data_2K8M
# 
_entry.id   2K8M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2K8M         
RCSB  RCSB100813   
WWPDB D_1000100813 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2K8M 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-09-14 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mohan, S.K.' 1 
'Rani, S.G.'  2 
'Kumar, S.M.' 3 
'Yu, C.'      4 
# 
_citation.id                        primary 
_citation.title                     
'S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.' 
_citation.journal_abbrev            Biochem.Biophys.Res.Commun. 
_citation.journal_volume            380 
_citation.page_first                514 
_citation.page_last                 519 
_citation.year                      2009 
_citation.journal_id_ASTM           BBRCA9 
_citation.country                   US 
_citation.journal_id_ISSN           0006-291X 
_citation.journal_id_CSD            0146 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19284995 
_citation.pdbx_database_id_DOI      10.1016/j.bbrc.2009.01.143 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mohan, S.K.' 1 
primary 'Rani, S.G.'  2 
primary 'Kumar, S.M.' 3 
primary 'Yu, C.'      4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Putative uncharacterized protein' 14783.882 2 ? ? 'residues 1-128' ? 
2 polymer man 'Protein S100-A13'                 11490.193 2 ? ? ?                ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 SYT1                               
2 'S100 calcium-binding protein A13' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSEL
GGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
;
;EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSEL
GGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
;
A,D ? 
2 'polypeptide(L)' no no 
;MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLI
GELAKEIRKKKDLKIRKK
;
;MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLI
GELAKEIRKKKDLKIRKK
;
B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   LYS n 
1 3   LEU n 
1 4   GLY n 
1 5   LYS n 
1 6   LEU n 
1 7   GLN n 
1 8   TYR n 
1 9   SER n 
1 10  LEU n 
1 11  ASP n 
1 12  TYR n 
1 13  ASP n 
1 14  PHE n 
1 15  GLN n 
1 16  ASN n 
1 17  ASN n 
1 18  GLN n 
1 19  LEU n 
1 20  LEU n 
1 21  VAL n 
1 22  GLY n 
1 23  ILE n 
1 24  ILE n 
1 25  GLN n 
1 26  ALA n 
1 27  ALA n 
1 28  GLU n 
1 29  LEU n 
1 30  PRO n 
1 31  ALA n 
1 32  LEU n 
1 33  ASP n 
1 34  MET n 
1 35  GLY n 
1 36  GLY n 
1 37  THR n 
1 38  SER n 
1 39  ASP n 
1 40  PRO n 
1 41  TYR n 
1 42  VAL n 
1 43  LYS n 
1 44  VAL n 
1 45  PHE n 
1 46  LEU n 
1 47  LEU n 
1 48  PRO n 
1 49  ASP n 
1 50  LYS n 
1 51  LYS n 
1 52  LYS n 
1 53  LYS n 
1 54  PHE n 
1 55  GLU n 
1 56  THR n 
1 57  LYS n 
1 58  VAL n 
1 59  HIS n 
1 60  ARG n 
1 61  LYS n 
1 62  THR n 
1 63  LEU n 
1 64  ASN n 
1 65  PRO n 
1 66  VAL n 
1 67  PHE n 
1 68  ASN n 
1 69  GLU n 
1 70  GLN n 
1 71  PHE n 
1 72  THR n 
1 73  PHE n 
1 74  LYS n 
1 75  VAL n 
1 76  PRO n 
1 77  TYR n 
1 78  SER n 
1 79  GLU n 
1 80  LEU n 
1 81  GLY n 
1 82  GLY n 
1 83  LYS n 
1 84  THR n 
1 85  LEU n 
1 86  VAL n 
1 87  MET n 
1 88  ALA n 
1 89  VAL n 
1 90  TYR n 
1 91  ASP n 
1 92  PHE n 
1 93  ASP n 
1 94  ARG n 
1 95  PHE n 
1 96  SER n 
1 97  LYS n 
1 98  HIS n 
1 99  ASP n 
1 100 ILE n 
1 101 ILE n 
1 102 GLY n 
1 103 GLU n 
1 104 PHE n 
1 105 LYS n 
1 106 VAL n 
1 107 PRO n 
1 108 MET n 
1 109 ASN n 
1 110 THR n 
1 111 VAL n 
1 112 ASP n 
1 113 PHE n 
1 114 GLY n 
1 115 HIS n 
1 116 VAL n 
1 117 THR n 
1 118 GLU n 
1 119 GLU n 
1 120 TRP n 
1 121 ARG n 
1 122 ASP n 
1 123 LEU n 
1 124 GLN n 
1 125 SER n 
1 126 ALA n 
1 127 GLU n 
1 128 LYS n 
2 1   MET n 
2 2   ALA n 
2 3   ALA n 
2 4   GLU n 
2 5   PRO n 
2 6   LEU n 
2 7   THR n 
2 8   GLU n 
2 9   LEU n 
2 10  GLU n 
2 11  GLU n 
2 12  SER n 
2 13  ILE n 
2 14  GLU n 
2 15  THR n 
2 16  VAL n 
2 17  VAL n 
2 18  THR n 
2 19  THR n 
2 20  PHE n 
2 21  PHE n 
2 22  THR n 
2 23  PHE n 
2 24  ALA n 
2 25  ARG n 
2 26  GLN n 
2 27  GLU n 
2 28  GLY n 
2 29  ARG n 
2 30  LYS n 
2 31  ASP n 
2 32  SER n 
2 33  LEU n 
2 34  SER n 
2 35  VAL n 
2 36  ASN n 
2 37  GLU n 
2 38  PHE n 
2 39  LYS n 
2 40  GLU n 
2 41  LEU n 
2 42  VAL n 
2 43  THR n 
2 44  GLN n 
2 45  GLN n 
2 46  LEU n 
2 47  PRO n 
2 48  HIS n 
2 49  LEU n 
2 50  LEU n 
2 51  LYS n 
2 52  ASP n 
2 53  VAL n 
2 54  GLY n 
2 55  SER n 
2 56  LEU n 
2 57  ASP n 
2 58  GLU n 
2 59  LYS n 
2 60  MET n 
2 61  LYS n 
2 62  SER n 
2 63  LEU n 
2 64  ASP n 
2 65  VAL n 
2 66  ASN n 
2 67  GLN n 
2 68  ASP n 
2 69  SER n 
2 70  GLU n 
2 71  LEU n 
2 72  LYS n 
2 73  PHE n 
2 74  ASN n 
2 75  GLU n 
2 76  TYR n 
2 77  TRP n 
2 78  ARG n 
2 79  LEU n 
2 80  ILE n 
2 81  GLY n 
2 82  GLU n 
2 83  LEU n 
2 84  ALA n 
2 85  LYS n 
2 86  GLU n 
2 87  ILE n 
2 88  ARG n 
2 89  LYS n 
2 90  LYS n 
2 91  LYS n 
2 92  ASP n 
2 93  LEU n 
2 94  LYS n 
2 95  ILE n 
2 96  ARG n 
2 97  LYS n 
2 98  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'DKFZp781D2042, hCG_2016754, SYT1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
? ? ? ? ? ? ? ? ? ? ? ? ? ? vector pGEX ? ? ? ? ? 
2 1 sample ? ? ? human ? S100A13                            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
? ? ? ? ? ? ? ? ? ? ? ? ? ? vector pGEX ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q6AI31_HUMAN Q6AI31 1 
;LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGG
KTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
;
143 ? 
2 UNP S10AD_HUMAN  Q99584 2 
;MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLI
GELAKEIRKKKDLKIRKK
;
1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2K8M A 3 ? 128 ? Q6AI31 143 ? 268 ? 3 128 
2 2 2K8M B 1 ? 98  ? Q99584 1   ? 98  ? 1 98  
3 2 2K8M C 1 ? 98  ? Q99584 1   ? 98  ? 1 98  
4 1 2K8M D 3 ? 128 ? Q6AI31 143 ? 268 ? 3 128 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2K8M GLU A 1 ? UNP Q6AI31 ? ? 'EXPRESSION TAG' 1 1 
1 2K8M LYS A 2 ? UNP Q6AI31 ? ? 'EXPRESSION TAG' 2 2 
4 2K8M GLU D 1 ? UNP Q6AI31 ? ? 'EXPRESSION TAG' 1 3 
4 2K8M LYS D 2 ? UNP Q6AI31 ? ? 'EXPRESSION TAG' 2 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-13C HSQC'  
1 3  1 '3D CBCA(CO)NH'   
1 4  1 '3D C(CO)NH'      
1 5  1 '3D HNCO'         
1 6  1 '3D HNCA'         
1 7  1 '3D HBHA(CO)NH'   
1 8  1 '3D HCCH-TOCSY'   
1 9  1 '3D 1H-15N TOCSY' 
1 10 1 '3D 1H-15N NOESY' 
1 11 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.1 
_pdbx_nmr_exptl_sample_conditions.pH                  5.7 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
'25 mM [U-100% 15N] sodium phosphate, 100 mM [U-100% 13C] sodium chloride, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker Avance 1 'Bruker Avance' 
600 Bruker Avance 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2K8M 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            'ARIA/CNS and HADDOCK' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2K8M 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2K8M 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
?                              'structure solution'        CNS    1.2         1 
?                              refinement                  CNS    1.2         2 
;Linge, O'Donoghue and Nilges
;
'structure solution'        ARIA   '1.2 & 2.2' 3 
Goddard                        'chemical shift assignment' SPARKY ?           4 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2K8M 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2K8M 
_struct.title                     'S100A13-C2A binary complex structure' 
_struct.pdbx_descriptor           'Putative uncharacterized protein, Protein S100-A13' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2K8M 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            'Protein-Protein complex, S100A13, C2A, PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 76  ? LEU A 80  ? PRO A 76  LEU A 80  5 ? 5  
HELX_P HELX_P2  2  THR B 7   ? ALA B 24  ? THR B 7   ALA B 24  1 ? 18 
HELX_P HELX_P3  3  VAL B 35  ? LEU B 46  ? VAL B 35  LEU B 46  1 ? 12 
HELX_P HELX_P4  4  LEU B 56  ? ASP B 64  ? LEU B 56  ASP B 64  1 ? 9  
HELX_P HELX_P5  5  LYS B 72  ? ILE B 87  ? LYS B 72  ILE B 87  1 ? 16 
HELX_P HELX_P6  6  THR C 7   ? ALA C 24  ? THR C 7   ALA C 24  1 ? 18 
HELX_P HELX_P7  7  SER C 34  ? THR C 43  ? SER C 34  THR C 43  1 ? 10 
HELX_P HELX_P8  8  SER C 55  ? ASP C 64  ? SER C 55  ASP C 64  1 ? 10 
HELX_P HELX_P9  9  TYR C 76  ? GLU C 86  ? TYR C 76  GLU C 86  1 ? 11 
HELX_P HELX_P10 10 ASP D 33  ? THR D 37  ? ASP D 33  THR D 37  5 ? 5  
HELX_P HELX_P11 11 PRO D 76  ? LEU D 80  ? PRO D 76  LEU D 80  5 ? 5  
HELX_P HELX_P12 12 ASN D 109 ? VAL D 111 ? ASN D 109 VAL D 111 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
D ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 70  ? LYS A 74  ? GLN A 70  LYS A 74  
A 2 GLN A 18  ? ALA A 27  ? GLN A 18  ALA A 27  
A 3 GLY A 4   ? ASP A 13  ? GLY A 4   ASP A 13  
A 4 VAL A 116 ? LEU A 123 ? VAL A 116 LEU A 123 
B 1 PHE A 54  ? GLU A 55  ? PHE A 54  GLU A 55  
B 2 TYR A 41  ? PHE A 45  ? TYR A 41  PHE A 45  
B 3 THR A 84  ? TYR A 90  ? THR A 84  TYR A 90  
B 4 ILE A 100 ? PRO A 107 ? ILE A 100 PRO A 107 
C 1 LEU B 33  ? SER B 34  ? LEU B 33  SER B 34  
C 2 GLU B 70  ? LEU B 71  ? GLU B 70  LEU B 71  
D 1 PRO D 40  ? LEU D 46  ? PRO D 40  LEU D 46  
D 2 THR D 84  ? ASP D 91  ? THR D 84  ASP D 91  
D 3 GLY D 102 ? PRO D 107 ? GLY D 102 PRO D 107 
D 4 VAL D 116 ? SER D 125 ? VAL D 116 SER D 125 
D 5 GLY D 4   ? ASP D 13  ? GLY D 4   ASP D 13  
D 6 GLN D 18  ? ALA D 27  ? GLN D 18  ALA D 27  
D 7 GLN D 70  ? LYS D 74  ? GLN D 70  LYS D 74  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 71  ? O PHE A 71  N VAL A 21  ? N VAL A 21  
A 2 3 O ILE A 24  ? O ILE A 24  N GLN A 7   ? N GLN A 7   
A 3 4 N LEU A 6   ? N LEU A 6   O ARG A 121 ? O ARG A 121 
B 1 2 O PHE A 54  ? O PHE A 54  N VAL A 44  ? N VAL A 44  
B 2 3 N TYR A 41  ? N TYR A 41  O TYR A 90  ? O TYR A 90  
B 3 4 N MET A 87  ? N MET A 87  O PHE A 104 ? O PHE A 104 
C 1 2 N LEU B 33  ? N LEU B 33  O LEU B 71  ? O LEU B 71  
D 1 2 N LYS D 43  ? N LYS D 43  O ALA D 88  ? O ALA D 88  
D 2 3 N MET D 87  ? N MET D 87  O PHE D 104 ? O PHE D 104 
D 3 4 N GLU D 103 ? N GLU D 103 O GLN D 124 ? O GLN D 124 
D 4 5 O ARG D 121 ? O ARG D 121 N LEU D 6   ? N LEU D 6   
D 5 6 N LYS D 5   ? N LYS D 5   O ALA D 27  ? O ALA D 27  
D 6 7 N VAL D 21  ? N VAL D 21  O PHE D 71  ? O PHE D 71  
# 
_atom_sites.entry_id                    2K8M 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . GLU A 1 1   ? -42.108 -11.884 11.591  1.00 4.87  ? 1   GLU A N    1  
ATOM 2      C CA   . GLU A 1 1   ? -41.654 -10.803 10.693  1.00 4.59  ? 1   GLU A CA   1  
ATOM 3      C C    . GLU A 1 1   ? -41.194 -9.606  11.511  1.00 4.47  ? 1   GLU A C    1  
ATOM 4      O O    . GLU A 1 1   ? -41.929 -9.110  12.363  1.00 4.50  ? 1   GLU A O    1  
ATOM 5      C CB   . GLU A 1 1   ? -42.774 -10.369 9.741   1.00 4.42  ? 1   GLU A CB   1  
ATOM 6      C CG   . GLU A 1 1   ? -43.441 -11.512 8.994   1.00 4.55  ? 1   GLU A CG   1  
ATOM 7      C CD   . GLU A 1 1   ? -44.724 -11.973 9.658   1.00 4.77  ? 1   GLU A CD   1  
ATOM 8      O OE1  . GLU A 1 1   ? -44.691 -12.286 10.865  1.00 5.03  ? 1   GLU A OE1  1  
ATOM 9      O OE2  . GLU A 1 1   ? -45.767 -12.022 8.977   1.00 4.81  ? 1   GLU A OE2  1  
ATOM 10     H H1   . GLU A 1 1   ? -42.728 -11.495 12.330  1.00 4.88  ? 1   GLU A H1   1  
ATOM 11     H H2   . GLU A 1 1   ? -41.293 -12.340 12.042  1.00 5.09  ? 1   GLU A H2   1  
ATOM 12     H H3   . GLU A 1 1   ? -42.638 -12.599 11.055  1.00 4.94  ? 1   GLU A H3   1  
ATOM 13     H HA   . GLU A 1 1   ? -40.820 -11.169 10.113  1.00 4.65  ? 1   GLU A HA   1  
ATOM 14     H HB2  . GLU A 1 1   ? -43.531 -9.852  10.311  1.00 4.42  ? 1   GLU A HB2  1  
ATOM 15     H HB3  . GLU A 1 1   ? -42.360 -9.687  9.013   1.00 4.27  ? 1   GLU A HB3  1  
ATOM 16     H HG2  . GLU A 1 1   ? -43.672 -11.184 7.992   1.00 4.45  ? 1   GLU A HG2  1  
ATOM 17     H HG3  . GLU A 1 1   ? -42.755 -12.345 8.951   1.00 4.67  ? 1   GLU A HG3  1  
ATOM 18     N N    . LYS A 1 2   ? -39.974 -9.158  11.268  1.00 4.39  ? 2   LYS A N    1  
ATOM 19     C CA   . LYS A 1 2   ? -39.433 -8.007  11.971  1.00 4.31  ? 2   LYS A CA   1  
ATOM 20     C C    . LYS A 1 2   ? -38.460 -7.249  11.074  1.00 4.03  ? 2   LYS A C    1  
ATOM 21     O O    . LYS A 1 2   ? -37.632 -7.849  10.387  1.00 4.07  ? 2   LYS A O    1  
ATOM 22     C CB   . LYS A 1 2   ? -38.753 -8.429  13.287  1.00 4.60  ? 2   LYS A CB   1  
ATOM 23     C CG   . LYS A 1 2   ? -37.551 -9.353  13.114  1.00 4.75  ? 2   LYS A CG   1  
ATOM 24     C CD   . LYS A 1 2   ? -36.232 -8.587  13.106  1.00 4.69  ? 2   LYS A CD   1  
ATOM 25     C CE   . LYS A 1 2   ? -35.927 -7.959  14.458  1.00 5.00  ? 2   LYS A CE   1  
ATOM 26     N NZ   . LYS A 1 2   ? -35.897 -8.969  15.548  1.00 5.48  ? 2   LYS A NZ   1  
ATOM 27     H H    . LYS A 1 2   ? -39.416 -9.618  10.598  1.00 4.42  ? 2   LYS A H    1  
ATOM 28     H HA   . LYS A 1 2   ? -40.262 -7.352  12.202  1.00 4.26  ? 2   LYS A HA   1  
ATOM 29     H HB2  . LYS A 1 2   ? -38.422 -7.541  13.803  1.00 4.55  ? 2   LYS A HB2  1  
ATOM 30     H HB3  . LYS A 1 2   ? -39.480 -8.937  13.902  1.00 4.82  ? 2   LYS A HB3  1  
ATOM 31     H HG2  . LYS A 1 2   ? -37.536 -10.061 13.928  1.00 5.05  ? 2   LYS A HG2  1  
ATOM 32     H HG3  . LYS A 1 2   ? -37.652 -9.885  12.179  1.00 4.76  ? 2   LYS A HG3  1  
ATOM 33     H HD2  . LYS A 1 2   ? -35.436 -9.270  12.852  1.00 4.74  ? 2   LYS A HD2  1  
ATOM 34     H HD3  . LYS A 1 2   ? -36.286 -7.807  12.361  1.00 4.60  ? 2   LYS A HD3  1  
ATOM 35     H HE2  . LYS A 1 2   ? -34.965 -7.473  14.403  1.00 5.03  ? 2   LYS A HE2  1  
ATOM 36     H HE3  . LYS A 1 2   ? -36.687 -7.223  14.679  1.00 5.06  ? 2   LYS A HE3  1  
ATOM 37     H HZ1  . LYS A 1 2   ? -35.555 -8.535  16.428  1.00 5.77  ? 2   LYS A HZ1  1  
ATOM 38     H HZ2  . LYS A 1 2   ? -35.260 -9.750  15.297  1.00 5.61  ? 2   LYS A HZ2  1  
ATOM 39     H HZ3  . LYS A 1 2   ? -36.849 -9.354  15.712  1.00 5.68  ? 2   LYS A HZ3  1  
ATOM 40     N N    . LEU A 1 3   ? -38.585 -5.938  11.059  1.00 3.78  ? 3   LEU A N    1  
ATOM 41     C CA   . LEU A 1 3   ? -37.715 -5.095  10.251  1.00 3.52  ? 3   LEU A CA   1  
ATOM 42     C C    . LEU A 1 3   ? -37.340 -3.838  11.031  1.00 3.47  ? 3   LEU A C    1  
ATOM 43     O O    . LEU A 1 3   ? -36.623 -2.974  10.537  1.00 3.31  ? 3   LEU A O    1  
ATOM 44     C CB   . LEU A 1 3   ? -38.410 -4.737  8.932   1.00 3.26  ? 3   LEU A CB   1  
ATOM 45     C CG   . LEU A 1 3   ? -37.592 -3.887  7.959   1.00 3.04  ? 3   LEU A CG   1  
ATOM 46     C CD1  . LEU A 1 3   ? -36.572 -4.742  7.229   1.00 3.11  ? 3   LEU A CD1  1  
ATOM 47     C CD2  . LEU A 1 3   ? -38.509 -3.189  6.972   1.00 2.79  ? 3   LEU A CD2  1  
ATOM 48     H H    . LEU A 1 3   ? -39.292 -5.518  11.597  1.00 3.79  ? 3   LEU A H    1  
ATOM 49     H HA   . LEU A 1 3   ? -36.816 -5.656  10.038  1.00 3.56  ? 3   LEU A HA   1  
ATOM 50     H HB2  . LEU A 1 3   ? -38.675 -5.657  8.431   1.00 3.35  ? 3   LEU A HB2  1  
ATOM 51     H HB3  . LEU A 1 3   ? -39.318 -4.204  9.165   1.00 3.21  ? 3   LEU A HB3  1  
ATOM 52     H HG   . LEU A 1 3   ? -37.057 -3.128  8.513   1.00 3.07  ? 3   LEU A HG   1  
ATOM 53     H HD11 . LEU A 1 3   ? -35.976 -4.118  6.580   1.00 3.08  ? 3   LEU A HD11 1  
ATOM 54     H HD12 . LEU A 1 3   ? -37.085 -5.488  6.640   1.00 3.21  ? 3   LEU A HD12 1  
ATOM 55     H HD13 . LEU A 1 3   ? -35.931 -5.228  7.949   1.00 3.35  ? 3   LEU A HD13 1  
ATOM 56     H HD21 . LEU A 1 3   ? -38.755 -2.206  7.342   1.00 2.75  ? 3   LEU A HD21 1  
ATOM 57     H HD22 . LEU A 1 3   ? -39.417 -3.764  6.856   1.00 2.87  ? 3   LEU A HD22 1  
ATOM 58     H HD23 . LEU A 1 3   ? -38.012 -3.103  6.018   1.00 2.70  ? 3   LEU A HD23 1  
ATOM 59     N N    . GLY A 1 4   ? -37.828 -3.752  12.259  1.00 3.65  ? 4   GLY A N    1  
ATOM 60     C CA   . GLY A 1 4   ? -37.529 -2.609  13.090  1.00 3.66  ? 4   GLY A CA   1  
ATOM 61     C C    . GLY A 1 4   ? -38.700 -1.668  13.243  1.00 3.55  ? 4   GLY A C    1  
ATOM 62     O O    . GLY A 1 4   ? -39.858 -2.097  13.247  1.00 3.59  ? 4   GLY A O    1  
ATOM 63     H H    . GLY A 1 4   ? -38.399 -4.469  12.602  1.00 3.81  ? 4   GLY A H    1  
ATOM 64     H HA2  . GLY A 1 4   ? -37.235 -2.959  14.068  1.00 3.89  ? 4   GLY A HA2  1  
ATOM 65     H HA3  . GLY A 1 4   ? -36.704 -2.068  12.650  1.00 3.54  ? 4   GLY A HA3  1  
ATOM 66     N N    . LYS A 1 5   ? -38.401 -0.387  13.382  1.00 3.44  ? 5   LYS A N    1  
ATOM 67     C CA   . LYS A 1 5   ? -39.428 0.632   13.538  1.00 3.34  ? 5   LYS A CA   1  
ATOM 68     C C    . LYS A 1 5   ? -39.123 1.816   12.637  1.00 3.09  ? 5   LYS A C    1  
ATOM 69     O O    . LYS A 1 5   ? -37.962 2.206   12.489  1.00 3.08  ? 5   LYS A O    1  
ATOM 70     C CB   . LYS A 1 5   ? -39.519 1.101   14.993  1.00 3.60  ? 5   LYS A CB   1  
ATOM 71     C CG   . LYS A 1 5   ? -40.091 0.059   15.943  1.00 3.87  ? 5   LYS A CG   1  
ATOM 72     C CD   . LYS A 1 5   ? -40.457 0.670   17.287  1.00 3.99  ? 5   LYS A CD   1  
ATOM 73     C CE   . LYS A 1 5   ? -41.750 1.469   17.201  1.00 3.83  ? 5   LYS A CE   1  
ATOM 74     N NZ   . LYS A 1 5   ? -42.095 2.111   18.497  1.00 3.97  ? 5   LYS A NZ   1  
ATOM 75     H H    . LYS A 1 5   ? -37.457 -0.112  13.364  1.00 3.44  ? 5   LYS A H    1  
ATOM 76     H HA   . LYS A 1 5   ? -40.373 0.199   13.244  1.00 3.30  ? 5   LYS A HA   1  
ATOM 77     H HB2  . LYS A 1 5   ? -38.529 1.364   15.334  1.00 3.70  ? 5   LYS A HB2  1  
ATOM 78     H HB3  . LYS A 1 5   ? -40.147 1.979   15.036  1.00 3.51  ? 5   LYS A HB3  1  
ATOM 79     H HG2  . LYS A 1 5   ? -40.975 -0.368  15.499  1.00 3.82  ? 5   LYS A HG2  1  
ATOM 80     H HG3  . LYS A 1 5   ? -39.353 -0.715  16.099  1.00 4.08  ? 5   LYS A HG3  1  
ATOM 81     H HD2  . LYS A 1 5   ? -40.582 -0.121  18.012  1.00 4.20  ? 5   LYS A HD2  1  
ATOM 82     H HD3  . LYS A 1 5   ? -39.660 1.326   17.603  1.00 4.05  ? 5   LYS A HD3  1  
ATOM 83     H HE2  . LYS A 1 5   ? -41.633 2.237   16.453  1.00 3.73  ? 5   LYS A HE2  1  
ATOM 84     H HE3  . LYS A 1 5   ? -42.553 0.806   16.911  1.00 3.83  ? 5   LYS A HE3  1  
ATOM 85     H HZ1  . LYS A 1 5   ? -42.077 1.409   19.263  1.00 4.11  ? 5   LYS A HZ1  1  
ATOM 86     H HZ2  . LYS A 1 5   ? -43.045 2.526   18.446  1.00 3.92  ? 5   LYS A HZ2  1  
ATOM 87     H HZ3  . LYS A 1 5   ? -41.410 2.864   18.716  1.00 4.09  ? 5   LYS A HZ3  1  
ATOM 88     N N    . LEU A 1 6   ? -40.157 2.376   12.035  1.00 2.90  ? 6   LEU A N    1  
ATOM 89     C CA   . LEU A 1 6   ? -39.997 3.512   11.150  1.00 2.66  ? 6   LEU A CA   1  
ATOM 90     C C    . LEU A 1 6   ? -40.736 4.721   11.694  1.00 2.67  ? 6   LEU A C    1  
ATOM 91     O O    . LEU A 1 6   ? -41.961 4.706   11.822  1.00 2.67  ? 6   LEU A O    1  
ATOM 92     C CB   . LEU A 1 6   ? -40.521 3.173   9.751   1.00 2.39  ? 6   LEU A CB   1  
ATOM 93     C CG   . LEU A 1 6   ? -40.548 4.336   8.755   1.00 2.18  ? 6   LEU A CG   1  
ATOM 94     C CD1  . LEU A 1 6   ? -39.147 4.643   8.242   1.00 2.15  ? 6   LEU A CD1  1  
ATOM 95     C CD2  . LEU A 1 6   ? -41.479 4.019   7.593   1.00 2.00  ? 6   LEU A CD2  1  
ATOM 96     H H    . LEU A 1 6   ? -41.061 2.016   12.192  1.00 2.93  ? 6   LEU A H    1  
ATOM 97     H HA   . LEU A 1 6   ? -38.942 3.742   11.087  1.00 2.71  ? 6   LEU A HA   1  
ATOM 98     H HB2  . LEU A 1 6   ? -39.899 2.393   9.340   1.00 2.45  ? 6   LEU A HB2  1  
ATOM 99     H HB3  . LEU A 1 6   ? -41.526 2.792   9.852   1.00 2.35  ? 6   LEU A HB3  1  
ATOM 100    H HG   . LEU A 1 6   ? -40.921 5.219   9.254   1.00 2.39  ? 6   LEU A HG   1  
ATOM 101    H HD11 . LEU A 1 6   ? -39.196 5.441   7.517   1.00 2.12  ? 6   LEU A HD11 1  
ATOM 102    H HD12 . LEU A 1 6   ? -38.733 3.759   7.775   1.00 2.12  ? 6   LEU A HD12 1  
ATOM 103    H HD13 . LEU A 1 6   ? -38.515 4.942   9.067   1.00 2.53  ? 6   LEU A HD13 1  
ATOM 104    H HD21 . LEU A 1 6   ? -41.483 4.847   6.901   1.00 1.95  ? 6   LEU A HD21 1  
ATOM 105    H HD22 . LEU A 1 6   ? -42.479 3.854   7.964   1.00 2.19  ? 6   LEU A HD22 1  
ATOM 106    H HD23 . LEU A 1 6   ? -41.133 3.129   7.088   1.00 1.96  ? 6   LEU A HD23 1  
ATOM 107    N N    . GLN A 1 7   ? -39.992 5.758   12.033  1.00 2.71  ? 7   GLN A N    1  
ATOM 108    C CA   . GLN A 1 7   ? -40.591 6.984   12.537  1.00 2.75  ? 7   GLN A CA   1  
ATOM 109    C C    . GLN A 1 7   ? -40.899 7.878   11.350  1.00 2.52  ? 7   GLN A C    1  
ATOM 110    O O    . GLN A 1 7   ? -40.000 8.212   10.580  1.00 2.43  ? 7   GLN A O    1  
ATOM 111    C CB   . GLN A 1 7   ? -39.661 7.719   13.518  1.00 3.01  ? 7   GLN A CB   1  
ATOM 112    C CG   . GLN A 1 7   ? -38.456 6.912   13.985  1.00 3.19  ? 7   GLN A CG   1  
ATOM 113    C CD   . GLN A 1 7   ? -38.806 5.828   14.989  1.00 3.37  ? 7   GLN A CD   1  
ATOM 114    O OE1  . GLN A 1 7   ? -39.752 5.961   15.762  1.00 3.45  ? 7   GLN A OE1  1  
ATOM 115    N NE2  . GLN A 1 7   ? -38.038 4.751   14.985  1.00 3.46  ? 7   GLN A NE2  1  
ATOM 116    H H    . GLN A 1 7   ? -39.016 5.704   11.928  1.00 2.73  ? 7   GLN A H    1  
ATOM 117    H HA   . GLN A 1 7   ? -41.514 6.729   13.035  1.00 2.79  ? 7   GLN A HA   1  
ATOM 118    H HB2  . GLN A 1 7   ? -39.294 8.615   13.040  1.00 2.97  ? 7   GLN A HB2  1  
ATOM 119    H HB3  . GLN A 1 7   ? -40.233 8.000   14.389  1.00 3.13  ? 7   GLN A HB3  1  
ATOM 120    H HG2  . GLN A 1 7   ? -37.997 6.445   13.125  1.00 3.05  ? 7   GLN A HG2  1  
ATOM 121    H HG3  . GLN A 1 7   ? -37.748 7.585   14.444  1.00 3.35  ? 7   GLN A HG3  1  
ATOM 122    H HE21 . GLN A 1 7   ? -37.292 4.714   14.342  1.00 3.39  ? 7   GLN A HE21 1  
ATOM 123    H HE22 . GLN A 1 7   ? -38.245 4.034   15.617  1.00 3.60  ? 7   GLN A HE22 1  
ATOM 124    N N    . TYR A 1 8   ? -42.157 8.250   11.181  1.00 2.44  ? 8   TYR A N    1  
ATOM 125    C CA   . TYR A 1 8   ? -42.539 9.087   10.053  1.00 2.24  ? 8   TYR A CA   1  
ATOM 126    C C    . TYR A 1 8   ? -43.675 10.032  10.413  1.00 2.29  ? 8   TYR A C    1  
ATOM 127    O O    . TYR A 1 8   ? -44.380 9.833   11.404  1.00 2.41  ? 8   TYR A O    1  
ATOM 128    C CB   . TYR A 1 8   ? -42.920 8.222   8.840   1.00 1.99  ? 8   TYR A CB   1  
ATOM 129    C CG   . TYR A 1 8   ? -44.142 7.340   9.025   1.00 1.98  ? 8   TYR A CG   1  
ATOM 130    C CD1  . TYR A 1 8   ? -44.275 6.502   10.127  1.00 2.21  ? 8   TYR A CD1  1  
ATOM 131    C CD2  . TYR A 1 8   ? -45.156 7.330   8.076   1.00 1.88  ? 8   TYR A CD2  1  
ATOM 132    C CE1  . TYR A 1 8   ? -45.378 5.689   10.278  1.00 2.25  ? 8   TYR A CE1  1  
ATOM 133    C CE2  . TYR A 1 8   ? -46.267 6.520   8.224   1.00 1.94  ? 8   TYR A CE2  1  
ATOM 134    C CZ   . TYR A 1 8   ? -46.372 5.699   9.324   1.00 2.08  ? 8   TYR A CZ   1  
ATOM 135    O OH   . TYR A 1 8   ? -47.469 4.879   9.465   1.00 2.19  ? 8   TYR A OH   1  
ATOM 136    H H    . TYR A 1 8   ? -42.843 7.968   11.829  1.00 2.52  ? 8   TYR A H    1  
ATOM 137    H HA   . TYR A 1 8   ? -41.678 9.683   9.790   1.00 2.28  ? 8   TYR A HA   1  
ATOM 138    H HB2  . TYR A 1 8   ? -43.116 8.871   8.001   1.00 1.86  ? 8   TYR A HB2  1  
ATOM 139    H HB3  . TYR A 1 8   ? -42.084 7.580   8.596   1.00 1.96  ? 8   TYR A HB3  1  
ATOM 140    H HD1  . TYR A 1 8   ? -43.498 6.496   10.876  1.00 2.44  ? 8   TYR A HD1  1  
ATOM 141    H HD2  . TYR A 1 8   ? -45.072 7.972   7.212   1.00 1.87  ? 8   TYR A HD2  1  
ATOM 142    H HE1  . TYR A 1 8   ? -45.461 5.050   11.143  1.00 2.50  ? 8   TYR A HE1  1  
ATOM 143    H HE2  . TYR A 1 8   ? -47.043 6.528   7.473   1.00 1.98  ? 8   TYR A HE2  1  
ATOM 144    H HH   . TYR A 1 8   ? -47.911 5.064   10.309  1.00 2.33  ? 8   TYR A HH   1  
ATOM 145    N N    . SER A 1 9   ? -43.836 11.059  9.595   1.00 2.22  ? 9   SER A N    1  
ATOM 146    C CA   . SER A 1 9   ? -44.866 12.059  9.797   1.00 2.28  ? 9   SER A CA   1  
ATOM 147    C C    . SER A 1 9   ? -45.568 12.371  8.476   1.00 2.09  ? 9   SER A C    1  
ATOM 148    O O    . SER A 1 9   ? -44.932 12.813  7.519   1.00 2.06  ? 9   SER A O    1  
ATOM 149    C CB   . SER A 1 9   ? -44.232 13.323  10.383  1.00 2.51  ? 9   SER A CB   1  
ATOM 150    O OG   . SER A 1 9   ? -42.820 13.309  10.216  1.00 2.78  ? 9   SER A OG   1  
ATOM 151    H H    . SER A 1 9   ? -43.237 11.148  8.820   1.00 2.14  ? 9   SER A H    1  
ATOM 152    H HA   . SER A 1 9   ? -45.585 11.663  10.498  1.00 2.32  ? 9   SER A HA   1  
ATOM 153    H HB2  . SER A 1 9   ? -44.635 14.192  9.885   1.00 2.54  ? 9   SER A HB2  1  
ATOM 154    H HB3  . SER A 1 9   ? -44.455 13.381  11.439  1.00 2.67  ? 9   SER A HB3  1  
ATOM 155    H HG   . SER A 1 9   ? -42.609 13.122  9.298   1.00 2.93  ? 9   SER A HG   1  
ATOM 156    N N    . LEU A 1 10  ? -46.870 12.125  8.418   1.00 2.01  ? 10  LEU A N    1  
ATOM 157    C CA   . LEU A 1 10  ? -47.638 12.378  7.203   1.00 1.89  ? 10  LEU A CA   1  
ATOM 158    C C    . LEU A 1 10  ? -48.496 13.632  7.336   1.00 2.01  ? 10  LEU A C    1  
ATOM 159    O O    . LEU A 1 10  ? -49.169 13.828  8.345   1.00 2.13  ? 10  LEU A O    1  
ATOM 160    C CB   . LEU A 1 10  ? -48.547 11.183  6.889   1.00 1.80  ? 10  LEU A CB   1  
ATOM 161    C CG   . LEU A 1 10  ? -47.864 9.813   6.877   1.00 1.70  ? 10  LEU A CG   1  
ATOM 162    C CD1  . LEU A 1 10  ? -48.896 8.708   6.718   1.00 1.72  ? 10  LEU A CD1  1  
ATOM 163    C CD2  . LEU A 1 10  ? -46.833 9.737   5.760   1.00 1.61  ? 10  LEU A CD2  1  
ATOM 164    H H    . LEU A 1 10  ? -47.327 11.755  9.203   1.00 2.08  ? 10  LEU A H    1  
ATOM 165    H HA   . LEU A 1 10  ? -46.942 12.514  6.389   1.00 1.84  ? 10  LEU A HA   1  
ATOM 166    H HB2  . LEU A 1 10  ? -49.337 11.159  7.625   1.00 1.92  ? 10  LEU A HB2  1  
ATOM 167    H HB3  . LEU A 1 10  ? -48.991 11.344  5.919   1.00 1.79  ? 10  LEU A HB3  1  
ATOM 168    H HG   . LEU A 1 10  ? -47.355 9.663   7.819   1.00 1.78  ? 10  LEU A HG   1  
ATOM 169    H HD11 . LEU A 1 10  ? -48.393 7.768   6.547   1.00 1.90  ? 10  LEU A HD11 1  
ATOM 170    H HD12 . LEU A 1 10  ? -49.536 8.934   5.878   1.00 1.77  ? 10  LEU A HD12 1  
ATOM 171    H HD13 . LEU A 1 10  ? -49.491 8.639   7.617   1.00 1.81  ? 10  LEU A HD13 1  
ATOM 172    H HD21 . LEU A 1 10  ? -47.299 9.996   4.821   1.00 1.59  ? 10  LEU A HD21 1  
ATOM 173    H HD22 . LEU A 1 10  ? -46.439 8.733   5.700   1.00 1.61  ? 10  LEU A HD22 1  
ATOM 174    H HD23 . LEU A 1 10  ? -46.027 10.427  5.963   1.00 1.70  ? 10  LEU A HD23 1  
ATOM 175    N N    . ASP A 1 11  ? -48.454 14.480  6.320   1.00 2.05  ? 11  ASP A N    1  
ATOM 176    C CA   . ASP A 1 11  ? -49.263 15.693  6.298   1.00 2.22  ? 11  ASP A CA   1  
ATOM 177    C C    . ASP A 1 11  ? -49.971 15.792  4.953   1.00 2.20  ? 11  ASP A C    1  
ATOM 178    O O    . ASP A 1 11  ? -49.496 15.245  3.959   1.00 2.11  ? 11  ASP A O    1  
ATOM 179    C CB   . ASP A 1 11  ? -48.431 16.955  6.585   1.00 2.46  ? 11  ASP A CB   1  
ATOM 180    C CG   . ASP A 1 11  ? -47.358 17.238  5.552   1.00 2.58  ? 11  ASP A CG   1  
ATOM 181    O OD1  . ASP A 1 11  ? -46.219 16.753  5.727   1.00 2.69  ? 11  ASP A OD1  1  
ATOM 182    O OD2  . ASP A 1 11  ? -47.639 17.977  4.586   1.00 2.85  ? 11  ASP A OD2  1  
ATOM 183    H H    . ASP A 1 11  ? -47.861 14.286  5.558   1.00 2.01  ? 11  ASP A H    1  
ATOM 184    H HA   . ASP A 1 11  ? -50.016 15.587  7.068   1.00 2.24  ? 11  ASP A HA   1  
ATOM 185    H HB2  . ASP A 1 11  ? -49.092 17.808  6.618   1.00 2.71  ? 11  ASP A HB2  1  
ATOM 186    H HB3  . ASP A 1 11  ? -47.954 16.845  7.548   1.00 2.56  ? 11  ASP A HB3  1  
ATOM 187    N N    . TYR A 1 12  ? -51.110 16.463  4.915   1.00 2.33  ? 12  TYR A N    1  
ATOM 188    C CA   . TYR A 1 12  ? -51.871 16.571  3.677   1.00 2.38  ? 12  TYR A CA   1  
ATOM 189    C C    . TYR A 1 12  ? -51.787 17.967  3.071   1.00 2.62  ? 12  TYR A C    1  
ATOM 190    O O    . TYR A 1 12  ? -51.724 18.970  3.783   1.00 2.75  ? 12  TYR A O    1  
ATOM 191    C CB   . TYR A 1 12  ? -53.336 16.175  3.914   1.00 2.36  ? 12  TYR A CB   1  
ATOM 192    C CG   . TYR A 1 12  ? -54.181 17.234  4.592   1.00 2.46  ? 12  TYR A CG   1  
ATOM 193    C CD1  . TYR A 1 12  ? -53.952 17.602  5.912   1.00 2.47  ? 12  TYR A CD1  1  
ATOM 194    C CD2  . TYR A 1 12  ? -55.217 17.862  3.910   1.00 2.60  ? 12  TYR A CD2  1  
ATOM 195    C CE1  . TYR A 1 12  ? -54.731 18.561  6.533   1.00 2.59  ? 12  TYR A CE1  1  
ATOM 196    C CE2  . TYR A 1 12  ? -55.998 18.821  4.522   1.00 2.71  ? 12  TYR A CE2  1  
ATOM 197    C CZ   . TYR A 1 12  ? -55.751 19.169  5.833   1.00 2.70  ? 12  TYR A CZ   1  
ATOM 198    O OH   . TYR A 1 12  ? -56.537 20.119  6.448   1.00 2.83  ? 12  TYR A OH   1  
ATOM 199    H H    . TYR A 1 12  ? -51.444 16.896  5.729   1.00 2.42  ? 12  TYR A H    1  
ATOM 200    H HA   . TYR A 1 12  ? -51.442 15.875  2.976   1.00 2.30  ? 12  TYR A HA   1  
ATOM 201    H HB2  . TYR A 1 12  ? -53.797 15.952  2.963   1.00 2.41  ? 12  TYR A HB2  1  
ATOM 202    H HB3  . TYR A 1 12  ? -53.362 15.289  4.532   1.00 2.26  ? 12  TYR A HB3  1  
ATOM 203    H HD1  . TYR A 1 12  ? -53.152 17.125  6.457   1.00 2.40  ? 12  TYR A HD1  1  
ATOM 204    H HD2  . TYR A 1 12  ? -55.411 17.587  2.883   1.00 2.65  ? 12  TYR A HD2  1  
ATOM 205    H HE1  . TYR A 1 12  ? -54.537 18.831  7.561   1.00 2.63  ? 12  TYR A HE1  1  
ATOM 206    H HE2  . TYR A 1 12  ? -56.797 19.299  3.973   1.00 2.83  ? 12  TYR A HE2  1  
ATOM 207    H HH   . TYR A 1 12  ? -57.442 19.795  6.502   1.00 2.79  ? 12  TYR A HH   1  
ATOM 208    N N    . ASP A 1 13  ? -51.773 18.012  1.748   1.00 2.70  ? 13  ASP A N    1  
ATOM 209    C CA   . ASP A 1 13  ? -51.720 19.268  1.018   1.00 2.96  ? 13  ASP A CA   1  
ATOM 210    C C    . ASP A 1 13  ? -52.969 19.394  0.159   1.00 3.08  ? 13  ASP A C    1  
ATOM 211    O O    . ASP A 1 13  ? -53.292 18.496  -0.621  1.00 3.01  ? 13  ASP A O    1  
ATOM 212    C CB   . ASP A 1 13  ? -50.464 19.340  0.147   1.00 3.03  ? 13  ASP A CB   1  
ATOM 213    C CG   . ASP A 1 13  ? -50.162 20.744  -0.347  1.00 3.31  ? 13  ASP A CG   1  
ATOM 214    O OD1  . ASP A 1 13  ? -51.107 21.473  -0.716  1.00 3.46  ? 13  ASP A OD1  1  
ATOM 215    O OD2  . ASP A 1 13  ? -48.972 21.122  -0.374  1.00 3.46  ? 13  ASP A OD2  1  
ATOM 216    H H    . ASP A 1 13  ? -51.801 17.169  1.241   1.00 2.62  ? 13  ASP A H    1  
ATOM 217    H HA   . ASP A 1 13  ? -51.706 20.073  1.738   1.00 3.06  ? 13  ASP A HA   1  
ATOM 218    H HB2  . ASP A 1 13  ? -49.618 18.994  0.722   1.00 2.95  ? 13  ASP A HB2  1  
ATOM 219    H HB3  . ASP A 1 13  ? -50.594 18.696  -0.712  1.00 3.00  ? 13  ASP A HB3  1  
ATOM 220    N N    . PHE A 1 14  ? -53.672 20.504  0.308   1.00 3.29  ? 14  PHE A N    1  
ATOM 221    C CA   . PHE A 1 14  ? -54.908 20.727  -0.432  1.00 3.44  ? 14  PHE A CA   1  
ATOM 222    C C    . PHE A 1 14  ? -54.718 21.651  -1.634  1.00 3.70  ? 14  PHE A C    1  
ATOM 223    O O    . PHE A 1 14  ? -55.686 21.982  -2.321  1.00 3.92  ? 14  PHE A O    1  
ATOM 224    C CB   . PHE A 1 14  ? -55.982 21.299  0.503   1.00 3.49  ? 14  PHE A CB   1  
ATOM 225    C CG   . PHE A 1 14  ? -55.466 22.351  1.451   1.00 3.55  ? 14  PHE A CG   1  
ATOM 226    C CD1  . PHE A 1 14  ? -55.186 23.630  1.002   1.00 3.78  ? 14  PHE A CD1  1  
ATOM 227    C CD2  . PHE A 1 14  ? -55.256 22.055  2.790   1.00 3.43  ? 14  PHE A CD2  1  
ATOM 228    C CE1  . PHE A 1 14  ? -54.702 24.594  1.866   1.00 3.89  ? 14  PHE A CE1  1  
ATOM 229    C CE2  . PHE A 1 14  ? -54.775 23.016  3.658   1.00 3.54  ? 14  PHE A CE2  1  
ATOM 230    C CZ   . PHE A 1 14  ? -54.497 24.286  3.196   1.00 3.77  ? 14  PHE A CZ   1  
ATOM 231    H H    . PHE A 1 14  ? -53.349 21.193  0.925   1.00 3.37  ? 14  PHE A H    1  
ATOM 232    H HA   . PHE A 1 14  ? -55.246 19.768  -0.792  1.00 3.35  ? 14  PHE A HA   1  
ATOM 233    H HB2  . PHE A 1 14  ? -56.765 21.745  -0.091  1.00 3.65  ? 14  PHE A HB2  1  
ATOM 234    H HB3  . PHE A 1 14  ? -56.400 20.494  1.091   1.00 3.37  ? 14  PHE A HB3  1  
ATOM 235    H HD1  . PHE A 1 14  ? -55.346 23.873  -0.039  1.00 3.92  ? 14  PHE A HD1  1  
ATOM 236    H HD2  . PHE A 1 14  ? -55.474 21.061  3.155   1.00 3.29  ? 14  PHE A HD2  1  
ATOM 237    H HE1  . PHE A 1 14  ? -54.488 25.587  1.501   1.00 4.10  ? 14  PHE A HE1  1  
ATOM 238    H HE2  . PHE A 1 14  ? -54.614 22.774  4.699   1.00 3.49  ? 14  PHE A HE2  1  
ATOM 239    H HZ   . PHE A 1 14  ? -54.119 25.038  3.874   1.00 3.89  ? 14  PHE A HZ   1  
ATOM 240    N N    . GLN A 1 15  ? -53.489 22.066  -1.902  1.00 3.72  ? 15  GLN A N    1  
ATOM 241    C CA   . GLN A 1 15  ? -53.239 22.954  -3.031  1.00 3.98  ? 15  GLN A CA   1  
ATOM 242    C C    . GLN A 1 15  ? -52.821 22.156  -4.262  1.00 3.99  ? 15  GLN A C    1  
ATOM 243    O O    . GLN A 1 15  ? -53.200 22.483  -5.384  1.00 4.21  ? 15  GLN A O    1  
ATOM 244    C CB   . GLN A 1 15  ? -52.184 24.011  -2.672  1.00 4.09  ? 15  GLN A CB   1  
ATOM 245    C CG   . GLN A 1 15  ? -50.752 23.613  -3.001  1.00 4.00  ? 15  GLN A CG   1  
ATOM 246    C CD   . GLN A 1 15  ? -49.736 24.389  -2.200  1.00 4.09  ? 15  GLN A CD   1  
ATOM 247    O OE1  . GLN A 1 15  ? -49.266 25.449  -2.622  1.00 4.36  ? 15  GLN A OE1  1  
ATOM 248    N NE2  . GLN A 1 15  ? -49.386 23.869  -1.041  1.00 3.90  ? 15  GLN A NE2  1  
ATOM 249    H H    . GLN A 1 15  ? -52.734 21.771  -1.334  1.00 3.59  ? 15  GLN A H    1  
ATOM 250    H HA   . GLN A 1 15  ? -54.168 23.457  -3.254  1.00 4.12  ? 15  GLN A HA   1  
ATOM 251    H HB2  . GLN A 1 15  ? -52.409 24.921  -3.208  1.00 4.32  ? 15  GLN A HB2  1  
ATOM 252    H HB3  . GLN A 1 15  ? -52.243 24.209  -1.611  1.00 4.04  ? 15  GLN A HB3  1  
ATOM 253    H HG2  . GLN A 1 15  ? -50.626 22.563  -2.788  1.00 3.78  ? 15  GLN A HG2  1  
ATOM 254    H HG3  . GLN A 1 15  ? -50.576 23.791  -4.051  1.00 4.13  ? 15  GLN A HG3  1  
ATOM 255    H HE21 . GLN A 1 15  ? -49.804 23.015  -0.770  1.00 3.71  ? 15  GLN A HE21 1  
ATOM 256    H HE22 . GLN A 1 15  ? -48.718 24.340  -0.500  1.00 3.98  ? 15  GLN A HE22 1  
ATOM 257    N N    . ASN A 1 16  ? -52.051 21.097  -4.047  1.00 3.78  ? 16  ASN A N    1  
ATOM 258    C CA   . ASN A 1 16  ? -51.592 20.252  -5.146  1.00 3.79  ? 16  ASN A CA   1  
ATOM 259    C C    . ASN A 1 16  ? -52.328 18.920  -5.138  1.00 3.61  ? 16  ASN A C    1  
ATOM 260    O O    . ASN A 1 16  ? -52.164 18.104  -6.043  1.00 3.61  ? 16  ASN A O    1  
ATOM 261    C CB   . ASN A 1 16  ? -50.076 20.022  -5.070  1.00 3.72  ? 16  ASN A CB   1  
ATOM 262    C CG   . ASN A 1 16  ? -49.607 19.636  -3.682  1.00 3.53  ? 16  ASN A CG   1  
ATOM 263    O OD1  . ASN A 1 16  ? -50.360 19.076  -2.888  1.00 3.48  ? 16  ASN A OD1  1  
ATOM 264    N ND2  . ASN A 1 16  ? -48.354 19.932  -3.380  1.00 3.56  ? 16  ASN A ND2  1  
ATOM 265    H H    . ASN A 1 16  ? -51.772 20.882  -3.128  1.00 3.63  ? 16  ASN A H    1  
ATOM 266    H HA   . ASN A 1 16  ? -51.821 20.764  -6.068  1.00 4.00  ? 16  ASN A HA   1  
ATOM 267    H HB2  . ASN A 1 16  ? -49.803 19.230  -5.750  1.00 3.72  ? 16  ASN A HB2  1  
ATOM 268    H HB3  . ASN A 1 16  ? -49.567 20.930  -5.361  1.00 3.89  ? 16  ASN A HB3  1  
ATOM 269    H HD21 . ASN A 1 16  ? -47.807 20.382  -4.058  1.00 3.76  ? 16  ASN A HD21 1  
ATOM 270    H HD22 . ASN A 1 16  ? -48.023 19.694  -2.488  1.00 3.48  ? 16  ASN A HD22 1  
ATOM 271    N N    . ASN A 1 17  ? -53.143 18.724  -4.101  1.00 3.48  ? 17  ASN A N    1  
ATOM 272    C CA   . ASN A 1 17  ? -53.942 17.509  -3.933  1.00 3.33  ? 17  ASN A CA   1  
ATOM 273    C C    . ASN A 1 17  ? -53.059 16.268  -3.828  1.00 3.13  ? 17  ASN A C    1  
ATOM 274    O O    . ASN A 1 17  ? -53.019 15.443  -4.743  1.00 3.17  ? 17  ASN A O    1  
ATOM 275    C CB   . ASN A 1 17  ? -54.934 17.347  -5.090  1.00 3.54  ? 17  ASN A CB   1  
ATOM 276    C CG   . ASN A 1 17  ? -56.325 16.964  -4.620  1.00 3.56  ? 17  ASN A CG   1  
ATOM 277    O OD1  . ASN A 1 17  ? -56.501 16.393  -3.543  1.00 3.39  ? 17  ASN A OD1  1  
ATOM 278    N ND2  . ASN A 1 17  ? -57.328 17.263  -5.435  1.00 3.89  ? 17  ASN A ND2  1  
ATOM 279    H H    . ASN A 1 17  ? -53.204 19.421  -3.419  1.00 3.49  ? 17  ASN A H    1  
ATOM 280    H HA   . ASN A 1 17  ? -54.499 17.611  -3.013  1.00 3.25  ? 17  ASN A HA   1  
ATOM 281    H HB2  . ASN A 1 17  ? -55.002 18.279  -5.630  1.00 3.76  ? 17  ASN A HB2  1  
ATOM 282    H HB3  . ASN A 1 17  ? -54.574 16.576  -5.757  1.00 3.54  ? 17  ASN A HB3  1  
ATOM 283    H HD21 . ASN A 1 17  ? -57.116 17.708  -6.285  1.00 4.07  ? 17  ASN A HD21 1  
ATOM 284    H HD22 . ASN A 1 17  ? -58.239 17.026  -5.160  1.00 3.99  ? 17  ASN A HD22 1  
ATOM 285    N N    . GLN A 1 18  ? -52.341 16.150  -2.717  1.00 2.93  ? 18  GLN A N    1  
ATOM 286    C CA   . GLN A 1 18  ? -51.474 15.002  -2.489  1.00 2.72  ? 18  GLN A CA   1  
ATOM 287    C C    . GLN A 1 18  ? -51.145 14.867  -1.010  1.00 2.51  ? 18  GLN A C    1  
ATOM 288    O O    . GLN A 1 18  ? -51.385 15.787  -0.221  1.00 2.57  ? 18  GLN A O    1  
ATOM 289    C CB   . GLN A 1 18  ? -50.182 15.105  -3.321  1.00 2.80  ? 18  GLN A CB   1  
ATOM 290    C CG   . GLN A 1 18  ? -49.275 16.277  -2.966  1.00 2.94  ? 18  GLN A CG   1  
ATOM 291    C CD   . GLN A 1 18  ? -48.322 15.983  -1.820  1.00 2.77  ? 18  GLN A CD   1  
ATOM 292    O OE1  . GLN A 1 18  ? -47.423 15.153  -1.937  1.00 2.69  ? 18  GLN A OE1  1  
ATOM 293    N NE2  . GLN A 1 18  ? -48.504 16.675  -0.707  1.00 2.85  ? 18  GLN A NE2  1  
ATOM 294    H H    . GLN A 1 18  ? -52.400 16.850  -2.030  1.00 2.94  ? 18  GLN A H    1  
ATOM 295    H HA   . GLN A 1 18  ? -52.015 14.121  -2.800  1.00 2.70  ? 18  GLN A HA   1  
ATOM 296    H HB2  . GLN A 1 18  ? -49.615 14.195  -3.188  1.00 2.62  ? 18  GLN A HB2  1  
ATOM 297    H HB3  . GLN A 1 18  ? -50.452 15.194  -4.363  1.00 2.97  ? 18  GLN A HB3  1  
ATOM 298    H HG2  . GLN A 1 18  ? -48.689 16.535  -3.836  1.00 3.11  ? 18  GLN A HG2  1  
ATOM 299    H HG3  . GLN A 1 18  ? -49.894 17.120  -2.691  1.00 3.06  ? 18  GLN A HG3  1  
ATOM 300    H HE21 . GLN A 1 18  ? -49.230 17.332  -0.683  1.00 3.03  ? 18  GLN A HE21 1  
ATOM 301    H HE22 . GLN A 1 18  ? -47.907 16.498  0.048   1.00 2.78  ? 18  GLN A HE22 1  
ATOM 302    N N    . LEU A 1 19  ? -50.597 13.722  -0.640  1.00 2.29  ? 19  LEU A N    1  
ATOM 303    C CA   . LEU A 1 19  ? -50.212 13.470  0.738   1.00 2.11  ? 19  LEU A CA   1  
ATOM 304    C C    . LEU A 1 19  ? -48.692 13.507  0.852   1.00 2.05  ? 19  LEU A C    1  
ATOM 305    O O    . LEU A 1 19  ? -47.990 12.819  0.114   1.00 2.00  ? 19  LEU A O    1  
ATOM 306    C CB   . LEU A 1 19  ? -50.746 12.115  1.218   1.00 1.95  ? 19  LEU A CB   1  
ATOM 307    C CG   . LEU A 1 19  ? -52.271 11.965  1.189   1.00 2.10  ? 19  LEU A CG   1  
ATOM 308    C CD1  . LEU A 1 19  ? -52.669 10.524  1.476   1.00 2.03  ? 19  LEU A CD1  1  
ATOM 309    C CD2  . LEU A 1 19  ? -52.920 12.909  2.192   1.00 2.26  ? 19  LEU A CD2  1  
ATOM 310    H H    . LEU A 1 19  ? -50.437 13.028  -1.314  1.00 2.27  ? 19  LEU A H    1  
ATOM 311    H HA   . LEU A 1 19  ? -50.629 14.256  1.352   1.00 2.19  ? 19  LEU A HA   1  
ATOM 312    H HB2  . LEU A 1 19  ? -50.319 11.344  0.592   1.00 1.87  ? 19  LEU A HB2  1  
ATOM 313    H HB3  . LEU A 1 19  ? -50.409 11.960  2.232   1.00 1.87  ? 19  LEU A HB3  1  
ATOM 314    H HG   . LEU A 1 19  ? -52.633 12.220  0.204   1.00 2.29  ? 19  LEU A HG   1  
ATOM 315    H HD11 . LEU A 1 19  ? -53.727 10.478  1.689   1.00 2.20  ? 19  LEU A HD11 1  
ATOM 316    H HD12 . LEU A 1 19  ? -52.112 10.158  2.325   1.00 2.01  ? 19  LEU A HD12 1  
ATOM 317    H HD13 . LEU A 1 19  ? -52.450 9.913   0.613   1.00 2.16  ? 19  LEU A HD13 1  
ATOM 318    H HD21 . LEU A 1 19  ? -52.542 12.701  3.183   1.00 2.19  ? 19  LEU A HD21 1  
ATOM 319    H HD22 . LEU A 1 19  ? -53.990 12.769  2.178   1.00 2.44  ? 19  LEU A HD22 1  
ATOM 320    H HD23 . LEU A 1 19  ? -52.688 13.930  1.927   1.00 2.46  ? 19  LEU A HD23 1  
ATOM 321    N N    . LEU A 1 20  ? -48.191 14.313  1.770   1.00 2.09  ? 20  LEU A N    1  
ATOM 322    C CA   . LEU A 1 20  ? -46.756 14.444  1.961   1.00 2.09  ? 20  LEU A CA   1  
ATOM 323    C C    . LEU A 1 20  ? -46.241 13.328  2.862   1.00 1.89  ? 20  LEU A C    1  
ATOM 324    O O    . LEU A 1 20  ? -46.476 13.326  4.072   1.00 1.92  ? 20  LEU A O    1  
ATOM 325    C CB   . LEU A 1 20  ? -46.427 15.815  2.562   1.00 2.33  ? 20  LEU A CB   1  
ATOM 326    C CG   . LEU A 1 20  ? -45.098 16.442  2.120   1.00 2.51  ? 20  LEU A CG   1  
ATOM 327    C CD1  . LEU A 1 20  ? -43.919 15.601  2.583   1.00 2.44  ? 20  LEU A CD1  1  
ATOM 328    C CD2  . LEU A 1 20  ? -45.064 16.621  0.609   1.00 2.60  ? 20  LEU A CD2  1  
ATOM 329    H H    . LEU A 1 20  ? -48.799 14.818  2.355   1.00 2.14  ? 20  LEU A H    1  
ATOM 330    H HA   . LEU A 1 20  ? -46.284 14.359  0.995   1.00 2.12  ? 20  LEU A HA   1  
ATOM 331    H HB2  . LEU A 1 20  ? -47.223 16.496  2.302   1.00 2.44  ? 20  LEU A HB2  1  
ATOM 332    H HB3  . LEU A 1 20  ? -46.407 15.713  3.638   1.00 2.29  ? 20  LEU A HB3  1  
ATOM 333    H HG   . LEU A 1 20  ? -45.005 17.418  2.572   1.00 2.70  ? 20  LEU A HG   1  
ATOM 334    H HD11 . LEU A 1 20  ? -43.983 15.450  3.652   1.00 2.54  ? 20  LEU A HD11 1  
ATOM 335    H HD12 . LEU A 1 20  ? -42.998 16.112  2.346   1.00 2.58  ? 20  LEU A HD12 1  
ATOM 336    H HD13 . LEU A 1 20  ? -43.941 14.645  2.082   1.00 2.33  ? 20  LEU A HD13 1  
ATOM 337    H HD21 . LEU A 1 20  ? -44.150 17.121  0.326   1.00 2.77  ? 20  LEU A HD21 1  
ATOM 338    H HD22 . LEU A 1 20  ? -45.911 17.216  0.299   1.00 2.68  ? 20  LEU A HD22 1  
ATOM 339    H HD23 . LEU A 1 20  ? -45.108 15.656  0.130   1.00 2.46  ? 20  LEU A HD23 1  
ATOM 340    N N    . VAL A 1 21  ? -45.557 12.368  2.259   1.00 1.72  ? 21  VAL A N    1  
ATOM 341    C CA   . VAL A 1 21  ? -44.997 11.253  2.999   1.00 1.56  ? 21  VAL A CA   1  
ATOM 342    C C    . VAL A 1 21  ? -43.550 11.551  3.363   1.00 1.64  ? 21  VAL A C    1  
ATOM 343    O O    . VAL A 1 21  ? -42.652 11.461  2.521   1.00 1.62  ? 21  VAL A O    1  
ATOM 344    C CB   . VAL A 1 21  ? -45.073 9.933   2.198   1.00 1.38  ? 21  VAL A CB   1  
ATOM 345    C CG1  . VAL A 1 21  ? -44.499 8.774   3.003   1.00 1.30  ? 21  VAL A CG1  1  
ATOM 346    C CG2  . VAL A 1 21  ? -46.510 9.640   1.787   1.00 1.40  ? 21  VAL A CG2  1  
ATOM 347    H H    . VAL A 1 21  ? -45.420 12.414  1.287   1.00 1.74  ? 21  VAL A H    1  
ATOM 348    H HA   . VAL A 1 21  ? -45.567 11.133  3.908   1.00 1.59  ? 21  VAL A HA   1  
ATOM 349    H HB   . VAL A 1 21  ? -44.482 10.048  1.302   1.00 1.39  ? 21  VAL A HB   1  
ATOM 350    H HG11 . VAL A 1 21  ? -45.062 8.659   3.917   1.00 1.59  ? 21  VAL A HG11 1  
ATOM 351    H HG12 . VAL A 1 21  ? -43.466 8.976   3.241   1.00 1.45  ? 21  VAL A HG12 1  
ATOM 352    H HG13 . VAL A 1 21  ? -44.563 7.864   2.422   1.00 1.36  ? 21  VAL A HG13 1  
ATOM 353    H HG21 . VAL A 1 21  ? -47.124 9.554   2.669   1.00 1.48  ? 21  VAL A HG21 1  
ATOM 354    H HG22 . VAL A 1 21  ? -46.545 8.714   1.232   1.00 1.37  ? 21  VAL A HG22 1  
ATOM 355    H HG23 . VAL A 1 21  ? -46.881 10.444  1.169   1.00 1.52  ? 21  VAL A HG23 1  
ATOM 356    N N    . GLY A 1 22  ? -43.337 11.942  4.611   1.00 1.79  ? 22  GLY A N    1  
ATOM 357    C CA   . GLY A 1 22  ? -42.002 12.250  5.075   1.00 1.95  ? 22  GLY A CA   1  
ATOM 358    C C    . GLY A 1 22  ? -41.563 11.335  6.197   1.00 1.93  ? 22  GLY A C    1  
ATOM 359    O O    . GLY A 1 22  ? -42.086 11.412  7.313   1.00 2.05  ? 22  GLY A O    1  
ATOM 360    H H    . GLY A 1 22  ? -44.098 12.026  5.226   1.00 1.83  ? 22  GLY A H    1  
ATOM 361    H HA2  . GLY A 1 22  ? -41.313 12.149  4.250   1.00 1.93  ? 22  GLY A HA2  1  
ATOM 362    H HA3  . GLY A 1 22  ? -41.981 13.271  5.427   1.00 2.16  ? 22  GLY A HA3  1  
ATOM 363    N N    . ILE A 1 23  ? -40.621 10.456  5.901   1.00 1.83  ? 23  ILE A N    1  
ATOM 364    C CA   . ILE A 1 23  ? -40.107 9.531   6.900   1.00 1.89  ? 23  ILE A CA   1  
ATOM 365    C C    . ILE A 1 23  ? -38.881 10.125  7.578   1.00 2.14  ? 23  ILE A C    1  
ATOM 366    O O    . ILE A 1 23  ? -38.071 10.785  6.934   1.00 2.21  ? 23  ILE A O    1  
ATOM 367    C CB   . ILE A 1 23  ? -39.758 8.140   6.307   1.00 1.69  ? 23  ILE A CB   1  
ATOM 368    C CG1  . ILE A 1 23  ? -38.541 8.208   5.361   1.00 1.61  ? 23  ILE A CG1  1  
ATOM 369    C CG2  . ILE A 1 23  ? -40.969 7.545   5.598   1.00 1.53  ? 23  ILE A CG2  1  
ATOM 370    C CD1  . ILE A 1 23  ? -38.835 8.747   3.972   1.00 1.62  ? 23  ILE A CD1  1  
ATOM 371    H H    . ILE A 1 23  ? -40.249 10.437  4.995   1.00 1.76  ? 23  ILE A H    1  
ATOM 372    H HA   . ILE A 1 23  ? -40.879 9.397   7.645   1.00 1.94  ? 23  ILE A HA   1  
ATOM 373    H HB   . ILE A 1 23  ? -39.516 7.489   7.133   1.00 1.81  ? 23  ILE A HB   1  
ATOM 374    H HG12 . ILE A 1 23  ? -37.792 8.847   5.803   1.00 1.77  ? 23  ILE A HG12 1  
ATOM 375    H HG13 . ILE A 1 23  ? -38.131 7.214   5.249   1.00 1.63  ? 23  ILE A HG13 1  
ATOM 376    H HG21 . ILE A 1 23  ? -41.785 7.447   6.299   1.00 1.71  ? 23  ILE A HG21 1  
ATOM 377    H HG22 . ILE A 1 23  ? -40.714 6.573   5.206   1.00 1.49  ? 23  ILE A HG22 1  
ATOM 378    H HG23 . ILE A 1 23  ? -41.267 8.194   4.787   1.00 1.49  ? 23  ILE A HG23 1  
ATOM 379    H HD11 . ILE A 1 23  ? -37.988 8.565   3.328   1.00 1.70  ? 23  ILE A HD11 1  
ATOM 380    H HD12 . ILE A 1 23  ? -39.016 9.810   4.031   1.00 1.94  ? 23  ILE A HD12 1  
ATOM 381    H HD13 . ILE A 1 23  ? -39.707 8.253   3.569   1.00 1.83  ? 23  ILE A HD13 1  
ATOM 382    N N    . ILE A 1 24  ? -38.755 9.902   8.876   1.00 2.32  ? 24  ILE A N    1  
ATOM 383    C CA   . ILE A 1 24  ? -37.635 10.437  9.633   1.00 2.59  ? 24  ILE A CA   1  
ATOM 384    C C    . ILE A 1 24  ? -36.451 9.476   9.613   1.00 2.60  ? 24  ILE A C    1  
ATOM 385    O O    . ILE A 1 24  ? -35.394 9.794   9.068   1.00 2.64  ? 24  ILE A O    1  
ATOM 386    C CB   . ILE A 1 24  ? -38.034 10.728  11.097  1.00 2.82  ? 24  ILE A CB   1  
ATOM 387    C CG1  . ILE A 1 24  ? -39.312 11.574  11.139  1.00 2.80  ? 24  ILE A CG1  1  
ATOM 388    C CG2  . ILE A 1 24  ? -36.903 11.436  11.833  1.00 3.11  ? 24  ILE A CG2  1  
ATOM 389    C CD1  . ILE A 1 24  ? -39.976 11.608  12.497  1.00 2.98  ? 24  ILE A CD1  1  
ATOM 390    H H    . ILE A 1 24  ? -39.428 9.353   9.339   1.00 2.30  ? 24  ILE A H    1  
ATOM 391    H HA   . ILE A 1 24  ? -37.337 11.368  9.175   1.00 2.64  ? 24  ILE A HA   1  
ATOM 392    H HB   . ILE A 1 24  ? -38.219 9.787   11.592  1.00 2.82  ? 24  ILE A HB   1  
ATOM 393    H HG12 . ILE A 1 24  ? -39.071 12.590  10.864  1.00 2.88  ? 24  ILE A HG12 1  
ATOM 394    H HG13 . ILE A 1 24  ? -40.022 11.173  10.431  1.00 2.61  ? 24  ILE A HG13 1  
ATOM 395    H HG21 . ILE A 1 24  ? -37.196 11.622  12.856  1.00 3.28  ? 24  ILE A HG21 1  
ATOM 396    H HG22 . ILE A 1 24  ? -36.689 12.376  11.344  1.00 3.15  ? 24  ILE A HG22 1  
ATOM 397    H HG23 . ILE A 1 24  ? -36.020 10.815  11.819  1.00 3.13  ? 24  ILE A HG23 1  
ATOM 398    H HD11 . ILE A 1 24  ? -39.267 11.950  13.236  1.00 3.25  ? 24  ILE A HD11 1  
ATOM 399    H HD12 . ILE A 1 24  ? -40.315 10.616  12.756  1.00 2.96  ? 24  ILE A HD12 1  
ATOM 400    H HD13 . ILE A 1 24  ? -40.821 12.282  12.469  1.00 3.07  ? 24  ILE A HD13 1  
ATOM 401    N N    . GLN A 1 25  ? -36.637 8.298   10.197  1.00 2.61  ? 25  GLN A N    1  
ATOM 402    C CA   . GLN A 1 25  ? -35.573 7.304   10.252  1.00 2.65  ? 25  GLN A CA   1  
ATOM 403    C C    . GLN A 1 25  ? -36.129 5.905   10.478  1.00 2.65  ? 25  GLN A C    1  
ATOM 404    O O    . GLN A 1 25  ? -37.283 5.739   10.888  1.00 2.65  ? 25  GLN A O    1  
ATOM 405    C CB   . GLN A 1 25  ? -34.569 7.651   11.362  1.00 2.96  ? 25  GLN A CB   1  
ATOM 406    C CG   . GLN A 1 25  ? -35.166 7.677   12.764  1.00 3.20  ? 25  GLN A CG   1  
ATOM 407    C CD   . GLN A 1 25  ? -34.820 6.443   13.579  1.00 3.44  ? 25  GLN A CD   1  
ATOM 408    O OE1  . GLN A 1 25  ? -35.546 5.449   13.569  1.00 3.45  ? 25  GLN A OE1  1  
ATOM 409    N NE2  . GLN A 1 25  ? -33.714 6.504   14.304  1.00 3.78  ? 25  GLN A NE2  1  
ATOM 410    H H    . GLN A 1 25  ? -37.511 8.084   10.588  1.00 2.60  ? 25  GLN A H    1  
ATOM 411    H HA   . GLN A 1 25  ? -35.060 7.321   9.302   1.00 2.50  ? 25  GLN A HA   1  
ATOM 412    H HB2  . GLN A 1 25  ? -33.773 6.921   11.350  1.00 3.00  ? 25  GLN A HB2  1  
ATOM 413    H HB3  . GLN A 1 25  ? -34.150 8.625   11.156  1.00 2.99  ? 25  GLN A HB3  1  
ATOM 414    H HG2  . GLN A 1 25  ? -34.793 8.548   13.284  1.00 3.36  ? 25  GLN A HG2  1  
ATOM 415    H HG3  . GLN A 1 25  ? -36.240 7.745   12.681  1.00 3.11  ? 25  GLN A HG3  1  
ATOM 416    H HE21 . GLN A 1 25  ? -33.190 7.330   14.277  1.00 3.88  ? 25  GLN A HE21 1  
ATOM 417    H HE22 . GLN A 1 25  ? -33.462 5.716   14.833  1.00 4.00  ? 25  GLN A HE22 1  
ATOM 418    N N    . ALA A 1 26  ? -35.293 4.916   10.203  1.00 2.67  ? 26  ALA A N    1  
ATOM 419    C CA   . ALA A 1 26  ? -35.643 3.517   10.380  1.00 2.74  ? 26  ALA A CA   1  
ATOM 420    C C    . ALA A 1 26  ? -34.500 2.811   11.090  1.00 3.00  ? 26  ALA A C    1  
ATOM 421    O O    . ALA A 1 26  ? -33.338 2.980   10.719  1.00 3.07  ? 26  ALA A O    1  
ATOM 422    C CB   . ALA A 1 26  ? -35.932 2.858   9.039   1.00 2.50  ? 26  ALA A CB   1  
ATOM 423    H H    . ALA A 1 26  ? -34.394 5.135   9.877   1.00 2.67  ? 26  ALA A H    1  
ATOM 424    H HA   . ALA A 1 26  ? -36.532 3.461   10.993  1.00 2.79  ? 26  ALA A HA   1  
ATOM 425    H HB1  . ALA A 1 26  ? -36.326 1.865   9.203   1.00 2.42  ? 26  ALA A HB1  1  
ATOM 426    H HB2  . ALA A 1 26  ? -35.020 2.793   8.466   1.00 2.60  ? 26  ALA A HB2  1  
ATOM 427    H HB3  . ALA A 1 26  ? -36.656 3.447   8.497   1.00 2.56  ? 26  ALA A HB3  1  
ATOM 428    N N    . ALA A 1 27  ? -34.822 2.037   12.109  1.00 3.18  ? 27  ALA A N    1  
ATOM 429    C CA   . ALA A 1 27  ? -33.804 1.334   12.873  1.00 3.45  ? 27  ALA A CA   1  
ATOM 430    C C    . ALA A 1 27  ? -34.084 -0.159  12.945  1.00 3.55  ? 27  ALA A C    1  
ATOM 431    O O    . ALA A 1 27  ? -35.172 -0.608  12.582  1.00 3.49  ? 27  ALA A O    1  
ATOM 432    C CB   . ALA A 1 27  ? -33.711 1.915   14.277  1.00 3.70  ? 27  ALA A CB   1  
ATOM 433    H H    . ALA A 1 27  ? -35.766 1.926   12.348  1.00 3.14  ? 27  ALA A H    1  
ATOM 434    H HA   . ALA A 1 27  ? -32.853 1.489   12.385  1.00 3.44  ? 27  ALA A HA   1  
ATOM 435    H HB1  . ALA A 1 27  ? -33.592 2.987   14.217  1.00 3.67  ? 27  ALA A HB1  1  
ATOM 436    H HB2  . ALA A 1 27  ? -32.862 1.487   14.789  1.00 3.92  ? 27  ALA A HB2  1  
ATOM 437    H HB3  . ALA A 1 27  ? -34.613 1.682   14.824  1.00 3.73  ? 27  ALA A HB3  1  
ATOM 438    N N    . GLU A 1 28  ? -33.082 -0.908  13.419  1.00 3.72  ? 28  GLU A N    1  
ATOM 439    C CA   . GLU A 1 28  ? -33.166 -2.366  13.582  1.00 3.88  ? 28  GLU A CA   1  
ATOM 440    C C    . GLU A 1 28  ? -33.249 -3.077  12.236  1.00 3.67  ? 28  GLU A C    1  
ATOM 441    O O    . GLU A 1 28  ? -33.753 -4.198  12.144  1.00 3.75  ? 28  GLU A O    1  
ATOM 442    C CB   . GLU A 1 28  ? -34.365 -2.752  14.453  1.00 4.09  ? 28  GLU A CB   1  
ATOM 443    C CG   . GLU A 1 28  ? -34.438 -1.992  15.765  1.00 4.36  ? 28  GLU A CG   1  
ATOM 444    C CD   . GLU A 1 28  ? -33.355 -2.401  16.730  1.00 4.60  ? 28  GLU A CD   1  
ATOM 445    O OE1  . GLU A 1 28  ? -32.240 -1.842  16.662  1.00 4.90  ? 28  GLU A OE1  1  
ATOM 446    O OE2  . GLU A 1 28  ? -33.616 -3.284  17.572  1.00 4.80  ? 28  GLU A OE2  1  
ATOM 447    H H    . GLU A 1 28  ? -32.248 -0.459  13.670  1.00 3.77  ? 28  GLU A H    1  
ATOM 448    H HA   . GLU A 1 28  ? -32.262 -2.687  14.078  1.00 4.03  ? 28  GLU A HA   1  
ATOM 449    H HB2  . GLU A 1 28  ? -35.270 -2.559  13.902  1.00 3.95  ? 28  GLU A HB2  1  
ATOM 450    H HB3  . GLU A 1 28  ? -34.309 -3.808  14.678  1.00 4.21  ? 28  GLU A HB3  1  
ATOM 451    H HG2  . GLU A 1 28  ? -34.337 -0.937  15.561  1.00 4.49  ? 28  GLU A HG2  1  
ATOM 452    H HG3  . GLU A 1 28  ? -35.398 -2.180  16.223  1.00 4.53  ? 28  GLU A HG3  1  
ATOM 453    N N    . LEU A 1 29  ? -32.733 -2.429  11.203  1.00 3.45  ? 29  LEU A N    1  
ATOM 454    C CA   . LEU A 1 29  ? -32.748 -2.997  9.862   1.00 3.26  ? 29  LEU A CA   1  
ATOM 455    C C    . LEU A 1 29  ? -31.762 -4.159  9.753   1.00 3.40  ? 29  LEU A C    1  
ATOM 456    O O    . LEU A 1 29  ? -30.622 -4.055  10.212  1.00 3.53  ? 29  LEU A O    1  
ATOM 457    C CB   . LEU A 1 29  ? -32.403 -1.922  8.825   1.00 2.96  ? 29  LEU A CB   1  
ATOM 458    C CG   . LEU A 1 29  ? -33.382 -0.749  8.750   1.00 2.78  ? 29  LEU A CG   1  
ATOM 459    C CD1  . LEU A 1 29  ? -32.872 0.308   7.788   1.00 2.52  ? 29  LEU A CD1  1  
ATOM 460    C CD2  . LEU A 1 29  ? -34.763 -1.222  8.329   1.00 2.72  ? 29  LEU A CD2  1  
ATOM 461    H H    . LEU A 1 29  ? -32.335 -1.547  11.344  1.00 3.44  ? 29  LEU A H    1  
ATOM 462    H HA   . LEU A 1 29  ? -33.743 -3.362  9.668   1.00 3.24  ? 29  LEU A HA   1  
ATOM 463    H HB2  . LEU A 1 29  ? -31.423 -1.533  9.056   1.00 3.01  ? 29  LEU A HB2  1  
ATOM 464    H HB3  . LEU A 1 29  ? -32.365 -2.391  7.854   1.00 2.85  ? 29  LEU A HB3  1  
ATOM 465    H HG   . LEU A 1 29  ? -33.466 -0.297  9.727   1.00 2.91  ? 29  LEU A HG   1  
ATOM 466    H HD11 . LEU A 1 29  ? -33.593 1.108   7.717   1.00 2.40  ? 29  LEU A HD11 1  
ATOM 467    H HD12 . LEU A 1 29  ? -32.727 -0.133  6.812   1.00 2.40  ? 29  LEU A HD12 1  
ATOM 468    H HD13 . LEU A 1 29  ? -31.933 0.700   8.147   1.00 2.63  ? 29  LEU A HD13 1  
ATOM 469    H HD21 . LEU A 1 29  ? -34.691 -1.761  7.397   1.00 2.66  ? 29  LEU A HD21 1  
ATOM 470    H HD22 . LEU A 1 29  ? -35.413 -0.366  8.200   1.00 2.60  ? 29  LEU A HD22 1  
ATOM 471    H HD23 . LEU A 1 29  ? -35.171 -1.871  9.091   1.00 2.92  ? 29  LEU A HD23 1  
ATOM 472    N N    . PRO A 1 30  ? -32.200 -5.297  9.183   1.00 3.42  ? 30  PRO A N    1  
ATOM 473    C CA   . PRO A 1 30  ? -31.346 -6.475  8.997   1.00 3.57  ? 30  PRO A CA   1  
ATOM 474    C C    . PRO A 1 30  ? -30.186 -6.201  8.044   1.00 3.39  ? 30  PRO A C    1  
ATOM 475    O O    . PRO A 1 30  ? -30.240 -5.274  7.229   1.00 3.15  ? 30  PRO A O    1  
ATOM 476    C CB   . PRO A 1 30  ? -32.288 -7.522  8.391   1.00 3.60  ? 30  PRO A CB   1  
ATOM 477    C CG   . PRO A 1 30  ? -33.660 -7.035  8.699   1.00 3.56  ? 30  PRO A CG   1  
ATOM 478    C CD   . PRO A 1 30  ? -33.568 -5.537  8.704   1.00 3.34  ? 30  PRO A CD   1  
ATOM 479    H HA   . PRO A 1 30  ? -30.958 -6.835  9.940   1.00 3.79  ? 30  PRO A HA   1  
ATOM 480    H HB2  . PRO A 1 30  ? -32.122 -7.582  7.324   1.00 3.45  ? 30  PRO A HB2  1  
ATOM 481    H HB3  . PRO A 1 30  ? -32.099 -8.484  8.843   1.00 3.82  ? 30  PRO A HB3  1  
ATOM 482    H HG2  . PRO A 1 30  ? -34.348 -7.367  7.935   1.00 3.50  ? 30  PRO A HG2  1  
ATOM 483    H HG3  . PRO A 1 30  ? -33.970 -7.395  9.669   1.00 3.79  ? 30  PRO A HG3  1  
ATOM 484    H HD2  . PRO A 1 30  ? -33.705 -5.146  7.707   1.00 3.12  ? 30  PRO A HD2  1  
ATOM 485    H HD3  . PRO A 1 30  ? -34.295 -5.119  9.382   1.00 3.39  ? 30  PRO A HD3  1  
ATOM 486    N N    . ALA A 1 31  ? -29.151 -7.022  8.130   1.00 3.53  ? 31  ALA A N    1  
ATOM 487    C CA   . ALA A 1 31  ? -27.982 -6.858  7.284   1.00 3.41  ? 31  ALA A CA   1  
ATOM 488    C C    . ALA A 1 31  ? -28.049 -7.780  6.073   1.00 3.30  ? 31  ALA A C    1  
ATOM 489    O O    . ALA A 1 31  ? -28.586 -8.887  6.151   1.00 3.46  ? 31  ALA A O    1  
ATOM 490    C CB   . ALA A 1 31  ? -26.714 -7.116  8.081   1.00 3.63  ? 31  ALA A CB   1  
ATOM 491    H H    . ALA A 1 31  ? -29.180 -7.767  8.767   1.00 3.73  ? 31  ALA A H    1  
ATOM 492    H HA   . ALA A 1 31  ? -27.960 -5.833  6.943   1.00 3.24  ? 31  ALA A HA   1  
ATOM 493    H HB1  . ALA A 1 31  ? -26.761 -8.100  8.522   1.00 3.79  ? 31  ALA A HB1  1  
ATOM 494    H HB2  . ALA A 1 31  ? -26.621 -6.375  8.859   1.00 3.77  ? 31  ALA A HB2  1  
ATOM 495    H HB3  . ALA A 1 31  ? -25.859 -7.056  7.423   1.00 3.63  ? 31  ALA A HB3  1  
ATOM 496    N N    . LEU A 1 32  ? -27.499 -7.319  4.960   1.00 3.08  ? 32  LEU A N    1  
ATOM 497    C CA   . LEU A 1 32  ? -27.490 -8.096  3.728   1.00 2.98  ? 32  LEU A CA   1  
ATOM 498    C C    . LEU A 1 32  ? -26.071 -8.149  3.174   1.00 2.93  ? 32  LEU A C    1  
ATOM 499    O O    . LEU A 1 32  ? -25.533 -9.226  2.909   1.00 2.99  ? 32  LEU A O    1  
ATOM 500    C CB   . LEU A 1 32  ? -28.445 -7.474  2.701   1.00 2.71  ? 32  LEU A CB   1  
ATOM 501    C CG   . LEU A 1 32  ? -28.993 -8.423  1.619   1.00 2.74  ? 32  LEU A CG   1  
ATOM 502    C CD1  . LEU A 1 32  ? -27.959 -8.681  0.531   1.00 2.78  ? 32  LEU A CD1  1  
ATOM 503    C CD2  . LEU A 1 32  ? -29.453 -9.737  2.231   1.00 3.06  ? 32  LEU A CD2  1  
ATOM 504    H H    . LEU A 1 32  ? -27.075 -6.432  4.971   1.00 3.01  ? 32  LEU A H    1  
ATOM 505    H HA   . LEU A 1 32  ? -27.816 -9.098  3.960   1.00 3.15  ? 32  LEU A HA   1  
ATOM 506    H HB2  . LEU A 1 32  ? -29.285 -7.055  3.237   1.00 2.72  ? 32  LEU A HB2  1  
ATOM 507    H HB3  . LEU A 1 32  ? -27.922 -6.669  2.208   1.00 2.56  ? 32  LEU A HB3  1  
ATOM 508    H HG   . LEU A 1 32  ? -29.850 -7.960  1.152   1.00 2.58  ? 32  LEU A HG   1  
ATOM 509    H HD11 . LEU A 1 32  ? -27.712 -7.751  0.041   1.00 2.76  ? 32  LEU A HD11 1  
ATOM 510    H HD12 . LEU A 1 32  ? -28.364 -9.373  -0.192  1.00 2.88  ? 32  LEU A HD12 1  
ATOM 511    H HD13 . LEU A 1 32  ? -27.069 -9.104  0.974   1.00 3.06  ? 32  LEU A HD13 1  
ATOM 512    H HD21 . LEU A 1 32  ? -30.096 -9.536  3.075   1.00 3.19  ? 32  LEU A HD21 1  
ATOM 513    H HD22 . LEU A 1 32  ? -28.592 -10.302 2.558   1.00 3.30  ? 32  LEU A HD22 1  
ATOM 514    H HD23 . LEU A 1 32  ? -29.996 -10.306 1.491   1.00 3.12  ? 32  LEU A HD23 1  
ATOM 515    N N    . ASP A 1 33  ? -25.472 -6.978  3.008   1.00 2.85  ? 33  ASP A N    1  
ATOM 516    C CA   . ASP A 1 33  ? -24.109 -6.877  2.504   1.00 2.81  ? 33  ASP A CA   1  
ATOM 517    C C    . ASP A 1 33  ? -23.138 -7.496  3.505   1.00 3.17  ? 33  ASP A C    1  
ATOM 518    O O    . ASP A 1 33  ? -23.062 -7.061  4.657   1.00 3.27  ? 33  ASP A O    1  
ATOM 519    C CB   . ASP A 1 33  ? -23.748 -5.412  2.245   1.00 2.57  ? 33  ASP A CB   1  
ATOM 520    C CG   . ASP A 1 33  ? -22.360 -5.239  1.662   1.00 2.47  ? 33  ASP A CG   1  
ATOM 521    O OD1  . ASP A 1 33  ? -21.884 -6.147  0.958   1.00 2.49  ? 33  ASP A OD1  1  
ATOM 522    O OD2  . ASP A 1 33  ? -21.736 -4.183  1.913   1.00 2.50  ? 33  ASP A OD2  1  
ATOM 523    H H    . ASP A 1 33  ? -25.959 -6.157  3.231   1.00 2.84  ? 33  ASP A H    1  
ATOM 524    H HA   . ASP A 1 33  ? -24.052 -7.425  1.576   1.00 2.74  ? 33  ASP A HA   1  
ATOM 525    H HB2  . ASP A 1 33  ? -24.461 -4.989  1.553   1.00 2.35  ? 33  ASP A HB2  1  
ATOM 526    H HB3  . ASP A 1 33  ? -23.795 -4.872  3.178   1.00 2.73  ? 33  ASP A HB3  1  
ATOM 527    N N    . MET A 1 34  ? -22.419 -8.519  3.046   1.00 3.37  ? 34  MET A N    1  
ATOM 528    C CA   . MET A 1 34  ? -21.449 -9.254  3.865   1.00 3.72  ? 34  MET A CA   1  
ATOM 529    C C    . MET A 1 34  ? -20.618 -8.328  4.751   1.00 3.78  ? 34  MET A C    1  
ATOM 530    O O    . MET A 1 34  ? -20.001 -7.376  4.269   1.00 3.85  ? 34  MET A O    1  
ATOM 531    C CB   . MET A 1 34  ? -20.520 -10.072 2.962   1.00 3.91  ? 34  MET A CB   1  
ATOM 532    C CG   . MET A 1 34  ? -19.385 -10.764 3.702   1.00 4.30  ? 34  MET A CG   1  
ATOM 533    S SD   . MET A 1 34  ? -19.958 -12.069 4.807   1.00 4.57  ? 34  MET A SD   1  
ATOM 534    C CE   . MET A 1 34  ? -18.402 -12.609 5.511   1.00 5.18  ? 34  MET A CE   1  
ATOM 535    H H    . MET A 1 34  ? -22.541 -8.789  2.113   1.00 3.30  ? 34  MET A H    1  
ATOM 536    H HA   . MET A 1 34  ? -22.002 -9.932  4.498   1.00 3.83  ? 34  MET A HA   1  
ATOM 537    H HB2  . MET A 1 34  ? -21.103 -10.826 2.457   1.00 3.89  ? 34  MET A HB2  1  
ATOM 538    H HB3  . MET A 1 34  ? -20.088 -9.411  2.223   1.00 3.86  ? 34  MET A HB3  1  
ATOM 539    H HG2  . MET A 1 34  ? -18.712 -11.196 2.976   1.00 4.44  ? 34  MET A HG2  1  
ATOM 540    H HG3  . MET A 1 34  ? -18.854 -10.027 4.287   1.00 4.47  ? 34  MET A HG3  1  
ATOM 541    H HE1  . MET A 1 34  ? -18.571 -13.469 6.142   1.00 5.52  ? 34  MET A HE1  1  
ATOM 542    H HE2  . MET A 1 34  ? -17.976 -11.807 6.099   1.00 5.25  ? 34  MET A HE2  1  
ATOM 543    H HE3  . MET A 1 34  ? -17.720 -12.873 4.718   1.00 5.41  ? 34  MET A HE3  1  
ATOM 544    N N    . GLY A 1 35  ? -20.616 -8.616  6.047   1.00 3.92  ? 35  GLY A N    1  
ATOM 545    C CA   . GLY A 1 35  ? -19.859 -7.814  6.986   1.00 3.99  ? 35  GLY A CA   1  
ATOM 546    C C    . GLY A 1 35  ? -20.733 -7.146  8.029   1.00 3.95  ? 35  GLY A C    1  
ATOM 547    O O    . GLY A 1 35  ? -20.274 -6.261  8.753   1.00 4.09  ? 35  GLY A O    1  
ATOM 548    H H    . GLY A 1 35  ? -21.126 -9.391  6.368   1.00 4.08  ? 35  GLY A H    1  
ATOM 549    H HA2  . GLY A 1 35  ? -19.145 -8.447  7.487   1.00 4.18  ? 35  GLY A HA2  1  
ATOM 550    H HA3  . GLY A 1 35  ? -19.325 -7.051  6.440   1.00 3.91  ? 35  GLY A HA3  1  
ATOM 551    N N    . GLY A 1 36  ? -21.993 -7.556  8.102   1.00 3.82  ? 36  GLY A N    1  
ATOM 552    C CA   . GLY A 1 36  ? -22.905 -6.989  9.077   1.00 3.79  ? 36  GLY A CA   1  
ATOM 553    C C    . GLY A 1 36  ? -23.376 -5.602  8.696   1.00 3.62  ? 36  GLY A C    1  
ATOM 554    O O    . GLY A 1 36  ? -23.441 -4.708  9.536   1.00 3.73  ? 36  GLY A O    1  
ATOM 555    H H    . GLY A 1 36  ? -22.311 -8.247  7.485   1.00 3.76  ? 36  GLY A H    1  
ATOM 556    H HA2  . GLY A 1 36  ? -23.765 -7.635  9.169   1.00 3.79  ? 36  GLY A HA2  1  
ATOM 557    H HA3  . GLY A 1 36  ? -22.404 -6.935  10.032  1.00 3.93  ? 36  GLY A HA3  1  
ATOM 558    N N    . THR A 1 37  ? -23.682 -5.415  7.424   1.00 3.40  ? 37  THR A N    1  
ATOM 559    C CA   . THR A 1 37  ? -24.154 -4.130  6.938   1.00 3.24  ? 37  THR A CA   1  
ATOM 560    C C    . THR A 1 37  ? -25.132 -4.326  5.791   1.00 2.98  ? 37  THR A C    1  
ATOM 561    O O    . THR A 1 37  ? -25.333 -5.446  5.329   1.00 3.12  ? 37  THR A O    1  
ATOM 562    C CB   . THR A 1 37  ? -22.983 -3.250  6.459   1.00 3.22  ? 37  THR A CB   1  
ATOM 563    O OG1  . THR A 1 37  ? -21.763 -4.007  6.485   1.00 3.33  ? 37  THR A OG1  1  
ATOM 564    C CG2  . THR A 1 37  ? -22.834 -2.011  7.331   1.00 3.43  ? 37  THR A CG2  1  
ATOM 565    H H    . THR A 1 37  ? -23.598 -6.160  6.789   1.00 3.40  ? 37  THR A H    1  
ATOM 566    H HA   . THR A 1 37  ? -24.655 -3.625  7.752   1.00 3.37  ? 37  THR A HA   1  
ATOM 567    H HB   . THR A 1 37  ? -23.181 -2.938  5.445   1.00 3.06  ? 37  THR A HB   1  
ATOM 568    H HG1  . THR A 1 37  ? -21.729 -4.519  7.305   1.00 3.43  ? 37  THR A HG1  1  
ATOM 569    H HG21 . THR A 1 37  ? -23.755 -1.445  7.313   1.00 3.42  ? 37  THR A HG21 1  
ATOM 570    H HG22 . THR A 1 37  ? -22.030 -1.400  6.950   1.00 3.52  ? 37  THR A HG22 1  
ATOM 571    H HG23 . THR A 1 37  ? -22.612 -2.307  8.345   1.00 3.62  ? 37  THR A HG23 1  
ATOM 572    N N    . SER A 1 38  ? -25.743 -3.242  5.347   1.00 2.79  ? 38  SER A N    1  
ATOM 573    C CA   . SER A 1 38  ? -26.688 -3.288  4.243   1.00 2.52  ? 38  SER A CA   1  
ATOM 574    C C    . SER A 1 38  ? -26.817 -1.906  3.627   1.00 2.29  ? 38  SER A C    1  
ATOM 575    O O    . SER A 1 38  ? -26.369 -0.915  4.220   1.00 2.38  ? 38  SER A O    1  
ATOM 576    C CB   . SER A 1 38  ? -28.058 -3.782  4.726   1.00 2.58  ? 38  SER A CB   1  
ATOM 577    O OG   . SER A 1 38  ? -28.091 -3.905  6.141   1.00 2.89  ? 38  SER A OG   1  
ATOM 578    H H    . SER A 1 38  ? -25.567 -2.384  5.777   1.00 2.96  ? 38  SER A H    1  
ATOM 579    H HA   . SER A 1 38  ? -26.303 -3.971  3.499   1.00 2.49  ? 38  SER A HA   1  
ATOM 580    H HB2  . SER A 1 38  ? -28.820 -3.080  4.422   1.00 2.48  ? 38  SER A HB2  1  
ATOM 581    H HB3  . SER A 1 38  ? -28.265 -4.748  4.288   1.00 2.58  ? 38  SER A HB3  1  
ATOM 582    H HG   . SER A 1 38  ? -28.945 -4.268  6.414   1.00 2.97  ? 38  SER A HG   1  
ATOM 583    N N    . ASP A 1 39  ? -27.399 -1.846  2.442   1.00 2.02  ? 39  ASP A N    1  
ATOM 584    C CA   . ASP A 1 39  ? -27.616 -0.581  1.747   1.00 1.78  ? 39  ASP A CA   1  
ATOM 585    C C    . ASP A 1 39  ? -29.119 -0.415  1.536   1.00 1.62  ? 39  ASP A C    1  
ATOM 586    O O    . ASP A 1 39  ? -29.617 -0.534  0.415   1.00 1.40  ? 39  ASP A O    1  
ATOM 587    C CB   . ASP A 1 39  ? -26.883 -0.555  0.392   1.00 1.60  ? 39  ASP A CB   1  
ATOM 588    C CG   . ASP A 1 39  ? -25.361 -0.578  0.503   1.00 1.81  ? 39  ASP A CG   1  
ATOM 589    O OD1  . ASP A 1 39  ? -24.824 -0.969  1.562   1.00 2.13  ? 39  ASP A OD1  1  
ATOM 590    O OD2  . ASP A 1 39  ? -24.679 -0.211  -0.477  1.00 1.86  ? 39  ASP A OD2  1  
ATOM 591    H H    . ASP A 1 39  ? -27.705 -2.686  2.015   1.00 1.99  ? 39  ASP A H    1  
ATOM 592    H HA   . ASP A 1 39  ? -27.252 0.221   2.376   1.00 1.90  ? 39  ASP A HA   1  
ATOM 593    H HB2  . ASP A 1 39  ? -27.188 -1.414  -0.186  1.00 1.53  ? 39  ASP A HB2  1  
ATOM 594    H HB3  . ASP A 1 39  ? -27.170 0.343   -0.139  1.00 1.44  ? 39  ASP A HB3  1  
ATOM 595    N N    . PRO A 1 40  ? -29.865 -0.128  2.618   1.00 1.74  ? 40  PRO A N    1  
ATOM 596    C CA   . PRO A 1 40  ? -31.316 -0.015  2.581   1.00 1.64  ? 40  PRO A CA   1  
ATOM 597    C C    . PRO A 1 40  ? -31.840 1.336   2.105   1.00 1.45  ? 40  PRO A C    1  
ATOM 598    O O    . PRO A 1 40  ? -31.623 2.372   2.738   1.00 1.56  ? 40  PRO A O    1  
ATOM 599    C CB   . PRO A 1 40  ? -31.732 -0.254  4.044   1.00 1.91  ? 40  PRO A CB   1  
ATOM 600    C CG   . PRO A 1 40  ? -30.463 -0.401  4.829   1.00 2.16  ? 40  PRO A CG   1  
ATOM 601    C CD   . PRO A 1 40  ? -29.360 0.133   3.965   1.00 2.02  ? 40  PRO A CD   1  
ATOM 602    H HA   . PRO A 1 40  ? -31.748 -0.791  1.964   1.00 1.57  ? 40  PRO A HA   1  
ATOM 603    H HB2  . PRO A 1 40  ? -32.310 0.588   4.393   1.00 1.85  ? 40  PRO A HB2  1  
ATOM 604    H HB3  . PRO A 1 40  ? -32.333 -1.152  4.103   1.00 2.03  ? 40  PRO A HB3  1  
ATOM 605    H HG2  . PRO A 1 40  ? -30.530 0.171   5.741   1.00 2.25  ? 40  PRO A HG2  1  
ATOM 606    H HG3  . PRO A 1 40  ? -30.289 -1.443  5.053   1.00 2.41  ? 40  PRO A HG3  1  
ATOM 607    H HD2  . PRO A 1 40  ? -29.224 1.193   4.131   1.00 2.03  ? 40  PRO A HD2  1  
ATOM 608    H HD3  . PRO A 1 40  ? -28.441 -0.404  4.146   1.00 2.14  ? 40  PRO A HD3  1  
ATOM 609    N N    . TYR A 1 41  ? -32.528 1.308   0.979   1.00 1.21  ? 41  TYR A N    1  
ATOM 610    C CA   . TYR A 1 41  ? -33.150 2.491   0.421   1.00 1.05  ? 41  TYR A CA   1  
ATOM 611    C C    . TYR A 1 41  ? -34.630 2.180   0.203   1.00 0.98  ? 41  TYR A C    1  
ATOM 612    O O    . TYR A 1 41  ? -34.981 1.204   -0.463  1.00 1.03  ? 41  TYR A O    1  
ATOM 613    C CB   . TYR A 1 41  ? -32.452 2.948   -0.874  1.00 0.88  ? 41  TYR A CB   1  
ATOM 614    C CG   . TYR A 1 41  ? -32.628 2.029   -2.064  1.00 0.72  ? 41  TYR A CG   1  
ATOM 615    C CD1  . TYR A 1 41  ? -31.896 0.853   -2.179  1.00 0.77  ? 41  TYR A CD1  1  
ATOM 616    C CD2  . TYR A 1 41  ? -33.523 2.345   -3.077  1.00 0.69  ? 41  TYR A CD2  1  
ATOM 617    C CE1  . TYR A 1 41  ? -32.053 0.017   -3.270  1.00 0.77  ? 41  TYR A CE1  1  
ATOM 618    C CE2  . TYR A 1 41  ? -33.687 1.516   -4.171  1.00 0.75  ? 41  TYR A CE2  1  
ATOM 619    C CZ   . TYR A 1 41  ? -32.952 0.352   -4.262  1.00 0.76  ? 41  TYR A CZ   1  
ATOM 620    O OH   . TYR A 1 41  ? -33.121 -0.479  -5.349  1.00 0.94  ? 41  TYR A OH   1  
ATOM 621    H H    . TYR A 1 41  ? -32.621 0.451   0.500   1.00 1.19  ? 41  TYR A H    1  
ATOM 622    H HA   . TYR A 1 41  ? -33.072 3.277   1.160   1.00 1.18  ? 41  TYR A HA   1  
ATOM 623    H HB2  . TYR A 1 41  ? -32.838 3.916   -1.154  1.00 0.88  ? 41  TYR A HB2  1  
ATOM 624    H HB3  . TYR A 1 41  ? -31.393 3.038   -0.683  1.00 0.99  ? 41  TYR A HB3  1  
ATOM 625    H HD1  . TYR A 1 41  ? -31.196 0.592   -1.398  1.00 0.94  ? 41  TYR A HD1  1  
ATOM 626    H HD2  . TYR A 1 41  ? -34.099 3.255   -3.003  1.00 0.77  ? 41  TYR A HD2  1  
ATOM 627    H HE1  . TYR A 1 41  ? -31.475 -0.892  -3.342  1.00 0.89  ? 41  TYR A HE1  1  
ATOM 628    H HE2  . TYR A 1 41  ? -34.390 1.781   -4.947  1.00 0.89  ? 41  TYR A HE2  1  
ATOM 629    H HH   . TYR A 1 41  ? -32.734 -1.339  -5.159  1.00 1.16  ? 41  TYR A HH   1  
ATOM 630    N N    . VAL A 1 42  ? -35.493 2.980   0.807   1.00 0.98  ? 42  VAL A N    1  
ATOM 631    C CA   . VAL A 1 42  ? -36.929 2.759   0.707   1.00 0.98  ? 42  VAL A CA   1  
ATOM 632    C C    . VAL A 1 42  ? -37.497 3.274   -0.607  1.00 0.82  ? 42  VAL A C    1  
ATOM 633    O O    . VAL A 1 42  ? -37.146 4.360   -1.075  1.00 0.78  ? 42  VAL A O    1  
ATOM 634    C CB   . VAL A 1 42  ? -37.699 3.403   1.886   1.00 1.10  ? 42  VAL A CB   1  
ATOM 635    C CG1  . VAL A 1 42  ? -37.509 2.596   3.157   1.00 1.37  ? 42  VAL A CG1  1  
ATOM 636    C CG2  . VAL A 1 42  ? -37.270 4.846   2.108   1.00 1.11  ? 42  VAL A CG2  1  
ATOM 637    H H    . VAL A 1 42  ? -35.159 3.746   1.317   1.00 1.04  ? 42  VAL A H    1  
ATOM 638    H HA   . VAL A 1 42  ? -37.093 1.694   0.751   1.00 1.10  ? 42  VAL A HA   1  
ATOM 639    H HB   . VAL A 1 42  ? -38.753 3.399   1.643   1.00 1.08  ? 42  VAL A HB   1  
ATOM 640    H HG11 . VAL A 1 42  ? -37.973 3.115   3.984   1.00 1.46  ? 42  VAL A HG11 1  
ATOM 641    H HG12 . VAL A 1 42  ? -36.454 2.475   3.353   1.00 1.45  ? 42  VAL A HG12 1  
ATOM 642    H HG13 . VAL A 1 42  ? -37.967 1.626   3.039   1.00 1.45  ? 42  VAL A HG13 1  
ATOM 643    H HG21 . VAL A 1 42  ? -36.211 4.878   2.326   1.00 1.27  ? 42  VAL A HG21 1  
ATOM 644    H HG22 . VAL A 1 42  ? -37.820 5.260   2.940   1.00 1.27  ? 42  VAL A HG22 1  
ATOM 645    H HG23 . VAL A 1 42  ? -37.473 5.422   1.218   1.00 1.04  ? 42  VAL A HG23 1  
ATOM 646    N N    . LYS A 1 43  ? -38.355 2.470   -1.211  1.00 0.92  ? 43  LYS A N    1  
ATOM 647    C CA   . LYS A 1 43  ? -39.010 2.834   -2.451  1.00 0.97  ? 43  LYS A CA   1  
ATOM 648    C C    . LYS A 1 43  ? -40.505 2.595   -2.297  1.00 1.14  ? 43  LYS A C    1  
ATOM 649    O O    . LYS A 1 43  ? -40.941 1.506   -1.915  1.00 1.31  ? 43  LYS A O    1  
ATOM 650    C CB   . LYS A 1 43  ? -38.435 2.065   -3.651  1.00 1.11  ? 43  LYS A CB   1  
ATOM 651    C CG   . LYS A 1 43  ? -38.513 0.549   -3.535  1.00 1.25  ? 43  LYS A CG   1  
ATOM 652    C CD   . LYS A 1 43  ? -38.060 -0.125  -4.822  1.00 1.45  ? 43  LYS A CD   1  
ATOM 653    C CE   . LYS A 1 43  ? -36.549 -0.074  -4.978  1.00 1.20  ? 43  LYS A CE   1  
ATOM 654    N NZ   . LYS A 1 43  ? -36.113 -0.360  -6.373  1.00 1.37  ? 43  LYS A NZ   1  
ATOM 655    H H    . LYS A 1 43  ? -38.566 1.599   -0.799  1.00 1.07  ? 43  LYS A H    1  
ATOM 656    H HA   . LYS A 1 43  ? -38.848 3.893   -2.600  1.00 0.91  ? 43  LYS A HA   1  
ATOM 657    H HB2  . LYS A 1 43  ? -38.976 2.359   -4.540  1.00 1.36  ? 43  LYS A HB2  1  
ATOM 658    H HB3  . LYS A 1 43  ? -37.398 2.341   -3.770  1.00 1.08  ? 43  LYS A HB3  1  
ATOM 659    H HG2  . LYS A 1 43  ? -37.877 0.225   -2.725  1.00 1.20  ? 43  LYS A HG2  1  
ATOM 660    H HG3  . LYS A 1 43  ? -39.536 0.265   -3.330  1.00 1.50  ? 43  LYS A HG3  1  
ATOM 661    H HD2  . LYS A 1 43  ? -38.373 -1.159  -4.804  1.00 1.71  ? 43  LYS A HD2  1  
ATOM 662    H HD3  . LYS A 1 43  ? -38.518 0.376   -5.662  1.00 1.76  ? 43  LYS A HD3  1  
ATOM 663    H HE2  . LYS A 1 43  ? -36.203 0.909   -4.700  1.00 1.36  ? 43  LYS A HE2  1  
ATOM 664    H HE3  . LYS A 1 43  ? -36.110 -0.808  -4.318  1.00 1.36  ? 43  LYS A HE3  1  
ATOM 665    H HZ1  . LYS A 1 43  ? -36.285 0.473   -6.982  1.00 1.56  ? 43  LYS A HZ1  1  
ATOM 666    H HZ2  . LYS A 1 43  ? -36.638 -1.170  -6.757  1.00 1.72  ? 43  LYS A HZ2  1  
ATOM 667    H HZ3  . LYS A 1 43  ? -35.094 -0.583  -6.393  1.00 1.85  ? 43  LYS A HZ3  1  
ATOM 668    N N    . VAL A 1 44  ? -41.282 3.624   -2.565  1.00 1.15  ? 44  VAL A N    1  
ATOM 669    C CA   . VAL A 1 44  ? -42.725 3.544   -2.422  1.00 1.31  ? 44  VAL A CA   1  
ATOM 670    C C    . VAL A 1 44  ? -43.389 2.969   -3.662  1.00 1.55  ? 44  VAL A C    1  
ATOM 671    O O    . VAL A 1 44  ? -43.102 3.380   -4.790  1.00 1.65  ? 44  VAL A O    1  
ATOM 672    C CB   . VAL A 1 44  ? -43.345 4.921   -2.115  1.00 1.31  ? 44  VAL A CB   1  
ATOM 673    C CG1  . VAL A 1 44  ? -43.860 4.967   -0.686  1.00 1.38  ? 44  VAL A CG1  1  
ATOM 674    C CG2  . VAL A 1 44  ? -42.340 6.039   -2.356  1.00 1.52  ? 44  VAL A CG2  1  
ATOM 675    H H    . VAL A 1 44  ? -40.876 4.459   -2.878  1.00 1.11  ? 44  VAL A H    1  
ATOM 676    H HA   . VAL A 1 44  ? -42.935 2.890   -1.586  1.00 1.31  ? 44  VAL A HA   1  
ATOM 677    H HB   . VAL A 1 44  ? -44.183 5.072   -2.778  1.00 1.52  ? 44  VAL A HB   1  
ATOM 678    H HG11 . VAL A 1 44  ? -44.593 4.188   -0.543  1.00 1.59  ? 44  VAL A HG11 1  
ATOM 679    H HG12 . VAL A 1 44  ? -44.316 5.928   -0.499  1.00 1.42  ? 44  VAL A HG12 1  
ATOM 680    H HG13 . VAL A 1 44  ? -43.038 4.818   -0.001  1.00 1.52  ? 44  VAL A HG13 1  
ATOM 681    H HG21 . VAL A 1 44  ? -41.491 5.907   -1.701  1.00 1.62  ? 44  VAL A HG21 1  
ATOM 682    H HG22 . VAL A 1 44  ? -42.805 6.994   -2.155  1.00 1.60  ? 44  VAL A HG22 1  
ATOM 683    H HG23 . VAL A 1 44  ? -42.011 6.010   -3.383  1.00 1.79  ? 44  VAL A HG23 1  
ATOM 684    N N    . PHE A 1 45  ? -44.272 2.011   -3.432  1.00 1.72  ? 45  PHE A N    1  
ATOM 685    C CA   . PHE A 1 45  ? -45.022 1.370   -4.496  1.00 2.00  ? 45  PHE A CA   1  
ATOM 686    C C    . PHE A 1 45  ? -46.507 1.482   -4.191  1.00 2.14  ? 45  PHE A C    1  
ATOM 687    O O    . PHE A 1 45  ? -46.890 1.799   -3.064  1.00 2.10  ? 45  PHE A O    1  
ATOM 688    C CB   . PHE A 1 45  ? -44.623 -0.101  -4.648  1.00 2.13  ? 45  PHE A CB   1  
ATOM 689    C CG   . PHE A 1 45  ? -43.429 -0.321  -5.532  1.00 2.22  ? 45  PHE A CG   1  
ATOM 690    C CD1  . PHE A 1 45  ? -43.388 0.209   -6.813  1.00 2.39  ? 45  PHE A CD1  1  
ATOM 691    C CD2  . PHE A 1 45  ? -42.350 -1.070  -5.086  1.00 2.31  ? 45  PHE A CD2  1  
ATOM 692    C CE1  . PHE A 1 45  ? -42.291 0.001   -7.627  1.00 2.57  ? 45  PHE A CE1  1  
ATOM 693    C CE2  . PHE A 1 45  ? -41.253 -1.282  -5.898  1.00 2.48  ? 45  PHE A CE2  1  
ATOM 694    C CZ   . PHE A 1 45  ? -41.225 -0.748  -7.172  1.00 2.57  ? 45  PHE A CZ   1  
ATOM 695    H H    . PHE A 1 45  ? -44.439 1.730   -2.503  1.00 1.70  ? 45  PHE A H    1  
ATOM 696    H HA   . PHE A 1 45  ? -44.813 1.894   -5.416  1.00 2.04  ? 45  PHE A HA   1  
ATOM 697    H HB2  . PHE A 1 45  ? -44.392 -0.505  -3.674  1.00 2.10  ? 45  PHE A HB2  1  
ATOM 698    H HB3  . PHE A 1 45  ? -45.454 -0.648  -5.069  1.00 2.31  ? 45  PHE A HB3  1  
ATOM 699    H HD1  . PHE A 1 45  ? -44.221 0.796   -7.172  1.00 2.51  ? 45  PHE A HD1  1  
ATOM 700    H HD2  . PHE A 1 45  ? -42.371 -1.488  -4.091  1.00 2.37  ? 45  PHE A HD2  1  
ATOM 701    H HE1  . PHE A 1 45  ? -42.271 0.420   -8.623  1.00 2.80  ? 45  PHE A HE1  1  
ATOM 702    H HE2  . PHE A 1 45  ? -40.419 -1.866  -5.537  1.00 2.66  ? 45  PHE A HE2  1  
ATOM 703    H HZ   . PHE A 1 45  ? -40.369 -0.913  -7.812  1.00 2.76  ? 45  PHE A HZ   1  
ATOM 704    N N    . LEU A 1 46  ? -47.337 1.211   -5.180  1.00 2.36  ? 46  LEU A N    1  
ATOM 705    C CA   . LEU A 1 46  ? -48.776 1.306   -5.002  1.00 2.52  ? 46  LEU A CA   1  
ATOM 706    C C    . LEU A 1 46  ? -49.482 0.118   -5.640  1.00 2.82  ? 46  LEU A C    1  
ATOM 707    O O    . LEU A 1 46  ? -48.861 -0.698  -6.320  1.00 2.91  ? 46  LEU A O    1  
ATOM 708    C CB   . LEU A 1 46  ? -49.296 2.611   -5.624  1.00 2.56  ? 46  LEU A CB   1  
ATOM 709    C CG   . LEU A 1 46  ? -49.958 3.603   -4.658  1.00 2.40  ? 46  LEU A CG   1  
ATOM 710    C CD1  . LEU A 1 46  ? -51.246 3.034   -4.087  1.00 2.46  ? 46  LEU A CD1  1  
ATOM 711    C CD2  . LEU A 1 46  ? -49.002 3.984   -3.538  1.00 2.12  ? 46  LEU A CD2  1  
ATOM 712    H H    . LEU A 1 46  ? -46.977 0.931   -6.045  1.00 2.44  ? 46  LEU A H    1  
ATOM 713    H HA   . LEU A 1 46  ? -48.984 1.310   -3.944  1.00 2.43  ? 46  LEU A HA   1  
ATOM 714    H HB2  . LEU A 1 46  ? -48.463 3.110   -6.098  1.00 2.53  ? 46  LEU A HB2  1  
ATOM 715    H HB3  . LEU A 1 46  ? -50.015 2.355   -6.386  1.00 2.77  ? 46  LEU A HB3  1  
ATOM 716    H HG   . LEU A 1 46  ? -50.209 4.503   -5.200  1.00 2.46  ? 46  LEU A HG   1  
ATOM 717    H HD11 . LEU A 1 46  ? -51.955 2.877   -4.887  1.00 2.74  ? 46  LEU A HD11 1  
ATOM 718    H HD12 . LEU A 1 46  ? -51.659 3.725   -3.370  1.00 2.33  ? 46  LEU A HD12 1  
ATOM 719    H HD13 . LEU A 1 46  ? -51.039 2.091   -3.600  1.00 2.61  ? 46  LEU A HD13 1  
ATOM 720    H HD21 . LEU A 1 46  ? -49.563 4.384   -2.710  1.00 2.05  ? 46  LEU A HD21 1  
ATOM 721    H HD22 . LEU A 1 46  ? -48.308 4.729   -3.896  1.00 2.12  ? 46  LEU A HD22 1  
ATOM 722    H HD23 . LEU A 1 46  ? -48.456 3.110   -3.215  1.00 2.14  ? 46  LEU A HD23 1  
ATOM 723    N N    . LEU A 1 47  ? -50.780 0.037   -5.397  1.00 2.97  ? 47  LEU A N    1  
ATOM 724    C CA   . LEU A 1 47  ? -51.627 -1.011  -5.953  1.00 3.28  ? 47  LEU A CA   1  
ATOM 725    C C    . LEU A 1 47  ? -51.904 -0.674  -7.441  1.00 3.46  ? 47  LEU A C    1  
ATOM 726    O O    . LEU A 1 47  ? -51.131 0.099   -8.007  1.00 3.35  ? 47  LEU A O    1  
ATOM 727    C CB   . LEU A 1 47  ? -52.892 -1.107  -5.078  1.00 3.37  ? 47  LEU A CB   1  
ATOM 728    C CG   . LEU A 1 47  ? -53.630 0.215   -4.814  1.00 3.40  ? 47  LEU A CG   1  
ATOM 729    C CD1  . LEU A 1 47  ? -54.808 0.391   -5.757  1.00 3.57  ? 47  LEU A CD1  1  
ATOM 730    C CD2  . LEU A 1 47  ? -54.099 0.269   -3.370  1.00 3.20  ? 47  LEU A CD2  1  
ATOM 731    H H    . LEU A 1 47  ? -51.188 0.709   -4.816  1.00 2.89  ? 47  LEU A H    1  
ATOM 732    H HA   . LEU A 1 47  ? -51.080 -1.941  -5.902  1.00 3.32  ? 47  LEU A HA   1  
ATOM 733    H HB2  . LEU A 1 47  ? -53.575 -1.792  -5.540  1.00 3.57  ? 47  LEU A HB2  1  
ATOM 734    H HB3  . LEU A 1 47  ? -52.601 -1.520  -4.124  1.00 3.24  ? 47  LEU A HB3  1  
ATOM 735    H HG   . LEU A 1 47  ? -52.952 1.038   -4.975  1.00 3.55  ? 47  LEU A HG   1  
ATOM 736    H HD11 . LEU A 1 47  ? -55.253 1.364   -5.601  1.00 3.58  ? 47  LEU A HD11 1  
ATOM 737    H HD12 . LEU A 1 47  ? -55.544 -0.374  -5.562  1.00 3.61  ? 47  LEU A HD12 1  
ATOM 738    H HD13 . LEU A 1 47  ? -54.467 0.310   -6.779  1.00 3.85  ? 47  LEU A HD13 1  
ATOM 739    H HD21 . LEU A 1 47  ? -54.685 -0.611  -3.148  1.00 3.23  ? 47  LEU A HD21 1  
ATOM 740    H HD22 . LEU A 1 47  ? -54.705 1.152   -3.221  1.00 3.17  ? 47  LEU A HD22 1  
ATOM 741    H HD23 . LEU A 1 47  ? -53.242 0.305   -2.714  1.00 3.26  ? 47  LEU A HD23 1  
ATOM 742    N N    . PRO A 1 48  ? -52.950 -1.232  -8.134  1.00 3.76  ? 48  PRO A N    1  
ATOM 743    C CA   . PRO A 1 48  ? -53.229 -0.897  -9.552  1.00 3.96  ? 48  PRO A CA   1  
ATOM 744    C C    . PRO A 1 48  ? -53.185 0.604   -9.883  1.00 3.88  ? 48  PRO A C    1  
ATOM 745    O O    . PRO A 1 48  ? -53.145 0.976   -11.059 1.00 4.04  ? 48  PRO A O    1  
ATOM 746    C CB   . PRO A 1 48  ? -54.633 -1.450  -9.757  1.00 4.25  ? 48  PRO A CB   1  
ATOM 747    C CG   . PRO A 1 48  ? -54.645 -2.664  -8.908  1.00 4.26  ? 48  PRO A CG   1  
ATOM 748    C CD   . PRO A 1 48  ? -53.903 -2.273  -7.659  1.00 3.94  ? 48  PRO A CD   1  
ATOM 749    H HA   . PRO A 1 48  ? -52.548 -1.416  -10.210 1.00 4.02  ? 48  PRO A HA   1  
ATOM 750    H HB2  . PRO A 1 48  ? -55.364 -0.722  -9.431  1.00 4.25  ? 48  PRO A HB2  1  
ATOM 751    H HB3  . PRO A 1 48  ? -54.786 -1.689  -10.797 1.00 4.44  ? 48  PRO A HB3  1  
ATOM 752    H HG2  . PRO A 1 48  ? -55.663 -2.943  -8.675  1.00 4.40  ? 48  PRO A HG2  1  
ATOM 753    H HG3  . PRO A 1 48  ? -54.135 -3.471  -9.411  1.00 4.36  ? 48  PRO A HG3  1  
ATOM 754    H HD2  . PRO A 1 48  ? -54.597 -1.866  -6.938  1.00 3.89  ? 48  PRO A HD2  1  
ATOM 755    H HD3  . PRO A 1 48  ? -53.378 -3.122  -7.247  1.00 3.92  ? 48  PRO A HD3  1  
ATOM 756    N N    . ASP A 1 49  ? -53.217 1.456   -8.855  1.00 3.68  ? 49  ASP A N    1  
ATOM 757    C CA   . ASP A 1 49  ? -53.135 2.905   -9.041  1.00 3.62  ? 49  ASP A CA   1  
ATOM 758    C C    . ASP A 1 49  ? -51.903 3.239   -9.875  1.00 3.56  ? 49  ASP A C    1  
ATOM 759    O O    . ASP A 1 49  ? -52.013 3.831   -10.947 1.00 3.73  ? 49  ASP A O    1  
ATOM 760    C CB   . ASP A 1 49  ? -53.047 3.611   -7.683  1.00 3.37  ? 49  ASP A CB   1  
ATOM 761    C CG   . ASP A 1 49  ? -52.874 5.114   -7.811  1.00 3.31  ? 49  ASP A CG   1  
ATOM 762    O OD1  . ASP A 1 49  ? -53.870 5.796   -8.136  1.00 3.48  ? 49  ASP A OD1  1  
ATOM 763    O OD2  . ASP A 1 49  ? -51.748 5.618   -7.581  1.00 3.12  ? 49  ASP A OD2  1  
ATOM 764    H H    . ASP A 1 49  ? -53.290 1.096   -7.948  1.00 3.59  ? 49  ASP A H    1  
ATOM 765    H HA   . ASP A 1 49  ? -54.021 3.232   -9.563  1.00 3.81  ? 49  ASP A HA   1  
ATOM 766    H HB2  . ASP A 1 49  ? -53.951 3.418   -7.126  1.00 3.43  ? 49  ASP A HB2  1  
ATOM 767    H HB3  . ASP A 1 49  ? -52.202 3.217   -7.137  1.00 3.19  ? 49  ASP A HB3  1  
ATOM 768    N N    . LYS A 1 50  ? -50.742 2.830   -9.357  1.00 3.34  ? 50  LYS A N    1  
ATOM 769    C CA   . LYS A 1 50  ? -49.441 3.022   -10.010 1.00 3.27  ? 50  LYS A CA   1  
ATOM 770    C C    . LYS A 1 50  ? -49.245 4.427   -10.582 1.00 3.28  ? 50  LYS A C    1  
ATOM 771    O O    . LYS A 1 50  ? -48.640 4.590   -11.643 1.00 3.36  ? 50  LYS A O    1  
ATOM 772    C CB   . LYS A 1 50  ? -49.247 1.980   -11.114 1.00 3.49  ? 50  LYS A CB   1  
ATOM 773    C CG   . LYS A 1 50  ? -49.210 0.549   -10.602 1.00 3.52  ? 50  LYS A CG   1  
ATOM 774    C CD   . LYS A 1 50  ? -47.939 0.257   -9.815  1.00 3.27  ? 50  LYS A CD   1  
ATOM 775    C CE   . LYS A 1 50  ? -46.752 -0.015  -10.728 1.00 3.35  ? 50  LYS A CE   1  
ATOM 776    N NZ   . LYS A 1 50  ? -46.986 -1.194  -11.603 1.00 3.70  ? 50  LYS A NZ   1  
ATOM 777    H H    . LYS A 1 50  ? -50.763 2.361   -8.496  1.00 3.24  ? 50  LYS A H    1  
ATOM 778    H HA   . LYS A 1 50  ? -48.683 2.861   -9.258  1.00 3.07  ? 50  LYS A HA   1  
ATOM 779    H HB2  . LYS A 1 50  ? -50.059 2.066   -11.819 1.00 3.73  ? 50  LYS A HB2  1  
ATOM 780    H HB3  . LYS A 1 50  ? -48.316 2.181   -11.625 1.00 3.45  ? 50  LYS A HB3  1  
ATOM 781    H HG2  . LYS A 1 50  ? -50.062 0.389   -9.959  1.00 3.56  ? 50  LYS A HG2  1  
ATOM 782    H HG3  . LYS A 1 50  ? -49.264 -0.123  -11.445 1.00 3.73  ? 50  LYS A HG3  1  
ATOM 783    H HD2  . LYS A 1 50  ? -47.710 1.108   -9.193  1.00 3.13  ? 50  LYS A HD2  1  
ATOM 784    H HD3  . LYS A 1 50  ? -48.106 -0.609  -9.194  1.00 3.29  ? 50  LYS A HD3  1  
ATOM 785    H HE2  . LYS A 1 50  ? -46.579 0.854   -11.344 1.00 3.43  ? 50  LYS A HE2  1  
ATOM 786    H HE3  . LYS A 1 50  ? -45.881 -0.200  -10.116 1.00 3.17  ? 50  LYS A HE3  1  
ATOM 787    H HZ1  . LYS A 1 50  ? -46.082 -1.547  -11.974 1.00 3.93  ? 50  LYS A HZ1  1  
ATOM 788    H HZ2  . LYS A 1 50  ? -47.593 -0.929  -12.405 1.00 3.92  ? 50  LYS A HZ2  1  
ATOM 789    H HZ3  . LYS A 1 50  ? -47.453 -1.955  -11.067 1.00 3.73  ? 50  LYS A HZ3  1  
ATOM 790    N N    . LYS A 1 51  ? -49.744 5.436   -9.885  1.00 3.24  ? 51  LYS A N    1  
ATOM 791    C CA   . LYS A 1 51  ? -49.584 6.814   -10.332 1.00 3.30  ? 51  LYS A CA   1  
ATOM 792    C C    . LYS A 1 51  ? -48.518 7.501   -9.491  1.00 3.04  ? 51  LYS A C    1  
ATOM 793    O O    . LYS A 1 51  ? -48.602 8.699   -9.214  1.00 3.06  ? 51  LYS A O    1  
ATOM 794    C CB   . LYS A 1 51  ? -50.901 7.581   -10.214 1.00 3.46  ? 51  LYS A CB   1  
ATOM 795    C CG   . LYS A 1 51  ? -52.035 6.988   -11.027 1.00 3.74  ? 51  LYS A CG   1  
ATOM 796    C CD   . LYS A 1 51  ? -53.352 7.679   -10.719 1.00 3.88  ? 51  LYS A CD   1  
ATOM 797    C CE   . LYS A 1 51  ? -54.526 6.919   -11.306 1.00 4.11  ? 51  LYS A CE   1  
ATOM 798    N NZ   . LYS A 1 51  ? -54.634 5.553   -10.734 1.00 4.04  ? 51  LYS A NZ   1  
ATOM 799    H H    . LYS A 1 51  ? -50.250 5.251   -9.061  1.00 3.18  ? 51  LYS A H    1  
ATOM 800    H HA   . LYS A 1 51  ? -49.268 6.800   -11.365 1.00 3.44  ? 51  LYS A HA   1  
ATOM 801    H HB2  . LYS A 1 51  ? -51.201 7.598   -9.176  1.00 3.32  ? 51  LYS A HB2  1  
ATOM 802    H HB3  . LYS A 1 51  ? -50.742 8.597   -10.547 1.00 3.52  ? 51  LYS A HB3  1  
ATOM 803    H HG2  . LYS A 1 51  ? -51.813 7.107   -12.076 1.00 3.90  ? 51  LYS A HG2  1  
ATOM 804    H HG3  . LYS A 1 51  ? -52.126 5.939   -10.791 1.00 3.71  ? 51  LYS A HG3  1  
ATOM 805    H HD2  . LYS A 1 51  ? -53.474 7.737   -9.648  1.00 3.72  ? 51  LYS A HD2  1  
ATOM 806    H HD3  . LYS A 1 51  ? -53.333 8.672   -11.136 1.00 3.99  ? 51  LYS A HD3  1  
ATOM 807    H HE2  . LYS A 1 51  ? -55.435 7.461   -11.093 1.00 4.23  ? 51  LYS A HE2  1  
ATOM 808    H HE3  . LYS A 1 51  ? -54.392 6.844   -12.374 1.00 4.28  ? 51  LYS A HE3  1  
ATOM 809    H HZ1  . LYS A 1 51  ? -55.581 5.162   -10.916 1.00 4.22  ? 51  LYS A HZ1  1  
ATOM 810    H HZ2  . LYS A 1 51  ? -54.477 5.585   -9.701  1.00 3.87  ? 51  LYS A HZ2  1  
ATOM 811    H HZ3  . LYS A 1 51  ? -53.922 4.927   -11.162 1.00 4.07  ? 51  LYS A HZ3  1  
ATOM 812    N N    . LYS A 1 52  ? -47.537 6.723   -9.055  1.00 2.82  ? 52  LYS A N    1  
ATOM 813    C CA   . LYS A 1 52  ? -46.457 7.228   -8.217  1.00 2.58  ? 52  LYS A CA   1  
ATOM 814    C C    . LYS A 1 52  ? -45.382 6.163   -8.032  1.00 2.38  ? 52  LYS A C    1  
ATOM 815    O O    . LYS A 1 52  ? -45.696 4.986   -7.841  1.00 2.39  ? 52  LYS A O    1  
ATOM 816    C CB   . LYS A 1 52  ? -47.011 7.649   -6.849  1.00 2.45  ? 52  LYS A CB   1  
ATOM 817    C CG   . LYS A 1 52  ? -47.948 6.614   -6.240  1.00 2.44  ? 52  LYS A CG   1  
ATOM 818    C CD   . LYS A 1 52  ? -48.802 7.199   -5.123  1.00 2.43  ? 52  LYS A CD   1  
ATOM 819    C CE   . LYS A 1 52  ? -49.754 8.277   -5.625  1.00 2.69  ? 52  LYS A CE   1  
ATOM 820    N NZ   . LYS A 1 52  ? -50.410 7.909   -6.910  1.00 2.94  ? 52  LYS A NZ   1  
ATOM 821    H H    . LYS A 1 52  ? -47.530 5.777   -9.314  1.00 2.85  ? 52  LYS A H    1  
ATOM 822    H HA   . LYS A 1 52  ? -46.023 8.088   -8.706  1.00 2.66  ? 52  LYS A HA   1  
ATOM 823    H HB2  . LYS A 1 52  ? -46.185 7.804   -6.169  1.00 2.26  ? 52  LYS A HB2  1  
ATOM 824    H HB3  . LYS A 1 52  ? -47.553 8.575   -6.961  1.00 2.60  ? 52  LYS A HB3  1  
ATOM 825    H HG2  . LYS A 1 52  ? -48.601 6.237   -7.013  1.00 2.64  ? 52  LYS A HG2  1  
ATOM 826    H HG3  . LYS A 1 52  ? -47.358 5.802   -5.841  1.00 2.32  ? 52  LYS A HG3  1  
ATOM 827    H HD2  . LYS A 1 52  ? -49.382 6.408   -4.678  1.00 2.47  ? 52  LYS A HD2  1  
ATOM 828    H HD3  . LYS A 1 52  ? -48.151 7.629   -4.377  1.00 2.35  ? 52  LYS A HD3  1  
ATOM 829    H HE2  . LYS A 1 52  ? -50.517 8.435   -4.879  1.00 2.80  ? 52  LYS A HE2  1  
ATOM 830    H HE3  . LYS A 1 52  ? -49.196 9.191   -5.764  1.00 2.77  ? 52  LYS A HE3  1  
ATOM 831    H HZ1  . LYS A 1 52  ? -49.702 7.849   -7.666  1.00 2.97  ? 52  LYS A HZ1  1  
ATOM 832    H HZ2  . LYS A 1 52  ? -51.113 8.636   -7.171  1.00 3.11  ? 52  LYS A HZ2  1  
ATOM 833    H HZ3  . LYS A 1 52  ? -50.894 6.987   -6.826  1.00 2.99  ? 52  LYS A HZ3  1  
ATOM 834    N N    . LYS A 1 53  ? -44.127 6.579   -8.108  1.00 2.24  ? 53  LYS A N    1  
ATOM 835    C CA   . LYS A 1 53  ? -42.995 5.680   -7.931  1.00 2.04  ? 53  LYS A CA   1  
ATOM 836    C C    . LYS A 1 53  ? -41.739 6.497   -7.661  1.00 1.89  ? 53  LYS A C    1  
ATOM 837    O O    . LYS A 1 53  ? -41.151 7.070   -8.579  1.00 2.06  ? 53  LYS A O    1  
ATOM 838    C CB   . LYS A 1 53  ? -42.788 4.802   -9.168  1.00 2.22  ? 53  LYS A CB   1  
ATOM 839    C CG   . LYS A 1 53  ? -41.907 3.590   -8.911  1.00 2.09  ? 53  LYS A CG   1  
ATOM 840    C CD   . LYS A 1 53  ? -41.191 3.131   -10.172 1.00 2.37  ? 53  LYS A CD   1  
ATOM 841    C CE   . LYS A 1 53  ? -40.032 4.051   -10.527 1.00 2.53  ? 53  LYS A CE   1  
ATOM 842    N NZ   . LYS A 1 53  ? -39.346 3.628   -11.774 1.00 2.84  ? 53  LYS A NZ   1  
ATOM 843    H H    . LYS A 1 53  ? -43.951 7.526   -8.296  1.00 2.30  ? 53  LYS A H    1  
ATOM 844    H HA   . LYS A 1 53  ? -43.200 5.051   -7.076  1.00 1.92  ? 53  LYS A HA   1  
ATOM 845    H HB2  . LYS A 1 53  ? -43.751 4.456   -9.516  1.00 2.41  ? 53  LYS A HB2  1  
ATOM 846    H HB3  . LYS A 1 53  ? -42.329 5.395   -9.942  1.00 2.33  ? 53  LYS A HB3  1  
ATOM 847    H HG2  . LYS A 1 53  ? -41.168 3.846   -8.166  1.00 1.91  ? 53  LYS A HG2  1  
ATOM 848    H HG3  . LYS A 1 53  ? -42.524 2.783   -8.543  1.00 2.07  ? 53  LYS A HG3  1  
ATOM 849    H HD2  . LYS A 1 53  ? -40.808 2.135   -10.014 1.00 2.35  ? 53  LYS A HD2  1  
ATOM 850    H HD3  . LYS A 1 53  ? -41.896 3.121   -10.990 1.00 2.62  ? 53  LYS A HD3  1  
ATOM 851    H HE2  . LYS A 1 53  ? -40.410 5.052   -10.657 1.00 2.76  ? 53  LYS A HE2  1  
ATOM 852    H HE3  . LYS A 1 53  ? -39.320 4.041   -9.716  1.00 2.40  ? 53  LYS A HE3  1  
ATOM 853    H HZ1  . LYS A 1 53  ? -40.046 3.412   -12.513 1.00 3.15  ? 53  LYS A HZ1  1  
ATOM 854    H HZ2  . LYS A 1 53  ? -38.771 2.778   -11.600 1.00 2.80  ? 53  LYS A HZ2  1  
ATOM 855    H HZ3  . LYS A 1 53  ? -38.724 4.388   -12.118 1.00 3.12  ? 53  LYS A HZ3  1  
ATOM 856    N N    . PHE A 1 54  ? -41.336 6.558   -6.403  1.00 1.63  ? 54  PHE A N    1  
ATOM 857    C CA   . PHE A 1 54  ? -40.161 7.326   -6.019  1.00 1.53  ? 54  PHE A CA   1  
ATOM 858    C C    . PHE A 1 54  ? -39.221 6.486   -5.169  1.00 1.26  ? 54  PHE A C    1  
ATOM 859    O O    . PHE A 1 54  ? -39.646 5.828   -4.219  1.00 1.12  ? 54  PHE A O    1  
ATOM 860    C CB   . PHE A 1 54  ? -40.588 8.586   -5.256  1.00 1.54  ? 54  PHE A CB   1  
ATOM 861    C CG   . PHE A 1 54  ? -39.440 9.415   -4.744  1.00 1.60  ? 54  PHE A CG   1  
ATOM 862    C CD1  . PHE A 1 54  ? -38.716 10.228  -5.602  1.00 1.94  ? 54  PHE A CD1  1  
ATOM 863    C CD2  . PHE A 1 54  ? -39.088 9.382   -3.402  1.00 1.51  ? 54  PHE A CD2  1  
ATOM 864    C CE1  . PHE A 1 54  ? -37.663 10.989  -5.133  1.00 2.15  ? 54  PHE A CE1  1  
ATOM 865    C CE2  . PHE A 1 54  ? -38.035 10.142  -2.929  1.00 1.74  ? 54  PHE A CE2  1  
ATOM 866    C CZ   . PHE A 1 54  ? -37.323 10.947  -3.795  1.00 2.03  ? 54  PHE A CZ   1  
ATOM 867    H H    . PHE A 1 54  ? -41.832 6.065   -5.716  1.00 1.57  ? 54  PHE A H    1  
ATOM 868    H HA   . PHE A 1 54  ? -39.646 7.619   -6.921  1.00 1.69  ? 54  PHE A HA   1  
ATOM 869    H HB2  . PHE A 1 54  ? -41.178 9.209   -5.909  1.00 1.76  ? 54  PHE A HB2  1  
ATOM 870    H HB3  . PHE A 1 54  ? -41.188 8.293   -4.407  1.00 1.43  ? 54  PHE A HB3  1  
ATOM 871    H HD1  . PHE A 1 54  ? -38.980 10.264  -6.649  1.00 2.14  ? 54  PHE A HD1  1  
ATOM 872    H HD2  . PHE A 1 54  ? -39.646 8.752   -2.724  1.00 1.41  ? 54  PHE A HD2  1  
ATOM 873    H HE1  . PHE A 1 54  ? -37.104 11.617  -5.813  1.00 2.48  ? 54  PHE A HE1  1  
ATOM 874    H HE2  . PHE A 1 54  ? -37.772 10.106  -1.882  1.00 1.80  ? 54  PHE A HE2  1  
ATOM 875    H HZ   . PHE A 1 54  ? -36.501 11.543  -3.426  1.00 2.27  ? 54  PHE A HZ   1  
ATOM 876    N N    . GLU A 1 55  ? -37.947 6.506   -5.526  1.00 1.28  ? 55  GLU A N    1  
ATOM 877    C CA   . GLU A 1 55  ? -36.934 5.769   -4.795  1.00 1.09  ? 55  GLU A CA   1  
ATOM 878    C C    . GLU A 1 55  ? -36.040 6.751   -4.051  1.00 1.09  ? 55  GLU A C    1  
ATOM 879    O O    . GLU A 1 55  ? -35.614 7.761   -4.615  1.00 1.30  ? 55  GLU A O    1  
ATOM 880    C CB   . GLU A 1 55  ? -36.101 4.910   -5.751  1.00 1.17  ? 55  GLU A CB   1  
ATOM 881    C CG   . GLU A 1 55  ? -36.942 4.026   -6.658  1.00 1.29  ? 55  GLU A CG   1  
ATOM 882    C CD   . GLU A 1 55  ? -36.105 3.196   -7.607  1.00 1.29  ? 55  GLU A CD   1  
ATOM 883    O OE1  . GLU A 1 55  ? -35.276 3.772   -8.341  1.00 1.90  ? 55  GLU A OE1  1  
ATOM 884    O OE2  . GLU A 1 55  ? -36.288 1.962   -7.641  1.00 1.43  ? 55  GLU A OE2  1  
ATOM 885    H H    . GLU A 1 55  ? -37.678 7.041   -6.304  1.00 1.47  ? 55  GLU A H    1  
ATOM 886    H HA   . GLU A 1 55  ? -37.432 5.132   -4.081  1.00 0.99  ? 55  GLU A HA   1  
ATOM 887    H HB2  . GLU A 1 55  ? -35.501 5.561   -6.370  1.00 1.36  ? 55  GLU A HB2  1  
ATOM 888    H HB3  . GLU A 1 55  ? -35.447 4.275   -5.171  1.00 1.53  ? 55  GLU A HB3  1  
ATOM 889    H HG2  . GLU A 1 55  ? -37.529 3.361   -6.045  1.00 1.86  ? 55  GLU A HG2  1  
ATOM 890    H HG3  . GLU A 1 55  ? -37.602 4.654   -7.240  1.00 1.69  ? 55  GLU A HG3  1  
ATOM 891    N N    . THR A 1 56  ? -35.769 6.466   -2.788  1.00 0.96  ? 56  THR A N    1  
ATOM 892    C CA   . THR A 1 56  ? -34.938 7.343   -1.978  1.00 1.09  ? 56  THR A CA   1  
ATOM 893    C C    . THR A 1 56  ? -33.462 7.175   -2.324  1.00 1.14  ? 56  THR A C    1  
ATOM 894    O O    . THR A 1 56  ? -33.095 6.293   -3.108  1.00 1.05  ? 56  THR A O    1  
ATOM 895    C CB   . THR A 1 56  ? -35.159 7.075   -0.479  1.00 1.06  ? 56  THR A CB   1  
ATOM 896    O OG1  . THR A 1 56  ? -34.995 5.679   -0.203  1.00 0.90  ? 56  THR A OG1  1  
ATOM 897    C CG2  . THR A 1 56  ? -36.552 7.518   -0.061  1.00 1.12  ? 56  THR A CG2  1  
ATOM 898    H H    . THR A 1 56  ? -36.132 5.646   -2.390  1.00 0.85  ? 56  THR A H    1  
ATOM 899    H HA   . THR A 1 56  ? -35.233 8.361   -2.186  1.00 1.27  ? 56  THR A HA   1  
ATOM 900    H HB   . THR A 1 56  ? -34.432 7.637   0.086   1.00 1.22  ? 56  THR A HB   1  
ATOM 901    H HG1  . THR A 1 56  ? -35.811 5.214   -0.439  1.00 0.80  ? 56  THR A HG1  1  
ATOM 902    H HG21 . THR A 1 56  ? -36.672 7.369   1.001   1.00 1.16  ? 56  THR A HG21 1  
ATOM 903    H HG22 . THR A 1 56  ? -37.292 6.935   -0.592  1.00 1.01  ? 56  THR A HG22 1  
ATOM 904    H HG23 . THR A 1 56  ? -36.684 8.564   -0.295  1.00 1.29  ? 56  THR A HG23 1  
ATOM 905    N N    . LYS A 1 57  ? -32.620 8.023   -1.745  1.00 1.35  ? 57  LYS A N    1  
ATOM 906    C CA   . LYS A 1 57  ? -31.188 7.966   -1.997  1.00 1.46  ? 57  LYS A CA   1  
ATOM 907    C C    . LYS A 1 57  ? -30.618 6.682   -1.418  1.00 1.33  ? 57  LYS A C    1  
ATOM 908    O O    . LYS A 1 57  ? -30.983 6.279   -0.316  1.00 1.33  ? 57  LYS A O    1  
ATOM 909    C CB   . LYS A 1 57  ? -30.482 9.177   -1.379  1.00 1.78  ? 57  LYS A CB   1  
ATOM 910    C CG   . LYS A 1 57  ? -28.979 9.183   -1.608  1.00 1.90  ? 57  LYS A CG   1  
ATOM 911    C CD   . LYS A 1 57  ? -28.265 10.080  -0.614  1.00 2.39  ? 57  LYS A CD   1  
ATOM 912    C CE   . LYS A 1 57  ? -26.754 10.003  -0.774  1.00 2.56  ? 57  LYS A CE   1  
ATOM 913    N NZ   . LYS A 1 57  ? -26.252 8.604   -0.709  1.00 2.59  ? 57  LYS A NZ   1  
ATOM 914    H H    . LYS A 1 57  ? -32.965 8.686   -1.109  1.00 1.45  ? 57  LYS A H    1  
ATOM 915    H HA   . LYS A 1 57  ? -31.032 7.970   -3.067  1.00 1.45  ? 57  LYS A HA   1  
ATOM 916    H HB2  . LYS A 1 57  ? -30.893 10.077  -1.810  1.00 1.92  ? 57  LYS A HB2  1  
ATOM 917    H HB3  . LYS A 1 57  ? -30.665 9.181   -0.314  1.00 1.86  ? 57  LYS A HB3  1  
ATOM 918    H HG2  . LYS A 1 57  ? -28.606 8.175   -1.500  1.00 1.79  ? 57  LYS A HG2  1  
ATOM 919    H HG3  . LYS A 1 57  ? -28.780 9.537   -2.608  1.00 2.15  ? 57  LYS A HG3  1  
ATOM 920    H HD2  . LYS A 1 57  ? -28.581 11.100  -0.777  1.00 2.83  ? 57  LYS A HD2  1  
ATOM 921    H HD3  . LYS A 1 57  ? -28.529 9.777   0.389   1.00 2.56  ? 57  LYS A HD3  1  
ATOM 922    H HE2  . LYS A 1 57  ? -26.485 10.426  -1.728  1.00 2.60  ? 57  LYS A HE2  1  
ATOM 923    H HE3  . LYS A 1 57  ? -26.293 10.579  0.016   1.00 3.04  ? 57  LYS A HE3  1  
ATOM 924    H HZ1  . LYS A 1 57  ? -26.590 8.134   0.153   1.00 2.92  ? 57  LYS A HZ1  1  
ATOM 925    H HZ2  . LYS A 1 57  ? -25.214 8.599   -0.703  1.00 2.85  ? 57  LYS A HZ2  1  
ATOM 926    H HZ3  . LYS A 1 57  ? -26.577 8.065   -1.536  1.00 2.68  ? 57  LYS A HZ3  1  
ATOM 927    N N    . VAL A 1 58  ? -29.745 6.029   -2.168  1.00 1.27  ? 58  VAL A N    1  
ATOM 928    C CA   . VAL A 1 58  ? -29.137 4.797   -1.702  1.00 1.21  ? 58  VAL A CA   1  
ATOM 929    C C    . VAL A 1 58  ? -28.282 5.054   -0.459  1.00 1.49  ? 58  VAL A C    1  
ATOM 930    O O    . VAL A 1 58  ? -27.239 5.712   -0.520  1.00 1.70  ? 58  VAL A O    1  
ATOM 931    C CB   . VAL A 1 58  ? -28.299 4.102   -2.806  1.00 1.13  ? 58  VAL A CB   1  
ATOM 932    C CG1  . VAL A 1 58  ? -27.306 5.064   -3.442  1.00 1.34  ? 58  VAL A CG1  1  
ATOM 933    C CG2  . VAL A 1 58  ? -27.577 2.881   -2.249  1.00 1.17  ? 58  VAL A CG2  1  
ATOM 934    H H    . VAL A 1 58  ? -29.513 6.377   -3.056  1.00 1.31  ? 58  VAL A H    1  
ATOM 935    H HA   . VAL A 1 58  ? -29.940 4.130   -1.425  1.00 1.08  ? 58  VAL A HA   1  
ATOM 936    H HB   . VAL A 1 58  ? -28.977 3.767   -3.576  1.00 0.97  ? 58  VAL A HB   1  
ATOM 937    H HG11 . VAL A 1 58  ? -26.747 4.546   -4.207  1.00 1.32  ? 58  VAL A HG11 1  
ATOM 938    H HG12 . VAL A 1 58  ? -26.627 5.432   -2.688  1.00 1.54  ? 58  VAL A HG12 1  
ATOM 939    H HG13 . VAL A 1 58  ? -27.838 5.892   -3.883  1.00 1.42  ? 58  VAL A HG13 1  
ATOM 940    H HG21 . VAL A 1 58  ? -28.302 2.168   -1.888  1.00 1.12  ? 58  VAL A HG21 1  
ATOM 941    H HG22 . VAL A 1 58  ? -26.931 3.183   -1.437  1.00 1.39  ? 58  VAL A HG22 1  
ATOM 942    H HG23 . VAL A 1 58  ? -26.983 2.426   -3.030  1.00 1.18  ? 58  VAL A HG23 1  
ATOM 943    N N    . HIS A 1 59  ? -28.764 4.572   0.676   1.00 1.55  ? 59  HIS A N    1  
ATOM 944    C CA   . HIS A 1 59  ? -28.051 4.726   1.932   1.00 1.84  ? 59  HIS A CA   1  
ATOM 945    C C    . HIS A 1 59  ? -27.109 3.543   2.085   1.00 1.91  ? 59  HIS A C    1  
ATOM 946    O O    . HIS A 1 59  ? -27.424 2.565   2.759   1.00 1.98  ? 59  HIS A O    1  
ATOM 947    C CB   . HIS A 1 59  ? -29.019 4.808   3.126   1.00 1.93  ? 59  HIS A CB   1  
ATOM 948    C CG   . HIS A 1 59  ? -30.261 5.623   2.880   1.00 1.80  ? 59  HIS A CG   1  
ATOM 949    N ND1  . HIS A 1 59  ? -31.519 5.063   2.812   1.00 1.62  ? 59  HIS A ND1  1  
ATOM 950    C CD2  . HIS A 1 59  ? -30.441 6.958   2.707   1.00 1.87  ? 59  HIS A CD2  1  
ATOM 951    C CE1  . HIS A 1 59  ? -32.415 6.012   2.607   1.00 1.56  ? 59  HIS A CE1  1  
ATOM 952    N NE2  . HIS A 1 59  ? -31.791 7.172   2.537   1.00 1.72  ? 59  HIS A NE2  1  
ATOM 953    H H    . HIS A 1 59  ? -29.615 4.089   0.664   1.00 1.42  ? 59  HIS A H    1  
ATOM 954    H HA   . HIS A 1 59  ? -27.467 5.632   1.876   1.00 1.98  ? 59  HIS A HA   1  
ATOM 955    H HB2  . HIS A 1 59  ? -29.331 3.811   3.393   1.00 1.90  ? 59  HIS A HB2  1  
ATOM 956    H HB3  . HIS A 1 59  ? -28.496 5.249   3.965   1.00 2.17  ? 59  HIS A HB3  1  
ATOM 957    H HD1  . HIS A 1 59  ? -31.725 4.103   2.896   1.00 1.58  ? 59  HIS A HD1  1  
ATOM 958    H HD2  . HIS A 1 59  ? -29.666 7.713   2.700   1.00 2.04  ? 59  HIS A HD2  1  
ATOM 959    H HE1  . HIS A 1 59  ? -33.480 5.863   2.513   1.00 1.43  ? 59  HIS A HE1  1  
ATOM 960    H HE2  . HIS A 1 59  ? -32.200 8.004   2.166   1.00 1.73  ? 59  HIS A HE2  1  
ATOM 961    N N    . ARG A 1 60  ? -25.968 3.634   1.424   1.00 1.95  ? 60  ARG A N    1  
ATOM 962    C CA   . ARG A 1 60  ? -24.987 2.562   1.430   1.00 2.02  ? 60  ARG A CA   1  
ATOM 963    C C    . ARG A 1 60  ? -24.307 2.380   2.785   1.00 2.32  ? 60  ARG A C    1  
ATOM 964    O O    . ARG A 1 60  ? -23.925 3.353   3.441   1.00 2.54  ? 60  ARG A O    1  
ATOM 965    C CB   . ARG A 1 60  ? -23.940 2.803   0.333   1.00 2.04  ? 60  ARG A CB   1  
ATOM 966    C CG   . ARG A 1 60  ? -23.204 4.132   0.446   1.00 2.27  ? 60  ARG A CG   1  
ATOM 967    C CD   . ARG A 1 60  ? -21.897 3.986   1.210   1.00 2.66  ? 60  ARG A CD   1  
ATOM 968    N NE   . ARG A 1 60  ? -21.253 5.274   1.465   1.00 2.67  ? 60  ARG A NE   1  
ATOM 969    C CZ   . ARG A 1 60  ? -21.438 6.003   2.566   1.00 3.07  ? 60  ARG A CZ   1  
ATOM 970    N NH1  . ARG A 1 60  ? -22.296 5.610   3.503   1.00 3.37  ? 60  ARG A NH1  1  
ATOM 971    N NH2  . ARG A 1 60  ? -20.760 7.131   2.727   1.00 3.45  ? 60  ARG A NH2  1  
ATOM 972    H H    . ARG A 1 60  ? -25.778 4.452   0.916   1.00 1.95  ? 60  ARG A H    1  
ATOM 973    H HA   . ARG A 1 60  ? -25.516 1.649   1.195   1.00 1.88  ? 60  ARG A HA   1  
ATOM 974    H HB2  . ARG A 1 60  ? -23.208 2.010   0.376   1.00 2.19  ? 60  ARG A HB2  1  
ATOM 975    H HB3  . ARG A 1 60  ? -24.432 2.771   -0.630  1.00 1.82  ? 60  ARG A HB3  1  
ATOM 976    H HG2  . ARG A 1 60  ? -22.986 4.498   -0.546  1.00 2.22  ? 60  ARG A HG2  1  
ATOM 977    H HG3  . ARG A 1 60  ? -23.836 4.841   0.964   1.00 2.34  ? 60  ARG A HG3  1  
ATOM 978    H HD2  . ARG A 1 60  ? -22.101 3.503   2.155   1.00 3.09  ? 60  ARG A HD2  1  
ATOM 979    H HD3  . ARG A 1 60  ? -21.227 3.370   0.631   1.00 2.92  ? 60  ARG A HD3  1  
ATOM 980    H HE   . ARG A 1 60  ? -20.626 5.606   0.779   1.00 2.63  ? 60  ARG A HE   1  
ATOM 981    H HH11 . ARG A 1 60  ? -22.816 4.755   3.388   1.00 3.34  ? 60  ARG A HH11 1  
ATOM 982    H HH12 . ARG A 1 60  ? -22.432 6.164   4.330   1.00 3.80  ? 60  ARG A HH12 1  
ATOM 983    H HH21 . ARG A 1 60  ? -20.108 7.432   2.020   1.00 3.45  ? 60  ARG A HH21 1  
ATOM 984    H HH22 . ARG A 1 60  ? -20.890 7.689   3.550   1.00 3.90  ? 60  ARG A HH22 1  
ATOM 985    N N    . LYS A 1 61  ? -24.167 1.114   3.177   1.00 2.36  ? 61  LYS A N    1  
ATOM 986    C CA   . LYS A 1 61  ? -23.505 0.714   4.419   1.00 2.66  ? 61  LYS A CA   1  
ATOM 987    C C    . LYS A 1 61  ? -24.064 1.433   5.643   1.00 2.84  ? 61  LYS A C    1  
ATOM 988    O O    . LYS A 1 61  ? -23.397 2.289   6.229   1.00 3.01  ? 61  LYS A O    1  
ATOM 989    C CB   . LYS A 1 61  ? -21.988 0.940   4.321   1.00 2.83  ? 61  LYS A CB   1  
ATOM 990    C CG   . LYS A 1 61  ? -21.389 0.589   2.962   1.00 2.65  ? 61  LYS A CG   1  
ATOM 991    C CD   . LYS A 1 61  ? -21.691 -0.847  2.559   1.00 2.58  ? 61  LYS A CD   1  
ATOM 992    C CE   . LYS A 1 61  ? -21.609 -1.032  1.049   1.00 2.36  ? 61  LYS A CE   1  
ATOM 993    N NZ   . LYS A 1 61  ? -22.598 -2.027  0.565   1.00 2.24  ? 61  LYS A NZ   1  
ATOM 994    H H    . LYS A 1 61  ? -24.545 0.402   2.602   1.00 2.20  ? 61  LYS A H    1  
ATOM 995    H HA   . LYS A 1 61  ? -23.680 -0.343  4.544   1.00 2.67  ? 61  LYS A HA   1  
ATOM 996    H HB2  . LYS A 1 61  ? -21.780 1.981   4.521   1.00 2.91  ? 61  LYS A HB2  1  
ATOM 997    H HB3  . LYS A 1 61  ? -21.498 0.337   5.071   1.00 3.04  ? 61  LYS A HB3  1  
ATOM 998    H HG2  . LYS A 1 61  ? -21.802 1.253   2.218   1.00 2.48  ? 61  LYS A HG2  1  
ATOM 999    H HG3  . LYS A 1 61  ? -20.319 0.722   3.008   1.00 2.81  ? 61  LYS A HG3  1  
ATOM 1000   H HD2  . LYS A 1 61  ? -20.977 -1.505  3.034   1.00 2.79  ? 61  LYS A HD2  1  
ATOM 1001   H HD3  . LYS A 1 61  ? -22.689 -1.100  2.888   1.00 2.55  ? 61  LYS A HD3  1  
ATOM 1002   H HE2  . LYS A 1 61  ? -21.804 -0.083  0.572   1.00 2.27  ? 61  LYS A HE2  1  
ATOM 1003   H HE3  . LYS A 1 61  ? -20.615 -1.369  0.793   1.00 2.42  ? 61  LYS A HE3  1  
ATOM 1004   H HZ1  . LYS A 1 61  ? -22.546 -2.112  -0.468  1.00 2.19  ? 61  LYS A HZ1  1  
ATOM 1005   H HZ2  . LYS A 1 61  ? -23.567 -1.723  0.829   1.00 2.22  ? 61  LYS A HZ2  1  
ATOM 1006   H HZ3  . LYS A 1 61  ? -22.409 -2.960  0.994   1.00 2.36  ? 61  LYS A HZ3  1  
ATOM 1007   N N    . THR A 1 62  ? -25.285 1.084   6.029   1.00 2.81  ? 62  THR A N    1  
ATOM 1008   C CA   . THR A 1 62  ? -25.911 1.680   7.198   1.00 2.98  ? 62  THR A CA   1  
ATOM 1009   C C    . THR A 1 62  ? -27.039 0.792   7.716   1.00 2.97  ? 62  THR A C    1  
ATOM 1010   O O    . THR A 1 62  ? -27.631 0.017   6.964   1.00 2.79  ? 62  THR A O    1  
ATOM 1011   C CB   . THR A 1 62  ? -26.454 3.099   6.899   1.00 2.91  ? 62  THR A CB   1  
ATOM 1012   O OG1  . THR A 1 62  ? -26.827 3.752   8.121   1.00 3.19  ? 62  THR A OG1  1  
ATOM 1013   C CG2  . THR A 1 62  ? -27.657 3.045   5.968   1.00 2.72  ? 62  THR A CG2  1  
ATOM 1014   H H    . THR A 1 62  ? -25.782 0.409   5.508   1.00 2.68  ? 62  THR A H    1  
ATOM 1015   H HA   . THR A 1 62  ? -25.158 1.764   7.968   1.00 3.21  ? 62  THR A HA   1  
ATOM 1016   H HB   . THR A 1 62  ? -25.673 3.674   6.420   1.00 2.89  ? 62  THR A HB   1  
ATOM 1017   H HG1  . THR A 1 62  ? -26.056 4.190   8.497   1.00 3.30  ? 62  THR A HG1  1  
ATOM 1018   H HG21 . THR A 1 62  ? -28.013 4.047   5.780   1.00 2.69  ? 62  THR A HG21 1  
ATOM 1019   H HG22 . THR A 1 62  ? -28.442 2.465   6.429   1.00 2.83  ? 62  THR A HG22 1  
ATOM 1020   H HG23 . THR A 1 62  ? -27.369 2.583   5.034   1.00 2.60  ? 62  THR A HG23 1  
ATOM 1021   N N    . LEU A 1 63  ? -27.311 0.888   9.010   1.00 3.20  ? 63  LEU A N    1  
ATOM 1022   C CA   . LEU A 1 63  ? -28.369 0.104   9.634   1.00 3.24  ? 63  LEU A CA   1  
ATOM 1023   C C    . LEU A 1 63  ? -29.388 1.034   10.278  1.00 3.27  ? 63  LEU A C    1  
ATOM 1024   O O    . LEU A 1 63  ? -30.350 0.591   10.910  1.00 3.33  ? 63  LEU A O    1  
ATOM 1025   C CB   . LEU A 1 63  ? -27.776 -0.847  10.679  1.00 3.54  ? 63  LEU A CB   1  
ATOM 1026   C CG   . LEU A 1 63  ? -26.769 -1.865  10.132  1.00 3.55  ? 63  LEU A CG   1  
ATOM 1027   C CD1  . LEU A 1 63  ? -26.018 -2.538  11.269  1.00 3.88  ? 63  LEU A CD1  1  
ATOM 1028   C CD2  . LEU A 1 63  ? -27.476 -2.904  9.274   1.00 3.37  ? 63  LEU A CD2  1  
ATOM 1029   H H    . LEU A 1 63  ? -26.783 1.504   9.564   1.00 3.35  ? 63  LEU A H    1  
ATOM 1030   H HA   . LEU A 1 63  ? -28.857 -0.472  8.862   1.00 3.07  ? 63  LEU A HA   1  
ATOM 1031   H HB2  . LEU A 1 63  ? -27.283 -0.254  11.434  1.00 3.72  ? 63  LEU A HB2  1  
ATOM 1032   H HB3  . LEU A 1 63  ? -28.586 -1.390  11.141  1.00 3.59  ? 63  LEU A HB3  1  
ATOM 1033   H HG   . LEU A 1 63  ? -26.046 -1.351  9.511   1.00 3.49  ? 63  LEU A HG   1  
ATOM 1034   H HD11 . LEU A 1 63  ? -26.720 -3.052  11.908  1.00 3.99  ? 63  LEU A HD11 1  
ATOM 1035   H HD12 . LEU A 1 63  ? -25.490 -1.792  11.844  1.00 4.06  ? 63  LEU A HD12 1  
ATOM 1036   H HD13 . LEU A 1 63  ? -25.312 -3.249  10.867  1.00 3.88  ? 63  LEU A HD13 1  
ATOM 1037   H HD21 . LEU A 1 63  ? -28.027 -2.409  8.490   1.00 3.25  ? 63  LEU A HD21 1  
ATOM 1038   H HD22 . LEU A 1 63  ? -28.158 -3.472  9.889   1.00 3.47  ? 63  LEU A HD22 1  
ATOM 1039   H HD23 . LEU A 1 63  ? -26.746 -3.570  8.839   1.00 3.45  ? 63  LEU A HD23 1  
ATOM 1040   N N    . ASN A 1 64  ? -29.158 2.330   10.103  1.00 3.24  ? 64  ASN A N    1  
ATOM 1041   C CA   . ASN A 1 64  ? -30.028 3.366   10.648  1.00 3.27  ? 64  ASN A CA   1  
ATOM 1042   C C    . ASN A 1 64  ? -29.870 4.639   9.820   1.00 3.09  ? 64  ASN A C    1  
ATOM 1043   O O    . ASN A 1 64  ? -29.085 5.524   10.168  1.00 3.26  ? 64  ASN A O    1  
ATOM 1044   C CB   . ASN A 1 64  ? -29.678 3.640   12.116  1.00 3.63  ? 64  ASN A CB   1  
ATOM 1045   C CG   . ASN A 1 64  ? -30.644 4.594   12.801  1.00 3.76  ? 64  ASN A CG   1  
ATOM 1046   O OD1  . ASN A 1 64  ? -31.566 4.174   13.498  1.00 3.91  ? 64  ASN A OD1  1  
ATOM 1047   N ND2  . ASN A 1 64  ? -30.436 5.889   12.610  1.00 3.83  ? 64  ASN A ND2  1  
ATOM 1048   H H    . ASN A 1 64  ? -28.375 2.603   9.579   1.00 3.21  ? 64  ASN A H    1  
ATOM 1049   H HA   . ASN A 1 64  ? -31.050 3.020   10.580  1.00 3.19  ? 64  ASN A HA   1  
ATOM 1050   H HB2  . ASN A 1 64  ? -29.683 2.708   12.659  1.00 3.78  ? 64  ASN A HB2  1  
ATOM 1051   H HB3  . ASN A 1 64  ? -28.688 4.070   12.163  1.00 3.73  ? 64  ASN A HB3  1  
ATOM 1052   H HD21 . ASN A 1 64  ? -29.679 6.157   12.040  1.00 3.80  ? 64  ASN A HD21 1  
ATOM 1053   H HD22 . ASN A 1 64  ? -31.042 6.523   13.040  1.00 3.97  ? 64  ASN A HD22 1  
ATOM 1054   N N    . PRO A 1 65  ? -30.594 4.736   8.699   1.00 2.78  ? 65  PRO A N    1  
ATOM 1055   C CA   . PRO A 1 65  ? -30.516 5.891   7.811   1.00 2.62  ? 65  PRO A CA   1  
ATOM 1056   C C    . PRO A 1 65  ? -31.356 7.078   8.279   1.00 2.70  ? 65  PRO A C    1  
ATOM 1057   O O    . PRO A 1 65  ? -32.523 6.933   8.649   1.00 2.67  ? 65  PRO A O    1  
ATOM 1058   C CB   . PRO A 1 65  ? -31.052 5.341   6.492   1.00 2.29  ? 65  PRO A CB   1  
ATOM 1059   C CG   . PRO A 1 65  ? -32.017 4.272   6.885   1.00 2.33  ? 65  PRO A CG   1  
ATOM 1060   C CD   . PRO A 1 65  ? -31.540 3.720   8.205   1.00 2.61  ? 65  PRO A CD   1  
ATOM 1061   H HA   . PRO A 1 65  ? -29.496 6.213   7.675   1.00 2.69  ? 65  PRO A HA   1  
ATOM 1062   H HB2  . PRO A 1 65  ? -31.540 6.133   5.941   1.00 2.19  ? 65  PRO A HB2  1  
ATOM 1063   H HB3  . PRO A 1 65  ? -30.236 4.940   5.909   1.00 2.27  ? 65  PRO A HB3  1  
ATOM 1064   H HG2  . PRO A 1 65  ? -33.006 4.693   6.992   1.00 2.31  ? 65  PRO A HG2  1  
ATOM 1065   H HG3  . PRO A 1 65  ? -32.024 3.494   6.134   1.00 2.35  ? 65  PRO A HG3  1  
ATOM 1066   H HD2  . PRO A 1 65  ? -32.370 3.607   8.887   1.00 2.71  ? 65  PRO A HD2  1  
ATOM 1067   H HD3  . PRO A 1 65  ? -31.042 2.771   8.058   1.00 2.67  ? 65  PRO A HD3  1  
ATOM 1068   N N    . VAL A 1 66  ? -30.741 8.251   8.256   1.00 2.85  ? 66  VAL A N    1  
ATOM 1069   C CA   . VAL A 1 66  ? -31.404 9.488   8.653   1.00 2.97  ? 66  VAL A CA   1  
ATOM 1070   C C    . VAL A 1 66  ? -31.261 10.530  7.549   1.00 2.91  ? 66  VAL A C    1  
ATOM 1071   O O    . VAL A 1 66  ? -30.320 11.325  7.552   1.00 3.09  ? 66  VAL A O    1  
ATOM 1072   C CB   . VAL A 1 66  ? -30.831 10.065  9.970   1.00 3.30  ? 66  VAL A CB   1  
ATOM 1073   C CG1  . VAL A 1 66  ? -31.698 9.674   11.154  1.00 3.41  ? 66  VAL A CG1  1  
ATOM 1074   C CG2  . VAL A 1 66  ? -29.396 9.611   10.188  1.00 3.53  ? 66  VAL A CG2  1  
ATOM 1075   H H    . VAL A 1 66  ? -29.803 8.290   7.963   1.00 2.91  ? 66  VAL A H    1  
ATOM 1076   H HA   . VAL A 1 66  ? -32.452 9.273   8.800   1.00 2.89  ? 66  VAL A HA   1  
ATOM 1077   H HB   . VAL A 1 66  ? -30.835 11.144  9.895   1.00 3.39  ? 66  VAL A HB   1  
ATOM 1078   H HG11 . VAL A 1 66  ? -32.682 10.102  11.036  1.00 3.66  ? 66  VAL A HG11 1  
ATOM 1079   H HG12 . VAL A 1 66  ? -31.251 10.045  12.065  1.00 3.57  ? 66  VAL A HG12 1  
ATOM 1080   H HG13 . VAL A 1 66  ? -31.776 8.598   11.203  1.00 3.52  ? 66  VAL A HG13 1  
ATOM 1081   H HG21 . VAL A 1 66  ? -28.763 10.044  9.430   1.00 3.59  ? 66  VAL A HG21 1  
ATOM 1082   H HG22 . VAL A 1 66  ? -29.347 8.533   10.127  1.00 3.51  ? 66  VAL A HG22 1  
ATOM 1083   H HG23 . VAL A 1 66  ? -29.061 9.931   11.164  1.00 3.79  ? 66  VAL A HG23 1  
ATOM 1084   N N    . PHE A 1 67  ? -32.177 10.508  6.593   1.00 2.73  ? 67  PHE A N    1  
ATOM 1085   C CA   . PHE A 1 67  ? -32.131 11.452  5.481   1.00 2.70  ? 67  PHE A CA   1  
ATOM 1086   C C    . PHE A 1 67  ? -33.414 12.274  5.400   1.00 2.67  ? 67  PHE A C    1  
ATOM 1087   O O    . PHE A 1 67  ? -33.378 13.459  5.067   1.00 2.82  ? 67  PHE A O    1  
ATOM 1088   C CB   . PHE A 1 67  ? -31.891 10.705  4.168   1.00 2.46  ? 67  PHE A CB   1  
ATOM 1089   C CG   . PHE A 1 67  ? -31.172 11.519  3.128   1.00 2.62  ? 67  PHE A CG   1  
ATOM 1090   C CD1  . PHE A 1 67  ? -31.876 12.334  2.256   1.00 2.66  ? 67  PHE A CD1  1  
ATOM 1091   C CD2  . PHE A 1 67  ? -29.793 11.471  3.027   1.00 2.84  ? 67  PHE A CD2  1  
ATOM 1092   C CE1  . PHE A 1 67  ? -31.218 13.079  1.297   1.00 2.89  ? 67  PHE A CE1  1  
ATOM 1093   C CE2  . PHE A 1 67  ? -29.128 12.213  2.069   1.00 3.06  ? 67  PHE A CE2  1  
ATOM 1094   C CZ   . PHE A 1 67  ? -29.840 13.021  1.206   1.00 3.07  ? 67  PHE A CZ   1  
ATOM 1095   H H    . PHE A 1 67  ? -32.900 9.848   6.635   1.00 2.68  ? 67  PHE A H    1  
ATOM 1096   H HA   . PHE A 1 67  ? -31.305 12.122  5.656   1.00 2.90  ? 67  PHE A HA   1  
ATOM 1097   H HB2  . PHE A 1 67  ? -31.296 9.826   4.366   1.00 2.45  ? 67  PHE A HB2  1  
ATOM 1098   H HB3  . PHE A 1 67  ? -32.843 10.403  3.753   1.00 2.26  ? 67  PHE A HB3  1  
ATOM 1099   H HD1  . PHE A 1 67  ? -32.952 12.382  2.330   1.00 2.60  ? 67  PHE A HD1  1  
ATOM 1100   H HD2  . PHE A 1 67  ? -29.233 10.839  3.700   1.00 2.92  ? 67  PHE A HD2  1  
ATOM 1101   H HE1  . PHE A 1 67  ? -31.780 13.709  0.622   1.00 3.01  ? 67  PHE A HE1  1  
ATOM 1102   H HE2  . PHE A 1 67  ? -28.051 12.166  2.000   1.00 3.28  ? 67  PHE A HE2  1  
ATOM 1103   H HZ   . PHE A 1 67  ? -29.322 13.601  0.459   1.00 3.29  ? 67  PHE A HZ   1  
ATOM 1104   N N    . ASN A 1 68  ? -34.537 11.632  5.709   1.00 2.50  ? 68  ASN A N    1  
ATOM 1105   C CA   . ASN A 1 68  ? -35.850 12.279  5.689   1.00 2.46  ? 68  ASN A CA   1  
ATOM 1106   C C    . ASN A 1 68  ? -36.228 12.723  4.275   1.00 2.33  ? 68  ASN A C    1  
ATOM 1107   O O    . ASN A 1 68  ? -36.464 13.911  4.021   1.00 2.52  ? 68  ASN A O    1  
ATOM 1108   C CB   . ASN A 1 68  ? -35.890 13.479  6.648   1.00 2.75  ? 68  ASN A CB   1  
ATOM 1109   C CG   . ASN A 1 68  ? -37.298 13.829  7.108   1.00 2.74  ? 68  ASN A CG   1  
ATOM 1110   O OD1  . ASN A 1 68  ? -37.653 13.621  8.270   1.00 2.83  ? 68  ASN A OD1  1  
ATOM 1111   N ND2  . ASN A 1 68  ? -38.110 14.357  6.202   1.00 2.76  ? 68  ASN A ND2  1  
ATOM 1112   H H    . ASN A 1 68  ? -34.485 10.689  5.955   1.00 2.42  ? 68  ASN A H    1  
ATOM 1113   H HA   . ASN A 1 68  ? -36.572 11.548  6.020   1.00 2.33  ? 68  ASN A HA   1  
ATOM 1114   H HB2  . ASN A 1 68  ? -35.295 13.254  7.520   1.00 2.87  ? 68  ASN A HB2  1  
ATOM 1115   H HB3  . ASN A 1 68  ? -35.472 14.342  6.148   1.00 2.87  ? 68  ASN A HB3  1  
ATOM 1116   H HD21 . ASN A 1 68  ? -37.761 14.489  5.289   1.00 2.82  ? 68  ASN A HD21 1  
ATOM 1117   H HD22 . ASN A 1 68  ? -39.023 14.590  6.476   1.00 2.77  ? 68  ASN A HD22 1  
ATOM 1118   N N    . GLU A 1 69  ? -36.270 11.771  3.352   1.00 2.06  ? 69  GLU A N    1  
ATOM 1119   C CA   . GLU A 1 69  ? -36.633 12.058  1.971   1.00 1.97  ? 69  GLU A CA   1  
ATOM 1120   C C    . GLU A 1 69  ? -38.116 12.421  1.868   1.00 1.91  ? 69  GLU A C    1  
ATOM 1121   O O    . GLU A 1 69  ? -38.928 12.023  2.704   1.00 1.87  ? 69  GLU A O    1  
ATOM 1122   C CB   . GLU A 1 69  ? -36.315 10.863  1.069   1.00 1.75  ? 69  GLU A CB   1  
ATOM 1123   C CG   . GLU A 1 69  ? -34.828 10.677  0.796   1.00 1.89  ? 69  GLU A CG   1  
ATOM 1124   C CD   . GLU A 1 69  ? -34.171 9.671   1.728   1.00 1.79  ? 69  GLU A CD   1  
ATOM 1125   O OE1  . GLU A 1 69  ? -34.638 9.519   2.877   1.00 1.98  ? 69  GLU A OE1  1  
ATOM 1126   O OE2  . GLU A 1 69  ? -33.182 9.027   1.306   1.00 1.91  ? 69  GLU A OE2  1  
ATOM 1127   H H    . GLU A 1 69  ? -36.032 10.849  3.601   1.00 1.95  ? 69  GLU A H    1  
ATOM 1128   H HA   . GLU A 1 69  ? -36.048 12.907  1.651   1.00 2.17  ? 69  GLU A HA   1  
ATOM 1129   H HB2  . GLU A 1 69  ? -36.684 9.963   1.540   1.00 1.60  ? 69  GLU A HB2  1  
ATOM 1130   H HB3  . GLU A 1 69  ? -36.819 10.995  0.123   1.00 1.72  ? 69  GLU A HB3  1  
ATOM 1131   H HG2  . GLU A 1 69  ? -34.705 10.334  -0.220  1.00 2.14  ? 69  GLU A HG2  1  
ATOM 1132   H HG3  . GLU A 1 69  ? -34.334 11.630  0.914   1.00 2.19  ? 69  GLU A HG3  1  
ATOM 1133   N N    . GLN A 1 70  ? -38.459 13.179  0.836   1.00 1.99  ? 70  GLN A N    1  
ATOM 1134   C CA   . GLN A 1 70  ? -39.833 13.615  0.628   1.00 2.00  ? 70  GLN A CA   1  
ATOM 1135   C C    . GLN A 1 70  ? -40.480 12.873  -0.541  1.00 1.85  ? 70  GLN A C    1  
ATOM 1136   O O    . GLN A 1 70  ? -39.972 12.903  -1.663  1.00 1.92  ? 70  GLN A O    1  
ATOM 1137   C CB   . GLN A 1 70  ? -39.853 15.127  0.363   1.00 2.32  ? 70  GLN A CB   1  
ATOM 1138   C CG   . GLN A 1 70  ? -41.244 15.743  0.317   1.00 2.40  ? 70  GLN A CG   1  
ATOM 1139   C CD   . GLN A 1 70  ? -41.703 16.061  -1.096  1.00 2.60  ? 70  GLN A CD   1  
ATOM 1140   O OE1  . GLN A 1 70  ? -41.395 17.120  -1.642  1.00 2.89  ? 70  GLN A OE1  1  
ATOM 1141   N NE2  . GLN A 1 70  ? -42.466 15.157  -1.689  1.00 2.75  ? 70  GLN A NE2  1  
ATOM 1142   H H    . GLN A 1 70  ? -37.771 13.447  0.193   1.00 2.11  ? 70  GLN A H    1  
ATOM 1143   H HA   . GLN A 1 70  ? -40.390 13.408  1.530   1.00 1.93  ? 70  GLN A HA   1  
ATOM 1144   H HB2  . GLN A 1 70  ? -39.293 15.620  1.142   1.00 2.56  ? 70  GLN A HB2  1  
ATOM 1145   H HB3  . GLN A 1 70  ? -39.372 15.317  -0.584  1.00 2.47  ? 70  GLN A HB3  1  
ATOM 1146   H HG2  . GLN A 1 70  ? -41.943 15.051  0.758   1.00 2.36  ? 70  GLN A HG2  1  
ATOM 1147   H HG3  . GLN A 1 70  ? -41.234 16.657  0.891   1.00 2.62  ? 70  GLN A HG3  1  
ATOM 1148   H HE21 . GLN A 1 70  ? -42.690 14.343  -1.194  1.00 2.73  ? 70  GLN A HE21 1  
ATOM 1149   H HE22 . GLN A 1 70  ? -42.775 15.336  -2.607  1.00 3.03  ? 70  GLN A HE22 1  
ATOM 1150   N N    . PHE A 1 71  ? -41.590 12.199  -0.274  1.00 1.71  ? 71  PHE A N    1  
ATOM 1151   C CA   . PHE A 1 71  ? -42.313 11.482  -1.316  1.00 1.65  ? 71  PHE A CA   1  
ATOM 1152   C C    . PHE A 1 71  ? -43.639 12.179  -1.599  1.00 1.81  ? 71  PHE A C    1  
ATOM 1153   O O    . PHE A 1 71  ? -44.400 12.483  -0.678  1.00 1.79  ? 71  PHE A O    1  
ATOM 1154   C CB   . PHE A 1 71  ? -42.553 10.021  -0.920  1.00 1.40  ? 71  PHE A CB   1  
ATOM 1155   C CG   . PHE A 1 71  ? -43.546 9.310   -1.805  1.00 1.44  ? 71  PHE A CG   1  
ATOM 1156   C CD1  . PHE A 1 71  ? -43.380 9.285   -3.182  1.00 1.57  ? 71  PHE A CD1  1  
ATOM 1157   C CD2  . PHE A 1 71  ? -44.647 8.671   -1.258  1.00 1.43  ? 71  PHE A CD2  1  
ATOM 1158   C CE1  . PHE A 1 71  ? -44.294 8.638   -3.994  1.00 1.70  ? 71  PHE A CE1  1  
ATOM 1159   C CE2  . PHE A 1 71  ? -45.565 8.023   -2.066  1.00 1.57  ? 71  PHE A CE2  1  
ATOM 1160   C CZ   . PHE A 1 71  ? -45.387 8.006   -3.434  1.00 1.70  ? 71  PHE A CZ   1  
ATOM 1161   H H    . PHE A 1 71  ? -41.932 12.178  0.648   1.00 1.69  ? 71  PHE A H    1  
ATOM 1162   H HA   . PHE A 1 71  ? -41.710 11.509  -2.213  1.00 1.72  ? 71  PHE A HA   1  
ATOM 1163   H HB2  . PHE A 1 71  ? -41.618 9.483   -0.974  1.00 1.30  ? 71  PHE A HB2  1  
ATOM 1164   H HB3  . PHE A 1 71  ? -42.923 9.988   0.092   1.00 1.35  ? 71  PHE A HB3  1  
ATOM 1165   H HD1  . PHE A 1 71  ? -42.526 9.778   -3.623  1.00 1.62  ? 71  PHE A HD1  1  
ATOM 1166   H HD2  . PHE A 1 71  ? -44.788 8.682   -0.187  1.00 1.38  ? 71  PHE A HD2  1  
ATOM 1167   H HE1  . PHE A 1 71  ? -44.152 8.627   -5.064  1.00 1.85  ? 71  PHE A HE1  1  
ATOM 1168   H HE2  . PHE A 1 71  ? -46.417 7.529   -1.624  1.00 1.61  ? 71  PHE A HE2  1  
ATOM 1169   H HZ   . PHE A 1 71  ? -46.101 7.500   -4.066  1.00 1.86  ? 71  PHE A HZ   1  
ATOM 1170   N N    . THR A 1 72  ? -43.891 12.455  -2.868  1.00 2.00  ? 72  THR A N    1  
ATOM 1171   C CA   . THR A 1 72  ? -45.116 13.115  -3.284  1.00 2.20  ? 72  THR A CA   1  
ATOM 1172   C C    . THR A 1 72  ? -46.197 12.094  -3.641  1.00 2.16  ? 72  THR A C    1  
ATOM 1173   O O    . THR A 1 72  ? -46.160 11.481  -4.713  1.00 2.23  ? 72  THR A O    1  
ATOM 1174   C CB   . THR A 1 72  ? -44.846 14.022  -4.501  1.00 2.48  ? 72  THR A CB   1  
ATOM 1175   O OG1  . THR A 1 72  ? -43.597 14.707  -4.329  1.00 2.60  ? 72  THR A OG1  1  
ATOM 1176   C CG2  . THR A 1 72  ? -45.961 15.040  -4.696  1.00 2.78  ? 72  THR A CG2  1  
ATOM 1177   H H    . THR A 1 72  ? -43.229 12.213  -3.549  1.00 2.03  ? 72  THR A H    1  
ATOM 1178   H HA   . THR A 1 72  ? -45.463 13.729  -2.467  1.00 2.21  ? 72  THR A HA   1  
ATOM 1179   H HB   . THR A 1 72  ? -44.787 13.402  -5.385  1.00 2.55  ? 72  THR A HB   1  
ATOM 1180   H HG1  . THR A 1 72  ? -43.382 15.180  -5.140  1.00 2.78  ? 72  THR A HG1  1  
ATOM 1181   H HG21 . THR A 1 72  ? -45.764 15.624  -5.583  1.00 2.88  ? 72  THR A HG21 1  
ATOM 1182   H HG22 . THR A 1 72  ? -46.007 15.695  -3.837  1.00 2.90  ? 72  THR A HG22 1  
ATOM 1183   H HG23 . THR A 1 72  ? -46.903 14.526  -4.806  1.00 3.00  ? 72  THR A HG23 1  
ATOM 1184   N N    . PHE A 1 73  ? -47.148 11.901  -2.735  1.00 2.08  ? 73  PHE A N    1  
ATOM 1185   C CA   . PHE A 1 73  ? -48.242 10.962  -2.962  1.00 2.10  ? 73  PHE A CA   1  
ATOM 1186   C C    . PHE A 1 73  ? -49.282 11.605  -3.875  1.00 2.37  ? 73  PHE A C    1  
ATOM 1187   O O    . PHE A 1 73  ? -50.319 12.077  -3.419  1.00 2.43  ? 73  PHE A O    1  
ATOM 1188   C CB   . PHE A 1 73  ? -48.870 10.554  -1.624  1.00 1.95  ? 73  PHE A CB   1  
ATOM 1189   C CG   . PHE A 1 73  ? -49.877 9.440   -1.715  1.00 1.97  ? 73  PHE A CG   1  
ATOM 1190   C CD1  . PHE A 1 73  ? -49.467 8.122   -1.827  1.00 1.90  ? 73  PHE A CD1  1  
ATOM 1191   C CD2  . PHE A 1 73  ? -51.235 9.711   -1.674  1.00 2.16  ? 73  PHE A CD2  1  
ATOM 1192   C CE1  . PHE A 1 73  ? -50.390 7.099   -1.900  1.00 2.04  ? 73  PHE A CE1  1  
ATOM 1193   C CE2  . PHE A 1 73  ? -52.163 8.691   -1.745  1.00 2.24  ? 73  PHE A CE2  1  
ATOM 1194   C CZ   . PHE A 1 73  ? -51.740 7.383   -1.858  1.00 2.18  ? 73  PHE A CZ   1  
ATOM 1195   H H    . PHE A 1 73  ? -47.118 12.408  -1.891  1.00 2.05  ? 73  PHE A H    1  
ATOM 1196   H HA   . PHE A 1 73  ? -47.837 10.085  -3.449  1.00 2.06  ? 73  PHE A HA   1  
ATOM 1197   H HB2  . PHE A 1 73  ? -48.088 10.232  -0.954  1.00 1.77  ? 73  PHE A HB2  1  
ATOM 1198   H HB3  . PHE A 1 73  ? -49.366 11.415  -1.196  1.00 2.06  ? 73  PHE A HB3  1  
ATOM 1199   H HD1  . PHE A 1 73  ? -48.412 7.897   -1.860  1.00 1.83  ? 73  PHE A HD1  1  
ATOM 1200   H HD2  . PHE A 1 73  ? -51.569 10.737  -1.587  1.00 2.30  ? 73  PHE A HD2  1  
ATOM 1201   H HE1  . PHE A 1 73  ? -50.056 6.079   -1.989  1.00 2.10  ? 73  PHE A HE1  1  
ATOM 1202   H HE2  . PHE A 1 73  ? -53.219 8.915   -1.712  1.00 2.42  ? 73  PHE A HE2  1  
ATOM 1203   H HZ   . PHE A 1 73  ? -52.464 6.582   -1.914  1.00 2.32  ? 73  PHE A HZ   1  
ATOM 1204   N N    . LYS A 1 74  ? -48.967 11.638  -5.166  1.00 2.55  ? 74  LYS A N    1  
ATOM 1205   C CA   . LYS A 1 74  ? -49.838 12.234  -6.177  1.00 2.85  ? 74  LYS A CA   1  
ATOM 1206   C C    . LYS A 1 74  ? -51.159 11.484  -6.325  1.00 2.92  ? 74  LYS A C    1  
ATOM 1207   O O    . LYS A 1 74  ? -51.266 10.537  -7.108  1.00 3.03  ? 74  LYS A O    1  
ATOM 1208   C CB   . LYS A 1 74  ? -49.116 12.276  -7.524  1.00 3.05  ? 74  LYS A CB   1  
ATOM 1209   C CG   . LYS A 1 74  ? -47.955 13.257  -7.561  1.00 3.14  ? 74  LYS A CG   1  
ATOM 1210   C CD   . LYS A 1 74  ? -48.346 14.564  -8.230  1.00 3.38  ? 74  LYS A CD   1  
ATOM 1211   C CE   . LYS A 1 74  ? -48.519 14.392  -9.733  1.00 3.72  ? 74  LYS A CE   1  
ATOM 1212   N NZ   . LYS A 1 74  ? -47.326 13.769  -10.367 1.00 3.87  ? 74  LYS A NZ   1  
ATOM 1213   H H    . LYS A 1 74  ? -48.105 11.262  -5.448  1.00 2.50  ? 74  LYS A H    1  
ATOM 1214   H HA   . LYS A 1 74  ? -50.050 13.246  -5.869  1.00 2.90  ? 74  LYS A HA   1  
ATOM 1215   H HB2  . LYS A 1 74  ? -48.734 11.290  -7.744  1.00 3.00  ? 74  LYS A HB2  1  
ATOM 1216   H HB3  . LYS A 1 74  ? -49.823 12.557  -8.290  1.00 3.26  ? 74  LYS A HB3  1  
ATOM 1217   H HG2  . LYS A 1 74  ? -47.639 13.463  -6.550  1.00 3.06  ? 74  LYS A HG2  1  
ATOM 1218   H HG3  . LYS A 1 74  ? -47.140 12.812  -8.110  1.00 3.28  ? 74  LYS A HG3  1  
ATOM 1219   H HD2  . LYS A 1 74  ? -49.279 14.908  -7.807  1.00 3.37  ? 74  LYS A HD2  1  
ATOM 1220   H HD3  . LYS A 1 74  ? -47.574 15.296  -8.045  1.00 3.47  ? 74  LYS A HD3  1  
ATOM 1221   H HE2  . LYS A 1 74  ? -49.378 13.766  -9.914  1.00 3.74  ? 74  LYS A HE2  1  
ATOM 1222   H HE3  . LYS A 1 74  ? -48.684 15.364  -10.173 1.00 4.00  ? 74  LYS A HE3  1  
ATOM 1223   H HZ1  . LYS A 1 74  ? -47.229 12.782  -10.057 1.00 3.99  ? 74  LYS A HZ1  1  
ATOM 1224   H HZ2  . LYS A 1 74  ? -46.465 14.288  -10.102 1.00 3.97  ? 74  LYS A HZ2  1  
ATOM 1225   H HZ3  . LYS A 1 74  ? -47.422 13.789  -11.403 1.00 4.11  ? 74  LYS A HZ3  1  
ATOM 1226   N N    . VAL A 1 75  ? -52.144 11.909  -5.551  1.00 2.90  ? 75  VAL A N    1  
ATOM 1227   C CA   . VAL A 1 75  ? -53.480 11.333  -5.573  1.00 2.99  ? 75  VAL A CA   1  
ATOM 1228   C C    . VAL A 1 75  ? -54.419 12.254  -4.802  1.00 3.01  ? 75  VAL A C    1  
ATOM 1229   O O    . VAL A 1 75  ? -54.109 12.655  -3.678  1.00 2.84  ? 75  VAL A O    1  
ATOM 1230   C CB   . VAL A 1 75  ? -53.515 9.889   -4.982  1.00 2.88  ? 75  VAL A CB   1  
ATOM 1231   C CG1  . VAL A 1 75  ? -54.675 9.691   -4.013  1.00 2.79  ? 75  VAL A CG1  1  
ATOM 1232   C CG2  . VAL A 1 75  ? -53.599 8.861   -6.100  1.00 3.11  ? 75  VAL A CG2  1  
ATOM 1233   H H    . VAL A 1 75  ? -51.966 12.647  -4.927  1.00 2.85  ? 75  VAL A H    1  
ATOM 1234   H HA   . VAL A 1 75  ? -53.802 11.290  -6.603  1.00 3.16  ? 75  VAL A HA   1  
ATOM 1235   H HB   . VAL A 1 75  ? -52.594 9.720   -4.444  1.00 2.83  ? 75  VAL A HB   1  
ATOM 1236   H HG11 . VAL A 1 75  ? -54.649 8.687   -3.618  1.00 2.75  ? 75  VAL A HG11 1  
ATOM 1237   H HG12 . VAL A 1 75  ? -55.607 9.849   -4.533  1.00 2.93  ? 75  VAL A HG12 1  
ATOM 1238   H HG13 . VAL A 1 75  ? -54.591 10.400  -3.202  1.00 2.73  ? 75  VAL A HG13 1  
ATOM 1239   H HG21 . VAL A 1 75  ? -53.531 7.869   -5.681  1.00 3.17  ? 75  VAL A HG21 1  
ATOM 1240   H HG22 . VAL A 1 75  ? -52.786 9.016   -6.794  1.00 3.26  ? 75  VAL A HG22 1  
ATOM 1241   H HG23 . VAL A 1 75  ? -54.539 8.971   -6.618  1.00 3.24  ? 75  VAL A HG23 1  
ATOM 1242   N N    . PRO A 1 76  ? -55.547 12.645  -5.414  1.00 3.23  ? 76  PRO A N    1  
ATOM 1243   C CA   . PRO A 1 76  ? -56.525 13.521  -4.765  1.00 3.27  ? 76  PRO A CA   1  
ATOM 1244   C C    . PRO A 1 76  ? -57.015 12.946  -3.441  1.00 3.08  ? 76  PRO A C    1  
ATOM 1245   O O    . PRO A 1 76  ? -57.152 11.729  -3.302  1.00 3.03  ? 76  PRO A O    1  
ATOM 1246   C CB   . PRO A 1 76  ? -57.677 13.586  -5.770  1.00 3.52  ? 76  PRO A CB   1  
ATOM 1247   C CG   . PRO A 1 76  ? -57.058 13.249  -7.083  1.00 3.68  ? 76  PRO A CG   1  
ATOM 1248   C CD   . PRO A 1 76  ? -55.952 12.278  -6.781  1.00 3.48  ? 76  PRO A CD   1  
ATOM 1249   H HA   . PRO A 1 76  ? -56.123 14.510  -4.604  1.00 3.28  ? 76  PRO A HA   1  
ATOM 1250   H HB2  . PRO A 1 76  ? -58.437 12.870  -5.496  1.00 3.51  ? 76  PRO A HB2  1  
ATOM 1251   H HB3  . PRO A 1 76  ? -58.096 14.581  -5.776  1.00 3.62  ? 76  PRO A HB3  1  
ATOM 1252   H HG2  . PRO A 1 76  ? -57.792 12.791  -7.728  1.00 3.83  ? 76  PRO A HG2  1  
ATOM 1253   H HG3  . PRO A 1 76  ? -56.658 14.142  -7.539  1.00 3.78  ? 76  PRO A HG3  1  
ATOM 1254   H HD2  . PRO A 1 76  ? -56.320 11.263  -6.816  1.00 3.48  ? 76  PRO A HD2  1  
ATOM 1255   H HD3  . PRO A 1 76  ? -55.135 12.411  -7.475  1.00 3.55  ? 76  PRO A HD3  1  
ATOM 1256   N N    . TYR A 1 77  ? -57.282 13.819  -2.475  1.00 3.02  ? 77  TYR A N    1  
ATOM 1257   C CA   . TYR A 1 77  ? -57.761 13.385  -1.163  1.00 2.87  ? 77  TYR A CA   1  
ATOM 1258   C C    . TYR A 1 77  ? -59.060 12.590  -1.296  1.00 2.98  ? 77  TYR A C    1  
ATOM 1259   O O    . TYR A 1 77  ? -59.389 11.764  -0.449  1.00 2.91  ? 77  TYR A O    1  
ATOM 1260   C CB   . TYR A 1 77  ? -57.957 14.593  -0.231  1.00 2.84  ? 77  TYR A CB   1  
ATOM 1261   C CG   . TYR A 1 77  ? -59.103 15.510  -0.620  1.00 3.07  ? 77  TYR A CG   1  
ATOM 1262   C CD1  . TYR A 1 77  ? -58.953 16.458  -1.626  1.00 3.23  ? 77  TYR A CD1  1  
ATOM 1263   C CD2  . TYR A 1 77  ? -60.334 15.430  0.025   1.00 3.21  ? 77  TYR A CD2  1  
ATOM 1264   C CE1  . TYR A 1 77  ? -59.992 17.296  -1.979  1.00 3.49  ? 77  TYR A CE1  1  
ATOM 1265   C CE2  . TYR A 1 77  ? -61.378 16.266  -0.326  1.00 3.45  ? 77  TYR A CE2  1  
ATOM 1266   C CZ   . TYR A 1 77  ? -61.201 17.196  -1.326  1.00 3.57  ? 77  TYR A CZ   1  
ATOM 1267   O OH   . TYR A 1 77  ? -62.237 18.032  -1.674  1.00 3.86  ? 77  TYR A OH   1  
ATOM 1268   H H    . TYR A 1 77  ? -57.134 14.778  -2.641  1.00 3.10  ? 77  TYR A H    1  
ATOM 1269   H HA   . TYR A 1 77  ? -57.006 12.739  -0.739  1.00 2.74  ? 77  TYR A HA   1  
ATOM 1270   H HB2  . TYR A 1 77  ? -58.147 14.238  0.770   1.00 2.77  ? 77  TYR A HB2  1  
ATOM 1271   H HB3  . TYR A 1 77  ? -57.049 15.181  -0.230  1.00 2.78  ? 77  TYR A HB3  1  
ATOM 1272   H HD1  . TYR A 1 77  ? -58.003 16.533  -2.137  1.00 3.22  ? 77  TYR A HD1  1  
ATOM 1273   H HD2  . TYR A 1 77  ? -60.471 14.702  0.809   1.00 3.20  ? 77  TYR A HD2  1  
ATOM 1274   H HE1  . TYR A 1 77  ? -59.854 18.024  -2.764  1.00 3.68  ? 77  TYR A HE1  1  
ATOM 1275   H HE2  . TYR A 1 77  ? -62.327 16.188  0.187   1.00 3.60  ? 77  TYR A HE2  1  
ATOM 1276   H HH   . TYR A 1 77  ? -62.267 18.120  -2.636  1.00 4.03  ? 77  TYR A HH   1  
ATOM 1277   N N    . SER A 1 78  ? -59.783 12.838  -2.377  1.00 3.20  ? 78  SER A N    1  
ATOM 1278   C CA   . SER A 1 78  ? -61.032 12.152  -2.645  1.00 3.35  ? 78  SER A CA   1  
ATOM 1279   C C    . SER A 1 78  ? -60.785 10.701  -3.064  1.00 3.39  ? 78  SER A C    1  
ATOM 1280   O O    . SER A 1 78  ? -61.685 9.866   -3.004  1.00 3.51  ? 78  SER A O    1  
ATOM 1281   C CB   . SER A 1 78  ? -61.775 12.898  -3.747  1.00 3.61  ? 78  SER A CB   1  
ATOM 1282   O OG   . SER A 1 78  ? -61.191 14.173  -3.963  1.00 3.67  ? 78  SER A OG   1  
ATOM 1283   H H    . SER A 1 78  ? -59.475 13.518  -3.011  1.00 3.28  ? 78  SER A H    1  
ATOM 1284   H HA   . SER A 1 78  ? -61.625 12.165  -1.745  1.00 3.29  ? 78  SER A HA   1  
ATOM 1285   H HB2  . SER A 1 78  ? -61.725 12.330  -4.664  1.00 3.75  ? 78  SER A HB2  1  
ATOM 1286   H HB3  . SER A 1 78  ? -62.807 13.030  -3.461  1.00 3.71  ? 78  SER A HB3  1  
ATOM 1287   H HG   . SER A 1 78  ? -61.865 14.778  -4.289  1.00 3.83  ? 78  SER A HG   1  
ATOM 1288   N N    . GLU A 1 79  ? -59.559 10.407  -3.475  1.00 3.30  ? 79  GLU A N    1  
ATOM 1289   C CA   . GLU A 1 79  ? -59.201 9.067   -3.908  1.00 3.34  ? 79  GLU A CA   1  
ATOM 1290   C C    . GLU A 1 79  ? -58.384 8.348   -2.842  1.00 3.11  ? 79  GLU A C    1  
ATOM 1291   O O    . GLU A 1 79  ? -57.766 7.320   -3.109  1.00 3.12  ? 79  GLU A O    1  
ATOM 1292   C CB   . GLU A 1 79  ? -58.410 9.125   -5.213  1.00 3.45  ? 79  GLU A CB   1  
ATOM 1293   C CG   . GLU A 1 79  ? -59.280 9.268   -6.448  1.00 3.75  ? 79  GLU A CG   1  
ATOM 1294   C CD   . GLU A 1 79  ? -58.523 8.973   -7.723  1.00 3.85  ? 79  GLU A CD   1  
ATOM 1295   O OE1  . GLU A 1 79  ? -57.915 7.884   -7.819  1.00 3.79  ? 79  GLU A OE1  1  
ATOM 1296   O OE2  . GLU A 1 79  ? -58.538 9.821   -8.640  1.00 4.10  ? 79  GLU A OE2  1  
ATOM 1297   H H    . GLU A 1 79  ? -58.869 11.108  -3.474  1.00 3.22  ? 79  GLU A H    1  
ATOM 1298   H HA   . GLU A 1 79  ? -60.115 8.518   -4.076  1.00 3.49  ? 79  GLU A HA   1  
ATOM 1299   H HB2  . GLU A 1 79  ? -57.738 9.969   -5.173  1.00 3.50  ? 79  GLU A HB2  1  
ATOM 1300   H HB3  . GLU A 1 79  ? -57.830 8.218   -5.310  1.00 3.38  ? 79  GLU A HB3  1  
ATOM 1301   H HG2  . GLU A 1 79  ? -60.107 8.580   -6.372  1.00 3.83  ? 79  GLU A HG2  1  
ATOM 1302   H HG3  . GLU A 1 79  ? -59.655 10.281  -6.493  1.00 3.94  ? 79  GLU A HG3  1  
ATOM 1303   N N    . LEU A 1 80  ? -58.387 8.887   -1.632  1.00 2.95  ? 80  LEU A N    1  
ATOM 1304   C CA   . LEU A 1 80  ? -57.640 8.283   -0.535  1.00 2.75  ? 80  LEU A CA   1  
ATOM 1305   C C    . LEU A 1 80  ? -58.419 7.108   0.058   1.00 2.83  ? 80  LEU A C    1  
ATOM 1306   O O    . LEU A 1 80  ? -57.866 6.278   0.779   1.00 2.76  ? 80  LEU A O    1  
ATOM 1307   C CB   . LEU A 1 80  ? -57.306 9.347   0.527   1.00 2.60  ? 80  LEU A CB   1  
ATOM 1308   C CG   . LEU A 1 80  ? -57.945 9.169   1.910   1.00 2.48  ? 80  LEU A CG   1  
ATOM 1309   C CD1  . LEU A 1 80  ? -57.110 9.877   2.964   1.00 2.36  ? 80  LEU A CD1  1  
ATOM 1310   C CD2  . LEU A 1 80  ? -59.373 9.698   1.927   1.00 2.61  ? 80  LEU A CD2  1  
ATOM 1311   H H    . LEU A 1 80  ? -58.898 9.710   -1.472  1.00 2.98  ? 80  LEU A H    1  
ATOM 1312   H HA   . LEU A 1 80  ? -56.716 7.903   -0.946  1.00 2.69  ? 80  LEU A HA   1  
ATOM 1313   H HB2  . LEU A 1 80  ? -56.234 9.363   0.657   1.00 2.58  ? 80  LEU A HB2  1  
ATOM 1314   H HB3  . LEU A 1 80  ? -57.611 10.310  0.142   1.00 2.77  ? 80  LEU A HB3  1  
ATOM 1315   H HG   . LEU A 1 80  ? -57.971 8.118   2.156   1.00 2.53  ? 80  LEU A HG   1  
ATOM 1316   H HD11 . LEU A 1 80  ? -57.567 9.747   3.935   1.00 2.39  ? 80  LEU A HD11 1  
ATOM 1317   H HD12 . LEU A 1 80  ? -57.055 10.929  2.731   1.00 2.37  ? 80  LEU A HD12 1  
ATOM 1318   H HD13 . LEU A 1 80  ? -56.114 9.458   2.975   1.00 2.39  ? 80  LEU A HD13 1  
ATOM 1319   H HD21 . LEU A 1 80  ? -59.988 9.096   1.275   1.00 2.80  ? 80  LEU A HD21 1  
ATOM 1320   H HD22 . LEU A 1 80  ? -59.382 10.722  1.587   1.00 2.62  ? 80  LEU A HD22 1  
ATOM 1321   H HD23 . LEU A 1 80  ? -59.762 9.651   2.934   1.00 2.66  ? 80  LEU A HD23 1  
ATOM 1322   N N    . GLY A 1 81  ? -59.703 7.031   -0.284  1.00 3.02  ? 81  GLY A N    1  
ATOM 1323   C CA   . GLY A 1 81  ? -60.544 5.958   0.208   1.00 3.16  ? 81  GLY A CA   1  
ATOM 1324   C C    . GLY A 1 81  ? -60.178 4.620   -0.401  1.00 3.29  ? 81  GLY A C    1  
ATOM 1325   O O    . GLY A 1 81  ? -60.237 3.585   0.262   1.00 3.39  ? 81  GLY A O    1  
ATOM 1326   H H    . GLY A 1 81  ? -60.079 7.711   -0.879  1.00 3.10  ? 81  GLY A H    1  
ATOM 1327   H HA2  . GLY A 1 81  ? -60.439 5.894   1.281   1.00 3.05  ? 81  GLY A HA2  1  
ATOM 1328   H HA3  . GLY A 1 81  ? -61.574 6.180   -0.032  1.00 3.30  ? 81  GLY A HA3  1  
ATOM 1329   N N    . GLY A 1 82  ? -59.789 4.637   -1.664  1.00 3.35  ? 82  GLY A N    1  
ATOM 1330   C CA   . GLY A 1 82  ? -59.411 3.415   -2.338  1.00 3.49  ? 82  GLY A CA   1  
ATOM 1331   C C    . GLY A 1 82  ? -57.945 3.410   -2.700  1.00 3.32  ? 82  GLY A C    1  
ATOM 1332   O O    . GLY A 1 82  ? -57.560 2.917   -3.763  1.00 3.41  ? 82  GLY A O    1  
ATOM 1333   H H    . GLY A 1 82  ? -59.755 5.490   -2.148  1.00 3.35  ? 82  GLY A H    1  
ATOM 1334   H HA2  . GLY A 1 82  ? -59.618 2.578   -1.689  1.00 3.54  ? 82  GLY A HA2  1  
ATOM 1335   H HA3  . GLY A 1 82  ? -59.996 3.315   -3.241  1.00 3.68  ? 82  GLY A HA3  1  
ATOM 1336   N N    . LYS A 1 83  ? -57.124 3.965   -1.818  1.00 3.09  ? 83  LYS A N    1  
ATOM 1337   C CA   . LYS A 1 83  ? -55.693 4.034   -2.052  1.00 2.92  ? 83  LYS A CA   1  
ATOM 1338   C C    . LYS A 1 83  ? -54.914 3.600   -0.813  1.00 2.73  ? 83  LYS A C    1  
ATOM 1339   O O    . LYS A 1 83  ? -55.084 4.156   0.271   1.00 2.64  ? 83  LYS A O    1  
ATOM 1340   C CB   . LYS A 1 83  ? -55.294 5.458   -2.448  1.00 2.81  ? 83  LYS A CB   1  
ATOM 1341   C CG   . LYS A 1 83  ? -54.297 5.520   -3.595  1.00 2.82  ? 83  LYS A CG   1  
ATOM 1342   C CD   . LYS A 1 83  ? -54.929 5.111   -4.921  1.00 3.11  ? 83  LYS A CD   1  
ATOM 1343   C CE   . LYS A 1 83  ? -55.939 6.139   -5.410  1.00 3.26  ? 83  LYS A CE   1  
ATOM 1344   N NZ   . LYS A 1 83  ? -56.285 5.943   -6.845  1.00 3.51  ? 83  LYS A NZ   1  
ATOM 1345   H H    . LYS A 1 83  ? -57.491 4.336   -0.987  1.00 3.05  ? 83  LYS A H    1  
ATOM 1346   H HA   . LYS A 1 83  ? -55.458 3.365   -2.866  1.00 3.04  ? 83  LYS A HA   1  
ATOM 1347   H HB2  . LYS A 1 83  ? -56.182 5.999   -2.743  1.00 2.93  ? 83  LYS A HB2  1  
ATOM 1348   H HB3  . LYS A 1 83  ? -54.854 5.947   -1.590  1.00 2.64  ? 83  LYS A HB3  1  
ATOM 1349   H HG2  . LYS A 1 83  ? -53.927 6.531   -3.681  1.00 2.75  ? 83  LYS A HG2  1  
ATOM 1350   H HG3  . LYS A 1 83  ? -53.476 4.853   -3.378  1.00 2.73  ? 83  LYS A HG3  1  
ATOM 1351   H HD2  . LYS A 1 83  ? -54.149 5.010   -5.661  1.00 3.12  ? 83  LYS A HD2  1  
ATOM 1352   H HD3  . LYS A 1 83  ? -55.428 4.163   -4.791  1.00 3.21  ? 83  LYS A HD3  1  
ATOM 1353   H HE2  . LYS A 1 83  ? -56.838 6.052   -4.819  1.00 3.33  ? 83  LYS A HE2  1  
ATOM 1354   H HE3  . LYS A 1 83  ? -55.519 7.126   -5.281  1.00 3.17  ? 83  LYS A HE3  1  
ATOM 1355   H HZ1  . LYS A 1 83  ? -55.416 5.893   -7.422  1.00 3.49  ? 83  LYS A HZ1  1  
ATOM 1356   H HZ2  . LYS A 1 83  ? -56.868 6.740   -7.187  1.00 3.61  ? 83  LYS A HZ2  1  
ATOM 1357   H HZ3  . LYS A 1 83  ? -56.823 5.061   -6.969  1.00 3.64  ? 83  LYS A HZ3  1  
ATOM 1358   N N    . THR A 1 84  ? -54.077 2.592   -0.985  1.00 2.77  ? 84  THR A N    1  
ATOM 1359   C CA   . THR A 1 84  ? -53.245 2.080   0.092   1.00 2.64  ? 84  THR A CA   1  
ATOM 1360   C C    . THR A 1 84  ? -51.782 2.137   -0.330  1.00 2.47  ? 84  THR A C    1  
ATOM 1361   O O    . THR A 1 84  ? -51.374 1.444   -1.264  1.00 2.58  ? 84  THR A O    1  
ATOM 1362   C CB   . THR A 1 84  ? -53.622 0.625   0.446   1.00 2.88  ? 84  THR A CB   1  
ATOM 1363   O OG1  . THR A 1 84  ? -55.030 0.531   0.708   1.00 3.12  ? 84  THR A OG1  1  
ATOM 1364   C CG2  . THR A 1 84  ? -52.844 0.135   1.660   1.00 2.80  ? 84  THR A CG2  1  
ATOM 1365   H H    . THR A 1 84  ? -54.017 2.169   -1.865  1.00 2.94  ? 84  THR A H    1  
ATOM 1366   H HA   . THR A 1 84  ? -53.391 2.703   0.964   1.00 2.53  ? 84  THR A HA   1  
ATOM 1367   H HB   . THR A 1 84  ? -53.380 -0.006  -0.396  1.00 2.98  ? 84  THR A HB   1  
ATOM 1368   H HG1  . THR A 1 84  ? -55.174 -0.035  1.477   1.00 3.12  ? 84  THR A HG1  1  
ATOM 1369   H HG21 . THR A 1 84  ? -53.074 -0.905  1.836   1.00 3.05  ? 84  THR A HG21 1  
ATOM 1370   H HG22 . THR A 1 84  ? -53.123 0.718   2.526   1.00 2.81  ? 84  THR A HG22 1  
ATOM 1371   H HG23 . THR A 1 84  ? -51.786 0.244   1.476   1.00 2.68  ? 84  THR A HG23 1  
ATOM 1372   N N    . LEU A 1 85  ? -51.002 2.973   0.337   1.00 2.24  ? 85  LEU A N    1  
ATOM 1373   C CA   . LEU A 1 85  ? -49.594 3.115   0.003   1.00 2.07  ? 85  LEU A CA   1  
ATOM 1374   C C    . LEU A 1 85  ? -48.756 2.075   0.733   1.00 2.05  ? 85  LEU A C    1  
ATOM 1375   O O    . LEU A 1 85  ? -49.031 1.737   1.888   1.00 2.10  ? 85  LEU A O    1  
ATOM 1376   C CB   . LEU A 1 85  ? -49.097 4.532   0.330   1.00 1.89  ? 85  LEU A CB   1  
ATOM 1377   C CG   . LEU A 1 85  ? -49.146 4.936   1.808   1.00 1.78  ? 85  LEU A CG   1  
ATOM 1378   C CD1  . LEU A 1 85  ? -47.765 4.836   2.441   1.00 1.69  ? 85  LEU A CD1  1  
ATOM 1379   C CD2  . LEU A 1 85  ? -49.691 6.347   1.954   1.00 1.91  ? 85  LEU A CD2  1  
ATOM 1380   H H    . LEU A 1 85  ? -51.377 3.496   1.077   1.00 2.20  ? 85  LEU A H    1  
ATOM 1381   H HA   . LEU A 1 85  ? -49.494 2.950   -1.059  1.00 2.16  ? 85  LEU A HA   1  
ATOM 1382   H HB2  . LEU A 1 85  ? -48.074 4.613   -0.008  1.00 1.87  ? 85  LEU A HB2  1  
ATOM 1383   H HB3  . LEU A 1 85  ? -49.695 5.234   -0.228  1.00 2.03  ? 85  LEU A HB3  1  
ATOM 1384   H HG   . LEU A 1 85  ? -49.807 4.264   2.337   1.00 1.94  ? 85  LEU A HG   1  
ATOM 1385   H HD11 . LEU A 1 85  ? -47.401 3.822   2.358   1.00 1.79  ? 85  LEU A HD11 1  
ATOM 1386   H HD12 . LEU A 1 85  ? -47.826 5.114   3.484   1.00 1.75  ? 85  LEU A HD12 1  
ATOM 1387   H HD13 . LEU A 1 85  ? -47.087 5.505   1.930   1.00 1.85  ? 85  LEU A HD13 1  
ATOM 1388   H HD21 . LEU A 1 85  ? -49.047 7.038   1.430   1.00 1.93  ? 85  LEU A HD21 1  
ATOM 1389   H HD22 . LEU A 1 85  ? -49.727 6.613   3.000   1.00 1.91  ? 85  LEU A HD22 1  
ATOM 1390   H HD23 . LEU A 1 85  ? -50.688 6.398   1.537   1.00 2.20  ? 85  LEU A HD23 1  
ATOM 1391   N N    . VAL A 1 86  ? -47.751 1.550   0.041   1.00 2.01  ? 86  VAL A N    1  
ATOM 1392   C CA   . VAL A 1 86  ? -46.864 0.562   0.623   1.00 2.03  ? 86  VAL A CA   1  
ATOM 1393   C C    . VAL A 1 86  ? -45.416 1.035   0.507   1.00 1.81  ? 86  VAL A C    1  
ATOM 1394   O O    . VAL A 1 86  ? -44.985 1.523   -0.544  1.00 1.75  ? 86  VAL A O    1  
ATOM 1395   C CB   . VAL A 1 86  ? -47.035 -0.844  -0.023  1.00 2.28  ? 86  VAL A CB   1  
ATOM 1396   C CG1  . VAL A 1 86  ? -48.506 -1.226  -0.095  1.00 2.69  ? 86  VAL A CG1  1  
ATOM 1397   C CG2  . VAL A 1 86  ? -46.404 -0.912  -1.407  1.00 2.49  ? 86  VAL A CG2  1  
ATOM 1398   H H    . VAL A 1 86  ? -47.602 1.836   -0.886  1.00 2.00  ? 86  VAL A H    1  
ATOM 1399   H HA   . VAL A 1 86  ? -47.111 0.482   1.673   1.00 2.06  ? 86  VAL A HA   1  
ATOM 1400   H HB   . VAL A 1 86  ? -46.537 -1.565  0.609   1.00 2.43  ? 86  VAL A HB   1  
ATOM 1401   H HG11 . VAL A 1 86  ? -48.982 -0.673  -0.891  1.00 2.93  ? 86  VAL A HG11 1  
ATOM 1402   H HG12 . VAL A 1 86  ? -48.988 -0.989  0.843   1.00 2.88  ? 86  VAL A HG12 1  
ATOM 1403   H HG13 . VAL A 1 86  ? -48.595 -2.285  -0.289  1.00 2.92  ? 86  VAL A HG13 1  
ATOM 1404   H HG21 . VAL A 1 86  ? -46.800 -0.117  -2.022  1.00 2.71  ? 86  VAL A HG21 1  
ATOM 1405   H HG22 . VAL A 1 86  ? -46.631 -1.865  -1.858  1.00 2.69  ? 86  VAL A HG22 1  
ATOM 1406   H HG23 . VAL A 1 86  ? -45.332 -0.799  -1.319  1.00 2.63  ? 86  VAL A HG23 1  
ATOM 1407   N N    . MET A 1 87  ? -44.685 0.939   1.602   1.00 1.75  ? 87  MET A N    1  
ATOM 1408   C CA   . MET A 1 87  ? -43.292 1.354   1.628   1.00 1.57  ? 87  MET A CA   1  
ATOM 1409   C C    . MET A 1 87  ? -42.396 0.139   1.784   1.00 1.69  ? 87  MET A C    1  
ATOM 1410   O O    . MET A 1 87  ? -42.354 -0.477  2.850   1.00 1.86  ? 87  MET A O    1  
ATOM 1411   C CB   . MET A 1 87  ? -43.045 2.344   2.771   1.00 1.49  ? 87  MET A CB   1  
ATOM 1412   C CG   . MET A 1 87  ? -41.586 2.755   2.922   1.00 1.38  ? 87  MET A CG   1  
ATOM 1413   S SD   . MET A 1 87  ? -41.058 3.942   1.672   1.00 1.18  ? 87  MET A SD   1  
ATOM 1414   C CE   . MET A 1 87  ? -41.793 5.449   2.303   1.00 1.14  ? 87  MET A CE   1  
ATOM 1415   H H    . MET A 1 87  ? -45.093 0.567   2.418   1.00 1.86  ? 87  MET A H    1  
ATOM 1416   H HA   . MET A 1 87  ? -43.069 1.834   0.687   1.00 1.47  ? 87  MET A HA   1  
ATOM 1417   H HB2  . MET A 1 87  ? -43.632 3.233   2.594   1.00 1.44  ? 87  MET A HB2  1  
ATOM 1418   H HB3  . MET A 1 87  ? -43.367 1.892   3.698   1.00 1.64  ? 87  MET A HB3  1  
ATOM 1419   H HG2  . MET A 1 87  ? -41.451 3.199   3.897   1.00 1.45  ? 87  MET A HG2  1  
ATOM 1420   H HG3  . MET A 1 87  ? -40.969 1.872   2.843   1.00 1.50  ? 87  MET A HG3  1  
ATOM 1421   H HE1  . MET A 1 87  ? -41.468 5.610   3.320   1.00 1.32  ? 87  MET A HE1  1  
ATOM 1422   H HE2  . MET A 1 87  ? -42.869 5.362   2.279   1.00 1.24  ? 87  MET A HE2  1  
ATOM 1423   H HE3  . MET A 1 87  ? -41.486 6.284   1.691   1.00 1.21  ? 87  MET A HE3  1  
ATOM 1424   N N    . ALA A 1 88  ? -41.693 -0.205  0.721   1.00 1.63  ? 88  ALA A N    1  
ATOM 1425   C CA   . ALA A 1 88  ? -40.808 -1.354  0.734   1.00 1.76  ? 88  ALA A CA   1  
ATOM 1426   C C    . ALA A 1 88  ? -39.356 -0.911  0.735   1.00 1.58  ? 88  ALA A C    1  
ATOM 1427   O O    . ALA A 1 88  ? -38.941 -0.099  -0.095  1.00 1.36  ? 88  ALA A O    1  
ATOM 1428   C CB   . ALA A 1 88  ? -41.090 -2.247  -0.465  1.00 1.90  ? 88  ALA A CB   1  
ATOM 1429   H H    . ALA A 1 88  ? -41.761 0.336   -0.097  1.00 1.53  ? 88  ALA A H    1  
ATOM 1430   H HA   . ALA A 1 88  ? -41.003 -1.919  1.633   1.00 1.93  ? 88  ALA A HA   1  
ATOM 1431   H HB1  . ALA A 1 88  ? -40.952 -1.683  -1.377  1.00 1.78  ? 88  ALA A HB1  1  
ATOM 1432   H HB2  . ALA A 1 88  ? -42.107 -2.606  -0.417  1.00 2.05  ? 88  ALA A HB2  1  
ATOM 1433   H HB3  . ALA A 1 88  ? -40.410 -3.086  -0.456  1.00 2.02  ? 88  ALA A HB3  1  
ATOM 1434   N N    . VAL A 1 89  ? -38.583 -1.433  1.672   1.00 1.72  ? 89  VAL A N    1  
ATOM 1435   C CA   . VAL A 1 89  ? -37.178 -1.086  1.757   1.00 1.62  ? 89  VAL A CA   1  
ATOM 1436   C C    . VAL A 1 89  ? -36.343 -2.098  0.977   1.00 1.67  ? 89  VAL A C    1  
ATOM 1437   O O    . VAL A 1 89  ? -36.432 -3.308  1.195   1.00 1.92  ? 89  VAL A O    1  
ATOM 1438   C CB   . VAL A 1 89  ? -36.687 -0.974  3.220   1.00 1.80  ? 89  VAL A CB   1  
ATOM 1439   C CG1  . VAL A 1 89  ? -36.914 -2.262  3.977   1.00 2.11  ? 89  VAL A CG1  1  
ATOM 1440   C CG2  . VAL A 1 89  ? -35.223 -0.576  3.271   1.00 1.78  ? 89  VAL A CG2  1  
ATOM 1441   H H    . VAL A 1 89  ? -38.967 -2.078  2.311   1.00 1.91  ? 89  VAL A H    1  
ATOM 1442   H HA   . VAL A 1 89  ? -37.058 -0.119  1.291   1.00 1.41  ? 89  VAL A HA   1  
ATOM 1443   H HB   . VAL A 1 89  ? -37.259 -0.199  3.706   1.00 1.77  ? 89  VAL A HB   1  
ATOM 1444   H HG11 . VAL A 1 89  ? -36.448 -2.192  4.946   1.00 2.20  ? 89  VAL A HG11 1  
ATOM 1445   H HG12 . VAL A 1 89  ? -36.482 -3.083  3.424   1.00 2.24  ? 89  VAL A HG12 1  
ATOM 1446   H HG13 . VAL A 1 89  ? -37.973 -2.425  4.096   1.00 2.20  ? 89  VAL A HG13 1  
ATOM 1447   H HG21 . VAL A 1 89  ? -35.092 0.382   2.790   1.00 1.65  ? 89  VAL A HG21 1  
ATOM 1448   H HG22 . VAL A 1 89  ? -34.629 -1.320  2.761   1.00 1.81  ? 89  VAL A HG22 1  
ATOM 1449   H HG23 . VAL A 1 89  ? -34.906 -0.506  4.301   1.00 1.99  ? 89  VAL A HG23 1  
ATOM 1450   N N    . TYR A 1 90  ? -35.559 -1.588  0.045   1.00 1.44  ? 90  TYR A N    1  
ATOM 1451   C CA   . TYR A 1 90  ? -34.722 -2.420  -0.796  1.00 1.47  ? 90  TYR A CA   1  
ATOM 1452   C C    . TYR A 1 90  ? -33.260 -2.273  -0.414  1.00 1.41  ? 90  TYR A C    1  
ATOM 1453   O O    . TYR A 1 90  ? -32.830 -1.203  0.008   1.00 1.28  ? 90  TYR A O    1  
ATOM 1454   C CB   . TYR A 1 90  ? -34.908 -2.013  -2.256  1.00 1.31  ? 90  TYR A CB   1  
ATOM 1455   C CG   . TYR A 1 90  ? -35.289 -3.146  -3.178  1.00 1.49  ? 90  TYR A CG   1  
ATOM 1456   C CD1  . TYR A 1 90  ? -34.343 -4.063  -3.608  1.00 1.43  ? 90  TYR A CD1  1  
ATOM 1457   C CD2  . TYR A 1 90  ? -36.593 -3.288  -3.633  1.00 1.90  ? 90  TYR A CD2  1  
ATOM 1458   C CE1  . TYR A 1 90  ? -34.684 -5.089  -4.463  1.00 1.65  ? 90  TYR A CE1  1  
ATOM 1459   C CE2  . TYR A 1 90  ? -36.942 -4.315  -4.485  1.00 2.14  ? 90  TYR A CE2  1  
ATOM 1460   C CZ   . TYR A 1 90  ? -35.983 -5.210  -4.896  1.00 1.97  ? 90  TYR A CZ   1  
ATOM 1461   O OH   . TYR A 1 90  ? -36.325 -6.231  -5.747  1.00 2.25  ? 90  TYR A OH   1  
ATOM 1462   H H    . TYR A 1 90  ? -35.537 -0.613  -0.079  1.00 1.26  ? 90  TYR A H    1  
ATOM 1463   H HA   . TYR A 1 90  ? -35.024 -3.449  -0.670  1.00 1.70  ? 90  TYR A HA   1  
ATOM 1464   H HB2  . TYR A 1 90  ? -35.685 -1.267  -2.314  1.00 1.34  ? 90  TYR A HB2  1  
ATOM 1465   H HB3  . TYR A 1 90  ? -33.984 -1.587  -2.622  1.00 1.12  ? 90  TYR A HB3  1  
ATOM 1466   H HD1  . TYR A 1 90  ? -33.325 -3.968  -3.262  1.00 1.35  ? 90  TYR A HD1  1  
ATOM 1467   H HD2  . TYR A 1 90  ? -37.343 -2.582  -3.308  1.00 2.10  ? 90  TYR A HD2  1  
ATOM 1468   H HE1  . TYR A 1 90  ? -33.934 -5.794  -4.787  1.00 1.69  ? 90  TYR A HE1  1  
ATOM 1469   H HE2  . TYR A 1 90  ? -37.961 -4.412  -4.827  1.00 2.52  ? 90  TYR A HE2  1  
ATOM 1470   H HH   . TYR A 1 90  ? -36.403 -7.059  -5.237  1.00 2.33  ? 90  TYR A HH   1  
ATOM 1471   N N    . ASP A 1 91  ? -32.506 -3.351  -0.551  1.00 1.59  ? 91  ASP A N    1  
ATOM 1472   C CA   . ASP A 1 91  ? -31.082 -3.327  -0.255  1.00 1.59  ? 91  ASP A CA   1  
ATOM 1473   C C    . ASP A 1 91  ? -30.308 -3.119  -1.551  1.00 1.38  ? 91  ASP A C    1  
ATOM 1474   O O    . ASP A 1 91  ? -30.841 -3.357  -2.638  1.00 1.34  ? 91  ASP A O    1  
ATOM 1475   C CB   . ASP A 1 91  ? -30.642 -4.632  0.428   1.00 1.92  ? 91  ASP A CB   1  
ATOM 1476   C CG   . ASP A 1 91  ? -29.129 -4.760  0.524   1.00 1.96  ? 91  ASP A CG   1  
ATOM 1477   O OD1  . ASP A 1 91  ? -28.536 -4.212  1.480   1.00 2.04  ? 91  ASP A OD1  1  
ATOM 1478   O OD2  . ASP A 1 91  ? -28.531 -5.405  -0.365  1.00 1.96  ? 91  ASP A OD2  1  
ATOM 1479   H H    . ASP A 1 91  ? -32.914 -4.185  -0.861  1.00 1.74  ? 91  ASP A H    1  
ATOM 1480   H HA   . ASP A 1 91  ? -30.891 -2.494  0.407   1.00 1.56  ? 91  ASP A HA   1  
ATOM 1481   H HB2  . ASP A 1 91  ? -31.050 -4.662  1.427   1.00 2.07  ? 91  ASP A HB2  1  
ATOM 1482   H HB3  . ASP A 1 91  ? -31.020 -5.472  -0.135  1.00 2.00  ? 91  ASP A HB3  1  
ATOM 1483   N N    . PHE A 1 92  ? -29.076 -2.657  -1.449  1.00 1.32  ? 92  PHE A N    1  
ATOM 1484   C CA   . PHE A 1 92  ? -28.250 -2.431  -2.618  1.00 1.14  ? 92  PHE A CA   1  
ATOM 1485   C C    . PHE A 1 92  ? -26.808 -2.846  -2.342  1.00 1.28  ? 92  PHE A C    1  
ATOM 1486   O O    . PHE A 1 92  ? -25.886 -2.057  -2.519  1.00 1.23  ? 92  PHE A O    1  
ATOM 1487   C CB   . PHE A 1 92  ? -28.313 -0.957  -3.033  1.00 0.92  ? 92  PHE A CB   1  
ATOM 1488   C CG   . PHE A 1 92  ? -28.090 -0.731  -4.500  1.00 0.76  ? 92  PHE A CG   1  
ATOM 1489   C CD1  . PHE A 1 92  ? -28.972 -1.243  -5.437  1.00 0.94  ? 92  PHE A CD1  1  
ATOM 1490   C CD2  . PHE A 1 92  ? -26.999 -0.001  -4.942  1.00 0.86  ? 92  PHE A CD2  1  
ATOM 1491   C CE1  . PHE A 1 92  ? -28.770 -1.032  -6.787  1.00 1.04  ? 92  PHE A CE1  1  
ATOM 1492   C CE2  . PHE A 1 92  ? -26.791 0.214   -6.290  1.00 0.90  ? 92  PHE A CE2  1  
ATOM 1493   C CZ   . PHE A 1 92  ? -27.676 -0.303  -7.214  1.00 0.92  ? 92  PHE A CZ   1  
ATOM 1494   H H    . PHE A 1 92  ? -28.711 -2.458  -0.558  1.00 1.44  ? 92  PHE A H    1  
ATOM 1495   H HA   . PHE A 1 92  ? -28.639 -3.039  -3.421  1.00 1.13  ? 92  PHE A HA   1  
ATOM 1496   H HB2  . PHE A 1 92  ? -29.285 -0.562  -2.783  1.00 0.91  ? 92  PHE A HB2  1  
ATOM 1497   H HB3  . PHE A 1 92  ? -27.556 -0.407  -2.494  1.00 1.01  ? 92  PHE A HB3  1  
ATOM 1498   H HD1  . PHE A 1 92  ? -29.825 -1.813  -5.104  1.00 1.22  ? 92  PHE A HD1  1  
ATOM 1499   H HD2  . PHE A 1 92  ? -26.306 0.404   -4.220  1.00 1.15  ? 92  PHE A HD2  1  
ATOM 1500   H HE1  . PHE A 1 92  ? -29.467 -1.437  -7.508  1.00 1.39  ? 92  PHE A HE1  1  
ATOM 1501   H HE2  . PHE A 1 92  ? -25.936 0.783   -6.621  1.00 1.17  ? 92  PHE A HE2  1  
ATOM 1502   H HZ   . PHE A 1 92  ? -27.515 -0.137  -8.267  1.00 1.10  ? 92  PHE A HZ   1  
ATOM 1503   N N    . ASP A 1 93  ? -26.627 -4.092  -1.904  1.00 1.53  ? 93  ASP A N    1  
ATOM 1504   C CA   . ASP A 1 93  ? -25.296 -4.644  -1.604  1.00 1.71  ? 93  ASP A CA   1  
ATOM 1505   C C    . ASP A 1 93  ? -24.341 -4.526  -2.800  1.00 1.55  ? 93  ASP A C    1  
ATOM 1506   O O    . ASP A 1 93  ? -23.122 -4.606  -2.638  1.00 1.68  ? 93  ASP A O    1  
ATOM 1507   C CB   . ASP A 1 93  ? -25.418 -6.112  -1.180  1.00 1.99  ? 93  ASP A CB   1  
ATOM 1508   C CG   . ASP A 1 93  ? -25.327 -7.070  -2.350  1.00 1.99  ? 93  ASP A CG   1  
ATOM 1509   O OD1  . ASP A 1 93  ? -26.149 -6.959  -3.285  1.00 1.86  ? 93  ASP A OD1  1  
ATOM 1510   O OD2  . ASP A 1 93  ? -24.416 -7.926  -2.352  1.00 2.16  ? 93  ASP A OD2  1  
ATOM 1511   H H    . ASP A 1 93  ? -27.420 -4.655  -1.732  1.00 1.63  ? 93  ASP A H    1  
ATOM 1512   H HA   . ASP A 1 93  ? -24.886 -4.080  -0.781  1.00 1.80  ? 93  ASP A HA   1  
ATOM 1513   H HB2  . ASP A 1 93  ? -24.624 -6.347  -0.487  1.00 2.16  ? 93  ASP A HB2  1  
ATOM 1514   H HB3  . ASP A 1 93  ? -26.370 -6.259  -0.691  1.00 2.08  ? 93  ASP A HB3  1  
ATOM 1515   N N    . ARG A 1 94  ? -24.922 -4.361  -3.991  1.00 1.32  ? 94  ARG A N    1  
ATOM 1516   C CA   . ARG A 1 94  ? -24.175 -4.198  -5.241  1.00 1.20  ? 94  ARG A CA   1  
ATOM 1517   C C    . ARG A 1 94  ? -23.491 -5.486  -5.702  1.00 1.41  ? 94  ARG A C    1  
ATOM 1518   O O    . ARG A 1 94  ? -22.532 -5.433  -6.468  1.00 1.50  ? 94  ARG A O    1  
ATOM 1519   C CB   . ARG A 1 94  ? -23.134 -3.078  -5.115  1.00 1.14  ? 94  ARG A CB   1  
ATOM 1520   C CG   . ARG A 1 94  ? -23.732 -1.690  -4.949  1.00 1.05  ? 94  ARG A CG   1  
ATOM 1521   C CD   . ARG A 1 94  ? -23.299 -1.050  -3.638  1.00 1.38  ? 94  ARG A CD   1  
ATOM 1522   N NE   . ARG A 1 94  ? -21.849 -1.105  -3.456  1.00 1.67  ? 94  ARG A NE   1  
ATOM 1523   C CZ   . ARG A 1 94  ? -21.083 -0.058  -3.161  1.00 1.75  ? 94  ARG A CZ   1  
ATOM 1524   N NH1  . ARG A 1 94  ? -21.614 1.147   -2.994  1.00 1.64  ? 94  ARG A NH1  1  
ATOM 1525   N NH2  . ARG A 1 94  ? -19.780 -0.226  -3.032  1.00 2.11  ? 94  ARG A NH2  1  
ATOM 1526   H H    . ARG A 1 94  ? -25.899 -4.346  -4.025  1.00 1.28  ? 94  ARG A H    1  
ATOM 1527   H HA   . ARG A 1 94  ? -24.888 -3.910  -5.998  1.00 1.11  ? 94  ARG A HA   1  
ATOM 1528   H HB2  . ARG A 1 94  ? -22.512 -3.280  -4.255  1.00 1.35  ? 94  ARG A HB2  1  
ATOM 1529   H HB3  . ARG A 1 94  ? -22.516 -3.078  -6.001  1.00 1.14  ? 94  ARG A HB3  1  
ATOM 1530   H HG2  . ARG A 1 94  ? -23.406 -1.067  -5.769  1.00 1.05  ? 94  ARG A HG2  1  
ATOM 1531   H HG3  . ARG A 1 94  ? -24.810 -1.770  -4.962  1.00 0.98  ? 94  ARG A HG3  1  
ATOM 1532   H HD2  . ARG A 1 94  ? -23.615 -0.017  -3.632  1.00 1.46  ? 94  ARG A HD2  1  
ATOM 1533   H HD3  . ARG A 1 94  ? -23.775 -1.575  -2.822  1.00 1.56  ? 94  ARG A HD3  1  
ATOM 1534   H HE   . ARG A 1 94  ? -21.415 -1.982  -3.575  1.00 1.92  ? 94  ARG A HE   1  
ATOM 1535   H HH11 . ARG A 1 94  ? -22.601 1.279   -3.080  1.00 1.49  ? 94  ARG A HH11 1  
ATOM 1536   H HH12 . ARG A 1 94  ? -21.017 1.939   -2.807  1.00 1.84  ? 94  ARG A HH12 1  
ATOM 1537   H HH21 . ARG A 1 94  ? -19.379 -1.143  -3.156  1.00 2.33  ? 94  ARG A HH21 1  
ATOM 1538   H HH22 . ARG A 1 94  ? -19.181 0.562   -2.826  1.00 2.23  ? 94  ARG A HH22 1  
ATOM 1539   N N    . PHE A 1 95  ? -23.979 -6.640  -5.266  1.00 1.61  ? 95  PHE A N    1  
ATOM 1540   C CA   . PHE A 1 95  ? -23.381 -7.904  -5.683  1.00 1.84  ? 95  PHE A CA   1  
ATOM 1541   C C    . PHE A 1 95  ? -24.431 -8.992  -5.810  1.00 2.08  ? 95  PHE A C    1  
ATOM 1542   O O    . PHE A 1 95  ? -24.686 -9.500  -6.904  1.00 2.20  ? 95  PHE A O    1  
ATOM 1543   C CB   . PHE A 1 95  ? -22.293 -8.351  -4.707  1.00 2.03  ? 95  PHE A CB   1  
ATOM 1544   C CG   . PHE A 1 95  ? -21.784 -9.745  -4.972  1.00 2.27  ? 95  PHE A CG   1  
ATOM 1545   C CD1  . PHE A 1 95  ? -20.975 -10.008 -6.066  1.00 2.27  ? 95  PHE A CD1  1  
ATOM 1546   C CD2  . PHE A 1 95  ? -22.115 -10.789 -4.122  1.00 2.59  ? 95  PHE A CD2  1  
ATOM 1547   C CE1  . PHE A 1 95  ? -20.505 -11.287 -6.305  1.00 2.51  ? 95  PHE A CE1  1  
ATOM 1548   C CE2  . PHE A 1 95  ? -21.650 -12.069 -4.357  1.00 2.83  ? 95  PHE A CE2  1  
ATOM 1549   C CZ   . PHE A 1 95  ? -20.843 -12.318 -5.449  1.00 2.76  ? 95  PHE A CZ   1  
ATOM 1550   H H    . PHE A 1 95  ? -24.748 -6.647  -4.652  1.00 1.67  ? 95  PHE A H    1  
ATOM 1551   H HA   . PHE A 1 95  ? -22.933 -7.746  -6.649  1.00 1.76  ? 95  PHE A HA   1  
ATOM 1552   H HB2  . PHE A 1 95  ? -21.456 -7.674  -4.775  1.00 1.94  ? 95  PHE A HB2  1  
ATOM 1553   H HB3  . PHE A 1 95  ? -22.690 -8.326  -3.703  1.00 2.12  ? 95  PHE A HB3  1  
ATOM 1554   H HD1  . PHE A 1 95  ? -20.710 -9.204  -6.736  1.00 2.15  ? 95  PHE A HD1  1  
ATOM 1555   H HD2  . PHE A 1 95  ? -22.747 -10.596 -3.269  1.00 2.70  ? 95  PHE A HD2  1  
ATOM 1556   H HE1  . PHE A 1 95  ? -19.875 -11.481 -7.162  1.00 2.55  ? 95  PHE A HE1  1  
ATOM 1557   H HE2  . PHE A 1 95  ? -21.916 -12.873 -3.688  1.00 3.11  ? 95  PHE A HE2  1  
ATOM 1558   H HZ   . PHE A 1 95  ? -20.476 -13.318 -5.632  1.00 2.95  ? 95  PHE A HZ   1  
ATOM 1559   N N    . SER A 1 96  ? -25.032 -9.351  -4.691  1.00 2.22  ? 96  SER A N    1  
ATOM 1560   C CA   . SER A 1 96  ? -26.046 -10.380 -4.675  1.00 2.49  ? 96  SER A CA   1  
ATOM 1561   C C    . SER A 1 96  ? -27.354 -9.812  -5.205  1.00 2.40  ? 96  SER A C    1  
ATOM 1562   O O    . SER A 1 96  ? -27.489 -8.599  -5.384  1.00 2.12  ? 96  SER A O    1  
ATOM 1563   C CB   . SER A 1 96  ? -26.228 -10.922 -3.255  1.00 2.76  ? 96  SER A CB   1  
ATOM 1564   O OG   . SER A 1 96  ? -26.844 -12.197 -3.267  1.00 2.90  ? 96  SER A OG   1  
ATOM 1565   H H    . SER A 1 96  ? -24.797 -8.892  -3.847  1.00 2.17  ? 96  SER A H    1  
ATOM 1566   H HA   . SER A 1 96  ? -25.720 -11.181 -5.324  1.00 2.63  ? 96  SER A HA   1  
ATOM 1567   H HB2  . SER A 1 96  ? -25.262 -11.007 -2.779  1.00 2.75  ? 96  SER A HB2  1  
ATOM 1568   H HB3  . SER A 1 96  ? -26.848 -10.240 -2.691  1.00 3.00  ? 96  SER A HB3  1  
ATOM 1569   H HG   . SER A 1 96  ? -26.196 -12.867 -3.016  1.00 2.84  ? 96  SER A HG   1  
ATOM 1570   N N    . LYS A 1 97  ? -28.320 -10.678 -5.457  1.00 2.68  ? 97  LYS A N    1  
ATOM 1571   C CA   . LYS A 1 97  ? -29.604 -10.233 -5.962  1.00 2.68  ? 97  LYS A CA   1  
ATOM 1572   C C    . LYS A 1 97  ? -30.461 -9.703  -4.817  1.00 2.65  ? 97  LYS A C    1  
ATOM 1573   O O    . LYS A 1 97  ? -31.486 -10.287 -4.462  1.00 2.91  ? 97  LYS A O    1  
ATOM 1574   C CB   . LYS A 1 97  ? -30.320 -11.359 -6.710  1.00 3.03  ? 97  LYS A CB   1  
ATOM 1575   C CG   . LYS A 1 97  ? -29.613 -11.797 -7.989  1.00 3.04  ? 97  LYS A CG   1  
ATOM 1576   C CD   . LYS A 1 97  ? -29.300 -10.622 -8.913  1.00 2.95  ? 97  LYS A CD   1  
ATOM 1577   C CE   . LYS A 1 97  ? -30.555 -9.863  -9.333  1.00 3.31  ? 97  LYS A CE   1  
ATOM 1578   N NZ   . LYS A 1 97  ? -31.503 -10.712 -10.105 1.00 3.63  ? 97  LYS A NZ   1  
ATOM 1579   H H    . LYS A 1 97  ? -28.171 -11.633 -5.284  1.00 2.91  ? 97  LYS A H    1  
ATOM 1580   H HA   . LYS A 1 97  ? -29.417 -9.421  -6.650  1.00 2.47  ? 97  LYS A HA   1  
ATOM 1581   H HB2  . LYS A 1 97  ? -30.395 -12.215 -6.055  1.00 3.23  ? 97  LYS A HB2  1  
ATOM 1582   H HB3  . LYS A 1 97  ? -31.314 -11.028 -6.970  1.00 3.16  ? 97  LYS A HB3  1  
ATOM 1583   H HG2  . LYS A 1 97  ? -28.684 -12.283 -7.725  1.00 2.96  ? 97  LYS A HG2  1  
ATOM 1584   H HG3  . LYS A 1 97  ? -30.246 -12.495 -8.514  1.00 3.32  ? 97  LYS A HG3  1  
ATOM 1585   H HD2  . LYS A 1 97  ? -28.638 -9.941  -8.402  1.00 2.81  ? 97  LYS A HD2  1  
ATOM 1586   H HD3  . LYS A 1 97  ? -28.810 -11.001 -9.798  1.00 3.01  ? 97  LYS A HD3  1  
ATOM 1587   H HE2  . LYS A 1 97  ? -31.053 -9.501  -8.446  1.00 3.38  ? 97  LYS A HE2  1  
ATOM 1588   H HE3  . LYS A 1 97  ? -30.260 -9.022  -9.944  1.00 3.53  ? 97  LYS A HE3  1  
ATOM 1589   H HZ1  . LYS A 1 97  ? -31.011 -11.167 -10.899 1.00 3.73  ? 97  LYS A HZ1  1  
ATOM 1590   H HZ2  . LYS A 1 97  ? -32.281 -10.131 -10.480 1.00 3.98  ? 97  LYS A HZ2  1  
ATOM 1591   H HZ3  . LYS A 1 97  ? -31.907 -11.450 -9.492  1.00 3.72  ? 97  LYS A HZ3  1  
ATOM 1592   N N    . HIS A 1 98  ? -29.990 -8.608  -4.230  1.00 2.38  ? 98  HIS A N    1  
ATOM 1593   C CA   . HIS A 1 98  ? -30.665 -7.936  -3.121  1.00 2.33  ? 98  HIS A CA   1  
ATOM 1594   C C    . HIS A 1 98  ? -32.146 -7.746  -3.415  1.00 2.37  ? 98  HIS A C    1  
ATOM 1595   O O    . HIS A 1 98  ? -32.522 -7.348  -4.520  1.00 2.31  ? 98  HIS A O    1  
ATOM 1596   C CB   . HIS A 1 98  ? -30.004 -6.578  -2.844  1.00 2.06  ? 98  HIS A CB   1  
ATOM 1597   C CG   . HIS A 1 98  ? -29.519 -5.869  -4.076  1.00 1.74  ? 98  HIS A CG   1  
ATOM 1598   N ND1  . HIS A 1 98  ? -28.197 -5.855  -4.465  1.00 1.60  ? 98  HIS A ND1  1  
ATOM 1599   C CD2  . HIS A 1 98  ? -30.190 -5.161  -5.017  1.00 1.63  ? 98  HIS A CD2  1  
ATOM 1600   C CE1  . HIS A 1 98  ? -28.078 -5.170  -5.586  1.00 1.42  ? 98  HIS A CE1  1  
ATOM 1601   N NE2  . HIS A 1 98  ? -29.272 -4.738  -5.947  1.00 1.45  ? 98  HIS A NE2  1  
ATOM 1602   H H    . HIS A 1 98  ? -29.136 -8.242  -4.551  1.00 2.25  ? 98  HIS A H    1  
ATOM 1603   H HA   . HIS A 1 98  ? -30.562 -8.559  -2.247  1.00 2.52  ? 98  HIS A HA   1  
ATOM 1604   H HB2  . HIS A 1 98  ? -30.720 -5.935  -2.354  1.00 2.12  ? 98  HIS A HB2  1  
ATOM 1605   H HB3  . HIS A 1 98  ? -29.157 -6.725  -2.189  1.00 2.17  ? 98  HIS A HB3  1  
ATOM 1606   H HD1  . HIS A 1 98  ? -27.446 -6.300  -3.986  1.00 1.72  ? 98  HIS A HD1  1  
ATOM 1607   H HD2  . HIS A 1 98  ? -31.252 -4.959  -5.028  1.00 1.75  ? 98  HIS A HD2  1  
ATOM 1608   H HE1  . HIS A 1 98  ? -27.154 -4.988  -6.119  1.00 1.36  ? 98  HIS A HE1  1  
ATOM 1609   H HE2  . HIS A 1 98  ? -29.498 -4.411  -6.849  1.00 1.49  ? 98  HIS A HE2  1  
ATOM 1610   N N    . ASP A 1 99  ? -32.980 -8.020  -2.424  1.00 2.56  ? 99  ASP A N    1  
ATOM 1611   C CA   . ASP A 1 99  ? -34.421 -7.903  -2.586  1.00 2.67  ? 99  ASP A CA   1  
ATOM 1612   C C    . ASP A 1 99  ? -35.038 -7.074  -1.466  1.00 2.53  ? 99  ASP A C    1  
ATOM 1613   O O    . ASP A 1 99  ? -34.335 -6.355  -0.754  1.00 2.38  ? 99  ASP A O    1  
ATOM 1614   C CB   . ASP A 1 99  ? -35.056 -9.295  -2.613  1.00 3.07  ? 99  ASP A CB   1  
ATOM 1615   C CG   . ASP A 1 99  ? -36.176 -9.397  -3.625  1.00 3.26  ? 99  ASP A CG   1  
ATOM 1616   O OD1  . ASP A 1 99  ? -36.492 -8.378  -4.268  1.00 3.23  ? 99  ASP A OD1  1  
ATOM 1617   O OD2  . ASP A 1 99  ? -36.727 -10.500 -3.795  1.00 3.68  ? 99  ASP A OD2  1  
ATOM 1618   H H    . ASP A 1 99  ? -32.617 -8.296  -1.557  1.00 2.66  ? 99  ASP A H    1  
ATOM 1619   H HA   . ASP A 1 99  ? -34.612 -7.414  -3.527  1.00 2.64  ? 99  ASP A HA   1  
ATOM 1620   H HB2  . ASP A 1 99  ? -34.300 -10.022 -2.866  1.00 3.22  ? 99  ASP A HB2  1  
ATOM 1621   H HB3  . ASP A 1 99  ? -35.456 -9.521  -1.635  1.00 3.17  ? 99  ASP A HB3  1  
ATOM 1622   N N    . ILE A 1 100 ? -36.352 -7.174  -1.327  1.00 2.62  ? 100 ILE A N    1  
ATOM 1623   C CA   . ILE A 1 100 ? -37.084 -6.453  -0.295  1.00 2.52  ? 100 ILE A CA   1  
ATOM 1624   C C    . ILE A 1 100 ? -36.908 -7.145  1.053   1.00 2.72  ? 100 ILE A C    1  
ATOM 1625   O O    . ILE A 1 100 ? -37.418 -8.247  1.264   1.00 3.00  ? 100 ILE A O    1  
ATOM 1626   C CB   . ILE A 1 100 ? -38.590 -6.371  -0.637  1.00 2.56  ? 100 ILE A CB   1  
ATOM 1627   C CG1  . ILE A 1 100 ? -38.789 -5.658  -1.974  1.00 2.45  ? 100 ILE A CG1  1  
ATOM 1628   C CG2  . ILE A 1 100 ? -39.359 -5.658  0.465   1.00 2.44  ? 100 ILE A CG2  1  
ATOM 1629   C CD1  . ILE A 1 100 ? -40.076 -6.029  -2.681  1.00 2.68  ? 100 ILE A CD1  1  
ATOM 1630   H H    . ILE A 1 100 ? -36.847 -7.762  -1.937  1.00 2.79  ? 100 ILE A H    1  
ATOM 1631   H HA   . ILE A 1 100 ? -36.686 -5.450  -0.235  1.00 2.29  ? 100 ILE A HA   1  
ATOM 1632   H HB   . ILE A 1 100 ? -38.973 -7.378  -0.716  1.00 2.81  ? 100 ILE A HB   1  
ATOM 1633   H HG12 . ILE A 1 100 ? -38.801 -4.590  -1.807  1.00 2.32  ? 100 ILE A HG12 1  
ATOM 1634   H HG13 . ILE A 1 100 ? -37.968 -5.904  -2.627  1.00 2.53  ? 100 ILE A HG13 1  
ATOM 1635   H HG21 . ILE A 1 100 ? -40.405 -5.617  0.204   1.00 2.49  ? 100 ILE A HG21 1  
ATOM 1636   H HG22 . ILE A 1 100 ? -38.977 -4.653  0.579   1.00 2.23  ? 100 ILE A HG22 1  
ATOM 1637   H HG23 . ILE A 1 100 ? -39.243 -6.196  1.393   1.00 2.60  ? 100 ILE A HG23 1  
ATOM 1638   H HD11 . ILE A 1 100 ? -40.018 -7.055  -3.016  1.00 3.05  ? 100 ILE A HD11 1  
ATOM 1639   H HD12 . ILE A 1 100 ? -40.219 -5.380  -3.532  1.00 2.73  ? 100 ILE A HD12 1  
ATOM 1640   H HD13 . ILE A 1 100 ? -40.905 -5.921  -2.000  1.00 2.86  ? 100 ILE A HD13 1  
ATOM 1641   N N    . ILE A 1 101 ? -36.180 -6.498  1.955   1.00 2.63  ? 101 ILE A N    1  
ATOM 1642   C CA   . ILE A 1 101 ? -35.931 -7.057  3.278   1.00 2.86  ? 101 ILE A CA   1  
ATOM 1643   C C    . ILE A 1 101 ? -37.112 -6.810  4.212   1.00 2.94  ? 101 ILE A C    1  
ATOM 1644   O O    . ILE A 1 101 ? -37.194 -7.393  5.292   1.00 3.20  ? 101 ILE A O    1  
ATOM 1645   C CB   . ILE A 1 101 ? -34.640 -6.487  3.911   1.00 2.81  ? 101 ILE A CB   1  
ATOM 1646   C CG1  . ILE A 1 101 ? -34.621 -4.955  3.827   1.00 2.53  ? 101 ILE A CG1  1  
ATOM 1647   C CG2  . ILE A 1 101 ? -33.419 -7.082  3.228   1.00 3.08  ? 101 ILE A CG2  1  
ATOM 1648   C CD1  . ILE A 1 101 ? -33.409 -4.318  4.475   1.00 2.63  ? 101 ILE A CD1  1  
ATOM 1649   H H    . ILE A 1 101 ? -35.802 -5.623  1.724   1.00 2.43  ? 101 ILE A H    1  
ATOM 1650   H HA   . ILE A 1 101 ? -35.801 -8.124  3.162   1.00 3.07  ? 101 ILE A HA   1  
ATOM 1651   H HB   . ILE A 1 101 ? -34.616 -6.783  4.949   1.00 2.97  ? 101 ILE A HB   1  
ATOM 1652   H HG12 . ILE A 1 101 ? -34.634 -4.658  2.789   1.00 2.46  ? 101 ILE A HG12 1  
ATOM 1653   H HG13 . ILE A 1 101 ? -35.503 -4.569  4.318   1.00 2.65  ? 101 ILE A HG13 1  
ATOM 1654   H HG21 . ILE A 1 101 ? -33.408 -8.151  3.378   1.00 3.37  ? 101 ILE A HG21 1  
ATOM 1655   H HG22 . ILE A 1 101 ? -32.525 -6.649  3.648   1.00 3.14  ? 101 ILE A HG22 1  
ATOM 1656   H HG23 . ILE A 1 101 ? -33.462 -6.869  2.171   1.00 3.09  ? 101 ILE A HG23 1  
ATOM 1657   H HD11 . ILE A 1 101 ? -33.379 -4.581  5.521   1.00 2.91  ? 101 ILE A HD11 1  
ATOM 1658   H HD12 . ILE A 1 101 ? -33.469 -3.243  4.376   1.00 2.68  ? 101 ILE A HD12 1  
ATOM 1659   H HD13 . ILE A 1 101 ? -32.513 -4.676  3.990   1.00 2.78  ? 101 ILE A HD13 1  
ATOM 1660   N N    . GLY A 1 102 ? -38.025 -5.945  3.789   1.00 2.74  ? 102 GLY A N    1  
ATOM 1661   C CA   . GLY A 1 102 ? -39.191 -5.645  4.590   1.00 2.81  ? 102 GLY A CA   1  
ATOM 1662   C C    . GLY A 1 102 ? -40.030 -4.537  3.993   1.00 2.55  ? 102 GLY A C    1  
ATOM 1663   O O    . GLY A 1 102 ? -39.567 -3.809  3.114   1.00 2.31  ? 102 GLY A O    1  
ATOM 1664   H H    . GLY A 1 102 ? -37.902 -5.502  2.922   1.00 2.56  ? 102 GLY A H    1  
ATOM 1665   H HA2  . GLY A 1 102 ? -39.800 -6.533  4.665   1.00 3.00  ? 102 GLY A HA2  1  
ATOM 1666   H HA3  . GLY A 1 102 ? -38.875 -5.352  5.580   1.00 2.90  ? 102 GLY A HA3  1  
ATOM 1667   N N    . GLU A 1 103 ? -41.258 -4.404  4.473   1.00 2.60  ? 103 GLU A N    1  
ATOM 1668   C CA   . GLU A 1 103 ? -42.167 -3.387  3.974   1.00 2.38  ? 103 GLU A CA   1  
ATOM 1669   C C    . GLU A 1 103 ? -43.266 -3.101  4.989   1.00 2.48  ? 103 GLU A C    1  
ATOM 1670   O O    . GLU A 1 103 ? -43.341 -3.746  6.037   1.00 2.66  ? 103 GLU A O    1  
ATOM 1671   C CB   . GLU A 1 103 ? -42.793 -3.844  2.652   1.00 2.38  ? 103 GLU A CB   1  
ATOM 1672   C CG   . GLU A 1 103 ? -43.463 -5.206  2.735   1.00 2.71  ? 103 GLU A CG   1  
ATOM 1673   C CD   . GLU A 1 103 ? -44.704 -5.305  1.875   1.00 2.86  ? 103 GLU A CD   1  
ATOM 1674   O OE1  . GLU A 1 103 ? -45.569 -4.412  1.970   1.00 3.05  ? 103 GLU A OE1  1  
ATOM 1675   O OE2  . GLU A 1 103 ? -44.828 -6.289  1.116   1.00 2.94  ? 103 GLU A OE2  1  
ATOM 1676   H H    . GLU A 1 103 ? -41.563 -5.003  5.191   1.00 2.79  ? 103 GLU A H    1  
ATOM 1677   H HA   . GLU A 1 103 ? -41.599 -2.484  3.805   1.00 2.18  ? 103 GLU A HA   1  
ATOM 1678   H HB2  . GLU A 1 103 ? -43.536 -3.120  2.348   1.00 2.26  ? 103 GLU A HB2  1  
ATOM 1679   H HB3  . GLU A 1 103 ? -42.021 -3.892  1.900   1.00 2.29  ? 103 GLU A HB3  1  
ATOM 1680   H HG2  . GLU A 1 103 ? -42.760 -5.957  2.411   1.00 2.78  ? 103 GLU A HG2  1  
ATOM 1681   H HG3  . GLU A 1 103 ? -43.740 -5.394  3.763   1.00 2.93  ? 103 GLU A HG3  1  
ATOM 1682   N N    . PHE A 1 104 ? -44.101 -2.123  4.678   1.00 2.39  ? 104 PHE A N    1  
ATOM 1683   C CA   . PHE A 1 104 ? -45.218 -1.753  5.530   1.00 2.48  ? 104 PHE A CA   1  
ATOM 1684   C C    . PHE A 1 104 ? -46.286 -1.069  4.684   1.00 2.36  ? 104 PHE A C    1  
ATOM 1685   O O    . PHE A 1 104 ? -45.970 -0.403  3.696   1.00 2.15  ? 104 PHE A O    1  
ATOM 1686   C CB   . PHE A 1 104 ? -44.755 -0.854  6.699   1.00 2.44  ? 104 PHE A CB   1  
ATOM 1687   C CG   . PHE A 1 104 ? -45.113 0.605   6.570   1.00 2.20  ? 104 PHE A CG   1  
ATOM 1688   C CD1  . PHE A 1 104 ? -46.334 1.078   7.029   1.00 2.16  ? 104 PHE A CD1  1  
ATOM 1689   C CD2  . PHE A 1 104 ? -44.225 1.504   6.001   1.00 2.07  ? 104 PHE A CD2  1  
ATOM 1690   C CE1  . PHE A 1 104 ? -46.661 2.416   6.920   1.00 2.01  ? 104 PHE A CE1  1  
ATOM 1691   C CE2  . PHE A 1 104 ? -44.547 2.844   5.893   1.00 1.92  ? 104 PHE A CE2  1  
ATOM 1692   C CZ   . PHE A 1 104 ? -45.768 3.300   6.351   1.00 1.90  ? 104 PHE A CZ   1  
ATOM 1693   H H    . PHE A 1 104 ? -43.960 -1.629  3.841   1.00 2.28  ? 104 PHE A H    1  
ATOM 1694   H HA   . PHE A 1 104 ? -45.634 -2.667  5.932   1.00 2.68  ? 104 PHE A HA   1  
ATOM 1695   H HB2  . PHE A 1 104 ? -45.200 -1.218  7.613   1.00 2.59  ? 104 PHE A HB2  1  
ATOM 1696   H HB3  . PHE A 1 104 ? -43.679 -0.924  6.784   1.00 2.51  ? 104 PHE A HB3  1  
ATOM 1697   H HD1  . PHE A 1 104 ? -47.036 0.388   7.475   1.00 2.30  ? 104 PHE A HD1  1  
ATOM 1698   H HD2  . PHE A 1 104 ? -43.273 1.148   5.641   1.00 2.13  ? 104 PHE A HD2  1  
ATOM 1699   H HE1  . PHE A 1 104 ? -47.617 2.770   7.278   1.00 2.03  ? 104 PHE A HE1  1  
ATOM 1700   H HE2  . PHE A 1 104 ? -43.843 3.535   5.449   1.00 1.89  ? 104 PHE A HE2  1  
ATOM 1701   H HZ   . PHE A 1 104 ? -46.022 4.346   6.268   1.00 1.85  ? 104 PHE A HZ   1  
ATOM 1702   N N    . LYS A 1 105 ? -47.541 -1.248  5.061   1.00 2.53  ? 105 LYS A N    1  
ATOM 1703   C CA   . LYS A 1 105 ? -48.649 -0.657  4.331   1.00 2.48  ? 105 LYS A CA   1  
ATOM 1704   C C    . LYS A 1 105 ? -49.677 -0.086  5.293   1.00 2.53  ? 105 LYS A C    1  
ATOM 1705   O O    . LYS A 1 105 ? -49.842 -0.586  6.406   1.00 2.71  ? 105 LYS A O    1  
ATOM 1706   C CB   . LYS A 1 105 ? -49.303 -1.701  3.422   1.00 2.65  ? 105 LYS A CB   1  
ATOM 1707   C CG   . LYS A 1 105 ? -49.598 -3.023  4.117   1.00 2.90  ? 105 LYS A CG   1  
ATOM 1708   C CD   . LYS A 1 105 ? -48.670 -4.124  3.630   1.00 3.13  ? 105 LYS A CD   1  
ATOM 1709   C CE   . LYS A 1 105 ? -48.958 -4.491  2.183   1.00 3.31  ? 105 LYS A CE   1  
ATOM 1710   N NZ   . LYS A 1 105 ? -47.938 -5.415  1.625   1.00 3.55  ? 105 LYS A NZ   1  
ATOM 1711   H H    . LYS A 1 105 ? -47.731 -1.785  5.857   1.00 2.70  ? 105 LYS A H    1  
ATOM 1712   H HA   . LYS A 1 105 ? -48.256 0.143   3.722   1.00 2.32  ? 105 LYS A HA   1  
ATOM 1713   H HB2  . LYS A 1 105 ? -50.234 -1.301  3.045   1.00 2.64  ? 105 LYS A HB2  1  
ATOM 1714   H HB3  . LYS A 1 105 ? -48.644 -1.896  2.591   1.00 2.64  ? 105 LYS A HB3  1  
ATOM 1715   H HG2  . LYS A 1 105 ? -49.463 -2.897  5.180   1.00 2.89  ? 105 LYS A HG2  1  
ATOM 1716   H HG3  . LYS A 1 105 ? -50.620 -3.306  3.913   1.00 2.97  ? 105 LYS A HG3  1  
ATOM 1717   H HD2  . LYS A 1 105 ? -47.649 -3.782  3.708   1.00 3.06  ? 105 LYS A HD2  1  
ATOM 1718   H HD3  . LYS A 1 105 ? -48.809 -4.998  4.249   1.00 3.32  ? 105 LYS A HD3  1  
ATOM 1719   H HE2  . LYS A 1 105 ? -49.923 -4.968  2.133   1.00 3.46  ? 105 LYS A HE2  1  
ATOM 1720   H HE3  . LYS A 1 105 ? -48.974 -3.587  1.591   1.00 3.22  ? 105 LYS A HE3  1  
ATOM 1721   H HZ1  . LYS A 1 105 ? -47.950 -6.317  2.140   1.00 3.80  ? 105 LYS A HZ1  1  
ATOM 1722   H HZ2  . LYS A 1 105 ? -46.983 -4.992  1.711   1.00 3.31  ? 105 LYS A HZ2  1  
ATOM 1723   H HZ3  . LYS A 1 105 ? -48.133 -5.597  0.621   1.00 3.82  ? 105 LYS A HZ3  1  
ATOM 1724   N N    . VAL A 1 106 ? -50.359 0.962   4.863   1.00 2.41  ? 106 VAL A N    1  
ATOM 1725   C CA   . VAL A 1 106 ? -51.370 1.597   5.688   1.00 2.46  ? 106 VAL A CA   1  
ATOM 1726   C C    . VAL A 1 106 ? -52.562 2.042   4.837   1.00 2.48  ? 106 VAL A C    1  
ATOM 1727   O O    . VAL A 1 106 ? -52.400 2.730   3.825   1.00 2.38  ? 106 VAL A O    1  
ATOM 1728   C CB   . VAL A 1 106 ? -50.779 2.799   6.473   1.00 2.35  ? 106 VAL A CB   1  
ATOM 1729   C CG1  . VAL A 1 106 ? -50.169 3.834   5.536   1.00 2.16  ? 106 VAL A CG1  1  
ATOM 1730   C CG2  . VAL A 1 106 ? -51.833 3.439   7.362   1.00 2.45  ? 106 VAL A CG2  1  
ATOM 1731   H H    . VAL A 1 106 ? -50.177 1.320   3.967   1.00 2.30  ? 106 VAL A H    1  
ATOM 1732   H HA   . VAL A 1 106 ? -51.714 0.865   6.405   1.00 2.63  ? 106 VAL A HA   1  
ATOM 1733   H HB   . VAL A 1 106 ? -49.991 2.424   7.111   1.00 2.38  ? 106 VAL A HB   1  
ATOM 1734   H HG11 . VAL A 1 106 ? -49.811 4.674   6.114   1.00 2.15  ? 106 VAL A HG11 1  
ATOM 1735   H HG12 . VAL A 1 106 ? -50.918 4.171   4.836   1.00 2.19  ? 106 VAL A HG12 1  
ATOM 1736   H HG13 . VAL A 1 106 ? -49.345 3.391   4.997   1.00 2.10  ? 106 VAL A HG13 1  
ATOM 1737   H HG21 . VAL A 1 106 ? -52.175 2.719   8.090   1.00 2.61  ? 106 VAL A HG21 1  
ATOM 1738   H HG22 . VAL A 1 106 ? -52.666 3.761   6.755   1.00 2.46  ? 106 VAL A HG22 1  
ATOM 1739   H HG23 . VAL A 1 106 ? -51.407 4.292   7.869   1.00 2.40  ? 106 VAL A HG23 1  
ATOM 1740   N N    . PRO A 1 107 ? -53.775 1.601   5.207   1.00 2.66  ? 107 PRO A N    1  
ATOM 1741   C CA   . PRO A 1 107 ? -54.997 1.968   4.491   1.00 2.73  ? 107 PRO A CA   1  
ATOM 1742   C C    . PRO A 1 107 ? -55.372 3.428   4.735   1.00 2.57  ? 107 PRO A C    1  
ATOM 1743   O O    . PRO A 1 107 ? -55.800 3.793   5.831   1.00 2.58  ? 107 PRO A O    1  
ATOM 1744   C CB   . PRO A 1 107 ? -56.057 1.032   5.080   1.00 2.97  ? 107 PRO A CB   1  
ATOM 1745   C CG   . PRO A 1 107 ? -55.546 0.673   6.434   1.00 2.96  ? 107 PRO A CG   1  
ATOM 1746   C CD   . PRO A 1 107 ? -54.045 0.694   6.340   1.00 2.84  ? 107 PRO A CD   1  
ATOM 1747   H HA   . PRO A 1 107 ? -54.902 1.793   3.427   1.00 2.76  ? 107 PRO A HA   1  
ATOM 1748   H HB2  . PRO A 1 107 ? -57.003 1.550   5.141   1.00 3.04  ? 107 PRO A HB2  1  
ATOM 1749   H HB3  . PRO A 1 107 ? -56.159 0.159   4.454   1.00 3.10  ? 107 PRO A HB3  1  
ATOM 1750   H HG2  . PRO A 1 107 ? -55.883 1.402   7.155   1.00 2.89  ? 107 PRO A HG2  1  
ATOM 1751   H HG3  . PRO A 1 107 ? -55.891 -0.313  6.709   1.00 3.12  ? 107 PRO A HG3  1  
ATOM 1752   H HD2  . PRO A 1 107 ? -53.620 1.081   7.252   1.00 2.79  ? 107 PRO A HD2  1  
ATOM 1753   H HD3  . PRO A 1 107 ? -53.665 -0.298  6.137   1.00 2.97  ? 107 PRO A HD3  1  
ATOM 1754   N N    . MET A 1 108 ? -55.225 4.257   3.709   1.00 2.47  ? 108 MET A N    1  
ATOM 1755   C CA   . MET A 1 108 ? -55.529 5.681   3.827   1.00 2.36  ? 108 MET A CA   1  
ATOM 1756   C C    . MET A 1 108 ? -57.018 5.920   4.052   1.00 2.51  ? 108 MET A C    1  
ATOM 1757   O O    . MET A 1 108 ? -57.421 6.995   4.481   1.00 2.47  ? 108 MET A O    1  
ATOM 1758   C CB   . MET A 1 108 ? -55.053 6.445   2.589   1.00 2.30  ? 108 MET A CB   1  
ATOM 1759   C CG   . MET A 1 108 ? -53.538 6.483   2.445   1.00 2.15  ? 108 MET A CG   1  
ATOM 1760   S SD   . MET A 1 108 ? -52.690 6.768   4.013   1.00 1.97  ? 108 MET A SD   1  
ATOM 1761   C CE   . MET A 1 108 ? -53.335 8.374   4.481   1.00 1.93  ? 108 MET A CE   1  
ATOM 1762   H H    . MET A 1 108 ? -54.900 3.907   2.852   1.00 2.49  ? 108 MET A H    1  
ATOM 1763   H HA   . MET A 1 108 ? -54.993 6.052   4.687   1.00 2.24  ? 108 MET A HA   1  
ATOM 1764   H HB2  . MET A 1 108 ? -55.468 5.975   1.708   1.00 2.44  ? 108 MET A HB2  1  
ATOM 1765   H HB3  . MET A 1 108 ? -55.413 7.460   2.647   1.00 2.27  ? 108 MET A HB3  1  
ATOM 1766   H HG2  . MET A 1 108 ? -53.206 5.537   2.041   1.00 2.22  ? 108 MET A HG2  1  
ATOM 1767   H HG3  . MET A 1 108 ? -53.276 7.274   1.759   1.00 2.14  ? 108 MET A HG3  1  
ATOM 1768   H HE1  . MET A 1 108 ? -53.088 9.096   3.719   1.00 1.97  ? 108 MET A HE1  1  
ATOM 1769   H HE2  . MET A 1 108 ? -52.898 8.678   5.420   1.00 1.92  ? 108 MET A HE2  1  
ATOM 1770   H HE3  . MET A 1 108 ? -54.409 8.315   4.585   1.00 1.99  ? 108 MET A HE3  1  
ATOM 1771   N N    . ASN A 1 109 ? -57.831 4.915   3.765   1.00 2.71  ? 109 ASN A N    1  
ATOM 1772   C CA   . ASN A 1 109 ? -59.271 5.025   3.960   1.00 2.87  ? 109 ASN A CA   1  
ATOM 1773   C C    . ASN A 1 109 ? -59.595 5.122   5.447   1.00 2.86  ? 109 ASN A C    1  
ATOM 1774   O O    . ASN A 1 109 ? -60.501 5.850   5.854   1.00 2.91  ? 109 ASN A O    1  
ATOM 1775   C CB   . ASN A 1 109 ? -59.993 3.824   3.349   1.00 3.11  ? 109 ASN A CB   1  
ATOM 1776   C CG   . ASN A 1 109 ? -61.502 3.968   3.403   1.00 3.31  ? 109 ASN A CG   1  
ATOM 1777   O OD1  . ASN A 1 109 ? -62.034 5.079   3.418   1.00 3.30  ? 109 ASN A OD1  1  
ATOM 1778   N ND2  . ASN A 1 109 ? -62.203 2.848   3.428   1.00 3.54  ? 109 ASN A ND2  1  
ATOM 1779   H H    . ASN A 1 109 ? -57.456 4.088   3.401   1.00 2.76  ? 109 ASN A H    1  
ATOM 1780   H HA   . ASN A 1 109 ? -59.605 5.926   3.470   1.00 2.85  ? 109 ASN A HA   1  
ATOM 1781   H HB2  . ASN A 1 109 ? -59.694 3.719   2.316   1.00 3.13  ? 109 ASN A HB2  1  
ATOM 1782   H HB3  . ASN A 1 109 ? -59.714 2.933   3.892   1.00 3.16  ? 109 ASN A HB3  1  
ATOM 1783   H HD21 . ASN A 1 109 ? -61.718 1.995   3.411   1.00 3.60  ? 109 ASN A HD21 1  
ATOM 1784   H HD22 . ASN A 1 109 ? -63.182 2.915   3.450   1.00 3.67  ? 109 ASN A HD22 1  
ATOM 1785   N N    . THR A 1 110 ? -58.835 4.394   6.252   1.00 2.82  ? 110 THR A N    1  
ATOM 1786   C CA   . THR A 1 110 ? -59.026 4.391   7.693   1.00 2.86  ? 110 THR A CA   1  
ATOM 1787   C C    . THR A 1 110 ? -58.372 5.616   8.328   1.00 2.66  ? 110 THR A C    1  
ATOM 1788   O O    . THR A 1 110 ? -58.891 6.181   9.290   1.00 2.75  ? 110 THR A O    1  
ATOM 1789   C CB   . THR A 1 110 ? -58.441 3.107   8.316   1.00 3.01  ? 110 THR A CB   1  
ATOM 1790   O OG1  . THR A 1 110 ? -58.968 1.959   7.638   1.00 3.14  ? 110 THR A OG1  1  
ATOM 1791   C CG2  . THR A 1 110 ? -58.766 3.014   9.799   1.00 3.22  ? 110 THR A CG2  1  
ATOM 1792   H H    . THR A 1 110 ? -58.119 3.847   5.866   1.00 2.80  ? 110 THR A H    1  
ATOM 1793   H HA   . THR A 1 110 ? -60.086 4.412   7.891   1.00 2.97  ? 110 THR A HA   1  
ATOM 1794   H HB   . THR A 1 110 ? -57.367 3.123   8.197   1.00 2.93  ? 110 THR A HB   1  
ATOM 1795   H HG1  . THR A 1 110 ? -59.925 2.046   7.557   1.00 3.36  ? 110 THR A HG1  1  
ATOM 1796   H HG21 . THR A 1 110 ? -59.838 3.009   9.931   1.00 3.39  ? 110 THR A HG21 1  
ATOM 1797   H HG22 . THR A 1 110 ? -58.345 3.862   10.314  1.00 3.20  ? 110 THR A HG22 1  
ATOM 1798   H HG23 . THR A 1 110 ? -58.347 2.104   10.204  1.00 3.32  ? 110 THR A HG23 1  
ATOM 1799   N N    . VAL A 1 111 ? -57.247 6.032   7.764   1.00 2.47  ? 111 VAL A N    1  
ATOM 1800   C CA   . VAL A 1 111 ? -56.516 7.183   8.271   1.00 2.31  ? 111 VAL A CA   1  
ATOM 1801   C C    . VAL A 1 111 ? -57.175 8.484   7.829   1.00 2.27  ? 111 VAL A C    1  
ATOM 1802   O O    . VAL A 1 111 ? -57.485 8.666   6.653   1.00 2.31  ? 111 VAL A O    1  
ATOM 1803   C CB   . VAL A 1 111 ? -55.050 7.168   7.788   1.00 2.18  ? 111 VAL A CB   1  
ATOM 1804   C CG1  . VAL A 1 111 ? -54.266 8.329   8.380   1.00 2.11  ? 111 VAL A CG1  1  
ATOM 1805   C CG2  . VAL A 1 111 ? -54.387 5.849   8.138   1.00 2.26  ? 111 VAL A CG2  1  
ATOM 1806   H H    . VAL A 1 111 ? -56.905 5.558   6.977   1.00 2.48  ? 111 VAL A H    1  
ATOM 1807   H HA   . VAL A 1 111 ? -56.521 7.137   9.349   1.00 2.38  ? 111 VAL A HA   1  
ATOM 1808   H HB   . VAL A 1 111 ? -55.047 7.271   6.712   1.00 2.16  ? 111 VAL A HB   1  
ATOM 1809   H HG11 . VAL A 1 111 ? -53.245 8.292   8.026   1.00 2.07  ? 111 VAL A HG11 1  
ATOM 1810   H HG12 . VAL A 1 111 ? -54.276 8.258   9.457   1.00 2.18  ? 111 VAL A HG12 1  
ATOM 1811   H HG13 . VAL A 1 111 ? -54.719 9.262   8.077   1.00 2.13  ? 111 VAL A HG13 1  
ATOM 1812   H HG21 . VAL A 1 111 ? -54.919 5.040   7.660   1.00 2.32  ? 111 VAL A HG21 1  
ATOM 1813   H HG22 . VAL A 1 111 ? -54.407 5.710   9.209   1.00 2.39  ? 111 VAL A HG22 1  
ATOM 1814   H HG23 . VAL A 1 111 ? -53.363 5.860   7.794   1.00 2.22  ? 111 VAL A HG23 1  
ATOM 1815   N N    . ASP A 1 112 ? -57.406 9.380   8.773   1.00 2.30  ? 112 ASP A N    1  
ATOM 1816   C CA   . ASP A 1 112 ? -58.014 10.660  8.454   1.00 2.31  ? 112 ASP A CA   1  
ATOM 1817   C C    . ASP A 1 112 ? -56.934 11.691  8.168   1.00 2.18  ? 112 ASP A C    1  
ATOM 1818   O O    . ASP A 1 112 ? -55.821 11.603  8.691   1.00 2.18  ? 112 ASP A O    1  
ATOM 1819   C CB   . ASP A 1 112 ? -58.924 11.148  9.587   1.00 2.49  ? 112 ASP A CB   1  
ATOM 1820   C CG   . ASP A 1 112 ? -58.158 11.699  10.775  1.00 2.54  ? 112 ASP A CG   1  
ATOM 1821   O OD1  . ASP A 1 112 ? -57.782 10.906  11.661  1.00 2.74  ? 112 ASP A OD1  1  
ATOM 1822   O OD2  . ASP A 1 112 ? -57.950 12.933  10.837  1.00 2.59  ? 112 ASP A OD2  1  
ATOM 1823   H H    . ASP A 1 112 ? -57.159 9.184   9.701   1.00 2.39  ? 112 ASP A H    1  
ATOM 1824   H HA   . ASP A 1 112 ? -58.606 10.527  7.560   1.00 2.36  ? 112 ASP A HA   1  
ATOM 1825   H HB2  . ASP A 1 112 ? -59.568 11.929  9.210   1.00 2.53  ? 112 ASP A HB2  1  
ATOM 1826   H HB3  . ASP A 1 112 ? -59.534 10.324  9.928   1.00 2.73  ? 112 ASP A HB3  1  
ATOM 1827   N N    . PHE A 1 113 ? -57.262 12.662  7.332   1.00 2.17  ? 113 PHE A N    1  
ATOM 1828   C CA   . PHE A 1 113 ? -56.319 13.711  6.979   1.00 2.14  ? 113 PHE A CA   1  
ATOM 1829   C C    . PHE A 1 113 ? -56.692 15.012  7.681   1.00 2.26  ? 113 PHE A C    1  
ATOM 1830   O O    . PHE A 1 113 ? -56.544 16.098  7.124   1.00 2.39  ? 113 PHE A O    1  
ATOM 1831   C CB   . PHE A 1 113 ? -56.260 13.906  5.450   1.00 2.20  ? 113 PHE A CB   1  
ATOM 1832   C CG   . PHE A 1 113 ? -57.598 14.122  4.787   1.00 2.37  ? 113 PHE A CG   1  
ATOM 1833   C CD1  . PHE A 1 113 ? -58.117 15.399  4.634   1.00 2.62  ? 113 PHE A CD1  1  
ATOM 1834   C CD2  . PHE A 1 113 ? -58.330 13.047  4.310   1.00 2.40  ? 113 PHE A CD2  1  
ATOM 1835   C CE1  . PHE A 1 113 ? -59.339 15.597  4.022   1.00 2.82  ? 113 PHE A CE1  1  
ATOM 1836   C CE2  . PHE A 1 113 ? -59.553 13.239  3.698   1.00 2.63  ? 113 PHE A CE2  1  
ATOM 1837   C CZ   . PHE A 1 113 ? -60.059 14.515  3.553   1.00 2.81  ? 113 PHE A CZ   1  
ATOM 1838   H H    . PHE A 1 113 ? -58.163 12.679  6.949   1.00 2.26  ? 113 PHE A H    1  
ATOM 1839   H HA   . PHE A 1 113 ? -55.344 13.403  7.328   1.00 2.08  ? 113 PHE A HA   1  
ATOM 1840   H HB2  . PHE A 1 113 ? -55.645 14.764  5.230   1.00 2.28  ? 113 PHE A HB2  1  
ATOM 1841   H HB3  . PHE A 1 113 ? -55.811 13.030  5.003   1.00 2.12  ? 113 PHE A HB3  1  
ATOM 1842   H HD1  . PHE A 1 113 ? -57.556 16.247  5.001   1.00 2.71  ? 113 PHE A HD1  1  
ATOM 1843   H HD2  . PHE A 1 113 ? -57.936 12.048  4.421   1.00 2.33  ? 113 PHE A HD2  1  
ATOM 1844   H HE1  . PHE A 1 113 ? -59.732 16.597  3.909   1.00 3.05  ? 113 PHE A HE1  1  
ATOM 1845   H HE2  . PHE A 1 113 ? -60.115 12.391  3.334   1.00 2.74  ? 113 PHE A HE2  1  
ATOM 1846   H HZ   . PHE A 1 113 ? -61.015 14.667  3.077   1.00 3.02  ? 113 PHE A HZ   1  
ATOM 1847   N N    . GLY A 1 114 ? -57.174 14.890  8.915   1.00 2.31  ? 114 GLY A N    1  
ATOM 1848   C CA   . GLY A 1 114 ? -57.568 16.055  9.683   1.00 2.47  ? 114 GLY A CA   1  
ATOM 1849   C C    . GLY A 1 114 ? -56.413 17.004  9.918   1.00 2.51  ? 114 GLY A C    1  
ATOM 1850   O O    . GLY A 1 114 ? -56.547 18.216  9.743   1.00 2.65  ? 114 GLY A O    1  
ATOM 1851   H H    . GLY A 1 114 ? -57.265 13.992  9.311   1.00 2.31  ? 114 GLY A H    1  
ATOM 1852   H HA2  . GLY A 1 114 ? -58.349 16.577  9.151   1.00 2.57  ? 114 GLY A HA2  1  
ATOM 1853   H HA3  . GLY A 1 114 ? -57.951 15.730  10.639  1.00 2.55  ? 114 GLY A HA3  1  
ATOM 1854   N N    . HIS A 1 115 ? -55.273 16.460  10.317  1.00 2.45  ? 115 HIS A N    1  
ATOM 1855   C CA   . HIS A 1 115 ? -54.096 17.278  10.570  1.00 2.55  ? 115 HIS A CA   1  
ATOM 1856   C C    . HIS A 1 115 ? -52.831 16.586  10.083  1.00 2.47  ? 115 HIS A C    1  
ATOM 1857   O O    . HIS A 1 115 ? -52.448 16.732  8.921   1.00 2.44  ? 115 HIS A O    1  
ATOM 1858   C CB   . HIS A 1 115 ? -53.980 17.626  12.059  1.00 2.72  ? 115 HIS A CB   1  
ATOM 1859   C CG   . HIS A 1 115 ? -54.912 18.722  12.475  1.00 2.84  ? 115 HIS A CG   1  
ATOM 1860   N ND1  . HIS A 1 115 ? -55.954 18.532  13.352  1.00 3.01  ? 115 HIS A ND1  1  
ATOM 1861   C CD2  . HIS A 1 115 ? -54.970 20.022  12.101  1.00 3.04  ? 115 HIS A CD2  1  
ATOM 1862   C CE1  . HIS A 1 115 ? -56.617 19.664  13.497  1.00 3.18  ? 115 HIS A CE1  1  
ATOM 1863   N NE2  . HIS A 1 115 ? -56.040 20.586  12.751  1.00 3.19  ? 115 HIS A NE2  1  
ATOM 1864   H H    . HIS A 1 115 ? -55.221 15.486  10.440  1.00 2.39  ? 115 HIS A H    1  
ATOM 1865   H HA   . HIS A 1 115 ? -54.215 18.194  10.012  1.00 2.61  ? 115 HIS A HA   1  
ATOM 1866   H HB2  . HIS A 1 115 ? -54.209 16.749  12.649  1.00 2.71  ? 115 HIS A HB2  1  
ATOM 1867   H HB3  . HIS A 1 115 ? -52.971 17.944  12.274  1.00 2.88  ? 115 HIS A HB3  1  
ATOM 1868   H HD1  . HIS A 1 115 ? -56.177 17.690  13.806  1.00 3.14  ? 115 HIS A HD1  1  
ATOM 1869   H HD2  . HIS A 1 115 ? -54.298 20.523  11.420  1.00 3.22  ? 115 HIS A HD2  1  
ATOM 1870   H HE1  . HIS A 1 115 ? -57.485 19.811  14.125  1.00 3.41  ? 115 HIS A HE1  1  
ATOM 1871   H HE2  . HIS A 1 115 ? -56.451 21.446  12.509  1.00 3.39  ? 115 HIS A HE2  1  
ATOM 1872   N N    . VAL A 1 116 ? -52.187 15.831  10.963  1.00 2.50  ? 116 VAL A N    1  
ATOM 1873   C CA   . VAL A 1 116 ? -50.959 15.127  10.612  1.00 2.44  ? 116 VAL A CA   1  
ATOM 1874   C C    . VAL A 1 116 ? -50.917 13.748  11.259  1.00 2.39  ? 116 VAL A C    1  
ATOM 1875   O O    . VAL A 1 116 ? -51.336 13.570  12.404  1.00 2.52  ? 116 VAL A O    1  
ATOM 1876   C CB   . VAL A 1 116 ? -49.690 15.913  11.028  1.00 2.61  ? 116 VAL A CB   1  
ATOM 1877   C CG1  . VAL A 1 116 ? -49.467 17.110  10.112  1.00 2.67  ? 116 VAL A CG1  1  
ATOM 1878   C CG2  . VAL A 1 116 ? -49.777 16.354  12.485  1.00 2.82  ? 116 VAL A CG2  1  
ATOM 1879   H H    . VAL A 1 116 ? -52.547 15.734  11.870  1.00 2.61  ? 116 VAL A H    1  
ATOM 1880   H HA   . VAL A 1 116 ? -50.943 15.005  9.538   1.00 2.33  ? 116 VAL A HA   1  
ATOM 1881   H HB   . VAL A 1 116 ? -48.841 15.254  10.927  1.00 2.60  ? 116 VAL A HB   1  
ATOM 1882   H HG11 . VAL A 1 116 ? -50.289 17.803  10.216  1.00 2.78  ? 116 VAL A HG11 1  
ATOM 1883   H HG12 . VAL A 1 116 ? -49.408 16.772  9.087   1.00 2.62  ? 116 VAL A HG12 1  
ATOM 1884   H HG13 . VAL A 1 116 ? -48.546 17.603  10.381  1.00 2.78  ? 116 VAL A HG13 1  
ATOM 1885   H HG21 . VAL A 1 116 ? -50.573 17.076  12.595  1.00 2.90  ? 116 VAL A HG21 1  
ATOM 1886   H HG22 . VAL A 1 116 ? -48.840 16.801  12.782  1.00 2.90  ? 116 VAL A HG22 1  
ATOM 1887   H HG23 . VAL A 1 116 ? -49.980 15.496  13.108  1.00 2.91  ? 116 VAL A HG23 1  
ATOM 1888   N N    . THR A 1 117 ? -50.413 12.778  10.517  1.00 2.25  ? 117 THR A N    1  
ATOM 1889   C CA   . THR A 1 117 ? -50.304 11.418  11.010  1.00 2.25  ? 117 THR A CA   1  
ATOM 1890   C C    . THR A 1 117 ? -48.853 11.102  11.366  1.00 2.30  ? 117 THR A C    1  
ATOM 1891   O O    . THR A 1 117 ? -48.100 10.570  10.549  1.00 2.17  ? 117 THR A O    1  
ATOM 1892   C CB   . THR A 1 117 ? -50.811 10.398  9.970   1.00 2.10  ? 117 THR A CB   1  
ATOM 1893   O OG1  . THR A 1 117 ? -51.834 10.994  9.157   1.00 2.08  ? 117 THR A OG1  1  
ATOM 1894   C CG2  . THR A 1 117 ? -51.358 9.154   10.659  1.00 2.22  ? 117 THR A CG2  1  
ATOM 1895   H H    . THR A 1 117 ? -50.104 12.987  9.605   1.00 2.19  ? 117 THR A H    1  
ATOM 1896   H HA   . THR A 1 117 ? -50.912 11.335  11.899  1.00 2.39  ? 117 THR A HA   1  
ATOM 1897   H HB   . THR A 1 117 ? -49.983 10.107  9.340   1.00 1.99  ? 117 THR A HB   1  
ATOM 1898   H HG1  . THR A 1 117 ? -52.659 11.027  9.651   1.00 2.24  ? 117 THR A HG1  1  
ATOM 1899   H HG21 . THR A 1 117 ? -52.185 9.428   11.295  1.00 2.36  ? 117 THR A HG21 1  
ATOM 1900   H HG22 . THR A 1 117 ? -50.580 8.698   11.255  1.00 2.31  ? 117 THR A HG22 1  
ATOM 1901   H HG23 . THR A 1 117 ? -51.698 8.450   9.913   1.00 2.17  ? 117 THR A HG23 1  
ATOM 1902   N N    . GLU A 1 118 ? -48.456 11.465  12.577  1.00 2.50  ? 118 GLU A N    1  
ATOM 1903   C CA   . GLU A 1 118 ? -47.096 11.218  13.042  1.00 2.61  ? 118 GLU A CA   1  
ATOM 1904   C C    . GLU A 1 118 ? -47.082 10.031  13.992  1.00 2.74  ? 118 GLU A C    1  
ATOM 1905   O O    . GLU A 1 118 ? -47.819 10.017  14.977  1.00 2.89  ? 118 GLU A O    1  
ATOM 1906   C CB   . GLU A 1 118 ? -46.535 12.461  13.738  1.00 2.82  ? 118 GLU A CB   1  
ATOM 1907   C CG   . GLU A 1 118 ? -46.828 13.757  13.001  1.00 2.78  ? 118 GLU A CG   1  
ATOM 1908   C CD   . GLU A 1 118 ? -45.932 14.893  13.449  1.00 3.08  ? 118 GLU A CD   1  
ATOM 1909   O OE1  . GLU A 1 118 ? -46.203 15.493  14.507  1.00 3.39  ? 118 GLU A OE1  1  
ATOM 1910   O OE2  . GLU A 1 118 ? -44.950 15.193  12.743  1.00 3.25  ? 118 GLU A OE2  1  
ATOM 1911   H H    . GLU A 1 118 ? -49.091 11.913  13.176  1.00 2.60  ? 118 GLU A H    1  
ATOM 1912   H HA   . GLU A 1 118 ? -46.486 10.987  12.183  1.00 2.49  ? 118 GLU A HA   1  
ATOM 1913   H HB2  . GLU A 1 118 ? -46.963 12.531  14.729  1.00 2.99  ? 118 GLU A HB2  1  
ATOM 1914   H HB3  . GLU A 1 118 ? -45.464 12.357  13.826  1.00 2.89  ? 118 GLU A HB3  1  
ATOM 1915   H HG2  . GLU A 1 118 ? -46.678 13.596  11.943  1.00 2.68  ? 118 GLU A HG2  1  
ATOM 1916   H HG3  . GLU A 1 118 ? -47.857 14.036  13.179  1.00 2.72  ? 118 GLU A HG3  1  
ATOM 1917   N N    . GLU A 1 119 ? -46.256 9.034   13.694  1.00 2.70  ? 119 GLU A N    1  
ATOM 1918   C CA   . GLU A 1 119 ? -46.175 7.848   14.531  1.00 2.86  ? 119 GLU A CA   1  
ATOM 1919   C C    . GLU A 1 119 ? -44.907 7.054   14.243  1.00 2.87  ? 119 GLU A C    1  
ATOM 1920   O O    . GLU A 1 119 ? -44.090 7.449   13.407  1.00 2.72  ? 119 GLU A O    1  
ATOM 1921   C CB   . GLU A 1 119 ? -47.403 6.964   14.313  1.00 2.82  ? 119 GLU A CB   1  
ATOM 1922   C CG   . GLU A 1 119 ? -47.673 6.640   12.853  1.00 2.58  ? 119 GLU A CG   1  
ATOM 1923   C CD   . GLU A 1 119 ? -48.830 5.683   12.679  1.00 2.64  ? 119 GLU A CD   1  
ATOM 1924   O OE1  . GLU A 1 119 ? -49.751 5.704   13.520  1.00 2.77  ? 119 GLU A OE1  1  
ATOM 1925   O OE2  . GLU A 1 119 ? -48.823 4.902   11.709  1.00 2.64  ? 119 GLU A OE2  1  
ATOM 1926   H H    . GLU A 1 119 ? -45.683 9.100   12.896  1.00 2.59  ? 119 GLU A H    1  
ATOM 1927   H HA   . GLU A 1 119 ? -46.156 8.171   15.560  1.00 3.05  ? 119 GLU A HA   1  
ATOM 1928   H HB2  . GLU A 1 119 ? -47.263 6.037   14.847  1.00 2.95  ? 119 GLU A HB2  1  
ATOM 1929   H HB3  . GLU A 1 119 ? -48.269 7.470   14.713  1.00 2.87  ? 119 GLU A HB3  1  
ATOM 1930   H HG2  . GLU A 1 119 ? -47.899 7.557   12.329  1.00 2.49  ? 119 GLU A HG2  1  
ATOM 1931   H HG3  . GLU A 1 119 ? -46.786 6.192   12.427  1.00 2.52  ? 119 GLU A HG3  1  
ATOM 1932   N N    . TRP A 1 120 ? -44.757 5.932   14.936  1.00 3.07  ? 120 TRP A N    1  
ATOM 1933   C CA   . TRP A 1 120 ? -43.597 5.068   14.778  1.00 3.13  ? 120 TRP A CA   1  
ATOM 1934   C C    . TRP A 1 120 ? -44.052 3.668   14.394  1.00 3.10  ? 120 TRP A C    1  
ATOM 1935   O O    . TRP A 1 120 ? -44.033 2.744   15.211  1.00 3.33  ? 120 TRP A O    1  
ATOM 1936   C CB   . TRP A 1 120 ? -42.772 5.020   16.070  1.00 3.44  ? 120 TRP A CB   1  
ATOM 1937   C CG   . TRP A 1 120 ? -43.283 5.920   17.159  1.00 3.59  ? 120 TRP A CG   1  
ATOM 1938   C CD1  . TRP A 1 120 ? -44.058 5.557   18.223  1.00 3.82  ? 120 TRP A CD1  1  
ATOM 1939   C CD2  . TRP A 1 120 ? -43.059 7.329   17.291  1.00 3.61  ? 120 TRP A CD2  1  
ATOM 1940   N NE1  . TRP A 1 120 ? -44.334 6.652   19.002  1.00 3.96  ? 120 TRP A NE1  1  
ATOM 1941   C CE2  . TRP A 1 120 ? -43.733 7.753   18.452  1.00 3.84  ? 120 TRP A CE2  1  
ATOM 1942   C CE3  . TRP A 1 120 ? -42.359 8.274   16.537  1.00 3.51  ? 120 TRP A CE3  1  
ATOM 1943   C CZ2  . TRP A 1 120 ? -43.721 9.080   18.879  1.00 3.98  ? 120 TRP A CZ2  1  
ATOM 1944   C CZ3  . TRP A 1 120 ? -42.348 9.589   16.960  1.00 3.67  ? 120 TRP A CZ3  1  
ATOM 1945   C CH2  . TRP A 1 120 ? -43.026 9.982   18.120  1.00 3.90  ? 120 TRP A CH2  1  
ATOM 1946   H H    . TRP A 1 120 ? -45.460 5.665   15.569  1.00 3.20  ? 120 TRP A H    1  
ATOM 1947   H HA   . TRP A 1 120 ? -42.991 5.471   13.982  1.00 3.00  ? 120 TRP A HA   1  
ATOM 1948   H HB2  . TRP A 1 120 ? -42.777 4.008   16.449  1.00 3.60  ? 120 TRP A HB2  1  
ATOM 1949   H HB3  . TRP A 1 120 ? -41.754 5.308   15.847  1.00 3.47  ? 120 TRP A HB3  1  
ATOM 1950   H HD1  . TRP A 1 120 ? -44.399 4.550   18.410  1.00 3.93  ? 120 TRP A HD1  1  
ATOM 1951   H HE1  . TRP A 1 120 ? -44.874 6.646   19.823  1.00 4.15  ? 120 TRP A HE1  1  
ATOM 1952   H HE3  . TRP A 1 120 ? -41.832 7.990   15.640  1.00 3.36  ? 120 TRP A HE3  1  
ATOM 1953   H HZ2  . TRP A 1 120 ? -44.239 9.397   19.773  1.00 4.20  ? 120 TRP A HZ2  1  
ATOM 1954   H HZ3  . TRP A 1 120 ? -41.811 10.333  16.389  1.00 3.66  ? 120 TRP A HZ3  1  
ATOM 1955   H HH2  . TRP A 1 120 ? -42.992 11.024  18.413  1.00 4.06  ? 120 TRP A HH2  1  
ATOM 1956   N N    . ARG A 1 121 ? -44.462 3.529   13.145  1.00 2.87  ? 121 ARG A N    1  
ATOM 1957   C CA   . ARG A 1 121 ? -44.960 2.267   12.614  1.00 2.87  ? 121 ARG A CA   1  
ATOM 1958   C C    . ARG A 1 121 ? -43.904 1.171   12.669  1.00 3.01  ? 121 ARG A C    1  
ATOM 1959   O O    . ARG A 1 121 ? -42.738 1.397   12.339  1.00 2.97  ? 121 ARG A O    1  
ATOM 1960   C CB   . ARG A 1 121 ? -45.421 2.469   11.168  1.00 2.61  ? 121 ARG A CB   1  
ATOM 1961   C CG   . ARG A 1 121 ? -45.972 1.218   10.500  1.00 2.67  ? 121 ARG A CG   1  
ATOM 1962   C CD   . ARG A 1 121 ? -47.245 0.734   11.171  1.00 2.89  ? 121 ARG A CD   1  
ATOM 1963   N NE   . ARG A 1 121 ? -48.192 1.824   11.407  1.00 2.86  ? 121 ARG A NE   1  
ATOM 1964   C CZ   . ARG A 1 121 ? -49.444 1.644   11.816  1.00 3.05  ? 121 ARG A CZ   1  
ATOM 1965   N NH1  . ARG A 1 121 ? -49.922 0.418   11.988  1.00 3.31  ? 121 ARG A NH1  1  
ATOM 1966   N NH2  . ARG A 1 121 ? -50.212 2.693   12.052  1.00 3.04  ? 121 ARG A NH2  1  
ATOM 1967   H H    . ARG A 1 121 ? -44.407 4.303   12.546  1.00 2.73  ? 121 ARG A H    1  
ATOM 1968   H HA   . ARG A 1 121 ? -45.807 1.966   13.210  1.00 2.99  ? 121 ARG A HA   1  
ATOM 1969   H HB2  . ARG A 1 121 ? -46.194 3.222   11.157  1.00 2.53  ? 121 ARG A HB2  1  
ATOM 1970   H HB3  . ARG A 1 121 ? -44.582 2.823   10.586  1.00 2.50  ? 121 ARG A HB3  1  
ATOM 1971   H HG2  . ARG A 1 121 ? -46.187 1.443   9.466   1.00 2.52  ? 121 ARG A HG2  1  
ATOM 1972   H HG3  . ARG A 1 121 ? -45.227 0.437   10.551  1.00 2.74  ? 121 ARG A HG3  1  
ATOM 1973   H HD2  . ARG A 1 121 ? -47.712 -0.007  10.537  1.00 2.93  ? 121 ARG A HD2  1  
ATOM 1974   H HD3  . ARG A 1 121 ? -46.988 0.281   12.119  1.00 3.09  ? 121 ARG A HD3  1  
ATOM 1975   H HE   . ARG A 1 121 ? -47.870 2.745   11.266  1.00 2.72  ? 121 ARG A HE   1  
ATOM 1976   H HH11 . ARG A 1 121 ? -49.341 -0.381  11.810  1.00 3.34  ? 121 ARG A HH11 1  
ATOM 1977   H HH12 . ARG A 1 121 ? -50.865 0.284   12.298  1.00 3.50  ? 121 ARG A HH12 1  
ATOM 1978   H HH21 . ARG A 1 121 ? -49.845 3.629   11.922  1.00 2.88  ? 121 ARG A HH21 1  
ATOM 1979   H HH22 . ARG A 1 121 ? -51.157 2.568   12.362  1.00 3.23  ? 121 ARG A HH22 1  
ATOM 1980   N N    . ASP A 1 122 ? -44.314 -0.011  13.105  1.00 3.22  ? 122 ASP A N    1  
ATOM 1981   C CA   . ASP A 1 122 ? -43.409 -1.144  13.166  1.00 3.40  ? 122 ASP A CA   1  
ATOM 1982   C C    . ASP A 1 122 ? -43.267 -1.730  11.768  1.00 3.24  ? 122 ASP A C    1  
ATOM 1983   O O    . ASP A 1 122 ? -44.218 -1.722  10.981  1.00 3.12  ? 122 ASP A O    1  
ATOM 1984   C CB   . ASP A 1 122 ? -43.901 -2.204  14.166  1.00 3.70  ? 122 ASP A CB   1  
ATOM 1985   C CG   . ASP A 1 122 ? -44.957 -3.135  13.601  1.00 3.70  ? 122 ASP A CG   1  
ATOM 1986   O OD1  . ASP A 1 122 ? -46.136 -2.724  13.502  1.00 3.60  ? 122 ASP A OD1  1  
ATOM 1987   O OD2  . ASP A 1 122 ? -44.623 -4.297  13.283  1.00 3.88  ? 122 ASP A OD2  1  
ATOM 1988   H H    . ASP A 1 122 ? -45.246 -0.126  13.387  1.00 3.28  ? 122 ASP A H    1  
ATOM 1989   H HA   . ASP A 1 122 ? -42.443 -0.778  13.486  1.00 3.45  ? 122 ASP A HA   1  
ATOM 1990   H HB2  . ASP A 1 122 ? -43.062 -2.803  14.482  1.00 3.85  ? 122 ASP A HB2  1  
ATOM 1991   H HB3  . ASP A 1 122 ? -44.318 -1.703  15.030  1.00 3.81  ? 122 ASP A HB3  1  
ATOM 1992   N N    . LEU A 1 123 ? -42.080 -2.199  11.448  1.00 3.27  ? 123 LEU A N    1  
ATOM 1993   C CA   . LEU A 1 123 ? -41.824 -2.758  10.135  1.00 3.14  ? 123 LEU A CA   1  
ATOM 1994   C C    . LEU A 1 123 ? -41.779 -4.279  10.189  1.00 3.37  ? 123 LEU A C    1  
ATOM 1995   O O    . LEU A 1 123 ? -41.359 -4.863  11.191  1.00 3.61  ? 123 LEU A O    1  
ATOM 1996   C CB   . LEU A 1 123 ? -40.512 -2.205  9.587   1.00 3.01  ? 123 LEU A CB   1  
ATOM 1997   C CG   . LEU A 1 123 ? -40.414 -0.679  9.531   1.00 2.78  ? 123 LEU A CG   1  
ATOM 1998   C CD1  . LEU A 1 123 ? -38.969 -0.247  9.339   1.00 2.73  ? 123 LEU A CD1  1  
ATOM 1999   C CD2  . LEU A 1 123 ? -41.279 -0.131  8.408   1.00 2.53  ? 123 LEU A CD2  1  
ATOM 2000   H H    . LEU A 1 123 ? -41.355 -2.175  12.111  1.00 3.39  ? 123 LEU A H    1  
ATOM 2001   H HA   . LEU A 1 123 ? -42.629 -2.456  9.484   1.00 2.99  ? 123 LEU A HA   1  
ATOM 2002   H HB2  . LEU A 1 123 ? -39.705 -2.572  10.205  1.00 3.19  ? 123 LEU A HB2  1  
ATOM 2003   H HB3  . LEU A 1 123 ? -40.379 -2.587  8.588   1.00 2.94  ? 123 LEU A HB3  1  
ATOM 2004   H HG   . LEU A 1 123 ? -40.769 -0.267  10.462  1.00 2.86  ? 123 LEU A HG   1  
ATOM 2005   H HD11 . LEU A 1 123 ? -38.853 0.776   9.660   1.00 2.79  ? 123 LEU A HD11 1  
ATOM 2006   H HD12 . LEU A 1 123 ? -38.707 -0.327  8.293   1.00 2.92  ? 123 LEU A HD12 1  
ATOM 2007   H HD13 . LEU A 1 123 ? -38.322 -0.884  9.921   1.00 2.88  ? 123 LEU A HD13 1  
ATOM 2008   H HD21 . LEU A 1 123 ? -40.944 -0.535  7.465   1.00 2.46  ? 123 LEU A HD21 1  
ATOM 2009   H HD22 . LEU A 1 123 ? -41.198 0.947   8.384   1.00 2.44  ? 123 LEU A HD22 1  
ATOM 2010   H HD23 . LEU A 1 123 ? -42.310 -0.410  8.577   1.00 2.62  ? 123 LEU A HD23 1  
ATOM 2011   N N    . GLN A 1 124 ? -42.207 -4.917  9.107   1.00 3.32  ? 124 GLN A N    1  
ATOM 2012   C CA   . GLN A 1 124 ? -42.221 -6.370  9.031   1.00 3.56  ? 124 GLN A CA   1  
ATOM 2013   C C    . GLN A 1 124 ? -41.481 -6.849  7.787   1.00 3.50  ? 124 GLN A C    1  
ATOM 2014   O O    . GLN A 1 124 ? -41.552 -6.224  6.727   1.00 3.26  ? 124 GLN A O    1  
ATOM 2015   C CB   . GLN A 1 124 ? -43.661 -6.892  9.030   1.00 3.67  ? 124 GLN A CB   1  
ATOM 2016   C CG   . GLN A 1 124 ? -44.555 -6.242  7.986   1.00 3.94  ? 124 GLN A CG   1  
ATOM 2017   C CD   . GLN A 1 124 ? -46.003 -6.673  8.114   1.00 4.12  ? 124 GLN A CD   1  
ATOM 2018   O OE1  . GLN A 1 124 ? -46.297 -7.775  8.581   1.00 4.20  ? 124 GLN A OE1  1  
ATOM 2019   N NE2  . GLN A 1 124 ? -46.918 -5.812  7.700   1.00 4.37  ? 124 GLN A NE2  1  
ATOM 2020   H H    . GLN A 1 124 ? -42.521 -4.395  8.335   1.00 3.14  ? 124 GLN A H    1  
ATOM 2021   H HA   . GLN A 1 124 ? -41.712 -6.750  9.905   1.00 3.74  ? 124 GLN A HA   1  
ATOM 2022   H HB2  . GLN A 1 124 ? -43.645 -7.956  8.845   1.00 3.72  ? 124 GLN A HB2  1  
ATOM 2023   H HB3  . GLN A 1 124 ? -44.096 -6.715  10.002  1.00 3.76  ? 124 GLN A HB3  1  
ATOM 2024   H HG2  . GLN A 1 124 ? -44.503 -5.171  8.102   1.00 4.10  ? 124 GLN A HG2  1  
ATOM 2025   H HG3  . GLN A 1 124 ? -44.198 -6.517  7.005   1.00 4.11  ? 124 GLN A HG3  1  
ATOM 2026   H HE21 . GLN A 1 124 ? -46.617 -4.954  7.337   1.00 4.46  ? 124 GLN A HE21 1  
ATOM 2027   H HE22 . GLN A 1 124 ? -47.861 -6.073  7.768   1.00 4.55  ? 124 GLN A HE22 1  
ATOM 2028   N N    . SER A 1 125 ? -40.762 -7.951  7.922   1.00 3.72  ? 125 SER A N    1  
ATOM 2029   C CA   . SER A 1 125 ? -40.010 -8.512  6.813   1.00 3.70  ? 125 SER A CA   1  
ATOM 2030   C C    . SER A 1 125 ? -40.908 -9.341  5.903   1.00 3.80  ? 125 SER A C    1  
ATOM 2031   O O    . SER A 1 125 ? -40.885 -10.571 5.939   1.00 4.15  ? 125 SER A O    1  
ATOM 2032   C CB   . SER A 1 125 ? -38.868 -9.368  7.346   1.00 3.95  ? 125 SER A CB   1  
ATOM 2033   O OG   . SER A 1 125 ? -38.934 -9.465  8.757   1.00 4.07  ? 125 SER A OG   1  
ATOM 2034   H H    . SER A 1 125 ? -40.723 -8.397  8.794   1.00 3.91  ? 125 SER A H    1  
ATOM 2035   H HA   . SER A 1 125 ? -39.599 -7.695  6.244   1.00 3.45  ? 125 SER A HA   1  
ATOM 2036   H HB2  . SER A 1 125 ? -38.939 -10.358 6.924   1.00 4.12  ? 125 SER A HB2  1  
ATOM 2037   H HB3  . SER A 1 125 ? -37.926 -8.922  7.070   1.00 3.89  ? 125 SER A HB3  1  
ATOM 2038   H HG   . SER A 1 125 ? -38.197 -8.972  9.144   1.00 4.05  ? 125 SER A HG   1  
ATOM 2039   N N    . ALA A 1 126 ? -41.720 -8.667  5.106   1.00 3.59  ? 126 ALA A N    1  
ATOM 2040   C CA   . ALA A 1 126 ? -42.605 -9.350  4.182   1.00 3.71  ? 126 ALA A CA   1  
ATOM 2041   C C    . ALA A 1 126 ? -41.857 -9.666  2.893   1.00 3.68  ? 126 ALA A C    1  
ATOM 2042   O O    . ALA A 1 126 ? -41.983 -8.954  1.893   1.00 3.47  ? 126 ALA A O    1  
ATOM 2043   C CB   . ALA A 1 126 ? -43.849 -8.515  3.910   1.00 3.58  ? 126 ALA A CB   1  
ATOM 2044   H H    . ALA A 1 126 ? -41.724 -7.687  5.143   1.00 3.43  ? 126 ALA A H    1  
ATOM 2045   H HA   . ALA A 1 126 ? -42.912 -10.277 4.644   1.00 3.97  ? 126 ALA A HA   1  
ATOM 2046   H HB1  . ALA A 1 126 ? -44.441 -8.988  3.142   1.00 3.71  ? 126 ALA A HB1  1  
ATOM 2047   H HB2  . ALA A 1 126 ? -43.558 -7.529  3.582   1.00 3.45  ? 126 ALA A HB2  1  
ATOM 2048   H HB3  . ALA A 1 126 ? -44.433 -8.434  4.817   1.00 3.63  ? 126 ALA A HB3  1  
ATOM 2049   N N    . GLU A 1 127 ? -41.059 -10.728 2.945   1.00 3.94  ? 127 GLU A N    1  
ATOM 2050   C CA   . GLU A 1 127 ? -40.260 -11.168 1.806   1.00 3.96  ? 127 GLU A CA   1  
ATOM 2051   C C    . GLU A 1 127 ? -41.132 -11.426 0.583   1.00 3.97  ? 127 GLU A C    1  
ATOM 2052   O O    . GLU A 1 127 ? -42.331 -11.699 0.705   1.00 4.18  ? 127 GLU A O    1  
ATOM 2053   C CB   . GLU A 1 127 ? -39.495 -12.442 2.160   1.00 4.29  ? 127 GLU A CB   1  
ATOM 2054   C CG   . GLU A 1 127 ? -38.809 -12.404 3.517   1.00 4.27  ? 127 GLU A CG   1  
ATOM 2055   C CD   . GLU A 1 127 ? -38.384 -13.783 3.976   1.00 4.59  ? 127 GLU A CD   1  
ATOM 2056   O OE1  . GLU A 1 127 ? -38.718 -14.775 3.290   1.00 4.85  ? 127 GLU A OE1  1  
ATOM 2057   O OE2  . GLU A 1 127 ? -37.710 -13.886 5.021   1.00 4.86  ? 127 GLU A OE2  1  
ATOM 2058   H H    . GLU A 1 127 ? -41.004 -11.235 3.782   1.00 4.14  ? 127 GLU A H    1  
ATOM 2059   H HA   . GLU A 1 127 ? -39.552 -10.387 1.573   1.00 3.77  ? 127 GLU A HA   1  
ATOM 2060   H HB2  . GLU A 1 127 ? -40.185 -13.270 2.157   1.00 4.55  ? 127 GLU A HB2  1  
ATOM 2061   H HB3  . GLU A 1 127 ? -38.740 -12.612 1.407   1.00 4.34  ? 127 GLU A HB3  1  
ATOM 2062   H HG2  . GLU A 1 127 ? -37.933 -11.774 3.449   1.00 4.16  ? 127 GLU A HG2  1  
ATOM 2063   H HG3  . GLU A 1 127 ? -39.494 -11.992 4.244   1.00 4.24  ? 127 GLU A HG3  1  
ATOM 2064   N N    . LYS A 1 128 ? -40.532 -11.343 -0.593  1.00 3.79  ? 128 LYS A N    1  
ATOM 2065   C CA   . LYS A 1 128 ? -41.257 -11.566 -1.831  1.00 3.83  ? 128 LYS A CA   1  
ATOM 2066   C C    . LYS A 1 128 ? -40.721 -12.793 -2.547  1.00 3.99  ? 128 LYS A C    1  
ATOM 2067   O O    . LYS A 1 128 ? -41.539 -13.633 -2.973  1.00 4.21  ? 128 LYS A O    1  
ATOM 2068   C CB   . LYS A 1 128 ? -41.167 -10.336 -2.738  1.00 3.56  ? 128 LYS A CB   1  
ATOM 2069   C CG   . LYS A 1 128 ? -41.903 -9.124  -2.188  1.00 3.44  ? 128 LYS A CG   1  
ATOM 2070   C CD   . LYS A 1 128 ? -43.410 -9.307  -2.261  1.00 3.68  ? 128 LYS A CD   1  
ATOM 2071   C CE   . LYS A 1 128 ? -44.143 -8.258  -1.443  1.00 3.64  ? 128 LYS A CE   1  
ATOM 2072   N NZ   . LYS A 1 128 ? -44.074 -8.539  0.017   1.00 3.49  ? 128 LYS A NZ   1  
ATOM 2073   O OXT  . LYS A 1 128 ? -39.487 -12.926 -2.658  1.00 4.14  ? 128 LYS A OXT  1  
ATOM 2074   H H    . LYS A 1 128 ? -39.572 -11.139 -0.632  1.00 3.65  ? 128 LYS A H    1  
ATOM 2075   H HA   . LYS A 1 128 ? -42.290 -11.740 -1.580  1.00 3.99  ? 128 LYS A HA   1  
ATOM 2076   H HB2  . LYS A 1 128 ? -40.129 -10.073 -2.868  1.00 3.41  ? 128 LYS A HB2  1  
ATOM 2077   H HB3  . LYS A 1 128 ? -41.592 -10.581 -3.702  1.00 3.65  ? 128 LYS A HB3  1  
ATOM 2078   H HG2  . LYS A 1 128 ? -41.618 -8.978  -1.156  1.00 3.42  ? 128 LYS A HG2  1  
ATOM 2079   H HG3  . LYS A 1 128 ? -41.627 -8.254  -2.766  1.00 3.27  ? 128 LYS A HG3  1  
ATOM 2080   H HD2  . LYS A 1 128 ? -43.722 -9.225  -3.293  1.00 3.77  ? 128 LYS A HD2  1  
ATOM 2081   H HD3  . LYS A 1 128 ? -43.663 -10.287 -1.886  1.00 3.90  ? 128 LYS A HD3  1  
ATOM 2082   H HE2  . LYS A 1 128 ? -43.694 -7.294  -1.637  1.00 3.88  ? 128 LYS A HE2  1  
ATOM 2083   H HE3  . LYS A 1 128 ? -45.178 -8.240  -1.751  1.00 3.66  ? 128 LYS A HE3  1  
ATOM 2084   H HZ1  . LYS A 1 128 ? -44.459 -7.724  0.556   1.00 3.51  ? 128 LYS A HZ1  1  
ATOM 2085   H HZ2  . LYS A 1 128 ? -43.088 -8.696  0.311   1.00 3.62  ? 128 LYS A HZ2  1  
ATOM 2086   H HZ3  . LYS A 1 128 ? -44.632 -9.384  0.246   1.00 3.66  ? 128 LYS A HZ3  1  
ATOM 2087   N N    . MET B 2 1   ? 18.902  -26.604 -16.165 1.00 3.30  ? 1   MET B N    1  
ATOM 2088   C CA   . MET B 2 1   ? 18.174  -26.698 -17.449 1.00 3.22  ? 1   MET B CA   1  
ATOM 2089   C C    . MET B 2 1   ? 17.324  -25.451 -17.652 1.00 3.14  ? 1   MET B C    1  
ATOM 2090   O O    . MET B 2 1   ? 17.286  -24.575 -16.787 1.00 3.33  ? 1   MET B O    1  
ATOM 2091   C CB   . MET B 2 1   ? 17.292  -27.954 -17.481 1.00 3.32  ? 1   MET B CB   1  
ATOM 2092   C CG   . MET B 2 1   ? 18.061  -29.237 -17.760 1.00 3.56  ? 1   MET B CG   1  
ATOM 2093   S SD   . MET B 2 1   ? 16.988  -30.677 -17.907 1.00 3.77  ? 1   MET B SD   1  
ATOM 2094   C CE   . MET B 2 1   ? 18.202  -31.965 -18.175 1.00 4.08  ? 1   MET B CE   1  
ATOM 2095   H H1   . MET B 2 1   ? 19.555  -27.403 -16.057 1.00 3.42  ? 1   MET B H1   1  
ATOM 2096   H H2   . MET B 2 1   ? 18.231  -26.607 -15.371 1.00 3.41  ? 1   MET B H2   1  
ATOM 2097   H H3   . MET B 2 1   ? 19.446  -25.718 -16.130 1.00 3.36  ? 1   MET B H3   1  
ATOM 2098   H HA   . MET B 2 1   ? 18.900  -26.754 -18.248 1.00 3.27  ? 1   MET B HA   1  
ATOM 2099   H HB2  . MET B 2 1   ? 16.798  -28.058 -16.527 1.00 3.41  ? 1   MET B HB2  1  
ATOM 2100   H HB3  . MET B 2 1   ? 16.544  -27.835 -18.249 1.00 3.32  ? 1   MET B HB3  1  
ATOM 2101   H HG2  . MET B 2 1   ? 18.607  -29.121 -18.684 1.00 3.65  ? 1   MET B HG2  1  
ATOM 2102   H HG3  . MET B 2 1   ? 18.758  -29.404 -16.952 1.00 3.79  ? 1   MET B HG3  1  
ATOM 2103   H HE1  . MET B 2 1   ? 17.700  -32.915 -18.290 1.00 4.39  ? 1   MET B HE1  1  
ATOM 2104   H HE2  . MET B 2 1   ? 18.870  -32.013 -17.328 1.00 4.33  ? 1   MET B HE2  1  
ATOM 2105   H HE3  . MET B 2 1   ? 18.767  -31.746 -19.069 1.00 4.13  ? 1   MET B HE3  1  
ATOM 2106   N N    . ALA B 2 2   ? 16.654  -25.368 -18.796 1.00 3.03  ? 2   ALA B N    1  
ATOM 2107   C CA   . ALA B 2 2   ? 15.810  -24.227 -19.106 1.00 2.97  ? 2   ALA B CA   1  
ATOM 2108   C C    . ALA B 2 2   ? 14.574  -24.201 -18.218 1.00 2.90  ? 2   ALA B C    1  
ATOM 2109   O O    . ALA B 2 2   ? 14.218  -25.216 -17.609 1.00 2.91  ? 2   ALA B O    1  
ATOM 2110   C CB   . ALA B 2 2   ? 15.408  -24.246 -20.573 1.00 3.02  ? 2   ALA B CB   1  
ATOM 2111   H H    . ALA B 2 2   ? 16.728  -26.098 -19.449 1.00 3.09  ? 2   ALA B H    1  
ATOM 2112   H HA   . ALA B 2 2   ? 16.387  -23.331 -18.928 1.00 2.98  ? 2   ALA B HA   1  
ATOM 2113   H HB1  . ALA B 2 2   ? 14.836  -25.140 -20.777 1.00 3.10  ? 2   ALA B HB1  1  
ATOM 2114   H HB2  . ALA B 2 2   ? 16.293  -24.238 -21.188 1.00 3.09  ? 2   ALA B HB2  1  
ATOM 2115   H HB3  . ALA B 2 2   ? 14.807  -23.376 -20.794 1.00 3.02  ? 2   ALA B HB3  1  
ATOM 2116   N N    . ALA B 2 3   ? 13.940  -23.032 -18.145 1.00 2.86  ? 3   ALA B N    1  
ATOM 2117   C CA   . ALA B 2 3   ? 12.742  -22.831 -17.340 1.00 2.81  ? 3   ALA B CA   1  
ATOM 2118   C C    . ALA B 2 3   ? 13.047  -23.026 -15.858 1.00 2.77  ? 3   ALA B C    1  
ATOM 2119   O O    . ALA B 2 3   ? 12.325  -23.724 -15.143 1.00 2.77  ? 3   ALA B O    1  
ATOM 2120   C CB   . ALA B 2 3   ? 11.615  -23.752 -17.794 1.00 2.88  ? 3   ALA B CB   1  
ATOM 2121   H H    . ALA B 2 3   ? 14.300  -22.273 -18.647 1.00 2.88  ? 3   ALA B H    1  
ATOM 2122   H HA   . ALA B 2 3   ? 12.417  -21.811 -17.490 1.00 2.80  ? 3   ALA B HA   1  
ATOM 2123   H HB1  . ALA B 2 3   ? 11.890  -24.779 -17.603 1.00 2.90  ? 3   ALA B HB1  1  
ATOM 2124   H HB2  . ALA B 2 3   ? 11.443  -23.616 -18.852 1.00 2.90  ? 3   ALA B HB2  1  
ATOM 2125   H HB3  . ALA B 2 3   ? 10.713  -23.514 -17.248 1.00 2.93  ? 3   ALA B HB3  1  
ATOM 2126   N N    . GLU B 2 4   ? 14.133  -22.418 -15.407 1.00 2.78  ? 4   GLU B N    1  
ATOM 2127   C CA   . GLU B 2 4   ? 14.538  -22.512 -14.015 1.00 2.77  ? 4   GLU B CA   1  
ATOM 2128   C C    . GLU B 2 4   ? 13.696  -21.566 -13.156 1.00 2.65  ? 4   GLU B C    1  
ATOM 2129   O O    . GLU B 2 4   ? 13.357  -20.463 -13.590 1.00 2.60  ? 4   GLU B O    1  
ATOM 2130   C CB   . GLU B 2 4   ? 16.030  -22.183 -13.869 1.00 2.85  ? 4   GLU B CB   1  
ATOM 2131   C CG   . GLU B 2 4   ? 16.415  -20.821 -14.430 1.00 2.86  ? 4   GLU B CG   1  
ATOM 2132   C CD   . GLU B 2 4   ? 16.969  -20.888 -15.840 1.00 3.00  ? 4   GLU B CD   1  
ATOM 2133   O OE1  . GLU B 2 4   ? 16.194  -21.139 -16.789 1.00 2.95  ? 4   GLU B OE1  1  
ATOM 2134   O OE2  . GLU B 2 4   ? 18.184  -20.663 -16.005 1.00 3.24  ? 4   GLU B OE2  1  
ATOM 2135   H H    . GLU B 2 4   ? 14.682  -21.886 -16.029 1.00 2.81  ? 4   GLU B H    1  
ATOM 2136   H HA   . GLU B 2 4   ? 14.365  -23.527 -13.689 1.00 2.81  ? 4   GLU B HA   1  
ATOM 2137   H HB2  . GLU B 2 4   ? 16.291  -22.201 -12.820 1.00 2.85  ? 4   GLU B HB2  1  
ATOM 2138   H HB3  . GLU B 2 4   ? 16.607  -22.937 -14.385 1.00 2.96  ? 4   GLU B HB3  1  
ATOM 2139   H HG2  . GLU B 2 4   ? 15.541  -20.188 -14.437 1.00 2.77  ? 4   GLU B HG2  1  
ATOM 2140   H HG3  . GLU B 2 4   ? 17.166  -20.384 -13.788 1.00 2.90  ? 4   GLU B HG3  1  
ATOM 2141   N N    . PRO B 2 5   ? 13.326  -21.997 -11.939 1.00 2.63  ? 5   PRO B N    1  
ATOM 2142   C CA   . PRO B 2 5   ? 12.517  -21.183 -11.029 1.00 2.53  ? 5   PRO B CA   1  
ATOM 2143   C C    . PRO B 2 5   ? 13.303  -20.033 -10.404 1.00 2.49  ? 5   PRO B C    1  
ATOM 2144   O O    . PRO B 2 5   ? 14.500  -20.162 -10.111 1.00 2.55  ? 5   PRO B O    1  
ATOM 2145   C CB   . PRO B 2 5   ? 12.088  -22.182 -9.952  1.00 2.56  ? 5   PRO B CB   1  
ATOM 2146   C CG   . PRO B 2 5   ? 13.167  -23.208 -9.941  1.00 2.67  ? 5   PRO B CG   1  
ATOM 2147   C CD   . PRO B 2 5   ? 13.655  -23.315 -11.362 1.00 2.72  ? 5   PRO B CD   1  
ATOM 2148   H HA   . PRO B 2 5   ? 11.644  -20.787 -11.525 1.00 2.50  ? 5   PRO B HA   1  
ATOM 2149   H HB2  . PRO B 2 5   ? 12.011  -21.678 -8.999  1.00 2.52  ? 5   PRO B HB2  1  
ATOM 2150   H HB3  . PRO B 2 5   ? 11.136  -22.614 -10.217 1.00 2.57  ? 5   PRO B HB3  1  
ATOM 2151   H HG2  . PRO B 2 5   ? 13.970  -22.889 -9.290  1.00 2.67  ? 5   PRO B HG2  1  
ATOM 2152   H HG3  . PRO B 2 5   ? 12.768  -24.154 -9.609  1.00 2.75  ? 5   PRO B HG3  1  
ATOM 2153   H HD2  . PRO B 2 5   ? 14.720  -23.492 -11.386 1.00 2.80  ? 5   PRO B HD2  1  
ATOM 2154   H HD3  . PRO B 2 5   ? 13.130  -24.102 -11.883 1.00 2.77  ? 5   PRO B HD3  1  
ATOM 2155   N N    . LEU B 2 6   ? 12.626  -18.917 -10.193 1.00 2.41  ? 6   LEU B N    1  
ATOM 2156   C CA   . LEU B 2 6   ? 13.241  -17.739 -9.603  1.00 2.37  ? 6   LEU B CA   1  
ATOM 2157   C C    . LEU B 2 6   ? 12.931  -17.679 -8.111  1.00 2.31  ? 6   LEU B C    1  
ATOM 2158   O O    . LEU B 2 6   ? 12.465  -18.661 -7.530  1.00 2.32  ? 6   LEU B O    1  
ATOM 2159   C CB   . LEU B 2 6   ? 12.731  -16.475 -10.296 1.00 2.33  ? 6   LEU B CB   1  
ATOM 2160   C CG   . LEU B 2 6   ? 13.073  -16.360 -11.783 1.00 2.40  ? 6   LEU B CG   1  
ATOM 2161   C CD1  . LEU B 2 6   ? 12.233  -15.273 -12.436 1.00 2.42  ? 6   LEU B CD1  1  
ATOM 2162   C CD2  . LEU B 2 6   ? 14.559  -16.076 -11.970 1.00 2.49  ? 6   LEU B CD2  1  
ATOM 2163   H H    . LEU B 2 6   ? 11.665  -18.885 -10.433 1.00 2.40  ? 6   LEU B H    1  
ATOM 2164   H HA   . LEU B 2 6   ? 14.309  -17.816 -9.739  1.00 2.43  ? 6   LEU B HA   1  
ATOM 2165   H HB2  . LEU B 2 6   ? 11.656  -16.442 -10.190 1.00 2.28  ? 6   LEU B HB2  1  
ATOM 2166   H HB3  . LEU B 2 6   ? 13.150  -15.619 -9.788  1.00 2.32  ? 6   LEU B HB3  1  
ATOM 2167   H HG   . LEU B 2 6   ? 12.845  -17.297 -12.273 1.00 2.46  ? 6   LEU B HG   1  
ATOM 2168   H HD11 . LEU B 2 6   ? 11.196  -15.575 -12.446 1.00 2.45  ? 6   LEU B HD11 1  
ATOM 2169   H HD12 . LEU B 2 6   ? 12.571  -15.116 -13.450 1.00 2.51  ? 6   LEU B HD12 1  
ATOM 2170   H HD13 . LEU B 2 6   ? 12.333  -14.356 -11.876 1.00 2.43  ? 6   LEU B HD13 1  
ATOM 2171   H HD21 . LEU B 2 6   ? 14.780  -16.004 -13.025 1.00 2.68  ? 6   LEU B HD21 1  
ATOM 2172   H HD22 . LEU B 2 6   ? 15.139  -16.877 -11.535 1.00 2.57  ? 6   LEU B HD22 1  
ATOM 2173   H HD23 . LEU B 2 6   ? 14.812  -15.145 -11.486 1.00 2.52  ? 6   LEU B HD23 1  
ATOM 2174   N N    . THR B 2 7   ? 13.193  -16.537 -7.489  1.00 2.26  ? 7   THR B N    1  
ATOM 2175   C CA   . THR B 2 7   ? 12.931  -16.373 -6.072  1.00 2.20  ? 7   THR B CA   1  
ATOM 2176   C C    . THR B 2 7   ? 11.423  -16.350 -5.819  1.00 2.13  ? 7   THR B C    1  
ATOM 2177   O O    . THR B 2 7   ? 10.654  -15.959 -6.699  1.00 2.10  ? 7   THR B O    1  
ATOM 2178   C CB   . THR B 2 7   ? 13.572  -15.077 -5.535  1.00 2.18  ? 7   THR B CB   1  
ATOM 2179   O OG1  . THR B 2 7   ? 14.799  -14.823 -6.228  1.00 2.48  ? 7   THR B OG1  1  
ATOM 2180   C CG2  . THR B 2 7   ? 13.845  -15.175 -4.041  1.00 2.12  ? 7   THR B CG2  1  
ATOM 2181   H H    . THR B 2 7   ? 13.560  -15.779 -7.998  1.00 2.26  ? 7   THR B H    1  
ATOM 2182   H HA   . THR B 2 7   ? 13.364  -17.214 -5.550  1.00 2.25  ? 7   THR B HA   1  
ATOM 2183   H HB   . THR B 2 7   ? 12.890  -14.257 -5.710  1.00 2.22  ? 7   THR B HB   1  
ATOM 2184   H HG1  . THR B 2 7   ? 14.608  -14.350 -7.053  1.00 2.71  ? 7   THR B HG1  1  
ATOM 2185   H HG21 . THR B 2 7   ? 14.555  -15.966 -3.856  1.00 2.33  ? 7   THR B HG21 1  
ATOM 2186   H HG22 . THR B 2 7   ? 12.923  -15.389 -3.519  1.00 2.40  ? 7   THR B HG22 1  
ATOM 2187   H HG23 . THR B 2 7   ? 14.250  -14.238 -3.687  1.00 2.35  ? 7   THR B HG23 1  
ATOM 2188   N N    . GLU B 2 8   ? 11.022  -16.779 -4.624  1.00 2.10  ? 8   GLU B N    1  
ATOM 2189   C CA   . GLU B 2 8   ? 9.615   -16.833 -4.217  1.00 2.05  ? 8   GLU B CA   1  
ATOM 2190   C C    . GLU B 2 8   ? 8.823   -15.600 -4.662  1.00 1.96  ? 8   GLU B C    1  
ATOM 2191   O O    . GLU B 2 8   ? 7.878   -15.719 -5.442  1.00 1.95  ? 8   GLU B O    1  
ATOM 2192   C CB   . GLU B 2 8   ? 9.535   -16.995 -2.697  1.00 2.03  ? 8   GLU B CB   1  
ATOM 2193   C CG   . GLU B 2 8   ? 8.131   -16.903 -2.122  1.00 2.16  ? 8   GLU B CG   1  
ATOM 2194   C CD   . GLU B 2 8   ? 8.148   -16.812 -0.612  1.00 2.21  ? 8   GLU B CD   1  
ATOM 2195   O OE1  . GLU B 2 8   ? 9.223   -16.519 -0.050  1.00 2.27  ? 8   GLU B OE1  1  
ATOM 2196   O OE2  . GLU B 2 8   ? 7.098   -17.044 0.020   1.00 2.39  ? 8   GLU B OE2  1  
ATOM 2197   H H    . GLU B 2 8   ? 11.701  -17.087 -3.990  1.00 2.14  ? 8   GLU B H    1  
ATOM 2198   H HA   . GLU B 2 8   ? 9.178   -17.704 -4.678  1.00 2.09  ? 8   GLU B HA   1  
ATOM 2199   H HB2  . GLU B 2 8   ? 9.939   -17.960 -2.431  1.00 2.23  ? 8   GLU B HB2  1  
ATOM 2200   H HB3  . GLU B 2 8   ? 10.137  -16.227 -2.236  1.00 2.07  ? 8   GLU B HB3  1  
ATOM 2201   H HG2  . GLU B 2 8   ? 7.648   -16.023 -2.518  1.00 2.29  ? 8   GLU B HG2  1  
ATOM 2202   H HG3  . GLU B 2 8   ? 7.577   -17.782 -2.411  1.00 2.41  ? 8   GLU B HG3  1  
ATOM 2203   N N    . LEU B 2 9   ? 9.231   -14.423 -4.197  1.00 1.90  ? 9   LEU B N    1  
ATOM 2204   C CA   . LEU B 2 9   ? 8.539   -13.181 -4.538  1.00 1.82  ? 9   LEU B CA   1  
ATOM 2205   C C    . LEU B 2 9   ? 8.561   -12.905 -6.042  1.00 1.86  ? 9   LEU B C    1  
ATOM 2206   O O    . LEU B 2 9   ? 7.589   -12.387 -6.592  1.00 1.82  ? 9   LEU B O    1  
ATOM 2207   C CB   . LEU B 2 9   ? 9.139   -11.999 -3.771  1.00 1.77  ? 9   LEU B CB   1  
ATOM 2208   C CG   . LEU B 2 9   ? 8.687   -11.884 -2.315  1.00 1.87  ? 9   LEU B CG   1  
ATOM 2209   C CD1  . LEU B 2 9   ? 9.767   -12.393 -1.376  1.00 1.82  ? 9   LEU B CD1  1  
ATOM 2210   C CD2  . LEU B 2 9   ? 8.320   -10.447 -1.978  1.00 2.40  ? 9   LEU B CD2  1  
ATOM 2211   H H    . LEU B 2 9   ? 10.008  -14.388 -3.605  1.00 1.93  ? 9   LEU B H    1  
ATOM 2212   H HA   . LEU B 2 9   ? 7.509   -13.299 -4.235  1.00 1.79  ? 9   LEU B HA   1  
ATOM 2213   H HB2  . LEU B 2 9   ? 10.216  -12.094 -3.789  1.00 1.75  ? 9   LEU B HB2  1  
ATOM 2214   H HB3  . LEU B 2 9   ? 8.869   -11.086 -4.283  1.00 1.78  ? 9   LEU B HB3  1  
ATOM 2215   H HG   . LEU B 2 9   ? 7.809   -12.496 -2.171  1.00 2.19  ? 9   LEU B HG   1  
ATOM 2216   H HD11 . LEU B 2 9   ? 10.675  -11.829 -1.534  1.00 2.03  ? 9   LEU B HD11 1  
ATOM 2217   H HD12 . LEU B 2 9   ? 9.952   -13.437 -1.572  1.00 2.08  ? 9   LEU B HD12 1  
ATOM 2218   H HD13 . LEU B 2 9   ? 9.441   -12.269 -0.352  1.00 1.92  ? 9   LEU B HD13 1  
ATOM 2219   H HD21 . LEU B 2 9   ? 7.975   -10.395 -0.956  1.00 2.51  ? 9   LEU B HD21 1  
ATOM 2220   H HD22 . LEU B 2 9   ? 7.538   -10.110 -2.641  1.00 2.89  ? 9   LEU B HD22 1  
ATOM 2221   H HD23 . LEU B 2 9   ? 9.189   -9.817  -2.098  1.00 2.62  ? 9   LEU B HD23 1  
ATOM 2222   N N    . GLU B 2 10  ? 9.655   -13.263 -6.708  1.00 1.94  ? 10  GLU B N    1  
ATOM 2223   C CA   . GLU B 2 10  ? 9.769   -13.049 -8.149  1.00 1.99  ? 10  GLU B CA   1  
ATOM 2224   C C    . GLU B 2 10  ? 8.733   -13.895 -8.885  1.00 2.03  ? 10  GLU B C    1  
ATOM 2225   O O    . GLU B 2 10  ? 8.166   -13.472 -9.891  1.00 2.04  ? 10  GLU B O    1  
ATOM 2226   C CB   . GLU B 2 10  ? 11.175  -13.390 -8.647  1.00 2.08  ? 10  GLU B CB   1  
ATOM 2227   C CG   . GLU B 2 10  ? 12.254  -12.462 -8.115  1.00 2.08  ? 10  GLU B CG   1  
ATOM 2228   C CD   . GLU B 2 10  ? 13.629  -12.788 -8.664  1.00 2.21  ? 10  GLU B CD   1  
ATOM 2229   O OE1  . GLU B 2 10  ? 14.048  -13.961 -8.568  1.00 2.31  ? 10  GLU B OE1  1  
ATOM 2230   O OE2  . GLU B 2 10  ? 14.305  -11.868 -9.178  1.00 2.36  ? 10  GLU B OE2  1  
ATOM 2231   H H    . GLU B 2 10  ? 10.393  -13.688 -6.229  1.00 1.97  ? 10  GLU B H    1  
ATOM 2232   H HA   . GLU B 2 10  ? 9.568   -12.007 -8.342  1.00 1.95  ? 10  GLU B HA   1  
ATOM 2233   H HB2  . GLU B 2 10  ? 11.416  -14.399 -8.344  1.00 2.12  ? 10  GLU B HB2  1  
ATOM 2234   H HB3  . GLU B 2 10  ? 11.182  -13.337 -9.726  1.00 2.14  ? 10  GLU B HB3  1  
ATOM 2235   H HG2  . GLU B 2 10  ? 12.005  -11.448 -8.388  1.00 2.05  ? 10  GLU B HG2  1  
ATOM 2236   H HG3  . GLU B 2 10  ? 12.284  -12.547 -7.038  1.00 2.03  ? 10  GLU B HG3  1  
ATOM 2237   N N    . GLU B 2 11  ? 8.486   -15.087 -8.365  1.00 2.05  ? 11  GLU B N    1  
ATOM 2238   C CA   . GLU B 2 11  ? 7.509   -15.991 -8.952  1.00 2.09  ? 11  GLU B CA   1  
ATOM 2239   C C    . GLU B 2 11  ? 6.098   -15.456 -8.719  1.00 2.00  ? 11  GLU B C    1  
ATOM 2240   O O    . GLU B 2 11  ? 5.252   -15.479 -9.614  1.00 2.01  ? 11  GLU B O    1  
ATOM 2241   C CB   . GLU B 2 11  ? 7.647   -17.389 -8.341  1.00 2.16  ? 11  GLU B CB   1  
ATOM 2242   C CG   . GLU B 2 11  ? 9.004   -18.037 -8.581  1.00 2.25  ? 11  GLU B CG   1  
ATOM 2243   C CD   . GLU B 2 11  ? 9.010   -18.958 -9.783  1.00 2.31  ? 11  GLU B CD   1  
ATOM 2244   O OE1  . GLU B 2 11  ? 8.099   -19.807 -9.892  1.00 2.52  ? 11  GLU B OE1  1  
ATOM 2245   O OE2  . GLU B 2 11  ? 9.928   -18.847 -10.619 1.00 2.48  ? 11  GLU B OE2  1  
ATOM 2246   H H    . GLU B 2 11  ? 8.978   -15.369 -7.563  1.00 2.06  ? 11  GLU B H    1  
ATOM 2247   H HA   . GLU B 2 11  ? 7.697   -16.045 -10.014 1.00 2.15  ? 11  GLU B HA   1  
ATOM 2248   H HB2  . GLU B 2 11  ? 7.492   -17.316 -7.273  1.00 2.12  ? 11  GLU B HB2  1  
ATOM 2249   H HB3  . GLU B 2 11  ? 6.886   -18.028 -8.762  1.00 2.20  ? 11  GLU B HB3  1  
ATOM 2250   H HG2  . GLU B 2 11  ? 9.738   -17.262 -8.740  1.00 2.35  ? 11  GLU B HG2  1  
ATOM 2251   H HG3  . GLU B 2 11  ? 9.273   -18.610 -7.707  1.00 2.40  ? 11  GLU B HG3  1  
ATOM 2252   N N    . SER B 2 12  ? 5.864   -14.942 -7.513  1.00 1.94  ? 12  SER B N    1  
ATOM 2253   C CA   . SER B 2 12  ? 4.562   -14.404 -7.139  1.00 1.86  ? 12  SER B CA   1  
ATOM 2254   C C    . SER B 2 12  ? 4.174   -13.202 -8.003  1.00 1.83  ? 12  SER B C    1  
ATOM 2255   O O    . SER B 2 12  ? 3.030   -13.100 -8.460  1.00 1.83  ? 12  SER B O    1  
ATOM 2256   C CB   . SER B 2 12  ? 4.569   -14.005 -5.662  1.00 1.80  ? 12  SER B CB   1  
ATOM 2257   O OG   . SER B 2 12  ? 5.201   -14.999 -4.872  1.00 1.84  ? 12  SER B OG   1  
ATOM 2258   H H    . SER B 2 12  ? 6.595   -14.922 -6.855  1.00 1.95  ? 12  SER B H    1  
ATOM 2259   H HA   . SER B 2 12  ? 3.831   -15.185 -7.283  1.00 1.89  ? 12  SER B HA   1  
ATOM 2260   H HB2  . SER B 2 12  ? 5.103   -13.074 -5.543  1.00 1.78  ? 12  SER B HB2  1  
ATOM 2261   H HB3  . SER B 2 12  ? 3.552   -13.882 -5.320  1.00 1.78  ? 12  SER B HB3  1  
ATOM 2262   H HG   . SER B 2 12  ? 5.308   -15.802 -5.391  1.00 2.00  ? 12  SER B HG   1  
ATOM 2263   N N    . ILE B 2 13  ? 5.122   -12.296 -8.236  1.00 1.83  ? 13  ILE B N    1  
ATOM 2264   C CA   . ILE B 2 13  ? 4.847   -11.110 -9.041  1.00 1.82  ? 13  ILE B CA   1  
ATOM 2265   C C    . ILE B 2 13  ? 4.651   -11.477 -10.509 1.00 1.90  ? 13  ILE B C    1  
ATOM 2266   O O    . ILE B 2 13  ? 3.881   -10.831 -11.217 1.00 1.91  ? 13  ILE B O    1  
ATOM 2267   C CB   . ILE B 2 13  ? 5.950   -10.029 -8.918  1.00 1.81  ? 13  ILE B CB   1  
ATOM 2268   C CG1  . ILE B 2 13  ? 7.310   -10.572 -9.365  1.00 1.89  ? 13  ILE B CG1  1  
ATOM 2269   C CG2  . ILE B 2 13  ? 6.023   -9.509  -7.490  1.00 1.74  ? 13  ILE B CG2  1  
ATOM 2270   C CD1  . ILE B 2 13  ? 8.396   -9.519  -9.432  1.00 1.96  ? 13  ILE B CD1  1  
ATOM 2271   H H    . ILE B 2 13  ? 6.020   -12.424 -7.855  1.00 1.85  ? 13  ILE B H    1  
ATOM 2272   H HA   . ILE B 2 13  ? 3.924   -10.682 -8.675  1.00 1.76  ? 13  ILE B HA   1  
ATOM 2273   H HB   . ILE B 2 13  ? 5.678   -9.201  -9.555  1.00 1.82  ? 13  ILE B HB   1  
ATOM 2274   H HG12 . ILE B 2 13  ? 7.629   -11.333 -8.671  1.00 1.87  ? 13  ILE B HG12 1  
ATOM 2275   H HG13 . ILE B 2 13  ? 7.208   -11.008 -10.348 1.00 2.00  ? 13  ILE B HG13 1  
ATOM 2276   H HG21 . ILE B 2 13  ? 6.284   -10.320 -6.825  1.00 1.76  ? 13  ILE B HG21 1  
ATOM 2277   H HG22 . ILE B 2 13  ? 5.064   -9.106  -7.203  1.00 1.73  ? 13  ILE B HG22 1  
ATOM 2278   H HG23 . ILE B 2 13  ? 6.773   -8.733  -7.425  1.00 1.74  ? 13  ILE B HG23 1  
ATOM 2279   H HD11 . ILE B 2 13  ? 9.315   -9.971  -9.774  1.00 2.06  ? 13  ILE B HD11 1  
ATOM 2280   H HD12 . ILE B 2 13  ? 8.545   -9.095  -8.451  1.00 2.15  ? 13  ILE B HD12 1  
ATOM 2281   H HD13 . ILE B 2 13  ? 8.101   -8.740  -10.120 1.00 2.10  ? 13  ILE B HD13 1  
ATOM 2282   N N    . GLU B 2 14  ? 5.329   -12.523 -10.959 1.00 1.96  ? 14  GLU B N    1  
ATOM 2283   C CA   . GLU B 2 14  ? 5.208   -12.971 -12.338 1.00 2.05  ? 14  GLU B CA   1  
ATOM 2284   C C    . GLU B 2 14  ? 3.798   -13.483 -12.612 1.00 2.05  ? 14  GLU B C    1  
ATOM 2285   O O    . GLU B 2 14  ? 3.224   -13.228 -13.671 1.00 2.08  ? 14  GLU B O    1  
ATOM 2286   C CB   . GLU B 2 14  ? 6.240   -14.058 -12.640 1.00 2.15  ? 14  GLU B CB   1  
ATOM 2287   C CG   . GLU B 2 14  ? 7.498   -13.527 -13.304 1.00 2.26  ? 14  GLU B CG   1  
ATOM 2288   C CD   . GLU B 2 14  ? 7.216   -12.956 -14.676 1.00 2.29  ? 14  GLU B CD   1  
ATOM 2289   O OE1  . GLU B 2 14  ? 7.060   -13.746 -15.630 1.00 2.42  ? 14  GLU B OE1  1  
ATOM 2290   O OE2  . GLU B 2 14  ? 7.147   -11.716 -14.807 1.00 2.58  ? 14  GLU B OE2  1  
ATOM 2291   H H    . GLU B 2 14  ? 5.929   -13.005 -10.351 1.00 1.97  ? 14  GLU B H    1  
ATOM 2292   H HA   . GLU B 2 14  ? 5.398   -12.121 -12.977 1.00 2.06  ? 14  GLU B HA   1  
ATOM 2293   H HB2  . GLU B 2 14  ? 6.523   -14.540 -11.715 1.00 2.27  ? 14  GLU B HB2  1  
ATOM 2294   H HB3  . GLU B 2 14  ? 5.796   -14.790 -13.296 1.00 2.17  ? 14  GLU B HB3  1  
ATOM 2295   H HG2  . GLU B 2 14  ? 7.920   -12.751 -12.683 1.00 2.51  ? 14  GLU B HG2  1  
ATOM 2296   H HG3  . GLU B 2 14  ? 8.207   -14.335 -13.404 1.00 2.39  ? 14  GLU B HG3  1  
ATOM 2297   N N    . THR B 2 15  ? 3.236   -14.191 -11.641 1.00 2.02  ? 15  THR B N    1  
ATOM 2298   C CA   . THR B 2 15  ? 1.895   -14.737 -11.769 1.00 2.03  ? 15  THR B CA   1  
ATOM 2299   C C    . THR B 2 15  ? 0.851   -13.631 -11.934 1.00 1.95  ? 15  THR B C    1  
ATOM 2300   O O    . THR B 2 15  ? 0.095   -13.626 -12.909 1.00 1.96  ? 15  THR B O    1  
ATOM 2301   C CB   . THR B 2 15  ? 1.542   -15.597 -10.546 1.00 2.03  ? 15  THR B CB   1  
ATOM 2302   O OG1  . THR B 2 15  ? 2.646   -16.455 -10.239 1.00 2.38  ? 15  THR B OG1  1  
ATOM 2303   C CG2  . THR B 2 15  ? 0.295   -16.430 -10.807 1.00 2.31  ? 15  THR B CG2  1  
ATOM 2304   H H    . THR B 2 15  ? 3.744   -14.360 -10.817 1.00 2.00  ? 15  THR B H    1  
ATOM 2305   H HA   . THR B 2 15  ? 1.877   -15.370 -12.643 1.00 2.11  ? 15  THR B HA   1  
ATOM 2306   H HB   . THR B 2 15  ? 1.354   -14.943 -9.706  1.00 2.28  ? 15  THR B HB   1  
ATOM 2307   H HG1  . THR B 2 15  ? 3.257   -16.471 -10.989 1.00 2.81  ? 15  THR B HG1  1  
ATOM 2308   H HG21 . THR B 2 15  ? 0.454   -17.055 -11.673 1.00 2.68  ? 15  THR B HG21 1  
ATOM 2309   H HG22 . THR B 2 15  ? -0.546  -15.775 -10.986 1.00 2.70  ? 15  THR B HG22 1  
ATOM 2310   H HG23 . THR B 2 15  ? 0.091   -17.053 -9.949  1.00 2.33  ? 15  THR B HG23 1  
ATOM 2311   N N    . VAL B 2 16  ? 0.829   -12.682 -11.000 1.00 1.89  ? 16  VAL B N    1  
ATOM 2312   C CA   . VAL B 2 16  ? -0.140  -11.587 -11.058 1.00 1.82  ? 16  VAL B CA   1  
ATOM 2313   C C    . VAL B 2 16  ? 0.053   -10.734 -12.313 1.00 1.84  ? 16  VAL B C    1  
ATOM 2314   O O    . VAL B 2 16  ? -0.921  -10.279 -12.908 1.00 1.83  ? 16  VAL B O    1  
ATOM 2315   C CB   . VAL B 2 16  ? -0.094  -10.685 -9.801  1.00 1.75  ? 16  VAL B CB   1  
ATOM 2316   C CG1  . VAL B 2 16  ? -0.708  -11.402 -8.607  1.00 1.77  ? 16  VAL B CG1  1  
ATOM 2317   C CG2  . VAL B 2 16  ? 1.327   -10.248 -9.488  1.00 1.79  ? 16  VAL B CG2  1  
ATOM 2318   H H    . VAL B 2 16  ? 1.472   -12.719 -10.259 1.00 1.92  ? 16  VAL B H    1  
ATOM 2319   H HA   . VAL B 2 16  ? -1.121  -12.038 -11.105 1.00 1.82  ? 16  VAL B HA   1  
ATOM 2320   H HB   . VAL B 2 16  ? -0.683  -9.802  -9.999  1.00 1.73  ? 16  VAL B HB   1  
ATOM 2321   H HG11 . VAL B 2 16  ? -1.740  -11.639 -8.818  1.00 1.84  ? 16  VAL B HG11 1  
ATOM 2322   H HG12 . VAL B 2 16  ? -0.658  -10.761 -7.738  1.00 1.74  ? 16  VAL B HG12 1  
ATOM 2323   H HG13 . VAL B 2 16  ? -0.161  -12.313 -8.413  1.00 1.88  ? 16  VAL B HG13 1  
ATOM 2324   H HG21 . VAL B 2 16  ? 1.787   -9.849  -10.380 1.00 1.85  ? 16  VAL B HG21 1  
ATOM 2325   H HG22 . VAL B 2 16  ? 1.896   -11.097 -9.138  1.00 1.89  ? 16  VAL B HG22 1  
ATOM 2326   H HG23 . VAL B 2 16  ? 1.308   -9.488  -8.722  1.00 1.79  ? 16  VAL B HG23 1  
ATOM 2327   N N    . VAL B 2 17  ? 1.303   -10.536 -12.724 1.00 1.89  ? 17  VAL B N    1  
ATOM 2328   C CA   . VAL B 2 17  ? 1.593   -9.746  -13.916 1.00 1.92  ? 17  VAL B CA   1  
ATOM 2329   C C    . VAL B 2 17  ? 1.033   -10.439 -15.159 1.00 1.98  ? 17  VAL B C    1  
ATOM 2330   O O    . VAL B 2 17  ? 0.517   -9.786  -16.064 1.00 1.99  ? 17  VAL B O    1  
ATOM 2331   C CB   . VAL B 2 17  ? 3.114   -9.494  -14.072 1.00 1.95  ? 17  VAL B CB   1  
ATOM 2332   C CG1  . VAL B 2 17  ? 3.472   -9.099  -15.500 1.00 2.10  ? 17  VAL B CG1  1  
ATOM 2333   C CG2  . VAL B 2 17  ? 3.573   -8.418  -13.095 1.00 1.91  ? 17  VAL B CG2  1  
ATOM 2334   H H    . VAL B 2 17  ? 2.046   -10.923 -12.211 1.00 1.90  ? 17  VAL B H    1  
ATOM 2335   H HA   . VAL B 2 17  ? 1.102   -8.791  -13.803 1.00 1.88  ? 17  VAL B HA   1  
ATOM 2336   H HB   . VAL B 2 17  ? 3.637   -10.408 -13.833 1.00 1.94  ? 17  VAL B HB   1  
ATOM 2337   H HG11 . VAL B 2 17  ? 3.183   -9.891  -16.174 1.00 2.22  ? 17  VAL B HG11 1  
ATOM 2338   H HG12 . VAL B 2 17  ? 4.537   -8.934  -15.572 1.00 2.19  ? 17  VAL B HG12 1  
ATOM 2339   H HG13 . VAL B 2 17  ? 2.948   -8.192  -15.764 1.00 2.17  ? 17  VAL B HG13 1  
ATOM 2340   H HG21 . VAL B 2 17  ? 3.427   -8.765  -12.082 1.00 1.82  ? 17  VAL B HG21 1  
ATOM 2341   H HG22 . VAL B 2 17  ? 2.997   -7.518  -13.254 1.00 2.00  ? 17  VAL B HG22 1  
ATOM 2342   H HG23 . VAL B 2 17  ? 4.620   -8.208  -13.257 1.00 2.01  ? 17  VAL B HG23 1  
ATOM 2343   N N    . THR B 2 18  ? 1.107   -11.763 -15.180 1.00 2.04  ? 18  THR B N    1  
ATOM 2344   C CA   . THR B 2 18  ? 0.597   -12.533 -16.305 1.00 2.11  ? 18  THR B CA   1  
ATOM 2345   C C    . THR B 2 18  ? -0.919  -12.365 -16.431 1.00 2.08  ? 18  THR B C    1  
ATOM 2346   O O    . THR B 2 18  ? -1.442  -12.174 -17.535 1.00 2.12  ? 18  THR B O    1  
ATOM 2347   C CB   . THR B 2 18  ? 0.957   -14.026 -16.171 1.00 2.18  ? 18  THR B CB   1  
ATOM 2348   O OG1  . THR B 2 18  ? 2.379   -14.167 -16.043 1.00 2.44  ? 18  THR B OG1  1  
ATOM 2349   C CG2  . THR B 2 18  ? 0.475   -14.821 -17.377 1.00 2.43  ? 18  THR B CG2  1  
ATOM 2350   H H    . THR B 2 18  ? 1.517   -12.234 -14.422 1.00 2.03  ? 18  THR B H    1  
ATOM 2351   H HA   . THR B 2 18  ? 1.063   -12.151 -17.202 1.00 2.15  ? 18  THR B HA   1  
ATOM 2352   H HB   . THR B 2 18  ? 0.481   -14.418 -15.282 1.00 2.47  ? 18  THR B HB   1  
ATOM 2353   H HG1  . THR B 2 18  ? 2.648   -13.941 -15.141 1.00 2.71  ? 18  THR B HG1  1  
ATOM 2354   H HG21 . THR B 2 18  ? -0.603  -14.788 -17.423 1.00 2.80  ? 18  THR B HG21 1  
ATOM 2355   H HG22 . THR B 2 18  ? 0.801   -15.846 -17.287 1.00 2.46  ? 18  THR B HG22 1  
ATOM 2356   H HG23 . THR B 2 18  ? 0.886   -14.391 -18.279 1.00 2.77  ? 18  THR B HG23 1  
ATOM 2357   N N    . THR B 2 19  ? -1.620  -12.420 -15.300 1.00 2.01  ? 19  THR B N    1  
ATOM 2358   C CA   . THR B 2 19  ? -3.068  -12.254 -15.291 1.00 1.98  ? 19  THR B CA   1  
ATOM 2359   C C    . THR B 2 19  ? -3.432  -10.801 -15.605 1.00 1.94  ? 19  THR B C    1  
ATOM 2360   O O    . THR B 2 19  ? -4.438  -10.517 -16.252 1.00 1.96  ? 19  THR B O    1  
ATOM 2361   C CB   . THR B 2 19  ? -3.665  -12.661 -13.928 1.00 1.93  ? 19  THR B CB   1  
ATOM 2362   O OG1  . THR B 2 19  ? -3.069  -13.889 -13.482 1.00 1.96  ? 19  THR B OG1  1  
ATOM 2363   C CG2  . THR B 2 19  ? -5.172  -12.831 -14.023 1.00 1.98  ? 19  THR B CG2  1  
ATOM 2364   H H    . THR B 2 19  ? -1.153  -12.587 -14.451 1.00 1.99  ? 19  THR B H    1  
ATOM 2365   H HA   . THR B 2 19  ? -3.486  -12.895 -16.055 1.00 2.04  ? 19  THR B HA   1  
ATOM 2366   H HB   . THR B 2 19  ? -3.448  -11.883 -13.209 1.00 1.93  ? 19  THR B HB   1  
ATOM 2367   H HG1  . THR B 2 19  ? -3.746  -14.438 -13.047 1.00 1.94  ? 19  THR B HG1  1  
ATOM 2368   H HG21 . THR B 2 19  ? -5.401  -13.681 -14.650 1.00 2.10  ? 19  THR B HG21 1  
ATOM 2369   H HG22 . THR B 2 19  ? -5.606  -11.940 -14.453 1.00 2.10  ? 19  THR B HG22 1  
ATOM 2370   H HG23 . THR B 2 19  ? -5.581  -12.990 -13.037 1.00 2.03  ? 19  THR B HG23 1  
ATOM 2371   N N    . PHE B 2 20  ? -2.588  -9.885  -15.151 1.00 1.91  ? 20  PHE B N    1  
ATOM 2372   C CA   . PHE B 2 20  ? -2.796  -8.464  -15.386 1.00 1.88  ? 20  PHE B CA   1  
ATOM 2373   C C    . PHE B 2 20  ? -2.628  -8.140  -16.870 1.00 1.94  ? 20  PHE B C    1  
ATOM 2374   O O    . PHE B 2 20  ? -3.411  -7.388  -17.445 1.00 1.94  ? 20  PHE B O    1  
ATOM 2375   C CB   . PHE B 2 20  ? -1.812  -7.644  -14.527 1.00 1.84  ? 20  PHE B CB   1  
ATOM 2376   C CG   . PHE B 2 20  ? -1.230  -6.423  -15.196 1.00 1.86  ? 20  PHE B CG   1  
ATOM 2377   C CD1  . PHE B 2 20  ? -1.921  -5.222  -15.209 1.00 1.82  ? 20  PHE B CD1  1  
ATOM 2378   C CD2  . PHE B 2 20  ? 0.015   -6.478  -15.806 1.00 1.95  ? 20  PHE B CD2  1  
ATOM 2379   C CE1  . PHE B 2 20  ? -1.384  -4.103  -15.815 1.00 1.85  ? 20  PHE B CE1  1  
ATOM 2380   C CE2  . PHE B 2 20  ? 0.557   -5.362  -16.414 1.00 1.98  ? 20  PHE B CE2  1  
ATOM 2381   C CZ   . PHE B 2 20  ? -0.145  -4.172  -16.420 1.00 1.94  ? 20  PHE B CZ   1  
ATOM 2382   H H    . PHE B 2 20  ? -1.806  -10.174 -14.631 1.00 1.90  ? 20  PHE B H    1  
ATOM 2383   H HA   . PHE B 2 20  ? -3.807  -8.223  -15.091 1.00 1.85  ? 20  PHE B HA   1  
ATOM 2384   H HB2  . PHE B 2 20  ? -2.320  -7.314  -13.635 1.00 1.78  ? 20  PHE B HB2  1  
ATOM 2385   H HB3  . PHE B 2 20  ? -0.989  -8.285  -14.240 1.00 1.89  ? 20  PHE B HB3  1  
ATOM 2386   H HD1  . PHE B 2 20  ? -2.892  -5.163  -14.737 1.00 1.77  ? 20  PHE B HD1  1  
ATOM 2387   H HD2  . PHE B 2 20  ? 0.564   -7.409  -15.804 1.00 2.01  ? 20  PHE B HD2  1  
ATOM 2388   H HE1  . PHE B 2 20  ? -1.934  -3.173  -15.819 1.00 1.84  ? 20  PHE B HE1  1  
ATOM 2389   H HE2  . PHE B 2 20  ? 1.526   -5.420  -16.884 1.00 2.07  ? 20  PHE B HE2  1  
ATOM 2390   H HZ   . PHE B 2 20  ? 0.276   -3.299  -16.893 1.00 1.98  ? 20  PHE B HZ   1  
ATOM 2391   N N    . PHE B 2 21  ? -1.622  -8.743  -17.487 1.00 2.00  ? 21  PHE B N    1  
ATOM 2392   C CA   . PHE B 2 21  ? -1.332  -8.503  -18.893 1.00 2.07  ? 21  PHE B CA   1  
ATOM 2393   C C    . PHE B 2 21  ? -2.406  -9.085  -19.810 1.00 2.11  ? 21  PHE B C    1  
ATOM 2394   O O    . PHE B 2 21  ? -2.722  -8.497  -20.840 1.00 2.19  ? 21  PHE B O    1  
ATOM 2395   C CB   . PHE B 2 21  ? 0.032   -9.089  -19.261 1.00 2.12  ? 21  PHE B CB   1  
ATOM 2396   C CG   . PHE B 2 21  ? 0.634   -8.476  -20.499 1.00 2.19  ? 21  PHE B CG   1  
ATOM 2397   C CD1  . PHE B 2 21  ? 1.244   -7.232  -20.445 1.00 2.39  ? 21  PHE B CD1  1  
ATOM 2398   C CD2  . PHE B 2 21  ? 0.585   -9.141  -21.717 1.00 2.27  ? 21  PHE B CD2  1  
ATOM 2399   C CE1  . PHE B 2 21  ? 1.793   -6.662  -21.578 1.00 2.59  ? 21  PHE B CE1  1  
ATOM 2400   C CE2  . PHE B 2 21  ? 1.134   -8.575  -22.854 1.00 2.47  ? 21  PHE B CE2  1  
ATOM 2401   C CZ   . PHE B 2 21  ? 1.738   -7.335  -22.784 1.00 2.60  ? 21  PHE B CZ   1  
ATOM 2402   H H    . PHE B 2 21  ? -1.048  -9.359  -16.979 1.00 2.00  ? 21  PHE B H    1  
ATOM 2403   H HA   . PHE B 2 21  ? -1.299  -7.434  -19.038 1.00 2.06  ? 21  PHE B HA   1  
ATOM 2404   H HB2  . PHE B 2 21  ? 0.718   -8.931  -18.442 1.00 2.18  ? 21  PHE B HB2  1  
ATOM 2405   H HB3  . PHE B 2 21  ? -0.078  -10.150 -19.433 1.00 2.15  ? 21  PHE B HB3  1  
ATOM 2406   H HD1  . PHE B 2 21  ? 1.291   -6.704  -19.504 1.00 2.52  ? 21  PHE B HD1  1  
ATOM 2407   H HD2  . PHE B 2 21  ? 0.113   -10.110 -21.773 1.00 2.33  ? 21  PHE B HD2  1  
ATOM 2408   H HE1  . PHE B 2 21  ? 2.263   -5.692  -21.522 1.00 2.86  ? 21  PHE B HE1  1  
ATOM 2409   H HE2  . PHE B 2 21  ? 1.092   -9.100  -23.795 1.00 2.66  ? 21  PHE B HE2  1  
ATOM 2410   H HZ   . PHE B 2 21  ? 2.168   -6.891  -23.671 1.00 2.83  ? 21  PHE B HZ   1  
ATOM 2411   N N    . THR B 2 22  ? -2.972  -10.228 -19.438 1.00 2.08  ? 22  THR B N    1  
ATOM 2412   C CA   . THR B 2 22  ? -3.993  -10.867 -20.264 1.00 2.12  ? 22  THR B CA   1  
ATOM 2413   C C    . THR B 2 22  ? -5.279  -10.045 -20.306 1.00 2.06  ? 22  THR B C    1  
ATOM 2414   O O    . THR B 2 22  ? -6.005  -10.060 -21.302 1.00 2.09  ? 22  THR B O    1  
ATOM 2415   C CB   . THR B 2 22  ? -4.313  -12.287 -19.765 1.00 2.15  ? 22  THR B CB   1  
ATOM 2416   O OG1  . THR B 2 22  ? -3.971  -12.405 -18.379 1.00 2.44  ? 22  THR B OG1  1  
ATOM 2417   C CG2  . THR B 2 22  ? -3.555  -13.328 -20.574 1.00 2.31  ? 22  THR B CG2  1  
ATOM 2418   H H    . THR B 2 22  ? -2.705  -10.648 -18.593 1.00 2.05  ? 22  THR B H    1  
ATOM 2419   H HA   . THR B 2 22  ? -3.601  -10.946 -21.267 1.00 2.20  ? 22  THR B HA   1  
ATOM 2420   H HB   . THR B 2 22  ? -5.374  -12.461 -19.880 1.00 2.34  ? 22  THR B HB   1  
ATOM 2421   H HG1  . THR B 2 22  ? -3.034  -12.617 -18.294 1.00 2.72  ? 22  THR B HG1  1  
ATOM 2422   H HG21 . THR B 2 22  ? -2.500  -13.093 -20.566 1.00 2.66  ? 22  THR B HG21 1  
ATOM 2423   H HG22 . THR B 2 22  ? -3.916  -13.327 -21.592 1.00 2.54  ? 22  THR B HG22 1  
ATOM 2424   H HG23 . THR B 2 22  ? -3.707  -14.306 -20.139 1.00 2.37  ? 22  THR B HG23 1  
ATOM 2425   N N    . PHE B 2 23  ? -5.549  -9.322  -19.230 1.00 1.99  ? 23  PHE B N    1  
ATOM 2426   C CA   . PHE B 2 23  ? -6.747  -8.496  -19.150 1.00 1.94  ? 23  PHE B CA   1  
ATOM 2427   C C    . PHE B 2 23  ? -6.475  -7.082  -19.655 1.00 1.94  ? 23  PHE B C    1  
ATOM 2428   O O    . PHE B 2 23  ? -7.402  -6.354  -19.991 1.00 1.99  ? 23  PHE B O    1  
ATOM 2429   C CB   . PHE B 2 23  ? -7.273  -8.456  -17.714 1.00 1.85  ? 23  PHE B CB   1  
ATOM 2430   C CG   . PHE B 2 23  ? -8.058  -9.680  -17.334 1.00 1.86  ? 23  PHE B CG   1  
ATOM 2431   C CD1  . PHE B 2 23  ? -7.414  -10.873 -17.042 1.00 1.89  ? 23  PHE B CD1  1  
ATOM 2432   C CD2  . PHE B 2 23  ? -9.441  -9.641  -17.278 1.00 1.86  ? 23  PHE B CD2  1  
ATOM 2433   C CE1  . PHE B 2 23  ? -8.134  -12.001 -16.701 1.00 1.91  ? 23  PHE B CE1  1  
ATOM 2434   C CE2  . PHE B 2 23  ? -10.167 -10.766 -16.939 1.00 1.88  ? 23  PHE B CE2  1  
ATOM 2435   C CZ   . PHE B 2 23  ? -9.513  -11.947 -16.649 1.00 1.90  ? 23  PHE B CZ   1  
ATOM 2436   H H    . PHE B 2 23  ? -4.934  -9.351  -18.466 1.00 1.98  ? 23  PHE B H    1  
ATOM 2437   H HA   . PHE B 2 23  ? -7.496  -8.948  -19.781 1.00 1.96  ? 23  PHE B HA   1  
ATOM 2438   H HB2  . PHE B 2 23  ? -6.439  -8.369  -17.033 1.00 1.83  ? 23  PHE B HB2  1  
ATOM 2439   H HB3  . PHE B 2 23  ? -7.918  -7.597  -17.599 1.00 1.83  ? 23  PHE B HB3  1  
ATOM 2440   H HD1  . PHE B 2 23  ? -6.334  -10.916 -17.082 1.00 1.91  ? 23  PHE B HD1  1  
ATOM 2441   H HD2  . PHE B 2 23  ? -9.955  -8.717  -17.503 1.00 1.87  ? 23  PHE B HD2  1  
ATOM 2442   H HE1  . PHE B 2 23  ? -7.621  -12.922 -16.474 1.00 1.96  ? 23  PHE B HE1  1  
ATOM 2443   H HE2  . PHE B 2 23  ? -11.245 -10.721 -16.899 1.00 1.91  ? 23  PHE B HE2  1  
ATOM 2444   H HZ   . PHE B 2 23  ? -10.080 -12.828 -16.385 1.00 1.93  ? 23  PHE B HZ   1  
ATOM 2445   N N    . ALA B 2 24  ? -5.199  -6.704  -19.717 1.00 1.94  ? 24  ALA B N    1  
ATOM 2446   C CA   . ALA B 2 24  ? -4.813  -5.372  -20.185 1.00 1.95  ? 24  ALA B CA   1  
ATOM 2447   C C    . ALA B 2 24  ? -4.717  -5.334  -21.705 1.00 2.05  ? 24  ALA B C    1  
ATOM 2448   O O    . ALA B 2 24  ? -4.277  -4.348  -22.291 1.00 2.21  ? 24  ALA B O    1  
ATOM 2449   C CB   . ALA B 2 24  ? -3.490  -4.952  -19.561 1.00 1.93  ? 24  ALA B CB   1  
ATOM 2450   H H    . ALA B 2 24  ? -4.501  -7.330  -19.433 1.00 1.93  ? 24  ALA B H    1  
ATOM 2451   H HA   . ALA B 2 24  ? -5.572  -4.674  -19.865 1.00 1.92  ? 24  ALA B HA   1  
ATOM 2452   H HB1  . ALA B 2 24  ? -2.711  -5.632  -19.872 1.00 1.94  ? 24  ALA B HB1  1  
ATOM 2453   H HB2  . ALA B 2 24  ? -3.576  -4.975  -18.484 1.00 1.95  ? 24  ALA B HB2  1  
ATOM 2454   H HB3  . ALA B 2 24  ? -3.243  -3.950  -19.880 1.00 2.11  ? 24  ALA B HB3  1  
ATOM 2455   N N    . ARG B 2 25  ? -5.107  -6.428  -22.339 1.00 2.03  ? 25  ARG B N    1  
ATOM 2456   C CA   . ARG B 2 25  ? -5.089  -6.518  -23.789 1.00 2.11  ? 25  ARG B CA   1  
ATOM 2457   C C    . ARG B 2 25  ? -6.456  -6.957  -24.295 1.00 2.13  ? 25  ARG B C    1  
ATOM 2458   O O    . ARG B 2 25  ? -6.568  -7.721  -25.257 1.00 2.18  ? 25  ARG B O    1  
ATOM 2459   C CB   . ARG B 2 25  ? -3.994  -7.481  -24.274 1.00 2.18  ? 25  ARG B CB   1  
ATOM 2460   C CG   . ARG B 2 25  ? -3.986  -8.829  -23.573 1.00 2.19  ? 25  ARG B CG   1  
ATOM 2461   C CD   . ARG B 2 25  ? -4.194  -9.980  -24.551 1.00 2.28  ? 25  ARG B CD   1  
ATOM 2462   N NE   . ARG B 2 25  ? -5.615  -10.273 -24.757 1.00 2.29  ? 25  ARG B NE   1  
ATOM 2463   C CZ   . ARG B 2 25  ? -6.115  -11.499 -24.925 1.00 2.40  ? 25  ARG B CZ   1  
ATOM 2464   N NH1  . ARG B 2 25  ? -5.306  -12.551 -24.966 1.00 2.60  ? 25  ARG B NH1  1  
ATOM 2465   N NH2  . ARG B 2 25  ? -7.427  -11.674 -25.051 1.00 2.57  ? 25  ARG B NH2  1  
ATOM 2466   H H    . ARG B 2 25  ? -5.422  -7.192  -21.815 1.00 2.00  ? 25  ARG B H    1  
ATOM 2467   H HA   . ARG B 2 25  ? -4.882  -5.531  -24.176 1.00 2.13  ? 25  ARG B HA   1  
ATOM 2468   H HB2  . ARG B 2 25  ? -4.130  -7.654  -25.331 1.00 2.25  ? 25  ARG B HB2  1  
ATOM 2469   H HB3  . ARG B 2 25  ? -3.033  -7.015  -24.118 1.00 2.19  ? 25  ARG B HB3  1  
ATOM 2470   H HG2  . ARG B 2 25  ? -3.033  -8.960  -23.080 1.00 2.24  ? 25  ARG B HG2  1  
ATOM 2471   H HG3  . ARG B 2 25  ? -4.777  -8.846  -22.837 1.00 2.22  ? 25  ARG B HG3  1  
ATOM 2472   H HD2  . ARG B 2 25  ? -3.749  -9.714  -25.497 1.00 2.44  ? 25  ARG B HD2  1  
ATOM 2473   H HD3  . ARG B 2 25  ? -3.707  -10.860 -24.159 1.00 2.41  ? 25  ARG B HD3  1  
ATOM 2474   H HE   . ARG B 2 25  ? -6.232  -9.502  -24.756 1.00 2.41  ? 25  ARG B HE   1  
ATOM 2475   H HH11 . ARG B 2 25  ? -4.313  -12.431 -24.873 1.00 2.67  ? 25  ARG B HH11 1  
ATOM 2476   H HH12 . ARG B 2 25  ? -5.685  -13.474 -25.088 1.00 2.83  ? 25  ARG B HH12 1  
ATOM 2477   H HH21 . ARG B 2 25  ? -8.053  -10.885 -25.012 1.00 2.68  ? 25  ARG B HH21 1  
ATOM 2478   H HH22 . ARG B 2 25  ? -7.800  -12.595 -25.190 1.00 2.73  ? 25  ARG B HH22 1  
ATOM 2479   N N    . GLN B 2 26  ? -7.499  -6.469  -23.644 1.00 2.10  ? 26  GLN B N    1  
ATOM 2480   C CA   . GLN B 2 26  ? -8.855  -6.811  -24.030 1.00 2.12  ? 26  GLN B CA   1  
ATOM 2481   C C    . GLN B 2 26  ? -9.446  -5.701  -24.881 1.00 2.13  ? 26  GLN B C    1  
ATOM 2482   O O    . GLN B 2 26  ? -10.038 -5.954  -25.929 1.00 2.19  ? 26  GLN B O    1  
ATOM 2483   C CB   . GLN B 2 26  ? -9.731  -7.050  -22.801 1.00 2.06  ? 26  GLN B CB   1  
ATOM 2484   C CG   . GLN B 2 26  ? -10.600 -8.288  -22.926 1.00 2.09  ? 26  GLN B CG   1  
ATOM 2485   C CD   . GLN B 2 26  ? -9.783  -9.561  -22.963 1.00 2.18  ? 26  GLN B CD   1  
ATOM 2486   O OE1  . GLN B 2 26  ? -9.282  -9.961  -24.014 1.00 2.33  ? 26  GLN B OE1  1  
ATOM 2487   N NE2  . GLN B 2 26  ? -9.668  -10.223 -21.823 1.00 2.26  ? 26  GLN B NE2  1  
ATOM 2488   H H    . GLN B 2 26  ? -7.353  -5.840  -22.894 1.00 2.09  ? 26  GLN B H    1  
ATOM 2489   H HA   . GLN B 2 26  ? -8.815  -7.716  -24.617 1.00 2.18  ? 26  GLN B HA   1  
ATOM 2490   H HB2  . GLN B 2 26  ? -9.100  -7.161  -21.934 1.00 2.08  ? 26  GLN B HB2  1  
ATOM 2491   H HB3  . GLN B 2 26  ? -10.377 -6.195  -22.664 1.00 2.09  ? 26  GLN B HB3  1  
ATOM 2492   H HG2  . GLN B 2 26  ? -11.269 -8.330  -22.078 1.00 2.12  ? 26  GLN B HG2  1  
ATOM 2493   H HG3  . GLN B 2 26  ? -11.175 -8.219  -23.838 1.00 2.23  ? 26  GLN B HG3  1  
ATOM 2494   H HE21 . GLN B 2 26  ? -10.125 -9.858  -21.021 1.00 2.22  ? 26  GLN B HE21 1  
ATOM 2495   H HE22 . GLN B 2 26  ? -9.125  -11.038 -21.811 1.00 2.46  ? 26  GLN B HE22 1  
ATOM 2496   N N    . GLU B 2 27  ? -9.264  -4.470  -24.436 1.00 2.09  ? 27  GLU B N    1  
ATOM 2497   C CA   . GLU B 2 27  ? -9.770  -3.318  -25.155 1.00 2.12  ? 27  GLU B CA   1  
ATOM 2498   C C    . GLU B 2 27  ? -8.654  -2.679  -25.971 1.00 2.17  ? 27  GLU B C    1  
ATOM 2499   O O    . GLU B 2 27  ? -8.761  -2.551  -27.193 1.00 2.26  ? 27  GLU B O    1  
ATOM 2500   C CB   . GLU B 2 27  ? -10.379 -2.297  -24.190 1.00 2.05  ? 27  GLU B CB   1  
ATOM 2501   C CG   . GLU B 2 27  ? -11.685 -2.759  -23.556 1.00 2.03  ? 27  GLU B CG   1  
ATOM 2502   C CD   . GLU B 2 27  ? -12.611 -1.608  -23.218 1.00 2.03  ? 27  GLU B CD   1  
ATOM 2503   O OE1  . GLU B 2 27  ? -13.250 -1.070  -24.149 1.00 2.18  ? 27  GLU B OE1  1  
ATOM 2504   O OE2  . GLU B 2 27  ? -12.719 -1.244  -22.028 1.00 2.06  ? 27  GLU B OE2  1  
ATOM 2505   H H    . GLU B 2 27  ? -8.757  -4.331  -23.594 1.00 2.06  ? 27  GLU B H    1  
ATOM 2506   H HA   . GLU B 2 27  ? -10.539 -3.665  -25.830 1.00 2.15  ? 27  GLU B HA   1  
ATOM 2507   H HB2  . GLU B 2 27  ? -9.670  -2.101  -23.399 1.00 2.01  ? 27  GLU B HB2  1  
ATOM 2508   H HB3  . GLU B 2 27  ? -10.569 -1.380  -24.726 1.00 2.08  ? 27  GLU B HB3  1  
ATOM 2509   H HG2  . GLU B 2 27  ? -12.193 -3.418  -24.245 1.00 2.12  ? 27  GLU B HG2  1  
ATOM 2510   H HG3  . GLU B 2 27  ? -11.462 -3.300  -22.649 1.00 2.06  ? 27  GLU B HG3  1  
ATOM 2511   N N    . GLY B 2 28  ? -7.578  -2.298  -25.301 1.00 2.14  ? 28  GLY B N    1  
ATOM 2512   C CA   . GLY B 2 28  ? -6.462  -1.685  -25.988 1.00 2.19  ? 28  GLY B CA   1  
ATOM 2513   C C    . GLY B 2 28  ? -5.433  -1.124  -25.034 1.00 2.15  ? 28  GLY B C    1  
ATOM 2514   O O    . GLY B 2 28  ? -5.723  -0.923  -23.856 1.00 2.09  ? 28  GLY B O    1  
ATOM 2515   H H    . GLY B 2 28  ? -7.540  -2.429  -24.325 1.00 2.10  ? 28  GLY B H    1  
ATOM 2516   H HA2  . GLY B 2 28  ? -5.990  -2.426  -26.617 1.00 2.24  ? 28  GLY B HA2  1  
ATOM 2517   H HA3  . GLY B 2 28  ? -6.832  -0.884  -26.610 1.00 2.22  ? 28  GLY B HA3  1  
ATOM 2518   N N    . ARG B 2 29  ? -4.232  -0.872  -25.557 1.00 2.20  ? 29  ARG B N    1  
ATOM 2519   C CA   . ARG B 2 29  ? -3.126  -0.328  -24.773 1.00 2.19  ? 29  ARG B CA   1  
ATOM 2520   C C    . ARG B 2 29  ? -2.702  -1.303  -23.678 1.00 2.15  ? 29  ARG B C    1  
ATOM 2521   O O    . ARG B 2 29  ? -2.949  -1.069  -22.493 1.00 2.07  ? 29  ARG B O    1  
ATOM 2522   C CB   . ARG B 2 29  ? -3.497  1.031   -24.171 1.00 2.16  ? 29  ARG B CB   1  
ATOM 2523   C CG   . ARG B 2 29  ? -3.745  2.104   -25.217 1.00 2.35  ? 29  ARG B CG   1  
ATOM 2524   C CD   . ARG B 2 29  ? -4.262  3.383   -24.583 1.00 2.34  ? 29  ARG B CD   1  
ATOM 2525   N NE   . ARG B 2 29  ? -4.244  4.507   -25.519 1.00 2.57  ? 29  ARG B NE   1  
ATOM 2526   C CZ   . ARG B 2 29  ? -4.795  5.694   -25.269 1.00 2.59  ? 29  ARG B CZ   1  
ATOM 2527   N NH1  . ARG B 2 29  ? -5.442  5.906   -24.133 1.00 2.43  ? 29  ARG B NH1  1  
ATOM 2528   N NH2  . ARG B 2 29  ? -4.697  6.670   -26.161 1.00 2.89  ? 29  ARG B NH2  1  
ATOM 2529   H H    . ARG B 2 29  ? -4.085  -1.062  -26.506 1.00 2.26  ? 29  ARG B H    1  
ATOM 2530   H HA   . ARG B 2 29  ? -2.292  -0.192  -25.445 1.00 2.26  ? 29  ARG B HA   1  
ATOM 2531   H HB2  . ARG B 2 29  ? -4.397  0.917   -23.583 1.00 2.14  ? 29  ARG B HB2  1  
ATOM 2532   H HB3  . ARG B 2 29  ? -2.695  1.360   -23.529 1.00 2.17  ? 29  ARG B HB3  1  
ATOM 2533   H HG2  . ARG B 2 29  ? -2.819  2.319   -25.728 1.00 2.51  ? 29  ARG B HG2  1  
ATOM 2534   H HG3  . ARG B 2 29  ? -4.476  1.741   -25.925 1.00 2.48  ? 29  ARG B HG3  1  
ATOM 2535   H HD2  . ARG B 2 29  ? -5.277  3.220   -24.252 1.00 2.26  ? 29  ARG B HD2  1  
ATOM 2536   H HD3  . ARG B 2 29  ? -3.641  3.626   -23.733 1.00 2.35  ? 29  ARG B HD3  1  
ATOM 2537   H HE   . ARG B 2 29  ? -3.781  4.371   -26.376 1.00 2.79  ? 29  ARG B HE   1  
ATOM 2538   H HH11 . ARG B 2 29  ? -5.522  5.166   -23.443 1.00 2.29  ? 29  ARG B HH11 1  
ATOM 2539   H HH12 . ARG B 2 29  ? -5.859  6.797   -23.948 1.00 2.52  ? 29  ARG B HH12 1  
ATOM 2540   H HH21 . ARG B 2 29  ? -4.207  6.516   -27.024 1.00 3.10  ? 29  ARG B HH21 1  
ATOM 2541   H HH22 . ARG B 2 29  ? -5.100  7.568   -25.971 1.00 2.95  ? 29  ARG B HH22 1  
ATOM 2542   N N    . LYS B 2 30  ? -2.060  -2.395  -24.100 1.00 2.21  ? 30  LYS B N    1  
ATOM 2543   C CA   . LYS B 2 30  ? -1.583  -3.434  -23.186 1.00 2.18  ? 30  LYS B CA   1  
ATOM 2544   C C    . LYS B 2 30  ? -0.544  -2.882  -22.209 1.00 2.15  ? 30  LYS B C    1  
ATOM 2545   O O    . LYS B 2 30  ? 0.662   -2.977  -22.439 1.00 2.21  ? 30  LYS B O    1  
ATOM 2546   C CB   . LYS B 2 30  ? -1.007  -4.619  -23.977 1.00 2.27  ? 30  LYS B CB   1  
ATOM 2547   C CG   . LYS B 2 30  ? -0.146  -4.219  -25.167 1.00 2.37  ? 30  LYS B CG   1  
ATOM 2548   C CD   . LYS B 2 30  ? 0.346   -5.441  -25.922 1.00 2.48  ? 30  LYS B CD   1  
ATOM 2549   C CE   . LYS B 2 30  ? 1.310   -5.060  -27.033 1.00 2.59  ? 30  LYS B CE   1  
ATOM 2550   N NZ   . LYS B 2 30  ? 1.759   -6.246  -27.811 1.00 2.81  ? 30  LYS B NZ   1  
ATOM 2551   H H    . LYS B 2 30  ? -1.912  -2.509  -25.059 1.00 2.28  ? 30  LYS B H    1  
ATOM 2552   H HA   . LYS B 2 30  ? -2.435  -3.783  -22.619 1.00 2.13  ? 30  LYS B HA   1  
ATOM 2553   H HB2  . LYS B 2 30  ? -0.403  -5.219  -23.313 1.00 2.25  ? 30  LYS B HB2  1  
ATOM 2554   H HB3  . LYS B 2 30  ? -1.825  -5.221  -24.343 1.00 2.30  ? 30  LYS B HB3  1  
ATOM 2555   H HG2  . LYS B 2 30  ? -0.733  -3.607  -25.836 1.00 2.41  ? 30  LYS B HG2  1  
ATOM 2556   H HG3  . LYS B 2 30  ? 0.704   -3.654  -24.812 1.00 2.36  ? 30  LYS B HG3  1  
ATOM 2557   H HD2  . LYS B 2 30  ? 0.849   -6.100  -25.231 1.00 2.51  ? 30  LYS B HD2  1  
ATOM 2558   H HD3  . LYS B 2 30  ? -0.503  -5.950  -26.355 1.00 2.59  ? 30  LYS B HD3  1  
ATOM 2559   H HE2  . LYS B 2 30  ? 0.820   -4.369  -27.699 1.00 2.74  ? 30  LYS B HE2  1  
ATOM 2560   H HE3  . LYS B 2 30  ? 2.173   -4.583  -26.593 1.00 2.58  ? 30  LYS B HE3  1  
ATOM 2561   H HZ1  . LYS B 2 30  ? 2.282   -6.901  -27.196 1.00 2.99  ? 30  LYS B HZ1  1  
ATOM 2562   H HZ2  . LYS B 2 30  ? 2.381   -5.949  -28.588 1.00 3.02  ? 30  LYS B HZ2  1  
ATOM 2563   H HZ3  . LYS B 2 30  ? 0.939   -6.745  -28.213 1.00 3.02  ? 30  LYS B HZ3  1  
ATOM 2564   N N    . ASP B 2 31  ? -1.046  -2.310  -21.122 1.00 2.07  ? 31  ASP B N    1  
ATOM 2565   C CA   . ASP B 2 31  ? -0.228  -1.708  -20.070 1.00 2.03  ? 31  ASP B CA   1  
ATOM 2566   C C    . ASP B 2 31  ? -1.157  -1.069  -19.049 1.00 1.97  ? 31  ASP B C    1  
ATOM 2567   O O    . ASP B 2 31  ? -0.816  -0.903  -17.878 1.00 1.97  ? 31  ASP B O    1  
ATOM 2568   C CB   . ASP B 2 31  ? 0.726   -0.646  -20.642 1.00 2.08  ? 31  ASP B CB   1  
ATOM 2569   C CG   . ASP B 2 31  ? 1.688   -0.092  -19.604 1.00 2.06  ? 31  ASP B CG   1  
ATOM 2570   O OD1  . ASP B 2 31  ? 2.596   -0.828  -19.164 1.00 2.13  ? 31  ASP B OD1  1  
ATOM 2571   O OD2  . ASP B 2 31  ? 1.566   1.100   -19.248 1.00 2.09  ? 31  ASP B OD2  1  
ATOM 2572   H H    . ASP B 2 31  ? -2.024  -2.292  -21.020 1.00 2.06  ? 31  ASP B H    1  
ATOM 2573   H HA   . ASP B 2 31  ? 0.345   -2.491  -19.591 1.00 2.03  ? 31  ASP B HA   1  
ATOM 2574   H HB2  . ASP B 2 31  ? 1.307   -1.091  -21.437 1.00 2.13  ? 31  ASP B HB2  1  
ATOM 2575   H HB3  . ASP B 2 31  ? 0.147   0.172   -21.043 1.00 2.10  ? 31  ASP B HB3  1  
ATOM 2576   N N    . SER B 2 32  ? -2.347  -0.723  -19.519 1.00 1.94  ? 32  SER B N    1  
ATOM 2577   C CA   . SER B 2 32  ? -3.358  -0.109  -18.682 1.00 1.89  ? 32  SER B CA   1  
ATOM 2578   C C    . SER B 2 32  ? -4.651  -0.913  -18.740 1.00 1.87  ? 32  SER B C    1  
ATOM 2579   O O    . SER B 2 32  ? -4.881  -1.662  -19.688 1.00 1.93  ? 32  SER B O    1  
ATOM 2580   C CB   . SER B 2 32  ? -3.603  1.330   -19.138 1.00 1.91  ? 32  SER B CB   1  
ATOM 2581   O OG   . SER B 2 32  ? -3.394  1.469   -20.535 1.00 2.12  ? 32  SER B OG   1  
ATOM 2582   H H    . SER B 2 32  ? -2.553  -0.888  -20.465 1.00 1.98  ? 32  SER B H    1  
ATOM 2583   H HA   . SER B 2 32  ? -2.994  -0.103  -17.665 1.00 1.87  ? 32  SER B HA   1  
ATOM 2584   H HB2  . SER B 2 32  ? -4.620  1.609   -18.910 1.00 1.96  ? 32  SER B HB2  1  
ATOM 2585   H HB3  . SER B 2 32  ? -2.923  1.990   -18.617 1.00 2.02  ? 32  SER B HB3  1  
ATOM 2586   H HG   . SER B 2 32  ? -3.850  0.753   -20.999 1.00 2.44  ? 32  SER B HG   1  
ATOM 2587   N N    . LEU B 2 33  ? -5.474  -0.767  -17.711 1.00 1.79  ? 33  LEU B N    1  
ATOM 2588   C CA   . LEU B 2 33  ? -6.747  -1.470  -17.635 1.00 1.77  ? 33  LEU B CA   1  
ATOM 2589   C C    . LEU B 2 33  ? -7.901  -0.507  -17.888 1.00 1.75  ? 33  LEU B C    1  
ATOM 2590   O O    . LEU B 2 33  ? -8.148  0.402   -17.089 1.00 1.70  ? 33  LEU B O    1  
ATOM 2591   C CB   . LEU B 2 33  ? -6.923  -2.125  -16.256 1.00 1.70  ? 33  LEU B CB   1  
ATOM 2592   C CG   . LEU B 2 33  ? -6.327  -3.532  -16.090 1.00 1.73  ? 33  LEU B CG   1  
ATOM 2593   C CD1  . LEU B 2 33  ? -6.979  -4.515  -17.049 1.00 1.79  ? 33  LEU B CD1  1  
ATOM 2594   C CD2  . LEU B 2 33  ? -4.822  -3.509  -16.293 1.00 1.79  ? 33  LEU B CD2  1  
ATOM 2595   H H    . LEU B 2 33  ? -5.215  -0.170  -16.974 1.00 1.77  ? 33  LEU B H    1  
ATOM 2596   H HA   . LEU B 2 33  ? -6.753  -2.234  -18.394 1.00 1.81  ? 33  LEU B HA   1  
ATOM 2597   H HB2  . LEU B 2 33  ? -6.466  -1.480  -15.520 1.00 1.68  ? 33  LEU B HB2  1  
ATOM 2598   H HB3  . LEU B 2 33  ? -7.980  -2.182  -16.047 1.00 1.67  ? 33  LEU B HB3  1  
ATOM 2599   H HG   . LEU B 2 33  ? -6.522  -3.876  -15.083 1.00 1.69  ? 33  LEU B HG   1  
ATOM 2600   H HD11 . LEU B 2 33  ? -6.725  -4.250  -18.064 1.00 1.98  ? 33  LEU B HD11 1  
ATOM 2601   H HD12 . LEU B 2 33  ? -8.052  -4.479  -16.927 1.00 1.83  ? 33  LEU B HD12 1  
ATOM 2602   H HD13 . LEU B 2 33  ? -6.625  -5.514  -16.839 1.00 1.91  ? 33  LEU B HD13 1  
ATOM 2603   H HD21 . LEU B 2 33  ? -4.435  -4.514  -16.226 1.00 1.85  ? 33  LEU B HD21 1  
ATOM 2604   H HD22 . LEU B 2 33  ? -4.365  -2.897  -15.528 1.00 1.79  ? 33  LEU B HD22 1  
ATOM 2605   H HD23 . LEU B 2 33  ? -4.597  -3.099  -17.265 1.00 1.83  ? 33  LEU B HD23 1  
ATOM 2606   N N    . SER B 2 34  ? -8.590  -0.696  -19.002 1.00 1.79  ? 34  SER B N    1  
ATOM 2607   C CA   . SER B 2 34  ? -9.727  0.143   -19.355 1.00 1.78  ? 34  SER B CA   1  
ATOM 2608   C C    . SER B 2 34  ? -10.938 -0.211  -18.483 1.00 1.71  ? 34  SER B C    1  
ATOM 2609   O O    . SER B 2 34  ? -10.868 -1.124  -17.658 1.00 1.67  ? 34  SER B O    1  
ATOM 2610   C CB   . SER B 2 34  ? -10.063 -0.027  -20.840 1.00 1.86  ? 34  SER B CB   1  
ATOM 2611   O OG   . SER B 2 34  ? -8.888  -0.018  -21.629 1.00 2.04  ? 34  SER B OG   1  
ATOM 2612   H H    . SER B 2 34  ? -8.318  -1.420  -19.620 1.00 1.83  ? 34  SER B H    1  
ATOM 2613   H HA   . SER B 2 34  ? -9.453  1.170   -19.170 1.00 1.79  ? 34  SER B HA   1  
ATOM 2614   H HB2  . SER B 2 34  ? -10.572 -0.967  -20.989 1.00 2.00  ? 34  SER B HB2  1  
ATOM 2615   H HB3  . SER B 2 34  ? -10.702 0.783   -21.160 1.00 2.07  ? 34  SER B HB3  1  
ATOM 2616   H HG   . SER B 2 34  ? -8.387  -0.839  -21.468 1.00 2.28  ? 34  SER B HG   1  
ATOM 2617   N N    . VAL B 2 35  ? -12.045 0.500   -18.680 1.00 1.70  ? 35  VAL B N    1  
ATOM 2618   C CA   . VAL B 2 35  ? -13.261 0.280   -17.897 1.00 1.64  ? 35  VAL B CA   1  
ATOM 2619   C C    . VAL B 2 35  ? -13.720 -1.180  -17.937 1.00 1.63  ? 35  VAL B C    1  
ATOM 2620   O O    . VAL B 2 35  ? -13.858 -1.824  -16.895 1.00 1.58  ? 35  VAL B O    1  
ATOM 2621   C CB   . VAL B 2 35  ? -14.418 1.182   -18.384 1.00 1.66  ? 35  VAL B CB   1  
ATOM 2622   C CG1  . VAL B 2 35  ? -15.630 1.042   -17.473 1.00 1.60  ? 35  VAL B CG1  1  
ATOM 2623   C CG2  . VAL B 2 35  ? -13.978 2.636   -18.462 1.00 1.71  ? 35  VAL B CG2  1  
ATOM 2624   H H    . VAL B 2 35  ? -12.044 1.196   -19.371 1.00 1.75  ? 35  VAL B H    1  
ATOM 2625   H HA   . VAL B 2 35  ? -13.043 0.543   -16.872 1.00 1.60  ? 35  VAL B HA   1  
ATOM 2626   H HB   . VAL B 2 35  ? -14.703 0.862   -19.375 1.00 1.71  ? 35  VAL B HB   1  
ATOM 2627   H HG11 . VAL B 2 35  ? -15.942 0.008   -17.446 1.00 1.58  ? 35  VAL B HG11 1  
ATOM 2628   H HG12 . VAL B 2 35  ? -16.439 1.654   -17.850 1.00 1.63  ? 35  VAL B HG12 1  
ATOM 2629   H HG13 . VAL B 2 35  ? -15.369 1.365   -16.475 1.00 1.57  ? 35  VAL B HG13 1  
ATOM 2630   H HG21 . VAL B 2 35  ? -13.219 2.741   -19.222 1.00 1.74  ? 35  VAL B HG21 1  
ATOM 2631   H HG22 . VAL B 2 35  ? -13.576 2.941   -17.507 1.00 1.84  ? 35  VAL B HG22 1  
ATOM 2632   H HG23 . VAL B 2 35  ? -14.826 3.254   -18.711 1.00 1.84  ? 35  VAL B HG23 1  
ATOM 2633   N N    . ASN B 2 36  ? -13.939 -1.705  -19.139 1.00 1.70  ? 36  ASN B N    1  
ATOM 2634   C CA   . ASN B 2 36  ? -14.401 -3.083  -19.291 1.00 1.72  ? 36  ASN B CA   1  
ATOM 2635   C C    . ASN B 2 36  ? -13.366 -4.076  -18.786 1.00 1.72  ? 36  ASN B C    1  
ATOM 2636   O O    . ASN B 2 36  ? -13.707 -5.045  -18.117 1.00 1.70  ? 36  ASN B O    1  
ATOM 2637   C CB   . ASN B 2 36  ? -14.740 -3.385  -20.754 1.00 1.81  ? 36  ASN B CB   1  
ATOM 2638   C CG   . ASN B 2 36  ? -15.007 -4.862  -21.005 1.00 1.86  ? 36  ASN B CG   1  
ATOM 2639   O OD1  . ASN B 2 36  ? -16.105 -5.358  -20.752 1.00 1.90  ? 36  ASN B OD1  1  
ATOM 2640   N ND2  . ASN B 2 36  ? -14.015 -5.572  -21.524 1.00 1.97  ? 36  ASN B ND2  1  
ATOM 2641   H H    . ASN B 2 36  ? -13.779 -1.160  -19.940 1.00 1.75  ? 36  ASN B H    1  
ATOM 2642   H HA   . ASN B 2 36  ? -15.296 -3.192  -18.699 1.00 1.68  ? 36  ASN B HA   1  
ATOM 2643   H HB2  . ASN B 2 36  ? -15.622 -2.830  -21.032 1.00 1.83  ? 36  ASN B HB2  1  
ATOM 2644   H HB3  . ASN B 2 36  ? -13.915 -3.075  -21.379 1.00 1.86  ? 36  ASN B HB3  1  
ATOM 2645   H HD21 . ASN B 2 36  ? -13.169 -5.114  -21.714 1.00 2.02  ? 36  ASN B HD21 1  
ATOM 2646   H HD22 . ASN B 2 36  ? -14.167 -6.526  -21.696 1.00 2.06  ? 36  ASN B HD22 1  
ATOM 2647   N N    . GLU B 2 37  ? -12.102 -3.819  -19.089 1.00 1.76  ? 37  GLU B N    1  
ATOM 2648   C CA   . GLU B 2 37  ? -11.014 -4.703  -18.678 1.00 1.77  ? 37  GLU B CA   1  
ATOM 2649   C C    . GLU B 2 37  ? -10.917 -4.801  -17.156 1.00 1.71  ? 37  GLU B C    1  
ATOM 2650   O O    . GLU B 2 37  ? -10.775 -5.894  -16.602 1.00 1.71  ? 37  GLU B O    1  
ATOM 2651   C CB   . GLU B 2 37  ? -9.695  -4.203  -19.257 1.00 1.82  ? 37  GLU B CB   1  
ATOM 2652   C CG   . GLU B 2 37  ? -9.755  -3.964  -20.752 1.00 1.90  ? 37  GLU B CG   1  
ATOM 2653   C CD   . GLU B 2 37  ? -8.437  -3.488  -21.325 1.00 1.94  ? 37  GLU B CD   1  
ATOM 2654   O OE1  . GLU B 2 37  ? -7.968  -2.414  -20.909 1.00 1.93  ? 37  GLU B OE1  1  
ATOM 2655   O OE2  . GLU B 2 37  ? -7.890  -4.175  -22.213 1.00 1.99  ? 37  GLU B OE2  1  
ATOM 2656   H H    . GLU B 2 37  ? -11.890 -3.009  -19.599 1.00 1.78  ? 37  GLU B H    1  
ATOM 2657   H HA   . GLU B 2 37  ? -11.222 -5.686  -19.079 1.00 1.81  ? 37  GLU B HA   1  
ATOM 2658   H HB2  . GLU B 2 37  ? -9.430  -3.275  -18.772 1.00 1.79  ? 37  GLU B HB2  1  
ATOM 2659   H HB3  . GLU B 2 37  ? -8.927  -4.935  -19.061 1.00 1.84  ? 37  GLU B HB3  1  
ATOM 2660   H HG2  . GLU B 2 37  ? -10.030 -4.887  -21.240 1.00 1.95  ? 37  GLU B HG2  1  
ATOM 2661   H HG3  . GLU B 2 37  ? -10.506 -3.216  -20.950 1.00 1.90  ? 37  GLU B HG3  1  
ATOM 2662   N N    . PHE B 2 38  ? -11.006 -3.658  -16.485 1.00 1.65  ? 38  PHE B N    1  
ATOM 2663   C CA   . PHE B 2 38  ? -10.933 -3.610  -15.031 1.00 1.59  ? 38  PHE B CA   1  
ATOM 2664   C C    . PHE B 2 38  ? -12.098 -4.374  -14.401 1.00 1.57  ? 38  PHE B C    1  
ATOM 2665   O O    . PHE B 2 38  ? -11.916 -5.130  -13.444 1.00 1.55  ? 38  PHE B O    1  
ATOM 2666   C CB   . PHE B 2 38  ? -10.934 -2.153  -14.556 1.00 1.55  ? 38  PHE B CB   1  
ATOM 2667   C CG   . PHE B 2 38  ? -10.504 -1.979  -13.128 1.00 1.52  ? 38  PHE B CG   1  
ATOM 2668   C CD1  . PHE B 2 38  ? -9.187  -2.203  -12.756 1.00 1.54  ? 38  PHE B CD1  1  
ATOM 2669   C CD2  . PHE B 2 38  ? -11.411 -1.583  -12.159 1.00 1.53  ? 38  PHE B CD2  1  
ATOM 2670   C CE1  . PHE B 2 38  ? -8.786  -2.037  -11.444 1.00 1.55  ? 38  PHE B CE1  1  
ATOM 2671   C CE2  . PHE B 2 38  ? -11.017 -1.417  -10.847 1.00 1.54  ? 38  PHE B CE2  1  
ATOM 2672   C CZ   . PHE B 2 38  ? -9.702  -1.644  -10.489 1.00 1.54  ? 38  PHE B CZ   1  
ATOM 2673   H H    . PHE B 2 38  ? -11.114 -2.817  -16.986 1.00 1.66  ? 38  PHE B H    1  
ATOM 2674   H HA   . PHE B 2 38  ? -10.006 -4.077  -14.729 1.00 1.60  ? 38  PHE B HA   1  
ATOM 2675   H HB2  . PHE B 2 38  ? -10.262 -1.582  -15.176 1.00 1.59  ? 38  PHE B HB2  1  
ATOM 2676   H HB3  . PHE B 2 38  ? -11.933 -1.753  -14.656 1.00 1.54  ? 38  PHE B HB3  1  
ATOM 2677   H HD1  . PHE B 2 38  ? -8.470  -2.511  -13.504 1.00 1.58  ? 38  PHE B HD1  1  
ATOM 2678   H HD2  . PHE B 2 38  ? -12.438 -1.405  -12.437 1.00 1.55  ? 38  PHE B HD2  1  
ATOM 2679   H HE1  . PHE B 2 38  ? -7.760  -2.216  -11.165 1.00 1.60  ? 38  PHE B HE1  1  
ATOM 2680   H HE2  . PHE B 2 38  ? -11.736 -1.109  -10.101 1.00 1.57  ? 38  PHE B HE2  1  
ATOM 2681   H HZ   . PHE B 2 38  ? -9.390  -1.513  -9.462  1.00 1.58  ? 38  PHE B HZ   1  
ATOM 2682   N N    . LYS B 2 39  ? -13.288 -4.195  -14.960 1.00 1.57  ? 39  LYS B N    1  
ATOM 2683   C CA   . LYS B 2 39  ? -14.479 -4.867  -14.451 1.00 1.56  ? 39  LYS B CA   1  
ATOM 2684   C C    . LYS B 2 39  ? -14.456 -6.356  -14.790 1.00 1.60  ? 39  LYS B C    1  
ATOM 2685   O O    . LYS B 2 39  ? -14.906 -7.187  -14.000 1.00 1.59  ? 39  LYS B O    1  
ATOM 2686   C CB   . LYS B 2 39  ? -15.744 -4.224  -15.022 1.00 1.57  ? 39  LYS B CB   1  
ATOM 2687   C CG   . LYS B 2 39  ? -17.026 -4.734  -14.382 1.00 1.57  ? 39  LYS B CG   1  
ATOM 2688   C CD   . LYS B 2 39  ? -18.219 -3.884  -14.771 1.00 1.60  ? 39  LYS B CD   1  
ATOM 2689   C CE   . LYS B 2 39  ? -19.485 -4.353  -14.071 1.00 1.66  ? 39  LYS B CE   1  
ATOM 2690   N NZ   . LYS B 2 39  ? -20.670 -3.565  -14.495 1.00 1.82  ? 39  LYS B NZ   1  
ATOM 2691   H H    . LYS B 2 39  ? -13.369 -3.593  -15.733 1.00 1.60  ? 39  LYS B H    1  
ATOM 2692   H HA   . LYS B 2 39  ? -14.483 -4.756  -13.378 1.00 1.53  ? 39  LYS B HA   1  
ATOM 2693   H HB2  . LYS B 2 39  ? -15.691 -3.155  -14.871 1.00 1.57  ? 39  LYS B HB2  1  
ATOM 2694   H HB3  . LYS B 2 39  ? -15.790 -4.426  -16.082 1.00 1.61  ? 39  LYS B HB3  1  
ATOM 2695   H HG2  . LYS B 2 39  ? -17.201 -5.750  -14.708 1.00 1.65  ? 39  LYS B HG2  1  
ATOM 2696   H HG3  . LYS B 2 39  ? -16.917 -4.715  -13.307 1.00 1.60  ? 39  LYS B HG3  1  
ATOM 2697   H HD2  . LYS B 2 39  ? -18.023 -2.859  -14.494 1.00 1.64  ? 39  LYS B HD2  1  
ATOM 2698   H HD3  . LYS B 2 39  ? -18.362 -3.952  -15.839 1.00 1.67  ? 39  LYS B HD3  1  
ATOM 2699   H HE2  . LYS B 2 39  ? -19.651 -5.393  -14.311 1.00 1.70  ? 39  LYS B HE2  1  
ATOM 2700   H HE3  . LYS B 2 39  ? -19.353 -4.246  -13.004 1.00 1.68  ? 39  LYS B HE3  1  
ATOM 2701   H HZ1  . LYS B 2 39  ? -20.470 -2.546  -14.418 1.00 1.99  ? 39  LYS B HZ1  1  
ATOM 2702   H HZ2  . LYS B 2 39  ? -21.486 -3.790  -13.895 1.00 2.07  ? 39  LYS B HZ2  1  
ATOM 2703   H HZ3  . LYS B 2 39  ? -20.910 -3.783  -15.484 1.00 2.13  ? 39  LYS B HZ3  1  
ATOM 2704   N N    . GLU B 2 40  ? -13.923 -6.683  -15.961 1.00 1.65  ? 40  GLU B N    1  
ATOM 2705   C CA   . GLU B 2 40  ? -13.831 -8.068  -16.420 1.00 1.70  ? 40  GLU B CA   1  
ATOM 2706   C C    . GLU B 2 40  ? -12.957 -8.897  -15.482 1.00 1.70  ? 40  GLU B C    1  
ATOM 2707   O O    . GLU B 2 40  ? -13.172 -10.097 -15.316 1.00 1.73  ? 40  GLU B O    1  
ATOM 2708   C CB   . GLU B 2 40  ? -13.260 -8.111  -17.843 1.00 1.77  ? 40  GLU B CB   1  
ATOM 2709   C CG   . GLU B 2 40  ? -13.500 -9.427  -18.565 1.00 1.86  ? 40  GLU B CG   1  
ATOM 2710   C CD   . GLU B 2 40  ? -12.904 -9.447  -19.958 1.00 1.95  ? 40  GLU B CD   1  
ATOM 2711   O OE1  . GLU B 2 40  ? -11.715 -9.796  -20.100 1.00 2.15  ? 40  GLU B OE1  1  
ATOM 2712   O OE2  . GLU B 2 40  ? -13.629 -9.124  -20.926 1.00 2.22  ? 40  GLU B OE2  1  
ATOM 2713   H H    . GLU B 2 40  ? -13.587 -5.967  -16.545 1.00 1.67  ? 40  GLU B H    1  
ATOM 2714   H HA   . GLU B 2 40  ? -14.828 -8.480  -16.427 1.00 1.70  ? 40  GLU B HA   1  
ATOM 2715   H HB2  . GLU B 2 40  ? -13.716 -7.322  -18.423 1.00 1.85  ? 40  GLU B HB2  1  
ATOM 2716   H HB3  . GLU B 2 40  ? -12.193 -7.940  -17.797 1.00 1.88  ? 40  GLU B HB3  1  
ATOM 2717   H HG2  . GLU B 2 40  ? -13.057 -10.225 -17.990 1.00 2.06  ? 40  GLU B HG2  1  
ATOM 2718   H HG3  . GLU B 2 40  ? -14.565 -9.589  -18.644 1.00 1.96  ? 40  GLU B HG3  1  
ATOM 2719   N N    . LEU B 2 41  ? -11.981 -8.246  -14.865 1.00 1.67  ? 41  LEU B N    1  
ATOM 2720   C CA   . LEU B 2 41  ? -11.071 -8.909  -13.943 1.00 1.67  ? 41  LEU B CA   1  
ATOM 2721   C C    . LEU B 2 41  ? -11.799 -9.335  -12.666 1.00 1.63  ? 41  LEU B C    1  
ATOM 2722   O O    . LEU B 2 41  ? -11.818 -10.519 -12.314 1.00 1.67  ? 41  LEU B O    1  
ATOM 2723   C CB   . LEU B 2 41  ? -9.899  -7.966  -13.609 1.00 1.65  ? 41  LEU B CB   1  
ATOM 2724   C CG   . LEU B 2 41  ? -8.684  -8.599  -12.910 1.00 1.66  ? 41  LEU B CG   1  
ATOM 2725   C CD1  . LEU B 2 41  ? -8.871  -8.626  -11.400 1.00 1.61  ? 41  LEU B CD1  1  
ATOM 2726   C CD2  . LEU B 2 41  ? -8.419  -10.003 -13.439 1.00 1.73  ? 41  LEU B CD2  1  
ATOM 2727   H H    . LEU B 2 41  ? -11.865 -7.288  -15.043 1.00 1.66  ? 41  LEU B H    1  
ATOM 2728   H HA   . LEU B 2 41  ? -10.686 -9.789  -14.434 1.00 1.72  ? 41  LEU B HA   1  
ATOM 2729   H HB2  . LEU B 2 41  ? -9.560  -7.521  -14.531 1.00 1.68  ? 41  LEU B HB2  1  
ATOM 2730   H HB3  . LEU B 2 41  ? -10.277 -7.178  -12.973 1.00 1.60  ? 41  LEU B HB3  1  
ATOM 2731   H HG   . LEU B 2 41  ? -7.811  -7.996  -13.120 1.00 1.67  ? 41  LEU B HG   1  
ATOM 2732   H HD11 . LEU B 2 41  ? -9.698  -9.275  -11.152 1.00 1.72  ? 41  LEU B HD11 1  
ATOM 2733   H HD12 . LEU B 2 41  ? -9.077  -7.628  -11.042 1.00 1.62  ? 41  LEU B HD12 1  
ATOM 2734   H HD13 . LEU B 2 41  ? -7.972  -8.998  -10.932 1.00 1.69  ? 41  LEU B HD13 1  
ATOM 2735   H HD21 . LEU B 2 41  ? -9.243  -10.648 -13.175 1.00 1.79  ? 41  LEU B HD21 1  
ATOM 2736   H HD22 . LEU B 2 41  ? -7.509  -10.387 -13.003 1.00 1.76  ? 41  LEU B HD22 1  
ATOM 2737   H HD23 . LEU B 2 41  ? -8.317  -9.971  -14.515 1.00 1.75  ? 41  LEU B HD23 1  
ATOM 2738   N N    . VAL B 2 42  ? -12.417 -8.371  -11.990 1.00 1.56  ? 42  VAL B N    1  
ATOM 2739   C CA   . VAL B 2 42  ? -13.119 -8.649  -10.741 1.00 1.53  ? 42  VAL B CA   1  
ATOM 2740   C C    . VAL B 2 42  ? -14.353 -9.523  -10.957 1.00 1.55  ? 42  VAL B C    1  
ATOM 2741   O O    . VAL B 2 42  ? -14.553 -10.510 -10.247 1.00 1.57  ? 42  VAL B O    1  
ATOM 2742   C CB   . VAL B 2 42  ? -13.528 -7.355  -10.003 1.00 1.48  ? 42  VAL B CB   1  
ATOM 2743   C CG1  . VAL B 2 42  ? -12.318 -6.729  -9.328  1.00 1.58  ? 42  VAL B CG1  1  
ATOM 2744   C CG2  . VAL B 2 42  ? -14.183 -6.355  -10.948 1.00 1.55  ? 42  VAL B CG2  1  
ATOM 2745   H H    . VAL B 2 42  ? -12.404 -7.457  -12.342 1.00 1.54  ? 42  VAL B H    1  
ATOM 2746   H HA   . VAL B 2 42  ? -12.432 -9.188  -10.107 1.00 1.55  ? 42  VAL B HA   1  
ATOM 2747   H HB   . VAL B 2 42  ? -14.244 -7.617  -9.236  1.00 1.53  ? 42  VAL B HB   1  
ATOM 2748   H HG11 . VAL B 2 42  ? -11.600 -6.437  -10.079 1.00 1.75  ? 42  VAL B HG11 1  
ATOM 2749   H HG12 . VAL B 2 42  ? -11.867 -7.447  -8.658  1.00 1.73  ? 42  VAL B HG12 1  
ATOM 2750   H HG13 . VAL B 2 42  ? -12.628 -5.859  -8.768  1.00 1.64  ? 42  VAL B HG13 1  
ATOM 2751   H HG21 . VAL B 2 42  ? -13.464 -6.034  -11.686 1.00 1.80  ? 42  VAL B HG21 1  
ATOM 2752   H HG22 . VAL B 2 42  ? -14.527 -5.502  -10.385 1.00 1.61  ? 42  VAL B HG22 1  
ATOM 2753   H HG23 . VAL B 2 42  ? -15.023 -6.822  -11.442 1.00 1.85  ? 42  VAL B HG23 1  
ATOM 2754   N N    . THR B 2 43  ? -15.153 -9.187  -11.960 1.00 1.56  ? 43  THR B N    1  
ATOM 2755   C CA   . THR B 2 43  ? -16.368 -9.935  -12.263 1.00 1.58  ? 43  THR B CA   1  
ATOM 2756   C C    . THR B 2 43  ? -16.040 -11.231 -13.005 1.00 1.65  ? 43  THR B C    1  
ATOM 2757   O O    . THR B 2 43  ? -16.683 -11.578 -13.995 1.00 1.83  ? 43  THR B O    1  
ATOM 2758   C CB   . THR B 2 43  ? -17.339 -9.082  -13.110 1.00 1.59  ? 43  THR B CB   1  
ATOM 2759   O OG1  . THR B 2 43  ? -17.216 -7.698  -12.748 1.00 1.55  ? 43  THR B OG1  1  
ATOM 2760   C CG2  . THR B 2 43  ? -18.782 -9.528  -12.912 1.00 1.62  ? 43  THR B CG2  1  
ATOM 2761   H H    . THR B 2 43  ? -14.921 -8.414  -12.515 1.00 1.56  ? 43  THR B H    1  
ATOM 2762   H HA   . THR B 2 43  ? -16.851 -10.178 -11.329 1.00 1.56  ? 43  THR B HA   1  
ATOM 2763   H HB   . THR B 2 43  ? -17.081 -9.197  -14.153 1.00 1.63  ? 43  THR B HB   1  
ATOM 2764   H HG1  . THR B 2 43  ? -16.472 -7.310  -13.225 1.00 1.67  ? 43  THR B HG1  1  
ATOM 2765   H HG21 . THR B 2 43  ? -18.849 -10.598 -13.035 1.00 1.72  ? 43  THR B HG21 1  
ATOM 2766   H HG22 . THR B 2 43  ? -19.412 -9.042  -13.641 1.00 1.65  ? 43  THR B HG22 1  
ATOM 2767   H HG23 . THR B 2 43  ? -19.108 -9.258  -11.918 1.00 1.76  ? 43  THR B HG23 1  
ATOM 2768   N N    . GLN B 2 44  ? -15.045 -11.957 -12.513 1.00 1.70  ? 44  GLN B N    1  
ATOM 2769   C CA   . GLN B 2 44  ? -14.636 -13.204 -13.133 1.00 1.75  ? 44  GLN B CA   1  
ATOM 2770   C C    . GLN B 2 44  ? -13.718 -13.993 -12.212 1.00 1.78  ? 44  GLN B C    1  
ATOM 2771   O O    . GLN B 2 44  ? -14.040 -15.113 -11.816 1.00 1.83  ? 44  GLN B O    1  
ATOM 2772   C CB   . GLN B 2 44  ? -13.920 -12.927 -14.456 1.00 1.80  ? 44  GLN B CB   1  
ATOM 2773   C CG   . GLN B 2 44  ? -13.829 -14.136 -15.373 1.00 1.94  ? 44  GLN B CG   1  
ATOM 2774   C CD   . GLN B 2 44  ? -13.018 -13.863 -16.628 1.00 1.98  ? 44  GLN B CD   1  
ATOM 2775   O OE1  . GLN B 2 44  ? -12.430 -14.774 -17.213 1.00 2.18  ? 44  GLN B OE1  1  
ATOM 2776   N NE2  . GLN B 2 44  ? -12.977 -12.609 -17.053 1.00 1.96  ? 44  GLN B NE2  1  
ATOM 2777   H H    . GLN B 2 44  ? -14.579 -11.645 -11.705 1.00 1.80  ? 44  GLN B H    1  
ATOM 2778   H HA   . GLN B 2 44  ? -15.523 -13.785 -13.328 1.00 1.77  ? 44  GLN B HA   1  
ATOM 2779   H HB2  . GLN B 2 44  ? -14.450 -12.146 -14.981 1.00 1.90  ? 44  GLN B HB2  1  
ATOM 2780   H HB3  . GLN B 2 44  ? -12.916 -12.588 -14.246 1.00 1.92  ? 44  GLN B HB3  1  
ATOM 2781   H HG2  . GLN B 2 44  ? -13.366 -14.947 -14.833 1.00 2.10  ? 44  GLN B HG2  1  
ATOM 2782   H HG3  . GLN B 2 44  ? -14.829 -14.424 -15.666 1.00 2.12  ? 44  GLN B HG3  1  
ATOM 2783   H HE21 . GLN B 2 44  ? -13.466 -11.925 -16.540 1.00 2.01  ? 44  GLN B HE21 1  
ATOM 2784   H HE22 . GLN B 2 44  ? -12.459 -12.409 -17.859 1.00 2.01  ? 44  GLN B HE22 1  
ATOM 2785   N N    . GLN B 2 45  ? -12.589 -13.394 -11.846 1.00 1.76  ? 45  GLN B N    1  
ATOM 2786   C CA   . GLN B 2 45  ? -11.610 -14.073 -11.001 1.00 1.80  ? 45  GLN B CA   1  
ATOM 2787   C C    . GLN B 2 45  ? -11.518 -13.483 -9.597  1.00 1.74  ? 45  GLN B C    1  
ATOM 2788   O O    . GLN B 2 45  ? -10.563 -13.761 -8.876  1.00 1.78  ? 45  GLN B O    1  
ATOM 2789   C CB   . GLN B 2 45  ? -10.234 -14.033 -11.663 1.00 1.86  ? 45  GLN B CB   1  
ATOM 2790   C CG   . GLN B 2 45  ? -9.943  -15.242 -12.531 1.00 1.98  ? 45  GLN B CG   1  
ATOM 2791   C CD   . GLN B 2 45  ? -8.706  -15.063 -13.388 1.00 2.12  ? 45  GLN B CD   1  
ATOM 2792   O OE1  . GLN B 2 45  ? -8.791  -14.648 -14.541 1.00 2.20  ? 45  GLN B OE1  1  
ATOM 2793   N NE2  . GLN B 2 45  ? -7.550  -15.371 -12.824 1.00 2.31  ? 45  GLN B NE2  1  
ATOM 2794   H H    . GLN B 2 45  ? -12.406 -12.474 -12.151 1.00 1.74  ? 45  GLN B H    1  
ATOM 2795   H HA   . GLN B 2 45  ? -11.917 -15.104 -10.917 1.00 1.85  ? 45  GLN B HA   1  
ATOM 2796   H HB2  . GLN B 2 45  ? -10.168 -13.147 -12.280 1.00 1.84  ? 45  GLN B HB2  1  
ATOM 2797   H HB3  . GLN B 2 45  ? -9.479  -13.979 -10.891 1.00 1.90  ? 45  GLN B HB3  1  
ATOM 2798   H HG2  . GLN B 2 45  ? -9.801  -16.103 -11.894 1.00 2.12  ? 45  GLN B HG2  1  
ATOM 2799   H HG3  . GLN B 2 45  ? -10.790 -15.417 -13.181 1.00 2.00  ? 45  GLN B HG3  1  
ATOM 2800   H HE21 . GLN B 2 45  ? -7.557  -15.695 -11.902 1.00 2.37  ? 45  GLN B HE21 1  
ATOM 2801   H HE22 . GLN B 2 45  ? -6.729  -15.262 -13.354 1.00 2.48  ? 45  GLN B HE22 1  
ATOM 2802   N N    . LEU B 2 46  ? -12.495 -12.682 -9.193  1.00 1.66  ? 46  LEU B N    1  
ATOM 2803   C CA   . LEU B 2 46  ? -12.459 -12.098 -7.857  1.00 1.61  ? 46  LEU B CA   1  
ATOM 2804   C C    . LEU B 2 46  ? -13.859 -11.797 -7.315  1.00 1.54  ? 46  LEU B C    1  
ATOM 2805   O O    . LEU B 2 46  ? -14.161 -10.657 -6.973  1.00 1.49  ? 46  LEU B O    1  
ATOM 2806   C CB   . LEU B 2 46  ? -11.621 -10.820 -7.865  1.00 1.61  ? 46  LEU B CB   1  
ATOM 2807   C CG   . LEU B 2 46  ? -11.129 -10.361 -6.492  1.00 1.61  ? 46  LEU B CG   1  
ATOM 2808   C CD1  . LEU B 2 46  ? -9.994  -11.248 -6.004  1.00 1.71  ? 46  LEU B CD1  1  
ATOM 2809   C CD2  . LEU B 2 46  ? -10.693 -8.908  -6.549  1.00 1.63  ? 46  LEU B CD2  1  
ATOM 2810   H H    . LEU B 2 46  ? -13.243 -12.480 -9.792  1.00 1.65  ? 46  LEU B H    1  
ATOM 2811   H HA   . LEU B 2 46  ? -11.986 -12.816 -7.204  1.00 1.66  ? 46  LEU B HA   1  
ATOM 2812   H HB2  . LEU B 2 46  ? -10.760 -10.981 -8.498  1.00 1.68  ? 46  LEU B HB2  1  
ATOM 2813   H HB3  . LEU B 2 46  ? -12.218 -10.028 -8.291  1.00 1.57  ? 46  LEU B HB3  1  
ATOM 2814   H HG   . LEU B 2 46  ? -11.940 -10.438 -5.785  1.00 1.57  ? 46  LEU B HG   1  
ATOM 2815   H HD11 . LEU B 2 46  ? -9.191  -11.239 -6.727  1.00 1.81  ? 46  LEU B HD11 1  
ATOM 2816   H HD12 . LEU B 2 46  ? -10.355 -12.259 -5.880  1.00 1.75  ? 46  LEU B HD12 1  
ATOM 2817   H HD13 . LEU B 2 46  ? -9.628  -10.879 -5.058  1.00 1.91  ? 46  LEU B HD13 1  
ATOM 2818   H HD21 . LEU B 2 46  ? -10.260 -8.624  -5.601  1.00 1.78  ? 46  LEU B HD21 1  
ATOM 2819   H HD22 . LEU B 2 46  ? -11.551 -8.283  -6.752  1.00 1.69  ? 46  LEU B HD22 1  
ATOM 2820   H HD23 . LEU B 2 46  ? -9.961  -8.781  -7.333  1.00 1.68  ? 46  LEU B HD23 1  
ATOM 2821   N N    . PRO B 2 47  ? -14.736 -12.812 -7.219  1.00 1.57  ? 47  PRO B N    1  
ATOM 2822   C CA   . PRO B 2 47  ? -16.085 -12.641 -6.706  1.00 1.53  ? 47  PRO B CA   1  
ATOM 2823   C C    . PRO B 2 47  ? -16.199 -13.071 -5.243  1.00 1.51  ? 47  PRO B C    1  
ATOM 2824   O O    . PRO B 2 47  ? -17.297 -13.279 -4.729  1.00 1.54  ? 47  PRO B O    1  
ATOM 2825   C CB   . PRO B 2 47  ? -16.869 -13.595 -7.599  1.00 1.55  ? 47  PRO B CB   1  
ATOM 2826   C CG   . PRO B 2 47  ? -15.918 -14.721 -7.893  1.00 1.66  ? 47  PRO B CG   1  
ATOM 2827   C CD   . PRO B 2 47  ? -14.516 -14.210 -7.623  1.00 1.66  ? 47  PRO B CD   1  
ATOM 2828   H HA   . PRO B 2 47  ? -16.447 -11.631 -6.832  1.00 1.52  ? 47  PRO B HA   1  
ATOM 2829   H HB2  . PRO B 2 47  ? -17.747 -13.943 -7.073  1.00 1.54  ? 47  PRO B HB2  1  
ATOM 2830   H HB3  . PRO B 2 47  ? -17.165 -13.086 -8.503  1.00 1.54  ? 47  PRO B HB3  1  
ATOM 2831   H HG2  . PRO B 2 47  ? -16.135 -15.557 -7.245  1.00 1.73  ? 47  PRO B HG2  1  
ATOM 2832   H HG3  . PRO B 2 47  ? -16.014 -15.016 -8.927  1.00 1.71  ? 47  PRO B HG3  1  
ATOM 2833   H HD2  . PRO B 2 47  ? -14.056 -14.771 -6.823  1.00 1.70  ? 47  PRO B HD2  1  
ATOM 2834   H HD3  . PRO B 2 47  ? -13.916 -14.262 -8.518  1.00 1.71  ? 47  PRO B HD3  1  
ATOM 2835   N N    . HIS B 2 48  ? -15.054 -13.202 -4.581  1.00 1.58  ? 48  HIS B N    1  
ATOM 2836   C CA   . HIS B 2 48  ? -15.018 -13.643 -3.192  1.00 1.57  ? 48  HIS B CA   1  
ATOM 2837   C C    . HIS B 2 48  ? -14.420 -12.578 -2.270  1.00 1.55  ? 48  HIS B C    1  
ATOM 2838   O O    . HIS B 2 48  ? -15.055 -12.173 -1.294  1.00 1.52  ? 48  HIS B O    1  
ATOM 2839   C CB   . HIS B 2 48  ? -14.222 -14.948 -3.103  1.00 1.61  ? 48  HIS B CB   1  
ATOM 2840   C CG   . HIS B 2 48  ? -13.976 -15.437 -1.709  1.00 1.60  ? 48  HIS B CG   1  
ATOM 2841   N ND1  . HIS B 2 48  ? -12.741 -15.381 -1.110  1.00 1.60  ? 48  HIS B ND1  1  
ATOM 2842   C CD2  . HIS B 2 48  ? -14.808 -15.994 -0.798  1.00 1.64  ? 48  HIS B CD2  1  
ATOM 2843   C CE1  . HIS B 2 48  ? -12.815 -15.886 0.103   1.00 1.62  ? 48  HIS B CE1  1  
ATOM 2844   N NE2  . HIS B 2 48  ? -14.060 -16.267 0.322   1.00 1.64  ? 48  HIS B NE2  1  
ATOM 2845   H H    . HIS B 2 48  ? -14.215 -12.995 -5.040  1.00 1.72  ? 48  HIS B H    1  
ATOM 2846   H HA   . HIS B 2 48  ? -16.035 -13.836 -2.883  1.00 1.57  ? 48  HIS B HA   1  
ATOM 2847   H HB2  . HIS B 2 48  ? -14.761 -15.720 -3.629  1.00 1.64  ? 48  HIS B HB2  1  
ATOM 2848   H HB3  . HIS B 2 48  ? -13.262 -14.806 -3.577  1.00 1.62  ? 48  HIS B HB3  1  
ATOM 2849   H HD1  . HIS B 2 48  ? -11.912 -15.021 -1.531  1.00 1.61  ? 48  HIS B HD1  1  
ATOM 2850   H HD2  . HIS B 2 48  ? -15.866 -16.181 -0.923  1.00 1.68  ? 48  HIS B HD2  1  
ATOM 2851   H HE1  . HIS B 2 48  ? -11.999 -15.970 0.804   1.00 1.63  ? 48  HIS B HE1  1  
ATOM 2852   H HE2  . HIS B 2 48  ? -14.341 -16.857 1.058   1.00 1.68  ? 48  HIS B HE2  1  
ATOM 2853   N N    . LEU B 2 49  ? -13.199 -12.141 -2.571  1.00 1.60  ? 49  LEU B N    1  
ATOM 2854   C CA   . LEU B 2 49  ? -12.518 -11.131 -1.762  1.00 1.60  ? 49  LEU B CA   1  
ATOM 2855   C C    . LEU B 2 49  ? -13.317 -9.828  -1.729  1.00 1.61  ? 49  LEU B C    1  
ATOM 2856   O O    . LEU B 2 49  ? -13.515 -9.231  -0.665  1.00 1.61  ? 49  LEU B O    1  
ATOM 2857   C CB   . LEU B 2 49  ? -11.112 -10.881 -2.311  1.00 1.62  ? 49  LEU B CB   1  
ATOM 2858   C CG   . LEU B 2 49  ? -10.148 -10.171 -1.355  1.00 1.57  ? 49  LEU B CG   1  
ATOM 2859   C CD1  . LEU B 2 49  ? -10.087 -10.892 -0.016  1.00 1.62  ? 49  LEU B CD1  1  
ATOM 2860   C CD2  . LEU B 2 49  ? -8.763  -10.090 -1.973  1.00 1.60  ? 49  LEU B CD2  1  
ATOM 2861   H H    . LEU B 2 49  ? -12.733 -12.521 -3.345  1.00 1.65  ? 49  LEU B H    1  
ATOM 2862   H HA   . LEU B 2 49  ? -12.438 -11.514 -0.753  1.00 1.59  ? 49  LEU B HA   1  
ATOM 2863   H HB2  . LEU B 2 49  ? -10.679 -11.836 -2.577  1.00 1.70  ? 49  LEU B HB2  1  
ATOM 2864   H HB3  . LEU B 2 49  ? -11.200 -10.283 -3.205  1.00 1.63  ? 49  LEU B HB3  1  
ATOM 2865   H HG   . LEU B 2 49  ? -10.500 -9.164  -1.180  1.00 1.53  ? 49  LEU B HG   1  
ATOM 2866   H HD11 . LEU B 2 49  ? -9.330  -10.436 0.603   1.00 1.74  ? 49  LEU B HD11 1  
ATOM 2867   H HD12 . LEU B 2 49  ? -9.841  -11.932 -0.178  1.00 1.83  ? 49  LEU B HD12 1  
ATOM 2868   H HD13 . LEU B 2 49  ? -11.045 -10.821 0.477   1.00 1.66  ? 49  LEU B HD13 1  
ATOM 2869   H HD21 . LEU B 2 49  ? -8.114  -9.509  -1.332  1.00 1.65  ? 49  LEU B HD21 1  
ATOM 2870   H HD22 . LEU B 2 49  ? -8.829  -9.618  -2.941  1.00 1.59  ? 49  LEU B HD22 1  
ATOM 2871   H HD23 . LEU B 2 49  ? -8.361  -11.086 -2.085  1.00 1.74  ? 49  LEU B HD23 1  
ATOM 2872   N N    . LEU B 2 50  ? -13.765 -9.397  -2.899  1.00 1.66  ? 50  LEU B N    1  
ATOM 2873   C CA   . LEU B 2 50  ? -14.563 -8.188  -3.023  1.00 1.69  ? 50  LEU B CA   1  
ATOM 2874   C C    . LEU B 2 50  ? -15.823 -8.500  -3.807  1.00 1.69  ? 50  LEU B C    1  
ATOM 2875   O O    . LEU B 2 50  ? -15.766 -8.795  -4.997  1.00 1.80  ? 50  LEU B O    1  
ATOM 2876   C CB   . LEU B 2 50  ? -13.780 -7.068  -3.714  1.00 1.76  ? 50  LEU B CB   1  
ATOM 2877   C CG   . LEU B 2 50  ? -12.995 -6.138  -2.783  1.00 1.81  ? 50  LEU B CG   1  
ATOM 2878   C CD1  . LEU B 2 50  ? -12.483 -4.932  -3.551  1.00 2.01  ? 50  LEU B CD1  1  
ATOM 2879   C CD2  . LEU B 2 50  ? -13.857 -5.685  -1.611  1.00 1.95  ? 50  LEU B CD2  1  
ATOM 2880   H H    . LEU B 2 50  ? -13.559 -9.911  -3.707  1.00 1.70  ? 50  LEU B H    1  
ATOM 2881   H HA   . LEU B 2 50  ? -14.840 -7.867  -2.030  1.00 1.69  ? 50  LEU B HA   1  
ATOM 2882   H HB2  . LEU B 2 50  ? -13.083 -7.522  -4.404  1.00 1.95  ? 50  LEU B HB2  1  
ATOM 2883   H HB3  . LEU B 2 50  ? -14.476 -6.467  -4.280  1.00 1.82  ? 50  LEU B HB3  1  
ATOM 2884   H HG   . LEU B 2 50  ? -12.141 -6.669  -2.388  1.00 2.11  ? 50  LEU B HG   1  
ATOM 2885   H HD11 . LEU B 2 50  ? -11.860 -4.330  -2.904  1.00 2.12  ? 50  LEU B HD11 1  
ATOM 2886   H HD12 . LEU B 2 50  ? -13.320 -4.342  -3.891  1.00 2.11  ? 50  LEU B HD12 1  
ATOM 2887   H HD13 . LEU B 2 50  ? -11.907 -5.263  -4.403  1.00 2.34  ? 50  LEU B HD13 1  
ATOM 2888   H HD21 . LEU B 2 50  ? -13.398 -4.829  -1.137  1.00 2.17  ? 50  LEU B HD21 1  
ATOM 2889   H HD22 . LEU B 2 50  ? -13.944 -6.485  -0.893  1.00 2.21  ? 50  LEU B HD22 1  
ATOM 2890   H HD23 . LEU B 2 50  ? -14.839 -5.415  -1.971  1.00 2.14  ? 50  LEU B HD23 1  
ATOM 2891   N N    . LYS B 2 51  ? -16.960 -8.454  -3.141  1.00 1.63  ? 51  LYS B N    1  
ATOM 2892   C CA   . LYS B 2 51  ? -18.218 -8.751  -3.795  1.00 1.62  ? 51  LYS B CA   1  
ATOM 2893   C C    . LYS B 2 51  ? -18.944 -7.472  -4.205  1.00 1.63  ? 51  LYS B C    1  
ATOM 2894   O O    . LYS B 2 51  ? -19.798 -6.961  -3.478  1.00 1.95  ? 51  LYS B O    1  
ATOM 2895   C CB   . LYS B 2 51  ? -19.104 -9.639  -2.903  1.00 1.59  ? 51  LYS B CB   1  
ATOM 2896   C CG   . LYS B 2 51  ? -18.922 -9.441  -1.396  1.00 1.67  ? 51  LYS B CG   1  
ATOM 2897   C CD   . LYS B 2 51  ? -19.767 -8.290  -0.856  1.00 1.79  ? 51  LYS B CD   1  
ATOM 2898   C CE   . LYS B 2 51  ? -21.262 -8.550  -1.013  1.00 2.00  ? 51  LYS B CE   1  
ATOM 2899   N NZ   . LYS B 2 51  ? -22.006 -7.313  -1.372  1.00 2.50  ? 51  LYS B NZ   1  
ATOM 2900   H H    . LYS B 2 51  ? -16.953 -8.208  -2.195  1.00 1.63  ? 51  LYS B H    1  
ATOM 2901   H HA   . LYS B 2 51  ? -17.983 -9.302  -4.695  1.00 1.65  ? 51  LYS B HA   1  
ATOM 2902   H HB2  . LYS B 2 51  ? -20.135 -9.439  -3.145  1.00 1.57  ? 51  LYS B HB2  1  
ATOM 2903   H HB3  . LYS B 2 51  ? -18.891 -10.673 -3.135  1.00 1.63  ? 51  LYS B HB3  1  
ATOM 2904   H HG2  . LYS B 2 51  ? -19.212 -10.350 -0.890  1.00 1.82  ? 51  LYS B HG2  1  
ATOM 2905   H HG3  . LYS B 2 51  ? -17.881 -9.238  -1.192  1.00 1.81  ? 51  LYS B HG3  1  
ATOM 2906   H HD2  . LYS B 2 51  ? -19.546 -8.157  0.193   1.00 1.86  ? 51  LYS B HD2  1  
ATOM 2907   H HD3  . LYS B 2 51  ? -19.511 -7.388  -1.394  1.00 1.95  ? 51  LYS B HD3  1  
ATOM 2908   H HE2  . LYS B 2 51  ? -21.412 -9.287  -1.784  1.00 1.99  ? 51  LYS B HE2  1  
ATOM 2909   H HE3  . LYS B 2 51  ? -21.646 -8.929  -0.076  1.00 2.12  ? 51  LYS B HE3  1  
ATOM 2910   H HZ1  . LYS B 2 51  ? -22.039 -6.665  -0.549  1.00 2.63  ? 51  LYS B HZ1  1  
ATOM 2911   H HZ2  . LYS B 2 51  ? -22.986 -7.548  -1.656  1.00 2.89  ? 51  LYS B HZ2  1  
ATOM 2912   H HZ3  . LYS B 2 51  ? -21.536 -6.828  -2.164  1.00 2.80  ? 51  LYS B HZ3  1  
ATOM 2913   N N    . ASP B 2 52  ? -18.591 -6.955  -5.373  1.00 1.37  ? 52  ASP B N    1  
ATOM 2914   C CA   . ASP B 2 52  ? -19.208 -5.742  -5.895  1.00 1.35  ? 52  ASP B CA   1  
ATOM 2915   C C    . ASP B 2 52  ? -19.178 -5.747  -7.415  1.00 1.38  ? 52  ASP B C    1  
ATOM 2916   O O    . ASP B 2 52  ? -18.113 -5.669  -8.026  1.00 1.45  ? 52  ASP B O    1  
ATOM 2917   C CB   . ASP B 2 52  ? -18.491 -4.501  -5.365  1.00 1.33  ? 52  ASP B CB   1  
ATOM 2918   C CG   . ASP B 2 52  ? -19.372 -3.267  -5.373  1.00 1.42  ? 52  ASP B CG   1  
ATOM 2919   O OD1  . ASP B 2 52  ? -20.018 -2.986  -6.405  1.00 1.85  ? 52  ASP B OD1  1  
ATOM 2920   O OD2  . ASP B 2 52  ? -19.395 -2.552  -4.345  1.00 1.80  ? 52  ASP B OD2  1  
ATOM 2921   H H    . ASP B 2 52  ? -17.892 -7.398  -5.902  1.00 1.28  ? 52  ASP B H    1  
ATOM 2922   H HA   . ASP B 2 52  ? -20.237 -5.724  -5.567  1.00 1.37  ? 52  ASP B HA   1  
ATOM 2923   H HB2  . ASP B 2 52  ? -18.173 -4.685  -4.349  1.00 1.40  ? 52  ASP B HB2  1  
ATOM 2924   H HB3  . ASP B 2 52  ? -17.623 -4.306  -5.979  1.00 1.29  ? 52  ASP B HB3  1  
ATOM 2925   N N    . VAL B 2 53  ? -20.352 -5.847  -8.016  1.00 1.39  ? 53  VAL B N    1  
ATOM 2926   C CA   . VAL B 2 53  ? -20.469 -5.867  -9.466  1.00 1.44  ? 53  VAL B CA   1  
ATOM 2927   C C    . VAL B 2 53  ? -21.416 -4.771  -9.940  1.00 1.42  ? 53  VAL B C    1  
ATOM 2928   O O    . VAL B 2 53  ? -21.614 -4.581  -11.142 1.00 1.54  ? 53  VAL B O    1  
ATOM 2929   C CB   . VAL B 2 53  ? -20.978 -7.233  -9.981  1.00 1.53  ? 53  VAL B CB   1  
ATOM 2930   C CG1  . VAL B 2 53  ? -19.995 -8.338  -9.630  1.00 1.56  ? 53  VAL B CG1  1  
ATOM 2931   C CG2  . VAL B 2 53  ? -22.355 -7.554  -9.413  1.00 1.55  ? 53  VAL B CG2  1  
ATOM 2932   H H    . VAL B 2 53  ? -21.166 -5.900  -7.468  1.00 1.40  ? 53  VAL B H    1  
ATOM 2933   H HA   . VAL B 2 53  ? -19.490 -5.689  -9.883  1.00 1.45  ? 53  VAL B HA   1  
ATOM 2934   H HB   . VAL B 2 53  ? -21.058 -7.183  -11.057 1.00 1.59  ? 53  VAL B HB   1  
ATOM 2935   H HG11 . VAL B 2 53  ? -19.873 -8.383  -8.559  1.00 1.65  ? 53  VAL B HG11 1  
ATOM 2936   H HG12 . VAL B 2 53  ? -19.042 -8.131  -10.094 1.00 1.73  ? 53  VAL B HG12 1  
ATOM 2937   H HG13 . VAL B 2 53  ? -20.374 -9.283  -9.990  1.00 1.67  ? 53  VAL B HG13 1  
ATOM 2938   H HG21 . VAL B 2 53  ? -22.257 -7.859  -8.384  1.00 1.66  ? 53  VAL B HG21 1  
ATOM 2939   H HG22 . VAL B 2 53  ? -22.803 -8.353  -9.983  1.00 1.90  ? 53  VAL B HG22 1  
ATOM 2940   H HG23 . VAL B 2 53  ? -22.983 -6.677  -9.470  1.00 1.82  ? 53  VAL B HG23 1  
ATOM 2941   N N    . GLY B 2 54  ? -21.992 -4.050  -8.987  1.00 1.33  ? 54  GLY B N    1  
ATOM 2942   C CA   . GLY B 2 54  ? -22.928 -2.994  -9.314  1.00 1.31  ? 54  GLY B CA   1  
ATOM 2943   C C    . GLY B 2 54  ? -22.317 -1.610  -9.231  1.00 1.28  ? 54  GLY B C    1  
ATOM 2944   O O    . GLY B 2 54  ? -22.790 -0.680  -9.882  1.00 1.37  ? 54  GLY B O    1  
ATOM 2945   H H    . GLY B 2 54  ? -21.770 -4.234  -8.047  1.00 1.29  ? 54  GLY B H    1  
ATOM 2946   H HA2  . GLY B 2 54  ? -23.295 -3.152  -10.317 1.00 1.37  ? 54  GLY B HA2  1  
ATOM 2947   H HA3  . GLY B 2 54  ? -23.760 -3.047  -8.629  1.00 1.31  ? 54  GLY B HA3  1  
ATOM 2948   N N    . SER B 2 55  ? -21.282 -1.459  -8.425  1.00 1.21  ? 55  SER B N    1  
ATOM 2949   C CA   . SER B 2 55  ? -20.627 -0.174  -8.280  1.00 1.19  ? 55  SER B CA   1  
ATOM 2950   C C    . SER B 2 55  ? -19.124 -0.310  -8.495  1.00 1.20  ? 55  SER B C    1  
ATOM 2951   O O    . SER B 2 55  ? -18.321 -0.003  -7.613  1.00 1.23  ? 55  SER B O    1  
ATOM 2952   C CB   . SER B 2 55  ? -20.932 0.417   -6.903  1.00 1.21  ? 55  SER B CB   1  
ATOM 2953   O OG   . SER B 2 55  ? -22.327 0.627   -6.740  1.00 1.33  ? 55  SER B OG   1  
ATOM 2954   H H    . SER B 2 55  ? -20.951 -2.229  -7.904  1.00 1.23  ? 55  SER B H    1  
ATOM 2955   H HA   . SER B 2 55  ? -21.025 0.484   -9.038  1.00 1.21  ? 55  SER B HA   1  
ATOM 2956   H HB2  . SER B 2 55  ? -20.593 -0.267  -6.139  1.00 1.33  ? 55  SER B HB2  1  
ATOM 2957   H HB3  . SER B 2 55  ? -20.423 1.362   -6.795  1.00 1.30  ? 55  SER B HB3  1  
ATOM 2958   H HG   . SER B 2 55  ? -22.778 0.402   -7.558  1.00 1.75  ? 55  SER B HG   1  
ATOM 2959   N N    . LEU B 2 56  ? -18.751 -0.780  -9.678  1.00 1.23  ? 56  LEU B N    1  
ATOM 2960   C CA   . LEU B 2 56  ? -17.351 -0.958  -10.035 1.00 1.27  ? 56  LEU B CA   1  
ATOM 2961   C C    . LEU B 2 56  ? -16.690 0.403   -10.241 1.00 1.31  ? 56  LEU B C    1  
ATOM 2962   O O    . LEU B 2 56  ? -15.528 0.607   -9.881  1.00 1.32  ? 56  LEU B O    1  
ATOM 2963   C CB   . LEU B 2 56  ? -17.240 -1.818  -11.307 1.00 1.34  ? 56  LEU B CB   1  
ATOM 2964   C CG   . LEU B 2 56  ? -15.842 -2.355  -11.659 1.00 1.47  ? 56  LEU B CG   1  
ATOM 2965   C CD1  . LEU B 2 56  ? -15.091 -1.373  -12.547 1.00 1.87  ? 56  LEU B CD1  1  
ATOM 2966   C CD2  . LEU B 2 56  ? -15.037 -2.660  -10.404 1.00 1.87  ? 56  LEU B CD2  1  
ATOM 2967   H H    . LEU B 2 56  ? -19.443 -1.012  -10.336 1.00 1.26  ? 56  LEU B H    1  
ATOM 2968   H HA   . LEU B 2 56  ? -16.860 -1.465  -9.219  1.00 1.25  ? 56  LEU B HA   1  
ATOM 2969   H HB2  . LEU B 2 56  ? -17.903 -2.664  -11.197 1.00 1.47  ? 56  LEU B HB2  1  
ATOM 2970   H HB3  . LEU B 2 56  ? -17.587 -1.223  -12.139 1.00 1.47  ? 56  LEU B HB3  1  
ATOM 2971   H HG   . LEU B 2 56  ? -15.951 -3.278  -12.212 1.00 1.46  ? 56  LEU B HG   1  
ATOM 2972   H HD11 . LEU B 2 56  ? -15.768 -0.969  -13.284 1.00 2.04  ? 56  LEU B HD11 1  
ATOM 2973   H HD12 . LEU B 2 56  ? -14.283 -1.887  -13.047 1.00 2.10  ? 56  LEU B HD12 1  
ATOM 2974   H HD13 . LEU B 2 56  ? -14.692 -0.572  -11.944 1.00 2.17  ? 56  LEU B HD13 1  
ATOM 2975   H HD21 . LEU B 2 56  ? -15.594 -3.344  -9.781  1.00 1.99  ? 56  LEU B HD21 1  
ATOM 2976   H HD22 . LEU B 2 56  ? -14.856 -1.744  -9.862  1.00 2.14  ? 56  LEU B HD22 1  
ATOM 2977   H HD23 . LEU B 2 56  ? -14.094 -3.108  -10.679 1.00 2.18  ? 56  LEU B HD23 1  
ATOM 2978   N N    . ASP B 2 57  ? -17.453 1.342   -10.793 1.00 1.36  ? 57  ASP B N    1  
ATOM 2979   C CA   . ASP B 2 57  ? -16.949 2.688   -11.044 1.00 1.43  ? 57  ASP B CA   1  
ATOM 2980   C C    . ASP B 2 57  ? -16.586 3.374   -9.734  1.00 1.39  ? 57  ASP B C    1  
ATOM 2981   O O    . ASP B 2 57  ? -15.744 4.275   -9.706  1.00 1.43  ? 57  ASP B O    1  
ATOM 2982   C CB   . ASP B 2 57  ? -17.976 3.515   -11.821 1.00 1.51  ? 57  ASP B CB   1  
ATOM 2983   C CG   . ASP B 2 57  ? -19.185 3.909   -10.993 1.00 1.53  ? 57  ASP B CG   1  
ATOM 2984   O OD1  . ASP B 2 57  ? -19.852 3.011   -10.436 1.00 1.53  ? 57  ASP B OD1  1  
ATOM 2985   O OD2  . ASP B 2 57  ? -19.487 5.118   -10.918 1.00 1.70  ? 57  ASP B OD2  1  
ATOM 2986   H H    . ASP B 2 57  ? -18.378 1.125   -11.039 1.00 1.36  ? 57  ASP B H    1  
ATOM 2987   H HA   . ASP B 2 57  ? -16.054 2.594   -11.640 1.00 1.48  ? 57  ASP B HA   1  
ATOM 2988   H HB2  . ASP B 2 57  ? -17.503 4.417   -12.181 1.00 1.67  ? 57  ASP B HB2  1  
ATOM 2989   H HB3  . ASP B 2 57  ? -18.318 2.936   -12.667 1.00 1.50  ? 57  ASP B HB3  1  
ATOM 2990   N N    . GLU B 2 58  ? -17.215 2.928   -8.650  1.00 1.32  ? 58  GLU B N    1  
ATOM 2991   C CA   . GLU B 2 58  ? -16.948 3.468   -7.324  1.00 1.30  ? 58  GLU B CA   1  
ATOM 2992   C C    . GLU B 2 58  ? -15.496 3.196   -6.938  1.00 1.26  ? 58  GLU B C    1  
ATOM 2993   O O    . GLU B 2 58  ? -14.865 3.991   -6.246  1.00 1.31  ? 58  GLU B O    1  
ATOM 2994   C CB   . GLU B 2 58  ? -17.901 2.843   -6.296  1.00 1.27  ? 58  GLU B CB   1  
ATOM 2995   C CG   . GLU B 2 58  ? -17.827 3.463   -4.906  1.00 1.27  ? 58  GLU B CG   1  
ATOM 2996   C CD   . GLU B 2 58  ? -18.382 2.543   -3.837  1.00 1.31  ? 58  GLU B CD   1  
ATOM 2997   O OE1  . GLU B 2 58  ? -17.779 1.473   -3.601  1.00 1.39  ? 58  GLU B OE1  1  
ATOM 2998   O OE2  . GLU B 2 58  ? -19.429 2.870   -3.237  1.00 1.53  ? 58  GLU B OE2  1  
ATOM 2999   H H    . GLU B 2 58  ? -17.890 2.223   -8.753  1.00 1.29  ? 58  GLU B H    1  
ATOM 3000   H HA   . GLU B 2 58  ? -17.110 4.536   -7.358  1.00 1.38  ? 58  GLU B HA   1  
ATOM 3001   H HB2  . GLU B 2 58  ? -18.913 2.949   -6.657  1.00 1.30  ? 58  GLU B HB2  1  
ATOM 3002   H HB3  . GLU B 2 58  ? -17.671 1.791   -6.210  1.00 1.27  ? 58  GLU B HB3  1  
ATOM 3003   H HG2  . GLU B 2 58  ? -16.794 3.679   -4.674  1.00 1.28  ? 58  GLU B HG2  1  
ATOM 3004   H HG3  . GLU B 2 58  ? -18.396 4.382   -4.902  1.00 1.34  ? 58  GLU B HG3  1  
ATOM 3005   N N    . LYS B 2 59  ? -14.965 2.072   -7.409  1.00 1.20  ? 59  LYS B N    1  
ATOM 3006   C CA   . LYS B 2 59  ? -13.586 1.697   -7.121  1.00 1.19  ? 59  LYS B CA   1  
ATOM 3007   C C    . LYS B 2 59  ? -12.638 2.409   -8.072  1.00 1.24  ? 59  LYS B C    1  
ATOM 3008   O O    . LYS B 2 59  ? -11.619 2.949   -7.654  1.00 1.25  ? 59  LYS B O    1  
ATOM 3009   C CB   . LYS B 2 59  ? -13.385 0.182   -7.246  1.00 1.20  ? 59  LYS B CB   1  
ATOM 3010   C CG   . LYS B 2 59  ? -14.020 -0.620  -6.120  1.00 1.19  ? 59  LYS B CG   1  
ATOM 3011   C CD   . LYS B 2 59  ? -15.505 -0.820  -6.358  1.00 1.32  ? 59  LYS B CD   1  
ATOM 3012   C CE   . LYS B 2 59  ? -16.226 -1.228  -5.086  1.00 1.40  ? 59  LYS B CE   1  
ATOM 3013   N NZ   . LYS B 2 59  ? -17.623 -0.730  -5.072  1.00 1.43  ? 59  LYS B NZ   1  
ATOM 3014   H H    . LYS B 2 59  ? -15.512 1.486   -7.976  1.00 1.19  ? 59  LYS B H    1  
ATOM 3015   H HA   . LYS B 2 59  ? -13.360 2.001   -6.111  1.00 1.17  ? 59  LYS B HA   1  
ATOM 3016   H HB2  . LYS B 2 59  ? -13.816 -0.149  -8.180  1.00 1.26  ? 59  LYS B HB2  1  
ATOM 3017   H HB3  . LYS B 2 59  ? -12.326 -0.028  -7.254  1.00 1.27  ? 59  LYS B HB3  1  
ATOM 3018   H HG2  . LYS B 2 59  ? -13.542 -1.586  -6.061  1.00 1.36  ? 59  LYS B HG2  1  
ATOM 3019   H HG3  . LYS B 2 59  ? -13.881 -0.087  -5.192  1.00 1.31  ? 59  LYS B HG3  1  
ATOM 3020   H HD2  . LYS B 2 59  ? -15.928 0.104   -6.720  1.00 1.61  ? 59  LYS B HD2  1  
ATOM 3021   H HD3  . LYS B 2 59  ? -15.637 -1.594  -7.101  1.00 1.66  ? 59  LYS B HD3  1  
ATOM 3022   H HE2  . LYS B 2 59  ? -16.234 -2.306  -5.020  1.00 1.64  ? 59  LYS B HE2  1  
ATOM 3023   H HE3  . LYS B 2 59  ? -15.697 -0.820  -4.237  1.00 1.64  ? 59  LYS B HE3  1  
ATOM 3024   H HZ1  . LYS B 2 59  ? -18.264 -1.460  -4.686  1.00 1.47  ? 59  LYS B HZ1  1  
ATOM 3025   H HZ2  . LYS B 2 59  ? -17.929 -0.494  -6.039  1.00 1.69  ? 59  LYS B HZ2  1  
ATOM 3026   H HZ3  . LYS B 2 59  ? -17.692 0.128   -4.477  1.00 1.74  ? 59  LYS B HZ3  1  
ATOM 3027   N N    . MET B 2 60  ? -12.994 2.413   -9.352  1.00 1.29  ? 60  MET B N    1  
ATOM 3028   C CA   . MET B 2 60  ? -12.183 3.052   -10.383 1.00 1.38  ? 60  MET B CA   1  
ATOM 3029   C C    . MET B 2 60  ? -11.914 4.521   -10.054 1.00 1.40  ? 60  MET B C    1  
ATOM 3030   O O    . MET B 2 60  ? -10.766 4.966   -10.071 1.00 1.45  ? 60  MET B O    1  
ATOM 3031   C CB   . MET B 2 60  ? -12.877 2.927   -11.746 1.00 1.45  ? 60  MET B CB   1  
ATOM 3032   C CG   . MET B 2 60  ? -12.321 3.860   -12.814 1.00 1.57  ? 60  MET B CG   1  
ATOM 3033   S SD   . MET B 2 60  ? -13.344 5.326   -13.048 1.00 1.82  ? 60  MET B SD   1  
ATOM 3034   C CE   . MET B 2 60  ? -12.275 6.324   -14.079 1.00 1.99  ? 60  MET B CE   1  
ATOM 3035   H H    . MET B 2 60  ? -13.828 1.965   -9.613  1.00 1.29  ? 60  MET B H    1  
ATOM 3036   H HA   . MET B 2 60  ? -11.239 2.530   -10.426 1.00 1.39  ? 60  MET B HA   1  
ATOM 3037   H HB2  . MET B 2 60  ? -12.773 1.911   -12.097 1.00 1.47  ? 60  MET B HB2  1  
ATOM 3038   H HB3  . MET B 2 60  ? -13.927 3.147   -11.620 1.00 1.45  ? 60  MET B HB3  1  
ATOM 3039   H HG2  . MET B 2 60  ? -11.330 4.173   -12.519 1.00 1.66  ? 60  MET B HG2  1  
ATOM 3040   H HG3  . MET B 2 60  ? -12.264 3.323   -13.749 1.00 1.69  ? 60  MET B HG3  1  
ATOM 3041   H HE1  . MET B 2 60  ? -12.752 7.272   -14.278 1.00 2.23  ? 60  MET B HE1  1  
ATOM 3042   H HE2  . MET B 2 60  ? -12.090 5.812   -15.011 1.00 2.14  ? 60  MET B HE2  1  
ATOM 3043   H HE3  . MET B 2 60  ? -11.338 6.495   -13.569 1.00 2.28  ? 60  MET B HE3  1  
ATOM 3044   N N    . LYS B 2 61  ? -12.968 5.258   -9.714  1.00 1.39  ? 61  LYS B N    1  
ATOM 3045   C CA   . LYS B 2 61  ? -12.843 6.679   -9.394  1.00 1.44  ? 61  LYS B CA   1  
ATOM 3046   C C    . LYS B 2 61  ? -12.152 6.907   -8.051  1.00 1.40  ? 61  LYS B C    1  
ATOM 3047   O O    . LYS B 2 61  ? -11.884 8.048   -7.671  1.00 1.53  ? 61  LYS B O    1  
ATOM 3048   C CB   . LYS B 2 61  ? -14.217 7.347   -9.392  1.00 1.45  ? 61  LYS B CB   1  
ATOM 3049   C CG   . LYS B 2 61  ? -14.653 7.846   -10.760 1.00 1.53  ? 61  LYS B CG   1  
ATOM 3050   C CD   . LYS B 2 61  ? -16.101 8.304   -10.755 1.00 1.57  ? 61  LYS B CD   1  
ATOM 3051   C CE   . LYS B 2 61  ? -17.056 7.122   -10.729 1.00 1.71  ? 61  LYS B CE   1  
ATOM 3052   N NZ   . LYS B 2 61  ? -18.480 7.546   -10.774 1.00 1.69  ? 61  LYS B NZ   1  
ATOM 3053   H H    . LYS B 2 61  ? -13.856 4.839   -9.683  1.00 1.36  ? 61  LYS B H    1  
ATOM 3054   H HA   . LYS B 2 61  ? -12.241 7.133   -10.167 1.00 1.51  ? 61  LYS B HA   1  
ATOM 3055   H HB2  . LYS B 2 61  ? -14.952 6.636   -9.042  1.00 1.44  ? 61  LYS B HB2  1  
ATOM 3056   H HB3  . LYS B 2 61  ? -14.194 8.188   -8.719  1.00 1.46  ? 61  LYS B HB3  1  
ATOM 3057   H HG2  . LYS B 2 61  ? -14.024 8.676   -11.045 1.00 1.56  ? 61  LYS B HG2  1  
ATOM 3058   H HG3  . LYS B 2 61  ? -14.541 7.046   -11.477 1.00 1.57  ? 61  LYS B HG3  1  
ATOM 3059   H HD2  . LYS B 2 61  ? -16.272 8.913   -9.880  1.00 1.63  ? 61  LYS B HD2  1  
ATOM 3060   H HD3  . LYS B 2 61  ? -16.287 8.888   -11.642 1.00 1.72  ? 61  LYS B HD3  1  
ATOM 3061   H HE2  . LYS B 2 61  ? -16.853 6.496   -11.585 1.00 2.02  ? 61  LYS B HE2  1  
ATOM 3062   H HE3  . LYS B 2 61  ? -16.888 6.557   -9.826  1.00 1.96  ? 61  LYS B HE3  1  
ATOM 3063   H HZ1  . LYS B 2 61  ? -19.100 6.706   -10.879 1.00 1.70  ? 61  LYS B HZ1  1  
ATOM 3064   H HZ2  . LYS B 2 61  ? -18.641 8.182   -11.577 1.00 1.86  ? 61  LYS B HZ2  1  
ATOM 3065   H HZ3  . LYS B 2 61  ? -18.737 8.039   -9.897  1.00 1.88  ? 61  LYS B HZ3  1  
ATOM 3066   N N    . SER B 2 62  ? -11.874 5.831   -7.334  1.00 1.28  ? 62  SER B N    1  
ATOM 3067   C CA   . SER B 2 62  ? -11.206 5.932   -6.045  1.00 1.25  ? 62  SER B CA   1  
ATOM 3068   C C    . SER B 2 62  ? -9.770  5.414   -6.138  1.00 1.26  ? 62  SER B C    1  
ATOM 3069   O O    . SER B 2 62  ? -9.000  5.522   -5.186  1.00 1.28  ? 62  SER B O    1  
ATOM 3070   C CB   . SER B 2 62  ? -11.984 5.157   -4.978  1.00 1.22  ? 62  SER B CB   1  
ATOM 3071   O OG   . SER B 2 62  ? -13.310 5.647   -4.852  1.00 1.23  ? 62  SER B OG   1  
ATOM 3072   H H    . SER B 2 62  ? -12.124 4.948   -7.676  1.00 1.25  ? 62  SER B H    1  
ATOM 3073   H HA   . SER B 2 62  ? -11.180 6.976   -5.769  1.00 1.27  ? 62  SER B HA   1  
ATOM 3074   H HB2  . SER B 2 62  ? -12.022 4.112   -5.250  1.00 1.21  ? 62  SER B HB2  1  
ATOM 3075   H HB3  . SER B 2 62  ? -11.483 5.263   -4.027  1.00 1.21  ? 62  SER B HB3  1  
ATOM 3076   H HG   . SER B 2 62  ? -13.908 5.090   -5.375  1.00 1.22  ? 62  SER B HG   1  
ATOM 3077   N N    . LEU B 2 63  ? -9.413  4.857   -7.289  1.00 1.27  ? 63  LEU B N    1  
ATOM 3078   C CA   . LEU B 2 63  ? -8.071  4.329   -7.497  1.00 1.30  ? 63  LEU B CA   1  
ATOM 3079   C C    . LEU B 2 63  ? -7.325  5.165   -8.528  1.00 1.35  ? 63  LEU B C    1  
ATOM 3080   O O    . LEU B 2 63  ? -6.133  5.441   -8.369  1.00 1.36  ? 63  LEU B O    1  
ATOM 3081   C CB   . LEU B 2 63  ? -8.126  2.865   -7.946  1.00 1.31  ? 63  LEU B CB   1  
ATOM 3082   C CG   . LEU B 2 63  ? -8.708  1.889   -6.921  1.00 1.27  ? 63  LEU B CG   1  
ATOM 3083   C CD1  . LEU B 2 63  ? -8.847  0.505   -7.530  1.00 1.31  ? 63  LEU B CD1  1  
ATOM 3084   C CD2  . LEU B 2 63  ? -7.840  1.839   -5.669  1.00 1.25  ? 63  LEU B CD2  1  
ATOM 3085   H H    . LEU B 2 63  ? -10.066 4.807   -8.020  1.00 1.29  ? 63  LEU B H    1  
ATOM 3086   H HA   . LEU B 2 63  ? -7.543  4.386   -6.556  1.00 1.27  ? 63  LEU B HA   1  
ATOM 3087   H HB2  . LEU B 2 63  ? -8.724  2.811   -8.844  1.00 1.34  ? 63  LEU B HB2  1  
ATOM 3088   H HB3  . LEU B 2 63  ? -7.123  2.545   -8.183  1.00 1.34  ? 63  LEU B HB3  1  
ATOM 3089   H HG   . LEU B 2 63  ? -9.693  2.227   -6.632  1.00 1.25  ? 63  LEU B HG   1  
ATOM 3090   H HD11 . LEU B 2 63  ? -7.876  0.149   -7.842  1.00 1.35  ? 63  LEU B HD11 1  
ATOM 3091   H HD12 . LEU B 2 63  ? -9.504  0.554   -8.386  1.00 1.35  ? 63  LEU B HD12 1  
ATOM 3092   H HD13 . LEU B 2 63  ? -9.260  -0.173  -6.798  1.00 1.30  ? 63  LEU B HD13 1  
ATOM 3093   H HD21 . LEU B 2 63  ? -8.240  1.107   -4.982  1.00 1.38  ? 63  LEU B HD21 1  
ATOM 3094   H HD22 . LEU B 2 63  ? -7.834  2.810   -5.196  1.00 1.34  ? 63  LEU B HD22 1  
ATOM 3095   H HD23 . LEU B 2 63  ? -6.831  1.564   -5.939  1.00 1.48  ? 63  LEU B HD23 1  
ATOM 3096   N N    . ASP B 2 64  ? -8.035  5.571   -9.575  1.00 1.39  ? 64  ASP B N    1  
ATOM 3097   C CA   . ASP B 2 64  ? -7.443  6.385   -10.628 1.00 1.46  ? 64  ASP B CA   1  
ATOM 3098   C C    . ASP B 2 64  ? -7.216  7.799   -10.114 1.00 1.46  ? 64  ASP B C    1  
ATOM 3099   O O    . ASP B 2 64  ? -8.144  8.459   -9.646  1.00 1.51  ? 64  ASP B O    1  
ATOM 3100   C CB   . ASP B 2 64  ? -8.345  6.409   -11.867 1.00 1.53  ? 64  ASP B CB   1  
ATOM 3101   C CG   . ASP B 2 64  ? -7.660  7.005   -13.087 1.00 1.59  ? 64  ASP B CG   1  
ATOM 3102   O OD1  . ASP B 2 64  ? -6.550  7.571   -12.944 1.00 1.62  ? 64  ASP B OD1  1  
ATOM 3103   O OD2  . ASP B 2 64  ? -8.241  6.930   -14.192 1.00 1.61  ? 64  ASP B OD2  1  
ATOM 3104   H H    . ASP B 2 64  ? -8.983  5.324   -9.639  1.00 1.39  ? 64  ASP B H    1  
ATOM 3105   H HA   . ASP B 2 64  ? -6.489  5.951   -10.891 1.00 1.47  ? 64  ASP B HA   1  
ATOM 3106   H HB2  . ASP B 2 64  ? -8.642  5.399   -12.104 1.00 1.55  ? 64  ASP B HB2  1  
ATOM 3107   H HB3  . ASP B 2 64  ? -9.226  6.995   -11.650 1.00 1.55  ? 64  ASP B HB3  1  
ATOM 3108   N N    . VAL B 2 65  ? -5.975  8.249   -10.194 1.00 1.47  ? 65  VAL B N    1  
ATOM 3109   C CA   . VAL B 2 65  ? -5.609  9.576   -9.724  1.00 1.50  ? 65  VAL B CA   1  
ATOM 3110   C C    . VAL B 2 65  ? -5.601  10.590  -10.864 1.00 1.56  ? 65  VAL B C    1  
ATOM 3111   O O    . VAL B 2 65  ? -5.473  11.792  -10.634 1.00 1.61  ? 65  VAL B O    1  
ATOM 3112   C CB   . VAL B 2 65  ? -4.221  9.569   -9.047  1.00 1.52  ? 65  VAL B CB   1  
ATOM 3113   C CG1  . VAL B 2 65  ? -4.214  8.627   -7.855  1.00 1.49  ? 65  VAL B CG1  1  
ATOM 3114   C CG2  . VAL B 2 65  ? -3.140  9.178   -10.046 1.00 1.57  ? 65  VAL B CG2  1  
ATOM 3115   H H    . VAL B 2 65  ? -5.286  7.675   -10.591 1.00 1.50  ? 65  VAL B H    1  
ATOM 3116   H HA   . VAL B 2 65  ? -6.340  9.880   -8.990  1.00 1.50  ? 65  VAL B HA   1  
ATOM 3117   H HB   . VAL B 2 65  ? -4.009  10.568  -8.692  1.00 1.56  ? 65  VAL B HB   1  
ATOM 3118   H HG11 . VAL B 2 65  ? -3.301  8.761   -7.293  1.00 1.56  ? 65  VAL B HG11 1  
ATOM 3119   H HG12 . VAL B 2 65  ? -4.276  7.607   -8.203  1.00 1.48  ? 65  VAL B HG12 1  
ATOM 3120   H HG13 . VAL B 2 65  ? -5.061  8.843   -7.222  1.00 1.50  ? 65  VAL B HG13 1  
ATOM 3121   H HG21 . VAL B 2 65  ? -2.168  9.335   -9.606  1.00 1.66  ? 65  VAL B HG21 1  
ATOM 3122   H HG22 . VAL B 2 65  ? -3.237  9.782   -10.935 1.00 1.66  ? 65  VAL B HG22 1  
ATOM 3123   H HG23 . VAL B 2 65  ? -3.253  8.135   -10.306 1.00 1.60  ? 65  VAL B HG23 1  
ATOM 3124   N N    . ASN B 2 66  ? -5.747  10.104  -12.088 1.00 1.61  ? 66  ASN B N    1  
ATOM 3125   C CA   . ASN B 2 66  ? -5.739  10.979  -13.255 1.00 1.69  ? 66  ASN B CA   1  
ATOM 3126   C C    . ASN B 2 66  ? -7.125  11.030  -13.896 1.00 1.69  ? 66  ASN B C    1  
ATOM 3127   O O    . ASN B 2 66  ? -7.464  11.990  -14.591 1.00 1.76  ? 66  ASN B O    1  
ATOM 3128   C CB   . ASN B 2 66  ? -4.666  10.510  -14.251 1.00 1.78  ? 66  ASN B CB   1  
ATOM 3129   C CG   . ASN B 2 66  ? -5.225  9.817   -15.479 1.00 1.78  ? 66  ASN B CG   1  
ATOM 3130   O OD1  . ASN B 2 66  ? -5.301  10.411  -16.555 1.00 1.84  ? 66  ASN B OD1  1  
ATOM 3131   N ND2  . ASN B 2 66  ? -5.631  8.565   -15.325 1.00 1.74  ? 66  ASN B ND2  1  
ATOM 3132   H H    . ASN B 2 66  ? -5.876  9.134   -12.211 1.00 1.60  ? 66  ASN B H    1  
ATOM 3133   H HA   . ASN B 2 66  ? -5.488  11.972  -12.912 1.00 1.72  ? 66  ASN B HA   1  
ATOM 3134   H HB2  . ASN B 2 66  ? -4.098  11.365  -14.580 1.00 1.86  ? 66  ASN B HB2  1  
ATOM 3135   H HB3  . ASN B 2 66  ? -4.003  9.821   -13.746 1.00 1.79  ? 66  ASN B HB3  1  
ATOM 3136   H HD21 . ASN B 2 66  ? -5.557  8.151   -14.431 1.00 1.71  ? 66  ASN B HD21 1  
ATOM 3137   H HD22 . ASN B 2 66  ? -6.006  8.092   -16.108 1.00 1.76  ? 66  ASN B HD22 1  
ATOM 3138   N N    . GLN B 2 67  ? -7.911  9.989   -13.638 1.00 1.62  ? 67  GLN B N    1  
ATOM 3139   C CA   . GLN B 2 67  ? -9.276  9.864   -14.145 1.00 1.62  ? 67  GLN B CA   1  
ATOM 3140   C C    . GLN B 2 67  ? -9.329  9.970   -15.670 1.00 1.67  ? 67  GLN B C    1  
ATOM 3141   O O    . GLN B 2 67  ? -9.846  10.943  -16.222 1.00 1.71  ? 67  GLN B O    1  
ATOM 3142   C CB   . GLN B 2 67  ? -10.193 10.908  -13.500 1.00 1.65  ? 67  GLN B CB   1  
ATOM 3143   C CG   . GLN B 2 67  ? -11.657 10.486  -13.442 1.00 1.79  ? 67  GLN B CG   1  
ATOM 3144   C CD   . GLN B 2 67  ? -12.523 11.468  -12.674 1.00 1.89  ? 67  GLN B CD   1  
ATOM 3145   O OE1  . GLN B 2 67  ? -13.502 11.085  -12.029 1.00 2.18  ? 67  GLN B OE1  1  
ATOM 3146   N NE2  . GLN B 2 67  ? -12.177 12.743  -12.740 1.00 1.92  ? 67  GLN B NE2  1  
ATOM 3147   H H    . GLN B 2 67  ? -7.548  9.257   -13.093 1.00 1.58  ? 67  GLN B H    1  
ATOM 3148   H HA   . GLN B 2 67  ? -9.630  8.881   -13.865 1.00 1.60  ? 67  GLN B HA   1  
ATOM 3149   H HB2  . GLN B 2 67  ? -9.856  11.094  -12.491 1.00 1.76  ? 67  GLN B HB2  1  
ATOM 3150   H HB3  . GLN B 2 67  ? -10.128 11.824  -14.067 1.00 1.73  ? 67  GLN B HB3  1  
ATOM 3151   H HG2  . GLN B 2 67  ? -12.034 10.412  -14.450 1.00 1.94  ? 67  GLN B HG2  1  
ATOM 3152   H HG3  . GLN B 2 67  ? -11.720 9.520   -12.962 1.00 2.00  ? 67  GLN B HG3  1  
ATOM 3153   H HE21 . GLN B 2 67  ? -11.390 12.982  -13.274 1.00 1.96  ? 67  GLN B HE21 1  
ATOM 3154   H HE22 . GLN B 2 67  ? -12.723 13.399  -12.260 1.00 2.07  ? 67  GLN B HE22 1  
ATOM 3155   N N    . ASP B 2 68  ? -8.781  8.970   -16.347 1.00 1.68  ? 68  ASP B N    1  
ATOM 3156   C CA   . ASP B 2 68  ? -8.790  8.943   -17.809 1.00 1.75  ? 68  ASP B CA   1  
ATOM 3157   C C    . ASP B 2 68  ? -9.431  7.654   -18.306 1.00 1.73  ? 68  ASP B C    1  
ATOM 3158   O O    . ASP B 2 68  ? -9.387  7.343   -19.496 1.00 1.79  ? 68  ASP B O    1  
ATOM 3159   C CB   . ASP B 2 68  ? -7.376  9.108   -18.387 1.00 1.81  ? 68  ASP B CB   1  
ATOM 3160   C CG   . ASP B 2 68  ? -6.552  7.836   -18.362 1.00 1.84  ? 68  ASP B CG   1  
ATOM 3161   O OD1  . ASP B 2 68  ? -6.599  7.104   -17.354 1.00 1.80  ? 68  ASP B OD1  1  
ATOM 3162   O OD2  . ASP B 2 68  ? -5.818  7.581   -19.341 1.00 2.02  ? 68  ASP B OD2  1  
ATOM 3163   H H    . ASP B 2 68  ? -8.352  8.230   -15.851 1.00 1.67  ? 68  ASP B H    1  
ATOM 3164   H HA   . ASP B 2 68  ? -9.399  9.772   -18.140 1.00 1.78  ? 68  ASP B HA   1  
ATOM 3165   H HB2  . ASP B 2 68  ? -7.451  9.440   -19.411 1.00 1.89  ? 68  ASP B HB2  1  
ATOM 3166   H HB3  . ASP B 2 68  ? -6.850  9.860   -17.815 1.00 1.83  ? 68  ASP B HB3  1  
ATOM 3167   N N    . SER B 2 69  ? -10.023 6.913   -17.364 1.00 1.67  ? 69  SER B N    1  
ATOM 3168   C CA   . SER B 2 69  ? -10.717 5.653   -17.648 1.00 1.67  ? 69  SER B CA   1  
ATOM 3169   C C    . SER B 2 69  ? -9.755  4.513   -17.968 1.00 1.71  ? 69  SER B C    1  
ATOM 3170   O O    . SER B 2 69  ? -10.178 3.451   -18.422 1.00 1.76  ? 69  SER B O    1  
ATOM 3171   C CB   . SER B 2 69  ? -11.717 5.833   -18.792 1.00 1.73  ? 69  SER B CB   1  
ATOM 3172   O OG   . SER B 2 69  ? -12.634 6.876   -18.505 1.00 1.73  ? 69  SER B OG   1  
ATOM 3173   H H    . SER B 2 69  ? -9.976  7.221   -16.433 1.00 1.64  ? 69  SER B H    1  
ATOM 3174   H HA   . SER B 2 69  ? -11.266 5.385   -16.760 1.00 1.63  ? 69  SER B HA   1  
ATOM 3175   H HB2  . SER B 2 69  ? -11.182 6.080   -19.699 1.00 1.78  ? 69  SER B HB2  1  
ATOM 3176   H HB3  . SER B 2 69  ? -12.267 4.914   -18.938 1.00 1.74  ? 69  SER B HB3  1  
ATOM 3177   H HG   . SER B 2 69  ? -12.171 7.588   -18.050 1.00 1.83  ? 69  SER B HG   1  
ATOM 3178   N N    . GLU B 2 70  ? -8.471  4.722   -17.716 1.00 1.71  ? 70  GLU B N    1  
ATOM 3179   C CA   . GLU B 2 70  ? -7.477  3.696   -17.982 1.00 1.75  ? 70  GLU B CA   1  
ATOM 3180   C C    . GLU B 2 70  ? -6.521  3.557   -16.806 1.00 1.71  ? 70  GLU B C    1  
ATOM 3181   O O    . GLU B 2 70  ? -5.587  4.345   -16.651 1.00 1.73  ? 70  GLU B O    1  
ATOM 3182   C CB   . GLU B 2 70  ? -6.711  4.019   -19.264 1.00 1.85  ? 70  GLU B CB   1  
ATOM 3183   C CG   . GLU B 2 70  ? -7.479  3.671   -20.531 1.00 2.07  ? 70  GLU B CG   1  
ATOM 3184   C CD   . GLU B 2 70  ? -6.941  4.374   -21.758 1.00 2.21  ? 70  GLU B CD   1  
ATOM 3185   O OE1  . GLU B 2 70  ? -5.722  4.298   -22.007 1.00 2.32  ? 70  GLU B OE1  1  
ATOM 3186   O OE2  . GLU B 2 70  ? -7.733  5.019   -22.480 1.00 2.46  ? 70  GLU B OE2  1  
ATOM 3187   H H    . GLU B 2 70  ? -8.181  5.588   -17.346 1.00 1.70  ? 70  GLU B H    1  
ATOM 3188   H HA   . GLU B 2 70  ? -8.001  2.761   -18.115 1.00 1.77  ? 70  GLU B HA   1  
ATOM 3189   H HB2  . GLU B 2 70  ? -6.489  5.076   -19.281 1.00 1.93  ? 70  GLU B HB2  1  
ATOM 3190   H HB3  . GLU B 2 70  ? -5.784  3.465   -19.267 1.00 1.96  ? 70  GLU B HB3  1  
ATOM 3191   H HG2  . GLU B 2 70  ? -7.417  2.606   -20.690 1.00 2.22  ? 70  GLU B HG2  1  
ATOM 3192   H HG3  . GLU B 2 70  ? -8.514  3.953   -20.395 1.00 2.25  ? 70  GLU B HG3  1  
ATOM 3193   N N    . LEU B 2 71  ? -6.761  2.549   -15.982 1.00 1.68  ? 71  LEU B N    1  
ATOM 3194   C CA   . LEU B 2 71  ? -5.932  2.296   -14.812 1.00 1.64  ? 71  LEU B CA   1  
ATOM 3195   C C    . LEU B 2 71  ? -4.544  1.838   -15.240 1.00 1.68  ? 71  LEU B C    1  
ATOM 3196   O O    . LEU B 2 71  ? -4.386  0.748   -15.779 1.00 1.71  ? 71  LEU B O    1  
ATOM 3197   C CB   . LEU B 2 71  ? -6.570  1.225   -13.914 1.00 1.61  ? 71  LEU B CB   1  
ATOM 3198   C CG   . LEU B 2 71  ? -7.858  1.629   -13.178 1.00 1.56  ? 71  LEU B CG   1  
ATOM 3199   C CD1  . LEU B 2 71  ? -7.724  3.010   -12.559 1.00 1.61  ? 71  LEU B CD1  1  
ATOM 3200   C CD2  . LEU B 2 71  ? -9.063  1.572   -14.108 1.00 1.52  ? 71  LEU B CD2  1  
ATOM 3201   H H    . LEU B 2 71  ? -7.517  1.948   -16.171 1.00 1.69  ? 71  LEU B H    1  
ATOM 3202   H HA   . LEU B 2 71  ? -5.842  3.217   -14.259 1.00 1.62  ? 71  LEU B HA   1  
ATOM 3203   H HB2  . LEU B 2 71  ? -6.791  0.365   -14.529 1.00 1.62  ? 71  LEU B HB2  1  
ATOM 3204   H HB3  . LEU B 2 71  ? -5.840  0.932   -13.174 1.00 1.64  ? 71  LEU B HB3  1  
ATOM 3205   H HG   . LEU B 2 71  ? -8.030  0.926   -12.375 1.00 1.57  ? 71  LEU B HG   1  
ATOM 3206   H HD11 . LEU B 2 71  ? -8.583  3.209   -11.935 1.00 1.67  ? 71  LEU B HD11 1  
ATOM 3207   H HD12 . LEU B 2 71  ? -7.671  3.753   -13.342 1.00 1.78  ? 71  LEU B HD12 1  
ATOM 3208   H HD13 . LEU B 2 71  ? -6.828  3.052   -11.961 1.00 1.73  ? 71  LEU B HD13 1  
ATOM 3209   H HD21 . LEU B 2 71  ? -9.186  0.564   -14.477 1.00 1.63  ? 71  LEU B HD21 1  
ATOM 3210   H HD22 . LEU B 2 71  ? -8.908  2.244   -14.939 1.00 1.59  ? 71  LEU B HD22 1  
ATOM 3211   H HD23 . LEU B 2 71  ? -9.950  1.869   -13.566 1.00 1.48  ? 71  LEU B HD23 1  
ATOM 3212   N N    . LYS B 2 72  ? -3.544  2.678   -15.009 1.00 1.70  ? 72  LYS B N    1  
ATOM 3213   C CA   . LYS B 2 72  ? -2.171  2.343   -15.373 1.00 1.74  ? 72  LYS B CA   1  
ATOM 3214   C C    . LYS B 2 72  ? -1.621  1.280   -14.430 1.00 1.70  ? 72  LYS B C    1  
ATOM 3215   O O    . LYS B 2 72  ? -2.270  0.934   -13.445 1.00 1.64  ? 72  LYS B O    1  
ATOM 3216   C CB   . LYS B 2 72  ? -1.288  3.593   -15.338 1.00 1.77  ? 72  LYS B CB   1  
ATOM 3217   C CG   . LYS B 2 72  ? -0.891  4.105   -16.717 1.00 1.87  ? 72  LYS B CG   1  
ATOM 3218   C CD   . LYS B 2 72  ? -2.109  4.405   -17.583 1.00 1.92  ? 72  LYS B CD   1  
ATOM 3219   C CE   . LYS B 2 72  ? -2.735  5.753   -17.247 1.00 1.90  ? 72  LYS B CE   1  
ATOM 3220   N NZ   . LYS B 2 72  ? -3.956  6.014   -18.056 1.00 2.05  ? 72  LYS B NZ   1  
ATOM 3221   H H    . LYS B 2 72  ? -3.730  3.534   -14.575 1.00 1.69  ? 72  LYS B H    1  
ATOM 3222   H HA   . LYS B 2 72  ? -2.183  1.947   -16.379 1.00 1.79  ? 72  LYS B HA   1  
ATOM 3223   H HB2  . LYS B 2 72  ? -1.819  4.381   -14.824 1.00 1.74  ? 72  LYS B HB2  1  
ATOM 3224   H HB3  . LYS B 2 72  ? -0.386  3.364   -14.790 1.00 1.79  ? 72  LYS B HB3  1  
ATOM 3225   H HG2  . LYS B 2 72  ? -0.311  5.010   -16.602 1.00 1.93  ? 72  LYS B HG2  1  
ATOM 3226   H HG3  . LYS B 2 72  ? -0.289  3.353   -17.208 1.00 2.00  ? 72  LYS B HG3  1  
ATOM 3227   H HD2  . LYS B 2 72  ? -1.810  4.409   -18.620 1.00 2.15  ? 72  LYS B HD2  1  
ATOM 3228   H HD3  . LYS B 2 72  ? -2.846  3.632   -17.424 1.00 2.10  ? 72  LYS B HD3  1  
ATOM 3229   H HE2  . LYS B 2 72  ? -3.000  5.761   -16.201 1.00 2.06  ? 72  LYS B HE2  1  
ATOM 3230   H HE3  . LYS B 2 72  ? -2.010  6.530   -17.439 1.00 1.95  ? 72  LYS B HE3  1  
ATOM 3231   H HZ1  . LYS B 2 72  ? -4.795  5.615   -17.579 1.00 2.04  ? 72  LYS B HZ1  1  
ATOM 3232   H HZ2  . LYS B 2 72  ? -3.868  5.578   -18.995 1.00 2.38  ? 72  LYS B HZ2  1  
ATOM 3233   H HZ3  . LYS B 2 72  ? -4.100  7.036   -18.179 1.00 2.24  ? 72  LYS B HZ3  1  
ATOM 3234   N N    . PHE B 2 73  ? -0.428  0.772   -14.733 1.00 1.76  ? 73  PHE B N    1  
ATOM 3235   C CA   . PHE B 2 73  ? 0.214   -0.261  -13.918 1.00 1.74  ? 73  PHE B CA   1  
ATOM 3236   C C    . PHE B 2 73  ? 0.201   0.097   -12.428 1.00 1.67  ? 73  PHE B C    1  
ATOM 3237   O O    . PHE B 2 73  ? -0.149  -0.730  -11.585 1.00 1.63  ? 73  PHE B O    1  
ATOM 3238   C CB   . PHE B 2 73  ? 1.655   -0.467  -14.395 1.00 1.82  ? 73  PHE B CB   1  
ATOM 3239   C CG   . PHE B 2 73  ? 2.381   -1.578  -13.688 1.00 1.84  ? 73  PHE B CG   1  
ATOM 3240   C CD1  . PHE B 2 73  ? 1.985   -2.897  -13.849 1.00 1.90  ? 73  PHE B CD1  1  
ATOM 3241   C CD2  . PHE B 2 73  ? 3.465   -1.304  -12.870 1.00 1.93  ? 73  PHE B CD2  1  
ATOM 3242   C CE1  . PHE B 2 73  ? 2.653   -3.919  -13.203 1.00 1.96  ? 73  PHE B CE1  1  
ATOM 3243   C CE2  . PHE B 2 73  ? 4.137   -2.322  -12.223 1.00 1.97  ? 73  PHE B CE2  1  
ATOM 3244   C CZ   . PHE B 2 73  ? 3.733   -3.631  -12.392 1.00 1.93  ? 73  PHE B CZ   1  
ATOM 3245   H H    . PHE B 2 73  ? 0.032   1.092   -15.539 1.00 1.81  ? 73  PHE B H    1  
ATOM 3246   H HA   . PHE B 2 73  ? -0.331  -1.180  -14.059 1.00 1.74  ? 73  PHE B HA   1  
ATOM 3247   H HB2  . PHE B 2 73  ? 1.648   -0.697  -15.450 1.00 1.86  ? 73  PHE B HB2  1  
ATOM 3248   H HB3  . PHE B 2 73  ? 2.210   0.449   -14.237 1.00 1.86  ? 73  PHE B HB3  1  
ATOM 3249   H HD1  . PHE B 2 73  ? 1.141   -3.123  -14.483 1.00 2.00  ? 73  PHE B HD1  1  
ATOM 3250   H HD2  . PHE B 2 73  ? 3.780   -0.280  -12.737 1.00 2.07  ? 73  PHE B HD2  1  
ATOM 3251   H HE1  . PHE B 2 73  ? 2.335   -4.945  -13.335 1.00 2.10  ? 73  PHE B HE1  1  
ATOM 3252   H HE2  . PHE B 2 73  ? 4.981   -2.093  -11.588 1.00 2.12  ? 73  PHE B HE2  1  
ATOM 3253   H HZ   . PHE B 2 73  ? 4.259   -4.431  -11.888 1.00 1.99  ? 73  PHE B HZ   1  
ATOM 3254   N N    . ASN B 2 74  ? 0.563   1.335   -12.115 1.00 1.67  ? 74  ASN B N    1  
ATOM 3255   C CA   . ASN B 2 74  ? 0.602   1.803   -10.730 1.00 1.63  ? 74  ASN B CA   1  
ATOM 3256   C C    . ASN B 2 74  ? -0.802  1.883   -10.130 1.00 1.55  ? 74  ASN B C    1  
ATOM 3257   O O    . ASN B 2 74  ? -1.042  1.406   -9.022  1.00 1.51  ? 74  ASN B O    1  
ATOM 3258   C CB   . ASN B 2 74  ? 1.287   3.174   -10.664 1.00 1.66  ? 74  ASN B CB   1  
ATOM 3259   C CG   . ASN B 2 74  ? 1.295   3.767   -9.264  1.00 1.66  ? 74  ASN B CG   1  
ATOM 3260   O OD1  . ASN B 2 74  ? 2.151   3.441   -8.441  1.00 1.71  ? 74  ASN B OD1  1  
ATOM 3261   N ND2  . ASN B 2 74  ? 0.361   4.667   -8.996  1.00 1.64  ? 74  ASN B ND2  1  
ATOM 3262   H H    . ASN B 2 74  ? 0.811   1.953   -12.833 1.00 1.72  ? 74  ASN B H    1  
ATOM 3263   H HA   . ASN B 2 74  ? 1.183   1.095   -10.159 1.00 1.63  ? 74  ASN B HA   1  
ATOM 3264   H HB2  . ASN B 2 74  ? 2.308   3.071   -10.994 1.00 1.72  ? 74  ASN B HB2  1  
ATOM 3265   H HB3  . ASN B 2 74  ? 0.771   3.858   -11.320 1.00 1.67  ? 74  ASN B HB3  1  
ATOM 3266   H HD21 . ASN B 2 74  ? -0.282  4.905   -9.708  1.00 1.64  ? 74  ASN B HD21 1  
ATOM 3267   H HD22 . ASN B 2 74  ? 0.344   5.062   -8.102  1.00 1.67  ? 74  ASN B HD22 1  
ATOM 3268   N N    . GLU B 2 75  ? -1.727  2.468   -10.878 1.00 1.55  ? 75  GLU B N    1  
ATOM 3269   C CA   . GLU B 2 75  ? -3.103  2.627   -10.422 1.00 1.49  ? 75  GLU B CA   1  
ATOM 3270   C C    . GLU B 2 75  ? -3.801  1.272   -10.270 1.00 1.46  ? 75  GLU B C    1  
ATOM 3271   O O    . GLU B 2 75  ? -4.621  1.088   -9.371  1.00 1.41  ? 75  GLU B O    1  
ATOM 3272   C CB   . GLU B 2 75  ? -3.883  3.522   -11.390 1.00 1.51  ? 75  GLU B CB   1  
ATOM 3273   C CG   . GLU B 2 75  ? -3.572  5.008   -11.243 1.00 1.52  ? 75  GLU B CG   1  
ATOM 3274   C CD   . GLU B 2 75  ? -2.114  5.333   -11.508 1.00 1.65  ? 75  GLU B CD   1  
ATOM 3275   O OE1  . GLU B 2 75  ? -1.604  4.941   -12.576 1.00 1.86  ? 75  GLU B OE1  1  
ATOM 3276   O OE2  . GLU B 2 75  ? -1.469  5.964   -10.645 1.00 2.00  ? 75  GLU B OE2  1  
ATOM 3277   H H    . GLU B 2 75  ? -1.477  2.810   -11.762 1.00 1.59  ? 75  GLU B H    1  
ATOM 3278   H HA   . GLU B 2 75  ? -3.072  3.106   -9.454  1.00 1.46  ? 75  GLU B HA   1  
ATOM 3279   H HB2  . GLU B 2 75  ? -3.644  3.227   -12.402 1.00 1.56  ? 75  GLU B HB2  1  
ATOM 3280   H HB3  . GLU B 2 75  ? -4.938  3.379   -11.222 1.00 1.51  ? 75  GLU B HB3  1  
ATOM 3281   H HG2  . GLU B 2 75  ? -4.178  5.559   -11.947 1.00 1.58  ? 75  GLU B HG2  1  
ATOM 3282   H HG3  . GLU B 2 75  ? -3.820  5.318   -10.238 1.00 1.51  ? 75  GLU B HG3  1  
ATOM 3283   N N    . TYR B 2 76  ? -3.470  0.326   -11.142 1.00 1.51  ? 76  TYR B N    1  
ATOM 3284   C CA   . TYR B 2 76  ? -4.062  -1.006  -11.084 1.00 1.50  ? 76  TYR B CA   1  
ATOM 3285   C C    . TYR B 2 76  ? -3.550  -1.754  -9.857  1.00 1.48  ? 76  TYR B C    1  
ATOM 3286   O O    . TYR B 2 76  ? -4.308  -2.451  -9.179  1.00 1.46  ? 76  TYR B O    1  
ATOM 3287   C CB   . TYR B 2 76  ? -3.743  -1.799  -12.361 1.00 1.58  ? 76  TYR B CB   1  
ATOM 3288   C CG   . TYR B 2 76  ? -4.197  -3.243  -12.317 1.00 1.59  ? 76  TYR B CG   1  
ATOM 3289   C CD1  . TYR B 2 76  ? -5.524  -3.585  -12.541 1.00 1.58  ? 76  TYR B CD1  1  
ATOM 3290   C CD2  . TYR B 2 76  ? -3.294  -4.263  -12.047 1.00 1.62  ? 76  TYR B CD2  1  
ATOM 3291   C CE1  . TYR B 2 76  ? -5.936  -4.901  -12.498 1.00 1.60  ? 76  TYR B CE1  1  
ATOM 3292   C CE2  . TYR B 2 76  ? -3.701  -5.581  -12.001 1.00 1.64  ? 76  TYR B CE2  1  
ATOM 3293   C CZ   . TYR B 2 76  ? -5.022  -5.894  -12.227 1.00 1.63  ? 76  TYR B CZ   1  
ATOM 3294   O OH   . TYR B 2 76  ? -5.429  -7.204  -12.181 1.00 1.66  ? 76  TYR B OH   1  
ATOM 3295   H H    . TYR B 2 76  ? -2.816  0.532   -11.850 1.00 1.55  ? 76  TYR B H    1  
ATOM 3296   H HA   . TYR B 2 76  ? -5.132  -0.888  -10.999 1.00 1.47  ? 76  TYR B HA   1  
ATOM 3297   H HB2  . TYR B 2 76  ? -4.229  -1.326  -13.201 1.00 1.60  ? 76  TYR B HB2  1  
ATOM 3298   H HB3  . TYR B 2 76  ? -2.675  -1.792  -12.521 1.00 1.61  ? 76  TYR B HB3  1  
ATOM 3299   H HD1  . TYR B 2 76  ? -6.238  -2.803  -12.756 1.00 1.57  ? 76  TYR B HD1  1  
ATOM 3300   H HD2  . TYR B 2 76  ? -2.258  -4.013  -11.871 1.00 1.64  ? 76  TYR B HD2  1  
ATOM 3301   H HE1  . TYR B 2 76  ? -6.972  -5.148  -12.674 1.00 1.61  ? 76  TYR B HE1  1  
ATOM 3302   H HE2  . TYR B 2 76  ? -2.984  -6.359  -11.792 1.00 1.68  ? 76  TYR B HE2  1  
ATOM 3303   H HH   . TYR B 2 76  ? -5.987  -7.391  -12.938 1.00 1.73  ? 76  TYR B HH   1  
ATOM 3304   N N    . TRP B 2 77  ? -2.266  -1.584  -9.562  1.00 1.49  ? 77  TRP B N    1  
ATOM 3305   C CA   . TRP B 2 77  ? -1.652  -2.238  -8.414  1.00 1.48  ? 77  TRP B CA   1  
ATOM 3306   C C    . TRP B 2 77  ? -2.285  -1.752  -7.115  1.00 1.41  ? 77  TRP B C    1  
ATOM 3307   O O    . TRP B 2 77  ? -2.269  -2.456  -6.104  1.00 1.39  ? 77  TRP B O    1  
ATOM 3308   C CB   . TRP B 2 77  ? -0.143  -1.994  -8.397  1.00 1.51  ? 77  TRP B CB   1  
ATOM 3309   C CG   . TRP B 2 77  ? 0.622   -3.095  -7.728  1.00 1.59  ? 77  TRP B CG   1  
ATOM 3310   C CD1  . TRP B 2 77  ? 0.925   -3.195  -6.402  1.00 1.68  ? 77  TRP B CD1  1  
ATOM 3311   C CD2  . TRP B 2 77  ? 1.174   -4.256  -8.356  1.00 1.77  ? 77  TRP B CD2  1  
ATOM 3312   N NE1  . TRP B 2 77  ? 1.625   -4.351  -6.165  1.00 1.85  ? 77  TRP B NE1  1  
ATOM 3313   C CE2  . TRP B 2 77  ? 1.794   -5.018  -7.349  1.00 1.92  ? 77  TRP B CE2  1  
ATOM 3314   C CE3  . TRP B 2 77  ? 1.203   -4.729  -9.671  1.00 1.95  ? 77  TRP B CE3  1  
ATOM 3315   C CZ2  . TRP B 2 77  ? 2.438   -6.222  -7.617  1.00 2.21  ? 77  TRP B CZ2  1  
ATOM 3316   C CZ3  . TRP B 2 77  ? 1.843   -5.925  -9.936  1.00 2.26  ? 77  TRP B CZ3  1  
ATOM 3317   C CH2  . TRP B 2 77  ? 2.451   -6.661  -8.913  1.00 2.37  ? 77  TRP B CH2  1  
ATOM 3318   H H    . TRP B 2 77  ? -1.714  -1.011  -10.136 1.00 1.52  ? 77  TRP B H    1  
ATOM 3319   H HA   . TRP B 2 77  ? -1.832  -3.299  -8.505  1.00 1.51  ? 77  TRP B HA   1  
ATOM 3320   H HB2  . TRP B 2 77  ? 0.213   -1.908  -9.414  1.00 1.58  ? 77  TRP B HB2  1  
ATOM 3321   H HB3  . TRP B 2 77  ? 0.063   -1.073  -7.870  1.00 1.51  ? 77  TRP B HB3  1  
ATOM 3322   H HD1  . TRP B 2 77  ? 0.646   -2.464  -5.658  1.00 1.72  ? 77  TRP B HD1  1  
ATOM 3323   H HE1  . TRP B 2 77  ? 1.955   -4.649  -5.293  1.00 1.99  ? 77  TRP B HE1  1  
ATOM 3324   H HE3  . TRP B 2 77  ? 0.736   -4.174  -10.475 1.00 1.94  ? 77  TRP B HE3  1  
ATOM 3325   H HZ2  . TRP B 2 77  ? 2.912   -6.801  -6.838  1.00 2.37  ? 77  TRP B HZ2  1  
ATOM 3326   H HZ3  . TRP B 2 77  ? 1.875   -6.305  -10.946 1.00 2.48  ? 77  TRP B HZ3  1  
ATOM 3327   H HH2  . TRP B 2 77  ? 2.940   -7.591  -9.164  1.00 2.65  ? 77  TRP B HH2  1  
ATOM 3328   N N    . ARG B 2 78  ? -2.861  -0.551  -7.153  1.00 1.38  ? 78  ARG B N    1  
ATOM 3329   C CA   . ARG B 2 78  ? -3.514  0.014   -5.980  1.00 1.32  ? 78  ARG B CA   1  
ATOM 3330   C C    . ARG B 2 78  ? -4.661  -0.886  -5.536  1.00 1.30  ? 78  ARG B C    1  
ATOM 3331   O O    . ARG B 2 78  ? -4.951  -0.997  -4.345  1.00 1.27  ? 78  ARG B O    1  
ATOM 3332   C CB   . ARG B 2 78  ? -4.042  1.421   -6.262  1.00 1.31  ? 78  ARG B CB   1  
ATOM 3333   C CG   . ARG B 2 78  ? -2.956  2.452   -6.532  1.00 1.37  ? 78  ARG B CG   1  
ATOM 3334   C CD   . ARG B 2 78  ? -3.504  3.871   -6.441  1.00 1.35  ? 78  ARG B CD   1  
ATOM 3335   N NE   . ARG B 2 78  ? -3.847  4.231   -5.061  1.00 1.32  ? 78  ARG B NE   1  
ATOM 3336   C CZ   . ARG B 2 78  ? -4.711  5.192   -4.723  1.00 1.32  ? 78  ARG B CZ   1  
ATOM 3337   N NH1  . ARG B 2 78  ? -5.331  5.902   -5.661  1.00 1.38  ? 78  ARG B NH1  1  
ATOM 3338   N NH2  . ARG B 2 78  ? -4.959  5.442   -3.440  1.00 1.41  ? 78  ARG B NH2  1  
ATOM 3339   H H    . ARG B 2 78  ? -2.845  -0.038  -7.991  1.00 1.40  ? 78  ARG B H    1  
ATOM 3340   H HA   . ARG B 2 78  ? -2.783  0.064   -5.187  1.00 1.31  ? 78  ARG B HA   1  
ATOM 3341   H HB2  . ARG B 2 78  ? -4.692  1.382   -7.124  1.00 1.34  ? 78  ARG B HB2  1  
ATOM 3342   H HB3  . ARG B 2 78  ? -4.614  1.751   -5.408  1.00 1.29  ? 78  ARG B HB3  1  
ATOM 3343   H HG2  . ARG B 2 78  ? -2.172  2.333   -5.799  1.00 1.39  ? 78  ARG B HG2  1  
ATOM 3344   H HG3  . ARG B 2 78  ? -2.557  2.289   -7.523  1.00 1.45  ? 78  ARG B HG3  1  
ATOM 3345   H HD2  . ARG B 2 78  ? -2.754  4.558   -6.810  1.00 1.44  ? 78  ARG B HD2  1  
ATOM 3346   H HD3  . ARG B 2 78  ? -4.388  3.942   -7.056  1.00 1.38  ? 78  ARG B HD3  1  
ATOM 3347   H HE   . ARG B 2 78  ? -3.402  3.728   -4.345  1.00 1.38  ? 78  ARG B HE   1  
ATOM 3348   H HH11 . ARG B 2 78  ? -5.156  5.720   -6.634  1.00 1.44  ? 78  ARG B HH11 1  
ATOM 3349   H HH12 . ARG B 2 78  ? -5.976  6.627   -5.402  1.00 1.43  ? 78  ARG B HH12 1  
ATOM 3350   H HH21 . ARG B 2 78  ? -4.501  4.910   -2.724  1.00 1.51  ? 78  ARG B HH21 1  
ATOM 3351   H HH22 . ARG B 2 78  ? -5.606  6.169   -3.181  1.00 1.45  ? 78  ARG B HH22 1  
ATOM 3352   N N    . LEU B 2 79  ? -5.304  -1.532  -6.505  1.00 1.34  ? 79  LEU B N    1  
ATOM 3353   C CA   . LEU B 2 79  ? -6.406  -2.435  -6.218  1.00 1.33  ? 79  LEU B CA   1  
ATOM 3354   C C    . LEU B 2 79  ? -5.895  -3.625  -5.421  1.00 1.35  ? 79  LEU B C    1  
ATOM 3355   O O    . LEU B 2 79  ? -6.479  -4.008  -4.411  1.00 1.32  ? 79  LEU B O    1  
ATOM 3356   C CB   . LEU B 2 79  ? -7.062  -2.915  -7.517  1.00 1.37  ? 79  LEU B CB   1  
ATOM 3357   C CG   . LEU B 2 79  ? -8.194  -3.931  -7.338  1.00 1.39  ? 79  LEU B CG   1  
ATOM 3358   C CD1  . LEU B 2 79  ? -9.448  -3.257  -6.809  1.00 1.35  ? 79  LEU B CD1  1  
ATOM 3359   C CD2  . LEU B 2 79  ? -8.483  -4.645  -8.648  1.00 1.45  ? 79  LEU B CD2  1  
ATOM 3360   H H    . LEU B 2 79  ? -5.020  -1.406  -7.438  1.00 1.37  ? 79  LEU B H    1  
ATOM 3361   H HA   . LEU B 2 79  ? -7.133  -1.899  -5.627  1.00 1.30  ? 79  LEU B HA   1  
ATOM 3362   H HB2  . LEU B 2 79  ? -7.458  -2.053  -8.036  1.00 1.37  ? 79  LEU B HB2  1  
ATOM 3363   H HB3  . LEU B 2 79  ? -6.299  -3.365  -8.134  1.00 1.41  ? 79  LEU B HB3  1  
ATOM 3364   H HG   . LEU B 2 79  ? -7.890  -4.675  -6.614  1.00 1.40  ? 79  LEU B HG   1  
ATOM 3365   H HD11 . LEU B 2 79  ? -9.241  -2.817  -5.846  1.00 1.41  ? 79  LEU B HD11 1  
ATOM 3366   H HD12 . LEU B 2 79  ? -10.236 -3.990  -6.710  1.00 1.46  ? 79  LEU B HD12 1  
ATOM 3367   H HD13 . LEU B 2 79  ? -9.758  -2.486  -7.499  1.00 1.40  ? 79  LEU B HD13 1  
ATOM 3368   H HD21 . LEU B 2 79  ? -7.683  -5.339  -8.864  1.00 1.52  ? 79  LEU B HD21 1  
ATOM 3369   H HD22 . LEU B 2 79  ? -8.552  -3.919  -9.444  1.00 1.47  ? 79  LEU B HD22 1  
ATOM 3370   H HD23 . LEU B 2 79  ? -9.416  -5.183  -8.568  1.00 1.53  ? 79  LEU B HD23 1  
ATOM 3371   N N    . ILE B 2 80  ? -4.779  -4.185  -5.877  1.00 1.42  ? 80  ILE B N    1  
ATOM 3372   C CA   . ILE B 2 80  ? -4.163  -5.335  -5.225  1.00 1.45  ? 80  ILE B CA   1  
ATOM 3373   C C    . ILE B 2 80  ? -3.802  -5.006  -3.778  1.00 1.42  ? 80  ILE B C    1  
ATOM 3374   O O    . ILE B 2 80  ? -3.942  -5.845  -2.885  1.00 1.42  ? 80  ILE B O    1  
ATOM 3375   C CB   . ILE B 2 80  ? -2.897  -5.797  -5.978  1.00 1.53  ? 80  ILE B CB   1  
ATOM 3376   C CG1  . ILE B 2 80  ? -3.208  -5.998  -7.466  1.00 1.59  ? 80  ILE B CG1  1  
ATOM 3377   C CG2  . ILE B 2 80  ? -2.354  -7.084  -5.368  1.00 1.58  ? 80  ILE B CG2  1  
ATOM 3378   C CD1  . ILE B 2 80  ? -1.992  -6.327  -8.305  1.00 1.66  ? 80  ILE B CD1  1  
ATOM 3379   H H    . ILE B 2 80  ? -4.354  -3.809  -6.678  1.00 1.45  ? 80  ILE B H    1  
ATOM 3380   H HA   . ILE B 2 80  ? -4.878  -6.145  -5.234  1.00 1.46  ? 80  ILE B HA   1  
ATOM 3381   H HB   . ILE B 2 80  ? -2.142  -5.031  -5.875  1.00 1.53  ? 80  ILE B HB   1  
ATOM 3382   H HG12 . ILE B 2 80  ? -3.912  -6.810  -7.574  1.00 1.61  ? 80  ILE B HG12 1  
ATOM 3383   H HG13 . ILE B 2 80  ? -3.649  -5.092  -7.858  1.00 1.56  ? 80  ILE B HG13 1  
ATOM 3384   H HG21 . ILE B 2 80  ? -1.380  -7.300  -5.784  1.00 1.65  ? 80  ILE B HG21 1  
ATOM 3385   H HG22 . ILE B 2 80  ? -3.027  -7.898  -5.588  1.00 1.62  ? 80  ILE B HG22 1  
ATOM 3386   H HG23 . ILE B 2 80  ? -2.271  -6.966  -4.296  1.00 1.57  ? 80  ILE B HG23 1  
ATOM 3387   H HD11 . ILE B 2 80  ? -2.280  -6.402  -9.344  1.00 1.76  ? 80  ILE B HD11 1  
ATOM 3388   H HD12 . ILE B 2 80  ? -1.574  -7.267  -7.980  1.00 1.92  ? 80  ILE B HD12 1  
ATOM 3389   H HD13 . ILE B 2 80  ? -1.252  -5.547  -8.193  1.00 1.83  ? 80  ILE B HD13 1  
ATOM 3390   N N    . GLY B 2 81  ? -3.348  -3.777  -3.555  1.00 1.40  ? 81  GLY B N    1  
ATOM 3391   C CA   . GLY B 2 81  ? -2.982  -3.348  -2.219  1.00 1.38  ? 81  GLY B CA   1  
ATOM 3392   C C    . GLY B 2 81  ? -4.158  -3.403  -1.265  1.00 1.33  ? 81  GLY B C    1  
ATOM 3393   O O    . GLY B 2 81  ? -4.063  -3.985  -0.182  1.00 1.35  ? 81  GLY B O    1  
ATOM 3394   H H    . GLY B 2 81  ? -3.264  -3.153  -4.308  1.00 1.41  ? 81  GLY B H    1  
ATOM 3395   H HA2  . GLY B 2 81  ? -2.195  -3.988  -1.847  1.00 1.42  ? 81  GLY B HA2  1  
ATOM 3396   H HA3  . GLY B 2 81  ? -2.614  -2.333  -2.265  1.00 1.37  ? 81  GLY B HA3  1  
ATOM 3397   N N    . GLU B 2 82  ? -5.276  -2.816  -1.677  1.00 1.29  ? 82  GLU B N    1  
ATOM 3398   C CA   . GLU B 2 82  ? -6.476  -2.804  -0.853  1.00 1.26  ? 82  GLU B CA   1  
ATOM 3399   C C    . GLU B 2 82  ? -7.069  -4.208  -0.751  1.00 1.29  ? 82  GLU B C    1  
ATOM 3400   O O    . GLU B 2 82  ? -7.684  -4.556  0.253   1.00 1.30  ? 82  GLU B O    1  
ATOM 3401   C CB   . GLU B 2 82  ? -7.509  -1.826  -1.414  1.00 1.21  ? 82  GLU B CB   1  
ATOM 3402   C CG   . GLU B 2 82  ? -7.079  -0.368  -1.330  1.00 1.22  ? 82  GLU B CG   1  
ATOM 3403   C CD   . GLU B 2 82  ? -6.623  0.023   0.061   1.00 1.32  ? 82  GLU B CD   1  
ATOM 3404   O OE1  . GLU B 2 82  ? -7.481  0.150   0.966   1.00 1.69  ? 82  GLU B OE1  1  
ATOM 3405   O OE2  . GLU B 2 82  ? -5.407  0.211   0.264   1.00 1.77  ? 82  GLU B OE2  1  
ATOM 3406   H H    . GLU B 2 82  ? -5.293  -2.377  -2.555  1.00 1.29  ? 82  GLU B H    1  
ATOM 3407   H HA   . GLU B 2 82  ? -6.188  -2.478  0.136   1.00 1.26  ? 82  GLU B HA   1  
ATOM 3408   H HB2  . GLU B 2 82  ? -7.689  -2.068  -2.452  1.00 1.21  ? 82  GLU B HB2  1  
ATOM 3409   H HB3  . GLU B 2 82  ? -8.431  -1.940  -0.863  1.00 1.22  ? 82  GLU B HB3  1  
ATOM 3410   H HG2  . GLU B 2 82  ? -6.264  -0.205  -2.020  1.00 1.27  ? 82  GLU B HG2  1  
ATOM 3411   H HG3  . GLU B 2 82  ? -7.914  0.255   -1.606  1.00 1.20  ? 82  GLU B HG3  1  
ATOM 3412   N N    . LEU B 2 83  ? -6.868  -5.010  -1.794  1.00 1.33  ? 83  LEU B N    1  
ATOM 3413   C CA   . LEU B 2 83  ? -7.365  -6.382  -1.814  1.00 1.38  ? 83  LEU B CA   1  
ATOM 3414   C C    . LEU B 2 83  ? -6.712  -7.187  -0.699  1.00 1.43  ? 83  LEU B C    1  
ATOM 3415   O O    . LEU B 2 83  ? -7.386  -7.879  0.064   1.00 1.47  ? 83  LEU B O    1  
ATOM 3416   C CB   . LEU B 2 83  ? -7.078  -7.050  -3.162  1.00 1.44  ? 83  LEU B CB   1  
ATOM 3417   C CG   . LEU B 2 83  ? -7.934  -6.573  -4.334  1.00 1.42  ? 83  LEU B CG   1  
ATOM 3418   C CD1  . LEU B 2 83  ? -7.592  -7.358  -5.591  1.00 1.49  ? 83  LEU B CD1  1  
ATOM 3419   C CD2  . LEU B 2 83  ? -9.413  -6.701  -4.005  1.00 1.40  ? 83  LEU B CD2  1  
ATOM 3420   H H    . LEU B 2 83  ? -6.381  -4.666  -2.575  1.00 1.33  ? 83  LEU B H    1  
ATOM 3421   H HA   . LEU B 2 83  ? -8.432  -6.354  -1.650  1.00 1.37  ? 83  LEU B HA   1  
ATOM 3422   H HB2  . LEU B 2 83  ? -6.041  -6.876  -3.410  1.00 1.46  ? 83  LEU B HB2  1  
ATOM 3423   H HB3  . LEU B 2 83  ? -7.227  -8.113  -3.048  1.00 1.49  ? 83  LEU B HB3  1  
ATOM 3424   H HG   . LEU B 2 83  ? -7.723  -5.530  -4.523  1.00 1.40  ? 83  LEU B HG   1  
ATOM 3425   H HD11 . LEU B 2 83  ? -7.785  -8.408  -5.423  1.00 1.65  ? 83  LEU B HD11 1  
ATOM 3426   H HD12 . LEU B 2 83  ? -6.548  -7.218  -5.829  1.00 1.60  ? 83  LEU B HD12 1  
ATOM 3427   H HD13 . LEU B 2 83  ? -8.199  -7.007  -6.413  1.00 1.57  ? 83  LEU B HD13 1  
ATOM 3428   H HD21 . LEU B 2 83  ? -9.618  -7.700  -3.655  1.00 1.41  ? 83  LEU B HD21 1  
ATOM 3429   H HD22 . LEU B 2 83  ? -9.996  -6.502  -4.892  1.00 1.43  ? 83  LEU B HD22 1  
ATOM 3430   H HD23 . LEU B 2 83  ? -9.673  -5.989  -3.236  1.00 1.36  ? 83  LEU B HD23 1  
ATOM 3431   N N    . ALA B 2 84  ? -5.393  -7.065  -0.605  1.00 1.45  ? 84  ALA B N    1  
ATOM 3432   C CA   . ALA B 2 84  ? -4.623  -7.764  0.414   1.00 1.51  ? 84  ALA B CA   1  
ATOM 3433   C C    . ALA B 2 84  ? -5.004  -7.267  1.802   1.00 1.49  ? 84  ALA B C    1  
ATOM 3434   O O    . ALA B 2 84  ? -4.863  -7.977  2.795   1.00 1.57  ? 84  ALA B O    1  
ATOM 3435   C CB   . ALA B 2 84  ? -3.136  -7.574  0.169   1.00 1.54  ? 84  ALA B CB   1  
ATOM 3436   H H    . ALA B 2 84  ? -4.922  -6.485  -1.245  1.00 1.42  ? 84  ALA B H    1  
ATOM 3437   H HA   . ALA B 2 84  ? -4.848  -8.818  0.344   1.00 1.56  ? 84  ALA B HA   1  
ATOM 3438   H HB1  . ALA B 2 84  ? -2.884  -6.528  0.269   1.00 1.58  ? 84  ALA B HB1  1  
ATOM 3439   H HB2  . ALA B 2 84  ? -2.888  -7.912  -0.826  1.00 1.55  ? 84  ALA B HB2  1  
ATOM 3440   H HB3  . ALA B 2 84  ? -2.577  -8.149  0.893   1.00 1.62  ? 84  ALA B HB3  1  
ATOM 3441   N N    . LYS B 2 85  ? -5.490  -6.041  1.862   1.00 1.42  ? 85  LYS B N    1  
ATOM 3442   C CA   . LYS B 2 85  ? -5.913  -5.450  3.117   1.00 1.42  ? 85  LYS B CA   1  
ATOM 3443   C C    . LYS B 2 85  ? -7.305  -5.949  3.487   1.00 1.42  ? 85  LYS B C    1  
ATOM 3444   O O    . LYS B 2 85  ? -7.600  -6.209  4.651   1.00 1.43  ? 85  LYS B O    1  
ATOM 3445   C CB   . LYS B 2 85  ? -5.917  -3.926  2.998   1.00 1.38  ? 85  LYS B CB   1  
ATOM 3446   C CG   . LYS B 2 85  ? -6.196  -3.200  4.306   1.00 1.52  ? 85  LYS B CG   1  
ATOM 3447   C CD   . LYS B 2 85  ? -6.476  -1.723  4.073   1.00 1.51  ? 85  LYS B CD   1  
ATOM 3448   C CE   . LYS B 2 85  ? -5.296  -1.021  3.419   1.00 1.52  ? 85  LYS B CE   1  
ATOM 3449   N NZ   . LYS B 2 85  ? -5.656  0.336   2.936   1.00 1.50  ? 85  LYS B NZ   1  
ATOM 3450   H H    . LYS B 2 85  ? -5.564  -5.514  1.036   1.00 1.39  ? 85  LYS B H    1  
ATOM 3451   H HA   . LYS B 2 85  ? -5.214  -5.746  3.883   1.00 1.48  ? 85  LYS B HA   1  
ATOM 3452   H HB2  . LYS B 2 85  ? -4.952  -3.607  2.634   1.00 1.53  ? 85  LYS B HB2  1  
ATOM 3453   H HB3  . LYS B 2 85  ? -6.673  -3.637  2.283   1.00 1.49  ? 85  LYS B HB3  1  
ATOM 3454   H HG2  . LYS B 2 85  ? -7.056  -3.650  4.780   1.00 1.73  ? 85  LYS B HG2  1  
ATOM 3455   H HG3  . LYS B 2 85  ? -5.334  -3.297  4.950   1.00 1.77  ? 85  LYS B HG3  1  
ATOM 3456   H HD2  . LYS B 2 85  ? -7.338  -1.628  3.431   1.00 1.49  ? 85  LYS B HD2  1  
ATOM 3457   H HD3  . LYS B 2 85  ? -6.681  -1.254  5.023   1.00 1.76  ? 85  LYS B HD3  1  
ATOM 3458   H HE2  . LYS B 2 85  ? -4.500  -0.934  4.142   1.00 1.77  ? 85  LYS B HE2  1  
ATOM 3459   H HE3  . LYS B 2 85  ? -4.958  -1.613  2.582   1.00 1.54  ? 85  LYS B HE3  1  
ATOM 3460   H HZ1  . LYS B 2 85  ? -5.918  0.947   3.734   1.00 1.52  ? 85  LYS B HZ1  1  
ATOM 3461   H HZ2  . LYS B 2 85  ? -6.462  0.279   2.269   1.00 1.74  ? 85  LYS B HZ2  1  
ATOM 3462   H HZ3  . LYS B 2 85  ? -4.851  0.758   2.436   1.00 1.83  ? 85  LYS B HZ3  1  
ATOM 3463   N N    . GLU B 2 86  ? -8.143  -6.120  2.473   1.00 1.44  ? 86  GLU B N    1  
ATOM 3464   C CA   . GLU B 2 86  ? -9.513  -6.573  2.661   1.00 1.45  ? 86  GLU B CA   1  
ATOM 3465   C C    . GLU B 2 86  ? -9.591  -8.022  3.135   1.00 1.43  ? 86  GLU B C    1  
ATOM 3466   O O    . GLU B 2 86  ? -10.660 -8.489  3.525   1.00 1.47  ? 86  GLU B O    1  
ATOM 3467   C CB   . GLU B 2 86  ? -10.306 -6.407  1.365   1.00 1.52  ? 86  GLU B CB   1  
ATOM 3468   C CG   . GLU B 2 86  ? -11.014 -5.067  1.270   1.00 1.62  ? 86  GLU B CG   1  
ATOM 3469   C CD   . GLU B 2 86  ? -11.874 -4.794  2.485   1.00 1.67  ? 86  GLU B CD   1  
ATOM 3470   O OE1  . GLU B 2 86  ? -12.888 -5.502  2.673   1.00 1.79  ? 86  GLU B OE1  1  
ATOM 3471   O OE2  . GLU B 2 86  ? -11.532 -3.883  3.267   1.00 1.71  ? 86  GLU B OE2  1  
ATOM 3472   H H    . GLU B 2 86  ? -7.833  -5.921  1.561   1.00 1.46  ? 86  GLU B H    1  
ATOM 3473   H HA   . GLU B 2 86  ? -9.960  -5.946  3.417   1.00 1.45  ? 86  GLU B HA   1  
ATOM 3474   H HB2  . GLU B 2 86  ? -9.632  -6.495  0.526   1.00 1.56  ? 86  GLU B HB2  1  
ATOM 3475   H HB3  . GLU B 2 86  ? -11.050 -7.188  1.303   1.00 1.53  ? 86  GLU B HB3  1  
ATOM 3476   H HG2  . GLU B 2 86  ? -10.274 -4.286  1.187   1.00 1.66  ? 86  GLU B HG2  1  
ATOM 3477   H HG3  . GLU B 2 86  ? -11.644 -5.065  0.391   1.00 1.68  ? 86  GLU B HG3  1  
ATOM 3478   N N    . ILE B 2 87  ? -8.473  -8.734  3.101   1.00 1.41  ? 87  ILE B N    1  
ATOM 3479   C CA   . ILE B 2 87  ? -8.459  -10.123 3.541   1.00 1.42  ? 87  ILE B CA   1  
ATOM 3480   C C    . ILE B 2 87  ? -8.158  -10.214 5.039   1.00 1.38  ? 87  ILE B C    1  
ATOM 3481   O O    . ILE B 2 87  ? -8.411  -11.236 5.678   1.00 1.44  ? 87  ILE B O    1  
ATOM 3482   C CB   . ILE B 2 87  ? -7.440  -10.966 2.733   1.00 1.44  ? 87  ILE B CB   1  
ATOM 3483   C CG1  . ILE B 2 87  ? -7.837  -12.448 2.753   1.00 1.47  ? 87  ILE B CG1  1  
ATOM 3484   C CG2  . ILE B 2 87  ? -6.025  -10.787 3.268   1.00 1.43  ? 87  ILE B CG2  1  
ATOM 3485   C CD1  . ILE B 2 87  ? -6.943  -13.331 1.904   1.00 1.63  ? 87  ILE B CD1  1  
ATOM 3486   H H    . ILE B 2 87  ? -7.648  -8.326  2.761   1.00 1.42  ? 87  ILE B H    1  
ATOM 3487   H HA   . ILE B 2 87  ? -9.444  -10.531 3.365   1.00 1.48  ? 87  ILE B HA   1  
ATOM 3488   H HB   . ILE B 2 87  ? -7.454  -10.615 1.712   1.00 1.48  ? 87  ILE B HB   1  
ATOM 3489   H HG12 . ILE B 2 87  ? -7.795  -12.812 3.767   1.00 1.55  ? 87  ILE B HG12 1  
ATOM 3490   H HG13 . ILE B 2 87  ? -8.849  -12.548 2.382   1.00 1.54  ? 87  ILE B HG13 1  
ATOM 3491   H HG21 . ILE B 2 87  ? -5.728  -9.755  3.159   1.00 1.42  ? 87  ILE B HG21 1  
ATOM 3492   H HG22 . ILE B 2 87  ? -5.348  -11.417 2.712   1.00 1.47  ? 87  ILE B HG22 1  
ATOM 3493   H HG23 . ILE B 2 87  ? -5.999  -11.061 4.313   1.00 1.43  ? 87  ILE B HG23 1  
ATOM 3494   H HD11 . ILE B 2 87  ? -6.915  -12.949 0.895   1.00 1.79  ? 87  ILE B HD11 1  
ATOM 3495   H HD12 . ILE B 2 87  ? -7.330  -14.339 1.900   1.00 1.85  ? 87  ILE B HD12 1  
ATOM 3496   H HD13 . ILE B 2 87  ? -5.943  -13.331 2.317   1.00 1.91  ? 87  ILE B HD13 1  
ATOM 3497   N N    . ARG B 2 88  ? -7.638  -9.128  5.598   1.00 1.33  ? 88  ARG B N    1  
ATOM 3498   C CA   . ARG B 2 88  ? -7.300  -9.089  7.016   1.00 1.35  ? 88  ARG B CA   1  
ATOM 3499   C C    . ARG B 2 88  ? -8.166  -8.070  7.756   1.00 1.36  ? 88  ARG B C    1  
ATOM 3500   O O    . ARG B 2 88  ? -8.464  -8.230  8.941   1.00 1.46  ? 88  ARG B O    1  
ATOM 3501   C CB   . ARG B 2 88  ? -5.819  -8.740  7.191   1.00 1.35  ? 88  ARG B CB   1  
ATOM 3502   C CG   . ARG B 2 88  ? -5.263  -9.077  8.569   1.00 1.51  ? 88  ARG B CG   1  
ATOM 3503   C CD   . ARG B 2 88  ? -4.750  -7.837  9.289   1.00 1.53  ? 88  ARG B CD   1  
ATOM 3504   N NE   . ARG B 2 88  ? -5.814  -7.136  10.007  1.00 1.56  ? 88  ARG B NE   1  
ATOM 3505   C CZ   . ARG B 2 88  ? -5.765  -5.844  10.344  1.00 1.78  ? 88  ARG B CZ   1  
ATOM 3506   N NH1  . ARG B 2 88  ? -4.703  -5.105  10.032  1.00 2.14  ? 88  ARG B NH1  1  
ATOM 3507   N NH2  . ARG B 2 88  ? -6.778  -5.289  10.998  1.00 1.88  ? 88  ARG B NH2  1  
ATOM 3508   H H    . ARG B 2 88  ? -7.479  -8.337  5.044   1.00 1.32  ? 88  ARG B H    1  
ATOM 3509   H HA   . ARG B 2 88  ? -7.483  -10.069 7.428   1.00 1.43  ? 88  ARG B HA   1  
ATOM 3510   H HB2  . ARG B 2 88  ? -5.244  -9.280  6.451   1.00 1.42  ? 88  ARG B HB2  1  
ATOM 3511   H HB3  . ARG B 2 88  ? -5.693  -7.681  7.024   1.00 1.28  ? 88  ARG B HB3  1  
ATOM 3512   H HG2  . ARG B 2 88  ? -6.045  -9.523  9.163   1.00 1.63  ? 88  ARG B HG2  1  
ATOM 3513   H HG3  . ARG B 2 88  ? -4.450  -9.780  8.456   1.00 1.61  ? 88  ARG B HG3  1  
ATOM 3514   H HD2  . ARG B 2 88  ? -3.991  -8.136  9.997   1.00 1.71  ? 88  ARG B HD2  1  
ATOM 3515   H HD3  . ARG B 2 88  ? -4.317  -7.165  8.562   1.00 1.50  ? 88  ARG B HD3  1  
ATOM 3516   H HE   . ARG B 2 88  ? -6.613  -7.661  10.254  1.00 1.60  ? 88  ARG B HE   1  
ATOM 3517   H HH11 . ARG B 2 88  ? -3.927  -5.510  9.538   1.00 2.19  ? 88  ARG B HH11 1  
ATOM 3518   H HH12 . ARG B 2 88  ? -4.670  -4.137  10.293  1.00 2.47  ? 88  ARG B HH12 1  
ATOM 3519   H HH21 . ARG B 2 88  ? -7.582  -5.836  11.243  1.00 1.85  ? 88  ARG B HH21 1  
ATOM 3520   H HH22 . ARG B 2 88  ? -6.742  -4.320  11.252  1.00 2.13  ? 88  ARG B HH22 1  
ATOM 3521   N N    . LYS B 2 89  ? -8.552  -7.016  7.051   1.00 1.36  ? 89  LYS B N    1  
ATOM 3522   C CA   . LYS B 2 89  ? -9.373  -5.959  7.623   1.00 1.43  ? 89  LYS B CA   1  
ATOM 3523   C C    . LYS B 2 89  ? -10.855 -6.220  7.374   1.00 1.46  ? 89  LYS B C    1  
ATOM 3524   O O    . LYS B 2 89  ? -11.648 -6.242  8.316   1.00 1.51  ? 89  LYS B O    1  
ATOM 3525   C CB   . LYS B 2 89  ? -8.962  -4.601  7.030   1.00 1.49  ? 89  LYS B CB   1  
ATOM 3526   C CG   . LYS B 2 89  ? -10.034 -3.521  7.117   1.00 1.53  ? 89  LYS B CG   1  
ATOM 3527   C CD   . LYS B 2 89  ? -9.693  -2.337  6.224   1.00 1.72  ? 89  LYS B CD   1  
ATOM 3528   C CE   . LYS B 2 89  ? -10.910 -1.464  5.955   1.00 1.89  ? 89  LYS B CE   1  
ATOM 3529   N NZ   . LYS B 2 89  ? -11.953 -2.185  5.177   1.00 2.00  ? 89  LYS B NZ   1  
ATOM 3530   H H    . LYS B 2 89  ? -8.273  -6.944  6.113   1.00 1.38  ? 89  LYS B H    1  
ATOM 3531   H HA   . LYS B 2 89  ? -9.197  -5.944  8.688   1.00 1.47  ? 89  LYS B HA   1  
ATOM 3532   H HB2  . LYS B 2 89  ? -8.086  -4.245  7.553   1.00 1.57  ? 89  LYS B HB2  1  
ATOM 3533   H HB3  . LYS B 2 89  ? -8.711  -4.741  5.989   1.00 1.55  ? 89  LYS B HB3  1  
ATOM 3534   H HG2  . LYS B 2 89  ? -10.979 -3.937  6.804   1.00 1.53  ? 89  LYS B HG2  1  
ATOM 3535   H HG3  . LYS B 2 89  ? -10.109 -3.182  8.142   1.00 1.60  ? 89  LYS B HG3  1  
ATOM 3536   H HD2  . LYS B 2 89  ? -8.935  -1.741  6.707   1.00 1.88  ? 89  LYS B HD2  1  
ATOM 3537   H HD3  . LYS B 2 89  ? -9.316  -2.710  5.284   1.00 1.82  ? 89  LYS B HD3  1  
ATOM 3538   H HE2  . LYS B 2 89  ? -11.331 -1.151  6.900   1.00 2.14  ? 89  LYS B HE2  1  
ATOM 3539   H HE3  . LYS B 2 89  ? -10.595 -0.594  5.397   1.00 1.95  ? 89  LYS B HE3  1  
ATOM 3540   H HZ1  . LYS B 2 89  ? -12.700 -1.528  4.881   1.00 2.29  ? 89  LYS B HZ1  1  
ATOM 3541   H HZ2  . LYS B 2 89  ? -12.385 -2.935  5.757   1.00 2.28  ? 89  LYS B HZ2  1  
ATOM 3542   H HZ3  . LYS B 2 89  ? -11.538 -2.628  4.324   1.00 2.05  ? 89  LYS B HZ3  1  
ATOM 3543   N N    . LYS B 2 90  ? -11.210 -6.423  6.103   1.00 1.46  ? 90  LYS B N    1  
ATOM 3544   C CA   . LYS B 2 90  ? -12.597 -6.660  5.709   1.00 1.50  ? 90  LYS B CA   1  
ATOM 3545   C C    . LYS B 2 90  ? -13.483 -5.531  6.243   1.00 1.49  ? 90  LYS B C    1  
ATOM 3546   O O    . LYS B 2 90  ? -13.318 -4.376  5.858   1.00 1.61  ? 90  LYS B O    1  
ATOM 3547   C CB   . LYS B 2 90  ? -13.074 -8.032  6.208   1.00 1.59  ? 90  LYS B CB   1  
ATOM 3548   C CG   . LYS B 2 90  ? -14.319 -8.545  5.496   1.00 1.65  ? 90  LYS B CG   1  
ATOM 3549   C CD   . LYS B 2 90  ? -13.973 -9.454  4.323   1.00 1.73  ? 90  LYS B CD   1  
ATOM 3550   C CE   . LYS B 2 90  ? -14.283 -8.803  2.981   1.00 1.89  ? 90  LYS B CE   1  
ATOM 3551   N NZ   . LYS B 2 90  ? -13.100 -8.108  2.406   1.00 2.21  ? 90  LYS B NZ   1  
ATOM 3552   H H    . LYS B 2 90  ? -10.519 -6.410  5.412   1.00 1.44  ? 90  LYS B H    1  
ATOM 3553   H HA   . LYS B 2 90  ? -12.636 -6.646  4.629   1.00 1.51  ? 90  LYS B HA   1  
ATOM 3554   H HB2  . LYS B 2 90  ? -12.281 -8.748  6.059   1.00 1.69  ? 90  LYS B HB2  1  
ATOM 3555   H HB3  . LYS B 2 90  ? -13.288 -7.962  7.263   1.00 1.63  ? 90  LYS B HB3  1  
ATOM 3556   H HG2  . LYS B 2 90  ? -14.917 -9.100  6.204   1.00 1.81  ? 90  LYS B HG2  1  
ATOM 3557   H HG3  . LYS B 2 90  ? -14.882 -7.700  5.134   1.00 1.80  ? 90  LYS B HG3  1  
ATOM 3558   H HD2  . LYS B 2 90  ? -12.922 -9.689  4.361   1.00 1.94  ? 90  LYS B HD2  1  
ATOM 3559   H HD3  . LYS B 2 90  ? -14.547 -10.364 4.410   1.00 1.86  ? 90  LYS B HD3  1  
ATOM 3560   H HE2  . LYS B 2 90  ? -14.606 -9.570  2.290   1.00 2.06  ? 90  LYS B HE2  1  
ATOM 3561   H HE3  . LYS B 2 90  ? -15.080 -8.086  3.118   1.00 1.98  ? 90  LYS B HE3  1  
ATOM 3562   H HZ1  . LYS B 2 90  ? -12.228 -8.428  2.882   1.00 2.45  ? 90  LYS B HZ1  1  
ATOM 3563   H HZ2  . LYS B 2 90  ? -13.191 -7.073  2.534   1.00 2.29  ? 90  LYS B HZ2  1  
ATOM 3564   H HZ3  . LYS B 2 90  ? -13.022 -8.313  1.389   1.00 2.49  ? 90  LYS B HZ3  1  
ATOM 3565   N N    . LYS B 2 91  ? -14.394 -5.849  7.145   1.00 1.43  ? 91  LYS B N    1  
ATOM 3566   C CA   . LYS B 2 91  ? -15.263 -4.846  7.728   1.00 1.42  ? 91  LYS B CA   1  
ATOM 3567   C C    . LYS B 2 91  ? -15.084 -4.849  9.235   1.00 1.44  ? 91  LYS B C    1  
ATOM 3568   O O    . LYS B 2 91  ? -15.941 -5.335  9.978   1.00 1.50  ? 91  LYS B O    1  
ATOM 3569   C CB   . LYS B 2 91  ? -16.722 -5.108  7.361   1.00 1.48  ? 91  LYS B CB   1  
ATOM 3570   C CG   . LYS B 2 91  ? -17.178 -4.395  6.099   1.00 1.40  ? 91  LYS B CG   1  
ATOM 3571   C CD   . LYS B 2 91  ? -18.509 -4.940  5.633   1.00 1.77  ? 91  LYS B CD   1  
ATOM 3572   C CE   . LYS B 2 91  ? -19.114 -4.118  4.511   1.00 1.88  ? 91  LYS B CE   1  
ATOM 3573   N NZ   . LYS B 2 91  ? -20.452 -4.641  4.141   1.00 2.77  ? 91  LYS B NZ   1  
ATOM 3574   H H    . LYS B 2 91  ? -14.476 -6.780  7.438   1.00 1.44  ? 91  LYS B H    1  
ATOM 3575   H HA   . LYS B 2 91  ? -14.965 -3.880  7.341   1.00 1.39  ? 91  LYS B HA   1  
ATOM 3576   H HB2  . LYS B 2 91  ? -16.858 -6.170  7.217   1.00 1.71  ? 91  LYS B HB2  1  
ATOM 3577   H HB3  . LYS B 2 91  ? -17.348 -4.784  8.178   1.00 1.57  ? 91  LYS B HB3  1  
ATOM 3578   H HG2  . LYS B 2 91  ? -17.283 -3.340  6.304   1.00 1.59  ? 91  LYS B HG2  1  
ATOM 3579   H HG3  . LYS B 2 91  ? -16.444 -4.545  5.323   1.00 1.71  ? 91  LYS B HG3  1  
ATOM 3580   H HD2  . LYS B 2 91  ? -18.359 -5.947  5.275   1.00 2.20  ? 91  LYS B HD2  1  
ATOM 3581   H HD3  . LYS B 2 91  ? -19.191 -4.952  6.471   1.00 2.13  ? 91  LYS B HD3  1  
ATOM 3582   H HE2  . LYS B 2 91  ? -19.210 -3.093  4.838   1.00 2.08  ? 91  LYS B HE2  1  
ATOM 3583   H HE3  . LYS B 2 91  ? -18.465 -4.163  3.649   1.00 1.88  ? 91  LYS B HE3  1  
ATOM 3584   H HZ1  . LYS B 2 91  ? -20.775 -4.221  3.239   1.00 3.23  ? 91  LYS B HZ1  1  
ATOM 3585   H HZ2  . LYS B 2 91  ? -21.144 -4.412  4.889   1.00 3.21  ? 91  LYS B HZ2  1  
ATOM 3586   H HZ3  . LYS B 2 91  ? -20.412 -5.677  4.032   1.00 3.08  ? 91  LYS B HZ3  1  
ATOM 3587   N N    . ASP B 2 92  ? -13.949 -4.328  9.679   1.00 1.43  ? 92  ASP B N    1  
ATOM 3588   C CA   . ASP B 2 92  ? -13.631 -4.282  11.098  1.00 1.48  ? 92  ASP B CA   1  
ATOM 3589   C C    . ASP B 2 92  ? -14.480 -3.243  11.818  1.00 1.47  ? 92  ASP B C    1  
ATOM 3590   O O    . ASP B 2 92  ? -14.000 -2.178  12.212  1.00 1.50  ? 92  ASP B O    1  
ATOM 3591   C CB   . ASP B 2 92  ? -12.145 -3.999  11.308  1.00 1.52  ? 92  ASP B CB   1  
ATOM 3592   C CG   . ASP B 2 92  ? -11.603 -4.684  12.545  1.00 1.59  ? 92  ASP B CG   1  
ATOM 3593   O OD1  . ASP B 2 92  ? -12.355 -4.829  13.532  1.00 1.82  ? 92  ASP B OD1  1  
ATOM 3594   O OD2  . ASP B 2 92  ? -10.426 -5.089  12.531  1.00 2.01  ? 92  ASP B OD2  1  
ATOM 3595   H H    . ASP B 2 92  ? -13.305 -3.970  9.033   1.00 1.43  ? 92  ASP B H    1  
ATOM 3596   H HA   . ASP B 2 92  ? -13.858 -5.254  11.511  1.00 1.54  ? 92  ASP B HA   1  
ATOM 3597   H HB2  . ASP B 2 92  ? -11.593 -4.353  10.451  1.00 1.63  ? 92  ASP B HB2  1  
ATOM 3598   H HB3  . ASP B 2 92  ? -11.998 -2.934  11.412  1.00 1.57  ? 92  ASP B HB3  1  
ATOM 3599   N N    . LEU B 2 93  ? -15.751 -3.570  11.963  1.00 1.48  ? 93  LEU B N    1  
ATOM 3600   C CA   . LEU B 2 93  ? -16.716 -2.716  12.627  1.00 1.51  ? 93  LEU B CA   1  
ATOM 3601   C C    . LEU B 2 93  ? -17.848 -3.580  13.155  1.00 1.66  ? 93  LEU B C    1  
ATOM 3602   O O    . LEU B 2 93  ? -18.286 -3.429  14.293  1.00 1.78  ? 93  LEU B O    1  
ATOM 3603   C CB   . LEU B 2 93  ? -17.266 -1.669  11.657  1.00 1.43  ? 93  LEU B CB   1  
ATOM 3604   C CG   . LEU B 2 93  ? -18.254 -0.673  12.267  1.00 1.45  ? 93  LEU B CG   1  
ATOM 3605   C CD1  . LEU B 2 93  ? -17.516 0.368   13.096  1.00 1.53  ? 93  LEU B CD1  1  
ATOM 3606   C CD2  . LEU B 2 93  ? -19.074 -0.007  11.171  1.00 1.48  ? 93  LEU B CD2  1  
ATOM 3607   H H    . LEU B 2 93  ? -16.055 -4.430  11.600  1.00 1.50  ? 93  LEU B H    1  
ATOM 3608   H HA   . LEU B 2 93  ? -16.225 -2.225  13.453  1.00 1.54  ? 93  LEU B HA   1  
ATOM 3609   H HB2  . LEU B 2 93  ? -16.432 -1.117  11.251  1.00 1.41  ? 93  LEU B HB2  1  
ATOM 3610   H HB3  . LEU B 2 93  ? -17.761 -2.185  10.848  1.00 1.45  ? 93  LEU B HB3  1  
ATOM 3611   H HG   . LEU B 2 93  ? -18.933 -1.203  12.921  1.00 1.48  ? 93  LEU B HG   1  
ATOM 3612   H HD11 . LEU B 2 93  ? -16.985 -0.121  13.899  1.00 1.67  ? 93  LEU B HD11 1  
ATOM 3613   H HD12 . LEU B 2 93  ? -18.225 1.071   13.507  1.00 1.67  ? 93  LEU B HD12 1  
ATOM 3614   H HD13 . LEU B 2 93  ? -16.810 0.894   12.470  1.00 1.59  ? 93  LEU B HD13 1  
ATOM 3615   H HD21 . LEU B 2 93  ? -19.619 -0.760  10.622  1.00 1.60  ? 93  LEU B HD21 1  
ATOM 3616   H HD22 . LEU B 2 93  ? -18.414 0.524   10.500  1.00 1.58  ? 93  LEU B HD22 1  
ATOM 3617   H HD23 . LEU B 2 93  ? -19.771 0.687   11.617  1.00 1.65  ? 93  LEU B HD23 1  
ATOM 3618   N N    . LYS B 2 94  ? -18.304 -4.498  12.316  1.00 1.71  ? 94  LYS B N    1  
ATOM 3619   C CA   . LYS B 2 94  ? -19.377 -5.404  12.685  1.00 1.90  ? 94  LYS B CA   1  
ATOM 3620   C C    . LYS B 2 94  ? -18.936 -6.851  12.492  1.00 1.98  ? 94  LYS B C    1  
ATOM 3621   O O    . LYS B 2 94  ? -18.682 -7.564  13.462  1.00 2.20  ? 94  LYS B O    1  
ATOM 3622   C CB   . LYS B 2 94  ? -20.632 -5.125  11.854  1.00 1.98  ? 94  LYS B CB   1  
ATOM 3623   C CG   . LYS B 2 94  ? -21.284 -3.777  12.139  1.00 1.96  ? 94  LYS B CG   1  
ATOM 3624   C CD   . LYS B 2 94  ? -21.939 -3.746  13.512  1.00 2.06  ? 94  LYS B CD   1  
ATOM 3625   C CE   . LYS B 2 94  ? -22.805 -2.506  13.688  1.00 1.96  ? 94  LYS B CE   1  
ATOM 3626   N NZ   . LYS B 2 94  ? -23.400 -2.429  15.050  1.00 2.17  ? 94  LYS B NZ   1  
ATOM 3627   H H    . LYS B 2 94  ? -17.908 -4.569  11.423  1.00 1.64  ? 94  LYS B H    1  
ATOM 3628   H HA   . LYS B 2 94  ? -19.602 -5.245  13.729  1.00 1.97  ? 94  LYS B HA   1  
ATOM 3629   H HB2  . LYS B 2 94  ? -20.368 -5.155  10.807  1.00 1.94  ? 94  LYS B HB2  1  
ATOM 3630   H HB3  . LYS B 2 94  ? -21.359 -5.900  12.053  1.00 2.15  ? 94  LYS B HB3  1  
ATOM 3631   H HG2  . LYS B 2 94  ? -20.526 -3.008  12.098  1.00 1.92  ? 94  LYS B HG2  1  
ATOM 3632   H HG3  . LYS B 2 94  ? -22.034 -3.587  11.386  1.00 2.05  ? 94  LYS B HG3  1  
ATOM 3633   H HD2  . LYS B 2 94  ? -22.558 -4.625  13.624  1.00 2.25  ? 94  LYS B HD2  1  
ATOM 3634   H HD3  . LYS B 2 94  ? -21.168 -3.746  14.268  1.00 2.21  ? 94  LYS B HD3  1  
ATOM 3635   H HE2  . LYS B 2 94  ? -22.196 -1.630  13.522  1.00 2.01  ? 94  LYS B HE2  1  
ATOM 3636   H HE3  . LYS B 2 94  ? -23.601 -2.534  12.957  1.00 1.96  ? 94  LYS B HE3  1  
ATOM 3637   H HZ1  . LYS B 2 94  ? -23.808 -3.347  15.319  1.00 2.40  ? 94  LYS B HZ1  1  
ATOM 3638   H HZ2  . LYS B 2 94  ? -24.153 -1.712  15.073  1.00 2.37  ? 94  LYS B HZ2  1  
ATOM 3639   H HZ3  . LYS B 2 94  ? -22.672 -2.169  15.746  1.00 2.37  ? 94  LYS B HZ3  1  
ATOM 3640   N N    . ILE B 2 95  ? -18.832 -7.272  11.239  1.00 1.91  ? 95  ILE B N    1  
ATOM 3641   C CA   . ILE B 2 95  ? -18.430 -8.635  10.914  1.00 2.00  ? 95  ILE B CA   1  
ATOM 3642   C C    . ILE B 2 95  ? -17.253 -8.636  9.942   1.00 1.68  ? 95  ILE B C    1  
ATOM 3643   O O    . ILE B 2 95  ? -17.261 -7.920  8.942   1.00 1.68  ? 95  ILE B O    1  
ATOM 3644   C CB   . ILE B 2 95  ? -19.610 -9.425  10.297  1.00 2.32  ? 95  ILE B CB   1  
ATOM 3645   C CG1  . ILE B 2 95  ? -20.692 -9.662  11.353  1.00 2.62  ? 95  ILE B CG1  1  
ATOM 3646   C CG2  . ILE B 2 95  ? -19.138 -10.751 9.715   1.00 2.65  ? 95  ILE B CG2  1  
ATOM 3647   C CD1  . ILE B 2 95  ? -21.980 -10.225 10.792  1.00 2.91  ? 95  ILE B CD1  1  
ATOM 3648   H H    . ILE B 2 95  ? -19.036 -6.650  10.506  1.00 1.87  ? 95  ILE B H    1  
ATOM 3649   H HA   . ILE B 2 95  ? -18.133 -9.127  11.829  1.00 2.20  ? 95  ILE B HA   1  
ATOM 3650   H HB   . ILE B 2 95  ? -20.024 -8.837  9.493   1.00 2.45  ? 95  ILE B HB   1  
ATOM 3651   H HG12 . ILE B 2 95  ? -20.320 -10.361 12.086  1.00 2.83  ? 95  ILE B HG12 1  
ATOM 3652   H HG13 . ILE B 2 95  ? -20.923 -8.724  11.838  1.00 2.85  ? 95  ILE B HG13 1  
ATOM 3653   H HG21 . ILE B 2 95  ? -18.768 -11.378 10.510  1.00 2.90  ? 95  ILE B HG21 1  
ATOM 3654   H HG22 . ILE B 2 95  ? -18.349 -10.571 9.001   1.00 2.81  ? 95  ILE B HG22 1  
ATOM 3655   H HG23 . ILE B 2 95  ? -19.964 -11.244 9.224   1.00 3.03  ? 95  ILE B HG23 1  
ATOM 3656   H HD11 . ILE B 2 95  ? -21.775 -11.158 10.289  1.00 3.11  ? 95  ILE B HD11 1  
ATOM 3657   H HD12 . ILE B 2 95  ? -22.404 -9.523  10.090  1.00 3.13  ? 95  ILE B HD12 1  
ATOM 3658   H HD13 . ILE B 2 95  ? -22.680 -10.395 11.596  1.00 3.22  ? 95  ILE B HD13 1  
ATOM 3659   N N    . ARG B 2 96  ? -16.239 -9.434  10.249  1.00 1.63  ? 96  ARG B N    1  
ATOM 3660   C CA   . ARG B 2 96  ? -15.062 -9.539  9.397   1.00 1.48  ? 96  ARG B CA   1  
ATOM 3661   C C    . ARG B 2 96  ? -14.989 -10.926 8.777   1.00 1.48  ? 96  ARG B C    1  
ATOM 3662   O O    . ARG B 2 96  ? -15.299 -11.105 7.597   1.00 1.89  ? 96  ARG B O    1  
ATOM 3663   C CB   . ARG B 2 96  ? -13.787 -9.265  10.198  1.00 1.65  ? 96  ARG B CB   1  
ATOM 3664   C CG   . ARG B 2 96  ? -13.710 -7.860  10.771  1.00 1.87  ? 96  ARG B CG   1  
ATOM 3665   C CD   . ARG B 2 96  ? -13.228 -7.869  12.216  1.00 2.36  ? 96  ARG B CD   1  
ATOM 3666   N NE   . ARG B 2 96  ? -14.242 -8.403  13.126  1.00 2.59  ? 96  ARG B NE   1  
ATOM 3667   C CZ   . ARG B 2 96  ? -14.761 -7.724  14.151  1.00 2.99  ? 96  ARG B CZ   1  
ATOM 3668   N NH1  . ARG B 2 96  ? -14.326 -6.501  14.442  1.00 3.38  ? 96  ARG B NH1  1  
ATOM 3669   N NH2  . ARG B 2 96  ? -15.710 -8.275  14.900  1.00 3.45  ? 96  ARG B NH2  1  
ATOM 3670   H H    . ARG B 2 96  ? -16.285 -9.972  11.067  1.00 1.85  ? 96  ARG B H    1  
ATOM 3671   H HA   . ARG B 2 96  ? -15.151 -8.805  8.609   1.00 1.50  ? 96  ARG B HA   1  
ATOM 3672   H HB2  . ARG B 2 96  ? -13.732 -9.968  11.013  1.00 1.93  ? 96  ARG B HB2  1  
ATOM 3673   H HB3  . ARG B 2 96  ? -12.934 -9.413  9.551   1.00 1.90  ? 96  ARG B HB3  1  
ATOM 3674   H HG2  . ARG B 2 96  ? -13.021 -7.278  10.178  1.00 2.16  ? 96  ARG B HG2  1  
ATOM 3675   H HG3  . ARG B 2 96  ? -14.691 -7.411  10.730  1.00 1.96  ? 96  ARG B HG3  1  
ATOM 3676   H HD2  . ARG B 2 96  ? -12.340 -8.478  12.281  1.00 2.64  ? 96  ARG B HD2  1  
ATOM 3677   H HD3  . ARG B 2 96  ? -12.991 -6.856  12.509  1.00 2.80  ? 96  ARG B HD3  1  
ATOM 3678   H HE   . ARG B 2 96  ? -14.558 -9.319  12.956  1.00 2.81  ? 96  ARG B HE   1  
ATOM 3679   H HH11 . ARG B 2 96  ? -13.597 -6.069  13.892  1.00 3.40  ? 96  ARG B HH11 1  
ATOM 3680   H HH12 . ARG B 2 96  ? -14.714 -6.000  15.220  1.00 3.92  ? 96  ARG B HH12 1  
ATOM 3681   H HH21 . ARG B 2 96  ? -16.042 -9.199  14.700  1.00 3.63  ? 96  ARG B HH21 1  
ATOM 3682   H HH22 . ARG B 2 96  ? -16.100 -7.767  15.674  1.00 3.86  ? 96  ARG B HH22 1  
ATOM 3683   N N    . LYS B 2 97  ? -14.595 -11.904 9.599   1.00 1.85  ? 97  LYS B N    1  
ATOM 3684   C CA   . LYS B 2 97  ? -14.468 -13.299 9.175   1.00 2.00  ? 97  LYS B CA   1  
ATOM 3685   C C    . LYS B 2 97  ? -13.417 -13.453 8.079   1.00 1.91  ? 97  LYS B C    1  
ATOM 3686   O O    . LYS B 2 97  ? -12.589 -12.567 7.859   1.00 2.47  ? 97  LYS B O    1  
ATOM 3687   C CB   . LYS B 2 97  ? -15.820 -13.856 8.693   1.00 2.51  ? 97  LYS B CB   1  
ATOM 3688   C CG   . LYS B 2 97  ? -16.944 -13.716 9.708   1.00 3.25  ? 97  LYS B CG   1  
ATOM 3689   C CD   . LYS B 2 97  ? -18.233 -14.343 9.196   1.00 3.73  ? 97  LYS B CD   1  
ATOM 3690   C CE   . LYS B 2 97  ? -18.314 -15.823 9.534   1.00 3.96  ? 97  LYS B CE   1  
ATOM 3691   N NZ   . LYS B 2 97  ? -18.560 -16.042 10.984  1.00 4.34  ? 97  LYS B NZ   1  
ATOM 3692   H H    . LYS B 2 97  ? -14.374 -11.675 10.526  1.00 2.40  ? 97  LYS B H    1  
ATOM 3693   H HA   . LYS B 2 97  ? -14.147 -13.871 10.033  1.00 2.43  ? 97  LYS B HA   1  
ATOM 3694   H HB2  . LYS B 2 97  ? -16.109 -13.331 7.794   1.00 2.72  ? 97  LYS B HB2  1  
ATOM 3695   H HB3  . LYS B 2 97  ? -15.703 -14.904 8.462   1.00 2.81  ? 97  LYS B HB3  1  
ATOM 3696   H HG2  . LYS B 2 97  ? -16.653 -14.208 10.625  1.00 3.50  ? 97  LYS B HG2  1  
ATOM 3697   H HG3  . LYS B 2 97  ? -17.115 -12.667 9.898   1.00 3.69  ? 97  LYS B HG3  1  
ATOM 3698   H HD2  . LYS B 2 97  ? -19.073 -13.837 9.649   1.00 4.16  ? 97  LYS B HD2  1  
ATOM 3699   H HD3  . LYS B 2 97  ? -18.275 -14.226 8.124   1.00 3.99  ? 97  LYS B HD3  1  
ATOM 3700   H HE2  . LYS B 2 97  ? -19.121 -16.266 8.970   1.00 4.23  ? 97  LYS B HE2  1  
ATOM 3701   H HE3  . LYS B 2 97  ? -17.383 -16.294 9.261   1.00 4.07  ? 97  LYS B HE3  1  
ATOM 3702   H HZ1  . LYS B 2 97  ? -18.751 -17.047 11.169  1.00 4.59  ? 97  LYS B HZ1  1  
ATOM 3703   H HZ2  . LYS B 2 97  ? -19.380 -15.484 11.297  1.00 4.57  ? 97  LYS B HZ2  1  
ATOM 3704   H HZ3  . LYS B 2 97  ? -17.728 -15.752 11.535  1.00 4.58  ? 97  LYS B HZ3  1  
ATOM 3705   N N    . LYS B 2 98  ? -13.447 -14.592 7.408   1.00 1.87  ? 98  LYS B N    1  
ATOM 3706   C CA   . LYS B 2 98  ? -12.514 -14.875 6.328   1.00 2.23  ? 98  LYS B CA   1  
ATOM 3707   C C    . LYS B 2 98  ? -13.226 -15.602 5.190   1.00 2.54  ? 98  LYS B C    1  
ATOM 3708   O O    . LYS B 2 98  ? -14.303 -16.173 5.388   1.00 2.77  ? 98  LYS B O    1  
ATOM 3709   C CB   . LYS B 2 98  ? -11.323 -15.712 6.831   1.00 2.56  ? 98  LYS B CB   1  
ATOM 3710   C CG   . LYS B 2 98  ? -11.615 -16.552 8.074   1.00 2.88  ? 98  LYS B CG   1  
ATOM 3711   C CD   . LYS B 2 98  ? -12.593 -17.686 7.792   1.00 3.33  ? 98  LYS B CD   1  
ATOM 3712   C CE   . LYS B 2 98  ? -11.919 -18.868 7.112   1.00 3.56  ? 98  LYS B CE   1  
ATOM 3713   N NZ   . LYS B 2 98  ? -11.004 -19.598 8.023   1.00 3.47  ? 98  LYS B NZ   1  
ATOM 3714   H H    . LYS B 2 98  ? -14.124 -15.261 7.635   1.00 2.06  ? 98  LYS B H    1  
ATOM 3715   H HA   . LYS B 2 98  ? -12.148 -13.930 5.958   1.00 2.67  ? 98  LYS B HA   1  
ATOM 3716   H HB2  . LYS B 2 98  ? -11.015 -16.379 6.042   1.00 2.88  ? 98  LYS B HB2  1  
ATOM 3717   H HB3  . LYS B 2 98  ? -10.505 -15.043 7.062   1.00 3.01  ? 98  LYS B HB3  1  
ATOM 3718   H HG2  . LYS B 2 98  ? -10.688 -16.977 8.432   1.00 3.25  ? 98  LYS B HG2  1  
ATOM 3719   H HG3  . LYS B 2 98  ? -12.033 -15.909 8.835   1.00 3.12  ? 98  LYS B HG3  1  
ATOM 3720   H HD2  . LYS B 2 98  ? -13.021 -18.022 8.723   1.00 3.85  ? 98  LYS B HD2  1  
ATOM 3721   H HD3  . LYS B 2 98  ? -13.378 -17.314 7.149   1.00 3.57  ? 98  LYS B HD3  1  
ATOM 3722   H HE2  . LYS B 2 98  ? -12.683 -19.549 6.766   1.00 3.98  ? 98  LYS B HE2  1  
ATOM 3723   H HE3  . LYS B 2 98  ? -11.357 -18.503 6.267   1.00 3.89  ? 98  LYS B HE3  1  
ATOM 3724   H HZ1  . LYS B 2 98  ? -10.168 -19.016 8.244   1.00 3.80  ? 98  LYS B HZ1  1  
ATOM 3725   H HZ2  . LYS B 2 98  ? -10.685 -20.487 7.570   1.00 3.50  ? 98  LYS B HZ2  1  
ATOM 3726   H HZ3  . LYS B 2 98  ? -11.492 -19.835 8.911   1.00 3.57  ? 98  LYS B HZ3  1  
ATOM 3727   N N    . MET C 2 1   ? -7.598  -15.364 11.810  1.00 1.94  ? 1   MET C N    1  
ATOM 3728   C CA   . MET C 2 1   ? -6.812  -16.520 12.226  1.00 1.87  ? 1   MET C CA   1  
ATOM 3729   C C    . MET C 2 1   ? -6.100  -17.164 11.038  1.00 1.90  ? 1   MET C C    1  
ATOM 3730   O O    . MET C 2 1   ? -4.872  -17.111 10.942  1.00 2.24  ? 1   MET C O    1  
ATOM 3731   C CB   . MET C 2 1   ? -7.698  -17.549 12.934  1.00 2.20  ? 1   MET C CB   1  
ATOM 3732   C CG   . MET C 2 1   ? -7.158  -17.971 14.290  1.00 2.38  ? 1   MET C CG   1  
ATOM 3733   S SD   . MET C 2 1   ? -5.506  -18.699 14.189  1.00 2.85  ? 1   MET C SD   1  
ATOM 3734   C CE   . MET C 2 1   ? -5.828  -20.147 13.180  1.00 3.33  ? 1   MET C CE   1  
ATOM 3735   H H1   . MET C 2 1   ? -7.405  -14.496 12.226  1.00 2.34  ? 1   MET C H1   1  
ATOM 3736   H HA   . MET C 2 1   ? -6.064  -16.170 12.923  1.00 2.02  ? 1   MET C HA   1  
ATOM 3737   H HB2  . MET C 2 1   ? -8.681  -17.125 13.074  1.00 2.48  ? 1   MET C HB2  1  
ATOM 3738   H HB3  . MET C 2 1   ? -7.779  -18.428 12.311  1.00 2.62  ? 1   MET C HB3  1  
ATOM 3739   H HG2  . MET C 2 1   ? -7.113  -17.102 14.928  1.00 2.53  ? 1   MET C HG2  1  
ATOM 3740   H HG3  . MET C 2 1   ? -7.831  -18.697 14.722  1.00 2.86  ? 1   MET C HG3  1  
ATOM 3741   H HE1  . MET C 2 1   ? -6.549  -20.780 13.673  1.00 3.54  ? 1   MET C HE1  1  
ATOM 3742   H HE2  . MET C 2 1   ? -4.909  -20.695 13.037  1.00 3.81  ? 1   MET C HE2  1  
ATOM 3743   H HE3  . MET C 2 1   ? -6.215  -19.837 12.222  1.00 3.56  ? 1   MET C HE3  1  
ATOM 3744   N N    . ALA C 2 2   ? -6.872  -17.773 10.146  1.00 1.83  ? 2   ALA C N    1  
ATOM 3745   C CA   . ALA C 2 2   ? -6.319  -18.424 8.966   1.00 1.93  ? 2   ALA C CA   1  
ATOM 3746   C C    . ALA C 2 2   ? -7.340  -18.424 7.835   1.00 1.86  ? 2   ALA C C    1  
ATOM 3747   O O    . ALA C 2 2   ? -8.544  -18.292 8.078   1.00 1.97  ? 2   ALA C O    1  
ATOM 3748   C CB   . ALA C 2 2   ? -5.887  -19.843 9.300   1.00 2.28  ? 2   ALA C CB   1  
ATOM 3749   H H    . ALA C 2 2   ? -7.841  -17.788 10.284  1.00 1.90  ? 2   ALA C H    1  
ATOM 3750   H HA   . ALA C 2 2   ? -5.447  -17.867 8.651   1.00 2.11  ? 2   ALA C HA   1  
ATOM 3751   H HB1  . ALA C 2 2   ? -5.465  -20.305 8.421   1.00 2.45  ? 2   ALA C HB1  1  
ATOM 3752   H HB2  . ALA C 2 2   ? -6.745  -20.412 9.629   1.00 2.46  ? 2   ALA C HB2  1  
ATOM 3753   H HB3  . ALA C 2 2   ? -5.148  -19.821 10.087  1.00 2.54  ? 2   ALA C HB3  1  
ATOM 3754   N N    . ALA C 2 3   ? -6.869  -18.576 6.606   1.00 1.94  ? 3   ALA C N    1  
ATOM 3755   C CA   . ALA C 2 3   ? -7.755  -18.578 5.453   1.00 2.05  ? 3   ALA C CA   1  
ATOM 3756   C C    . ALA C 2 3   ? -7.861  -19.964 4.825   1.00 2.00  ? 3   ALA C C    1  
ATOM 3757   O O    . ALA C 2 3   ? -6.957  -20.794 4.954   1.00 2.09  ? 3   ALA C O    1  
ATOM 3758   C CB   . ALA C 2 3   ? -7.277  -17.567 4.421   1.00 2.43  ? 3   ALA C CB   1  
ATOM 3759   H H    . ALA C 2 3   ? -5.904  -18.697 6.469   1.00 2.09  ? 3   ALA C H    1  
ATOM 3760   H HA   . ALA C 2 3   ? -8.736  -18.271 5.789   1.00 2.12  ? 3   ALA C HA   1  
ATOM 3761   H HB1  . ALA C 2 3   ? -7.963  -17.552 3.586   1.00 2.69  ? 3   ALA C HB1  1  
ATOM 3762   H HB2  . ALA C 2 3   ? -6.295  -17.847 4.073   1.00 2.56  ? 3   ALA C HB2  1  
ATOM 3763   H HB3  . ALA C 2 3   ? -7.232  -16.584 4.870   1.00 2.64  ? 3   ALA C HB3  1  
ATOM 3764   N N    . GLU C 2 4   ? -8.981  -20.204 4.158   1.00 1.99  ? 4   GLU C N    1  
ATOM 3765   C CA   . GLU C 2 4   ? -9.232  -21.464 3.479   1.00 1.98  ? 4   GLU C CA   1  
ATOM 3766   C C    . GLU C 2 4   ? -8.940  -21.282 1.986   1.00 1.96  ? 4   GLU C C    1  
ATOM 3767   O O    . GLU C 2 4   ? -8.775  -20.145 1.544   1.00 1.96  ? 4   GLU C O    1  
ATOM 3768   C CB   . GLU C 2 4   ? -10.693 -21.889 3.704   1.00 1.98  ? 4   GLU C CB   1  
ATOM 3769   C CG   . GLU C 2 4   ? -10.864 -23.022 4.711   1.00 2.08  ? 4   GLU C CG   1  
ATOM 3770   C CD   . GLU C 2 4   ? -10.141 -22.771 6.017   1.00 2.25  ? 4   GLU C CD   1  
ATOM 3771   O OE1  . GLU C 2 4   ? -10.496 -21.808 6.726   1.00 2.55  ? 4   GLU C OE1  1  
ATOM 3772   O OE2  . GLU C 2 4   ? -9.220  -23.545 6.345   1.00 2.75  ? 4   GLU C OE2  1  
ATOM 3773   H H    . GLU C 2 4   ? -9.660  -19.506 4.111   1.00 2.10  ? 4   GLU C H    1  
ATOM 3774   H HA   . GLU C 2 4   ? -8.569  -22.212 3.888   1.00 2.04  ? 4   GLU C HA   1  
ATOM 3775   H HB2  . GLU C 2 4   ? -11.247 -21.036 4.064   1.00 2.10  ? 4   GLU C HB2  1  
ATOM 3776   H HB3  . GLU C 2 4   ? -11.112 -22.208 2.761   1.00 2.03  ? 4   GLU C HB3  1  
ATOM 3777   H HG2  . GLU C 2 4   ? -11.916 -23.142 4.919   1.00 2.23  ? 4   GLU C HG2  1  
ATOM 3778   H HG3  . GLU C 2 4   ? -10.482 -23.933 4.276   1.00 2.34  ? 4   GLU C HG3  1  
ATOM 3779   N N    . PRO C 2 5   ? -8.857  -22.379 1.198   1.00 2.00  ? 5   PRO C N    1  
ATOM 3780   C CA   . PRO C 2 5   ? -8.583  -22.325 -0.250  1.00 2.01  ? 5   PRO C CA   1  
ATOM 3781   C C    . PRO C 2 5   ? -9.266  -21.155 -0.966  1.00 1.93  ? 5   PRO C C    1  
ATOM 3782   O O    . PRO C 2 5   ? -10.477 -20.939 -0.830  1.00 1.95  ? 5   PRO C O    1  
ATOM 3783   C CB   . PRO C 2 5   ? -9.151  -23.654 -0.738  1.00 2.13  ? 5   PRO C CB   1  
ATOM 3784   C CG   . PRO C 2 5   ? -8.910  -24.595 0.392   1.00 2.22  ? 5   PRO C CG   1  
ATOM 3785   C CD   . PRO C 2 5   ? -9.004  -23.777 1.658   1.00 2.09  ? 5   PRO C CD   1  
ATOM 3786   H HA   . PRO C 2 5   ? -7.524  -22.293 -0.449  1.00 2.03  ? 5   PRO C HA   1  
ATOM 3787   H HB2  . PRO C 2 5   ? -10.205 -23.545 -0.947  1.00 2.13  ? 5   PRO C HB2  1  
ATOM 3788   H HB3  . PRO C 2 5   ? -8.631  -23.966 -1.631  1.00 2.23  ? 5   PRO C HB3  1  
ATOM 3789   H HG2  . PRO C 2 5   ? -9.664  -25.368 0.392   1.00 2.39  ? 5   PRO C HG2  1  
ATOM 3790   H HG3  . PRO C 2 5   ? -7.924  -25.032 0.301   1.00 2.34  ? 5   PRO C HG3  1  
ATOM 3791   H HD2  . PRO C 2 5   ? -9.963  -23.926 2.128   1.00 2.16  ? 5   PRO C HD2  1  
ATOM 3792   H HD3  . PRO C 2 5   ? -8.207  -24.045 2.336   1.00 2.11  ? 5   PRO C HD3  1  
ATOM 3793   N N    . LEU C 2 6   ? -8.477  -20.406 -1.727  1.00 1.90  ? 6   LEU C N    1  
ATOM 3794   C CA   . LEU C 2 6   ? -8.975  -19.247 -2.460  1.00 1.86  ? 6   LEU C CA   1  
ATOM 3795   C C    . LEU C 2 6   ? -8.674  -19.388 -3.954  1.00 1.88  ? 6   LEU C C    1  
ATOM 3796   O O    . LEU C 2 6   ? -8.251  -20.454 -4.410  1.00 1.94  ? 6   LEU C O    1  
ATOM 3797   C CB   . LEU C 2 6   ? -8.333  -17.964 -1.919  1.00 1.83  ? 6   LEU C CB   1  
ATOM 3798   C CG   . LEU C 2 6   ? -8.326  -17.811 -0.396  1.00 1.85  ? 6   LEU C CG   1  
ATOM 3799   C CD1  . LEU C 2 6   ? -6.900  -17.661 0.116   1.00 1.95  ? 6   LEU C CD1  1  
ATOM 3800   C CD2  . LEU C 2 6   ? -9.178  -16.622 0.027   1.00 2.03  ? 6   LEU C CD2  1  
ATOM 3801   H H    . LEU C 2 6   ? -7.530  -20.645 -1.808  1.00 1.93  ? 6   LEU C H    1  
ATOM 3802   H HA   . LEU C 2 6   ? -10.045 -19.195 -2.320  1.00 1.91  ? 6   LEU C HA   1  
ATOM 3803   H HB2  . LEU C 2 6   ? -7.312  -17.928 -2.267  1.00 1.85  ? 6   LEU C HB2  1  
ATOM 3804   H HB3  . LEU C 2 6   ? -8.865  -17.122 -2.339  1.00 1.86  ? 6   LEU C HB3  1  
ATOM 3805   H HG   . LEU C 2 6   ? -8.747  -18.700 0.050   1.00 1.86  ? 6   LEU C HG   1  
ATOM 3806   H HD11 . LEU C 2 6   ? -6.413  -16.850 -0.407  1.00 2.07  ? 6   LEU C HD11 1  
ATOM 3807   H HD12 . LEU C 2 6   ? -6.358  -18.577 -0.058  1.00 2.19  ? 6   LEU C HD12 1  
ATOM 3808   H HD13 . LEU C 2 6   ? -6.915  -17.446 1.175   1.00 2.08  ? 6   LEU C HD13 1  
ATOM 3809   H HD21 . LEU C 2 6   ? -9.171  -16.540 1.104   1.00 2.36  ? 6   LEU C HD21 1  
ATOM 3810   H HD22 . LEU C 2 6   ? -10.193 -16.765 -0.316  1.00 2.21  ? 6   LEU C HD22 1  
ATOM 3811   H HD23 . LEU C 2 6   ? -8.777  -15.717 -0.404  1.00 2.25  ? 6   LEU C HD23 1  
ATOM 3812   N N    . THR C 2 7   ? -8.898  -18.322 -4.715  1.00 1.83  ? 7   THR C N    1  
ATOM 3813   C CA   . THR C 2 7   ? -8.638  -18.343 -6.149  1.00 1.85  ? 7   THR C CA   1  
ATOM 3814   C C    . THR C 2 7   ? -7.198  -17.911 -6.447  1.00 1.85  ? 7   THR C C    1  
ATOM 3815   O O    . THR C 2 7   ? -6.448  -17.567 -5.530  1.00 1.82  ? 7   THR C O    1  
ATOM 3816   C CB   . THR C 2 7   ? -9.634  -17.444 -6.923  1.00 1.82  ? 7   THR C CB   1  
ATOM 3817   O OG1  . THR C 2 7   ? -9.650  -17.807 -8.310  1.00 1.88  ? 7   THR C OG1  1  
ATOM 3818   C CG2  . THR C 2 7   ? -9.278  -15.967 -6.790  1.00 1.75  ? 7   THR C CG2  1  
ATOM 3819   H H    . THR C 2 7   ? -9.255  -17.497 -4.302  1.00 1.79  ? 7   THR C H    1  
ATOM 3820   H HA   . THR C 2 7   ? -8.769  -19.361 -6.488  1.00 1.91  ? 7   THR C HA   1  
ATOM 3821   H HB   . THR C 2 7   ? -10.621 -17.598 -6.512  1.00 1.82  ? 7   THR C HB   1  
ATOM 3822   H HG1  . THR C 2 7   ? -10.268 -18.538 -8.438  1.00 1.97  ? 7   THR C HG1  1  
ATOM 3823   H HG21 . THR C 2 7   ? -8.247  -15.819 -7.072  1.00 1.80  ? 7   THR C HG21 1  
ATOM 3824   H HG22 . THR C 2 7   ? -9.421  -15.657 -5.765  1.00 1.77  ? 7   THR C HG22 1  
ATOM 3825   H HG23 . THR C 2 7   ? -9.916  -15.382 -7.436  1.00 1.79  ? 7   THR C HG23 1  
ATOM 3826   N N    . GLU C 2 8   ? -6.833  -17.926 -7.731  1.00 1.89  ? 8   GLU C N    1  
ATOM 3827   C CA   . GLU C 2 8   ? -5.487  -17.561 -8.183  1.00 1.91  ? 8   GLU C CA   1  
ATOM 3828   C C    . GLU C 2 8   ? -5.003  -16.254 -7.560  1.00 1.83  ? 8   GLU C C    1  
ATOM 3829   O O    . GLU C 2 8   ? -4.007  -16.236 -6.839  1.00 1.82  ? 8   GLU C O    1  
ATOM 3830   C CB   . GLU C 2 8   ? -5.453  -17.436 -9.714  1.00 1.97  ? 8   GLU C CB   1  
ATOM 3831   C CG   . GLU C 2 8   ? -4.158  -16.836 -10.255 1.00 2.01  ? 8   GLU C CG   1  
ATOM 3832   C CD   . GLU C 2 8   ? -4.132  -16.748 -11.769 1.00 2.08  ? 8   GLU C CD   1  
ATOM 3833   O OE1  . GLU C 2 8   ? -4.704  -15.790 -12.326 1.00 2.15  ? 8   GLU C OE1  1  
ATOM 3834   O OE2  . GLU C 2 8   ? -3.531  -17.636 -12.413 1.00 2.37  ? 8   GLU C OE2  1  
ATOM 3835   H H    . GLU C 2 8   ? -7.500  -18.193 -8.403  1.00 1.92  ? 8   GLU C H    1  
ATOM 3836   H HA   . GLU C 2 8   ? -4.816  -18.354 -7.887  1.00 1.96  ? 8   GLU C HA   1  
ATOM 3837   H HB2  . GLU C 2 8   ? -5.580  -18.417 -10.146 1.00 2.05  ? 8   GLU C HB2  1  
ATOM 3838   H HB3  . GLU C 2 8   ? -6.273  -16.807 -10.028 1.00 1.93  ? 8   GLU C HB3  1  
ATOM 3839   H HG2  . GLU C 2 8   ? -4.044  -15.839 -9.853  1.00 1.96  ? 8   GLU C HG2  1  
ATOM 3840   H HG3  . GLU C 2 8   ? -3.331  -17.447 -9.930  1.00 2.11  ? 8   GLU C HG3  1  
ATOM 3841   N N    . LEU C 2 9   ? -5.720  -15.170 -7.834  1.00 1.78  ? 9   LEU C N    1  
ATOM 3842   C CA   . LEU C 2 9   ? -5.354  -13.845 -7.333  1.00 1.71  ? 9   LEU C CA   1  
ATOM 3843   C C    . LEU C 2 9   ? -5.232  -13.816 -5.813  1.00 1.67  ? 9   LEU C C    1  
ATOM 3844   O O    . LEU C 2 9   ? -4.231  -13.340 -5.276  1.00 1.64  ? 9   LEU C O    1  
ATOM 3845   C CB   . LEU C 2 9   ? -6.384  -12.808 -7.785  1.00 1.67  ? 9   LEU C CB   1  
ATOM 3846   C CG   . LEU C 2 9   ? -6.500  -12.627 -9.300  1.00 1.70  ? 9   LEU C CG   1  
ATOM 3847   C CD1  . LEU C 2 9   ? -7.638  -11.675 -9.635  1.00 1.68  ? 9   LEU C CD1  1  
ATOM 3848   C CD2  . LEU C 2 9   ? -5.189  -12.115 -9.880  1.00 1.73  ? 9   LEU C CD2  1  
ATOM 3849   H H    . LEU C 2 9   ? -6.520  -15.262 -8.388  1.00 1.80  ? 9   LEU C H    1  
ATOM 3850   H HA   . LEU C 2 9   ? -4.396  -13.588 -7.758  1.00 1.73  ? 9   LEU C HA   1  
ATOM 3851   H HB2  . LEU C 2 9   ? -7.349  -13.103 -7.401  1.00 1.68  ? 9   LEU C HB2  1  
ATOM 3852   H HB3  . LEU C 2 9   ? -6.119  -11.856 -7.351  1.00 1.63  ? 9   LEU C HB3  1  
ATOM 3853   H HG   . LEU C 2 9   ? -6.720  -13.581 -9.754  1.00 1.77  ? 9   LEU C HG   1  
ATOM 3854   H HD11 . LEU C 2 9   ? -7.686  -11.533 -10.704 1.00 1.75  ? 9   LEU C HD11 1  
ATOM 3855   H HD12 . LEU C 2 9   ? -7.464  -10.725 -9.152  1.00 1.69  ? 9   LEU C HD12 1  
ATOM 3856   H HD13 . LEU C 2 9   ? -8.571  -12.092 -9.287  1.00 1.77  ? 9   LEU C HD13 1  
ATOM 3857   H HD21 . LEU C 2 9   ? -4.870  -11.240 -9.336  1.00 1.76  ? 9   LEU C HD21 1  
ATOM 3858   H HD22 . LEU C 2 9   ? -5.332  -11.861 -10.918 1.00 2.03  ? 9   LEU C HD22 1  
ATOM 3859   H HD23 . LEU C 2 9   ? -4.433  -12.884 -9.799  1.00 1.91  ? 9   LEU C HD23 1  
ATOM 3860   N N    . GLU C 2 10  ? -6.240  -14.342 -5.133  1.00 1.67  ? 10  GLU C N    1  
ATOM 3861   C CA   . GLU C 2 10  ? -6.261  -14.357 -3.675  1.00 1.64  ? 10  GLU C CA   1  
ATOM 3862   C C    . GLU C 2 10  ? -5.074  -15.132 -3.102  1.00 1.68  ? 10  GLU C C    1  
ATOM 3863   O O    . GLU C 2 10  ? -4.455  -14.703 -2.133  1.00 1.66  ? 10  GLU C O    1  
ATOM 3864   C CB   . GLU C 2 10  ? -7.575  -14.959 -3.179  1.00 1.64  ? 10  GLU C CB   1  
ATOM 3865   C CG   . GLU C 2 10  ? -8.807  -14.182 -3.618  1.00 1.60  ? 10  GLU C CG   1  
ATOM 3866   C CD   . GLU C 2 10  ? -10.101 -14.908 -3.304  1.00 1.59  ? 10  GLU C CD   1  
ATOM 3867   O OE1  . GLU C 2 10  ? -10.232 -16.087 -3.694  1.00 1.86  ? 10  GLU C OE1  1  
ATOM 3868   O OE2  . GLU C 2 10  ? -10.989 -14.302 -2.669  1.00 1.56  ? 10  GLU C OE2  1  
ATOM 3869   H H    . GLU C 2 10  ? -6.992  -14.733 -5.623  1.00 1.70  ? 10  GLU C H    1  
ATOM 3870   H HA   . GLU C 2 10  ? -6.199  -13.334 -3.338  1.00 1.58  ? 10  GLU C HA   1  
ATOM 3871   H HB2  . GLU C 2 10  ? -7.658  -15.966 -3.556  1.00 1.69  ? 10  GLU C HB2  1  
ATOM 3872   H HB3  . GLU C 2 10  ? -7.559  -14.987 -2.100  1.00 1.63  ? 10  GLU C HB3  1  
ATOM 3873   H HG2  . GLU C 2 10  ? -8.816  -13.230 -3.110  1.00 1.57  ? 10  GLU C HG2  1  
ATOM 3874   H HG3  . GLU C 2 10  ? -8.753  -14.021 -4.684  1.00 1.61  ? 10  GLU C HG3  1  
ATOM 3875   N N    . GLU C 2 11  ? -4.745  -16.265 -3.709  1.00 1.76  ? 11  GLU C N    1  
ATOM 3876   C CA   . GLU C 2 11  ? -3.628  -17.074 -3.236  1.00 1.81  ? 11  GLU C CA   1  
ATOM 3877   C C    . GLU C 2 11  ? -2.292  -16.449 -3.621  1.00 1.80  ? 11  GLU C C    1  
ATOM 3878   O O    . GLU C 2 11  ? -1.289  -16.635 -2.931  1.00 1.83  ? 11  GLU C O    1  
ATOM 3879   C CB   . GLU C 2 11  ? -3.729  -18.492 -3.781  1.00 1.89  ? 11  GLU C CB   1  
ATOM 3880   C CG   . GLU C 2 11  ? -4.908  -19.260 -3.213  1.00 2.14  ? 11  GLU C CG   1  
ATOM 3881   C CD   . GLU C 2 11  ? -4.541  -20.663 -2.792  1.00 2.22  ? 11  GLU C CD   1  
ATOM 3882   O OE1  . GLU C 2 11  ? -3.756  -20.811 -1.834  1.00 2.30  ? 11  GLU C OE1  1  
ATOM 3883   O OE2  . GLU C 2 11  ? -5.036  -21.621 -3.417  1.00 2.56  ? 11  GLU C OE2  1  
ATOM 3884   H H    . GLU C 2 11  ? -5.272  -16.572 -4.482  1.00 1.79  ? 11  GLU C H    1  
ATOM 3885   H HA   . GLU C 2 11  ? -3.689  -17.111 -2.158  1.00 1.80  ? 11  GLU C HA   1  
ATOM 3886   H HB2  . GLU C 2 11  ? -3.835  -18.448 -4.855  1.00 2.00  ? 11  GLU C HB2  1  
ATOM 3887   H HB3  . GLU C 2 11  ? -2.823  -19.029 -3.537  1.00 2.03  ? 11  GLU C HB3  1  
ATOM 3888   H HG2  . GLU C 2 11  ? -5.283  -18.729 -2.351  1.00 2.40  ? 11  GLU C HG2  1  
ATOM 3889   H HG3  . GLU C 2 11  ? -5.683  -19.313 -3.966  1.00 2.36  ? 11  GLU C HG3  1  
ATOM 3890   N N    . SER C 2 12  ? -2.282  -15.696 -4.713  1.00 1.77  ? 12  SER C N    1  
ATOM 3891   C CA   . SER C 2 12  ? -1.064  -15.042 -5.172  1.00 1.77  ? 12  SER C CA   1  
ATOM 3892   C C    . SER C 2 12  ? -0.649  -13.941 -4.197  1.00 1.71  ? 12  SER C C    1  
ATOM 3893   O O    . SER C 2 12  ? 0.529   -13.608 -4.089  1.00 1.73  ? 12  SER C O    1  
ATOM 3894   C CB   . SER C 2 12  ? -1.257  -14.468 -6.578  1.00 1.78  ? 12  SER C CB   1  
ATOM 3895   O OG   . SER C 2 12  ? -1.573  -15.491 -7.509  1.00 1.85  ? 12  SER C OG   1  
ATOM 3896   H H    . SER C 2 12  ? -3.114  -15.581 -5.226  1.00 1.76  ? 12  SER C H    1  
ATOM 3897   H HA   . SER C 2 12  ? -0.283  -15.786 -5.200  1.00 1.82  ? 12  SER C HA   1  
ATOM 3898   H HB2  . SER C 2 12  ? -2.064  -13.750 -6.565  1.00 1.76  ? 12  SER C HB2  1  
ATOM 3899   H HB3  . SER C 2 12  ? -0.346  -13.981 -6.891  1.00 1.78  ? 12  SER C HB3  1  
ATOM 3900   H HG   . SER C 2 12  ? -2.399  -15.920 -7.248  1.00 1.90  ? 12  SER C HG   1  
ATOM 3901   N N    . ILE C 2 13  ? -1.621  -13.383 -3.484  1.00 1.64  ? 13  ILE C N    1  
ATOM 3902   C CA   . ILE C 2 13  ? -1.338  -12.334 -2.512  1.00 1.59  ? 13  ILE C CA   1  
ATOM 3903   C C    . ILE C 2 13  ? -1.273  -12.914 -1.103  1.00 1.61  ? 13  ILE C C    1  
ATOM 3904   O O    . ILE C 2 13  ? -0.883  -12.238 -0.157  1.00 1.60  ? 13  ILE C O    1  
ATOM 3905   C CB   . ILE C 2 13  ? -2.383  -11.199 -2.555  1.00 1.53  ? 13  ILE C CB   1  
ATOM 3906   C CG1  . ILE C 2 13  ? -3.768  -11.724 -2.161  1.00 1.51  ? 13  ILE C CG1  1  
ATOM 3907   C CG2  . ILE C 2 13  ? -2.423  -10.571 -3.940  1.00 1.56  ? 13  ILE C CG2  1  
ATOM 3908   C CD1  . ILE C 2 13  ? -4.843  -10.659 -2.133  1.00 1.48  ? 13  ILE C CD1  1  
ATOM 3909   H H    . ILE C 2 13  ? -2.549  -13.671 -3.625  1.00 1.65  ? 13  ILE C H    1  
ATOM 3910   H HA   . ILE C 2 13  ? -0.372  -11.915 -2.756  1.00 1.60  ? 13  ILE C HA   1  
ATOM 3911   H HB   . ILE C 2 13  ? -2.081  -10.437 -1.853  1.00 1.52  ? 13  ILE C HB   1  
ATOM 3912   H HG12 . ILE C 2 13  ? -4.072  -12.480 -2.870  1.00 1.52  ? 13  ILE C HG12 1  
ATOM 3913   H HG13 . ILE C 2 13  ? -3.712  -12.164 -1.177  1.00 1.53  ? 13  ILE C HG13 1  
ATOM 3914   H HG21 . ILE C 2 13  ? -3.096  -9.728  -3.929  1.00 1.60  ? 13  ILE C HG21 1  
ATOM 3915   H HG22 . ILE C 2 13  ? -2.769  -11.300 -4.656  1.00 1.64  ? 13  ILE C HG22 1  
ATOM 3916   H HG23 . ILE C 2 13  ? -1.433  -10.238 -4.212  1.00 1.64  ? 13  ILE C HG23 1  
ATOM 3917   H HD11 . ILE C 2 13  ? -4.548  -9.871  -1.458  1.00 1.66  ? 13  ILE C HD11 1  
ATOM 3918   H HD12 . ILE C 2 13  ? -5.772  -11.094 -1.794  1.00 1.57  ? 13  ILE C HD12 1  
ATOM 3919   H HD13 . ILE C 2 13  ? -4.977  -10.253 -3.127  1.00 1.56  ? 13  ILE C HD13 1  
ATOM 3920   N N    . GLU C 2 14  ? -1.656  -14.175 -0.972  1.00 1.65  ? 14  GLU C N    1  
ATOM 3921   C CA   . GLU C 2 14  ? -1.628  -14.848 0.321   1.00 1.69  ? 14  GLU C CA   1  
ATOM 3922   C C    . GLU C 2 14  ? -0.260  -15.479 0.538   1.00 1.73  ? 14  GLU C C    1  
ATOM 3923   O O    . GLU C 2 14  ? 0.216   -15.578 1.665   1.00 1.74  ? 14  GLU C O    1  
ATOM 3924   C CB   . GLU C 2 14  ? -2.727  -15.913 0.396   1.00 1.76  ? 14  GLU C CB   1  
ATOM 3925   C CG   . GLU C 2 14  ? -3.058  -16.373 1.812   1.00 1.82  ? 14  GLU C CG   1  
ATOM 3926   C CD   . GLU C 2 14  ? -2.264  -17.593 2.238   1.00 2.03  ? 14  GLU C CD   1  
ATOM 3927   O OE1  . GLU C 2 14  ? -1.709  -18.284 1.355   1.00 2.38  ? 14  GLU C OE1  1  
ATOM 3928   O OE2  . GLU C 2 14  ? -2.211  -17.881 3.452   1.00 2.33  ? 14  GLU C OE2  1  
ATOM 3929   H H    . GLU C 2 14  ? -1.973  -14.664 -1.759  1.00 1.68  ? 14  GLU C H    1  
ATOM 3930   H HA   . GLU C 2 14  ? -1.799  -14.106 1.088   1.00 1.65  ? 14  GLU C HA   1  
ATOM 3931   H HB2  . GLU C 2 14  ? -3.626  -15.517 -0.049  1.00 1.77  ? 14  GLU C HB2  1  
ATOM 3932   H HB3  . GLU C 2 14  ? -2.407  -16.776 -0.170  1.00 1.83  ? 14  GLU C HB3  1  
ATOM 3933   H HG2  . GLU C 2 14  ? -2.843  -15.568 2.500   1.00 1.92  ? 14  GLU C HG2  1  
ATOM 3934   H HG3  . GLU C 2 14  ? -4.109  -16.613 1.860   1.00 1.87  ? 14  GLU C HG3  1  
ATOM 3935   N N    . THR C 2 15  ? 0.379   -15.873 -0.560  1.00 1.76  ? 15  THR C N    1  
ATOM 3936   C CA   . THR C 2 15  ? 1.692   -16.502 -0.504  1.00 1.81  ? 15  THR C CA   1  
ATOM 3937   C C    . THR C 2 15  ? 2.735   -15.568 0.114   1.00 1.76  ? 15  THR C C    1  
ATOM 3938   O O    . THR C 2 15  ? 3.703   -16.028 0.716   1.00 1.80  ? 15  THR C O    1  
ATOM 3939   C CB   . THR C 2 15  ? 2.152   -16.975 -1.906  1.00 1.86  ? 15  THR C CB   1  
ATOM 3940   O OG1  . THR C 2 15  ? 3.303   -17.817 -1.799  1.00 2.27  ? 15  THR C OG1  1  
ATOM 3941   C CG2  . THR C 2 15  ? 2.472   -15.800 -2.817  1.00 2.18  ? 15  THR C CG2  1  
ATOM 3942   H H    . THR C 2 15  ? -0.054  -15.753 -1.431  1.00 1.75  ? 15  THR C H    1  
ATOM 3943   H HA   . THR C 2 15  ? 1.604   -17.375 0.127   1.00 1.87  ? 15  THR C HA   1  
ATOM 3944   H HB   . THR C 2 15  ? 1.348   -17.541 -2.353  1.00 2.14  ? 15  THR C HB   1  
ATOM 3945   H HG1  . THR C 2 15  ? 3.837   -17.534 -1.045  1.00 2.72  ? 15  THR C HG1  1  
ATOM 3946   H HG21 . THR C 2 15  ? 1.614   -15.148 -2.878  1.00 2.61  ? 15  THR C HG21 1  
ATOM 3947   H HG22 . THR C 2 15  ? 2.717   -16.165 -3.802  1.00 2.24  ? 15  THR C HG22 1  
ATOM 3948   H HG23 . THR C 2 15  ? 3.312   -15.253 -2.416  1.00 2.55  ? 15  THR C HG23 1  
ATOM 3949   N N    . VAL C 2 16  ? 2.529   -14.258 -0.018  1.00 1.70  ? 16  VAL C N    1  
ATOM 3950   C CA   . VAL C 2 16  ? 3.458   -13.290 0.556   1.00 1.66  ? 16  VAL C CA   1  
ATOM 3951   C C    . VAL C 2 16  ? 3.192   -13.142 2.051   1.00 1.63  ? 16  VAL C C    1  
ATOM 3952   O O    . VAL C 2 16  ? 4.051   -12.697 2.814   1.00 1.63  ? 16  VAL C O    1  
ATOM 3953   C CB   . VAL C 2 16  ? 3.379   -11.910 -0.140  1.00 1.61  ? 16  VAL C CB   1  
ATOM 3954   C CG1  . VAL C 2 16  ? 3.694   -12.040 -1.624  1.00 1.68  ? 16  VAL C CG1  1  
ATOM 3955   C CG2  . VAL C 2 16  ? 2.019   -11.261 0.069   1.00 1.60  ? 16  VAL C CG2  1  
ATOM 3956   H H    . VAL C 2 16  ? 1.745   -13.941 -0.511  1.00 1.69  ? 16  VAL C H    1  
ATOM 3957   H HA   . VAL C 2 16  ? 4.457   -13.681 0.422   1.00 1.69  ? 16  VAL C HA   1  
ATOM 3958   H HB   . VAL C 2 16  ? 4.127   -11.269 0.302   1.00 1.61  ? 16  VAL C HB   1  
ATOM 3959   H HG11 . VAL C 2 16  ? 3.627   -11.070 -2.093  1.00 1.68  ? 16  VAL C HG11 1  
ATOM 3960   H HG12 . VAL C 2 16  ? 2.985   -12.711 -2.085  1.00 1.78  ? 16  VAL C HG12 1  
ATOM 3961   H HG13 . VAL C 2 16  ? 4.693   -12.432 -1.747  1.00 1.77  ? 16  VAL C HG13 1  
ATOM 3962   H HG21 . VAL C 2 16  ? 1.854   -11.100 1.124   1.00 1.64  ? 16  VAL C HG21 1  
ATOM 3963   H HG22 . VAL C 2 16  ? 1.247   -11.908 -0.320  1.00 1.67  ? 16  VAL C HG22 1  
ATOM 3964   H HG23 . VAL C 2 16  ? 1.989   -10.314 -0.449  1.00 1.58  ? 16  VAL C HG23 1  
ATOM 3965   N N    . VAL C 2 17  ? 1.991   -13.528 2.463   1.00 1.63  ? 17  VAL C N    1  
ATOM 3966   C CA   . VAL C 2 17  ? 1.603   -13.475 3.862   1.00 1.62  ? 17  VAL C CA   1  
ATOM 3967   C C    . VAL C 2 17  ? 2.254   -14.639 4.598   1.00 1.69  ? 17  VAL C C    1  
ATOM 3968   O O    . VAL C 2 17  ? 2.644   -14.525 5.764   1.00 1.69  ? 17  VAL C O    1  
ATOM 3969   C CB   . VAL C 2 17  ? 0.070   -13.538 4.026   1.00 1.63  ? 17  VAL C CB   1  
ATOM 3970   C CG1  . VAL C 2 17  ? -0.320  -13.566 5.493   1.00 1.64  ? 17  VAL C CG1  1  
ATOM 3971   C CG2  . VAL C 2 17  ? -0.593  -12.362 3.325   1.00 1.56  ? 17  VAL C CG2  1  
ATOM 3972   H H    . VAL C 2 17  ? 1.350   -13.869 1.804   1.00 1.64  ? 17  VAL C H    1  
ATOM 3973   H HA   . VAL C 2 17  ? 1.962   -12.545 4.279   1.00 1.58  ? 17  VAL C HA   1  
ATOM 3974   H HB   . VAL C 2 17  ? -0.284  -14.447 3.567   1.00 1.70  ? 17  VAL C HB   1  
ATOM 3975   H HG11 . VAL C 2 17  ? 0.006   -14.495 5.935   1.00 1.75  ? 17  VAL C HG11 1  
ATOM 3976   H HG12 . VAL C 2 17  ? -1.393  -13.480 5.581   1.00 1.69  ? 17  VAL C HG12 1  
ATOM 3977   H HG13 . VAL C 2 17  ? 0.150   -12.740 6.006   1.00 1.62  ? 17  VAL C HG13 1  
ATOM 3978   H HG21 . VAL C 2 17  ? -1.662  -12.412 3.472   1.00 1.52  ? 17  VAL C HG21 1  
ATOM 3979   H HG22 . VAL C 2 17  ? -0.371  -12.403 2.268   1.00 1.63  ? 17  VAL C HG22 1  
ATOM 3980   H HG23 . VAL C 2 17  ? -0.215  -11.439 3.737   1.00 1.59  ? 17  VAL C HG23 1  
ATOM 3981   N N    . THR C 2 18  ? 2.389   -15.755 3.892   1.00 1.74  ? 18  THR C N    1  
ATOM 3982   C CA   . THR C 2 18  ? 3.019   -16.940 4.444   1.00 1.82  ? 18  THR C CA   1  
ATOM 3983   C C    . THR C 2 18  ? 4.475   -16.635 4.781   1.00 1.82  ? 18  THR C C    1  
ATOM 3984   O O    . THR C 2 18  ? 4.992   -17.075 5.812   1.00 1.86  ? 18  THR C O    1  
ATOM 3985   C CB   . THR C 2 18  ? 2.940   -18.107 3.448   1.00 1.88  ? 18  THR C CB   1  
ATOM 3986   O OG1  . THR C 2 18  ? 1.938   -17.826 2.461   1.00 2.09  ? 18  THR C OG1  1  
ATOM 3987   C CG2  . THR C 2 18  ? 2.601   -19.407 4.156   1.00 2.26  ? 18  THR C CG2  1  
ATOM 3988   H H    . THR C 2 18  ? 2.047   -15.787 2.970   1.00 1.75  ? 18  THR C H    1  
ATOM 3989   H HA   . THR C 2 18  ? 2.493   -17.218 5.347   1.00 1.83  ? 18  THR C HA   1  
ATOM 3990   H HB   . THR C 2 18  ? 3.899   -18.214 2.962   1.00 2.09  ? 18  THR C HB   1  
ATOM 3991   H HG1  . THR C 2 18  ? 1.080   -18.135 2.775   1.00 2.28  ? 18  THR C HG1  1  
ATOM 3992   H HG21 . THR C 2 18  ? 1.635   -19.315 4.631   1.00 2.55  ? 18  THR C HG21 1  
ATOM 3993   H HG22 . THR C 2 18  ? 3.350   -19.617 4.904   1.00 2.65  ? 18  THR C HG22 1  
ATOM 3994   H HG23 . THR C 2 18  ? 2.572   -20.213 3.438   1.00 2.30  ? 18  THR C HG23 1  
ATOM 3995   N N    . THR C 2 19  ? 5.120   -15.860 3.910   1.00 1.79  ? 19  THR C N    1  
ATOM 3996   C CA   . THR C 2 19  ? 6.506   -15.454 4.107   1.00 1.80  ? 19  THR C CA   1  
ATOM 3997   C C    . THR C 2 19  ? 6.625   -14.592 5.361   1.00 1.75  ? 19  THR C C    1  
ATOM 3998   O O    . THR C 2 19  ? 7.606   -14.667 6.102   1.00 1.78  ? 19  THR C O    1  
ATOM 3999   C CB   . THR C 2 19  ? 7.016   -14.651 2.897   1.00 1.79  ? 19  THR C CB   1  
ATOM 4000   O OG1  . THR C 2 19  ? 6.240   -14.981 1.738   1.00 1.85  ? 19  THR C OG1  1  
ATOM 4001   C CG2  . THR C 2 19  ? 8.491   -14.922 2.632   1.00 1.87  ? 19  THR C CG2  1  
ATOM 4002   H H    . THR C 2 19  ? 4.654   -15.561 3.097   1.00 1.77  ? 19  THR C H    1  
ATOM 4003   H HA   . THR C 2 19  ? 7.111   -16.341 4.220   1.00 1.87  ? 19  THR C HA   1  
ATOM 4004   H HB   . THR C 2 19  ? 6.893   -13.597 3.111   1.00 1.75  ? 19  THR C HB   1  
ATOM 4005   H HG1  . THR C 2 19  ? 6.678   -15.690 1.241   1.00 1.89  ? 19  THR C HG1  1  
ATOM 4006   H HG21 . THR C 2 19  ? 8.616   -15.941 2.299   1.00 1.99  ? 19  THR C HG21 1  
ATOM 4007   H HG22 . THR C 2 19  ? 9.056   -14.768 3.540   1.00 1.84  ? 19  THR C HG22 1  
ATOM 4008   H HG23 . THR C 2 19  ? 8.849   -14.247 1.867   1.00 1.95  ? 19  THR C HG23 1  
ATOM 4009   N N    . PHE C 2 20  ? 5.605   -13.777 5.588   1.00 1.67  ? 20  PHE C N    1  
ATOM 4010   C CA   . PHE C 2 20  ? 5.560   -12.899 6.744   1.00 1.62  ? 20  PHE C CA   1  
ATOM 4011   C C    . PHE C 2 20  ? 5.463   -13.710 8.035   1.00 1.65  ? 20  PHE C C    1  
ATOM 4012   O O    . PHE C 2 20  ? 6.239   -13.501 8.962   1.00 1.66  ? 20  PHE C O    1  
ATOM 4013   C CB   . PHE C 2 20  ? 4.369   -11.939 6.616   1.00 1.56  ? 20  PHE C CB   1  
ATOM 4014   C CG   . PHE C 2 20  ? 3.943   -11.292 7.912   1.00 1.52  ? 20  PHE C CG   1  
ATOM 4015   C CD1  . PHE C 2 20  ? 4.667   -10.239 8.448   1.00 1.52  ? 20  PHE C CD1  1  
ATOM 4016   C CD2  . PHE C 2 20  ? 2.820   -11.738 8.592   1.00 1.58  ? 20  PHE C CD2  1  
ATOM 4017   C CE1  . PHE C 2 20  ? 4.280   -9.644  9.635   1.00 1.53  ? 20  PHE C CE1  1  
ATOM 4018   C CE2  . PHE C 2 20  ? 2.430   -11.149 9.781   1.00 1.59  ? 20  PHE C CE2  1  
ATOM 4019   C CZ   . PHE C 2 20  ? 3.163   -10.100 10.302  1.00 1.54  ? 20  PHE C CZ   1  
ATOM 4020   H H    . PHE C 2 20  ? 4.860   -13.760 4.949   1.00 1.66  ? 20  PHE C H    1  
ATOM 4021   H HA   . PHE C 2 20  ? 6.475   -12.324 6.760   1.00 1.61  ? 20  PHE C HA   1  
ATOM 4022   H HB2  . PHE C 2 20  ? 4.628   -11.151 5.926   1.00 1.55  ? 20  PHE C HB2  1  
ATOM 4023   H HB3  . PHE C 2 20  ? 3.524   -12.485 6.226   1.00 1.60  ? 20  PHE C HB3  1  
ATOM 4024   H HD1  . PHE C 2 20  ? 5.543   -9.880  7.928   1.00 1.57  ? 20  PHE C HD1  1  
ATOM 4025   H HD2  . PHE C 2 20  ? 2.244   -12.557 8.186   1.00 1.67  ? 20  PHE C HD2  1  
ATOM 4026   H HE1  . PHE C 2 20  ? 4.853   -8.824  10.040  1.00 1.58  ? 20  PHE C HE1  1  
ATOM 4027   H HE2  . PHE C 2 20  ? 1.553   -11.506 10.301  1.00 1.69  ? 20  PHE C HE2  1  
ATOM 4028   H HZ   . PHE C 2 20  ? 2.862   -9.638  11.231  1.00 1.57  ? 20  PHE C HZ   1  
ATOM 4029   N N    . PHE C 2 21  ? 4.529   -14.660 8.068   1.00 1.70  ? 21  PHE C N    1  
ATOM 4030   C CA   . PHE C 2 21  ? 4.304   -15.496 9.252   1.00 1.75  ? 21  PHE C CA   1  
ATOM 4031   C C    . PHE C 2 21  ? 5.522   -16.345 9.608   1.00 1.83  ? 21  PHE C C    1  
ATOM 4032   O O    . PHE C 2 21  ? 5.699   -16.728 10.761  1.00 1.88  ? 21  PHE C O    1  
ATOM 4033   C CB   . PHE C 2 21  ? 3.091   -16.405 9.036   1.00 1.78  ? 21  PHE C CB   1  
ATOM 4034   C CG   . PHE C 2 21  ? 1.799   -15.801 9.506   1.00 1.78  ? 21  PHE C CG   1  
ATOM 4035   C CD1  . PHE C 2 21  ? 1.431   -15.877 10.840  1.00 1.95  ? 21  PHE C CD1  1  
ATOM 4036   C CD2  . PHE C 2 21  ? 0.951   -15.164 8.618   1.00 1.86  ? 21  PHE C CD2  1  
ATOM 4037   C CE1  . PHE C 2 21  ? 0.241   -15.326 11.278  1.00 2.09  ? 21  PHE C CE1  1  
ATOM 4038   C CE2  . PHE C 2 21  ? -0.239  -14.610 9.050   1.00 1.98  ? 21  PHE C CE2  1  
ATOM 4039   C CZ   . PHE C 2 21  ? -0.595  -14.693 10.382  1.00 2.05  ? 21  PHE C CZ   1  
ATOM 4040   H H    . PHE C 2 21  ? 3.972   -14.804 7.272   1.00 1.70  ? 21  PHE C H    1  
ATOM 4041   H HA   . PHE C 2 21  ? 4.094   -14.836 10.081  1.00 1.72  ? 21  PHE C HA   1  
ATOM 4042   H HB2  . PHE C 2 21  ? 2.993   -16.620 7.983   1.00 1.81  ? 21  PHE C HB2  1  
ATOM 4043   H HB3  . PHE C 2 21  ? 3.241   -17.328 9.576   1.00 1.88  ? 21  PHE C HB3  1  
ATOM 4044   H HD1  . PHE C 2 21  ? 2.085   -16.373 11.542  1.00 2.13  ? 21  PHE C HD1  1  
ATOM 4045   H HD2  . PHE C 2 21  ? 1.228   -15.097 7.576   1.00 1.99  ? 21  PHE C HD2  1  
ATOM 4046   H HE1  . PHE C 2 21  ? -0.033  -15.393 12.320  1.00 2.37  ? 21  PHE C HE1  1  
ATOM 4047   H HE2  . PHE C 2 21  ? -0.892  -14.116 8.345   1.00 2.19  ? 21  PHE C HE2  1  
ATOM 4048   H HZ   . PHE C 2 21  ? -1.525  -14.262 10.723  1.00 2.23  ? 21  PHE C HZ   1  
ATOM 4049   N N    . THR C 2 22  ? 6.357   -16.646 8.625   1.00 1.86  ? 22  THR C N    1  
ATOM 4050   C CA   . THR C 2 22  ? 7.537   -17.456 8.875   1.00 1.95  ? 22  THR C CA   1  
ATOM 4051   C C    . THR C 2 22  ? 8.726   -16.600 9.308   1.00 1.91  ? 22  THR C C    1  
ATOM 4052   O O    . THR C 2 22  ? 9.609   -17.071 10.027  1.00 1.98  ? 22  THR C O    1  
ATOM 4053   C CB   . THR C 2 22  ? 7.915   -18.296 7.644   1.00 2.04  ? 22  THR C CB   1  
ATOM 4054   O OG1  . THR C 2 22  ? 7.536   -17.607 6.444   1.00 1.99  ? 22  THR C OG1  1  
ATOM 4055   C CG2  . THR C 2 22  ? 7.236   -19.657 7.695   1.00 2.21  ? 22  THR C CG2  1  
ATOM 4056   H H    . THR C 2 22  ? 6.176   -16.320 7.717   1.00 1.85  ? 22  THR C H    1  
ATOM 4057   H HA   . THR C 2 22  ? 7.297   -18.137 9.680   1.00 1.99  ? 22  THR C HA   1  
ATOM 4058   H HB   . THR C 2 22  ? 8.984   -18.442 7.641   1.00 2.14  ? 22  THR C HB   1  
ATOM 4059   H HG1  . THR C 2 22  ? 6.594   -17.754 6.266   1.00 2.00  ? 22  THR C HG1  1  
ATOM 4060   H HG21 . THR C 2 22  ? 7.500   -20.159 8.614   1.00 2.33  ? 22  THR C HG21 1  
ATOM 4061   H HG22 . THR C 2 22  ? 7.563   -20.252 6.856   1.00 2.30  ? 22  THR C HG22 1  
ATOM 4062   H HG23 . THR C 2 22  ? 6.166   -19.527 7.649   1.00 2.28  ? 22  THR C HG23 1  
ATOM 4063   N N    . PHE C 2 23  ? 8.746   -15.347 8.877   1.00 1.83  ? 23  PHE C N    1  
ATOM 4064   C CA   . PHE C 2 23  ? 9.828   -14.438 9.239   1.00 1.80  ? 23  PHE C CA   1  
ATOM 4065   C C    . PHE C 2 23  ? 9.525   -13.753 10.565  1.00 1.75  ? 23  PHE C C    1  
ATOM 4066   O O    . PHE C 2 23  ? 10.401  -13.629 11.424  1.00 1.79  ? 23  PHE C O    1  
ATOM 4067   C CB   . PHE C 2 23  ? 10.047  -13.395 8.141   1.00 1.76  ? 23  PHE C CB   1  
ATOM 4068   C CG   . PHE C 2 23  ? 11.196  -13.719 7.224   1.00 1.80  ? 23  PHE C CG   1  
ATOM 4069   C CD1  . PHE C 2 23  ? 12.504  -13.625 7.672   1.00 1.83  ? 23  PHE C CD1  1  
ATOM 4070   C CD2  . PHE C 2 23  ? 10.966  -14.115 5.917   1.00 1.83  ? 23  PHE C CD2  1  
ATOM 4071   C CE1  . PHE C 2 23  ? 13.562  -13.924 6.834   1.00 1.88  ? 23  PHE C CE1  1  
ATOM 4072   C CE2  . PHE C 2 23  ? 12.021  -14.416 5.073   1.00 1.88  ? 23  PHE C CE2  1  
ATOM 4073   C CZ   . PHE C 2 23  ? 13.319  -14.318 5.533   1.00 1.90  ? 23  PHE C CZ   1  
ATOM 4074   H H    . PHE C 2 23  ? 8.019   -15.024 8.304   1.00 1.80  ? 23  PHE C H    1  
ATOM 4075   H HA   . PHE C 2 23  ? 10.729  -15.023 9.350   1.00 1.85  ? 23  PHE C HA   1  
ATOM 4076   H HB2  . PHE C 2 23  ? 9.154   -13.322 7.539   1.00 1.76  ? 23  PHE C HB2  1  
ATOM 4077   H HB3  . PHE C 2 23  ? 10.247  -12.437 8.599   1.00 1.74  ? 23  PHE C HB3  1  
ATOM 4078   H HD1  . PHE C 2 23  ? 12.695  -13.318 8.690   1.00 1.84  ? 23  PHE C HD1  1  
ATOM 4079   H HD2  . PHE C 2 23  ? 9.952   -14.192 5.556   1.00 1.83  ? 23  PHE C HD2  1  
ATOM 4080   H HE1  . PHE C 2 23  ? 14.577  -13.847 7.196   1.00 1.92  ? 23  PHE C HE1  1  
ATOM 4081   H HE2  . PHE C 2 23  ? 11.830  -14.724 4.056   1.00 1.93  ? 23  PHE C HE2  1  
ATOM 4082   H HZ   . PHE C 2 23  ? 14.144  -14.552 4.874   1.00 1.96  ? 23  PHE C HZ   1  
ATOM 4083   N N    . ALA C 2 24  ? 8.278   -13.338 10.736  1.00 1.70  ? 24  ALA C N    1  
ATOM 4084   C CA   . ALA C 2 24  ? 7.849   -12.665 11.955  1.00 1.67  ? 24  ALA C CA   1  
ATOM 4085   C C    . ALA C 2 24  ? 7.438   -13.681 13.007  1.00 1.74  ? 24  ALA C C    1  
ATOM 4086   O O    . ALA C 2 24  ? 6.254   -13.889 13.253  1.00 1.80  ? 24  ALA C O    1  
ATOM 4087   C CB   . ALA C 2 24  ? 6.691   -11.719 11.668  1.00 1.63  ? 24  ALA C CB   1  
ATOM 4088   H H    . ALA C 2 24  ? 7.618   -13.502 10.026  1.00 1.70  ? 24  ALA C H    1  
ATOM 4089   H HA   . ALA C 2 24  ? 8.679   -12.083 12.329  1.00 1.65  ? 24  ALA C HA   1  
ATOM 4090   H HB1  . ALA C 2 24  ? 5.762   -12.268 11.705  1.00 1.78  ? 24  ALA C HB1  1  
ATOM 4091   H HB2  . ALA C 2 24  ? 6.811   -11.287 10.687  1.00 1.67  ? 24  ALA C HB2  1  
ATOM 4092   H HB3  . ALA C 2 24  ? 6.674   -10.932 12.408  1.00 1.74  ? 24  ALA C HB3  1  
ATOM 4093   N N    . ARG C 2 25  ? 8.423   -14.339 13.593  1.00 1.79  ? 25  ARG C N    1  
ATOM 4094   C CA   . ARG C 2 25  ? 8.179   -15.331 14.631  1.00 1.87  ? 25  ARG C CA   1  
ATOM 4095   C C    . ARG C 2 25  ? 9.492   -15.717 15.294  1.00 1.89  ? 25  ARG C C    1  
ATOM 4096   O O    . ARG C 2 25  ? 9.593   -16.750 15.962  1.00 2.02  ? 25  ARG C O    1  
ATOM 4097   C CB   . ARG C 2 25  ? 7.497   -16.577 14.055  1.00 1.95  ? 25  ARG C CB   1  
ATOM 4098   C CG   . ARG C 2 25  ? 8.348   -17.342 13.057  1.00 1.97  ? 25  ARG C CG   1  
ATOM 4099   C CD   . ARG C 2 25  ? 7.945   -18.804 12.992  1.00 2.10  ? 25  ARG C CD   1  
ATOM 4100   N NE   . ARG C 2 25  ? 9.059   -19.655 12.577  1.00 2.09  ? 25  ARG C NE   1  
ATOM 4101   C CZ   . ARG C 2 25  ? 9.996   -20.112 13.412  1.00 2.31  ? 25  ARG C CZ   1  
ATOM 4102   N NH1  . ARG C 2 25  ? 9.940   -19.819 14.708  1.00 2.63  ? 25  ARG C NH1  1  
ATOM 4103   N NH2  . ARG C 2 25  ? 10.990  -20.854 12.947  1.00 2.48  ? 25  ARG C NH2  1  
ATOM 4104   H H    . ARG C 2 25  ? 9.346   -14.151 13.317  1.00 1.83  ? 25  ARG C H    1  
ATOM 4105   H HA   . ARG C 2 25  ? 7.531   -14.883 15.369  1.00 1.85  ? 25  ARG C HA   1  
ATOM 4106   H HB2  . ARG C 2 25  ? 7.253   -17.243 14.868  1.00 2.07  ? 25  ARG C HB2  1  
ATOM 4107   H HB3  . ARG C 2 25  ? 6.584   -16.278 13.562  1.00 1.98  ? 25  ARG C HB3  1  
ATOM 4108   H HG2  . ARG C 2 25  ? 8.225   -16.900 12.079  1.00 2.00  ? 25  ARG C HG2  1  
ATOM 4109   H HG3  . ARG C 2 25  ? 9.386   -17.276 13.355  1.00 1.96  ? 25  ARG C HG3  1  
ATOM 4110   H HD2  . ARG C 2 25  ? 7.608   -19.117 13.969  1.00 2.28  ? 25  ARG C HD2  1  
ATOM 4111   H HD3  . ARG C 2 25  ? 7.137   -18.912 12.282  1.00 2.29  ? 25  ARG C HD3  1  
ATOM 4112   H HE   . ARG C 2 25  ? 9.120   -19.888 11.622  1.00 2.12  ? 25  ARG C HE   1  
ATOM 4113   H HH11 . ARG C 2 25  ? 9.195   -19.255 15.067  1.00 2.73  ? 25  ARG C HH11 1  
ATOM 4114   H HH12 . ARG C 2 25  ? 10.648  -20.157 15.332  1.00 2.91  ? 25  ARG C HH12 1  
ATOM 4115   H HH21 . ARG C 2 25  ? 11.045  -21.072 11.968  1.00 2.53  ? 25  ARG C HH21 1  
ATOM 4116   H HH22 . ARG C 2 25  ? 11.696  -21.200 13.571  1.00 2.70  ? 25  ARG C HH22 1  
ATOM 4117   N N    . GLN C 2 26  ? 10.492  -14.870 15.117  1.00 1.81  ? 26  GLN C N    1  
ATOM 4118   C CA   . GLN C 2 26  ? 11.811  -15.106 15.675  1.00 1.85  ? 26  GLN C CA   1  
ATOM 4119   C C    . GLN C 2 26  ? 11.982  -14.307 16.957  1.00 1.82  ? 26  GLN C C    1  
ATOM 4120   O O    . GLN C 2 26  ? 12.415  -14.835 17.985  1.00 1.88  ? 26  GLN C O    1  
ATOM 4121   C CB   . GLN C 2 26  ? 12.897  -14.710 14.671  1.00 1.83  ? 26  GLN C CB   1  
ATOM 4122   C CG   . GLN C 2 26  ? 13.432  -15.862 13.829  1.00 1.91  ? 26  GLN C CG   1  
ATOM 4123   C CD   . GLN C 2 26  ? 12.354  -16.572 13.033  1.00 2.02  ? 26  GLN C CD   1  
ATOM 4124   O OE1  . GLN C 2 26  ? 11.789  -17.564 13.482  1.00 2.19  ? 26  GLN C OE1  1  
ATOM 4125   N NE2  . GLN C 2 26  ? 12.075  -16.078 11.838  1.00 2.15  ? 26  GLN C NE2  1  
ATOM 4126   H H    . GLN C 2 26  ? 10.327  -14.029 14.623  1.00 1.77  ? 26  GLN C H    1  
ATOM 4127   H HA   . GLN C 2 26  ? 11.897  -16.158 15.899  1.00 1.91  ? 26  GLN C HA   1  
ATOM 4128   H HB2  . GLN C 2 26  ? 12.494  -13.968 14.003  1.00 1.84  ? 26  GLN C HB2  1  
ATOM 4129   H HB3  . GLN C 2 26  ? 13.726  -14.277 15.212  1.00 1.90  ? 26  GLN C HB3  1  
ATOM 4130   H HG2  . GLN C 2 26  ? 14.160  -15.470 13.139  1.00 1.98  ? 26  GLN C HG2  1  
ATOM 4131   H HG3  . GLN C 2 26  ? 13.907  -16.577 14.483  1.00 2.02  ? 26  GLN C HG3  1  
ATOM 4132   H HE21 . GLN C 2 26  ? 12.573  -15.288 11.536  1.00 2.12  ? 26  GLN C HE21 1  
ATOM 4133   H HE22 . GLN C 2 26  ? 11.377  -16.516 11.306  1.00 2.37  ? 26  GLN C HE22 1  
ATOM 4134   N N    . GLU C 2 27  ? 11.618  -13.035 16.893  1.00 1.76  ? 27  GLU C N    1  
ATOM 4135   C CA   . GLU C 2 27  ? 11.734  -12.158 18.040  1.00 1.75  ? 27  GLU C CA   1  
ATOM 4136   C C    . GLU C 2 27  ? 10.543  -12.337 18.971  1.00 1.76  ? 27  GLU C C    1  
ATOM 4137   O O    . GLU C 2 27  ? 10.683  -12.896 20.061  1.00 1.82  ? 27  GLU C O    1  
ATOM 4138   C CB   . GLU C 2 27  ? 11.857  -10.698 17.599  1.00 1.69  ? 27  GLU C CB   1  
ATOM 4139   C CG   . GLU C 2 27  ? 13.198  -10.368 16.961  1.00 1.70  ? 27  GLU C CG   1  
ATOM 4140   C CD   . GLU C 2 27  ? 13.656  -8.958  17.274  1.00 1.66  ? 27  GLU C CD   1  
ATOM 4141   O OE1  . GLU C 2 27  ? 13.815  -8.638  18.471  1.00 1.74  ? 27  GLU C OE1  1  
ATOM 4142   O OE2  . GLU C 2 27  ? 13.854  -8.167  16.328  1.00 1.62  ? 27  GLU C OE2  1  
ATOM 4143   H H    . GLU C 2 27  ? 11.243  -12.681 16.048  1.00 1.74  ? 27  GLU C H    1  
ATOM 4144   H HA   . GLU C 2 27  ? 12.630  -12.437 18.573  1.00 1.78  ? 27  GLU C HA   1  
ATOM 4145   H HB2  . GLU C 2 27  ? 11.079  -10.483 16.882  1.00 1.66  ? 27  GLU C HB2  1  
ATOM 4146   H HB3  . GLU C 2 27  ? 11.727  -10.061 18.461  1.00 1.69  ? 27  GLU C HB3  1  
ATOM 4147   H HG2  . GLU C 2 27  ? 13.939  -11.062 17.330  1.00 1.78  ? 27  GLU C HG2  1  
ATOM 4148   H HG3  . GLU C 2 27  ? 13.107  -10.472 15.891  1.00 1.73  ? 27  GLU C HG3  1  
ATOM 4149   N N    . GLY C 2 28  ? 9.372   -11.892 18.536  1.00 1.73  ? 28  GLY C N    1  
ATOM 4150   C CA   . GLY C 2 28  ? 8.189   -12.018 19.361  1.00 1.75  ? 28  GLY C CA   1  
ATOM 4151   C C    . GLY C 2 28  ? 6.911   -11.732 18.602  1.00 1.68  ? 28  GLY C C    1  
ATOM 4152   O O    . GLY C 2 28  ? 6.838   -10.753 17.863  1.00 1.62  ? 28  GLY C O    1  
ATOM 4153   H H    . GLY C 2 28  ? 9.310   -11.472 17.649  1.00 1.71  ? 28  GLY C H    1  
ATOM 4154   H HA2  . GLY C 2 28  ? 8.143   -13.023 19.749  1.00 1.80  ? 28  GLY C HA2  1  
ATOM 4155   H HA3  . GLY C 2 28  ? 8.267   -11.329 20.189  1.00 1.77  ? 28  GLY C HA3  1  
ATOM 4156   N N    . ARG C 2 29  ? 5.911   -12.599 18.802  1.00 1.72  ? 29  ARG C N    1  
ATOM 4157   C CA   . ARG C 2 29  ? 4.595   -12.480 18.157  1.00 1.69  ? 29  ARG C CA   1  
ATOM 4158   C C    . ARG C 2 29  ? 4.670   -12.748 16.657  1.00 1.66  ? 29  ARG C C    1  
ATOM 4159   O O    . ARG C 2 29  ? 5.407   -12.089 15.929  1.00 1.68  ? 29  ARG C O    1  
ATOM 4160   C CB   . ARG C 2 29  ? 3.972   -11.104 18.413  1.00 1.65  ? 29  ARG C CB   1  
ATOM 4161   C CG   . ARG C 2 29  ? 3.144   -11.030 19.685  1.00 1.68  ? 29  ARG C CG   1  
ATOM 4162   C CD   . ARG C 2 29  ? 2.649   -9.615  19.943  1.00 1.62  ? 29  ARG C CD   1  
ATOM 4163   N NE   . ARG C 2 29  ? 1.922   -9.064  18.797  1.00 1.71  ? 29  ARG C NE   1  
ATOM 4164   C CZ   . ARG C 2 29  ? 1.846   -7.764  18.520  1.00 1.81  ? 29  ARG C CZ   1  
ATOM 4165   N NH1  . ARG C 2 29  ? 2.476   -6.883  19.288  1.00 1.70  ? 29  ARG C NH1  1  
ATOM 4166   N NH2  . ARG C 2 29  ? 1.142   -7.349  17.472  1.00 2.23  ? 29  ARG C NH2  1  
ATOM 4167   H H    . ARG C 2 29  ? 6.065   -13.354 19.410  1.00 1.78  ? 29  ARG C H    1  
ATOM 4168   H HA   . ARG C 2 29  ? 3.957   -13.227 18.600  1.00 1.74  ? 29  ARG C HA   1  
ATOM 4169   H HB2  . ARG C 2 29  ? 4.762   -10.376 18.484  1.00 1.77  ? 29  ARG C HB2  1  
ATOM 4170   H HB3  . ARG C 2 29  ? 3.333   -10.852 17.580  1.00 1.77  ? 29  ARG C HB3  1  
ATOM 4171   H HG2  . ARG C 2 29  ? 2.293   -11.686 19.586  1.00 1.90  ? 29  ARG C HG2  1  
ATOM 4172   H HG3  . ARG C 2 29  ? 3.752   -11.347 20.518  1.00 1.84  ? 29  ARG C HG3  1  
ATOM 4173   H HD2  . ARG C 2 29  ? 1.990   -9.628  20.799  1.00 1.71  ? 29  ARG C HD2  1  
ATOM 4174   H HD3  . ARG C 2 29  ? 3.500   -8.984  20.154  1.00 1.73  ? 29  ARG C HD3  1  
ATOM 4175   H HE   . ARG C 2 29  ? 1.458   -9.707  18.201  1.00 1.90  ? 29  ARG C HE   1  
ATOM 4176   H HH11 . ARG C 2 29  ? 3.009   -7.193  20.080  1.00 1.65  ? 29  ARG C HH11 1  
ATOM 4177   H HH12 . ARG C 2 29  ? 2.438   -5.897  19.070  1.00 1.85  ? 29  ARG C HH12 1  
ATOM 4178   H HH21 . ARG C 2 29  ? 0.660   -8.025  16.885  1.00 2.47  ? 29  ARG C HH21 1  
ATOM 4179   H HH22 . ARG C 2 29  ? 1.079   -6.372  17.258  1.00 2.41  ? 29  ARG C HH22 1  
ATOM 4180   N N    . LYS C 2 30  ? 3.869   -13.702 16.197  1.00 1.70  ? 30  LYS C N    1  
ATOM 4181   C CA   . LYS C 2 30  ? 3.837   -14.073 14.783  1.00 1.70  ? 30  LYS C CA   1  
ATOM 4182   C C    . LYS C 2 30  ? 2.948   -13.127 13.971  1.00 1.65  ? 30  LYS C C    1  
ATOM 4183   O O    . LYS C 2 30  ? 2.566   -13.437 12.844  1.00 1.73  ? 30  LYS C O    1  
ATOM 4184   C CB   . LYS C 2 30  ? 3.337   -15.513 14.627  1.00 1.79  ? 30  LYS C CB   1  
ATOM 4185   C CG   . LYS C 2 30  ? 1.925   -15.728 15.149  1.00 1.88  ? 30  LYS C CG   1  
ATOM 4186   C CD   . LYS C 2 30  ? 1.382   -17.093 14.763  1.00 2.02  ? 30  LYS C CD   1  
ATOM 4187   C CE   . LYS C 2 30  ? 0.013   -17.325 15.381  1.00 2.15  ? 30  LYS C CE   1  
ATOM 4188   N NZ   . LYS C 2 30  ? -0.563  -18.637 14.990  1.00 2.39  ? 30  LYS C NZ   1  
ATOM 4189   H H    . LYS C 2 30  ? 3.286   -14.176 16.826  1.00 1.78  ? 30  LYS C H    1  
ATOM 4190   H HA   . LYS C 2 30  ? 4.845   -14.011 14.402  1.00 1.68  ? 30  LYS C HA   1  
ATOM 4191   H HB2  . LYS C 2 30  ? 3.355   -15.777 13.582  1.00 1.81  ? 30  LYS C HB2  1  
ATOM 4192   H HB3  . LYS C 2 30  ? 4.000   -16.173 15.167  1.00 1.83  ? 30  LYS C HB3  1  
ATOM 4193   H HG2  . LYS C 2 30  ? 1.934   -15.650 16.224  1.00 1.91  ? 30  LYS C HG2  1  
ATOM 4194   H HG3  . LYS C 2 30  ? 1.281   -14.966 14.738  1.00 1.92  ? 30  LYS C HG3  1  
ATOM 4195   H HD2  . LYS C 2 30  ? 1.296   -17.145 13.688  1.00 2.10  ? 30  LYS C HD2  1  
ATOM 4196   H HD3  . LYS C 2 30  ? 2.061   -17.855 15.113  1.00 2.07  ? 30  LYS C HD3  1  
ATOM 4197   H HE2  . LYS C 2 30  ? 0.106   -17.292 16.455  1.00 2.20  ? 30  LYS C HE2  1  
ATOM 4198   H HE3  . LYS C 2 30  ? -0.653  -16.537 15.053  1.00 2.19  ? 30  LYS C HE3  1  
ATOM 4199   H HZ1  . LYS C 2 30  ? -0.767  -18.649 13.970  1.00 2.60  ? 30  LYS C HZ1  1  
ATOM 4200   H HZ2  . LYS C 2 30  ? -1.445  -18.811 15.511  1.00 2.43  ? 30  LYS C HZ2  1  
ATOM 4201   H HZ3  . LYS C 2 30  ? 0.110   -19.400 15.205  1.00 2.60  ? 30  LYS C HZ3  1  
ATOM 4202   N N    . ASP C 2 31  ? 2.624   -11.976 14.544  1.00 1.59  ? 31  ASP C N    1  
ATOM 4203   C CA   . ASP C 2 31  ? 1.773   -11.005 13.868  1.00 1.56  ? 31  ASP C CA   1  
ATOM 4204   C C    . ASP C 2 31  ? 2.420   -9.624  13.862  1.00 1.48  ? 31  ASP C C    1  
ATOM 4205   O O    . ASP C 2 31  ? 1.764   -8.618  13.573  1.00 1.47  ? 31  ASP C O    1  
ATOM 4206   C CB   . ASP C 2 31  ? 0.395   -10.941 14.539  1.00 1.60  ? 31  ASP C CB   1  
ATOM 4207   C CG   . ASP C 2 31  ? 0.424   -10.249 15.889  1.00 1.78  ? 31  ASP C CG   1  
ATOM 4208   O OD1  . ASP C 2 31  ? 0.996   -10.818 16.846  1.00 2.25  ? 31  ASP C OD1  1  
ATOM 4209   O OD2  . ASP C 2 31  ? -0.132  -9.138  16.001  1.00 2.19  ? 31  ASP C OD2  1  
ATOM 4210   H H    . ASP C 2 31  ? 2.967   -11.772 15.440  1.00 1.61  ? 31  ASP C H    1  
ATOM 4211   H HA   . ASP C 2 31  ? 1.649   -11.332 12.847  1.00 1.62  ? 31  ASP C HA   1  
ATOM 4212   H HB2  . ASP C 2 31  ? -0.285  -10.398 13.897  1.00 1.93  ? 31  ASP C HB2  1  
ATOM 4213   H HB3  . ASP C 2 31  ? 0.024   -11.945 14.677  1.00 1.85  ? 31  ASP C HB3  1  
ATOM 4214   N N    . SER C 2 32  ? 3.707   -9.578  14.170  1.00 1.45  ? 32  SER C N    1  
ATOM 4215   C CA   . SER C 2 32  ? 4.429   -8.316  14.194  1.00 1.41  ? 32  SER C CA   1  
ATOM 4216   C C    . SER C 2 32  ? 5.864   -8.484  13.708  1.00 1.44  ? 32  SER C C    1  
ATOM 4217   O O    . SER C 2 32  ? 6.616   -9.298  14.241  1.00 1.49  ? 32  SER C O    1  
ATOM 4218   C CB   . SER C 2 32  ? 4.423   -7.732  15.608  1.00 1.42  ? 32  SER C CB   1  
ATOM 4219   O OG   . SER C 2 32  ? 4.888   -8.679  16.559  1.00 1.76  ? 32  SER C OG   1  
ATOM 4220   H H    . SER C 2 32  ? 4.184   -10.410 14.386  1.00 1.48  ? 32  SER C H    1  
ATOM 4221   H HA   . SER C 2 32  ? 3.916   -7.632  13.534  1.00 1.41  ? 32  SER C HA   1  
ATOM 4222   H HB2  . SER C 2 32  ? 5.065   -6.866  15.639  1.00 1.52  ? 32  SER C HB2  1  
ATOM 4223   H HB3  . SER C 2 32  ? 3.416   -7.443  15.871  1.00 1.51  ? 32  SER C HB3  1  
ATOM 4224   H HG   . SER C 2 32  ? 5.550   -9.254  16.146  1.00 1.99  ? 32  SER C HG   1  
ATOM 4225   N N    . LEU C 2 33  ? 6.234   -7.710  12.696  1.00 1.43  ? 33  LEU C N    1  
ATOM 4226   C CA   . LEU C 2 33  ? 7.579   -7.755  12.152  1.00 1.47  ? 33  LEU C CA   1  
ATOM 4227   C C    . LEU C 2 33  ? 8.502   -6.917  13.030  1.00 1.46  ? 33  LEU C C    1  
ATOM 4228   O O    . LEU C 2 33  ? 8.327   -5.699  13.147  1.00 1.42  ? 33  LEU C O    1  
ATOM 4229   C CB   . LEU C 2 33  ? 7.589   -7.230  10.710  1.00 1.46  ? 33  LEU C CB   1  
ATOM 4230   C CG   . LEU C 2 33  ? 8.500   -7.978  9.724   1.00 1.49  ? 33  LEU C CG   1  
ATOM 4231   C CD1  . LEU C 2 33  ? 9.914   -8.076  10.256  1.00 1.61  ? 33  LEU C CD1  1  
ATOM 4232   C CD2  . LEU C 2 33  ? 7.962   -9.363  9.427   1.00 1.64  ? 33  LEU C CD2  1  
ATOM 4233   H H    . LEU C 2 33  ? 5.583   -7.080  12.313  1.00 1.41  ? 33  LEU C H    1  
ATOM 4234   H HA   . LEU C 2 33  ? 7.914   -8.781  12.164  1.00 1.52  ? 33  LEU C HA   1  
ATOM 4235   H HB2  . LEU C 2 33  ? 6.579   -7.275  10.333  1.00 1.48  ? 33  LEU C HB2  1  
ATOM 4236   H HB3  . LEU C 2 33  ? 7.897   -6.196  10.732  1.00 1.48  ? 33  LEU C HB3  1  
ATOM 4237   H HG   . LEU C 2 33  ? 8.535   -7.429  8.794   1.00 1.52  ? 33  LEU C HG   1  
ATOM 4238   H HD11 . LEU C 2 33  ? 10.332  -7.087  10.355  1.00 1.69  ? 33  LEU C HD11 1  
ATOM 4239   H HD12 . LEU C 2 33  ? 10.516  -8.655  9.570   1.00 1.87  ? 33  LEU C HD12 1  
ATOM 4240   H HD13 . LEU C 2 33  ? 9.901   -8.560  11.221  1.00 1.84  ? 33  LEU C HD13 1  
ATOM 4241   H HD21 . LEU C 2 33  ? 8.366   -9.712  8.489   1.00 1.77  ? 33  LEU C HD21 1  
ATOM 4242   H HD22 . LEU C 2 33  ? 6.883   -9.327  9.365   1.00 1.89  ? 33  LEU C HD22 1  
ATOM 4243   H HD23 . LEU C 2 33  ? 8.254   -10.038 10.216  1.00 1.92  ? 33  LEU C HD23 1  
ATOM 4244   N N    . SER C 2 34  ? 9.461   -7.570  13.664  1.00 1.52  ? 34  SER C N    1  
ATOM 4245   C CA   . SER C 2 34  ? 10.397  -6.886  14.535  1.00 1.53  ? 34  SER C CA   1  
ATOM 4246   C C    . SER C 2 34  ? 11.565  -6.291  13.745  1.00 1.54  ? 34  SER C C    1  
ATOM 4247   O O    . SER C 2 34  ? 11.521  -6.215  12.518  1.00 1.71  ? 34  SER C O    1  
ATOM 4248   C CB   . SER C 2 34  ? 10.895  -7.851  15.604  1.00 1.61  ? 34  SER C CB   1  
ATOM 4249   O OG   . SER C 2 34  ? 9.813   -8.565  16.182  1.00 1.62  ? 34  SER C OG   1  
ATOM 4250   H H    . SER C 2 34  ? 9.541   -8.549  13.549  1.00 1.57  ? 34  SER C H    1  
ATOM 4251   H HA   . SER C 2 34  ? 9.864   -6.079  15.017  1.00 1.50  ? 34  SER C HA   1  
ATOM 4252   H HB2  . SER C 2 34  ? 11.579  -8.559  15.159  1.00 1.66  ? 34  SER C HB2  1  
ATOM 4253   H HB3  . SER C 2 34  ? 11.400  -7.297  16.380  1.00 1.63  ? 34  SER C HB3  1  
ATOM 4254   H HG   . SER C 2 34  ? 9.463   -9.192  15.529  1.00 1.63  ? 34  SER C HG   1  
ATOM 4255   N N    . VAL C 2 35  ? 12.613  -5.880  14.448  1.00 1.45  ? 35  VAL C N    1  
ATOM 4256   C CA   . VAL C 2 35  ? 13.767  -5.264  13.802  1.00 1.45  ? 35  VAL C CA   1  
ATOM 4257   C C    . VAL C 2 35  ? 14.730  -6.300  13.217  1.00 1.50  ? 35  VAL C C    1  
ATOM 4258   O O    . VAL C 2 35  ? 15.162  -6.167  12.069  1.00 1.51  ? 35  VAL C O    1  
ATOM 4259   C CB   . VAL C 2 35  ? 14.524  -4.320  14.771  1.00 1.43  ? 35  VAL C CB   1  
ATOM 4260   C CG1  . VAL C 2 35  ? 14.960  -5.043  16.039  1.00 1.47  ? 35  VAL C CG1  1  
ATOM 4261   C CG2  . VAL C 2 35  ? 15.719  -3.683  14.076  1.00 1.43  ? 35  VAL C CG2  1  
ATOM 4262   H H    . VAL C 2 35  ? 12.618  -6.004  15.422  1.00 1.46  ? 35  VAL C H    1  
ATOM 4263   H HA   . VAL C 2 35  ? 13.389  -4.663  12.988  1.00 1.43  ? 35  VAL C HA   1  
ATOM 4264   H HB   . VAL C 2 35  ? 13.849  -3.529  15.059  1.00 1.44  ? 35  VAL C HB   1  
ATOM 4265   H HG11 . VAL C 2 35  ? 14.097  -5.478  16.520  1.00 1.62  ? 35  VAL C HG11 1  
ATOM 4266   H HG12 . VAL C 2 35  ? 15.430  -4.340  16.710  1.00 1.61  ? 35  VAL C HG12 1  
ATOM 4267   H HG13 . VAL C 2 35  ? 15.663  -5.824  15.787  1.00 1.66  ? 35  VAL C HG13 1  
ATOM 4268   H HG21 . VAL C 2 35  ? 16.266  -3.081  14.785  1.00 1.69  ? 35  VAL C HG21 1  
ATOM 4269   H HG22 . VAL C 2 35  ? 15.374  -3.061  13.265  1.00 1.61  ? 35  VAL C HG22 1  
ATOM 4270   H HG23 . VAL C 2 35  ? 16.365  -4.457  13.688  1.00 1.54  ? 35  VAL C HG23 1  
ATOM 4271   N N    . ASN C 2 36  ? 15.048  -7.339  13.982  1.00 1.56  ? 36  ASN C N    1  
ATOM 4272   C CA   . ASN C 2 36  ? 15.974  -8.369  13.511  1.00 1.64  ? 36  ASN C CA   1  
ATOM 4273   C C    . ASN C 2 36  ? 15.388  -9.112  12.321  1.00 1.64  ? 36  ASN C C    1  
ATOM 4274   O O    . ASN C 2 36  ? 16.062  -9.334  11.316  1.00 1.67  ? 36  ASN C O    1  
ATOM 4275   C CB   . ASN C 2 36  ? 16.295  -9.361  14.629  1.00 1.71  ? 36  ASN C CB   1  
ATOM 4276   C CG   . ASN C 2 36  ? 17.318  -10.403 14.211  1.00 1.88  ? 36  ASN C CG   1  
ATOM 4277   O OD1  . ASN C 2 36  ? 18.223  -10.125 13.425  1.00 2.07  ? 36  ASN C OD1  1  
ATOM 4278   N ND2  . ASN C 2 36  ? 17.182  -11.610 14.734  1.00 2.02  ? 36  ASN C ND2  1  
ATOM 4279   H H    . ASN C 2 36  ? 14.650  -7.421  14.885  1.00 1.57  ? 36  ASN C H    1  
ATOM 4280   H HA   . ASN C 2 36  ? 16.884  -7.878  13.202  1.00 1.64  ? 36  ASN C HA   1  
ATOM 4281   H HB2  . ASN C 2 36  ? 16.686  -8.823  15.479  1.00 1.74  ? 36  ASN C HB2  1  
ATOM 4282   H HB3  . ASN C 2 36  ? 15.387  -9.871  14.918  1.00 1.73  ? 36  ASN C HB3  1  
ATOM 4283   H HD21 . ASN C 2 36  ? 16.445  -11.766 15.357  1.00 2.07  ? 36  ASN C HD21 1  
ATOM 4284   H HD22 . ASN C 2 36  ? 17.820  -12.306 14.463  1.00 2.20  ? 36  ASN C HD22 1  
ATOM 4285   N N    . GLU C 2 37  ? 14.115  -9.463  12.435  1.00 1.64  ? 37  GLU C N    1  
ATOM 4286   C CA   . GLU C 2 37  ? 13.416  -10.183 11.383  1.00 1.65  ? 37  GLU C CA   1  
ATOM 4287   C C    . GLU C 2 37  ? 13.334  -9.353  10.109  1.00 1.61  ? 37  GLU C C    1  
ATOM 4288   O O    . GLU C 2 37  ? 13.414  -9.888  9.007   1.00 1.64  ? 37  GLU C O    1  
ATOM 4289   C CB   . GLU C 2 37  ? 12.018  -10.556 11.859  1.00 1.65  ? 37  GLU C CB   1  
ATOM 4290   C CG   . GLU C 2 37  ? 12.030  -11.389 13.124  1.00 1.73  ? 37  GLU C CG   1  
ATOM 4291   C CD   . GLU C 2 37  ? 10.741  -11.285 13.904  1.00 1.68  ? 37  GLU C CD   1  
ATOM 4292   O OE1  . GLU C 2 37  ? 10.079  -10.228 13.828  1.00 1.66  ? 37  GLU C OE1  1  
ATOM 4293   O OE2  . GLU C 2 37  ? 10.396  -12.257 14.603  1.00 1.71  ? 37  GLU C OE2  1  
ATOM 4294   H H    . GLU C 2 37  ? 13.632  -9.228  13.255  1.00 1.63  ? 37  GLU C H    1  
ATOM 4295   H HA   . GLU C 2 37  ? 13.967  -11.088 11.174  1.00 1.71  ? 37  GLU C HA   1  
ATOM 4296   H HB2  . GLU C 2 37  ? 11.461  -9.651  12.054  1.00 1.59  ? 37  GLU C HB2  1  
ATOM 4297   H HB3  . GLU C 2 37  ? 11.518  -11.120 11.085  1.00 1.68  ? 37  GLU C HB3  1  
ATOM 4298   H HG2  . GLU C 2 37  ? 12.186  -12.421 12.854  1.00 1.84  ? 37  GLU C HG2  1  
ATOM 4299   H HG3  . GLU C 2 37  ? 12.843  -11.054 13.754  1.00 1.76  ? 37  GLU C HG3  1  
ATOM 4300   N N    . PHE C 2 38  ? 13.186  -8.041  10.264  1.00 1.55  ? 38  PHE C N    1  
ATOM 4301   C CA   . PHE C 2 38  ? 13.097  -7.146  9.119   1.00 1.52  ? 38  PHE C CA   1  
ATOM 4302   C C    . PHE C 2 38  ? 14.433  -7.087  8.393   1.00 1.57  ? 38  PHE C C    1  
ATOM 4303   O O    . PHE C 2 38  ? 14.493  -7.154  7.163   1.00 1.58  ? 38  PHE C O    1  
ATOM 4304   C CB   . PHE C 2 38  ? 12.685  -5.740  9.566   1.00 1.45  ? 38  PHE C CB   1  
ATOM 4305   C CG   . PHE C 2 38  ? 11.789  -5.035  8.585   1.00 1.40  ? 38  PHE C CG   1  
ATOM 4306   C CD1  . PHE C 2 38  ? 12.276  -4.624  7.356   1.00 1.40  ? 38  PHE C CD1  1  
ATOM 4307   C CD2  . PHE C 2 38  ? 10.460  -4.789  8.890   1.00 1.41  ? 38  PHE C CD2  1  
ATOM 4308   C CE1  . PHE C 2 38  ? 11.459  -3.980  6.451   1.00 1.38  ? 38  PHE C CE1  1  
ATOM 4309   C CE2  . PHE C 2 38  ? 9.638   -4.147  7.987   1.00 1.39  ? 38  PHE C CE2  1  
ATOM 4310   C CZ   . PHE C 2 38  ? 10.138  -3.741  6.767   1.00 1.35  ? 38  PHE C CZ   1  
ATOM 4311   H H    . PHE C 2 38  ? 13.133  -7.669  11.168  1.00 1.54  ? 38  PHE C H    1  
ATOM 4312   H HA   . PHE C 2 38  ? 12.350  -7.539  8.445   1.00 1.52  ? 38  PHE C HA   1  
ATOM 4313   H HB2  . PHE C 2 38  ? 12.161  -5.805  10.507  1.00 1.45  ? 38  PHE C HB2  1  
ATOM 4314   H HB3  . PHE C 2 38  ? 13.574  -5.138  9.696   1.00 1.46  ? 38  PHE C HB3  1  
ATOM 4315   H HD1  . PHE C 2 38  ? 13.311  -4.811  7.108   1.00 1.46  ? 38  PHE C HD1  1  
ATOM 4316   H HD2  . PHE C 2 38  ? 10.068  -5.102  9.845   1.00 1.48  ? 38  PHE C HD2  1  
ATOM 4317   H HE1  . PHE C 2 38  ? 11.852  -3.661  5.496   1.00 1.41  ? 38  PHE C HE1  1  
ATOM 4318   H HE2  . PHE C 2 38  ? 8.605   -3.963  8.234   1.00 1.44  ? 38  PHE C HE2  1  
ATOM 4319   H HZ   . PHE C 2 38  ? 9.495   -3.238  6.061   1.00 1.34  ? 38  PHE C HZ   1  
ATOM 4320   N N    . LYS C 2 39  ? 15.502  -6.986  9.167   1.00 1.60  ? 39  LYS C N    1  
ATOM 4321   C CA   . LYS C 2 39  ? 16.842  -6.912  8.615   1.00 1.66  ? 39  LYS C CA   1  
ATOM 4322   C C    . LYS C 2 39  ? 17.208  -8.220  7.919   1.00 1.72  ? 39  LYS C C    1  
ATOM 4323   O O    . LYS C 2 39  ? 17.776  -8.213  6.827   1.00 1.75  ? 39  LYS C O    1  
ATOM 4324   C CB   . LYS C 2 39  ? 17.846  -6.593  9.724   1.00 1.68  ? 39  LYS C CB   1  
ATOM 4325   C CG   . LYS C 2 39  ? 19.064  -5.825  9.237   1.00 1.78  ? 39  LYS C CG   1  
ATOM 4326   C CD   . LYS C 2 39  ? 19.347  -4.610  10.110  1.00 1.61  ? 39  LYS C CD   1  
ATOM 4327   C CE   . LYS C 2 39  ? 20.657  -3.934  9.729   1.00 1.78  ? 39  LYS C CE   1  
ATOM 4328   N NZ   . LYS C 2 39  ? 21.022  -2.860  10.690  1.00 1.66  ? 39  LYS C NZ   1  
ATOM 4329   H H    . LYS C 2 39  ? 15.386  -6.965  10.141  1.00 1.60  ? 39  LYS C H    1  
ATOM 4330   H HA   . LYS C 2 39  ? 16.856  -6.114  7.887   1.00 1.64  ? 39  LYS C HA   1  
ATOM 4331   H HB2  . LYS C 2 39  ? 17.351  -6.002  10.480  1.00 1.78  ? 39  LYS C HB2  1  
ATOM 4332   H HB3  . LYS C 2 39  ? 18.183  -7.519  10.165  1.00 1.91  ? 39  LYS C HB3  1  
ATOM 4333   H HG2  . LYS C 2 39  ? 19.921  -6.480  9.260   1.00 2.24  ? 39  LYS C HG2  1  
ATOM 4334   H HG3  . LYS C 2 39  ? 18.889  -5.495  8.223   1.00 2.12  ? 39  LYS C HG3  1  
ATOM 4335   H HD2  . LYS C 2 39  ? 18.542  -3.901  9.994   1.00 1.77  ? 39  LYS C HD2  1  
ATOM 4336   H HD3  . LYS C 2 39  ? 19.404  -4.926  11.142  1.00 1.90  ? 39  LYS C HD3  1  
ATOM 4337   H HE2  . LYS C 2 39  ? 21.441  -4.676  9.716   1.00 2.21  ? 39  LYS C HE2  1  
ATOM 4338   H HE3  . LYS C 2 39  ? 20.554  -3.504  8.743   1.00 2.04  ? 39  LYS C HE3  1  
ATOM 4339   H HZ1  . LYS C 2 39  ? 20.871  -3.184  11.666  1.00 1.73  ? 39  LYS C HZ1  1  
ATOM 4340   H HZ2  . LYS C 2 39  ? 20.439  -2.013  10.531  1.00 1.84  ? 39  LYS C HZ2  1  
ATOM 4341   H HZ3  . LYS C 2 39  ? 22.022  -2.602  10.576  1.00 1.91  ? 39  LYS C HZ3  1  
ATOM 4342   N N    . GLU C 2 40  ? 16.861  -9.340  8.541   1.00 1.74  ? 40  GLU C N    1  
ATOM 4343   C CA   . GLU C 2 40  ? 17.159  -10.648 7.967   1.00 1.80  ? 40  GLU C CA   1  
ATOM 4344   C C    . GLU C 2 40  ? 16.268  -10.927 6.756   1.00 1.80  ? 40  GLU C C    1  
ATOM 4345   O O    . GLU C 2 40  ? 16.597  -11.750 5.906   1.00 1.84  ? 40  GLU C O    1  
ATOM 4346   C CB   . GLU C 2 40  ? 16.991  -11.749 9.016   1.00 1.84  ? 40  GLU C CB   1  
ATOM 4347   C CG   . GLU C 2 40  ? 17.673  -13.054 8.634   1.00 2.02  ? 40  GLU C CG   1  
ATOM 4348   C CD   . GLU C 2 40  ? 17.703  -14.061 9.765   1.00 2.02  ? 40  GLU C CD   1  
ATOM 4349   O OE1  . GLU C 2 40  ? 18.661  -14.030 10.567  1.00 2.24  ? 40  GLU C OE1  1  
ATOM 4350   O OE2  . GLU C 2 40  ? 16.779  -14.901 9.849   1.00 2.24  ? 40  GLU C OE2  1  
ATOM 4351   H H    . GLU C 2 40  ? 16.400  -9.288  9.409   1.00 1.72  ? 40  GLU C H    1  
ATOM 4352   H HA   . GLU C 2 40  ? 18.188  -10.632 7.640   1.00 1.85  ? 40  GLU C HA   1  
ATOM 4353   H HB2  . GLU C 2 40  ? 17.410  -11.406 9.951   1.00 2.00  ? 40  GLU C HB2  1  
ATOM 4354   H HB3  . GLU C 2 40  ? 15.938  -11.943 9.152   1.00 2.02  ? 40  GLU C HB3  1  
ATOM 4355   H HG2  . GLU C 2 40  ? 17.142  -13.490 7.803   1.00 2.36  ? 40  GLU C HG2  1  
ATOM 4356   H HG3  . GLU C 2 40  ? 18.689  -12.840 8.336   1.00 2.34  ? 40  GLU C HG3  1  
ATOM 4357   N N    . LEU C 2 41  ? 15.137  -10.240 6.687   1.00 1.76  ? 41  LEU C N    1  
ATOM 4358   C CA   . LEU C 2 41  ? 14.207  -10.400 5.577   1.00 1.75  ? 41  LEU C CA   1  
ATOM 4359   C C    . LEU C 2 41  ? 14.755  -9.740  4.316   1.00 1.75  ? 41  LEU C C    1  
ATOM 4360   O O    . LEU C 2 41  ? 14.846  -10.371 3.261   1.00 1.79  ? 41  LEU C O    1  
ATOM 4361   C CB   . LEU C 2 41  ? 12.843  -9.796  5.933   1.00 1.70  ? 41  LEU C CB   1  
ATOM 4362   C CG   . LEU C 2 41  ? 11.896  -9.560  4.753   1.00 1.68  ? 41  LEU C CG   1  
ATOM 4363   C CD1  . LEU C 2 41  ? 11.273  -10.868 4.287   1.00 1.73  ? 41  LEU C CD1  1  
ATOM 4364   C CD2  . LEU C 2 41  ? 10.814  -8.562  5.139   1.00 1.62  ? 41  LEU C CD2  1  
ATOM 4365   H H    . LEU C 2 41  ? 14.913  -9.617  7.411   1.00 1.74  ? 41  LEU C H    1  
ATOM 4366   H HA   . LEU C 2 41  ? 14.086  -11.459 5.393   1.00 1.79  ? 41  LEU C HA   1  
ATOM 4367   H HB2  . LEU C 2 41  ? 12.353  -10.459 6.630   1.00 1.70  ? 41  LEU C HB2  1  
ATOM 4368   H HB3  . LEU C 2 41  ? 13.013  -8.849  6.424   1.00 1.69  ? 41  LEU C HB3  1  
ATOM 4369   H HG   . LEU C 2 41  ? 12.455  -9.143  3.929   1.00 1.71  ? 41  LEU C HG   1  
ATOM 4370   H HD11 . LEU C 2 41  ? 10.619  -10.678 3.450   1.00 1.78  ? 41  LEU C HD11 1  
ATOM 4371   H HD12 . LEU C 2 41  ? 10.706  -11.305 5.095   1.00 1.72  ? 41  LEU C HD12 1  
ATOM 4372   H HD13 . LEU C 2 41  ? 12.054  -11.551 3.986   1.00 1.80  ? 41  LEU C HD13 1  
ATOM 4373   H HD21 . LEU C 2 41  ? 10.153  -8.406  4.299   1.00 1.67  ? 41  LEU C HD21 1  
ATOM 4374   H HD22 . LEU C 2 41  ? 11.271  -7.622  5.416   1.00 1.70  ? 41  LEU C HD22 1  
ATOM 4375   H HD23 . LEU C 2 41  ? 10.250  -8.948  5.974   1.00 1.62  ? 41  LEU C HD23 1  
ATOM 4376   N N    . VAL C 2 42  ? 15.133  -8.474  4.429   1.00 1.73  ? 42  VAL C N    1  
ATOM 4377   C CA   . VAL C 2 42  ? 15.654  -7.733  3.288   1.00 1.74  ? 42  VAL C CA   1  
ATOM 4378   C C    . VAL C 2 42  ? 17.038  -8.231  2.872   1.00 1.79  ? 42  VAL C C    1  
ATOM 4379   O O    . VAL C 2 42  ? 17.327  -8.349  1.685   1.00 1.82  ? 42  VAL C O    1  
ATOM 4380   C CB   . VAL C 2 42  ? 15.701  -6.211  3.562   1.00 1.71  ? 42  VAL C CB   1  
ATOM 4381   C CG1  . VAL C 2 42  ? 14.294  -5.667  3.766   1.00 1.70  ? 42  VAL C CG1  1  
ATOM 4382   C CG2  . VAL C 2 42  ? 16.573  -5.888  4.766   1.00 1.70  ? 42  VAL C CG2  1  
ATOM 4383   H H    . VAL C 2 42  ? 15.054  -8.024  5.300   1.00 1.71  ? 42  VAL C H    1  
ATOM 4384   H HA   . VAL C 2 42  ? 14.977  -7.898  2.464   1.00 1.73  ? 42  VAL C HA   1  
ATOM 4385   H HB   . VAL C 2 42  ? 16.126  -5.725  2.696   1.00 1.72  ? 42  VAL C HB   1  
ATOM 4386   H HG11 . VAL C 2 42  ? 13.704  -5.853  2.879   1.00 1.83  ? 42  VAL C HG11 1  
ATOM 4387   H HG12 . VAL C 2 42  ? 14.342  -4.605  3.949   1.00 1.77  ? 42  VAL C HG12 1  
ATOM 4388   H HG13 . VAL C 2 42  ? 13.838  -6.159  4.612   1.00 1.76  ? 42  VAL C HG13 1  
ATOM 4389   H HG21 . VAL C 2 42  ? 17.570  -6.268  4.600   1.00 1.87  ? 42  VAL C HG21 1  
ATOM 4390   H HG22 . VAL C 2 42  ? 16.154  -6.349  5.649   1.00 1.81  ? 42  VAL C HG22 1  
ATOM 4391   H HG23 . VAL C 2 42  ? 16.614  -4.819  4.903   1.00 1.76  ? 42  VAL C HG23 1  
ATOM 4392   N N    . THR C 2 43  ? 17.873  -8.575  3.840   1.00 1.82  ? 43  THR C N    1  
ATOM 4393   C CA   . THR C 2 43  ? 19.220  -9.044  3.543   1.00 1.88  ? 43  THR C CA   1  
ATOM 4394   C C    . THR C 2 43  ? 19.250  -10.558 3.321   1.00 1.94  ? 43  THR C C    1  
ATOM 4395   O O    . THR C 2 43  ? 20.203  -11.234 3.707   1.00 2.01  ? 43  THR C O    1  
ATOM 4396   C CB   . THR C 2 43  ? 20.202  -8.661  4.672   1.00 1.88  ? 43  THR C CB   1  
ATOM 4397   O OG1  . THR C 2 43  ? 19.782  -7.433  5.285   1.00 1.90  ? 43  THR C OG1  1  
ATOM 4398   C CG2  . THR C 2 43  ? 21.617  -8.497  4.133   1.00 1.94  ? 43  THR C CG2  1  
ATOM 4399   H H    . THR C 2 43  ? 17.583  -8.506  4.773   1.00 1.81  ? 43  THR C H    1  
ATOM 4400   H HA   . THR C 2 43  ? 19.545  -8.555  2.636   1.00 1.90  ? 43  THR C HA   1  
ATOM 4401   H HB   . THR C 2 43  ? 20.202  -9.448  5.415   1.00 1.88  ? 43  THR C HB   1  
ATOM 4402   H HG1  . THR C 2 43  ? 19.087  -7.621  5.929   1.00 1.90  ? 43  THR C HG1  1  
ATOM 4403   H HG21 . THR C 2 43  ? 21.623  -7.735  3.369   1.00 2.00  ? 43  THR C HG21 1  
ATOM 4404   H HG22 . THR C 2 43  ? 21.952  -9.435  3.711   1.00 1.99  ? 43  THR C HG22 1  
ATOM 4405   H HG23 . THR C 2 43  ? 22.276  -8.206  4.938   1.00 1.99  ? 43  THR C HG23 1  
ATOM 4406   N N    . GLN C 2 44  ? 18.207  -11.090 2.686   1.00 1.97  ? 44  GLN C N    1  
ATOM 4407   C CA   . GLN C 2 44  ? 18.137  -12.523 2.414   1.00 2.02  ? 44  GLN C CA   1  
ATOM 4408   C C    . GLN C 2 44  ? 17.054  -12.851 1.393   1.00 2.02  ? 44  GLN C C    1  
ATOM 4409   O O    . GLN C 2 44  ? 17.294  -13.592 0.443   1.00 2.10  ? 44  GLN C O    1  
ATOM 4410   C CB   . GLN C 2 44  ? 17.872  -13.313 3.696   1.00 2.03  ? 44  GLN C CB   1  
ATOM 4411   C CG   . GLN C 2 44  ? 18.753  -14.543 3.845   1.00 2.24  ? 44  GLN C CG   1  
ATOM 4412   C CD   . GLN C 2 44  ? 18.227  -15.522 4.877   1.00 2.34  ? 44  GLN C CD   1  
ATOM 4413   O OE1  . GLN C 2 44  ? 18.472  -16.725 4.785   1.00 2.59  ? 44  GLN C OE1  1  
ATOM 4414   N NE2  . GLN C 2 44  ? 17.495  -15.021 5.860   1.00 2.28  ? 44  GLN C NE2  1  
ATOM 4415   H H    . GLN C 2 44  ? 17.480  -10.506 2.387   1.00 1.99  ? 44  GLN C H    1  
ATOM 4416   H HA   . GLN C 2 44  ? 19.092  -12.826 2.011   1.00 2.07  ? 44  GLN C HA   1  
ATOM 4417   H HB2  . GLN C 2 44  ? 18.042  -12.668 4.546   1.00 2.09  ? 44  GLN C HB2  1  
ATOM 4418   H HB3  . GLN C 2 44  ? 16.840  -13.635 3.700   1.00 2.03  ? 44  GLN C HB3  1  
ATOM 4419   H HG2  . GLN C 2 44  ? 18.809  -15.047 2.892   1.00 2.39  ? 44  GLN C HG2  1  
ATOM 4420   H HG3  . GLN C 2 44  ? 19.743  -14.227 4.142   1.00 2.41  ? 44  GLN C HG3  1  
ATOM 4421   H HE21 . GLN C 2 44  ? 17.335  -14.051 5.875   1.00 2.22  ? 44  GLN C HE21 1  
ATOM 4422   H HE22 . GLN C 2 44  ? 17.135  -15.640 6.532   1.00 2.39  ? 44  GLN C HE22 1  
ATOM 4423   N N    . GLN C 2 45  ? 15.858  -12.312 1.594   1.00 1.95  ? 45  GLN C N    1  
ATOM 4424   C CA   . GLN C 2 45  ? 14.750  -12.587 0.688   1.00 1.95  ? 45  GLN C CA   1  
ATOM 4425   C C    . GLN C 2 45  ? 14.587  -11.490 -0.361  1.00 1.92  ? 45  GLN C C    1  
ATOM 4426   O O    . GLN C 2 45  ? 14.182  -11.760 -1.490  1.00 1.98  ? 45  GLN C O    1  
ATOM 4427   C CB   . GLN C 2 45  ? 13.451  -12.766 1.478   1.00 1.90  ? 45  GLN C CB   1  
ATOM 4428   C CG   . GLN C 2 45  ? 12.420  -13.636 0.771   1.00 1.94  ? 45  GLN C CG   1  
ATOM 4429   C CD   . GLN C 2 45  ? 12.809  -15.106 0.728   1.00 2.07  ? 45  GLN C CD   1  
ATOM 4430   O OE1  . GLN C 2 45  ? 13.989  -15.455 0.751   1.00 2.24  ? 45  GLN C OE1  1  
ATOM 4431   N NE2  . GLN C 2 45  ? 11.823  -15.983 0.653   1.00 2.14  ? 45  GLN C NE2  1  
ATOM 4432   H H    . GLN C 2 45  ? 15.714  -11.725 2.371   1.00 1.90  ? 45  GLN C H    1  
ATOM 4433   H HA   . GLN C 2 45  ? 14.971  -13.514 0.178   1.00 2.01  ? 45  GLN C HA   1  
ATOM 4434   H HB2  . GLN C 2 45  ? 13.685  -13.223 2.428   1.00 1.95  ? 45  GLN C HB2  1  
ATOM 4435   H HB3  . GLN C 2 45  ? 13.013  -11.795 1.654   1.00 1.88  ? 45  GLN C HB3  1  
ATOM 4436   H HG2  . GLN C 2 45  ? 11.477  -13.546 1.288   1.00 1.95  ? 45  GLN C HG2  1  
ATOM 4437   H HG3  . GLN C 2 45  ? 12.306  -13.280 -0.244  1.00 2.02  ? 45  GLN C HG3  1  
ATOM 4438   H HE21 . GLN C 2 45  ? 10.895  -15.649 0.622   1.00 2.12  ? 45  GLN C HE21 1  
ATOM 4439   H HE22 . GLN C 2 45  ? 12.051  -16.936 0.629   1.00 2.30  ? 45  GLN C HE22 1  
ATOM 4440   N N    . LEU C 2 46  ? 14.922  -10.254 -0.001  1.00 1.86  ? 46  LEU C N    1  
ATOM 4441   C CA   . LEU C 2 46  ? 14.796  -9.139  -0.940  1.00 1.85  ? 46  LEU C CA   1  
ATOM 4442   C C    . LEU C 2 46  ? 16.105  -8.353  -1.110  1.00 1.90  ? 46  LEU C C    1  
ATOM 4443   O O    . LEU C 2 46  ? 16.095  -7.131  -1.010  1.00 1.86  ? 46  LEU C O    1  
ATOM 4444   C CB   . LEU C 2 46  ? 13.699  -8.167  -0.477  1.00 1.80  ? 46  LEU C CB   1  
ATOM 4445   C CG   . LEU C 2 46  ? 12.252  -8.560  -0.799  1.00 1.80  ? 46  LEU C CG   1  
ATOM 4446   C CD1  . LEU C 2 46  ? 12.147  -9.201  -2.175  1.00 1.85  ? 46  LEU C CD1  1  
ATOM 4447   C CD2  . LEU C 2 46  ? 11.693  -9.482  0.275   1.00 1.80  ? 46  LEU C CD2  1  
ATOM 4448   H H    . LEU C 2 46  ? 15.259  -10.089 0.904   1.00 1.85  ? 46  LEU C H    1  
ATOM 4449   H HA   . LEU C 2 46  ? 14.514  -9.547  -1.898  1.00 1.90  ? 46  LEU C HA   1  
ATOM 4450   H HB2  . LEU C 2 46  ? 13.783  -8.056  0.594   1.00 1.81  ? 46  LEU C HB2  1  
ATOM 4451   H HB3  . LEU C 2 46  ? 13.893  -7.208  -0.932  1.00 1.82  ? 46  LEU C HB3  1  
ATOM 4452   H HG   . LEU C 2 46  ? 11.647  -7.666  -0.810  1.00 1.83  ? 46  LEU C HG   1  
ATOM 4453   H HD11 . LEU C 2 46  ? 12.562  -10.199 -2.143  1.00 1.86  ? 46  LEU C HD11 1  
ATOM 4454   H HD12 . LEU C 2 46  ? 12.695  -8.607  -2.889  1.00 1.89  ? 46  LEU C HD12 1  
ATOM 4455   H HD13 . LEU C 2 46  ? 11.110  -9.254  -2.471  1.00 1.90  ? 46  LEU C HD13 1  
ATOM 4456   H HD21 . LEU C 2 46  ? 10.684  -9.766  0.016   1.00 1.81  ? 46  LEU C HD21 1  
ATOM 4457   H HD22 . LEU C 2 46  ? 11.688  -8.966  1.224   1.00 1.99  ? 46  LEU C HD22 1  
ATOM 4458   H HD23 . LEU C 2 46  ? 12.309  -10.365 0.348   1.00 1.90  ? 46  LEU C HD23 1  
ATOM 4459   N N    . PRO C 2 47  ? 17.246  -9.014  -1.392  1.00 2.02  ? 47  PRO C N    1  
ATOM 4460   C CA   . PRO C 2 47  ? 18.517  -8.313  -1.560  1.00 2.10  ? 47  PRO C CA   1  
ATOM 4461   C C    . PRO C 2 47  ? 18.722  -7.826  -2.992  1.00 2.18  ? 47  PRO C C    1  
ATOM 4462   O O    . PRO C 2 47  ? 19.613  -7.022  -3.271  1.00 2.28  ? 47  PRO C O    1  
ATOM 4463   C CB   . PRO C 2 47  ? 19.540  -9.386  -1.196  1.00 2.22  ? 47  PRO C CB   1  
ATOM 4464   C CG   . PRO C 2 47  ? 18.902  -10.679 -1.597  1.00 2.28  ? 47  PRO C CG   1  
ATOM 4465   C CD   . PRO C 2 47  ? 17.404  -10.470 -1.562  1.00 2.11  ? 47  PRO C CD   1  
ATOM 4466   H HA   . PRO C 2 47  ? 18.606  -7.479  -0.882  1.00 2.06  ? 47  PRO C HA   1  
ATOM 4467   H HB2  . PRO C 2 47  ? 20.457  -9.212  -1.742  1.00 2.33  ? 47  PRO C HB2  1  
ATOM 4468   H HB3  . PRO C 2 47  ? 19.736  -9.354  -0.134  1.00 2.22  ? 47  PRO C HB3  1  
ATOM 4469   H HG2  . PRO C 2 47  ? 19.213  -10.938 -2.598  1.00 2.46  ? 47  PRO C HG2  1  
ATOM 4470   H HG3  . PRO C 2 47  ? 19.185  -11.458 -0.906  1.00 2.38  ? 47  PRO C HG3  1  
ATOM 4471   H HD2  . PRO C 2 47  ? 16.959  -10.795 -2.490  1.00 2.16  ? 47  PRO C HD2  1  
ATOM 4472   H HD3  . PRO C 2 47  ? 16.967  -11.003 -0.729  1.00 2.08  ? 47  PRO C HD3  1  
ATOM 4473   N N    . HIS C 2 48  ? 17.894  -8.325  -3.897  1.00 2.18  ? 48  HIS C N    1  
ATOM 4474   C CA   . HIS C 2 48  ? 17.981  -7.945  -5.299  1.00 2.27  ? 48  HIS C CA   1  
ATOM 4475   C C    . HIS C 2 48  ? 16.887  -6.949  -5.658  1.00 2.18  ? 48  HIS C C    1  
ATOM 4476   O O    . HIS C 2 48  ? 17.164  -5.901  -6.240  1.00 2.32  ? 48  HIS C O    1  
ATOM 4477   C CB   . HIS C 2 48  ? 17.878  -9.175  -6.196  1.00 2.42  ? 48  HIS C CB   1  
ATOM 4478   C CG   . HIS C 2 48  ? 18.220  -8.897  -7.630  1.00 2.59  ? 48  HIS C CG   1  
ATOM 4479   N ND1  . HIS C 2 48  ? 17.441  -9.311  -8.688  1.00 2.77  ? 48  HIS C ND1  1  
ATOM 4480   C CD2  . HIS C 2 48  ? 19.274  -8.247  -8.176  1.00 2.70  ? 48  HIS C CD2  1  
ATOM 4481   C CE1  . HIS C 2 48  ? 18.003  -8.933  -9.821  1.00 2.94  ? 48  HIS C CE1  1  
ATOM 4482   N NE2  . HIS C 2 48  ? 19.116  -8.282  -9.539  1.00 2.89  ? 48  HIS C NE2  1  
ATOM 4483   H H    . HIS C 2 48  ? 17.211  -8.964  -3.611  1.00 2.13  ? 48  HIS C H    1  
ATOM 4484   H HA   . HIS C 2 48  ? 18.942  -7.477  -5.454  1.00 2.34  ? 48  HIS C HA   1  
ATOM 4485   H HB2  . HIS C 2 48  ? 18.553  -9.936  -5.833  1.00 2.47  ? 48  HIS C HB2  1  
ATOM 4486   H HB3  . HIS C 2 48  ? 16.867  -9.552  -6.162  1.00 2.41  ? 48  HIS C HB3  1  
ATOM 4487   H HD1  . HIS C 2 48  ? 16.599  -9.815  -8.621  1.00 2.84  ? 48  HIS C HD1  1  
ATOM 4488   H HD2  . HIS C 2 48  ? 20.090  -7.786  -7.639  1.00 2.70  ? 48  HIS C HD2  1  
ATOM 4489   H HE1  . HIS C 2 48  ? 17.617  -9.121  -10.812 1.00 3.15  ? 48  HIS C HE1  1  
ATOM 4490   H HE2  . HIS C 2 48  ? 19.825  -8.079  -10.189 1.00 3.02  ? 48  HIS C HE2  1  
ATOM 4491   N N    . LEU C 2 49  ? 15.643  -7.293  -5.328  1.00 1.99  ? 49  LEU C N    1  
ATOM 4492   C CA   . LEU C 2 49  ? 14.511  -6.421  -5.615  1.00 1.92  ? 49  LEU C CA   1  
ATOM 4493   C C    . LEU C 2 49  ? 14.682  -5.100  -4.876  1.00 1.86  ? 49  LEU C C    1  
ATOM 4494   O O    . LEU C 2 49  ? 14.509  -4.026  -5.455  1.00 1.91  ? 49  LEU C O    1  
ATOM 4495   C CB   . LEU C 2 49  ? 13.197  -7.098  -5.216  1.00 1.85  ? 49  LEU C CB   1  
ATOM 4496   C CG   . LEU C 2 49  ? 11.929  -6.475  -5.813  1.00 1.98  ? 49  LEU C CG   1  
ATOM 4497   C CD1  . LEU C 2 49  ? 12.090  -6.240  -7.312  1.00 2.48  ? 49  LEU C CD1  1  
ATOM 4498   C CD2  . LEU C 2 49  ? 10.727  -7.365  -5.538  1.00 1.83  ? 49  LEU C CD2  1  
ATOM 4499   H H    . LEU C 2 49  ? 15.485  -8.153  -4.889  1.00 1.94  ? 49  LEU C H    1  
ATOM 4500   H HA   . LEU C 2 49  ? 14.503  -6.228  -6.678  1.00 1.98  ? 49  LEU C HA   1  
ATOM 4501   H HB2  . LEU C 2 49  ? 13.243  -8.133  -5.521  1.00 2.02  ? 49  LEU C HB2  1  
ATOM 4502   H HB3  . LEU C 2 49  ? 13.114  -7.061  -4.142  1.00 1.83  ? 49  LEU C HB3  1  
ATOM 4503   H HG   . LEU C 2 49  ? 11.751  -5.519  -5.342  1.00 2.27  ? 49  LEU C HG   1  
ATOM 4504   H HD11 . LEU C 2 49  ? 12.483  -7.131  -7.778  1.00 2.58  ? 49  LEU C HD11 1  
ATOM 4505   H HD12 . LEU C 2 49  ? 12.769  -5.417  -7.476  1.00 2.89  ? 49  LEU C HD12 1  
ATOM 4506   H HD13 . LEU C 2 49  ? 11.129  -6.003  -7.744  1.00 2.69  ? 49  LEU C HD13 1  
ATOM 4507   H HD21 . LEU C 2 49  ? 10.661  -7.561  -4.478  1.00 1.97  ? 49  LEU C HD21 1  
ATOM 4508   H HD22 . LEU C 2 49  ? 10.840  -8.299  -6.070  1.00 1.81  ? 49  LEU C HD22 1  
ATOM 4509   H HD23 . LEU C 2 49  ? 9.827   -6.869  -5.869  1.00 2.09  ? 49  LEU C HD23 1  
ATOM 4510   N N    . LEU C 2 50  ? 15.030  -5.194  -3.599  1.00 1.79  ? 50  LEU C N    1  
ATOM 4511   C CA   . LEU C 2 50  ? 15.277  -4.019  -2.788  1.00 1.74  ? 50  LEU C CA   1  
ATOM 4512   C C    . LEU C 2 50  ? 16.762  -3.719  -2.853  1.00 1.71  ? 50  LEU C C    1  
ATOM 4513   O O    . LEU C 2 50  ? 17.585  -4.522  -2.413  1.00 1.75  ? 50  LEU C O    1  
ATOM 4514   C CB   . LEU C 2 50  ? 14.832  -4.240  -1.340  1.00 1.71  ? 50  LEU C CB   1  
ATOM 4515   C CG   . LEU C 2 50  ? 13.318  -4.207  -1.118  1.00 1.80  ? 50  LEU C CG   1  
ATOM 4516   C CD1  . LEU C 2 50  ? 12.979  -4.563  0.321   1.00 1.82  ? 50  LEU C CD1  1  
ATOM 4517   C CD2  . LEU C 2 50  ? 12.754  -2.839  -1.474  1.00 1.95  ? 50  LEU C CD2  1  
ATOM 4518   H H    . LEU C 2 50  ? 15.139  -6.078  -3.195  1.00 1.80  ? 50  LEU C H    1  
ATOM 4519   H HA   . LEU C 2 50  ? 14.731  -3.192  -3.214  1.00 1.77  ? 50  LEU C HA   1  
ATOM 4520   H HB2  . LEU C 2 50  ? 15.203  -5.202  -1.016  1.00 1.76  ? 50  LEU C HB2  1  
ATOM 4521   H HB3  . LEU C 2 50  ? 15.281  -3.473  -0.725  1.00 1.76  ? 50  LEU C HB3  1  
ATOM 4522   H HG   . LEU C 2 50  ? 12.854  -4.941  -1.760  1.00 1.95  ? 50  LEU C HG   1  
ATOM 4523   H HD11 . LEU C 2 50  ? 13.410  -5.522  0.567   1.00 2.03  ? 50  LEU C HD11 1  
ATOM 4524   H HD12 . LEU C 2 50  ? 11.906  -4.612  0.434   1.00 2.05  ? 50  LEU C HD12 1  
ATOM 4525   H HD13 . LEU C 2 50  ? 13.376  -3.808  0.983   1.00 1.84  ? 50  LEU C HD13 1  
ATOM 4526   H HD21 . LEU C 2 50  ? 11.733  -2.769  -1.129  1.00 2.11  ? 50  LEU C HD21 1  
ATOM 4527   H HD22 . LEU C 2 50  ? 12.779  -2.708  -2.546  1.00 2.06  ? 50  LEU C HD22 1  
ATOM 4528   H HD23 . LEU C 2 50  ? 13.348  -2.070  -1.004  1.00 2.05  ? 50  LEU C HD23 1  
ATOM 4529   N N    . LYS C 2 51  ? 17.101  -2.581  -3.428  1.00 1.73  ? 51  LYS C N    1  
ATOM 4530   C CA   . LYS C 2 51  ? 18.497  -2.200  -3.593  1.00 1.76  ? 51  LYS C CA   1  
ATOM 4531   C C    . LYS C 2 51  ? 19.089  -1.634  -2.310  1.00 1.82  ? 51  LYS C C    1  
ATOM 4532   O O    . LYS C 2 51  ? 20.304  -1.463  -2.206  1.00 2.25  ? 51  LYS C O    1  
ATOM 4533   C CB   . LYS C 2 51  ? 18.644  -1.191  -4.732  1.00 1.85  ? 51  LYS C CB   1  
ATOM 4534   C CG   . LYS C 2 51  ? 18.198  -1.722  -6.086  1.00 1.88  ? 51  LYS C CG   1  
ATOM 4535   C CD   . LYS C 2 51  ? 16.713  -1.495  -6.304  1.00 1.87  ? 51  LYS C CD   1  
ATOM 4536   C CE   . LYS C 2 51  ? 16.239  -2.058  -7.632  1.00 1.89  ? 51  LYS C CE   1  
ATOM 4537   N NZ   . LYS C 2 51  ? 14.755  -2.134  -7.697  1.00 1.95  ? 51  LYS C NZ   1  
ATOM 4538   H H    . LYS C 2 51  ? 16.394  -1.977  -3.745  1.00 1.78  ? 51  LYS C H    1  
ATOM 4539   H HA   . LYS C 2 51  ? 19.046  -3.091  -3.855  1.00 1.73  ? 51  LYS C HA   1  
ATOM 4540   H HB2  . LYS C 2 51  ? 18.053  -0.317  -4.502  1.00 1.93  ? 51  LYS C HB2  1  
ATOM 4541   H HB3  . LYS C 2 51  ? 19.682  -0.901  -4.808  1.00 1.90  ? 51  LYS C HB3  1  
ATOM 4542   H HG2  . LYS C 2 51  ? 18.749  -1.212  -6.863  1.00 1.96  ? 51  LYS C HG2  1  
ATOM 4543   H HG3  . LYS C 2 51  ? 18.406  -2.783  -6.131  1.00 2.07  ? 51  LYS C HG3  1  
ATOM 4544   H HD2  . LYS C 2 51  ? 16.166  -1.981  -5.511  1.00 2.07  ? 51  LYS C HD2  1  
ATOM 4545   H HD3  . LYS C 2 51  ? 16.515  -0.432  -6.281  1.00 1.96  ? 51  LYS C HD3  1  
ATOM 4546   H HE2  . LYS C 2 51  ? 16.595  -1.418  -8.425  1.00 1.91  ? 51  LYS C HE2  1  
ATOM 4547   H HE3  . LYS C 2 51  ? 16.651  -3.049  -7.755  1.00 2.08  ? 51  LYS C HE3  1  
ATOM 4548   H HZ1  . LYS C 2 51  ? 14.446  -2.359  -8.663  1.00 2.27  ? 51  LYS C HZ1  1  
ATOM 4549   H HZ2  . LYS C 2 51  ? 14.335  -1.216  -7.411  1.00 2.08  ? 51  LYS C HZ2  1  
ATOM 4550   H HZ3  . LYS C 2 51  ? 14.409  -2.870  -7.048  1.00 2.20  ? 51  LYS C HZ3  1  
ATOM 4551   N N    . ASP C 2 52  ? 18.241  -1.353  -1.337  1.00 1.65  ? 52  ASP C N    1  
ATOM 4552   C CA   . ASP C 2 52  ? 18.712  -0.808  -0.074  1.00 1.71  ? 52  ASP C CA   1  
ATOM 4553   C C    . ASP C 2 52  ? 18.573  -1.819  1.050   1.00 1.67  ? 52  ASP C C    1  
ATOM 4554   O O    . ASP C 2 52  ? 17.466  -2.155  1.475   1.00 1.69  ? 52  ASP C O    1  
ATOM 4555   C CB   . ASP C 2 52  ? 17.972  0.477   0.300   1.00 1.73  ? 52  ASP C CB   1  
ATOM 4556   C CG   . ASP C 2 52  ? 18.362  0.976   1.684   1.00 1.81  ? 52  ASP C CG   1  
ATOM 4557   O OD1  . ASP C 2 52  ? 19.514  0.732   2.112   1.00 1.92  ? 52  ASP C OD1  1  
ATOM 4558   O OD2  . ASP C 2 52  ? 17.517  1.610   2.349   1.00 1.95  ? 52  ASP C OD2  1  
ATOM 4559   H H    . ASP C 2 52  ? 17.286  -1.532  -1.461  1.00 1.70  ? 52  ASP C H    1  
ATOM 4560   H HA   . ASP C 2 52  ? 19.759  -0.577  -0.196  1.00 1.85  ? 52  ASP C HA   1  
ATOM 4561   H HB2  . ASP C 2 52  ? 18.208  1.246   -0.421  1.00 1.86  ? 52  ASP C HB2  1  
ATOM 4562   H HB3  . ASP C 2 52  ? 16.908  0.291   0.289   1.00 1.64  ? 52  ASP C HB3  1  
ATOM 4563   N N    . VAL C 2 53  ? 19.709  -2.310  1.510   1.00 1.69  ? 53  VAL C N    1  
ATOM 4564   C CA   . VAL C 2 53  ? 19.754  -3.260  2.608   1.00 1.70  ? 53  VAL C CA   1  
ATOM 4565   C C    . VAL C 2 53  ? 20.654  -2.709  3.704   1.00 1.72  ? 53  VAL C C    1  
ATOM 4566   O O    . VAL C 2 53  ? 21.055  -3.421  4.629   1.00 1.81  ? 53  VAL C O    1  
ATOM 4567   C CB   . VAL C 2 53  ? 20.270  -4.646  2.157   1.00 1.83  ? 53  VAL C CB   1  
ATOM 4568   C CG1  . VAL C 2 53  ? 19.255  -5.334  1.257   1.00 1.78  ? 53  VAL C CG1  1  
ATOM 4569   C CG2  . VAL C 2 53  ? 21.608  -4.520  1.443   1.00 2.00  ? 53  VAL C CG2  1  
ATOM 4570   H H    . VAL C 2 53  ? 20.549  -2.023  1.096   1.00 1.77  ? 53  VAL C H    1  
ATOM 4571   H HA   . VAL C 2 53  ? 18.752  -3.373  2.997   1.00 1.62  ? 53  VAL C HA   1  
ATOM 4572   H HB   . VAL C 2 53  ? 20.412  -5.257  3.035   1.00 1.88  ? 53  VAL C HB   1  
ATOM 4573   H HG11 . VAL C 2 53  ? 19.070  -4.719  0.388   1.00 1.95  ? 53  VAL C HG11 1  
ATOM 4574   H HG12 . VAL C 2 53  ? 18.333  -5.478  1.798   1.00 1.92  ? 53  VAL C HG12 1  
ATOM 4575   H HG13 . VAL C 2 53  ? 19.642  -6.293  0.945   1.00 1.71  ? 53  VAL C HG13 1  
ATOM 4576   H HG21 . VAL C 2 53  ? 22.313  -4.012  2.086   1.00 2.21  ? 53  VAL C HG21 1  
ATOM 4577   H HG22 . VAL C 2 53  ? 21.478  -3.955  0.532   1.00 2.16  ? 53  VAL C HG22 1  
ATOM 4578   H HG23 . VAL C 2 53  ? 21.982  -5.506  1.207   1.00 1.93  ? 53  VAL C HG23 1  
ATOM 4579   N N    . GLY C 2 54  ? 20.960  -1.423  3.589   1.00 1.71  ? 54  GLY C N    1  
ATOM 4580   C CA   . GLY C 2 54  ? 21.814  -0.770  4.555   1.00 1.75  ? 54  GLY C CA   1  
ATOM 4581   C C    . GLY C 2 54  ? 21.083  0.314   5.311   1.00 1.69  ? 54  GLY C C    1  
ATOM 4582   O O    . GLY C 2 54  ? 21.234  0.449   6.525   1.00 1.67  ? 54  GLY C O    1  
ATOM 4583   H H    . GLY C 2 54  ? 20.576  -0.904  2.847   1.00 1.71  ? 54  GLY C H    1  
ATOM 4584   H HA2  . GLY C 2 54  ? 22.174  -1.507  5.259   1.00 1.77  ? 54  GLY C HA2  1  
ATOM 4585   H HA3  . GLY C 2 54  ? 22.655  -0.334  4.040   1.00 1.83  ? 54  GLY C HA3  1  
ATOM 4586   N N    . SER C 2 55  ? 20.270  1.078   4.597   1.00 1.69  ? 55  SER C N    1  
ATOM 4587   C CA   . SER C 2 55  ? 19.497  2.148   5.199   1.00 1.65  ? 55  SER C CA   1  
ATOM 4588   C C    . SER C 2 55  ? 18.113  1.625   5.572   1.00 1.52  ? 55  SER C C    1  
ATOM 4589   O O    . SER C 2 55  ? 17.115  2.348   5.504   1.00 1.48  ? 55  SER C O    1  
ATOM 4590   C CB   . SER C 2 55  ? 19.380  3.332   4.232   1.00 1.73  ? 55  SER C CB   1  
ATOM 4591   O OG   . SER C 2 55  ? 20.631  3.628   3.625   1.00 1.88  ? 55  SER C OG   1  
ATOM 4592   H H    . SER C 2 55  ? 20.174  0.909   3.624   1.00 1.72  ? 55  SER C H    1  
ATOM 4593   H HA   . SER C 2 55  ? 20.008  2.469   6.096   1.00 1.69  ? 55  SER C HA   1  
ATOM 4594   H HB2  . SER C 2 55  ? 18.666  3.092   3.459   1.00 1.85  ? 55  SER C HB2  1  
ATOM 4595   H HB3  . SER C 2 55  ? 19.042  4.202   4.776   1.00 1.86  ? 55  SER C HB3  1  
ATOM 4596   H HG   . SER C 2 55  ? 20.698  3.144   2.790   1.00 2.21  ? 55  SER C HG   1  
ATOM 4597   N N    . LEU C 2 56  ? 18.076  0.355   5.978   1.00 1.48  ? 56  LEU C N    1  
ATOM 4598   C CA   . LEU C 2 56  ? 16.838  -0.305  6.378   1.00 1.38  ? 56  LEU C CA   1  
ATOM 4599   C C    . LEU C 2 56  ? 16.167  0.476   7.503   1.00 1.36  ? 56  LEU C C    1  
ATOM 4600   O O    . LEU C 2 56  ? 14.941  0.517   7.602   1.00 1.31  ? 56  LEU C O    1  
ATOM 4601   C CB   . LEU C 2 56  ? 17.132  -1.752  6.812   1.00 1.40  ? 56  LEU C CB   1  
ATOM 4602   C CG   . LEU C 2 56  ? 15.920  -2.699  6.895   1.00 1.33  ? 56  LEU C CG   1  
ATOM 4603   C CD1  . LEU C 2 56  ? 15.280  -2.641  8.275   1.00 1.40  ? 56  LEU C CD1  1  
ATOM 4604   C CD2  . LEU C 2 56  ? 14.892  -2.372  5.815   1.00 1.40  ? 56  LEU C CD2  1  
ATOM 4605   H H    . LEU C 2 56  ? 18.913  -0.154  5.999   1.00 1.55  ? 56  LEU C H    1  
ATOM 4606   H HA   . LEU C 2 56  ? 16.181  -0.320  5.523   1.00 1.31  ? 56  LEU C HA   1  
ATOM 4607   H HB2  . LEU C 2 56  ? 17.841  -2.174  6.111   1.00 1.47  ? 56  LEU C HB2  1  
ATOM 4608   H HB3  . LEU C 2 56  ? 17.602  -1.723  7.785   1.00 1.49  ? 56  LEU C HB3  1  
ATOM 4609   H HG   . LEU C 2 56  ? 16.256  -3.712  6.734   1.00 1.37  ? 56  LEU C HG   1  
ATOM 4610   H HD11 . LEU C 2 56  ? 15.987  -2.984  9.015   1.00 1.67  ? 56  LEU C HD11 1  
ATOM 4611   H HD12 . LEU C 2 56  ? 14.405  -3.275  8.294   1.00 1.63  ? 56  LEU C HD12 1  
ATOM 4612   H HD13 . LEU C 2 56  ? 14.991  -1.624  8.496   1.00 1.51  ? 56  LEU C HD13 1  
ATOM 4613   H HD21 . LEU C 2 56  ? 14.095  -3.099  5.847   1.00 1.43  ? 56  LEU C HD21 1  
ATOM 4614   H HD22 . LEU C 2 56  ? 15.365  -2.398  4.843   1.00 1.50  ? 56  LEU C HD22 1  
ATOM 4615   H HD23 . LEU C 2 56  ? 14.485  -1.387  5.990   1.00 1.50  ? 56  LEU C HD23 1  
ATOM 4616   N N    . ASP C 2 57  ? 16.985  1.113   8.336   1.00 1.42  ? 57  ASP C N    1  
ATOM 4617   C CA   . ASP C 2 57  ? 16.484  1.912   9.447   1.00 1.43  ? 57  ASP C CA   1  
ATOM 4618   C C    . ASP C 2 57  ? 15.619  3.057   8.934   1.00 1.41  ? 57  ASP C C    1  
ATOM 4619   O O    . ASP C 2 57  ? 14.667  3.475   9.598   1.00 1.39  ? 57  ASP C O    1  
ATOM 4620   C CB   . ASP C 2 57  ? 17.642  2.456   10.286  1.00 1.51  ? 57  ASP C CB   1  
ATOM 4621   C CG   . ASP C 2 57  ? 18.200  1.416   11.234  1.00 1.57  ? 57  ASP C CG   1  
ATOM 4622   O OD1  . ASP C 2 57  ? 18.998  0.568   10.789  1.00 1.56  ? 57  ASP C OD1  1  
ATOM 4623   O OD2  . ASP C 2 57  ? 17.826  1.431   12.424  1.00 1.83  ? 57  ASP C OD2  1  
ATOM 4624   H H    . ASP C 2 57  ? 17.953  1.032   8.206   1.00 1.47  ? 57  ASP C H    1  
ATOM 4625   H HA   . ASP C 2 57  ? 15.876  1.271   10.065  1.00 1.42  ? 57  ASP C HA   1  
ATOM 4626   H HB2  . ASP C 2 57  ? 18.435  2.776   9.627   1.00 1.49  ? 57  ASP C HB2  1  
ATOM 4627   H HB3  . ASP C 2 57  ? 17.294  3.298   10.865  1.00 1.64  ? 57  ASP C HB3  1  
ATOM 4628   N N    . GLU C 2 58  ? 15.953  3.564   7.750   1.00 1.43  ? 58  GLU C N    1  
ATOM 4629   C CA   . GLU C 2 58  ? 15.183  4.636   7.136   1.00 1.44  ? 58  GLU C CA   1  
ATOM 4630   C C    . GLU C 2 58  ? 13.838  4.088   6.692   1.00 1.36  ? 58  GLU C C    1  
ATOM 4631   O O    . GLU C 2 58  ? 12.795  4.688   6.943   1.00 1.35  ? 58  GLU C O    1  
ATOM 4632   C CB   . GLU C 2 58  ? 15.921  5.235   5.931   1.00 1.51  ? 58  GLU C CB   1  
ATOM 4633   C CG   . GLU C 2 58  ? 15.107  6.278   5.174   1.00 1.79  ? 58  GLU C CG   1  
ATOM 4634   C CD   . GLU C 2 58  ? 15.709  6.637   3.830   1.00 2.16  ? 58  GLU C CD   1  
ATOM 4635   O OE1  . GLU C 2 58  ? 15.817  5.750   2.961   1.00 2.67  ? 58  GLU C OE1  1  
ATOM 4636   O OE2  . GLU C 2 58  ? 16.068  7.813   3.631   1.00 2.45  ? 58  GLU C OE2  1  
ATOM 4637   H H    . GLU C 2 58  ? 16.735  3.205   7.277   1.00 1.45  ? 58  GLU C H    1  
ATOM 4638   H HA   . GLU C 2 58  ? 15.025  5.405   7.878   1.00 1.48  ? 58  GLU C HA   1  
ATOM 4639   H HB2  . GLU C 2 58  ? 16.832  5.700   6.277   1.00 1.64  ? 58  GLU C HB2  1  
ATOM 4640   H HB3  . GLU C 2 58  ? 16.171  4.439   5.246   1.00 1.45  ? 58  GLU C HB3  1  
ATOM 4641   H HG2  . GLU C 2 58  ? 14.112  5.892   5.011   1.00 1.93  ? 58  GLU C HG2  1  
ATOM 4642   H HG3  . GLU C 2 58  ? 15.049  7.174   5.775   1.00 2.02  ? 58  GLU C HG3  1  
ATOM 4643   N N    . LYS C 2 59  ? 13.876  2.924   6.051   1.00 1.35  ? 59  LYS C N    1  
ATOM 4644   C CA   . LYS C 2 59  ? 12.667  2.272   5.571   1.00 1.30  ? 59  LYS C CA   1  
ATOM 4645   C C    . LYS C 2 59  ? 11.749  1.933   6.739   1.00 1.25  ? 59  LYS C C    1  
ATOM 4646   O O    . LYS C 2 59  ? 10.560  2.231   6.707   1.00 1.22  ? 59  LYS C O    1  
ATOM 4647   C CB   . LYS C 2 59  ? 13.017  0.997   4.798   1.00 1.31  ? 59  LYS C CB   1  
ATOM 4648   C CG   . LYS C 2 59  ? 12.815  1.109   3.291   1.00 1.43  ? 59  LYS C CG   1  
ATOM 4649   C CD   . LYS C 2 59  ? 14.100  1.491   2.567   1.00 1.66  ? 59  LYS C CD   1  
ATOM 4650   C CE   . LYS C 2 59  ? 14.392  2.977   2.684   1.00 1.75  ? 59  LYS C CE   1  
ATOM 4651   N NZ   . LYS C 2 59  ? 15.663  3.352   2.009   1.00 1.91  ? 59  LYS C NZ   1  
ATOM 4652   H H    . LYS C 2 59  ? 14.746  2.491   5.900   1.00 1.39  ? 59  LYS C H    1  
ATOM 4653   H HA   . LYS C 2 59  ? 12.158  2.959   4.912   1.00 1.33  ? 59  LYS C HA   1  
ATOM 4654   H HB2  . LYS C 2 59  ? 14.051  0.753   4.983   1.00 1.38  ? 59  LYS C HB2  1  
ATOM 4655   H HB3  . LYS C 2 59  ? 12.397  0.193   5.164   1.00 1.32  ? 59  LYS C HB3  1  
ATOM 4656   H HG2  . LYS C 2 59  ? 12.475  0.155   2.912   1.00 1.57  ? 59  LYS C HG2  1  
ATOM 4657   H HG3  . LYS C 2 59  ? 12.065  1.862   3.096   1.00 1.52  ? 59  LYS C HG3  1  
ATOM 4658   H HD2  . LYS C 2 59  ? 14.923  0.941   2.998   1.00 1.94  ? 59  LYS C HD2  1  
ATOM 4659   H HD3  . LYS C 2 59  ? 14.002  1.235   1.521   1.00 1.98  ? 59  LYS C HD3  1  
ATOM 4660   H HE2  . LYS C 2 59  ? 13.580  3.527   2.231   1.00 1.93  ? 59  LYS C HE2  1  
ATOM 4661   H HE3  . LYS C 2 59  ? 14.460  3.235   3.732   1.00 2.01  ? 59  LYS C HE3  1  
ATOM 4662   H HZ1  . LYS C 2 59  ? 15.934  4.327   2.279   1.00 2.10  ? 59  LYS C HZ1  1  
ATOM 4663   H HZ2  . LYS C 2 59  ? 15.553  3.306   0.979   1.00 2.26  ? 59  LYS C HZ2  1  
ATOM 4664   H HZ3  . LYS C 2 59  ? 16.431  2.697   2.294   1.00 2.02  ? 59  LYS C HZ3  1  
ATOM 4665   N N    . MET C 2 60  ? 12.324  1.333   7.775   1.00 1.25  ? 60  MET C N    1  
ATOM 4666   C CA   . MET C 2 60  ? 11.575  0.941   8.969   1.00 1.24  ? 60  MET C CA   1  
ATOM 4667   C C    . MET C 2 60  ? 10.846  2.134   9.581   1.00 1.21  ? 60  MET C C    1  
ATOM 4668   O O    . MET C 2 60  ? 9.681   2.033   9.955   1.00 1.20  ? 60  MET C O    1  
ATOM 4669   C CB   . MET C 2 60  ? 12.522  0.319   10.003  1.00 1.30  ? 60  MET C CB   1  
ATOM 4670   C CG   . MET C 2 60  ? 11.817  -0.204  11.246  1.00 1.32  ? 60  MET C CG   1  
ATOM 4671   S SD   . MET C 2 60  ? 12.952  -0.967  12.427  1.00 1.73  ? 60  MET C SD   1  
ATOM 4672   C CE   . MET C 2 60  ? 11.798  -1.605  13.639  1.00 2.03  ? 60  MET C CE   1  
ATOM 4673   H H    . MET C 2 60  ? 13.290  1.142   7.737   1.00 1.29  ? 60  MET C H    1  
ATOM 4674   H HA   . MET C 2 60  ? 10.845  0.203   8.673   1.00 1.22  ? 60  MET C HA   1  
ATOM 4675   H HB2  . MET C 2 60  ? 13.047  -0.504  9.541   1.00 1.36  ? 60  MET C HB2  1  
ATOM 4676   H HB3  . MET C 2 60  ? 13.240  1.065   10.310  1.00 1.34  ? 60  MET C HB3  1  
ATOM 4677   H HG2  . MET C 2 60  ? 11.316  0.619   11.734  1.00 1.40  ? 60  MET C HG2  1  
ATOM 4678   H HG3  . MET C 2 60  ? 11.086  -0.941  10.944  1.00 1.51  ? 60  MET C HG3  1  
ATOM 4679   H HE1  . MET C 2 60  ? 12.322  -2.242  14.337  1.00 2.28  ? 60  MET C HE1  1  
ATOM 4680   H HE2  . MET C 2 60  ? 11.031  -2.176  13.140  1.00 2.38  ? 60  MET C HE2  1  
ATOM 4681   H HE3  . MET C 2 60  ? 11.345  -0.782  14.172  1.00 2.36  ? 60  MET C HE3  1  
ATOM 4682   N N    . LYS C 2 61  ? 11.537  3.265   9.652   1.00 1.22  ? 61  LYS C N    1  
ATOM 4683   C CA   . LYS C 2 61  ? 10.976  4.483   10.226  1.00 1.23  ? 61  LYS C CA   1  
ATOM 4684   C C    . LYS C 2 61  ? 9.902   5.085   9.321   1.00 1.21  ? 61  LYS C C    1  
ATOM 4685   O O    . LYS C 2 61  ? 8.971   5.733   9.796   1.00 1.25  ? 61  LYS C O    1  
ATOM 4686   C CB   . LYS C 2 61  ? 12.094  5.495   10.484  1.00 1.29  ? 61  LYS C CB   1  
ATOM 4687   C CG   . LYS C 2 61  ? 11.638  6.748   11.216  1.00 1.34  ? 61  LYS C CG   1  
ATOM 4688   C CD   . LYS C 2 61  ? 12.792  7.413   11.946  1.00 1.48  ? 61  LYS C CD   1  
ATOM 4689   C CE   . LYS C 2 61  ? 12.958  6.850   13.348  1.00 1.59  ? 61  LYS C CE   1  
ATOM 4690   N NZ   . LYS C 2 61  ? 14.262  7.226   13.948  1.00 1.75  ? 61  LYS C NZ   1  
ATOM 4691   H H    . LYS C 2 61  ? 12.457  3.282   9.309   1.00 1.24  ? 61  LYS C H    1  
ATOM 4692   H HA   . LYS C 2 61  ? 10.520  4.222   11.170  1.00 1.23  ? 61  LYS C HA   1  
ATOM 4693   H HB2  . LYS C 2 61  ? 12.861  5.020   11.078  1.00 1.34  ? 61  LYS C HB2  1  
ATOM 4694   H HB3  . LYS C 2 61  ? 12.520  5.794   9.537   1.00 1.44  ? 61  LYS C HB3  1  
ATOM 4695   H HG2  . LYS C 2 61  ? 11.228  7.444   10.500  1.00 1.49  ? 61  LYS C HG2  1  
ATOM 4696   H HG3  . LYS C 2 61  ? 10.879  6.475   11.935  1.00 1.36  ? 61  LYS C HG3  1  
ATOM 4697   H HD2  . LYS C 2 61  ? 13.704  7.240   11.390  1.00 1.65  ? 61  LYS C HD2  1  
ATOM 4698   H HD3  . LYS C 2 61  ? 12.602  8.474   12.011  1.00 1.62  ? 61  LYS C HD3  1  
ATOM 4699   H HE2  . LYS C 2 61  ? 12.163  7.234   13.972  1.00 1.83  ? 61  LYS C HE2  1  
ATOM 4700   H HE3  . LYS C 2 61  ? 12.888  5.771   13.302  1.00 1.87  ? 61  LYS C HE3  1  
ATOM 4701   H HZ1  . LYS C 2 61  ? 14.282  6.962   14.954  1.00 2.09  ? 61  LYS C HZ1  1  
ATOM 4702   H HZ2  . LYS C 2 61  ? 14.411  8.252   13.870  1.00 1.90  ? 61  LYS C HZ2  1  
ATOM 4703   H HZ3  . LYS C 2 61  ? 15.039  6.735   13.458  1.00 2.15  ? 61  LYS C HZ3  1  
ATOM 4704   N N    . SER C 2 62  ? 10.026  4.862   8.019   1.00 1.21  ? 62  SER C N    1  
ATOM 4705   C CA   . SER C 2 62  ? 9.060   5.389   7.064   1.00 1.22  ? 62  SER C CA   1  
ATOM 4706   C C    . SER C 2 62  ? 7.814   4.506   7.001   1.00 1.19  ? 62  SER C C    1  
ATOM 4707   O O    . SER C 2 62  ? 6.737   4.960   6.606   1.00 1.23  ? 62  SER C O    1  
ATOM 4708   C CB   . SER C 2 62  ? 9.693   5.499   5.677   1.00 1.28  ? 62  SER C CB   1  
ATOM 4709   O OG   . SER C 2 62  ? 10.924  6.201   5.730   1.00 1.40  ? 62  SER C OG   1  
ATOM 4710   H H    . SER C 2 62  ? 10.785  4.333   7.694   1.00 1.23  ? 62  SER C H    1  
ATOM 4711   H HA   . SER C 2 62  ? 8.771   6.375   7.397   1.00 1.25  ? 62  SER C HA   1  
ATOM 4712   H HB2  . SER C 2 62  ? 9.875   4.509   5.287   1.00 1.30  ? 62  SER C HB2  1  
ATOM 4713   H HB3  . SER C 2 62  ? 9.019   6.028   5.017   1.00 1.26  ? 62  SER C HB3  1  
ATOM 4714   H HG   . SER C 2 62  ? 11.549  5.721   6.289   1.00 1.35  ? 62  SER C HG   1  
ATOM 4715   N N    . LEU C 2 63  ? 7.964   3.245   7.381   1.00 1.16  ? 63  LEU C N    1  
ATOM 4716   C CA   . LEU C 2 63  ? 6.847   2.313   7.365   1.00 1.15  ? 63  LEU C CA   1  
ATOM 4717   C C    . LEU C 2 63  ? 6.100   2.359   8.689   1.00 1.13  ? 63  LEU C C    1  
ATOM 4718   O O    . LEU C 2 63  ? 4.868   2.418   8.717   1.00 1.17  ? 63  LEU C O    1  
ATOM 4719   C CB   . LEU C 2 63  ? 7.330   0.886   7.095   1.00 1.20  ? 63  LEU C CB   1  
ATOM 4720   C CG   . LEU C 2 63  ? 8.192   0.702   5.846   1.00 1.27  ? 63  LEU C CG   1  
ATOM 4721   C CD1  . LEU C 2 63  ? 8.506   -0.769  5.641   1.00 1.37  ? 63  LEU C CD1  1  
ATOM 4722   C CD2  . LEU C 2 63  ? 7.502   1.283   4.620   1.00 1.35  ? 63  LEU C CD2  1  
ATOM 4723   H H    . LEU C 2 63  ? 8.847   2.934   7.678   1.00 1.17  ? 63  LEU C H    1  
ATOM 4724   H HA   . LEU C 2 63  ? 6.174   2.614   6.576   1.00 1.18  ? 63  LEU C HA   1  
ATOM 4725   H HB2  . LEU C 2 63  ? 7.899   0.555   7.950   1.00 1.22  ? 63  LEU C HB2  1  
ATOM 4726   H HB3  . LEU C 2 63  ? 6.462   0.249   6.999   1.00 1.23  ? 63  LEU C HB3  1  
ATOM 4727   H HG   . LEU C 2 63  ? 9.126   1.225   5.983   1.00 1.25  ? 63  LEU C HG   1  
ATOM 4728   H HD11 . LEU C 2 63  ? 7.583   -1.322  5.543   1.00 1.61  ? 63  LEU C HD11 1  
ATOM 4729   H HD12 . LEU C 2 63  ? 9.060   -1.140  6.490   1.00 1.51  ? 63  LEU C HD12 1  
ATOM 4730   H HD13 . LEU C 2 63  ? 9.097   -0.890  4.744   1.00 1.55  ? 63  LEU C HD13 1  
ATOM 4731   H HD21 . LEU C 2 63  ? 7.569   2.361   4.646   1.00 1.64  ? 63  LEU C HD21 1  
ATOM 4732   H HD22 . LEU C 2 63  ? 6.464   0.989   4.622   1.00 1.47  ? 63  LEU C HD22 1  
ATOM 4733   H HD23 . LEU C 2 63  ? 7.981   0.913   3.724   1.00 1.66  ? 63  LEU C HD23 1  
ATOM 4734   N N    . ASP C 2 64  ? 6.852   2.338   9.782   1.00 1.14  ? 64  ASP C N    1  
ATOM 4735   C CA   . ASP C 2 64  ? 6.267   2.376   11.114  1.00 1.16  ? 64  ASP C CA   1  
ATOM 4736   C C    . ASP C 2 64  ? 5.876   3.802   11.485  1.00 1.24  ? 64  ASP C C    1  
ATOM 4737   O O    . ASP C 2 64  ? 6.656   4.541   12.087  1.00 1.80  ? 64  ASP C O    1  
ATOM 4738   C CB   . ASP C 2 64  ? 7.241   1.798   12.150  1.00 1.21  ? 64  ASP C CB   1  
ATOM 4739   C CG   . ASP C 2 64  ? 6.664   1.804   13.554  1.00 1.28  ? 64  ASP C CG   1  
ATOM 4740   O OD1  . ASP C 2 64  ? 5.426   1.908   13.689  1.00 1.80  ? 64  ASP C OD1  1  
ATOM 4741   O OD2  . ASP C 2 64  ? 7.446   1.707   14.525  1.00 1.58  ? 64  ASP C OD2  1  
ATOM 4742   H H    . ASP C 2 64  ? 7.830   2.312   9.691   1.00 1.17  ? 64  ASP C H    1  
ATOM 4743   H HA   . ASP C 2 64  ? 5.375   1.768   11.098  1.00 1.20  ? 64  ASP C HA   1  
ATOM 4744   H HB2  . ASP C 2 64  ? 7.478   0.779   11.884  1.00 1.30  ? 64  ASP C HB2  1  
ATOM 4745   H HB3  . ASP C 2 64  ? 8.149   2.386   12.151  1.00 1.27  ? 64  ASP C HB3  1  
ATOM 4746   N N    . VAL C 2 65  ? 4.660   4.184   11.113  1.00 1.19  ? 65  VAL C N    1  
ATOM 4747   C CA   . VAL C 2 65  ? 4.157   5.520   11.406  1.00 1.20  ? 65  VAL C CA   1  
ATOM 4748   C C    . VAL C 2 65  ? 3.801   5.657   12.883  1.00 1.14  ? 65  VAL C C    1  
ATOM 4749   O O    . VAL C 2 65  ? 3.505   6.753   13.363  1.00 1.24  ? 65  VAL C O    1  
ATOM 4750   C CB   . VAL C 2 65  ? 2.926   5.874   10.545  1.00 1.34  ? 65  VAL C CB   1  
ATOM 4751   C CG1  . VAL C 2 65  ? 3.316   5.997   9.079   1.00 1.60  ? 65  VAL C CG1  1  
ATOM 4752   C CG2  . VAL C 2 65  ? 1.819   4.842   10.725  1.00 1.55  ? 65  VAL C CG2  1  
ATOM 4753   H H    . VAL C 2 65  ? 4.095   3.554   10.618  1.00 1.53  ? 65  VAL C H    1  
ATOM 4754   H HA   . VAL C 2 65  ? 4.944   6.223   11.173  1.00 1.29  ? 65  VAL C HA   1  
ATOM 4755   H HB   . VAL C 2 65  ? 2.548   6.832   10.873  1.00 1.49  ? 65  VAL C HB   1  
ATOM 4756   H HG11 . VAL C 2 65  ? 4.085   6.751   8.972   1.00 1.82  ? 65  VAL C HG11 1  
ATOM 4757   H HG12 . VAL C 2 65  ? 2.452   6.281   8.500   1.00 1.98  ? 65  VAL C HG12 1  
ATOM 4758   H HG13 . VAL C 2 65  ? 3.689   5.047   8.727   1.00 1.86  ? 65  VAL C HG13 1  
ATOM 4759   H HG21 . VAL C 2 65  ? 2.210   3.857   10.523  1.00 1.77  ? 65  VAL C HG21 1  
ATOM 4760   H HG22 . VAL C 2 65  ? 1.013   5.057   10.038  1.00 1.84  ? 65  VAL C HG22 1  
ATOM 4761   H HG23 . VAL C 2 65  ? 1.448   4.883   11.739  1.00 1.84  ? 65  VAL C HG23 1  
ATOM 4762   N N    . ASN C 2 66  ? 3.825   4.536   13.593  1.00 1.17  ? 66  ASN C N    1  
ATOM 4763   C CA   . ASN C 2 66  ? 3.524   4.526   15.017  1.00 1.23  ? 66  ASN C CA   1  
ATOM 4764   C C    . ASN C 2 66  ? 4.791   4.866   15.783  1.00 1.16  ? 66  ASN C C    1  
ATOM 4765   O O    . ASN C 2 66  ? 4.745   5.439   16.878  1.00 1.22  ? 66  ASN C O    1  
ATOM 4766   C CB   . ASN C 2 66  ? 3.002   3.151   15.474  1.00 1.45  ? 66  ASN C CB   1  
ATOM 4767   C CG   . ASN C 2 66  ? 2.164   2.439   14.422  1.00 1.48  ? 66  ASN C CG   1  
ATOM 4768   O OD1  . ASN C 2 66  ? 0.945   2.603   14.358  1.00 1.60  ? 66  ASN C OD1  1  
ATOM 4769   N ND2  . ASN C 2 66  ? 2.815   1.633   13.593  1.00 2.10  ? 66  ASN C ND2  1  
ATOM 4770   H H    . ASN C 2 66  ? 4.070   3.694   13.151  1.00 1.26  ? 66  ASN C H    1  
ATOM 4771   H HA   . ASN C 2 66  ? 2.775   5.281   15.211  1.00 1.32  ? 66  ASN C HA   1  
ATOM 4772   H HB2  . ASN C 2 66  ? 3.844   2.521   15.717  1.00 1.93  ? 66  ASN C HB2  1  
ATOM 4773   H HB3  . ASN C 2 66  ? 2.395   3.285   16.359  1.00 1.63  ? 66  ASN C HB3  1  
ATOM 4774   H HD21 . ASN C 2 66  ? 3.801   1.543   13.705  1.00 2.46  ? 66  ASN C HD21 1  
ATOM 4775   H HD22 . ASN C 2 66  ? 2.302   1.164   12.903  1.00 2.43  ? 66  ASN C HD22 1  
ATOM 4776   N N    . GLN C 2 67  ? 5.923   4.502   15.177  1.00 1.13  ? 67  GLN C N    1  
ATOM 4777   C CA   . GLN C 2 67  ? 7.247   4.737   15.740  1.00 1.17  ? 67  GLN C CA   1  
ATOM 4778   C C    . GLN C 2 67  ? 7.406   4.023   17.076  1.00 1.19  ? 67  GLN C C    1  
ATOM 4779   O O    . GLN C 2 67  ? 8.020   4.540   18.012  1.00 1.28  ? 67  GLN C O    1  
ATOM 4780   C CB   . GLN C 2 67  ? 7.522   6.238   15.878  1.00 1.24  ? 67  GLN C CB   1  
ATOM 4781   C CG   . GLN C 2 67  ? 8.036   6.873   14.594  1.00 1.45  ? 67  GLN C CG   1  
ATOM 4782   C CD   . GLN C 2 67  ? 8.399   8.339   14.753  1.00 1.52  ? 67  GLN C CD   1  
ATOM 4783   O OE1  . GLN C 2 67  ? 8.353   9.109   13.794  1.00 1.70  ? 67  GLN C OE1  1  
ATOM 4784   N NE2  . GLN C 2 67  ? 8.766   8.740   15.962  1.00 1.90  ? 67  GLN C NE2  1  
ATOM 4785   H H    . GLN C 2 67  ? 5.862   4.042   14.310  1.00 1.15  ? 67  GLN C H    1  
ATOM 4786   H HA   . GLN C 2 67  ? 7.965   4.319   15.049  1.00 1.23  ? 67  GLN C HA   1  
ATOM 4787   H HB2  . GLN C 2 67  ? 6.606   6.737   16.162  1.00 1.32  ? 67  GLN C HB2  1  
ATOM 4788   H HB3  . GLN C 2 67  ? 8.258   6.388   16.652  1.00 1.32  ? 67  GLN C HB3  1  
ATOM 4789   H HG2  . GLN C 2 67  ? 8.916   6.338   14.270  1.00 1.88  ? 67  GLN C HG2  1  
ATOM 4790   H HG3  . GLN C 2 67  ? 7.269   6.790   13.837  1.00 1.74  ? 67  GLN C HG3  1  
ATOM 4791   H HE21 . GLN C 2 67  ? 8.783   8.078   16.687  1.00 1.97  ? 67  GLN C HE21 1  
ATOM 4792   H HE22 . GLN C 2 67  ? 9.004   9.682   16.085  1.00 2.31  ? 67  GLN C HE22 1  
ATOM 4793   N N    . ASP C 2 68  ? 6.860   2.821   17.152  1.00 1.17  ? 68  ASP C N    1  
ATOM 4794   C CA   . ASP C 2 68  ? 6.941   2.021   18.363  1.00 1.21  ? 68  ASP C CA   1  
ATOM 4795   C C    . ASP C 2 68  ? 7.856   0.826   18.136  1.00 1.22  ? 68  ASP C C    1  
ATOM 4796   O O    . ASP C 2 68  ? 8.027   -0.018  19.017  1.00 1.28  ? 68  ASP C O    1  
ATOM 4797   C CB   . ASP C 2 68  ? 5.550   1.563   18.811  1.00 1.26  ? 68  ASP C CB   1  
ATOM 4798   C CG   . ASP C 2 68  ? 4.952   0.492   17.919  1.00 1.29  ? 68  ASP C CG   1  
ATOM 4799   O OD1  . ASP C 2 68  ? 5.055   0.609   16.685  1.00 1.37  ? 68  ASP C OD1  1  
ATOM 4800   O OD2  . ASP C 2 68  ? 4.347   -0.464  18.455  1.00 1.70  ? 68  ASP C OD2  1  
ATOM 4801   H H    . ASP C 2 68  ? 6.396   2.452   16.362  1.00 1.18  ? 68  ASP C H    1  
ATOM 4802   H HA   . ASP C 2 68  ? 7.372   2.642   19.136  1.00 1.23  ? 68  ASP C HA   1  
ATOM 4803   H HB2  . ASP C 2 68  ? 5.618   1.165   19.813  1.00 1.40  ? 68  ASP C HB2  1  
ATOM 4804   H HB3  . ASP C 2 68  ? 4.887   2.414   18.813  1.00 1.29  ? 68  ASP C HB3  1  
ATOM 4805   N N    . SER C 2 69  ? 8.431   0.771   16.931  1.00 1.19  ? 69  SER C N    1  
ATOM 4806   C CA   . SER C 2 69  ? 9.357   -0.287  16.537  1.00 1.22  ? 69  SER C CA   1  
ATOM 4807   C C    . SER C 2 69  ? 8.635   -1.623  16.406  1.00 1.25  ? 69  SER C C    1  
ATOM 4808   O O    . SER C 2 69  ? 9.215   -2.687  16.635  1.00 1.35  ? 69  SER C O    1  
ATOM 4809   C CB   . SER C 2 69  ? 10.516  -0.389  17.535  1.00 1.26  ? 69  SER C CB   1  
ATOM 4810   O OG   . SER C 2 69  ? 11.020  0.899   17.857  1.00 1.27  ? 69  SER C OG   1  
ATOM 4811   H H    . SER C 2 69  ? 8.187   1.456   16.263  1.00 1.16  ? 69  SER C H    1  
ATOM 4812   H HA   . SER C 2 69  ? 9.756   -0.020  15.569  1.00 1.21  ? 69  SER C HA   1  
ATOM 4813   H HB2  . SER C 2 69  ? 10.169  -0.865  18.440  1.00 1.29  ? 69  SER C HB2  1  
ATOM 4814   H HB3  . SER C 2 69  ? 11.311  -0.976  17.101  1.00 1.30  ? 69  SER C HB3  1  
ATOM 4815   H HG   . SER C 2 69  ? 10.365  1.563   17.612  1.00 1.40  ? 69  SER C HG   1  
ATOM 4816   N N    . GLU C 2 70  ? 7.370   -1.558  16.020  1.00 1.24  ? 70  GLU C N    1  
ATOM 4817   C CA   . GLU C 2 70  ? 6.559   -2.748  15.858  1.00 1.27  ? 70  GLU C CA   1  
ATOM 4818   C C    . GLU C 2 70  ? 5.760   -2.659  14.567  1.00 1.24  ? 70  GLU C C    1  
ATOM 4819   O O    . GLU C 2 70  ? 4.755   -1.950  14.493  1.00 1.25  ? 70  GLU C O    1  
ATOM 4820   C CB   . GLU C 2 70  ? 5.628   -2.905  17.057  1.00 1.32  ? 70  GLU C CB   1  
ATOM 4821   C CG   . GLU C 2 70  ? 4.949   -4.260  17.145  1.00 1.45  ? 70  GLU C CG   1  
ATOM 4822   C CD   . GLU C 2 70  ? 4.111   -4.397  18.400  1.00 1.49  ? 70  GLU C CD   1  
ATOM 4823   O OE1  . GLU C 2 70  ? 4.691   -4.470  19.500  1.00 1.57  ? 70  GLU C OE1  1  
ATOM 4824   O OE2  . GLU C 2 70  ? 2.867   -4.423  18.297  1.00 1.63  ? 70  GLU C OE2  1  
ATOM 4825   H H    . GLU C 2 70  ? 6.968   -0.676  15.841  1.00 1.27  ? 70  GLU C H    1  
ATOM 4826   H HA   . GLU C 2 70  ? 7.219   -3.603  15.805  1.00 1.30  ? 70  GLU C HA   1  
ATOM 4827   H HB2  . GLU C 2 70  ? 6.200   -2.757  17.960  1.00 1.34  ? 70  GLU C HB2  1  
ATOM 4828   H HB3  . GLU C 2 70  ? 4.860   -2.144  16.999  1.00 1.37  ? 70  GLU C HB3  1  
ATOM 4829   H HG2  . GLU C 2 70  ? 4.306   -4.387  16.286  1.00 1.55  ? 70  GLU C HG2  1  
ATOM 4830   H HG3  . GLU C 2 70  ? 5.706   -5.031  17.147  1.00 1.53  ? 70  GLU C HG3  1  
ATOM 4831   N N    . LEU C 2 71  ? 6.215   -3.365  13.546  1.00 1.25  ? 71  LEU C N    1  
ATOM 4832   C CA   . LEU C 2 71  ? 5.540   -3.360  12.260  1.00 1.24  ? 71  LEU C CA   1  
ATOM 4833   C C    . LEU C 2 71  ? 4.364   -4.327  12.292  1.00 1.26  ? 71  LEU C C    1  
ATOM 4834   O O    . LEU C 2 71  ? 4.525   -5.533  12.090  1.00 1.33  ? 71  LEU C O    1  
ATOM 4835   C CB   . LEU C 2 71  ? 6.513   -3.731  11.133  1.00 1.29  ? 71  LEU C CB   1  
ATOM 4836   C CG   . LEU C 2 71  ? 7.407   -2.599  10.610  1.00 1.29  ? 71  LEU C CG   1  
ATOM 4837   C CD1  . LEU C 2 71  ? 6.568   -1.449  10.085  1.00 1.31  ? 71  LEU C CD1  1  
ATOM 4838   C CD2  . LEU C 2 71  ? 8.361   -2.115  11.689  1.00 1.34  ? 71  LEU C CD2  1  
ATOM 4839   H H    . LEU C 2 71  ? 7.024   -3.912  13.660  1.00 1.29  ? 71  LEU C H    1  
ATOM 4840   H HA   . LEU C 2 71  ? 5.163   -2.362  12.091  1.00 1.22  ? 71  LEU C HA   1  
ATOM 4841   H HB2  . LEU C 2 71  ? 7.153   -4.522  11.493  1.00 1.34  ? 71  LEU C HB2  1  
ATOM 4842   H HB3  . LEU C 2 71  ? 5.936   -4.112  10.306  1.00 1.31  ? 71  LEU C HB3  1  
ATOM 4843   H HG   . LEU C 2 71  ? 7.999   -2.974  9.790   1.00 1.34  ? 71  LEU C HG   1  
ATOM 4844   H HD11 . LEU C 2 71  ? 6.006   -1.013  10.897  1.00 1.58  ? 71  LEU C HD11 1  
ATOM 4845   H HD12 . LEU C 2 71  ? 5.886   -1.817  9.333   1.00 1.43  ? 71  LEU C HD12 1  
ATOM 4846   H HD13 . LEU C 2 71  ? 7.214   -0.700  9.651   1.00 1.39  ? 71  LEU C HD13 1  
ATOM 4847   H HD21 . LEU C 2 71  ? 9.021   -2.922  11.976  1.00 1.63  ? 71  LEU C HD21 1  
ATOM 4848   H HD22 . LEU C 2 71  ? 7.795   -1.789  12.550  1.00 1.65  ? 71  LEU C HD22 1  
ATOM 4849   H HD23 . LEU C 2 71  ? 8.945   -1.291  11.309  1.00 1.46  ? 71  LEU C HD23 1  
ATOM 4850   N N    . LYS C 2 72  ? 3.185   -3.788  12.573  1.00 1.23  ? 72  LYS C N    1  
ATOM 4851   C CA   . LYS C 2 72  ? 1.964   -4.584  12.655  1.00 1.26  ? 72  LYS C CA   1  
ATOM 4852   C C    . LYS C 2 72  ? 1.511   -5.058  11.276  1.00 1.26  ? 72  LYS C C    1  
ATOM 4853   O O    . LYS C 2 72  ? 2.107   -4.698  10.252  1.00 1.24  ? 72  LYS C O    1  
ATOM 4854   C CB   . LYS C 2 72  ? 0.844   -3.771  13.317  1.00 1.26  ? 72  LYS C CB   1  
ATOM 4855   C CG   . LYS C 2 72  ? 0.836   -3.842  14.841  1.00 1.32  ? 72  LYS C CG   1  
ATOM 4856   C CD   . LYS C 2 72  ? 1.952   -3.013  15.463  1.00 1.63  ? 72  LYS C CD   1  
ATOM 4857   C CE   . LYS C 2 72  ? 1.645   -1.523  15.428  1.00 1.41  ? 72  LYS C CE   1  
ATOM 4858   N NZ   . LYS C 2 72  ? 2.736   -0.716  16.042  1.00 1.53  ? 72  LYS C NZ   1  
ATOM 4859   H H    . LYS C 2 72  ? 3.135   -2.823  12.736  1.00 1.21  ? 72  LYS C H    1  
ATOM 4860   H HA   . LYS C 2 72  ? 2.173   -5.449  13.265  1.00 1.32  ? 72  LYS C HA   1  
ATOM 4861   H HB2  . LYS C 2 72  ? 0.949   -2.735  13.029  1.00 1.33  ? 72  LYS C HB2  1  
ATOM 4862   H HB3  . LYS C 2 72  ? -0.107  -4.138  12.959  1.00 1.35  ? 72  LYS C HB3  1  
ATOM 4863   H HG2  . LYS C 2 72  ? -0.111  -3.470  15.202  1.00 1.44  ? 72  LYS C HG2  1  
ATOM 4864   H HG3  . LYS C 2 72  ? 0.955   -4.872  15.141  1.00 1.60  ? 72  LYS C HG3  1  
ATOM 4865   H HD2  . LYS C 2 72  ? 2.081   -3.317  16.492  1.00 2.20  ? 72  LYS C HD2  1  
ATOM 4866   H HD3  . LYS C 2 72  ? 2.867   -3.195  14.918  1.00 2.19  ? 72  LYS C HD3  1  
ATOM 4867   H HE2  . LYS C 2 72  ? 1.522   -1.218  14.399  1.00 1.67  ? 72  LYS C HE2  1  
ATOM 4868   H HE3  . LYS C 2 72  ? 0.728   -1.343  15.967  1.00 1.47  ? 72  LYS C HE3  1  
ATOM 4869   H HZ1  . LYS C 2 72  ? 3.605   -0.783  15.470  1.00 1.67  ? 72  LYS C HZ1  1  
ATOM 4870   H HZ2  . LYS C 2 72  ? 2.945   -1.060  17.001  1.00 1.85  ? 72  LYS C HZ2  1  
ATOM 4871   H HZ3  . LYS C 2 72  ? 2.454   0.282   16.104  1.00 1.88  ? 72  LYS C HZ3  1  
ATOM 4872   N N    . PHE C 2 73  ? 0.444   -5.853  11.263  1.00 1.31  ? 73  PHE C N    1  
ATOM 4873   C CA   . PHE C 2 73  ? -0.117  -6.397  10.028  1.00 1.34  ? 73  PHE C CA   1  
ATOM 4874   C C    . PHE C 2 73  ? -0.867  -5.313  9.250   1.00 1.33  ? 73  PHE C C    1  
ATOM 4875   O O    . PHE C 2 73  ? -2.076  -5.410  9.018   1.00 1.71  ? 73  PHE C O    1  
ATOM 4876   C CB   . PHE C 2 73  ? -1.060  -7.562  10.351  1.00 1.47  ? 73  PHE C CB   1  
ATOM 4877   C CG   . PHE C 2 73  ? -1.121  -8.625  9.281   1.00 1.52  ? 73  PHE C CG   1  
ATOM 4878   C CD1  . PHE C 2 73  ? -1.294  -8.284  7.947   1.00 1.67  ? 73  PHE C CD1  1  
ATOM 4879   C CD2  . PHE C 2 73  ? -1.005  -9.965  9.613   1.00 2.04  ? 73  PHE C CD2  1  
ATOM 4880   C CE1  . PHE C 2 73  ? -1.352  -9.258  6.969   1.00 1.82  ? 73  PHE C CE1  1  
ATOM 4881   C CE2  . PHE C 2 73  ? -1.064  -10.943 8.639   1.00 2.33  ? 73  PHE C CE2  1  
ATOM 4882   C CZ   . PHE C 2 73  ? -1.235  -10.589 7.315   1.00 2.02  ? 73  PHE C CZ   1  
ATOM 4883   H H    . PHE C 2 73  ? 0.018   -6.086  12.118  1.00 1.36  ? 73  PHE C H    1  
ATOM 4884   H HA   . PHE C 2 73  ? 0.699   -6.761  9.421   1.00 1.35  ? 73  PHE C HA   1  
ATOM 4885   H HB2  . PHE C 2 73  ? -0.734  -8.033  11.267  1.00 1.69  ? 73  PHE C HB2  1  
ATOM 4886   H HB3  . PHE C 2 73  ? -2.059  -7.174  10.492  1.00 1.52  ? 73  PHE C HB3  1  
ATOM 4887   H HD1  . PHE C 2 73  ? -1.386  -7.244  7.674   1.00 2.07  ? 73  PHE C HD1  1  
ATOM 4888   H HD2  . PHE C 2 73  ? -0.870  -10.244 10.648  1.00 2.50  ? 73  PHE C HD2  1  
ATOM 4889   H HE1  . PHE C 2 73  ? -1.484  -8.978  5.935   1.00 2.18  ? 73  PHE C HE1  1  
ATOM 4890   H HE2  . PHE C 2 73  ? -0.973  -11.984 8.911   1.00 3.00  ? 73  PHE C HE2  1  
ATOM 4891   H HZ   . PHE C 2 73  ? -1.279  -11.353 6.554   1.00 2.30  ? 73  PHE C HZ   1  
ATOM 4892   N N    . ASN C 2 74  ? -0.131  -4.286  8.855   1.00 1.24  ? 74  ASN C N    1  
ATOM 4893   C CA   . ASN C 2 74  ? -0.681  -3.168  8.104   1.00 1.20  ? 74  ASN C CA   1  
ATOM 4894   C C    . ASN C 2 74  ? 0.453   -2.298  7.587   1.00 1.18  ? 74  ASN C C    1  
ATOM 4895   O O    . ASN C 2 74  ? 0.616   -2.114  6.383   1.00 1.21  ? 74  ASN C O    1  
ATOM 4896   C CB   . ASN C 2 74  ? -1.627  -2.331  8.978   1.00 1.22  ? 74  ASN C CB   1  
ATOM 4897   C CG   . ASN C 2 74  ? -2.411  -1.311  8.172   1.00 1.31  ? 74  ASN C CG   1  
ATOM 4898   O OD1  . ASN C 2 74  ? -3.410  -1.644  7.535   1.00 1.53  ? 74  ASN C OD1  1  
ATOM 4899   N ND2  . ASN C 2 74  ? -1.987  -0.054  8.215   1.00 1.42  ? 74  ASN C ND2  1  
ATOM 4900   H H    . ASN C 2 74  ? 0.826   -4.282  9.081   1.00 1.43  ? 74  ASN C H    1  
ATOM 4901   H HA   . ASN C 2 74  ? -1.229  -3.566  7.263   1.00 1.24  ? 74  ASN C HA   1  
ATOM 4902   H HB2  . ASN C 2 74  ? -2.328  -2.989  9.470   1.00 1.28  ? 74  ASN C HB2  1  
ATOM 4903   H HB3  . ASN C 2 74  ? -1.048  -1.806  9.725   1.00 1.21  ? 74  ASN C HB3  1  
ATOM 4904   H HD21 . ASN C 2 74  ? -1.196  0.156   8.765   1.00 1.55  ? 74  ASN C HD21 1  
ATOM 4905   H HD22 . ASN C 2 74  ? -2.472  0.614   7.688   1.00 1.54  ? 74  ASN C HD22 1  
ATOM 4906   N N    . GLU C 2 75  ? 1.257   -1.793  8.516   1.00 1.16  ? 75  GLU C N    1  
ATOM 4907   C CA   . GLU C 2 75  ? 2.388   -0.941  8.175   1.00 1.18  ? 75  GLU C CA   1  
ATOM 4908   C C    . GLU C 2 75  ? 3.472   -1.735  7.445   1.00 1.20  ? 75  GLU C C    1  
ATOM 4909   O O    . GLU C 2 75  ? 4.188   -1.196  6.603   1.00 1.22  ? 75  GLU C O    1  
ATOM 4910   C CB   . GLU C 2 75  ? 2.974   -0.297  9.435   1.00 1.23  ? 75  GLU C CB   1  
ATOM 4911   C CG   . GLU C 2 75  ? 2.185   0.901   9.952   1.00 1.25  ? 75  GLU C CG   1  
ATOM 4912   C CD   . GLU C 2 75  ? 0.816   0.526   10.478  1.00 1.37  ? 75  GLU C CD   1  
ATOM 4913   O OE1  . GLU C 2 75  ? 0.726   -0.403  11.301  1.00 1.60  ? 75  GLU C OE1  1  
ATOM 4914   O OE2  . GLU C 2 75  ? -0.176  1.164   10.069  1.00 1.84  ? 75  GLU C OE2  1  
ATOM 4915   H H    . GLU C 2 75  ? 1.076   -1.989  9.461   1.00 1.17  ? 75  GLU C H    1  
ATOM 4916   H HA   . GLU C 2 75  ? 2.027   -0.163  7.519   1.00 1.19  ? 75  GLU C HA   1  
ATOM 4917   H HB2  . GLU C 2 75  ? 3.009   -1.039  10.217  1.00 1.29  ? 75  GLU C HB2  1  
ATOM 4918   H HB3  . GLU C 2 75  ? 3.982   0.029   9.220   1.00 1.30  ? 75  GLU C HB3  1  
ATOM 4919   H HG2  . GLU C 2 75  ? 2.744   1.361   10.753  1.00 1.43  ? 75  GLU C HG2  1  
ATOM 4920   H HG3  . GLU C 2 75  ? 2.065   1.611   9.147   1.00 1.39  ? 75  GLU C HG3  1  
ATOM 4921   N N    . TYR C 2 76  ? 3.576   -3.021  7.767   1.00 1.23  ? 76  TYR C N    1  
ATOM 4922   C CA   . TYR C 2 76  ? 4.572   -3.890  7.148   1.00 1.29  ? 76  TYR C CA   1  
ATOM 4923   C C    . TYR C 2 76  ? 4.282   -4.098  5.661   1.00 1.29  ? 76  TYR C C    1  
ATOM 4924   O O    . TYR C 2 76  ? 5.203   -4.168  4.845   1.00 1.32  ? 76  TYR C O    1  
ATOM 4925   C CB   . TYR C 2 76  ? 4.612   -5.247  7.867   1.00 1.35  ? 76  TYR C CB   1  
ATOM 4926   C CG   . TYR C 2 76  ? 5.303   -6.341  7.078   1.00 1.41  ? 76  TYR C CG   1  
ATOM 4927   C CD1  . TYR C 2 76  ? 6.689   -6.398  6.990   1.00 1.45  ? 76  TYR C CD1  1  
ATOM 4928   C CD2  . TYR C 2 76  ? 4.563   -7.312  6.412   1.00 1.45  ? 76  TYR C CD2  1  
ATOM 4929   C CE1  . TYR C 2 76  ? 7.318   -7.393  6.264   1.00 1.52  ? 76  TYR C CE1  1  
ATOM 4930   C CE2  . TYR C 2 76  ? 5.186   -8.311  5.684   1.00 1.52  ? 76  TYR C CE2  1  
ATOM 4931   C CZ   . TYR C 2 76  ? 6.564   -8.346  5.612   1.00 1.55  ? 76  TYR C CZ   1  
ATOM 4932   O OH   . TYR C 2 76  ? 7.189   -9.338  4.892   1.00 1.64  ? 76  TYR C OH   1  
ATOM 4933   H H    . TYR C 2 76  ? 2.973   -3.394  8.442   1.00 1.23  ? 76  TYR C H    1  
ATOM 4934   H HA   . TYR C 2 76  ? 5.535   -3.413  7.249   1.00 1.32  ? 76  TYR C HA   1  
ATOM 4935   H HB2  . TYR C 2 76  ? 5.136   -5.135  8.803   1.00 1.37  ? 76  TYR C HB2  1  
ATOM 4936   H HB3  . TYR C 2 76  ? 3.601   -5.570  8.065   1.00 1.34  ? 76  TYR C HB3  1  
ATOM 4937   H HD1  . TYR C 2 76  ? 7.279   -5.651  7.502   1.00 1.44  ? 76  TYR C HD1  1  
ATOM 4938   H HD2  . TYR C 2 76  ? 3.485   -7.282  6.469   1.00 1.44  ? 76  TYR C HD2  1  
ATOM 4939   H HE1  . TYR C 2 76  ? 8.398   -7.419  6.208   1.00 1.57  ? 76  TYR C HE1  1  
ATOM 4940   H HE2  . TYR C 2 76  ? 4.594   -9.056  5.174   1.00 1.57  ? 76  TYR C HE2  1  
ATOM 4941   H HH   . TYR C 2 76  ? 7.888   -9.729  5.422   1.00 1.69  ? 76  TYR C HH   1  
ATOM 4942   N N    . TRP C 2 77  ? 3.000   -4.170  5.308   1.00 1.27  ? 77  TRP C N    1  
ATOM 4943   C CA   . TRP C 2 77  ? 2.600   -4.394  3.923   1.00 1.29  ? 77  TRP C CA   1  
ATOM 4944   C C    . TRP C 2 77  ? 3.034   -3.241  3.022   1.00 1.27  ? 77  TRP C C    1  
ATOM 4945   O O    . TRP C 2 77  ? 3.126   -3.395  1.803   1.00 1.31  ? 77  TRP C O    1  
ATOM 4946   C CB   . TRP C 2 77  ? 1.088   -4.608  3.817   1.00 1.30  ? 77  TRP C CB   1  
ATOM 4947   C CG   . TRP C 2 77  ? 0.735   -5.870  3.097   1.00 1.57  ? 77  TRP C CG   1  
ATOM 4948   C CD1  . TRP C 2 77  ? 0.380   -7.061  3.660   1.00 1.83  ? 77  TRP C CD1  1  
ATOM 4949   C CD2  . TRP C 2 77  ? 0.706   -6.071  1.677   1.00 1.85  ? 77  TRP C CD2  1  
ATOM 4950   N NE1  . TRP C 2 77  ? 0.136   -7.992  2.680   1.00 2.17  ? 77  TRP C NE1  1  
ATOM 4951   C CE2  . TRP C 2 77  ? 0.331   -7.407  1.455   1.00 2.20  ? 77  TRP C CE2  1  
ATOM 4952   C CE3  . TRP C 2 77  ? 0.964   -5.249  0.573   1.00 2.00  ? 77  TRP C CE3  1  
ATOM 4953   C CZ2  . TRP C 2 77  ? 0.206   -7.941  0.175   1.00 2.62  ? 77  TRP C CZ2  1  
ATOM 4954   C CZ3  . TRP C 2 77  ? 0.838   -5.780  -0.696  1.00 2.46  ? 77  TRP C CZ3  1  
ATOM 4955   C CH2  . TRP C 2 77  ? 0.463   -7.116  -0.885  1.00 2.73  ? 77  TRP C CH2  1  
ATOM 4956   H H    . TRP C 2 77  ? 2.308   -4.057  5.993   1.00 1.25  ? 77  TRP C H    1  
ATOM 4957   H HA   . TRP C 2 77  ? 3.101   -5.291  3.587   1.00 1.35  ? 77  TRP C HA   1  
ATOM 4958   H HB2  . TRP C 2 77  ? 0.664   -4.659  4.808   1.00 1.31  ? 77  TRP C HB2  1  
ATOM 4959   H HB3  . TRP C 2 77  ? 0.646   -3.782  3.281   1.00 1.27  ? 77  TRP C HB3  1  
ATOM 4960   H HD1  . TRP C 2 77  ? 0.306   -7.233  4.724   1.00 1.89  ? 77  TRP C HD1  1  
ATOM 4961   H HE1  . TRP C 2 77  ? -0.134  -8.925  2.834   1.00 2.44  ? 77  TRP C HE1  1  
ATOM 4962   H HE3  . TRP C 2 77  ? 1.256   -4.215  0.700   1.00 1.87  ? 77  TRP C HE3  1  
ATOM 4963   H HZ2  . TRP C 2 77  ? -0.082  -8.968  0.010   1.00 2.92  ? 77  TRP C HZ2  1  
ATOM 4964   H HZ3  . TRP C 2 77  ? 1.032   -5.163  -1.561  1.00 2.68  ? 77  TRP C HZ3  1  
ATOM 4965   H HH2  . TRP C 2 77  ? 0.378   -7.489  -1.894  1.00 3.11  ? 77  TRP C HH2  1  
ATOM 4966   N N    . ARG C 2 78  ? 3.323   -2.094  3.626   1.00 1.24  ? 78  ARG C N    1  
ATOM 4967   C CA   . ARG C 2 78  ? 3.761   -0.930  2.871   1.00 1.24  ? 78  ARG C CA   1  
ATOM 4968   C C    . ARG C 2 78  ? 5.090   -1.227  2.178   1.00 1.26  ? 78  ARG C C    1  
ATOM 4969   O O    . ARG C 2 78  ? 5.354   -0.727  1.088   1.00 1.28  ? 78  ARG C O    1  
ATOM 4970   C CB   . ARG C 2 78  ? 3.883   0.287   3.792   1.00 1.22  ? 78  ARG C CB   1  
ATOM 4971   C CG   . ARG C 2 78  ? 4.217   1.580   3.064   1.00 1.54  ? 78  ARG C CG   1  
ATOM 4972   C CD   . ARG C 2 78  ? 3.936   2.792   3.938   1.00 1.60  ? 78  ARG C CD   1  
ATOM 4973   N NE   . ARG C 2 78  ? 2.499   3.044   4.071   1.00 1.57  ? 78  ARG C NE   1  
ATOM 4974   C CZ   . ARG C 2 78  ? 1.849   3.136   5.232   1.00 1.89  ? 78  ARG C CZ   1  
ATOM 4975   N NH1  . ARG C 2 78  ? 2.494   2.988   6.387   1.00 2.33  ? 78  ARG C NH1  1  
ATOM 4976   N NH2  . ARG C 2 78  ? 0.546   3.382   5.239   1.00 2.27  ? 78  ARG C NH2  1  
ATOM 4977   H H    . ARG C 2 78  ? 3.237   -2.031  4.600   1.00 1.22  ? 78  ARG C H    1  
ATOM 4978   H HA   . ARG C 2 78  ? 3.015   -0.727  2.117   1.00 1.25  ? 78  ARG C HA   1  
ATOM 4979   H HB2  . ARG C 2 78  ? 2.945   0.427   4.310   1.00 1.38  ? 78  ARG C HB2  1  
ATOM 4980   H HB3  . ARG C 2 78  ? 4.658   0.097   4.520   1.00 1.32  ? 78  ARG C HB3  1  
ATOM 4981   H HG2  . ARG C 2 78  ? 5.263   1.573   2.799   1.00 1.82  ? 78  ARG C HG2  1  
ATOM 4982   H HG3  . ARG C 2 78  ? 3.615   1.643   2.169   1.00 1.87  ? 78  ARG C HG3  1  
ATOM 4983   H HD2  . ARG C 2 78  ? 4.355   2.620   4.917   1.00 1.92  ? 78  ARG C HD2  1  
ATOM 4984   H HD3  . ARG C 2 78  ? 4.403   3.658   3.492   1.00 1.80  ? 78  ARG C HD3  1  
ATOM 4985   H HE   . ARG C 2 78  ? 1.986   3.154   3.236   1.00 1.79  ? 78  ARG C HE   1  
ATOM 4986   H HH11 . ARG C 2 78  ? 3.479   2.807   6.398   1.00 2.36  ? 78  ARG C HH11 1  
ATOM 4987   H HH12 . ARG C 2 78  ? 1.990   3.055   7.254   1.00 2.87  ? 78  ARG C HH12 1  
ATOM 4988   H HH21 . ARG C 2 78  ? 0.049   3.497   4.371   1.00 2.37  ? 78  ARG C HH21 1  
ATOM 4989   H HH22 . ARG C 2 78  ? 0.053   3.458   6.109   1.00 2.72  ? 78  ARG C HH22 1  
ATOM 4990   N N    . LEU C 2 79  ? 5.906   -2.077  2.803   1.00 1.27  ? 79  LEU C N    1  
ATOM 4991   C CA   . LEU C 2 79  ? 7.194   -2.460  2.234   1.00 1.31  ? 79  LEU C CA   1  
ATOM 4992   C C    . LEU C 2 79  ? 6.980   -3.209  0.926   1.00 1.36  ? 79  LEU C C    1  
ATOM 4993   O O    . LEU C 2 79  ? 7.656   -2.951  -0.071  1.00 1.39  ? 79  LEU C O    1  
ATOM 4994   C CB   . LEU C 2 79  ? 7.977   -3.348  3.206   1.00 1.32  ? 79  LEU C CB   1  
ATOM 4995   C CG   . LEU C 2 79  ? 9.318   -3.864  2.680   1.00 1.37  ? 79  LEU C CG   1  
ATOM 4996   C CD1  . LEU C 2 79  ? 10.399  -2.803  2.828   1.00 1.36  ? 79  LEU C CD1  1  
ATOM 4997   C CD2  . LEU C 2 79  ? 9.718   -5.144  3.396   1.00 1.40  ? 79  LEU C CD2  1  
ATOM 4998   H H    . LEU C 2 79  ? 5.628   -2.463  3.662   1.00 1.26  ? 79  LEU C H    1  
ATOM 4999   H HA   . LEU C 2 79  ? 7.758   -1.561  2.037   1.00 1.31  ? 79  LEU C HA   1  
ATOM 5000   H HB2  . LEU C 2 79  ? 8.159   -2.785  4.108   1.00 1.29  ? 79  LEU C HB2  1  
ATOM 5001   H HB3  . LEU C 2 79  ? 7.362   -4.201  3.454   1.00 1.34  ? 79  LEU C HB3  1  
ATOM 5002   H HG   . LEU C 2 79  ? 9.217   -4.088  1.628   1.00 1.41  ? 79  LEU C HG   1  
ATOM 5003   H HD11 . LEU C 2 79  ? 10.103  -1.909  2.298   1.00 1.44  ? 79  LEU C HD11 1  
ATOM 5004   H HD12 . LEU C 2 79  ? 11.325  -3.174  2.415   1.00 1.53  ? 79  LEU C HD12 1  
ATOM 5005   H HD13 . LEU C 2 79  ? 10.539  -2.574  3.876   1.00 1.42  ? 79  LEU C HD13 1  
ATOM 5006   H HD21 . LEU C 2 79  ? 8.964   -5.900  3.230   1.00 1.49  ? 79  LEU C HD21 1  
ATOM 5007   H HD22 . LEU C 2 79  ? 9.805   -4.951  4.454   1.00 1.41  ? 79  LEU C HD22 1  
ATOM 5008   H HD23 . LEU C 2 79  ? 10.666  -5.492  3.014   1.00 1.44  ? 79  LEU C HD23 1  
ATOM 5009   N N    . ILE C 2 80  ? 6.019   -4.127  0.939   1.00 1.37  ? 80  ILE C N    1  
ATOM 5010   C CA   . ILE C 2 80  ? 5.695   -4.918  -0.239  1.00 1.43  ? 80  ILE C CA   1  
ATOM 5011   C C    . ILE C 2 80  ? 5.183   -4.008  -1.350  1.00 1.44  ? 80  ILE C C    1  
ATOM 5012   O O    . ILE C 2 80  ? 5.444   -4.238  -2.530  1.00 1.48  ? 80  ILE C O    1  
ATOM 5013   C CB   . ILE C 2 80  ? 4.648   -6.008  0.077   1.00 1.46  ? 80  ILE C CB   1  
ATOM 5014   C CG1  . ILE C 2 80  ? 5.089   -6.814  1.301   1.00 1.46  ? 80  ILE C CG1  1  
ATOM 5015   C CG2  . ILE C 2 80  ? 4.452   -6.925  -1.126  1.00 1.52  ? 80  ILE C CG2  1  
ATOM 5016   C CD1  . ILE C 2 80  ? 4.036   -7.768  1.818   1.00 1.50  ? 80  ILE C CD1  1  
ATOM 5017   H H    . ILE C 2 80  ? 5.509   -4.270  1.764   1.00 1.36  ? 80  ILE C H    1  
ATOM 5018   H HA   . ILE C 2 80  ? 6.600   -5.404  -0.572  1.00 1.46  ? 80  ILE C HA   1  
ATOM 5019   H HB   . ILE C 2 80  ? 3.709   -5.525  0.289   1.00 1.44  ? 80  ILE C HB   1  
ATOM 5020   H HG12 . ILE C 2 80  ? 5.959   -7.396  1.042   1.00 1.49  ? 80  ILE C HG12 1  
ATOM 5021   H HG13 . ILE C 2 80  ? 5.342   -6.132  2.099   1.00 1.42  ? 80  ILE C HG13 1  
ATOM 5022   H HG21 . ILE C 2 80  ? 3.690   -7.659  -0.901  1.00 1.59  ? 80  ILE C HG21 1  
ATOM 5023   H HG22 . ILE C 2 80  ? 5.380   -7.428  -1.348  1.00 1.60  ? 80  ILE C HG22 1  
ATOM 5024   H HG23 . ILE C 2 80  ? 4.145   -6.339  -1.981  1.00 1.54  ? 80  ILE C HG23 1  
ATOM 5025   H HD11 . ILE C 2 80  ? 3.154   -7.211  2.102   1.00 1.50  ? 80  ILE C HD11 1  
ATOM 5026   H HD12 . ILE C 2 80  ? 4.421   -8.293  2.679   1.00 1.54  ? 80  ILE C HD12 1  
ATOM 5027   H HD13 . ILE C 2 80  ? 3.780   -8.478  1.046   1.00 1.57  ? 80  ILE C HD13 1  
ATOM 5028   N N    . GLY C 2 81  ? 4.469   -2.963  -0.954  1.00 1.42  ? 81  GLY C N    1  
ATOM 5029   C CA   . GLY C 2 81  ? 3.947   -2.012  -1.914  1.00 1.44  ? 81  GLY C CA   1  
ATOM 5030   C C    . GLY C 2 81  ? 5.052   -1.202  -2.563  1.00 1.45  ? 81  GLY C C    1  
ATOM 5031   O O    . GLY C 2 81  ? 4.959   -0.832  -3.735  1.00 1.51  ? 81  GLY C O    1  
ATOM 5032   H H    . GLY C 2 81  ? 4.288   -2.840  0.004   1.00 1.39  ? 81  GLY C H    1  
ATOM 5033   H HA2  . GLY C 2 81  ? 3.409   -2.547  -2.680  1.00 1.48  ? 81  GLY C HA2  1  
ATOM 5034   H HA3  . GLY C 2 81  ? 3.270   -1.338  -1.411  1.00 1.42  ? 81  GLY C HA3  1  
ATOM 5035   N N    . GLU C 2 82  ? 6.104   -0.931  -1.800  1.00 1.41  ? 82  GLU C N    1  
ATOM 5036   C CA   . GLU C 2 82  ? 7.231   -0.162  -2.302  1.00 1.43  ? 82  GLU C CA   1  
ATOM 5037   C C    . GLU C 2 82  ? 8.087   -1.000  -3.249  1.00 1.47  ? 82  GLU C C    1  
ATOM 5038   O O    . GLU C 2 82  ? 8.406   -0.560  -4.351  1.00 1.52  ? 82  GLU C O    1  
ATOM 5039   C CB   . GLU C 2 82  ? 8.086   0.370   -1.148  1.00 1.37  ? 82  GLU C CB   1  
ATOM 5040   C CG   . GLU C 2 82  ? 7.364   1.380   -0.264  1.00 1.34  ? 82  GLU C CG   1  
ATOM 5041   C CD   . GLU C 2 82  ? 6.543   2.377   -1.062  1.00 1.44  ? 82  GLU C CD   1  
ATOM 5042   O OE1  . GLU C 2 82  ? 7.108   3.056   -1.945  1.00 1.57  ? 82  GLU C OE1  1  
ATOM 5043   O OE2  . GLU C 2 82  ? 5.318   2.478   -0.828  1.00 1.51  ? 82  GLU C OE2  1  
ATOM 5044   H H    . GLU C 2 82  ? 6.116   -1.249  -0.870  1.00 1.37  ? 82  GLU C H    1  
ATOM 5045   H HA   . GLU C 2 82  ? 6.833   0.678   -2.851  1.00 1.46  ? 82  GLU C HA   1  
ATOM 5046   H HB2  . GLU C 2 82  ? 8.395   -0.460  -0.531  1.00 1.35  ? 82  GLU C HB2  1  
ATOM 5047   H HB3  . GLU C 2 82  ? 8.963   0.848   -1.558  1.00 1.42  ? 82  GLU C HB3  1  
ATOM 5048   H HG2  . GLU C 2 82  ? 6.706   0.849   0.407   1.00 1.30  ? 82  GLU C HG2  1  
ATOM 5049   H HG3  . GLU C 2 82  ? 8.101   1.921   0.311   1.00 1.34  ? 82  GLU C HG3  1  
ATOM 5050   N N    . LEU C 2 83  ? 8.429   -2.222  -2.842  1.00 1.48  ? 83  LEU C N    1  
ATOM 5051   C CA   . LEU C 2 83  ? 9.255   -3.088  -3.683  1.00 1.53  ? 83  LEU C CA   1  
ATOM 5052   C C    . LEU C 2 83  ? 8.516   -3.482  -4.962  1.00 1.59  ? 83  LEU C C    1  
ATOM 5053   O O    . LEU C 2 83  ? 9.137   -3.848  -5.957  1.00 1.66  ? 83  LEU C O    1  
ATOM 5054   C CB   . LEU C 2 83  ? 9.719   -4.339  -2.917  1.00 1.55  ? 83  LEU C CB   1  
ATOM 5055   C CG   . LEU C 2 83  ? 8.618   -5.180  -2.263  1.00 1.62  ? 83  LEU C CG   1  
ATOM 5056   C CD1  . LEU C 2 83  ? 8.073   -6.226  -3.229  1.00 1.85  ? 83  LEU C CD1  1  
ATOM 5057   C CD2  . LEU C 2 83  ? 9.151   -5.853  -1.006  1.00 1.84  ? 83  LEU C CD2  1  
ATOM 5058   H H    . LEU C 2 83  ? 8.125   -2.543  -1.964  1.00 1.45  ? 83  LEU C H    1  
ATOM 5059   H HA   . LEU C 2 83  ? 10.127  -2.517  -3.965  1.00 1.54  ? 83  LEU C HA   1  
ATOM 5060   H HB2  . LEU C 2 83  ? 10.259  -4.973  -3.605  1.00 1.77  ? 83  LEU C HB2  1  
ATOM 5061   H HB3  . LEU C 2 83  ? 10.402  -4.019  -2.143  1.00 1.66  ? 83  LEU C HB3  1  
ATOM 5062   H HG   . LEU C 2 83  ? 7.803   -4.531  -1.976  1.00 1.68  ? 83  LEU C HG   1  
ATOM 5063   H HD11 . LEU C 2 83  ? 7.327   -6.824  -2.726  1.00 2.25  ? 83  LEU C HD11 1  
ATOM 5064   H HD12 . LEU C 2 83  ? 8.878   -6.862  -3.562  1.00 2.02  ? 83  LEU C HD12 1  
ATOM 5065   H HD13 . LEU C 2 83  ? 7.627   -5.733  -4.080  1.00 1.97  ? 83  LEU C HD13 1  
ATOM 5066   H HD21 . LEU C 2 83  ? 9.438   -5.099  -0.287  1.00 2.04  ? 83  LEU C HD21 1  
ATOM 5067   H HD22 . LEU C 2 83  ? 10.011  -6.452  -1.258  1.00 1.95  ? 83  LEU C HD22 1  
ATOM 5068   H HD23 . LEU C 2 83  ? 8.385   -6.484  -0.582  1.00 2.20  ? 83  LEU C HD23 1  
ATOM 5069   N N    . ALA C 2 84  ? 7.192   -3.392  -4.932  1.00 1.58  ? 84  ALA C N    1  
ATOM 5070   C CA   . ALA C 2 84  ? 6.378   -3.728  -6.091  1.00 1.65  ? 84  ALA C CA   1  
ATOM 5071   C C    . ALA C 2 84  ? 6.561   -2.694  -7.198  1.00 1.69  ? 84  ALA C C    1  
ATOM 5072   O O    . ALA C 2 84  ? 6.514   -3.021  -8.383  1.00 1.78  ? 84  ALA C O    1  
ATOM 5073   C CB   . ALA C 2 84  ? 4.914   -3.831  -5.698  1.00 1.62  ? 84  ALA C CB   1  
ATOM 5074   H H    . ALA C 2 84  ? 6.750   -3.103  -4.105  1.00 1.53  ? 84  ALA C H    1  
ATOM 5075   H HA   . ALA C 2 84  ? 6.699   -4.692  -6.457  1.00 1.71  ? 84  ALA C HA   1  
ATOM 5076   H HB1  . ALA C 2 84  ? 4.593   -2.898  -5.260  1.00 1.56  ? 84  ALA C HB1  1  
ATOM 5077   H HB2  . ALA C 2 84  ? 4.792   -4.628  -4.978  1.00 1.65  ? 84  ALA C HB2  1  
ATOM 5078   H HB3  . ALA C 2 84  ? 4.319   -4.042  -6.572  1.00 1.71  ? 84  ALA C HB3  1  
ATOM 5079   N N    . LYS C 2 85  ? 6.791   -1.446  -6.808  1.00 1.65  ? 85  LYS C N    1  
ATOM 5080   C CA   . LYS C 2 85  ? 6.982   -0.375  -7.775  1.00 1.71  ? 85  LYS C CA   1  
ATOM 5081   C C    . LYS C 2 85  ? 8.462   -0.229  -8.124  1.00 1.76  ? 85  LYS C C    1  
ATOM 5082   O O    . LYS C 2 85  ? 8.821   0.508   -9.040  1.00 1.82  ? 85  LYS C O    1  
ATOM 5083   C CB   . LYS C 2 85  ? 6.417   0.951   -7.244  1.00 1.67  ? 85  LYS C CB   1  
ATOM 5084   C CG   . LYS C 2 85  ? 7.243   1.577   -6.129  1.00 1.61  ? 85  LYS C CG   1  
ATOM 5085   C CD   . LYS C 2 85  ? 6.535   2.762   -5.491  1.00 1.61  ? 85  LYS C CD   1  
ATOM 5086   C CE   . LYS C 2 85  ? 5.280   2.327   -4.751  1.00 1.64  ? 85  LYS C CE   1  
ATOM 5087   N NZ   . LYS C 2 85  ? 5.024   3.171   -3.556  1.00 1.69  ? 85  LYS C NZ   1  
ATOM 5088   H H    . LYS C 2 85  ? 6.840   -1.243  -5.849  1.00 1.59  ? 85  LYS C H    1  
ATOM 5089   H HA   . LYS C 2 85  ? 6.445   -0.646  -8.672  1.00 1.77  ? 85  LYS C HA   1  
ATOM 5090   H HB2  . LYS C 2 85  ? 6.363   1.656   -8.060  1.00 1.74  ? 85  LYS C HB2  1  
ATOM 5091   H HB3  . LYS C 2 85  ? 5.420   0.776   -6.867  1.00 1.66  ? 85  LYS C HB3  1  
ATOM 5092   H HG2  . LYS C 2 85  ? 7.421   0.832   -5.368  1.00 1.57  ? 85  LYS C HG2  1  
ATOM 5093   H HG3  . LYS C 2 85  ? 8.187   1.909   -6.537  1.00 1.64  ? 85  LYS C HG3  1  
ATOM 5094   H HD2  . LYS C 2 85  ? 7.207   3.238   -4.791  1.00 1.59  ? 85  LYS C HD2  1  
ATOM 5095   H HD3  . LYS C 2 85  ? 6.262   3.465   -6.264  1.00 1.69  ? 85  LYS C HD3  1  
ATOM 5096   H HE2  . LYS C 2 85  ? 4.438   2.403   -5.419  1.00 1.75  ? 85  LYS C HE2  1  
ATOM 5097   H HE3  . LYS C 2 85  ? 5.399   1.300   -4.438  1.00 1.63  ? 85  LYS C HE3  1  
ATOM 5098   H HZ1  . LYS C 2 85  ? 4.244   2.776   -2.994  1.00 1.94  ? 85  LYS C HZ1  1  
ATOM 5099   H HZ2  . LYS C 2 85  ? 4.777   4.135   -3.842  1.00 1.97  ? 85  LYS C HZ2  1  
ATOM 5100   H HZ3  . LYS C 2 85  ? 5.884   3.208   -2.952  1.00 1.91  ? 85  LYS C HZ3  1  
ATOM 5101   N N    . GLU C 2 86  ? 9.308   -0.966  -7.407  1.00 1.76  ? 86  GLU C N    1  
ATOM 5102   C CA   . GLU C 2 86  ? 10.754  -0.940  -7.629  1.00 1.83  ? 86  GLU C CA   1  
ATOM 5103   C C    . GLU C 2 86  ? 11.123  -1.642  -8.935  1.00 1.89  ? 86  GLU C C    1  
ATOM 5104   O O    . GLU C 2 86  ? 12.290  -1.671  -9.333  1.00 1.95  ? 86  GLU C O    1  
ATOM 5105   C CB   . GLU C 2 86  ? 11.481  -1.611  -6.459  1.00 1.86  ? 86  GLU C CB   1  
ATOM 5106   C CG   . GLU C 2 86  ? 11.930  -0.647  -5.372  1.00 1.98  ? 86  GLU C CG   1  
ATOM 5107   C CD   . GLU C 2 86  ? 13.431  -0.427  -5.385  1.00 1.84  ? 86  GLU C CD   1  
ATOM 5108   O OE1  . GLU C 2 86  ? 13.954  0.032   -6.423  1.00 2.14  ? 86  GLU C OE1  1  
ATOM 5109   O OE2  . GLU C 2 86  ? 14.097  -0.745  -4.377  1.00 2.01  ? 86  GLU C OE2  1  
ATOM 5110   H H    . GLU C 2 86  ? 8.949   -1.545  -6.700  1.00 1.73  ? 86  GLU C H    1  
ATOM 5111   H HA   . GLU C 2 86  ? 11.063  0.093   -7.688  1.00 1.84  ? 86  GLU C HA   1  
ATOM 5112   H HB2  . GLU C 2 86  ? 10.821  -2.340  -6.014  1.00 2.03  ? 86  GLU C HB2  1  
ATOM 5113   H HB3  . GLU C 2 86  ? 12.355  -2.119  -6.841  1.00 1.83  ? 86  GLU C HB3  1  
ATOM 5114   H HG2  . GLU C 2 86  ? 11.438  0.304   -5.522  1.00 2.27  ? 86  GLU C HG2  1  
ATOM 5115   H HG3  . GLU C 2 86  ? 11.647  -1.051  -4.411  1.00 2.24  ? 86  GLU C HG3  1  
ATOM 5116   N N    . ILE C 2 87  ? 10.130  -2.238  -9.582  1.00 1.92  ? 87  ILE C N    1  
ATOM 5117   C CA   . ILE C 2 87  ? 10.348  -2.920  -10.847 1.00 2.01  ? 87  ILE C CA   1  
ATOM 5118   C C    . ILE C 2 87  ? 10.031  -1.983  -12.013 1.00 2.03  ? 87  ILE C C    1  
ATOM 5119   O O    . ILE C 2 87  ? 10.389  -2.249  -13.160 1.00 2.12  ? 87  ILE C O    1  
ATOM 5120   C CB   . ILE C 2 87  ? 9.498   -4.211  -10.948 1.00 2.05  ? 87  ILE C CB   1  
ATOM 5121   C CG1  . ILE C 2 87  ? 10.025  -5.120  -12.068 1.00 2.14  ? 87  ILE C CG1  1  
ATOM 5122   C CG2  . ILE C 2 87  ? 8.024   -3.877  -11.170 1.00 2.05  ? 87  ILE C CG2  1  
ATOM 5123   C CD1  . ILE C 2 87  ? 9.461   -6.524  -12.031 1.00 2.21  ? 87  ILE C CD1  1  
ATOM 5124   H H    . ILE C 2 87  ? 9.232   -2.226  -9.189  1.00 1.90  ? 87  ILE C H    1  
ATOM 5125   H HA   . ILE C 2 87  ? 11.391  -3.195  -10.897 1.00 2.04  ? 87  ILE C HA   1  
ATOM 5126   H HB   . ILE C 2 87  ? 9.578   -4.734  -10.008 1.00 2.05  ? 87  ILE C HB   1  
ATOM 5127   H HG12 . ILE C 2 87  ? 9.771   -4.686  -13.023 1.00 2.17  ? 87  ILE C HG12 1  
ATOM 5128   H HG13 . ILE C 2 87  ? 11.101  -5.192  -11.988 1.00 2.17  ? 87  ILE C HG13 1  
ATOM 5129   H HG21 . ILE C 2 87  ? 7.921   -3.280  -12.064 1.00 2.13  ? 87  ILE C HG21 1  
ATOM 5130   H HG22 . ILE C 2 87  ? 7.647   -3.322  -10.322 1.00 1.99  ? 87  ILE C HG22 1  
ATOM 5131   H HG23 . ILE C 2 87  ? 7.460   -4.792  -11.280 1.00 2.07  ? 87  ILE C HG23 1  
ATOM 5132   H HD11 . ILE C 2 87  ? 9.800   -7.071  -12.898 1.00 2.42  ? 87  ILE C HD11 1  
ATOM 5133   H HD12 . ILE C 2 87  ? 8.382   -6.480  -12.032 1.00 2.26  ? 87  ILE C HD12 1  
ATOM 5134   H HD13 . ILE C 2 87  ? 9.799   -7.026  -11.137 1.00 2.28  ? 87  ILE C HD13 1  
ATOM 5135   N N    . ARG C 2 88  ? 9.375   -0.871  -11.704 1.00 1.98  ? 88  ARG C N    1  
ATOM 5136   C CA   . ARG C 2 88  ? 9.009   0.111   -12.717 1.00 2.03  ? 88  ARG C CA   1  
ATOM 5137   C C    . ARG C 2 88  ? 9.747   1.424   -12.461 1.00 2.02  ? 88  ARG C C    1  
ATOM 5138   O O    . ARG C 2 88  ? 10.253  2.057   -13.386 1.00 2.15  ? 88  ARG C O    1  
ATOM 5139   C CB   . ARG C 2 88  ? 7.490   0.336   -12.720 1.00 2.01  ? 88  ARG C CB   1  
ATOM 5140   C CG   . ARG C 2 88  ? 6.980   1.098   -13.935 1.00 2.10  ? 88  ARG C CG   1  
ATOM 5141   C CD   . ARG C 2 88  ? 6.379   0.166   -14.982 1.00 2.14  ? 88  ARG C CD   1  
ATOM 5142   N NE   . ARG C 2 88  ? 5.553   0.893   -15.946 1.00 2.21  ? 88  ARG C NE   1  
ATOM 5143   C CZ   . ARG C 2 88  ? 4.659   0.320   -16.762 1.00 2.25  ? 88  ARG C CZ   1  
ATOM 5144   N NH1  . ARG C 2 88  ? 4.514   -1.001  -16.791 1.00 2.26  ? 88  ARG C NH1  1  
ATOM 5145   N NH2  . ARG C 2 88  ? 3.918   1.070   -17.563 1.00 2.36  ? 88  ARG C NH2  1  
ATOM 5146   H H    . ARG C 2 88  ? 9.149   -0.697  -10.766 1.00 1.93  ? 88  ARG C H    1  
ATOM 5147   H HA   . ARG C 2 88  ? 9.311   -0.278  -13.678 1.00 2.13  ? 88  ARG C HA   1  
ATOM 5148   H HB2  . ARG C 2 88  ? 6.996   -0.624  -12.691 1.00 2.02  ? 88  ARG C HB2  1  
ATOM 5149   H HB3  . ARG C 2 88  ? 7.221   0.893   -11.835 1.00 1.99  ? 88  ARG C HB3  1  
ATOM 5150   H HG2  . ARG C 2 88  ? 6.222   1.797   -13.615 1.00 2.23  ? 88  ARG C HG2  1  
ATOM 5151   H HG3  . ARG C 2 88  ? 7.805   1.638   -14.378 1.00 2.28  ? 88  ARG C HG3  1  
ATOM 5152   H HD2  . ARG C 2 88  ? 7.179   -0.329  -15.510 1.00 2.31  ? 88  ARG C HD2  1  
ATOM 5153   H HD3  . ARG C 2 88  ? 5.767   -0.571  -14.483 1.00 2.21  ? 88  ARG C HD3  1  
ATOM 5154   H HE   . ARG C 2 88  ? 5.661   1.872   -15.975 1.00 2.29  ? 88  ARG C HE   1  
ATOM 5155   H HH11 . ARG C 2 88  ? 5.074   -1.589  -16.201 1.00 2.24  ? 88  ARG C HH11 1  
ATOM 5156   H HH12 . ARG C 2 88  ? 3.840   -1.418  -17.414 1.00 2.35  ? 88  ARG C HH12 1  
ATOM 5157   H HH21 . ARG C 2 88  ? 4.021   2.069   -17.566 1.00 2.43  ? 88  ARG C HH21 1  
ATOM 5158   H HH22 . ARG C 2 88  ? 3.235   0.638   -18.175 1.00 2.42  ? 88  ARG C HH22 1  
ATOM 5159   N N    . LYS C 2 89  ? 9.811   1.819   -11.195 1.00 1.96  ? 89  LYS C N    1  
ATOM 5160   C CA   . LYS C 2 89  ? 10.501  3.040   -10.795 1.00 1.96  ? 89  LYS C CA   1  
ATOM 5161   C C    . LYS C 2 89  ? 11.855  2.674   -10.201 1.00 2.00  ? 89  LYS C C    1  
ATOM 5162   O O    . LYS C 2 89  ? 12.137  1.496   -9.990  1.00 2.26  ? 89  LYS C O    1  
ATOM 5163   C CB   . LYS C 2 89  ? 9.667   3.814   -9.764  1.00 1.94  ? 89  LYS C CB   1  
ATOM 5164   C CG   . LYS C 2 89  ? 8.200   3.963   -10.141 1.00 2.06  ? 89  LYS C CG   1  
ATOM 5165   C CD   . LYS C 2 89  ? 7.964   5.151   -11.063 1.00 2.11  ? 89  LYS C CD   1  
ATOM 5166   C CE   . LYS C 2 89  ? 6.486   5.311   -11.392 1.00 2.24  ? 89  LYS C CE   1  
ATOM 5167   N NZ   . LYS C 2 89  ? 6.189   6.617   -12.044 1.00 2.30  ? 89  LYS C NZ   1  
ATOM 5168   H H    . LYS C 2 89  ? 9.394   1.264   -10.499 1.00 1.97  ? 89  LYS C H    1  
ATOM 5169   H HA   . LYS C 2 89  ? 10.649  3.650   -11.672 1.00 2.01  ? 89  LYS C HA   1  
ATOM 5170   H HB2  . LYS C 2 89  ? 9.722   3.300   -8.816  1.00 1.97  ? 89  LYS C HB2  1  
ATOM 5171   H HB3  . LYS C 2 89  ? 10.088  4.803   -9.649  1.00 2.04  ? 89  LYS C HB3  1  
ATOM 5172   H HG2  . LYS C 2 89  ? 7.879   3.063   -10.645 1.00 2.39  ? 89  LYS C HG2  1  
ATOM 5173   H HG3  . LYS C 2 89  ? 7.618   4.096   -9.239  1.00 2.45  ? 89  LYS C HG3  1  
ATOM 5174   H HD2  . LYS C 2 89  ? 8.314   6.048   -10.575 1.00 2.46  ? 89  LYS C HD2  1  
ATOM 5175   H HD3  . LYS C 2 89  ? 8.513   4.998   -11.980 1.00 2.37  ? 89  LYS C HD3  1  
ATOM 5176   H HE2  . LYS C 2 89  ? 6.191   4.513   -12.058 1.00 2.68  ? 89  LYS C HE2  1  
ATOM 5177   H HE3  . LYS C 2 89  ? 5.918   5.240   -10.477 1.00 2.55  ? 89  LYS C HE3  1  
ATOM 5178   H HZ1  . LYS C 2 89  ? 6.437   7.401   -11.408 1.00 2.59  ? 89  LYS C HZ1  1  
ATOM 5179   H HZ2  . LYS C 2 89  ? 5.177   6.678   -12.275 1.00 2.53  ? 89  LYS C HZ2  1  
ATOM 5180   H HZ3  . LYS C 2 89  ? 6.738   6.711   -12.920 1.00 2.56  ? 89  LYS C HZ3  1  
ATOM 5181   N N    . LYS C 2 90  ? 12.694  3.669   -9.946  1.00 1.91  ? 90  LYS C N    1  
ATOM 5182   C CA   . LYS C 2 90  ? 14.012  3.414   -9.368  1.00 1.95  ? 90  LYS C CA   1  
ATOM 5183   C C    . LYS C 2 90  ? 14.376  4.460   -8.313  1.00 1.95  ? 90  LYS C C    1  
ATOM 5184   O O    . LYS C 2 90  ? 14.774  4.118   -7.199  1.00 2.04  ? 90  LYS C O    1  
ATOM 5185   C CB   . LYS C 2 90  ? 15.093  3.350   -10.460 1.00 1.98  ? 90  LYS C CB   1  
ATOM 5186   C CG   . LYS C 2 90  ? 15.021  4.473   -11.484 1.00 2.08  ? 90  LYS C CG   1  
ATOM 5187   C CD   . LYS C 2 90  ? 14.311  4.034   -12.754 1.00 2.19  ? 90  LYS C CD   1  
ATOM 5188   C CE   . LYS C 2 90  ? 13.593  5.198   -13.410 1.00 2.28  ? 90  LYS C CE   1  
ATOM 5189   N NZ   . LYS C 2 90  ? 13.424  4.997   -14.872 1.00 2.60  ? 90  LYS C NZ   1  
ATOM 5190   H H    . LYS C 2 90  ? 12.425  4.595   -10.157 1.00 1.95  ? 90  LYS C H    1  
ATOM 5191   H HA   . LYS C 2 90  ? 13.963  2.451   -8.881  1.00 2.02  ? 90  LYS C HA   1  
ATOM 5192   H HB2  . LYS C 2 90  ? 16.064  3.390   -9.988  1.00 2.06  ? 90  LYS C HB2  1  
ATOM 5193   H HB3  . LYS C 2 90  ? 15.002  2.410   -10.985 1.00 2.02  ? 90  LYS C HB3  1  
ATOM 5194   H HG2  . LYS C 2 90  ? 14.483  5.305   -11.055 1.00 2.16  ? 90  LYS C HG2  1  
ATOM 5195   H HG3  . LYS C 2 90  ? 16.026  4.785   -11.735 1.00 2.24  ? 90  LYS C HG3  1  
ATOM 5196   H HD2  . LYS C 2 90  ? 15.039  3.636   -13.444 1.00 2.38  ? 90  LYS C HD2  1  
ATOM 5197   H HD3  . LYS C 2 90  ? 13.589  3.270   -12.505 1.00 2.21  ? 90  LYS C HD3  1  
ATOM 5198   H HE2  . LYS C 2 90  ? 12.620  5.302   -12.957 1.00 2.32  ? 90  LYS C HE2  1  
ATOM 5199   H HE3  . LYS C 2 90  ? 14.165  6.097   -13.241 1.00 2.50  ? 90  LYS C HE3  1  
ATOM 5200   H HZ1  . LYS C 2 90  ? 12.764  5.704   -15.255 1.00 2.87  ? 90  LYS C HZ1  1  
ATOM 5201   H HZ2  . LYS C 2 90  ? 13.047  4.049   -15.065 1.00 2.64  ? 90  LYS C HZ2  1  
ATOM 5202   H HZ3  . LYS C 2 90  ? 14.340  5.100   -15.356 1.00 3.04  ? 90  LYS C HZ3  1  
ATOM 5203   N N    . LYS C 2 91  ? 14.244  5.734   -8.660  1.00 1.90  ? 91  LYS C N    1  
ATOM 5204   C CA   . LYS C 2 91  ? 14.557  6.815   -7.731  1.00 1.91  ? 91  LYS C CA   1  
ATOM 5205   C C    . LYS C 2 91  ? 13.467  7.878   -7.804  1.00 1.87  ? 91  LYS C C    1  
ATOM 5206   O O    . LYS C 2 91  ? 13.572  8.959   -7.215  1.00 1.93  ? 91  LYS C O    1  
ATOM 5207   C CB   . LYS C 2 91  ? 15.932  7.418   -8.056  1.00 2.01  ? 91  LYS C CB   1  
ATOM 5208   C CG   . LYS C 2 91  ? 16.624  8.058   -6.856  1.00 2.25  ? 91  LYS C CG   1  
ATOM 5209   C CD   . LYS C 2 91  ? 17.077  7.014   -5.842  1.00 2.35  ? 91  LYS C CD   1  
ATOM 5210   C CE   . LYS C 2 91  ? 17.233  7.603   -4.444  1.00 2.41  ? 91  LYS C CE   1  
ATOM 5211   N NZ   . LYS C 2 91  ? 18.533  8.305   -4.267  1.00 2.45  ? 91  LYS C NZ   1  
ATOM 5212   H H    . LYS C 2 91  ? 13.929  5.954   -9.563  1.00 1.90  ? 91  LYS C H    1  
ATOM 5213   H HA   . LYS C 2 91  ? 14.575  6.402   -6.733  1.00 1.91  ? 91  LYS C HA   1  
ATOM 5214   H HB2  . LYS C 2 91  ? 16.574  6.638   -8.440  1.00 2.15  ? 91  LYS C HB2  1  
ATOM 5215   H HB3  . LYS C 2 91  ? 15.807  8.175   -8.816  1.00 2.04  ? 91  LYS C HB3  1  
ATOM 5216   H HG2  . LYS C 2 91  ? 17.487  8.607   -7.201  1.00 2.42  ? 91  LYS C HG2  1  
ATOM 5217   H HG3  . LYS C 2 91  ? 15.934  8.738   -6.375  1.00 2.60  ? 91  LYS C HG3  1  
ATOM 5218   H HD2  . LYS C 2 91  ? 16.349  6.219   -5.805  1.00 2.74  ? 91  LYS C HD2  1  
ATOM 5219   H HD3  . LYS C 2 91  ? 18.030  6.613   -6.158  1.00 2.56  ? 91  LYS C HD3  1  
ATOM 5220   H HE2  . LYS C 2 91  ? 16.433  8.307   -4.273  1.00 2.79  ? 91  LYS C HE2  1  
ATOM 5221   H HE3  . LYS C 2 91  ? 17.166  6.803   -3.720  1.00 2.74  ? 91  LYS C HE3  1  
ATOM 5222   H HZ1  . LYS C 2 91  ? 19.325  7.628   -4.383  1.00 2.66  ? 91  LYS C HZ1  1  
ATOM 5223   H HZ2  . LYS C 2 91  ? 18.591  8.717   -3.315  1.00 2.74  ? 91  LYS C HZ2  1  
ATOM 5224   H HZ3  . LYS C 2 91  ? 18.633  9.063   -4.969  1.00 2.65  ? 91  LYS C HZ3  1  
ATOM 5225   N N    . ASP C 2 92  ? 12.410  7.540   -8.524  1.00 1.84  ? 92  ASP C N    1  
ATOM 5226   C CA   . ASP C 2 92  ? 11.267  8.420   -8.724  1.00 1.85  ? 92  ASP C CA   1  
ATOM 5227   C C    . ASP C 2 92  ? 10.299  8.317   -7.551  1.00 1.81  ? 92  ASP C C    1  
ATOM 5228   O O    . ASP C 2 92  ? 9.111   8.050   -7.735  1.00 1.85  ? 92  ASP C O    1  
ATOM 5229   C CB   . ASP C 2 92  ? 10.531  8.047   -10.022 1.00 1.90  ? 92  ASP C CB   1  
ATOM 5230   C CG   . ASP C 2 92  ? 11.406  7.318   -11.030 1.00 2.22  ? 92  ASP C CG   1  
ATOM 5231   O OD1  . ASP C 2 92  ? 11.872  6.194   -10.729 1.00 2.32  ? 92  ASP C OD1  1  
ATOM 5232   O OD2  . ASP C 2 92  ? 11.636  7.868   -12.129 1.00 2.69  ? 92  ASP C OD2  1  
ATOM 5233   H H    . ASP C 2 92  ? 12.393  6.652   -8.950  1.00 1.84  ? 92  ASP C H    1  
ATOM 5234   H HA   . ASP C 2 92  ? 11.630  9.434   -8.797  1.00 1.90  ? 92  ASP C HA   1  
ATOM 5235   H HB2  . ASP C 2 92  ? 9.694   7.409   -9.781  1.00 1.77  ? 92  ASP C HB2  1  
ATOM 5236   H HB3  . ASP C 2 92  ? 10.161  8.950   -10.485 1.00 2.11  ? 92  ASP C HB3  1  
ATOM 5237   N N    . LEU C 2 93  ? 10.807  8.525   -6.346  1.00 1.79  ? 93  LEU C N    1  
ATOM 5238   C CA   . LEU C 2 93  ? 9.983   8.441   -5.150  1.00 1.78  ? 93  LEU C CA   1  
ATOM 5239   C C    . LEU C 2 93  ? 10.634  9.185   -3.981  1.00 1.84  ? 93  LEU C C    1  
ATOM 5240   O O    . LEU C 2 93  ? 11.433  10.105  -4.193  1.00 2.37  ? 93  LEU C O    1  
ATOM 5241   C CB   . LEU C 2 93  ? 9.731   6.970   -4.780  1.00 1.75  ? 93  LEU C CB   1  
ATOM 5242   C CG   . LEU C 2 93  ? 10.988  6.135   -4.514  1.00 1.76  ? 93  LEU C CG   1  
ATOM 5243   C CD1  . LEU C 2 93  ? 10.786  5.249   -3.295  1.00 1.88  ? 93  LEU C CD1  1  
ATOM 5244   C CD2  . LEU C 2 93  ? 11.343  5.291   -5.733  1.00 1.78  ? 93  LEU C CD2  1  
ATOM 5245   H H    . LEU C 2 93  ? 11.758  8.751   -6.257  1.00 1.84  ? 93  LEU C H    1  
ATOM 5246   H HA   . LEU C 2 93  ? 9.036   8.910   -5.372  1.00 1.79  ? 93  LEU C HA   1  
ATOM 5247   H HB2  . LEU C 2 93  ? 9.114   6.944   -3.895  1.00 1.77  ? 93  LEU C HB2  1  
ATOM 5248   H HB3  . LEU C 2 93  ? 9.187   6.506   -5.589  1.00 1.78  ? 93  LEU C HB3  1  
ATOM 5249   H HG   . LEU C 2 93  ? 11.818  6.797   -4.311  1.00 1.84  ? 93  LEU C HG   1  
ATOM 5250   H HD11 . LEU C 2 93  ? 11.696  4.709   -3.087  1.00 1.95  ? 93  LEU C HD11 1  
ATOM 5251   H HD12 . LEU C 2 93  ? 9.987   4.548   -3.485  1.00 1.96  ? 93  LEU C HD12 1  
ATOM 5252   H HD13 . LEU C 2 93  ? 10.529  5.864   -2.444  1.00 2.12  ? 93  LEU C HD13 1  
ATOM 5253   H HD21 . LEU C 2 93  ? 12.219  4.699   -5.519  1.00 1.83  ? 93  LEU C HD21 1  
ATOM 5254   H HD22 . LEU C 2 93  ? 11.543  5.940   -6.573  1.00 1.91  ? 93  LEU C HD22 1  
ATOM 5255   H HD23 . LEU C 2 93  ? 10.515  4.639   -5.972  1.00 1.85  ? 93  LEU C HD23 1  
ATOM 5256   N N    . LYS C 2 94  ? 10.281  8.768   -2.762  1.00 1.68  ? 94  LYS C N    1  
ATOM 5257   C CA   . LYS C 2 94  ? 10.784  9.356   -1.516  1.00 1.73  ? 94  LYS C CA   1  
ATOM 5258   C C    . LYS C 2 94  ? 10.069  10.670  -1.205  1.00 1.68  ? 94  LYS C C    1  
ATOM 5259   O O    . LYS C 2 94  ? 9.198   10.697  -0.335  1.00 1.77  ? 94  LYS C O    1  
ATOM 5260   C CB   . LYS C 2 94  ? 12.311  9.548   -1.529  1.00 1.83  ? 94  LYS C CB   1  
ATOM 5261   C CG   . LYS C 2 94  ? 13.058  8.521   -0.681  1.00 2.13  ? 94  LYS C CG   1  
ATOM 5262   C CD   . LYS C 2 94  ? 14.523  8.892   -0.484  1.00 2.63  ? 94  LYS C CD   1  
ATOM 5263   C CE   . LYS C 2 94  ? 15.247  7.857   0.371   1.00 3.05  ? 94  LYS C CE   1  
ATOM 5264   N NZ   . LYS C 2 94  ? 16.472  8.404   1.015   1.00 3.70  ? 94  LYS C NZ   1  
ATOM 5265   H H    . LYS C 2 94  ? 9.643   8.030   -2.694  1.00 1.84  ? 94  LYS C H    1  
ATOM 5266   H HA   . LYS C 2 94  ? 10.539  8.659   -0.727  1.00 1.86  ? 94  LYS C HA   1  
ATOM 5267   H HB2  . LYS C 2 94  ? 12.663  9.467   -2.549  1.00 1.86  ? 94  LYS C HB2  1  
ATOM 5268   H HB3  . LYS C 2 94  ? 12.544  10.534  -1.153  1.00 2.00  ? 94  LYS C HB3  1  
ATOM 5269   H HG2  . LYS C 2 94  ? 12.584  8.459   0.287   1.00 2.26  ? 94  LYS C HG2  1  
ATOM 5270   H HG3  . LYS C 2 94  ? 13.004  7.560   -1.172  1.00 2.42  ? 94  LYS C HG3  1  
ATOM 5271   H HD2  . LYS C 2 94  ? 15.003  8.945   -1.450  1.00 2.86  ? 94  LYS C HD2  1  
ATOM 5272   H HD3  . LYS C 2 94  ? 14.581  9.855   0.005   1.00 2.98  ? 94  LYS C HD3  1  
ATOM 5273   H HE2  . LYS C 2 94  ? 14.574  7.515   1.144   1.00 3.19  ? 94  LYS C HE2  1  
ATOM 5274   H HE3  . LYS C 2 94  ? 15.523  7.022   -0.257  1.00 3.25  ? 94  LYS C HE3  1  
ATOM 5275   H HZ1  . LYS C 2 94  ? 17.300  8.312   0.380   1.00 4.15  ? 94  LYS C HZ1  1  
ATOM 5276   H HZ2  . LYS C 2 94  ? 16.668  7.892   1.904   1.00 4.02  ? 94  LYS C HZ2  1  
ATOM 5277   H HZ3  . LYS C 2 94  ? 16.335  9.408   1.240   1.00 3.83  ? 94  LYS C HZ3  1  
ATOM 5278   N N    . ILE C 2 95  ? 10.413  11.732  -1.948  1.00 1.67  ? 95  ILE C N    1  
ATOM 5279   C CA   . ILE C 2 95  ? 9.833   13.078  -1.767  1.00 1.75  ? 95  ILE C CA   1  
ATOM 5280   C C    . ILE C 2 95  ? 9.656   13.435  -0.281  1.00 1.72  ? 95  ILE C C    1  
ATOM 5281   O O    . ILE C 2 95  ? 10.471  13.035  0.554   1.00 1.79  ? 95  ILE C O    1  
ATOM 5282   C CB   . ILE C 2 95  ? 8.494   13.266  -2.541  1.00 1.92  ? 95  ILE C CB   1  
ATOM 5283   C CG1  . ILE C 2 95  ? 7.418   12.275  -2.087  1.00 2.01  ? 95  ILE C CG1  1  
ATOM 5284   C CG2  . ILE C 2 95  ? 8.733   13.127  -4.037  1.00 2.06  ? 95  ILE C CG2  1  
ATOM 5285   C CD1  . ILE C 2 95  ? 6.037   12.579  -2.633  1.00 2.34  ? 95  ILE C CD1  1  
ATOM 5286   H H    . ILE C 2 95  ? 11.084  11.607  -2.653  1.00 1.70  ? 95  ILE C H    1  
ATOM 5287   H HA   . ILE C 2 95  ? 10.544  13.778  -2.185  1.00 1.88  ? 95  ILE C HA   1  
ATOM 5288   H HB   . ILE C 2 95  ? 8.141   14.272  -2.358  1.00 2.07  ? 95  ILE C HB   1  
ATOM 5289   H HG12 . ILE C 2 95  ? 7.692   11.284  -2.414  1.00 2.03  ? 95  ILE C HG12 1  
ATOM 5290   H HG13 . ILE C 2 95  ? 7.360   12.289  -1.008  1.00 2.01  ? 95  ILE C HG13 1  
ATOM 5291   H HG21 . ILE C 2 95  ? 7.795   13.233  -4.561  1.00 2.26  ? 95  ILE C HG21 1  
ATOM 5292   H HG22 . ILE C 2 95  ? 9.153   12.154  -4.247  1.00 2.09  ? 95  ILE C HG22 1  
ATOM 5293   H HG23 . ILE C 2 95  ? 9.418   13.894  -4.367  1.00 2.21  ? 95  ILE C HG23 1  
ATOM 5294   H HD11 . ILE C 2 95  ? 6.077   12.622  -3.712  1.00 2.53  ? 95  ILE C HD11 1  
ATOM 5295   H HD12 . ILE C 2 95  ? 5.701   13.530  -2.249  1.00 2.45  ? 95  ILE C HD12 1  
ATOM 5296   H HD13 . ILE C 2 95  ? 5.350   11.804  -2.328  1.00 2.58  ? 95  ILE C HD13 1  
ATOM 5297   N N    . ARG C 2 96  ? 8.617   14.201  0.049   1.00 1.69  ? 96  ARG C N    1  
ATOM 5298   C CA   . ARG C 2 96  ? 8.370   14.584  1.434   1.00 1.69  ? 96  ARG C CA   1  
ATOM 5299   C C    . ARG C 2 96  ? 6.974   15.182  1.599   1.00 1.64  ? 96  ARG C C    1  
ATOM 5300   O O    . ARG C 2 96  ? 6.730   16.323  1.212   1.00 1.76  ? 96  ARG C O    1  
ATOM 5301   C CB   . ARG C 2 96  ? 9.432   15.588  1.907   1.00 1.85  ? 96  ARG C CB   1  
ATOM 5302   C CG   . ARG C 2 96  ? 9.466   15.786  3.417   1.00 1.99  ? 96  ARG C CG   1  
ATOM 5303   C CD   . ARG C 2 96  ? 8.672   17.014  3.839   1.00 2.18  ? 96  ARG C CD   1  
ATOM 5304   N NE   . ARG C 2 96  ? 9.298   18.255  3.381   1.00 2.30  ? 96  ARG C NE   1  
ATOM 5305   C CZ   . ARG C 2 96  ? 8.698   19.162  2.607   1.00 2.39  ? 96  ARG C CZ   1  
ATOM 5306   N NH1  . ARG C 2 96  ? 7.467   18.950  2.148   1.00 2.40  ? 96  ARG C NH1  1  
ATOM 5307   N NH2  . ARG C 2 96  ? 9.341   20.273  2.268   1.00 2.58  ? 96  ARG C NH2  1  
ATOM 5308   H H    . ARG C 2 96  ? 8.006   14.513  -0.650  1.00 1.72  ? 96  ARG C H    1  
ATOM 5309   H HA   . ARG C 2 96  ? 8.438   13.693  2.039   1.00 1.65  ? 96  ARG C HA   1  
ATOM 5310   H HB2  . ARG C 2 96  ? 10.404  15.239  1.590   1.00 1.93  ? 96  ARG C HB2  1  
ATOM 5311   H HB3  . ARG C 2 96  ? 9.237   16.545  1.444   1.00 1.88  ? 96  ARG C HB3  1  
ATOM 5312   H HG2  . ARG C 2 96  ? 9.042   14.916  3.896   1.00 1.99  ? 96  ARG C HG2  1  
ATOM 5313   H HG3  . ARG C 2 96  ? 10.494  15.908  3.731   1.00 2.11  ? 96  ARG C HG3  1  
ATOM 5314   H HD2  . ARG C 2 96  ? 7.680   16.946  3.419   1.00 2.16  ? 96  ARG C HD2  1  
ATOM 5315   H HD3  . ARG C 2 96  ? 8.604   17.033  4.917   1.00 2.39  ? 96  ARG C HD3  1  
ATOM 5316   H HE   . ARG C 2 96  ? 10.222  18.425  3.676   1.00 2.40  ? 96  ARG C HE   1  
ATOM 5317   H HH11 . ARG C 2 96  ? 6.977   18.107  2.379   1.00 2.33  ? 96  ARG C HH11 1  
ATOM 5318   H HH12 . ARG C 2 96  ? 7.026   19.633  1.557   1.00 2.56  ? 96  ARG C HH12 1  
ATOM 5319   H HH21 . ARG C 2 96  ? 10.279  20.431  2.590   1.00 2.67  ? 96  ARG C HH21 1  
ATOM 5320   H HH22 . ARG C 2 96  ? 8.893   20.960  1.690   1.00 2.71  ? 96  ARG C HH22 1  
ATOM 5321   N N    . LYS C 2 97  ? 6.064   14.410  2.173   1.00 1.59  ? 97  LYS C N    1  
ATOM 5322   C CA   . LYS C 2 97  ? 4.703   14.876  2.396   1.00 1.57  ? 97  LYS C CA   1  
ATOM 5323   C C    . LYS C 2 97  ? 4.436   14.997  3.890   1.00 1.53  ? 97  LYS C C    1  
ATOM 5324   O O    . LYS C 2 97  ? 4.539   14.018  4.635   1.00 1.55  ? 97  LYS C O    1  
ATOM 5325   C CB   . LYS C 2 97  ? 3.691   13.923  1.744   1.00 1.57  ? 97  LYS C CB   1  
ATOM 5326   C CG   . LYS C 2 97  ? 2.275   14.483  1.663   1.00 1.61  ? 97  LYS C CG   1  
ATOM 5327   C CD   . LYS C 2 97  ? 1.458   14.135  2.898   1.00 1.72  ? 97  LYS C CD   1  
ATOM 5328   C CE   . LYS C 2 97  ? 0.162   14.922  2.943   1.00 1.78  ? 97  LYS C CE   1  
ATOM 5329   N NZ   . LYS C 2 97  ? -0.478  14.871  4.286   1.00 1.87  ? 97  LYS C NZ   1  
ATOM 5330   H H    . LYS C 2 97  ? 6.314   13.505  2.461   1.00 1.64  ? 97  LYS C H    1  
ATOM 5331   H HA   . LYS C 2 97  ? 4.609   15.853  1.945   1.00 1.66  ? 97  LYS C HA   1  
ATOM 5332   H HB2  . LYS C 2 97  ? 4.021   13.697  0.742   1.00 1.61  ? 97  LYS C HB2  1  
ATOM 5333   H HB3  . LYS C 2 97  ? 3.657   13.006  2.317   1.00 1.61  ? 97  LYS C HB3  1  
ATOM 5334   H HG2  . LYS C 2 97  ? 2.329   15.558  1.575   1.00 1.71  ? 97  LYS C HG2  1  
ATOM 5335   H HG3  . LYS C 2 97  ? 1.787   14.073  0.790   1.00 1.76  ? 97  LYS C HG3  1  
ATOM 5336   H HD2  . LYS C 2 97  ? 1.228   13.081  2.881   1.00 1.90  ? 97  LYS C HD2  1  
ATOM 5337   H HD3  . LYS C 2 97  ? 2.041   14.365  3.780   1.00 1.86  ? 97  LYS C HD3  1  
ATOM 5338   H HE2  . LYS C 2 97  ? 0.373   15.953  2.696   1.00 1.84  ? 97  LYS C HE2  1  
ATOM 5339   H HE3  . LYS C 2 97  ? -0.519  14.510  2.212   1.00 1.90  ? 97  LYS C HE3  1  
ATOM 5340   H HZ1  . LYS C 2 97  ? -1.238  15.579  4.347   1.00 1.98  ? 97  LYS C HZ1  1  
ATOM 5341   H HZ2  . LYS C 2 97  ? 0.229   15.075  5.028   1.00 2.02  ? 97  LYS C HZ2  1  
ATOM 5342   H HZ3  . LYS C 2 97  ? -0.883  13.930  4.455   1.00 2.12  ? 97  LYS C HZ3  1  
ATOM 5343   N N    . LYS C 2 98  ? 4.098   16.197  4.332   1.00 1.55  ? 98  LYS C N    1  
ATOM 5344   C CA   . LYS C 2 98  ? 3.826   16.434  5.739   1.00 1.56  ? 98  LYS C CA   1  
ATOM 5345   C C    . LYS C 2 98  ? 2.330   16.620  5.971   1.00 1.54  ? 98  LYS C C    1  
ATOM 5346   O O    . LYS C 2 98  ? 1.890   17.777  6.135   1.00 1.62  ? 98  LYS C O    1  
ATOM 5347   C CB   . LYS C 2 98  ? 4.592   17.663  6.235   1.00 1.69  ? 98  LYS C CB   1  
ATOM 5348   C CG   . LYS C 2 98  ? 5.339   17.429  7.539   1.00 1.79  ? 98  LYS C CG   1  
ATOM 5349   C CD   . LYS C 2 98  ? 4.961   18.452  8.600   1.00 1.97  ? 98  LYS C CD   1  
ATOM 5350   C CE   . LYS C 2 98  ? 3.655   18.093  9.296   1.00 1.91  ? 98  LYS C CE   1  
ATOM 5351   N NZ   . LYS C 2 98  ? 2.467   18.682  8.620   1.00 1.92  ? 98  LYS C NZ   1  
ATOM 5352   O OXT  . LYS C 2 98  ? 1.598   15.610  5.992   1.00 1.68  ? 98  LYS C OXT  1  
ATOM 5353   H H    . LYS C 2 98  ? 4.023   16.942  3.696   1.00 1.61  ? 98  LYS C H    1  
ATOM 5354   H HA   . LYS C 2 98  ? 4.158   15.566  6.290   1.00 1.63  ? 98  LYS C HA   1  
ATOM 5355   H HB2  . LYS C 2 98  ? 5.308   17.956  5.480   1.00 1.83  ? 98  LYS C HB2  1  
ATOM 5356   H HB3  . LYS C 2 98  ? 3.891   18.471  6.387   1.00 1.73  ? 98  LYS C HB3  1  
ATOM 5357   H HG2  . LYS C 2 98  ? 5.101   16.441  7.908   1.00 1.70  ? 98  LYS C HG2  1  
ATOM 5358   H HG3  . LYS C 2 98  ? 6.401   17.497  7.350   1.00 1.96  ? 98  LYS C HG3  1  
ATOM 5359   H HD2  . LYS C 2 98  ? 5.748   18.495  9.339   1.00 2.20  ? 98  LYS C HD2  1  
ATOM 5360   H HD3  . LYS C 2 98  ? 4.855   19.416  8.130   1.00 2.09  ? 98  LYS C HD3  1  
ATOM 5361   H HE2  . LYS C 2 98  ? 3.552   17.019  9.303   1.00 1.89  ? 98  LYS C HE2  1  
ATOM 5362   H HE3  . LYS C 2 98  ? 3.694   18.454  10.313  1.00 2.13  ? 98  LYS C HE3  1  
ATOM 5363   H HZ1  . LYS C 2 98  ? 2.517   19.721  8.643   1.00 2.14  ? 98  LYS C HZ1  1  
ATOM 5364   H HZ2  . LYS C 2 98  ? 1.597   18.380  9.103   1.00 2.09  ? 98  LYS C HZ2  1  
ATOM 5365   H HZ3  . LYS C 2 98  ? 2.419   18.368  7.625   1.00 1.85  ? 98  LYS C HZ3  1  
ATOM 5366   N N    . GLU D 1 1   ? 33.630  -10.970 4.453   1.00 11.29 ? 1   GLU D N    1  
ATOM 5367   C CA   . GLU D 1 1   ? 33.159  -9.627  4.048   1.00 10.41 ? 1   GLU D CA   1  
ATOM 5368   C C    . GLU D 1 1   ? 33.611  -9.320  2.629   1.00 9.97  ? 1   GLU D C    1  
ATOM 5369   O O    . GLU D 1 1   ? 34.701  -9.721  2.218   1.00 9.99  ? 1   GLU D O    1  
ATOM 5370   C CB   . GLU D 1 1   ? 33.692  -8.555  5.004   1.00 10.15 ? 1   GLU D CB   1  
ATOM 5371   C CG   . GLU D 1 1   ? 33.047  -8.576  6.382   1.00 10.52 ? 1   GLU D CG   1  
ATOM 5372   C CD   . GLU D 1 1   ? 33.466  -9.775  7.202   1.00 11.24 ? 1   GLU D CD   1  
ATOM 5373   O OE1  . GLU D 1 1   ? 32.872  -10.856 7.024   1.00 11.78 ? 1   GLU D OE1  1  
ATOM 5374   O OE2  . GLU D 1 1   ? 34.403  -9.647  8.012   1.00 11.35 ? 1   GLU D OE2  1  
ATOM 5375   H H1   . GLU D 1 1   ? 34.660  -11.040 4.330   1.00 11.47 ? 1   GLU D H1   1  
ATOM 5376   H H2   . GLU D 1 1   ? 33.173  -11.698 3.869   1.00 11.53 ? 1   GLU D H2   1  
ATOM 5377   H H3   . GLU D 1 1   ? 33.395  -11.147 5.455   1.00 11.59 ? 1   GLU D H3   1  
ATOM 5378   H HA   . GLU D 1 1   ? 32.079  -9.623  4.078   1.00 10.33 ? 1   GLU D HA   1  
ATOM 5379   H HB2  . GLU D 1 1   ? 34.754  -8.698  5.128   1.00 10.31 ? 1   GLU D HB2  1  
ATOM 5380   H HB3  . GLU D 1 1   ? 33.518  -7.584  4.565   1.00 9.59  ? 1   GLU D HB3  1  
ATOM 5381   H HG2  . GLU D 1 1   ? 33.335  -7.680  6.911   1.00 10.29 ? 1   GLU D HG2  1  
ATOM 5382   H HG3  . GLU D 1 1   ? 31.973  -8.594  6.264   1.00 10.59 ? 1   GLU D HG3  1  
ATOM 5383   N N    . LYS D 1 2   ? 32.776  -8.613  1.876   1.00 9.64  ? 2   LYS D N    1  
ATOM 5384   C CA   . LYS D 1 2   ? 33.107  -8.260  0.503   1.00 9.31  ? 2   LYS D CA   1  
ATOM 5385   C C    . LYS D 1 2   ? 32.642  -6.845  0.177   1.00 8.43  ? 2   LYS D C    1  
ATOM 5386   O O    . LYS D 1 2   ? 31.494  -6.479  0.438   1.00 8.22  ? 2   LYS D O    1  
ATOM 5387   C CB   . LYS D 1 2   ? 32.484  -9.258  -0.479  1.00 9.96  ? 2   LYS D CB   1  
ATOM 5388   C CG   . LYS D 1 2   ? 31.021  -9.566  -0.195  1.00 10.34 ? 2   LYS D CG   1  
ATOM 5389   C CD   . LYS D 1 2   ? 30.193  -9.587  -1.472  1.00 9.91  ? 2   LYS D CD   1  
ATOM 5390   C CE   . LYS D 1 2   ? 30.642  -10.689 -2.417  1.00 10.18 ? 2   LYS D CE   1  
ATOM 5391   N NZ   . LYS D 1 2   ? 30.420  -12.041 -1.841  1.00 10.92 ? 2   LYS D NZ   1  
ATOM 5392   H H    . LYS D 1 2   ? 31.915  -8.317  2.253   1.00 9.67  ? 2   LYS D H    1  
ATOM 5393   H HA   . LYS D 1 2   ? 34.183  -8.299  0.405   1.00 9.29  ? 2   LYS D HA   1  
ATOM 5394   H HB2  . LYS D 1 2   ? 32.556  -8.855  -1.478  1.00 9.71  ? 2   LYS D HB2  1  
ATOM 5395   H HB3  . LYS D 1 2   ? 33.040  -10.183 -0.433  1.00 10.46 ? 2   LYS D HB3  1  
ATOM 5396   H HG2  . LYS D 1 2   ? 30.952  -10.531 0.283   1.00 10.97 ? 2   LYS D HG2  1  
ATOM 5397   H HG3  . LYS D 1 2   ? 30.629  -8.807  0.466   1.00 10.36 ? 2   LYS D HG3  1  
ATOM 5398   H HD2  . LYS D 1 2   ? 29.158  -9.749  -1.217  1.00 10.13 ? 2   LYS D HD2  1  
ATOM 5399   H HD3  . LYS D 1 2   ? 30.298  -8.633  -1.973  1.00 9.29  ? 2   LYS D HD3  1  
ATOM 5400   H HE2  . LYS D 1 2   ? 30.085  -10.605 -3.337  1.00 9.90  ? 2   LYS D HE2  1  
ATOM 5401   H HE3  . LYS D 1 2   ? 31.692  -10.562 -2.621  1.00 10.20 ? 2   LYS D HE3  1  
ATOM 5402   H HZ1  . LYS D 1 2   ? 30.167  -11.968 -0.835  1.00 11.13 ? 2   LYS D HZ1  1  
ATOM 5403   H HZ2  . LYS D 1 2   ? 31.284  -12.612 -1.927  1.00 11.10 ? 2   LYS D HZ2  1  
ATOM 5404   H HZ3  . LYS D 1 2   ? 29.648  -12.526 -2.347  1.00 11.18 ? 2   LYS D HZ3  1  
ATOM 5405   N N    . LEU D 1 3   ? 33.551  -6.051  -0.360  1.00 7.94  ? 3   LEU D N    1  
ATOM 5406   C CA   . LEU D 1 3   ? 33.250  -4.681  -0.746  1.00 7.11  ? 3   LEU D CA   1  
ATOM 5407   C C    . LEU D 1 3   ? 33.744  -4.425  -2.167  1.00 7.01  ? 3   LEU D C    1  
ATOM 5408   O O    . LEU D 1 3   ? 33.500  -3.365  -2.743  1.00 6.42  ? 3   LEU D O    1  
ATOM 5409   C CB   . LEU D 1 3   ? 33.898  -3.707  0.240   1.00 6.48  ? 3   LEU D CB   1  
ATOM 5410   C CG   . LEU D 1 3   ? 33.687  -2.222  -0.054  1.00 5.60  ? 3   LEU D CG   1  
ATOM 5411   C CD1  . LEU D 1 3   ? 32.331  -1.767  0.455   1.00 5.48  ? 3   LEU D CD1  1  
ATOM 5412   C CD2  . LEU D 1 3   ? 34.797  -1.393  0.564   1.00 5.07  ? 3   LEU D CD2  1  
ATOM 5413   H H    . LEU D 1 3   ? 34.467  -6.390  -0.487  1.00 8.17  ? 3   LEU D H    1  
ATOM 5414   H HA   . LEU D 1 3   ? 32.178  -4.552  -0.720  1.00 7.08  ? 3   LEU D HA   1  
ATOM 5415   H HB2  . LEU D 1 3   ? 33.503  -3.914  1.224   1.00 6.74  ? 3   LEU D HB2  1  
ATOM 5416   H HB3  . LEU D 1 3   ? 34.959  -3.900  0.254   1.00 6.51  ? 3   LEU D HB3  1  
ATOM 5417   H HG   . LEU D 1 3   ? 33.709  -2.068  -1.124  1.00 5.52  ? 3   LEU D HG   1  
ATOM 5418   H HD11 . LEU D 1 3   ? 32.219  -0.707  0.283   1.00 5.09  ? 3   LEU D HD11 1  
ATOM 5419   H HD12 . LEU D 1 3   ? 32.257  -1.970  1.513   1.00 5.68  ? 3   LEU D HD12 1  
ATOM 5420   H HD13 . LEU D 1 3   ? 31.553  -2.300  -0.070  1.00 5.79  ? 3   LEU D HD13 1  
ATOM 5421   H HD21 . LEU D 1 3   ? 35.187  -1.904  1.433   1.00 4.88  ? 3   LEU D HD21 1  
ATOM 5422   H HD22 . LEU D 1 3   ? 34.403  -0.433  0.860   1.00 5.39  ? 3   LEU D HD22 1  
ATOM 5423   H HD23 . LEU D 1 3   ? 35.586  -1.252  -0.157  1.00 4.72  ? 3   LEU D HD23 1  
ATOM 5424   N N    . GLY D 1 4   ? 34.447  -5.405  -2.721  1.00 7.69  ? 4   GLY D N    1  
ATOM 5425   C CA   . GLY D 1 4   ? 34.959  -5.281  -4.068  1.00 7.82  ? 4   GLY D CA   1  
ATOM 5426   C C    . GLY D 1 4   ? 36.471  -5.275  -4.131  1.00 7.79  ? 4   GLY D C    1  
ATOM 5427   O O    . GLY D 1 4   ? 37.137  -6.007  -3.395  1.00 7.99  ? 4   GLY D O    1  
ATOM 5428   H H    . GLY D 1 4   ? 34.617  -6.224  -2.212  1.00 8.16  ? 4   GLY D H    1  
ATOM 5429   H HA2  . GLY D 1 4   ? 34.593  -6.109  -4.656  1.00 8.43  ? 4   GLY D HA2  1  
ATOM 5430   H HA3  . GLY D 1 4   ? 34.591  -4.361  -4.497  1.00 7.37  ? 4   GLY D HA3  1  
ATOM 5431   N N    . LYS D 1 5   ? 37.014  -4.451  -5.018  1.00 7.60  ? 5   LYS D N    1  
ATOM 5432   C CA   . LYS D 1 5   ? 38.456  -4.336  -5.191  1.00 7.59  ? 5   LYS D CA   1  
ATOM 5433   C C    . LYS D 1 5   ? 38.839  -2.894  -5.473  1.00 6.93  ? 5   LYS D C    1  
ATOM 5434   O O    . LYS D 1 5   ? 38.093  -2.166  -6.129  1.00 6.76  ? 5   LYS D O    1  
ATOM 5435   C CB   . LYS D 1 5   ? 38.947  -5.214  -6.342  1.00 8.44  ? 5   LYS D CB   1  
ATOM 5436   C CG   . LYS D 1 5   ? 38.949  -6.697  -6.031  1.00 9.14  ? 5   LYS D CG   1  
ATOM 5437   C CD   . LYS D 1 5   ? 39.678  -7.483  -7.103  1.00 9.81  ? 5   LYS D CD   1  
ATOM 5438   C CE   . LYS D 1 5   ? 41.184  -7.458  -6.898  1.00 9.61  ? 5   LYS D CE   1  
ATOM 5439   N NZ   . LYS D 1 5   ? 41.898  -8.115  -8.022  1.00 10.29 ? 5   LYS D NZ   1  
ATOM 5440   H H    . LYS D 1 5   ? 36.421  -3.890  -5.571  1.00 7.51  ? 5   LYS D H    1  
ATOM 5441   H HA   . LYS D 1 5   ? 38.932  -4.654  -4.275  1.00 7.50  ? 5   LYS D HA   1  
ATOM 5442   H HB2  . LYS D 1 5   ? 38.311  -5.049  -7.197  1.00 8.67  ? 5   LYS D HB2  1  
ATOM 5443   H HB3  . LYS D 1 5   ? 39.955  -4.921  -6.595  1.00 8.39  ? 5   LYS D HB3  1  
ATOM 5444   H HG2  . LYS D 1 5   ? 39.438  -6.857  -5.083  1.00 8.93  ? 5   LYS D HG2  1  
ATOM 5445   H HG3  . LYS D 1 5   ? 37.927  -7.043  -5.974  1.00 9.43  ? 5   LYS D HG3  1  
ATOM 5446   H HD2  . LYS D 1 5   ? 39.340  -8.507  -7.076  1.00 10.32 ? 5   LYS D HD2  1  
ATOM 5447   H HD3  . LYS D 1 5   ? 39.448  -7.054  -8.066  1.00 10.01 ? 5   LYS D HD3  1  
ATOM 5448   H HE2  . LYS D 1 5   ? 41.509  -6.430  -6.826  1.00 9.26  ? 5   LYS D HE2  1  
ATOM 5449   H HE3  . LYS D 1 5   ? 41.421  -7.975  -5.980  1.00 9.38  ? 5   LYS D HE3  1  
ATOM 5450   H HZ1  . LYS D 1 5   ? 41.489  -9.054  -8.206  1.00 10.69 ? 5   LYS D HZ1  1  
ATOM 5451   H HZ2  . LYS D 1 5   ? 42.906  -8.232  -7.792  1.00 10.11 ? 5   LYS D HZ2  1  
ATOM 5452   H HZ3  . LYS D 1 5   ? 41.816  -7.542  -8.886  1.00 10.64 ? 5   LYS D HZ3  1  
ATOM 5453   N N    . LEU D 1 6   ? 40.000  -2.487  -4.986  1.00 6.61  ? 6   LEU D N    1  
ATOM 5454   C CA   . LEU D 1 6   ? 40.475  -1.133  -5.193  1.00 6.04  ? 6   LEU D CA   1  
ATOM 5455   C C    . LEU D 1 6   ? 41.864  -1.149  -5.809  1.00 6.40  ? 6   LEU D C    1  
ATOM 5456   O O    . LEU D 1 6   ? 42.779  -1.786  -5.289  1.00 6.57  ? 6   LEU D O    1  
ATOM 5457   C CB   . LEU D 1 6   ? 40.499  -0.366  -3.869  1.00 5.16  ? 6   LEU D CB   1  
ATOM 5458   C CG   . LEU D 1 6   ? 40.756  1.138   -3.990  1.00 4.53  ? 6   LEU D CG   1  
ATOM 5459   C CD1  . LEU D 1 6   ? 39.716  1.922   -3.205  1.00 3.82  ? 6   LEU D CD1  1  
ATOM 5460   C CD2  . LEU D 1 6   ? 42.157  1.483   -3.509  1.00 4.32  ? 6   LEU D CD2  1  
ATOM 5461   H H    . LEU D 1 6   ? 40.558  -3.117  -4.474  1.00 6.81  ? 6   LEU D H    1  
ATOM 5462   H HA   . LEU D 1 6   ? 39.796  -0.642  -5.874  1.00 6.06  ? 6   LEU D HA   1  
ATOM 5463   H HB2  . LEU D 1 6   ? 39.550  -0.512  -3.379  1.00 5.01  ? 6   LEU D HB2  1  
ATOM 5464   H HB3  . LEU D 1 6   ? 41.274  -0.791  -3.250  1.00 5.21  ? 6   LEU D HB3  1  
ATOM 5465   H HG   . LEU D 1 6   ? 40.677  1.427   -5.028  1.00 4.89  ? 6   LEU D HG   1  
ATOM 5466   H HD11 . LEU D 1 6   ? 39.882  2.981   -3.345  1.00 3.48  ? 6   LEU D HD11 1  
ATOM 5467   H HD12 . LEU D 1 6   ? 39.799  1.681   -2.156  1.00 3.60  ? 6   LEU D HD12 1  
ATOM 5468   H HD13 . LEU D 1 6   ? 38.729  1.663   -3.557  1.00 4.07  ? 6   LEU D HD13 1  
ATOM 5469   H HD21 . LEU D 1 6   ? 42.319  2.546   -3.606  1.00 4.02  ? 6   LEU D HD21 1  
ATOM 5470   H HD22 . LEU D 1 6   ? 42.884  0.952   -4.104  1.00 4.83  ? 6   LEU D HD22 1  
ATOM 5471   H HD23 . LEU D 1 6   ? 42.264  1.197   -2.473  1.00 4.13  ? 6   LEU D HD23 1  
ATOM 5472   N N    . GLN D 1 7   ? 42.010  -0.451  -6.918  1.00 6.59  ? 7   GLN D N    1  
ATOM 5473   C CA   . GLN D 1 7   ? 43.287  -0.368  -7.605  1.00 7.01  ? 7   GLN D CA   1  
ATOM 5474   C C    . GLN D 1 7   ? 43.953  0.948   -7.238  1.00 6.41  ? 7   GLN D C    1  
ATOM 5475   O O    . GLN D 1 7   ? 43.327  2.004   -7.333  1.00 6.07  ? 7   GLN D O    1  
ATOM 5476   C CB   . GLN D 1 7   ? 43.107  -0.456  -9.131  1.00 7.78  ? 7   GLN D CB   1  
ATOM 5477   C CG   . GLN D 1 7   ? 41.698  -0.821  -9.588  1.00 7.99  ? 7   GLN D CG   1  
ATOM 5478   C CD   . GLN D 1 7   ? 41.283  -2.240  -9.230  1.00 8.39  ? 7   GLN D CD   1  
ATOM 5479   O OE1  . GLN D 1 7   ? 42.109  -3.147  -9.140  1.00 8.83  ? 7   GLN D OE1  1  
ATOM 5480   N NE2  . GLN D 1 7   ? 39.993  -2.438  -9.023  1.00 8.29  ? 7   GLN D NE2  1  
ATOM 5481   H H    . GLN D 1 7   ? 41.238  0.038   -7.280  1.00 6.50  ? 7   GLN D H    1  
ATOM 5482   H HA   . GLN D 1 7   ? 43.908  -1.185  -7.265  1.00 7.24  ? 7   GLN D HA   1  
ATOM 5483   H HB2  . GLN D 1 7   ? 43.357  0.502   -9.561  1.00 7.73  ? 7   GLN D HB2  1  
ATOM 5484   H HB3  . GLN D 1 7   ? 43.789  -1.196  -9.516  1.00 8.32  ? 7   GLN D HB3  1  
ATOM 5485   H HG2  . GLN D 1 7   ? 41.001  -0.138  -9.129  1.00 7.43  ? 7   GLN D HG2  1  
ATOM 5486   H HG3  . GLN D 1 7   ? 41.647  -0.713  -10.663 1.00 8.46  ? 7   GLN D HG3  1  
ATOM 5487   H HE21 . GLN D 1 7   ? 39.384  -1.666  -9.111  1.00 7.95  ? 7   GLN D HE21 1  
ATOM 5488   H HE22 . GLN D 1 7   ? 39.693  -3.340  -8.791  1.00 8.60  ? 7   GLN D HE22 1  
ATOM 5489   N N    . TYR D 1 8   ? 45.205  0.895   -6.805  1.00 6.32  ? 8   TYR D N    1  
ATOM 5490   C CA   . TYR D 1 8   ? 45.909  2.108   -6.407  1.00 5.79  ? 8   TYR D CA   1  
ATOM 5491   C C    . TYR D 1 8   ? 47.421  1.965   -6.533  1.00 6.09  ? 8   TYR D C    1  
ATOM 5492   O O    . TYR D 1 8   ? 47.958  0.854   -6.580  1.00 6.58  ? 8   TYR D O    1  
ATOM 5493   C CB   . TYR D 1 8   ? 45.529  2.507   -4.970  1.00 4.88  ? 8   TYR D CB   1  
ATOM 5494   C CG   . TYR D 1 8   ? 45.937  1.525   -3.882  1.00 4.82  ? 8   TYR D CG   1  
ATOM 5495   C CD1  . TYR D 1 8   ? 45.898  0.151   -4.086  1.00 5.36  ? 8   TYR D CD1  1  
ATOM 5496   C CD2  . TYR D 1 8   ? 46.351  1.985   -2.641  1.00 4.40  ? 8   TYR D CD2  1  
ATOM 5497   C CE1  . TYR D 1 8   ? 46.255  -0.731  -3.088  1.00 5.51  ? 8   TYR D CE1  1  
ATOM 5498   C CE2  . TYR D 1 8   ? 46.713  1.108   -1.637  1.00 4.54  ? 8   TYR D CE2  1  
ATOM 5499   C CZ   . TYR D 1 8   ? 46.666  -0.250  -1.866  1.00 5.11  ? 8   TYR D CZ   1  
ATOM 5500   O OH   . TYR D 1 8   ? 47.021  -1.126  -0.867  1.00 5.43  ? 8   TYR D OH   1  
ATOM 5501   H H    . TYR D 1 8   ? 45.668  0.028   -6.757  1.00 6.66  ? 8   TYR D H    1  
ATOM 5502   H HA   . TYR D 1 8   ? 45.589  2.894   -7.072  1.00 5.89  ? 8   TYR D HA   1  
ATOM 5503   H HB2  . TYR D 1 8   ? 45.994  3.453   -4.740  1.00 4.53  ? 8   TYR D HB2  1  
ATOM 5504   H HB3  . TYR D 1 8   ? 44.455  2.626   -4.918  1.00 4.68  ? 8   TYR D HB3  1  
ATOM 5505   H HD1  . TYR D 1 8   ? 45.579  -0.228  -5.045  1.00 5.77  ? 8   TYR D HD1  1  
ATOM 5506   H HD2  . TYR D 1 8   ? 46.388  3.048   -2.463  1.00 4.09  ? 8   TYR D HD2  1  
ATOM 5507   H HE1  . TYR D 1 8   ? 46.217  -1.794  -3.269  1.00 6.03  ? 8   TYR D HE1  1  
ATOM 5508   H HE2  . TYR D 1 8   ? 47.035  1.488   -0.678  1.00 4.33  ? 8   TYR D HE2  1  
ATOM 5509   H HH   . TYR D 1 8   ? 47.307  -1.970  -1.258  1.00 5.96  ? 8   TYR D HH   1  
ATOM 5510   N N    . SER D 1 9   ? 48.093  3.107   -6.587  1.00 5.85  ? 9   SER D N    1  
ATOM 5511   C CA   . SER D 1 9   ? 49.539  3.162   -6.706  1.00 6.08  ? 9   SER D CA   1  
ATOM 5512   C C    . SER D 1 9   ? 50.107  4.172   -5.706  1.00 5.38  ? 9   SER D C    1  
ATOM 5513   O O    . SER D 1 9   ? 49.875  5.377   -5.826  1.00 5.19  ? 9   SER D O    1  
ATOM 5514   C CB   . SER D 1 9   ? 49.923  3.544   -8.140  1.00 6.87  ? 9   SER D CB   1  
ATOM 5515   O OG   . SER D 1 9   ? 48.923  4.364   -8.731  1.00 7.06  ? 9   SER D OG   1  
ATOM 5516   H H    . SER D 1 9   ? 47.593  3.956   -6.553  1.00 5.55  ? 9   SER D H    1  
ATOM 5517   H HA   . SER D 1 9   ? 49.931  2.182   -6.481  1.00 6.26  ? 9   SER D HA   1  
ATOM 5518   H HB2  . SER D 1 9   ? 50.858  4.085   -8.129  1.00 6.91  ? 9   SER D HB2  1  
ATOM 5519   H HB3  . SER D 1 9   ? 50.033  2.648   -8.733  1.00 7.37  ? 9   SER D HB3  1  
ATOM 5520   H HG   . SER D 1 9   ? 49.081  5.283   -8.490  1.00 6.70  ? 9   SER D HG   1  
ATOM 5521   N N    . LEU D 1 10  ? 50.829  3.681   -4.713  1.00 5.08  ? 10  LEU D N    1  
ATOM 5522   C CA   . LEU D 1 10  ? 51.408  4.552   -3.698  1.00 4.42  ? 10  LEU D CA   1  
ATOM 5523   C C    . LEU D 1 10  ? 52.874  4.839   -3.986  1.00 4.79  ? 10  LEU D C    1  
ATOM 5524   O O    . LEU D 1 10  ? 53.617  3.950   -4.396  1.00 5.25  ? 10  LEU D O    1  
ATOM 5525   C CB   . LEU D 1 10  ? 51.284  3.913   -2.312  1.00 3.85  ? 10  LEU D CB   1  
ATOM 5526   C CG   . LEU D 1 10  ? 49.897  3.381   -1.954  1.00 3.63  ? 10  LEU D CG   1  
ATOM 5527   C CD1  . LEU D 1 10  ? 49.945  2.614   -0.643  1.00 3.50  ? 10  LEU D CD1  1  
ATOM 5528   C CD2  . LEU D 1 10  ? 48.896  4.519   -1.864  1.00 3.12  ? 10  LEU D CD2  1  
ATOM 5529   H H    . LEU D 1 10  ? 50.983  2.711   -4.660  1.00 5.38  ? 10  LEU D H    1  
ATOM 5530   H HA   . LEU D 1 10  ? 50.859  5.481   -3.706  1.00 4.16  ? 10  LEU D HA   1  
ATOM 5531   H HB2  . LEU D 1 10  ? 51.985  3.093   -2.256  1.00 4.22  ? 10  LEU D HB2  1  
ATOM 5532   H HB3  . LEU D 1 10  ? 51.563  4.650   -1.573  1.00 3.37  ? 10  LEU D HB3  1  
ATOM 5533   H HG   . LEU D 1 10  ? 49.569  2.701   -2.727  1.00 4.17  ? 10  LEU D HG   1  
ATOM 5534   H HD11 . LEU D 1 10  ? 50.656  1.806   -0.724  1.00 4.00  ? 10  LEU D HD11 1  
ATOM 5535   H HD12 . LEU D 1 10  ? 48.967  2.213   -0.428  1.00 3.54  ? 10  LEU D HD12 1  
ATOM 5536   H HD13 . LEU D 1 10  ? 50.245  3.278   0.153   1.00 3.14  ? 10  LEU D HD13 1  
ATOM 5537   H HD21 . LEU D 1 10  ? 47.937  4.133   -1.554  1.00 2.73  ? 10  LEU D HD21 1  
ATOM 5538   H HD22 . LEU D 1 10  ? 48.799  4.989   -2.830  1.00 3.02  ? 10  LEU D HD22 1  
ATOM 5539   H HD23 . LEU D 1 10  ? 49.243  5.246   -1.144  1.00 3.51  ? 10  LEU D HD23 1  
ATOM 5540   N N    . ASP D 1 11  ? 53.278  6.084   -3.778  1.00 4.69  ? 11  ASP D N    1  
ATOM 5541   C CA   . ASP D 1 11  ? 54.663  6.490   -3.973  1.00 5.07  ? 11  ASP D CA   1  
ATOM 5542   C C    . ASP D 1 11  ? 55.082  7.397   -2.823  1.00 4.46  ? 11  ASP D C    1  
ATOM 5543   O O    . ASP D 1 11  ? 54.241  8.041   -2.198  1.00 3.97  ? 11  ASP D O    1  
ATOM 5544   C CB   . ASP D 1 11  ? 54.874  7.175   -5.333  1.00 5.92  ? 11  ASP D CB   1  
ATOM 5545   C CG   . ASP D 1 11  ? 54.340  8.594   -5.404  1.00 6.05  ? 11  ASP D CG   1  
ATOM 5546   O OD1  . ASP D 1 11  ? 53.115  8.762   -5.566  1.00 6.39  ? 11  ASP D OD1  1  
ATOM 5547   O OD2  . ASP D 1 11  ? 55.154  9.544   -5.356  1.00 5.98  ? 11  ASP D OD2  1  
ATOM 5548   H H    . ASP D 1 11  ? 52.624  6.755   -3.478  1.00 4.44  ? 11  ASP D H    1  
ATOM 5549   H HA   . ASP D 1 11  ? 55.269  5.598   -3.935  1.00 5.26  ? 11  ASP D HA   1  
ATOM 5550   H HB2  . ASP D 1 11  ? 55.931  7.205   -5.546  1.00 6.23  ? 11  ASP D HB2  1  
ATOM 5551   H HB3  . ASP D 1 11  ? 54.381  6.589   -6.096  1.00 6.32  ? 11  ASP D HB3  1  
ATOM 5552   N N    . TYR D 1 12  ? 56.368  7.431   -2.526  1.00 4.57  ? 12  TYR D N    1  
ATOM 5553   C CA   . TYR D 1 12  ? 56.868  8.236   -1.419  1.00 4.11  ? 12  TYR D CA   1  
ATOM 5554   C C    . TYR D 1 12  ? 57.580  9.492   -1.901  1.00 4.71  ? 12  TYR D C    1  
ATOM 5555   O O    . TYR D 1 12  ? 58.194  9.504   -2.969  1.00 5.35  ? 12  TYR D O    1  
ATOM 5556   C CB   . TYR D 1 12  ? 57.814  7.402   -0.546  1.00 3.66  ? 12  TYR D CB   1  
ATOM 5557   C CG   . TYR D 1 12  ? 59.151  7.094   -1.192  1.00 4.15  ? 12  TYR D CG   1  
ATOM 5558   C CD1  . TYR D 1 12  ? 59.255  6.165   -2.221  1.00 4.76  ? 12  TYR D CD1  1  
ATOM 5559   C CD2  . TYR D 1 12  ? 60.311  7.732   -0.769  1.00 4.10  ? 12  TYR D CD2  1  
ATOM 5560   C CE1  . TYR D 1 12  ? 60.474  5.883   -2.808  1.00 5.28  ? 12  TYR D CE1  1  
ATOM 5561   C CE2  . TYR D 1 12  ? 61.533  7.455   -1.352  1.00 4.56  ? 12  TYR D CE2  1  
ATOM 5562   C CZ   . TYR D 1 12  ? 61.610  6.529   -2.369  1.00 5.14  ? 12  TYR D CZ   1  
ATOM 5563   O OH   . TYR D 1 12  ? 62.825  6.248   -2.952  1.00 5.65  ? 12  TYR D OH   1  
ATOM 5564   H H    . TYR D 1 12  ? 56.999  6.911   -3.067  1.00 5.01  ? 12  TYR D H    1  
ATOM 5565   H HA   . TYR D 1 12  ? 56.019  8.533   -0.821  1.00 3.77  ? 12  TYR D HA   1  
ATOM 5566   H HB2  . TYR D 1 12  ? 58.008  7.938   0.369   1.00 3.30  ? 12  TYR D HB2  1  
ATOM 5567   H HB3  . TYR D 1 12  ? 57.335  6.464   -0.311  1.00 3.46  ? 12  TYR D HB3  1  
ATOM 5568   H HD1  . TYR D 1 12  ? 58.366  5.659   -2.562  1.00 4.88  ? 12  TYR D HD1  1  
ATOM 5569   H HD2  . TYR D 1 12  ? 60.249  8.458   0.030   1.00 3.79  ? 12  TYR D HD2  1  
ATOM 5570   H HE1  . TYR D 1 12  ? 60.534  5.157   -3.606  1.00 5.82  ? 12  TYR D HE1  1  
ATOM 5571   H HE2  . TYR D 1 12  ? 62.421  7.962   -1.008  1.00 4.52  ? 12  TYR D HE2  1  
ATOM 5572   H HH   . TYR D 1 12  ? 63.387  5.792   -2.309  1.00 5.63  ? 12  TYR D HH   1  
ATOM 5573   N N    . ASP D 1 13  ? 57.495  10.547  -1.104  1.00 4.64  ? 13  ASP D N    1  
ATOM 5574   C CA   . ASP D 1 13  ? 58.149  11.804  -1.418  1.00 5.30  ? 13  ASP D CA   1  
ATOM 5575   C C    . ASP D 1 13  ? 59.009  12.228  -0.231  1.00 5.09  ? 13  ASP D C    1  
ATOM 5576   O O    . ASP D 1 13  ? 58.509  12.412  0.882   1.00 4.68  ? 13  ASP D O    1  
ATOM 5577   C CB   . ASP D 1 13  ? 57.120  12.880  -1.758  1.00 5.83  ? 13  ASP D CB   1  
ATOM 5578   C CG   . ASP D 1 13  ? 57.731  14.024  -2.541  1.00 6.69  ? 13  ASP D CG   1  
ATOM 5579   O OD1  . ASP D 1 13  ? 58.972  14.046  -2.695  1.00 6.89  ? 13  ASP D OD1  1  
ATOM 5580   O OD2  . ASP D 1 13  ? 56.973  14.899  -3.016  1.00 7.23  ? 13  ASP D OD2  1  
ATOM 5581   H H    . ASP D 1 13  ? 56.972  10.480  -0.272  1.00 4.21  ? 13  ASP D H    1  
ATOM 5582   H HA   . ASP D 1 13  ? 58.791  11.640  -2.274  1.00 5.68  ? 13  ASP D HA   1  
ATOM 5583   H HB2  . ASP D 1 13  ? 56.331  12.443  -2.352  1.00 5.89  ? 13  ASP D HB2  1  
ATOM 5584   H HB3  . ASP D 1 13  ? 56.701  13.273  -0.843  1.00 5.62  ? 13  ASP D HB3  1  
ATOM 5585   N N    . PHE D 1 14  ? 60.305  12.368  -0.469  1.00 5.46  ? 14  PHE D N    1  
ATOM 5586   C CA   . PHE D 1 14  ? 61.248  12.722  0.590   1.00 5.36  ? 14  PHE D CA   1  
ATOM 5587   C C    . PHE D 1 14  ? 61.545  14.219  0.636   1.00 6.11  ? 14  PHE D C    1  
ATOM 5588   O O    . PHE D 1 14  ? 62.261  14.682  1.528   1.00 6.21  ? 14  PHE D O    1  
ATOM 5589   C CB   . PHE D 1 14  ? 62.552  11.926  0.426   1.00 5.21  ? 14  PHE D CB   1  
ATOM 5590   C CG   . PHE D 1 14  ? 63.175  12.033  -0.942  1.00 5.77  ? 14  PHE D CG   1  
ATOM 5591   C CD1  . PHE D 1 14  ? 64.083  13.041  -1.225  1.00 6.49  ? 14  PHE D CD1  1  
ATOM 5592   C CD2  . PHE D 1 14  ? 62.854  11.126  -1.940  1.00 5.70  ? 14  PHE D CD2  1  
ATOM 5593   C CE1  . PHE D 1 14  ? 64.657  13.143  -2.478  1.00 7.08  ? 14  PHE D CE1  1  
ATOM 5594   C CE2  . PHE D 1 14  ? 63.427  11.223  -3.194  1.00 6.37  ? 14  PHE D CE2  1  
ATOM 5595   C CZ   . PHE D 1 14  ? 64.329  12.233  -3.464  1.00 7.04  ? 14  PHE D CZ   1  
ATOM 5596   H H    . PHE D 1 14  ? 60.637  12.238  -1.381  1.00 5.86  ? 14  PHE D H    1  
ATOM 5597   H HA   . PHE D 1 14  ? 60.794  12.440  1.528   1.00 4.92  ? 14  PHE D HA   1  
ATOM 5598   H HB2  . PHE D 1 14  ? 63.276  12.282  1.145   1.00 5.33  ? 14  PHE D HB2  1  
ATOM 5599   H HB3  . PHE D 1 14  ? 62.353  10.881  0.617   1.00 4.68  ? 14  PHE D HB3  1  
ATOM 5600   H HD1  . PHE D 1 14  ? 64.342  13.754  -0.456  1.00 6.66  ? 14  PHE D HD1  1  
ATOM 5601   H HD2  . PHE D 1 14  ? 62.148  10.336  -1.731  1.00 5.21  ? 14  PHE D HD2  1  
ATOM 5602   H HE1  . PHE D 1 14  ? 65.362  13.934  -2.687  1.00 7.66  ? 14  PHE D HE1  1  
ATOM 5603   H HE2  . PHE D 1 14  ? 63.169  10.509  -3.962  1.00 6.45  ? 14  PHE D HE2  1  
ATOM 5604   H HZ   . PHE D 1 14  ? 64.777  12.311  -4.444  1.00 7.59  ? 14  PHE D HZ   1  
ATOM 5605   N N    . GLN D 1 15  ? 61.001  14.981  -0.307  1.00 6.70  ? 15  GLN D N    1  
ATOM 5606   C CA   . GLN D 1 15  ? 61.238  16.425  -0.332  1.00 7.49  ? 15  GLN D CA   1  
ATOM 5607   C C    . GLN D 1 15  ? 60.358  17.127  0.700   1.00 7.58  ? 15  GLN D C    1  
ATOM 5608   O O    . GLN D 1 15  ? 60.724  18.170  1.244   1.00 8.07  ? 15  GLN D O    1  
ATOM 5609   C CB   . GLN D 1 15  ? 60.977  16.998  -1.729  1.00 8.17  ? 15  GLN D CB   1  
ATOM 5610   C CG   . GLN D 1 15  ? 59.508  17.020  -2.113  1.00 8.44  ? 15  GLN D CG   1  
ATOM 5611   C CD   . GLN D 1 15  ? 59.267  17.551  -3.507  1.00 9.03  ? 15  GLN D CD   1  
ATOM 5612   O OE1  . GLN D 1 15  ? 59.986  18.427  -3.989  1.00 9.73  ? 15  GLN D OE1  1  
ATOM 5613   N NE2  . GLN D 1 15  ? 58.259  17.015  -4.165  1.00 8.80  ? 15  GLN D NE2  1  
ATOM 5614   H H    . GLN D 1 15  ? 60.436  14.569  -1.000  1.00 6.65  ? 15  GLN D H    1  
ATOM 5615   H HA   . GLN D 1 15  ? 62.274  16.589  -0.072  1.00 7.61  ? 15  GLN D HA   1  
ATOM 5616   H HB2  . GLN D 1 15  ? 61.352  18.012  -1.766  1.00 8.68  ? 15  GLN D HB2  1  
ATOM 5617   H HB3  . GLN D 1 15  ? 61.508  16.400  -2.456  1.00 8.06  ? 15  GLN D HB3  1  
ATOM 5618   H HG2  . GLN D 1 15  ? 59.123  16.012  -2.060  1.00 7.95  ? 15  GLN D HG2  1  
ATOM 5619   H HG3  . GLN D 1 15  ? 58.974  17.643  -1.410  1.00 8.77  ? 15  GLN D HG3  1  
ATOM 5620   H HE21 . GLN D 1 15  ? 57.734  16.307  -3.713  1.00 8.25  ? 15  GLN D HE21 1  
ATOM 5621   H HE22 . GLN D 1 15  ? 58.071  17.335  -5.069  1.00 9.23  ? 15  GLN D HE22 1  
ATOM 5622   N N    . ASN D 1 16  ? 59.198  16.547  0.959   1.00 7.15  ? 16  ASN D N    1  
ATOM 5623   C CA   . ASN D 1 16  ? 58.252  17.100  1.921   1.00 7.27  ? 16  ASN D CA   1  
ATOM 5624   C C    . ASN D 1 16  ? 58.015  16.118  3.058   1.00 6.56  ? 16  ASN D C    1  
ATOM 5625   O O    . ASN D 1 16  ? 57.377  16.453  4.057   1.00 6.67  ? 16  ASN D O    1  
ATOM 5626   C CB   . ASN D 1 16  ? 56.926  17.438  1.227   1.00 7.55  ? 16  ASN D CB   1  
ATOM 5627   C CG   . ASN D 1 16  ? 56.540  16.408  0.180   1.00 7.12  ? 16  ASN D CG   1  
ATOM 5628   O OD1  . ASN D 1 16  ? 56.846  15.223  0.310   1.00 6.60  ? 16  ASN D OD1  1  
ATOM 5629   N ND2  . ASN D 1 16  ? 55.879  16.853  -0.875  1.00 7.45  ? 16  ASN D ND2  1  
ATOM 5630   H H    . ASN D 1 16  ? 58.958  15.727  0.477   1.00 6.80  ? 16  ASN D H    1  
ATOM 5631   H HA   . ASN D 1 16  ? 58.679  18.005  2.325   1.00 7.77  ? 16  ASN D HA   1  
ATOM 5632   H HB2  . ASN D 1 16  ? 56.141  17.482  1.967   1.00 7.54  ? 16  ASN D HB2  1  
ATOM 5633   H HB3  . ASN D 1 16  ? 57.015  18.400  0.745   1.00 8.15  ? 16  ASN D HB3  1  
ATOM 5634   H HD21 . ASN D 1 16  ? 55.675  17.813  -0.922  1.00 7.92  ? 16  ASN D HD21 1  
ATOM 5635   H HD22 . ASN D 1 16  ? 55.636  16.212  -1.576  1.00 7.26  ? 16  ASN D HD22 1  
ATOM 5636   N N    . ASN D 1 17  ? 58.545  14.908  2.885   1.00 5.91  ? 17  ASN D N    1  
ATOM 5637   C CA   . ASN D 1 17  ? 58.420  13.837  3.870   1.00 5.22  ? 17  ASN D CA   1  
ATOM 5638   C C    . ASN D 1 17  ? 56.967  13.419  4.052   1.00 4.92  ? 17  ASN D C    1  
ATOM 5639   O O    . ASN D 1 17  ? 56.351  13.700  5.081   1.00 5.15  ? 17  ASN D O    1  
ATOM 5640   C CB   . ASN D 1 17  ? 59.021  14.247  5.217   1.00 5.51  ? 17  ASN D CB   1  
ATOM 5641   C CG   . ASN D 1 17  ? 60.219  13.398  5.595   1.00 5.06  ? 17  ASN D CG   1  
ATOM 5642   O OD1  . ASN D 1 17  ? 60.075  12.300  6.133   1.00 4.38  ? 17  ASN D OD1  1  
ATOM 5643   N ND2  . ASN D 1 17  ? 61.411  13.904  5.321   1.00 5.53  ? 17  ASN D ND2  1  
ATOM 5644   H H    . ASN D 1 17  ? 59.031  14.726  2.058   1.00 5.95  ? 17  ASN D H    1  
ATOM 5645   H HA   . ASN D 1 17  ? 58.973  12.988  3.492   1.00 4.79  ? 17  ASN D HA   1  
ATOM 5646   H HB2  . ASN D 1 17  ? 59.338  15.277  5.166   1.00 6.04  ? 17  ASN D HB2  1  
ATOM 5647   H HB3  . ASN D 1 17  ? 58.270  14.143  5.985   1.00 5.64  ? 17  ASN D HB3  1  
ATOM 5648   H HD21 . ASN D 1 17  ? 61.454  14.788  4.897   1.00 6.11  ? 17  ASN D HD21 1  
ATOM 5649   H HD22 . ASN D 1 17  ? 62.206  13.377  5.555   1.00 5.33  ? 17  ASN D HD22 1  
ATOM 5650   N N    . GLN D 1 18  ? 56.421  12.766  3.037   1.00 4.51  ? 18  GLN D N    1  
ATOM 5651   C CA   . GLN D 1 18  ? 55.046  12.295  3.080   1.00 4.16  ? 18  GLN D CA   1  
ATOM 5652   C C    . GLN D 1 18  ? 54.823  11.218  2.028   1.00 3.66  ? 18  GLN D C    1  
ATOM 5653   O O    . GLN D 1 18  ? 55.646  11.042  1.125   1.00 3.83  ? 18  GLN D O    1  
ATOM 5654   C CB   . GLN D 1 18  ? 54.063  13.461  2.884   1.00 4.80  ? 18  GLN D CB   1  
ATOM 5655   C CG   . GLN D 1 18  ? 54.244  14.225  1.582   1.00 5.38  ? 18  GLN D CG   1  
ATOM 5656   C CD   . GLN D 1 18  ? 53.371  13.703  0.459   1.00 5.22  ? 18  GLN D CD   1  
ATOM 5657   O OE1  . GLN D 1 18  ? 52.267  13.208  0.687   1.00 4.98  ? 18  GLN D OE1  1  
ATOM 5658   N NE2  . GLN D 1 18  ? 53.863  13.807  -0.765  1.00 5.49  ? 18  GLN D NE2  1  
ATOM 5659   H H    . GLN D 1 18  ? 56.957  12.595  2.231   1.00 4.49  ? 18  GLN D H    1  
ATOM 5660   H HA   . GLN D 1 18  ? 54.880  11.860  4.054   1.00 3.93  ? 18  GLN D HA   1  
ATOM 5661   H HB2  . GLN D 1 18  ? 53.055  13.072  2.905   1.00 4.54  ? 18  GLN D HB2  1  
ATOM 5662   H HB3  . GLN D 1 18  ? 54.186  14.156  3.701   1.00 5.21  ? 18  GLN D HB3  1  
ATOM 5663   H HG2  . GLN D 1 18  ? 53.998  15.262  1.752   1.00 5.96  ? 18  GLN D HG2  1  
ATOM 5664   H HG3  . GLN D 1 18  ? 55.277  14.147  1.280   1.00 5.47  ? 18  GLN D HG3  1  
ATOM 5665   H HE21 . GLN D 1 18  ? 54.752  14.209  -0.873  1.00 5.74  ? 18  GLN D HE21 1  
ATOM 5666   H HE22 . GLN D 1 18  ? 53.319  13.487  -1.512  1.00 5.51  ? 18  GLN D HE22 1  
ATOM 5667   N N    . LEU D 1 19  ? 53.728  10.489  2.158   1.00 3.17  ? 19  LEU D N    1  
ATOM 5668   C CA   . LEU D 1 19  ? 53.398  9.434   1.215   1.00 2.84  ? 19  LEU D CA   1  
ATOM 5669   C C    . LEU D 1 19  ? 52.275  9.891   0.292   1.00 3.18  ? 19  LEU D C    1  
ATOM 5670   O O    . LEU D 1 19  ? 51.223  10.339  0.747   1.00 3.15  ? 19  LEU D O    1  
ATOM 5671   C CB   . LEU D 1 19  ? 52.992  8.153   1.950   1.00 2.11  ? 19  LEU D CB   1  
ATOM 5672   C CG   . LEU D 1 19  ? 54.037  7.591   2.918   1.00 1.94  ? 19  LEU D CG   1  
ATOM 5673   C CD1  . LEU D 1 19  ? 53.452  6.440   3.721   1.00 1.74  ? 19  LEU D CD1  1  
ATOM 5674   C CD2  . LEU D 1 19  ? 55.281  7.138   2.167   1.00 2.20  ? 19  LEU D CD2  1  
ATOM 5675   H H    . LEU D 1 19  ? 53.121  10.669  2.907   1.00 3.15  ? 19  LEU D H    1  
ATOM 5676   H HA   . LEU D 1 19  ? 54.277  9.235   0.620   1.00 3.08  ? 19  LEU D HA   1  
ATOM 5677   H HB2  . LEU D 1 19  ? 52.089  8.356   2.507   1.00 1.98  ? 19  LEU D HB2  1  
ATOM 5678   H HB3  . LEU D 1 19  ? 52.774  7.395   1.210   1.00 2.14  ? 19  LEU D HB3  1  
ATOM 5679   H HG   . LEU D 1 19  ? 54.327  8.368   3.614   1.00 2.19  ? 19  LEU D HG   1  
ATOM 5680   H HD11 . LEU D 1 19  ? 54.218  6.014   4.355   1.00 2.00  ? 19  LEU D HD11 1  
ATOM 5681   H HD12 . LEU D 1 19  ? 53.082  5.682   3.047   1.00 1.92  ? 19  LEU D HD12 1  
ATOM 5682   H HD13 . LEU D 1 19  ? 52.640  6.804   4.334   1.00 1.76  ? 19  LEU D HD13 1  
ATOM 5683   H HD21 . LEU D 1 19  ? 55.009  6.390   1.437   1.00 2.37  ? 19  LEU D HD21 1  
ATOM 5684   H HD22 . LEU D 1 19  ? 55.988  6.719   2.865   1.00 2.17  ? 19  LEU D HD22 1  
ATOM 5685   H HD23 . LEU D 1 19  ? 55.728  7.984   1.667   1.00 2.58  ? 19  LEU D HD23 1  
ATOM 5686   N N    . LEU D 1 20  ? 52.505  9.781   -1.001  1.00 3.67  ? 20  LEU D N    1  
ATOM 5687   C CA   . LEU D 1 20  ? 51.521  10.188  -1.985  1.00 4.11  ? 20  LEU D CA   1  
ATOM 5688   C C    . LEU D 1 20  ? 50.548  9.044   -2.248  1.00 3.74  ? 20  LEU D C    1  
ATOM 5689   O O    . LEU D 1 20  ? 50.898  8.039   -2.870  1.00 3.95  ? 20  LEU D O    1  
ATOM 5690   C CB   . LEU D 1 20  ? 52.220  10.621  -3.280  1.00 5.01  ? 20  LEU D CB   1  
ATOM 5691   C CG   . LEU D 1 20  ? 51.496  11.687  -4.113  1.00 5.69  ? 20  LEU D CG   1  
ATOM 5692   C CD1  . LEU D 1 20  ? 50.314  11.087  -4.859  1.00 5.67  ? 20  LEU D CD1  1  
ATOM 5693   C CD2  . LEU D 1 20  ? 51.044  12.840  -3.231  1.00 5.73  ? 20  LEU D CD2  1  
ATOM 5694   H H    . LEU D 1 20  ? 53.356  9.392   -1.307  1.00 3.80  ? 20  LEU D H    1  
ATOM 5695   H HA   . LEU D 1 20  ? 50.974  11.025  -1.580  1.00 4.19  ? 20  LEU D HA   1  
ATOM 5696   H HB2  . LEU D 1 20  ? 53.196  11.001  -3.021  1.00 5.15  ? 20  LEU D HB2  1  
ATOM 5697   H HB3  . LEU D 1 20  ? 52.351  9.745   -3.897  1.00 5.10  ? 20  LEU D HB3  1  
ATOM 5698   H HG   . LEU D 1 20  ? 52.183  12.080  -4.849  1.00 6.30  ? 20  LEU D HG   1  
ATOM 5699   H HD11 . LEU D 1 20  ? 50.642  10.223  -5.418  1.00 5.78  ? 20  LEU D HD11 1  
ATOM 5700   H HD12 . LEU D 1 20  ? 49.911  11.824  -5.539  1.00 6.07  ? 20  LEU D HD12 1  
ATOM 5701   H HD13 . LEU D 1 20  ? 49.554  10.794  -4.152  1.00 5.26  ? 20  LEU D HD13 1  
ATOM 5702   H HD21 . LEU D 1 20  ? 50.819  13.698  -3.848  1.00 6.34  ? 20  LEU D HD21 1  
ATOM 5703   H HD22 . LEU D 1 20  ? 51.831  13.092  -2.537  1.00 5.72  ? 20  LEU D HD22 1  
ATOM 5704   H HD23 . LEU D 1 20  ? 50.159  12.550  -2.685  1.00 5.26  ? 20  LEU D HD23 1  
ATOM 5705   N N    . VAL D 1 21  ? 49.332  9.197   -1.751  1.00 3.31  ? 21  VAL D N    1  
ATOM 5706   C CA   . VAL D 1 21  ? 48.307  8.185   -1.927  1.00 2.98  ? 21  VAL D CA   1  
ATOM 5707   C C    . VAL D 1 21  ? 47.484  8.473   -3.175  1.00 3.60  ? 21  VAL D C    1  
ATOM 5708   O O    . VAL D 1 21  ? 46.687  9.415   -3.206  1.00 3.65  ? 21  VAL D O    1  
ATOM 5709   C CB   . VAL D 1 21  ? 47.375  8.096   -0.698  1.00 2.19  ? 21  VAL D CB   1  
ATOM 5710   C CG1  . VAL D 1 21  ? 46.292  7.044   -0.906  1.00 1.96  ? 21  VAL D CG1  1  
ATOM 5711   C CG2  . VAL D 1 21  ? 48.179  7.796   0.560   1.00 1.74  ? 21  VAL D CG2  1  
ATOM 5712   H H    . VAL D 1 21  ? 49.116  10.018  -1.255  1.00 3.33  ? 21  VAL D H    1  
ATOM 5713   H HA   . VAL D 1 21  ? 48.801  7.232   -2.050  1.00 3.01  ? 21  VAL D HA   1  
ATOM 5714   H HB   . VAL D 1 21  ? 46.896  9.054   -0.570  1.00 2.38  ? 21  VAL D HB   1  
ATOM 5715   H HG11 . VAL D 1 21  ? 46.751  6.076   -1.028  1.00 2.14  ? 21  VAL D HG11 1  
ATOM 5716   H HG12 . VAL D 1 21  ? 45.720  7.286   -1.790  1.00 2.36  ? 21  VAL D HG12 1  
ATOM 5717   H HG13 . VAL D 1 21  ? 45.637  7.026   -0.048  1.00 1.65  ? 21  VAL D HG13 1  
ATOM 5718   H HG21 . VAL D 1 21  ? 48.754  6.894   0.412   1.00 1.74  ? 21  VAL D HG21 1  
ATOM 5719   H HG22 . VAL D 1 21  ? 47.506  7.662   1.394   1.00 1.47  ? 21  VAL D HG22 1  
ATOM 5720   H HG23 . VAL D 1 21  ? 48.849  8.619   0.766   1.00 2.06  ? 21  VAL D HG23 1  
ATOM 5721   N N    . GLY D 1 22  ? 47.715  7.679   -4.208  1.00 4.18  ? 22  GLY D N    1  
ATOM 5722   C CA   . GLY D 1 22  ? 46.990  7.838   -5.448  1.00 4.83  ? 22  GLY D CA   1  
ATOM 5723   C C    . GLY D 1 22  ? 46.174  6.607   -5.778  1.00 4.83  ? 22  GLY D C    1  
ATOM 5724   O O    . GLY D 1 22  ? 46.725  5.572   -6.159  1.00 5.18  ? 22  GLY D O    1  
ATOM 5725   H H    . GLY D 1 22  ? 48.392  6.977   -4.130  1.00 4.24  ? 22  GLY D H    1  
ATOM 5726   H HA2  . GLY D 1 22  ? 46.329  8.688   -5.365  1.00 4.83  ? 22  GLY D HA2  1  
ATOM 5727   H HA3  . GLY D 1 22  ? 47.695  8.015   -6.246  1.00 5.42  ? 22  GLY D HA3  1  
ATOM 5728   N N    . ILE D 1 23  ? 44.866  6.706   -5.612  1.00 4.52  ? 23  ILE D N    1  
ATOM 5729   C CA   . ILE D 1 23  ? 43.983  5.589   -5.900  1.00 4.58  ? 23  ILE D CA   1  
ATOM 5730   C C    . ILE D 1 23  ? 43.409  5.727   -7.301  1.00 5.36  ? 23  ILE D C    1  
ATOM 5731   O O    . ILE D 1 23  ? 43.019  6.818   -7.709  1.00 5.57  ? 23  ILE D O    1  
ATOM 5732   C CB   . ILE D 1 23  ? 42.833  5.461   -4.870  1.00 3.82  ? 23  ILE D CB   1  
ATOM 5733   C CG1  . ILE D 1 23  ? 41.954  6.728   -4.831  1.00 3.66  ? 23  ILE D CG1  1  
ATOM 5734   C CG2  . ILE D 1 23  ? 43.399  5.149   -3.491  1.00 3.14  ? 23  ILE D CG2  1  
ATOM 5735   C CD1  . ILE D 1 23  ? 42.416  7.790   -3.849  1.00 3.20  ? 23  ILE D CD1  1  
ATOM 5736   H H    . ILE D 1 23  ? 44.483  7.555   -5.309  1.00 4.33  ? 23  ILE D H    1  
ATOM 5737   H HA   . ILE D 1 23  ? 44.573  4.685   -5.862  1.00 4.70  ? 23  ILE D HA   1  
ATOM 5738   H HB   . ILE D 1 23  ? 42.219  4.623   -5.165  1.00 4.02  ? 23  ILE D HB   1  
ATOM 5739   H HG12 . ILE D 1 23  ? 41.940  7.175   -5.814  1.00 4.28  ? 23  ILE D HG12 1  
ATOM 5740   H HG13 . ILE D 1 23  ? 40.947  6.445   -4.561  1.00 3.46  ? 23  ILE D HG13 1  
ATOM 5741   H HG21 . ILE D 1 23  ? 43.955  4.225   -3.532  1.00 3.45  ? 23  ILE D HG21 1  
ATOM 5742   H HG22 . ILE D 1 23  ? 42.589  5.052   -2.784  1.00 2.68  ? 23  ILE D HG22 1  
ATOM 5743   H HG23 . ILE D 1 23  ? 44.054  5.949   -3.181  1.00 2.94  ? 23  ILE D HG23 1  
ATOM 5744   H HD11 . ILE D 1 23  ? 43.395  8.145   -4.135  1.00 3.39  ? 23  ILE D HD11 1  
ATOM 5745   H HD12 . ILE D 1 23  ? 42.463  7.366   -2.857  1.00 3.44  ? 23  ILE D HD12 1  
ATOM 5746   H HD13 . ILE D 1 23  ? 41.717  8.614   -3.855  1.00 2.70  ? 23  ILE D HD13 1  
ATOM 5747   N N    . ILE D 1 24  ? 43.376  4.630   -8.036  1.00 5.89  ? 24  ILE D N    1  
ATOM 5748   C CA   . ILE D 1 24  ? 42.863  4.646   -9.395  1.00 6.66  ? 24  ILE D CA   1  
ATOM 5749   C C    . ILE D 1 24  ? 41.341  4.590   -9.393  1.00 6.50  ? 24  ILE D C    1  
ATOM 5750   O O    . ILE D 1 24  ? 40.678  5.530   -9.837  1.00 6.62  ? 24  ILE D O    1  
ATOM 5751   C CB   . ILE D 1 24  ? 43.416  3.470   -10.233 1.00 7.39  ? 24  ILE D CB   1  
ATOM 5752   C CG1  . ILE D 1 24  ? 44.945  3.408   -10.124 1.00 7.53  ? 24  ILE D CG1  1  
ATOM 5753   C CG2  . ILE D 1 24  ? 42.990  3.611   -11.688 1.00 8.21  ? 24  ILE D CG2  1  
ATOM 5754   C CD1  . ILE D 1 24  ? 45.564  2.258   -10.891 1.00 8.17  ? 24  ILE D CD1  1  
ATOM 5755   H H    . ILE D 1 24  ? 43.690  3.782   -7.652  1.00 5.82  ? 24  ILE D H    1  
ATOM 5756   H HA   . ILE D 1 24  ? 43.178  5.570   -9.859  1.00 6.92  ? 24  ILE D HA   1  
ATOM 5757   H HB   . ILE D 1 24  ? 42.997  2.553   -9.847  1.00 7.28  ? 24  ILE D HB   1  
ATOM 5758   H HG12 . ILE D 1 24  ? 45.364  4.324   -10.509 1.00 7.80  ? 24  ILE D HG12 1  
ATOM 5759   H HG13 . ILE D 1 24  ? 45.219  3.300   -9.085  1.00 6.94  ? 24  ILE D HG13 1  
ATOM 5760   H HG21 . ILE D 1 24  ? 43.402  2.796   -12.265 1.00 8.70  ? 24  ILE D HG21 1  
ATOM 5761   H HG22 . ILE D 1 24  ? 43.355  4.549   -12.079 1.00 8.42  ? 24  ILE D HG22 1  
ATOM 5762   H HG23 . ILE D 1 24  ? 41.912  3.588   -11.750 1.00 8.15  ? 24  ILE D HG23 1  
ATOM 5763   H HD11 . ILE D 1 24  ? 45.388  2.393   -11.948 1.00 8.76  ? 24  ILE D HD11 1  
ATOM 5764   H HD12 . ILE D 1 24  ? 45.118  1.329   -10.568 1.00 8.02  ? 24  ILE D HD12 1  
ATOM 5765   H HD13 . ILE D 1 24  ? 46.628  2.232   -10.705 1.00 8.27  ? 24  ILE D HD13 1  
ATOM 5766   N N    . GLN D 1 25  ? 40.791  3.497   -8.875  1.00 6.30  ? 25  GLN D N    1  
ATOM 5767   C CA   . GLN D 1 25  ? 39.346  3.328   -8.829  1.00 6.15  ? 25  GLN D CA   1  
ATOM 5768   C C    . GLN D 1 25  ? 38.945  2.169   -7.929  1.00 5.89  ? 25  GLN D C    1  
ATOM 5769   O O    . GLN D 1 25  ? 39.792  1.403   -7.460  1.00 5.99  ? 25  GLN D O    1  
ATOM 5770   C CB   . GLN D 1 25  ? 38.791  3.103   -10.239 1.00 6.97  ? 25  GLN D CB   1  
ATOM 5771   C CG   . GLN D 1 25  ? 39.339  1.867   -10.945 1.00 7.70  ? 25  GLN D CG   1  
ATOM 5772   C CD   . GLN D 1 25  ? 38.390  0.685   -10.881 1.00 7.92  ? 25  GLN D CD   1  
ATOM 5773   O OE1  . GLN D 1 25  ? 38.503  -0.177  -10.011 1.00 7.84  ? 25  GLN D OE1  1  
ATOM 5774   N NE2  . GLN D 1 25  ? 37.449  0.640   -11.809 1.00 8.32  ? 25  GLN D NE2  1  
ATOM 5775   H H    . GLN D 1 25  ? 41.368  2.795   -8.504  1.00 6.29  ? 25  GLN D H    1  
ATOM 5776   H HA   . GLN D 1 25  ? 38.920  4.236   -8.431  1.00 5.71  ? 25  GLN D HA   1  
ATOM 5777   H HB2  . GLN D 1 25  ? 37.719  3.004   -10.177 1.00 6.85  ? 25  GLN D HB2  1  
ATOM 5778   H HB3  . GLN D 1 25  ? 39.028  3.967   -10.842 1.00 7.21  ? 25  GLN D HB3  1  
ATOM 5779   H HG2  . GLN D 1 25  ? 39.515  2.111   -11.982 1.00 8.26  ? 25  GLN D HG2  1  
ATOM 5780   H HG3  . GLN D 1 25  ? 40.272  1.588   -10.480 1.00 7.59  ? 25  GLN D HG3  1  
ATOM 5781   H HE21 . GLN D 1 25  ? 37.423  1.357   -12.475 1.00 8.47  ? 25  GLN D HE21 1  
ATOM 5782   H HE22 . GLN D 1 25  ? 36.802  -0.100  -11.783 1.00 8.51  ? 25  GLN D HE22 1  
ATOM 5783   N N    . ALA D 1 26  ? 37.644  2.052   -7.707  1.00 5.65  ? 26  ALA D N    1  
ATOM 5784   C CA   . ALA D 1 26  ? 37.083  0.990   -6.892  1.00 5.55  ? 26  ALA D CA   1  
ATOM 5785   C C    . ALA D 1 26  ? 36.005  0.269   -7.686  1.00 6.08  ? 26  ALA D C    1  
ATOM 5786   O O    . ALA D 1 26  ? 35.179  0.908   -8.336  1.00 6.14  ? 26  ALA D O    1  
ATOM 5787   C CB   . ALA D 1 26  ? 36.509  1.550   -5.597  1.00 4.67  ? 26  ALA D CB   1  
ATOM 5788   H H    . ALA D 1 26  ? 37.034  2.700   -8.121  1.00 5.61  ? 26  ALA D H    1  
ATOM 5789   H HA   . ALA D 1 26  ? 37.873  0.296   -6.649  1.00 5.82  ? 26  ALA D HA   1  
ATOM 5790   H HB1  . ALA D 1 26  ? 36.126  0.739   -4.993  1.00 4.38  ? 26  ALA D HB1  1  
ATOM 5791   H HB2  . ALA D 1 26  ? 35.709  2.237   -5.825  1.00 4.72  ? 26  ALA D HB2  1  
ATOM 5792   H HB3  . ALA D 1 26  ? 37.285  2.068   -5.054  1.00 4.49  ? 26  ALA D HB3  1  
ATOM 5793   N N    . ALA D 1 27  ? 36.014  -1.053  -7.640  1.00 6.54  ? 27  ALA D N    1  
ATOM 5794   C CA   . ALA D 1 27  ? 35.043  -1.837  -8.386  1.00 7.09  ? 27  ALA D CA   1  
ATOM 5795   C C    . ALA D 1 27  ? 34.340  -2.839  -7.487  1.00 7.14  ? 27  ALA D C    1  
ATOM 5796   O O    . ALA D 1 27  ? 34.833  -3.163  -6.405  1.00 7.03  ? 27  ALA D O    1  
ATOM 5797   C CB   . ALA D 1 27  ? 35.726  -2.556  -9.543  1.00 7.99  ? 27  ALA D CB   1  
ATOM 5798   H H    . ALA D 1 27  ? 36.677  -1.512  -7.079  1.00 6.56  ? 27  ALA D H    1  
ATOM 5799   H HA   . ALA D 1 27  ? 34.311  -1.159  -8.797  1.00 6.90  ? 27  ALA D HA   1  
ATOM 5800   H HB1  . ALA D 1 27  ? 36.215  -1.833  -10.178 1.00 8.04  ? 27  ALA D HB1  1  
ATOM 5801   H HB2  . ALA D 1 27  ? 34.990  -3.099  -10.116 1.00 8.38  ? 27  ALA D HB2  1  
ATOM 5802   H HB3  . ALA D 1 27  ? 36.461  -3.247  -9.155  1.00 8.21  ? 27  ALA D HB3  1  
ATOM 5803   N N    . GLU D 1 28  ? 33.183  -3.315  -7.953  1.00 7.39  ? 28  GLU D N    1  
ATOM 5804   C CA   . GLU D 1 28  ? 32.371  -4.302  -7.234  1.00 7.58  ? 28  GLU D CA   1  
ATOM 5805   C C    . GLU D 1 28  ? 31.792  -3.730  -5.939  1.00 6.87  ? 28  GLU D C    1  
ATOM 5806   O O    . GLU D 1 28  ? 31.593  -4.459  -4.968  1.00 7.05  ? 28  GLU D O    1  
ATOM 5807   C CB   . GLU D 1 28  ? 33.187  -5.565  -6.925  1.00 8.30  ? 28  GLU D CB   1  
ATOM 5808   C CG   . GLU D 1 28  ? 33.565  -6.387  -8.148  1.00 9.07  ? 28  GLU D CG   1  
ATOM 5809   C CD   . GLU D 1 28  ? 34.255  -7.687  -7.777  1.00 9.75  ? 28  GLU D CD   1  
ATOM 5810   O OE1  . GLU D 1 28  ? 33.549  -8.668  -7.463  1.00 9.92  ? 28  GLU D OE1  1  
ATOM 5811   O OE2  . GLU D 1 28  ? 35.506  -7.735  -7.798  1.00 10.26 ? 28  GLU D OE2  1  
ATOM 5812   H H    . GLU D 1 28  ? 32.859  -2.982  -8.813  1.00 7.50  ? 28  GLU D H    1  
ATOM 5813   H HA   . GLU D 1 28  ? 31.549  -4.576  -7.880  1.00 7.82  ? 28  GLU D HA   1  
ATOM 5814   H HB2  . GLU D 1 28  ? 34.096  -5.272  -6.426  1.00 8.19  ? 28  GLU D HB2  1  
ATOM 5815   H HB3  . GLU D 1 28  ? 32.612  -6.195  -6.263  1.00 8.42  ? 28  GLU D HB3  1  
ATOM 5816   H HG2  . GLU D 1 28  ? 32.670  -6.617  -8.706  1.00 9.14  ? 28  GLU D HG2  1  
ATOM 5817   H HG3  . GLU D 1 28  ? 34.233  -5.806  -8.766  1.00 9.18  ? 28  GLU D HG3  1  
ATOM 5818   N N    . LEU D 1 29  ? 31.501  -2.434  -5.940  1.00 6.15  ? 29  LEU D N    1  
ATOM 5819   C CA   . LEU D 1 29  ? 30.938  -1.786  -4.760  1.00 5.46  ? 29  LEU D CA   1  
ATOM 5820   C C    . LEU D 1 29  ? 29.493  -2.237  -4.532  1.00 5.57  ? 29  LEU D C    1  
ATOM 5821   O O    . LEU D 1 29  ? 28.729  -2.385  -5.489  1.00 5.80  ? 29  LEU D O    1  
ATOM 5822   C CB   . LEU D 1 29  ? 31.005  -0.262  -4.899  1.00 4.65  ? 29  LEU D CB   1  
ATOM 5823   C CG   . LEU D 1 29  ? 32.419  0.325   -4.937  1.00 4.53  ? 29  LEU D CG   1  
ATOM 5824   C CD1  . LEU D 1 29  ? 32.359  1.834   -5.095  1.00 3.83  ? 29  LEU D CD1  1  
ATOM 5825   C CD2  . LEU D 1 29  ? 33.187  -0.037  -3.677  1.00 4.50  ? 29  LEU D CD2  1  
ATOM 5826   H H    . LEU D 1 29  ? 31.664  -1.904  -6.746  1.00 6.14  ? 29  LEU D H    1  
ATOM 5827   H HA   . LEU D 1 29  ? 31.535  -2.084  -3.912  1.00 5.52  ? 29  LEU D HA   1  
ATOM 5828   H HB2  . LEU D 1 29  ? 30.494  0.020   -5.809  1.00 4.69  ? 29  LEU D HB2  1  
ATOM 5829   H HB3  . LEU D 1 29  ? 30.481  0.177   -4.063  1.00 4.16  ? 29  LEU D HB3  1  
ATOM 5830   H HG   . LEU D 1 29  ? 32.951  -0.082  -5.786  1.00 5.10  ? 29  LEU D HG   1  
ATOM 5831   H HD11 . LEU D 1 29  ? 33.362  2.232   -5.124  1.00 3.86  ? 29  LEU D HD11 1  
ATOM 5832   H HD12 . LEU D 1 29  ? 31.826  2.261   -4.258  1.00 3.30  ? 29  LEU D HD12 1  
ATOM 5833   H HD13 . LEU D 1 29  ? 31.846  2.081   -6.013  1.00 3.99  ? 29  LEU D HD13 1  
ATOM 5834   H HD21 . LEU D 1 29  ? 32.603  0.232   -2.809  1.00 4.16  ? 29  LEU D HD21 1  
ATOM 5835   H HD22 . LEU D 1 29  ? 34.125  0.499   -3.659  1.00 4.40  ? 29  LEU D HD22 1  
ATOM 5836   H HD23 . LEU D 1 29  ? 33.382  -1.099  -3.664  1.00 5.07  ? 29  LEU D HD23 1  
ATOM 5837   N N    . PRO D 1 30  ? 29.112  -2.489  -3.266  1.00 5.51  ? 30  PRO D N    1  
ATOM 5838   C CA   . PRO D 1 30  ? 27.757  -2.929  -2.909  1.00 5.69  ? 30  PRO D CA   1  
ATOM 5839   C C    . PRO D 1 30  ? 26.708  -1.825  -3.058  1.00 5.06  ? 30  PRO D C    1  
ATOM 5840   O O    . PRO D 1 30  ? 27.029  -0.634  -3.056  1.00 4.47  ? 30  PRO D O    1  
ATOM 5841   C CB   . PRO D 1 30  ? 27.871  -3.336  -1.431  1.00 5.87  ? 30  PRO D CB   1  
ATOM 5842   C CG   . PRO D 1 30  ? 29.330  -3.354  -1.127  1.00 5.82  ? 30  PRO D CG   1  
ATOM 5843   C CD   . PRO D 1 30  ? 29.970  -2.390  -2.082  1.00 5.39  ? 30  PRO D CD   1  
ATOM 5844   H HA   . PRO D 1 30  ? 27.456  -3.786  -3.493  1.00 6.23  ? 30  PRO D HA   1  
ATOM 5845   H HB2  . PRO D 1 30  ? 27.354  -2.613  -0.819  1.00 5.55  ? 30  PRO D HB2  1  
ATOM 5846   H HB3  . PRO D 1 30  ? 27.431  -4.311  -1.290  1.00 6.45  ? 30  PRO D HB3  1  
ATOM 5847   H HG2  . PRO D 1 30  ? 29.495  -3.037  -0.108  1.00 5.65  ? 30  PRO D HG2  1  
ATOM 5848   H HG3  . PRO D 1 30  ? 29.725  -4.348  -1.279  1.00 6.36  ? 30  PRO D HG3  1  
ATOM 5849   H HD2  . PRO D 1 30  ? 29.957  -1.389  -1.675  1.00 4.82  ? 30  PRO D HD2  1  
ATOM 5850   H HD3  . PRO D 1 30  ? 30.978  -2.698  -2.306  1.00 5.68  ? 30  PRO D HD3  1  
ATOM 5851   N N    . ALA D 1 31  ? 25.451  -2.237  -3.164  1.00 5.21  ? 31  ALA D N    1  
ATOM 5852   C CA   . ALA D 1 31  ? 24.342  -1.303  -3.309  1.00 4.69  ? 31  ALA D CA   1  
ATOM 5853   C C    . ALA D 1 31  ? 23.885  -0.788  -1.945  1.00 4.41  ? 31  ALA D C    1  
ATOM 5854   O O    . ALA D 1 31  ? 23.804  -1.552  -0.981  1.00 4.97  ? 31  ALA D O    1  
ATOM 5855   C CB   . ALA D 1 31  ? 23.187  -1.970  -4.037  1.00 5.16  ? 31  ALA D CB   1  
ATOM 5856   H H    . ALA D 1 31  ? 25.259  -3.200  -3.139  1.00 5.71  ? 31  ALA D H    1  
ATOM 5857   H HA   . ALA D 1 31  ? 24.683  -0.470  -3.908  1.00 4.27  ? 31  ALA D HA   1  
ATOM 5858   H HB1  . ALA D 1 31  ? 22.833  -2.814  -3.460  1.00 5.63  ? 31  ALA D HB1  1  
ATOM 5859   H HB2  . ALA D 1 31  ? 23.523  -2.313  -5.005  1.00 5.48  ? 31  ALA D HB2  1  
ATOM 5860   H HB3  . ALA D 1 31  ? 22.384  -1.261  -4.164  1.00 4.81  ? 31  ALA D HB3  1  
ATOM 5861   N N    . LEU D 1 32  ? 23.597  0.505   -1.868  1.00 3.70  ? 32  LEU D N    1  
ATOM 5862   C CA   . LEU D 1 32  ? 23.148  1.118   -0.624  1.00 3.62  ? 32  LEU D CA   1  
ATOM 5863   C C    . LEU D 1 32  ? 21.959  2.038   -0.889  1.00 3.32  ? 32  LEU D C    1  
ATOM 5864   O O    . LEU D 1 32  ? 20.921  1.925   -0.244  1.00 3.68  ? 32  LEU D O    1  
ATOM 5865   C CB   . LEU D 1 32  ? 24.296  1.904   0.027   1.00 3.27  ? 32  LEU D CB   1  
ATOM 5866   C CG   . LEU D 1 32  ? 24.463  1.713   1.542   1.00 3.75  ? 32  LEU D CG   1  
ATOM 5867   C CD1  . LEU D 1 32  ? 23.261  2.264   2.292   1.00 4.02  ? 32  LEU D CD1  1  
ATOM 5868   C CD2  . LEU D 1 32  ? 24.682  0.244   1.887   1.00 4.47  ? 32  LEU D CD2  1  
ATOM 5869   H H    . LEU D 1 32  ? 23.684  1.065   -2.669  1.00 3.35  ? 32  LEU D H    1  
ATOM 5870   H HA   . LEU D 1 32  ? 22.837  0.328   0.043   1.00 4.19  ? 32  LEU D HA   1  
ATOM 5871   H HB2  . LEU D 1 32  ? 25.219  1.613   -0.454  1.00 3.18  ? 32  LEU D HB2  1  
ATOM 5872   H HB3  . LEU D 1 32  ? 24.130  2.955   -0.161  1.00 2.94  ? 32  LEU D HB3  1  
ATOM 5873   H HG   . LEU D 1 32  ? 25.333  2.265   1.869   1.00 3.59  ? 32  LEU D HG   1  
ATOM 5874   H HD11 . LEU D 1 32  ? 23.160  3.319   2.083   1.00 3.82  ? 32  LEU D HD11 1  
ATOM 5875   H HD12 . LEU D 1 32  ? 23.401  2.119   3.352   1.00 4.44  ? 32  LEU D HD12 1  
ATOM 5876   H HD13 . LEU D 1 32  ? 22.370  1.746   1.971   1.00 4.33  ? 32  LEU D HD13 1  
ATOM 5877   H HD21 . LEU D 1 32  ? 25.490  -0.149  1.290   1.00 4.60  ? 32  LEU D HD21 1  
ATOM 5878   H HD22 . LEU D 1 32  ? 23.780  -0.315  1.685   1.00 4.73  ? 32  LEU D HD22 1  
ATOM 5879   H HD23 . LEU D 1 32  ? 24.933  0.154   2.934   1.00 4.87  ? 32  LEU D HD23 1  
ATOM 5880   N N    . ASP D 1 33  ? 22.112  2.945   -1.844  1.00 2.81  ? 33  ASP D N    1  
ATOM 5881   C CA   . ASP D 1 33  ? 21.040  3.875   -2.188  1.00 2.57  ? 33  ASP D CA   1  
ATOM 5882   C C    . ASP D 1 33  ? 20.007  3.189   -3.080  1.00 2.89  ? 33  ASP D C    1  
ATOM 5883   O O    . ASP D 1 33  ? 20.326  2.239   -3.805  1.00 3.19  ? 33  ASP D O    1  
ATOM 5884   C CB   . ASP D 1 33  ? 21.607  5.116   -2.891  1.00 2.11  ? 33  ASP D CB   1  
ATOM 5885   C CG   . ASP D 1 33  ? 20.546  6.140   -3.271  1.00 1.85  ? 33  ASP D CG   1  
ATOM 5886   O OD1  . ASP D 1 33  ? 19.519  6.246   -2.569  1.00 2.14  ? 33  ASP D OD1  1  
ATOM 5887   O OD2  . ASP D 1 33  ? 20.737  6.853   -4.281  1.00 1.78  ? 33  ASP D OD2  1  
ATOM 5888   H H    . ASP D 1 33  ? 22.962  2.993   -2.327  1.00 2.73  ? 33  ASP D H    1  
ATOM 5889   H HA   . ASP D 1 33  ? 20.562  4.180   -1.268  1.00 2.76  ? 33  ASP D HA   1  
ATOM 5890   H HB2  . ASP D 1 33  ? 22.318  5.596   -2.235  1.00 2.17  ? 33  ASP D HB2  1  
ATOM 5891   H HB3  . ASP D 1 33  ? 22.113  4.803   -3.791  1.00 2.28  ? 33  ASP D HB3  1  
ATOM 5892   N N    . MET D 1 34  ? 18.775  3.683   -3.027  1.00 2.94  ? 34  MET D N    1  
ATOM 5893   C CA   . MET D 1 34  ? 17.678  3.134   -3.816  1.00 3.27  ? 34  MET D CA   1  
ATOM 5894   C C    . MET D 1 34  ? 18.014  3.191   -5.302  1.00 3.34  ? 34  MET D C    1  
ATOM 5895   O O    . MET D 1 34  ? 18.701  4.108   -5.761  1.00 3.18  ? 34  MET D O    1  
ATOM 5896   C CB   . MET D 1 34  ? 16.384  3.908   -3.547  1.00 3.28  ? 34  MET D CB   1  
ATOM 5897   C CG   . MET D 1 34  ? 15.188  3.012   -3.268  1.00 3.66  ? 34  MET D CG   1  
ATOM 5898   S SD   . MET D 1 34  ? 15.083  2.510   -1.537  1.00 4.43  ? 34  MET D SD   1  
ATOM 5899   C CE   . MET D 1 34  ? 14.016  1.076   -1.679  1.00 4.74  ? 34  MET D CE   1  
ATOM 5900   H H    . MET D 1 34  ? 18.606  4.461   -2.453  1.00 2.82  ? 34  MET D H    1  
ATOM 5901   H HA   . MET D 1 34  ? 17.540  2.104   -3.527  1.00 3.68  ? 34  MET D HA   1  
ATOM 5902   H HB2  . MET D 1 34  ? 16.533  4.551   -2.692  1.00 3.42  ? 34  MET D HB2  1  
ATOM 5903   H HB3  . MET D 1 34  ? 16.156  4.518   -4.409  1.00 3.04  ? 34  MET D HB3  1  
ATOM 5904   H HG2  . MET D 1 34  ? 14.285  3.545   -3.528  1.00 3.52  ? 34  MET D HG2  1  
ATOM 5905   H HG3  . MET D 1 34  ? 15.270  2.127   -3.880  1.00 4.00  ? 34  MET D HG3  1  
ATOM 5906   H HE1  . MET D 1 34  ? 13.805  0.687   -0.694  1.00 5.21  ? 34  MET D HE1  1  
ATOM 5907   H HE2  . MET D 1 34  ? 14.509  0.316   -2.267  1.00 5.02  ? 34  MET D HE2  1  
ATOM 5908   H HE3  . MET D 1 34  ? 13.093  1.361   -2.161  1.00 4.52  ? 34  MET D HE3  1  
ATOM 5909   N N    . GLY D 1 35  ? 17.542  2.205   -6.049  1.00 3.85  ? 35  GLY D N    1  
ATOM 5910   C CA   . GLY D 1 35  ? 17.818  2.160   -7.470  1.00 4.22  ? 35  GLY D CA   1  
ATOM 5911   C C    . GLY D 1 35  ? 19.027  1.302   -7.783  1.00 4.61  ? 35  GLY D C    1  
ATOM 5912   O O    . GLY D 1 35  ? 19.170  0.791   -8.894  1.00 5.10  ? 35  GLY D O    1  
ATOM 5913   H H    . GLY D 1 35  ? 16.992  1.504   -5.636  1.00 4.13  ? 35  GLY D H    1  
ATOM 5914   H HA2  . GLY D 1 35  ? 16.956  1.758   -7.983  1.00 4.56  ? 35  GLY D HA2  1  
ATOM 5915   H HA3  . GLY D 1 35  ? 18.001  3.163   -7.825  1.00 4.01  ? 35  GLY D HA3  1  
ATOM 5916   N N    . GLY D 1 36  ? 19.895  1.135   -6.792  1.00 4.47  ? 36  GLY D N    1  
ATOM 5917   C CA   . GLY D 1 36  ? 21.087  0.330   -6.971  1.00 4.87  ? 36  GLY D CA   1  
ATOM 5918   C C    . GLY D 1 36  ? 22.287  1.163   -7.359  1.00 4.58  ? 36  GLY D C    1  
ATOM 5919   O O    . GLY D 1 36  ? 23.261  0.642   -7.902  1.00 5.06  ? 36  GLY D O    1  
ATOM 5920   H H    . GLY D 1 36  ? 19.721  1.565   -5.926  1.00 4.18  ? 36  GLY D H    1  
ATOM 5921   H HA2  . GLY D 1 36  ? 21.305  -0.183  -6.047  1.00 4.92  ? 36  GLY D HA2  1  
ATOM 5922   H HA3  . GLY D 1 36  ? 20.902  -0.400  -7.744  1.00 5.44  ? 36  GLY D HA3  1  
ATOM 5923   N N    . THR D 1 37  ? 22.216  2.453   -7.080  1.00 3.92  ? 37  THR D N    1  
ATOM 5924   C CA   . THR D 1 37  ? 23.299  3.363   -7.404  1.00 3.70  ? 37  THR D CA   1  
ATOM 5925   C C    . THR D 1 37  ? 23.594  4.288   -6.228  1.00 2.92  ? 37  THR D C    1  
ATOM 5926   O O    . THR D 1 37  ? 22.928  5.306   -6.048  1.00 2.67  ? 37  THR D O    1  
ATOM 5927   C CB   . THR D 1 37  ? 22.962  4.204   -8.649  1.00 4.02  ? 37  THR D CB   1  
ATOM 5928   O OG1  . THR D 1 37  ? 21.564  4.525   -8.655  1.00 4.20  ? 37  THR D OG1  1  
ATOM 5929   C CG2  . THR D 1 37  ? 23.329  3.462   -9.926  1.00 4.80  ? 37  THR D CG2  1  
ATOM 5930   H H    . THR D 1 37  ? 21.413  2.805   -6.645  1.00 3.68  ? 37  THR D H    1  
ATOM 5931   H HA   . THR D 1 37  ? 24.179  2.774   -7.620  1.00 4.05  ? 37  THR D HA   1  
ATOM 5932   H HB   . THR D 1 37  ? 23.529  5.119   -8.608  1.00 3.71  ? 37  THR D HB   1  
ATOM 5933   H HG1  . THR D 1 37  ? 21.326  4.922   -7.810  1.00 4.37  ? 37  THR D HG1  1  
ATOM 5934   H HG21 . THR D 1 37  ? 24.400  3.332   -9.971  1.00 4.72  ? 37  THR D HG21 1  
ATOM 5935   H HG22 . THR D 1 37  ? 23.000  4.032   -10.783 1.00 5.16  ? 37  THR D HG22 1  
ATOM 5936   H HG23 . THR D 1 37  ? 22.848  2.494   -9.933  1.00 5.20  ? 37  THR D HG23 1  
ATOM 5937   N N    . SER D 1 38  ? 24.573  3.913   -5.424  1.00 2.81  ? 38  SER D N    1  
ATOM 5938   C CA   . SER D 1 38  ? 24.958  4.701   -4.262  1.00 2.16  ? 38  SER D CA   1  
ATOM 5939   C C    . SER D 1 38  ? 25.913  5.831   -4.653  1.00 2.10  ? 38  SER D C    1  
ATOM 5940   O O    . SER D 1 38  ? 26.400  5.879   -5.791  1.00 2.66  ? 38  SER D O    1  
ATOM 5941   C CB   . SER D 1 38  ? 25.616  3.785   -3.232  1.00 2.28  ? 38  SER D CB   1  
ATOM 5942   O OG   . SER D 1 38  ? 25.168  2.442   -3.386  1.00 2.92  ? 38  SER D OG   1  
ATOM 5943   H H    . SER D 1 38  ? 25.045  3.076   -5.603  1.00 3.32  ? 38  SER D H    1  
ATOM 5944   H HA   . SER D 1 38  ? 24.065  5.129   -3.834  1.00 1.98  ? 38  SER D HA   1  
ATOM 5945   H HB2  . SER D 1 38  ? 26.688  3.811   -3.362  1.00 2.34  ? 38  SER D HB2  1  
ATOM 5946   H HB3  . SER D 1 38  ? 25.365  4.123   -2.238  1.00 2.13  ? 38  SER D HB3  1  
ATOM 5947   H HG   . SER D 1 38  ? 25.851  1.839   -3.069  1.00 3.29  ? 38  SER D HG   1  
ATOM 5948   N N    . ASP D 1 39  ? 26.169  6.733   -3.708  1.00 1.77  ? 39  ASP D N    1  
ATOM 5949   C CA   . ASP D 1 39  ? 27.075  7.864   -3.920  1.00 2.10  ? 39  ASP D CA   1  
ATOM 5950   C C    . ASP D 1 39  ? 28.281  7.703   -2.999  1.00 1.78  ? 39  ASP D C    1  
ATOM 5951   O O    . ASP D 1 39  ? 28.390  8.392   -1.984  1.00 1.95  ? 39  ASP D O    1  
ATOM 5952   C CB   . ASP D 1 39  ? 26.380  9.202   -3.606  1.00 2.56  ? 39  ASP D CB   1  
ATOM 5953   C CG   . ASP D 1 39  ? 25.136  9.461   -4.437  1.00 2.98  ? 39  ASP D CG   1  
ATOM 5954   O OD1  . ASP D 1 39  ? 24.859  8.692   -5.378  1.00 2.84  ? 39  ASP D OD1  1  
ATOM 5955   O OD2  . ASP D 1 39  ? 24.425  10.452  -4.159  1.00 3.58  ? 39  ASP D OD2  1  
ATOM 5956   H H    . ASP D 1 39  ? 25.744  6.625   -2.820  1.00 1.60  ? 39  ASP D H    1  
ATOM 5957   H HA   . ASP D 1 39  ? 27.403  7.856   -4.949  1.00 2.51  ? 39  ASP D HA   1  
ATOM 5958   H HB2  . ASP D 1 39  ? 26.096  9.211   -2.564  1.00 2.42  ? 39  ASP D HB2  1  
ATOM 5959   H HB3  . ASP D 1 39  ? 27.079  10.007  -3.785  1.00 2.96  ? 39  ASP D HB3  1  
ATOM 5960   N N    . PRO D 1 40  ? 29.207  6.791   -3.334  1.00 1.62  ? 40  PRO D N    1  
ATOM 5961   C CA   . PRO D 1 40  ? 30.363  6.505   -2.507  1.00 1.31  ? 40  PRO D CA   1  
ATOM 5962   C C    . PRO D 1 40  ? 31.634  7.279   -2.870  1.00 1.57  ? 40  PRO D C    1  
ATOM 5963   O O    . PRO D 1 40  ? 31.981  7.457   -4.044  1.00 2.15  ? 40  PRO D O    1  
ATOM 5964   C CB   . PRO D 1 40  ? 30.565  5.012   -2.757  1.00 1.56  ? 40  PRO D CB   1  
ATOM 5965   C CG   . PRO D 1 40  ? 30.057  4.766   -4.148  1.00 2.14  ? 40  PRO D CG   1  
ATOM 5966   C CD   . PRO D 1 40  ? 29.210  5.957   -4.542  1.00 2.11  ? 40  PRO D CD   1  
ATOM 5967   H HA   . PRO D 1 40  ? 30.144  6.659   -1.464  1.00 1.20  ? 40  PRO D HA   1  
ATOM 5968   H HB2  . PRO D 1 40  ? 31.616  4.774   -2.674  1.00 1.64  ? 40  PRO D HB2  1  
ATOM 5969   H HB3  . PRO D 1 40  ? 30.005  4.445   -2.028  1.00 1.63  ? 40  PRO D HB3  1  
ATOM 5970   H HG2  . PRO D 1 40  ? 30.890  4.663   -4.826  1.00 2.58  ? 40  PRO D HG2  1  
ATOM 5971   H HG3  . PRO D 1 40  ? 29.458  3.867   -4.159  1.00 2.40  ? 40  PRO D HG3  1  
ATOM 5972   H HD2  . PRO D 1 40  ? 29.662  6.484   -5.370  1.00 2.58  ? 40  PRO D HD2  1  
ATOM 5973   H HD3  . PRO D 1 40  ? 28.209  5.641   -4.794  1.00 2.20  ? 40  PRO D HD3  1  
ATOM 5974   N N    . TYR D 1 41  ? 32.316  7.728   -1.831  1.00 1.49  ? 41  TYR D N    1  
ATOM 5975   C CA   . TYR D 1 41  ? 33.578  8.436   -1.949  1.00 1.84  ? 41  TYR D CA   1  
ATOM 5976   C C    . TYR D 1 41  ? 34.494  7.939   -0.835  1.00 1.44  ? 41  TYR D C    1  
ATOM 5977   O O    . TYR D 1 41  ? 34.009  7.422   0.173   1.00 1.50  ? 41  TYR D O    1  
ATOM 5978   C CB   . TYR D 1 41  ? 33.376  9.957   -1.877  1.00 2.67  ? 41  TYR D CB   1  
ATOM 5979   C CG   . TYR D 1 41  ? 32.893  10.467  -0.539  1.00 2.95  ? 41  TYR D CG   1  
ATOM 5980   C CD1  . TYR D 1 41  ? 33.798  10.832  0.445   1.00 3.30  ? 41  TYR D CD1  1  
ATOM 5981   C CD2  . TYR D 1 41  ? 31.537  10.593  -0.266  1.00 3.09  ? 41  TYR D CD2  1  
ATOM 5982   C CE1  . TYR D 1 41  ? 33.369  11.305  1.664   1.00 3.87  ? 41  TYR D CE1  1  
ATOM 5983   C CE2  . TYR D 1 41  ? 31.098  11.072  0.955   1.00 3.66  ? 41  TYR D CE2  1  
ATOM 5984   C CZ   . TYR D 1 41  ? 32.021  11.424  1.917   1.00 4.08  ? 41  TYR D CZ   1  
ATOM 5985   O OH   . TYR D 1 41  ? 31.603  11.905  3.137   1.00 4.79  ? 41  TYR D OH   1  
ATOM 5986   H H    . TYR D 1 41  ? 31.944  7.580   -0.929  1.00 1.45  ? 41  TYR D H    1  
ATOM 5987   H HA   . TYR D 1 41  ? 34.015  8.177   -2.903  1.00 2.04  ? 41  TYR D HA   1  
ATOM 5988   H HB2  . TYR D 1 41  ? 34.314  10.444  -2.092  1.00 3.00  ? 41  TYR D HB2  1  
ATOM 5989   H HB3  . TYR D 1 41  ? 32.652  10.248  -2.623  1.00 2.95  ? 41  TYR D HB3  1  
ATOM 5990   H HD1  . TYR D 1 41  ? 34.856  10.738  0.245   1.00 3.22  ? 41  TYR D HD1  1  
ATOM 5991   H HD2  . TYR D 1 41  ? 30.819  10.312  -1.022  1.00 2.87  ? 41  TYR D HD2  1  
ATOM 5992   H HE1  . TYR D 1 41  ? 34.092  11.580  2.419   1.00 4.22  ? 41  TYR D HE1  1  
ATOM 5993   H HE2  . TYR D 1 41  ? 30.041  11.163  1.153   1.00 3.86  ? 41  TYR D HE2  1  
ATOM 5994   H HH   . TYR D 1 41  ? 32.102  12.715  3.347   1.00 5.21  ? 41  TYR D HH   1  
ATOM 5995   N N    . VAL D 1 42  ? 35.795  8.081   -0.999  1.00 1.39  ? 42  VAL D N    1  
ATOM 5996   C CA   . VAL D 1 42  ? 36.728  7.588   0.006   1.00 1.07  ? 42  VAL D CA   1  
ATOM 5997   C C    . VAL D 1 42  ? 37.221  8.691   0.936   1.00 1.70  ? 42  VAL D C    1  
ATOM 5998   O O    . VAL D 1 42  ? 37.599  9.778   0.500   1.00 2.18  ? 42  VAL D O    1  
ATOM 5999   C CB   . VAL D 1 42  ? 37.940  6.878   -0.636  1.00 0.99  ? 42  VAL D CB   1  
ATOM 6000   C CG1  . VAL D 1 42  ? 37.551  5.488   -1.114  1.00 1.29  ? 42  VAL D CG1  1  
ATOM 6001   C CG2  . VAL D 1 42  ? 38.511  7.697   -1.787  1.00 1.73  ? 42  VAL D CG2  1  
ATOM 6002   H H    . VAL D 1 42  ? 36.138  8.542   -1.794  1.00 1.78  ? 42  VAL D H    1  
ATOM 6003   H HA   . VAL D 1 42  ? 36.200  6.858   0.602   1.00 1.02  ? 42  VAL D HA   1  
ATOM 6004   H HB   . VAL D 1 42  ? 38.707  6.772   0.117   1.00 0.85  ? 42  VAL D HB   1  
ATOM 6005   H HG11 . VAL D 1 42  ? 38.412  5.005   -1.553  1.00 1.75  ? 42  VAL D HG11 1  
ATOM 6006   H HG12 . VAL D 1 42  ? 36.767  5.569   -1.852  1.00 1.44  ? 42  VAL D HG12 1  
ATOM 6007   H HG13 . VAL D 1 42  ? 37.199  4.905   -0.276  1.00 1.39  ? 42  VAL D HG13 1  
ATOM 6008   H HG21 . VAL D 1 42  ? 37.758  7.815   -2.551  1.00 2.07  ? 42  VAL D HG21 1  
ATOM 6009   H HG22 . VAL D 1 42  ? 39.369  7.188   -2.201  1.00 2.05  ? 42  VAL D HG22 1  
ATOM 6010   H HG23 . VAL D 1 42  ? 38.810  8.668   -1.423  1.00 2.00  ? 42  VAL D HG23 1  
ATOM 6011   N N    . LYS D 1 43  ? 37.200  8.400   2.225   1.00 2.06  ? 43  LYS D N    1  
ATOM 6012   C CA   . LYS D 1 43  ? 37.669  9.332   3.233   1.00 2.81  ? 43  LYS D CA   1  
ATOM 6013   C C    . LYS D 1 43  ? 38.792  8.675   4.018   1.00 2.82  ? 43  LYS D C    1  
ATOM 6014   O O    . LYS D 1 43  ? 38.611  7.611   4.616   1.00 2.89  ? 43  LYS D O    1  
ATOM 6015   C CB   . LYS D 1 43  ? 36.533  9.779   4.165   1.00 3.57  ? 43  LYS D CB   1  
ATOM 6016   C CG   . LYS D 1 43  ? 35.611  8.655   4.614   1.00 3.58  ? 43  LYS D CG   1  
ATOM 6017   C CD   . LYS D 1 43  ? 34.623  9.128   5.671   1.00 4.47  ? 43  LYS D CD   1  
ATOM 6018   C CE   . LYS D 1 43  ? 33.613  10.114  5.103   1.00 4.75  ? 43  LYS D CE   1  
ATOM 6019   N NZ   . LYS D 1 43  ? 33.796  11.488  5.646   1.00 5.50  ? 43  LYS D NZ   1  
ATOM 6020   H H    . LYS D 1 43  ? 36.877  7.514   2.510   1.00 2.00  ? 43  LYS D H    1  
ATOM 6021   H HA   . LYS D 1 43  ? 38.067  10.198  2.721   1.00 2.97  ? 43  LYS D HA   1  
ATOM 6022   H HB2  . LYS D 1 43  ? 36.967  10.228  5.047   1.00 4.13  ? 43  LYS D HB2  1  
ATOM 6023   H HB3  . LYS D 1 43  ? 35.937  10.520  3.655   1.00 3.77  ? 43  LYS D HB3  1  
ATOM 6024   H HG2  . LYS D 1 43  ? 35.060  8.290   3.759   1.00 3.21  ? 43  LYS D HG2  1  
ATOM 6025   H HG3  . LYS D 1 43  ? 36.212  7.856   5.025   1.00 3.51  ? 43  LYS D HG3  1  
ATOM 6026   H HD2  . LYS D 1 43  ? 34.091  8.272   6.057   1.00 4.62  ? 43  LYS D HD2  1  
ATOM 6027   H HD3  . LYS D 1 43  ? 35.167  9.606   6.471   1.00 4.92  ? 43  LYS D HD3  1  
ATOM 6028   H HE2  . LYS D 1 43  ? 33.727  10.144  4.030   1.00 4.59  ? 43  LYS D HE2  1  
ATOM 6029   H HE3  . LYS D 1 43  ? 32.619  9.769   5.346   1.00 4.82  ? 43  LYS D HE3  1  
ATOM 6030   H HZ1  . LYS D 1 43  ? 32.994  12.093  5.366   1.00 5.61  ? 43  LYS D HZ1  1  
ATOM 6031   H HZ2  . LYS D 1 43  ? 34.670  11.913  5.265   1.00 5.95  ? 43  LYS D HZ2  1  
ATOM 6032   H HZ3  . LYS D 1 43  ? 33.854  11.465  6.682   1.00 5.75  ? 43  LYS D HZ3  1  
ATOM 6033   N N    . VAL D 1 44  ? 39.957  9.293   3.983   1.00 2.94  ? 44  VAL D N    1  
ATOM 6034   C CA   . VAL D 1 44  ? 41.122  8.755   4.666   1.00 2.97  ? 44  VAL D CA   1  
ATOM 6035   C C    . VAL D 1 44  ? 41.034  8.932   6.176   1.00 3.87  ? 44  VAL D C    1  
ATOM 6036   O O    . VAL D 1 44  ? 40.690  10.005  6.677   1.00 4.51  ? 44  VAL D O    1  
ATOM 6037   C CB   . VAL D 1 44  ? 42.428  9.396   4.154   1.00 2.83  ? 44  VAL D CB   1  
ATOM 6038   C CG1  . VAL D 1 44  ? 42.761  8.893   2.761   1.00 2.15  ? 44  VAL D CG1  1  
ATOM 6039   C CG2  . VAL D 1 44  ? 42.323  10.912  4.158   1.00 3.51  ? 44  VAL D CG2  1  
ATOM 6040   H H    . VAL D 1 44  ? 40.036  10.136  3.490   1.00 3.14  ? 44  VAL D H    1  
ATOM 6041   H HA   . VAL D 1 44  ? 41.165  7.697   4.448   1.00 2.58  ? 44  VAL D HA   1  
ATOM 6042   H HB   . VAL D 1 44  ? 43.230  9.111   4.817   1.00 3.11  ? 44  VAL D HB   1  
ATOM 6043   H HG11 . VAL D 1 44  ? 42.897  7.822   2.787   1.00 2.09  ? 44  VAL D HG11 1  
ATOM 6044   H HG12 . VAL D 1 44  ? 43.671  9.362   2.418   1.00 2.24  ? 44  VAL D HG12 1  
ATOM 6045   H HG13 . VAL D 1 44  ? 41.954  9.137   2.088   1.00 2.17  ? 44  VAL D HG13 1  
ATOM 6046   H HG21 . VAL D 1 44  ? 41.523  11.219  3.501   1.00 3.53  ? 44  VAL D HG21 1  
ATOM 6047   H HG22 . VAL D 1 44  ? 43.254  11.338  3.811   1.00 3.62  ? 44  VAL D HG22 1  
ATOM 6048   H HG23 . VAL D 1 44  ? 42.118  11.259  5.160   1.00 4.14  ? 44  VAL D HG23 1  
ATOM 6049   N N    . PHE D 1 45  ? 41.337  7.861   6.891   1.00 4.05  ? 45  PHE D N    1  
ATOM 6050   C CA   . PHE D 1 45  ? 41.329  7.873   8.340   1.00 4.95  ? 45  PHE D CA   1  
ATOM 6051   C C    . PHE D 1 45  ? 42.638  7.291   8.848   1.00 5.06  ? 45  PHE D C    1  
ATOM 6052   O O    . PHE D 1 45  ? 43.240  6.434   8.200   1.00 4.58  ? 45  PHE D O    1  
ATOM 6053   C CB   . PHE D 1 45  ? 40.135  7.088   8.894   1.00 5.38  ? 45  PHE D CB   1  
ATOM 6054   C CG   . PHE D 1 45  ? 38.866  7.892   8.953   1.00 5.87  ? 45  PHE D CG   1  
ATOM 6055   C CD1  . PHE D 1 45  ? 38.827  9.098   9.637   1.00 6.56  ? 45  PHE D CD1  1  
ATOM 6056   C CD2  . PHE D 1 45  ? 37.715  7.449   8.320   1.00 5.74  ? 45  PHE D CD2  1  
ATOM 6057   C CE1  . PHE D 1 45  ? 37.666  9.844   9.692   1.00 7.09  ? 45  PHE D CE1  1  
ATOM 6058   C CE2  . PHE D 1 45  ? 36.552  8.193   8.371   1.00 6.25  ? 45  PHE D CE2  1  
ATOM 6059   C CZ   . PHE D 1 45  ? 36.527  9.392   9.058   1.00 6.92  ? 45  PHE D CZ   1  
ATOM 6060   H H    . PHE D 1 45  ? 41.581  7.030   6.426   1.00 3.67  ? 45  PHE D H    1  
ATOM 6061   H HA   . PHE D 1 45  ? 41.258  8.902   8.660   1.00 5.31  ? 45  PHE D HA   1  
ATOM 6062   H HB2  . PHE D 1 45  ? 39.955  6.230   8.264   1.00 4.97  ? 45  PHE D HB2  1  
ATOM 6063   H HB3  . PHE D 1 45  ? 40.366  6.753   9.895   1.00 5.83  ? 45  PHE D HB3  1  
ATOM 6064   H HD1  . PHE D 1 45  ? 39.718  9.452   10.135  1.00 6.74  ? 45  PHE D HD1  1  
ATOM 6065   H HD2  . PHE D 1 45  ? 37.729  6.512   7.784   1.00 5.30  ? 45  PHE D HD2  1  
ATOM 6066   H HE1  . PHE D 1 45  ? 37.652  10.782  10.230  1.00 7.68  ? 45  PHE D HE1  1  
ATOM 6067   H HE2  . PHE D 1 45  ? 35.661  7.839   7.874   1.00 6.19  ? 45  PHE D HE2  1  
ATOM 6068   H HZ   . PHE D 1 45  ? 35.617  9.974   9.096   1.00 7.37  ? 45  PHE D HZ   1  
ATOM 6069   N N    . LEU D 1 46  ? 43.085  7.764   9.992   1.00 5.73  ? 46  LEU D N    1  
ATOM 6070   C CA   . LEU D 1 46  ? 44.339  7.304   10.553  1.00 5.90  ? 46  LEU D CA   1  
ATOM 6071   C C    . LEU D 1 46  ? 44.161  6.826   11.984  1.00 6.77  ? 46  LEU D C    1  
ATOM 6072   O O    . LEU D 1 46  ? 43.089  6.960   12.574  1.00 7.26  ? 46  LEU D O    1  
ATOM 6073   C CB   . LEU D 1 46  ? 45.373  8.437   10.517  1.00 5.92  ? 46  LEU D CB   1  
ATOM 6074   C CG   . LEU D 1 46  ? 46.429  8.358   9.406   1.00 5.16  ? 46  LEU D CG   1  
ATOM 6075   C CD1  . LEU D 1 46  ? 47.350  7.169   9.619   1.00 5.06  ? 46  LEU D CD1  1  
ATOM 6076   C CD2  . LEU D 1 46  ? 45.777  8.298   8.029   1.00 4.40  ? 46  LEU D CD2  1  
ATOM 6077   H H    . LEU D 1 46  ? 42.558  8.429   10.479  1.00 6.15  ? 46  LEU D H    1  
ATOM 6078   H HA   . LEU D 1 46  ? 44.695  6.481   9.950   1.00 5.45  ? 46  LEU D HA   1  
ATOM 6079   H HB2  . LEU D 1 46  ? 44.841  9.370   10.408  1.00 6.08  ? 46  LEU D HB2  1  
ATOM 6080   H HB3  . LEU D 1 46  ? 45.887  8.450   11.467  1.00 6.45  ? 46  LEU D HB3  1  
ATOM 6081   H HG   . LEU D 1 46  ? 47.037  9.250   9.443   1.00 5.32  ? 46  LEU D HG   1  
ATOM 6082   H HD11 . LEU D 1 46  ? 47.994  7.362   10.464  1.00 5.55  ? 46  LEU D HD11 1  
ATOM 6083   H HD12 . LEU D 1 46  ? 47.952  7.017   8.735   1.00 4.58  ? 46  LEU D HD12 1  
ATOM 6084   H HD13 . LEU D 1 46  ? 46.762  6.285   9.813   1.00 5.13  ? 46  LEU D HD13 1  
ATOM 6085   H HD21 . LEU D 1 46  ? 46.539  8.344   7.266   1.00 3.93  ? 46  LEU D HD21 1  
ATOM 6086   H HD22 . LEU D 1 46  ? 45.102  9.134   7.914   1.00 4.59  ? 46  LEU D HD22 1  
ATOM 6087   H HD23 . LEU D 1 46  ? 45.226  7.374   7.931   1.00 4.26  ? 46  LEU D HD23 1  
ATOM 6088   N N    . LEU D 1 47  ? 45.226  6.254   12.515  1.00 6.97  ? 47  LEU D N    1  
ATOM 6089   C CA   . LEU D 1 47  ? 45.267  5.772   13.886  1.00 7.82  ? 47  LEU D CA   1  
ATOM 6090   C C    . LEU D 1 47  ? 45.378  6.988   14.829  1.00 8.41  ? 47  LEU D C    1  
ATOM 6091   O O    . LEU D 1 47  ? 45.183  8.110   14.360  1.00 8.22  ? 47  LEU D O    1  
ATOM 6092   C CB   . LEU D 1 47  ? 46.458  4.804   14.024  1.00 7.82  ? 47  LEU D CB   1  
ATOM 6093   C CG   . LEU D 1 47  ? 47.839  5.456   14.174  1.00 7.73  ? 47  LEU D CG   1  
ATOM 6094   C CD1  . LEU D 1 47  ? 48.842  4.451   14.709  1.00 8.05  ? 47  LEU D CD1  1  
ATOM 6095   C CD2  . LEU D 1 47  ? 48.324  6.019   12.850  1.00 6.87  ? 47  LEU D CD2  1  
ATOM 6096   H H    . LEU D 1 47  ? 46.020  6.140   11.956  1.00 6.54  ? 47  LEU D H    1  
ATOM 6097   H HA   . LEU D 1 47  ? 44.345  5.246   14.089  1.00 8.06  ? 47  LEU D HA   1  
ATOM 6098   H HB2  . LEU D 1 47  ? 46.285  4.178   14.884  1.00 8.42  ? 47  LEU D HB2  1  
ATOM 6099   H HB3  . LEU D 1 47  ? 46.480  4.175   13.147  1.00 7.35  ? 47  LEU D HB3  1  
ATOM 6100   H HG   . LEU D 1 47  ? 47.770  6.270   14.881  1.00 8.13  ? 47  LEU D HG   1  
ATOM 6101   H HD11 . LEU D 1 47  ? 49.801  4.932   14.837  1.00 7.97  ? 47  LEU D HD11 1  
ATOM 6102   H HD12 . LEU D 1 47  ? 48.940  3.632   14.010  1.00 7.81  ? 47  LEU D HD12 1  
ATOM 6103   H HD13 . LEU D 1 47  ? 48.500  4.073   15.660  1.00 8.68  ? 47  LEU D HD13 1  
ATOM 6104   H HD21 . LEU D 1 47  ? 47.648  6.792   12.521  1.00 6.73  ? 47  LEU D HD21 1  
ATOM 6105   H HD22 . LEU D 1 47  ? 48.355  5.230   12.113  1.00 6.55  ? 47  LEU D HD22 1  
ATOM 6106   H HD23 . LEU D 1 47  ? 49.312  6.435   12.976  1.00 6.83  ? 47  LEU D HD23 1  
ATOM 6107   N N    . PRO D 1 48  ? 45.653  6.821   16.156  1.00 9.19  ? 48  PRO D N    1  
ATOM 6108   C CA   . PRO D 1 48  ? 45.789  7.955   17.099  1.00 9.82  ? 48  PRO D CA   1  
ATOM 6109   C C    . PRO D 1 48  ? 46.606  9.146   16.570  1.00 9.51  ? 48  PRO D C    1  
ATOM 6110   O O    . PRO D 1 48  ? 46.549  10.233  17.146  1.00 10.01 ? 48  PRO D O    1  
ATOM 6111   C CB   . PRO D 1 48  ? 46.487  7.315   18.287  1.00 10.42 ? 48  PRO D CB   1  
ATOM 6112   C CG   . PRO D 1 48  ? 45.932  5.938   18.321  1.00 10.48 ? 48  PRO D CG   1  
ATOM 6113   C CD   . PRO D 1 48  ? 45.774  5.529   16.879  1.00 9.62  ? 48  PRO D CD   1  
ATOM 6114   H HA   . PRO D 1 48  ? 44.819  8.312   17.412  1.00 10.17 ? 48  PRO D HA   1  
ATOM 6115   H HB2  . PRO D 1 48  ? 47.555  7.314   18.125  1.00 10.18 ? 48  PRO D HB2  1  
ATOM 6116   H HB3  . PRO D 1 48  ? 46.251  7.859   19.188  1.00 11.03 ? 48  PRO D HB3  1  
ATOM 6117   H HG2  . PRO D 1 48  ? 46.618  5.276   18.828  1.00 10.70 ? 48  PRO D HG2  1  
ATOM 6118   H HG3  . PRO D 1 48  ? 44.972  5.940   18.816  1.00 10.93 ? 48  PRO D HG3  1  
ATOM 6119   H HD2  . PRO D 1 48  ? 46.645  4.985   16.549  1.00 9.33  ? 48  PRO D HD2  1  
ATOM 6120   H HD3  . PRO D 1 48  ? 44.884  4.932   16.751  1.00 9.69  ? 48  PRO D HD3  1  
ATOM 6121   N N    . ASP D 1 49  ? 47.388  8.930   15.510  1.00 8.76  ? 49  ASP D N    1  
ATOM 6122   C CA   . ASP D 1 49  ? 48.169  9.997   14.884  1.00 8.45  ? 49  ASP D CA   1  
ATOM 6123   C C    . ASP D 1 49  ? 47.246  11.160  14.543  1.00 8.61  ? 49  ASP D C    1  
ATOM 6124   O O    . ASP D 1 49  ? 47.459  12.285  14.993  1.00 9.13  ? 49  ASP D O    1  
ATOM 6125   C CB   . ASP D 1 49  ? 48.838  9.480   13.604  1.00 7.53  ? 49  ASP D CB   1  
ATOM 6126   C CG   . ASP D 1 49  ? 49.547  10.570  12.815  1.00 7.23  ? 49  ASP D CG   1  
ATOM 6127   O OD1  . ASP D 1 49  ? 50.664  10.962  13.213  1.00 7.44  ? 49  ASP D OD1  1  
ATOM 6128   O OD2  . ASP D 1 49  ? 48.992  11.028  11.785  1.00 6.83  ? 49  ASP D OD2  1  
ATOM 6129   H H    . ASP D 1 49  ? 47.434  8.026   15.138  1.00 8.44  ? 49  ASP D H    1  
ATOM 6130   H HA   . ASP D 1 49  ? 48.924  10.328  15.581  1.00 8.83  ? 49  ASP D HA   1  
ATOM 6131   H HB2  . ASP D 1 49  ? 49.565  8.728   13.869  1.00 7.49  ? 49  ASP D HB2  1  
ATOM 6132   H HB3  . ASP D 1 49  ? 48.085  9.036   12.970  1.00 7.17  ? 49  ASP D HB3  1  
ATOM 6133   N N    . LYS D 1 50  ? 46.215  10.849  13.754  1.00 8.20  ? 50  LYS D N    1  
ATOM 6134   C CA   . LYS D 1 50  ? 45.193  11.810  13.325  1.00 8.33  ? 50  LYS D CA   1  
ATOM 6135   C C    . LYS D 1 50  ? 45.776  13.156  12.881  1.00 8.39  ? 50  LYS D C    1  
ATOM 6136   O O    . LYS D 1 50  ? 45.170  14.205  13.099  1.00 8.89  ? 50  LYS D O    1  
ATOM 6137   C CB   . LYS D 1 50  ? 44.164  12.024  14.442  1.00 9.17  ? 50  LYS D CB   1  
ATOM 6138   C CG   . LYS D 1 50  ? 43.381  10.769  14.812  1.00 9.24  ? 50  LYS D CG   1  
ATOM 6139   C CD   . LYS D 1 50  ? 42.441  10.331  13.694  1.00 8.72  ? 50  LYS D CD   1  
ATOM 6140   C CE   . LYS D 1 50  ? 41.218  11.229  13.593  1.00 9.12  ? 50  LYS D CE   1  
ATOM 6141   N NZ   . LYS D 1 50  ? 40.257  10.991  14.701  1.00 9.92  ? 50  LYS D NZ   1  
ATOM 6142   H H    . LYS D 1 50  ? 46.128  9.919   13.457  1.00 7.83  ? 50  LYS D H    1  
ATOM 6143   H HA   . LYS D 1 50  ? 44.685  11.373  12.479  1.00 7.84  ? 50  LYS D HA   1  
ATOM 6144   H HB2  . LYS D 1 50  ? 44.679  12.370  15.325  1.00 9.65  ? 50  LYS D HB2  1  
ATOM 6145   H HB3  . LYS D 1 50  ? 43.460  12.781  14.127  1.00 9.33  ? 50  LYS D HB3  1  
ATOM 6146   H HG2  . LYS D 1 50  ? 44.080  9.968   15.009  1.00 9.07  ? 50  LYS D HG2  1  
ATOM 6147   H HG3  . LYS D 1 50  ? 42.802  10.967  15.700  1.00 9.89  ? 50  LYS D HG3  1  
ATOM 6148   H HD2  . LYS D 1 50  ? 42.972  10.363  12.755  1.00 8.14  ? 50  LYS D HD2  1  
ATOM 6149   H HD3  . LYS D 1 50  ? 42.116  9.320   13.888  1.00 8.69  ? 50  LYS D HD3  1  
ATOM 6150   H HE2  . LYS D 1 50  ? 41.542  12.258  13.625  1.00 9.28  ? 50  LYS D HE2  1  
ATOM 6151   H HE3  . LYS D 1 50  ? 40.724  11.039  12.652  1.00 8.73  ? 50  LYS D HE3  1  
ATOM 6152   H HZ1  . LYS D 1 50  ? 39.495  11.699  14.673  1.00 10.21 ? 50  LYS D HZ1  1  
ATOM 6153   H HZ2  . LYS D 1 50  ? 40.739  11.058  15.617  1.00 10.23 ? 50  LYS D HZ2  1  
ATOM 6154   H HZ3  . LYS D 1 50  ? 39.835  10.045  14.613  1.00 9.99  ? 50  LYS D HZ3  1  
ATOM 6155   N N    . LYS D 1 51  ? 46.942  13.129  12.252  1.00 7.94  ? 51  LYS D N    1  
ATOM 6156   C CA   . LYS D 1 51  ? 47.567  14.356  11.770  1.00 8.07  ? 51  LYS D CA   1  
ATOM 6157   C C    . LYS D 1 51  ? 47.307  14.503  10.281  1.00 7.46  ? 51  LYS D C    1  
ATOM 6158   O O    . LYS D 1 51  ? 48.143  15.016  9.540   1.00 7.32  ? 51  LYS D O    1  
ATOM 6159   C CB   . LYS D 1 51  ? 49.076  14.341  12.026  1.00 8.07  ? 51  LYS D CB   1  
ATOM 6160   C CG   . LYS D 1 51  ? 49.452  14.327  13.495  1.00 8.78  ? 51  LYS D CG   1  
ATOM 6161   C CD   . LYS D 1 51  ? 50.959  14.290  13.679  1.00 8.75  ? 51  LYS D CD   1  
ATOM 6162   C CE   . LYS D 1 51  ? 51.340  13.867  15.086  1.00 9.28  ? 51  LYS D CE   1  
ATOM 6163   N NZ   . LYS D 1 51  ? 50.809  12.519  15.418  1.00 9.09  ? 51  LYS D NZ   1  
ATOM 6164   H H    . LYS D 1 51  ? 47.399  12.269  12.120  1.00 7.55  ? 51  LYS D H    1  
ATOM 6165   H HA   . LYS D 1 51  ? 47.122  15.191  12.293  1.00 8.70  ? 51  LYS D HA   1  
ATOM 6166   H HB2  . LYS D 1 51  ? 49.498  13.463  11.560  1.00 7.48  ? 51  LYS D HB2  1  
ATOM 6167   H HB3  . LYS D 1 51  ? 49.511  15.219  11.574  1.00 8.18  ? 51  LYS D HB3  1  
ATOM 6168   H HG2  . LYS D 1 51  ? 49.062  15.217  13.965  1.00 9.38  ? 51  LYS D HG2  1  
ATOM 6169   H HG3  . LYS D 1 51  ? 49.019  13.454  13.958  1.00 8.77  ? 51  LYS D HG3  1  
ATOM 6170   H HD2  . LYS D 1 51  ? 51.382  13.588  12.976  1.00 8.12  ? 51  LYS D HD2  1  
ATOM 6171   H HD3  . LYS D 1 51  ? 51.358  15.275  13.488  1.00 9.00  ? 51  LYS D HD3  1  
ATOM 6172   H HE2  . LYS D 1 51  ? 52.416  13.851  15.165  1.00 9.26  ? 51  LYS D HE2  1  
ATOM 6173   H HE3  . LYS D 1 51  ? 50.939  14.586  15.786  1.00 9.89  ? 51  LYS D HE3  1  
ATOM 6174   H HZ1  . LYS D 1 51  ? 51.341  12.112  16.213  1.00 9.35  ? 51  LYS D HZ1  1  
ATOM 6175   H HZ2  . LYS D 1 51  ? 50.896  11.882  14.593  1.00 8.49  ? 51  LYS D HZ2  1  
ATOM 6176   H HZ3  . LYS D 1 51  ? 49.806  12.588  15.685  1.00 9.36  ? 51  LYS D HZ3  1  
ATOM 6177   N N    . LYS D 1 52  ? 46.153  14.015  9.846   1.00 7.13  ? 52  LYS D N    1  
ATOM 6178   C CA   . LYS D 1 52  ? 45.773  14.067  8.443   1.00 6.58  ? 52  LYS D CA   1  
ATOM 6179   C C    . LYS D 1 52  ? 44.336  13.598  8.266   1.00 6.38  ? 52  LYS D C    1  
ATOM 6180   O O    . LYS D 1 52  ? 43.903  12.649  8.919   1.00 6.32  ? 52  LYS D O    1  
ATOM 6181   C CB   . LYS D 1 52  ? 46.710  13.184  7.611   1.00 5.78  ? 52  LYS D CB   1  
ATOM 6182   C CG   . LYS D 1 52  ? 46.911  11.795  8.204   1.00 5.38  ? 52  LYS D CG   1  
ATOM 6183   C CD   . LYS D 1 52  ? 48.098  11.069  7.588   1.00 4.80  ? 52  LYS D CD   1  
ATOM 6184   C CE   . LYS D 1 52  ? 49.421  11.733  7.935   1.00 5.24  ? 52  LYS D CE   1  
ATOM 6185   N NZ   . LYS D 1 52  ? 49.484  12.212  9.346   1.00 6.00  ? 52  LYS D NZ   1  
ATOM 6186   H H    . LYS D 1 52  ? 45.531  13.613  10.490  1.00 7.32  ? 52  LYS D H    1  
ATOM 6187   H HA   . LYS D 1 52  ? 45.857  15.090  8.109   1.00 6.96  ? 52  LYS D HA   1  
ATOM 6188   H HB2  . LYS D 1 52  ? 46.297  13.073  6.618   1.00 5.37  ? 52  LYS D HB2  1  
ATOM 6189   H HB3  . LYS D 1 52  ? 47.672  13.665  7.540   1.00 5.95  ? 52  LYS D HB3  1  
ATOM 6190   H HG2  . LYS D 1 52  ? 47.079  11.893  9.265   1.00 5.92  ? 52  LYS D HG2  1  
ATOM 6191   H HG3  . LYS D 1 52  ? 46.017  11.214  8.035   1.00 5.08  ? 52  LYS D HG3  1  
ATOM 6192   H HD2  . LYS D 1 52  ? 48.116  10.052  7.952   1.00 4.55  ? 52  LYS D HD2  1  
ATOM 6193   H HD3  . LYS D 1 52  ? 47.980  11.064  6.513   1.00 4.44  ? 52  LYS D HD3  1  
ATOM 6194   H HE2  . LYS D 1 52  ? 50.214  11.019  7.776   1.00 5.00  ? 52  LYS D HE2  1  
ATOM 6195   H HE3  . LYS D 1 52  ? 49.565  12.574  7.274   1.00 5.37  ? 52  LYS D HE3  1  
ATOM 6196   H HZ1  . LYS D 1 52  ? 48.767  12.945  9.505   1.00 6.43  ? 52  LYS D HZ1  1  
ATOM 6197   H HZ2  . LYS D 1 52  ? 50.422  12.620  9.540   1.00 6.12  ? 52  LYS D HZ2  1  
ATOM 6198   H HZ3  . LYS D 1 52  ? 49.316  11.424  10.013  1.00 6.10  ? 52  LYS D HZ3  1  
ATOM 6199   N N    . LYS D 1 53  ? 43.608  14.278  7.393   1.00 6.37  ? 53  LYS D N    1  
ATOM 6200   C CA   . LYS D 1 53  ? 42.224  13.935  7.098   1.00 6.17  ? 53  LYS D CA   1  
ATOM 6201   C C    . LYS D 1 53  ? 41.785  14.679  5.845   1.00 6.07  ? 53  LYS D C    1  
ATOM 6202   O O    . LYS D 1 53  ? 41.848  15.907  5.792   1.00 6.64  ? 53  LYS D O    1  
ATOM 6203   C CB   . LYS D 1 53  ? 41.301  14.288  8.268   1.00 6.89  ? 53  LYS D CB   1  
ATOM 6204   C CG   . LYS D 1 53  ? 40.106  13.353  8.406   1.00 6.70  ? 53  LYS D CG   1  
ATOM 6205   C CD   . LYS D 1 53  ? 39.101  13.872  9.422   1.00 7.47  ? 53  LYS D CD   1  
ATOM 6206   C CE   . LYS D 1 53  ? 38.272  15.016  8.856   1.00 7.97  ? 53  LYS D CE   1  
ATOM 6207   N NZ   . LYS D 1 53  ? 37.422  15.655  9.893   1.00 8.67  ? 53  LYS D NZ   1  
ATOM 6208   H H    . LYS D 1 53  ? 44.013  15.043  6.930   1.00 6.56  ? 53  LYS D H    1  
ATOM 6209   H HA   . LYS D 1 53  ? 42.176  12.872  6.911   1.00 5.63  ? 53  LYS D HA   1  
ATOM 6210   H HB2  . LYS D 1 53  ? 41.869  14.251  9.185   1.00 7.16  ? 53  LYS D HB2  1  
ATOM 6211   H HB3  . LYS D 1 53  ? 40.930  15.292  8.124   1.00 7.38  ? 53  LYS D HB3  1  
ATOM 6212   H HG2  . LYS D 1 53  ? 39.617  13.261  7.447   1.00 6.39  ? 53  LYS D HG2  1  
ATOM 6213   H HG3  . LYS D 1 53  ? 40.459  12.381  8.726   1.00 6.36  ? 53  LYS D HG3  1  
ATOM 6214   H HD2  . LYS D 1 53  ? 38.441  13.066  9.705   1.00 7.35  ? 53  LYS D HD2  1  
ATOM 6215   H HD3  . LYS D 1 53  ? 39.635  14.222  10.291  1.00 7.86  ? 53  LYS D HD3  1  
ATOM 6216   H HE2  . LYS D 1 53  ? 38.937  15.760  8.443   1.00 8.22  ? 53  LYS D HE2  1  
ATOM 6217   H HE3  . LYS D 1 53  ? 37.637  14.630  8.075   1.00 7.65  ? 53  LYS D HE3  1  
ATOM 6218   H HZ1  . LYS D 1 53  ? 36.725  14.973  10.258  1.00 8.97  ? 53  LYS D HZ1  1  
ATOM 6219   H HZ2  . LYS D 1 53  ? 36.916  16.465  9.488   1.00 8.68  ? 53  LYS D HZ2  1  
ATOM 6220   H HZ3  . LYS D 1 53  ? 38.012  15.991  10.681  1.00 9.00  ? 53  LYS D HZ3  1  
ATOM 6221   N N    . PHE D 1 54  ? 41.352  13.940  4.838   1.00 5.42  ? 54  PHE D N    1  
ATOM 6222   C CA   . PHE D 1 54  ? 40.934  14.548  3.586   1.00 5.41  ? 54  PHE D CA   1  
ATOM 6223   C C    . PHE D 1 54  ? 39.703  13.860  3.018   1.00 5.01  ? 54  PHE D C    1  
ATOM 6224   O O    . PHE D 1 54  ? 39.594  12.635  3.045   1.00 4.36  ? 54  PHE D O    1  
ATOM 6225   C CB   . PHE D 1 54  ? 42.079  14.489  2.568   1.00 5.07  ? 54  PHE D CB   1  
ATOM 6226   C CG   . PHE D 1 54  ? 41.798  15.227  1.287   1.00 5.35  ? 54  PHE D CG   1  
ATOM 6227   C CD1  . PHE D 1 54  ? 41.822  16.612  1.251   1.00 6.17  ? 54  PHE D CD1  1  
ATOM 6228   C CD2  . PHE D 1 54  ? 41.508  14.533  0.120   1.00 4.92  ? 54  PHE D CD2  1  
ATOM 6229   C CE1  . PHE D 1 54  ? 41.568  17.292  0.076   1.00 6.56  ? 54  PHE D CE1  1  
ATOM 6230   C CE2  . PHE D 1 54  ? 41.253  15.210  -1.058  1.00 5.39  ? 54  PHE D CE2  1  
ATOM 6231   C CZ   . PHE D 1 54  ? 41.281  16.590  -1.079  1.00 6.20  ? 54  PHE D CZ   1  
ATOM 6232   H H    . PHE D 1 54  ? 41.297  12.966  4.942   1.00 5.02  ? 54  PHE D H    1  
ATOM 6233   H HA   . PHE D 1 54  ? 40.696  15.581  3.784   1.00 6.05  ? 54  PHE D HA   1  
ATOM 6234   H HB2  . PHE D 1 54  ? 42.964  14.920  3.009   1.00 5.32  ? 54  PHE D HB2  1  
ATOM 6235   H HB3  . PHE D 1 54  ? 42.273  13.457  2.320   1.00 4.44  ? 54  PHE D HB3  1  
ATOM 6236   H HD1  . PHE D 1 54  ? 42.046  17.161  2.154   1.00 6.56  ? 54  PHE D HD1  1  
ATOM 6237   H HD2  . PHE D 1 54  ? 41.485  13.455  0.135   1.00 4.32  ? 54  PHE D HD2  1  
ATOM 6238   H HE1  . PHE D 1 54  ? 41.592  18.371  0.061   1.00 7.23  ? 54  PHE D HE1  1  
ATOM 6239   H HE2  . PHE D 1 54  ? 41.028  14.661  -1.961  1.00 5.21  ? 54  PHE D HE2  1  
ATOM 6240   H HZ   . PHE D 1 54  ? 41.081  17.121  -1.997  1.00 6.63  ? 54  PHE D HZ   1  
ATOM 6241   N N    . GLU D 1 55  ? 38.785  14.666  2.509   1.00 5.46  ? 55  GLU D N    1  
ATOM 6242   C CA   . GLU D 1 55  ? 37.562  14.164  1.907   1.00 5.17  ? 55  GLU D CA   1  
ATOM 6243   C C    . GLU D 1 55  ? 37.681  14.264  0.388   1.00 5.10  ? 55  GLU D C    1  
ATOM 6244   O O    . GLU D 1 55  ? 38.015  15.329  -0.139  1.00 5.75  ? 55  GLU D O    1  
ATOM 6245   C CB   . GLU D 1 55  ? 36.361  14.980  2.397   1.00 5.84  ? 55  GLU D CB   1  
ATOM 6246   C CG   . GLU D 1 55  ? 35.038  14.236  2.336   1.00 5.59  ? 55  GLU D CG   1  
ATOM 6247   C CD   . GLU D 1 55  ? 34.603  13.703  3.689   1.00 5.80  ? 55  GLU D CD   1  
ATOM 6248   O OE1  . GLU D 1 55  ? 35.468  13.277  4.483   1.00 6.22  ? 55  GLU D OE1  1  
ATOM 6249   O OE2  . GLU D 1 55  ? 33.386  13.702  3.968   1.00 5.82  ? 55  GLU D OE2  1  
ATOM 6250   H H    . GLU D 1 55  ? 38.938  15.634  2.530   1.00 6.02  ? 55  GLU D H    1  
ATOM 6251   H HA   . GLU D 1 55  ? 37.440  13.129  2.194   1.00 4.61  ? 55  GLU D HA   1  
ATOM 6252   H HB2  . GLU D 1 55  ? 36.533  15.275  3.421   1.00 6.23  ? 55  GLU D HB2  1  
ATOM 6253   H HB3  . GLU D 1 55  ? 36.275  15.869  1.789   1.00 6.25  ? 55  GLU D HB3  1  
ATOM 6254   H HG2  . GLU D 1 55  ? 34.278  14.913  1.973   1.00 5.91  ? 55  GLU D HG2  1  
ATOM 6255   H HG3  . GLU D 1 55  ? 35.135  13.406  1.651   1.00 5.16  ? 55  GLU D HG3  1  
ATOM 6256   N N    . THR D 1 56  ? 37.424  13.170  -0.314  1.00 4.42  ? 56  THR D N    1  
ATOM 6257   C CA   . THR D 1 56  ? 37.529  13.167  -1.770  1.00 4.53  ? 56  THR D CA   1  
ATOM 6258   C C    . THR D 1 56  ? 36.277  13.749  -2.427  1.00 4.96  ? 56  THR D C    1  
ATOM 6259   O O    . THR D 1 56  ? 35.401  14.291  -1.746  1.00 5.10  ? 56  THR D O    1  
ATOM 6260   C CB   . THR D 1 56  ? 37.785  11.746  -2.309  1.00 3.78  ? 56  THR D CB   1  
ATOM 6261   O OG1  . THR D 1 56  ? 36.835  10.830  -1.753  1.00 3.09  ? 56  THR D OG1  1  
ATOM 6262   C CG2  . THR D 1 56  ? 39.195  11.292  -1.966  1.00 3.58  ? 56  THR D CG2  1  
ATOM 6263   H H    . THR D 1 56  ? 37.151  12.350  0.150   1.00 3.92  ? 56  THR D H    1  
ATOM 6264   H HA   . THR D 1 56  ? 38.374  13.784  -2.037  1.00 4.96  ? 56  THR D HA   1  
ATOM 6265   H HB   . THR D 1 56  ? 37.679  11.758  -3.383  1.00 4.05  ? 56  THR D HB   1  
ATOM 6266   H HG1  . THR D 1 56  ? 37.193  10.457  -0.935  1.00 2.73  ? 56  THR D HG1  1  
ATOM 6267   H HG21 . THR D 1 56  ? 39.414  10.371  -2.487  1.00 3.22  ? 56  THR D HG21 1  
ATOM 6268   H HG22 . THR D 1 56  ? 39.271  11.130  -0.901  1.00 3.35  ? 56  THR D HG22 1  
ATOM 6269   H HG23 . THR D 1 56  ? 39.900  12.052  -2.265  1.00 4.15  ? 56  THR D HG23 1  
ATOM 6270   N N    . LYS D 1 57  ? 36.202  13.644  -3.747  1.00 5.28  ? 57  LYS D N    1  
ATOM 6271   C CA   . LYS D 1 57  ? 35.065  14.161  -4.482  1.00 5.73  ? 57  LYS D CA   1  
ATOM 6272   C C    . LYS D 1 57  ? 33.913  13.169  -4.423  1.00 5.09  ? 57  LYS D C    1  
ATOM 6273   O O    . LYS D 1 57  ? 34.119  11.960  -4.528  1.00 4.52  ? 57  LYS D O    1  
ATOM 6274   C CB   . LYS D 1 57  ? 35.449  14.436  -5.936  1.00 6.39  ? 57  LYS D CB   1  
ATOM 6275   C CG   . LYS D 1 57  ? 34.619  15.531  -6.579  1.00 7.07  ? 57  LYS D CG   1  
ATOM 6276   C CD   . LYS D 1 57  ? 34.936  15.678  -8.057  1.00 7.62  ? 57  LYS D CD   1  
ATOM 6277   C CE   . LYS D 1 57  ? 34.346  16.957  -8.626  1.00 8.39  ? 57  LYS D CE   1  
ATOM 6278   N NZ   . LYS D 1 57  ? 32.870  17.025  -8.455  1.00 8.21  ? 57  LYS D NZ   1  
ATOM 6279   H H    . LYS D 1 57  ? 36.919  13.190  -4.237  1.00 5.28  ? 57  LYS D H    1  
ATOM 6280   H HA   . LYS D 1 57  ? 34.756  15.085  -4.017  1.00 6.13  ? 57  LYS D HA   1  
ATOM 6281   H HB2  . LYS D 1 57  ? 36.487  14.731  -5.974  1.00 6.71  ? 57  LYS D HB2  1  
ATOM 6282   H HB3  . LYS D 1 57  ? 35.320  13.529  -6.510  1.00 6.14  ? 57  LYS D HB3  1  
ATOM 6283   H HG2  . LYS D 1 57  ? 33.573  15.288  -6.468  1.00 6.81  ? 57  LYS D HG2  1  
ATOM 6284   H HG3  . LYS D 1 57  ? 34.829  16.467  -6.080  1.00 7.53  ? 57  LYS D HG3  1  
ATOM 6285   H HD2  . LYS D 1 57  ? 36.009  15.700  -8.187  1.00 7.88  ? 57  LYS D HD2  1  
ATOM 6286   H HD3  . LYS D 1 57  ? 34.524  14.833  -8.588  1.00 7.33  ? 57  LYS D HD3  1  
ATOM 6287   H HE2  . LYS D 1 57  ? 34.795  17.799  -8.122  1.00 8.75  ? 57  LYS D HE2  1  
ATOM 6288   H HE3  . LYS D 1 57  ? 34.582  17.005  -9.677  1.00 8.83  ? 57  LYS D HE3  1  
ATOM 6289   H HZ1  . LYS D 1 57  ? 32.630  17.201  -7.459  1.00 7.99  ? 57  LYS D HZ1  1  
ATOM 6290   H HZ2  . LYS D 1 57  ? 32.433  16.130  -8.751  1.00 8.46  ? 57  LYS D HZ2  1  
ATOM 6291   H HZ3  . LYS D 1 57  ? 32.477  17.797  -9.034  1.00 8.25  ? 57  LYS D HZ3  1  
ATOM 6292   N N    . VAL D 1 58  ? 32.706  13.671  -4.244  1.00 5.25  ? 58  VAL D N    1  
ATOM 6293   C CA   . VAL D 1 58  ? 31.544  12.806  -4.170  1.00 4.70  ? 58  VAL D CA   1  
ATOM 6294   C C    . VAL D 1 58  ? 31.168  12.276  -5.555  1.00 4.76  ? 58  VAL D C    1  
ATOM 6295   O O    . VAL D 1 58  ? 30.862  13.034  -6.482  1.00 5.46  ? 58  VAL D O    1  
ATOM 6296   C CB   . VAL D 1 58  ? 30.335  13.508  -3.502  1.00 5.00  ? 58  VAL D CB   1  
ATOM 6297   C CG1  . VAL D 1 58  ? 29.988  14.809  -4.208  1.00 5.92  ? 58  VAL D CG1  1  
ATOM 6298   C CG2  . VAL D 1 58  ? 29.131  12.580  -3.465  1.00 4.45  ? 58  VAL D CG2  1  
ATOM 6299   H H    . VAL D 1 58  ? 32.593  14.643  -4.160  1.00 5.79  ? 58  VAL D H    1  
ATOM 6300   H HA   . VAL D 1 58  ? 31.817  11.961  -3.552  1.00 4.08  ? 58  VAL D HA   1  
ATOM 6301   H HB   . VAL D 1 58  ? 30.606  13.744  -2.482  1.00 5.04  ? 58  VAL D HB   1  
ATOM 6302   H HG11 . VAL D 1 58  ? 29.130  15.261  -3.730  1.00 6.13  ? 58  VAL D HG11 1  
ATOM 6303   H HG12 . VAL D 1 58  ? 29.757  14.605  -5.242  1.00 6.12  ? 58  VAL D HG12 1  
ATOM 6304   H HG13 . VAL D 1 58  ? 30.828  15.483  -4.154  1.00 6.26  ? 58  VAL D HG13 1  
ATOM 6305   H HG21 . VAL D 1 58  ? 29.378  11.692  -2.898  1.00 3.87  ? 58  VAL D HG21 1  
ATOM 6306   H HG22 . VAL D 1 58  ? 28.860  12.302  -4.472  1.00 4.51  ? 58  VAL D HG22 1  
ATOM 6307   H HG23 . VAL D 1 58  ? 28.302  13.087  -2.995  1.00 4.72  ? 58  VAL D HG23 1  
ATOM 6308   N N    . HIS D 1 59  ? 31.247  10.964  -5.701  1.00 4.17  ? 59  HIS D N    1  
ATOM 6309   C CA   . HIS D 1 59  ? 30.903  10.306  -6.953  1.00 4.43  ? 59  HIS D CA   1  
ATOM 6310   C C    . HIS D 1 59  ? 29.501  9.737   -6.810  1.00 4.14  ? 59  HIS D C    1  
ATOM 6311   O O    . HIS D 1 59  ? 29.320  8.652   -6.265  1.00 3.55  ? 59  HIS D O    1  
ATOM 6312   C CB   . HIS D 1 59  ? 31.895  9.180   -7.296  1.00 4.23  ? 59  HIS D CB   1  
ATOM 6313   C CG   . HIS D 1 59  ? 33.295  9.395   -6.789  1.00 4.20  ? 59  HIS D CG   1  
ATOM 6314   N ND1  . HIS D 1 59  ? 33.790  8.754   -5.675  1.00 3.49  ? 59  HIS D ND1  1  
ATOM 6315   C CD2  . HIS D 1 59  ? 34.311  10.159  -7.259  1.00 4.81  ? 59  HIS D CD2  1  
ATOM 6316   C CE1  . HIS D 1 59  ? 35.046  9.114   -5.481  1.00 3.66  ? 59  HIS D CE1  1  
ATOM 6317   N NE2  . HIS D 1 59  ? 35.389  9.964   -6.429  1.00 4.46  ? 59  HIS D NE2  1  
ATOM 6318   H H    . HIS D 1 59  ? 31.534  10.420  -4.937  1.00 3.65  ? 59  HIS D H    1  
ATOM 6319   H HA   . HIS D 1 59  ? 30.907  11.049  -7.738  1.00 5.10  ? 59  HIS D HA   1  
ATOM 6320   H HB2  . HIS D 1 59  ? 31.534  8.255   -6.872  1.00 3.67  ? 59  HIS D HB2  1  
ATOM 6321   H HB3  . HIS D 1 59  ? 31.947  9.074   -8.371  1.00 4.75  ? 59  HIS D HB3  1  
ATOM 6322   H HD1  . HIS D 1 59  ? 33.286  8.129   -5.100  1.00 2.96  ? 59  HIS D HD1  1  
ATOM 6323   H HD2  . HIS D 1 59  ? 34.279  10.800  -8.130  1.00 5.47  ? 59  HIS D HD2  1  
ATOM 6324   H HE1  . HIS D 1 59  ? 35.684  8.773   -4.679  1.00 3.23  ? 59  HIS D HE1  1  
ATOM 6325   H HE2  . HIS D 1 59  ? 36.187  10.561  -6.383  1.00 4.76  ? 59  HIS D HE2  1  
ATOM 6326   N N    . ARG D 1 60  ? 28.514  10.482  -7.280  1.00 4.62  ? 60  ARG D N    1  
ATOM 6327   C CA   . ARG D 1 60  ? 27.126  10.068  -7.151  1.00 4.42  ? 60  ARG D CA   1  
ATOM 6328   C C    . ARG D 1 60  ? 26.703  9.032   -8.191  1.00 4.47  ? 60  ARG D C    1  
ATOM 6329   O O    . ARG D 1 60  ? 27.157  9.049   -9.337  1.00 5.12  ? 60  ARG D O    1  
ATOM 6330   C CB   . ARG D 1 60  ? 26.198  11.286  -7.229  1.00 5.03  ? 60  ARG D CB   1  
ATOM 6331   C CG   . ARG D 1 60  ? 25.961  11.796  -8.645  1.00 5.89  ? 60  ARG D CG   1  
ATOM 6332   C CD   . ARG D 1 60  ? 24.669  12.588  -8.750  1.00 6.18  ? 60  ARG D CD   1  
ATOM 6333   N NE   . ARG D 1 60  ? 24.252  12.763  -10.139 1.00 6.77  ? 60  ARG D NE   1  
ATOM 6334   C CZ   . ARG D 1 60  ? 23.102  12.310  -10.637 1.00 7.00  ? 60  ARG D CZ   1  
ATOM 6335   N NH1  . ARG D 1 60  ? 22.233  11.682  -9.851  1.00 6.72  ? 60  ARG D NH1  1  
ATOM 6336   N NH2  . ARG D 1 60  ? 22.817  12.494  -11.920 1.00 7.68  ? 60  ARG D NH2  1  
ATOM 6337   H H    . ARG D 1 60  ? 28.722  11.326  -7.729  1.00 5.15  ? 60  ARG D H    1  
ATOM 6338   H HA   . ARG D 1 60  ? 27.016  9.624   -6.174  1.00 3.89  ? 60  ARG D HA   1  
ATOM 6339   H HB2  . ARG D 1 60  ? 25.244  11.019  -6.800  1.00 4.84  ? 60  ARG D HB2  1  
ATOM 6340   H HB3  . ARG D 1 60  ? 26.630  12.087  -6.648  1.00 5.14  ? 60  ARG D HB3  1  
ATOM 6341   H HG2  . ARG D 1 60  ? 26.783  12.432  -8.930  1.00 6.32  ? 60  ARG D HG2  1  
ATOM 6342   H HG3  . ARG D 1 60  ? 25.907  10.953  -9.318  1.00 5.97  ? 60  ARG D HG3  1  
ATOM 6343   H HD2  . ARG D 1 60  ? 23.895  12.064  -8.212  1.00 6.36  ? 60  ARG D HD2  1  
ATOM 6344   H HD3  . ARG D 1 60  ? 24.820  13.560  -8.304  1.00 6.01  ? 60  ARG D HD3  1  
ATOM 6345   H HE   . ARG D 1 60  ? 24.873  13.240  -10.737 1.00 7.13  ? 60  ARG D HE   1  
ATOM 6346   H HH11 . ARG D 1 60  ? 22.434  11.551  -8.879  1.00 6.34  ? 60  ARG D HH11 1  
ATOM 6347   H HH12 . ARG D 1 60  ? 21.374  11.326  -10.232 1.00 7.01  ? 60  ARG D HH12 1  
ATOM 6348   H HH21 . ARG D 1 60  ? 23.463  12.975  -12.517 1.00 8.03  ? 60  ARG D HH21 1  
ATOM 6349   H HH22 . ARG D 1 60  ? 21.951  12.154  -12.297 1.00 7.93  ? 60  ARG D HH22 1  
ATOM 6350   N N    . LYS D 1 61  ? 25.820  8.143   -7.744  1.00 3.91  ? 61  LYS D N    1  
ATOM 6351   C CA   . LYS D 1 61  ? 25.231  7.087   -8.560  1.00 4.06  ? 61  LYS D CA   1  
ATOM 6352   C C    . LYS D 1 61  ? 26.256  6.298   -9.370  1.00 4.58  ? 61  LYS D C    1  
ATOM 6353   O O    . LYS D 1 61  ? 26.194  6.263   -10.603 1.00 5.31  ? 61  LYS D O    1  
ATOM 6354   C CB   . LYS D 1 61  ? 24.168  7.681   -9.488  1.00 4.52  ? 61  LYS D CB   1  
ATOM 6355   C CG   . LYS D 1 61  ? 23.169  8.583   -8.774  1.00 4.24  ? 61  LYS D CG   1  
ATOM 6356   C CD   . LYS D 1 61  ? 22.279  7.801   -7.823  1.00 3.48  ? 61  LYS D CD   1  
ATOM 6357   C CE   . LYS D 1 61  ? 21.612  8.712   -6.805  1.00 3.34  ? 61  LYS D CE   1  
ATOM 6358   N NZ   . LYS D 1 61  ? 22.259  8.625   -5.467  1.00 2.90  ? 61  LYS D NZ   1  
ATOM 6359   H H    . LYS D 1 61  ? 25.543  8.206   -6.795  1.00 3.45  ? 61  LYS D H    1  
ATOM 6360   H HA   . LYS D 1 61  ? 24.746  6.402   -7.884  1.00 3.58  ? 61  LYS D HA   1  
ATOM 6361   H HB2  . LYS D 1 61  ? 24.663  8.261   -10.251 1.00 5.11  ? 61  LYS D HB2  1  
ATOM 6362   H HB3  . LYS D 1 61  ? 23.625  6.875   -9.956  1.00 4.59  ? 61  LYS D HB3  1  
ATOM 6363   H HG2  . LYS D 1 61  ? 23.711  9.326   -8.208  1.00 4.38  ? 61  LYS D HG2  1  
ATOM 6364   H HG3  . LYS D 1 61  ? 22.551  9.072   -9.512  1.00 4.60  ? 61  LYS D HG3  1  
ATOM 6365   H HD2  . LYS D 1 61  ? 21.517  7.295   -8.395  1.00 3.45  ? 61  LYS D HD2  1  
ATOM 6366   H HD3  . LYS D 1 61  ? 22.882  7.072   -7.301  1.00 3.24  ? 61  LYS D HD3  1  
ATOM 6367   H HE2  . LYS D 1 61  ? 21.674  9.731   -7.157  1.00 3.77  ? 61  LYS D HE2  1  
ATOM 6368   H HE3  . LYS D 1 61  ? 20.572  8.426   -6.712  1.00 3.35  ? 61  LYS D HE3  1  
ATOM 6369   H HZ1  . LYS D 1 61  ? 22.102  9.501   -4.932  1.00 3.10  ? 61  LYS D HZ1  1  
ATOM 6370   H HZ2  . LYS D 1 61  ? 23.290  8.480   -5.570  1.00 2.78  ? 61  LYS D HZ2  1  
ATOM 6371   H HZ3  . LYS D 1 61  ? 21.860  7.823   -4.927  1.00 2.72  ? 61  LYS D HZ3  1  
ATOM 6372   N N    . THR D 1 62  ? 27.184  5.651   -8.682  1.00 4.27  ? 62  THR D N    1  
ATOM 6373   C CA   . THR D 1 62  ? 28.190  4.852   -9.354  1.00 4.83  ? 62  THR D CA   1  
ATOM 6374   C C    . THR D 1 62  ? 28.815  3.833   -8.406  1.00 4.54  ? 62  THR D C    1  
ATOM 6375   O O    . THR D 1 62  ? 29.156  4.146   -7.266  1.00 3.83  ? 62  THR D O    1  
ATOM 6376   C CB   . THR D 1 62  ? 29.296  5.726   -9.992  1.00 5.16  ? 62  THR D CB   1  
ATOM 6377   O OG1  . THR D 1 62  ? 30.242  4.896   -10.686 1.00 5.82  ? 62  THR D OG1  1  
ATOM 6378   C CG2  . THR D 1 62  ? 30.023  6.564   -8.949  1.00 4.54  ? 62  THR D CG2  1  
ATOM 6379   H H    . THR D 1 62  ? 27.197  5.719   -7.700  1.00 3.70  ? 62  THR D H    1  
ATOM 6380   H HA   . THR D 1 62  ? 27.695  4.313   -10.149 1.00 5.37  ? 62  THR D HA   1  
ATOM 6381   H HB   . THR D 1 62  ? 28.831  6.394   -10.705 1.00 5.49  ? 62  THR D HB   1  
ATOM 6382   H HG1  . THR D 1 62  ? 31.051  5.394   -10.849 1.00 6.34  ? 62  THR D HG1  1  
ATOM 6383   H HG21 . THR D 1 62  ? 30.761  7.183   -9.438  1.00 4.74  ? 62  THR D HG21 1  
ATOM 6384   H HG22 . THR D 1 62  ? 30.512  5.911   -8.243  1.00 4.33  ? 62  THR D HG22 1  
ATOM 6385   H HG23 . THR D 1 62  ? 29.313  7.192   -8.430  1.00 4.23  ? 62  THR D HG23 1  
ATOM 6386   N N    . LEU D 1 63  ? 28.923  2.601   -8.879  1.00 5.20  ? 63  LEU D N    1  
ATOM 6387   C CA   . LEU D 1 63  ? 29.525  1.531   -8.101  1.00 5.26  ? 63  LEU D CA   1  
ATOM 6388   C C    . LEU D 1 63  ? 30.919  1.245   -8.642  1.00 5.70  ? 63  LEU D C    1  
ATOM 6389   O O    . LEU D 1 63  ? 31.537  0.230   -8.320  1.00 5.94  ? 63  LEU D O    1  
ATOM 6390   C CB   . LEU D 1 63  ? 28.658  0.273   -8.159  1.00 5.81  ? 63  LEU D CB   1  
ATOM 6391   C CG   . LEU D 1 63  ? 27.241  0.432   -7.596  1.00 5.46  ? 63  LEU D CG   1  
ATOM 6392   C CD1  . LEU D 1 63  ? 26.457  -0.863  -7.743  1.00 6.16  ? 63  LEU D CD1  1  
ATOM 6393   C CD2  . LEU D 1 63  ? 27.286  0.867   -6.137  1.00 4.78  ? 63  LEU D CD2  1  
ATOM 6394   H H    . LEU D 1 63  ? 28.585  2.404   -9.779  1.00 5.76  ? 63  LEU D H    1  
ATOM 6395   H HA   . LEU D 1 63  ? 29.605  1.863   -7.077  1.00 4.66  ? 63  LEU D HA   1  
ATOM 6396   H HB2  . LEU D 1 63  ? 28.581  -0.037  -9.192  1.00 6.41  ? 63  LEU D HB2  1  
ATOM 6397   H HB3  . LEU D 1 63  ? 29.158  -0.507  -7.604  1.00 6.00  ? 63  LEU D HB3  1  
ATOM 6398   H HG   . LEU D 1 63  ? 26.725  1.198   -8.155  1.00 5.29  ? 63  LEU D HG   1  
ATOM 6399   H HD11 . LEU D 1 63  ? 26.996  -1.667  -7.264  1.00 6.51  ? 63  LEU D HD11 1  
ATOM 6400   H HD12 . LEU D 1 63  ? 26.330  -1.090  -8.791  1.00 6.60  ? 63  LEU D HD12 1  
ATOM 6401   H HD13 . LEU D 1 63  ? 25.487  -0.753  -7.279  1.00 5.97  ? 63  LEU D HD13 1  
ATOM 6402   H HD21 . LEU D 1 63  ? 27.720  1.854   -6.068  1.00 4.31  ? 63  LEU D HD21 1  
ATOM 6403   H HD22 . LEU D 1 63  ? 27.885  0.171   -5.571  1.00 5.03  ? 63  LEU D HD22 1  
ATOM 6404   H HD23 . LEU D 1 63  ? 26.282  0.884   -5.736  1.00 4.68  ? 63  LEU D HD23 1  
ATOM 6405   N N    . ASN D 1 64  ? 31.388  2.158   -9.481  1.00 5.90  ? 64  ASN D N    1  
ATOM 6406   C CA   . ASN D 1 64  ? 32.703  2.065   -10.098 1.00 6.36  ? 64  ASN D CA   1  
ATOM 6407   C C    . ASN D 1 64  ? 33.182  3.473   -10.449 1.00 6.23  ? 64  ASN D C    1  
ATOM 6408   O O    . ASN D 1 64  ? 33.071  3.915   -11.594 1.00 6.83  ? 64  ASN D O    1  
ATOM 6409   C CB   . ASN D 1 64  ? 32.640  1.185   -11.354 1.00 7.31  ? 64  ASN D CB   1  
ATOM 6410   C CG   . ASN D 1 64  ? 34.004  0.915   -11.963 1.00 7.82  ? 64  ASN D CG   1  
ATOM 6411   O OD1  . ASN D 1 64  ? 34.667  -0.063  -11.621 1.00 8.07  ? 64  ASN D OD1  1  
ATOM 6412   N ND2  . ASN D 1 64  ? 34.425  1.771   -12.881 1.00 8.14  ? 64  ASN D ND2  1  
ATOM 6413   H H    . ASN D 1 64  ? 30.828  2.935   -9.690  1.00 5.80  ? 64  ASN D H    1  
ATOM 6414   H HA   . ASN D 1 64  ? 33.383  1.626   -9.383  1.00 6.17  ? 64  ASN D HA   1  
ATOM 6415   H HB2  . ASN D 1 64  ? 32.192  0.238   -11.096 1.00 7.46  ? 64  ASN D HB2  1  
ATOM 6416   H HB3  . ASN D 1 64  ? 32.026  1.674   -12.097 1.00 7.59  ? 64  ASN D HB3  1  
ATOM 6417   H HD21 . ASN D 1 64  ? 33.838  2.524   -13.112 1.00 8.06  ? 64  ASN D HD21 1  
ATOM 6418   H HD22 . ASN D 1 64  ? 35.298  1.615   -13.296 1.00 8.52  ? 64  ASN D HD22 1  
ATOM 6419   N N    . PRO D 1 65  ? 33.676  4.220   -9.453  1.00 5.52  ? 65  PRO D N    1  
ATOM 6420   C CA   . PRO D 1 65  ? 34.142  5.584   -9.655  1.00 5.47  ? 65  PRO D CA   1  
ATOM 6421   C C    . PRO D 1 65  ? 35.600  5.668   -10.106 1.00 5.99  ? 65  PRO D C    1  
ATOM 6422   O O    . PRO D 1 65  ? 36.488  5.079   -9.492  1.00 5.84  ? 65  PRO D O    1  
ATOM 6423   C CB   . PRO D 1 65  ? 33.971  6.205   -8.273  1.00 4.56  ? 65  PRO D CB   1  
ATOM 6424   C CG   . PRO D 1 65  ? 34.111  5.074   -7.302  1.00 4.20  ? 65  PRO D CG   1  
ATOM 6425   C CD   . PRO D 1 65  ? 33.817  3.793   -8.050  1.00 4.81  ? 65  PRO D CD   1  
ATOM 6426   H HA   . PRO D 1 65  ? 33.520  6.108   -10.363 1.00 5.74  ? 65  PRO D HA   1  
ATOM 6427   H HB2  . PRO D 1 65  ? 34.735  6.953   -8.119  1.00 4.52  ? 65  PRO D HB2  1  
ATOM 6428   H HB3  . PRO D 1 65  ? 32.996  6.663   -8.204  1.00 4.37  ? 65  PRO D HB3  1  
ATOM 6429   H HG2  . PRO D 1 65  ? 35.119  5.050   -6.914  1.00 4.15  ? 65  PRO D HG2  1  
ATOM 6430   H HG3  . PRO D 1 65  ? 33.406  5.202   -6.493  1.00 3.76  ? 65  PRO D HG3  1  
ATOM 6431   H HD2  . PRO D 1 65  ? 34.638  3.098   -7.942  1.00 5.03  ? 65  PRO D HD2  1  
ATOM 6432   H HD3  . PRO D 1 65  ? 32.900  3.350   -7.691  1.00 4.63  ? 65  PRO D HD3  1  
ATOM 6433   N N    . VAL D 1 66  ? 35.834  6.416   -11.178 1.00 6.65  ? 66  VAL D N    1  
ATOM 6434   C CA   . VAL D 1 66  ? 37.173  6.599   -11.719 1.00 7.22  ? 66  VAL D CA   1  
ATOM 6435   C C    . VAL D 1 66  ? 37.546  8.078   -11.737 1.00 7.33  ? 66  VAL D C    1  
ATOM 6436   O O    . VAL D 1 66  ? 37.224  8.795   -12.683 1.00 7.76  ? 66  VAL D O    1  
ATOM 6437   C CB   . VAL D 1 66  ? 37.290  6.031   -13.155 1.00 8.13  ? 66  VAL D CB   1  
ATOM 6438   C CG1  . VAL D 1 66  ? 37.679  4.563   -13.135 1.00 8.26  ? 66  VAL D CG1  1  
ATOM 6439   C CG2  . VAL D 1 66  ? 35.991  6.222   -13.931 1.00 8.43  ? 66  VAL D CG2  1  
ATOM 6440   H H    . VAL D 1 66  ? 35.078  6.862   -11.622 1.00 6.80  ? 66  VAL D H    1  
ATOM 6441   H HA   . VAL D 1 66  ? 37.868  6.069   -11.083 1.00 6.97  ? 66  VAL D HA   1  
ATOM 6442   H HB   . VAL D 1 66  ? 38.069  6.576   -13.666 1.00 8.56  ? 66  VAL D HB   1  
ATOM 6443   H HG11 . VAL D 1 66  ? 37.601  4.157   -14.132 1.00 8.46  ? 66  VAL D HG11 1  
ATOM 6444   H HG12 . VAL D 1 66  ? 37.017  4.023   -12.473 1.00 8.18  ? 66  VAL D HG12 1  
ATOM 6445   H HG13 . VAL D 1 66  ? 38.696  4.462   -12.787 1.00 8.47  ? 66  VAL D HG13 1  
ATOM 6446   H HG21 . VAL D 1 66  ? 35.705  7.264   -13.906 1.00 8.41  ? 66  VAL D HG21 1  
ATOM 6447   H HG22 . VAL D 1 66  ? 35.213  5.624   -13.483 1.00 8.08  ? 66  VAL D HG22 1  
ATOM 6448   H HG23 . VAL D 1 66  ? 36.138  5.914   -14.955 1.00 9.06  ? 66  VAL D HG23 1  
ATOM 6449   N N    . PHE D 1 67  ? 38.211  8.543   -10.692 1.00 7.02  ? 67  PHE D N    1  
ATOM 6450   C CA   . PHE D 1 67  ? 38.601  9.943   -10.621 1.00 7.23  ? 67  PHE D CA   1  
ATOM 6451   C C    . PHE D 1 67  ? 40.087  10.087  -10.309 1.00 7.29  ? 67  PHE D C    1  
ATOM 6452   O O    . PHE D 1 67  ? 40.731  11.032  -10.772 1.00 7.87  ? 67  PHE D O    1  
ATOM 6453   C CB   . PHE D 1 67  ? 37.761  10.687  -9.581  1.00 6.64  ? 67  PHE D CB   1  
ATOM 6454   C CG   . PHE D 1 67  ? 37.664  12.165  -9.842  1.00 7.16  ? 67  PHE D CG   1  
ATOM 6455   C CD1  . PHE D 1 67  ? 36.788  12.653  -10.798 1.00 7.53  ? 67  PHE D CD1  1  
ATOM 6456   C CD2  . PHE D 1 67  ? 38.453  13.062  -9.142  1.00 7.37  ? 67  PHE D CD2  1  
ATOM 6457   C CE1  . PHE D 1 67  ? 36.700  14.007  -11.048 1.00 8.10  ? 67  PHE D CE1  1  
ATOM 6458   C CE2  . PHE D 1 67  ? 38.369  14.419  -9.388  1.00 7.96  ? 67  PHE D CE2  1  
ATOM 6459   C CZ   . PHE D 1 67  ? 37.491  14.892  -10.345 1.00 8.33  ? 67  PHE D CZ   1  
ATOM 6460   H H    . PHE D 1 67  ? 38.447  7.937   -9.960  1.00 6.71  ? 67  PHE D H    1  
ATOM 6461   H HA   . PHE D 1 67  ? 38.414  10.379  -11.592 1.00 7.86  ? 67  PHE D HA   1  
ATOM 6462   H HB2  . PHE D 1 67  ? 36.758  10.283  -9.581  1.00 6.33  ? 67  PHE D HB2  1  
ATOM 6463   H HB3  . PHE D 1 67  ? 38.202  10.548  -8.606  1.00 6.20  ? 67  PHE D HB3  1  
ATOM 6464   H HD1  . PHE D 1 67  ? 36.168  11.962  -11.349 1.00 7.43  ? 67  PHE D HD1  1  
ATOM 6465   H HD2  . PHE D 1 67  ? 39.137  12.693  -8.395  1.00 7.11  ? 67  PHE D HD2  1  
ATOM 6466   H HE1  . PHE D 1 67  ? 36.014  14.376  -11.795 1.00 8.41  ? 67  PHE D HE1  1  
ATOM 6467   H HE2  . PHE D 1 67  ? 38.990  15.110  -8.836  1.00 8.19  ? 67  PHE D HE2  1  
ATOM 6468   H HZ   . PHE D 1 67  ? 37.423  15.952  -10.541 1.00 8.84  ? 67  PHE D HZ   1  
ATOM 6469   N N    . ASN D 1 68  ? 40.621  9.146   -9.529  1.00 6.72  ? 68  ASN D N    1  
ATOM 6470   C CA   . ASN D 1 68  ? 42.034  9.146   -9.145  1.00 6.70  ? 68  ASN D CA   1  
ATOM 6471   C C    . ASN D 1 68  ? 42.371  10.372  -8.300  1.00 6.48  ? 68  ASN D C    1  
ATOM 6472   O O    . ASN D 1 68  ? 43.107  11.263  -8.736  1.00 7.02  ? 68  ASN D O    1  
ATOM 6473   C CB   . ASN D 1 68  ? 42.945  9.079   -10.383 1.00 7.57  ? 68  ASN D CB   1  
ATOM 6474   C CG   . ASN D 1 68  ? 44.320  8.508   -10.074 1.00 7.53  ? 68  ASN D CG   1  
ATOM 6475   O OD1  . ASN D 1 68  ? 44.593  7.336   -10.337 1.00 7.68  ? 68  ASN D OD1  1  
ATOM 6476   N ND2  . ASN D 1 68  ? 45.197  9.328   -9.517  1.00 7.44  ? 68  ASN D ND2  1  
ATOM 6477   H H    . ASN D 1 68  ? 40.046  8.430   -9.189  1.00 6.32  ? 68  ASN D H    1  
ATOM 6478   H HA   . ASN D 1 68  ? 42.205  8.263   -8.544  1.00 6.25  ? 68  ASN D HA   1  
ATOM 6479   H HB2  . ASN D 1 68  ? 42.478  8.452   -11.129 1.00 7.89  ? 68  ASN D HB2  1  
ATOM 6480   H HB3  . ASN D 1 68  ? 43.070  10.073  -10.784 1.00 7.99  ? 68  ASN D HB3  1  
ATOM 6481   H HD21 . ASN D 1 68  ? 44.917  10.251  -9.335  1.00 7.45  ? 68  ASN D HD21 1  
ATOM 6482   H HD22 . ASN D 1 68  ? 46.087  8.980   -9.303  1.00 7.41  ? 68  ASN D HD22 1  
ATOM 6483   N N    . GLU D 1 69  ? 41.803  10.434  -7.103  1.00 5.77  ? 69  GLU D N    1  
ATOM 6484   C CA   . GLU D 1 69  ? 42.057  11.540  -6.190  1.00 5.66  ? 69  GLU D CA   1  
ATOM 6485   C C    . GLU D 1 69  ? 43.431  11.398  -5.540  1.00 5.39  ? 69  GLU D C    1  
ATOM 6486   O O    . GLU D 1 69  ? 43.977  10.297  -5.447  1.00 5.04  ? 69  GLU D O    1  
ATOM 6487   C CB   . GLU D 1 69  ? 40.964  11.615  -5.121  1.00 5.08  ? 69  GLU D CB   1  
ATOM 6488   C CG   . GLU D 1 69  ? 39.675  12.265  -5.609  1.00 5.46  ? 69  GLU D CG   1  
ATOM 6489   C CD   . GLU D 1 69  ? 38.614  11.259  -6.029  1.00 5.08  ? 69  GLU D CD   1  
ATOM 6490   O OE1  . GLU D 1 69  ? 38.972  10.192  -6.568  1.00 4.96  ? 69  GLU D OE1  1  
ATOM 6491   O OE2  . GLU D 1 69  ? 37.414  11.543  -5.822  1.00 5.10  ? 69  GLU D OE2  1  
ATOM 6492   H H    . GLU D 1 69  ? 41.178  9.724   -6.830  1.00 5.38  ? 69  GLU D H    1  
ATOM 6493   H HA   . GLU D 1 69  ? 42.042  12.452  -6.770  1.00 6.28  ? 69  GLU D HA   1  
ATOM 6494   H HB2  . GLU D 1 69  ? 40.733  10.613  -4.787  1.00 4.49  ? 69  GLU D HB2  1  
ATOM 6495   H HB3  . GLU D 1 69  ? 41.336  12.186  -4.285  1.00 5.04  ? 69  GLU D HB3  1  
ATOM 6496   H HG2  . GLU D 1 69  ? 39.272  12.868  -4.811  1.00 5.59  ? 69  GLU D HG2  1  
ATOM 6497   H HG3  . GLU D 1 69  ? 39.904  12.898  -6.453  1.00 6.04  ? 69  GLU D HG3  1  
ATOM 6498   N N    . GLN D 1 70  ? 43.990  12.517  -5.096  1.00 5.65  ? 70  GLN D N    1  
ATOM 6499   C CA   . GLN D 1 70  ? 45.306  12.521  -4.477  1.00 5.47  ? 70  GLN D CA   1  
ATOM 6500   C C    . GLN D 1 70  ? 45.236  12.935  -3.010  1.00 5.06  ? 70  GLN D C    1  
ATOM 6501   O O    . GLN D 1 70  ? 44.636  13.957  -2.670  1.00 5.47  ? 70  GLN D O    1  
ATOM 6502   C CB   . GLN D 1 70  ? 46.234  13.473  -5.235  1.00 6.29  ? 70  GLN D CB   1  
ATOM 6503   C CG   . GLN D 1 70  ? 47.672  13.433  -4.754  1.00 6.35  ? 70  GLN D CG   1  
ATOM 6504   C CD   . GLN D 1 70  ? 48.557  14.427  -5.476  1.00 6.96  ? 70  GLN D CD   1  
ATOM 6505   O OE1  . GLN D 1 70  ? 49.079  14.141  -6.554  1.00 7.55  ? 70  GLN D OE1  1  
ATOM 6506   N NE2  . GLN D 1 70  ? 48.734  15.599  -4.891  1.00 6.97  ? 70  GLN D NE2  1  
ATOM 6507   H H    . GLN D 1 70  ? 43.503  13.364  -5.189  1.00 6.02  ? 70  GLN D H    1  
ATOM 6508   H HA   . GLN D 1 70  ? 45.706  11.521  -4.539  1.00 5.11  ? 70  GLN D HA   1  
ATOM 6509   H HB2  . GLN D 1 70  ? 46.219  13.213  -6.283  1.00 6.55  ? 70  GLN D HB2  1  
ATOM 6510   H HB3  . GLN D 1 70  ? 45.866  14.482  -5.117  1.00 6.70  ? 70  GLN D HB3  1  
ATOM 6511   H HG2  . GLN D 1 70  ? 47.690  13.660  -3.698  1.00 5.89  ? 70  GLN D HG2  1  
ATOM 6512   H HG3  . GLN D 1 70  ? 48.063  12.439  -4.913  1.00 6.50  ? 70  GLN D HG3  1  
ATOM 6513   H HE21 . GLN D 1 70  ? 48.288  15.764  -4.031  1.00 6.58  ? 70  GLN D HE21 1  
ATOM 6514   H HE22 . GLN D 1 70  ? 49.319  16.252  -5.331  1.00 7.44  ? 70  GLN D HE22 1  
ATOM 6515   N N    . PHE D 1 71  ? 45.850  12.137  -2.146  1.00 4.37  ? 71  PHE D N    1  
ATOM 6516   C CA   . PHE D 1 71  ? 45.884  12.429  -0.720  1.00 4.11  ? 71  PHE D CA   1  
ATOM 6517   C C    . PHE D 1 71  ? 47.328  12.576  -0.248  1.00 4.17  ? 71  PHE D C    1  
ATOM 6518   O O    . PHE D 1 71  ? 48.193  11.770  -0.601  1.00 3.86  ? 71  PHE D O    1  
ATOM 6519   C CB   . PHE D 1 71  ? 45.165  11.333  0.077   1.00 3.27  ? 71  PHE D CB   1  
ATOM 6520   C CG   . PHE D 1 71  ? 45.434  11.378  1.558   1.00 3.15  ? 71  PHE D CG   1  
ATOM 6521   C CD1  . PHE D 1 71  ? 45.116  12.503  2.305   1.00 3.86  ? 71  PHE D CD1  1  
ATOM 6522   C CD2  . PHE D 1 71  ? 46.013  10.297  2.200   1.00 2.54  ? 71  PHE D CD2  1  
ATOM 6523   C CE1  . PHE D 1 71  ? 45.370  12.544  3.663   1.00 4.07  ? 71  PHE D CE1  1  
ATOM 6524   C CE2  . PHE D 1 71  ? 46.270  10.333  3.557   1.00 2.78  ? 71  PHE D CE2  1  
ATOM 6525   C CZ   . PHE D 1 71  ? 45.948  11.458  4.289   1.00 3.59  ? 71  PHE D CZ   1  
ATOM 6526   H H    . PHE D 1 71  ? 46.295  11.323  -2.476  1.00 4.13  ? 71  PHE D H    1  
ATOM 6527   H HA   . PHE D 1 71  ? 45.374  13.367  -0.564  1.00 4.59  ? 71  PHE D HA   1  
ATOM 6528   H HB2  . PHE D 1 71  ? 44.099  11.434  -0.067  1.00 3.30  ? 71  PHE D HB2  1  
ATOM 6529   H HB3  . PHE D 1 71  ? 45.480  10.368  -0.288  1.00 2.83  ? 71  PHE D HB3  1  
ATOM 6530   H HD1  . PHE D 1 71  ? 44.662  13.353  1.817   1.00 4.36  ? 71  PHE D HD1  1  
ATOM 6531   H HD2  . PHE D 1 71  ? 46.267  9.416   1.629   1.00 2.05  ? 71  PHE D HD2  1  
ATOM 6532   H HE1  . PHE D 1 71  ? 45.118  13.426  4.235   1.00 4.71  ? 71  PHE D HE1  1  
ATOM 6533   H HE2  . PHE D 1 71  ? 46.718  9.483   4.043   1.00 2.50  ? 71  PHE D HE2  1  
ATOM 6534   H HZ   . PHE D 1 71  ? 46.148  11.486  5.352   1.00 3.94  ? 71  PHE D HZ   1  
ATOM 6535   N N    . THR D 1 72  ? 47.577  13.616  0.534   1.00 4.68  ? 72  THR D N    1  
ATOM 6536   C CA   . THR D 1 72  ? 48.901  13.892  1.062   1.00 4.84  ? 72  THR D CA   1  
ATOM 6537   C C    . THR D 1 72  ? 49.063  13.314  2.471   1.00 4.44  ? 72  THR D C    1  
ATOM 6538   O O    . THR D 1 72  ? 48.502  13.837  3.436   1.00 4.81  ? 72  THR D O    1  
ATOM 6539   C CB   . THR D 1 72  ? 49.152  15.412  1.099   1.00 5.75  ? 72  THR D CB   1  
ATOM 6540   O OG1  . THR D 1 72  ? 47.987  16.110  0.621   1.00 6.35  ? 72  THR D OG1  1  
ATOM 6541   C CG2  . THR D 1 72  ? 50.347  15.789  0.238   1.00 6.01  ? 72  THR D CG2  1  
ATOM 6542   H H    . THR D 1 72  ? 46.847  14.225  0.764   1.00 5.01  ? 72  THR D H    1  
ATOM 6543   H HA   . THR D 1 72  ? 49.630  13.440  0.406   1.00 4.68  ? 72  THR D HA   1  
ATOM 6544   H HB   . THR D 1 72  ? 49.352  15.707  2.118   1.00 5.90  ? 72  THR D HB   1  
ATOM 6545   H HG1  . THR D 1 72  ? 48.117  16.341  -0.306  1.00 6.63  ? 72  THR D HG1  1  
ATOM 6546   H HG21 . THR D 1 72  ? 50.136  15.548  -0.793  1.00 6.06  ? 72  THR D HG21 1  
ATOM 6547   H HG22 . THR D 1 72  ? 51.217  15.239  0.566   1.00 5.66  ? 72  THR D HG22 1  
ATOM 6548   H HG23 . THR D 1 72  ? 50.534  16.849  0.327   1.00 6.62  ? 72  THR D HG23 1  
ATOM 6549   N N    . PHE D 1 73  ? 49.828  12.233  2.583   1.00 3.79  ? 73  PHE D N    1  
ATOM 6550   C CA   . PHE D 1 73  ? 50.071  11.586  3.869   1.00 3.53  ? 73  PHE D CA   1  
ATOM 6551   C C    . PHE D 1 73  ? 51.144  12.357  4.635   1.00 4.08  ? 73  PHE D C    1  
ATOM 6552   O O    . PHE D 1 73  ? 52.281  11.908  4.752   1.00 3.85  ? 73  PHE D O    1  
ATOM 6553   C CB   . PHE D 1 73  ? 50.506  10.133  3.646   1.00 2.71  ? 73  PHE D CB   1  
ATOM 6554   C CG   . PHE D 1 73  ? 50.464  9.263   4.871   1.00 2.63  ? 73  PHE D CG   1  
ATOM 6555   C CD1  . PHE D 1 73  ? 49.281  8.662   5.264   1.00 2.72  ? 73  PHE D CD1  1  
ATOM 6556   C CD2  . PHE D 1 73  ? 51.608  9.034   5.620   1.00 2.73  ? 73  PHE D CD2  1  
ATOM 6557   C CE1  . PHE D 1 73  ? 49.238  7.849   6.379   1.00 3.08  ? 73  PHE D CE1  1  
ATOM 6558   C CE2  . PHE D 1 73  ? 51.570  8.219   6.735   1.00 3.03  ? 73  PHE D CE2  1  
ATOM 6559   C CZ   . PHE D 1 73  ? 50.382  7.628   7.117   1.00 3.28  ? 73  PHE D CZ   1  
ATOM 6560   H H    . PHE D 1 73  ? 50.253  11.862  1.775   1.00 3.60  ? 73  PHE D H    1  
ATOM 6561   H HA   . PHE D 1 73  ? 49.151  11.600  4.435   1.00 3.68  ? 73  PHE D HA   1  
ATOM 6562   H HB2  . PHE D 1 73  ? 49.860  9.685   2.906   1.00 2.40  ? 73  PHE D HB2  1  
ATOM 6563   H HB3  . PHE D 1 73  ? 51.519  10.129  3.272   1.00 2.67  ? 73  PHE D HB3  1  
ATOM 6564   H HD1  . PHE D 1 73  ? 48.386  8.833   4.691   1.00 2.68  ? 73  PHE D HD1  1  
ATOM 6565   H HD2  . PHE D 1 73  ? 52.538  9.500   5.324   1.00 2.73  ? 73  PHE D HD2  1  
ATOM 6566   H HE1  . PHE D 1 73  ? 48.309  7.388   6.676   1.00 3.33  ? 73  PHE D HE1  1  
ATOM 6567   H HE2  . PHE D 1 73  ? 52.470  8.048   7.309   1.00 3.22  ? 73  PHE D HE2  1  
ATOM 6568   H HZ   . PHE D 1 73  ? 50.352  6.990   7.988   1.00 3.73  ? 73  PHE D HZ   1  
ATOM 6569   N N    . LYS D 1 74  ? 50.769  13.531  5.135   1.00 4.83  ? 74  LYS D N    1  
ATOM 6570   C CA   . LYS D 1 74  ? 51.683  14.402  5.873   1.00 5.45  ? 74  LYS D CA   1  
ATOM 6571   C C    . LYS D 1 74  ? 52.208  13.756  7.153   1.00 5.40  ? 74  LYS D C    1  
ATOM 6572   O O    . LYS D 1 74  ? 51.572  13.826  8.207   1.00 5.84  ? 74  LYS D O    1  
ATOM 6573   C CB   . LYS D 1 74  ? 50.992  15.726  6.208   1.00 6.31  ? 74  LYS D CB   1  
ATOM 6574   C CG   . LYS D 1 74  ? 51.049  16.755  5.087   1.00 6.65  ? 74  LYS D CG   1  
ATOM 6575   C CD   . LYS D 1 74  ? 52.481  17.164  4.761   1.00 6.98  ? 74  LYS D CD   1  
ATOM 6576   C CE   . LYS D 1 74  ? 53.182  17.793  5.958   1.00 7.69  ? 74  LYS D CE   1  
ATOM 6577   N NZ   . LYS D 1 74  ? 52.514  19.043  6.406   1.00 8.39  ? 74  LYS D NZ   1  
ATOM 6578   H H    . LYS D 1 74  ? 49.845  13.829  4.986   1.00 5.00  ? 74  LYS D H    1  
ATOM 6579   H HA   . LYS D 1 74  ? 52.523  14.607  5.228   1.00 5.44  ? 74  LYS D HA   1  
ATOM 6580   H HB2  . LYS D 1 74  ? 49.952  15.528  6.429   1.00 6.39  ? 74  LYS D HB2  1  
ATOM 6581   H HB3  . LYS D 1 74  ? 51.458  16.153  7.082   1.00 6.71  ? 74  LYS D HB3  1  
ATOM 6582   H HG2  . LYS D 1 74  ? 50.599  16.333  4.200   1.00 6.28  ? 74  LYS D HG2  1  
ATOM 6583   H HG3  . LYS D 1 74  ? 50.494  17.631  5.390   1.00 7.15  ? 74  LYS D HG3  1  
ATOM 6584   H HD2  . LYS D 1 74  ? 53.033  16.291  4.455   1.00 6.59  ? 74  LYS D HD2  1  
ATOM 6585   H HD3  . LYS D 1 74  ? 52.462  17.879  3.952   1.00 7.23  ? 74  LYS D HD3  1  
ATOM 6586   H HE2  . LYS D 1 74  ? 53.186  17.086  6.774   1.00 7.63  ? 74  LYS D HE2  1  
ATOM 6587   H HE3  . LYS D 1 74  ? 54.201  18.023  5.680   1.00 7.89  ? 74  LYS D HE3  1  
ATOM 6588   H HZ1  . LYS D 1 74  ? 52.960  19.390  7.281   1.00 8.48  ? 74  LYS D HZ1  1  
ATOM 6589   H HZ2  . LYS D 1 74  ? 51.508  18.868  6.592   1.00 8.50  ? 74  LYS D HZ2  1  
ATOM 6590   H HZ3  . LYS D 1 74  ? 52.599  19.779  5.676   1.00 8.85  ? 74  LYS D HZ3  1  
ATOM 6591   N N    . VAL D 1 75  ? 53.368  13.129  7.037   1.00 4.95  ? 75  VAL D N    1  
ATOM 6592   C CA   . VAL D 1 75  ? 54.040  12.476  8.150   1.00 4.96  ? 75  VAL D CA   1  
ATOM 6593   C C    . VAL D 1 75  ? 55.382  11.942  7.658   1.00 4.55  ? 75  VAL D C    1  
ATOM 6594   O O    . VAL D 1 75  ? 55.455  11.372  6.567   1.00 3.97  ? 75  VAL D O    1  
ATOM 6595   C CB   . VAL D 1 75  ? 53.178  11.331  8.764   1.00 4.72  ? 75  VAL D CB   1  
ATOM 6596   C CG1  . VAL D 1 75  ? 53.898  9.986   8.748   1.00 4.24  ? 75  VAL D CG1  1  
ATOM 6597   C CG2  . VAL D 1 75  ? 52.768  11.687  10.186  1.00 5.51  ? 75  VAL D CG2  1  
ATOM 6598   H H    . VAL D 1 75  ? 53.794  13.088  6.152   1.00 4.67  ? 75  VAL D H    1  
ATOM 6599   H HA   . VAL D 1 75  ? 54.220  13.221  8.913   1.00 5.58  ? 75  VAL D HA   1  
ATOM 6600   H HB   . VAL D 1 75  ? 52.279  11.236  8.174   1.00 4.47  ? 75  VAL D HB   1  
ATOM 6601   H HG11 . VAL D 1 75  ? 53.229  9.217   9.099   1.00 4.26  ? 75  VAL D HG11 1  
ATOM 6602   H HG12 . VAL D 1 75  ? 54.763  10.033  9.394   1.00 4.54  ? 75  VAL D HG12 1  
ATOM 6603   H HG13 . VAL D 1 75  ? 54.210  9.759   7.741   1.00 3.75  ? 75  VAL D HG13 1  
ATOM 6604   H HG21 . VAL D 1 75  ? 52.122  10.915  10.578  1.00 5.50  ? 75  VAL D HG21 1  
ATOM 6605   H HG22 . VAL D 1 75  ? 52.243  12.630  10.185  1.00 5.92  ? 75  VAL D HG22 1  
ATOM 6606   H HG23 . VAL D 1 75  ? 53.649  11.766  10.806  1.00 5.79  ? 75  VAL D HG23 1  
ATOM 6607   N N    . PRO D 1 76  ? 56.463  12.167  8.422   1.00 4.91  ? 76  PRO D N    1  
ATOM 6608   C CA   . PRO D 1 76  ? 57.797  11.692  8.050   1.00 4.59  ? 76  PRO D CA   1  
ATOM 6609   C C    . PRO D 1 76  ? 57.799  10.202  7.732   1.00 3.89  ? 76  PRO D C    1  
ATOM 6610   O O    . PRO D 1 76  ? 57.212  9.406   8.468   1.00 3.94  ? 76  PRO D O    1  
ATOM 6611   C CB   . PRO D 1 76  ? 58.636  11.970  9.299   1.00 5.18  ? 76  PRO D CB   1  
ATOM 6612   C CG   . PRO D 1 76  ? 57.935  13.090  9.985   1.00 5.92  ? 76  PRO D CG   1  
ATOM 6613   C CD   . PRO D 1 76  ? 56.471  12.899  9.700   1.00 5.72  ? 76  PRO D CD   1  
ATOM 6614   H HA   . PRO D 1 76  ? 58.197  12.241  7.212   1.00 4.58  ? 76  PRO D HA   1  
ATOM 6615   H HB2  . PRO D 1 76  ? 58.668  11.084  9.917   1.00 5.10  ? 76  PRO D HB2  1  
ATOM 6616   H HB3  . PRO D 1 76  ? 59.637  12.249  9.009   1.00 5.22  ? 76  PRO D HB3  1  
ATOM 6617   H HG2  . PRO D 1 76  ? 58.119  13.044  11.048  1.00 6.34  ? 76  PRO D HG2  1  
ATOM 6618   H HG3  . PRO D 1 76  ? 58.273  14.034  9.585   1.00 6.22  ? 76  PRO D HG3  1  
ATOM 6619   H HD2  . PRO D 1 76  ? 56.008  12.316  10.482  1.00 5.80  ? 76  PRO D HD2  1  
ATOM 6620   H HD3  . PRO D 1 76  ? 55.979  13.855  9.599   1.00 6.12  ? 76  PRO D HD3  1  
ATOM 6621   N N    . TYR D 1 77  ? 58.469  9.824   6.646   1.00 3.41  ? 77  TYR D N    1  
ATOM 6622   C CA   . TYR D 1 77  ? 58.531  8.423   6.239   1.00 2.89  ? 77  TYR D CA   1  
ATOM 6623   C C    . TYR D 1 77  ? 59.210  7.572   7.311   1.00 3.17  ? 77  TYR D C    1  
ATOM 6624   O O    . TYR D 1 77  ? 59.042  6.359   7.353   1.00 3.15  ? 77  TYR D O    1  
ATOM 6625   C CB   . TYR D 1 77  ? 59.244  8.265   4.883   1.00 2.66  ? 77  TYR D CB   1  
ATOM 6626   C CG   . TYR D 1 77  ? 60.655  8.824   4.826   1.00 2.92  ? 77  TYR D CG   1  
ATOM 6627   C CD1  . TYR D 1 77  ? 61.716  8.164   5.438   1.00 2.90  ? 77  TYR D CD1  1  
ATOM 6628   C CD2  . TYR D 1 77  ? 60.929  10.004  4.143   1.00 3.41  ? 77  TYR D CD2  1  
ATOM 6629   C CE1  . TYR D 1 77  ? 63.001  8.665   5.375   1.00 3.16  ? 77  TYR D CE1  1  
ATOM 6630   C CE2  . TYR D 1 77  ? 62.214  10.509  4.075   1.00 3.72  ? 77  TYR D CE2  1  
ATOM 6631   C CZ   . TYR D 1 77  ? 63.244  9.836   4.693   1.00 3.50  ? 77  TYR D CZ   1  
ATOM 6632   O OH   . TYR D 1 77  ? 64.526  10.335  4.625   1.00 3.83  ? 77  TYR D OH   1  
ATOM 6633   H H    . TYR D 1 77  ? 58.932  10.503  6.109   1.00 3.57  ? 77  TYR D H    1  
ATOM 6634   H HA   . TYR D 1 77  ? 57.512  8.077   6.132   1.00 2.71  ? 77  TYR D HA   1  
ATOM 6635   H HB2  . TYR D 1 77  ? 59.302  7.215   4.639   1.00 2.49  ? 77  TYR D HB2  1  
ATOM 6636   H HB3  . TYR D 1 77  ? 58.660  8.767   4.123   1.00 2.76  ? 77  TYR D HB3  1  
ATOM 6637   H HD1  . TYR D 1 77  ? 61.523  7.246   5.971   1.00 2.89  ? 77  TYR D HD1  1  
ATOM 6638   H HD2  . TYR D 1 77  ? 60.119  10.532  3.662   1.00 3.68  ? 77  TYR D HD2  1  
ATOM 6639   H HE1  . TYR D 1 77  ? 63.809  8.138   5.861   1.00 3.25  ? 77  TYR D HE1  1  
ATOM 6640   H HE2  . TYR D 1 77  ? 62.406  11.426  3.540   1.00 4.24  ? 77  TYR D HE2  1  
ATOM 6641   H HH   . TYR D 1 77  ? 64.520  11.267  4.881   1.00 4.17  ? 77  TYR D HH   1  
ATOM 6642   N N    . SER D 1 78  ? 59.963  8.222   8.182   1.00 3.66  ? 78  SER D N    1  
ATOM 6643   C CA   . SER D 1 78  ? 60.651  7.538   9.262   1.00 4.11  ? 78  SER D CA   1  
ATOM 6644   C C    . SER D 1 78  ? 59.650  7.058   10.314  1.00 4.63  ? 78  SER D C    1  
ATOM 6645   O O    . SER D 1 78  ? 59.918  6.116   11.063  1.00 5.09  ? 78  SER D O    1  
ATOM 6646   C CB   . SER D 1 78  ? 61.668  8.491   9.879   1.00 4.54  ? 78  SER D CB   1  
ATOM 6647   O OG   . SER D 1 78  ? 61.855  9.621   9.040   1.00 4.48  ? 78  SER D OG   1  
ATOM 6648   H H    . SER D 1 78  ? 60.070  9.192   8.094   1.00 3.82  ? 78  SER D H    1  
ATOM 6649   H HA   . SER D 1 78  ? 61.167  6.686   8.848   1.00 3.91  ? 78  SER D HA   1  
ATOM 6650   H HB2  . SER D 1 78  ? 61.311  8.824   10.843  1.00 5.03  ? 78  SER D HB2  1  
ATOM 6651   H HB3  . SER D 1 78  ? 62.613  7.983   9.999   1.00 4.55  ? 78  SER D HB3  1  
ATOM 6652   H HG   . SER D 1 78  ? 62.798  9.797   8.949   1.00 4.67  ? 78  SER D HG   1  
ATOM 6653   N N    . GLU D 1 79  ? 58.479  7.691   10.336  1.00 4.65  ? 79  GLU D N    1  
ATOM 6654   C CA   . GLU D 1 79  ? 57.431  7.343   11.287  1.00 5.19  ? 79  GLU D CA   1  
ATOM 6655   C C    . GLU D 1 79  ? 56.425  6.382   10.661  1.00 4.83  ? 79  GLU D C    1  
ATOM 6656   O O    . GLU D 1 79  ? 55.375  6.113   11.246  1.00 5.23  ? 79  GLU D O    1  
ATOM 6657   C CB   . GLU D 1 79  ? 56.692  8.600   11.752  1.00 5.62  ? 79  GLU D CB   1  
ATOM 6658   C CG   . GLU D 1 79  ? 57.512  9.519   12.640  1.00 6.36  ? 79  GLU D CG   1  
ATOM 6659   C CD   . GLU D 1 79  ? 56.679  10.655  13.205  1.00 6.96  ? 79  GLU D CD   1  
ATOM 6660   O OE1  . GLU D 1 79  ? 55.432  10.544  13.192  1.00 7.14  ? 79  GLU D OE1  1  
ATOM 6661   O OE2  . GLU D 1 79  ? 57.261  11.661  13.661  1.00 7.36  ? 79  GLU D OE2  1  
ATOM 6662   H H    . GLU D 1 79  ? 58.312  8.405   9.683   1.00 4.36  ? 79  GLU D H    1  
ATOM 6663   H HA   . GLU D 1 79  ? 57.892  6.869   12.140  1.00 5.64  ? 79  GLU D HA   1  
ATOM 6664   H HB2  . GLU D 1 79  ? 56.382  9.160   10.882  1.00 5.42  ? 79  GLU D HB2  1  
ATOM 6665   H HB3  . GLU D 1 79  ? 55.813  8.297   12.301  1.00 5.73  ? 79  GLU D HB3  1  
ATOM 6666   H HG2  . GLU D 1 79  ? 57.915  8.945   13.460  1.00 6.62  ? 79  GLU D HG2  1  
ATOM 6667   H HG3  . GLU D 1 79  ? 58.321  9.939   12.059  1.00 6.35  ? 79  GLU D HG3  1  
ATOM 6668   N N    . LEU D 1 80  ? 56.750  5.860   9.479   1.00 4.17  ? 80  LEU D N    1  
ATOM 6669   C CA   . LEU D 1 80  ? 55.853  4.945   8.773   1.00 3.88  ? 80  LEU D CA   1  
ATOM 6670   C C    . LEU D 1 80  ? 55.650  3.649   9.557   1.00 4.50  ? 80  LEU D C    1  
ATOM 6671   O O    . LEU D 1 80  ? 54.644  2.961   9.383   1.00 4.67  ? 80  LEU D O    1  
ATOM 6672   C CB   . LEU D 1 80  ? 56.376  4.653   7.355   1.00 3.20  ? 80  LEU D CB   1  
ATOM 6673   C CG   . LEU D 1 80  ? 57.059  3.291   7.144   1.00 3.33  ? 80  LEU D CG   1  
ATOM 6674   C CD1  . LEU D 1 80  ? 57.116  2.958   5.660   1.00 2.93  ? 80  LEU D CD1  1  
ATOM 6675   C CD2  . LEU D 1 80  ? 58.463  3.284   7.739   1.00 3.61  ? 80  LEU D CD2  1  
ATOM 6676   H H    . LEU D 1 80  ? 57.609  6.099   9.071   1.00 3.93  ? 80  LEU D H    1  
ATOM 6677   H HA   . LEU D 1 80  ? 54.896  5.442   8.688   1.00 3.85  ? 80  LEU D HA   1  
ATOM 6678   H HB2  . LEU D 1 80  ? 55.540  4.713   6.673   1.00 2.92  ? 80  LEU D HB2  1  
ATOM 6679   H HB3  . LEU D 1 80  ? 57.082  5.426   7.092   1.00 3.12  ? 80  LEU D HB3  1  
ATOM 6680   H HG   . LEU D 1 80  ? 56.478  2.525   7.636   1.00 3.76  ? 80  LEU D HG   1  
ATOM 6681   H HD11 . LEU D 1 80  ? 57.503  1.958   5.530   1.00 3.28  ? 80  LEU D HD11 1  
ATOM 6682   H HD12 . LEU D 1 80  ? 57.765  3.661   5.159   1.00 2.66  ? 80  LEU D HD12 1  
ATOM 6683   H HD13 . LEU D 1 80  ? 56.125  3.020   5.237   1.00 2.83  ? 80  LEU D HD13 1  
ATOM 6684   H HD21 . LEU D 1 80  ? 58.403  3.434   8.807   1.00 4.02  ? 80  LEU D HD21 1  
ATOM 6685   H HD22 . LEU D 1 80  ? 59.047  4.076   7.296   1.00 3.26  ? 80  LEU D HD22 1  
ATOM 6686   H HD23 . LEU D 1 80  ? 58.935  2.333   7.536   1.00 3.94  ? 80  LEU D HD23 1  
ATOM 6687   N N    . GLY D 1 81  ? 56.601  3.332   10.428  1.00 4.93  ? 81  GLY D N    1  
ATOM 6688   C CA   . GLY D 1 81  ? 56.504  2.126   11.225  1.00 5.63  ? 81  GLY D CA   1  
ATOM 6689   C C    . GLY D 1 81  ? 55.303  2.152   12.146  1.00 6.25  ? 81  GLY D C    1  
ATOM 6690   O O    . GLY D 1 81  ? 54.515  1.208   12.184  1.00 6.74  ? 81  GLY D O    1  
ATOM 6691   H H    . GLY D 1 81  ? 57.375  3.924   10.530  1.00 4.79  ? 81  GLY D H    1  
ATOM 6692   H HA2  . GLY D 1 81  ? 56.424  1.276   10.563  1.00 5.57  ? 81  GLY D HA2  1  
ATOM 6693   H HA3  . GLY D 1 81  ? 57.397  2.026   11.820  1.00 5.86  ? 81  GLY D HA3  1  
ATOM 6694   N N    . GLY D 1 82  ? 55.150  3.248   12.868  1.00 6.33  ? 82  GLY D N    1  
ATOM 6695   C CA   . GLY D 1 82  ? 54.038  3.387   13.781  1.00 6.97  ? 82  GLY D CA   1  
ATOM 6696   C C    . GLY D 1 82  ? 52.915  4.205   13.188  1.00 6.65  ? 82  GLY D C    1  
ATOM 6697   O O    . GLY D 1 82  ? 52.264  4.981   13.888  1.00 7.11  ? 82  GLY D O    1  
ATOM 6698   H H    . GLY D 1 82  ? 55.800  3.975   12.778  1.00 6.02  ? 82  GLY D H    1  
ATOM 6699   H HA2  . GLY D 1 82  ? 53.665  2.404   14.031  1.00 7.32  ? 82  GLY D HA2  1  
ATOM 6700   H HA3  . GLY D 1 82  ? 54.385  3.869   14.683  1.00 7.40  ? 82  GLY D HA3  1  
ATOM 6701   N N    . LYS D 1 83  ? 52.685  4.039   11.894  1.00 5.91  ? 83  LYS D N    1  
ATOM 6702   C CA   . LYS D 1 83  ? 51.631  4.777   11.220  1.00 5.56  ? 83  LYS D CA   1  
ATOM 6703   C C    . LYS D 1 83  ? 50.786  3.864   10.340  1.00 5.21  ? 83  LYS D C    1  
ATOM 6704   O O    . LYS D 1 83  ? 51.125  3.596   9.188   1.00 4.63  ? 83  LYS D O    1  
ATOM 6705   C CB   . LYS D 1 83  ? 52.223  5.914   10.382  1.00 4.97  ? 83  LYS D CB   1  
ATOM 6706   C CG   . LYS D 1 83  ? 51.449  7.220   10.496  1.00 5.18  ? 83  LYS D CG   1  
ATOM 6707   C CD   . LYS D 1 83  ? 51.612  7.859   11.868  1.00 6.05  ? 83  LYS D CD   1  
ATOM 6708   C CE   . LYS D 1 83  ? 53.006  8.441   12.059  1.00 6.18  ? 83  LYS D CE   1  
ATOM 6709   N NZ   . LYS D 1 83  ? 53.072  9.354   13.231  1.00 7.00  ? 83  LYS D NZ   1  
ATOM 6710   H H    . LYS D 1 83  ? 53.240  3.411   11.382  1.00 5.64  ? 83  LYS D H    1  
ATOM 6711   H HA   . LYS D 1 83  ? 50.995  5.203   11.980  1.00 6.06  ? 83  LYS D HA   1  
ATOM 6712   H HB2  . LYS D 1 83  ? 53.237  6.093   10.705  1.00 5.09  ? 83  LYS D HB2  1  
ATOM 6713   H HB3  . LYS D 1 83  ? 52.233  5.615   9.344   1.00 4.37  ? 83  LYS D HB3  1  
ATOM 6714   H HG2  . LYS D 1 83  ? 51.813  7.908   9.747   1.00 4.82  ? 83  LYS D HG2  1  
ATOM 6715   H HG3  . LYS D 1 83  ? 50.402  7.021   10.323  1.00 5.15  ? 83  LYS D HG3  1  
ATOM 6716   H HD2  . LYS D 1 83  ? 50.887  8.652   11.974  1.00 6.28  ? 83  LYS D HD2  1  
ATOM 6717   H HD3  . LYS D 1 83  ? 51.438  7.109   12.626  1.00 6.43  ? 83  LYS D HD3  1  
ATOM 6718   H HE2  . LYS D 1 83  ? 53.703  7.630   12.207  1.00 6.14  ? 83  LYS D HE2  1  
ATOM 6719   H HE3  . LYS D 1 83  ? 53.277  8.990   11.171  1.00 5.79  ? 83  LYS D HE3  1  
ATOM 6720   H HZ1  . LYS D 1 83  ? 52.307  10.062  13.180  1.00 7.18  ? 83  LYS D HZ1  1  
ATOM 6721   H HZ2  . LYS D 1 83  ? 53.993  9.853   13.247  1.00 7.05  ? 83  LYS D HZ2  1  
ATOM 6722   H HZ3  . LYS D 1 83  ? 52.969  8.814   14.112  1.00 7.44  ? 83  LYS D HZ3  1  
ATOM 6723   N N    . THR D 1 84  ? 49.695  3.372   10.905  1.00 5.67  ? 84  THR D N    1  
ATOM 6724   C CA   . THR D 1 84  ? 48.779  2.508   10.183  1.00 5.51  ? 84  THR D CA   1  
ATOM 6725   C C    . THR D 1 84  ? 47.641  3.338   9.591   1.00 5.12  ? 84  THR D C    1  
ATOM 6726   O O    . THR D 1 84  ? 46.876  3.964   10.326  1.00 5.56  ? 84  THR D O    1  
ATOM 6727   C CB   . THR D 1 84  ? 48.195  1.429   11.116  1.00 6.36  ? 84  THR D CB   1  
ATOM 6728   O OG1  . THR D 1 84  ? 49.169  1.058   12.105  1.00 6.89  ? 84  THR D OG1  1  
ATOM 6729   C CG2  . THR D 1 84  ? 47.772  0.199   10.327  1.00 6.31  ? 84  THR D CG2  1  
ATOM 6730   H H    . THR D 1 84  ? 49.505  3.586   11.839  1.00 6.20  ? 84  THR D H    1  
ATOM 6731   H HA   . THR D 1 84  ? 49.322  2.021   9.385   1.00 5.12  ? 84  THR D HA   1  
ATOM 6732   H HB   . THR D 1 84  ? 47.325  1.838   11.614  1.00 6.71  ? 84  THR D HB   1  
ATOM 6733   H HG1  . THR D 1 84  ? 49.005  0.148   12.386  1.00 7.19  ? 84  THR D HG1  1  
ATOM 6734   H HG21 . THR D 1 84  ? 47.372  -0.540  11.003  1.00 6.95  ? 84  THR D HG21 1  
ATOM 6735   H HG22 . THR D 1 84  ? 48.626  -0.211  9.811   1.00 6.14  ? 84  THR D HG22 1  
ATOM 6736   H HG23 . THR D 1 84  ? 47.016  0.476   9.607   1.00 5.95  ? 84  THR D HG23 1  
ATOM 6737   N N    . LEU D 1 85  ? 47.539  3.361   8.269   1.00 4.36  ? 85  LEU D N    1  
ATOM 6738   C CA   . LEU D 1 85  ? 46.497  4.136   7.609   1.00 3.95  ? 85  LEU D CA   1  
ATOM 6739   C C    . LEU D 1 85  ? 45.367  3.238   7.120   1.00 4.06  ? 85  LEU D C    1  
ATOM 6740   O O    . LEU D 1 85  ? 45.589  2.079   6.762   1.00 4.27  ? 85  LEU D O    1  
ATOM 6741   C CB   . LEU D 1 85  ? 47.084  4.931   6.438   1.00 3.08  ? 85  LEU D CB   1  
ATOM 6742   C CG   . LEU D 1 85  ? 47.422  4.114   5.185   1.00 2.65  ? 85  LEU D CG   1  
ATOM 6743   C CD1  . LEU D 1 85  ? 46.498  4.492   4.035   1.00 2.11  ? 85  LEU D CD1  1  
ATOM 6744   C CD2  . LEU D 1 85  ? 48.877  4.318   4.794   1.00 2.56  ? 85  LEU D CD2  1  
ATOM 6745   H H    . LEU D 1 85  ? 48.170  2.844   7.726   1.00 4.13  ? 85  LEU D H    1  
ATOM 6746   H HA   . LEU D 1 85  ? 46.096  4.829   8.333   1.00 4.30  ? 85  LEU D HA   1  
ATOM 6747   H HB2  . LEU D 1 85  ? 46.376  5.697   6.161   1.00 2.95  ? 85  LEU D HB2  1  
ATOM 6748   H HB3  . LEU D 1 85  ? 47.990  5.411   6.778   1.00 3.08  ? 85  LEU D HB3  1  
ATOM 6749   H HG   . LEU D 1 85  ? 47.276  3.064   5.397   1.00 3.13  ? 85  LEU D HG   1  
ATOM 6750   H HD11 . LEU D 1 85  ? 45.474  4.300   4.318   1.00 2.33  ? 85  LEU D HD11 1  
ATOM 6751   H HD12 . LEU D 1 85  ? 46.746  3.903   3.164   1.00 2.11  ? 85  LEU D HD12 1  
ATOM 6752   H HD13 . LEU D 1 85  ? 46.617  5.540   3.807   1.00 1.88  ? 85  LEU D HD13 1  
ATOM 6753   H HD21 . LEU D 1 85  ? 49.062  5.369   4.627   1.00 2.38  ? 85  LEU D HD21 1  
ATOM 6754   H HD22 . LEU D 1 85  ? 49.086  3.767   3.890   1.00 2.58  ? 85  LEU D HD22 1  
ATOM 6755   H HD23 . LEU D 1 85  ? 49.515  3.961   5.589   1.00 3.03  ? 85  LEU D HD23 1  
ATOM 6756   N N    . VAL D 1 86  ? 44.153  3.777   7.124   1.00 4.07  ? 86  VAL D N    1  
ATOM 6757   C CA   . VAL D 1 86  ? 42.989  3.041   6.664   1.00 4.19  ? 86  VAL D CA   1  
ATOM 6758   C C    . VAL D 1 86  ? 42.176  3.901   5.697   1.00 3.49  ? 86  VAL D C    1  
ATOM 6759   O O    . VAL D 1 86  ? 42.083  5.122   5.854   1.00 3.35  ? 86  VAL D O    1  
ATOM 6760   C CB   . VAL D 1 86  ? 42.085  2.570   7.834   1.00 5.07  ? 86  VAL D CB   1  
ATOM 6761   C CG1  . VAL D 1 86  ? 42.861  1.689   8.801   1.00 5.66  ? 86  VAL D CG1  1  
ATOM 6762   C CG2  . VAL D 1 86  ? 41.473  3.747   8.578   1.00 5.40  ? 86  VAL D CG2  1  
ATOM 6763   H H    . VAL D 1 86  ? 44.035  4.702   7.443   1.00 4.07  ? 86  VAL D H    1  
ATOM 6764   H HA   . VAL D 1 86  ? 43.341  2.168   6.134   1.00 4.25  ? 86  VAL D HA   1  
ATOM 6765   H HB   . VAL D 1 86  ? 41.279  1.981   7.419   1.00 5.31  ? 86  VAL D HB   1  
ATOM 6766   H HG11 . VAL D 1 86  ? 43.538  1.058   8.247   1.00 5.74  ? 86  VAL D HG11 1  
ATOM 6767   H HG12 . VAL D 1 86  ? 42.171  1.076   9.360   1.00 6.23  ? 86  VAL D HG12 1  
ATOM 6768   H HG13 . VAL D 1 86  ? 43.424  2.311   9.482   1.00 5.65  ? 86  VAL D HG13 1  
ATOM 6769   H HG21 . VAL D 1 86  ? 42.260  4.348   9.011   1.00 5.41  ? 86  VAL D HG21 1  
ATOM 6770   H HG22 . VAL D 1 86  ? 40.828  3.379   9.361   1.00 5.97  ? 86  VAL D HG22 1  
ATOM 6771   H HG23 . VAL D 1 86  ? 40.900  4.349   7.890   1.00 5.30  ? 86  VAL D HG23 1  
ATOM 6772   N N    . MET D 1 87  ? 41.619  3.267   4.682   1.00 3.21  ? 87  MET D N    1  
ATOM 6773   C CA   . MET D 1 87  ? 40.817  3.974   3.697   1.00 2.55  ? 87  MET D CA   1  
ATOM 6774   C C    . MET D 1 87  ? 39.386  3.464   3.740   1.00 2.90  ? 87  MET D C    1  
ATOM 6775   O O    . MET D 1 87  ? 39.122  2.312   3.392   1.00 3.28  ? 87  MET D O    1  
ATOM 6776   C CB   . MET D 1 87  ? 41.402  3.790   2.295   1.00 2.10  ? 87  MET D CB   1  
ATOM 6777   C CG   . MET D 1 87  ? 40.576  4.447   1.198   1.00 1.54  ? 87  MET D CG   1  
ATOM 6778   S SD   . MET D 1 87  ? 40.828  6.230   1.103   1.00 0.92  ? 87  MET D SD   1  
ATOM 6779   C CE   . MET D 1 87  ? 42.416  6.298   0.278   1.00 1.09  ? 87  MET D CE   1  
ATOM 6780   H H    . MET D 1 87  ? 41.740  2.297   4.596   1.00 3.56  ? 87  MET D H    1  
ATOM 6781   H HA   . MET D 1 87  ? 40.823  5.024   3.951   1.00 2.34  ? 87  MET D HA   1  
ATOM 6782   H HB2  . MET D 1 87  ? 42.395  4.214   2.274   1.00 1.88  ? 87  MET D HB2  1  
ATOM 6783   H HB3  . MET D 1 87  ? 41.466  2.733   2.082   1.00 2.62  ? 87  MET D HB3  1  
ATOM 6784   H HG2  . MET D 1 87  ? 40.849  4.010   0.250   1.00 1.79  ? 87  MET D HG2  1  
ATOM 6785   H HG3  . MET D 1 87  ? 39.532  4.256   1.392   1.00 1.71  ? 87  MET D HG3  1  
ATOM 6786   H HE1  . MET D 1 87  ? 42.340  5.817   -0.685  1.00 1.47  ? 87  MET D HE1  1  
ATOM 6787   H HE2  . MET D 1 87  ? 43.155  5.785   0.878   1.00 1.25  ? 87  MET D HE2  1  
ATOM 6788   H HE3  . MET D 1 87  ? 42.712  7.327   0.146   1.00 1.38  ? 87  MET D HE3  1  
ATOM 6789   N N    . ALA D 1 88  ? 38.474  4.319   4.169   1.00 2.94  ? 88  ALA D N    1  
ATOM 6790   C CA   . ALA D 1 88  ? 37.072  3.949   4.277   1.00 3.27  ? 88  ALA D CA   1  
ATOM 6791   C C    . ALA D 1 88  ? 36.237  4.644   3.210   1.00 2.61  ? 88  ALA D C    1  
ATOM 6792   O O    . ALA D 1 88  ? 36.429  5.828   2.930   1.00 2.26  ? 88  ALA D O    1  
ATOM 6793   C CB   . ALA D 1 88  ? 36.549  4.289   5.664   1.00 4.04  ? 88  ALA D CB   1  
ATOM 6794   H H    . ALA D 1 88  ? 38.746  5.231   4.412   1.00 2.86  ? 88  ALA D H    1  
ATOM 6795   H HA   . ALA D 1 88  ? 36.997  2.881   4.141   1.00 3.57  ? 88  ALA D HA   1  
ATOM 6796   H HB1  . ALA D 1 88  ? 36.639  5.353   5.834   1.00 3.97  ? 88  ALA D HB1  1  
ATOM 6797   H HB2  . ALA D 1 88  ? 37.124  3.756   6.406   1.00 4.52  ? 88  ALA D HB2  1  
ATOM 6798   H HB3  . ALA D 1 88  ? 35.511  3.999   5.737   1.00 4.33  ? 88  ALA D HB3  1  
ATOM 6799   N N    . VAL D 1 89  ? 35.319  3.902   2.612   1.00 2.62  ? 89  VAL D N    1  
ATOM 6800   C CA   . VAL D 1 89  ? 34.450  4.457   1.588   1.00 2.05  ? 89  VAL D CA   1  
ATOM 6801   C C    . VAL D 1 89  ? 33.062  4.730   2.168   1.00 2.42  ? 89  VAL D C    1  
ATOM 6802   O O    . VAL D 1 89  ? 32.432  3.851   2.763   1.00 3.03  ? 89  VAL D O    1  
ATOM 6803   C CB   . VAL D 1 89  ? 34.357  3.532   0.346   1.00 2.09  ? 89  VAL D CB   1  
ATOM 6804   C CG1  . VAL D 1 89  ? 33.902  2.132   0.731   1.00 2.98  ? 89  VAL D CG1  1  
ATOM 6805   C CG2  . VAL D 1 89  ? 33.435  4.125   -0.711  1.00 1.67  ? 89  VAL D CG2  1  
ATOM 6806   H H    . VAL D 1 89  ? 35.221  2.959   2.868   1.00 3.12  ? 89  VAL D H    1  
ATOM 6807   H HA   . VAL D 1 89  ? 34.879  5.398   1.276   1.00 1.56  ? 89  VAL D HA   1  
ATOM 6808   H HB   . VAL D 1 89  ? 35.347  3.453   -0.083  1.00 2.04  ? 89  VAL D HB   1  
ATOM 6809   H HG11 . VAL D 1 89  ? 33.774  1.536   -0.162  1.00 3.28  ? 89  VAL D HG11 1  
ATOM 6810   H HG12 . VAL D 1 89  ? 32.963  2.192   1.259   1.00 3.20  ? 89  VAL D HG12 1  
ATOM 6811   H HG13 . VAL D 1 89  ? 34.644  1.673   1.366   1.00 3.38  ? 89  VAL D HG13 1  
ATOM 6812   H HG21 . VAL D 1 89  ? 33.860  5.045   -1.085  1.00 1.39  ? 89  VAL D HG21 1  
ATOM 6813   H HG22 . VAL D 1 89  ? 32.469  4.328   -0.272  1.00 1.72  ? 89  VAL D HG22 1  
ATOM 6814   H HG23 . VAL D 1 89  ? 33.322  3.424   -1.525  1.00 1.98  ? 89  VAL D HG23 1  
ATOM 6815   N N    . TYR D 1 90  ? 32.597  5.956   2.006   1.00 2.26  ? 90  TYR D N    1  
ATOM 6816   C CA   . TYR D 1 90  ? 31.304  6.358   2.532   1.00 2.78  ? 90  TYR D CA   1  
ATOM 6817   C C    . TYR D 1 90  ? 30.366  6.781   1.409   1.00 2.34  ? 90  TYR D C    1  
ATOM 6818   O O    . TYR D 1 90  ? 30.786  7.424   0.447   1.00 1.87  ? 90  TYR D O    1  
ATOM 6819   C CB   . TYR D 1 90  ? 31.493  7.513   3.520   1.00 3.39  ? 90  TYR D CB   1  
ATOM 6820   C CG   . TYR D 1 90  ? 30.235  7.916   4.261   1.00 4.19  ? 90  TYR D CG   1  
ATOM 6821   C CD1  . TYR D 1 90  ? 29.513  6.988   4.998   1.00 4.76  ? 90  TYR D CD1  1  
ATOM 6822   C CD2  . TYR D 1 90  ? 29.772  9.227   4.224   1.00 4.53  ? 90  TYR D CD2  1  
ATOM 6823   C CE1  . TYR D 1 90  ? 28.366  7.352   5.675   1.00 5.51  ? 90  TYR D CE1  1  
ATOM 6824   C CE2  . TYR D 1 90  ? 28.626  9.599   4.902   1.00 5.27  ? 90  TYR D CE2  1  
ATOM 6825   C CZ   . TYR D 1 90  ? 27.926  8.655   5.626   1.00 5.71  ? 90  TYR D CZ   1  
ATOM 6826   O OH   . TYR D 1 90  ? 26.785  9.015   6.307   1.00 6.47  ? 90  TYR D OH   1  
ATOM 6827   H H    . TYR D 1 90  ? 33.132  6.611   1.501   1.00 1.95  ? 90  TYR D H    1  
ATOM 6828   H HA   . TYR D 1 90  ? 30.876  5.514   3.052   1.00 3.21  ? 90  TYR D HA   1  
ATOM 6829   H HB2  . TYR D 1 90  ? 32.230  7.228   4.255   1.00 3.54  ? 90  TYR D HB2  1  
ATOM 6830   H HB3  . TYR D 1 90  ? 31.849  8.376   2.980   1.00 3.26  ? 90  TYR D HB3  1  
ATOM 6831   H HD1  . TYR D 1 90  ? 29.857  5.966   5.040   1.00 4.72  ? 90  TYR D HD1  1  
ATOM 6832   H HD2  . TYR D 1 90  ? 30.323  9.961   3.656   1.00 4.33  ? 90  TYR D HD2  1  
ATOM 6833   H HE1  . TYR D 1 90  ? 27.817  6.614   6.242   1.00 6.02  ? 90  TYR D HE1  1  
ATOM 6834   H HE2  . TYR D 1 90  ? 28.282  10.624  4.861   1.00 5.61  ? 90  TYR D HE2  1  
ATOM 6835   H HH   . TYR D 1 90  ? 26.608  8.363   6.999   1.00 6.59  ? 90  TYR D HH   1  
ATOM 6836   N N    . ASP D 1 91  ? 29.105  6.404   1.543   1.00 2.65  ? 91  ASP D N    1  
ATOM 6837   C CA   . ASP D 1 91  ? 28.079  6.746   0.566   1.00 2.33  ? 91  ASP D CA   1  
ATOM 6838   C C    . ASP D 1 91  ? 27.134  7.779   1.173   1.00 2.89  ? 91  ASP D C    1  
ATOM 6839   O O    . ASP D 1 91  ? 26.932  7.795   2.388   1.00 3.58  ? 91  ASP D O    1  
ATOM 6840   C CB   . ASP D 1 91  ? 27.326  5.477   0.134   1.00 2.46  ? 91  ASP D CB   1  
ATOM 6841   C CG   . ASP D 1 91  ? 25.847  5.706   -0.117  1.00 2.27  ? 91  ASP D CG   1  
ATOM 6842   O OD1  . ASP D 1 91  ? 25.499  6.286   -1.164  1.00 1.82  ? 91  ASP D OD1  1  
ATOM 6843   O OD2  . ASP D 1 91  ? 25.037  5.303   0.739   1.00 2.73  ? 91  ASP D OD2  1  
ATOM 6844   H H    . ASP D 1 91  ? 28.850  5.884   2.332   1.00 3.15  ? 91  ASP D H    1  
ATOM 6845   H HA   . ASP D 1 91  ? 28.567  7.183   -0.292  1.00 1.83  ? 91  ASP D HA   1  
ATOM 6846   H HB2  . ASP D 1 91  ? 27.766  5.102   -0.778  1.00 2.32  ? 91  ASP D HB2  1  
ATOM 6847   H HB3  . ASP D 1 91  ? 27.430  4.728   0.907   1.00 3.06  ? 91  ASP D HB3  1  
ATOM 6848   N N    . PHE D 1 92  ? 26.567  8.647   0.346   1.00 2.77  ? 92  PHE D N    1  
ATOM 6849   C CA   . PHE D 1 92  ? 25.671  9.681   0.839   1.00 3.48  ? 92  PHE D CA   1  
ATOM 6850   C C    . PHE D 1 92  ? 24.605  10.039  -0.194  1.00 3.44  ? 92  PHE D C    1  
ATOM 6851   O O    . PHE D 1 92  ? 24.863  10.804  -1.124  1.00 3.78  ? 92  PHE D O    1  
ATOM 6852   C CB   . PHE D 1 92  ? 26.482  10.926  1.221   1.00 3.85  ? 92  PHE D CB   1  
ATOM 6853   C CG   . PHE D 1 92  ? 25.738  11.900  2.091   1.00 4.75  ? 92  PHE D CG   1  
ATOM 6854   C CD1  . PHE D 1 92  ? 25.155  11.487  3.278   1.00 5.19  ? 92  PHE D CD1  1  
ATOM 6855   C CD2  . PHE D 1 92  ? 25.623  13.231  1.723   1.00 5.34  ? 92  PHE D CD2  1  
ATOM 6856   C CE1  . PHE D 1 92  ? 24.470  12.380  4.079   1.00 6.06  ? 92  PHE D CE1  1  
ATOM 6857   C CE2  . PHE D 1 92  ? 24.940  14.129  2.520   1.00 6.18  ? 92  PHE D CE2  1  
ATOM 6858   C CZ   . PHE D 1 92  ? 24.363  13.703  3.700   1.00 6.48  ? 92  PHE D CZ   1  
ATOM 6859   H H    . PHE D 1 92  ? 26.753  8.587   -0.619  1.00 2.32  ? 92  PHE D H    1  
ATOM 6860   H HA   . PHE D 1 92  ? 25.183  9.298   1.722   1.00 3.93  ? 92  PHE D HA   1  
ATOM 6861   H HB2  . PHE D 1 92  ? 27.367  10.619  1.756   1.00 3.58  ? 92  PHE D HB2  1  
ATOM 6862   H HB3  . PHE D 1 92  ? 26.777  11.443  0.318   1.00 3.85  ? 92  PHE D HB3  1  
ATOM 6863   H HD1  . PHE D 1 92  ? 25.239  10.452  3.576   1.00 4.99  ? 92  PHE D HD1  1  
ATOM 6864   H HD2  . PHE D 1 92  ? 26.073  13.567  0.800   1.00 5.27  ? 92  PHE D HD2  1  
ATOM 6865   H HE1  . PHE D 1 92  ? 24.021  12.044  5.001   1.00 6.50  ? 92  PHE D HE1  1  
ATOM 6866   H HE2  . PHE D 1 92  ? 24.858  15.163  2.222   1.00 6.70  ? 92  PHE D HE2  1  
ATOM 6867   H HZ   . PHE D 1 92  ? 23.828  14.404  4.323   1.00 7.17  ? 92  PHE D HZ   1  
ATOM 6868   N N    . ASP D 1 93  ? 23.401  9.494   -0.016  1.00 3.20  ? 93  ASP D N    1  
ATOM 6869   C CA   . ASP D 1 93  ? 22.285  9.770   -0.924  1.00 3.16  ? 93  ASP D CA   1  
ATOM 6870   C C    . ASP D 1 93  ? 21.672  11.129  -0.592  1.00 3.87  ? 93  ASP D C    1  
ATOM 6871   O O    . ASP D 1 93  ? 20.761  11.597  -1.276  1.00 3.91  ? 93  ASP D O    1  
ATOM 6872   C CB   . ASP D 1 93  ? 21.215  8.660   -0.855  1.00 3.11  ? 93  ASP D CB   1  
ATOM 6873   C CG   . ASP D 1 93  ? 20.171  8.873   0.231   1.00 3.90  ? 93  ASP D CG   1  
ATOM 6874   O OD1  . ASP D 1 93  ? 20.554  8.990   1.416   1.00 4.33  ? 93  ASP D OD1  1  
ATOM 6875   O OD2  . ASP D 1 93  ? 18.959  8.907   -0.088  1.00 4.20  ? 93  ASP D OD2  1  
ATOM 6876   H H    . ASP D 1 93  ? 23.258  8.891   0.740   1.00 3.16  ? 93  ASP D H    1  
ATOM 6877   H HA   . ASP D 1 93  ? 22.685  9.810   -1.928  1.00 2.83  ? 93  ASP D HA   1  
ATOM 6878   H HB2  . ASP D 1 93  ? 20.702  8.610   -1.804  1.00 2.94  ? 93  ASP D HB2  1  
ATOM 6879   H HB3  . ASP D 1 93  ? 21.707  7.716   -0.673  1.00 2.89  ? 93  ASP D HB3  1  
ATOM 6880   N N    . ARG D 1 94  ? 22.196  11.746  0.473   1.00 4.53  ? 94  ARG D N    1  
ATOM 6881   C CA   . ARG D 1 94  ? 21.760  13.064  0.936   1.00 5.33  ? 94  ARG D CA   1  
ATOM 6882   C C    . ARG D 1 94  ? 20.362  13.021  1.547   1.00 5.49  ? 94  ARG D C    1  
ATOM 6883   O O    . ARG D 1 94  ? 19.658  14.033  1.565   1.00 5.93  ? 94  ARG D O    1  
ATOM 6884   C CB   . ARG D 1 94  ? 21.799  14.093  -0.206  1.00 5.55  ? 94  ARG D CB   1  
ATOM 6885   C CG   . ARG D 1 94  ? 23.181  14.649  -0.508  1.00 5.78  ? 94  ARG D CG   1  
ATOM 6886   C CD   . ARG D 1 94  ? 23.892  13.849  -1.588  1.00 5.51  ? 94  ARG D CD   1  
ATOM 6887   N NE   . ARG D 1 94  ? 24.896  14.650  -2.283  1.00 5.79  ? 94  ARG D NE   1  
ATOM 6888   C CZ   . ARG D 1 94  ? 25.579  14.230  -3.346  1.00 5.58  ? 94  ARG D CZ   1  
ATOM 6889   N NH1  . ARG D 1 94  ? 25.442  12.985  -3.786  1.00 5.04  ? 94  ARG D NH1  1  
ATOM 6890   N NH2  . ARG D 1 94  ? 26.421  15.057  -3.956  1.00 6.04  ? 94  ARG D NH2  1  
ATOM 6891   H H    . ARG D 1 94  ? 22.903  11.285  0.974   1.00 4.52  ? 94  ARG D H    1  
ATOM 6892   H HA   . ARG D 1 94  ? 22.452  13.379  1.702   1.00 5.81  ? 94  ARG D HA   1  
ATOM 6893   H HB2  . ARG D 1 94  ? 21.421  13.629  -1.104  1.00 5.12  ? 94  ARG D HB2  1  
ATOM 6894   H HB3  . ARG D 1 94  ? 21.154  14.918  0.056   1.00 6.11  ? 94  ARG D HB3  1  
ATOM 6895   H HG2  . ARG D 1 94  ? 23.080  15.670  -0.844  1.00 6.50  ? 94  ARG D HG2  1  
ATOM 6896   H HG3  . ARG D 1 94  ? 23.775  14.625  0.393   1.00 5.56  ? 94  ARG D HG3  1  
ATOM 6897   H HD2  . ARG D 1 94  ? 24.375  12.996  -1.133  1.00 5.81  ? 94  ARG D HD2  1  
ATOM 6898   H HD3  . ARG D 1 94  ? 23.162  13.508  -2.306  1.00 4.98  ? 94  ARG D HD3  1  
ATOM 6899   H HE   . ARG D 1 94  ? 25.050  15.565  -1.948  1.00 6.26  ? 94  ARG D HE   1  
ATOM 6900   H HH11 . ARG D 1 94  ? 24.824  12.340  -3.315  1.00 4.72  ? 94  ARG D HH11 1  
ATOM 6901   H HH12 . ARG D 1 94  ? 25.953  12.674  -4.589  1.00 5.03  ? 94  ARG D HH12 1  
ATOM 6902   H HH21 . ARG D 1 94  ? 26.546  15.993  -3.614  1.00 6.47  ? 94  ARG D HH21 1  
ATOM 6903   H HH22 . ARG D 1 94  ? 26.931  14.754  -4.766  1.00 6.03  ? 94  ARG D HH22 1  
ATOM 6904   N N    . PHE D 1 95  ? 19.968  11.863  2.064   1.00 5.24  ? 95  PHE D N    1  
ATOM 6905   C CA   . PHE D 1 95  ? 18.649  11.719  2.670   1.00 5.49  ? 95  PHE D CA   1  
ATOM 6906   C C    . PHE D 1 95  ? 18.668  10.745  3.849   1.00 5.88  ? 95  PHE D C    1  
ATOM 6907   O O    . PHE D 1 95  ? 18.255  11.092  4.956   1.00 6.58  ? 95  PHE D O    1  
ATOM 6908   C CB   . PHE D 1 95  ? 17.632  11.231  1.636   1.00 4.89  ? 95  PHE D CB   1  
ATOM 6909   C CG   . PHE D 1 95  ? 17.111  12.297  0.718   1.00 5.17  ? 95  PHE D CG   1  
ATOM 6910   C CD1  . PHE D 1 95  ? 16.178  13.215  1.166   1.00 5.27  ? 95  PHE D CD1  1  
ATOM 6911   C CD2  . PHE D 1 95  ? 17.542  12.369  -0.595  1.00 5.50  ? 95  PHE D CD2  1  
ATOM 6912   C CE1  . PHE D 1 95  ? 15.686  14.190  0.321   1.00 5.59  ? 95  PHE D CE1  1  
ATOM 6913   C CE2  . PHE D 1 95  ? 17.054  13.340  -1.447  1.00 5.81  ? 95  PHE D CE2  1  
ATOM 6914   C CZ   . PHE D 1 95  ? 16.124  14.252  -0.986  1.00 5.80  ? 95  PHE D CZ   1  
ATOM 6915   H H    . PHE D 1 95  ? 20.571  11.088  2.032   1.00 4.95  ? 95  PHE D H    1  
ATOM 6916   H HA   . PHE D 1 95  ? 18.343  12.688  3.029   1.00 5.94  ? 95  PHE D HA   1  
ATOM 6917   H HB2  . PHE D 1 95  ? 18.092  10.469  1.023   1.00 4.65  ? 95  PHE D HB2  1  
ATOM 6918   H HB3  . PHE D 1 95  ? 16.791  10.801  2.154   1.00 4.63  ? 95  PHE D HB3  1  
ATOM 6919   H HD1  . PHE D 1 95  ? 15.836  13.166  2.188   1.00 5.23  ? 95  PHE D HD1  1  
ATOM 6920   H HD2  . PHE D 1 95  ? 18.270  11.657  -0.954  1.00 5.64  ? 95  PHE D HD2  1  
ATOM 6921   H HE1  . PHE D 1 95  ? 14.959  14.902  0.681   1.00 5.80  ? 95  PHE D HE1  1  
ATOM 6922   H HE2  . PHE D 1 95  ? 17.397  13.384  -2.469  1.00 6.16  ? 95  PHE D HE2  1  
ATOM 6923   H HZ   . PHE D 1 95  ? 15.738  15.013  -1.647  1.00 6.08  ? 95  PHE D HZ   1  
ATOM 6924   N N    . SER D 1 96  ? 19.156  9.537   3.612   1.00 5.54  ? 96  SER D N    1  
ATOM 6925   C CA   . SER D 1 96  ? 19.191  8.509   4.645   1.00 6.04  ? 96  SER D CA   1  
ATOM 6926   C C    . SER D 1 96  ? 20.479  8.551   5.460   1.00 6.30  ? 96  SER D C    1  
ATOM 6927   O O    . SER D 1 96  ? 21.535  8.956   4.970   1.00 6.23  ? 96  SER D O    1  
ATOM 6928   C CB   . SER D 1 96  ? 19.024  7.128   4.009   1.00 5.79  ? 96  SER D CB   1  
ATOM 6929   O OG   . SER D 1 96  ? 19.966  6.920   2.969   1.00 5.43  ? 96  SER D OG   1  
ATOM 6930   H H    . SER D 1 96  ? 19.513  9.328   2.717   1.00 5.00  ? 96  SER D H    1  
ATOM 6931   H HA   . SER D 1 96  ? 18.359  8.684   5.309   1.00 6.53  ? 96  SER D HA   1  
ATOM 6932   H HB2  . SER D 1 96  ? 19.167  6.368   4.762   1.00 5.71  ? 96  SER D HB2  1  
ATOM 6933   H HB3  . SER D 1 96  ? 18.028  7.043   3.598   1.00 6.18  ? 96  SER D HB3  1  
ATOM 6934   H HG   . SER D 1 96  ? 19.978  7.689   2.377   1.00 5.10  ? 96  SER D HG   1  
ATOM 6935   N N    . LYS D 1 97  ? 20.381  8.123   6.711   1.00 6.68  ? 97  LYS D N    1  
ATOM 6936   C CA   . LYS D 1 97  ? 21.530  8.085   7.600   1.00 6.99  ? 97  LYS D CA   1  
ATOM 6937   C C    . LYS D 1 97  ? 22.123  6.682   7.599   1.00 6.36  ? 97  LYS D C    1  
ATOM 6938   O O    . LYS D 1 97  ? 21.568  5.761   8.198   1.00 6.52  ? 97  LYS D O    1  
ATOM 6939   C CB   . LYS D 1 97  ? 21.125  8.494   9.028   1.00 7.84  ? 97  LYS D CB   1  
ATOM 6940   C CG   . LYS D 1 97  ? 22.284  8.975   9.901   1.00 8.58  ? 97  LYS D CG   1  
ATOM 6941   C CD   . LYS D 1 97  ? 23.191  7.837   10.355  1.00 8.87  ? 97  LYS D CD   1  
ATOM 6942   C CE   . LYS D 1 97  ? 22.511  6.926   11.371  1.00 9.24  ? 97  LYS D CE   1  
ATOM 6943   N NZ   . LYS D 1 97  ? 22.522  7.505   12.741  1.00 9.78  ? 97  LYS D NZ   1  
ATOM 6944   H H    . LYS D 1 97  ? 19.511  7.821   7.043   1.00 6.80  ? 97  LYS D H    1  
ATOM 6945   H HA   . LYS D 1 97  ? 22.268  8.779   7.226   1.00 7.12  ? 97  LYS D HA   1  
ATOM 6946   H HB2  . LYS D 1 97  ? 20.402  9.295   8.962   1.00 7.94  ? 97  LYS D HB2  1  
ATOM 6947   H HB3  . LYS D 1 97  ? 20.661  7.647   9.512   1.00 7.94  ? 97  LYS D HB3  1  
ATOM 6948   H HG2  . LYS D 1 97  ? 22.874  9.678   9.333   1.00 8.49  ? 97  LYS D HG2  1  
ATOM 6949   H HG3  . LYS D 1 97  ? 21.880  9.468   10.772  1.00 9.11  ? 97  LYS D HG3  1  
ATOM 6950   H HD2  . LYS D 1 97  ? 23.470  7.248   9.493   1.00 8.63  ? 97  LYS D HD2  1  
ATOM 6951   H HD3  . LYS D 1 97  ? 24.078  8.260   10.804  1.00 9.18  ? 97  LYS D HD3  1  
ATOM 6952   H HE2  . LYS D 1 97  ? 21.486  6.771   11.066  1.00 8.97  ? 97  LYS D HE2  1  
ATOM 6953   H HE3  . LYS D 1 97  ? 23.026  5.978   11.385  1.00 9.51  ? 97  LYS D HE3  1  
ATOM 6954   H HZ1  . LYS D 1 97  ? 22.037  6.867   13.402  1.00 9.99  ? 97  LYS D HZ1  1  
ATOM 6955   H HZ2  . LYS D 1 97  ? 22.036  8.423   12.747  1.00 10.01 ? 97  LYS D HZ2  1  
ATOM 6956   H HZ3  . LYS D 1 97  ? 23.502  7.640   13.064  1.00 9.92  ? 97  LYS D HZ3  1  
ATOM 6957   N N    . HIS D 1 98  ? 23.237  6.522   6.906   1.00 5.75  ? 98  HIS D N    1  
ATOM 6958   C CA   . HIS D 1 98  ? 23.916  5.235   6.838   1.00 5.11  ? 98  HIS D CA   1  
ATOM 6959   C C    . HIS D 1 98  ? 25.378  5.410   7.212   1.00 5.49  ? 98  HIS D C    1  
ATOM 6960   O O    . HIS D 1 98  ? 25.843  6.539   7.385   1.00 6.03  ? 98  HIS D O    1  
ATOM 6961   C CB   . HIS D 1 98  ? 23.774  4.576   5.452   1.00 4.49  ? 98  HIS D CB   1  
ATOM 6962   C CG   . HIS D 1 98  ? 23.742  5.530   4.296   1.00 4.91  ? 98  HIS D CG   1  
ATOM 6963   N ND1  . HIS D 1 98  ? 22.655  5.662   3.463   1.00 5.01  ? 98  HIS D ND1  1  
ATOM 6964   C CD2  . HIS D 1 98  ? 24.679  6.379   3.820   1.00 5.39  ? 98  HIS D CD2  1  
ATOM 6965   C CE1  . HIS D 1 98  ? 22.925  6.552   2.529   1.00 5.60  ? 98  HIS D CE1  1  
ATOM 6966   N NE2  . HIS D 1 98  ? 24.152  7.005   2.718   1.00 5.84  ? 98  HIS D NE2  1  
ATOM 6967   H H    . HIS D 1 98  ? 23.628  7.296   6.448   1.00 5.80  ? 98  HIS D H    1  
ATOM 6968   H HA   . HIS D 1 98  ? 23.456  4.593   7.576   1.00 4.91  ? 98  HIS D HA   1  
ATOM 6969   H HB2  . HIS D 1 98  ? 24.608  3.908   5.298   1.00 4.26  ? 98  HIS D HB2  1  
ATOM 6970   H HB3  . HIS D 1 98  ? 22.860  4.001   5.432   1.00 4.06  ? 98  HIS D HB3  1  
ATOM 6971   H HD1  . HIS D 1 98  ? 21.801  5.169   3.544   1.00 4.75  ? 98  HIS D HD1  1  
ATOM 6972   H HD2  . HIS D 1 98  ? 25.668  6.535   4.232   1.00 5.48  ? 98  HIS D HD2  1  
ATOM 6973   H HE1  . HIS D 1 98  ? 22.255  6.858   1.739   1.00 5.90  ? 98  HIS D HE1  1  
ATOM 6974   H HE2  . HIS D 1 98  ? 24.701  7.394   2.003   1.00 6.37  ? 98  HIS D HE2  1  
ATOM 6975   N N    . ASP D 1 99  ? 26.100  4.305   7.331   1.00 5.32  ? 99  ASP D N    1  
ATOM 6976   C CA   . ASP D 1 99  ? 27.504  4.356   7.721   1.00 5.73  ? 99  ASP D CA   1  
ATOM 6977   C C    . ASP D 1 99  ? 28.418  3.894   6.596   1.00 5.15  ? 99  ASP D C    1  
ATOM 6978   O O    . ASP D 1 99  ? 28.001  3.783   5.441   1.00 4.43  ? 99  ASP D O    1  
ATOM 6979   C CB   . ASP D 1 99  ? 27.741  3.489   8.958   1.00 6.46  ? 99  ASP D CB   1  
ATOM 6980   C CG   . ASP D 1 99  ? 28.673  4.150   9.953   1.00 7.17  ? 99  ASP D CG   1  
ATOM 6981   O OD1  . ASP D 1 99  ? 29.882  4.261   9.663   1.00 7.40  ? 99  ASP D OD1  1  
ATOM 6982   O OD2  . ASP D 1 99  ? 28.192  4.567   11.030  1.00 7.65  ? 99  ASP D OD2  1  
ATOM 6983   H H    . ASP D 1 99  ? 25.687  3.438   7.145   1.00 4.98  ? 99  ASP D H    1  
ATOM 6984   H HA   . ASP D 1 99  ? 27.742  5.380   7.963   1.00 6.01  ? 99  ASP D HA   1  
ATOM 6985   H HB2  . ASP D 1 99  ? 26.798  3.302   9.446   1.00 6.69  ? 99  ASP D HB2  1  
ATOM 6986   H HB3  . ASP D 1 99  ? 28.179  2.548   8.654   1.00 6.32  ? 99  ASP D HB3  1  
ATOM 6987   N N    . ILE D 1 100 ? 29.668  3.640   6.952   1.00 5.52  ? 100 ILE D N    1  
ATOM 6988   C CA   . ILE D 1 100 ? 30.672  3.183   6.007   1.00 5.11  ? 100 ILE D CA   1  
ATOM 6989   C C    . ILE D 1 100 ? 30.372  1.756   5.551   1.00 5.26  ? 100 ILE D C    1  
ATOM 6990   O O    . ILE D 1 100 ? 30.108  0.879   6.372   1.00 5.99  ? 100 ILE D O    1  
ATOM 6991   C CB   . ILE D 1 100 ? 32.078  3.243   6.644   1.00 5.52  ? 100 ILE D CB   1  
ATOM 6992   C CG1  . ILE D 1 100 ? 32.415  4.684   7.038   1.00 5.57  ? 100 ILE D CG1  1  
ATOM 6993   C CG2  . ILE D 1 100 ? 33.134  2.689   5.695   1.00 5.13  ? 100 ILE D CG2  1  
ATOM 6994   C CD1  . ILE D 1 100 ? 33.562  4.795   8.020   1.00 6.11  ? 100 ILE D CD1  1  
ATOM 6995   H H    . ILE D 1 100 ? 29.926  3.764   7.898   1.00 6.12  ? 100 ILE D H    1  
ATOM 6996   H HA   . ILE D 1 100 ? 30.654  3.842   5.152   1.00 4.49  ? 100 ILE D HA   1  
ATOM 6997   H HB   . ILE D 1 100 ? 32.072  2.628   7.530   1.00 6.16  ? 100 ILE D HB   1  
ATOM 6998   H HG12 . ILE D 1 100 ? 32.688  5.236   6.152   1.00 5.01  ? 100 ILE D HG12 1  
ATOM 6999   H HG13 . ILE D 1 100 ? 31.546  5.141   7.488   1.00 5.88  ? 100 ILE D HG13 1  
ATOM 7000   H HG21 . ILE D 1 100 ? 34.075  2.604   6.215   1.00 5.42  ? 100 ILE D HG21 1  
ATOM 7001   H HG22 . ILE D 1 100 ? 33.247  3.354   4.852   1.00 4.48  ? 100 ILE D HG22 1  
ATOM 7002   H HG23 . ILE D 1 100 ? 32.827  1.714   5.345   1.00 5.30  ? 100 ILE D HG23 1  
ATOM 7003   H HD11 . ILE D 1 100 ? 33.267  4.371   8.969   1.00 6.60  ? 100 ILE D HD11 1  
ATOM 7004   H HD12 . ILE D 1 100 ? 33.821  5.835   8.155   1.00 6.25  ? 100 ILE D HD12 1  
ATOM 7005   H HD13 . ILE D 1 100 ? 34.418  4.258   7.638   1.00 6.02  ? 100 ILE D HD13 1  
ATOM 7006   N N    . ILE D 1 101 ? 30.413  1.533   4.244   1.00 4.67  ? 101 ILE D N    1  
ATOM 7007   C CA   . ILE D 1 101 ? 30.137  0.212   3.686   1.00 4.98  ? 101 ILE D CA   1  
ATOM 7008   C C    . ILE D 1 101 ? 31.318  -0.730  3.902   1.00 5.41  ? 101 ILE D C    1  
ATOM 7009   O O    . ILE D 1 101 ? 31.139  -1.904  4.225   1.00 6.05  ? 101 ILE D O    1  
ATOM 7010   C CB   . ILE D 1 101 ? 29.804  0.250   2.171   1.00 4.42  ? 101 ILE D CB   1  
ATOM 7011   C CG1  . ILE D 1 101 ? 30.156  1.611   1.539   1.00 3.67  ? 101 ILE D CG1  1  
ATOM 7012   C CG2  . ILE D 1 101 ? 28.338  -0.092  1.946   1.00 4.42  ? 101 ILE D CG2  1  
ATOM 7013   C CD1  . ILE D 1 101 ? 29.078  2.671   1.685   1.00 3.37  ? 101 ILE D CD1  1  
ATOM 7014   H H    . ILE D 1 101 ? 30.634  2.273   3.641   1.00 4.11  ? 101 ILE D H    1  
ATOM 7015   H HA   . ILE D 1 101 ? 29.279  -0.189  4.208   1.00 5.45  ? 101 ILE D HA   1  
ATOM 7016   H HB   . ILE D 1 101 ? 30.392  -0.517  1.690   1.00 4.78  ? 101 ILE D HB   1  
ATOM 7017   H HG12 . ILE D 1 101 ? 31.051  1.991   2.003   1.00 3.64  ? 101 ILE D HG12 1  
ATOM 7018   H HG13 . ILE D 1 101 ? 30.340  1.469   0.484   1.00 3.65  ? 101 ILE D HG13 1  
ATOM 7019   H HG21 . ILE D 1 101 ? 28.148  -1.101  2.281   1.00 5.05  ? 101 ILE D HG21 1  
ATOM 7020   H HG22 . ILE D 1 101 ? 28.107  -0.013  0.895   1.00 4.10  ? 101 ILE D HG22 1  
ATOM 7021   H HG23 . ILE D 1 101 ? 27.718  0.595   2.503   1.00 4.24  ? 101 ILE D HG23 1  
ATOM 7022   H HD11 . ILE D 1 101 ? 28.163  2.321   1.228   1.00 3.48  ? 101 ILE D HD11 1  
ATOM 7023   H HD12 . ILE D 1 101 ? 29.398  3.582   1.198   1.00 3.16  ? 101 ILE D HD12 1  
ATOM 7024   H HD13 . ILE D 1 101 ? 28.903  2.865   2.733   1.00 3.61  ? 101 ILE D HD13 1  
ATOM 7025   N N    . GLY D 1 102 ? 32.524  -0.213  3.728   1.00 5.10  ? 102 GLY D N    1  
ATOM 7026   C CA   . GLY D 1 102 ? 33.704  -1.030  3.903   1.00 5.50  ? 102 GLY D CA   1  
ATOM 7027   C C    . GLY D 1 102 ? 34.971  -0.210  3.908   1.00 5.00  ? 102 GLY D C    1  
ATOM 7028   O O    . GLY D 1 102 ? 34.934  0.998   3.657   1.00 4.32  ? 102 GLY D O    1  
ATOM 7029   H H    . GLY D 1 102 ? 32.616  0.732   3.490   1.00 4.63  ? 102 GLY D H    1  
ATOM 7030   H HA2  . GLY D 1 102 ? 33.628  -1.562  4.839   1.00 6.14  ? 102 GLY D HA2  1  
ATOM 7031   H HA3  . GLY D 1 102 ? 33.757  -1.747  3.097   1.00 5.61  ? 102 GLY D HA3  1  
ATOM 7032   N N    . GLU D 1 103 ? 36.090  -0.867  4.172   1.00 5.36  ? 103 GLU D N    1  
ATOM 7033   C CA   . GLU D 1 103 ? 37.378  -0.196  4.222   1.00 4.96  ? 103 GLU D CA   1  
ATOM 7034   C C    . GLU D 1 103 ? 38.513  -1.202  4.124   1.00 5.40  ? 103 GLU D C    1  
ATOM 7035   O O    . GLU D 1 103 ? 38.297  -2.410  4.239   1.00 6.12  ? 103 GLU D O    1  
ATOM 7036   C CB   . GLU D 1 103 ? 37.516  0.580   5.535   1.00 5.12  ? 103 GLU D CB   1  
ATOM 7037   C CG   . GLU D 1 103 ? 37.541  -0.318  6.765   1.00 6.08  ? 103 GLU D CG   1  
ATOM 7038   C CD   . GLU D 1 103 ? 37.923  0.419   8.030   1.00 6.46  ? 103 GLU D CD   1  
ATOM 7039   O OE1  . GLU D 1 103 ? 37.369  1.506   8.277   1.00 6.59  ? 103 GLU D OE1  1  
ATOM 7040   O OE2  . GLU D 1 103 ? 38.770  -0.098  8.790   1.00 6.78  ? 103 GLU D OE2  1  
ATOM 7041   H H    . GLU D 1 103 ? 36.052  -1.838  4.328   1.00 5.93  ? 103 GLU D H    1  
ATOM 7042   H HA   . GLU D 1 103 ? 37.437  0.494   3.394   1.00 4.30  ? 103 GLU D HA   1  
ATOM 7043   H HB2  . GLU D 1 103 ? 38.435  1.147   5.511   1.00 4.87  ? 103 GLU D HB2  1  
ATOM 7044   H HB3  . GLU D 1 103 ? 36.684  1.261   5.629   1.00 4.87  ? 103 GLU D HB3  1  
ATOM 7045   H HG2  . GLU D 1 103 ? 36.559  -0.744  6.900   1.00 6.30  ? 103 GLU D HG2  1  
ATOM 7046   H HG3  . GLU D 1 103 ? 38.254  -1.113  6.598   1.00 6.39  ? 103 GLU D HG3  1  
ATOM 7047   N N    . PHE D 1 104 ? 39.718  -0.697  3.913   1.00 5.02  ? 104 PHE D N    1  
ATOM 7048   C CA   . PHE D 1 104 ? 40.900  -1.538  3.843   1.00 5.42  ? 104 PHE D CA   1  
ATOM 7049   C C    . PHE D 1 104 ? 42.028  -0.869  4.616   1.00 5.15  ? 104 PHE D C    1  
ATOM 7050   O O    . PHE D 1 104 ? 42.066  0.360   4.731   1.00 4.48  ? 104 PHE D O    1  
ATOM 7051   C CB   . PHE D 1 104 ? 41.308  -1.833  2.385   1.00 5.37  ? 104 PHE D CB   1  
ATOM 7052   C CG   . PHE D 1 104 ? 41.989  -0.703  1.662   1.00 4.65  ? 104 PHE D CG   1  
ATOM 7053   C CD1  . PHE D 1 104 ? 43.364  -0.538  1.741   1.00 4.66  ? 104 PHE D CD1  1  
ATOM 7054   C CD2  . PHE D 1 104 ? 41.257  0.176   0.885   1.00 4.03  ? 104 PHE D CD2  1  
ATOM 7055   C CE1  . PHE D 1 104 ? 43.992  0.487   1.062   1.00 4.10  ? 104 PHE D CE1  1  
ATOM 7056   C CE2  . PHE D 1 104 ? 41.881  1.201   0.201   1.00 3.50  ? 104 PHE D CE2  1  
ATOM 7057   C CZ   . PHE D 1 104 ? 43.251  1.357   0.291   1.00 3.56  ? 104 PHE D CZ   1  
ATOM 7058   H H    . PHE D 1 104 ? 39.817  0.276   3.811   1.00 4.48  ? 104 PHE D H    1  
ATOM 7059   H HA   . PHE D 1 104 ? 40.660  -2.470  4.334   1.00 6.09  ? 104 PHE D HA   1  
ATOM 7060   H HB2  . PHE D 1 104 ? 41.985  -2.673  2.377   1.00 5.91  ? 104 PHE D HB2  1  
ATOM 7061   H HB3  . PHE D 1 104 ? 40.422  -2.097  1.823   1.00 5.45  ? 104 PHE D HB3  1  
ATOM 7062   H HD1  . PHE D 1 104 ? 43.945  -1.219  2.345   1.00 5.16  ? 104 PHE D HD1  1  
ATOM 7063   H HD2  . PHE D 1 104 ? 40.185  0.059   0.816   1.00 4.03  ? 104 PHE D HD2  1  
ATOM 7064   H HE1  . PHE D 1 104 ? 45.063  0.606   1.135   1.00 4.16  ? 104 PHE D HE1  1  
ATOM 7065   H HE2  . PHE D 1 104 ? 41.297  1.879   -0.401  1.00 3.13  ? 104 PHE D HE2  1  
ATOM 7066   H HZ   . PHE D 1 104 ? 43.740  2.157   -0.244  1.00 3.28  ? 104 PHE D HZ   1  
ATOM 7067   N N    . LYS D 1 105 ? 42.927  -1.671  5.154   1.00 5.70  ? 105 LYS D N    1  
ATOM 7068   C CA   . LYS D 1 105 ? 44.037  -1.151  5.932   1.00 5.56  ? 105 LYS D CA   1  
ATOM 7069   C C    . LYS D 1 105 ? 45.346  -1.777  5.479   1.00 5.86  ? 105 LYS D C    1  
ATOM 7070   O O    . LYS D 1 105 ? 45.369  -2.915  5.006   1.00 6.49  ? 105 LYS D O    1  
ATOM 7071   C CB   . LYS D 1 105 ? 43.812  -1.420  7.423   1.00 6.11  ? 105 LYS D CB   1  
ATOM 7072   C CG   . LYS D 1 105 ? 43.436  -2.860  7.744   1.00 7.03  ? 105 LYS D CG   1  
ATOM 7073   C CD   . LYS D 1 105 ? 41.924  -3.038  7.849   1.00 7.26  ? 105 LYS D CD   1  
ATOM 7074   C CE   . LYS D 1 105 ? 41.400  -2.563  9.196   1.00 7.44  ? 105 LYS D CE   1  
ATOM 7075   N NZ   . LYS D 1 105 ? 39.914  -2.502  9.229   1.00 7.70  ? 105 LYS D NZ   1  
ATOM 7076   H H    . LYS D 1 105 ? 42.856  -2.639  5.014   1.00 6.25  ? 105 LYS D H    1  
ATOM 7077   H HA   . LYS D 1 105 ? 44.087  -0.084  5.770   1.00 4.90  ? 105 LYS D HA   1  
ATOM 7078   H HB2  . LYS D 1 105 ? 44.717  -1.181  7.960   1.00 6.10  ? 105 LYS D HB2  1  
ATOM 7079   H HB3  . LYS D 1 105 ? 43.017  -0.780  7.772   1.00 5.93  ? 105 LYS D HB3  1  
ATOM 7080   H HG2  . LYS D 1 105 ? 43.811  -3.503  6.963   1.00 7.17  ? 105 LYS D HG2  1  
ATOM 7081   H HG3  . LYS D 1 105 ? 43.885  -3.135  8.686   1.00 7.46  ? 105 LYS D HG3  1  
ATOM 7082   H HD2  . LYS D 1 105 ? 41.448  -2.465  7.067   1.00 6.81  ? 105 LYS D HD2  1  
ATOM 7083   H HD3  . LYS D 1 105 ? 41.685  -4.084  7.728   1.00 7.82  ? 105 LYS D HD3  1  
ATOM 7084   H HE2  . LYS D 1 105 ? 41.739  -3.247  9.959   1.00 7.94  ? 105 LYS D HE2  1  
ATOM 7085   H HE3  . LYS D 1 105 ? 41.797  -1.578  9.395   1.00 6.96  ? 105 LYS D HE3  1  
ATOM 7086   H HZ1  . LYS D 1 105 ? 39.510  -3.199  8.574   1.00 8.08  ? 105 LYS D HZ1  1  
ATOM 7087   H HZ2  . LYS D 1 105 ? 39.581  -1.548  8.959   1.00 7.31  ? 105 LYS D HZ2  1  
ATOM 7088   H HZ3  . LYS D 1 105 ? 39.573  -2.712  10.190  1.00 7.97  ? 105 LYS D HZ3  1  
ATOM 7089   N N    . VAL D 1 106 ? 46.427  -1.030  5.620   1.00 5.45  ? 106 VAL D N    1  
ATOM 7090   C CA   . VAL D 1 106 ? 47.740  -1.512  5.233   1.00 5.73  ? 106 VAL D CA   1  
ATOM 7091   C C    . VAL D 1 106 ? 48.806  -1.030  6.223   1.00 5.66  ? 106 VAL D C    1  
ATOM 7092   O O    . VAL D 1 106 ? 48.965  0.172   6.458   1.00 5.05  ? 106 VAL D O    1  
ATOM 7093   C CB   . VAL D 1 106 ? 48.100  -1.078  3.786   1.00 5.36  ? 106 VAL D CB   1  
ATOM 7094   C CG1  . VAL D 1 106 ? 47.991  0.432   3.615   1.00 4.44  ? 106 VAL D CG1  1  
ATOM 7095   C CG2  . VAL D 1 106 ? 49.492  -1.563  3.400   1.00 5.79  ? 106 VAL D CG2  1  
ATOM 7096   H H    . VAL D 1 106 ? 46.343  -0.125  5.993   1.00 4.99  ? 106 VAL D H    1  
ATOM 7097   H HA   . VAL D 1 106 ? 47.709  -2.593  5.259   1.00 6.39  ? 106 VAL D HA   1  
ATOM 7098   H HB   . VAL D 1 106 ? 47.389  -1.537  3.116   1.00 5.56  ? 106 VAL D HB   1  
ATOM 7099   H HG11 . VAL D 1 106 ? 48.370  0.715   2.644   1.00 4.36  ? 106 VAL D HG11 1  
ATOM 7100   H HG12 . VAL D 1 106 ? 48.567  0.924   4.383   1.00 4.27  ? 106 VAL D HG12 1  
ATOM 7101   H HG13 . VAL D 1 106 ? 46.955  0.729   3.697   1.00 4.18  ? 106 VAL D HG13 1  
ATOM 7102   H HG21 . VAL D 1 106 ? 49.527  -2.641  3.458   1.00 6.46  ? 106 VAL D HG21 1  
ATOM 7103   H HG22 . VAL D 1 106 ? 50.220  -1.143  4.077   1.00 5.63  ? 106 VAL D HG22 1  
ATOM 7104   H HG23 . VAL D 1 106 ? 49.716  -1.250  2.390   1.00 5.67  ? 106 VAL D HG23 1  
ATOM 7105   N N    . PRO D 1 107 ? 49.516  -1.971  6.862   1.00 6.34  ? 107 PRO D N    1  
ATOM 7106   C CA   . PRO D 1 107 ? 50.571  -1.642  7.813   1.00 6.39  ? 107 PRO D CA   1  
ATOM 7107   C C    . PRO D 1 107 ? 51.854  -1.219  7.102   1.00 5.85  ? 107 PRO D C    1  
ATOM 7108   O O    . PRO D 1 107 ? 52.592  -2.057  6.580   1.00 6.11  ? 107 PRO D O    1  
ATOM 7109   C CB   . PRO D 1 107 ? 50.776  -2.949  8.580   1.00 7.31  ? 107 PRO D CB   1  
ATOM 7110   C CG   . PRO D 1 107 ? 50.382  -4.021  7.620   1.00 7.64  ? 107 PRO D CG   1  
ATOM 7111   C CD   . PRO D 1 107 ? 49.333  -3.428  6.717   1.00 7.15  ? 107 PRO D CD   1  
ATOM 7112   H HA   . PRO D 1 107 ? 50.261  -0.861  8.495   1.00 6.28  ? 107 PRO D HA   1  
ATOM 7113   H HB2  . PRO D 1 107 ? 51.813  -3.038  8.872   1.00 7.36  ? 107 PRO D HB2  1  
ATOM 7114   H HB3  . PRO D 1 107 ? 50.149  -2.954  9.459   1.00 7.67  ? 107 PRO D HB3  1  
ATOM 7115   H HG2  . PRO D 1 107 ? 51.241  -4.329  7.041   1.00 7.61  ? 107 PRO D HG2  1  
ATOM 7116   H HG3  . PRO D 1 107 ? 49.975  -4.864  8.160   1.00 8.29  ? 107 PRO D HG3  1  
ATOM 7117   H HD2  . PRO D 1 107 ? 49.502  -3.735  5.696   1.00 7.14  ? 107 PRO D HD2  1  
ATOM 7118   H HD3  . PRO D 1 107 ? 48.348  -3.726  7.043   1.00 7.46  ? 107 PRO D HD3  1  
ATOM 7119   N N    . MET D 1 108 ? 52.109  0.085   7.080   1.00 5.18  ? 108 MET D N    1  
ATOM 7120   C CA   . MET D 1 108 ? 53.301  0.626   6.425   1.00 4.62  ? 108 MET D CA   1  
ATOM 7121   C C    . MET D 1 108 ? 54.575  0.060   7.041   1.00 5.01  ? 108 MET D C    1  
ATOM 7122   O O    . MET D 1 108 ? 55.620  0.011   6.399   1.00 4.78  ? 108 MET D O    1  
ATOM 7123   C CB   . MET D 1 108 ? 53.313  2.152   6.509   1.00 3.93  ? 108 MET D CB   1  
ATOM 7124   C CG   . MET D 1 108 ? 52.189  2.817   5.731   1.00 3.44  ? 108 MET D CG   1  
ATOM 7125   S SD   . MET D 1 108 ? 52.058  2.217   4.032   1.00 3.34  ? 108 MET D SD   1  
ATOM 7126   C CE   . MET D 1 108 ? 53.693  2.592   3.400   1.00 3.08  ? 108 MET D CE   1  
ATOM 7127   H H    . MET D 1 108 ? 51.475  0.705   7.501   1.00 5.11  ? 108 MET D H    1  
ATOM 7128   H HA   . MET D 1 108 ? 53.261  0.335   5.387   1.00 4.51  ? 108 MET D HA   1  
ATOM 7129   H HB2  . MET D 1 108 ? 53.226  2.444   7.544   1.00 4.22  ? 108 MET D HB2  1  
ATOM 7130   H HB3  . MET D 1 108 ? 54.254  2.512   6.121   1.00 3.58  ? 108 MET D HB3  1  
ATOM 7131   H HG2  . MET D 1 108 ? 51.256  2.622   6.238   1.00 3.77  ? 108 MET D HG2  1  
ATOM 7132   H HG3  . MET D 1 108 ? 52.368  3.882   5.707   1.00 2.99  ? 108 MET D HG3  1  
ATOM 7133   H HE1  . MET D 1 108 ? 53.887  3.648   3.512   1.00 2.64  ? 108 MET D HE1  1  
ATOM 7134   H HE2  . MET D 1 108 ? 53.743  2.327   2.354   1.00 3.26  ? 108 MET D HE2  1  
ATOM 7135   H HE3  . MET D 1 108 ? 54.432  2.029   3.950   1.00 3.40  ? 108 MET D HE3  1  
ATOM 7136   N N    . ASN D 1 109 ? 54.473  -0.383  8.285   1.00 5.65  ? 109 ASN D N    1  
ATOM 7137   C CA   . ASN D 1 109 ? 55.606  -0.967  8.995   1.00 6.08  ? 109 ASN D CA   1  
ATOM 7138   C C    . ASN D 1 109 ? 56.075  -2.246  8.302   1.00 6.48  ? 109 ASN D C    1  
ATOM 7139   O O    . ASN D 1 109 ? 57.227  -2.654  8.437   1.00 6.62  ? 109 ASN D O    1  
ATOM 7140   C CB   . ASN D 1 109 ? 55.217  -1.272  10.444  1.00 6.79  ? 109 ASN D CB   1  
ATOM 7141   C CG   . ASN D 1 109 ? 56.415  -1.584  11.323  1.00 7.21  ? 109 ASN D CG   1  
ATOM 7142   O OD1  . ASN D 1 109 ? 57.527  -1.120  11.072  1.00 6.84  ? 109 ASN D OD1  1  
ATOM 7143   N ND2  . ASN D 1 109 ? 56.196  -2.370  12.363  1.00 8.00  ? 109 ASN D ND2  1  
ATOM 7144   H H    . ASN D 1 109 ? 53.614  -0.302  8.747   1.00 5.87  ? 109 ASN D H    1  
ATOM 7145   H HA   . ASN D 1 109 ? 56.412  -0.250  8.987   1.00 5.67  ? 109 ASN D HA   1  
ATOM 7146   H HB2  . ASN D 1 109 ? 54.707  -0.415  10.860  1.00 6.64  ? 109 ASN D HB2  1  
ATOM 7147   H HB3  . ASN D 1 109 ? 54.549  -2.122  10.461  1.00 7.22  ? 109 ASN D HB3  1  
ATOM 7148   H HD21 . ASN D 1 109 ? 55.284  -2.704  12.511  1.00 8.28  ? 109 ASN D HD21 1  
ATOM 7149   H HD22 . ASN D 1 109 ? 56.952  -2.584  12.949  1.00 8.28  ? 109 ASN D HD22 1  
ATOM 7150   N N    . THR D 1 110 ? 55.177  -2.865  7.548   1.00 6.72  ? 110 THR D N    1  
ATOM 7151   C CA   . THR D 1 110 ? 55.487  -4.091  6.834   1.00 7.25  ? 110 THR D CA   1  
ATOM 7152   C C    . THR D 1 110 ? 55.593  -3.826  5.330   1.00 6.86  ? 110 THR D C    1  
ATOM 7153   O O    . THR D 1 110 ? 55.721  -4.750  4.527   1.00 7.28  ? 110 THR D O    1  
ATOM 7154   C CB   . THR D 1 110 ? 54.410  -5.159  7.104   1.00 7.90  ? 110 THR D CB   1  
ATOM 7155   O OG1  . THR D 1 110 ? 53.923  -5.013  8.448   1.00 8.12  ? 110 THR D OG1  1  
ATOM 7156   C CG2  . THR D 1 110 ? 54.972  -6.564  6.916   1.00 8.72  ? 110 THR D CG2  1  
ATOM 7157   H H    . THR D 1 110 ? 54.277  -2.483  7.465   1.00 6.58  ? 110 THR D H    1  
ATOM 7158   H HA   . THR D 1 110 ? 56.435  -4.462  7.196   1.00 7.56  ? 110 THR D HA   1  
ATOM 7159   H HB   . THR D 1 110 ? 53.592  -5.014  6.411   1.00 7.65  ? 110 THR D HB   1  
ATOM 7160   H HG1  . THR D 1 110 ? 54.671  -5.039  9.059   1.00 8.37  ? 110 THR D HG1  1  
ATOM 7161   H HG21 . THR D 1 110 ? 55.804  -6.711  7.588   1.00 9.00  ? 110 THR D HG21 1  
ATOM 7162   H HG22 . THR D 1 110 ? 55.310  -6.685  5.895   1.00 8.65  ? 110 THR D HG22 1  
ATOM 7163   H HG23 . THR D 1 110 ? 54.204  -7.292  7.129   1.00 9.17  ? 110 THR D HG23 1  
ATOM 7164   N N    . VAL D 1 111 ? 55.552  -2.554  4.952   1.00 6.14  ? 111 VAL D N    1  
ATOM 7165   C CA   . VAL D 1 111 ? 55.639  -2.172  3.548   1.00 5.83  ? 111 VAL D CA   1  
ATOM 7166   C C    . VAL D 1 111 ? 56.789  -1.197  3.331   1.00 5.39  ? 111 VAL D C    1  
ATOM 7167   O O    . VAL D 1 111 ? 56.708  -0.031  3.714   1.00 4.76  ? 111 VAL D O    1  
ATOM 7168   C CB   . VAL D 1 111 ? 54.326  -1.527  3.047   1.00 5.31  ? 111 VAL D CB   1  
ATOM 7169   C CG1  . VAL D 1 111 ? 54.428  -1.160  1.572   1.00 5.19  ? 111 VAL D CG1  1  
ATOM 7170   C CG2  . VAL D 1 111 ? 53.141  -2.452  3.284   1.00 5.76  ? 111 VAL D CG2  1  
ATOM 7171   H H    . VAL D 1 111 ? 55.475  -1.850  5.634   1.00 5.88  ? 111 VAL D H    1  
ATOM 7172   H HA   . VAL D 1 111 ? 55.823  -3.064  2.970   1.00 6.37  ? 111 VAL D HA   1  
ATOM 7173   H HB   . VAL D 1 111 ? 54.162  -0.619  3.606   1.00 4.78  ? 111 VAL D HB   1  
ATOM 7174   H HG11 . VAL D 1 111 ? 53.503  -0.702  1.253   1.00 4.87  ? 111 VAL D HG11 1  
ATOM 7175   H HG12 . VAL D 1 111 ? 54.607  -2.053  0.992   1.00 5.80  ? 111 VAL D HG12 1  
ATOM 7176   H HG13 . VAL D 1 111 ? 55.243  -0.466  1.429   1.00 4.94  ? 111 VAL D HG13 1  
ATOM 7177   H HG21 . VAL D 1 111 ? 53.029  -2.631  4.344   1.00 5.96  ? 111 VAL D HG21 1  
ATOM 7178   H HG22 . VAL D 1 111 ? 53.308  -3.390  2.775   1.00 6.32  ? 111 VAL D HG22 1  
ATOM 7179   H HG23 . VAL D 1 111 ? 52.245  -1.989  2.899   1.00 5.38  ? 111 VAL D HG23 1  
ATOM 7180   N N    . ASP D 1 112 ? 57.862  -1.685  2.727   1.00 5.81  ? 112 ASP D N    1  
ATOM 7181   C CA   . ASP D 1 112 ? 59.031  -0.859  2.455   1.00 5.53  ? 112 ASP D CA   1  
ATOM 7182   C C    . ASP D 1 112 ? 58.723  0.154   1.354   1.00 5.15  ? 112 ASP D C    1  
ATOM 7183   O O    . ASP D 1 112 ? 57.837  -0.067  0.524   1.00 5.42  ? 112 ASP D O    1  
ATOM 7184   C CB   . ASP D 1 112 ? 60.229  -1.737  2.061   1.00 6.24  ? 112 ASP D CB   1  
ATOM 7185   C CG   . ASP D 1 112 ? 60.251  -2.093  0.586   1.00 6.82  ? 112 ASP D CG   1  
ATOM 7186   O OD1  . ASP D 1 112 ? 59.559  -3.058  0.191   1.00 7.37  ? 112 ASP D OD1  1  
ATOM 7187   O OD2  . ASP D 1 112 ? 60.969  -1.420  -0.183  1.00 6.86  ? 112 ASP D OD2  1  
ATOM 7188   H H    . ASP D 1 112 ? 57.868  -2.624  2.450   1.00 6.38  ? 112 ASP D H    1  
ATOM 7189   H HA   . ASP D 1 112 ? 59.270  -0.323  3.361   1.00 5.18  ? 112 ASP D HA   1  
ATOM 7190   H HB2  . ASP D 1 112 ? 61.140  -1.211  2.295   1.00 6.04  ? 112 ASP D HB2  1  
ATOM 7191   H HB3  . ASP D 1 112 ? 60.194  -2.654  2.632   1.00 6.65  ? 112 ASP D HB3  1  
ATOM 7192   N N    . PHE D 1 113 ? 59.448  1.264   1.348   1.00 4.63  ? 113 PHE D N    1  
ATOM 7193   C CA   . PHE D 1 113 ? 59.235  2.306   0.352   1.00 4.44  ? 113 PHE D CA   1  
ATOM 7194   C C    . PHE D 1 113 ? 60.440  2.432   -0.578  1.00 4.94  ? 113 PHE D C    1  
ATOM 7195   O O    . PHE D 1 113 ? 61.016  3.506   -0.737  1.00 4.81  ? 113 PHE D O    1  
ATOM 7196   C CB   . PHE D 1 113 ? 58.916  3.653   1.027   1.00 3.69  ? 113 PHE D CB   1  
ATOM 7197   C CG   . PHE D 1 113 ? 59.913  4.097   2.073   1.00 3.38  ? 113 PHE D CG   1  
ATOM 7198   C CD1  . PHE D 1 113 ? 59.928  3.521   3.333   1.00 3.30  ? 113 PHE D CD1  1  
ATOM 7199   C CD2  . PHE D 1 113 ? 60.825  5.102   1.792   1.00 3.38  ? 113 PHE D CD2  1  
ATOM 7200   C CE1  . PHE D 1 113 ? 60.835  3.933   4.291   1.00 3.21  ? 113 PHE D CE1  1  
ATOM 7201   C CE2  . PHE D 1 113 ? 61.733  5.521   2.746   1.00 3.15  ? 113 PHE D CE2  1  
ATOM 7202   C CZ   . PHE D 1 113 ? 61.739  4.935   3.996   1.00 3.05  ? 113 PHE D CZ   1  
ATOM 7203   H H    . PHE D 1 113 ? 60.147  1.384   2.025   1.00 4.48  ? 113 PHE D H    1  
ATOM 7204   H HA   . PHE D 1 113 ? 58.382  2.010   -0.241  1.00 4.61  ? 113 PHE D HA   1  
ATOM 7205   H HB2  . PHE D 1 113 ? 58.875  4.419   0.269   1.00 3.76  ? 113 PHE D HB2  1  
ATOM 7206   H HB3  . PHE D 1 113 ? 57.949  3.581   1.504   1.00 3.42  ? 113 PHE D HB3  1  
ATOM 7207   H HD1  . PHE D 1 113 ? 59.222  2.737   3.564   1.00 3.49  ? 113 PHE D HD1  1  
ATOM 7208   H HD2  . PHE D 1 113 ? 60.824  5.560   0.815   1.00 3.69  ? 113 PHE D HD2  1  
ATOM 7209   H HE1  . PHE D 1 113 ? 60.837  3.475   5.268   1.00 3.42  ? 113 PHE D HE1  1  
ATOM 7210   H HE2  . PHE D 1 113 ? 62.438  6.305   2.512   1.00 3.22  ? 113 PHE D HE2  1  
ATOM 7211   H HZ   . PHE D 1 113 ? 62.446  5.261   4.743   1.00 3.04  ? 113 PHE D HZ   1  
ATOM 7212   N N    . GLY D 1 114 ? 60.818  1.317   -1.185  1.00 5.63  ? 114 GLY D N    1  
ATOM 7213   C CA   . GLY D 1 114 ? 61.940  1.315   -2.099  1.00 6.21  ? 114 GLY D CA   1  
ATOM 7214   C C    . GLY D 1 114 ? 61.649  2.081   -3.374  1.00 6.50  ? 114 GLY D C    1  
ATOM 7215   O O    . GLY D 1 114 ? 62.506  2.810   -3.876  1.00 6.71  ? 114 GLY D O    1  
ATOM 7216   H H    . GLY D 1 114 ? 60.337  0.481   -0.997  1.00 5.81  ? 114 GLY D H    1  
ATOM 7217   H HA2  . GLY D 1 114 ? 62.790  1.761   -1.606  1.00 6.00  ? 114 GLY D HA2  1  
ATOM 7218   H HA3  . GLY D 1 114 ? 62.177  0.295   -2.353  1.00 6.73  ? 114 GLY D HA3  1  
ATOM 7219   N N    . HIS D 1 115 ? 60.445  1.913   -3.902  1.00 6.61  ? 115 HIS D N    1  
ATOM 7220   C CA   . HIS D 1 115 ? 60.041  2.594   -5.123  1.00 7.01  ? 115 HIS D CA   1  
ATOM 7221   C C    . HIS D 1 115 ? 58.575  3.012   -5.050  1.00 6.70  ? 115 HIS D C    1  
ATOM 7222   O O    . HIS D 1 115 ? 58.261  4.136   -4.658  1.00 6.22  ? 115 HIS D O    1  
ATOM 7223   C CB   . HIS D 1 115 ? 60.258  1.696   -6.342  1.00 7.92  ? 115 HIS D CB   1  
ATOM 7224   C CG   . HIS D 1 115 ? 61.641  1.770   -6.916  1.00 8.39  ? 115 HIS D CG   1  
ATOM 7225   N ND1  . HIS D 1 115 ? 62.345  0.659   -7.320  1.00 8.95  ? 115 HIS D ND1  1  
ATOM 7226   C CD2  . HIS D 1 115 ? 62.443  2.832   -7.162  1.00 8.48  ? 115 HIS D CD2  1  
ATOM 7227   C CE1  . HIS D 1 115 ? 63.521  1.033   -7.789  1.00 9.30  ? 115 HIS D CE1  1  
ATOM 7228   N NE2  . HIS D 1 115 ? 63.607  2.346   -7.699  1.00 9.04  ? 115 HIS D NE2  1  
ATOM 7229   H H    . HIS D 1 115 ? 59.807  1.314   -3.456  1.00 6.48  ? 115 HIS D H    1  
ATOM 7230   H HA   . HIS D 1 115 ? 60.650  3.480   -5.227  1.00 6.93  ? 115 HIS D HA   1  
ATOM 7231   H HB2  . HIS D 1 115 ? 60.071  0.670   -6.063  1.00 8.06  ? 115 HIS D HB2  1  
ATOM 7232   H HB3  . HIS D 1 115 ? 59.561  1.982   -7.115  1.00 8.17  ? 115 HIS D HB3  1  
ATOM 7233   H HD1  . HIS D 1 115 ? 62.028  -0.273  -7.278  1.00 9.12  ? 115 HIS D HD1  1  
ATOM 7234   H HD2  . HIS D 1 115 ? 62.212  3.870   -6.966  1.00 8.24  ? 115 HIS D HD2  1  
ATOM 7235   H HE1  . HIS D 1 115 ? 64.283  0.376   -8.177  1.00 9.78  ? 115 HIS D HE1  1  
ATOM 7236   H HE2  . HIS D 1 115 ? 64.317  2.893   -8.100  1.00 9.28  ? 115 HIS D HE2  1  
ATOM 7237   N N    . VAL D 1 116 ? 57.685  2.092   -5.413  1.00 7.03  ? 116 VAL D N    1  
ATOM 7238   C CA   . VAL D 1 116 ? 56.252  2.352   -5.408  1.00 6.79  ? 116 VAL D CA   1  
ATOM 7239   C C    . VAL D 1 116 ? 55.481  1.108   -4.985  1.00 6.84  ? 116 VAL D C    1  
ATOM 7240   O O    . VAL D 1 116 ? 55.969  -0.015  -5.127  1.00 7.46  ? 116 VAL D O    1  
ATOM 7241   C CB   . VAL D 1 116 ? 55.738  2.808   -6.799  1.00 7.43  ? 116 VAL D CB   1  
ATOM 7242   C CG1  . VAL D 1 116 ? 56.083  4.266   -7.058  1.00 7.39  ? 116 VAL D CG1  1  
ATOM 7243   C CG2  . VAL D 1 116 ? 56.296  1.918   -7.903  1.00 8.33  ? 116 VAL D CG2  1  
ATOM 7244   H H    . VAL D 1 116 ? 58.001  1.199   -5.670  1.00 7.49  ? 116 VAL D H    1  
ATOM 7245   H HA   . VAL D 1 116 ? 56.059  3.142   -4.698  1.00 6.18  ? 116 VAL D HA   1  
ATOM 7246   H HB   . VAL D 1 116 ? 54.661  2.714   -6.806  1.00 7.34  ? 116 VAL D HB   1  
ATOM 7247   H HG11 . VAL D 1 116 ? 57.156  4.385   -7.074  1.00 7.51  ? 116 VAL D HG11 1  
ATOM 7248   H HG12 . VAL D 1 116 ? 55.666  4.880   -6.273  1.00 6.85  ? 116 VAL D HG12 1  
ATOM 7249   H HG13 . VAL D 1 116 ? 55.674  4.572   -8.009  1.00 7.91  ? 116 VAL D HG13 1  
ATOM 7250   H HG21 . VAL D 1 116 ? 57.373  2.003   -7.924  1.00 8.50  ? 116 VAL D HG21 1  
ATOM 7251   H HG22 . VAL D 1 116 ? 55.894  2.229   -8.856  1.00 8.75  ? 116 VAL D HG22 1  
ATOM 7252   H HG23 . VAL D 1 116 ? 56.020  0.891   -7.713  1.00 8.47  ? 116 VAL D HG23 1  
ATOM 7253   N N    . THR D 1 117 ? 54.287  1.312   -4.462  1.00 6.25  ? 117 THR D N    1  
ATOM 7254   C CA   . THR D 1 117 ? 53.441  0.215   -4.029  1.00 6.35  ? 117 THR D CA   1  
ATOM 7255   C C    . THR D 1 117 ? 52.164  0.166   -4.866  1.00 6.59  ? 117 THR D C    1  
ATOM 7256   O O    . THR D 1 117 ? 51.191  0.868   -4.579  1.00 6.07  ? 117 THR D O    1  
ATOM 7257   C CB   . THR D 1 117 ? 53.079  0.343   -2.536  1.00 5.63  ? 117 THR D CB   1  
ATOM 7258   O OG1  . THR D 1 117 ? 54.184  0.912   -1.816  1.00 5.26  ? 117 THR D OG1  1  
ATOM 7259   C CG2  . THR D 1 117 ? 52.727  -1.014  -1.945  1.00 6.02  ? 117 THR D CG2  1  
ATOM 7260   H H    . THR D 1 117 ? 53.964  2.237   -4.353  1.00 5.79  ? 117 THR D H    1  
ATOM 7261   H HA   . THR D 1 117 ? 53.986  -0.707  -4.171  1.00 6.87  ? 117 THR D HA   1  
ATOM 7262   H HB   . THR D 1 117 ? 52.222  0.996   -2.442  1.00 5.19  ? 117 THR D HB   1  
ATOM 7263   H HG1  . THR D 1 117 ? 54.335  0.408   -1.011  1.00 5.29  ? 117 THR D HG1  1  
ATOM 7264   H HG21 . THR D 1 117 ? 53.588  -1.664  -1.996  1.00 6.49  ? 117 THR D HG21 1  
ATOM 7265   H HG22 . THR D 1 117 ? 51.912  -1.450  -2.505  1.00 6.30  ? 117 THR D HG22 1  
ATOM 7266   H HG23 . THR D 1 117 ? 52.428  -0.890  -0.914  1.00 5.63  ? 117 THR D HG23 1  
ATOM 7267   N N    . GLU D 1 118 ? 52.192  -0.633  -5.921  1.00 7.41  ? 118 GLU D N    1  
ATOM 7268   C CA   . GLU D 1 118 ? 51.048  -0.783  -6.806  1.00 7.75  ? 118 GLU D CA   1  
ATOM 7269   C C    . GLU D 1 118 ? 50.469  -2.181  -6.657  1.00 8.17  ? 118 GLU D C    1  
ATOM 7270   O O    . GLU D 1 118 ? 51.205  -3.166  -6.734  1.00 8.81  ? 118 GLU D O    1  
ATOM 7271   C CB   . GLU D 1 118 ? 51.457  -0.559  -8.262  1.00 8.43  ? 118 GLU D CB   1  
ATOM 7272   C CG   . GLU D 1 118 ? 52.309  0.675   -8.482  1.00 8.40  ? 118 GLU D CG   1  
ATOM 7273   C CD   . GLU D 1 118 ? 52.719  0.830   -9.930  1.00 9.20  ? 118 GLU D CD   1  
ATOM 7274   O OE1  . GLU D 1 118 ? 53.740  0.234   -10.330 1.00 9.68  ? 118 GLU D OE1  1  
ATOM 7275   O OE2  . GLU D 1 118 ? 52.018  1.543   -10.680 1.00 9.50  ? 118 GLU D OE2  1  
ATOM 7276   H H    . GLU D 1 118 ? 53.006  -1.149  -6.106  1.00 7.81  ? 118 GLU D H    1  
ATOM 7277   H HA   . GLU D 1 118 ? 50.301  -0.058  -6.525  1.00 7.26  ? 118 GLU D HA   1  
ATOM 7278   H HB2  . GLU D 1 118 ? 52.015  -1.419  -8.601  1.00 8.92  ? 118 GLU D HB2  1  
ATOM 7279   H HB3  . GLU D 1 118 ? 50.564  -0.465  -8.863  1.00 8.58  ? 118 GLU D HB3  1  
ATOM 7280   H HG2  . GLU D 1 118 ? 51.746  1.546   -8.184  1.00 8.04  ? 118 GLU D HG2  1  
ATOM 7281   H HG3  . GLU D 1 118 ? 53.199  0.596   -7.876  1.00 8.25  ? 118 GLU D HG3  1  
ATOM 7282   N N    . GLU D 1 119 ? 49.164  -2.272  -6.436  1.00 7.85  ? 119 GLU D N    1  
ATOM 7283   C CA   . GLU D 1 119 ? 48.508  -3.564  -6.276  1.00 8.29  ? 119 GLU D CA   1  
ATOM 7284   C C    . GLU D 1 119 ? 46.995  -3.434  -6.363  1.00 8.08  ? 119 GLU D C    1  
ATOM 7285   O O    . GLU D 1 119 ? 46.449  -2.328  -6.342  1.00 7.47  ? 119 GLU D O    1  
ATOM 7286   C CB   . GLU D 1 119 ? 48.895  -4.204  -4.938  1.00 8.15  ? 119 GLU D CB   1  
ATOM 7287   C CG   . GLU D 1 119 ? 48.827  -3.252  -3.752  1.00 7.26  ? 119 GLU D CG   1  
ATOM 7288   C CD   . GLU D 1 119 ? 48.548  -3.971  -2.448  1.00 7.30  ? 119 GLU D CD   1  
ATOM 7289   O OE1  . GLU D 1 119 ? 49.282  -4.930  -2.121  1.00 7.74  ? 119 GLU D OE1  1  
ATOM 7290   O OE2  . GLU D 1 119 ? 47.584  -3.594  -1.751  1.00 7.00  ? 119 GLU D OE2  1  
ATOM 7291   H H    . GLU D 1 119 ? 48.625  -1.451  -6.380  1.00 7.34  ? 119 GLU D H    1  
ATOM 7292   H HA   . GLU D 1 119 ? 48.845  -4.205  -7.078  1.00 8.94  ? 119 GLU D HA   1  
ATOM 7293   H HB2  . GLU D 1 119 ? 48.228  -5.032  -4.743  1.00 8.47  ? 119 GLU D HB2  1  
ATOM 7294   H HB3  . GLU D 1 119 ? 49.905  -4.579  -5.012  1.00 8.46  ? 119 GLU D HB3  1  
ATOM 7295   H HG2  . GLU D 1 119 ? 49.772  -2.736  -3.666  1.00 7.02  ? 119 GLU D HG2  1  
ATOM 7296   H HG3  . GLU D 1 119 ? 48.040  -2.535  -3.929  1.00 6.90  ? 119 GLU D HG3  1  
ATOM 7297   N N    . TRP D 1 120 ? 46.330  -4.576  -6.474  1.00 8.61  ? 120 TRP D N    1  
ATOM 7298   C CA   . TRP D 1 120 ? 44.880  -4.625  -6.545  1.00 8.50  ? 120 TRP D CA   1  
ATOM 7299   C C    . TRP D 1 120 ? 44.344  -5.066  -5.188  1.00 8.30  ? 120 TRP D C    1  
ATOM 7300   O O    . TRP D 1 120 ? 43.949  -6.217  -5.003  1.00 8.92  ? 120 TRP D O    1  
ATOM 7301   C CB   . TRP D 1 120 ? 44.427  -5.598  -7.645  1.00 9.33  ? 120 TRP D CB   1  
ATOM 7302   C CG   . TRP D 1 120 ? 45.400  -5.710  -8.781  1.00 9.94  ? 120 TRP D CG   1  
ATOM 7303   C CD1  . TRP D 1 120 ? 46.241  -6.754  -9.036  1.00 10.70 ? 120 TRP D CD1  1  
ATOM 7304   C CD2  . TRP D 1 120 ? 45.642  -4.742  -9.810  1.00 9.90  ? 120 TRP D CD2  1  
ATOM 7305   N NE1  . TRP D 1 120 ? 46.993  -6.493  -10.154 1.00 11.11 ? 120 TRP D NE1  1  
ATOM 7306   C CE2  . TRP D 1 120 ? 46.640  -5.265  -10.648 1.00 10.66 ? 120 TRP D CE2  1  
ATOM 7307   C CE3  . TRP D 1 120 ? 45.105  -3.487  -10.100 1.00 9.38  ? 120 TRP D CE3  1  
ATOM 7308   C CZ2  . TRP D 1 120 ? 47.119  -4.574  -11.758 1.00 10.92 ? 120 TRP D CZ2  1  
ATOM 7309   C CZ3  . TRP D 1 120 ? 45.579  -2.800  -11.201 1.00 9.70  ? 120 TRP D CZ3  1  
ATOM 7310   C CH2  . TRP D 1 120 ? 46.574  -3.345  -12.019 1.00 10.46 ? 120 TRP D CH2  1  
ATOM 7311   H H    . TRP D 1 120 ? 46.833  -5.415  -6.507  1.00 9.11  ? 120 TRP D H    1  
ATOM 7312   H HA   . TRP D 1 120 ? 44.517  -3.632  -6.767  1.00 7.99  ? 120 TRP D HA   1  
ATOM 7313   H HB2  . TRP D 1 120 ? 44.304  -6.581  -7.216  1.00 9.71  ? 120 TRP D HB2  1  
ATOM 7314   H HB3  . TRP D 1 120 ? 43.482  -5.265  -8.046  1.00 9.20  ? 120 TRP D HB3  1  
ATOM 7315   H HD1  . TRP D 1 120 ? 46.299  -7.647  -8.431  1.00 10.99 ? 120 TRP D HD1  1  
ATOM 7316   H HE1  . TRP D 1 120 ? 47.672  -7.090  -10.535 1.00 11.67 ? 120 TRP D HE1  1  
ATOM 7317   H HE3  . TRP D 1 120 ? 44.337  -3.055  -9.480  1.00 8.80  ? 120 TRP D HE3  1  
ATOM 7318   H HZ2  . TRP D 1 120 ? 47.887  -4.981  -12.399 1.00 11.52 ? 120 TRP D HZ2  1  
ATOM 7319   H HZ3  . TRP D 1 120 ? 45.175  -1.828  -11.441 1.00 9.41  ? 120 TRP D HZ3  1  
ATOM 7320   H HH2  . TRP D 1 120 ? 46.916  -2.773  -12.871 1.00 10.74 ? 120 TRP D HH2  1  
ATOM 7321   N N    . ARG D 1 121 ? 44.364  -4.141  -4.239  1.00 7.50  ? 121 ARG D N    1  
ATOM 7322   C CA   . ARG D 1 121 ? 43.922  -4.413  -2.878  1.00 7.36  ? 121 ARG D CA   1  
ATOM 7323   C C    . ARG D 1 121 ? 42.451  -4.802  -2.825  1.00 7.48  ? 121 ARG D C    1  
ATOM 7324   O O    . ARG D 1 121 ? 41.603  -4.206  -3.495  1.00 7.20  ? 121 ARG D O    1  
ATOM 7325   C CB   . ARG D 1 121 ? 44.189  -3.194  -1.988  1.00 6.51  ? 121 ARG D CB   1  
ATOM 7326   C CG   . ARG D 1 121 ? 43.784  -3.363  -0.528  1.00 6.51  ? 121 ARG D CG   1  
ATOM 7327   C CD   . ARG D 1 121 ? 44.333  -4.647  0.090   1.00 7.32  ? 121 ARG D CD   1  
ATOM 7328   N NE   . ARG D 1 121 ? 45.646  -5.024  -0.436  1.00 7.41  ? 121 ARG D NE   1  
ATOM 7329   C CZ   . ARG D 1 121 ? 46.081  -6.281  -0.513  1.00 7.96  ? 121 ARG D CZ   1  
ATOM 7330   N NH1  . ARG D 1 121 ? 45.288  -7.293  -0.161  1.00 8.46  ? 121 ARG D NH1  1  
ATOM 7331   N NH2  . ARG D 1 121 ? 47.298  -6.534  -0.973  1.00 8.04  ? 121 ARG D NH2  1  
ATOM 7332   H H    . ARG D 1 121 ? 44.671  -3.237  -4.465  1.00 7.05  ? 121 ARG D H    1  
ATOM 7333   H HA   . ARG D 1 121 ? 44.505  -5.242  -2.505  1.00 7.87  ? 121 ARG D HA   1  
ATOM 7334   H HB2  . ARG D 1 121 ? 45.246  -2.977  -2.013  1.00 6.44  ? 121 ARG D HB2  1  
ATOM 7335   H HB3  . ARG D 1 121 ? 43.652  -2.348  -2.392  1.00 6.00  ? 121 ARG D HB3  1  
ATOM 7336   H HG2  . ARG D 1 121 ? 44.156  -2.520  0.033   1.00 5.97  ? 121 ARG D HG2  1  
ATOM 7337   H HG3  . ARG D 1 121 ? 42.705  -3.382  -0.468  1.00 6.54  ? 121 ARG D HG3  1  
ATOM 7338   H HD2  . ARG D 1 121 ? 44.419  -4.508  1.158   1.00 7.34  ? 121 ARG D HD2  1  
ATOM 7339   H HD3  . ARG D 1 121 ? 43.636  -5.449  -0.107  1.00 7.89  ? 121 ARG D HD3  1  
ATOM 7340   H HE   . ARG D 1 121 ? 46.244  -4.293  -0.742  1.00 7.08  ? 121 ARG D HE   1  
ATOM 7341   H HH11 . ARG D 1 121 ? 44.347  -7.119  0.166   1.00 8.44  ? 121 ARG D HH11 1  
ATOM 7342   H HH12 . ARG D 1 121 ? 45.623  -8.235  -0.217  1.00 8.90  ? 121 ARG D HH12 1  
ATOM 7343   H HH21 . ARG D 1 121 ? 47.899  -5.772  -1.266  1.00 7.71  ? 121 ARG D HH21 1  
ATOM 7344   H HH22 . ARG D 1 121 ? 47.633  -7.475  -1.032  1.00 8.47  ? 121 ARG D HH22 1  
ATOM 7345   N N    . ASP D 1 122 ? 42.171  -5.821  -2.032  1.00 7.95  ? 122 ASP D N    1  
ATOM 7346   C CA   . ASP D 1 122 ? 40.821  -6.313  -1.849  1.00 8.15  ? 122 ASP D CA   1  
ATOM 7347   C C    . ASP D 1 122 ? 40.042  -5.373  -0.942  1.00 7.48  ? 122 ASP D C    1  
ATOM 7348   O O    . ASP D 1 122 ? 40.599  -4.779  -0.015  1.00 7.18  ? 122 ASP D O    1  
ATOM 7349   C CB   . ASP D 1 122 ? 40.846  -7.717  -1.234  1.00 9.03  ? 122 ASP D CB   1  
ATOM 7350   C CG   . ASP D 1 122 ? 41.405  -7.718  0.178   1.00 9.14  ? 122 ASP D CG   1  
ATOM 7351   O OD1  . ASP D 1 122 ? 42.630  -7.502  0.339   1.00 9.07  ? 122 ASP D OD1  1  
ATOM 7352   O OD2  . ASP D 1 122 ? 40.627  -7.929  1.135   1.00 9.37  ? 122 ASP D OD2  1  
ATOM 7353   H H    . ASP D 1 122 ? 42.900  -6.259  -1.547  1.00 8.21  ? 122 ASP D H    1  
ATOM 7354   H HA   . ASP D 1 122 ? 40.340  -6.353  -2.815  1.00 8.18  ? 122 ASP D HA   1  
ATOM 7355   H HB2  . ASP D 1 122 ? 39.840  -8.106  -1.204  1.00 9.19  ? 122 ASP D HB2  1  
ATOM 7356   H HB3  . ASP D 1 122 ? 41.459  -8.360  -1.846  1.00 9.50  ? 122 ASP D HB3  1  
ATOM 7357   N N    . LEU D 1 123 ? 38.766  -5.219  -1.230  1.00 7.30  ? 123 LEU D N    1  
ATOM 7358   C CA   . LEU D 1 123 ? 37.906  -4.374  -0.430  1.00 6.73  ? 123 LEU D CA   1  
ATOM 7359   C C    . LEU D 1 123 ? 36.964  -5.247  0.378   1.00 7.29  ? 123 LEU D C    1  
ATOM 7360   O O    . LEU D 1 123 ? 36.324  -6.151  -0.162  1.00 7.87  ? 123 LEU D O    1  
ATOM 7361   C CB   . LEU D 1 123 ? 37.117  -3.410  -1.317  1.00 6.11  ? 123 LEU D CB   1  
ATOM 7362   C CG   . LEU D 1 123 ? 37.920  -2.249  -1.903  1.00 5.57  ? 123 LEU D CG   1  
ATOM 7363   C CD1  . LEU D 1 123 ? 37.029  -1.387  -2.781  1.00 5.21  ? 123 LEU D CD1  1  
ATOM 7364   C CD2  . LEU D 1 123 ? 38.543  -1.414  -0.797  1.00 4.93  ? 123 LEU D CD2  1  
ATOM 7365   H H    . LEU D 1 123 ? 38.381  -5.696  -1.999  1.00 7.59  ? 123 LEU D H    1  
ATOM 7366   H HA   . LEU D 1 123 ? 38.528  -3.808  0.247   1.00 6.40  ? 123 LEU D HA   1  
ATOM 7367   H HB2  . LEU D 1 123 ? 36.693  -3.974  -2.134  1.00 6.48  ? 123 LEU D HB2  1  
ATOM 7368   H HB3  . LEU D 1 123 ? 36.311  -2.996  -0.733  1.00 5.75  ? 123 LEU D HB3  1  
ATOM 7369   H HG   . LEU D 1 123 ? 38.719  -2.643  -2.518  1.00 5.99  ? 123 LEU D HG   1  
ATOM 7370   H HD11 . LEU D 1 123 ? 36.132  -1.128  -2.239  1.00 5.24  ? 123 LEU D HD11 1  
ATOM 7371   H HD12 . LEU D 1 123 ? 36.767  -1.931  -3.675  1.00 5.00  ? 123 LEU D HD12 1  
ATOM 7372   H HD13 . LEU D 1 123 ? 37.557  -0.483  -3.051  1.00 5.40  ? 123 LEU D HD13 1  
ATOM 7373   H HD21 . LEU D 1 123 ? 37.784  -1.146  -0.079  1.00 4.64  ? 123 LEU D HD21 1  
ATOM 7374   H HD22 . LEU D 1 123 ? 38.967  -0.515  -1.222  1.00 4.56  ? 123 LEU D HD22 1  
ATOM 7375   H HD23 . LEU D 1 123 ? 39.319  -1.981  -0.309  1.00 5.25  ? 123 LEU D HD23 1  
ATOM 7376   N N    . GLN D 1 124 ? 36.893  -4.990  1.671   1.00 7.19  ? 124 GLN D N    1  
ATOM 7377   C CA   . GLN D 1 124 ? 36.040  -5.766  2.552   1.00 7.81  ? 124 GLN D CA   1  
ATOM 7378   C C    . GLN D 1 124 ? 35.121  -4.856  3.354   1.00 7.44  ? 124 GLN D C    1  
ATOM 7379   O O    . GLN D 1 124 ? 35.495  -3.735  3.704   1.00 6.83  ? 124 GLN D O    1  
ATOM 7380   C CB   . GLN D 1 124 ? 36.892  -6.629  3.486   1.00 8.35  ? 124 GLN D CB   1  
ATOM 7381   C CG   . GLN D 1 124 ? 38.195  -5.969  3.909   1.00 8.39  ? 124 GLN D CG   1  
ATOM 7382   C CD   . GLN D 1 124 ? 39.092  -6.904  4.688   1.00 9.03  ? 124 GLN D CD   1  
ATOM 7383   O OE1  . GLN D 1 124 ? 39.046  -6.947  5.916   1.00 9.48  ? 124 GLN D OE1  1  
ATOM 7384   N NE2  . GLN D 1 124 ? 39.912  -7.661  3.979   1.00 9.17  ? 124 GLN D NE2  1  
ATOM 7385   H H    . GLN D 1 124 ? 37.425  -4.257  2.047   1.00 6.75  ? 124 GLN D H    1  
ATOM 7386   H HA   . GLN D 1 124 ? 35.434  -6.413  1.934   1.00 8.22  ? 124 GLN D HA   1  
ATOM 7387   H HB2  . GLN D 1 124 ? 36.320  -6.849  4.374   1.00 8.55  ? 124 GLN D HB2  1  
ATOM 7388   H HB3  . GLN D 1 124 ? 37.130  -7.557  2.984   1.00 8.65  ? 124 GLN D HB3  1  
ATOM 7389   H HG2  . GLN D 1 124 ? 38.722  -5.642  3.025   1.00 8.23  ? 124 GLN D HG2  1  
ATOM 7390   H HG3  . GLN D 1 124 ? 37.965  -5.113  4.527   1.00 8.26  ? 124 GLN D HG3  1  
ATOM 7391   H HE21 . GLN D 1 124 ? 39.897  -7.578  2.995   1.00 8.90  ? 124 GLN D HE21 1  
ATOM 7392   H HE22 . GLN D 1 124 ? 40.497  -8.282  4.460   1.00 9.61  ? 124 GLN D HE22 1  
ATOM 7393   N N    . SER D 1 125 ? 33.915  -5.335  3.614   1.00 7.87  ? 125 SER D N    1  
ATOM 7394   C CA   . SER D 1 125 ? 32.933  -4.581  4.373   1.00 7.66  ? 125 SER D CA   1  
ATOM 7395   C C    . SER D 1 125 ? 33.383  -4.428  5.823   1.00 8.10  ? 125 SER D C    1  
ATOM 7396   O O    . SER D 1 125 ? 34.060  -5.303  6.367   1.00 8.79  ? 125 SER D O    1  
ATOM 7397   C CB   . SER D 1 125 ? 31.583  -5.296  4.302   1.00 8.00  ? 125 SER D CB   1  
ATOM 7398   O OG   . SER D 1 125 ? 31.603  -6.304  3.299   1.00 8.44  ? 125 SER D OG   1  
ATOM 7399   H H    . SER D 1 125 ? 33.675  -6.225  3.289   1.00 8.36  ? 125 SER D H    1  
ATOM 7400   H HA   . SER D 1 125 ? 32.841  -3.603  3.927   1.00 6.99  ? 125 SER D HA   1  
ATOM 7401   H HB2  . SER D 1 125 ? 31.369  -5.756  5.256   1.00 8.46  ? 125 SER D HB2  1  
ATOM 7402   H HB3  . SER D 1 125 ? 30.809  -4.579  4.064   1.00 7.52  ? 125 SER D HB3  1  
ATOM 7403   H HG   . SER D 1 125 ? 31.196  -5.964  2.490   1.00 8.27  ? 125 SER D HG   1  
ATOM 7404   N N    . ALA D 1 126 ? 33.019  -3.315  6.440   1.00 7.79  ? 126 ALA D N    1  
ATOM 7405   C CA   . ALA D 1 126 ? 33.391  -3.060  7.819   1.00 8.28  ? 126 ALA D CA   1  
ATOM 7406   C C    . ALA D 1 126 ? 32.315  -2.255  8.524   1.00 8.18  ? 126 ALA D C    1  
ATOM 7407   O O    . ALA D 1 126 ? 32.313  -1.023  8.474   1.00 7.63  ? 126 ALA D O    1  
ATOM 7408   C CB   . ALA D 1 126 ? 34.724  -2.332  7.884   1.00 8.10  ? 126 ALA D CB   1  
ATOM 7409   H H    . ALA D 1 126 ? 32.481  -2.649  5.958   1.00 7.30  ? 126 ALA D H    1  
ATOM 7410   H HA   . ALA D 1 126 ? 33.502  -4.012  8.317   1.00 8.92  ? 126 ALA D HA   1  
ATOM 7411   H HB1  . ALA D 1 126 ? 35.034  -2.240  8.915   1.00 8.54  ? 126 ALA D HB1  1  
ATOM 7412   H HB2  . ALA D 1 126 ? 34.618  -1.347  7.453   1.00 7.53  ? 126 ALA D HB2  1  
ATOM 7413   H HB3  . ALA D 1 126 ? 35.467  -2.890  7.332   1.00 8.19  ? 126 ALA D HB3  1  
ATOM 7414   N N    . GLU D 1 127 ? 31.390  -2.958  9.159   1.00 8.78  ? 127 GLU D N    1  
ATOM 7415   C CA   . GLU D 1 127 ? 30.305  -2.310  9.879   1.00 8.84  ? 127 GLU D CA   1  
ATOM 7416   C C    . GLU D 1 127 ? 30.843  -1.560  11.089  1.00 9.15  ? 127 GLU D C    1  
ATOM 7417   O O    . GLU D 1 127 ? 31.572  -2.120  11.912  1.00 9.77  ? 127 GLU D O    1  
ATOM 7418   C CB   . GLU D 1 127 ? 29.264  -3.337  10.320  1.00 9.49  ? 127 GLU D CB   1  
ATOM 7419   C CG   . GLU D 1 127 ? 28.408  -3.867  9.184   1.00 9.42  ? 127 GLU D CG   1  
ATOM 7420   C CD   . GLU D 1 127 ? 27.371  -4.862  9.661   1.00 10.16 ? 127 GLU D CD   1  
ATOM 7421   O OE1  . GLU D 1 127 ? 26.559  -4.507  10.545  1.00 10.31 ? 127 GLU D OE1  1  
ATOM 7422   O OE2  . GLU D 1 127 ? 27.363  -6.004  9.167   1.00 10.69 ? 127 GLU D OE2  1  
ATOM 7423   H H    . GLU D 1 127 ? 31.441  -3.940  9.145   1.00 9.23  ? 127 GLU D H    1  
ATOM 7424   H HA   . GLU D 1 127 ? 29.839  -1.604  9.209   1.00 8.23  ? 127 GLU D HA   1  
ATOM 7425   H HB2  . GLU D 1 127 ? 29.772  -4.172  10.780  1.00 10.06 ? 127 GLU D HB2  1  
ATOM 7426   H HB3  . GLU D 1 127 ? 28.612  -2.878  11.049  1.00 9.55  ? 127 GLU D HB3  1  
ATOM 7427   H HG2  . GLU D 1 127 ? 27.901  -3.038  8.714   1.00 8.98  ? 127 GLU D HG2  1  
ATOM 7428   H HG3  . GLU D 1 127 ? 29.050  -4.354  8.463   1.00 9.35  ? 127 GLU D HG3  1  
ATOM 7429   N N    . LYS D 1 128 ? 30.500  -0.288  11.180  1.00 8.79  ? 128 LYS D N    1  
ATOM 7430   C CA   . LYS D 1 128 ? 30.943  0.541   12.282  1.00 9.17  ? 128 LYS D CA   1  
ATOM 7431   C C    . LYS D 1 128 ? 29.810  0.738   13.278  1.00 9.67  ? 128 LYS D C    1  
ATOM 7432   O O    . LYS D 1 128 ? 28.970  1.629   13.055  1.00 10.17 ? 128 LYS D O    1  
ATOM 7433   C CB   . LYS D 1 128 ? 31.444  1.891   11.767  1.00 8.54  ? 128 LYS D CB   1  
ATOM 7434   C CG   . LYS D 1 128 ? 32.609  1.781   10.793  1.00 8.09  ? 128 LYS D CG   1  
ATOM 7435   C CD   . LYS D 1 128 ? 33.869  1.291   11.488  1.00 8.72  ? 128 LYS D CD   1  
ATOM 7436   C CE   . LYS D 1 128 ? 34.983  1.005   10.493  1.00 8.41  ? 128 LYS D CE   1  
ATOM 7437   N NZ   . LYS D 1 128 ? 35.387  2.226   9.748   1.00 7.81  ? 128 LYS D NZ   1  
ATOM 7438   O OXT  . LYS D 1 128 ? 29.763  -0.003  14.280  1.00 9.70  ? 128 LYS D OXT  1  
ATOM 7439   H H    . LYS D 1 128 ? 29.926  0.104   10.489  1.00 8.32  ? 128 LYS D H    1  
ATOM 7440   H HA   . LYS D 1 128 ? 31.756  0.031   12.776  1.00 9.61  ? 128 LYS D HA   1  
ATOM 7441   H HB2  . LYS D 1 128 ? 30.631  2.396   11.265  1.00 8.10  ? 128 LYS D HB2  1  
ATOM 7442   H HB3  . LYS D 1 128 ? 31.762  2.489   12.608  1.00 8.91  ? 128 LYS D HB3  1  
ATOM 7443   H HG2  . LYS D 1 128 ? 32.347  1.087   10.009  1.00 7.86  ? 128 LYS D HG2  1  
ATOM 7444   H HG3  . LYS D 1 128 ? 32.800  2.755   10.367  1.00 7.62  ? 128 LYS D HG3  1  
ATOM 7445   H HD2  . LYS D 1 128 ? 34.204  2.052   12.178  1.00 8.94  ? 128 LYS D HD2  1  
ATOM 7446   H HD3  . LYS D 1 128 ? 33.642  0.385   12.032  1.00 9.24  ? 128 LYS D HD3  1  
ATOM 7447   H HE2  . LYS D 1 128 ? 35.839  0.625   11.032  1.00 8.89  ? 128 LYS D HE2  1  
ATOM 7448   H HE3  . LYS D 1 128 ? 34.640  0.260   9.790   1.00 8.30  ? 128 LYS D HE3  1  
ATOM 7449   H HZ1  . LYS D 1 128 ? 34.591  2.586   9.190   1.00 7.49  ? 128 LYS D HZ1  1  
ATOM 7450   H HZ2  . LYS D 1 128 ? 36.181  2.004   9.099   1.00 7.92  ? 128 LYS D HZ2  1  
ATOM 7451   H HZ3  . LYS D 1 128 ? 35.694  2.964   10.409  1.00 7.76  ? 128 LYS D HZ3  1  
ATOM 7452   N N    . GLU A 1 1   ? -41.553 -11.648 11.763  1.00 4.87  ? 1   GLU A N    2  
ATOM 7453   C CA   . GLU A 1 1   ? -41.363 -10.422 10.958  1.00 4.59  ? 1   GLU A CA   2  
ATOM 7454   C C    . GLU A 1 1   ? -40.876 -9.270  11.828  1.00 4.47  ? 1   GLU A C    2  
ATOM 7455   O O    . GLU A 1 1   ? -41.657 -8.641  12.538  1.00 4.50  ? 1   GLU A O    2  
ATOM 7456   C CB   . GLU A 1 1   ? -42.670 -10.027 10.263  1.00 4.42  ? 1   GLU A CB   2  
ATOM 7457   C CG   . GLU A 1 1   ? -42.930 -10.775 8.963   1.00 4.55  ? 1   GLU A CG   2  
ATOM 7458   C CD   . GLU A 1 1   ? -43.321 -12.221 9.182   1.00 4.77  ? 1   GLU A CD   2  
ATOM 7459   O OE1  . GLU A 1 1   ? -42.449 -13.024 9.571   1.00 5.03  ? 1   GLU A OE1  2  
ATOM 7460   O OE2  . GLU A 1 1   ? -44.505 -12.556 8.976   1.00 4.81  ? 1   GLU A OE2  2  
ATOM 7461   H H1   . GLU A 1 1   ? -42.242 -11.478 12.523  1.00 4.88  ? 1   GLU A H1   2  
ATOM 7462   H H2   . GLU A 1 1   ? -40.652 -11.940 12.189  1.00 5.09  ? 1   GLU A H2   2  
ATOM 7463   H H3   . GLU A 1 1   ? -41.902 -12.421 11.157  1.00 4.94  ? 1   GLU A H3   2  
ATOM 7464   H HA   . GLU A 1 1   ? -40.614 -10.625 10.206  1.00 4.65  ? 1   GLU A HA   2  
ATOM 7465   H HB2  . GLU A 1 1   ? -43.493 -10.220 10.934  1.00 4.42  ? 1   GLU A HB2  2  
ATOM 7466   H HB3  . GLU A 1 1   ? -42.637 -8.970  10.044  1.00 4.27  ? 1   GLU A HB3  2  
ATOM 7467   H HG2  . GLU A 1 1   ? -43.730 -10.281 8.434   1.00 4.45  ? 1   GLU A HG2  2  
ATOM 7468   H HG3  . GLU A 1 1   ? -42.033 -10.747 8.362   1.00 4.67  ? 1   GLU A HG3  2  
ATOM 7469   N N    . LYS A 1 2   ? -39.579 -9.001  11.772  1.00 4.39  ? 2   LYS A N    2  
ATOM 7470   C CA   . LYS A 1 2   ? -38.983 -7.914  12.538  1.00 4.31  ? 2   LYS A CA   2  
ATOM 7471   C C    . LYS A 1 2   ? -38.110 -7.060  11.624  1.00 4.03  ? 2   LYS A C    2  
ATOM 7472   O O    . LYS A 1 2   ? -37.360 -7.589  10.796  1.00 4.07  ? 2   LYS A O    2  
ATOM 7473   C CB   . LYS A 1 2   ? -38.155 -8.453  13.712  1.00 4.60  ? 2   LYS A CB   2  
ATOM 7474   C CG   . LYS A 1 2   ? -36.985 -9.333  13.296  1.00 4.75  ? 2   LYS A CG   2  
ATOM 7475   C CD   . LYS A 1 2   ? -35.960 -9.473  14.415  1.00 4.69  ? 2   LYS A CD   2  
ATOM 7476   C CE   . LYS A 1 2   ? -36.555 -10.139 15.648  1.00 5.00  ? 2   LYS A CE   2  
ATOM 7477   N NZ   . LYS A 1 2   ? -36.868 -11.575 15.417  1.00 5.48  ? 2   LYS A NZ   2  
ATOM 7478   H H    . LYS A 1 2   ? -39.007 -9.539  11.183  1.00 4.42  ? 2   LYS A H    2  
ATOM 7479   H HA   . LYS A 1 2   ? -39.784 -7.301  12.922  1.00 4.26  ? 2   LYS A HA   2  
ATOM 7480   H HB2  . LYS A 1 2   ? -37.764 -7.617  14.272  1.00 4.55  ? 2   LYS A HB2  2  
ATOM 7481   H HB3  . LYS A 1 2   ? -38.801 -9.032  14.356  1.00 4.82  ? 2   LYS A HB3  2  
ATOM 7482   H HG2  . LYS A 1 2   ? -37.359 -10.313 13.040  1.00 5.05  ? 2   LYS A HG2  2  
ATOM 7483   H HG3  . LYS A 1 2   ? -36.507 -8.893  12.433  1.00 4.76  ? 2   LYS A HG3  2  
ATOM 7484   H HD2  . LYS A 1 2   ? -35.135 -10.072 14.062  1.00 4.74  ? 2   LYS A HD2  2  
ATOM 7485   H HD3  . LYS A 1 2   ? -35.601 -8.490  14.686  1.00 4.60  ? 2   LYS A HD3  2  
ATOM 7486   H HE2  . LYS A 1 2   ? -35.847 -10.063 16.458  1.00 5.03  ? 2   LYS A HE2  2  
ATOM 7487   H HE3  . LYS A 1 2   ? -37.462 -9.621  15.918  1.00 5.06  ? 2   LYS A HE3  2  
ATOM 7488   H HZ1  . LYS A 1 2   ? -37.314 -11.983 16.264  1.00 5.77  ? 2   LYS A HZ1  2  
ATOM 7489   H HZ2  . LYS A 1 2   ? -35.998 -12.104 15.210  1.00 5.61  ? 2   LYS A HZ2  2  
ATOM 7490   H HZ3  . LYS A 1 2   ? -37.522 -11.676 14.616  1.00 5.68  ? 2   LYS A HZ3  2  
ATOM 7491   N N    . LEU A 1 3   ? -38.224 -5.748  11.754  1.00 3.78  ? 3   LEU A N    2  
ATOM 7492   C CA   . LEU A 1 3   ? -37.440 -4.839  10.930  1.00 3.52  ? 3   LEU A CA   2  
ATOM 7493   C C    . LEU A 1 3   ? -37.201 -3.511  11.648  1.00 3.47  ? 3   LEU A C    2  
ATOM 7494   O O    . LEU A 1 3   ? -36.696 -2.557  11.056  1.00 3.31  ? 3   LEU A O    2  
ATOM 7495   C CB   . LEU A 1 3   ? -38.156 -4.601  9.600   1.00 3.26  ? 3   LEU A CB   2  
ATOM 7496   C CG   . LEU A 1 3   ? -37.254 -4.183  8.442   1.00 3.04  ? 3   LEU A CG   2  
ATOM 7497   C CD1  . LEU A 1 3   ? -36.638 -5.402  7.790   1.00 3.11  ? 3   LEU A CD1  2  
ATOM 7498   C CD2  . LEU A 1 3   ? -38.030 -3.366  7.423   1.00 2.79  ? 3   LEU A CD2  2  
ATOM 7499   H H    . LEU A 1 3   ? -38.856 -5.381  12.407  1.00 3.79  ? 3   LEU A H    2  
ATOM 7500   H HA   . LEU A 1 3   ? -36.487 -5.308  10.735  1.00 3.56  ? 3   LEU A HA   2  
ATOM 7501   H HB2  . LEU A 1 3   ? -38.664 -5.513  9.320   1.00 3.35  ? 3   LEU A HB2  2  
ATOM 7502   H HB3  . LEU A 1 3   ? -38.894 -3.831  9.746   1.00 3.21  ? 3   LEU A HB3  2  
ATOM 7503   H HG   . LEU A 1 3   ? -36.452 -3.568  8.823   1.00 3.07  ? 3   LEU A HG   2  
ATOM 7504   H HD11 . LEU A 1 3   ? -35.989 -5.089  6.987   1.00 3.08  ? 3   LEU A HD11 2  
ATOM 7505   H HD12 . LEU A 1 3   ? -37.420 -6.034  7.395   1.00 3.21  ? 3   LEU A HD12 2  
ATOM 7506   H HD13 . LEU A 1 3   ? -36.066 -5.954  8.522   1.00 3.35  ? 3   LEU A HD13 2  
ATOM 7507   H HD21 . LEU A 1 3   ? -38.097 -2.342  7.754   1.00 2.75  ? 3   LEU A HD21 2  
ATOM 7508   H HD22 . LEU A 1 3   ? -39.025 -3.775  7.319   1.00 2.87  ? 3   LEU A HD22 2  
ATOM 7509   H HD23 . LEU A 1 3   ? -37.526 -3.406  6.470   1.00 2.70  ? 3   LEU A HD23 2  
ATOM 7510   N N    . GLY A 1 4   ? -37.576 -3.453  12.919  1.00 3.65  ? 4   GLY A N    2  
ATOM 7511   C CA   . GLY A 1 4   ? -37.382 -2.244  13.692  1.00 3.66  ? 4   GLY A CA   2  
ATOM 7512   C C    . GLY A 1 4   ? -38.562 -1.302  13.606  1.00 3.55  ? 4   GLY A C    2  
ATOM 7513   O O    . GLY A 1 4   ? -39.710 -1.737  13.502  1.00 3.59  ? 4   GLY A O    2  
ATOM 7514   H H    . GLY A 1 4   ? -37.999 -4.230  13.331  1.00 3.81  ? 4   GLY A H    2  
ATOM 7515   H HA2  . GLY A 1 4   ? -37.229 -2.513  14.726  1.00 3.89  ? 4   GLY A HA2  2  
ATOM 7516   H HA3  . GLY A 1 4   ? -36.501 -1.735  13.328  1.00 3.54  ? 4   GLY A HA3  2  
ATOM 7517   N N    . LYS A 1 5   ? -38.278 -0.008  13.640  1.00 3.44  ? 5   LYS A N    2  
ATOM 7518   C CA   . LYS A 1 5   ? -39.319 1.011   13.575  1.00 3.34  ? 5   LYS A CA   2  
ATOM 7519   C C    . LYS A 1 5   ? -38.908 2.142   12.643  1.00 3.09  ? 5   LYS A C    2  
ATOM 7520   O O    . LYS A 1 5   ? -37.719 2.428   12.486  1.00 3.08  ? 5   LYS A O    2  
ATOM 7521   C CB   . LYS A 1 5   ? -39.611 1.581   14.967  1.00 3.60  ? 5   LYS A CB   2  
ATOM 7522   C CG   . LYS A 1 5   ? -40.383 0.635   15.877  1.00 3.87  ? 5   LYS A CG   2  
ATOM 7523   C CD   . LYS A 1 5   ? -40.574 1.223   17.268  1.00 3.99  ? 5   LYS A CD   2  
ATOM 7524   C CE   . LYS A 1 5   ? -41.534 2.403   17.254  1.00 3.83  ? 5   LYS A CE   2  
ATOM 7525   N NZ   . LYS A 1 5   ? -41.771 2.947   18.616  1.00 3.97  ? 5   LYS A NZ   2  
ATOM 7526   H H    . LYS A 1 5   ? -37.338 0.274   13.689  1.00 3.44  ? 5   LYS A H    2  
ATOM 7527   H HA   . LYS A 1 5   ? -40.213 0.548   13.188  1.00 3.30  ? 5   LYS A HA   2  
ATOM 7528   H HB2  . LYS A 1 5   ? -38.676 1.821   15.447  1.00 3.70  ? 5   LYS A HB2  2  
ATOM 7529   H HB3  . LYS A 1 5   ? -40.189 2.487   14.854  1.00 3.51  ? 5   LYS A HB3  2  
ATOM 7530   H HG2  . LYS A 1 5   ? -41.350 0.446   15.443  1.00 3.82  ? 5   LYS A HG2  2  
ATOM 7531   H HG3  . LYS A 1 5   ? -39.835 -0.293  15.961  1.00 4.08  ? 5   LYS A HG3  2  
ATOM 7532   H HD2  . LYS A 1 5   ? -40.969 0.459   17.921  1.00 4.20  ? 5   LYS A HD2  2  
ATOM 7533   H HD3  . LYS A 1 5   ? -39.615 1.554   17.640  1.00 4.05  ? 5   LYS A HD3  2  
ATOM 7534   H HE2  . LYS A 1 5   ? -41.115 3.183   16.635  1.00 3.73  ? 5   LYS A HE2  2  
ATOM 7535   H HE3  . LYS A 1 5   ? -42.476 2.079   16.835  1.00 3.83  ? 5   LYS A HE3  2  
ATOM 7536   H HZ1  . LYS A 1 5   ? -42.053 2.186   19.260  1.00 4.11  ? 5   LYS A HZ1  2  
ATOM 7537   H HZ2  . LYS A 1 5   ? -42.529 3.659   18.592  1.00 3.92  ? 5   LYS A HZ2  2  
ATOM 7538   H HZ3  . LYS A 1 5   ? -40.905 3.392   18.982  1.00 4.09  ? 5   LYS A HZ3  2  
ATOM 7539   N N    . LEU A 1 6   ? -39.896 2.773   12.029  1.00 2.90  ? 6   LEU A N    2  
ATOM 7540   C CA   . LEU A 1 6   ? -39.654 3.879   11.121  1.00 2.66  ? 6   LEU A CA   2  
ATOM 7541   C C    . LEU A 1 6   ? -40.375 5.121   11.627  1.00 2.67  ? 6   LEU A C    2  
ATOM 7542   O O    . LEU A 1 6   ? -41.575 5.086   11.901  1.00 2.67  ? 6   LEU A O    2  
ATOM 7543   C CB   . LEU A 1 6   ? -40.127 3.524   9.707   1.00 2.39  ? 6   LEU A CB   2  
ATOM 7544   C CG   . LEU A 1 6   ? -39.586 4.421   8.590   1.00 2.18  ? 6   LEU A CG   2  
ATOM 7545   C CD1  . LEU A 1 6   ? -39.316 3.606   7.333   1.00 2.15  ? 6   LEU A CD1  2  
ATOM 7546   C CD2  . LEU A 1 6   ? -40.560 5.550   8.289   1.00 2.00  ? 6   LEU A CD2  2  
ATOM 7547   H H    . LEU A 1 6   ? -40.825 2.489   12.196  1.00 2.93  ? 6   LEU A H    2  
ATOM 7548   H HA   . LEU A 1 6   ? -38.591 4.072   11.104  1.00 2.71  ? 6   LEU A HA   2  
ATOM 7549   H HB2  . LEU A 1 6   ? -39.833 2.508   9.499   1.00 2.45  ? 6   LEU A HB2  2  
ATOM 7550   H HB3  . LEU A 1 6   ? -41.205 3.578   9.689   1.00 2.35  ? 6   LEU A HB3  2  
ATOM 7551   H HG   . LEU A 1 6   ? -38.652 4.859   8.911   1.00 2.39  ? 6   LEU A HG   2  
ATOM 7552   H HD11 . LEU A 1 6   ? -38.930 4.253   6.560   1.00 2.12  ? 6   LEU A HD11 2  
ATOM 7553   H HD12 . LEU A 1 6   ? -40.235 3.150   6.994   1.00 2.12  ? 6   LEU A HD12 2  
ATOM 7554   H HD13 . LEU A 1 6   ? -38.591 2.835   7.552   1.00 2.53  ? 6   LEU A HD13 2  
ATOM 7555   H HD21 . LEU A 1 6   ? -40.143 6.193   7.526   1.00 1.95  ? 6   LEU A HD21 2  
ATOM 7556   H HD22 . LEU A 1 6   ? -40.733 6.124   9.187   1.00 2.19  ? 6   LEU A HD22 2  
ATOM 7557   H HD23 . LEU A 1 6   ? -41.495 5.136   7.942   1.00 1.96  ? 6   LEU A HD23 2  
ATOM 7558   N N    . GLN A 1 7   ? -39.643 6.212   11.759  1.00 2.71  ? 7   GLN A N    2  
ATOM 7559   C CA   . GLN A 1 7   ? -40.218 7.457   12.240  1.00 2.75  ? 7   GLN A CA   2  
ATOM 7560   C C    . GLN A 1 7   ? -40.574 8.342   11.055  1.00 2.52  ? 7   GLN A C    2  
ATOM 7561   O O    . GLN A 1 7   ? -39.715 8.647   10.224  1.00 2.43  ? 7   GLN A O    2  
ATOM 7562   C CB   . GLN A 1 7   ? -39.248 8.196   13.177  1.00 3.01  ? 7   GLN A CB   2  
ATOM 7563   C CG   . GLN A 1 7   ? -37.967 7.432   13.496  1.00 3.19  ? 7   GLN A CG   2  
ATOM 7564   C CD   . GLN A 1 7   ? -38.197 6.218   14.378  1.00 3.37  ? 7   GLN A CD   2  
ATOM 7565   O OE1  . GLN A 1 7   ? -39.119 6.185   15.191  1.00 3.45  ? 7   GLN A OE1  2  
ATOM 7566   N NE2  . GLN A 1 7   ? -37.350 5.213   14.227  1.00 3.46  ? 7   GLN A NE2  2  
ATOM 7567   H H    . GLN A 1 7   ? -38.693 6.186   11.506  1.00 2.73  ? 7   GLN A H    2  
ATOM 7568   H HA   . GLN A 1 7   ? -41.121 7.217   12.781  1.00 2.79  ? 7   GLN A HA   2  
ATOM 7569   H HB2  . GLN A 1 7   ? -38.972 9.133   12.719  1.00 2.97  ? 7   GLN A HB2  2  
ATOM 7570   H HB3  . GLN A 1 7   ? -39.757 8.402   14.108  1.00 3.13  ? 7   GLN A HB3  2  
ATOM 7571   H HG2  . GLN A 1 7   ? -37.522 7.101   12.573  1.00 3.05  ? 7   GLN A HG2  2  
ATOM 7572   H HG3  . GLN A 1 7   ? -37.284 8.101   14.001  1.00 3.35  ? 7   GLN A HG3  2  
ATOM 7573   H HE21 . GLN A 1 7   ? -36.629 5.310   13.565  1.00 3.39  ? 7   GLN A HE21 2  
ATOM 7574   H HE22 . GLN A 1 7   ? -37.474 4.413   14.780  1.00 3.60  ? 7   GLN A HE22 2  
ATOM 7575   N N    . TYR A 1 8   ? -41.831 8.751   10.970  1.00 2.44  ? 8   TYR A N    2  
ATOM 7576   C CA   . TYR A 1 8   ? -42.278 9.584   9.864   1.00 2.24  ? 8   TYR A CA   2  
ATOM 7577   C C    . TYR A 1 8   ? -43.431 10.489  10.276  1.00 2.29  ? 8   TYR A C    2  
ATOM 7578   O O    . TYR A 1 8   ? -43.959 10.380  11.384  1.00 2.41  ? 8   TYR A O    2  
ATOM 7579   C CB   . TYR A 1 8   ? -42.700 8.711   8.674   1.00 1.99  ? 8   TYR A CB   2  
ATOM 7580   C CG   . TYR A 1 8   ? -43.934 7.863   8.918   1.00 1.98  ? 8   TYR A CG   2  
ATOM 7581   C CD1  . TYR A 1 8   ? -43.926 6.836   9.855   1.00 2.21  ? 8   TYR A CD1  2  
ATOM 7582   C CD2  . TYR A 1 8   ? -45.105 8.087   8.204   1.00 1.88  ? 8   TYR A CD2  2  
ATOM 7583   C CE1  . TYR A 1 8   ? -45.047 6.058   10.072  1.00 2.25  ? 8   TYR A CE1  2  
ATOM 7584   C CE2  . TYR A 1 8   ? -46.231 7.313   8.417   1.00 1.94  ? 8   TYR A CE2  2  
ATOM 7585   C CZ   . TYR A 1 8   ? -46.197 6.300   9.353   1.00 2.08  ? 8   TYR A CZ   2  
ATOM 7586   O OH   . TYR A 1 8   ? -47.314 5.523   9.564   1.00 2.19  ? 8   TYR A OH   2  
ATOM 7587   H H    . TYR A 1 8   ? -42.474 8.490   11.669  1.00 2.52  ? 8   TYR A H    2  
ATOM 7588   H HA   . TYR A 1 8   ? -41.446 10.201  9.561   1.00 2.28  ? 8   TYR A HA   2  
ATOM 7589   H HB2  . TYR A 1 8   ? -42.903 9.348   7.826   1.00 1.86  ? 8   TYR A HB2  2  
ATOM 7590   H HB3  . TYR A 1 8   ? -41.886 8.046   8.424   1.00 1.96  ? 8   TYR A HB3  2  
ATOM 7591   H HD1  . TYR A 1 8   ? -43.026 6.647   10.420  1.00 2.44  ? 8   TYR A HD1  2  
ATOM 7592   H HD2  . TYR A 1 8   ? -45.131 8.882   7.472   1.00 1.87  ? 8   TYR A HD2  2  
ATOM 7593   H HE1  . TYR A 1 8   ? -45.018 5.268   10.805  1.00 2.50  ? 8   TYR A HE1  2  
ATOM 7594   H HE2  . TYR A 1 8   ? -47.130 7.502   7.852   1.00 1.98  ? 8   TYR A HE2  2  
ATOM 7595   H HH   . TYR A 1 8   ? -47.437 5.386   10.518  1.00 2.33  ? 8   TYR A HH   2  
ATOM 7596   N N    . SER A 1 9   ? -43.797 11.391  9.380   1.00 2.22  ? 9   SER A N    2  
ATOM 7597   C CA   . SER A 1 9   ? -44.888 12.323  9.611   1.00 2.28  ? 9   SER A CA   2  
ATOM 7598   C C    . SER A 1 9   ? -45.673 12.530  8.317   1.00 2.09  ? 9   SER A C    2  
ATOM 7599   O O    . SER A 1 9   ? -45.088 12.809  7.269   1.00 2.06  ? 9   SER A O    2  
ATOM 7600   C CB   . SER A 1 9   ? -44.334 13.653  10.128  1.00 2.51  ? 9   SER A CB   2  
ATOM 7601   O OG   . SER A 1 9   ? -43.546 13.449  11.292  1.00 2.78  ? 9   SER A OG   2  
ATOM 7602   H H    . SER A 1 9   ? -43.308 11.440  8.527   1.00 2.14  ? 9   SER A H    2  
ATOM 7603   H HA   . SER A 1 9   ? -45.543 11.895  10.356  1.00 2.32  ? 9   SER A HA   2  
ATOM 7604   H HB2  . SER A 1 9   ? -43.720 14.108  9.366   1.00 2.54  ? 9   SER A HB2  2  
ATOM 7605   H HB3  . SER A 1 9   ? -45.152 14.315  10.374  1.00 2.67  ? 9   SER A HB3  2  
ATOM 7606   H HG   . SER A 1 9   ? -43.537 12.508  11.506  1.00 2.93  ? 9   SER A HG   2  
ATOM 7607   N N    . LEU A 1 10  ? -46.989 12.361  8.381   1.00 2.01  ? 10  LEU A N    2  
ATOM 7608   C CA   . LEU A 1 10  ? -47.837 12.531  7.206   1.00 1.89  ? 10  LEU A CA   2  
ATOM 7609   C C    . LEU A 1 10  ? -48.600 13.848  7.254   1.00 2.01  ? 10  LEU A C    2  
ATOM 7610   O O    . LEU A 1 10  ? -49.420 14.076  8.149   1.00 2.13  ? 10  LEU A O    2  
ATOM 7611   C CB   . LEU A 1 10  ? -48.828 11.369  7.076   1.00 1.80  ? 10  LEU A CB   2  
ATOM 7612   C CG   . LEU A 1 10  ? -48.212 9.985   6.852   1.00 1.70  ? 10  LEU A CG   2  
ATOM 7613   C CD1  . LEU A 1 10  ? -49.304 8.929   6.735   1.00 1.72  ? 10  LEU A CD1  2  
ATOM 7614   C CD2  . LEU A 1 10  ? -47.337 9.982   5.610   1.00 1.61  ? 10  LEU A CD2  2  
ATOM 7615   H H    . LEU A 1 10  ? -47.402 12.108  9.236   1.00 2.08  ? 10  LEU A H    2  
ATOM 7616   H HA   . LEU A 1 10  ? -47.196 12.540  6.338   1.00 1.84  ? 10  LEU A HA   2  
ATOM 7617   H HB2  . LEU A 1 10  ? -49.420 11.333  7.975   1.00 1.92  ? 10  LEU A HB2  2  
ATOM 7618   H HB3  . LEU A 1 10  ? -49.485 11.580  6.245   1.00 1.79  ? 10  LEU A HB3  2  
ATOM 7619   H HG   . LEU A 1 10  ? -47.593 9.731   7.700   1.00 1.78  ? 10  LEU A HG   2  
ATOM 7620   H HD11 . LEU A 1 10  ? -49.863 8.883   7.658   1.00 1.90  ? 10  LEU A HD11 2  
ATOM 7621   H HD12 . LEU A 1 10  ? -48.855 7.966   6.537   1.00 1.77  ? 10  LEU A HD12 2  
ATOM 7622   H HD13 . LEU A 1 10  ? -49.968 9.188   5.924   1.00 1.81  ? 10  LEU A HD13 2  
ATOM 7623   H HD21 . LEU A 1 10  ? -47.880 10.424  4.789   1.00 1.59  ? 10  LEU A HD21 2  
ATOM 7624   H HD22 . LEU A 1 10  ? -47.070 8.966   5.359   1.00 1.61  ? 10  LEU A HD22 2  
ATOM 7625   H HD23 . LEU A 1 10  ? -46.442 10.553  5.799   1.00 1.70  ? 10  LEU A HD23 2  
ATOM 7626   N N    . ASP A 1 11  ? -48.316 14.707  6.289   1.00 2.05  ? 11  ASP A N    2  
ATOM 7627   C CA   . ASP A 1 11  ? -48.976 16.001  6.175   1.00 2.22  ? 11  ASP A CA   2  
ATOM 7628   C C    . ASP A 1 11  ? -49.838 15.999  4.921   1.00 2.20  ? 11  ASP A C    2  
ATOM 7629   O O    . ASP A 1 11  ? -49.475 15.388  3.917   1.00 2.11  ? 11  ASP A O    2  
ATOM 7630   C CB   . ASP A 1 11  ? -47.934 17.128  6.119   1.00 2.46  ? 11  ASP A CB   2  
ATOM 7631   C CG   . ASP A 1 11  ? -48.499 18.440  5.605   1.00 2.58  ? 11  ASP A CG   2  
ATOM 7632   O OD1  . ASP A 1 11  ? -49.333 19.052  6.303   1.00 2.85  ? 11  ASP A OD1  2  
ATOM 7633   O OD2  . ASP A 1 11  ? -48.091 18.874  4.505   1.00 2.69  ? 11  ASP A OD2  2  
ATOM 7634   H H    . ASP A 1 11  ? -47.641 14.462  5.619   1.00 2.01  ? 11  ASP A H    2  
ATOM 7635   H HA   . ASP A 1 11  ? -49.610 16.136  7.041   1.00 2.24  ? 11  ASP A HA   2  
ATOM 7636   H HB2  . ASP A 1 11  ? -47.545 17.297  7.111   1.00 2.71  ? 11  ASP A HB2  2  
ATOM 7637   H HB3  . ASP A 1 11  ? -47.125 16.828  5.470   1.00 2.56  ? 11  ASP A HB3  2  
ATOM 7638   N N    . TYR A 1 12  ? -50.982 16.653  4.969   1.00 2.33  ? 12  TYR A N    2  
ATOM 7639   C CA   . TYR A 1 12  ? -51.867 16.682  3.817   1.00 2.38  ? 12  TYR A CA   2  
ATOM 7640   C C    . TYR A 1 12  ? -51.861 18.059  3.164   1.00 2.62  ? 12  TYR A C    2  
ATOM 7641   O O    . TYR A 1 12  ? -51.933 19.082  3.844   1.00 2.75  ? 12  TYR A O    2  
ATOM 7642   C CB   . TYR A 1 12  ? -53.294 16.271  4.213   1.00 2.36  ? 12  TYR A CB   2  
ATOM 7643   C CG   . TYR A 1 12  ? -54.043 17.293  5.045   1.00 2.46  ? 12  TYR A CG   2  
ATOM 7644   C CD1  . TYR A 1 12  ? -53.754 17.475  6.390   1.00 2.47  ? 12  TYR A CD1  2  
ATOM 7645   C CD2  . TYR A 1 12  ? -55.041 18.076  4.478   1.00 2.60  ? 12  TYR A CD2  2  
ATOM 7646   C CE1  . TYR A 1 12  ? -54.439 18.405  7.146   1.00 2.59  ? 12  TYR A CE1  2  
ATOM 7647   C CE2  . TYR A 1 12  ? -55.729 19.008  5.228   1.00 2.71  ? 12  TYR A CE2  2  
ATOM 7648   C CZ   . TYR A 1 12  ? -55.423 19.169  6.562   1.00 2.70  ? 12  TYR A CZ   2  
ATOM 7649   O OH   . TYR A 1 12  ? -56.102 20.100  7.316   1.00 2.83  ? 12  TYR A OH   2  
ATOM 7650   H H    . TYR A 1 12  ? -51.226 17.144  5.782   1.00 2.42  ? 12  TYR A H    2  
ATOM 7651   H HA   . TYR A 1 12  ? -51.489 15.966  3.102   1.00 2.30  ? 12  TYR A HA   2  
ATOM 7652   H HB2  . TYR A 1 12  ? -53.868 16.100  3.314   1.00 2.41  ? 12  TYR A HB2  2  
ATOM 7653   H HB3  . TYR A 1 12  ? -53.249 15.353  4.779   1.00 2.26  ? 12  TYR A HB3  2  
ATOM 7654   H HD1  . TYR A 1 12  ? -52.980 16.876  6.848   1.00 2.40  ? 12  TYR A HD1  2  
ATOM 7655   H HD2  . TYR A 1 12  ? -55.277 17.946  3.433   1.00 2.65  ? 12  TYR A HD2  2  
ATOM 7656   H HE1  . TYR A 1 12  ? -54.199 18.533  8.189   1.00 2.63  ? 12  TYR A HE1  2  
ATOM 7657   H HE2  . TYR A 1 12  ? -56.502 19.606  4.770   1.00 2.83  ? 12  TYR A HE2  2  
ATOM 7658   H HH   . TYR A 1 12  ? -55.573 20.332  8.084   1.00 2.79  ? 12  TYR A HH   2  
ATOM 7659   N N    . ASP A 1 13  ? -51.764 18.081  1.845   1.00 2.70  ? 13  ASP A N    2  
ATOM 7660   C CA   . ASP A 1 13  ? -51.747 19.332  1.112   1.00 2.96  ? 13  ASP A CA   2  
ATOM 7661   C C    . ASP A 1 13  ? -52.966 19.433  0.211   1.00 3.08  ? 13  ASP A C    2  
ATOM 7662   O O    . ASP A 1 13  ? -53.269 18.514  -0.550  1.00 3.01  ? 13  ASP A O    2  
ATOM 7663   C CB   . ASP A 1 13  ? -50.473 19.449  0.287   1.00 3.03  ? 13  ASP A CB   2  
ATOM 7664   C CG   . ASP A 1 13  ? -50.081 20.888  0.037   1.00 3.31  ? 13  ASP A CG   2  
ATOM 7665   O OD1  . ASP A 1 13  ? -50.976 21.722  -0.205  1.00 3.46  ? 13  ASP A OD1  2  
ATOM 7666   O OD2  . ASP A 1 13  ? -48.873 21.191  0.104   1.00 3.46  ? 13  ASP A OD2  2  
ATOM 7667   H H    . ASP A 1 13  ? -51.704 17.234  1.350   1.00 2.62  ? 13  ASP A H    2  
ATOM 7668   H HA   . ASP A 1 13  ? -51.777 20.139  1.830   1.00 3.06  ? 13  ASP A HA   2  
ATOM 7669   H HB2  . ASP A 1 13  ? -49.665 18.960  0.812   1.00 2.95  ? 13  ASP A HB2  2  
ATOM 7670   H HB3  . ASP A 1 13  ? -50.624 18.964  -0.665  1.00 3.00  ? 13  ASP A HB3  2  
ATOM 7671   N N    . PHE A 1 14  ? -53.655 20.557  0.293   1.00 3.29  ? 14  PHE A N    2  
ATOM 7672   C CA   . PHE A 1 14  ? -54.860 20.776  -0.493  1.00 3.44  ? 14  PHE A CA   2  
ATOM 7673   C C    . PHE A 1 14  ? -54.620 21.757  -1.636  1.00 3.70  ? 14  PHE A C    2  
ATOM 7674   O O    . PHE A 1 14  ? -55.510 21.989  -2.452  1.00 3.92  ? 14  PHE A O    2  
ATOM 7675   C CB   . PHE A 1 14  ? -55.995 21.279  0.408   1.00 3.49  ? 14  PHE A CB   2  
ATOM 7676   C CG   . PHE A 1 14  ? -55.564 22.335  1.386   1.00 3.55  ? 14  PHE A CG   2  
ATOM 7677   C CD1  . PHE A 1 14  ? -55.542 23.670  1.021   1.00 3.78  ? 14  PHE A CD1  2  
ATOM 7678   C CD2  . PHE A 1 14  ? -55.176 21.989  2.671   1.00 3.43  ? 14  PHE A CD2  2  
ATOM 7679   C CE1  . PHE A 1 14  ? -55.142 24.642  1.915   1.00 3.89  ? 14  PHE A CE1  2  
ATOM 7680   C CE2  . PHE A 1 14  ? -54.774 22.954  3.570   1.00 3.54  ? 14  PHE A CE2  2  
ATOM 7681   C CZ   . PHE A 1 14  ? -54.757 24.283  3.193   1.00 3.77  ? 14  PHE A CZ   2  
ATOM 7682   H H    . PHE A 1 14  ? -53.339 21.265  0.893   1.00 3.37  ? 14  PHE A H    2  
ATOM 7683   H HA   . PHE A 1 14  ? -55.149 19.825  -0.913  1.00 3.35  ? 14  PHE A HA   2  
ATOM 7684   H HB2  . PHE A 1 14  ? -56.775 21.699  -0.209  1.00 3.65  ? 14  PHE A HB2  2  
ATOM 7685   H HB3  . PHE A 1 14  ? -56.394 20.449  0.969   1.00 3.37  ? 14  PHE A HB3  2  
ATOM 7686   H HD1  . PHE A 1 14  ? -55.846 23.951  0.022   1.00 3.92  ? 14  PHE A HD1  2  
ATOM 7687   H HD2  . PHE A 1 14  ? -55.190 20.951  2.965   1.00 3.29  ? 14  PHE A HD2  2  
ATOM 7688   H HE1  . PHE A 1 14  ? -55.128 25.680  1.616   1.00 4.10  ? 14  PHE A HE1  2  
ATOM 7689   H HE2  . PHE A 1 14  ? -54.475 22.671  4.569   1.00 3.49  ? 14  PHE A HE2  2  
ATOM 7690   H HZ   . PHE A 1 14  ? -54.442 25.038  3.892   1.00 3.89  ? 14  PHE A HZ   2  
ATOM 7691   N N    . GLN A 1 15  ? -53.424 22.334  -1.705  1.00 3.72  ? 15  GLN A N    2  
ATOM 7692   C CA   . GLN A 1 15  ? -53.120 23.284  -2.771  1.00 3.98  ? 15  GLN A CA   2  
ATOM 7693   C C    . GLN A 1 15  ? -52.831 22.528  -4.062  1.00 3.99  ? 15  GLN A C    2  
ATOM 7694   O O    . GLN A 1 15  ? -53.110 23.007  -5.158  1.00 4.21  ? 15  GLN A O    2  
ATOM 7695   C CB   . GLN A 1 15  ? -51.943 24.189  -2.383  1.00 4.09  ? 15  GLN A CB   2  
ATOM 7696   C CG   . GLN A 1 15  ? -50.570 23.602  -2.671  1.00 4.00  ? 15  GLN A CG   2  
ATOM 7697   C CD   . GLN A 1 15  ? -49.456 24.374  -1.993  1.00 4.09  ? 15  GLN A CD   2  
ATOM 7698   O OE1  . GLN A 1 15  ? -48.938 25.347  -2.540  1.00 4.36  ? 15  GLN A OE1  2  
ATOM 7699   N NE2  . GLN A 1 15  ? -49.080 23.942  -0.802  1.00 3.90  ? 15  GLN A NE2  2  
ATOM 7700   H H    . GLN A 1 15  ? -52.733 22.117  -1.034  1.00 3.59  ? 15  GLN A H    2  
ATOM 7701   H HA   . GLN A 1 15  ? -53.999 23.896  -2.922  1.00 4.12  ? 15  GLN A HA   2  
ATOM 7702   H HB2  . GLN A 1 15  ? -52.029 25.118  -2.925  1.00 4.32  ? 15  GLN A HB2  2  
ATOM 7703   H HB3  . GLN A 1 15  ? -52.004 24.397  -1.325  1.00 4.04  ? 15  GLN A HB3  2  
ATOM 7704   H HG2  . GLN A 1 15  ? -50.545 22.582  -2.319  1.00 3.78  ? 15  GLN A HG2  2  
ATOM 7705   H HG3  . GLN A 1 15  ? -50.402 23.617  -3.739  1.00 4.13  ? 15  GLN A HG3  2  
ATOM 7706   H HE21 . GLN A 1 15  ? -49.535 23.149  -0.429  1.00 3.71  ? 15  GLN A HE21 2  
ATOM 7707   H HE22 . GLN A 1 15  ? -48.366 24.427  -0.337  1.00 3.98  ? 15  GLN A HE22 2  
ATOM 7708   N N    . ASN A 1 16  ? -52.279 21.335  -3.911  1.00 3.78  ? 16  ASN A N    2  
ATOM 7709   C CA   . ASN A 1 16  ? -51.963 20.477  -5.043  1.00 3.79  ? 16  ASN A CA   2  
ATOM 7710   C C    . ASN A 1 16  ? -52.775 19.192  -4.951  1.00 3.61  ? 16  ASN A C    2  
ATOM 7711   O O    . ASN A 1 16  ? -52.784 18.386  -5.881  1.00 3.61  ? 16  ASN A O    2  
ATOM 7712   C CB   . ASN A 1 16  ? -50.461 20.165  -5.092  1.00 3.72  ? 16  ASN A CB   2  
ATOM 7713   C CG   . ASN A 1 16  ? -49.853 19.969  -3.716  1.00 3.53  ? 16  ASN A CG   2  
ATOM 7714   O OD1  . ASN A 1 16  ? -50.506 19.476  -2.800  1.00 3.48  ? 16  ASN A OD1  2  
ATOM 7715   N ND2  . ASN A 1 16  ? -48.603 20.368  -3.559  1.00 3.56  ? 16  ASN A ND2  2  
ATOM 7716   H H    . ASN A 1 16  ? -52.064 21.024  -3.005  1.00 3.63  ? 16  ASN A H    2  
ATOM 7717   H HA   . ASN A 1 16  ? -52.244 21.003  -5.944  1.00 4.00  ? 16  ASN A HA   2  
ATOM 7718   H HB2  . ASN A 1 16  ? -50.308 19.260  -5.661  1.00 3.72  ? 16  ASN A HB2  2  
ATOM 7719   H HB3  . ASN A 1 16  ? -49.947 20.981  -5.579  1.00 3.89  ? 16  ASN A HB3  2  
ATOM 7720   H HD21 . ASN A 1 16  ? -48.142 20.763  -4.331  1.00 3.76  ? 16  ASN A HD21 2  
ATOM 7721   H HD22 . ASN A 1 16  ? -48.187 20.256  -2.677  1.00 3.48  ? 16  ASN A HD22 2  
ATOM 7722   N N    . ASN A 1 17  ? -53.457 19.028  -3.815  1.00 3.48  ? 17  ASN A N    2  
ATOM 7723   C CA   . ASN A 1 17  ? -54.308 17.865  -3.553  1.00 3.33  ? 17  ASN A CA   2  
ATOM 7724   C C    . ASN A 1 17  ? -53.491 16.577  -3.534  1.00 3.13  ? 17  ASN A C    2  
ATOM 7725   O O    . ASN A 1 17  ? -53.589 15.748  -4.441  1.00 3.17  ? 17  ASN A O    2  
ATOM 7726   C CB   . ASN A 1 17  ? -55.426 17.770  -4.598  1.00 3.54  ? 17  ASN A CB   2  
ATOM 7727   C CG   . ASN A 1 17  ? -56.668 17.064  -4.082  1.00 3.56  ? 17  ASN A CG   2  
ATOM 7728   O OD1  . ASN A 1 17  ? -56.693 16.542  -2.968  1.00 3.39  ? 17  ASN A OD1  2  
ATOM 7729   N ND2  . ASN A 1 17  ? -57.706 17.033  -4.904  1.00 3.89  ? 17  ASN A ND2  2  
ATOM 7730   H H    . ASN A 1 17  ? -53.381 19.712  -3.122  1.00 3.49  ? 17  ASN A H    2  
ATOM 7731   H HA   . ASN A 1 17  ? -54.755 18.002  -2.579  1.00 3.25  ? 17  ASN A HA   2  
ATOM 7732   H HB2  . ASN A 1 17  ? -55.707 18.766  -4.904  1.00 3.76  ? 17  ASN A HB2  2  
ATOM 7733   H HB3  . ASN A 1 17  ? -55.059 17.227  -5.456  1.00 3.54  ? 17  ASN A HB3  2  
ATOM 7734   H HD21 . ASN A 1 17  ? -57.610 17.458  -5.783  1.00 4.07  ? 17  ASN A HD21 2  
ATOM 7735   H HD22 . ASN A 1 17  ? -58.529 16.598  -4.599  1.00 3.99  ? 17  ASN A HD22 2  
ATOM 7736   N N    . GLN A 1 18  ? -52.670 16.425  -2.500  1.00 2.93  ? 18  GLN A N    2  
ATOM 7737   C CA   . GLN A 1 18  ? -51.829 15.242  -2.345  1.00 2.72  ? 18  GLN A CA   2  
ATOM 7738   C C    . GLN A 1 18  ? -51.281 15.155  -0.925  1.00 2.51  ? 18  GLN A C    2  
ATOM 7739   O O    . GLN A 1 18  ? -51.421 16.096  -0.139  1.00 2.57  ? 18  GLN A O    2  
ATOM 7740   C CB   . GLN A 1 18  ? -50.683 15.248  -3.368  1.00 2.80  ? 18  GLN A CB   2  
ATOM 7741   C CG   . GLN A 1 18  ? -49.814 16.498  -3.356  1.00 2.94  ? 18  GLN A CG   2  
ATOM 7742   C CD   . GLN A 1 18  ? -48.604 16.380  -2.449  1.00 2.77  ? 18  GLN A CD   2  
ATOM 7743   O OE1  . GLN A 1 18  ? -47.574 15.831  -2.835  1.00 2.69  ? 18  GLN A OE1  2  
ATOM 7744   N NE2  . GLN A 1 18  ? -48.711 16.917  -1.244  1.00 2.85  ? 18  GLN A NE2  2  
ATOM 7745   H H    . GLN A 1 18  ? -52.635 17.126  -1.810  1.00 2.94  ? 18  GLN A H    2  
ATOM 7746   H HA   . GLN A 1 18  ? -52.451 14.377  -2.527  1.00 2.70  ? 18  GLN A HA   2  
ATOM 7747   H HB2  . GLN A 1 18  ? -50.045 14.399  -3.174  1.00 2.62  ? 18  GLN A HB2  2  
ATOM 7748   H HB3  . GLN A 1 18  ? -51.108 15.144  -4.355  1.00 2.97  ? 18  GLN A HB3  2  
ATOM 7749   H HG2  . GLN A 1 18  ? -49.468 16.686  -4.361  1.00 3.11  ? 18  GLN A HG2  2  
ATOM 7750   H HG3  . GLN A 1 18  ? -50.415 17.332  -3.023  1.00 3.06  ? 18  GLN A HG3  2  
ATOM 7751   H HE21 . GLN A 1 18  ? -49.555 17.355  -1.006  1.00 3.03  ? 18  GLN A HE21 2  
ATOM 7752   H HE22 . GLN A 1 18  ? -47.944 16.853  -0.641  1.00 2.78  ? 18  GLN A HE22 2  
ATOM 7753   N N    . LEU A 1 19  ? -50.655 14.034  -0.595  1.00 2.29  ? 19  LEU A N    2  
ATOM 7754   C CA   . LEU A 1 19  ? -50.093 13.847  0.735   1.00 2.11  ? 19  LEU A CA   2  
ATOM 7755   C C    . LEU A 1 19  ? -48.585 14.046  0.728   1.00 2.05  ? 19  LEU A C    2  
ATOM 7756   O O    . LEU A 1 19  ? -47.883 13.566  -0.164  1.00 2.00  ? 19  LEU A O    2  
ATOM 7757   C CB   . LEU A 1 19  ? -50.417 12.453  1.284   1.00 1.95  ? 19  LEU A CB   2  
ATOM 7758   C CG   . LEU A 1 19  ? -51.893 12.179  1.573   1.00 2.10  ? 19  LEU A CG   2  
ATOM 7759   C CD1  . LEU A 1 19  ? -52.073 10.756  2.077   1.00 2.03  ? 19  LEU A CD1  2  
ATOM 7760   C CD2  . LEU A 1 19  ? -52.434 13.173  2.588   1.00 2.26  ? 19  LEU A CD2  2  
ATOM 7761   H H    . LEU A 1 19  ? -50.559 13.319  -1.264  1.00 2.27  ? 19  LEU A H    2  
ATOM 7762   H HA   . LEU A 1 19  ? -50.533 14.588  1.384   1.00 2.19  ? 19  LEU A HA   2  
ATOM 7763   H HB2  . LEU A 1 19  ? -50.075 11.721  0.570   1.00 1.87  ? 19  LEU A HB2  2  
ATOM 7764   H HB3  . LEU A 1 19  ? -49.864 12.319  2.202   1.00 1.87  ? 19  LEU A HB3  2  
ATOM 7765   H HG   . LEU A 1 19  ? -52.459 12.286  0.660   1.00 2.29  ? 19  LEU A HG   2  
ATOM 7766   H HD11 . LEU A 1 19  ? -53.124 10.554  2.216   1.00 2.20  ? 19  LEU A HD11 2  
ATOM 7767   H HD12 . LEU A 1 19  ? -51.557 10.639  3.019   1.00 2.01  ? 19  LEU A HD12 2  
ATOM 7768   H HD13 . LEU A 1 19  ? -51.668 10.063  1.356   1.00 2.16  ? 19  LEU A HD13 2  
ATOM 7769   H HD21 . LEU A 1 19  ? -53.428 12.878  2.886   1.00 2.19  ? 19  LEU A HD21 2  
ATOM 7770   H HD22 . LEU A 1 19  ? -52.469 14.157  2.143   1.00 2.44  ? 19  LEU A HD22 2  
ATOM 7771   H HD23 . LEU A 1 19  ? -51.790 13.192  3.453   1.00 2.46  ? 19  LEU A HD23 2  
ATOM 7772   N N    . LEU A 1 20  ? -48.098 14.754  1.730   1.00 2.09  ? 20  LEU A N    2  
ATOM 7773   C CA   . LEU A 1 20  ? -46.679 15.011  1.871   1.00 2.09  ? 20  LEU A CA   2  
ATOM 7774   C C    . LEU A 1 20  ? -46.094 13.985  2.833   1.00 1.89  ? 20  LEU A C    2  
ATOM 7775   O O    . LEU A 1 20  ? -46.218 14.115  4.053   1.00 1.92  ? 20  LEU A O    2  
ATOM 7776   C CB   . LEU A 1 20  ? -46.443 16.441  2.382   1.00 2.33  ? 20  LEU A CB   2  
ATOM 7777   C CG   . LEU A 1 20  ? -45.147 17.120  1.916   1.00 2.51  ? 20  LEU A CG   2  
ATOM 7778   C CD1  . LEU A 1 20  ? -43.930 16.464  2.550   1.00 2.44  ? 20  LEU A CD1  2  
ATOM 7779   C CD2  . LEU A 1 20  ? -45.042 17.094  0.398   1.00 2.60  ? 20  LEU A CD2  2  
ATOM 7780   H H    . LEU A 1 20  ? -48.714 15.106  2.412   1.00 2.14  ? 20  LEU A H    2  
ATOM 7781   H HA   . LEU A 1 20  ? -46.216 14.892  0.902   1.00 2.12  ? 20  LEU A HA   2  
ATOM 7782   H HB2  . LEU A 1 20  ? -47.274 17.052  2.063   1.00 2.44  ? 20  LEU A HB2  2  
ATOM 7783   H HB3  . LEU A 1 20  ? -46.437 16.414  3.460   1.00 2.29  ? 20  LEU A HB3  2  
ATOM 7784   H HG   . LEU A 1 20  ? -45.161 18.153  2.229   1.00 2.70  ? 20  LEU A HG   2  
ATOM 7785   H HD11 . LEU A 1 20  ? -44.065 16.411  3.619   1.00 2.54  ? 20  LEU A HD11 2  
ATOM 7786   H HD12 . LEU A 1 20  ? -43.051 17.050  2.327   1.00 2.58  ? 20  LEU A HD12 2  
ATOM 7787   H HD13 . LEU A 1 20  ? -43.810 15.468  2.151   1.00 2.33  ? 20  LEU A HD13 2  
ATOM 7788   H HD21 . LEU A 1 20  ? -44.220 17.720  0.084   1.00 2.77  ? 20  LEU A HD21 2  
ATOM 7789   H HD22 . LEU A 1 20  ? -45.961 17.462  -0.031  1.00 2.68  ? 20  LEU A HD22 2  
ATOM 7790   H HD23 . LEU A 1 20  ? -44.871 16.081  0.067   1.00 2.46  ? 20  LEU A HD23 2  
ATOM 7791   N N    . VAL A 1 21  ? -45.494 12.947  2.274   1.00 1.72  ? 21  VAL A N    2  
ATOM 7792   C CA   . VAL A 1 21  ? -44.906 11.888  3.073   1.00 1.56  ? 21  VAL A CA   2  
ATOM 7793   C C    . VAL A 1 21  ? -43.467 12.221  3.443   1.00 1.64  ? 21  VAL A C    2  
ATOM 7794   O O    . VAL A 1 21  ? -42.577 12.225  2.587   1.00 1.62  ? 21  VAL A O    2  
ATOM 7795   C CB   . VAL A 1 21  ? -44.951 10.530  2.338   1.00 1.38  ? 21  VAL A CB   2  
ATOM 7796   C CG1  . VAL A 1 21  ? -44.426 9.411   3.229   1.00 1.30  ? 21  VAL A CG1  2  
ATOM 7797   C CG2  . VAL A 1 21  ? -46.367 10.226  1.866   1.00 1.40  ? 21  VAL A CG2  2  
ATOM 7798   H H    . VAL A 1 21  ? -45.437 12.896  1.294   1.00 1.74  ? 21  VAL A H    2  
ATOM 7799   H HA   . VAL A 1 21  ? -45.483 11.799  3.981   1.00 1.59  ? 21  VAL A HA   2  
ATOM 7800   H HB   . VAL A 1 21  ? -44.312 10.595  1.470   1.00 1.39  ? 21  VAL A HB   2  
ATOM 7801   H HG11 . VAL A 1 21  ? -45.059 9.319   4.100   1.00 1.59  ? 21  VAL A HG11 2  
ATOM 7802   H HG12 . VAL A 1 21  ? -43.418 9.639   3.540   1.00 1.45  ? 21  VAL A HG12 2  
ATOM 7803   H HG13 . VAL A 1 21  ? -44.434 8.478   2.682   1.00 1.36  ? 21  VAL A HG13 2  
ATOM 7804   H HG21 . VAL A 1 21  ? -47.050 10.316  2.698   1.00 1.48  ? 21  VAL A HG21 2  
ATOM 7805   H HG22 . VAL A 1 21  ? -46.409 9.222   1.473   1.00 1.37  ? 21  VAL A HG22 2  
ATOM 7806   H HG23 . VAL A 1 21  ? -46.649 10.927  1.092   1.00 1.52  ? 21  VAL A HG23 2  
ATOM 7807   N N    . GLY A 1 22  ? -43.256 12.527  4.714   1.00 1.79  ? 22  GLY A N    2  
ATOM 7808   C CA   . GLY A 1 22  ? -41.927 12.843  5.192   1.00 1.95  ? 22  GLY A CA   2  
ATOM 7809   C C    . GLY A 1 22  ? -41.412 11.788  6.146   1.00 1.93  ? 22  GLY A C    2  
ATOM 7810   O O    . GLY A 1 22  ? -41.873 11.691  7.285   1.00 2.05  ? 22  GLY A O    2  
ATOM 7811   H H    . GLY A 1 22  ? -44.016 12.549  5.339   1.00 1.83  ? 22  GLY A H    2  
ATOM 7812   H HA2  . GLY A 1 22  ? -41.258 12.914  4.347   1.00 1.93  ? 22  GLY A HA2  2  
ATOM 7813   H HA3  . GLY A 1 22  ? -41.952 13.794  5.702   1.00 2.16  ? 22  GLY A HA3  2  
ATOM 7814   N N    . ILE A 1 23  ? -40.477 10.974  5.679   1.00 1.83  ? 23  ILE A N    2  
ATOM 7815   C CA   . ILE A 1 23  ? -39.901 9.927   6.508   1.00 1.89  ? 23  ILE A CA   2  
ATOM 7816   C C    . ILE A 1 23  ? -38.596 10.409  7.126   1.00 2.14  ? 23  ILE A C    2  
ATOM 7817   O O    . ILE A 1 23  ? -37.656 10.758  6.415   1.00 2.21  ? 23  ILE A O    2  
ATOM 7818   C CB   . ILE A 1 23  ? -39.658 8.613   5.722   1.00 1.69  ? 23  ILE A CB   2  
ATOM 7819   C CG1  . ILE A 1 23  ? -38.959 8.886   4.377   1.00 1.61  ? 23  ILE A CG1  2  
ATOM 7820   C CG2  . ILE A 1 23  ? -40.973 7.870   5.511   1.00 1.53  ? 23  ILE A CG2  2  
ATOM 7821   C CD1  . ILE A 1 23  ? -39.897 8.969   3.186   1.00 1.62  ? 23  ILE A CD1  2  
ATOM 7822   H H    . ILE A 1 23  ? -40.157 11.086  4.759   1.00 1.76  ? 23  ILE A H    2  
ATOM 7823   H HA   . ILE A 1 23  ? -40.602 9.719   7.305   1.00 1.94  ? 23  ILE A HA   2  
ATOM 7824   H HB   . ILE A 1 23  ? -39.021 7.985   6.326   1.00 1.81  ? 23  ILE A HB   2  
ATOM 7825   H HG12 . ILE A 1 23  ? -38.430 9.825   4.443   1.00 1.77  ? 23  ILE A HG12 2  
ATOM 7826   H HG13 . ILE A 1 23  ? -38.247 8.095   4.185   1.00 1.63  ? 23  ILE A HG13 2  
ATOM 7827   H HG21 . ILE A 1 23  ? -41.429 7.661   6.468   1.00 1.71  ? 23  ILE A HG21 2  
ATOM 7828   H HG22 . ILE A 1 23  ? -40.783 6.943   4.993   1.00 1.49  ? 23  ILE A HG22 2  
ATOM 7829   H HG23 . ILE A 1 23  ? -41.639 8.481   4.922   1.00 1.49  ? 23  ILE A HG23 2  
ATOM 7830   H HD11 . ILE A 1 23  ? -39.345 9.296   2.318   1.00 1.70  ? 23  ILE A HD11 2  
ATOM 7831   H HD12 . ILE A 1 23  ? -40.688 9.674   3.398   1.00 1.94  ? 23  ILE A HD12 2  
ATOM 7832   H HD13 . ILE A 1 23  ? -40.325 7.995   2.994   1.00 1.83  ? 23  ILE A HD13 2  
ATOM 7833   N N    . ILE A 1 24  ? -38.551 10.435  8.451   1.00 2.32  ? 24  ILE A N    2  
ATOM 7834   C CA   . ILE A 1 24  ? -37.374 10.895  9.171   1.00 2.59  ? 24  ILE A CA   2  
ATOM 7835   C C    . ILE A 1 24  ? -36.230 9.893   9.061   1.00 2.60  ? 24  ILE A C    2  
ATOM 7836   O O    . ILE A 1 24  ? -35.198 10.182  8.447   1.00 2.64  ? 24  ILE A O    2  
ATOM 7837   C CB   . ILE A 1 24  ? -37.696 11.151  10.664  1.00 2.82  ? 24  ILE A CB   2  
ATOM 7838   C CG1  . ILE A 1 24  ? -38.892 12.102  10.796  1.00 2.80  ? 24  ILE A CG1  2  
ATOM 7839   C CG2  . ILE A 1 24  ? -36.478 11.724  11.382  1.00 3.11  ? 24  ILE A CG2  2  
ATOM 7840   C CD1  . ILE A 1 24  ? -39.381 12.276  12.219  1.00 2.98  ? 24  ILE A CD1  2  
ATOM 7841   H H    . ILE A 1 24  ? -39.330 10.124  8.962   1.00 2.30  ? 24  ILE A H    2  
ATOM 7842   H HA   . ILE A 1 24  ? -37.061 11.830  8.729   1.00 2.64  ? 24  ILE A HA   2  
ATOM 7843   H HB   . ILE A 1 24  ? -37.943 10.207  11.124  1.00 2.82  ? 24  ILE A HB   2  
ATOM 7844   H HG12 . ILE A 1 24  ? -38.610 13.074  10.423  1.00 2.88  ? 24  ILE A HG12 2  
ATOM 7845   H HG13 . ILE A 1 24  ? -39.714 11.722  10.207  1.00 2.61  ? 24  ILE A HG13 2  
ATOM 7846   H HG21 . ILE A 1 24  ? -36.739 11.957  12.403  1.00 3.28  ? 24  ILE A HG21 2  
ATOM 7847   H HG22 . ILE A 1 24  ? -36.154 12.624  10.879  1.00 3.15  ? 24  ILE A HG22 2  
ATOM 7848   H HG23 . ILE A 1 24  ? -35.678 10.998  11.371  1.00 3.13  ? 24  ILE A HG23 2  
ATOM 7849   H HD11 . ILE A 1 24  ? -38.578 12.654  12.835  1.00 3.25  ? 24  ILE A HD11 2  
ATOM 7850   H HD12 . ILE A 1 24  ? -39.712 11.324  12.603  1.00 2.96  ? 24  ILE A HD12 2  
ATOM 7851   H HD13 . ILE A 1 24  ? -40.203 12.976  12.232  1.00 3.07  ? 24  ILE A HD13 2  
ATOM 7852   N N    . GLN A 1 25  ? -36.420 8.710   9.641   1.00 2.61  ? 25  GLN A N    2  
ATOM 7853   C CA   . GLN A 1 25  ? -35.389 7.681   9.617   1.00 2.65  ? 25  GLN A CA   2  
ATOM 7854   C C    . GLN A 1 25  ? -35.946 6.326   10.034  1.00 2.65  ? 25  GLN A C    2  
ATOM 7855   O O    . GLN A 1 25  ? -37.098 6.217   10.461  1.00 2.65  ? 25  GLN A O    2  
ATOM 7856   C CB   . GLN A 1 25  ? -34.230 8.071   10.542  1.00 2.96  ? 25  GLN A CB   2  
ATOM 7857   C CG   . GLN A 1 25  ? -34.633 8.266   11.997  1.00 3.20  ? 25  GLN A CG   2  
ATOM 7858   C CD   . GLN A 1 25  ? -34.145 7.148   12.897  1.00 3.44  ? 25  GLN A CD   2  
ATOM 7859   O OE1  . GLN A 1 25  ? -34.843 6.159   13.117  1.00 3.45  ? 25  GLN A OE1  2  
ATOM 7860   N NE2  . GLN A 1 25  ? -32.946 7.300   13.433  1.00 3.78  ? 25  GLN A NE2  2  
ATOM 7861   H H    . GLN A 1 25  ? -37.275 8.524   10.084  1.00 2.60  ? 25  GLN A H    2  
ATOM 7862   H HA   . GLN A 1 25  ? -35.019 7.608   8.606   1.00 2.50  ? 25  GLN A HA   2  
ATOM 7863   H HB2  . GLN A 1 25  ? -33.480 7.298   10.503  1.00 3.00  ? 25  GLN A HB2  2  
ATOM 7864   H HB3  . GLN A 1 25  ? -33.800 8.995   10.185  1.00 2.99  ? 25  GLN A HB3  2  
ATOM 7865   H HG2  . GLN A 1 25  ? -34.217 9.198   12.350  1.00 3.36  ? 25  GLN A HG2  2  
ATOM 7866   H HG3  . GLN A 1 25  ? -35.710 8.311   12.055  1.00 3.11  ? 25  GLN A HG3  2  
ATOM 7867   H HE21 . GLN A 1 25  ? -32.448 8.115   13.224  1.00 3.88  ? 25  GLN A HE21 2  
ATOM 7868   H HE22 . GLN A 1 25  ? -32.608 6.592   14.022  1.00 4.00  ? 25  GLN A HE22 2  
ATOM 7869   N N    . ALA A 1 26  ? -35.110 5.305   9.908   1.00 2.67  ? 26  ALA A N    2  
ATOM 7870   C CA   . ALA A 1 26  ? -35.472 3.945   10.272  1.00 2.74  ? 26  ALA A CA   2  
ATOM 7871   C C    . ALA A 1 26  ? -34.337 3.323   11.073  1.00 3.00  ? 26  ALA A C    2  
ATOM 7872   O O    . ALA A 1 26  ? -33.170 3.647   10.849  1.00 3.07  ? 26  ALA A O    2  
ATOM 7873   C CB   . ALA A 1 26  ? -35.770 3.125   9.026   1.00 2.50  ? 26  ALA A CB   2  
ATOM 7874   H H    . ALA A 1 26  ? -34.206 5.473   9.562   1.00 2.67  ? 26  ALA A H    2  
ATOM 7875   H HA   . ALA A 1 26  ? -36.362 3.981   10.884  1.00 2.79  ? 26  ALA A HA   2  
ATOM 7876   H HB1  . ALA A 1 26  ? -36.555 3.604   8.457   1.00 2.42  ? 26  ALA A HB1  2  
ATOM 7877   H HB2  . ALA A 1 26  ? -36.088 2.134   9.313   1.00 2.60  ? 26  ALA A HB2  2  
ATOM 7878   H HB3  . ALA A 1 26  ? -34.879 3.056   8.421   1.00 2.56  ? 26  ALA A HB3  2  
ATOM 7879   N N    . ALA A 1 27  ? -34.671 2.445   12.006  1.00 3.18  ? 27  ALA A N    2  
ATOM 7880   C CA   . ALA A 1 27  ? -33.656 1.810   12.837  1.00 3.45  ? 27  ALA A CA   2  
ATOM 7881   C C    . ALA A 1 27  ? -33.888 0.309   12.960  1.00 3.55  ? 27  ALA A C    2  
ATOM 7882   O O    . ALA A 1 27  ? -34.970 -0.183  12.642  1.00 3.49  ? 27  ALA A O    2  
ATOM 7883   C CB   . ALA A 1 27  ? -33.632 2.455   14.216  1.00 3.70  ? 27  ALA A CB   2  
ATOM 7884   H H    . ALA A 1 27  ? -35.618 2.212   12.136  1.00 3.14  ? 27  ALA A H    2  
ATOM 7885   H HA   . ALA A 1 27  ? -32.695 1.978   12.374  1.00 3.44  ? 27  ALA A HA   2  
ATOM 7886   H HB1  . ALA A 1 27  ? -33.449 3.514   14.114  1.00 3.67  ? 27  ALA A HB1  2  
ATOM 7887   H HB2  . ALA A 1 27  ? -32.846 2.008   14.808  1.00 3.92  ? 27  ALA A HB2  2  
ATOM 7888   H HB3  . ALA A 1 27  ? -34.582 2.298   14.703  1.00 3.73  ? 27  ALA A HB3  2  
ATOM 7889   N N    . GLU A 1 28  ? -32.852 -0.398  13.430  1.00 3.72  ? 28  GLU A N    2  
ATOM 7890   C CA   . GLU A 1 28  ? -32.892 -1.849  13.625  1.00 3.88  ? 28  GLU A CA   2  
ATOM 7891   C C    . GLU A 1 28  ? -33.075 -2.599  12.310  1.00 3.67  ? 28  GLU A C    2  
ATOM 7892   O O    . GLU A 1 28  ? -33.733 -3.641  12.260  1.00 3.75  ? 28  GLU A O    2  
ATOM 7893   C CB   . GLU A 1 28  ? -33.991 -2.233  14.619  1.00 4.09  ? 28  GLU A CB   2  
ATOM 7894   C CG   . GLU A 1 28  ? -33.575 -2.062  16.067  1.00 4.36  ? 28  GLU A CG   2  
ATOM 7895   C CD   . GLU A 1 28  ? -32.206 -2.647  16.347  1.00 4.60  ? 28  GLU A CD   2  
ATOM 7896   O OE1  . GLU A 1 28  ? -32.104 -3.879  16.532  1.00 4.80  ? 28  GLU A OE1  2  
ATOM 7897   O OE2  . GLU A 1 28  ? -31.224 -1.878  16.384  1.00 4.90  ? 28  GLU A OE2  2  
ATOM 7898   H H    . GLU A 1 28  ? -32.027 0.078   13.659  1.00 3.77  ? 28  GLU A H    2  
ATOM 7899   H HA   . GLU A 1 28  ? -31.940 -2.140  14.043  1.00 4.03  ? 28  GLU A HA   2  
ATOM 7900   H HB2  . GLU A 1 28  ? -34.854 -1.611  14.440  1.00 3.95  ? 28  GLU A HB2  2  
ATOM 7901   H HB3  . GLU A 1 28  ? -34.260 -3.266  14.463  1.00 4.21  ? 28  GLU A HB3  2  
ATOM 7902   H HG2  . GLU A 1 28  ? -33.555 -1.008  16.301  1.00 4.49  ? 28  GLU A HG2  2  
ATOM 7903   H HG3  . GLU A 1 28  ? -34.299 -2.557  16.697  1.00 4.53  ? 28  GLU A HG3  2  
ATOM 7904   N N    . LEU A 1 29  ? -32.464 -2.078  11.255  1.00 3.45  ? 29  LEU A N    2  
ATOM 7905   C CA   . LEU A 1 29  ? -32.545 -2.702  9.943   1.00 3.26  ? 29  LEU A CA   2  
ATOM 7906   C C    . LEU A 1 29  ? -31.559 -3.865  9.847   1.00 3.40  ? 29  LEU A C    2  
ATOM 7907   O O    . LEU A 1 29  ? -30.363 -3.685  10.075  1.00 3.53  ? 29  LEU A O    2  
ATOM 7908   C CB   . LEU A 1 29  ? -32.247 -1.676  8.846   1.00 2.96  ? 29  LEU A CB   2  
ATOM 7909   C CG   . LEU A 1 29  ? -33.118 -0.417  8.870   1.00 2.78  ? 29  LEU A CG   2  
ATOM 7910   C CD1  . LEU A 1 29  ? -32.650 0.573   7.818   1.00 2.52  ? 29  LEU A CD1  2  
ATOM 7911   C CD2  . LEU A 1 29  ? -34.583 -0.773  8.656   1.00 2.72  ? 29  LEU A CD2  2  
ATOM 7912   H H    . LEU A 1 29  ? -31.945 -1.255  11.362  1.00 3.44  ? 29  LEU A H    2  
ATOM 7913   H HA   . LEU A 1 29  ? -33.547 -3.077  9.812   1.00 3.24  ? 29  LEU A HA   2  
ATOM 7914   H HB2  . LEU A 1 29  ? -31.215 -1.374  8.937   1.00 3.01  ? 29  LEU A HB2  2  
ATOM 7915   H HB3  . LEU A 1 29  ? -32.379 -2.157  7.889   1.00 2.85  ? 29  LEU A HB3  2  
ATOM 7916   H HG   . LEU A 1 29  ? -33.026 0.058   9.837   1.00 2.91  ? 29  LEU A HG   2  
ATOM 7917   H HD11 . LEU A 1 29  ? -33.256 1.466   7.868   1.00 2.40  ? 29  LEU A HD11 2  
ATOM 7918   H HD12 . LEU A 1 29  ? -32.744 0.129   6.839   1.00 2.40  ? 29  LEU A HD12 2  
ATOM 7919   H HD13 . LEU A 1 29  ? -31.617 0.831   8.001   1.00 2.63  ? 29  LEU A HD13 2  
ATOM 7920   H HD21 . LEU A 1 29  ? -34.696 -1.268  7.702   1.00 2.66  ? 29  LEU A HD21 2  
ATOM 7921   H HD22 . LEU A 1 29  ? -35.179 0.128   8.668   1.00 2.60  ? 29  LEU A HD22 2  
ATOM 7922   H HD23 . LEU A 1 29  ? -34.914 -1.434  9.445   1.00 2.92  ? 29  LEU A HD23 2  
ATOM 7923   N N    . PRO A 1 30  ? -32.057 -5.079  9.544   1.00 3.42  ? 30  PRO A N    2  
ATOM 7924   C CA   . PRO A 1 30  ? -31.218 -6.277  9.410   1.00 3.57  ? 30  PRO A CA   2  
ATOM 7925   C C    . PRO A 1 30  ? -30.113 -6.114  8.363   1.00 3.39  ? 30  PRO A C    2  
ATOM 7926   O O    . PRO A 1 30  ? -30.255 -5.363  7.394   1.00 3.15  ? 30  PRO A O    2  
ATOM 7927   C CB   . PRO A 1 30  ? -32.205 -7.366  8.977   1.00 3.60  ? 30  PRO A CB   2  
ATOM 7928   C CG   . PRO A 1 30  ? -33.532 -6.883  9.443   1.00 3.56  ? 30  PRO A CG   2  
ATOM 7929   C CD   . PRO A 1 30  ? -33.483 -5.385  9.339   1.00 3.34  ? 30  PRO A CD   2  
ATOM 7930   H HA   . PRO A 1 30  ? -30.772 -6.551  10.355  1.00 3.79  ? 30  PRO A HA   2  
ATOM 7931   H HB2  . PRO A 1 30  ? -32.178 -7.476  7.902   1.00 3.45  ? 30  PRO A HB2  2  
ATOM 7932   H HB3  . PRO A 1 30  ? -31.940 -8.301  9.445   1.00 3.82  ? 30  PRO A HB3  2  
ATOM 7933   H HG2  . PRO A 1 30  ? -34.310 -7.280  8.807   1.00 3.50  ? 30  PRO A HG2  2  
ATOM 7934   H HG3  . PRO A 1 30  ? -33.694 -7.185  10.468  1.00 3.79  ? 30  PRO A HG3  2  
ATOM 7935   H HD2  . PRO A 1 30  ? -33.810 -5.063  8.360   1.00 3.12  ? 30  PRO A HD2  2  
ATOM 7936   H HD3  . PRO A 1 30  ? -34.088 -4.936  10.111  1.00 3.39  ? 30  PRO A HD3  2  
ATOM 7937   N N    . ALA A 1 31  ? -29.018 -6.839  8.558   1.00 3.53  ? 31  ALA A N    2  
ATOM 7938   C CA   . ALA A 1 31  ? -27.885 -6.771  7.650   1.00 3.41  ? 31  ALA A CA   2  
ATOM 7939   C C    . ALA A 1 31  ? -28.068 -7.712  6.462   1.00 3.30  ? 31  ALA A C    2  
ATOM 7940   O O    . ALA A 1 31  ? -28.458 -8.869  6.625   1.00 3.46  ? 31  ALA A O    2  
ATOM 7941   C CB   . ALA A 1 31  ? -26.597 -7.097  8.392   1.00 3.63  ? 31  ALA A CB   2  
ATOM 7942   H H    . ALA A 1 31  ? -28.974 -7.440  9.332   1.00 3.73  ? 31  ALA A H    2  
ATOM 7943   H HA   . ALA A 1 31  ? -27.813 -5.758  7.283   1.00 3.24  ? 31  ALA A HA   2  
ATOM 7944   H HB1  . ALA A 1 31  ? -26.665 -8.090  8.811   1.00 3.79  ? 31  ALA A HB1  2  
ATOM 7945   H HB2  . ALA A 1 31  ? -26.451 -6.380  9.186   1.00 3.77  ? 31  ALA A HB2  2  
ATOM 7946   H HB3  . ALA A 1 31  ? -25.764 -7.050  7.706   1.00 3.63  ? 31  ALA A HB3  2  
ATOM 7947   N N    . LEU A 1 32  ? -27.798 -7.199  5.273   1.00 3.08  ? 32  LEU A N    2  
ATOM 7948   C CA   . LEU A 1 32  ? -27.918 -7.977  4.048   1.00 2.98  ? 32  LEU A CA   2  
ATOM 7949   C C    . LEU A 1 32  ? -26.543 -8.174  3.416   1.00 2.93  ? 32  LEU A C    2  
ATOM 7950   O O    . LEU A 1 32  ? -26.047 -9.298  3.323   1.00 2.99  ? 32  LEU A O    2  
ATOM 7951   C CB   . LEU A 1 32  ? -28.857 -7.264  3.063   1.00 2.71  ? 32  LEU A CB   2  
ATOM 7952   C CG   . LEU A 1 32  ? -29.685 -8.169  2.138   1.00 2.74  ? 32  LEU A CG   2  
ATOM 7953   C CD1  . LEU A 1 32  ? -28.794 -8.910  1.155   1.00 2.78  ? 32  LEU A CD1  2  
ATOM 7954   C CD2  . LEU A 1 32  ? -30.512 -9.151  2.952   1.00 3.06  ? 32  LEU A CD2  2  
ATOM 7955   H H    . LEU A 1 32  ? -27.521 -6.256  5.215   1.00 3.01  ? 32  LEU A H    2  
ATOM 7956   H HA   . LEU A 1 32  ? -28.329 -8.942  4.302   1.00 3.15  ? 32  LEU A HA   2  
ATOM 7957   H HB2  . LEU A 1 32  ? -29.541 -6.656  3.637   1.00 2.72  ? 32  LEU A HB2  2  
ATOM 7958   H HB3  . LEU A 1 32  ? -28.259 -6.608  2.445   1.00 2.56  ? 32  LEU A HB3  2  
ATOM 7959   H HG   . LEU A 1 32  ? -30.366 -7.556  1.565   1.00 2.58  ? 32  LEU A HG   2  
ATOM 7960   H HD11 . LEU A 1 32  ? -28.258 -8.196  0.548   1.00 2.76  ? 32  LEU A HD11 2  
ATOM 7961   H HD12 . LEU A 1 32  ? -29.400 -9.538  0.521   1.00 2.88  ? 32  LEU A HD12 2  
ATOM 7962   H HD13 . LEU A 1 32  ? -28.089 -9.521  1.700   1.00 3.06  ? 32  LEU A HD13 2  
ATOM 7963   H HD21 . LEU A 1 32  ? -31.028 -8.621  3.740   1.00 3.19  ? 32  LEU A HD21 2  
ATOM 7964   H HD22 . LEU A 1 32  ? -29.864 -9.897  3.385   1.00 3.30  ? 32  LEU A HD22 2  
ATOM 7965   H HD23 . LEU A 1 32  ? -31.235 -9.630  2.310   1.00 3.12  ? 32  LEU A HD23 2  
ATOM 7966   N N    . ASP A 1 33  ? -25.935 -7.069  2.991   1.00 2.85  ? 33  ASP A N    2  
ATOM 7967   C CA   . ASP A 1 33  ? -24.617 -7.099  2.362   1.00 2.81  ? 33  ASP A CA   2  
ATOM 7968   C C    . ASP A 1 33  ? -23.564 -7.711  3.283   1.00 3.17  ? 33  ASP A C    2  
ATOM 7969   O O    . ASP A 1 33  ? -23.668 -7.631  4.514   1.00 3.27  ? 33  ASP A O    2  
ATOM 7970   C CB   . ASP A 1 33  ? -24.197 -5.684  1.952   1.00 2.57  ? 33  ASP A CB   2  
ATOM 7971   C CG   . ASP A 1 33  ? -22.916 -5.670  1.140   1.00 2.47  ? 33  ASP A CG   2  
ATOM 7972   O OD1  . ASP A 1 33  ? -22.626 -6.678  0.465   1.00 2.49  ? 33  ASP A OD1  2  
ATOM 7973   O OD2  . ASP A 1 33  ? -22.196 -4.656  1.181   1.00 2.50  ? 33  ASP A OD2  2  
ATOM 7974   H H    . ASP A 1 33  ? -26.394 -6.210  3.087   1.00 2.84  ? 33  ASP A H    2  
ATOM 7975   H HA   . ASP A 1 33  ? -24.691 -7.711  1.474   1.00 2.74  ? 33  ASP A HA   2  
ATOM 7976   H HB2  . ASP A 1 33  ? -24.982 -5.242  1.357   1.00 2.35  ? 33  ASP A HB2  2  
ATOM 7977   H HB3  . ASP A 1 33  ? -24.047 -5.090  2.840   1.00 2.73  ? 33  ASP A HB3  2  
ATOM 7978   N N    . MET A 1 34  ? -22.552 -8.316  2.676   1.00 3.37  ? 34  MET A N    2  
ATOM 7979   C CA   . MET A 1 34  ? -21.474 -8.963  3.408   1.00 3.72  ? 34  MET A CA   2  
ATOM 7980   C C    . MET A 1 34  ? -20.604 -7.925  4.103   1.00 3.78  ? 34  MET A C    2  
ATOM 7981   O O    . MET A 1 34  ? -19.849 -7.195  3.463   1.00 3.85  ? 34  MET A O    2  
ATOM 7982   C CB   . MET A 1 34  ? -20.625 -9.821  2.465   1.00 3.91  ? 34  MET A CB   2  
ATOM 7983   C CG   . MET A 1 34  ? -19.484 -10.552 3.160   1.00 4.30  ? 34  MET A CG   2  
ATOM 7984   S SD   . MET A 1 34  ? -20.064 -11.728 4.400   1.00 4.57  ? 34  MET A SD   2  
ATOM 7985   C CE   . MET A 1 34  ? -18.507 -12.377 5.006   1.00 5.18  ? 34  MET A CE   2  
ATOM 7986   H H    . MET A 1 34  ? -22.518 -8.296  1.694   1.00 3.30  ? 34  MET A H    2  
ATOM 7987   H HA   . MET A 1 34  ? -21.921 -9.602  4.157   1.00 3.83  ? 34  MET A HA   2  
ATOM 7988   H HB2  . MET A 1 34  ? -21.262 -10.557 1.996   1.00 3.89  ? 34  MET A HB2  2  
ATOM 7989   H HB3  . MET A 1 34  ? -20.204 -9.186  1.701   1.00 3.86  ? 34  MET A HB3  2  
ATOM 7990   H HG2  . MET A 1 34  ? -18.913 -11.089 2.417   1.00 4.44  ? 34  MET A HG2  2  
ATOM 7991   H HG3  . MET A 1 34  ? -18.849 -9.824  3.643   1.00 4.47  ? 34  MET A HG3  2  
ATOM 7992   H HE1  . MET A 1 34  ? -18.698 -13.068 5.815   1.00 5.52  ? 34  MET A HE1  2  
ATOM 7993   H HE2  . MET A 1 34  ? -17.894 -11.564 5.364   1.00 5.25  ? 34  MET A HE2  2  
ATOM 7994   H HE3  . MET A 1 34  ? -17.994 -12.890 4.207   1.00 5.41  ? 34  MET A HE3  2  
ATOM 7995   N N    . GLY A 1 35  ? -20.714 -7.875  5.418   1.00 3.92  ? 35  GLY A N    2  
ATOM 7996   C CA   . GLY A 1 35  ? -19.951 -6.922  6.191   1.00 3.99  ? 35  GLY A CA   2  
ATOM 7997   C C    . GLY A 1 35  ? -20.720 -6.460  7.405   1.00 3.95  ? 35  GLY A C    2  
ATOM 7998   O O    . GLY A 1 35  ? -20.142 -5.918  8.346   1.00 4.09  ? 35  GLY A O    2  
ATOM 7999   H H    . GLY A 1 35  ? -21.317 -8.498  5.872   1.00 4.08  ? 35  GLY A H    2  
ATOM 8000   H HA2  . GLY A 1 35  ? -19.028 -7.385  6.509   1.00 4.18  ? 35  GLY A HA2  2  
ATOM 8001   H HA3  . GLY A 1 35  ? -19.724 -6.069  5.571   1.00 3.91  ? 35  GLY A HA3  2  
ATOM 8002   N N    . GLY A 1 36  ? -22.030 -6.680  7.380   1.00 3.82  ? 36  GLY A N    2  
ATOM 8003   C CA   . GLY A 1 36  ? -22.872 -6.291  8.495   1.00 3.79  ? 36  GLY A CA   2  
ATOM 8004   C C    . GLY A 1 36  ? -23.496 -4.928  8.296   1.00 3.62  ? 36  GLY A C    2  
ATOM 8005   O O    . GLY A 1 36  ? -24.148 -4.396  9.191   1.00 3.73  ? 36  GLY A O    2  
ATOM 8006   H H    . GLY A 1 36  ? -22.431 -7.103  6.589   1.00 3.76  ? 36  GLY A H    2  
ATOM 8007   H HA2  . GLY A 1 36  ? -23.658 -7.022  8.610   1.00 3.79  ? 36  GLY A HA2  2  
ATOM 8008   H HA3  . GLY A 1 36  ? -22.275 -6.275  9.394   1.00 3.93  ? 36  GLY A HA3  2  
ATOM 8009   N N    . THR A 1 37  ? -23.291 -4.362  7.120   1.00 3.40  ? 37  THR A N    2  
ATOM 8010   C CA   . THR A 1 37  ? -23.839 -3.059  6.797   1.00 3.24  ? 37  THR A CA   2  
ATOM 8011   C C    . THR A 1 37  ? -24.414 -3.063  5.386   1.00 2.98  ? 37  THR A C    2  
ATOM 8012   O O    . THR A 1 37  ? -23.677 -3.008  4.402   1.00 3.12  ? 37  THR A O    2  
ATOM 8013   C CB   . THR A 1 37  ? -22.771 -1.959  6.928   1.00 3.22  ? 37  THR A CB   2  
ATOM 8014   O OG1  . THR A 1 37  ? -21.476 -2.554  7.097   1.00 3.33  ? 37  THR A OG1  2  
ATOM 8015   C CG2  . THR A 1 37  ? -23.076 -1.056  8.112   1.00 3.43  ? 37  THR A CG2  2  
ATOM 8016   H H    . THR A 1 37  ? -22.759 -4.833  6.448   1.00 3.40  ? 37  THR A H    2  
ATOM 8017   H HA   . THR A 1 37  ? -24.632 -2.848  7.499   1.00 3.37  ? 37  THR A HA   2  
ATOM 8018   H HB   . THR A 1 37  ? -22.771 -1.362  6.028   1.00 3.06  ? 37  THR A HB   2  
ATOM 8019   H HG1  . THR A 1 37  ? -21.543 -3.291  7.709   1.00 3.43  ? 37  THR A HG1  2  
ATOM 8020   H HG21 . THR A 1 37  ? -24.023 -0.564  7.954   1.00 3.42  ? 37  THR A HG21 2  
ATOM 8021   H HG22 . THR A 1 37  ? -22.295 -0.316  8.211   1.00 3.52  ? 37  THR A HG22 2  
ATOM 8022   H HG23 . THR A 1 37  ? -23.125 -1.649  9.012   1.00 3.62  ? 37  THR A HG23 2  
ATOM 8023   N N    . SER A 1 38  ? -25.731 -3.162  5.298   1.00 2.79  ? 38  SER A N    2  
ATOM 8024   C CA   . SER A 1 38  ? -26.425 -3.191  4.019   1.00 2.52  ? 38  SER A CA   2  
ATOM 8025   C C    . SER A 1 38  ? -26.565 -1.791  3.425   1.00 2.29  ? 38  SER A C    2  
ATOM 8026   O O    . SER A 1 38  ? -26.181 -0.795  4.052   1.00 2.38  ? 38  SER A O    2  
ATOM 8027   C CB   . SER A 1 38  ? -27.806 -3.811  4.226   1.00 2.58  ? 38  SER A CB   2  
ATOM 8028   O OG   . SER A 1 38  ? -27.877 -4.450  5.497   1.00 2.89  ? 38  SER A OG   2  
ATOM 8029   H H    . SER A 1 38  ? -26.262 -3.225  6.120   1.00 2.96  ? 38  SER A H    2  
ATOM 8030   H HA   . SER A 1 38  ? -25.859 -3.807  3.340   1.00 2.49  ? 38  SER A HA   2  
ATOM 8031   H HB2  . SER A 1 38  ? -28.561 -3.039  4.181   1.00 2.48  ? 38  SER A HB2  2  
ATOM 8032   H HB3  . SER A 1 38  ? -27.992 -4.544  3.455   1.00 2.58  ? 38  SER A HB3  2  
ATOM 8033   H HG   . SER A 1 38  ? -28.765 -4.341  5.866   1.00 2.97  ? 38  SER A HG   2  
ATOM 8034   N N    . ASP A 1 39  ? -27.110 -1.731  2.213   1.00 2.02  ? 39  ASP A N    2  
ATOM 8035   C CA   . ASP A 1 39  ? -27.342 -0.468  1.514   1.00 1.78  ? 39  ASP A CA   2  
ATOM 8036   C C    . ASP A 1 39  ? -28.845 -0.316  1.296   1.00 1.62  ? 39  ASP A C    2  
ATOM 8037   O O    . ASP A 1 39  ? -29.337 -0.471  0.180   1.00 1.40  ? 39  ASP A O    2  
ATOM 8038   C CB   . ASP A 1 39  ? -26.612 -0.448  0.157   1.00 1.60  ? 39  ASP A CB   2  
ATOM 8039   C CG   . ASP A 1 39  ? -25.099 -0.353  0.276   1.00 1.81  ? 39  ASP A CG   2  
ATOM 8040   O OD1  . ASP A 1 39  ? -24.559 -0.574  1.381   1.00 2.13  ? 39  ASP A OD1  2  
ATOM 8041   O OD2  . ASP A 1 39  ? -24.440 -0.046  -0.737  1.00 1.86  ? 39  ASP A OD2  2  
ATOM 8042   H H    . ASP A 1 39  ? -27.377 -2.574  1.768   1.00 1.99  ? 39  ASP A H    2  
ATOM 8043   H HA   . ASP A 1 39  ? -26.984 0.339   2.136   1.00 1.90  ? 39  ASP A HA   2  
ATOM 8044   H HB2  . ASP A 1 39  ? -26.849 -1.355  -0.380  1.00 1.53  ? 39  ASP A HB2  2  
ATOM 8045   H HB3  . ASP A 1 39  ? -26.962 0.398   -0.415  1.00 1.44  ? 39  ASP A HB3  2  
ATOM 8046   N N    . PRO A 1 40  ? -29.602 -0.009  2.362   1.00 1.74  ? 40  PRO A N    2  
ATOM 8047   C CA   . PRO A 1 40  ? -31.052 0.084   2.296   1.00 1.64  ? 40  PRO A CA   2  
ATOM 8048   C C    . PRO A 1 40  ? -31.614 1.464   1.944   1.00 1.45  ? 40  PRO A C    2  
ATOM 8049   O O    . PRO A 1 40  ? -31.272 2.484   2.554   1.00 1.56  ? 40  PRO A O    2  
ATOM 8050   C CB   . PRO A 1 40  ? -31.456 -0.305  3.715   1.00 1.91  ? 40  PRO A CB   2  
ATOM 8051   C CG   . PRO A 1 40  ? -30.339 0.173   4.588   1.00 2.16  ? 40  PRO A CG   2  
ATOM 8052   C CD   . PRO A 1 40  ? -29.108 0.286   3.717   1.00 2.02  ? 40  PRO A CD   2  
ATOM 8053   H HA   . PRO A 1 40  ? -31.455 -0.643  1.608   1.00 1.57  ? 40  PRO A HA   2  
ATOM 8054   H HB2  . PRO A 1 40  ? -32.389 0.177   3.969   1.00 1.85  ? 40  PRO A HB2  2  
ATOM 8055   H HB3  . PRO A 1 40  ? -31.572 -1.377  3.780   1.00 2.03  ? 40  PRO A HB3  2  
ATOM 8056   H HG2  . PRO A 1 40  ? -30.587 1.139   5.002   1.00 2.25  ? 40  PRO A HG2  2  
ATOM 8057   H HG3  . PRO A 1 40  ? -30.169 -0.539  5.384   1.00 2.41  ? 40  PRO A HG3  2  
ATOM 8058   H HD2  . PRO A 1 40  ? -28.704 1.285   3.768   1.00 2.03  ? 40  PRO A HD2  2  
ATOM 8059   H HD3  . PRO A 1 40  ? -28.365 -0.437  4.022   1.00 2.14  ? 40  PRO A HD3  2  
ATOM 8060   N N    . TYR A 1 41  ? -32.489 1.475   0.951   1.00 1.21  ? 41  TYR A N    2  
ATOM 8061   C CA   . TYR A 1 41  ? -33.177 2.678   0.521   1.00 1.05  ? 41  TYR A CA   2  
ATOM 8062   C C    . TYR A 1 41  ? -34.666 2.353   0.435   1.00 0.98  ? 41  TYR A C    2  
ATOM 8063   O O    . TYR A 1 41  ? -35.039 1.251   0.035   1.00 1.03  ? 41  TYR A O    2  
ATOM 8064   C CB   . TYR A 1 41  ? -32.619 3.212   -0.811  1.00 0.88  ? 41  TYR A CB   2  
ATOM 8065   C CG   . TYR A 1 41  ? -33.068 2.470   -2.052  1.00 0.72  ? 41  TYR A CG   2  
ATOM 8066   C CD1  . TYR A 1 41  ? -32.348 1.389   -2.543  1.00 0.77  ? 41  TYR A CD1  2  
ATOM 8067   C CD2  . TYR A 1 41  ? -34.203 2.872   -2.748  1.00 0.69  ? 41  TYR A CD2  2  
ATOM 8068   C CE1  . TYR A 1 41  ? -32.747 0.728   -3.691  1.00 0.77  ? 41  TYR A CE1  2  
ATOM 8069   C CE2  . TYR A 1 41  ? -34.610 2.213   -3.890  1.00 0.75  ? 41  TYR A CE2  2  
ATOM 8070   C CZ   . TYR A 1 41  ? -33.880 1.145   -4.360  1.00 0.76  ? 41  TYR A CZ   2  
ATOM 8071   O OH   . TYR A 1 41  ? -34.283 0.495   -5.507  1.00 0.94  ? 41  TYR A OH   2  
ATOM 8072   H H    . TYR A 1 41  ? -32.679 0.628   0.484   1.00 1.19  ? 41  TYR A H    2  
ATOM 8073   H HA   . TYR A 1 41  ? -33.037 3.425   1.290   1.00 1.18  ? 41  TYR A HA   2  
ATOM 8074   H HB2  . TYR A 1 41  ? -32.923 4.241   -0.923  1.00 0.88  ? 41  TYR A HB2  2  
ATOM 8075   H HB3  . TYR A 1 41  ? -31.539 3.171   -0.774  1.00 0.99  ? 41  TYR A HB3  2  
ATOM 8076   H HD1  . TYR A 1 41  ? -31.462 1.064   -2.015  1.00 0.94  ? 41  TYR A HD1  2  
ATOM 8077   H HD2  . TYR A 1 41  ? -34.774 3.711   -2.380  1.00 0.77  ? 41  TYR A HD2  2  
ATOM 8078   H HE1  . TYR A 1 41  ? -32.174 -0.111  -4.056  1.00 0.89  ? 41  TYR A HE1  2  
ATOM 8079   H HE2  . TYR A 1 41  ? -35.498 2.538   -4.412  1.00 0.89  ? 41  TYR A HE2  2  
ATOM 8080   H HH   . TYR A 1 41  ? -34.622 1.148   -6.141  1.00 1.16  ? 41  TYR A HH   2  
ATOM 8081   N N    . VAL A 1 42  ? -35.511 3.283   0.838   1.00 0.98  ? 42  VAL A N    2  
ATOM 8082   C CA   . VAL A 1 42  ? -36.948 3.043   0.836   1.00 0.98  ? 42  VAL A CA   2  
ATOM 8083   C C    . VAL A 1 42  ? -37.603 3.431   -0.480  1.00 0.82  ? 42  VAL A C    2  
ATOM 8084   O O    . VAL A 1 42  ? -37.370 4.513   -1.017  1.00 0.78  ? 42  VAL A O    2  
ATOM 8085   C CB   . VAL A 1 42  ? -37.654 3.783   1.995   1.00 1.10  ? 42  VAL A CB   2  
ATOM 8086   C CG1  . VAL A 1 42  ? -37.423 3.059   3.312   1.00 1.37  ? 42  VAL A CG1  2  
ATOM 8087   C CG2  . VAL A 1 42  ? -37.182 5.226   2.088   1.00 1.11  ? 42  VAL A CG2  2  
ATOM 8088   H H    . VAL A 1 42  ? -35.171 4.157   1.116   1.00 1.04  ? 42  VAL A H    2  
ATOM 8089   H HA   . VAL A 1 42  ? -37.095 1.983   0.988   1.00 1.10  ? 42  VAL A HA   2  
ATOM 8090   H HB   . VAL A 1 42  ? -38.716 3.788   1.797   1.00 1.08  ? 42  VAL A HB   2  
ATOM 8091   H HG11 . VAL A 1 42  ? -37.903 3.604   4.112   1.00 1.46  ? 42  VAL A HG11 2  
ATOM 8092   H HG12 . VAL A 1 42  ? -36.363 2.994   3.507   1.00 1.45  ? 42  VAL A HG12 2  
ATOM 8093   H HG13 . VAL A 1 42  ? -37.841 2.064   3.254   1.00 1.45  ? 42  VAL A HG13 2  
ATOM 8094   H HG21 . VAL A 1 42  ? -36.127 5.246   2.319   1.00 1.27  ? 42  VAL A HG21 2  
ATOM 8095   H HG22 . VAL A 1 42  ? -37.732 5.735   2.866   1.00 1.27  ? 42  VAL A HG22 2  
ATOM 8096   H HG23 . VAL A 1 42  ? -37.353 5.721   1.144   1.00 1.04  ? 42  VAL A HG23 2  
ATOM 8097   N N    . LYS A 1 43  ? -38.405 2.525   -1.003  1.00 0.92  ? 43  LYS A N    2  
ATOM 8098   C CA   . LYS A 1 43  ? -39.131 2.761   -2.235  1.00 0.97  ? 43  LYS A CA   2  
ATOM 8099   C C    . LYS A 1 43  ? -40.616 2.561   -1.978  1.00 1.14  ? 43  LYS A C    2  
ATOM 8100   O O    . LYS A 1 43  ? -41.021 1.617   -1.294  1.00 1.31  ? 43  LYS A O    2  
ATOM 8101   C CB   . LYS A 1 43  ? -38.639 1.848   -3.364  1.00 1.11  ? 43  LYS A CB   2  
ATOM 8102   C CG   . LYS A 1 43  ? -38.651 0.364   -3.026  1.00 1.25  ? 43  LYS A CG   2  
ATOM 8103   C CD   . LYS A 1 43  ? -38.591 -0.489  -4.284  1.00 1.45  ? 43  LYS A CD   2  
ATOM 8104   C CE   . LYS A 1 43  ? -37.302 -0.261  -5.060  1.00 1.20  ? 43  LYS A CE   2  
ATOM 8105   N NZ   . LYS A 1 43  ? -37.452 -0.591  -6.501  1.00 1.37  ? 43  LYS A NZ   2  
ATOM 8106   H H    . LYS A 1 43  ? -38.529 1.668   -0.533  1.00 1.07  ? 43  LYS A H    2  
ATOM 8107   H HA   . LYS A 1 43  ? -38.966 3.791   -2.519  1.00 0.91  ? 43  LYS A HA   2  
ATOM 8108   H HB2  . LYS A 1 43  ? -39.267 1.999   -4.228  1.00 1.36  ? 43  LYS A HB2  2  
ATOM 8109   H HB3  . LYS A 1 43  ? -37.626 2.129   -3.616  1.00 1.08  ? 43  LYS A HB3  2  
ATOM 8110   H HG2  . LYS A 1 43  ? -37.795 0.138   -2.409  1.00 1.20  ? 43  LYS A HG2  2  
ATOM 8111   H HG3  . LYS A 1 43  ? -39.558 0.135   -2.488  1.00 1.50  ? 43  LYS A HG3  2  
ATOM 8112   H HD2  . LYS A 1 43  ? -38.649 -1.529  -4.003  1.00 1.71  ? 43  LYS A HD2  2  
ATOM 8113   H HD3  . LYS A 1 43  ? -39.431 -0.236  -4.916  1.00 1.76  ? 43  LYS A HD3  2  
ATOM 8114   H HE2  . LYS A 1 43  ? -37.018 0.776   -4.968  1.00 1.36  ? 43  LYS A HE2  2  
ATOM 8115   H HE3  . LYS A 1 43  ? -36.527 -0.884  -4.637  1.00 1.36  ? 43  LYS A HE3  2  
ATOM 8116   H HZ1  . LYS A 1 43  ? -36.536 -0.517  -6.982  1.00 1.56  ? 43  LYS A HZ1  2  
ATOM 8117   H HZ2  . LYS A 1 43  ? -38.117 0.069   -6.952  1.00 1.72  ? 43  LYS A HZ2  2  
ATOM 8118   H HZ3  . LYS A 1 43  ? -37.813 -1.561  -6.615  1.00 1.85  ? 43  LYS A HZ3  2  
ATOM 8119   N N    . VAL A 1 44  ? -41.419 3.461   -2.506  1.00 1.15  ? 44  VAL A N    2  
ATOM 8120   C CA   . VAL A 1 44  ? -42.855 3.400   -2.312  1.00 1.31  ? 44  VAL A CA   2  
ATOM 8121   C C    . VAL A 1 44  ? -43.509 2.375   -3.227  1.00 1.55  ? 44  VAL A C    2  
ATOM 8122   O O    . VAL A 1 44  ? -43.216 2.304   -4.422  1.00 1.65  ? 44  VAL A O    2  
ATOM 8123   C CB   . VAL A 1 44  ? -43.511 4.777   -2.533  1.00 1.31  ? 44  VAL A CB   2  
ATOM 8124   C CG1  . VAL A 1 44  ? -43.058 5.749   -1.461  1.00 1.38  ? 44  VAL A CG1  2  
ATOM 8125   C CG2  . VAL A 1 44  ? -43.192 5.321   -3.916  1.00 1.52  ? 44  VAL A CG2  2  
ATOM 8126   H H    . VAL A 1 44  ? -41.039 4.182   -3.046  1.00 1.11  ? 44  VAL A H    2  
ATOM 8127   H HA   . VAL A 1 44  ? -43.034 3.109   -1.288  1.00 1.31  ? 44  VAL A HA   2  
ATOM 8128   H HB   . VAL A 1 44  ? -44.582 4.658   -2.452  1.00 1.52  ? 44  VAL A HB   2  
ATOM 8129   H HG11 . VAL A 1 44  ? -43.385 5.397   -0.495  1.00 1.59  ? 44  VAL A HG11 2  
ATOM 8130   H HG12 . VAL A 1 44  ? -43.486 6.722   -1.654  1.00 1.42  ? 44  VAL A HG12 2  
ATOM 8131   H HG13 . VAL A 1 44  ? -41.981 5.821   -1.474  1.00 1.52  ? 44  VAL A HG13 2  
ATOM 8132   H HG21 . VAL A 1 44  ? -42.123 5.413   -4.029  1.00 1.62  ? 44  VAL A HG21 2  
ATOM 8133   H HG22 . VAL A 1 44  ? -43.652 6.290   -4.036  1.00 1.60  ? 44  VAL A HG22 2  
ATOM 8134   H HG23 . VAL A 1 44  ? -43.575 4.644   -4.665  1.00 1.79  ? 44  VAL A HG23 2  
ATOM 8135   N N    . PHE A 1 45  ? -44.381 1.572   -2.647  1.00 1.72  ? 45  PHE A N    2  
ATOM 8136   C CA   . PHE A 1 45  ? -45.108 0.564   -3.392  1.00 2.00  ? 45  PHE A CA   2  
ATOM 8137   C C    . PHE A 1 45  ? -46.597 0.796   -3.210  1.00 2.14  ? 45  PHE A C    2  
ATOM 8138   O O    . PHE A 1 45  ? -47.155 0.570   -2.134  1.00 2.10  ? 45  PHE A O    2  
ATOM 8139   C CB   . PHE A 1 45  ? -44.719 -0.848  -2.951  1.00 2.13  ? 45  PHE A CB   2  
ATOM 8140   C CG   . PHE A 1 45  ? -43.608 -1.445  -3.770  1.00 2.22  ? 45  PHE A CG   2  
ATOM 8141   C CD1  . PHE A 1 45  ? -43.687 -1.463  -5.154  1.00 2.39  ? 45  PHE A CD1  2  
ATOM 8142   C CD2  . PHE A 1 45  ? -42.486 -1.984  -3.162  1.00 2.31  ? 45  PHE A CD2  2  
ATOM 8143   C CE1  . PHE A 1 45  ? -42.668 -2.005  -5.915  1.00 2.57  ? 45  PHE A CE1  2  
ATOM 8144   C CE2  . PHE A 1 45  ? -41.465 -2.528  -3.917  1.00 2.48  ? 45  PHE A CE2  2  
ATOM 8145   C CZ   . PHE A 1 45  ? -41.555 -2.537  -5.296  1.00 2.57  ? 45  PHE A CZ   2  
ATOM 8146   H H    . PHE A 1 45  ? -44.548 1.663   -1.681  1.00 1.70  ? 45  PHE A H    2  
ATOM 8147   H HA   . PHE A 1 45  ? -44.865 0.689   -4.438  1.00 2.04  ? 45  PHE A HA   2  
ATOM 8148   H HB2  . PHE A 1 45  ? -44.393 -0.819  -1.923  1.00 2.10  ? 45  PHE A HB2  2  
ATOM 8149   H HB3  . PHE A 1 45  ? -45.582 -1.494  -3.033  1.00 2.31  ? 45  PHE A HB3  2  
ATOM 8150   H HD1  . PHE A 1 45  ? -44.558 -1.048  -5.640  1.00 2.51  ? 45  PHE A HD1  2  
ATOM 8151   H HD2  . PHE A 1 45  ? -42.412 -1.977  -2.084  1.00 2.37  ? 45  PHE A HD2  2  
ATOM 8152   H HE1  . PHE A 1 45  ? -42.742 -2.010  -6.992  1.00 2.80  ? 45  PHE A HE1  2  
ATOM 8153   H HE2  . PHE A 1 45  ? -40.596 -2.943  -3.429  1.00 2.66  ? 45  PHE A HE2  2  
ATOM 8154   H HZ   . PHE A 1 45  ? -40.758 -2.961  -5.888  1.00 2.76  ? 45  PHE A HZ   2  
ATOM 8155   N N    . LEU A 1 46  ? -47.231 1.273   -4.259  1.00 2.36  ? 46  LEU A N    2  
ATOM 8156   C CA   . LEU A 1 46  ? -48.650 1.566   -4.218  1.00 2.52  ? 46  LEU A CA   2  
ATOM 8157   C C    . LEU A 1 46  ? -49.477 0.361   -4.636  1.00 2.82  ? 46  LEU A C    2  
ATOM 8158   O O    . LEU A 1 46  ? -48.947 -0.644  -5.119  1.00 2.91  ? 46  LEU A O    2  
ATOM 8159   C CB   . LEU A 1 46  ? -48.968 2.756   -5.132  1.00 2.56  ? 46  LEU A CB   2  
ATOM 8160   C CG   . LEU A 1 46  ? -49.179 4.097   -4.422  1.00 2.40  ? 46  LEU A CG   2  
ATOM 8161   C CD1  . LEU A 1 46  ? -50.435 4.061   -3.569  1.00 2.46  ? 46  LEU A CD1  2  
ATOM 8162   C CD2  . LEU A 1 46  ? -47.967 4.454   -3.573  1.00 2.12  ? 46  LEU A CD2  2  
ATOM 8163   H H    . LEU A 1 46  ? -46.734 1.423   -5.090  1.00 2.44  ? 46  LEU A H    2  
ATOM 8164   H HA   . LEU A 1 46  ? -48.906 1.829   -3.204  1.00 2.43  ? 46  LEU A HA   2  
ATOM 8165   H HB2  . LEU A 1 46  ? -48.154 2.869   -5.832  1.00 2.53  ? 46  LEU A HB2  2  
ATOM 8166   H HB3  . LEU A 1 46  ? -49.865 2.525   -5.687  1.00 2.77  ? 46  LEU A HB3  2  
ATOM 8167   H HG   . LEU A 1 46  ? -49.305 4.869   -5.166  1.00 2.46  ? 46  LEU A HG   2  
ATOM 8168   H HD11 . LEU A 1 46  ? -50.948 5.009   -3.641  1.00 2.74  ? 46  LEU A HD11 2  
ATOM 8169   H HD12 . LEU A 1 46  ? -50.167 3.872   -2.541  1.00 2.33  ? 46  LEU A HD12 2  
ATOM 8170   H HD13 . LEU A 1 46  ? -51.085 3.275   -3.920  1.00 2.61  ? 46  LEU A HD13 2  
ATOM 8171   H HD21 . LEU A 1 46  ? -48.151 5.383   -3.052  1.00 2.05  ? 46  LEU A HD21 2  
ATOM 8172   H HD22 . LEU A 1 46  ? -47.100 4.564   -4.208  1.00 2.12  ? 46  LEU A HD22 2  
ATOM 8173   H HD23 . LEU A 1 46  ? -47.786 3.669   -2.853  1.00 2.14  ? 46  LEU A HD23 2  
ATOM 8174   N N    . LEU A 1 47  ? -50.775 0.472   -4.417  1.00 2.97  ? 47  LEU A N    2  
ATOM 8175   C CA   . LEU A 1 47  ? -51.726 -0.562  -4.786  1.00 3.28  ? 47  LEU A CA   2  
ATOM 8176   C C    . LEU A 1 47  ? -51.989 -0.449  -6.302  1.00 3.46  ? 47  LEU A C    2  
ATOM 8177   O O    . LEU A 1 47  ? -51.209 0.228   -6.978  1.00 3.35  ? 47  LEU A O    2  
ATOM 8178   C CB   . LEU A 1 47  ? -53.001 -0.387  -3.931  1.00 3.37  ? 47  LEU A CB   2  
ATOM 8179   C CG   . LEU A 1 47  ? -54.001 0.681   -4.400  1.00 3.40  ? 47  LEU A CG   2  
ATOM 8180   C CD1  . LEU A 1 47  ? -55.353 0.470   -3.734  1.00 3.57  ? 47  LEU A CD1  2  
ATOM 8181   C CD2  . LEU A 1 47  ? -53.485 2.080   -4.107  1.00 3.20  ? 47  LEU A CD2  2  
ATOM 8182   H H    . LEU A 1 47  ? -51.110 1.282   -3.979  1.00 2.89  ? 47  LEU A H    2  
ATOM 8183   H HA   . LEU A 1 47  ? -51.277 -1.520  -4.578  1.00 3.32  ? 47  LEU A HA   2  
ATOM 8184   H HB2  . LEU A 1 47  ? -53.513 -1.335  -3.897  1.00 3.57  ? 47  LEU A HB2  2  
ATOM 8185   H HB3  . LEU A 1 47  ? -52.691 -0.136  -2.925  1.00 3.24  ? 47  LEU A HB3  2  
ATOM 8186   H HG   . LEU A 1 47  ? -54.139 0.590   -5.467  1.00 3.55  ? 47  LEU A HG   2  
ATOM 8187   H HD11 . LEU A 1 47  ? -56.011 1.287   -3.990  1.00 3.58  ? 47  LEU A HD11 2  
ATOM 8188   H HD12 . LEU A 1 47  ? -55.226 0.434   -2.661  1.00 3.61  ? 47  LEU A HD12 2  
ATOM 8189   H HD13 . LEU A 1 47  ? -55.784 -0.459  -4.077  1.00 3.85  ? 47  LEU A HD13 2  
ATOM 8190   H HD21 . LEU A 1 47  ? -52.613 2.274   -4.713  1.00 3.23  ? 47  LEU A HD21 2  
ATOM 8191   H HD22 . LEU A 1 47  ? -53.223 2.157   -3.062  1.00 3.17  ? 47  LEU A HD22 2  
ATOM 8192   H HD23 . LEU A 1 47  ? -54.252 2.802   -4.340  1.00 3.26  ? 47  LEU A HD23 2  
ATOM 8193   N N    . PRO A 1 48  ? -53.029 -1.116  -6.884  1.00 3.76  ? 48  PRO A N    2  
ATOM 8194   C CA   . PRO A 1 48  ? -53.342 -1.015  -8.327  1.00 3.96  ? 48  PRO A CA   2  
ATOM 8195   C C    . PRO A 1 48  ? -53.268 0.407   -8.916  1.00 3.88  ? 48  PRO A C    2  
ATOM 8196   O O    . PRO A 1 48  ? -53.240 0.561   -10.139 1.00 4.04  ? 48  PRO A O    2  
ATOM 8197   C CB   . PRO A 1 48  ? -54.770 -1.540  -8.393  1.00 4.25  ? 48  PRO A CB   2  
ATOM 8198   C CG   . PRO A 1 48  ? -54.814 -2.588  -7.342  1.00 4.26  ? 48  PRO A CG   2  
ATOM 8199   C CD   . PRO A 1 48  ? -53.930 -2.096  -6.227  1.00 3.94  ? 48  PRO A CD   2  
ATOM 8200   H HA   . PRO A 1 48  ? -52.702 -1.666  -8.905  1.00 4.02  ? 48  PRO A HA   2  
ATOM 8201   H HB2  . PRO A 1 48  ? -55.463 -0.736  -8.188  1.00 4.25  ? 48  PRO A HB2  2  
ATOM 8202   H HB3  . PRO A 1 48  ? -54.962 -1.953  -9.372  1.00 4.44  ? 48  PRO A HB3  2  
ATOM 8203   H HG2  . PRO A 1 48  ? -55.827 -2.710  -6.989  1.00 4.40  ? 48  PRO A HG2  2  
ATOM 8204   H HG3  . PRO A 1 48  ? -54.437 -3.520  -7.735  1.00 4.36  ? 48  PRO A HG3  2  
ATOM 8205   H HD2  . PRO A 1 48  ? -54.525 -1.619  -5.464  1.00 3.89  ? 48  PRO A HD2  2  
ATOM 8206   H HD3  . PRO A 1 48  ? -53.364 -2.915  -5.808  1.00 3.92  ? 48  PRO A HD3  2  
ATOM 8207   N N    . ASP A 1 49  ? -53.264 1.429   -8.056  1.00 3.68  ? 49  ASP A N    2  
ATOM 8208   C CA   . ASP A 1 49  ? -53.155 2.821   -8.495  1.00 3.62  ? 49  ASP A CA   2  
ATOM 8209   C C    . ASP A 1 49  ? -51.953 2.974   -9.420  1.00 3.56  ? 49  ASP A C    2  
ATOM 8210   O O    . ASP A 1 49  ? -52.099 3.370   -10.576 1.00 3.73  ? 49  ASP A O    2  
ATOM 8211   C CB   . ASP A 1 49  ? -53.001 3.755   -7.286  1.00 3.37  ? 49  ASP A CB   2  
ATOM 8212   C CG   . ASP A 1 49  ? -52.832 5.214   -7.676  1.00 3.31  ? 49  ASP A CG   2  
ATOM 8213   O OD1  . ASP A 1 49  ? -53.827 5.829   -8.115  1.00 3.48  ? 49  ASP A OD1  2  
ATOM 8214   O OD2  . ASP A 1 49  ? -51.709 5.754   -7.533  1.00 3.12  ? 49  ASP A OD2  2  
ATOM 8215   H H    . ASP A 1 49  ? -53.332 1.237   -7.100  1.00 3.59  ? 49  ASP A H    2  
ATOM 8216   H HA   . ASP A 1 49  ? -54.054 3.076   -9.034  1.00 3.81  ? 49  ASP A HA   2  
ATOM 8217   H HB2  . ASP A 1 49  ? -53.879 3.670   -6.662  1.00 3.43  ? 49  ASP A HB2  2  
ATOM 8218   H HB3  . ASP A 1 49  ? -52.134 3.453   -6.716  1.00 3.19  ? 49  ASP A HB3  2  
ATOM 8219   N N    . LYS A 1 50  ? -50.773 2.647   -8.886  1.00 3.34  ? 50  LYS A N    2  
ATOM 8220   C CA   . LYS A 1 50  ? -49.505 2.694   -9.629  1.00 3.27  ? 50  LYS A CA   2  
ATOM 8221   C C    . LYS A 1 50  ? -49.255 4.040   -10.319 1.00 3.28  ? 50  LYS A C    2  
ATOM 8222   O O    . LYS A 1 50  ? -48.461 4.116   -11.254 1.00 3.36  ? 50  LYS A O    2  
ATOM 8223   C CB   . LYS A 1 50  ? -49.467 1.566   -10.668 1.00 3.49  ? 50  LYS A CB   2  
ATOM 8224   C CG   . LYS A 1 50  ? -49.670 0.180   -10.076 1.00 3.52  ? 50  LYS A CG   2  
ATOM 8225   C CD   . LYS A 1 50  ? -48.454 -0.279  -9.286  1.00 3.27  ? 50  LYS A CD   2  
ATOM 8226   C CE   . LYS A 1 50  ? -47.367 -0.831  -10.196 1.00 3.35  ? 50  LYS A CE   2  
ATOM 8227   N NZ   . LYS A 1 50  ? -47.782 -2.095  -10.862 1.00 3.70  ? 50  LYS A NZ   2  
ATOM 8228   H H    . LYS A 1 50  ? -50.754 2.346   -7.955  1.00 3.24  ? 50  LYS A H    2  
ATOM 8229   H HA   . LYS A 1 50  ? -48.713 2.528   -8.917  1.00 3.07  ? 50  LYS A HA   2  
ATOM 8230   H HB2  . LYS A 1 50  ? -50.244 1.739   -11.397 1.00 3.73  ? 50  LYS A HB2  2  
ATOM 8231   H HB3  . LYS A 1 50  ? -48.509 1.585   -11.167 1.00 3.45  ? 50  LYS A HB3  2  
ATOM 8232   H HG2  . LYS A 1 50  ? -50.524 0.204   -9.417  1.00 3.56  ? 50  LYS A HG2  2  
ATOM 8233   H HG3  . LYS A 1 50  ? -49.852 -0.520  -10.878 1.00 3.73  ? 50  LYS A HG3  2  
ATOM 8234   H HD2  . LYS A 1 50  ? -48.055 0.559   -8.736  1.00 3.13  ? 50  LYS A HD2  2  
ATOM 8235   H HD3  . LYS A 1 50  ? -48.758 -1.051  -8.597  1.00 3.29  ? 50  LYS A HD3  2  
ATOM 8236   H HE2  . LYS A 1 50  ? -47.144 -0.095  -10.952 1.00 3.43  ? 50  LYS A HE2  2  
ATOM 8237   H HE3  . LYS A 1 50  ? -46.483 -1.018  -9.606  1.00 3.17  ? 50  LYS A HE3  2  
ATOM 8238   H HZ1  . LYS A 1 50  ? -48.233 -1.889  -11.774 1.00 3.93  ? 50  LYS A HZ1  2  
ATOM 8239   H HZ2  . LYS A 1 50  ? -48.459 -2.611  -10.264 1.00 3.92  ? 50  LYS A HZ2  2  
ATOM 8240   H HZ3  . LYS A 1 50  ? -46.953 -2.701  -11.026 1.00 3.73  ? 50  LYS A HZ3  2  
ATOM 8241   N N    . LYS A 1 51  ? -49.895 5.100   -9.847  1.00 3.24  ? 51  LYS A N    2  
ATOM 8242   C CA   . LYS A 1 51  ? -49.720 6.418   -10.453 1.00 3.30  ? 51  LYS A CA   2  
ATOM 8243   C C    . LYS A 1 51  ? -48.678 7.230   -9.695  1.00 3.04  ? 51  LYS A C    2  
ATOM 8244   O O    . LYS A 1 51  ? -48.857 8.429   -9.474  1.00 3.06  ? 51  LYS A O    2  
ATOM 8245   C CB   . LYS A 1 51  ? -51.051 7.173   -10.477 1.00 3.46  ? 51  LYS A CB   2  
ATOM 8246   C CG   . LYS A 1 51  ? -52.132 6.490   -11.296 1.00 3.74  ? 51  LYS A CG   2  
ATOM 8247   C CD   . LYS A 1 51  ? -53.469 7.198   -11.160 1.00 3.88  ? 51  LYS A CD   2  
ATOM 8248   C CE   . LYS A 1 51  ? -54.626 6.266   -11.492 1.00 4.11  ? 51  LYS A CE   2  
ATOM 8249   N NZ   . LYS A 1 51  ? -54.634 5.062   -10.620 1.00 4.04  ? 51  LYS A NZ   2  
ATOM 8250   H H    . LYS A 1 51  ? -50.501 5.000   -9.078  1.00 3.18  ? 51  LYS A H    2  
ATOM 8251   H HA   . LYS A 1 51  ? -49.380 6.273   -11.467 1.00 3.44  ? 51  LYS A HA   2  
ATOM 8252   H HB2  . LYS A 1 51  ? -51.408 7.275   -9.462  1.00 3.32  ? 51  LYS A HB2  2  
ATOM 8253   H HB3  . LYS A 1 51  ? -50.885 8.156   -10.889 1.00 3.52  ? 51  LYS A HB3  2  
ATOM 8254   H HG2  . LYS A 1 51  ? -51.839 6.490   -12.336 1.00 3.90  ? 51  LYS A HG2  2  
ATOM 8255   H HG3  . LYS A 1 51  ? -52.239 5.473   -10.951 1.00 3.71  ? 51  LYS A HG3  2  
ATOM 8256   H HD2  . LYS A 1 51  ? -53.579 7.545   -10.144 1.00 3.72  ? 51  LYS A HD2  2  
ATOM 8257   H HD3  . LYS A 1 51  ? -53.491 8.040   -11.836 1.00 3.99  ? 51  LYS A HD3  2  
ATOM 8258   H HE2  . LYS A 1 51  ? -55.553 6.802   -11.360 1.00 4.23  ? 51  LYS A HE2  2  
ATOM 8259   H HE3  . LYS A 1 51  ? -54.536 5.953   -12.522 1.00 4.28  ? 51  LYS A HE3  2  
ATOM 8260   H HZ1  . LYS A 1 51  ? -55.543 4.560   -10.705 1.00 4.22  ? 51  LYS A HZ1  2  
ATOM 8261   H HZ2  . LYS A 1 51  ? -54.498 5.338   -9.621  1.00 3.87  ? 51  LYS A HZ2  2  
ATOM 8262   H HZ3  . LYS A 1 51  ? -53.866 4.414   -10.894 1.00 4.07  ? 51  LYS A HZ3  2  
ATOM 8263   N N    . LYS A 1 52  ? -47.604 6.568   -9.277  1.00 2.82  ? 52  LYS A N    2  
ATOM 8264   C CA   . LYS A 1 52  ? -46.528 7.218   -8.533  1.00 2.58  ? 52  LYS A CA   2  
ATOM 8265   C C    . LYS A 1 52  ? -45.412 6.230   -8.228  1.00 2.38  ? 52  LYS A C    2  
ATOM 8266   O O    . LYS A 1 52  ? -45.671 5.071   -7.905  1.00 2.39  ? 52  LYS A O    2  
ATOM 8267   C CB   . LYS A 1 52  ? -47.055 7.812   -7.222  1.00 2.45  ? 52  LYS A CB   2  
ATOM 8268   C CG   . LYS A 1 52  ? -47.956 6.863   -6.446  1.00 2.44  ? 52  LYS A CG   2  
ATOM 8269   C CD   . LYS A 1 52  ? -48.766 7.588   -5.388  1.00 2.43  ? 52  LYS A CD   2  
ATOM 8270   C CE   . LYS A 1 52  ? -49.637 8.683   -5.984  1.00 2.69  ? 52  LYS A CE   2  
ATOM 8271   N NZ   . LYS A 1 52  ? -50.431 8.216   -7.156  1.00 2.94  ? 52  LYS A NZ   2  
ATOM 8272   H H    . LYS A 1 52  ? -47.526 5.613   -9.480  1.00 2.85  ? 52  LYS A H    2  
ATOM 8273   H HA   . LYS A 1 52  ? -46.134 8.013   -9.146  1.00 2.66  ? 52  LYS A HA   2  
ATOM 8274   H HB2  . LYS A 1 52  ? -46.216 8.072   -6.594  1.00 2.26  ? 52  LYS A HB2  2  
ATOM 8275   H HB3  . LYS A 1 52  ? -47.617 8.705   -7.446  1.00 2.60  ? 52  LYS A HB3  2  
ATOM 8276   H HG2  . LYS A 1 52  ? -48.633 6.381   -7.136  1.00 2.64  ? 52  LYS A HG2  2  
ATOM 8277   H HG3  . LYS A 1 52  ? -47.342 6.117   -5.966  1.00 2.32  ? 52  LYS A HG3  2  
ATOM 8278   H HD2  . LYS A 1 52  ? -49.403 6.874   -4.889  1.00 2.47  ? 52  LYS A HD2  2  
ATOM 8279   H HD3  . LYS A 1 52  ? -48.087 8.028   -4.673  1.00 2.35  ? 52  LYS A HD3  2  
ATOM 8280   H HE2  . LYS A 1 52  ? -50.315 9.032   -5.221  1.00 2.80  ? 52  LYS A HE2  2  
ATOM 8281   H HE3  . LYS A 1 52  ? -49.004 9.498   -6.294  1.00 2.77  ? 52  LYS A HE3  2  
ATOM 8282   H HZ1  . LYS A 1 52  ? -49.823 8.160   -8.000  1.00 2.97  ? 52  LYS A HZ1  2  
ATOM 8283   H HZ2  . LYS A 1 52  ? -51.207 8.883   -7.347  1.00 3.11  ? 52  LYS A HZ2  2  
ATOM 8284   H HZ3  . LYS A 1 52  ? -50.838 7.272   -6.971  1.00 2.99  ? 52  LYS A HZ3  2  
ATOM 8285   N N    . LYS A 1 53  ? -44.179 6.692   -8.345  1.00 2.24  ? 53  LYS A N    2  
ATOM 8286   C CA   . LYS A 1 53  ? -43.017 5.864   -8.063  1.00 2.04  ? 53  LYS A CA   2  
ATOM 8287   C C    . LYS A 1 53  ? -41.860 6.743   -7.616  1.00 1.89  ? 53  LYS A C    2  
ATOM 8288   O O    . LYS A 1 53  ? -41.524 7.722   -8.283  1.00 2.06  ? 53  LYS A O    2  
ATOM 8289   C CB   . LYS A 1 53  ? -42.618 5.055   -9.300  1.00 2.22  ? 53  LYS A CB   2  
ATOM 8290   C CG   . LYS A 1 53  ? -41.591 3.969   -9.011  1.00 2.09  ? 53  LYS A CG   2  
ATOM 8291   C CD   . LYS A 1 53  ? -41.147 3.264   -10.283 1.00 2.37  ? 53  LYS A CD   2  
ATOM 8292   C CE   . LYS A 1 53  ? -40.339 4.187   -11.180 1.00 2.53  ? 53  LYS A CE   2  
ATOM 8293   N NZ   . LYS A 1 53  ? -39.805 3.473   -12.369 1.00 2.84  ? 53  LYS A NZ   2  
ATOM 8294   H H    . LYS A 1 53  ? -44.042 7.618   -8.639  1.00 2.30  ? 53  LYS A H    2  
ATOM 8295   H HA   . LYS A 1 53  ? -43.276 5.187   -7.265  1.00 1.92  ? 53  LYS A HA   2  
ATOM 8296   H HB2  . LYS A 1 53  ? -43.503 4.587   -9.709  1.00 2.41  ? 53  LYS A HB2  2  
ATOM 8297   H HB3  . LYS A 1 53  ? -42.205 5.729   -10.036 1.00 2.33  ? 53  LYS A HB3  2  
ATOM 8298   H HG2  . LYS A 1 53  ? -40.731 4.418   -8.541  1.00 1.91  ? 53  LYS A HG2  2  
ATOM 8299   H HG3  . LYS A 1 53  ? -42.030 3.242   -8.342  1.00 2.07  ? 53  LYS A HG3  2  
ATOM 8300   H HD2  . LYS A 1 53  ? -40.538 2.412   -10.017 1.00 2.35  ? 53  LYS A HD2  2  
ATOM 8301   H HD3  . LYS A 1 53  ? -42.020 2.929   -10.821 1.00 2.62  ? 53  LYS A HD3  2  
ATOM 8302   H HE2  . LYS A 1 53  ? -40.977 4.992   -11.514 1.00 2.76  ? 53  LYS A HE2  2  
ATOM 8303   H HE3  . LYS A 1 53  ? -39.515 4.594   -10.611 1.00 2.40  ? 53  LYS A HE3  2  
ATOM 8304   H HZ1  . LYS A 1 53  ? -40.587 3.150   -12.975 1.00 3.15  ? 53  LYS A HZ1  2  
ATOM 8305   H HZ2  . LYS A 1 53  ? -39.248 2.649   -12.074 1.00 2.80  ? 53  LYS A HZ2  2  
ATOM 8306   H HZ3  . LYS A 1 53  ? -39.196 4.105   -12.924 1.00 3.12  ? 53  LYS A HZ3  2  
ATOM 8307   N N    . PHE A 1 54  ? -41.249 6.403   -6.493  1.00 1.63  ? 54  PHE A N    2  
ATOM 8308   C CA   . PHE A 1 54  ? -40.147 7.192   -5.975  1.00 1.53  ? 54  PHE A CA   2  
ATOM 8309   C C    . PHE A 1 54  ? -38.983 6.314   -5.540  1.00 1.26  ? 54  PHE A C    2  
ATOM 8310   O O    . PHE A 1 54  ? -39.166 5.333   -4.817  1.00 1.12  ? 54  PHE A O    2  
ATOM 8311   C CB   . PHE A 1 54  ? -40.616 8.050   -4.802  1.00 1.54  ? 54  PHE A CB   2  
ATOM 8312   C CG   . PHE A 1 54  ? -39.875 9.351   -4.682  1.00 1.60  ? 54  PHE A CG   2  
ATOM 8313   C CD1  . PHE A 1 54  ? -40.232 10.437  -5.465  1.00 1.94  ? 54  PHE A CD1  2  
ATOM 8314   C CD2  . PHE A 1 54  ? -38.823 9.488   -3.791  1.00 1.51  ? 54  PHE A CD2  2  
ATOM 8315   C CE1  . PHE A 1 54  ? -39.553 11.635  -5.361  1.00 2.15  ? 54  PHE A CE1  2  
ATOM 8316   C CE2  . PHE A 1 54  ? -38.141 10.684  -3.683  1.00 1.74  ? 54  PHE A CE2  2  
ATOM 8317   C CZ   . PHE A 1 54  ? -38.507 11.760  -4.469  1.00 2.03  ? 54  PHE A CZ   2  
ATOM 8318   H H    . PHE A 1 54  ? -41.537 5.599   -6.009  1.00 1.57  ? 54  PHE A H    2  
ATOM 8319   H HA   . PHE A 1 54  ? -39.815 7.844   -6.765  1.00 1.69  ? 54  PHE A HA   2  
ATOM 8320   H HB2  . PHE A 1 54  ? -41.666 8.275   -4.922  1.00 1.76  ? 54  PHE A HB2  2  
ATOM 8321   H HB3  . PHE A 1 54  ? -40.474 7.499   -3.883  1.00 1.43  ? 54  PHE A HB3  2  
ATOM 8322   H HD1  . PHE A 1 54  ? -41.052 10.341  -6.161  1.00 2.14  ? 54  PHE A HD1  2  
ATOM 8323   H HD2  . PHE A 1 54  ? -38.535 8.648   -3.178  1.00 1.41  ? 54  PHE A HD2  2  
ATOM 8324   H HE1  . PHE A 1 54  ? -39.840 12.473  -5.979  1.00 2.48  ? 54  PHE A HE1  2  
ATOM 8325   H HE2  . PHE A 1 54  ? -37.322 10.779  -2.984  1.00 1.80  ? 54  PHE A HE2  2  
ATOM 8326   H HZ   . PHE A 1 54  ? -37.976 12.695  -4.385  1.00 2.27  ? 54  PHE A HZ   2  
ATOM 8327   N N    . GLU A 1 55  ? -37.794 6.673   -5.996  1.00 1.28  ? 55  GLU A N    2  
ATOM 8328   C CA   . GLU A 1 55  ? -36.581 5.951   -5.653  1.00 1.09  ? 55  GLU A CA   2  
ATOM 8329   C C    . GLU A 1 55  ? -35.679 6.864   -4.829  1.00 1.09  ? 55  GLU A C    2  
ATOM 8330   O O    . GLU A 1 55  ? -35.142 7.844   -5.346  1.00 1.30  ? 55  GLU A O    2  
ATOM 8331   C CB   . GLU A 1 55  ? -35.865 5.484   -6.922  1.00 1.17  ? 55  GLU A CB   2  
ATOM 8332   C CG   . GLU A 1 55  ? -34.769 4.461   -6.669  1.00 1.29  ? 55  GLU A CG   2  
ATOM 8333   C CD   . GLU A 1 55  ? -34.873 3.262   -7.587  1.00 1.29  ? 55  GLU A CD   2  
ATOM 8334   O OE1  . GLU A 1 55  ? -34.372 3.335   -8.728  1.00 1.90  ? 55  GLU A OE1  2  
ATOM 8335   O OE2  . GLU A 1 55  ? -35.456 2.236   -7.172  1.00 1.43  ? 55  GLU A OE2  2  
ATOM 8336   H H    . GLU A 1 55  ? -37.727 7.454   -6.587  1.00 1.47  ? 55  GLU A H    2  
ATOM 8337   H HA   . GLU A 1 55  ? -36.856 5.092   -5.059  1.00 0.99  ? 55  GLU A HA   2  
ATOM 8338   H HB2  . GLU A 1 55  ? -36.593 5.042   -7.585  1.00 1.36  ? 55  GLU A HB2  2  
ATOM 8339   H HB3  . GLU A 1 55  ? -35.424 6.342   -7.407  1.00 1.53  ? 55  GLU A HB3  2  
ATOM 8340   H HG2  . GLU A 1 55  ? -33.811 4.934   -6.827  1.00 1.86  ? 55  GLU A HG2  2  
ATOM 8341   H HG3  . GLU A 1 55  ? -34.837 4.122   -5.645  1.00 1.69  ? 55  GLU A HG3  2  
ATOM 8342   N N    . THR A 1 56  ? -35.539 6.556   -3.546  1.00 0.96  ? 56  THR A N    2  
ATOM 8343   C CA   . THR A 1 56  ? -34.724 7.370   -2.654  1.00 1.09  ? 56  THR A CA   2  
ATOM 8344   C C    . THR A 1 56  ? -33.229 7.187   -2.910  1.00 1.14  ? 56  THR A C    2  
ATOM 8345   O O    . THR A 1 56  ? -32.811 6.288   -3.649  1.00 1.05  ? 56  THR A O    2  
ATOM 8346   C CB   . THR A 1 56  ? -35.023 7.062   -1.174  1.00 1.06  ? 56  THR A CB   2  
ATOM 8347   O OG1  . THR A 1 56  ? -35.031 5.646   -0.956  1.00 0.90  ? 56  THR A OG1  2  
ATOM 8348   C CG2  . THR A 1 56  ? -36.362 7.653   -0.759  1.00 1.12  ? 56  THR A CG2  2  
ATOM 8349   H H    . THR A 1 56  ? -35.987 5.761   -3.190  1.00 0.85  ? 56  THR A H    2  
ATOM 8350   H HA   . THR A 1 56  ? -34.980 8.405   -2.836  1.00 1.27  ? 56  THR A HA   2  
ATOM 8351   H HB   . THR A 1 56  ? -34.248 7.508   -0.568  1.00 1.22  ? 56  THR A HB   2  
ATOM 8352   H HG1  . THR A 1 56  ? -35.941 5.315   -1.038  1.00 0.80  ? 56  THR A HG1  2  
ATOM 8353   H HG21 . THR A 1 56  ? -36.503 7.512   0.302   1.00 1.16  ? 56  THR A HG21 2  
ATOM 8354   H HG22 . THR A 1 56  ? -37.156 7.159   -1.298  1.00 1.01  ? 56  THR A HG22 2  
ATOM 8355   H HG23 . THR A 1 56  ? -36.375 8.709   -0.987  1.00 1.29  ? 56  THR A HG23 2  
ATOM 8356   N N    . LYS A 1 57  ? -32.437 8.051   -2.289  1.00 1.35  ? 57  LYS A N    2  
ATOM 8357   C CA   . LYS A 1 57  ? -30.991 8.023   -2.422  1.00 1.46  ? 57  LYS A CA   2  
ATOM 8358   C C    . LYS A 1 57  ? -30.432 6.740   -1.829  1.00 1.33  ? 57  LYS A C    2  
ATOM 8359   O O    . LYS A 1 57  ? -30.837 6.319   -0.746  1.00 1.33  ? 57  LYS A O    2  
ATOM 8360   C CB   . LYS A 1 57  ? -30.390 9.240   -1.717  1.00 1.78  ? 57  LYS A CB   2  
ATOM 8361   C CG   . LYS A 1 57  ? -29.024 9.653   -2.243  1.00 1.90  ? 57  LYS A CG   2  
ATOM 8362   C CD   . LYS A 1 57  ? -27.899 9.117   -1.371  1.00 2.39  ? 57  LYS A CD   2  
ATOM 8363   C CE   . LYS A 1 57  ? -26.801 10.151  -1.176  1.00 2.56  ? 57  LYS A CE   2  
ATOM 8364   N NZ   . LYS A 1 57  ? -26.076 10.448  -2.441  1.00 2.59  ? 57  LYS A NZ   2  
ATOM 8365   H H    . LYS A 1 57  ? -32.844 8.736   -1.704  1.00 1.45  ? 57  LYS A H    2  
ATOM 8366   H HA   . LYS A 1 57  ? -30.745 8.064   -3.471  1.00 1.45  ? 57  LYS A HA   2  
ATOM 8367   H HB2  . LYS A 1 57  ? -31.062 10.074  -1.837  1.00 1.92  ? 57  LYS A HB2  2  
ATOM 8368   H HB3  . LYS A 1 57  ? -30.295 9.017   -0.663  1.00 1.86  ? 57  LYS A HB3  2  
ATOM 8369   H HG2  . LYS A 1 57  ? -28.905 9.264   -3.242  1.00 1.79  ? 57  LYS A HG2  2  
ATOM 8370   H HG3  . LYS A 1 57  ? -28.971 10.733  -2.267  1.00 2.15  ? 57  LYS A HG3  2  
ATOM 8371   H HD2  . LYS A 1 57  ? -28.300 8.846   -0.406  1.00 2.83  ? 57  LYS A HD2  2  
ATOM 8372   H HD3  . LYS A 1 57  ? -27.478 8.243   -1.846  1.00 2.56  ? 57  LYS A HD3  2  
ATOM 8373   H HE2  . LYS A 1 57  ? -27.246 11.064  -0.807  1.00 2.60  ? 57  LYS A HE2  2  
ATOM 8374   H HE3  . LYS A 1 57  ? -26.098 9.774   -0.448  1.00 3.04  ? 57  LYS A HE3  2  
ATOM 8375   H HZ1  . LYS A 1 57  ? -25.514 9.623   -2.735  1.00 2.92  ? 57  LYS A HZ1  2  
ATOM 8376   H HZ2  . LYS A 1 57  ? -25.433 11.254  -2.303  1.00 2.85  ? 57  LYS A HZ2  2  
ATOM 8377   H HZ3  . LYS A 1 57  ? -26.750 10.684  -3.197  1.00 2.68  ? 57  LYS A HZ3  2  
ATOM 8378   N N    . VAL A 1 58  ? -29.520 6.111   -2.551  1.00 1.27  ? 58  VAL A N    2  
ATOM 8379   C CA   . VAL A 1 58  ? -28.912 4.875   -2.091  1.00 1.21  ? 58  VAL A CA   2  
ATOM 8380   C C    . VAL A 1 58  ? -28.039 5.132   -0.859  1.00 1.49  ? 58  VAL A C    2  
ATOM 8381   O O    . VAL A 1 58  ? -26.940 5.684   -0.956  1.00 1.70  ? 58  VAL A O    2  
ATOM 8382   C CB   . VAL A 1 58  ? -28.090 4.185   -3.212  1.00 1.13  ? 58  VAL A CB   2  
ATOM 8383   C CG1  . VAL A 1 58  ? -27.159 5.172   -3.908  1.00 1.34  ? 58  VAL A CG1  2  
ATOM 8384   C CG2  . VAL A 1 58  ? -27.305 2.996   -2.666  1.00 1.17  ? 58  VAL A CG2  2  
ATOM 8385   H H    . VAL A 1 58  ? -29.255 6.483   -3.419  1.00 1.31  ? 58  VAL A H    2  
ATOM 8386   H HA   . VAL A 1 58  ? -29.715 4.210   -1.805  1.00 1.08  ? 58  VAL A HA   2  
ATOM 8387   H HB   . VAL A 1 58  ? -28.785 3.811   -3.950  1.00 0.97  ? 58  VAL A HB   2  
ATOM 8388   H HG11 . VAL A 1 58  ? -26.550 4.648   -4.628  1.00 1.32  ? 58  VAL A HG11 2  
ATOM 8389   H HG12 . VAL A 1 58  ? -26.525 5.644   -3.174  1.00 1.54  ? 58  VAL A HG12 2  
ATOM 8390   H HG13 . VAL A 1 58  ? -27.746 5.926   -4.413  1.00 1.42  ? 58  VAL A HG13 2  
ATOM 8391   H HG21 . VAL A 1 58  ? -27.978 2.321   -2.157  1.00 1.12  ? 58  VAL A HG21 2  
ATOM 8392   H HG22 . VAL A 1 58  ? -26.556 3.347   -1.971  1.00 1.39  ? 58  VAL A HG22 2  
ATOM 8393   H HG23 . VAL A 1 58  ? -26.822 2.476   -3.482  1.00 1.18  ? 58  VAL A HG23 2  
ATOM 8394   N N    . HIS A 1 59  ? -28.566 4.766   0.304   1.00 1.55  ? 59  HIS A N    2  
ATOM 8395   C CA   . HIS A 1 59  ? -27.849 4.941   1.561   1.00 1.84  ? 59  HIS A CA   2  
ATOM 8396   C C    . HIS A 1 59  ? -26.922 3.750   1.764   1.00 1.91  ? 59  HIS A C    2  
ATOM 8397   O O    . HIS A 1 59  ? -27.290 2.769   2.405   1.00 1.98  ? 59  HIS A O    2  
ATOM 8398   C CB   . HIS A 1 59  ? -28.819 5.064   2.752   1.00 1.93  ? 59  HIS A CB   2  
ATOM 8399   C CG   . HIS A 1 59  ? -30.081 5.826   2.456   1.00 1.80  ? 59  HIS A CG   2  
ATOM 8400   N ND1  . HIS A 1 59  ? -31.310 5.213   2.354   1.00 1.62  ? 59  HIS A ND1  2  
ATOM 8401   C CD2  . HIS A 1 59  ? -30.307 7.149   2.252   1.00 1.87  ? 59  HIS A CD2  2  
ATOM 8402   C CE1  . HIS A 1 59  ? -32.236 6.117   2.095   1.00 1.56  ? 59  HIS A CE1  2  
ATOM 8403   N NE2  . HIS A 1 59  ? -31.659 7.302   2.029   1.00 1.72  ? 59  HIS A NE2  2  
ATOM 8404   H H    . HIS A 1 59  ? -29.456 4.357   0.315   1.00 1.42  ? 59  HIS A H    2  
ATOM 8405   H HA   . HIS A 1 59  ? -27.257 5.839   1.487   1.00 1.98  ? 59  HIS A HA   2  
ATOM 8406   H HB2  . HIS A 1 59  ? -29.103 4.076   3.076   1.00 1.90  ? 59  HIS A HB2  2  
ATOM 8407   H HB3  . HIS A 1 59  ? -28.314 5.567   3.562   1.00 2.17  ? 59  HIS A HB3  2  
ATOM 8408   H HD1  . HIS A 1 59  ? -31.477 4.245   2.450   1.00 1.58  ? 59  HIS A HD1  2  
ATOM 8409   H HD2  . HIS A 1 59  ? -29.566 7.935   2.263   1.00 2.04  ? 59  HIS A HD2  2  
ATOM 8410   H HE1  . HIS A 1 59  ? -33.290 5.921   1.960   1.00 1.43  ? 59  HIS A HE1  2  
ATOM 8411   H HE2  . HIS A 1 59  ? -32.094 8.121   1.668   1.00 1.73  ? 59  HIS A HE2  2  
ATOM 8412   N N    . ARG A 1 60  ? -25.733 3.842   1.191   1.00 1.95  ? 60  ARG A N    2  
ATOM 8413   C CA   . ARG A 1 60  ? -24.758 2.760   1.264   1.00 2.02  ? 60  ARG A CA   2  
ATOM 8414   C C    . ARG A 1 60  ? -24.112 2.637   2.643   1.00 2.32  ? 60  ARG A C    2  
ATOM 8415   O O    . ARG A 1 60  ? -23.717 3.633   3.257   1.00 2.54  ? 60  ARG A O    2  
ATOM 8416   C CB   . ARG A 1 60  ? -23.683 2.919   0.174   1.00 2.04  ? 60  ARG A CB   2  
ATOM 8417   C CG   . ARG A 1 60  ? -23.210 4.348   -0.063  1.00 2.27  ? 60  ARG A CG   2  
ATOM 8418   C CD   . ARG A 1 60  ? -22.102 4.742   0.896   1.00 2.66  ? 60  ARG A CD   2  
ATOM 8419   N NE   . ARG A 1 60  ? -20.888 3.950   0.704   1.00 2.67  ? 60  ARG A NE   2  
ATOM 8420   C CZ   . ARG A 1 60  ? -19.990 3.716   1.663   1.00 3.07  ? 60  ARG A CZ   2  
ATOM 8421   N NH1  . ARG A 1 60  ? -20.178 4.194   2.888   1.00 3.37  ? 60  ARG A NH1  2  
ATOM 8422   N NH2  . ARG A 1 60  ? -18.904 3.004   1.391   1.00 3.45  ? 60  ARG A NH2  2  
ATOM 8423   H H    . ARG A 1 60  ? -25.506 4.657   0.702   1.00 1.95  ? 60  ARG A H    2  
ATOM 8424   H HA   . ARG A 1 60  ? -25.294 1.844   1.070   1.00 1.88  ? 60  ARG A HA   2  
ATOM 8425   H HB2  . ARG A 1 60  ? -22.822 2.327   0.452   1.00 2.19  ? 60  ARG A HB2  2  
ATOM 8426   H HB3  . ARG A 1 60  ? -24.079 2.539   -0.754  1.00 1.82  ? 60  ARG A HB3  2  
ATOM 8427   H HG2  . ARG A 1 60  ? -22.840 4.428   -1.074  1.00 2.22  ? 60  ARG A HG2  2  
ATOM 8428   H HG3  . ARG A 1 60  ? -24.043 5.019   0.069   1.00 2.34  ? 60  ARG A HG3  2  
ATOM 8429   H HD2  . ARG A 1 60  ? -21.867 5.783   0.742   1.00 3.09  ? 60  ARG A HD2  2  
ATOM 8430   H HD3  . ARG A 1 60  ? -22.455 4.600   1.907   1.00 2.92  ? 60  ARG A HD3  2  
ATOM 8431   H HE   . ARG A 1 60  ? -20.732 3.574   -0.192  1.00 2.63  ? 60  ARG A HE   2  
ATOM 8432   H HH11 . ARG A 1 60  ? -20.996 4.737   3.099   1.00 3.34  ? 60  ARG A HH11 2  
ATOM 8433   H HH12 . ARG A 1 60  ? -19.506 4.012   3.611   1.00 3.80  ? 60  ARG A HH12 2  
ATOM 8434   H HH21 . ARG A 1 60  ? -18.756 2.645   0.464   1.00 3.45  ? 60  ARG A HH21 2  
ATOM 8435   H HH22 . ARG A 1 60  ? -18.227 2.820   2.108   1.00 3.90  ? 60  ARG A HH22 2  
ATOM 8436   N N    . LYS A 1 61  ? -24.028 1.390   3.105   1.00 2.36  ? 61  LYS A N    2  
ATOM 8437   C CA   . LYS A 1 61  ? -23.415 1.031   4.382   1.00 2.66  ? 61  LYS A CA   2  
ATOM 8438   C C    . LYS A 1 61  ? -24.025 1.774   5.569   1.00 2.84  ? 61  LYS A C    2  
ATOM 8439   O O    . LYS A 1 61  ? -23.436 2.720   6.092   1.00 3.01  ? 61  LYS A O    2  
ATOM 8440   C CB   . LYS A 1 61  ? -21.901 1.269   4.325   1.00 2.83  ? 61  LYS A CB   2  
ATOM 8441   C CG   . LYS A 1 61  ? -21.214 0.531   3.185   1.00 2.65  ? 61  LYS A CG   2  
ATOM 8442   C CD   . LYS A 1 61  ? -21.133 -0.962  3.453   1.00 2.58  ? 61  LYS A CD   2  
ATOM 8443   C CE   . LYS A 1 61  ? -21.280 -1.769  2.174   1.00 2.36  ? 61  LYS A CE   2  
ATOM 8444   N NZ   . LYS A 1 61  ? -22.673 -2.248  1.977   1.00 2.24  ? 61  LYS A NZ   2  
ATOM 8445   H H    . LYS A 1 61  ? -24.406 0.664   2.549   1.00 2.20  ? 61  LYS A H    2  
ATOM 8446   H HA   . LYS A 1 61  ? -23.583 -0.025  4.528   1.00 2.67  ? 61  LYS A HA   2  
ATOM 8447   H HB2  . LYS A 1 61  ? -21.718 2.327   4.204   1.00 2.91  ? 61  LYS A HB2  2  
ATOM 8448   H HB3  . LYS A 1 61  ? -21.459 0.942   5.255   1.00 3.04  ? 61  LYS A HB3  2  
ATOM 8449   H HG2  . LYS A 1 61  ? -21.776 0.693   2.278   1.00 2.48  ? 61  LYS A HG2  2  
ATOM 8450   H HG3  . LYS A 1 61  ? -20.213 0.922   3.063   1.00 2.81  ? 61  LYS A HG3  2  
ATOM 8451   H HD2  . LYS A 1 61  ? -20.177 -1.185  3.903   1.00 2.79  ? 61  LYS A HD2  2  
ATOM 8452   H HD3  . LYS A 1 61  ? -21.925 -1.237  4.134   1.00 2.55  ? 61  LYS A HD3  2  
ATOM 8453   H HE2  . LYS A 1 61  ? -21.000 -1.149  1.337   1.00 2.27  ? 61  LYS A HE2  2  
ATOM 8454   H HE3  . LYS A 1 61  ? -20.620 -2.623  2.224   1.00 2.42  ? 61  LYS A HE3  2  
ATOM 8455   H HZ1  . LYS A 1 61  ? -22.673 -3.107  1.378   1.00 2.19  ? 61  LYS A HZ1  2  
ATOM 8456   H HZ2  . LYS A 1 61  ? -23.254 -1.512  1.512   1.00 2.22  ? 61  LYS A HZ2  2  
ATOM 8457   H HZ3  . LYS A 1 61  ? -23.106 -2.483  2.894   1.00 2.36  ? 61  LYS A HZ3  2  
ATOM 8458   N N    . THR A 1 62  ? -25.206 1.345   5.994   1.00 2.81  ? 62  THR A N    2  
ATOM 8459   C CA   . THR A 1 62  ? -25.864 1.958   7.136   1.00 2.98  ? 62  THR A CA   2  
ATOM 8460   C C    . THR A 1 62  ? -27.077 1.146   7.571   1.00 2.97  ? 62  THR A C    2  
ATOM 8461   O O    . THR A 1 62  ? -27.763 0.539   6.751   1.00 2.79  ? 62  THR A O    2  
ATOM 8462   C CB   . THR A 1 62  ? -26.298 3.415   6.846   1.00 2.91  ? 62  THR A CB   2  
ATOM 8463   O OG1  . THR A 1 62  ? -26.857 4.006   8.028   1.00 3.19  ? 62  THR A OG1  2  
ATOM 8464   C CG2  . THR A 1 62  ? -27.316 3.482   5.715   1.00 2.72  ? 62  THR A CG2  2  
ATOM 8465   H H    . THR A 1 62  ? -25.656 0.609   5.519   1.00 2.68  ? 62  THR A H    2  
ATOM 8466   H HA   . THR A 1 62  ? -25.153 1.975   7.950   1.00 3.21  ? 62  THR A HA   2  
ATOM 8467   H HB   . THR A 1 62  ? -25.424 3.980   6.554   1.00 2.89  ? 62  THR A HB   2  
ATOM 8468   H HG1  . THR A 1 62  ? -26.152 4.403   8.552   1.00 3.30  ? 62  THR A HG1  2  
ATOM 8469   H HG21 . THR A 1 62  ? -27.571 4.515   5.522   1.00 2.69  ? 62  THR A HG21 2  
ATOM 8470   H HG22 . THR A 1 62  ? -28.206 2.940   5.997   1.00 2.83  ? 62  THR A HG22 2  
ATOM 8471   H HG23 . THR A 1 62  ? -26.895 3.042   4.824   1.00 2.60  ? 62  THR A HG23 2  
ATOM 8472   N N    . LEU A 1 63  ? -27.309 1.113   8.875   1.00 3.20  ? 63  LEU A N    2  
ATOM 8473   C CA   . LEU A 1 63  ? -28.446 0.400   9.441   1.00 3.24  ? 63  LEU A CA   2  
ATOM 8474   C C    . LEU A 1 63  ? -29.339 1.399   10.158  1.00 3.27  ? 63  LEU A C    2  
ATOM 8475   O O    . LEU A 1 63  ? -30.261 1.032   10.888  1.00 3.33  ? 63  LEU A O    2  
ATOM 8476   C CB   . LEU A 1 63  ? -27.977 -0.687  10.415  1.00 3.54  ? 63  LEU A CB   2  
ATOM 8477   C CG   . LEU A 1 63  ? -26.966 -1.688  9.846   1.00 3.55  ? 63  LEU A CG   2  
ATOM 8478   C CD1  . LEU A 1 63  ? -26.472 -2.625  10.937  1.00 3.88  ? 63  LEU A CD1  2  
ATOM 8479   C CD2  . LEU A 1 63  ? -27.584 -2.480  8.703   1.00 3.37  ? 63  LEU A CD2  2  
ATOM 8480   H H    . LEU A 1 63  ? -26.699 1.589   9.478   1.00 3.35  ? 63  LEU A H    2  
ATOM 8481   H HA   . LEU A 1 63  ? -29.000 -0.052  8.631   1.00 3.07  ? 63  LEU A HA   2  
ATOM 8482   H HB2  . LEU A 1 63  ? -27.530 -0.201  11.271  1.00 3.72  ? 63  LEU A HB2  2  
ATOM 8483   H HB3  . LEU A 1 63  ? -28.844 -1.237  10.749  1.00 3.59  ? 63  LEU A HB3  2  
ATOM 8484   H HG   . LEU A 1 63  ? -26.114 -1.148  9.458   1.00 3.49  ? 63  LEU A HG   2  
ATOM 8485   H HD11 . LEU A 1 63  ? -27.312 -3.157  11.362  1.00 3.99  ? 63  LEU A HD11 2  
ATOM 8486   H HD12 . LEU A 1 63  ? -25.981 -2.054  11.709  1.00 4.06  ? 63  LEU A HD12 2  
ATOM 8487   H HD13 . LEU A 1 63  ? -25.775 -3.333  10.514  1.00 3.88  ? 63  LEU A HD13 2  
ATOM 8488   H HD21 . LEU A 1 63  ? -27.859 -1.807  7.904   1.00 3.25  ? 63  LEU A HD21 2  
ATOM 8489   H HD22 . LEU A 1 63  ? -28.465 -2.995  9.058   1.00 3.47  ? 63  LEU A HD22 2  
ATOM 8490   H HD23 . LEU A 1 63  ? -26.867 -3.200  8.336   1.00 3.45  ? 63  LEU A HD23 2  
ATOM 8491   N N    . ASN A 1 64  ? -29.042 2.671   9.936   1.00 3.24  ? 64  ASN A N    2  
ATOM 8492   C CA   . ASN A 1 64  ? -29.778 3.773   10.541  1.00 3.27  ? 64  ASN A CA   2  
ATOM 8493   C C    . ASN A 1 64  ? -29.637 5.008   9.654   1.00 3.09  ? 64  ASN A C    2  
ATOM 8494   O O    . ASN A 1 64  ? -28.900 5.937   9.981   1.00 3.26  ? 64  ASN A O    2  
ATOM 8495   C CB   . ASN A 1 64  ? -29.231 4.062   11.946  1.00 3.63  ? 64  ASN A CB   2  
ATOM 8496   C CG   . ASN A 1 64  ? -30.129 4.973   12.763  1.00 3.76  ? 64  ASN A CG   2  
ATOM 8497   O OD1  . ASN A 1 64  ? -31.040 4.513   13.453  1.00 3.91  ? 64  ASN A OD1  2  
ATOM 8498   N ND2  . ASN A 1 64  ? -29.863 6.270   12.709  1.00 3.83  ? 64  ASN A ND2  2  
ATOM 8499   H H    . ASN A 1 64  ? -28.303 2.883   9.322   1.00 3.21  ? 64  ASN A H    2  
ATOM 8500   H HA   . ASN A 1 64  ? -30.819 3.494   10.604  1.00 3.19  ? 64  ASN A HA   2  
ATOM 8501   H HB2  . ASN A 1 64  ? -29.122 3.131   12.479  1.00 3.78  ? 64  ASN A HB2  2  
ATOM 8502   H HB3  . ASN A 1 64  ? -28.262 4.531   11.855  1.00 3.73  ? 64  ASN A HB3  2  
ATOM 8503   H HD21 . ASN A 1 64  ? -29.111 6.566   12.148  1.00 3.80  ? 64  ASN A HD21 2  
ATOM 8504   H HD22 . ASN A 1 64  ? -30.420 6.879   13.235  1.00 3.97  ? 64  ASN A HD22 2  
ATOM 8505   N N    . PRO A 1 65  ? -30.325 5.025   8.504   1.00 2.78  ? 65  PRO A N    2  
ATOM 8506   C CA   . PRO A 1 65  ? -30.241 6.132   7.558   1.00 2.62  ? 65  PRO A CA   2  
ATOM 8507   C C    . PRO A 1 65  ? -31.089 7.341   7.949   1.00 2.70  ? 65  PRO A C    2  
ATOM 8508   O O    . PRO A 1 65  ? -32.303 7.237   8.129   1.00 2.67  ? 65  PRO A O    2  
ATOM 8509   C CB   . PRO A 1 65  ? -30.753 5.513   6.258   1.00 2.29  ? 65  PRO A CB   2  
ATOM 8510   C CG   . PRO A 1 65  ? -31.696 4.436   6.682   1.00 2.33  ? 65  PRO A CG   2  
ATOM 8511   C CD   . PRO A 1 65  ? -31.247 3.969   8.045   1.00 2.61  ? 65  PRO A CD   2  
ATOM 8512   H HA   . PRO A 1 65  ? -29.217 6.449   7.420   1.00 2.69  ? 65  PRO A HA   2  
ATOM 8513   H HB2  . PRO A 1 65  ? -31.258 6.269   5.674   1.00 2.19  ? 65  PRO A HB2  2  
ATOM 8514   H HB3  . PRO A 1 65  ? -29.923 5.111   5.697   1.00 2.27  ? 65  PRO A HB3  2  
ATOM 8515   H HG2  . PRO A 1 65  ? -32.699 4.832   6.738   1.00 2.31  ? 65  PRO A HG2  2  
ATOM 8516   H HG3  . PRO A 1 65  ? -31.659 3.619   5.978   1.00 2.35  ? 65  PRO A HG3  2  
ATOM 8517   H HD2  . PRO A 1 65  ? -32.095 3.887   8.709   1.00 2.71  ? 65  PRO A HD2  2  
ATOM 8518   H HD3  . PRO A 1 65  ? -30.738 3.019   7.969   1.00 2.67  ? 65  PRO A HD3  2  
ATOM 8519   N N    . VAL A 1 66  ? -30.428 8.487   8.070   1.00 2.85  ? 66  VAL A N    2  
ATOM 8520   C CA   . VAL A 1 66  ? -31.085 9.741   8.416   1.00 2.97  ? 66  VAL A CA   2  
ATOM 8521   C C    . VAL A 1 66  ? -30.960 10.725  7.253   1.00 2.91  ? 66  VAL A C    2  
ATOM 8522   O O    . VAL A 1 66  ? -29.931 11.387  7.088   1.00 3.09  ? 66  VAL A O    2  
ATOM 8523   C CB   . VAL A 1 66  ? -30.487 10.372  9.699   1.00 3.30  ? 66  VAL A CB   2  
ATOM 8524   C CG1  . VAL A 1 66  ? -31.131 9.774   10.937  1.00 3.41  ? 66  VAL A CG1  2  
ATOM 8525   C CG2  . VAL A 1 66  ? -28.976 10.187  9.754   1.00 3.53  ? 66  VAL A CG2  2  
ATOM 8526   H H    . VAL A 1 66  ? -29.459 8.492   7.914   1.00 2.91  ? 66  VAL A H    2  
ATOM 8527   H HA   . VAL A 1 66  ? -32.133 9.534   8.590   1.00 2.89  ? 66  VAL A HA   2  
ATOM 8528   H HB   . VAL A 1 66  ? -30.699 11.432  9.686   1.00 3.39  ? 66  VAL A HB   2  
ATOM 8529   H HG11 . VAL A 1 66  ? -30.633 10.150  11.819  1.00 3.66  ? 66  VAL A HG11 2  
ATOM 8530   H HG12 . VAL A 1 66  ? -31.044 8.699   10.905  1.00 3.57  ? 66  VAL A HG12 2  
ATOM 8531   H HG13 . VAL A 1 66  ? -32.175 10.051  10.970  1.00 3.52  ? 66  VAL A HG13 2  
ATOM 8532   H HG21 . VAL A 1 66  ? -28.517 10.745  8.952   1.00 3.59  ? 66  VAL A HG21 2  
ATOM 8533   H HG22 . VAL A 1 66  ? -28.739 9.140   9.648   1.00 3.51  ? 66  VAL A HG22 2  
ATOM 8534   H HG23 . VAL A 1 66  ? -28.604 10.546  10.703  1.00 3.79  ? 66  VAL A HG23 2  
ATOM 8535   N N    . PHE A 1 67  ? -32.000 10.798  6.433   1.00 2.73  ? 67  PHE A N    2  
ATOM 8536   C CA   . PHE A 1 67  ? -31.992 11.680  5.269   1.00 2.70  ? 67  PHE A CA   2  
ATOM 8537   C C    . PHE A 1 67  ? -33.240 12.555  5.210   1.00 2.67  ? 67  PHE A C    2  
ATOM 8538   O O    . PHE A 1 67  ? -33.158 13.730  4.848   1.00 2.82  ? 67  PHE A O    2  
ATOM 8539   C CB   . PHE A 1 67  ? -31.886 10.851  3.988   1.00 2.46  ? 67  PHE A CB   2  
ATOM 8540   C CG   . PHE A 1 67  ? -30.551 10.954  3.302   1.00 2.62  ? 67  PHE A CG   2  
ATOM 8541   C CD1  . PHE A 1 67  ? -29.423 10.371  3.856   1.00 2.84  ? 67  PHE A CD1  2  
ATOM 8542   C CD2  . PHE A 1 67  ? -30.427 11.632  2.099   1.00 2.66  ? 67  PHE A CD2  2  
ATOM 8543   C CE1  . PHE A 1 67  ? -28.197 10.463  3.223   1.00 3.06  ? 67  PHE A CE1  2  
ATOM 8544   C CE2  . PHE A 1 67  ? -29.204 11.727  1.463   1.00 2.89  ? 67  PHE A CE2  2  
ATOM 8545   C CZ   . PHE A 1 67  ? -28.087 11.143  2.025   1.00 3.07  ? 67  PHE A CZ   2  
ATOM 8546   H H    . PHE A 1 67  ? -32.789 10.248  6.616   1.00 2.68  ? 67  PHE A H    2  
ATOM 8547   H HA   . PHE A 1 67  ? -31.124 12.318  5.343   1.00 2.90  ? 67  PHE A HA   2  
ATOM 8548   H HB2  . PHE A 1 67  ? -32.056 9.813   4.229   1.00 2.45  ? 67  PHE A HB2  2  
ATOM 8549   H HB3  . PHE A 1 67  ? -32.644 11.181  3.296   1.00 2.26  ? 67  PHE A HB3  2  
ATOM 8550   H HD1  . PHE A 1 67  ? -29.507 9.840   4.794   1.00 2.92  ? 67  PHE A HD1  2  
ATOM 8551   H HD2  . PHE A 1 67  ? -31.298 12.089  1.657   1.00 2.60  ? 67  PHE A HD2  2  
ATOM 8552   H HE1  . PHE A 1 67  ? -27.325 10.007  3.666   1.00 3.28  ? 67  PHE A HE1  2  
ATOM 8553   H HE2  . PHE A 1 67  ? -29.121 12.257  0.525   1.00 3.01  ? 67  PHE A HE2  2  
ATOM 8554   H HZ   . PHE A 1 67  ? -27.129 11.214  1.528   1.00 3.29  ? 67  PHE A HZ   2  
ATOM 8555   N N    . ASN A 1 68  ? -34.387 11.974  5.563   1.00 2.50  ? 68  ASN A N    2  
ATOM 8556   C CA   . ASN A 1 68  ? -35.669 12.683  5.540   1.00 2.46  ? 68  ASN A CA   2  
ATOM 8557   C C    . ASN A 1 68  ? -36.011 13.131  4.118   1.00 2.33  ? 68  ASN A C    2  
ATOM 8558   O O    . ASN A 1 68  ? -36.138 14.323  3.835   1.00 2.52  ? 68  ASN A O    2  
ATOM 8559   C CB   . ASN A 1 68  ? -35.654 13.884  6.496   1.00 2.75  ? 68  ASN A CB   2  
ATOM 8560   C CG   . ASN A 1 68  ? -37.047 14.325  6.916   1.00 2.74  ? 68  ASN A CG   2  
ATOM 8561   O OD1  . ASN A 1 68  ? -37.574 13.868  7.929   1.00 2.83  ? 68  ASN A OD1  2  
ATOM 8562   N ND2  . ASN A 1 68  ? -37.649 15.222  6.147   1.00 2.76  ? 68  ASN A ND2  2  
ATOM 8563   H H    . ASN A 1 68  ? -34.375 11.041  5.857   1.00 2.42  ? 68  ASN A H    2  
ATOM 8564   H HA   . ASN A 1 68  ? -36.428 11.989  5.870   1.00 2.33  ? 68  ASN A HA   2  
ATOM 8565   H HB2  . ASN A 1 68  ? -35.099 13.620  7.384   1.00 2.87  ? 68  ASN A HB2  2  
ATOM 8566   H HB3  . ASN A 1 68  ? -35.166 14.713  6.007   1.00 2.87  ? 68  ASN A HB3  2  
ATOM 8567   H HD21 . ASN A 1 68  ? -37.172 15.546  5.354   1.00 2.82  ? 68  ASN A HD21 2  
ATOM 8568   H HD22 . ASN A 1 68  ? -38.545 15.532  6.409   1.00 2.77  ? 68  ASN A HD22 2  
ATOM 8569   N N    . GLU A 1 69  ? -36.150 12.159  3.225   1.00 2.06  ? 69  GLU A N    2  
ATOM 8570   C CA   . GLU A 1 69  ? -36.474 12.431  1.832   1.00 1.97  ? 69  GLU A CA   2  
ATOM 8571   C C    . GLU A 1 69  ? -37.990 12.512  1.658   1.00 1.91  ? 69  GLU A C    2  
ATOM 8572   O O    . GLU A 1 69  ? -38.720 11.617  2.078   1.00 1.87  ? 69  GLU A O    2  
ATOM 8573   C CB   . GLU A 1 69  ? -35.863 11.347  0.935   1.00 1.75  ? 69  GLU A CB   2  
ATOM 8574   C CG   . GLU A 1 69  ? -34.338 11.354  0.948   1.00 1.89  ? 69  GLU A CG   2  
ATOM 8575   C CD   . GLU A 1 69  ? -33.724 10.096  0.360   1.00 1.79  ? 69  GLU A CD   2  
ATOM 8576   O OE1  . GLU A 1 69  ? -33.703 9.967   -0.882  1.00 1.91  ? 69  GLU A OE1  2  
ATOM 8577   O OE2  . GLU A 1 69  ? -33.248 9.235   1.138   1.00 1.98  ? 69  GLU A OE2  2  
ATOM 8578   H H    . GLU A 1 69  ? -36.044 11.231  3.514   1.00 1.95  ? 69  GLU A H    2  
ATOM 8579   H HA   . GLU A 1 69  ? -36.043 13.388  1.572   1.00 2.17  ? 69  GLU A HA   2  
ATOM 8580   H HB2  . GLU A 1 69  ? -36.203 10.379  1.275   1.00 1.60  ? 69  GLU A HB2  2  
ATOM 8581   H HB3  . GLU A 1 69  ? -36.197 11.500  -0.081  1.00 1.72  ? 69  GLU A HB3  2  
ATOM 8582   H HG2  . GLU A 1 69  ? -33.991 12.203  0.378   1.00 2.14  ? 69  GLU A HG2  2  
ATOM 8583   H HG3  . GLU A 1 69  ? -34.005 11.454  1.969   1.00 2.19  ? 69  GLU A HG3  2  
ATOM 8584   N N    . GLN A 1 70  ? -38.455 13.597  1.057   1.00 1.99  ? 70  GLN A N    2  
ATOM 8585   C CA   . GLN A 1 70  ? -39.883 13.814  0.854   1.00 2.00  ? 70  GLN A CA   2  
ATOM 8586   C C    . GLN A 1 70  ? -40.423 13.045  -0.350  1.00 1.85  ? 70  GLN A C    2  
ATOM 8587   O O    . GLN A 1 70  ? -39.843 13.076  -1.438  1.00 1.92  ? 70  GLN A O    2  
ATOM 8588   C CB   . GLN A 1 70  ? -40.161 15.311  0.672   1.00 2.32  ? 70  GLN A CB   2  
ATOM 8589   C CG   . GLN A 1 70  ? -41.524 15.616  0.064   1.00 2.40  ? 70  GLN A CG   2  
ATOM 8590   C CD   . GLN A 1 70  ? -41.424 16.338  -1.271  1.00 2.60  ? 70  GLN A CD   2  
ATOM 8591   O OE1  . GLN A 1 70  ? -41.461 17.565  -1.329  1.00 2.89  ? 70  GLN A OE1  2  
ATOM 8592   N NE2  . GLN A 1 70  ? -41.285 15.581  -2.349  1.00 2.75  ? 70  GLN A NE2  2  
ATOM 8593   H H    . GLN A 1 70  ? -37.820 14.274  0.737   1.00 2.11  ? 70  GLN A H    2  
ATOM 8594   H HA   . GLN A 1 70  ? -40.398 13.474  1.741   1.00 1.93  ? 70  GLN A HA   2  
ATOM 8595   H HB2  . GLN A 1 70  ? -40.102 15.795  1.636   1.00 2.56  ? 70  GLN A HB2  2  
ATOM 8596   H HB3  . GLN A 1 70  ? -39.404 15.727  0.025   1.00 2.47  ? 70  GLN A HB3  2  
ATOM 8597   H HG2  . GLN A 1 70  ? -42.051 14.685  -0.088  1.00 2.36  ? 70  GLN A HG2  2  
ATOM 8598   H HG3  . GLN A 1 70  ? -42.082 16.234  0.750   1.00 2.62  ? 70  GLN A HG3  2  
ATOM 8599   H HE21 . GLN A 1 70  ? -41.251 14.608  -2.231  1.00 2.73  ? 70  GLN A HE21 2  
ATOM 8600   H HE22 . GLN A 1 70  ? -41.220 16.025  -3.223  1.00 3.03  ? 70  GLN A HE22 2  
ATOM 8601   N N    . PHE A 1 71  ? -41.547 12.371  -0.143  1.00 1.71  ? 71  PHE A N    2  
ATOM 8602   C CA   . PHE A 1 71  ? -42.207 11.626  -1.202  1.00 1.65  ? 71  PHE A CA   2  
ATOM 8603   C C    . PHE A 1 71  ? -43.526 12.312  -1.550  1.00 1.81  ? 71  PHE A C    2  
ATOM 8604   O O    . PHE A 1 71  ? -44.362 12.558  -0.675  1.00 1.79  ? 71  PHE A O    2  
ATOM 8605   C CB   . PHE A 1 71  ? -42.448 10.169  -0.781  1.00 1.40  ? 71  PHE A CB   2  
ATOM 8606   C CG   . PHE A 1 71  ? -43.488 9.460   -1.609  1.00 1.44  ? 71  PHE A CG   2  
ATOM 8607   C CD1  . PHE A 1 71  ? -43.335 9.330   -2.983  1.00 1.57  ? 71  PHE A CD1  2  
ATOM 8608   C CD2  . PHE A 1 71  ? -44.623 8.930   -1.015  1.00 1.43  ? 71  PHE A CD2  2  
ATOM 8609   C CE1  . PHE A 1 71  ? -44.293 8.687   -3.744  1.00 1.70  ? 71  PHE A CE1  2  
ATOM 8610   C CE2  . PHE A 1 71  ? -45.582 8.286   -1.771  1.00 1.57  ? 71  PHE A CE2  2  
ATOM 8611   C CZ   . PHE A 1 71  ? -45.419 8.164   -3.137  1.00 1.70  ? 71  PHE A CZ   2  
ATOM 8612   H H    . PHE A 1 71  ? -41.946 12.374  0.756   1.00 1.69  ? 71  PHE A H    2  
ATOM 8613   H HA   . PHE A 1 71  ? -41.566 11.645  -2.074  1.00 1.72  ? 71  PHE A HA   2  
ATOM 8614   H HB2  . PHE A 1 71  ? -41.523 9.619   -0.870  1.00 1.30  ? 71  PHE A HB2  2  
ATOM 8615   H HB3  . PHE A 1 71  ? -42.770 10.150  0.250   1.00 1.35  ? 71  PHE A HB3  2  
ATOM 8616   H HD1  . PHE A 1 71  ? -42.456 9.737   -3.457  1.00 1.62  ? 71  PHE A HD1  2  
ATOM 8617   H HD2  . PHE A 1 71  ? -44.754 9.025   0.053   1.00 1.38  ? 71  PHE A HD2  2  
ATOM 8618   H HE1  . PHE A 1 71  ? -44.161 8.594   -4.812  1.00 1.85  ? 71  PHE A HE1  2  
ATOM 8619   H HE2  . PHE A 1 71  ? -46.460 7.877   -1.294  1.00 1.61  ? 71  PHE A HE2  2  
ATOM 8620   H HZ   . PHE A 1 71  ? -46.168 7.661   -3.728  1.00 1.86  ? 71  PHE A HZ   2  
ATOM 8621   N N    . THR A 1 72  ? -43.692 12.637  -2.820  1.00 2.00  ? 72  THR A N    2  
ATOM 8622   C CA   . THR A 1 72  ? -44.888 13.304  -3.296  1.00 2.20  ? 72  THR A CA   2  
ATOM 8623   C C    . THR A 1 72  ? -45.999 12.304  -3.621  1.00 2.16  ? 72  THR A C    2  
ATOM 8624   O O    . THR A 1 72  ? -46.057 11.752  -4.722  1.00 2.23  ? 72  THR A O    2  
ATOM 8625   C CB   . THR A 1 72  ? -44.561 14.141  -4.544  1.00 2.48  ? 72  THR A CB   2  
ATOM 8626   O OG1  . THR A 1 72  ? -43.239 13.813  -5.010  1.00 2.60  ? 72  THR A OG1  2  
ATOM 8627   C CG2  . THR A 1 72  ? -44.634 15.627  -4.235  1.00 2.78  ? 72  THR A CG2  2  
ATOM 8628   H H    . THR A 1 72  ? -42.983 12.428  -3.464  1.00 2.03  ? 72  THR A H    2  
ATOM 8629   H HA   . THR A 1 72  ? -45.230 13.974  -2.520  1.00 2.21  ? 72  THR A HA   2  
ATOM 8630   H HB   . THR A 1 72  ? -45.278 13.909  -5.316  1.00 2.55  ? 72  THR A HB   2  
ATOM 8631   H HG1  . THR A 1 72  ? -42.836 14.594  -5.405  1.00 2.78  ? 72  THR A HG1  2  
ATOM 8632   H HG21 . THR A 1 72  ? -43.873 15.882  -3.512  1.00 2.88  ? 72  THR A HG21 2  
ATOM 8633   H HG22 . THR A 1 72  ? -45.608 15.862  -3.831  1.00 2.90  ? 72  THR A HG22 2  
ATOM 8634   H HG23 . THR A 1 72  ? -44.473 16.194  -5.141  1.00 3.00  ? 72  THR A HG23 2  
ATOM 8635   N N    . PHE A 1 73  ? -46.870 12.057  -2.649  1.00 2.08  ? 73  PHE A N    2  
ATOM 8636   C CA   . PHE A 1 73  ? -47.988 11.141  -2.836  1.00 2.10  ? 73  PHE A CA   2  
ATOM 8637   C C    . PHE A 1 73  ? -49.110 11.865  -3.570  1.00 2.37  ? 73  PHE A C    2  
ATOM 8638   O O    . PHE A 1 73  ? -50.094 12.292  -2.968  1.00 2.43  ? 73  PHE A O    2  
ATOM 8639   C CB   . PHE A 1 73  ? -48.471 10.617  -1.478  1.00 1.95  ? 73  PHE A CB   2  
ATOM 8640   C CG   . PHE A 1 73  ? -49.557 9.572   -1.555  1.00 1.97  ? 73  PHE A CG   2  
ATOM 8641   C CD1  . PHE A 1 73  ? -49.262 8.272   -1.930  1.00 1.90  ? 73  PHE A CD1  2  
ATOM 8642   C CD2  . PHE A 1 73  ? -50.869 9.892   -1.242  1.00 2.16  ? 73  PHE A CD2  2  
ATOM 8643   C CE1  . PHE A 1 73  ? -50.256 7.314   -1.995  1.00 2.04  ? 73  PHE A CE1  2  
ATOM 8644   C CE2  . PHE A 1 73  ? -51.865 8.937   -1.306  1.00 2.24  ? 73  PHE A CE2  2  
ATOM 8645   C CZ   . PHE A 1 73  ? -51.557 7.646   -1.682  1.00 2.18  ? 73  PHE A CZ   2  
ATOM 8646   H H    . PHE A 1 73  ? -46.762 12.510  -1.782  1.00 2.05  ? 73  PHE A H    2  
ATOM 8647   H HA   . PHE A 1 73  ? -47.648 10.313  -3.441  1.00 2.06  ? 73  PHE A HA   2  
ATOM 8648   H HB2  . PHE A 1 73  ? -47.634 10.181  -0.955  1.00 1.77  ? 73  PHE A HB2  2  
ATOM 8649   H HB3  . PHE A 1 73  ? -48.851 11.448  -0.900  1.00 2.06  ? 73  PHE A HB3  2  
ATOM 8650   H HD1  . PHE A 1 73  ? -48.246 8.008   -2.177  1.00 1.83  ? 73  PHE A HD1  2  
ATOM 8651   H HD2  . PHE A 1 73  ? -51.112 10.901  -0.949  1.00 2.30  ? 73  PHE A HD2  2  
ATOM 8652   H HE1  . PHE A 1 73  ? -50.013 6.305   -2.289  1.00 2.10  ? 73  PHE A HE1  2  
ATOM 8653   H HE2  . PHE A 1 73  ? -52.883 9.200   -1.061  1.00 2.42  ? 73  PHE A HE2  2  
ATOM 8654   H HZ   . PHE A 1 73  ? -52.334 6.898   -1.733  1.00 2.32  ? 73  PHE A HZ   2  
ATOM 8655   N N    . LYS A 1 74  ? -48.935 12.022  -4.876  1.00 2.55  ? 74  LYS A N    2  
ATOM 8656   C CA   . LYS A 1 74  ? -49.906 12.717  -5.708  1.00 2.85  ? 74  LYS A CA   2  
ATOM 8657   C C    . LYS A 1 74  ? -51.193 11.916  -5.875  1.00 2.92  ? 74  LYS A C    2  
ATOM 8658   O O    . LYS A 1 74  ? -51.323 11.106  -6.796  1.00 3.03  ? 74  LYS A O    2  
ATOM 8659   C CB   . LYS A 1 74  ? -49.301 13.040  -7.073  1.00 3.05  ? 74  LYS A CB   2  
ATOM 8660   C CG   . LYS A 1 74  ? -48.105 13.976  -6.997  1.00 3.14  ? 74  LYS A CG   2  
ATOM 8661   C CD   . LYS A 1 74  ? -47.868 14.689  -8.316  1.00 3.38  ? 74  LYS A CD   2  
ATOM 8662   C CE   . LYS A 1 74  ? -47.359 13.738  -9.386  1.00 3.72  ? 74  LYS A CE   2  
ATOM 8663   N NZ   . LYS A 1 74  ? -47.440 14.338  -10.742 1.00 3.87  ? 74  LYS A NZ   2  
ATOM 8664   H H    . LYS A 1 74  ? -48.116 11.670  -5.288  1.00 2.50  ? 74  LYS A H    2  
ATOM 8665   H HA   . LYS A 1 74  ? -50.146 13.645  -5.211  1.00 2.90  ? 74  LYS A HA   2  
ATOM 8666   H HB2  . LYS A 1 74  ? -48.983 12.121  -7.543  1.00 3.00  ? 74  LYS A HB2  2  
ATOM 8667   H HB3  . LYS A 1 74  ? -50.058 13.508  -7.688  1.00 3.26  ? 74  LYS A HB3  2  
ATOM 8668   H HG2  . LYS A 1 74  ? -48.283 14.711  -6.227  1.00 3.06  ? 74  LYS A HG2  2  
ATOM 8669   H HG3  . LYS A 1 74  ? -47.225 13.397  -6.748  1.00 3.28  ? 74  LYS A HG3  2  
ATOM 8670   H HD2  . LYS A 1 74  ? -48.799 15.123  -8.650  1.00 3.37  ? 74  LYS A HD2  2  
ATOM 8671   H HD3  . LYS A 1 74  ? -47.139 15.473  -8.166  1.00 3.47  ? 74  LYS A HD3  2  
ATOM 8672   H HE2  . LYS A 1 74  ? -46.329 13.492  -9.170  1.00 3.74  ? 74  LYS A HE2  2  
ATOM 8673   H HE3  . LYS A 1 74  ? -47.955 12.838  -9.363  1.00 4.00  ? 74  LYS A HE3  2  
ATOM 8674   H HZ1  . LYS A 1 74  ? -46.946 15.253  -10.759 1.00 3.99  ? 74  LYS A HZ1  2  
ATOM 8675   H HZ2  . LYS A 1 74  ? -48.432 14.485  -11.011 1.00 3.97  ? 74  LYS A HZ2  2  
ATOM 8676   H HZ3  . LYS A 1 74  ? -46.994 13.705  -11.438 1.00 4.11  ? 74  LYS A HZ3  2  
ATOM 8677   N N    . VAL A 1 75  ? -52.123 12.140  -4.959  1.00 2.90  ? 75  VAL A N    2  
ATOM 8678   C CA   . VAL A 1 75  ? -53.423 11.488  -4.969  1.00 2.99  ? 75  VAL A CA   2  
ATOM 8679   C C    . VAL A 1 75  ? -54.440 12.404  -4.301  1.00 3.01  ? 75  VAL A C    2  
ATOM 8680   O O    . VAL A 1 75  ? -54.243 12.818  -3.158  1.00 2.84  ? 75  VAL A O    2  
ATOM 8681   C CB   . VAL A 1 75  ? -53.392 10.114  -4.248  1.00 2.88  ? 75  VAL A CB   2  
ATOM 8682   C CG1  . VAL A 1 75  ? -54.728 9.787   -3.592  1.00 2.79  ? 75  VAL A CG1  2  
ATOM 8683   C CG2  . VAL A 1 75  ? -53.014 9.012   -5.222  1.00 3.11  ? 75  VAL A CG2  2  
ATOM 8684   H H    . VAL A 1 75  ? -51.927 12.775  -4.236  1.00 2.85  ? 75  VAL A H    2  
ATOM 8685   H HA   . VAL A 1 75  ? -53.711 11.332  -5.998  1.00 3.16  ? 75  VAL A HA   2  
ATOM 8686   H HB   . VAL A 1 75  ? -52.639 10.154  -3.474  1.00 2.83  ? 75  VAL A HB   2  
ATOM 8687   H HG11 . VAL A 1 75  ? -54.651 8.844   -3.072  1.00 2.75  ? 75  VAL A HG11 2  
ATOM 8688   H HG12 . VAL A 1 75  ? -55.494 9.721   -4.350  1.00 2.93  ? 75  VAL A HG12 2  
ATOM 8689   H HG13 . VAL A 1 75  ? -54.985 10.567  -2.889  1.00 2.73  ? 75  VAL A HG13 2  
ATOM 8690   H HG21 . VAL A 1 75  ? -52.707 8.134   -4.673  1.00 3.17  ? 75  VAL A HG21 2  
ATOM 8691   H HG22 . VAL A 1 75  ? -52.202 9.347   -5.847  1.00 3.26  ? 75  VAL A HG22 2  
ATOM 8692   H HG23 . VAL A 1 75  ? -53.867 8.769   -5.840  1.00 3.24  ? 75  VAL A HG23 2  
ATOM 8693   N N    . PRO A 1 76  ? -55.513 12.767  -5.022  1.00 3.23  ? 76  PRO A N    2  
ATOM 8694   C CA   . PRO A 1 76  ? -56.565 13.634  -4.487  1.00 3.27  ? 76  PRO A CA   2  
ATOM 8695   C C    . PRO A 1 76  ? -57.180 13.066  -3.212  1.00 3.08  ? 76  PRO A C    2  
ATOM 8696   O O    . PRO A 1 76  ? -57.375 11.853  -3.092  1.00 3.03  ? 76  PRO A O    2  
ATOM 8697   C CB   . PRO A 1 76  ? -57.605 13.671  -5.611  1.00 3.52  ? 76  PRO A CB   2  
ATOM 8698   C CG   . PRO A 1 76  ? -56.841 13.344  -6.845  1.00 3.68  ? 76  PRO A CG   2  
ATOM 8699   C CD   . PRO A 1 76  ? -55.776 12.376  -6.418  1.00 3.48  ? 76  PRO A CD   2  
ATOM 8700   H HA   . PRO A 1 76  ? -56.197 14.631  -4.298  1.00 3.28  ? 76  PRO A HA   2  
ATOM 8701   H HB2  . PRO A 1 76  ? -58.374 12.937  -5.417  1.00 3.51  ? 76  PRO A HB2  2  
ATOM 8702   H HB3  . PRO A 1 76  ? -58.044 14.657  -5.668  1.00 3.62  ? 76  PRO A HB3  2  
ATOM 8703   H HG2  . PRO A 1 76  ? -57.493 12.887  -7.573  1.00 3.83  ? 76  PRO A HG2  2  
ATOM 8704   H HG3  . PRO A 1 76  ? -56.394 14.238  -7.249  1.00 3.78  ? 76  PRO A HG3  2  
ATOM 8705   H HD2  . PRO A 1 76  ? -56.143 11.362  -6.472  1.00 3.48  ? 76  PRO A HD2  2  
ATOM 8706   H HD3  . PRO A 1 76  ? -54.893 12.497  -7.026  1.00 3.55  ? 76  PRO A HD3  2  
ATOM 8707   N N    . TYR A 1 77  ? -57.504 13.948  -2.272  1.00 3.02  ? 77  TYR A N    2  
ATOM 8708   C CA   . TYR A 1 77  ? -58.091 13.544  -0.993  1.00 2.87  ? 77  TYR A CA   2  
ATOM 8709   C C    . TYR A 1 77  ? -59.407 12.782  -1.185  1.00 2.98  ? 77  TYR A C    2  
ATOM 8710   O O    . TYR A 1 77  ? -59.860 12.072  -0.289  1.00 2.91  ? 77  TYR A O    2  
ATOM 8711   C CB   . TYR A 1 77  ? -58.302 14.768  -0.088  1.00 2.84  ? 77  TYR A CB   2  
ATOM 8712   C CG   . TYR A 1 77  ? -59.526 15.603  -0.421  1.00 3.07  ? 77  TYR A CG   2  
ATOM 8713   C CD1  . TYR A 1 77  ? -59.616 16.314  -1.613  1.00 3.23  ? 77  TYR A CD1  2  
ATOM 8714   C CD2  . TYR A 1 77  ? -60.589 15.686  0.469   1.00 3.21  ? 77  TYR A CD2  2  
ATOM 8715   C CE1  . TYR A 1 77  ? -60.728 17.077  -1.906  1.00 3.49  ? 77  TYR A CE1  2  
ATOM 8716   C CE2  . TYR A 1 77  ? -61.705 16.447  0.182   1.00 3.45  ? 77  TYR A CE2  2  
ATOM 8717   C CZ   . TYR A 1 77  ? -61.769 17.139  -1.006  1.00 3.57  ? 77  TYR A CZ   2  
ATOM 8718   O OH   . TYR A 1 77  ? -62.877 17.901  -1.291  1.00 3.86  ? 77  TYR A OH   2  
ATOM 8719   H H    . TYR A 1 77  ? -57.324 14.904  -2.435  1.00 3.10  ? 77  TYR A H    2  
ATOM 8720   H HA   . TYR A 1 77  ? -57.384 12.882  -0.514  1.00 2.74  ? 77  TYR A HA   2  
ATOM 8721   H HB2  . TYR A 1 77  ? -58.405 14.433  0.932   1.00 2.77  ? 77  TYR A HB2  2  
ATOM 8722   H HB3  . TYR A 1 77  ? -57.436 15.409  -0.162  1.00 2.78  ? 77  TYR A HB3  2  
ATOM 8723   H HD1  . TYR A 1 77  ? -58.800 16.261  -2.318  1.00 3.22  ? 77  TYR A HD1  2  
ATOM 8724   H HD2  . TYR A 1 77  ? -60.535 15.146  1.402   1.00 3.20  ? 77  TYR A HD2  2  
ATOM 8725   H HE1  . TYR A 1 77  ? -60.780 17.623  -2.836  1.00 3.68  ? 77  TYR A HE1  2  
ATOM 8726   H HE2  . TYR A 1 77  ? -62.522 16.496  0.885   1.00 3.60  ? 77  TYR A HE2  2  
ATOM 8727   H HH   . TYR A 1 77  ? -63.098 18.441  -0.519  1.00 4.03  ? 77  TYR A HH   2  
ATOM 8728   N N    . SER A 1 78  ? -60.006 12.926  -2.358  1.00 3.20  ? 78  SER A N    2  
ATOM 8729   C CA   . SER A 1 78  ? -61.255 12.250  -2.677  1.00 3.35  ? 78  SER A CA   2  
ATOM 8730   C C    . SER A 1 78  ? -61.011 10.771  -2.991  1.00 3.39  ? 78  SER A C    2  
ATOM 8731   O O    . SER A 1 78  ? -61.931 9.954   -2.951  1.00 3.51  ? 78  SER A O    2  
ATOM 8732   C CB   . SER A 1 78  ? -61.906 12.950  -3.868  1.00 3.61  ? 78  SER A CB   2  
ATOM 8733   O OG   . SER A 1 78  ? -61.004 13.889  -4.440  1.00 3.67  ? 78  SER A OG   2  
ATOM 8734   H H    . SER A 1 78  ? -59.604 13.514  -3.032  1.00 3.28  ? 78  SER A H    2  
ATOM 8735   H HA   . SER A 1 78  ? -61.907 12.325  -1.820  1.00 3.29  ? 78  SER A HA   2  
ATOM 8736   H HB2  . SER A 1 78  ? -62.173 12.219  -4.619  1.00 3.75  ? 78  SER A HB2  2  
ATOM 8737   H HB3  . SER A 1 78  ? -62.793 13.473  -3.540  1.00 3.71  ? 78  SER A HB3  2  
ATOM 8738   H HG   . SER A 1 78  ? -61.498 14.632  -4.801  1.00 3.83  ? 78  SER A HG   2  
ATOM 8739   N N    . GLU A 1 79  ? -59.761 10.436  -3.290  1.00 3.30  ? 79  GLU A N    2  
ATOM 8740   C CA   . GLU A 1 79  ? -59.383 9.064   -3.612  1.00 3.34  ? 79  GLU A CA   2  
ATOM 8741   C C    . GLU A 1 79  ? -58.556 8.459   -2.484  1.00 3.11  ? 79  GLU A C    2  
ATOM 8742   O O    . GLU A 1 79  ? -58.046 7.349   -2.605  1.00 3.12  ? 79  GLU A O    2  
ATOM 8743   C CB   . GLU A 1 79  ? -58.578 9.023   -4.912  1.00 3.45  ? 79  GLU A CB   2  
ATOM 8744   C CG   . GLU A 1 79  ? -59.408 9.273   -6.158  1.00 3.75  ? 79  GLU A CG   2  
ATOM 8745   C CD   . GLU A 1 79  ? -58.588 9.218   -7.431  1.00 3.85  ? 79  GLU A CD   2  
ATOM 8746   O OE1  . GLU A 1 79  ? -57.481 8.634   -7.416  1.00 3.79  ? 79  GLU A OE1  2  
ATOM 8747   O OE2  . GLU A 1 79  ? -59.045 9.763   -8.461  1.00 4.10  ? 79  GLU A OE2  2  
ATOM 8748   H H    . GLU A 1 79  ? -59.066 11.133  -3.287  1.00 3.22  ? 79  GLU A H    2  
ATOM 8749   H HA   . GLU A 1 79  ? -60.286 8.487   -3.735  1.00 3.49  ? 79  GLU A HA   2  
ATOM 8750   H HB2  . GLU A 1 79  ? -57.803 9.777   -4.865  1.00 3.50  ? 79  GLU A HB2  2  
ATOM 8751   H HB3  . GLU A 1 79  ? -58.116 8.052   -5.004  1.00 3.38  ? 79  GLU A HB3  2  
ATOM 8752   H HG2  . GLU A 1 79  ? -60.180 8.521   -6.214  1.00 3.83  ? 79  GLU A HG2  2  
ATOM 8753   H HG3  . GLU A 1 79  ? -59.864 10.250  -6.081  1.00 3.94  ? 79  GLU A HG3  2  
ATOM 8754   N N    . LEU A 1 80  ? -58.443 9.198   -1.387  1.00 2.95  ? 80  LEU A N    2  
ATOM 8755   C CA   . LEU A 1 80  ? -57.665 8.761   -0.231  1.00 2.75  ? 80  LEU A CA   2  
ATOM 8756   C C    . LEU A 1 80  ? -58.267 7.508   0.407   1.00 2.83  ? 80  LEU A C    2  
ATOM 8757   O O    . LEU A 1 80  ? -57.545 6.655   0.923   1.00 2.76  ? 80  LEU A O    2  
ATOM 8758   C CB   . LEU A 1 80  ? -57.600 9.894   0.795   1.00 2.60  ? 80  LEU A CB   2  
ATOM 8759   C CG   . LEU A 1 80  ? -56.626 9.680   1.955   1.00 2.48  ? 80  LEU A CG   2  
ATOM 8760   C CD1  . LEU A 1 80  ? -55.696 10.874  2.089   1.00 2.36  ? 80  LEU A CD1  2  
ATOM 8761   C CD2  . LEU A 1 80  ? -57.380 9.449   3.255   1.00 2.61  ? 80  LEU A CD2  2  
ATOM 8762   H H    . LEU A 1 80  ? -58.894 10.067  -1.353  1.00 2.98  ? 80  LEU A H    2  
ATOM 8763   H HA   . LEU A 1 80  ? -56.664 8.536   -0.571  1.00 2.69  ? 80  LEU A HA   2  
ATOM 8764   H HB2  . LEU A 1 80  ? -57.319 10.801  0.280   1.00 2.58  ? 80  LEU A HB2  2  
ATOM 8765   H HB3  . LEU A 1 80  ? -58.589 10.030  1.208   1.00 2.77  ? 80  LEU A HB3  2  
ATOM 8766   H HG   . LEU A 1 80  ? -56.022 8.807   1.756   1.00 2.53  ? 80  LEU A HG   2  
ATOM 8767   H HD11 . LEU A 1 80  ? -55.084 10.755  2.970   1.00 2.39  ? 80  LEU A HD11 2  
ATOM 8768   H HD12 . LEU A 1 80  ? -56.281 11.778  2.176   1.00 2.37  ? 80  LEU A HD12 2  
ATOM 8769   H HD13 . LEU A 1 80  ? -55.064 10.937  1.216   1.00 2.39  ? 80  LEU A HD13 2  
ATOM 8770   H HD21 . LEU A 1 80  ? -57.973 8.550   3.172   1.00 2.80  ? 80  LEU A HD21 2  
ATOM 8771   H HD22 . LEU A 1 80  ? -58.027 10.290  3.451   1.00 2.62  ? 80  LEU A HD22 2  
ATOM 8772   H HD23 . LEU A 1 80  ? -56.675 9.342   4.066   1.00 2.66  ? 80  LEU A HD23 2  
ATOM 8773   N N    . GLY A 1 81  ? -59.591 7.400   0.347   1.00 3.02  ? 81  GLY A N    2  
ATOM 8774   C CA   . GLY A 1 81  ? -60.275 6.261   0.935   1.00 3.16  ? 81  GLY A CA   2  
ATOM 8775   C C    . GLY A 1 81  ? -59.910 4.948   0.272   1.00 3.29  ? 81  GLY A C    2  
ATOM 8776   O O    . GLY A 1 81  ? -59.846 3.911   0.928   1.00 3.39  ? 81  GLY A O    2  
ATOM 8777   H H    . GLY A 1 81  ? -60.109 8.100   -0.101  1.00 3.10  ? 81  GLY A H    2  
ATOM 8778   H HA2  . GLY A 1 81  ? -60.018 6.204   1.983   1.00 3.05  ? 81  GLY A HA2  2  
ATOM 8779   H HA3  . GLY A 1 81  ? -61.341 6.409   0.846   1.00 3.30  ? 81  GLY A HA3  2  
ATOM 8780   N N    . GLY A 1 82  ? -59.651 4.991   -1.023  1.00 3.35  ? 82  GLY A N    2  
ATOM 8781   C CA   . GLY A 1 82  ? -59.302 3.785   -1.742  1.00 3.49  ? 82  GLY A CA   2  
ATOM 8782   C C    . GLY A 1 82  ? -57.886 3.818   -2.268  1.00 3.32  ? 82  GLY A C    2  
ATOM 8783   O O    . GLY A 1 82  ? -57.622 3.371   -3.384  1.00 3.41  ? 82  GLY A O    2  
ATOM 8784   H H    . GLY A 1 82  ? -59.685 5.851   -1.495  1.00 3.35  ? 82  GLY A H    2  
ATOM 8785   H HA2  . GLY A 1 82  ? -59.411 2.940   -1.078  1.00 3.54  ? 82  GLY A HA2  2  
ATOM 8786   H HA3  . GLY A 1 82  ? -59.981 3.667   -2.573  1.00 3.68  ? 82  GLY A HA3  2  
ATOM 8787   N N    . LYS A 1 83  ? -56.969 4.351   -1.475  1.00 3.09  ? 83  LYS A N    2  
ATOM 8788   C CA   . LYS A 1 83  ? -55.579 4.437   -1.888  1.00 2.92  ? 83  LYS A CA   2  
ATOM 8789   C C    . LYS A 1 83  ? -54.640 3.987   -0.775  1.00 2.73  ? 83  LYS A C    2  
ATOM 8790   O O    . LYS A 1 83  ? -54.144 4.800   0.006   1.00 2.64  ? 83  LYS A O    2  
ATOM 8791   C CB   . LYS A 1 83  ? -55.241 5.863   -2.320  1.00 2.81  ? 83  LYS A CB   2  
ATOM 8792   C CG   . LYS A 1 83  ? -54.222 5.933   -3.448  1.00 2.82  ? 83  LYS A CG   2  
ATOM 8793   C CD   . LYS A 1 83  ? -54.831 5.539   -4.787  1.00 3.11  ? 83  LYS A CD   2  
ATOM 8794   C CE   . LYS A 1 83  ? -55.852 6.560   -5.268  1.00 3.26  ? 83  LYS A CE   2  
ATOM 8795   N NZ   . LYS A 1 83  ? -56.144 6.416   -6.719  1.00 3.51  ? 83  LYS A NZ   2  
ATOM 8796   H H    . LYS A 1 83  ? -57.233 4.701   -0.597  1.00 3.05  ? 83  LYS A H    2  
ATOM 8797   H HA   . LYS A 1 83  ? -55.449 3.779   -2.735  1.00 3.04  ? 83  LYS A HA   2  
ATOM 8798   H HB2  . LYS A 1 83  ? -56.145 6.352   -2.651  1.00 2.93  ? 83  LYS A HB2  2  
ATOM 8799   H HB3  . LYS A 1 83  ? -54.843 6.398   -1.470  1.00 2.64  ? 83  LYS A HB3  2  
ATOM 8800   H HG2  . LYS A 1 83  ? -53.851 6.942   -3.519  1.00 2.75  ? 83  LYS A HG2  2  
ATOM 8801   H HG3  . LYS A 1 83  ? -53.406 5.262   -3.223  1.00 2.73  ? 83  LYS A HG3  2  
ATOM 8802   H HD2  . LYS A 1 83  ? -54.041 5.467   -5.519  1.00 3.12  ? 83  LYS A HD2  2  
ATOM 8803   H HD3  . LYS A 1 83  ? -55.316 4.580   -4.684  1.00 3.21  ? 83  LYS A HD3  2  
ATOM 8804   H HE2  . LYS A 1 83  ? -56.766 6.423   -4.712  1.00 3.33  ? 83  LYS A HE2  2  
ATOM 8805   H HE3  . LYS A 1 83  ? -55.466 7.552   -5.084  1.00 3.17  ? 83  LYS A HE3  2  
ATOM 8806   H HZ1  . LYS A 1 83  ? -55.253 6.343   -7.261  1.00 3.49  ? 83  LYS A HZ1  2  
ATOM 8807   H HZ2  . LYS A 1 83  ? -56.682 7.245   -7.064  1.00 3.61  ? 83  LYS A HZ2  2  
ATOM 8808   H HZ3  . LYS A 1 83  ? -56.709 5.559   -6.887  1.00 3.64  ? 83  LYS A HZ3  2  
ATOM 8809   N N    . THR A 1 84  ? -54.416 2.686   -0.696  1.00 2.77  ? 84  THR A N    2  
ATOM 8810   C CA   . THR A 1 84  ? -53.521 2.129   0.304   1.00 2.64  ? 84  THR A CA   2  
ATOM 8811   C C    . THR A 1 84  ? -52.081 2.168   -0.203  1.00 2.47  ? 84  THR A C    2  
ATOM 8812   O O    . THR A 1 84  ? -51.777 1.636   -1.273  1.00 2.58  ? 84  THR A O    2  
ATOM 8813   C CB   . THR A 1 84  ? -53.904 0.675   0.645   1.00 2.88  ? 84  THR A CB   2  
ATOM 8814   O OG1  . THR A 1 84  ? -55.332 0.554   0.720   1.00 3.12  ? 84  THR A OG1  2  
ATOM 8815   C CG2  . THR A 1 84  ? -53.281 0.238   1.968   1.00 2.80  ? 84  THR A CG2  2  
ATOM 8816   H H    . THR A 1 84  ? -54.868 2.082   -1.318  1.00 2.94  ? 84  THR A H    2  
ATOM 8817   H HA   . THR A 1 84  ? -53.600 2.727   1.201   1.00 2.53  ? 84  THR A HA   2  
ATOM 8818   H HB   . THR A 1 84  ? -53.538 0.028   -0.139  1.00 2.98  ? 84  THR A HB   2  
ATOM 8819   H HG1  . THR A 1 84  ? -55.562 -0.270  1.166   1.00 3.12  ? 84  THR A HG1  2  
ATOM 8820   H HG21 . THR A 1 84  ? -53.503 -0.805  2.144   1.00 3.05  ? 84  THR A HG21 2  
ATOM 8821   H HG22 . THR A 1 84  ? -53.689 0.832   2.772   1.00 2.81  ? 84  THR A HG22 2  
ATOM 8822   H HG23 . THR A 1 84  ? -52.210 0.376   1.926   1.00 2.68  ? 84  THR A HG23 2  
ATOM 8823   N N    . LEU A 1 85  ? -51.203 2.815   0.550   1.00 2.24  ? 85  LEU A N    2  
ATOM 8824   C CA   . LEU A 1 85  ? -49.806 2.923   0.161   1.00 2.07  ? 85  LEU A CA   2  
ATOM 8825   C C    . LEU A 1 85  ? -48.908 2.198   1.152   1.00 2.05  ? 85  LEU A C    2  
ATOM 8826   O O    . LEU A 1 85  ? -49.194 2.153   2.353   1.00 2.10  ? 85  LEU A O    2  
ATOM 8827   C CB   . LEU A 1 85  ? -49.385 4.394   0.061   1.00 1.89  ? 85  LEU A CB   2  
ATOM 8828   C CG   . LEU A 1 85  ? -49.366 5.166   1.385   1.00 1.78  ? 85  LEU A CG   2  
ATOM 8829   C CD1  . LEU A 1 85  ? -48.156 6.085   1.444   1.00 1.69  ? 85  LEU A CD1  2  
ATOM 8830   C CD2  . LEU A 1 85  ? -50.647 5.965   1.554   1.00 1.91  ? 85  LEU A CD2  2  
ATOM 8831   H H    . LEU A 1 85  ? -51.499 3.227   1.389   1.00 2.20  ? 85  LEU A H    2  
ATOM 8832   H HA   . LEU A 1 85  ? -49.697 2.460   -0.808  1.00 2.16  ? 85  LEU A HA   2  
ATOM 8833   H HB2  . LEU A 1 85  ? -48.394 4.433   -0.369  1.00 1.87  ? 85  LEU A HB2  2  
ATOM 8834   H HB3  . LEU A 1 85  ? -50.068 4.894   -0.610  1.00 2.03  ? 85  LEU A HB3  2  
ATOM 8835   H HG   . LEU A 1 85  ? -49.293 4.465   2.204   1.00 1.94  ? 85  LEU A HG   2  
ATOM 8836   H HD11 . LEU A 1 85  ? -47.255 5.495   1.382   1.00 1.79  ? 85  LEU A HD11 2  
ATOM 8837   H HD12 . LEU A 1 85  ? -48.163 6.636   2.374   1.00 1.75  ? 85  LEU A HD12 2  
ATOM 8838   H HD13 . LEU A 1 85  ? -48.191 6.776   0.616   1.00 1.85  ? 85  LEU A HD13 2  
ATOM 8839   H HD21 . LEU A 1 85  ? -50.724 6.694   0.763   1.00 1.93  ? 85  LEU A HD21 2  
ATOM 8840   H HD22 . LEU A 1 85  ? -50.633 6.472   2.510   1.00 1.91  ? 85  LEU A HD22 2  
ATOM 8841   H HD23 . LEU A 1 85  ? -51.495 5.298   1.514   1.00 2.20  ? 85  LEU A HD23 2  
ATOM 8842   N N    . VAL A 1 86  ? -47.835 1.612   0.639   1.00 2.01  ? 86  VAL A N    2  
ATOM 8843   C CA   . VAL A 1 86  ? -46.880 0.899   1.473   1.00 2.03  ? 86  VAL A CA   2  
ATOM 8844   C C    . VAL A 1 86  ? -45.464 1.366   1.146   1.00 1.81  ? 86  VAL A C    2  
ATOM 8845   O O    . VAL A 1 86  ? -45.199 1.845   0.038   1.00 1.75  ? 86  VAL A O    2  
ATOM 8846   C CB   . VAL A 1 86  ? -46.984 -0.648  1.313   1.00 2.28  ? 86  VAL A CB   2  
ATOM 8847   C CG1  . VAL A 1 86  ? -48.414 -1.074  1.011   1.00 2.69  ? 86  VAL A CG1  2  
ATOM 8848   C CG2  . VAL A 1 86  ? -46.042 -1.173  0.238   1.00 2.49  ? 86  VAL A CG2  2  
ATOM 8849   H H    . VAL A 1 86  ? -47.676 1.658   -0.328  1.00 2.00  ? 86  VAL A H    2  
ATOM 8850   H HA   . VAL A 1 86  ? -47.095 1.148   2.505   1.00 2.06  ? 86  VAL A HA   2  
ATOM 8851   H HB   . VAL A 1 86  ? -46.698 -1.096  2.254   1.00 2.43  ? 86  VAL A HB   2  
ATOM 8852   H HG11 . VAL A 1 86  ? -49.074 -0.678  1.769   1.00 2.93  ? 86  VAL A HG11 2  
ATOM 8853   H HG12 . VAL A 1 86  ? -48.474 -2.151  1.006   1.00 2.88  ? 86  VAL A HG12 2  
ATOM 8854   H HG13 . VAL A 1 86  ? -48.705 -0.691  0.045   1.00 2.92  ? 86  VAL A HG13 2  
ATOM 8855   H HG21 . VAL A 1 86  ? -46.299 -0.730  -0.712  1.00 2.71  ? 86  VAL A HG21 2  
ATOM 8856   H HG22 . VAL A 1 86  ? -46.134 -2.248  0.172   1.00 2.69  ? 86  VAL A HG22 2  
ATOM 8857   H HG23 . VAL A 1 86  ? -45.025 -0.914  0.493   1.00 2.63  ? 86  VAL A HG23 2  
ATOM 8858   N N    . MET A 1 87  ? -44.567 1.253   2.109   1.00 1.75  ? 87  MET A N    2  
ATOM 8859   C CA   . MET A 1 87  ? -43.181 1.656   1.914   1.00 1.57  ? 87  MET A CA   2  
ATOM 8860   C C    . MET A 1 87  ? -42.264 0.471   2.170   1.00 1.69  ? 87  MET A C    2  
ATOM 8861   O O    . MET A 1 87  ? -42.208 -0.041  3.288   1.00 1.86  ? 87  MET A O    2  
ATOM 8862   C CB   . MET A 1 87  ? -42.820 2.813   2.850   1.00 1.49  ? 87  MET A CB   2  
ATOM 8863   C CG   . MET A 1 87  ? -41.373 3.265   2.737   1.00 1.38  ? 87  MET A CG   2  
ATOM 8864   S SD   . MET A 1 87  ? -41.087 4.362   1.335   1.00 1.18  ? 87  MET A SD   2  
ATOM 8865   C CE   . MET A 1 87  ? -41.846 5.872   1.931   1.00 1.14  ? 87  MET A CE   2  
ATOM 8866   H H    . MET A 1 87  ? -44.839 0.881   2.979   1.00 1.86  ? 87  MET A H    2  
ATOM 8867   H HA   . MET A 1 87  ? -43.067 1.976   0.890   1.00 1.47  ? 87  MET A HA   2  
ATOM 8868   H HB2  . MET A 1 87  ? -43.457 3.655   2.625   1.00 1.44  ? 87  MET A HB2  2  
ATOM 8869   H HB3  . MET A 1 87  ? -43.000 2.501   3.869   1.00 1.64  ? 87  MET A HB3  2  
ATOM 8870   H HG2  . MET A 1 87  ? -41.101 3.787   3.643   1.00 1.45  ? 87  MET A HG2  2  
ATOM 8871   H HG3  . MET A 1 87  ? -40.746 2.393   2.626   1.00 1.50  ? 87  MET A HG3  2  
ATOM 8872   H HE1  . MET A 1 87  ? -41.416 6.139   2.885   1.00 1.32  ? 87  MET A HE1  2  
ATOM 8873   H HE2  . MET A 1 87  ? -42.910 5.721   2.045   1.00 1.24  ? 87  MET A HE2  2  
ATOM 8874   H HE3  . MET A 1 87  ? -41.668 6.667   1.222   1.00 1.21  ? 87  MET A HE3  2  
ATOM 8875   N N    . ALA A 1 88  ? -41.552 0.038   1.140   1.00 1.63  ? 88  ALA A N    2  
ATOM 8876   C CA   . ALA A 1 88  ? -40.657 -1.103  1.262   1.00 1.76  ? 88  ALA A CA   2  
ATOM 8877   C C    . ALA A 1 88  ? -39.202 -0.667  1.201   1.00 1.58  ? 88  ALA A C    2  
ATOM 8878   O O    . ALA A 1 88  ? -38.846 0.243   0.453   1.00 1.36  ? 88  ALA A O    2  
ATOM 8879   C CB   . ALA A 1 88  ? -40.948 -2.122  0.169   1.00 1.90  ? 88  ALA A CB   2  
ATOM 8880   H H    . ALA A 1 88  ? -41.617 0.507   0.278   1.00 1.53  ? 88  ALA A H    2  
ATOM 8881   H HA   . ALA A 1 88  ? -40.841 -1.571  2.217   1.00 1.93  ? 88  ALA A HA   2  
ATOM 8882   H HB1  . ALA A 1 88  ? -40.694 -1.702  -0.792  1.00 1.78  ? 88  ALA A HB1  2  
ATOM 8883   H HB2  . ALA A 1 88  ? -41.997 -2.378  0.185   1.00 2.05  ? 88  ALA A HB2  2  
ATOM 8884   H HB3  . ALA A 1 88  ? -40.359 -3.011  0.341   1.00 2.02  ? 88  ALA A HB3  2  
ATOM 8885   N N    . VAL A 1 89  ? -38.363 -1.312  1.992   1.00 1.72  ? 89  VAL A N    2  
ATOM 8886   C CA   . VAL A 1 89  ? -36.949 -0.989  2.010   1.00 1.62  ? 89  VAL A CA   2  
ATOM 8887   C C    . VAL A 1 89  ? -36.168 -1.983  1.144   1.00 1.67  ? 89  VAL A C    2  
ATOM 8888   O O    . VAL A 1 89  ? -36.244 -3.201  1.336   1.00 1.92  ? 89  VAL A O    2  
ATOM 8889   C CB   . VAL A 1 89  ? -36.385 -0.946  3.453   1.00 1.80  ? 89  VAL A CB   2  
ATOM 8890   C CG1  . VAL A 1 89  ? -36.607 -2.262  4.179   1.00 2.11  ? 89  VAL A CG1  2  
ATOM 8891   C CG2  . VAL A 1 89  ? -34.911 -0.577  3.446   1.00 1.78  ? 89  VAL A CG2  2  
ATOM 8892   H H    . VAL A 1 89  ? -38.703 -2.030  2.572   1.00 1.91  ? 89  VAL A H    2  
ATOM 8893   H HA   . VAL A 1 89  ? -36.838 -0.004  1.578   1.00 1.41  ? 89  VAL A HA   2  
ATOM 8894   H HB   . VAL A 1 89  ? -36.917 -0.175  3.993   1.00 1.77  ? 89  VAL A HB   2  
ATOM 8895   H HG11 . VAL A 1 89  ? -36.120 -2.227  5.143   1.00 2.20  ? 89  VAL A HG11 2  
ATOM 8896   H HG12 . VAL A 1 89  ? -36.193 -3.070  3.594   1.00 2.24  ? 89  VAL A HG12 2  
ATOM 8897   H HG13 . VAL A 1 89  ? -37.665 -2.423  4.316   1.00 2.20  ? 89  VAL A HG13 2  
ATOM 8898   H HG21 . VAL A 1 89  ? -34.336 -1.397  3.039   1.00 1.65  ? 89  VAL A HG21 2  
ATOM 8899   H HG22 . VAL A 1 89  ? -34.586 -0.375  4.456   1.00 1.81  ? 89  VAL A HG22 2  
ATOM 8900   H HG23 . VAL A 1 89  ? -34.762 0.302   2.837   1.00 1.99  ? 89  VAL A HG23 2  
ATOM 8901   N N    . TYR A 1 90  ? -35.443 -1.450  0.176   1.00 1.44  ? 90  TYR A N    2  
ATOM 8902   C CA   . TYR A 1 90  ? -34.665 -2.266  -0.742  1.00 1.47  ? 90  TYR A CA   2  
ATOM 8903   C C    . TYR A 1 90  ? -33.174 -2.091  -0.482  1.00 1.41  ? 90  TYR A C    2  
ATOM 8904   O O    . TYR A 1 90  ? -32.735 -1.028  -0.050  1.00 1.28  ? 90  TYR A O    2  
ATOM 8905   C CB   . TYR A 1 90  ? -35.003 -1.867  -2.184  1.00 1.31  ? 90  TYR A CB   2  
ATOM 8906   C CG   . TYR A 1 90  ? -34.843 -2.979  -3.201  1.00 1.49  ? 90  TYR A CG   2  
ATOM 8907   C CD1  . TYR A 1 90  ? -35.325 -4.257  -2.949  1.00 1.90  ? 90  TYR A CD1  2  
ATOM 8908   C CD2  . TYR A 1 90  ? -34.216 -2.744  -4.422  1.00 1.43  ? 90  TYR A CD2  2  
ATOM 8909   C CE1  . TYR A 1 90  ? -35.187 -5.268  -3.880  1.00 2.14  ? 90  TYR A CE1  2  
ATOM 8910   C CE2  . TYR A 1 90  ? -34.077 -3.752  -5.358  1.00 1.65  ? 90  TYR A CE2  2  
ATOM 8911   C CZ   . TYR A 1 90  ? -34.565 -5.012  -5.081  1.00 1.97  ? 90  TYR A CZ   2  
ATOM 8912   O OH   . TYR A 1 90  ? -34.431 -6.020  -6.008  1.00 2.25  ? 90  TYR A OH   2  
ATOM 8913   H H    . TYR A 1 90  ? -35.423 -0.470  0.075   1.00 1.26  ? 90  TYR A H    2  
ATOM 8914   H HA   . TYR A 1 90  ? -34.932 -3.298  -0.586  1.00 1.70  ? 90  TYR A HA   2  
ATOM 8915   H HB2  . TYR A 1 90  ? -36.027 -1.533  -2.220  1.00 1.34  ? 90  TYR A HB2  2  
ATOM 8916   H HB3  . TYR A 1 90  ? -34.356 -1.053  -2.479  1.00 1.12  ? 90  TYR A HB3  2  
ATOM 8917   H HD1  . TYR A 1 90  ? -35.818 -4.457  -2.011  1.00 2.10  ? 90  TYR A HD1  2  
ATOM 8918   H HD2  . TYR A 1 90  ? -33.837 -1.757  -4.636  1.00 1.35  ? 90  TYR A HD2  2  
ATOM 8919   H HE1  . TYR A 1 90  ? -35.569 -6.255  -3.664  1.00 2.52  ? 90  TYR A HE1  2  
ATOM 8920   H HE2  . TYR A 1 90  ? -33.585 -3.551  -6.299  1.00 1.69  ? 90  TYR A HE2  2  
ATOM 8921   H HH   . TYR A 1 90  ? -35.133 -6.672  -5.870  1.00 2.33  ? 90  TYR A HH   2  
ATOM 8922   N N    . ASP A 1 91  ? -32.409 -3.140  -0.735  1.00 1.59  ? 91  ASP A N    2  
ATOM 8923   C CA   . ASP A 1 91  ? -30.966 -3.106  -0.537  1.00 1.59  ? 91  ASP A CA   2  
ATOM 8924   C C    . ASP A 1 91  ? -30.265 -2.937  -1.881  1.00 1.38  ? 91  ASP A C    2  
ATOM 8925   O O    . ASP A 1 91  ? -30.825 -3.279  -2.922  1.00 1.34  ? 91  ASP A O    2  
ATOM 8926   C CB   . ASP A 1 91  ? -30.504 -4.392  0.159   1.00 1.92  ? 91  ASP A CB   2  
ATOM 8927   C CG   . ASP A 1 91  ? -28.995 -4.549  0.187   1.00 1.96  ? 91  ASP A CG   2  
ATOM 8928   O OD1  . ASP A 1 91  ? -28.357 -4.050  1.141   1.00 2.04  ? 91  ASP A OD1  2  
ATOM 8929   O OD2  . ASP A 1 91  ? -28.448 -5.167  -0.750  1.00 1.96  ? 91  ASP A OD2  2  
ATOM 8930   H H    . ASP A 1 91  ? -32.821 -3.961  -1.073  1.00 1.74  ? 91  ASP A H    2  
ATOM 8931   H HA   . ASP A 1 91  ? -30.735 -2.256  0.088   1.00 1.56  ? 91  ASP A HA   2  
ATOM 8932   H HB2  . ASP A 1 91  ? -30.861 -4.384  1.177   1.00 2.07  ? 91  ASP A HB2  2  
ATOM 8933   H HB3  . ASP A 1 91  ? -30.926 -5.240  -0.358  1.00 2.00  ? 91  ASP A HB3  2  
ATOM 8934   N N    . PHE A 1 92  ? -29.056 -2.397  -1.863  1.00 1.32  ? 92  PHE A N    2  
ATOM 8935   C CA   . PHE A 1 92  ? -28.300 -2.187  -3.085  1.00 1.14  ? 92  PHE A CA   2  
ATOM 8936   C C    . PHE A 1 92  ? -26.856 -2.666  -2.930  1.00 1.28  ? 92  PHE A C    2  
ATOM 8937   O O    . PHE A 1 92  ? -25.917 -1.918  -3.190  1.00 1.23  ? 92  PHE A O    2  
ATOM 8938   C CB   . PHE A 1 92  ? -28.332 -0.706  -3.473  1.00 0.92  ? 92  PHE A CB   2  
ATOM 8939   C CG   . PHE A 1 92  ? -28.543 -0.470  -4.941  1.00 0.76  ? 92  PHE A CG   2  
ATOM 8940   C CD1  . PHE A 1 92  ? -29.697 -0.909  -5.566  1.00 0.94  ? 92  PHE A CD1  2  
ATOM 8941   C CD2  . PHE A 1 92  ? -27.588 0.194   -5.694  1.00 0.86  ? 92  PHE A CD2  2  
ATOM 8942   C CE1  . PHE A 1 92  ? -29.897 -0.691  -6.915  1.00 1.04  ? 92  PHE A CE1  2  
ATOM 8943   C CE2  . PHE A 1 92  ? -27.782 0.415   -7.044  1.00 0.90  ? 92  PHE A CE2  2  
ATOM 8944   C CZ   . PHE A 1 92  ? -28.939 -0.027  -7.655  1.00 0.92  ? 92  PHE A CZ   2  
ATOM 8945   H H    . PHE A 1 92  ? -28.663 -2.129  -1.000  1.00 1.44  ? 92  PHE A H    2  
ATOM 8946   H HA   . PHE A 1 92  ? -28.770 -2.764  -3.867  1.00 1.13  ? 92  PHE A HA   2  
ATOM 8947   H HB2  . PHE A 1 92  ? -29.134 -0.217  -2.941  1.00 0.91  ? 92  PHE A HB2  2  
ATOM 8948   H HB3  . PHE A 1 92  ? -27.393 -0.249  -3.194  1.00 1.01  ? 92  PHE A HB3  2  
ATOM 8949   H HD1  . PHE A 1 92  ? -30.448 -1.428  -4.987  1.00 1.22  ? 92  PHE A HD1  2  
ATOM 8950   H HD2  . PHE A 1 92  ? -26.682 0.541   -5.216  1.00 1.15  ? 92  PHE A HD2  2  
ATOM 8951   H HE1  . PHE A 1 92  ? -30.801 -1.039  -7.388  1.00 1.39  ? 92  PHE A HE1  2  
ATOM 8952   H HE2  . PHE A 1 92  ? -27.031 0.933   -7.621  1.00 1.17  ? 92  PHE A HE2  2  
ATOM 8953   H HZ   . PHE A 1 92  ? -29.093 0.146   -8.710  1.00 1.10  ? 92  PHE A HZ   2  
ATOM 8954   N N    . ASP A 1 93  ? -26.698 -3.923  -2.516  1.00 1.53  ? 93  ASP A N    2  
ATOM 8955   C CA   . ASP A 1 93  ? -25.376 -4.540  -2.324  1.00 1.71  ? 93  ASP A CA   2  
ATOM 8956   C C    . ASP A 1 93  ? -24.529 -4.501  -3.603  1.00 1.55  ? 93  ASP A C    2  
ATOM 8957   O O    . ASP A 1 93  ? -23.304 -4.617  -3.545  1.00 1.68  ? 93  ASP A O    2  
ATOM 8958   C CB   . ASP A 1 93  ? -25.541 -5.990  -1.858  1.00 1.99  ? 93  ASP A CB   2  
ATOM 8959   C CG   . ASP A 1 93  ? -25.635 -6.967  -3.012  1.00 1.99  ? 93  ASP A CG   2  
ATOM 8960   O OD1  . ASP A 1 93  ? -26.535 -6.808  -3.870  1.00 1.86  ? 93  ASP A OD1  2  
ATOM 8961   O OD2  . ASP A 1 93  ? -24.791 -7.885  -3.079  1.00 2.16  ? 93  ASP A OD2  2  
ATOM 8962   H H    . ASP A 1 93  ? -27.500 -4.451  -2.289  1.00 1.63  ? 93  ASP A H    2  
ATOM 8963   H HA   . ASP A 1 93  ? -24.864 -3.986  -1.554  1.00 1.80  ? 93  ASP A HA   2  
ATOM 8964   H HB2  . ASP A 1 93  ? -24.690 -6.264  -1.252  1.00 2.16  ? 93  ASP A HB2  2  
ATOM 8965   H HB3  . ASP A 1 93  ? -26.440 -6.072  -1.266  1.00 2.08  ? 93  ASP A HB3  2  
ATOM 8966   N N    . ARG A 1 94  ? -25.201 -4.373  -4.752  1.00 1.32  ? 94  ARG A N    2  
ATOM 8967   C CA   . ARG A 1 94  ? -24.545 -4.290  -6.062  1.00 1.20  ? 94  ARG A CA   2  
ATOM 8968   C C    . ARG A 1 94  ? -23.840 -5.590  -6.461  1.00 1.41  ? 94  ARG A C    2  
ATOM 8969   O O    . ARG A 1 94  ? -22.895 -5.566  -7.247  1.00 1.50  ? 94  ARG A O    2  
ATOM 8970   C CB   . ARG A 1 94  ? -23.534 -3.136  -6.093  1.00 1.14  ? 94  ARG A CB   2  
ATOM 8971   C CG   . ARG A 1 94  ? -24.124 -1.774  -5.764  1.00 1.05  ? 94  ARG A CG   2  
ATOM 8972   C CD   . ARG A 1 94  ? -23.200 -0.986  -4.851  1.00 1.38  ? 94  ARG A CD   2  
ATOM 8973   N NE   . ARG A 1 94  ? -21.799 -1.140  -5.240  1.00 1.67  ? 94  ARG A NE   2  
ATOM 8974   C CZ   . ARG A 1 94  ? -20.827 -0.313  -4.876  1.00 1.75  ? 94  ARG A CZ   2  
ATOM 8975   N NH1  . ARG A 1 94  ? -21.087 0.747   -4.118  1.00 1.64  ? 94  ARG A NH1  2  
ATOM 8976   N NH2  . ARG A 1 94  ? -19.587 -0.541  -5.273  1.00 2.11  ? 94  ARG A NH2  2  
ATOM 8977   H H    . ARG A 1 94  ? -26.178 -4.335  -4.711  1.00 1.28  ? 94  ARG A H    2  
ATOM 8978   H HA   . ARG A 1 94  ? -25.313 -4.087  -6.792  1.00 1.11  ? 94  ARG A HA   2  
ATOM 8979   H HB2  . ARG A 1 94  ? -22.751 -3.343  -5.378  1.00 1.35  ? 94  ARG A HB2  2  
ATOM 8980   H HB3  . ARG A 1 94  ? -23.098 -3.085  -7.081  1.00 1.14  ? 94  ARG A HB3  2  
ATOM 8981   H HG2  . ARG A 1 94  ? -24.269 -1.220  -6.680  1.00 1.05  ? 94  ARG A HG2  2  
ATOM 8982   H HG3  . ARG A 1 94  ? -25.075 -1.913  -5.270  1.00 0.98  ? 94  ARG A HG3  2  
ATOM 8983   H HD2  . ARG A 1 94  ? -23.469 0.059   -4.904  1.00 1.46  ? 94  ARG A HD2  2  
ATOM 8984   H HD3  . ARG A 1 94  ? -23.325 -1.338  -3.838  1.00 1.56  ? 94  ARG A HD3  2  
ATOM 8985   H HE   . ARG A 1 94  ? -21.574 -1.915  -5.807  1.00 1.92  ? 94  ARG A HE   2  
ATOM 8986   H HH11 . ARG A 1 94  ? -22.025 0.930   -3.814  1.00 1.49  ? 94  ARG A HH11 2  
ATOM 8987   H HH12 . ARG A 1 94  ? -20.341 1.373   -3.849  1.00 1.84  ? 94  ARG A HH12 2  
ATOM 8988   H HH21 . ARG A 1 94  ? -19.376 -1.345  -5.856  1.00 2.33  ? 94  ARG A HH21 2  
ATOM 8989   H HH22 . ARG A 1 94  ? -18.842 0.080   -4.994  1.00 2.23  ? 94  ARG A HH22 2  
ATOM 8990   N N    . PHE A 1 95  ? -24.290 -6.724  -5.947  1.00 1.61  ? 95  PHE A N    2  
ATOM 8991   C CA   . PHE A 1 95  ? -23.672 -7.995  -6.306  1.00 1.84  ? 95  PHE A CA   2  
ATOM 8992   C C    . PHE A 1 95  ? -24.710 -9.100  -6.364  1.00 2.08  ? 95  PHE A C    2  
ATOM 8993   O O    . PHE A 1 95  ? -25.050 -9.589  -7.441  1.00 2.20  ? 95  PHE A O    2  
ATOM 8994   C CB   . PHE A 1 95  ? -22.558 -8.369  -5.322  1.00 2.03  ? 95  PHE A CB   2  
ATOM 8995   C CG   . PHE A 1 95  ? -21.902 -9.691  -5.624  1.00 2.27  ? 95  PHE A CG   2  
ATOM 8996   C CD1  . PHE A 1 95  ? -20.933 -9.790  -6.608  1.00 2.27  ? 95  PHE A CD1  2  
ATOM 8997   C CD2  . PHE A 1 95  ? -22.250 -10.832 -4.917  1.00 2.59  ? 95  PHE A CD2  2  
ATOM 8998   C CE1  . PHE A 1 95  ? -20.323 -10.999 -6.882  1.00 2.51  ? 95  PHE A CE1  2  
ATOM 8999   C CE2  . PHE A 1 95  ? -21.645 -12.045 -5.188  1.00 2.83  ? 95  PHE A CE2  2  
ATOM 9000   C CZ   . PHE A 1 95  ? -20.680 -12.128 -6.171  1.00 2.76  ? 95  PHE A CZ   2  
ATOM 9001   H H    . PHE A 1 95  ? -25.047 -6.713  -5.316  1.00 1.67  ? 95  PHE A H    2  
ATOM 9002   H HA   . PHE A 1 95  ? -23.240 -7.879  -7.289  1.00 1.76  ? 95  PHE A HA   2  
ATOM 9003   H HB2  . PHE A 1 95  ? -21.795 -7.605  -5.346  1.00 1.94  ? 95  PHE A HB2  2  
ATOM 9004   H HB3  . PHE A 1 95  ? -22.973 -8.423  -4.326  1.00 2.12  ? 95  PHE A HB3  2  
ATOM 9005   H HD1  . PHE A 1 95  ? -20.654 -8.910  -7.164  1.00 2.15  ? 95  PHE A HD1  2  
ATOM 9006   H HD2  . PHE A 1 95  ? -23.008 -10.768 -4.149  1.00 2.70  ? 95  PHE A HD2  2  
ATOM 9007   H HE1  . PHE A 1 95  ? -19.568 -11.061 -7.654  1.00 2.55  ? 95  PHE A HE1  2  
ATOM 9008   H HE2  . PHE A 1 95  ? -21.926 -12.928 -4.631  1.00 3.11  ? 95  PHE A HE2  2  
ATOM 9009   H HZ   . PHE A 1 95  ? -20.202 -13.074 -6.382  1.00 2.95  ? 95  PHE A HZ   2  
ATOM 9010   N N    . SER A 1 96  ? -25.216 -9.471  -5.204  1.00 2.22  ? 96  SER A N    2  
ATOM 9011   C CA   . SER A 1 96  ? -26.210 -10.510 -5.106  1.00 2.49  ? 96  SER A CA   2  
ATOM 9012   C C    . SER A 1 96  ? -27.571 -9.960  -5.496  1.00 2.40  ? 96  SER A C    2  
ATOM 9013   O O    . SER A 1 96  ? -27.737 -8.748  -5.683  1.00 2.12  ? 96  SER A O    2  
ATOM 9014   C CB   . SER A 1 96  ? -26.246 -11.055 -3.675  1.00 2.76  ? 96  SER A CB   2  
ATOM 9015   O OG   . SER A 1 96  ? -24.988 -11.595 -3.294  1.00 2.90  ? 96  SER A OG   2  
ATOM 9016   H H    . SER A 1 96  ? -24.925 -9.010  -4.382  1.00 2.17  ? 96  SER A H    2  
ATOM 9017   H HA   . SER A 1 96  ? -25.940 -11.305 -5.784  1.00 2.63  ? 96  SER A HA   2  
ATOM 9018   H HB2  . SER A 1 96  ? -26.498 -10.253 -2.996  1.00 2.75  ? 96  SER A HB2  2  
ATOM 9019   H HB3  . SER A 1 96  ? -26.994 -11.830 -3.604  1.00 3.00  ? 96  SER A HB3  2  
ATOM 9020   H HG   . SER A 1 96  ? -25.125 -12.448 -2.869  1.00 2.84  ? 96  SER A HG   2  
ATOM 9021   N N    . LYS A 1 97  ? -28.541 -10.843 -5.637  1.00 2.68  ? 97  LYS A N    2  
ATOM 9022   C CA   . LYS A 1 97  ? -29.886 -10.428 -5.983  1.00 2.68  ? 97  LYS A CA   2  
ATOM 9023   C C    . LYS A 1 97  ? -30.578 -9.888  -4.738  1.00 2.65  ? 97  LYS A C    2  
ATOM 9024   O O    . LYS A 1 97  ? -31.432 -10.556 -4.150  1.00 2.91  ? 97  LYS A O    2  
ATOM 9025   C CB   . LYS A 1 97  ? -30.679 -11.594 -6.585  1.00 3.03  ? 97  LYS A CB   2  
ATOM 9026   C CG   . LYS A 1 97  ? -29.979 -12.267 -7.759  1.00 3.04  ? 97  LYS A CG   2  
ATOM 9027   C CD   . LYS A 1 97  ? -29.808 -11.317 -8.936  1.00 2.95  ? 97  LYS A CD   2  
ATOM 9028   C CE   . LYS A 1 97  ? -31.111 -11.119 -9.694  1.00 3.31  ? 97  LYS A CE   2  
ATOM 9029   N NZ   . LYS A 1 97  ? -31.516 -12.343 -10.433 1.00 3.63  ? 97  LYS A NZ   2  
ATOM 9030   H H    . LYS A 1 97  ? -28.347 -11.794 -5.504  1.00 2.91  ? 97  LYS A H    2  
ATOM 9031   H HA   . LYS A 1 97  ? -29.812 -9.631  -6.712  1.00 2.47  ? 97  LYS A HA   2  
ATOM 9032   H HB2  . LYS A 1 97  ? -30.846 -12.337 -5.818  1.00 3.23  ? 97  LYS A HB2  2  
ATOM 9033   H HB3  . LYS A 1 97  ? -31.635 -11.224 -6.928  1.00 3.16  ? 97  LYS A HB3  2  
ATOM 9034   H HG2  . LYS A 1 97  ? -29.003 -12.601 -7.440  1.00 2.96  ? 97  LYS A HG2  2  
ATOM 9035   H HG3  . LYS A 1 97  ? -30.565 -13.118 -8.076  1.00 3.32  ? 97  LYS A HG3  2  
ATOM 9036   H HD2  . LYS A 1 97  ? -29.469 -10.360 -8.569  1.00 2.81  ? 97  LYS A HD2  2  
ATOM 9037   H HD3  . LYS A 1 97  ? -29.069 -11.725 -9.609  1.00 3.01  ? 97  LYS A HD3  2  
ATOM 9038   H HE2  . LYS A 1 97  ? -31.887 -10.861 -8.990  1.00 3.38  ? 97  LYS A HE2  2  
ATOM 9039   H HE3  . LYS A 1 97  ? -30.982 -10.311 -10.396 1.00 3.53  ? 97  LYS A HE3  2  
ATOM 9040   H HZ1  . LYS A 1 97  ? -30.771 -12.620 -11.107 1.00 3.73  ? 97  LYS A HZ1  2  
ATOM 9041   H HZ2  . LYS A 1 97  ? -32.394 -12.170 -10.960 1.00 3.98  ? 97  LYS A HZ2  2  
ATOM 9042   H HZ3  . LYS A 1 97  ? -31.672 -13.126 -9.770  1.00 3.72  ? 97  LYS A HZ3  2  
ATOM 9043   N N    . HIS A 1 98  ? -30.147 -8.696  -4.320  1.00 2.38  ? 98  HIS A N    2  
ATOM 9044   C CA   . HIS A 1 98  ? -30.693 -8.022  -3.141  1.00 2.33  ? 98  HIS A CA   2  
ATOM 9045   C C    . HIS A 1 98  ? -32.212 -8.086  -3.139  1.00 2.37  ? 98  HIS A C    2  
ATOM 9046   O O    . HIS A 1 98  ? -32.861 -7.804  -4.149  1.00 2.31  ? 98  HIS A O    2  
ATOM 9047   C CB   . HIS A 1 98  ? -30.220 -6.560  -3.067  1.00 2.06  ? 98  HIS A CB   2  
ATOM 9048   C CG   . HIS A 1 98  ? -29.965 -5.927  -4.400  1.00 1.74  ? 98  HIS A CG   2  
ATOM 9049   N ND1  . HIS A 1 98  ? -28.729 -5.933  -5.008  1.00 1.60  ? 98  HIS A ND1  2  
ATOM 9050   C CD2  . HIS A 1 98  ? -30.796 -5.283  -5.250  1.00 1.63  ? 98  HIS A CD2  2  
ATOM 9051   C CE1  . HIS A 1 98  ? -28.813 -5.323  -6.175  1.00 1.42  ? 98  HIS A CE1  2  
ATOM 9052   N NE2  . HIS A 1 98  ? -30.059 -4.917  -6.349  1.00 1.45  ? 98  HIS A NE2  2  
ATOM 9053   H H    . HIS A 1 98  ? -29.425 -8.258  -4.822  1.00 2.25  ? 98  HIS A H    2  
ATOM 9054   H HA   . HIS A 1 98  ? -30.327 -8.547  -2.270  1.00 2.52  ? 98  HIS A HA   2  
ATOM 9055   H HB2  . HIS A 1 98  ? -30.975 -5.974  -2.563  1.00 2.12  ? 98  HIS A HB2  2  
ATOM 9056   H HB3  . HIS A 1 98  ? -29.304 -6.517  -2.496  1.00 2.17  ? 98  HIS A HB3  2  
ATOM 9057   H HD1  . HIS A 1 98  ? -27.898 -6.333  -4.630  1.00 1.72  ? 98  HIS A HD1  2  
ATOM 9058   H HD2  . HIS A 1 98  ? -31.848 -5.092  -5.095  1.00 1.75  ? 98  HIS A HD2  2  
ATOM 9059   H HE1  . HIS A 1 98  ? -28.000 -5.181  -6.872  1.00 1.36  ? 98  HIS A HE1  2  
ATOM 9060   H HE2  . HIS A 1 98  ? -30.444 -4.659  -7.216  1.00 1.49  ? 98  HIS A HE2  2  
ATOM 9061   N N    . ASP A 1 99  ? -32.761 -8.458  -2.001  1.00 2.56  ? 99  ASP A N    2  
ATOM 9062   C CA   . ASP A 1 99  ? -34.196 -8.608  -1.855  1.00 2.67  ? 99  ASP A CA   2  
ATOM 9063   C C    . ASP A 1 99  ? -34.766 -7.535  -0.936  1.00 2.53  ? 99  ASP A C    2  
ATOM 9064   O O    . ASP A 1 99  ? -34.020 -6.785  -0.306  1.00 2.38  ? 99  ASP A O    2  
ATOM 9065   C CB   . ASP A 1 99  ? -34.490 -9.999  -1.289  1.00 3.07  ? 99  ASP A CB   2  
ATOM 9066   C CG   . ASP A 1 99  ? -35.924 -10.434 -1.491  1.00 3.26  ? 99  ASP A CG   2  
ATOM 9067   O OD1  . ASP A 1 99  ? -36.681 -9.715  -2.171  1.00 3.68  ? 99  ASP A OD1  2  
ATOM 9068   O OD2  . ASP A 1 99  ? -36.297 -11.503 -0.967  1.00 3.23  ? 99  ASP A OD2  2  
ATOM 9069   H H    . ASP A 1 99  ? -32.186 -8.621  -1.226  1.00 2.66  ? 99  ASP A H    2  
ATOM 9070   H HA   . ASP A 1 99  ? -34.647 -8.518  -2.831  1.00 2.64  ? 99  ASP A HA   2  
ATOM 9071   H HB2  . ASP A 1 99  ? -33.850 -10.717 -1.774  1.00 3.22  ? 99  ASP A HB2  2  
ATOM 9072   H HB3  . ASP A 1 99  ? -34.282 -9.998  -0.229  1.00 3.17  ? 99  ASP A HB3  2  
ATOM 9073   N N    . ILE A 1 100 ? -36.088 -7.461  -0.882  1.00 2.62  ? 100 ILE A N    2  
ATOM 9074   C CA   . ILE A 1 100 ? -36.777 -6.507  -0.032  1.00 2.52  ? 100 ILE A CA   2  
ATOM 9075   C C    . ILE A 1 100 ? -36.640 -6.952  1.417   1.00 2.72  ? 100 ILE A C    2  
ATOM 9076   O O    . ILE A 1 100 ? -37.074 -8.049  1.777   1.00 3.00  ? 100 ILE A O    2  
ATOM 9077   C CB   . ILE A 1 100 ? -38.271 -6.397  -0.412  1.00 2.56  ? 100 ILE A CB   2  
ATOM 9078   C CG1  . ILE A 1 100 ? -38.410 -6.009  -1.886  1.00 2.45  ? 100 ILE A CG1  2  
ATOM 9079   C CG2  . ILE A 1 100 ? -38.975 -5.384  0.478   1.00 2.44  ? 100 ILE A CG2  2  
ATOM 9080   C CD1  . ILE A 1 100 ? -39.826 -6.106  -2.414  1.00 2.68  ? 100 ILE A CD1  2  
ATOM 9081   H H    . ILE A 1 100 ? -36.620 -8.089  -1.427  1.00 2.79  ? 100 ILE A H    2  
ATOM 9082   H HA   . ILE A 1 100 ? -36.313 -5.539  -0.156  1.00 2.29  ? 100 ILE A HA   2  
ATOM 9083   H HB   . ILE A 1 100 ? -38.732 -7.359  -0.256  1.00 2.81  ? 100 ILE A HB   2  
ATOM 9084   H HG12 . ILE A 1 100 ? -38.079 -4.989  -2.017  1.00 2.32  ? 100 ILE A HG12 2  
ATOM 9085   H HG13 . ILE A 1 100 ? -37.789 -6.662  -2.482  1.00 2.53  ? 100 ILE A HG13 2  
ATOM 9086   H HG21 . ILE A 1 100 ? -40.015 -5.318  0.195   1.00 2.49  ? 100 ILE A HG21 2  
ATOM 9087   H HG22 . ILE A 1 100 ? -38.507 -4.417  0.362   1.00 2.23  ? 100 ILE A HG22 2  
ATOM 9088   H HG23 . ILE A 1 100 ? -38.903 -5.698  1.509   1.00 2.60  ? 100 ILE A HG23 2  
ATOM 9089   H HD11 . ILE A 1 100 ? -40.169 -7.127  -2.342  1.00 3.05  ? 100 ILE A HD11 2  
ATOM 9090   H HD12 . ILE A 1 100 ? -39.845 -5.793  -3.448  1.00 2.73  ? 100 ILE A HD12 2  
ATOM 9091   H HD13 . ILE A 1 100 ? -40.470 -5.465  -1.832  1.00 2.86  ? 100 ILE A HD13 2  
ATOM 9092   N N    . ILE A 1 101 ? -36.018 -6.116  2.234   1.00 2.63  ? 101 ILE A N    2  
ATOM 9093   C CA   . ILE A 1 101 ? -35.797 -6.444  3.639   1.00 2.86  ? 101 ILE A CA   2  
ATOM 9094   C C    . ILE A 1 101 ? -37.111 -6.432  4.416   1.00 2.94  ? 101 ILE A C    2  
ATOM 9095   O O    . ILE A 1 101 ? -37.356 -7.299  5.256   1.00 3.20  ? 101 ILE A O    2  
ATOM 9096   C CB   . ILE A 1 101 ? -34.796 -5.470  4.309   1.00 2.81  ? 101 ILE A CB   2  
ATOM 9097   C CG1  . ILE A 1 101 ? -33.730 -4.997  3.310   1.00 2.53  ? 101 ILE A CG1  2  
ATOM 9098   C CG2  . ILE A 1 101 ? -34.135 -6.133  5.510   1.00 3.08  ? 101 ILE A CG2  2  
ATOM 9099   C CD1  . ILE A 1 101 ? -32.805 -6.095  2.829   1.00 2.63  ? 101 ILE A CD1  2  
ATOM 9100   H H    . ILE A 1 101 ? -35.703 -5.253  1.886   1.00 2.43  ? 101 ILE A H    2  
ATOM 9101   H HA   . ILE A 1 101 ? -35.378 -7.439  3.683   1.00 3.07  ? 101 ILE A HA   2  
ATOM 9102   H HB   . ILE A 1 101 ? -35.350 -4.615  4.666   1.00 2.97  ? 101 ILE A HB   2  
ATOM 9103   H HG12 . ILE A 1 101 ? -34.219 -4.579  2.444   1.00 2.46  ? 101 ILE A HG12 2  
ATOM 9104   H HG13 . ILE A 1 101 ? -33.124 -4.233  3.776   1.00 2.65  ? 101 ILE A HG13 2  
ATOM 9105   H HG21 . ILE A 1 101 ? -34.892 -6.583  6.136   1.00 3.37  ? 101 ILE A HG21 2  
ATOM 9106   H HG22 . ILE A 1 101 ? -33.592 -5.392  6.078   1.00 3.14  ? 101 ILE A HG22 2  
ATOM 9107   H HG23 . ILE A 1 101 ? -33.452 -6.895  5.169   1.00 3.09  ? 101 ILE A HG23 2  
ATOM 9108   H HD11 . ILE A 1 101 ? -32.305 -6.538  3.677   1.00 2.91  ? 101 ILE A HD11 2  
ATOM 9109   H HD12 . ILE A 1 101 ? -32.072 -5.680  2.155   1.00 2.68  ? 101 ILE A HD12 2  
ATOM 9110   H HD13 . ILE A 1 101 ? -33.382 -6.850  2.316   1.00 2.78  ? 101 ILE A HD13 2  
ATOM 9111   N N    . GLY A 1 102 ? -37.960 -5.459  4.115   1.00 2.74  ? 102 GLY A N    2  
ATOM 9112   C CA   . GLY A 1 102 ? -39.232 -5.352  4.794   1.00 2.81  ? 102 GLY A CA   2  
ATOM 9113   C C    . GLY A 1 102 ? -40.024 -4.155  4.330   1.00 2.55  ? 102 GLY A C    2  
ATOM 9114   O O    . GLY A 1 102 ? -39.582 -3.424  3.441   1.00 2.31  ? 102 GLY A O    2  
ATOM 9115   H H    . GLY A 1 102 ? -37.725 -4.813  3.417   1.00 2.56  ? 102 GLY A H    2  
ATOM 9116   H HA2  . GLY A 1 102 ? -39.805 -6.246  4.603   1.00 3.00  ? 102 GLY A HA2  2  
ATOM 9117   H HA3  . GLY A 1 102 ? -39.058 -5.266  5.855   1.00 2.90  ? 102 GLY A HA3  2  
ATOM 9118   N N    . GLU A 1 103 ? -41.177 -3.938  4.944   1.00 2.60  ? 103 GLU A N    2  
ATOM 9119   C CA   . GLU A 1 103 ? -42.046 -2.831  4.576   1.00 2.38  ? 103 GLU A CA   2  
ATOM 9120   C C    . GLU A 1 103 ? -43.096 -2.578  5.656   1.00 2.48  ? 103 GLU A C    2  
ATOM 9121   O O    . GLU A 1 103 ? -43.059 -3.182  6.733   1.00 2.66  ? 103 GLU A O    2  
ATOM 9122   C CB   . GLU A 1 103 ? -42.754 -3.147  3.254   1.00 2.38  ? 103 GLU A CB   2  
ATOM 9123   C CG   . GLU A 1 103 ? -43.663 -4.362  3.338   1.00 2.71  ? 103 GLU A CG   2  
ATOM 9124   C CD   . GLU A 1 103 ? -44.581 -4.500  2.144   1.00 2.86  ? 103 GLU A CD   2  
ATOM 9125   O OE1  . GLU A 1 103 ? -44.182 -5.141  1.157   1.00 2.94  ? 103 GLU A OE1  2  
ATOM 9126   O OE2  . GLU A 1 103 ? -45.719 -3.988  2.201   1.00 3.05  ? 103 GLU A OE2  2  
ATOM 9127   H H    . GLU A 1 103 ? -41.452 -4.538  5.674   1.00 2.79  ? 103 GLU A H    2  
ATOM 9128   H HA   . GLU A 1 103 ? -41.436 -1.946  4.454   1.00 2.18  ? 103 GLU A HA   2  
ATOM 9129   H HB2  . GLU A 1 103 ? -43.348 -2.296  2.961   1.00 2.26  ? 103 GLU A HB2  2  
ATOM 9130   H HB3  . GLU A 1 103 ? -42.010 -3.335  2.496   1.00 2.29  ? 103 GLU A HB3  2  
ATOM 9131   H HG2  . GLU A 1 103 ? -43.050 -5.247  3.402   1.00 2.78  ? 103 GLU A HG2  2  
ATOM 9132   H HG3  . GLU A 1 103 ? -44.266 -4.280  4.229   1.00 2.93  ? 103 GLU A HG3  2  
ATOM 9133   N N    . PHE A 1 104 ? -44.016 -1.672  5.354   1.00 2.39  ? 104 PHE A N    2  
ATOM 9134   C CA   . PHE A 1 104 ? -45.117 -1.336  6.243   1.00 2.48  ? 104 PHE A CA   2  
ATOM 9135   C C    . PHE A 1 104 ? -46.222 -0.682  5.423   1.00 2.36  ? 104 PHE A C    2  
ATOM 9136   O O    . PHE A 1 104 ? -45.944 0.011   4.441   1.00 2.15  ? 104 PHE A O    2  
ATOM 9137   C CB   . PHE A 1 104 ? -44.661 -0.424  7.397   1.00 2.44  ? 104 PHE A CB   2  
ATOM 9138   C CG   . PHE A 1 104 ? -44.503 1.034   7.043   1.00 2.20  ? 104 PHE A CG   2  
ATOM 9139   C CD1  . PHE A 1 104 ? -43.306 1.515   6.539   1.00 2.07  ? 104 PHE A CD1  2  
ATOM 9140   C CD2  . PHE A 1 104 ? -45.548 1.926   7.236   1.00 2.16  ? 104 PHE A CD2  2  
ATOM 9141   C CE1  . PHE A 1 104 ? -43.155 2.855   6.233   1.00 1.92  ? 104 PHE A CE1  2  
ATOM 9142   C CE2  . PHE A 1 104 ? -45.403 3.265   6.929   1.00 2.01  ? 104 PHE A CE2  2  
ATOM 9143   C CZ   . PHE A 1 104 ? -44.204 3.731   6.427   1.00 1.90  ? 104 PHE A CZ   2  
ATOM 9144   H H    . PHE A 1 104 ? -43.950 -1.210  4.492   1.00 2.28  ? 104 PHE A H    2  
ATOM 9145   H HA   . PHE A 1 104 ? -45.497 -2.262  6.653   1.00 2.68  ? 104 PHE A HA   2  
ATOM 9146   H HB2  . PHE A 1 104 ? -45.385 -0.488  8.194   1.00 2.59  ? 104 PHE A HB2  2  
ATOM 9147   H HB3  . PHE A 1 104 ? -43.708 -0.780  7.762   1.00 2.51  ? 104 PHE A HB3  2  
ATOM 9148   H HD1  . PHE A 1 104 ? -42.485 0.831   6.383   1.00 2.13  ? 104 PHE A HD1  2  
ATOM 9149   H HD2  . PHE A 1 104 ? -46.488 1.564   7.630   1.00 2.30  ? 104 PHE A HD2  2  
ATOM 9150   H HE1  . PHE A 1 104 ? -42.215 3.216   5.838   1.00 1.89  ? 104 PHE A HE1  2  
ATOM 9151   H HE2  . PHE A 1 104 ? -46.226 3.947   7.083   1.00 2.03  ? 104 PHE A HE2  2  
ATOM 9152   H HZ   . PHE A 1 104 ? -44.088 4.777   6.188   1.00 1.85  ? 104 PHE A HZ   2  
ATOM 9153   N N    . LYS A 1 105 ? -47.470 -0.912  5.811   1.00 2.53  ? 105 LYS A N    2  
ATOM 9154   C CA   . LYS A 1 105 ? -48.609 -0.360  5.088   1.00 2.48  ? 105 LYS A CA   2  
ATOM 9155   C C    . LYS A 1 105 ? -49.537 0.400   6.023   1.00 2.53  ? 105 LYS A C    2  
ATOM 9156   O O    . LYS A 1 105 ? -49.636 0.084   7.212   1.00 2.71  ? 105 LYS A O    2  
ATOM 9157   C CB   . LYS A 1 105 ? -49.386 -1.469  4.367   1.00 2.65  ? 105 LYS A CB   2  
ATOM 9158   C CG   . LYS A 1 105 ? -49.659 -2.701  5.223   1.00 2.90  ? 105 LYS A CG   2  
ATOM 9159   C CD   . LYS A 1 105 ? -48.630 -3.795  4.976   1.00 3.13  ? 105 LYS A CD   2  
ATOM 9160   C CE   . LYS A 1 105 ? -48.832 -4.462  3.624   1.00 3.31  ? 105 LYS A CE   2  
ATOM 9161   N NZ   . LYS A 1 105 ? -47.688 -5.339  3.263   1.00 3.55  ? 105 LYS A NZ   2  
ATOM 9162   H H    . LYS A 1 105 ? -47.630 -1.458  6.608   1.00 2.70  ? 105 LYS A H    2  
ATOM 9163   H HA   . LYS A 1 105 ? -48.224 0.328   4.351   1.00 2.32  ? 105 LYS A HA   2  
ATOM 9164   H HB2  . LYS A 1 105 ? -50.335 -1.071  4.038   1.00 2.64  ? 105 LYS A HB2  2  
ATOM 9165   H HB3  . LYS A 1 105 ? -48.821 -1.780  3.502   1.00 2.64  ? 105 LYS A HB3  2  
ATOM 9166   H HG2  . LYS A 1 105 ? -49.625 -2.418  6.264   1.00 2.89  ? 105 LYS A HG2  2  
ATOM 9167   H HG3  . LYS A 1 105 ? -50.639 -3.083  4.984   1.00 2.97  ? 105 LYS A HG3  2  
ATOM 9168   H HD2  . LYS A 1 105 ? -47.644 -3.358  5.006   1.00 3.06  ? 105 LYS A HD2  2  
ATOM 9169   H HD3  . LYS A 1 105 ? -48.717 -4.541  5.753   1.00 3.32  ? 105 LYS A HD3  2  
ATOM 9170   H HE2  . LYS A 1 105 ? -49.732 -5.056  3.661   1.00 3.46  ? 105 LYS A HE2  2  
ATOM 9171   H HE3  . LYS A 1 105 ? -48.938 -3.697  2.873   1.00 3.22  ? 105 LYS A HE3  2  
ATOM 9172   H HZ1  . LYS A 1 105 ? -47.940 -5.946  2.458   1.00 3.80  ? 105 LYS A HZ1  2  
ATOM 9173   H HZ2  . LYS A 1 105 ? -47.424 -5.939  4.069   1.00 3.31  ? 105 LYS A HZ2  2  
ATOM 9174   H HZ3  . LYS A 1 105 ? -46.862 -4.755  2.992   1.00 3.82  ? 105 LYS A HZ3  2  
ATOM 9175   N N    . VAL A 1 106 ? -50.223 1.393   5.475   1.00 2.41  ? 106 VAL A N    2  
ATOM 9176   C CA   . VAL A 1 106 ? -51.146 2.207   6.251   1.00 2.46  ? 106 VAL A CA   2  
ATOM 9177   C C    . VAL A 1 106 ? -52.472 2.385   5.508   1.00 2.48  ? 106 VAL A C    2  
ATOM 9178   O O    . VAL A 1 106 ? -52.495 2.795   4.345   1.00 2.38  ? 106 VAL A O    2  
ATOM 9179   C CB   . VAL A 1 106 ? -50.528 3.590   6.582   1.00 2.35  ? 106 VAL A CB   2  
ATOM 9180   C CG1  . VAL A 1 106 ? -49.975 4.258   5.329   1.00 2.16  ? 106 VAL A CG1  2  
ATOM 9181   C CG2  . VAL A 1 106 ? -51.542 4.493   7.271   1.00 2.45  ? 106 VAL A CG2  2  
ATOM 9182   H H    . VAL A 1 106 ? -50.104 1.588   4.518   1.00 2.30  ? 106 VAL A H    2  
ATOM 9183   H HA   . VAL A 1 106 ? -51.334 1.692   7.182   1.00 2.63  ? 106 VAL A HA   2  
ATOM 9184   H HB   . VAL A 1 106 ? -49.705 3.432   7.263   1.00 2.38  ? 106 VAL A HB   2  
ATOM 9185   H HG11 . VAL A 1 106 ? -49.567 5.223   5.586   1.00 2.15  ? 106 VAL A HG11 2  
ATOM 9186   H HG12 . VAL A 1 106 ? -50.770 4.383   4.607   1.00 2.19  ? 106 VAL A HG12 2  
ATOM 9187   H HG13 . VAL A 1 106 ? -49.198 3.639   4.905   1.00 2.10  ? 106 VAL A HG13 2  
ATOM 9188   H HG21 . VAL A 1 106 ? -51.880 4.023   8.182   1.00 2.61  ? 106 VAL A HG21 2  
ATOM 9189   H HG22 . VAL A 1 106 ? -52.386 4.654   6.616   1.00 2.46  ? 106 VAL A HG22 2  
ATOM 9190   H HG23 . VAL A 1 106 ? -51.082 5.441   7.504   1.00 2.40  ? 106 VAL A HG23 2  
ATOM 9191   N N    . PRO A 1 107 ? -53.594 2.038   6.156   1.00 2.66  ? 107 PRO A N    2  
ATOM 9192   C CA   . PRO A 1 107 ? -54.918 2.182   5.562   1.00 2.73  ? 107 PRO A CA   2  
ATOM 9193   C C    . PRO A 1 107 ? -55.435 3.615   5.684   1.00 2.57  ? 107 PRO A C    2  
ATOM 9194   O O    . PRO A 1 107 ? -55.997 4.004   6.711   1.00 2.58  ? 107 PRO A O    2  
ATOM 9195   C CB   . PRO A 1 107 ? -55.772 1.216   6.382   1.00 2.97  ? 107 PRO A CB   2  
ATOM 9196   C CG   . PRO A 1 107 ? -55.126 1.180   7.727   1.00 2.96  ? 107 PRO A CG   2  
ATOM 9197   C CD   . PRO A 1 107 ? -53.659 1.466   7.517   1.00 2.84  ? 107 PRO A CD   2  
ATOM 9198   H HA   . PRO A 1 107 ? -54.921 1.884   4.523   1.00 2.76  ? 107 PRO A HA   2  
ATOM 9199   H HB2  . PRO A 1 107 ? -56.785 1.585   6.439   1.00 3.04  ? 107 PRO A HB2  2  
ATOM 9200   H HB3  . PRO A 1 107 ? -55.763 0.240   5.918   1.00 3.10  ? 107 PRO A HB3  2  
ATOM 9201   H HG2  . PRO A 1 107 ? -55.565 1.938   8.361   1.00 2.89  ? 107 PRO A HG2  2  
ATOM 9202   H HG3  . PRO A 1 107 ? -55.256 0.204   8.170   1.00 3.12  ? 107 PRO A HG3  2  
ATOM 9203   H HD2  . PRO A 1 107 ? -53.306 2.178   8.250   1.00 2.79  ? 107 PRO A HD2  2  
ATOM 9204   H HD3  . PRO A 1 107 ? -53.086 0.552   7.575   1.00 2.97  ? 107 PRO A HD3  2  
ATOM 9205   N N    . MET A 1 108 ? -55.243 4.395   4.629   1.00 2.47  ? 108 MET A N    2  
ATOM 9206   C CA   . MET A 1 108 ? -55.665 5.794   4.616   1.00 2.36  ? 108 MET A CA   2  
ATOM 9207   C C    . MET A 1 108 ? -57.168 5.941   4.826   1.00 2.51  ? 108 MET A C    2  
ATOM 9208   O O    . MET A 1 108 ? -57.632 6.969   5.311   1.00 2.47  ? 108 MET A O    2  
ATOM 9209   C CB   . MET A 1 108 ? -55.253 6.470   3.308   1.00 2.30  ? 108 MET A CB   2  
ATOM 9210   C CG   . MET A 1 108 ? -53.749 6.628   3.152   1.00 2.15  ? 108 MET A CG   2  
ATOM 9211   S SD   . MET A 1 108 ? -52.940 7.166   4.674   1.00 1.97  ? 108 MET A SD   2  
ATOM 9212   C CE   . MET A 1 108 ? -53.734 8.749   4.949   1.00 1.93  ? 108 MET A CE   2  
ATOM 9213   H H    . MET A 1 108 ? -54.796 4.027   3.840   1.00 2.49  ? 108 MET A H    2  
ATOM 9214   H HA   . MET A 1 108 ? -55.159 6.291   5.431   1.00 2.24  ? 108 MET A HA   2  
ATOM 9215   H HB2  . MET A 1 108 ? -55.620 5.883   2.480   1.00 2.44  ? 108 MET A HB2  2  
ATOM 9216   H HB3  . MET A 1 108 ? -55.700 7.450   3.267   1.00 2.27  ? 108 MET A HB3  2  
ATOM 9217   H HG2  . MET A 1 108 ? -53.332 5.677   2.856   1.00 2.22  ? 108 MET A HG2  2  
ATOM 9218   H HG3  . MET A 1 108 ? -53.556 7.359   2.381   1.00 2.14  ? 108 MET A HG3  2  
ATOM 9219   H HE1  . MET A 1 108 ? -53.504 9.413   4.129   1.00 1.97  ? 108 MET A HE1  2  
ATOM 9220   H HE2  . MET A 1 108 ? -53.372 9.177   5.872   1.00 1.92  ? 108 MET A HE2  2  
ATOM 9221   H HE3  . MET A 1 108 ? -54.804 8.610   5.012   1.00 1.99  ? 108 MET A HE3  2  
ATOM 9222   N N    . ASN A 1 109 ? -57.927 4.912   4.465   1.00 2.71  ? 109 ASN A N    2  
ATOM 9223   C CA   . ASN A 1 109 ? -59.377 4.943   4.631   1.00 2.87  ? 109 ASN A CA   2  
ATOM 9224   C C    . ASN A 1 109 ? -59.740 5.108   6.104   1.00 2.86  ? 109 ASN A C    2  
ATOM 9225   O O    . ASN A 1 109 ? -60.727 5.756   6.448   1.00 2.91  ? 109 ASN A O    2  
ATOM 9226   C CB   . ASN A 1 109 ? -60.007 3.661   4.080   1.00 3.11  ? 109 ASN A CB   2  
ATOM 9227   C CG   . ASN A 1 109 ? -61.517 3.764   3.937   1.00 3.31  ? 109 ASN A CG   2  
ATOM 9228   O OD1  . ASN A 1 109 ? -62.062 4.839   3.691   1.00 3.30  ? 109 ASN A OD1  2  
ATOM 9229   N ND2  . ASN A 1 109 ? -62.204 2.639   4.084   1.00 3.54  ? 109 ASN A ND2  2  
ATOM 9230   H H    . ASN A 1 109 ? -57.506 4.123   4.074   1.00 2.76  ? 109 ASN A H    2  
ATOM 9231   H HA   . ASN A 1 109 ? -59.757 5.791   4.081   1.00 2.85  ? 109 ASN A HA   2  
ATOM 9232   H HB2  . ASN A 1 109 ? -59.587 3.452   3.108   1.00 3.13  ? 109 ASN A HB2  2  
ATOM 9233   H HB3  . ASN A 1 109 ? -59.782 2.844   4.748   1.00 3.16  ? 109 ASN A HB3  2  
ATOM 9234   H HD21 . ASN A 1 109 ? -61.707 1.814   4.273   1.00 3.60  ? 109 ASN A HD21 2  
ATOM 9235   H HD22 . ASN A 1 109 ? -63.180 2.678   3.999   1.00 3.67  ? 109 ASN A HD22 2  
ATOM 9236   N N    . THR A 1 110 ? -58.926 4.521   6.966   1.00 2.82  ? 110 THR A N    2  
ATOM 9237   C CA   . THR A 1 110 ? -59.143 4.593   8.396   1.00 2.86  ? 110 THR A CA   2  
ATOM 9238   C C    . THR A 1 110 ? -58.411 5.793   8.994   1.00 2.66  ? 110 THR A C    2  
ATOM 9239   O O    . THR A 1 110 ? -58.897 6.433   9.929   1.00 2.75  ? 110 THR A O    2  
ATOM 9240   C CB   . THR A 1 110 ? -58.653 3.306   9.075   1.00 3.01  ? 110 THR A CB   2  
ATOM 9241   O OG1  . THR A 1 110 ? -58.645 2.230   8.122   1.00 3.14  ? 110 THR A OG1  2  
ATOM 9242   C CG2  . THR A 1 110 ? -59.537 2.941   10.257  1.00 3.22  ? 110 THR A CG2  2  
ATOM 9243   H H    . THR A 1 110 ? -58.154 4.021   6.629   1.00 2.80  ? 110 THR A H    2  
ATOM 9244   H HA   . THR A 1 110 ? -60.204 4.697   8.574   1.00 2.97  ? 110 THR A HA   2  
ATOM 9245   H HB   . THR A 1 110 ? -57.647 3.469   9.432   1.00 2.93  ? 110 THR A HB   2  
ATOM 9246   H HG1  . THR A 1 110 ? -59.091 1.464   8.500   1.00 3.36  ? 110 THR A HG1  2  
ATOM 9247   H HG21 . THR A 1 110 ? -60.560 2.839   9.925   1.00 3.39  ? 110 THR A HG21 2  
ATOM 9248   H HG22 . THR A 1 110 ? -59.476 3.716   11.005  1.00 3.20  ? 110 THR A HG22 2  
ATOM 9249   H HG23 . THR A 1 110 ? -59.201 2.006   10.680  1.00 3.32  ? 110 THR A HG23 2  
ATOM 9250   N N    . VAL A 1 111 ? -57.243 6.097   8.441   1.00 2.47  ? 111 VAL A N    2  
ATOM 9251   C CA   . VAL A 1 111 ? -56.441 7.217   8.912   1.00 2.31  ? 111 VAL A CA   2  
ATOM 9252   C C    . VAL A 1 111 ? -56.913 8.521   8.273   1.00 2.27  ? 111 VAL A C    2  
ATOM 9253   O O    . VAL A 1 111 ? -56.496 8.878   7.170   1.00 2.31  ? 111 VAL A O    2  
ATOM 9254   C CB   . VAL A 1 111 ? -54.939 7.006   8.615   1.00 2.18  ? 111 VAL A CB   2  
ATOM 9255   C CG1  . VAL A 1 111 ? -54.109 8.147   9.186   1.00 2.11  ? 111 VAL A CG1  2  
ATOM 9256   C CG2  . VAL A 1 111 ? -54.469 5.671   9.176   1.00 2.26  ? 111 VAL A CG2  2  
ATOM 9257   H H    . VAL A 1 111 ? -56.913 5.558   7.691   1.00 2.48  ? 111 VAL A H    2  
ATOM 9258   H HA   . VAL A 1 111 ? -56.568 7.287   9.983   1.00 2.38  ? 111 VAL A HA   2  
ATOM 9259   H HB   . VAL A 1 111 ? -54.803 6.990   7.544   1.00 2.16  ? 111 VAL A HB   2  
ATOM 9260   H HG11 . VAL A 1 111 ? -53.067 7.991   8.945   1.00 2.07  ? 111 VAL A HG11 2  
ATOM 9261   H HG12 . VAL A 1 111 ? -54.229 8.175   10.259  1.00 2.18  ? 111 VAL A HG12 2  
ATOM 9262   H HG13 . VAL A 1 111 ? -54.443 9.081   8.762   1.00 2.13  ? 111 VAL A HG13 2  
ATOM 9263   H HG21 . VAL A 1 111 ? -55.021 4.870   8.705   1.00 2.32  ? 111 VAL A HG21 2  
ATOM 9264   H HG22 . VAL A 1 111 ? -54.638 5.648   10.241  1.00 2.39  ? 111 VAL A HG22 2  
ATOM 9265   H HG23 . VAL A 1 111 ? -53.415 5.548   8.975   1.00 2.22  ? 111 VAL A HG23 2  
ATOM 9266   N N    . ASP A 1 112 ? -57.799 9.218   8.969   1.00 2.30  ? 112 ASP A N    2  
ATOM 9267   C CA   . ASP A 1 112 ? -58.338 10.478  8.484   1.00 2.31  ? 112 ASP A CA   2  
ATOM 9268   C C    . ASP A 1 112 ? -57.272 11.568  8.523   1.00 2.18  ? 112 ASP A C    2  
ATOM 9269   O O    . ASP A 1 112 ? -56.409 11.580  9.406   1.00 2.18  ? 112 ASP A O    2  
ATOM 9270   C CB   . ASP A 1 112 ? -59.555 10.899  9.315   1.00 2.49  ? 112 ASP A CB   2  
ATOM 9271   C CG   . ASP A 1 112 ? -59.214 11.176  10.767  1.00 2.54  ? 112 ASP A CG   2  
ATOM 9272   O OD1  . ASP A 1 112 ? -58.939 10.209  11.514  1.00 2.74  ? 112 ASP A OD1  2  
ATOM 9273   O OD2  . ASP A 1 112 ? -59.233 12.356  11.172  1.00 2.59  ? 112 ASP A OD2  2  
ATOM 9274   H H    . ASP A 1 112 ? -58.095 8.875   9.838   1.00 2.39  ? 112 ASP A H    2  
ATOM 9275   H HA   . ASP A 1 112 ? -58.646 10.332  7.460   1.00 2.36  ? 112 ASP A HA   2  
ATOM 9276   H HB2  . ASP A 1 112 ? -59.978 11.795  8.890   1.00 2.53  ? 112 ASP A HB2  2  
ATOM 9277   H HB3  . ASP A 1 112 ? -60.291 10.111  9.283   1.00 2.73  ? 112 ASP A HB3  2  
ATOM 9278   N N    . PHE A 1 113 ? -57.341 12.484  7.568   1.00 2.17  ? 113 PHE A N    2  
ATOM 9279   C CA   . PHE A 1 113 ? -56.381 13.575  7.481   1.00 2.14  ? 113 PHE A CA   2  
ATOM 9280   C C    . PHE A 1 113 ? -56.803 14.746  8.365   1.00 2.26  ? 113 PHE A C    2  
ATOM 9281   O O    . PHE A 1 113 ? -57.177 15.811  7.874   1.00 2.39  ? 113 PHE A O    2  
ATOM 9282   C CB   . PHE A 1 113 ? -56.204 14.033  6.024   1.00 2.20  ? 113 PHE A CB   2  
ATOM 9283   C CG   . PHE A 1 113 ? -57.468 14.005  5.202   1.00 2.37  ? 113 PHE A CG   2  
ATOM 9284   C CD1  . PHE A 1 113 ? -58.356 15.071  5.218   1.00 2.62  ? 113 PHE A CD1  2  
ATOM 9285   C CD2  . PHE A 1 113 ? -57.761 12.910  4.406   1.00 2.40  ? 113 PHE A CD2  2  
ATOM 9286   C CE1  . PHE A 1 113 ? -59.510 15.043  4.458   1.00 2.82  ? 113 PHE A CE1  2  
ATOM 9287   C CE2  . PHE A 1 113 ? -58.914 12.876  3.645   1.00 2.63  ? 113 PHE A CE2  2  
ATOM 9288   C CZ   . PHE A 1 113 ? -59.790 13.944  3.671   1.00 2.81  ? 113 PHE A CZ   2  
ATOM 9289   H H    . PHE A 1 113 ? -58.061 12.430  6.907   1.00 2.26  ? 113 PHE A H    2  
ATOM 9290   H HA   . PHE A 1 113 ? -55.434 13.202  7.844   1.00 2.08  ? 113 PHE A HA   2  
ATOM 9291   H HB2  . PHE A 1 113 ? -55.829 15.045  6.017   1.00 2.28  ? 113 PHE A HB2  2  
ATOM 9292   H HB3  . PHE A 1 113 ? -55.482 13.388  5.543   1.00 2.12  ? 113 PHE A HB3  2  
ATOM 9293   H HD1  . PHE A 1 113 ? -58.139 15.931  5.833   1.00 2.71  ? 113 PHE A HD1  2  
ATOM 9294   H HD2  . PHE A 1 113 ? -57.078 12.073  4.386   1.00 2.33  ? 113 PHE A HD2  2  
ATOM 9295   H HE1  . PHE A 1 113 ? -60.195 15.880  4.479   1.00 3.05  ? 113 PHE A HE1  2  
ATOM 9296   H HE2  . PHE A 1 113 ? -59.131 12.015  3.030   1.00 2.74  ? 113 PHE A HE2  2  
ATOM 9297   H HZ   . PHE A 1 113 ? -60.691 13.920  3.077   1.00 3.02  ? 113 PHE A HZ   2  
ATOM 9298   N N    . GLY A 1 114 ? -56.753 14.530  9.674   1.00 2.31  ? 114 GLY A N    2  
ATOM 9299   C CA   . GLY A 1 114 ? -57.124 15.568  10.614  1.00 2.47  ? 114 GLY A CA   2  
ATOM 9300   C C    . GLY A 1 114 ? -56.207 16.771  10.526  1.00 2.51  ? 114 GLY A C    2  
ATOM 9301   O O    . GLY A 1 114 ? -56.624 17.856  10.119  1.00 2.65  ? 114 GLY A O    2  
ATOM 9302   H H    . GLY A 1 114 ? -56.467 13.652  10.005  1.00 2.31  ? 114 GLY A H    2  
ATOM 9303   H HA2  . GLY A 1 114 ? -58.136 15.882  10.411  1.00 2.57  ? 114 GLY A HA2  2  
ATOM 9304   H HA3  . GLY A 1 114 ? -57.077 15.166  11.616  1.00 2.55  ? 114 GLY A HA3  2  
ATOM 9305   N N    . HIS A 1 115 ? -54.953 16.581  10.906  1.00 2.45  ? 115 HIS A N    2  
ATOM 9306   C CA   . HIS A 1 115 ? -53.971 17.653  10.860  1.00 2.55  ? 115 HIS A CA   2  
ATOM 9307   C C    . HIS A 1 115 ? -52.607 17.115  10.439  1.00 2.47  ? 115 HIS A C    2  
ATOM 9308   O O    . HIS A 1 115 ? -52.135 17.403  9.341   1.00 2.44  ? 115 HIS A O    2  
ATOM 9309   C CB   . HIS A 1 115 ? -53.874 18.360  12.216  1.00 2.72  ? 115 HIS A CB   2  
ATOM 9310   C CG   . HIS A 1 115 ? -54.476 19.735  12.222  1.00 2.84  ? 115 HIS A CG   2  
ATOM 9311   N ND1  . HIS A 1 115 ? -53.754 20.875  12.515  1.00 3.01  ? 115 HIS A ND1  2  
ATOM 9312   C CD2  . HIS A 1 115 ? -55.740 20.151  11.973  1.00 3.04  ? 115 HIS A CD2  2  
ATOM 9313   C CE1  . HIS A 1 115 ? -54.549 21.928  12.442  1.00 3.18  ? 115 HIS A CE1  2  
ATOM 9314   N NE2  . HIS A 1 115 ? -55.757 21.515  12.117  1.00 3.19  ? 115 HIS A NE2  2  
ATOM 9315   H H    . HIS A 1 115 ? -54.679 15.693  11.227  1.00 2.39  ? 115 HIS A H    2  
ATOM 9316   H HA   . HIS A 1 115 ? -54.301 18.365  10.121  1.00 2.61  ? 115 HIS A HA   2  
ATOM 9317   H HB2  . HIS A 1 115 ? -54.390 17.768  12.958  1.00 2.71  ? 115 HIS A HB2  2  
ATOM 9318   H HB3  . HIS A 1 115 ? -52.835 18.450  12.495  1.00 2.88  ? 115 HIS A HB3  2  
ATOM 9319   H HD1  . HIS A 1 115 ? -52.801 20.907  12.752  1.00 3.14  ? 115 HIS A HD1  2  
ATOM 9320   H HD2  . HIS A 1 115 ? -56.581 19.527  11.710  1.00 3.22  ? 115 HIS A HD2  2  
ATOM 9321   H HE1  . HIS A 1 115 ? -54.258 22.952  12.620  1.00 3.41  ? 115 HIS A HE1  2  
ATOM 9322   H HE2  . HIS A 1 115 ? -56.542 22.096  11.991  1.00 3.39  ? 115 HIS A HE2  2  
ATOM 9323   N N    . VAL A 1 116 ? -51.989 16.320  11.306  1.00 2.50  ? 116 VAL A N    2  
ATOM 9324   C CA   . VAL A 1 116 ? -50.676 15.746  11.023  1.00 2.44  ? 116 VAL A CA   2  
ATOM 9325   C C    . VAL A 1 116 ? -50.530 14.376  11.678  1.00 2.39  ? 116 VAL A C    2  
ATOM 9326   O O    . VAL A 1 116 ? -50.556 14.254  12.903  1.00 2.52  ? 116 VAL A O    2  
ATOM 9327   C CB   . VAL A 1 116 ? -49.514 16.657  11.497  1.00 2.61  ? 116 VAL A CB   2  
ATOM 9328   C CG1  . VAL A 1 116 ? -49.186 17.708  10.446  1.00 2.67  ? 116 VAL A CG1  2  
ATOM 9329   C CG2  . VAL A 1 116 ? -49.842 17.315  12.831  1.00 2.82  ? 116 VAL A CG2  2  
ATOM 9330   H H    . VAL A 1 116 ? -52.438 16.093  12.151  1.00 2.61  ? 116 VAL A H    2  
ATOM 9331   H HA   . VAL A 1 116 ? -50.597 15.627  9.954   1.00 2.33  ? 116 VAL A HA   2  
ATOM 9332   H HB   . VAL A 1 116 ? -48.640 16.039  11.634  1.00 2.60  ? 116 VAL A HB   2  
ATOM 9333   H HG11 . VAL A 1 116 ? -50.049 18.339  10.287  1.00 2.78  ? 116 VAL A HG11 2  
ATOM 9334   H HG12 . VAL A 1 116 ? -48.922 17.219  9.520   1.00 2.62  ? 116 VAL A HG12 2  
ATOM 9335   H HG13 . VAL A 1 116 ? -48.357 18.312  10.784  1.00 2.78  ? 116 VAL A HG13 2  
ATOM 9336   H HG21 . VAL A 1 116 ? -50.677 17.989  12.706  1.00 2.90  ? 116 VAL A HG21 2  
ATOM 9337   H HG22 . VAL A 1 116 ? -48.983 17.867  13.182  1.00 2.90  ? 116 VAL A HG22 2  
ATOM 9338   H HG23 . VAL A 1 116 ? -50.099 16.554  13.552  1.00 2.91  ? 116 VAL A HG23 2  
ATOM 9339   N N    . THR A 1 117 ? -50.376 13.348  10.858  1.00 2.25  ? 117 THR A N    2  
ATOM 9340   C CA   . THR A 1 117 ? -50.225 11.993  11.359  1.00 2.25  ? 117 THR A CA   2  
ATOM 9341   C C    . THR A 1 117 ? -48.759 11.683  11.643  1.00 2.30  ? 117 THR A C    2  
ATOM 9342   O O    . THR A 1 117 ? -48.022 11.237  10.760  1.00 2.17  ? 117 THR A O    2  
ATOM 9343   C CB   . THR A 1 117 ? -50.778 10.968  10.354  1.00 2.10  ? 117 THR A CB   2  
ATOM 9344   O OG1  . THR A 1 117 ? -51.832 11.562  9.582   1.00 2.08  ? 117 THR A OG1  2  
ATOM 9345   C CG2  . THR A 1 117 ? -51.299 9.733   11.070  1.00 2.22  ? 117 THR A CG2  2  
ATOM 9346   H H    . THR A 1 117 ? -50.362 13.504  9.889   1.00 2.19  ? 117 THR A H    2  
ATOM 9347   H HA   . THR A 1 117 ? -50.790 11.909  12.278  1.00 2.39  ? 117 THR A HA   2  
ATOM 9348   H HB   . THR A 1 117 ? -49.979 10.670  9.693   1.00 1.99  ? 117 THR A HB   2  
ATOM 9349   H HG1  . THR A 1 117 ? -52.672 11.160  9.825   1.00 2.24  ? 117 THR A HG1  2  
ATOM 9350   H HG21 . THR A 1 117 ? -52.111 10.009  11.727  1.00 2.36  ? 117 THR A HG21 2  
ATOM 9351   H HG22 . THR A 1 117 ? -50.502 9.291   11.650  1.00 2.31  ? 117 THR A HG22 2  
ATOM 9352   H HG23 . THR A 1 117 ? -51.652 9.018   10.341  1.00 2.17  ? 117 THR A HG23 2  
ATOM 9353   N N    . GLU A 1 118 ? -48.333 11.955  12.865  1.00 2.50  ? 118 GLU A N    2  
ATOM 9354   C CA   . GLU A 1 118 ? -46.961 11.700  13.275  1.00 2.61  ? 118 GLU A CA   2  
ATOM 9355   C C    . GLU A 1 118 ? -46.919 10.501  14.209  1.00 2.74  ? 118 GLU A C    2  
ATOM 9356   O O    . GLU A 1 118 ? -47.507 10.528  15.292  1.00 2.89  ? 118 GLU A O    2  
ATOM 9357   C CB   . GLU A 1 118 ? -46.381 12.936  13.962  1.00 2.82  ? 118 GLU A CB   2  
ATOM 9358   C CG   . GLU A 1 118 ? -46.532 14.203  13.138  1.00 2.78  ? 118 GLU A CG   2  
ATOM 9359   C CD   . GLU A 1 118 ? -46.149 15.450  13.905  1.00 3.08  ? 118 GLU A CD   2  
ATOM 9360   O OE1  . GLU A 1 118 ? -46.884 15.825  14.844  1.00 3.39  ? 118 GLU A OE1  2  
ATOM 9361   O OE2  . GLU A 1 118 ? -45.119 16.066  13.569  1.00 3.25  ? 118 GLU A OE2  2  
ATOM 9362   H H    . GLU A 1 118 ? -48.958 12.343  13.513  1.00 2.60  ? 118 GLU A H    2  
ATOM 9363   H HA   . GLU A 1 118 ? -46.382 11.478  12.391  1.00 2.49  ? 118 GLU A HA   2  
ATOM 9364   H HB2  . GLU A 1 118 ? -46.887 13.079  14.906  1.00 2.99  ? 118 GLU A HB2  2  
ATOM 9365   H HB3  . GLU A 1 118 ? -45.331 12.772  14.147  1.00 2.89  ? 118 GLU A HB3  2  
ATOM 9366   H HG2  . GLU A 1 118 ? -45.898 14.128  12.268  1.00 2.68  ? 118 GLU A HG2  2  
ATOM 9367   H HG3  . GLU A 1 118 ? -47.561 14.292  12.825  1.00 2.72  ? 118 GLU A HG3  2  
ATOM 9368   N N    . GLU A 1 119 ? -46.240 9.445   13.784  1.00 2.70  ? 119 GLU A N    2  
ATOM 9369   C CA   . GLU A 1 119 ? -46.140 8.233   14.584  1.00 2.86  ? 119 GLU A CA   2  
ATOM 9370   C C    . GLU A 1 119 ? -44.886 7.448   14.226  1.00 2.87  ? 119 GLU A C    2  
ATOM 9371   O O    . GLU A 1 119 ? -44.253 7.706   13.200  1.00 2.72  ? 119 GLU A O    2  
ATOM 9372   C CB   . GLU A 1 119 ? -47.377 7.358   14.371  1.00 2.82  ? 119 GLU A CB   2  
ATOM 9373   C CG   . GLU A 1 119 ? -47.704 7.118   12.907  1.00 2.58  ? 119 GLU A CG   2  
ATOM 9374   C CD   . GLU A 1 119 ? -48.449 5.820   12.681  1.00 2.64  ? 119 GLU A CD   2  
ATOM 9375   O OE1  . GLU A 1 119 ? -49.628 5.724   13.082  1.00 2.77  ? 119 GLU A OE1  2  
ATOM 9376   O OE2  . GLU A 1 119 ? -47.860 4.888   12.098  1.00 2.64  ? 119 GLU A OE2  2  
ATOM 9377   H H    . GLU A 1 119 ? -45.787 9.480   12.912  1.00 2.59  ? 119 GLU A H    2  
ATOM 9378   H HA   . GLU A 1 119 ? -46.088 8.523   15.621  1.00 3.05  ? 119 GLU A HA   2  
ATOM 9379   H HB2  . GLU A 1 119 ? -47.214 6.401   14.845  1.00 2.95  ? 119 GLU A HB2  2  
ATOM 9380   H HB3  . GLU A 1 119 ? -48.226 7.840   14.832  1.00 2.87  ? 119 GLU A HB3  2  
ATOM 9381   H HG2  . GLU A 1 119 ? -48.315 7.932   12.550  1.00 2.49  ? 119 GLU A HG2  2  
ATOM 9382   H HG3  . GLU A 1 119 ? -46.779 7.090   12.346  1.00 2.52  ? 119 GLU A HG3  2  
ATOM 9383   N N    . TRP A 1 120 ? -44.531 6.503   15.082  1.00 3.07  ? 120 TRP A N    2  
ATOM 9384   C CA   . TRP A 1 120 ? -43.365 5.665   14.866  1.00 3.13  ? 120 TRP A CA   2  
ATOM 9385   C C    . TRP A 1 120 ? -43.830 4.248   14.547  1.00 3.10  ? 120 TRP A C    2  
ATOM 9386   O O    . TRP A 1 120 ? -43.874 3.380   15.421  1.00 3.33  ? 120 TRP A O    2  
ATOM 9387   C CB   . TRP A 1 120 ? -42.446 5.664   16.099  1.00 3.44  ? 120 TRP A CB   2  
ATOM 9388   C CG   . TRP A 1 120 ? -42.553 6.896   16.954  1.00 3.59  ? 120 TRP A CG   2  
ATOM 9389   C CD1  . TRP A 1 120 ? -42.917 6.943   18.270  1.00 3.82  ? 120 TRP A CD1  2  
ATOM 9390   C CD2  . TRP A 1 120 ? -42.293 8.252   16.563  1.00 3.61  ? 120 TRP A CD2  2  
ATOM 9391   N NE1  . TRP A 1 120 ? -42.902 8.241   18.719  1.00 3.96  ? 120 TRP A NE1  2  
ATOM 9392   C CE2  . TRP A 1 120 ? -42.521 9.063   17.693  1.00 3.84  ? 120 TRP A CE2  2  
ATOM 9393   C CE3  . TRP A 1 120 ? -41.897 8.858   15.371  1.00 3.51  ? 120 TRP A CE3  2  
ATOM 9394   C CZ2  . TRP A 1 120 ? -42.361 10.444  17.660  1.00 3.98  ? 120 TRP A CZ2  2  
ATOM 9395   C CZ3  . TRP A 1 120 ? -41.734 10.230  15.341  1.00 3.67  ? 120 TRP A CZ3  2  
ATOM 9396   C CH2  . TRP A 1 120 ? -41.966 11.010  16.480  1.00 3.90  ? 120 TRP A CH2  2  
ATOM 9397   H H    . TRP A 1 120 ? -45.077 6.356   15.885  1.00 3.20  ? 120 TRP A H    2  
ATOM 9398   H HA   . TRP A 1 120 ? -42.824 6.056   14.016  1.00 3.00  ? 120 TRP A HA   2  
ATOM 9399   H HB2  . TRP A 1 120 ? -42.689 4.812   16.717  1.00 3.60  ? 120 TRP A HB2  2  
ATOM 9400   H HB3  . TRP A 1 120 ? -41.421 5.578   15.769  1.00 3.47  ? 120 TRP A HB3  2  
ATOM 9401   H HD1  . TRP A 1 120 ? -43.175 6.077   18.860  1.00 3.93  ? 120 TRP A HD1  2  
ATOM 9402   H HE1  . TRP A 1 120 ? -43.124 8.532   19.631  1.00 4.15  ? 120 TRP A HE1  2  
ATOM 9403   H HE3  . TRP A 1 120 ? -41.715 8.273   14.481  1.00 3.36  ? 120 TRP A HE3  2  
ATOM 9404   H HZ2  . TRP A 1 120 ? -42.534 11.060  18.531  1.00 4.20  ? 120 TRP A HZ2  2  
ATOM 9405   H HZ3  . TRP A 1 120 ? -41.425 10.716  14.428  1.00 3.66  ? 120 TRP A HZ3  2  
ATOM 9406   H HH2  . TRP A 1 120 ? -41.829 12.078  16.409  1.00 4.06  ? 120 TRP A HH2  2  
ATOM 9407   N N    . ARG A 1 121 ? -44.208 4.039   13.295  1.00 2.87  ? 121 ARG A N    2  
ATOM 9408   C CA   . ARG A 1 121 ? -44.705 2.748   12.836  1.00 2.87  ? 121 ARG A CA   2  
ATOM 9409   C C    . ARG A 1 121 ? -43.612 1.687   12.850  1.00 3.01  ? 121 ARG A C    2  
ATOM 9410   O O    . ARG A 1 121 ? -42.463 1.953   12.499  1.00 2.97  ? 121 ARG A O    2  
ATOM 9411   C CB   . ARG A 1 121 ? -45.285 2.888   11.422  1.00 2.61  ? 121 ARG A CB   2  
ATOM 9412   C CG   . ARG A 1 121 ? -45.911 1.614   10.864  1.00 2.67  ? 121 ARG A CG   2  
ATOM 9413   C CD   . ARG A 1 121 ? -47.047 1.103   11.738  1.00 2.89  ? 121 ARG A CD   2  
ATOM 9414   N NE   . ARG A 1 121 ? -47.989 2.160   12.104  1.00 2.86  ? 121 ARG A NE   2  
ATOM 9415   C CZ   . ARG A 1 121 ? -49.215 1.933   12.568  1.00 3.05  ? 121 ARG A CZ   2  
ATOM 9416   N NH1  . ARG A 1 121 ? -49.668 0.690   12.687  1.00 3.31  ? 121 ARG A NH1  2  
ATOM 9417   N NH2  . ARG A 1 121 ? -49.990 2.953   12.909  1.00 3.04  ? 121 ARG A NH2  2  
ATOM 9418   H H    . ARG A 1 121 ? -44.142 4.778   12.654  1.00 2.73  ? 121 ARG A H    2  
ATOM 9419   H HA   . ARG A 1 121 ? -45.494 2.441   13.507  1.00 2.99  ? 121 ARG A HA   2  
ATOM 9420   H HB2  . ARG A 1 121 ? -46.046 3.653   11.440  1.00 2.53  ? 121 ARG A HB2  2  
ATOM 9421   H HB3  . ARG A 1 121 ? -44.496 3.197   10.754  1.00 2.50  ? 121 ARG A HB3  2  
ATOM 9422   H HG2  . ARG A 1 121 ? -46.297 1.819   9.875   1.00 2.52  ? 121 ARG A HG2  2  
ATOM 9423   H HG3  . ARG A 1 121 ? -45.147 0.851   10.800  1.00 2.74  ? 121 ARG A HG3  2  
ATOM 9424   H HD2  . ARG A 1 121 ? -47.581 0.336   11.196  1.00 2.93  ? 121 ARG A HD2  2  
ATOM 9425   H HD3  . ARG A 1 121 ? -46.631 0.679   12.639  1.00 3.09  ? 121 ARG A HD3  2  
ATOM 9426   H HE   . ARG A 1 121 ? -47.684 3.101   12.009  1.00 2.72  ? 121 ARG A HE   2  
ATOM 9427   H HH11 . ARG A 1 121 ? -49.090 -0.089  12.427  1.00 3.34  ? 121 ARG A HH11 2  
ATOM 9428   H HH12 . ARG A 1 121 ? -50.593 0.523   13.037  1.00 3.50  ? 121 ARG A HH12 2  
ATOM 9429   H HH21 . ARG A 1 121 ? -49.649 3.901   12.820  1.00 2.88  ? 121 ARG A HH21 2  
ATOM 9430   H HH22 . ARG A 1 121 ? -50.916 2.791   13.256  1.00 3.23  ? 121 ARG A HH22 2  
ATOM 9431   N N    . ASP A 1 122 ? -43.983 0.486   13.267  1.00 3.22  ? 122 ASP A N    2  
ATOM 9432   C CA   . ASP A 1 122 ? -43.057 -0.632  13.314  1.00 3.40  ? 122 ASP A CA   2  
ATOM 9433   C C    . ASP A 1 122 ? -42.913 -1.239  11.926  1.00 3.24  ? 122 ASP A C    2  
ATOM 9434   O O    . ASP A 1 122 ? -43.877 -1.314  11.160  1.00 3.12  ? 122 ASP A O    2  
ATOM 9435   C CB   . ASP A 1 122 ? -43.532 -1.691  14.317  1.00 3.70  ? 122 ASP A CB   2  
ATOM 9436   C CG   . ASP A 1 122 ? -44.886 -2.282  13.964  1.00 3.70  ? 122 ASP A CG   2  
ATOM 9437   O OD1  . ASP A 1 122 ? -45.856 -1.509  13.801  1.00 3.60  ? 122 ASP A OD1  2  
ATOM 9438   O OD2  . ASP A 1 122 ? -44.992 -3.522  13.868  1.00 3.88  ? 122 ASP A OD2  2  
ATOM 9439   H H    . ASP A 1 122 ? -44.911 0.342   13.550  1.00 3.28  ? 122 ASP A H    2  
ATOM 9440   H HA   . ASP A 1 122 ? -42.097 -0.252  13.629  1.00 3.45  ? 122 ASP A HA   2  
ATOM 9441   H HB2  . ASP A 1 122 ? -42.813 -2.493  14.348  1.00 3.85  ? 122 ASP A HB2  2  
ATOM 9442   H HB3  . ASP A 1 122 ? -43.603 -1.240  15.297  1.00 3.81  ? 122 ASP A HB3  2  
ATOM 9443   N N    . LEU A 1 123 ? -41.704 -1.656  11.601  1.00 3.27  ? 123 LEU A N    2  
ATOM 9444   C CA   . LEU A 1 123 ? -41.420 -2.241  10.304  1.00 3.14  ? 123 LEU A CA   2  
ATOM 9445   C C    . LEU A 1 123 ? -41.489 -3.764  10.377  1.00 3.37  ? 123 LEU A C    2  
ATOM 9446   O O    . LEU A 1 123 ? -41.088 -4.367  11.376  1.00 3.61  ? 123 LEU A O    2  
ATOM 9447   C CB   . LEU A 1 123 ? -40.041 -1.793  9.823   1.00 3.01  ? 123 LEU A CB   2  
ATOM 9448   C CG   . LEU A 1 123 ? -39.898 -0.301  9.536   1.00 2.78  ? 123 LEU A CG   2  
ATOM 9449   C CD1  . LEU A 1 123 ? -38.430 0.085   9.460   1.00 2.73  ? 123 LEU A CD1  2  
ATOM 9450   C CD2  . LEU A 1 123 ? -40.612 0.058   8.244   1.00 2.53  ? 123 LEU A CD2  2  
ATOM 9451   H H    . LEU A 1 123 ? -40.977 -1.580  12.261  1.00 3.39  ? 123 LEU A H    2  
ATOM 9452   H HA   . LEU A 1 123 ? -42.167 -1.893  9.611   1.00 2.99  ? 123 LEU A HA   2  
ATOM 9453   H HB2  . LEU A 1 123 ? -39.317 -2.061  10.577  1.00 3.19  ? 123 LEU A HB2  2  
ATOM 9454   H HB3  . LEU A 1 123 ? -39.810 -2.332  8.918   1.00 2.94  ? 123 LEU A HB3  2  
ATOM 9455   H HG   . LEU A 1 123 ? -40.353 0.262   10.339  1.00 2.86  ? 123 LEU A HG   2  
ATOM 9456   H HD11 . LEU A 1 123 ? -37.963 -0.085  10.419  1.00 2.79  ? 123 LEU A HD11 2  
ATOM 9457   H HD12 . LEU A 1 123 ? -38.341 1.129   9.197   1.00 2.92  ? 123 LEU A HD12 2  
ATOM 9458   H HD13 . LEU A 1 123 ? -37.937 -0.517  8.710   1.00 2.88  ? 123 LEU A HD13 2  
ATOM 9459   H HD21 . LEU A 1 123 ? -40.227 -0.548  7.438   1.00 2.46  ? 123 LEU A HD21 2  
ATOM 9460   H HD22 . LEU A 1 123 ? -40.448 1.101   8.020   1.00 2.44  ? 123 LEU A HD22 2  
ATOM 9461   H HD23 . LEU A 1 123 ? -41.671 -0.122  8.356   1.00 2.62  ? 123 LEU A HD23 2  
ATOM 9462   N N    . GLN A 1 124 ? -42.004 -4.379  9.319   1.00 3.32  ? 124 GLN A N    2  
ATOM 9463   C CA   . GLN A 1 124 ? -42.136 -5.829  9.264   1.00 3.56  ? 124 GLN A CA   2  
ATOM 9464   C C    . GLN A 1 124 ? -41.427 -6.383  8.035   1.00 3.50  ? 124 GLN A C    2  
ATOM 9465   O O    . GLN A 1 124 ? -41.501 -5.803  6.952   1.00 3.26  ? 124 GLN A O    2  
ATOM 9466   C CB   . GLN A 1 124 ? -43.614 -6.224  9.232   1.00 3.67  ? 124 GLN A CB   2  
ATOM 9467   C CG   . GLN A 1 124 ? -44.469 -5.474  10.241  1.00 3.94  ? 124 GLN A CG   2  
ATOM 9468   C CD   . GLN A 1 124 ? -45.951 -5.664  10.006  1.00 4.12  ? 124 GLN A CD   2  
ATOM 9469   O OE1  . GLN A 1 124 ? -46.389 -5.905  8.880   1.00 4.20  ? 124 GLN A OE1  2  
ATOM 9470   N NE2  . GLN A 1 124 ? -46.735 -5.548  11.063  1.00 4.37  ? 124 GLN A NE2  2  
ATOM 9471   H H    . GLN A 1 124 ? -42.303 -3.843  8.549   1.00 3.14  ? 124 GLN A H    2  
ATOM 9472   H HA   . GLN A 1 124 ? -41.679 -6.242  10.150  1.00 3.74  ? 124 GLN A HA   2  
ATOM 9473   H HB2  . GLN A 1 124 ? -44.007 -6.028  8.246   1.00 3.72  ? 124 GLN A HB2  2  
ATOM 9474   H HB3  . GLN A 1 124 ? -43.696 -7.281  9.439   1.00 3.76  ? 124 GLN A HB3  2  
ATOM 9475   H HG2  . GLN A 1 124 ? -44.230 -5.832  11.231  1.00 4.10  ? 124 GLN A HG2  2  
ATOM 9476   H HG3  . GLN A 1 124 ? -44.240 -4.421  10.176  1.00 4.11  ? 124 GLN A HG3  2  
ATOM 9477   H HE21 . GLN A 1 124 ? -46.316 -5.346  11.929  1.00 4.46  ? 124 GLN A HE21 2  
ATOM 9478   H HE22 . GLN A 1 124 ? -47.699 -5.659  10.941  1.00 4.55  ? 124 GLN A HE22 2  
ATOM 9479   N N    . SER A 1 125 ? -40.737 -7.500  8.207   1.00 3.72  ? 125 SER A N    2  
ATOM 9480   C CA   . SER A 1 125 ? -40.021 -8.135  7.113   1.00 3.70  ? 125 SER A CA   2  
ATOM 9481   C C    . SER A 1 125 ? -40.979 -8.918  6.215   1.00 3.80  ? 125 SER A C    2  
ATOM 9482   O O    . SER A 1 125 ? -41.089 -10.139 6.322   1.00 4.15  ? 125 SER A O    2  
ATOM 9483   C CB   . SER A 1 125 ? -38.947 -9.063  7.677   1.00 3.95  ? 125 SER A CB   2  
ATOM 9484   O OG   . SER A 1 125 ? -38.908 -8.979  9.092   1.00 4.07  ? 125 SER A OG   2  
ATOM 9485   H H    . SER A 1 125 ? -40.700 -7.909  9.095   1.00 3.91  ? 125 SER A H    2  
ATOM 9486   H HA   . SER A 1 125 ? -39.547 -7.360  6.530   1.00 3.45  ? 125 SER A HA   2  
ATOM 9487   H HB2  . SER A 1 125 ? -39.170 -10.081 7.395   1.00 4.12  ? 125 SER A HB2  2  
ATOM 9488   H HB3  . SER A 1 125 ? -37.982 -8.781  7.282   1.00 3.89  ? 125 SER A HB3  2  
ATOM 9489   H HG   . SER A 1 125 ? -38.149 -8.442  9.360   1.00 4.05  ? 125 SER A HG   2  
ATOM 9490   N N    . ALA A 1 126 ? -41.694 -8.208  5.354   1.00 3.59  ? 126 ALA A N    2  
ATOM 9491   C CA   . ALA A 1 126 ? -42.632 -8.842  4.443   1.00 3.71  ? 126 ALA A CA   2  
ATOM 9492   C C    . ALA A 1 126 ? -41.894 -9.435  3.250   1.00 3.68  ? 126 ALA A C    2  
ATOM 9493   O O    . ALA A 1 126 ? -41.581 -8.734  2.287   1.00 3.47  ? 126 ALA A O    2  
ATOM 9494   C CB   . ALA A 1 126 ? -43.686 -7.847  3.988   1.00 3.58  ? 126 ALA A CB   2  
ATOM 9495   H H    . ALA A 1 126 ? -41.589 -7.234  5.332   1.00 3.43  ? 126 ALA A H    2  
ATOM 9496   H HA   . ALA A 1 126 ? -43.129 -9.640  4.979   1.00 3.97  ? 126 ALA A HA   2  
ATOM 9497   H HB1  . ALA A 1 126 ? -44.531 -8.378  3.577   1.00 3.71  ? 126 ALA A HB1  2  
ATOM 9498   H HB2  . ALA A 1 126 ? -43.264 -7.202  3.231   1.00 3.45  ? 126 ALA A HB2  2  
ATOM 9499   H HB3  . ALA A 1 126 ? -44.008 -7.254  4.830   1.00 3.63  ? 126 ALA A HB3  2  
ATOM 9500   N N    . GLU A 1 127 ? -41.599 -10.723 3.335   1.00 3.94  ? 127 GLU A N    2  
ATOM 9501   C CA   . GLU A 1 127 ? -40.893 -11.423 2.273   1.00 3.96  ? 127 GLU A CA   2  
ATOM 9502   C C    . GLU A 1 127 ? -41.731 -11.449 1.000   1.00 3.97  ? 127 GLU A C    2  
ATOM 9503   O O    . GLU A 1 127 ? -42.905 -11.826 1.025   1.00 4.18  ? 127 GLU A O    2  
ATOM 9504   C CB   . GLU A 1 127 ? -40.553 -12.845 2.721   1.00 4.29  ? 127 GLU A CB   2  
ATOM 9505   C CG   . GLU A 1 127 ? -39.652 -12.894 3.944   1.00 4.27  ? 127 GLU A CG   2  
ATOM 9506   C CD   . GLU A 1 127 ? -39.583 -14.276 4.554   1.00 4.59  ? 127 GLU A CD   2  
ATOM 9507   O OE1  . GLU A 1 127 ? -38.953 -15.168 3.947   1.00 4.85  ? 127 GLU A OE1  2  
ATOM 9508   O OE2  . GLU A 1 127 ? -40.161 -14.482 5.642   1.00 4.86  ? 127 GLU A OE2  2  
ATOM 9509   H H    . GLU A 1 127 ? -41.861 -11.219 4.138   1.00 4.14  ? 127 GLU A H    2  
ATOM 9510   H HA   . GLU A 1 127 ? -39.978 -10.887 2.078   1.00 3.77  ? 127 GLU A HA   2  
ATOM 9511   H HB2  . GLU A 1 127 ? -41.469 -13.366 2.955   1.00 4.55  ? 127 GLU A HB2  2  
ATOM 9512   H HB3  . GLU A 1 127 ? -40.053 -13.356 1.912   1.00 4.34  ? 127 GLU A HB3  2  
ATOM 9513   H HG2  . GLU A 1 127 ? -38.656 -12.593 3.654   1.00 4.16  ? 127 GLU A HG2  2  
ATOM 9514   H HG3  . GLU A 1 127 ? -40.035 -12.207 4.684   1.00 4.24  ? 127 GLU A HG3  2  
ATOM 9515   N N    . LYS A 1 128 ? -41.130 -11.034 -0.105  1.00 3.79  ? 128 LYS A N    2  
ATOM 9516   C CA   . LYS A 1 128 ? -41.823 -10.998 -1.383  1.00 3.83  ? 128 LYS A CA   2  
ATOM 9517   C C    . LYS A 1 128 ? -41.143 -11.912 -2.388  1.00 3.99  ? 128 LYS A C    2  
ATOM 9518   O O    . LYS A 1 128 ? -41.653 -13.032 -2.601  1.00 4.21  ? 128 LYS A O    2  
ATOM 9519   C CB   . LYS A 1 128 ? -41.881 -9.565  -1.920  1.00 3.56  ? 128 LYS A CB   2  
ATOM 9520   C CG   . LYS A 1 128 ? -42.720 -8.630  -1.062  1.00 3.44  ? 128 LYS A CG   2  
ATOM 9521   C CD   . LYS A 1 128 ? -44.170 -9.090  -0.998  1.00 3.68  ? 128 LYS A CD   2  
ATOM 9522   C CE   . LYS A 1 128 ? -44.965 -8.302  0.028   1.00 3.64  ? 128 LYS A CE   2  
ATOM 9523   N NZ   . LYS A 1 128 ? -45.209 -6.906  -0.410  1.00 3.49  ? 128 LYS A NZ   2  
ATOM 9524   O OXT  . LYS A 1 128 ? -40.101 -11.515 -2.948  1.00 4.14  ? 128 LYS A OXT  2  
ATOM 9525   H H    . LYS A 1 128 ? -40.192 -10.755 -0.064  1.00 3.65  ? 128 LYS A H    2  
ATOM 9526   H HA   . LYS A 1 128 ? -42.828 -11.351 -1.222  1.00 3.99  ? 128 LYS A HA   2  
ATOM 9527   H HB2  . LYS A 1 128 ? -40.877 -9.171  -1.971  1.00 3.41  ? 128 LYS A HB2  2  
ATOM 9528   H HB3  . LYS A 1 128 ? -42.303 -9.580  -2.915  1.00 3.65  ? 128 LYS A HB3  2  
ATOM 9529   H HG2  . LYS A 1 128 ? -42.314 -8.613  -0.062  1.00 3.42  ? 128 LYS A HG2  2  
ATOM 9530   H HG3  . LYS A 1 128 ? -42.684 -7.638  -1.485  1.00 3.27  ? 128 LYS A HG3  2  
ATOM 9531   H HD2  . LYS A 1 128 ? -44.622 -8.957  -1.968  1.00 3.77  ? 128 LYS A HD2  2  
ATOM 9532   H HD3  . LYS A 1 128 ? -44.195 -10.135 -0.730  1.00 3.90  ? 128 LYS A HD3  2  
ATOM 9533   H HE2  . LYS A 1 128 ? -45.915 -8.792  0.182   1.00 3.88  ? 128 LYS A HE2  2  
ATOM 9534   H HE3  . LYS A 1 128 ? -44.414 -8.288  0.957   1.00 3.66  ? 128 LYS A HE3  2  
ATOM 9535   H HZ1  . LYS A 1 128 ? -46.226 -6.699  -0.397  1.00 3.51  ? 128 LYS A HZ1  2  
ATOM 9536   H HZ2  . LYS A 1 128 ? -44.849 -6.761  -1.374  1.00 3.62  ? 128 LYS A HZ2  2  
ATOM 9537   H HZ3  . LYS A 1 128 ? -44.723 -6.235  0.233   1.00 3.66  ? 128 LYS A HZ3  2  
ATOM 9538   N N    . MET B 2 1   ? 18.095  -27.850 -15.819 1.00 3.30  ? 1   MET B N    2  
ATOM 9539   C CA   . MET B 2 1   ? 17.663  -27.497 -17.194 1.00 3.22  ? 1   MET B CA   2  
ATOM 9540   C C    . MET B 2 1   ? 17.231  -26.038 -17.260 1.00 3.14  ? 1   MET B C    2  
ATOM 9541   O O    . MET B 2 1   ? 17.243  -25.337 -16.246 1.00 3.33  ? 1   MET B O    2  
ATOM 9542   C CB   . MET B 2 1   ? 16.503  -28.395 -17.633 1.00 3.32  ? 1   MET B CB   2  
ATOM 9543   C CG   . MET B 2 1   ? 16.940  -29.736 -18.201 1.00 3.56  ? 1   MET B CG   2  
ATOM 9544   S SD   . MET B 2 1   ? 15.543  -30.797 -18.619 1.00 3.77  ? 1   MET B SD   2  
ATOM 9545   C CE   . MET B 2 1   ? 16.400  -32.266 -19.180 1.00 4.08  ? 1   MET B CE   2  
ATOM 9546   H H1   . MET B 2 1   ? 18.913  -27.269 -15.542 1.00 3.42  ? 1   MET B H1   2  
ATOM 9547   H H2   . MET B 2 1   ? 18.366  -28.853 -15.772 1.00 3.41  ? 1   MET B H2   2  
ATOM 9548   H H3   . MET B 2 1   ? 17.321  -27.682 -15.145 1.00 3.36  ? 1   MET B H3   2  
ATOM 9549   H HA   . MET B 2 1   ? 18.498  -27.645 -17.862 1.00 3.27  ? 1   MET B HA   2  
ATOM 9550   H HB2  . MET B 2 1   ? 15.866  -28.583 -16.779 1.00 3.41  ? 1   MET B HB2  2  
ATOM 9551   H HB3  . MET B 2 1   ? 15.929  -27.880 -18.388 1.00 3.32  ? 1   MET B HB3  2  
ATOM 9552   H HG2  . MET B 2 1   ? 17.520  -29.564 -19.093 1.00 3.65  ? 1   MET B HG2  2  
ATOM 9553   H HG3  . MET B 2 1   ? 17.549  -30.241 -17.469 1.00 3.79  ? 1   MET B HG3  2  
ATOM 9554   H HE1  . MET B 2 1   ? 15.679  -33.020 -19.454 1.00 4.39  ? 1   MET B HE1  2  
ATOM 9555   H HE2  . MET B 2 1   ? 17.030  -32.641 -18.387 1.00 4.33  ? 1   MET B HE2  2  
ATOM 9556   H HE3  . MET B 2 1   ? 17.009  -32.021 -20.037 1.00 4.13  ? 1   MET B HE3  2  
ATOM 9557   N N    . ALA B 2 2   ? 16.850  -25.590 -18.454 1.00 3.03  ? 2   ALA B N    2  
ATOM 9558   C CA   . ALA B 2 2   ? 16.397  -24.219 -18.654 1.00 2.97  ? 2   ALA B CA   2  
ATOM 9559   C C    . ALA B 2 2   ? 15.078  -23.970 -17.932 1.00 2.90  ? 2   ALA B C    2  
ATOM 9560   O O    . ALA B 2 2   ? 14.428  -24.914 -17.470 1.00 2.91  ? 2   ALA B O    2  
ATOM 9561   C CB   . ALA B 2 2   ? 16.255  -23.924 -20.140 1.00 3.02  ? 2   ALA B CB   2  
ATOM 9562   H H    . ALA B 2 2   ? 16.890  -26.193 -19.227 1.00 3.09  ? 2   ALA B H    2  
ATOM 9563   H HA   . ALA B 2 2   ? 17.149  -23.557 -18.249 1.00 2.98  ? 2   ALA B HA   2  
ATOM 9564   H HB1  . ALA B 2 2   ? 17.196  -24.112 -20.636 1.00 3.10  ? 2   ALA B HB1  2  
ATOM 9565   H HB2  . ALA B 2 2   ? 15.978  -22.890 -20.276 1.00 3.09  ? 2   ALA B HB2  2  
ATOM 9566   H HB3  . ALA B 2 2   ? 15.490  -24.560 -20.562 1.00 3.02  ? 2   ALA B HB3  2  
ATOM 9567   N N    . ALA B 2 3   ? 14.693  -22.698 -17.845 1.00 2.86  ? 3   ALA B N    2  
ATOM 9568   C CA   . ALA B 2 3   ? 13.463  -22.290 -17.170 1.00 2.81  ? 3   ALA B CA   2  
ATOM 9569   C C    . ALA B 2 3   ? 13.520  -22.662 -15.692 1.00 2.77  ? 3   ALA B C    2  
ATOM 9570   O O    . ALA B 2 3   ? 12.570  -23.212 -15.135 1.00 2.77  ? 3   ALA B O    2  
ATOM 9571   C CB   . ALA B 2 3   ? 12.240  -22.904 -17.842 1.00 2.88  ? 3   ALA B CB   2  
ATOM 9572   H H    . ALA B 2 3   ? 15.259  -22.006 -18.246 1.00 2.88  ? 3   ALA B H    2  
ATOM 9573   H HA   . ALA B 2 3   ? 13.387  -21.214 -17.251 1.00 2.80  ? 3   ALA B HA   2  
ATOM 9574   H HB1  . ALA B 2 3   ? 12.315  -23.979 -17.812 1.00 2.90  ? 3   ALA B HB1  2  
ATOM 9575   H HB2  . ALA B 2 3   ? 12.188  -22.572 -18.868 1.00 2.90  ? 3   ALA B HB2  2  
ATOM 9576   H HB3  . ALA B 2 3   ? 11.348  -22.592 -17.317 1.00 2.93  ? 3   ALA B HB3  2  
ATOM 9577   N N    . GLU B 2 4   ? 14.656  -22.368 -15.070 1.00 2.78  ? 4   GLU B N    2  
ATOM 9578   C CA   . GLU B 2 4   ? 14.862  -22.656 -13.658 1.00 2.77  ? 4   GLU B CA   2  
ATOM 9579   C C    . GLU B 2 4   ? 13.973  -21.771 -12.792 1.00 2.65  ? 4   GLU B C    2  
ATOM 9580   O O    . GLU B 2 4   ? 13.622  -20.658 -13.187 1.00 2.60  ? 4   GLU B O    2  
ATOM 9581   C CB   . GLU B 2 4   ? 16.335  -22.461 -13.278 1.00 2.85  ? 4   GLU B CB   2  
ATOM 9582   C CG   . GLU B 2 4   ? 16.939  -21.159 -13.774 1.00 2.86  ? 4   GLU B CG   2  
ATOM 9583   C CD   . GLU B 2 4   ? 17.612  -21.314 -15.122 1.00 3.00  ? 4   GLU B CD   2  
ATOM 9584   O OE1  . GLU B 2 4   ? 16.915  -21.225 -16.151 1.00 2.95  ? 4   GLU B OE1  2  
ATOM 9585   O OE2  . GLU B 2 4   ? 18.842  -21.526 -15.158 1.00 3.24  ? 4   GLU B OE2  2  
ATOM 9586   H H    . GLU B 2 4   ? 15.380  -21.933 -15.577 1.00 2.81  ? 4   GLU B H    2  
ATOM 9587   H HA   . GLU B 2 4   ? 14.592  -23.688 -13.489 1.00 2.81  ? 4   GLU B HA   2  
ATOM 9588   H HB2  . GLU B 2 4   ? 16.423  -22.484 -12.203 1.00 2.85  ? 4   GLU B HB2  2  
ATOM 9589   H HB3  . GLU B 2 4   ? 16.910  -23.276 -13.692 1.00 2.96  ? 4   GLU B HB3  2  
ATOM 9590   H HG2  . GLU B 2 4   ? 16.157  -20.421 -13.859 1.00 2.77  ? 4   GLU B HG2  2  
ATOM 9591   H HG3  . GLU B 2 4   ? 17.674  -20.826 -13.056 1.00 2.90  ? 4   GLU B HG3  2  
ATOM 9592   N N    . PRO B 2 5   ? 13.571  -22.270 -11.613 1.00 2.63  ? 5   PRO B N    2  
ATOM 9593   C CA   . PRO B 2 5   ? 12.727  -21.514 -10.685 1.00 2.53  ? 5   PRO B CA   2  
ATOM 9594   C C    . PRO B 2 5   ? 13.430  -20.267 -10.166 1.00 2.49  ? 5   PRO B C    2  
ATOM 9595   O O    . PRO B 2 5   ? 14.602  -20.311 -9.778  1.00 2.55  ? 5   PRO B O    2  
ATOM 9596   C CB   . PRO B 2 5   ? 12.462  -22.499 -9.543  1.00 2.56  ? 5   PRO B CB   2  
ATOM 9597   C CG   . PRO B 2 5   ? 13.564  -23.499 -9.635  1.00 2.67  ? 5   PRO B CG   2  
ATOM 9598   C CD   . PRO B 2 5   ? 13.898  -23.609 -11.092 1.00 2.72  ? 5   PRO B CD   2  
ATOM 9599   H HA   . PRO B 2 5   ? 11.790  -21.230 -11.146 1.00 2.50  ? 5   PRO B HA   2  
ATOM 9600   H HB2  . PRO B 2 5   ? 12.481  -21.973 -8.600  1.00 2.52  ? 5   PRO B HB2  2  
ATOM 9601   H HB3  . PRO B 2 5   ? 11.497  -22.962 -9.684  1.00 2.57  ? 5   PRO B HB3  2  
ATOM 9602   H HG2  . PRO B 2 5   ? 14.422  -23.152 -9.077  1.00 2.67  ? 5   PRO B HG2  2  
ATOM 9603   H HG3  . PRO B 2 5   ? 13.227  -24.452 -9.254  1.00 2.75  ? 5   PRO B HG3  2  
ATOM 9604   H HD2  . PRO B 2 5   ? 14.946  -23.830 -11.224 1.00 2.80  ? 5   PRO B HD2  2  
ATOM 9605   H HD3  . PRO B 2 5   ? 13.286  -24.365 -11.562 1.00 2.77  ? 5   PRO B HD3  2  
ATOM 9606   N N    . LEU B 2 6   ? 12.709  -19.161 -10.157 1.00 2.41  ? 6   LEU B N    2  
ATOM 9607   C CA   . LEU B 2 6   ? 13.253  -17.895 -9.696  1.00 2.37  ? 6   LEU B CA   2  
ATOM 9608   C C    . LEU B 2 6   ? 13.058  -17.746 -8.192  1.00 2.31  ? 6   LEU B C    2  
ATOM 9609   O O    . LEU B 2 6   ? 12.605  -18.676 -7.520  1.00 2.32  ? 6   LEU B O    2  
ATOM 9610   C CB   . LEU B 2 6   ? 12.576  -16.733 -10.426 1.00 2.33  ? 6   LEU B CB   2  
ATOM 9611   C CG   . LEU B 2 6   ? 12.490  -16.879 -11.947 1.00 2.40  ? 6   LEU B CG   2  
ATOM 9612   C CD1  . LEU B 2 6   ? 11.522  -15.856 -12.518 1.00 2.42  ? 6   LEU B CD1  2  
ATOM 9613   C CD2  . LEU B 2 6   ? 13.867  -16.723 -12.577 1.00 2.49  ? 6   LEU B CD2  2  
ATOM 9614   H H    . LEU B 2 6   ? 11.767  -19.203 -10.457 1.00 2.40  ? 6   LEU B H    2  
ATOM 9615   H HA   . LEU B 2 6   ? 14.308  -17.884 -9.917  1.00 2.43  ? 6   LEU B HA   2  
ATOM 9616   H HB2  . LEU B 2 6   ? 11.574  -16.628 -10.038 1.00 2.28  ? 6   LEU B HB2  2  
ATOM 9617   H HB3  . LEU B 2 6   ? 13.124  -15.832 -10.206 1.00 2.32  ? 6   LEU B HB3  2  
ATOM 9618   H HG   . LEU B 2 6   ? 12.118  -17.864 -12.189 1.00 2.46  ? 6   LEU B HG   2  
ATOM 9619   H HD11 . LEU B 2 6   ? 10.572  -15.937 -12.011 1.00 2.45  ? 6   LEU B HD11 2  
ATOM 9620   H HD12 . LEU B 2 6   ? 11.382  -16.041 -13.572 1.00 2.51  ? 6   LEU B HD12 2  
ATOM 9621   H HD13 . LEU B 2 6   ? 11.923  -14.863 -12.376 1.00 2.43  ? 6   LEU B HD13 2  
ATOM 9622   H HD21 . LEU B 2 6   ? 14.267  -15.750 -12.333 1.00 2.68  ? 6   LEU B HD21 2  
ATOM 9623   H HD22 . LEU B 2 6   ? 13.785  -16.819 -13.649 1.00 2.57  ? 6   LEU B HD22 2  
ATOM 9624   H HD23 . LEU B 2 6   ? 14.527  -17.487 -12.195 1.00 2.52  ? 6   LEU B HD23 2  
ATOM 9625   N N    . THR B 2 7   ? 13.403  -16.579 -7.668  1.00 2.26  ? 7   THR B N    2  
ATOM 9626   C CA   . THR B 2 7   ? 13.257  -16.310 -6.248  1.00 2.20  ? 7   THR B CA   2  
ATOM 9627   C C    . THR B 2 7   ? 11.775  -16.246 -5.864  1.00 2.13  ? 7   THR B C    2  
ATOM 9628   O O    . THR B 2 7   ? 10.920  -16.015 -6.721  1.00 2.10  ? 7   THR B O    2  
ATOM 9629   C CB   . THR B 2 7   ? 13.962  -14.990 -5.870  1.00 2.18  ? 7   THR B CB   2  
ATOM 9630   O OG1  . THR B 2 7   ? 15.156  -14.846 -6.651  1.00 2.48  ? 7   THR B OG1  2  
ATOM 9631   C CG2  . THR B 2 7   ? 14.321  -14.960 -4.391  1.00 2.12  ? 7   THR B CG2  2  
ATOM 9632   H H    . THR B 2 7   ? 13.769  -15.876 -8.256  1.00 2.26  ? 7   THR B H    2  
ATOM 9633   H HA   . THR B 2 7   ? 13.726  -17.117 -5.705  1.00 2.25  ? 7   THR B HA   2  
ATOM 9634   H HB   . THR B 2 7   ? 13.295  -14.167 -6.084  1.00 2.22  ? 7   THR B HB   2  
ATOM 9635   H HG1  . THR B 2 7   ? 14.925  -14.511 -7.540  1.00 2.71  ? 7   THR B HG1  2  
ATOM 9636   H HG21 . THR B 2 7   ? 15.004  -15.766 -4.169  1.00 2.33  ? 7   THR B HG21 2  
ATOM 9637   H HG22 . THR B 2 7   ? 13.424  -15.078 -3.801  1.00 2.40  ? 7   THR B HG22 2  
ATOM 9638   H HG23 . THR B 2 7   ? 14.787  -14.016 -4.152  1.00 2.35  ? 7   THR B HG23 2  
ATOM 9639   N N    . GLU B 2 8   ? 11.494  -16.456 -4.576  1.00 2.10  ? 8   GLU B N    2  
ATOM 9640   C CA   . GLU B 2 8   ? 10.128  -16.454 -4.037  1.00 2.05  ? 8   GLU B CA   2  
ATOM 9641   C C    . GLU B 2 8   ? 9.246   -15.358 -4.638  1.00 1.96  ? 8   GLU B C    2  
ATOM 9642   O O    . GLU B 2 8   ? 8.316   -15.645 -5.395  1.00 1.95  ? 8   GLU B O    2  
ATOM 9643   C CB   . GLU B 2 8   ? 10.168  -16.286 -2.517  1.00 2.03  ? 8   GLU B CB   2  
ATOM 9644   C CG   . GLU B 2 8   ? 10.119  -17.593 -1.745  1.00 2.16  ? 8   GLU B CG   2  
ATOM 9645   C CD   . GLU B 2 8   ? 10.099  -17.371 -0.245  1.00 2.21  ? 8   GLU B CD   2  
ATOM 9646   O OE1  . GLU B 2 8   ? 9.005   -17.168 0.318   1.00 2.27  ? 8   GLU B OE1  2  
ATOM 9647   O OE2  . GLU B 2 8   ? 11.179  -17.395 0.375   1.00 2.39  ? 8   GLU B OE2  2  
ATOM 9648   H H    . GLU B 2 8   ? 12.235  -16.633 -3.962  1.00 2.14  ? 8   GLU B H    2  
ATOM 9649   H HA   . GLU B 2 8   ? 9.687   -17.411 -4.263  1.00 2.09  ? 8   GLU B HA   2  
ATOM 9650   H HB2  . GLU B 2 8   ? 11.080  -15.774 -2.251  1.00 2.23  ? 8   GLU B HB2  2  
ATOM 9651   H HB3  . GLU B 2 8   ? 9.326   -15.684 -2.214  1.00 2.07  ? 8   GLU B HB3  2  
ATOM 9652   H HG2  . GLU B 2 8   ? 9.226   -18.131 -2.029  1.00 2.29  ? 8   GLU B HG2  2  
ATOM 9653   H HG3  . GLU B 2 8   ? 10.988  -18.182 -1.998  1.00 2.41  ? 8   GLU B HG3  2  
ATOM 9654   N N    . LEU B 2 9   ? 9.548   -14.108 -4.313  1.00 1.90  ? 9   LEU B N    2  
ATOM 9655   C CA   . LEU B 2 9   ? 8.757   -12.977 -4.794  1.00 1.82  ? 9   LEU B CA   2  
ATOM 9656   C C    . LEU B 2 9   ? 8.846   -12.806 -6.310  1.00 1.86  ? 9   LEU B C    2  
ATOM 9657   O O    . LEU B 2 9   ? 7.910   -12.303 -6.930  1.00 1.82  ? 9   LEU B O    2  
ATOM 9658   C CB   . LEU B 2 9   ? 9.180   -11.688 -4.088  1.00 1.77  ? 9   LEU B CB   2  
ATOM 9659   C CG   . LEU B 2 9   ? 8.613   -11.511 -2.677  1.00 1.87  ? 9   LEU B CG   2  
ATOM 9660   C CD1  . LEU B 2 9   ? 9.446   -12.274 -1.657  1.00 1.82  ? 9   LEU B CD1  2  
ATOM 9661   C CD2  . LEU B 2 9   ? 8.535   -10.035 -2.316  1.00 2.40  ? 9   LEU B CD2  2  
ATOM 9662   H H    . LEU B 2 9   ? 10.313  -13.940 -3.724  1.00 1.93  ? 9   LEU B H    2  
ATOM 9663   H HA   . LEU B 2 9   ? 7.727   -13.179 -4.539  1.00 1.79  ? 9   LEU B HA   2  
ATOM 9664   H HB2  . LEU B 2 9   ? 10.259  -11.673 -4.027  1.00 1.75  ? 9   LEU B HB2  2  
ATOM 9665   H HB3  . LEU B 2 9   ? 8.859   -10.849 -4.688  1.00 1.78  ? 9   LEU B HB3  2  
ATOM 9666   H HG   . LEU B 2 9   ? 7.611   -11.912 -2.651  1.00 2.19  ? 9   LEU B HG   2  
ATOM 9667   H HD11 . LEU B 2 9   ? 10.474  -11.943 -1.711  1.00 2.03  ? 9   LEU B HD11 2  
ATOM 9668   H HD12 . LEU B 2 9   ? 9.398   -13.331 -1.871  1.00 2.08  ? 9   LEU B HD12 2  
ATOM 9669   H HD13 . LEU B 2 9   ? 9.059   -12.089 -0.666  1.00 1.92  ? 9   LEU B HD13 2  
ATOM 9670   H HD21 . LEU B 2 9   ? 8.099   -9.928  -1.336  1.00 2.51  ? 9   LEU B HD21 2  
ATOM 9671   H HD22 . LEU B 2 9   ? 7.923   -9.518  -3.041  1.00 2.89  ? 9   LEU B HD22 2  
ATOM 9672   H HD23 . LEU B 2 9   ? 9.528   -9.609  -2.316  1.00 2.62  ? 9   LEU B HD23 2  
ATOM 9673   N N    . GLU B 2 10  ? 9.953   -13.232 -6.907  1.00 1.94  ? 10  GLU B N    2  
ATOM 9674   C CA   . GLU B 2 10  ? 10.128  -13.115 -8.351  1.00 1.99  ? 10  GLU B CA   2  
ATOM 9675   C C    . GLU B 2 10  ? 9.048   -13.900 -9.085  1.00 2.03  ? 10  GLU B C    2  
ATOM 9676   O O    . GLU B 2 10  ? 8.422   -13.397 -10.013 1.00 2.04  ? 10  GLU B O    2  
ATOM 9677   C CB   . GLU B 2 10  ? 11.510  -13.608 -8.775  1.00 2.08  ? 10  GLU B CB   2  
ATOM 9678   C CG   . GLU B 2 10  ? 12.629  -12.616 -8.507  1.00 2.08  ? 10  GLU B CG   2  
ATOM 9679   C CD   . GLU B 2 10  ? 13.934  -13.030 -9.155  1.00 2.21  ? 10  GLU B CD   2  
ATOM 9680   O OE1  . GLU B 2 10  ? 14.334  -14.203 -9.001  1.00 2.31  ? 10  GLU B OE1  2  
ATOM 9681   O OE2  . GLU B 2 10  ? 14.570  -12.183 -9.817  1.00 2.36  ? 10  GLU B OE2  2  
ATOM 9682   H H    . GLU B 2 10  ? 10.661  -13.642 -6.370  1.00 1.97  ? 10  GLU B H    2  
ATOM 9683   H HA   . GLU B 2 10  ? 10.031  -12.070 -8.611  1.00 1.95  ? 10  GLU B HA   2  
ATOM 9684   H HB2  . GLU B 2 10  ? 11.733  -14.518 -8.238  1.00 2.12  ? 10  GLU B HB2  2  
ATOM 9685   H HB3  . GLU B 2 10  ? 11.492  -13.819 -9.834  1.00 2.14  ? 10  GLU B HB3  2  
ATOM 9686   H HG2  . GLU B 2 10  ? 12.341  -11.651 -8.896  1.00 2.05  ? 10  GLU B HG2  2  
ATOM 9687   H HG3  . GLU B 2 10  ? 12.781  -12.543 -7.439  1.00 2.03  ? 10  GLU B HG3  2  
ATOM 9688   N N    . GLU B 2 11  ? 8.823   -15.133 -8.652  1.00 2.05  ? 11  GLU B N    2  
ATOM 9689   C CA   . GLU B 2 11  ? 7.806   -15.970 -9.271  1.00 2.09  ? 11  GLU B CA   2  
ATOM 9690   C C    . GLU B 2 11  ? 6.418   -15.531 -8.822  1.00 2.00  ? 11  GLU B C    2  
ATOM 9691   O O    . GLU B 2 11  ? 5.437   -15.677 -9.554  1.00 2.01  ? 11  GLU B O    2  
ATOM 9692   C CB   . GLU B 2 11  ? 8.043   -17.442 -8.941  1.00 2.16  ? 11  GLU B CB   2  
ATOM 9693   C CG   . GLU B 2 11  ? 9.361   -17.971 -9.485  1.00 2.25  ? 11  GLU B CG   2  
ATOM 9694   C CD   . GLU B 2 11  ? 9.335   -19.464 -9.726  1.00 2.31  ? 11  GLU B CD   2  
ATOM 9695   O OE1  . GLU B 2 11  ? 8.526   -20.162 -9.082  1.00 2.52  ? 11  GLU B OE1  2  
ATOM 9696   O OE2  . GLU B 2 11  ? 10.126  -19.949 -10.566 1.00 2.48  ? 11  GLU B OE2  2  
ATOM 9697   H H    . GLU B 2 11  ? 9.356   -15.490 -7.908  1.00 2.06  ? 11  GLU B H    2  
ATOM 9698   H HA   . GLU B 2 11  ? 7.882   -15.835 -10.339 1.00 2.15  ? 11  GLU B HA   2  
ATOM 9699   H HB2  . GLU B 2 11  ? 8.045   -17.565 -7.865  1.00 2.12  ? 11  GLU B HB2  2  
ATOM 9700   H HB3  . GLU B 2 11  ? 7.241   -18.029 -9.362  1.00 2.20  ? 11  GLU B HB3  2  
ATOM 9701   H HG2  . GLU B 2 11  ? 9.575   -17.478 -10.422 1.00 2.35  ? 11  GLU B HG2  2  
ATOM 9702   H HG3  . GLU B 2 11  ? 10.144  -17.748 -8.775  1.00 2.40  ? 11  GLU B HG3  2  
ATOM 9703   N N    . SER B 2 12  ? 6.346   -14.968 -7.622  1.00 1.94  ? 12  SER B N    2  
ATOM 9704   C CA   . SER B 2 12  ? 5.082   -14.495 -7.078  1.00 1.86  ? 12  SER B CA   2  
ATOM 9705   C C    . SER B 2 12  ? 4.519   -13.367 -7.939  1.00 1.83  ? 12  SER B C    2  
ATOM 9706   O O    . SER B 2 12  ? 3.327   -13.342 -8.245  1.00 1.83  ? 12  SER B O    2  
ATOM 9707   C CB   . SER B 2 12  ? 5.260   -14.018 -5.636  1.00 1.80  ? 12  SER B CB   2  
ATOM 9708   O OG   . SER B 2 12  ? 5.767   -15.054 -4.808  1.00 1.84  ? 12  SER B OG   2  
ATOM 9709   H H    . SER B 2 12  ? 7.164   -14.872 -7.091  1.00 1.95  ? 12  SER B H    2  
ATOM 9710   H HA   . SER B 2 12  ? 4.387   -15.321 -7.093  1.00 1.89  ? 12  SER B HA   2  
ATOM 9711   H HB2  . SER B 2 12  ? 5.949   -13.187 -5.616  1.00 1.78  ? 12  SER B HB2  2  
ATOM 9712   H HB3  . SER B 2 12  ? 4.304   -13.700 -5.246  1.00 1.78  ? 12  SER B HB3  2  
ATOM 9713   H HG   . SER B 2 12  ? 6.601   -15.377 -5.166  1.00 2.00  ? 12  SER B HG   2  
ATOM 9714   N N    . ILE B 2 13  ? 5.374   -12.438 -8.345  1.00 1.83  ? 13  ILE B N    2  
ATOM 9715   C CA   . ILE B 2 13  ? 4.926   -11.340 -9.183  1.00 1.82  ? 13  ILE B CA   2  
ATOM 9716   C C    . ILE B 2 13  ? 4.705   -11.824 -10.613 1.00 1.90  ? 13  ILE B C    2  
ATOM 9717   O O    . ILE B 2 13  ? 3.866   -11.297 -11.334 1.00 1.91  ? 13  ILE B O    2  
ATOM 9718   C CB   . ILE B 2 13  ? 5.908   -10.144 -9.168  1.00 1.81  ? 13  ILE B CB   2  
ATOM 9719   C CG1  . ILE B 2 13  ? 7.316   -10.583 -9.588  1.00 1.89  ? 13  ILE B CG1  2  
ATOM 9720   C CG2  . ILE B 2 13  ? 5.937   -9.504  -7.786  1.00 1.74  ? 13  ILE B CG2  2  
ATOM 9721   C CD1  . ILE B 2 13  ? 8.330   -9.455  -9.621  1.00 1.96  ? 13  ILE B CD1  2  
ATOM 9722   H H    . ILE B 2 13  ? 6.315   -12.487 -8.065  1.00 1.85  ? 13  ILE B H    2  
ATOM 9723   H HA   . ILE B 2 13  ? 3.977   -11.001 -8.789  1.00 1.76  ? 13  ILE B HA   2  
ATOM 9724   H HB   . ILE B 2 13  ? 5.545   -9.407  -9.868  1.00 1.82  ? 13  ILE B HB   2  
ATOM 9725   H HG12 . ILE B 2 13  ? 7.673   -11.324 -8.891  1.00 1.87  ? 13  ILE B HG12 2  
ATOM 9726   H HG13 . ILE B 2 13  ? 7.271   -11.018 -10.576 1.00 2.00  ? 13  ILE B HG13 2  
ATOM 9727   H HG21 . ILE B 2 13  ? 6.245   -10.237 -7.055  1.00 1.76  ? 13  ILE B HG21 2  
ATOM 9728   H HG22 . ILE B 2 13  ? 4.950   -9.139  -7.537  1.00 1.73  ? 13  ILE B HG22 2  
ATOM 9729   H HG23 . ILE B 2 13  ? 6.635   -8.681  -7.788  1.00 1.74  ? 13  ILE B HG23 2  
ATOM 9730   H HD11 . ILE B 2 13  ? 8.438   -9.036  -8.631  1.00 2.06  ? 13  ILE B HD11 2  
ATOM 9731   H HD12 . ILE B 2 13  ? 7.988   -8.688  -10.301 1.00 2.15  ? 13  ILE B HD12 2  
ATOM 9732   H HD13 . ILE B 2 13  ? 9.284   -9.834  -9.959  1.00 2.10  ? 13  ILE B HD13 2  
ATOM 9733   N N    . GLU B 2 14  ? 5.438   -12.857 -11.010 1.00 1.96  ? 14  GLU B N    2  
ATOM 9734   C CA   . GLU B 2 14  ? 5.307   -13.410 -12.352 1.00 2.05  ? 14  GLU B CA   2  
ATOM 9735   C C    . GLU B 2 14  ? 3.942   -14.065 -12.543 1.00 2.05  ? 14  GLU B C    2  
ATOM 9736   O O    . GLU B 2 14  ? 3.392   -14.049 -13.645 1.00 2.08  ? 14  GLU B O    2  
ATOM 9737   C CB   . GLU B 2 14  ? 6.411   -14.430 -12.633 1.00 2.15  ? 14  GLU B CB   2  
ATOM 9738   C CG   . GLU B 2 14  ? 7.682   -13.816 -13.207 1.00 2.26  ? 14  GLU B CG   2  
ATOM 9739   C CD   . GLU B 2 14  ? 8.067   -14.407 -14.551 1.00 2.29  ? 14  GLU B CD   2  
ATOM 9740   O OE1  . GLU B 2 14  ? 7.385   -15.349 -15.013 1.00 2.42  ? 14  GLU B OE1  2  
ATOM 9741   O OE2  . GLU B 2 14  ? 9.049   -13.929 -15.158 1.00 2.58  ? 14  GLU B OE2  2  
ATOM 9742   H H    . GLU B 2 14  ? 6.089   -13.251 -10.391 1.00 1.97  ? 14  GLU B H    2  
ATOM 9743   H HA   . GLU B 2 14  ? 5.399   -12.594 -13.054 1.00 2.06  ? 14  GLU B HA   2  
ATOM 9744   H HB2  . GLU B 2 14  ? 6.662   -14.932 -11.711 1.00 2.27  ? 14  GLU B HB2  2  
ATOM 9745   H HB3  . GLU B 2 14  ? 6.038   -15.158 -13.339 1.00 2.17  ? 14  GLU B HB3  2  
ATOM 9746   H HG2  . GLU B 2 14  ? 7.528   -12.754 -13.332 1.00 2.51  ? 14  GLU B HG2  2  
ATOM 9747   H HG3  . GLU B 2 14  ? 8.493   -13.981 -12.513 1.00 2.39  ? 14  GLU B HG3  2  
ATOM 9748   N N    . THR B 2 15  ? 3.392   -14.628 -11.467 1.00 2.02  ? 15  THR B N    2  
ATOM 9749   C CA   . THR B 2 15  ? 2.098   -15.293 -11.537 1.00 2.03  ? 15  THR B CA   2  
ATOM 9750   C C    . THR B 2 15  ? 0.947   -14.279 -11.588 1.00 1.95  ? 15  THR B C    2  
ATOM 9751   O O    . THR B 2 15  ? -0.171  -14.634 -11.951 1.00 1.96  ? 15  THR B O    2  
ATOM 9752   C CB   . THR B 2 15  ? 1.894   -16.286 -10.362 1.00 2.03  ? 15  THR B CB   2  
ATOM 9753   O OG1  . THR B 2 15  ? 0.942   -17.295 -10.726 1.00 2.38  ? 15  THR B OG1  2  
ATOM 9754   C CG2  . THR B 2 15  ? 1.413   -15.581 -9.102  1.00 2.31  ? 15  THR B CG2  2  
ATOM 9755   H H    . THR B 2 15  ? 3.873   -14.604 -10.612 1.00 2.00  ? 15  THR B H    2  
ATOM 9756   H HA   . THR B 2 15  ? 2.081   -15.865 -12.455 1.00 2.11  ? 15  THR B HA   2  
ATOM 9757   H HB   . THR B 2 15  ? 2.841   -16.760 -10.148 1.00 2.28  ? 15  THR B HB   2  
ATOM 9758   H HG1  . THR B 2 15  ? 0.169   -16.874 -11.128 1.00 2.81  ? 15  THR B HG1  2  
ATOM 9759   H HG21 . THR B 2 15  ? 0.447   -15.135 -9.286  1.00 2.68  ? 15  THR B HG21 2  
ATOM 9760   H HG22 . THR B 2 15  ? 2.119   -14.809 -8.830  1.00 2.70  ? 15  THR B HG22 2  
ATOM 9761   H HG23 . THR B 2 15  ? 1.333   -16.297 -8.298  1.00 2.33  ? 15  THR B HG23 2  
ATOM 9762   N N    . VAL B 2 16  ? 1.215   -13.024 -11.229 1.00 1.89  ? 16  VAL B N    2  
ATOM 9763   C CA   . VAL B 2 16  ? 0.173   -12.000 -11.276 1.00 1.82  ? 16  VAL B CA   2  
ATOM 9764   C C    . VAL B 2 16  ? 0.345   -11.113 -12.508 1.00 1.84  ? 16  VAL B C    2  
ATOM 9765   O O    . VAL B 2 16  ? -0.623  -10.549 -13.019 1.00 1.83  ? 16  VAL B O    2  
ATOM 9766   C CB   . VAL B 2 16  ? 0.125   -11.129 -9.996  1.00 1.75  ? 16  VAL B CB   2  
ATOM 9767   C CG1  . VAL B 2 16  ? -0.127  -11.989 -8.768  1.00 1.77  ? 16  VAL B CG1  2  
ATOM 9768   C CG2  . VAL B 2 16  ? 1.398   -10.318 -9.824  1.00 1.79  ? 16  VAL B CG2  2  
ATOM 9769   H H    . VAL B 2 16  ? 2.116   -12.788 -10.923 1.00 1.92  ? 16  VAL B H    2  
ATOM 9770   H HA   . VAL B 2 16  ? -0.774  -12.514 -11.363 1.00 1.82  ? 16  VAL B HA   2  
ATOM 9771   H HB   . VAL B 2 16  ? -0.703  -10.438 -10.092 1.00 1.73  ? 16  VAL B HB   2  
ATOM 9772   H HG11 . VAL B 2 16  ? -1.068  -12.508 -8.879  1.00 1.84  ? 16  VAL B HG11 2  
ATOM 9773   H HG12 . VAL B 2 16  ? -0.162  -11.363 -7.890  1.00 1.74  ? 16  VAL B HG12 2  
ATOM 9774   H HG13 . VAL B 2 16  ? 0.670   -12.711 -8.664  1.00 1.88  ? 16  VAL B HG13 2  
ATOM 9775   H HG21 . VAL B 2 16  ? 1.477   -9.599  -10.626 1.00 1.85  ? 16  VAL B HG21 2  
ATOM 9776   H HG22 . VAL B 2 16  ? 2.250   -10.980 -9.850  1.00 1.89  ? 16  VAL B HG22 2  
ATOM 9777   H HG23 . VAL B 2 16  ? 1.370   -9.800  -8.877  1.00 1.79  ? 16  VAL B HG23 2  
ATOM 9778   N N    . VAL B 2 17  ? 1.578   -11.000 -12.994 1.00 1.89  ? 17  VAL B N    2  
ATOM 9779   C CA   . VAL B 2 17  ? 1.848   -10.196 -14.177 1.00 1.92  ? 17  VAL B CA   2  
ATOM 9780   C C    . VAL B 2 17  ? 1.238   -10.860 -15.409 1.00 1.98  ? 17  VAL B C    2  
ATOM 9781   O O    . VAL B 2 17  ? 0.723   -10.181 -16.295 1.00 1.99  ? 17  VAL B O    2  
ATOM 9782   C CB   . VAL B 2 17  ? 3.367   -9.971  -14.385 1.00 1.95  ? 17  VAL B CB   2  
ATOM 9783   C CG1  . VAL B 2 17  ? 3.664   -9.452  -15.786 1.00 2.10  ? 17  VAL B CG1  2  
ATOM 9784   C CG2  . VAL B 2 17  ? 3.907   -9.001  -13.341 1.00 1.91  ? 17  VAL B CG2  2  
ATOM 9785   H H    . VAL B 2 17  ? 2.319   -11.456 -12.540 1.00 1.90  ? 17  VAL B H    2  
ATOM 9786   H HA   . VAL B 2 17  ? 1.380   -9.232  -14.033 1.00 1.88  ? 17  VAL B HA   2  
ATOM 9787   H HB   . VAL B 2 17  ? 3.873   -10.915 -14.262 1.00 1.94  ? 17  VAL B HB   2  
ATOM 9788   H HG11 . VAL B 2 17  ? 3.308   -10.162 -16.517 1.00 2.22  ? 17  VAL B HG11 2  
ATOM 9789   H HG12 . VAL B 2 17  ? 4.729   -9.319  -15.903 1.00 2.19  ? 17  VAL B HG12 2  
ATOM 9790   H HG13 . VAL B 2 17  ? 3.165   -8.505  -15.931 1.00 2.17  ? 17  VAL B HG13 2  
ATOM 9791   H HG21 . VAL B 2 17  ? 3.756   -9.412  -12.354 1.00 1.82  ? 17  VAL B HG21 2  
ATOM 9792   H HG22 . VAL B 2 17  ? 3.387   -8.059  -13.422 1.00 2.00  ? 17  VAL B HG22 2  
ATOM 9793   H HG23 . VAL B 2 17  ? 4.963   -8.844  -13.506 1.00 2.01  ? 17  VAL B HG23 2  
ATOM 9794   N N    . THR B 2 18  ? 1.270   -12.190 -15.443 1.00 2.04  ? 18  THR B N    2  
ATOM 9795   C CA   . THR B 2 18  ? 0.710   -12.934 -16.566 1.00 2.11  ? 18  THR B CA   2  
ATOM 9796   C C    . THR B 2 18  ? -0.790  -12.668 -16.689 1.00 2.08  ? 18  THR B C    2  
ATOM 9797   O O    . THR B 2 18  ? -1.298  -12.442 -17.785 1.00 2.12  ? 18  THR B O    2  
ATOM 9798   C CB   . THR B 2 18  ? 0.978   -14.458 -16.447 1.00 2.18  ? 18  THR B CB   2  
ATOM 9799   O OG1  . THR B 2 18  ? 0.240   -15.177 -17.444 1.00 2.44  ? 18  THR B OG1  2  
ATOM 9800   C CG2  . THR B 2 18  ? 0.612   -14.983 -15.067 1.00 2.43  ? 18  THR B CG2  2  
ATOM 9801   H H    . THR B 2 18  ? 1.675   -12.681 -14.698 1.00 2.03  ? 18  THR B H    2  
ATOM 9802   H HA   . THR B 2 18  ? 1.196   -12.578 -17.463 1.00 2.15  ? 18  THR B HA   2  
ATOM 9803   H HB   . THR B 2 18  ? 2.032   -14.633 -16.606 1.00 2.47  ? 18  THR B HB   2  
ATOM 9804   H HG1  . THR B 2 18  ? -0.619  -15.436 -17.085 1.00 2.71  ? 18  THR B HG1  2  
ATOM 9805   H HG21 . THR B 2 18  ? 1.274   -14.554 -14.329 1.00 2.80  ? 18  THR B HG21 2  
ATOM 9806   H HG22 . THR B 2 18  ? 0.710   -16.059 -15.055 1.00 2.46  ? 18  THR B HG22 2  
ATOM 9807   H HG23 . THR B 2 18  ? -0.407  -14.711 -14.837 1.00 2.77  ? 18  THR B HG23 2  
ATOM 9808   N N    . THR B 2 19  ? -1.487  -12.663 -15.559 1.00 2.01  ? 19  THR B N    2  
ATOM 9809   C CA   . THR B 2 19  ? -2.917  -12.413 -15.544 1.00 1.98  ? 19  THR B CA   2  
ATOM 9810   C C    . THR B 2 19  ? -3.205  -10.963 -15.924 1.00 1.94  ? 19  THR B C    2  
ATOM 9811   O O    . THR B 2 19  ? -4.156  -10.670 -16.647 1.00 1.96  ? 19  THR B O    2  
ATOM 9812   C CB   . THR B 2 19  ? -3.496  -12.714 -14.154 1.00 1.93  ? 19  THR B CB   2  
ATOM 9813   O OG1  . THR B 2 19  ? -2.459  -13.246 -13.314 1.00 1.96  ? 19  THR B OG1  2  
ATOM 9814   C CG2  . THR B 2 19  ? -4.643  -13.707 -14.250 1.00 1.98  ? 19  THR B CG2  2  
ATOM 9815   H H    . THR B 2 19  ? -1.032  -12.839 -14.708 1.00 1.99  ? 19  THR B H    2  
ATOM 9816   H HA   . THR B 2 19  ? -3.384  -13.070 -16.261 1.00 2.04  ? 19  THR B HA   2  
ATOM 9817   H HB   . THR B 2 19  ? -3.865  -11.793 -13.725 1.00 1.93  ? 19  THR B HB   2  
ATOM 9818   H HG1  . THR B 2 19  ? -2.732  -14.108 -12.970 1.00 1.94  ? 19  THR B HG1  2  
ATOM 9819   H HG21 . THR B 2 19  ? -4.290  -14.621 -14.705 1.00 2.10  ? 19  THR B HG21 2  
ATOM 9820   H HG22 . THR B 2 19  ? -5.433  -13.286 -14.855 1.00 2.10  ? 19  THR B HG22 2  
ATOM 9821   H HG23 . THR B 2 19  ? -5.021  -13.918 -13.261 1.00 2.03  ? 19  THR B HG23 2  
ATOM 9822   N N    . PHE B 2 20  ? -2.359  -10.065 -15.436 1.00 1.91  ? 20  PHE B N    2  
ATOM 9823   C CA   . PHE B 2 20  ? -2.486  -8.643  -15.718 1.00 1.88  ? 20  PHE B CA   2  
ATOM 9824   C C    . PHE B 2 20  ? -2.283  -8.376  -17.211 1.00 1.94  ? 20  PHE B C    2  
ATOM 9825   O O    . PHE B 2 20  ? -3.073  -7.677  -17.844 1.00 1.94  ? 20  PHE B O    2  
ATOM 9826   C CB   . PHE B 2 20  ? -1.460  -7.868  -14.869 1.00 1.84  ? 20  PHE B CB   2  
ATOM 9827   C CG   . PHE B 2 20  ? -1.025  -6.538  -15.434 1.00 1.86  ? 20  PHE B CG   2  
ATOM 9828   C CD1  . PHE B 2 20  ? -1.767  -5.391  -15.197 1.00 1.82  ? 20  PHE B CD1  2  
ATOM 9829   C CD2  . PHE B 2 20  ? 0.133   -6.436  -16.193 1.00 1.95  ? 20  PHE B CD2  2  
ATOM 9830   C CE1  . PHE B 2 20  ? -1.367  -4.170  -15.710 1.00 1.85  ? 20  PHE B CE1  2  
ATOM 9831   C CE2  . PHE B 2 20  ? 0.535   -5.217  -16.708 1.00 1.98  ? 20  PHE B CE2  2  
ATOM 9832   C CZ   . PHE B 2 20  ? -0.217  -4.085  -16.468 1.00 1.94  ? 20  PHE B CZ   2  
ATOM 9833   H H    . PHE B 2 20  ? -1.625  -10.369 -14.855 1.00 1.90  ? 20  PHE B H    2  
ATOM 9834   H HA   . PHE B 2 20  ? -3.482  -8.336  -15.438 1.00 1.85  ? 20  PHE B HA   2  
ATOM 9835   H HB2  . PHE B 2 20  ? -1.887  -7.682  -13.895 1.00 1.78  ? 20  PHE B HB2  2  
ATOM 9836   H HB3  . PHE B 2 20  ? -0.578  -8.481  -14.750 1.00 1.89  ? 20  PHE B HB3  2  
ATOM 9837   H HD1  . PHE B 2 20  ? -2.666  -5.453  -14.603 1.00 1.77  ? 20  PHE B HD1  2  
ATOM 9838   H HD2  . PHE B 2 20  ? 0.720   -7.322  -16.387 1.00 2.01  ? 20  PHE B HD2  2  
ATOM 9839   H HE1  . PHE B 2 20  ? -1.957  -3.285  -15.520 1.00 1.84  ? 20  PHE B HE1  2  
ATOM 9840   H HE2  . PHE B 2 20  ? 1.438   -5.151  -17.295 1.00 2.07  ? 20  PHE B HE2  2  
ATOM 9841   H HZ   . PHE B 2 20  ? 0.097   -3.131  -16.870 1.00 1.98  ? 20  PHE B HZ   2  
ATOM 9842   N N    . PHE B 2 21  ? -1.236  -8.968  -17.769 1.00 2.00  ? 21  PHE B N    2  
ATOM 9843   C CA   . PHE B 2 21  ? -0.907  -8.789  -19.177 1.00 2.07  ? 21  PHE B CA   2  
ATOM 9844   C C    . PHE B 2 21  ? -1.865  -9.561  -20.087 1.00 2.11  ? 21  PHE B C    2  
ATOM 9845   O O    . PHE B 2 21  ? -2.098  -9.165  -21.227 1.00 2.19  ? 21  PHE B O    2  
ATOM 9846   C CB   . PHE B 2 21  ? 0.539   -9.226  -19.425 1.00 2.12  ? 21  PHE B CB   2  
ATOM 9847   C CG   . PHE B 2 21  ? 1.102   -8.760  -20.738 1.00 2.19  ? 21  PHE B CG   2  
ATOM 9848   C CD1  . PHE B 2 21  ? 1.232   -7.406  -21.014 1.00 2.39  ? 21  PHE B CD1  2  
ATOM 9849   C CD2  . PHE B 2 21  ? 1.507   -9.675  -21.694 1.00 2.27  ? 21  PHE B CD2  2  
ATOM 9850   C CE1  . PHE B 2 21  ? 1.756   -6.978  -22.217 1.00 2.59  ? 21  PHE B CE1  2  
ATOM 9851   C CE2  . PHE B 2 21  ? 2.030   -9.252  -22.900 1.00 2.47  ? 21  PHE B CE2  2  
ATOM 9852   C CZ   . PHE B 2 21  ? 2.155   -7.902  -23.162 1.00 2.60  ? 21  PHE B CZ   2  
ATOM 9853   H H    . PHE B 2 21  ? -0.656  -9.538  -17.213 1.00 2.00  ? 21  PHE B H    2  
ATOM 9854   H HA   . PHE B 2 21  ? -0.994  -7.737  -19.400 1.00 2.06  ? 21  PHE B HA   2  
ATOM 9855   H HB2  . PHE B 2 21  ? 1.165   -8.831  -18.639 1.00 2.18  ? 21  PHE B HB2  2  
ATOM 9856   H HB3  . PHE B 2 21  ? 0.588   -10.306 -19.406 1.00 2.15  ? 21  PHE B HB3  2  
ATOM 9857   H HD1  . PHE B 2 21  ? 0.918   -6.681  -20.276 1.00 2.52  ? 21  PHE B HD1  2  
ATOM 9858   H HD2  . PHE B 2 21  ? 1.410   -10.731 -21.490 1.00 2.33  ? 21  PHE B HD2  2  
ATOM 9859   H HE1  . PHE B 2 21  ? 1.853   -5.921  -22.419 1.00 2.86  ? 21  PHE B HE1  2  
ATOM 9860   H HE2  . PHE B 2 21  ? 2.340   -9.975  -23.638 1.00 2.66  ? 21  PHE B HE2  2  
ATOM 9861   H HZ   . PHE B 2 21  ? 2.565   -7.572  -24.102 1.00 2.83  ? 21  PHE B HZ   2  
ATOM 9862   N N    . THR B 2 22  ? -2.425  -10.652 -19.580 1.00 2.08  ? 22  THR B N    2  
ATOM 9863   C CA   . THR B 2 22  ? -3.347  -11.467 -20.358 1.00 2.12  ? 22  THR B CA   2  
ATOM 9864   C C    . THR B 2 22  ? -4.704  -10.774 -20.493 1.00 2.06  ? 22  THR B C    2  
ATOM 9865   O O    . THR B 2 22  ? -5.496  -11.103 -21.373 1.00 2.09  ? 22  THR B O    2  
ATOM 9866   C CB   . THR B 2 22  ? -3.507  -12.888 -19.749 1.00 2.15  ? 22  THR B CB   2  
ATOM 9867   O OG1  . THR B 2 22  ? -3.483  -13.872 -20.789 1.00 2.44  ? 22  THR B OG1  2  
ATOM 9868   C CG2  . THR B 2 22  ? -4.795  -13.035 -18.941 1.00 2.31  ? 22  THR B CG2  2  
ATOM 9869   H H    . THR B 2 22  ? -2.203  -10.924 -18.663 1.00 2.05  ? 22  THR B H    2  
ATOM 9870   H HA   . THR B 2 22  ? -2.923  -11.576 -21.348 1.00 2.20  ? 22  THR B HA   2  
ATOM 9871   H HB   . THR B 2 22  ? -2.669  -13.066 -19.087 1.00 2.34  ? 22  THR B HB   2  
ATOM 9872   H HG1  . THR B 2 22  ? -3.734  -14.729 -20.424 1.00 2.72  ? 22  THR B HG1  2  
ATOM 9873   H HG21 . THR B 2 22  ? -5.646  -12.848 -19.579 1.00 2.66  ? 22  THR B HG21 2  
ATOM 9874   H HG22 . THR B 2 22  ? -4.792  -12.323 -18.129 1.00 2.54  ? 22  THR B HG22 2  
ATOM 9875   H HG23 . THR B 2 22  ? -4.857  -14.037 -18.539 1.00 2.37  ? 22  THR B HG23 2  
ATOM 9876   N N    . PHE B 2 23  ? -4.969  -9.810  -19.624 1.00 1.99  ? 23  PHE B N    2  
ATOM 9877   C CA   . PHE B 2 23  ? -6.220  -9.073  -19.681 1.00 1.94  ? 23  PHE B CA   2  
ATOM 9878   C C    . PHE B 2 23  ? -6.005  -7.720  -20.344 1.00 1.94  ? 23  PHE B C    2  
ATOM 9879   O O    . PHE B 2 23  ? -6.852  -7.249  -21.098 1.00 1.99  ? 23  PHE B O    2  
ATOM 9880   C CB   . PHE B 2 23  ? -6.819  -8.902  -18.286 1.00 1.85  ? 23  PHE B CB   2  
ATOM 9881   C CG   . PHE B 2 23  ? -7.902  -9.900  -17.986 1.00 1.86  ? 23  PHE B CG   2  
ATOM 9882   C CD1  . PHE B 2 23  ? -9.212  -9.653  -18.372 1.00 1.86  ? 23  PHE B CD1  2  
ATOM 9883   C CD2  . PHE B 2 23  ? -7.614  -11.086 -17.329 1.00 1.89  ? 23  PHE B CD2  2  
ATOM 9884   C CE1  . PHE B 2 23  ? -10.212 -10.570 -18.107 1.00 1.88  ? 23  PHE B CE1  2  
ATOM 9885   C CE2  . PHE B 2 23  ? -8.610  -12.005 -17.060 1.00 1.91  ? 23  PHE B CE2  2  
ATOM 9886   C CZ   . PHE B 2 23  ? -9.911  -11.747 -17.450 1.00 1.90  ? 23  PHE B CZ   2  
ATOM 9887   H H    . PHE B 2 23  ? -4.314  -9.597  -18.925 1.00 1.98  ? 23  PHE B H    2  
ATOM 9888   H HA   . PHE B 2 23  ? -6.905  -9.644  -20.288 1.00 1.96  ? 23  PHE B HA   2  
ATOM 9889   H HB2  . PHE B 2 23  ? -6.040  -9.023  -17.549 1.00 1.83  ? 23  PHE B HB2  2  
ATOM 9890   H HB3  . PHE B 2 23  ? -7.243  -7.912  -18.199 1.00 1.83  ? 23  PHE B HB3  2  
ATOM 9891   H HD1  . PHE B 2 23  ? -9.448  -8.732  -18.886 1.00 1.87  ? 23  PHE B HD1  2  
ATOM 9892   H HD2  . PHE B 2 23  ? -6.598  -11.289 -17.023 1.00 1.91  ? 23  PHE B HD2  2  
ATOM 9893   H HE1  . PHE B 2 23  ? -11.227 -10.365 -18.412 1.00 1.91  ? 23  PHE B HE1  2  
ATOM 9894   H HE2  . PHE B 2 23  ? -8.372  -12.923 -16.545 1.00 1.96  ? 23  PHE B HE2  2  
ATOM 9895   H HZ   . PHE B 2 23  ? -10.693 -12.465 -17.243 1.00 1.93  ? 23  PHE B HZ   2  
ATOM 9896   N N    . ALA B 2 24  ? -4.855  -7.115  -20.079 1.00 1.94  ? 24  ALA B N    2  
ATOM 9897   C CA   . ALA B 2 24  ? -4.515  -5.820  -20.656 1.00 1.95  ? 24  ALA B CA   2  
ATOM 9898   C C    . ALA B 2 24  ? -4.023  -5.987  -22.090 1.00 2.05  ? 24  ALA B C    2  
ATOM 9899   O O    . ALA B 2 24  ? -2.855  -5.740  -22.389 1.00 2.21  ? 24  ALA B O    2  
ATOM 9900   C CB   . ALA B 2 24  ? -3.458  -5.127  -19.809 1.00 1.93  ? 24  ALA B CB   2  
ATOM 9901   H H    . ALA B 2 24  ? -4.211  -7.549  -19.479 1.00 1.93  ? 24  ALA B H    2  
ATOM 9902   H HA   . ALA B 2 24  ? -5.406  -5.208  -20.660 1.00 1.92  ? 24  ALA B HA   2  
ATOM 9903   H HB1  . ALA B 2 24  ? -2.527  -5.669  -19.882 1.00 1.94  ? 24  ALA B HB1  2  
ATOM 9904   H HB2  . ALA B 2 24  ? -3.781  -5.106  -18.778 1.00 1.95  ? 24  ALA B HB2  2  
ATOM 9905   H HB3  . ALA B 2 24  ? -3.316  -4.118  -20.164 1.00 2.11  ? 24  ALA B HB3  2  
ATOM 9906   N N    . ARG B 2 25  ? -4.916  -6.443  -22.958 1.00 2.03  ? 25  ARG B N    2  
ATOM 9907   C CA   . ARG B 2 25  ? -4.600  -6.657  -24.368 1.00 2.11  ? 25  ARG B CA   2  
ATOM 9908   C C    . ARG B 2 25  ? -5.858  -7.025  -25.141 1.00 2.13  ? 25  ARG B C    2  
ATOM 9909   O O    . ARG B 2 25  ? -5.786  -7.510  -26.268 1.00 2.18  ? 25  ARG B O    2  
ATOM 9910   C CB   . ARG B 2 25  ? -3.546  -7.767  -24.528 1.00 2.18  ? 25  ARG B CB   2  
ATOM 9911   C CG   . ARG B 2 25  ? -3.908  -9.071  -23.829 1.00 2.19  ? 25  ARG B CG   2  
ATOM 9912   C CD   . ARG B 2 25  ? -4.638  -10.034 -24.753 1.00 2.28  ? 25  ARG B CD   2  
ATOM 9913   N NE   . ARG B 2 25  ? -5.605  -10.849 -24.023 1.00 2.29  ? 25  ARG B NE   2  
ATOM 9914   C CZ   . ARG B 2 25  ? -6.278  -11.873 -24.544 1.00 2.40  ? 25  ARG B CZ   2  
ATOM 9915   N NH1  . ARG B 2 25  ? -6.081  -12.237 -25.802 1.00 2.60  ? 25  ARG B NH1  2  
ATOM 9916   N NH2  . ARG B 2 25  ? -7.148  -12.533 -23.791 1.00 2.57  ? 25  ARG B NH2  2  
ATOM 9917   H H    . ARG B 2 25  ? -5.826  -6.639  -22.636 1.00 2.00  ? 25  ARG B H    2  
ATOM 9918   H HA   . ARG B 2 25  ? -4.202  -5.734  -24.762 1.00 2.13  ? 25  ARG B HA   2  
ATOM 9919   H HB2  . ARG B 2 25  ? -3.421  -7.974  -25.579 1.00 2.25  ? 25  ARG B HB2  2  
ATOM 9920   H HB3  . ARG B 2 25  ? -2.607  -7.416  -24.124 1.00 2.19  ? 25  ARG B HB3  2  
ATOM 9921   H HG2  . ARG B 2 25  ? -3.001  -9.543  -23.479 1.00 2.24  ? 25  ARG B HG2  2  
ATOM 9922   H HG3  . ARG B 2 25  ? -4.544  -8.847  -22.984 1.00 2.22  ? 25  ARG B HG3  2  
ATOM 9923   H HD2  . ARG B 2 25  ? -5.155  -9.465  -25.511 1.00 2.44  ? 25  ARG B HD2  2  
ATOM 9924   H HD3  . ARG B 2 25  ? -3.913  -10.683 -25.222 1.00 2.41  ? 25  ARG B HD3  2  
ATOM 9925   H HE   . ARG B 2 25  ? -5.766  -10.614 -23.075 1.00 2.41  ? 25  ARG B HE   2  
ATOM 9926   H HH11 . ARG B 2 25  ? -5.422  -11.743 -26.374 1.00 2.67  ? 25  ARG B HH11 2  
ATOM 9927   H HH12 . ARG B 2 25  ? -6.589  -13.011 -26.188 1.00 2.83  ? 25  ARG B HH12 2  
ATOM 9928   H HH21 . ARG B 2 25  ? -7.299  -12.259 -22.837 1.00 2.68  ? 25  ARG B HH21 2  
ATOM 9929   H HH22 . ARG B 2 25  ? -7.658  -13.313 -24.170 1.00 2.73  ? 25  ARG B HH22 2  
ATOM 9930   N N    . GLN B 2 26  ? -7.009  -6.781  -24.537 1.00 2.10  ? 26  GLN B N    2  
ATOM 9931   C CA   . GLN B 2 26  ? -8.271  -7.116  -25.168 1.00 2.12  ? 26  GLN B CA   2  
ATOM 9932   C C    . GLN B 2 26  ? -8.878  -5.899  -25.848 1.00 2.13  ? 26  GLN B C    2  
ATOM 9933   O O    . GLN B 2 26  ? -9.315  -5.975  -26.996 1.00 2.19  ? 26  GLN B O    2  
ATOM 9934   C CB   . GLN B 2 26  ? -9.243  -7.706  -24.147 1.00 2.06  ? 26  GLN B CB   2  
ATOM 9935   C CG   . GLN B 2 26  ? -9.297  -9.225  -24.180 1.00 2.09  ? 26  GLN B CG   2  
ATOM 9936   C CD   . GLN B 2 26  ? -9.335  -9.845  -22.797 1.00 2.18  ? 26  GLN B CD   2  
ATOM 9937   O OE1  . GLN B 2 26  ? -8.298  -10.175 -22.223 1.00 2.33  ? 26  GLN B OE1  2  
ATOM 9938   N NE2  . GLN B 2 26  ? -10.531 -10.015 -22.255 1.00 2.26  ? 26  GLN B NE2  2  
ATOM 9939   H H    . GLN B 2 26  ? -7.014  -6.333  -23.658 1.00 2.09  ? 26  GLN B H    2  
ATOM 9940   H HA   . GLN B 2 26  ? -8.066  -7.860  -25.921 1.00 2.18  ? 26  GLN B HA   2  
ATOM 9941   H HB2  . GLN B 2 26  ? -8.941  -7.398  -23.156 1.00 2.08  ? 26  GLN B HB2  2  
ATOM 9942   H HB3  . GLN B 2 26  ? -10.235 -7.326  -24.347 1.00 2.09  ? 26  GLN B HB3  2  
ATOM 9943   H HG2  . GLN B 2 26  ? -10.183 -9.529  -24.717 1.00 2.12  ? 26  GLN B HG2  2  
ATOM 9944   H HG3  . GLN B 2 26  ? -8.422  -9.591  -24.697 1.00 2.23  ? 26  GLN B HG3  2  
ATOM 9945   H HE21 . GLN B 2 26  ? -11.317 -9.736  -22.769 1.00 2.22  ? 26  GLN B HE21 2  
ATOM 9946   H HE22 . GLN B 2 26  ? -10.580 -10.411 -21.360 1.00 2.46  ? 26  GLN B HE22 2  
ATOM 9947   N N    . GLU B 2 27  ? -8.896  -4.777  -25.145 1.00 2.09  ? 27  GLU B N    2  
ATOM 9948   C CA   . GLU B 2 27  ? -9.448  -3.552  -25.694 1.00 2.12  ? 27  GLU B CA   2  
ATOM 9949   C C    . GLU B 2 27  ? -8.382  -2.775  -26.455 1.00 2.17  ? 27  GLU B C    2  
ATOM 9950   O O    . GLU B 2 27  ? -8.473  -2.614  -27.674 1.00 2.26  ? 27  GLU B O    2  
ATOM 9951   C CB   . GLU B 2 27  ? -10.047 -2.684  -24.591 1.00 2.05  ? 27  GLU B CB   2  
ATOM 9952   C CG   . GLU B 2 27  ? -11.390 -3.185  -24.093 1.00 2.03  ? 27  GLU B CG   2  
ATOM 9953   C CD   . GLU B 2 27  ? -12.235 -2.075  -23.511 1.00 2.03  ? 27  GLU B CD   2  
ATOM 9954   O OE1  . GLU B 2 27  ? -12.577 -1.135  -24.261 1.00 2.18  ? 27  GLU B OE1  2  
ATOM 9955   O OE2  . GLU B 2 27  ? -12.563 -2.133  -22.310 1.00 2.06  ? 27  GLU B OE2  2  
ATOM 9956   H H    . GLU B 2 27  ? -8.522  -4.772  -24.227 1.00 2.06  ? 27  GLU B H    2  
ATOM 9957   H HA   . GLU B 2 27  ? -10.232 -3.829  -26.385 1.00 2.15  ? 27  GLU B HA   2  
ATOM 9958   H HB2  . GLU B 2 27  ? -9.362  -2.660  -23.756 1.00 2.01  ? 27  GLU B HB2  2  
ATOM 9959   H HB3  . GLU B 2 27  ? -10.178 -1.681  -24.967 1.00 2.08  ? 27  GLU B HB3  2  
ATOM 9960   H HG2  . GLU B 2 27  ? -11.923 -3.631  -24.918 1.00 2.12  ? 27  GLU B HG2  2  
ATOM 9961   H HG3  . GLU B 2 27  ? -11.223 -3.930  -23.329 1.00 2.06  ? 27  GLU B HG3  2  
ATOM 9962   N N    . GLY B 2 28  ? -7.366  -2.309  -25.746 1.00 2.14  ? 28  GLY B N    2  
ATOM 9963   C CA   . GLY B 2 28  ? -6.313  -1.560  -26.393 1.00 2.19  ? 28  GLY B CA   2  
ATOM 9964   C C    . GLY B 2 28  ? -5.156  -1.250  -25.471 1.00 2.15  ? 28  GLY B C    2  
ATOM 9965   O O    . GLY B 2 28  ? -5.340  -1.142  -24.261 1.00 2.09  ? 28  GLY B O    2  
ATOM 9966   H H    . GLY B 2 28  ? -7.328  -2.471  -24.775 1.00 2.10  ? 28  GLY B H    2  
ATOM 9967   H HA2  . GLY B 2 28  ? -5.945  -2.133  -27.229 1.00 2.24  ? 28  GLY B HA2  2  
ATOM 9968   H HA3  . GLY B 2 28  ? -6.724  -0.631  -26.763 1.00 2.22  ? 28  GLY B HA3  2  
ATOM 9969   N N    . ARG B 2 29  ? -3.971  -1.093  -26.063 1.00 2.20  ? 29  ARG B N    2  
ATOM 9970   C CA   . ARG B 2 29  ? -2.743  -0.791  -25.324 1.00 2.19  ? 29  ARG B CA   2  
ATOM 9971   C C    . ARG B 2 29  ? -2.399  -1.896  -24.335 1.00 2.15  ? 29  ARG B C    2  
ATOM 9972   O O    . ARG B 2 29  ? -2.866  -1.887  -23.194 1.00 2.07  ? 29  ARG B O    2  
ATOM 9973   C CB   . ARG B 2 29  ? -2.849  0.555   -24.596 1.00 2.16  ? 29  ARG B CB   2  
ATOM 9974   C CG   . ARG B 2 29  ? -2.972  1.744   -25.535 1.00 2.35  ? 29  ARG B CG   2  
ATOM 9975   C CD   . ARG B 2 29  ? -3.180  3.042   -24.779 1.00 2.34  ? 29  ARG B CD   2  
ATOM 9976   N NE   . ARG B 2 29  ? -3.547  4.131   -25.675 1.00 2.57  ? 29  ARG B NE   2  
ATOM 9977   C CZ   . ARG B 2 29  ? -4.552  4.973   -25.447 1.00 2.59  ? 29  ARG B CZ   2  
ATOM 9978   N NH1  . ARG B 2 29  ? -5.231  4.913   -24.310 1.00 2.43  ? 29  ARG B NH1  2  
ATOM 9979   N NH2  . ARG B 2 29  ? -4.858  5.901   -26.346 1.00 2.89  ? 29  ARG B NH2  2  
ATOM 9980   H H    . ARG B 2 29  ? -3.922  -1.177  -27.038 1.00 2.26  ? 29  ARG B H    2  
ATOM 9981   H HA   . ARG B 2 29  ? -1.943  -0.723  -26.048 1.00 2.26  ? 29  ARG B HA   2  
ATOM 9982   H HB2  . ARG B 2 29  ? -3.718  0.540   -23.956 1.00 2.14  ? 29  ARG B HB2  2  
ATOM 9983   H HB3  . ARG B 2 29  ? -1.964  0.694   -23.987 1.00 2.17  ? 29  ARG B HB3  2  
ATOM 9984   H HG2  . ARG B 2 29  ? -2.066  1.824   -26.116 1.00 2.51  ? 29  ARG B HG2  2  
ATOM 9985   H HG3  . ARG B 2 29  ? -3.812  1.583   -26.195 1.00 2.48  ? 29  ARG B HG3  2  
ATOM 9986   H HD2  . ARG B 2 29  ? -3.968  2.900   -24.054 1.00 2.26  ? 29  ARG B HD2  2  
ATOM 9987   H HD3  . ARG B 2 29  ? -2.264  3.301   -24.270 1.00 2.35  ? 29  ARG B HD3  2  
ATOM 9988   H HE   . ARG B 2 29  ? -3.028  4.221   -26.508 1.00 2.79  ? 29  ARG B HE   2  
ATOM 9989   H HH11 . ARG B 2 29  ? -4.989  4.230   -23.599 1.00 2.29  ? 29  ARG B HH11 2  
ATOM 9990   H HH12 . ARG B 2 29  ? -6.000  5.538   -24.148 1.00 2.52  ? 29  ARG B HH12 2  
ATOM 9991   H HH21 . ARG B 2 29  ? -4.336  5.972   -27.197 1.00 3.10  ? 29  ARG B HH21 2  
ATOM 9992   H HH22 . ARG B 2 29  ? -5.619  6.532   -26.178 1.00 2.95  ? 29  ARG B HH22 2  
ATOM 9993   N N    . LYS B 2 30  ? -1.580  -2.847  -24.781 1.00 2.21  ? 30  LYS B N    2  
ATOM 9994   C CA   . LYS B 2 30  ? -1.160  -3.960  -23.935 1.00 2.18  ? 30  LYS B CA   2  
ATOM 9995   C C    . LYS B 2 30  ? -0.209  -3.472  -22.839 1.00 2.15  ? 30  LYS B C    2  
ATOM 9996   O O    . LYS B 2 30  ? 1.002   -3.692  -22.896 1.00 2.21  ? 30  LYS B O    2  
ATOM 9997   C CB   . LYS B 2 30  ? -0.504  -5.072  -24.772 1.00 2.27  ? 30  LYS B CB   2  
ATOM 9998   C CG   . LYS B 2 30  ? 0.526   -4.583  -25.784 1.00 2.37  ? 30  LYS B CG   2  
ATOM 9999   C CD   . LYS B 2 30  ? 1.264   -5.749  -26.417 1.00 2.48  ? 30  LYS B CD   2  
ATOM 10000  C CE   . LYS B 2 30  ? 2.338   -5.281  -27.384 1.00 2.59  ? 30  LYS B CE   2  
ATOM 10001  N NZ   . LYS B 2 30  ? 3.096   -6.423  -27.950 1.00 2.81  ? 30  LYS B NZ   2  
ATOM 10002  H H    . LYS B 2 30  ? -1.253  -2.795  -25.704 1.00 2.28  ? 30  LYS B H    2  
ATOM 10003  H HA   . LYS B 2 30  ? -2.045  -4.359  -23.462 1.00 2.13  ? 30  LYS B HA   2  
ATOM 10004  H HB2  . LYS B 2 30  ? -0.013  -5.763  -24.103 1.00 2.25  ? 30  LYS B HB2  2  
ATOM 10005  H HB3  . LYS B 2 30  ? -1.279  -5.601  -25.309 1.00 2.30  ? 30  LYS B HB3  2  
ATOM 10006  H HG2  . LYS B 2 30  ? 0.024   -4.028  -26.560 1.00 2.41  ? 30  LYS B HG2  2  
ATOM 10007  H HG3  . LYS B 2 30  ? 1.242   -3.947  -25.283 1.00 2.36  ? 30  LYS B HG3  2  
ATOM 10008  H HD2  . LYS B 2 30  ? 1.727   -6.335  -25.639 1.00 2.51  ? 30  LYS B HD2  2  
ATOM 10009  H HD3  . LYS B 2 30  ? 0.554   -6.361  -26.954 1.00 2.59  ? 30  LYS B HD3  2  
ATOM 10010  H HE2  . LYS B 2 30  ? 1.869   -4.735  -28.190 1.00 2.74  ? 30  LYS B HE2  2  
ATOM 10011  H HE3  . LYS B 2 30  ? 3.020   -4.629  -26.859 1.00 2.58  ? 30  LYS B HE3  2  
ATOM 10012  H HZ1  . LYS B 2 30  ? 3.524   -6.983  -27.185 1.00 2.99  ? 30  LYS B HZ1  2  
ATOM 10013  H HZ2  . LYS B 2 30  ? 3.852   -6.079  -28.571 1.00 3.02  ? 30  LYS B HZ2  2  
ATOM 10014  H HZ3  . LYS B 2 30  ? 2.465   -7.037  -28.501 1.00 3.02  ? 30  LYS B HZ3  2  
ATOM 10015  N N    . ASP B 2 31  ? -0.781  -2.801  -21.849 1.00 2.07  ? 31  ASP B N    2  
ATOM 10016  C CA   . ASP B 2 31  ? -0.023  -2.241  -20.734 1.00 2.03  ? 31  ASP B CA   2  
ATOM 10017  C C    . ASP B 2 31  ? -0.971  -1.677  -19.679 1.00 1.97  ? 31  ASP B C    2  
ATOM 10018  O O    . ASP B 2 31  ? -0.630  -1.592  -18.498 1.00 1.97  ? 31  ASP B O    2  
ATOM 10019  C CB   . ASP B 2 31  ? 0.907   -1.133  -21.242 1.00 2.08  ? 31  ASP B CB   2  
ATOM 10020  C CG   . ASP B 2 31  ? 1.606   -0.378  -20.129 1.00 2.06  ? 31  ASP B CG   2  
ATOM 10021  O OD1  . ASP B 2 31  ? 2.434   -0.983  -19.418 1.00 2.13  ? 31  ASP B OD1  2  
ATOM 10022  O OD2  . ASP B 2 31  ? 1.349   0.836   -19.980 1.00 2.09  ? 31  ASP B OD2  2  
ATOM 10023  H H    . ASP B 2 31  ? -1.759  -2.678  -21.868 1.00 2.06  ? 31  ASP B H    2  
ATOM 10024  H HA   . ASP B 2 31  ? 0.568   -3.032  -20.296 1.00 2.03  ? 31  ASP B HA   2  
ATOM 10025  H HB2  . ASP B 2 31  ? 1.661   -1.572  -21.877 1.00 2.13  ? 31  ASP B HB2  2  
ATOM 10026  H HB3  . ASP B 2 31  ? 0.326   -0.427  -21.819 1.00 2.10  ? 31  ASP B HB3  2  
ATOM 10027  N N    . SER B 2 32  ? -2.167  -1.299  -20.111 1.00 1.94  ? 32  SER B N    2  
ATOM 10028  C CA   . SER B 2 32  ? -3.158  -0.731  -19.212 1.00 1.89  ? 32  SER B CA   2  
ATOM 10029  C C    . SER B 2 32  ? -4.486  -1.483  -19.296 1.00 1.87  ? 32  SER B C    2  
ATOM 10030  O O    . SER B 2 32  ? -4.776  -2.144  -20.292 1.00 1.93  ? 32  SER B O    2  
ATOM 10031  C CB   . SER B 2 32  ? -3.359  0.743   -19.554 1.00 1.91  ? 32  SER B CB   2  
ATOM 10032  O OG   . SER B 2 32  ? -2.783  1.059   -20.816 1.00 2.12  ? 32  SER B OG   2  
ATOM 10033  H H    . SER B 2 32  ? -2.390  -1.401  -21.060 1.00 1.98  ? 32  SER B H    2  
ATOM 10034  H HA   . SER B 2 32  ? -2.777  -0.809  -18.204 1.00 1.87  ? 32  SER B HA   2  
ATOM 10035  H HB2  . SER B 2 32  ? -4.414  0.958   -19.592 1.00 1.96  ? 32  SER B HB2  2  
ATOM 10036  H HB3  . SER B 2 32  ? -2.895  1.354   -18.794 1.00 2.02  ? 32  SER B HB3  2  
ATOM 10037  H HG   . SER B 2 32  ? -3.399  0.811   -21.517 1.00 2.44  ? 32  SER B HG   2  
ATOM 10038  N N    . LEU B 2 33  ? -5.281  -1.373  -18.238 1.00 1.79  ? 33  LEU B N    2  
ATOM 10039  C CA   . LEU B 2 33  ? -6.578  -2.027  -18.166 1.00 1.77  ? 33  LEU B CA   2  
ATOM 10040  C C    . LEU B 2 33  ? -7.702  -1.032  -18.421 1.00 1.75  ? 33  LEU B C    2  
ATOM 10041  O O    . LEU B 2 33  ? -7.820  -0.023  -17.718 1.00 1.70  ? 33  LEU B O    2  
ATOM 10042  C CB   . LEU B 2 33  ? -6.783  -2.663  -16.784 1.00 1.70  ? 33  LEU B CB   2  
ATOM 10043  C CG   . LEU B 2 33  ? -6.204  -4.070  -16.582 1.00 1.73  ? 33  LEU B CG   2  
ATOM 10044  C CD1  . LEU B 2 33  ? -6.687  -5.020  -17.664 1.00 1.79  ? 33  LEU B CD1  2  
ATOM 10045  C CD2  . LEU B 2 33  ? -4.686  -4.031  -16.540 1.00 1.79  ? 33  LEU B CD2  2  
ATOM 10046  H H    . LEU B 2 33  ? -4.985  -0.825  -17.474 1.00 1.77  ? 33  LEU B H    2  
ATOM 10047  H HA   . LEU B 2 33  ? -6.614  -2.798  -18.920 1.00 1.81  ? 33  LEU B HA   2  
ATOM 10048  H HB2  . LEU B 2 33  ? -6.332  -2.010  -16.049 1.00 1.68  ? 33  LEU B HB2  2  
ATOM 10049  H HB3  . LEU B 2 33  ? -7.845  -2.706  -16.590 1.00 1.67  ? 33  LEU B HB3  2  
ATOM 10050  H HG   . LEU B 2 33  ? -6.551  -4.454  -15.633 1.00 1.69  ? 33  LEU B HG   2  
ATOM 10051  H HD11 . LEU B 2 33  ? -6.257  -4.735  -18.613 1.00 1.98  ? 33  LEU B HD11 2  
ATOM 10052  H HD12 . LEU B 2 33  ? -7.764  -4.973  -17.730 1.00 1.83  ? 33  LEU B HD12 2  
ATOM 10053  H HD13 . LEU B 2 33  ? -6.385  -6.029  -17.422 1.00 1.91  ? 33  LEU B HD13 2  
ATOM 10054  H HD21 . LEU B 2 33  ? -4.300  -5.039  -16.486 1.00 1.85  ? 33  LEU B HD21 2  
ATOM 10055  H HD22 . LEU B 2 33  ? -4.363  -3.475  -15.672 1.00 1.79  ? 33  LEU B HD22 2  
ATOM 10056  H HD23 . LEU B 2 33  ? -4.313  -3.551  -17.433 1.00 1.83  ? 33  LEU B HD23 2  
ATOM 10057  N N    . SER B 2 34  ? -8.512  -1.305  -19.426 1.00 1.79  ? 34  SER B N    2  
ATOM 10058  C CA   . SER B 2 34  ? -9.640  -0.446  -19.741 1.00 1.78  ? 34  SER B CA   2  
ATOM 10059  C C    . SER B 2 34  ? -10.816 -0.773  -18.814 1.00 1.71  ? 34  SER B C    2  
ATOM 10060  O O    . SER B 2 34  ? -10.728 -1.697  -18.002 1.00 1.67  ? 34  SER B O    2  
ATOM 10061  C CB   . SER B 2 34  ? -10.039 -0.612  -21.206 1.00 1.86  ? 34  SER B CB   2  
ATOM 10062  O OG   . SER B 2 34  ? -8.899  -0.572  -22.050 1.00 2.04  ? 34  SER B OG   2  
ATOM 10063  H H    . SER B 2 34  ? -8.337  -2.101  -19.988 1.00 1.83  ? 34  SER B H    2  
ATOM 10064  H HA   . SER B 2 34  ? -9.337  0.577   -19.572 1.00 1.79  ? 34  SER B HA   2  
ATOM 10065  H HB2  . SER B 2 34  ? -10.537 -1.562  -21.339 1.00 2.00  ? 34  SER B HB2  2  
ATOM 10066  H HB3  . SER B 2 34  ? -10.706 0.186   -21.485 1.00 2.07  ? 34  SER B HB3  2  
ATOM 10067  H HG   . SER B 2 34  ? -8.410  -1.409  -21.962 1.00 2.28  ? 34  SER B HG   2  
ATOM 10068  N N    . VAL B 2 35  ? -11.909 -0.026  -18.946 1.00 1.70  ? 35  VAL B N    2  
ATOM 10069  C CA   . VAL B 2 35  ? -13.091 -0.215  -18.104 1.00 1.64  ? 35  VAL B CA   2  
ATOM 10070  C C    . VAL B 2 35  ? -13.618 -1.650  -18.157 1.00 1.63  ? 35  VAL B C    2  
ATOM 10071  O O    . VAL B 2 35  ? -13.805 -2.289  -17.117 1.00 1.58  ? 35  VAL B O    2  
ATOM 10072  C CB   . VAL B 2 35  ? -14.223 0.759   -18.502 1.00 1.66  ? 35  VAL B CB   2  
ATOM 10073  C CG1  . VAL B 2 35  ? -15.404 0.633   -17.548 1.00 1.60  ? 35  VAL B CG1  2  
ATOM 10074  C CG2  . VAL B 2 35  ? -13.713 2.193   -18.523 1.00 1.71  ? 35  VAL B CG2  2  
ATOM 10075  H H    . VAL B 2 35  ? -11.923 0.678   -19.628 1.00 1.75  ? 35  VAL B H    2  
ATOM 10076  H HA   . VAL B 2 35  ? -12.807 0.008   -17.087 1.00 1.60  ? 35  VAL B HA   2  
ATOM 10077  H HB   . VAL B 2 35  ? -14.561 0.504   -19.496 1.00 1.71  ? 35  VAL B HB   2  
ATOM 10078  H HG11 . VAL B 2 35  ? -15.798 -0.371  -17.594 1.00 1.58  ? 35  VAL B HG11 2  
ATOM 10079  H HG12 . VAL B 2 35  ? -16.174 1.336   -17.832 1.00 1.63  ? 35  VAL B HG12 2  
ATOM 10080  H HG13 . VAL B 2 35  ? -15.074 0.845   -16.543 1.00 1.57  ? 35  VAL B HG13 2  
ATOM 10081  H HG21 . VAL B 2 35  ? -12.951 2.295   -19.282 1.00 1.74  ? 35  VAL B HG21 2  
ATOM 10082  H HG22 . VAL B 2 35  ? -13.296 2.440   -17.558 1.00 1.84  ? 35  VAL B HG22 2  
ATOM 10083  H HG23 . VAL B 2 35  ? -14.531 2.862   -18.741 1.00 1.84  ? 35  VAL B HG23 2  
ATOM 10084  N N    . ASN B 2 36  ? -13.846 -2.162  -19.362 1.00 1.70  ? 36  ASN B N    2  
ATOM 10085  C CA   . ASN B 2 36  ? -14.361 -3.518  -19.521 1.00 1.72  ? 36  ASN B CA   2  
ATOM 10086  C C    . ASN B 2 36  ? -13.351 -4.554  -19.047 1.00 1.72  ? 36  ASN B C    2  
ATOM 10087  O O    . ASN B 2 36  ? -13.706 -5.469  -18.309 1.00 1.70  ? 36  ASN B O    2  
ATOM 10088  C CB   . ASN B 2 36  ? -14.757 -3.800  -20.975 1.00 1.81  ? 36  ASN B CB   2  
ATOM 10089  C CG   . ASN B 2 36  ? -15.137 -5.254  -21.195 1.00 1.86  ? 36  ASN B CG   2  
ATOM 10090  O OD1  . ASN B 2 36  ? -16.273 -5.660  -20.939 1.00 1.90  ? 36  ASN B OD1  2  
ATOM 10091  N ND2  . ASN B 2 36  ? -14.194 -6.045  -21.680 1.00 1.97  ? 36  ASN B ND2  2  
ATOM 10092  H H    . ASN B 2 36  ? -13.661 -1.619  -20.159 1.00 1.75  ? 36  ASN B H    2  
ATOM 10093  H HA   . ASN B 2 36  ? -15.242 -3.600  -18.903 1.00 1.68  ? 36  ASN B HA   2  
ATOM 10094  H HB2  . ASN B 2 36  ? -15.603 -3.185  -21.240 1.00 1.83  ? 36  ASN B HB2  2  
ATOM 10095  H HB3  . ASN B 2 36  ? -13.926 -3.562  -21.625 1.00 1.86  ? 36  ASN B HB3  2  
ATOM 10096  H HD21 . ASN B 2 36  ? -13.318 -5.654  -21.877 1.00 2.02  ? 36  ASN B HD21 2  
ATOM 10097  H HD22 . ASN B 2 36  ? -14.401 -7.004  -21.801 1.00 2.06  ? 36  ASN B HD22 2  
ATOM 10098  N N    . GLU B 2 37  ? -12.096 -4.396  -19.453 1.00 1.76  ? 37  GLU B N    2  
ATOM 10099  C CA   . GLU B 2 37  ? -11.043 -5.332  -19.065 1.00 1.77  ? 37  GLU B CA   2  
ATOM 10100  C C    . GLU B 2 37  ? -10.935 -5.433  -17.542 1.00 1.71  ? 37  GLU B C    2  
ATOM 10101  O O    . GLU B 2 37  ? -10.796 -6.526  -16.990 1.00 1.71  ? 37  GLU B O    2  
ATOM 10102  C CB   . GLU B 2 37  ? -9.708  -4.904  -19.669 1.00 1.82  ? 37  GLU B CB   2  
ATOM 10103  C CG   . GLU B 2 37  ? -9.694  -4.959  -21.188 1.00 1.90  ? 37  GLU B CG   2  
ATOM 10104  C CD   . GLU B 2 37  ? -8.483  -4.274  -21.791 1.00 1.94  ? 37  GLU B CD   2  
ATOM 10105  O OE1  . GLU B 2 37  ? -8.190  -3.130  -21.392 1.00 1.93  ? 37  GLU B OE1  2  
ATOM 10106  O OE2  . GLU B 2 37  ? -7.844  -4.869  -22.685 1.00 1.99  ? 37  GLU B OE2  2  
ATOM 10107  H H    . GLU B 2 37  ? -11.869 -3.630  -20.023 1.00 1.78  ? 37  GLU B H    2  
ATOM 10108  H HA   . GLU B 2 37  ? -11.307 -6.305  -19.458 1.00 1.81  ? 37  GLU B HA   2  
ATOM 10109  H HB2  . GLU B 2 37  ? -9.495  -3.889  -19.366 1.00 1.79  ? 37  GLU B HB2  2  
ATOM 10110  H HB3  . GLU B 2 37  ? -8.931  -5.555  -19.297 1.00 1.84  ? 37  GLU B HB3  2  
ATOM 10111  H HG2  . GLU B 2 37  ? -9.692  -5.993  -21.500 1.00 1.95  ? 37  GLU B HG2  2  
ATOM 10112  H HG3  . GLU B 2 37  ? -10.585 -4.475  -21.558 1.00 1.90  ? 37  GLU B HG3  2  
ATOM 10113  N N    . PHE B 2 38  ? -11.014 -4.289  -16.872 1.00 1.65  ? 38  PHE B N    2  
ATOM 10114  C CA   . PHE B 2 38  ? -10.947 -4.240  -15.416 1.00 1.59  ? 38  PHE B CA   2  
ATOM 10115  C C    . PHE B 2 38  ? -12.146 -4.965  -14.806 1.00 1.57  ? 38  PHE B C    2  
ATOM 10116  O O    . PHE B 2 38  ? -11.998 -5.768  -13.881 1.00 1.55  ? 38  PHE B O    2  
ATOM 10117  C CB   . PHE B 2 38  ? -10.907 -2.779  -14.944 1.00 1.55  ? 38  PHE B CB   2  
ATOM 10118  C CG   . PHE B 2 38  ? -10.952 -2.608  -13.449 1.00 1.52  ? 38  PHE B CG   2  
ATOM 10119  C CD1  . PHE B 2 38  ? -9.817  -2.804  -12.681 1.00 1.54  ? 38  PHE B CD1  2  
ATOM 10120  C CD2  . PHE B 2 38  ? -12.133 -2.245  -12.815 1.00 1.53  ? 38  PHE B CD2  2  
ATOM 10121  C CE1  . PHE B 2 38  ? -9.856  -2.646  -11.310 1.00 1.55  ? 38  PHE B CE1  2  
ATOM 10122  C CE2  . PHE B 2 38  ? -12.177 -2.085  -11.443 1.00 1.54  ? 38  PHE B CE2  2  
ATOM 10123  C CZ   . PHE B 2 38  ? -11.038 -2.286  -10.691 1.00 1.54  ? 38  PHE B CZ   2  
ATOM 10124  H H    . PHE B 2 38  ? -11.111 -3.447  -17.372 1.00 1.66  ? 38  PHE B H    2  
ATOM 10125  H HA   . PHE B 2 38  ? -10.042 -4.739  -15.105 1.00 1.60  ? 38  PHE B HA   2  
ATOM 10126  H HB2  . PHE B 2 38  ? -9.995  -2.324  -15.299 1.00 1.59  ? 38  PHE B HB2  2  
ATOM 10127  H HB3  . PHE B 2 38  ? -11.751 -2.251  -15.365 1.00 1.54  ? 38  PHE B HB3  2  
ATOM 10128  H HD1  . PHE B 2 38  ? -8.893  -3.087  -13.163 1.00 1.58  ? 38  PHE B HD1  2  
ATOM 10129  H HD2  . PHE B 2 38  ? -13.024 -2.086  -13.404 1.00 1.55  ? 38  PHE B HD2  2  
ATOM 10130  H HE1  . PHE B 2 38  ? -8.963  -2.800  -10.724 1.00 1.60  ? 38  PHE B HE1  2  
ATOM 10131  H HE2  . PHE B 2 38  ? -13.102 -1.805  -10.959 1.00 1.57  ? 38  PHE B HE2  2  
ATOM 10132  H HZ   . PHE B 2 38  ? -11.070 -2.161  -9.617  1.00 1.58  ? 38  PHE B HZ   2  
ATOM 10133  N N    . LYS B 2 39  ? -13.327 -4.683  -15.344 1.00 1.57  ? 39  LYS B N    2  
ATOM 10134  C CA   . LYS B 2 39  ? -14.560 -5.301  -14.875 1.00 1.56  ? 39  LYS B CA   2  
ATOM 10135  C C    . LYS B 2 39  ? -14.535 -6.813  -15.090 1.00 1.60  ? 39  LYS B C    2  
ATOM 10136  O O    . LYS B 2 39  ? -14.890 -7.583  -14.194 1.00 1.59  ? 39  LYS B O    2  
ATOM 10137  C CB   . LYS B 2 39  ? -15.762 -4.688  -15.604 1.00 1.57  ? 39  LYS B CB   2  
ATOM 10138  C CG   . LYS B 2 39  ? -17.091 -5.349  -15.270 1.00 1.57  ? 39  LYS B CG   2  
ATOM 10139  C CD   . LYS B 2 39  ? -18.236 -4.740  -16.068 1.00 1.60  ? 39  LYS B CD   2  
ATOM 10140  C CE   . LYS B 2 39  ? -19.551 -5.454  -15.798 1.00 1.66  ? 39  LYS B CE   2  
ATOM 10141  N NZ   . LYS B 2 39  ? -20.686 -4.817  -16.517 1.00 1.82  ? 39  LYS B NZ   2  
ATOM 10142  H H    . LYS B 2 39  ? -13.370 -4.030  -16.078 1.00 1.60  ? 39  LYS B H    2  
ATOM 10143  H HA   . LYS B 2 39  ? -14.652 -5.101  -13.819 1.00 1.53  ? 39  LYS B HA   2  
ATOM 10144  H HB2  . LYS B 2 39  ? -15.830 -3.642  -15.344 1.00 1.57  ? 39  LYS B HB2  2  
ATOM 10145  H HB3  . LYS B 2 39  ? -15.602 -4.775  -16.669 1.00 1.61  ? 39  LYS B HB3  2  
ATOM 10146  H HG2  . LYS B 2 39  ? -17.024 -6.403  -15.497 1.00 1.65  ? 39  LYS B HG2  2  
ATOM 10147  H HG3  . LYS B 2 39  ? -17.287 -5.220  -14.217 1.00 1.60  ? 39  LYS B HG3  2  
ATOM 10148  H HD2  . LYS B 2 39  ? -18.341 -3.701  -15.793 1.00 1.64  ? 39  LYS B HD2  2  
ATOM 10149  H HD3  . LYS B 2 39  ? -18.008 -4.813  -17.120 1.00 1.67  ? 39  LYS B HD3  2  
ATOM 10150  H HE2  . LYS B 2 39  ? -19.462 -6.481  -16.122 1.00 1.70  ? 39  LYS B HE2  2  
ATOM 10151  H HE3  . LYS B 2 39  ? -19.748 -5.429  -14.737 1.00 1.68  ? 39  LYS B HE3  2  
ATOM 10152  H HZ1  . LYS B 2 39  ? -20.747 -3.810  -16.267 1.00 1.99  ? 39  LYS B HZ1  2  
ATOM 10153  H HZ2  . LYS B 2 39  ? -21.582 -5.278  -16.258 1.00 2.07  ? 39  LYS B HZ2  2  
ATOM 10154  H HZ3  . LYS B 2 39  ? -20.551 -4.899  -17.545 1.00 2.13  ? 39  LYS B HZ3  2  
ATOM 10155  N N    . GLU B 2 40  ? -14.103 -7.229  -16.274 1.00 1.65  ? 40  GLU B N    2  
ATOM 10156  C CA   . GLU B 2 40  ? -14.038 -8.644  -16.619 1.00 1.70  ? 40  GLU B CA   2  
ATOM 10157  C C    . GLU B 2 40  ? -13.096 -9.401  -15.688 1.00 1.70  ? 40  GLU B C    2  
ATOM 10158  O O    . GLU B 2 40  ? -13.332 -10.566 -15.370 1.00 1.73  ? 40  GLU B O    2  
ATOM 10159  C CB   . GLU B 2 40  ? -13.585 -8.818  -18.067 1.00 1.77  ? 40  GLU B CB   2  
ATOM 10160  C CG   . GLU B 2 40  ? -14.707 -8.685  -19.082 1.00 1.86  ? 40  GLU B CG   2  
ATOM 10161  C CD   . GLU B 2 40  ? -14.393 -9.400  -20.379 1.00 1.95  ? 40  GLU B CD   2  
ATOM 10162  O OE1  . GLU B 2 40  ? -14.283 -10.647 -20.359 1.00 2.22  ? 40  GLU B OE1  2  
ATOM 10163  O OE2  . GLU B 2 40  ? -14.257 -8.727  -21.419 1.00 2.15  ? 40  GLU B OE2  2  
ATOM 10164  H H    . GLU B 2 40  ? -13.820 -6.561  -16.942 1.00 1.67  ? 40  GLU B H    2  
ATOM 10165  H HA   . GLU B 2 40  ? -15.031 -9.054  -16.515 1.00 1.70  ? 40  GLU B HA   2  
ATOM 10166  H HB2  . GLU B 2 40  ? -12.836 -8.072  -18.291 1.00 1.85  ? 40  GLU B HB2  2  
ATOM 10167  H HB3  . GLU B 2 40  ? -13.146 -9.799  -18.177 1.00 1.88  ? 40  GLU B HB3  2  
ATOM 10168  H HG2  . GLU B 2 40  ? -15.608 -9.108  -18.664 1.00 2.06  ? 40  GLU B HG2  2  
ATOM 10169  H HG3  . GLU B 2 40  ? -14.866 -7.635  -19.294 1.00 1.96  ? 40  GLU B HG3  2  
ATOM 10170  N N    . LEU B 2 41  ? -12.040 -8.727  -15.252 1.00 1.67  ? 41  LEU B N    2  
ATOM 10171  C CA   . LEU B 2 41  ? -11.049 -9.327  -14.364 1.00 1.67  ? 41  LEU B CA   2  
ATOM 10172  C C    . LEU B 2 41  ? -11.683 -9.766  -13.042 1.00 1.63  ? 41  LEU B C    2  
ATOM 10173  O O    . LEU B 2 41  ? -11.690 -10.950 -12.710 1.00 1.67  ? 41  LEU B O    2  
ATOM 10174  C CB   . LEU B 2 41  ? -9.902  -8.326  -14.110 1.00 1.65  ? 41  LEU B CB   2  
ATOM 10175  C CG   . LEU B 2 41  ? -8.641  -8.880  -13.422 1.00 1.66  ? 41  LEU B CG   2  
ATOM 10176  C CD1  . LEU B 2 41  ? -8.771  -8.801  -11.908 1.00 1.61  ? 41  LEU B CD1  2  
ATOM 10177  C CD2  . LEU B 2 41  ? -8.363  -10.309 -13.861 1.00 1.73  ? 41  LEU B CD2  2  
ATOM 10178  H H    . LEU B 2 41  ? -11.923 -7.795  -15.535 1.00 1.66  ? 41  LEU B H    2  
ATOM 10179  H HA   . LEU B 2 41  ? -10.648 -10.198 -14.860 1.00 1.72  ? 41  LEU B HA   2  
ATOM 10180  H HB2  . LEU B 2 41  ? -9.606  -7.910  -15.063 1.00 1.68  ? 41  LEU B HB2  2  
ATOM 10181  H HB3  . LEU B 2 41  ? -10.287 -7.524  -13.498 1.00 1.60  ? 41  LEU B HB3  2  
ATOM 10182  H HG   . LEU B 2 41  ? -7.791  -8.275  -13.709 1.00 1.67  ? 41  LEU B HG   2  
ATOM 10183  H HD11 . LEU B 2 41  ? -9.647  -9.349  -11.595 1.00 1.72  ? 41  LEU B HD11 2  
ATOM 10184  H HD12 . LEU B 2 41  ? -8.867  -7.768  -11.608 1.00 1.62  ? 41  LEU B HD12 2  
ATOM 10185  H HD13 . LEU B 2 41  ? -7.894  -9.231  -11.446 1.00 1.69  ? 41  LEU B HD13 2  
ATOM 10186  H HD21 . LEU B 2 41  ? -9.164  -10.951 -13.524 1.00 1.79  ? 41  LEU B HD21 2  
ATOM 10187  H HD22 . LEU B 2 41  ? -7.430  -10.644 -13.433 1.00 1.76  ? 41  LEU B HD22 2  
ATOM 10188  H HD23 . LEU B 2 41  ? -8.301  -10.349 -14.938 1.00 1.75  ? 41  LEU B HD23 2  
ATOM 10189  N N    . VAL B 2 42  ? -12.242 -8.815  -12.307 1.00 1.56  ? 42  VAL B N    2  
ATOM 10190  C CA   . VAL B 2 42  ? -12.844 -9.110  -11.008 1.00 1.53  ? 42  VAL B CA   2  
ATOM 10191  C C    . VAL B 2 42  ? -14.082 -10.003 -11.120 1.00 1.55  ? 42  VAL B C    2  
ATOM 10192  O O    . VAL B 2 42  ? -14.272 -10.909 -10.313 1.00 1.57  ? 42  VAL B O    2  
ATOM 10193  C CB   . VAL B 2 42  ? -13.212 -7.821  -10.237 1.00 1.48  ? 42  VAL B CB   2  
ATOM 10194  C CG1  . VAL B 2 42  ? -11.959 -7.129  -9.725  1.00 1.58  ? 42  VAL B CG1  2  
ATOM 10195  C CG2  . VAL B 2 42  ? -14.026 -6.875  -11.108 1.00 1.55  ? 42  VAL B CG2  2  
ATOM 10196  H H    . VAL B 2 42  ? -12.253 -7.892  -12.644 1.00 1.54  ? 42  VAL B H    2  
ATOM 10197  H HA   . VAL B 2 42  ? -12.102 -9.638  -10.426 1.00 1.55  ? 42  VAL B HA   2  
ATOM 10198  H HB   . VAL B 2 42  ? -13.814 -8.097  -9.383  1.00 1.53  ? 42  VAL B HB   2  
ATOM 10199  H HG11 . VAL B 2 42  ? -11.337 -6.845  -10.562 1.00 1.75  ? 42  VAL B HG11 2  
ATOM 10200  H HG12 . VAL B 2 42  ? -11.412 -7.802  -9.081  1.00 1.73  ? 42  VAL B HG12 2  
ATOM 10201  H HG13 . VAL B 2 42  ? -12.238 -6.247  -9.170  1.00 1.64  ? 42  VAL B HG13 2  
ATOM 10202  H HG21 . VAL B 2 42  ? -13.433 -6.564  -11.956 1.00 1.80  ? 42  VAL B HG21 2  
ATOM 10203  H HG22 . VAL B 2 42  ? -14.308 -6.007  -10.530 1.00 1.61  ? 42  VAL B HG22 2  
ATOM 10204  H HG23 . VAL B 2 42  ? -14.915 -7.379  -11.456 1.00 1.85  ? 42  VAL B HG23 2  
ATOM 10205  N N    . THR B 2 43  ? -14.900 -9.773  -12.136 1.00 1.56  ? 43  THR B N    2  
ATOM 10206  C CA   . THR B 2 43  ? -16.127 -10.539 -12.316 1.00 1.58  ? 43  THR B CA   2  
ATOM 10207  C C    . THR B 2 43  ? -15.863 -12.008 -12.675 1.00 1.65  ? 43  THR B C    2  
ATOM 10208  O O    . THR B 2 43  ? -16.707 -12.872 -12.425 1.00 1.83  ? 43  THR B O    2  
ATOM 10209  C CB   . THR B 2 43  ? -17.014 -9.898  -13.408 1.00 1.59  ? 43  THR B CB   2  
ATOM 10210  O OG1  . THR B 2 43  ? -17.147 -8.491  -13.167 1.00 1.55  ? 43  THR B OG1  2  
ATOM 10211  C CG2  . THR B 2 43  ? -18.399 -10.530 -13.445 1.00 1.62  ? 43  THR B CG2  2  
ATOM 10212  H H    . THR B 2 43  ? -14.678 -9.067  -12.780 1.00 1.56  ? 43  THR B H    2  
ATOM 10213  H HA   . THR B 2 43  ? -16.672 -10.505 -11.384 1.00 1.56  ? 43  THR B HA   2  
ATOM 10214  H HB   . THR B 2 43  ? -16.540 -10.047 -14.366 1.00 1.63  ? 43  THR B HB   2  
ATOM 10215  H HG1  . THR B 2 43  ? -16.347 -8.038  -13.463 1.00 1.67  ? 43  THR B HG1  2  
ATOM 10216  H HG21 . THR B 2 43  ? -18.307 -11.585 -13.658 1.00 1.72  ? 43  THR B HG21 2  
ATOM 10217  H HG22 . THR B 2 43  ? -18.989 -10.059 -14.217 1.00 1.65  ? 43  THR B HG22 2  
ATOM 10218  H HG23 . THR B 2 43  ? -18.882 -10.396 -12.490 1.00 1.76  ? 43  THR B HG23 2  
ATOM 10219  N N    . GLN B 2 44  ? -14.693 -12.313 -13.226 1.00 1.70  ? 44  GLN B N    2  
ATOM 10220  C CA   . GLN B 2 44  ? -14.410 -13.687 -13.633 1.00 1.75  ? 44  GLN B CA   2  
ATOM 10221  C C    . GLN B 2 44  ? -13.302 -14.352 -12.818 1.00 1.78  ? 44  GLN B C    2  
ATOM 10222  O O    . GLN B 2 44  ? -13.227 -15.577 -12.785 1.00 1.83  ? 44  GLN B O    2  
ATOM 10223  C CB   . GLN B 2 44  ? -14.054 -13.734 -15.119 1.00 1.80  ? 44  GLN B CB   2  
ATOM 10224  C CG   . GLN B 2 44  ? -15.160 -13.206 -16.017 1.00 1.94  ? 44  GLN B CG   2  
ATOM 10225  C CD   . GLN B 2 44  ? -14.743 -13.105 -17.471 1.00 1.98  ? 44  GLN B CD   2  
ATOM 10226  O OE1  . GLN B 2 44  ? -15.002 -14.000 -18.272 1.00 2.18  ? 44  GLN B OE1  2  
ATOM 10227  N NE2  . GLN B 2 44  ? -14.084 -12.016 -17.815 1.00 1.96  ? 44  GLN B NE2  2  
ATOM 10228  H H    . GLN B 2 44  ? -14.018 -11.611 -13.361 1.00 1.80  ? 44  GLN B H    2  
ATOM 10229  H HA   . GLN B 2 44  ? -15.319 -14.252 -13.488 1.00 1.77  ? 44  GLN B HA   2  
ATOM 10230  H HB2  . GLN B 2 44  ? -13.167 -13.139 -15.285 1.00 1.90  ? 44  GLN B HB2  2  
ATOM 10231  H HB3  . GLN B 2 44  ? -13.848 -14.756 -15.398 1.00 1.92  ? 44  GLN B HB3  2  
ATOM 10232  H HG2  . GLN B 2 44  ? -16.007 -13.872 -15.950 1.00 2.10  ? 44  GLN B HG2  2  
ATOM 10233  H HG3  . GLN B 2 44  ? -15.448 -12.224 -15.672 1.00 2.12  ? 44  GLN B HG3  2  
ATOM 10234  H HE21 . GLN B 2 44  ? -13.898 -11.348 -17.120 1.00 2.01  ? 44  GLN B HE21 2  
ATOM 10235  H HE22 . GLN B 2 44  ? -13.819 -11.908 -18.757 1.00 2.01  ? 44  GLN B HE22 2  
ATOM 10236  N N    . GLN B 2 45  ? -12.444 -13.578 -12.168 1.00 1.76  ? 45  GLN B N    2  
ATOM 10237  C CA   . GLN B 2 45  ? -11.357 -14.178 -11.396 1.00 1.80  ? 45  GLN B CA   2  
ATOM 10238  C C    . GLN B 2 45  ? -11.336 -13.725 -9.938  1.00 1.74  ? 45  GLN B C    2  
ATOM 10239  O O    . GLN B 2 45  ? -10.352 -13.952 -9.235  1.00 1.78  ? 45  GLN B O    2  
ATOM 10240  C CB   . GLN B 2 45  ? -10.005 -13.890 -12.054 1.00 1.86  ? 45  GLN B CB   2  
ATOM 10241  C CG   . GLN B 2 45  ? -9.683  -14.833 -13.203 1.00 1.98  ? 45  GLN B CG   2  
ATOM 10242  C CD   . GLN B 2 45  ? -8.230  -14.765 -13.630 1.00 2.12  ? 45  GLN B CD   2  
ATOM 10243  O OE1  . GLN B 2 45  ? -7.867  -14.005 -14.527 1.00 2.20  ? 45  GLN B OE1  2  
ATOM 10244  N NE2  . GLN B 2 45  ? -7.388  -15.567 -12.994 1.00 2.31  ? 45  GLN B NE2  2  
ATOM 10245  H H    . GLN B 2 45  ? -12.524 -12.599 -12.220 1.00 1.74  ? 45  GLN B H    2  
ATOM 10246  H HA   . GLN B 2 45  ? -11.515 -15.245 -11.407 1.00 1.85  ? 45  GLN B HA   2  
ATOM 10247  H HB2  . GLN B 2 45  ? -10.010 -12.879 -12.434 1.00 1.84  ? 45  GLN B HB2  2  
ATOM 10248  H HB3  . GLN B 2 45  ? -9.228  -13.984 -11.311 1.00 1.90  ? 45  GLN B HB3  2  
ATOM 10249  H HG2  . GLN B 2 45  ? -9.905  -15.844 -12.895 1.00 2.12  ? 45  GLN B HG2  2  
ATOM 10250  H HG3  . GLN B 2 45  ? -10.304 -14.572 -14.048 1.00 2.00  ? 45  GLN B HG3  2  
ATOM 10251  H HE21 . GLN B 2 45  ? -7.744  -16.152 -12.294 1.00 2.37  ? 45  GLN B HE21 2  
ATOM 10252  H HE22 . GLN B 2 45  ? -6.441  -15.545 -13.253 1.00 2.48  ? 45  GLN B HE22 2  
ATOM 10253  N N    . LEU B 2 46  ? -12.409 -13.105 -9.470  1.00 1.66  ? 46  LEU B N    2  
ATOM 10254  C CA   . LEU B 2 46  ? -12.462 -12.663 -8.081  1.00 1.61  ? 46  LEU B CA   2  
ATOM 10255  C C    . LEU B 2 46  ? -13.889 -12.730 -7.523  1.00 1.54  ? 46  LEU B C    2  
ATOM 10256  O O    . LEU B 2 46  ? -14.452 -11.716 -7.114  1.00 1.49  ? 46  LEU B O    2  
ATOM 10257  C CB   . LEU B 2 46  ? -11.909 -11.239 -7.956  1.00 1.61  ? 46  LEU B CB   2  
ATOM 10258  C CG   . LEU B 2 46  ? -11.417 -10.856 -6.559  1.00 1.61  ? 46  LEU B CG   2  
ATOM 10259  C CD1  . LEU B 2 46  ? -10.089 -11.540 -6.253  1.00 1.71  ? 46  LEU B CD1  2  
ATOM 10260  C CD2  . LEU B 2 46  ? -11.288 -9.347  -6.440  1.00 1.63  ? 46  LEU B CD2  2  
ATOM 10261  H H    . LEU B 2 46  ? -13.172 -12.934 -10.062 1.00 1.65  ? 46  LEU B H    2  
ATOM 10262  H HA   . LEU B 2 46  ? -11.838 -13.328 -7.504  1.00 1.66  ? 46  LEU B HA   2  
ATOM 10263  H HB2  . LEU B 2 46  ? -11.085 -11.134 -8.647  1.00 1.68  ? 46  LEU B HB2  2  
ATOM 10264  H HB3  . LEU B 2 46  ? -12.687 -10.546 -8.242  1.00 1.57  ? 46  LEU B HB3  2  
ATOM 10265  H HG   . LEU B 2 46  ? -12.139 -11.188 -5.827  1.00 1.57  ? 46  LEU B HG   2  
ATOM 10266  H HD11 . LEU B 2 46  ? -9.349  -11.229 -6.975  1.00 1.81  ? 46  LEU B HD11 2  
ATOM 10267  H HD12 . LEU B 2 46  ? -10.216 -12.611 -6.303  1.00 1.75  ? 46  LEU B HD12 2  
ATOM 10268  H HD13 . LEU B 2 46  ? -9.760  -11.263 -5.261  1.00 1.91  ? 46  LEU B HD13 2  
ATOM 10269  H HD21 . LEU B 2 46  ? -10.976 -9.091  -5.438  1.00 1.78  ? 46  LEU B HD21 2  
ATOM 10270  H HD22 . LEU B 2 46  ? -12.243 -8.884  -6.649  1.00 1.69  ? 46  LEU B HD22 2  
ATOM 10271  H HD23 . LEU B 2 46  ? -10.554 -8.991  -7.147  1.00 1.68  ? 46  LEU B HD23 2  
ATOM 10272  N N    . PRO B 2 47  ? -14.494 -13.929 -7.481  1.00 1.57  ? 47  PRO B N    2  
ATOM 10273  C CA   . PRO B 2 47  ? -15.845 -14.120 -6.980  1.00 1.53  ? 47  PRO B CA   2  
ATOM 10274  C C    . PRO B 2 47  ? -15.861 -14.594 -5.529  1.00 1.51  ? 47  PRO B C    2  
ATOM 10275  O O    . PRO B 2 47  ? -16.527 -15.577 -5.191  1.00 1.54  ? 47  PRO B O    2  
ATOM 10276  C CB   . PRO B 2 47  ? -16.356 -15.214 -7.908  1.00 1.55  ? 47  PRO B CB   2  
ATOM 10277  C CG   . PRO B 2 47  ? -15.154 -16.060 -8.205  1.00 1.66  ? 47  PRO B CG   2  
ATOM 10278  C CD   . PRO B 2 47  ? -13.928 -15.210 -7.930  1.00 1.66  ? 47  PRO B CD   2  
ATOM 10279  H HA   . PRO B 2 47  ? -16.448 -13.231 -7.088  1.00 1.52  ? 47  PRO B HA   2  
ATOM 10280  H HB2  . PRO B 2 47  ? -17.127 -15.781 -7.407  1.00 1.54  ? 47  PRO B HB2  2  
ATOM 10281  H HB3  . PRO B 2 47  ? -16.754 -14.767 -8.806  1.00 1.54  ? 47  PRO B HB3  2  
ATOM 10282  H HG2  . PRO B 2 47  ? -15.155 -16.931 -7.568  1.00 1.73  ? 47  PRO B HG2  2  
ATOM 10283  H HG3  . PRO B 2 47  ? -15.172 -16.358 -9.242  1.00 1.71  ? 47  PRO B HG3  2  
ATOM 10284  H HD2  . PRO B 2 47  ? -13.324 -15.658 -7.153  1.00 1.70  ? 47  PRO B HD2  2  
ATOM 10285  H HD3  . PRO B 2 47  ? -13.349 -15.081 -8.832  1.00 1.71  ? 47  PRO B HD3  2  
ATOM 10286  N N    . HIS B 2 48  ? -15.124 -13.895 -4.672  1.00 1.58  ? 48  HIS B N    2  
ATOM 10287  C CA   . HIS B 2 48  ? -15.050 -14.258 -3.259  1.00 1.57  ? 48  HIS B CA   2  
ATOM 10288  C C    . HIS B 2 48  ? -14.464 -13.120 -2.424  1.00 1.55  ? 48  HIS B C    2  
ATOM 10289  O O    . HIS B 2 48  ? -15.130 -12.600 -1.528  1.00 1.52  ? 48  HIS B O    2  
ATOM 10290  C CB   . HIS B 2 48  ? -14.211 -15.531 -3.083  1.00 1.61  ? 48  HIS B CB   2  
ATOM 10291  C CG   . HIS B 2 48  ? -13.957 -15.919 -1.656  1.00 1.60  ? 48  HIS B CG   2  
ATOM 10292  N ND1  . HIS B 2 48  ? -12.749 -15.713 -1.031  1.00 1.60  ? 48  HIS B ND1  2  
ATOM 10293  C CD2  . HIS B 2 48  ? -14.761 -16.499 -0.737  1.00 1.64  ? 48  HIS B CD2  2  
ATOM 10294  C CE1  . HIS B 2 48  ? -12.818 -16.153 0.211   1.00 1.62  ? 48  HIS B CE1  2  
ATOM 10295  N NE2  . HIS B 2 48  ? -14.029 -16.633 0.416   1.00 1.64  ? 48  HIS B NE2  2  
ATOM 10296  H H    . HIS B 2 48  ? -14.630 -13.114 -4.996  1.00 1.72  ? 48  HIS B H    2  
ATOM 10297  H HA   . HIS B 2 48  ? -16.054 -14.453 -2.917  1.00 1.57  ? 48  HIS B HA   2  
ATOM 10298  H HB2  . HIS B 2 48  ? -14.722 -16.356 -3.557  1.00 1.64  ? 48  HIS B HB2  2  
ATOM 10299  H HB3  . HIS B 2 48  ? -13.253 -15.390 -3.561  1.00 1.62  ? 48  HIS B HB3  2  
ATOM 10300  H HD1  . HIS B 2 48  ? -11.940 -15.318 -1.455  1.00 1.61  ? 48  HIS B HD1  2  
ATOM 10301  H HD2  . HIS B 2 48  ? -15.789 -16.803 -0.885  1.00 1.68  ? 48  HIS B HD2  2  
ATOM 10302  H HE1  . HIS B 2 48  ? -12.022 -16.119 0.937   1.00 1.63  ? 48  HIS B HE1  2  
ATOM 10303  H HE2  . HIS B 2 48  ? -14.294 -17.176 1.193   1.00 1.68  ? 48  HIS B HE2  2  
ATOM 10304  N N    . LEU B 2 49  ? -13.216 -12.758 -2.714  1.00 1.60  ? 49  LEU B N    2  
ATOM 10305  C CA   . LEU B 2 49  ? -12.525 -11.688 -1.991  1.00 1.60  ? 49  LEU B CA   2  
ATOM 10306  C C    . LEU B 2 49  ? -13.350 -10.405 -1.989  1.00 1.61  ? 49  LEU B C    2  
ATOM 10307  O O    . LEU B 2 49  ? -13.589 -9.811  -0.934  1.00 1.61  ? 49  LEU B O    2  
ATOM 10308  C CB   . LEU B 2 49  ? -11.149 -11.435 -2.618  1.00 1.62  ? 49  LEU B CB   2  
ATOM 10309  C CG   . LEU B 2 49  ? -10.169 -10.628 -1.762  1.00 1.57  ? 49  LEU B CG   2  
ATOM 10310  C CD1  . LEU B 2 49  ? -10.110 -11.176 -0.344  1.00 1.62  ? 49  LEU B CD1  2  
ATOM 10311  C CD2  . LEU B 2 49  ? -8.786  -10.648 -2.390  1.00 1.60  ? 49  LEU B CD2  2  
ATOM 10312  H H    . LEU B 2 49  ? -12.733 -13.242 -3.415  1.00 1.65  ? 49  LEU B H    2  
ATOM 10313  H HA   . LEU B 2 49  ? -12.391 -12.015 -0.972  1.00 1.59  ? 49  LEU B HA   2  
ATOM 10314  H HB2  . LEU B 2 49  ? -10.697 -12.391 -2.836  1.00 1.70  ? 49  LEU B HB2  2  
ATOM 10315  H HB3  . LEU B 2 49  ? -11.296 -10.906 -3.549  1.00 1.63  ? 49  LEU B HB3  2  
ATOM 10316  H HG   . LEU B 2 49  ? -10.499 -9.601  -1.713  1.00 1.53  ? 49  LEU B HG   2  
ATOM 10317  H HD11 . LEU B 2 49  ? -9.350  -10.649 0.214   1.00 1.74  ? 49  LEU B HD11 2  
ATOM 10318  H HD12 . LEU B 2 49  ? -9.871  -12.230 -0.374  1.00 1.83  ? 49  LEU B HD12 2  
ATOM 10319  H HD13 . LEU B 2 49  ? -11.066 -11.036 0.136   1.00 1.66  ? 49  LEU B HD13 2  
ATOM 10320  H HD21 . LEU B 2 49  ? -8.111  -10.049 -1.793  1.00 1.65  ? 49  LEU B HD21 2  
ATOM 10321  H HD22 . LEU B 2 49  ? -8.838  -10.243 -3.389  1.00 1.59  ? 49  LEU B HD22 2  
ATOM 10322  H HD23 . LEU B 2 49  ? -8.423  -11.664 -2.430  1.00 1.74  ? 49  LEU B HD23 2  
ATOM 10323  N N    . LEU B 2 50  ? -13.784 -9.988  -3.165  1.00 1.66  ? 50  LEU B N    2  
ATOM 10324  C CA   . LEU B 2 50  ? -14.601 -8.792  -3.302  1.00 1.69  ? 50  LEU B CA   2  
ATOM 10325  C C    . LEU B 2 50  ? -15.874 -9.134  -4.057  1.00 1.69  ? 50  LEU B C    2  
ATOM 10326  O O    . LEU B 2 50  ? -15.822 -9.734  -5.125  1.00 1.80  ? 50  LEU B O    2  
ATOM 10327  C CB   . LEU B 2 50  ? -13.842 -7.686  -4.046  1.00 1.76  ? 50  LEU B CB   2  
ATOM 10328  C CG   . LEU B 2 50  ? -13.259 -6.576  -3.163  1.00 1.81  ? 50  LEU B CG   2  
ATOM 10329  C CD1  . LEU B 2 50  ? -12.524 -5.554  -4.017  1.00 2.01  ? 50  LEU B CD1  2  
ATOM 10330  C CD2  . LEU B 2 50  ? -14.355 -5.897  -2.353  1.00 1.95  ? 50  LEU B CD2  2  
ATOM 10331  H H    . LEU B 2 50  ? -13.560 -10.503 -3.966  1.00 1.70  ? 50  LEU B H    2  
ATOM 10332  H HA   . LEU B 2 50  ? -14.858 -8.448  -2.314  1.00 1.69  ? 50  LEU B HA   2  
ATOM 10333  H HB2  . LEU B 2 50  ? -13.032 -8.143  -4.595  1.00 1.95  ? 50  LEU B HB2  2  
ATOM 10334  H HB3  . LEU B 2 50  ? -14.519 -7.230  -4.754  1.00 1.82  ? 50  LEU B HB3  2  
ATOM 10335  H HG   . LEU B 2 50  ? -12.550 -7.008  -2.471  1.00 2.11  ? 50  LEU B HG   2  
ATOM 10336  H HD11 . LEU B 2 50  ? -12.115 -4.782  -3.383  1.00 2.12  ? 50  LEU B HD11 2  
ATOM 10337  H HD12 . LEU B 2 50  ? -13.212 -5.111  -4.722  1.00 2.11  ? 50  LEU B HD12 2  
ATOM 10338  H HD13 . LEU B 2 50  ? -11.724 -6.041  -4.553  1.00 2.34  ? 50  LEU B HD13 2  
ATOM 10339  H HD21 . LEU B 2 50  ? -13.955 -5.015  -1.876  1.00 2.17  ? 50  LEU B HD21 2  
ATOM 10340  H HD22 . LEU B 2 50  ? -14.721 -6.578  -1.597  1.00 2.21  ? 50  LEU B HD22 2  
ATOM 10341  H HD23 . LEU B 2 50  ? -15.167 -5.616  -3.007  1.00 2.14  ? 50  LEU B HD23 2  
ATOM 10342  N N    . LYS B 2 51  ? -17.017 -8.771  -3.496  1.00 1.63  ? 51  LYS B N    2  
ATOM 10343  C CA   . LYS B 2 51  ? -18.285 -9.050  -4.146  1.00 1.62  ? 51  LYS B CA   2  
ATOM 10344  C C    . LYS B 2 51  ? -18.934 -7.765  -4.653  1.00 1.63  ? 51  LYS B C    2  
ATOM 10345  O O    . LYS B 2 51  ? -19.641 -7.074  -3.923  1.00 1.95  ? 51  LYS B O    2  
ATOM 10346  C CB   . LYS B 2 51  ? -19.237 -9.836  -3.224  1.00 1.59  ? 51  LYS B CB   2  
ATOM 10347  C CG   . LYS B 2 51  ? -19.192 -9.454  -1.743  1.00 1.67  ? 51  LYS B CG   2  
ATOM 10348  C CD   . LYS B 2 51  ? -20.155 -8.319  -1.398  1.00 1.79  ? 51  LYS B CD   2  
ATOM 10349  C CE   . LYS B 2 51  ? -21.608 -8.684  -1.687  1.00 2.00  ? 51  LYS B CE   2  
ATOM 10350  N NZ   . LYS B 2 51  ? -22.436 -7.480  -1.957  1.00 2.50  ? 51  LYS B NZ   2  
ATOM 10351  H H    . LYS B 2 51  ? -17.008 -8.300  -2.637  1.00 1.63  ? 51  LYS B H    2  
ATOM 10352  H HA   . LYS B 2 51  ? -18.063 -9.666  -5.008  1.00 1.65  ? 51  LYS B HA   2  
ATOM 10353  H HB2  . LYS B 2 51  ? -20.242 -9.689  -3.578  1.00 1.57  ? 51  LYS B HB2  2  
ATOM 10354  H HB3  . LYS B 2 51  ? -18.997 -10.888 -3.304  1.00 1.63  ? 51  LYS B HB3  2  
ATOM 10355  H HG2  . LYS B 2 51  ? -19.457 -10.318 -1.155  1.00 1.82  ? 51  LYS B HG2  2  
ATOM 10356  H HG3  . LYS B 2 51  ? -18.186 -9.147  -1.493  1.00 1.81  ? 51  LYS B HG3  2  
ATOM 10357  H HD2  . LYS B 2 51  ? -20.059 -8.090  -0.347  1.00 1.86  ? 51  LYS B HD2  2  
ATOM 10358  H HD3  . LYS B 2 51  ? -19.891 -7.448  -1.980  1.00 1.95  ? 51  LYS B HD3  2  
ATOM 10359  H HE2  . LYS B 2 51  ? -21.646 -9.332  -2.545  1.00 1.99  ? 51  LYS B HE2  2  
ATOM 10360  H HE3  . LYS B 2 51  ? -22.012 -9.200  -0.830  1.00 2.12  ? 51  LYS B HE3  2  
ATOM 10361  H HZ1  . LYS B 2 51  ? -22.590 -6.951  -1.065  1.00 2.63  ? 51  LYS B HZ1  2  
ATOM 10362  H HZ2  . LYS B 2 51  ? -23.367 -7.757  -2.347  1.00 2.89  ? 51  LYS B HZ2  2  
ATOM 10363  H HZ3  . LYS B 2 51  ? -21.960 -6.858  -2.636  1.00 2.80  ? 51  LYS B HZ3  2  
ATOM 10364  N N    . ASP B 2 52  ? -18.665 -7.442  -5.906  1.00 1.37  ? 52  ASP B N    2  
ATOM 10365  C CA   . ASP B 2 52  ? -19.221 -6.247  -6.529  1.00 1.35  ? 52  ASP B CA   2  
ATOM 10366  C C    . ASP B 2 52  ? -19.234 -6.412  -8.037  1.00 1.38  ? 52  ASP B C    2  
ATOM 10367  O O    . ASP B 2 52  ? -18.187 -6.405  -8.680  1.00 1.45  ? 52  ASP B O    2  
ATOM 10368  C CB   . ASP B 2 52  ? -18.407 -5.008  -6.144  1.00 1.33  ? 52  ASP B CB   2  
ATOM 10369  C CG   . ASP B 2 52  ? -19.072 -3.702  -6.550  1.00 1.42  ? 52  ASP B CG   2  
ATOM 10370  O OD1  . ASP B 2 52  ? -20.206 -3.722  -7.084  1.00 1.80  ? 52  ASP B OD1  2  
ATOM 10371  O OD2  . ASP B 2 52  ? -18.463 -2.638  -6.310  1.00 1.85  ? 52  ASP B OD2  2  
ATOM 10372  H H    . ASP B 2 52  ? -18.074 -8.022  -6.435  1.00 1.28  ? 52  ASP B H    2  
ATOM 10373  H HA   . ASP B 2 52  ? -20.237 -6.128  -6.179  1.00 1.37  ? 52  ASP B HA   2  
ATOM 10374  H HB2  . ASP B 2 52  ? -18.269 -4.998  -5.074  1.00 1.40  ? 52  ASP B HB2  2  
ATOM 10375  H HB3  . ASP B 2 52  ? -17.441 -5.059  -6.624  1.00 1.29  ? 52  ASP B HB3  2  
ATOM 10376  N N    . VAL B 2 53  ? -20.419 -6.593  -8.594  1.00 1.39  ? 53  VAL B N    2  
ATOM 10377  C CA   . VAL B 2 53  ? -20.566 -6.757  -10.031 1.00 1.44  ? 53  VAL B CA   2  
ATOM 10378  C C    . VAL B 2 53  ? -21.588 -5.764  -10.559 1.00 1.42  ? 53  VAL B C    2  
ATOM 10379  O O    . VAL B 2 53  ? -22.072 -5.884  -11.687 1.00 1.54  ? 53  VAL B O    2  
ATOM 10380  C CB   . VAL B 2 53  ? -21.000 -8.193  -10.416 1.00 1.53  ? 53  VAL B CB   2  
ATOM 10381  C CG1  . VAL B 2 53  ? -19.898 -9.195  -10.096 1.00 1.56  ? 53  VAL B CG1  2  
ATOM 10382  C CG2  . VAL B 2 53  ? -22.295 -8.577  -9.711  1.00 1.55  ? 53  VAL B CG2  2  
ATOM 10383  H H    . VAL B 2 53  ? -21.219 -6.602  -8.026  1.00 1.40  ? 53  VAL B H    2  
ATOM 10384  H HA   . VAL B 2 53  ? -19.610 -6.552  -10.491 1.00 1.45  ? 53  VAL B HA   2  
ATOM 10385  H HB   . VAL B 2 53  ? -21.176 -8.219  -11.482 1.00 1.59  ? 53  VAL B HB   2  
ATOM 10386  H HG11 . VAL B 2 53  ? -19.655 -9.138  -9.044  1.00 1.65  ? 53  VAL B HG11 2  
ATOM 10387  H HG12 . VAL B 2 53  ? -19.020 -8.965  -10.681 1.00 1.73  ? 53  VAL B HG12 2  
ATOM 10388  H HG13 . VAL B 2 53  ? -20.238 -10.192 -10.334 1.00 1.67  ? 53  VAL B HG13 2  
ATOM 10389  H HG21 . VAL B 2 53  ? -23.008 -7.773  -9.808  1.00 1.66  ? 53  VAL B HG21 2  
ATOM 10390  H HG22 . VAL B 2 53  ? -22.096 -8.758  -8.666  1.00 1.90  ? 53  VAL B HG22 2  
ATOM 10391  H HG23 . VAL B 2 53  ? -22.699 -9.473  -10.160 1.00 1.82  ? 53  VAL B HG23 2  
ATOM 10392  N N    . GLY B 2 54  ? -21.904 -4.775  -9.740  1.00 1.33  ? 54  GLY B N    2  
ATOM 10393  C CA   . GLY B 2 54  ? -22.879 -3.782  -10.126 1.00 1.31  ? 54  GLY B CA   2  
ATOM 10394  C C    . GLY B 2 54  ? -22.272 -2.416  -10.357 1.00 1.28  ? 54  GLY B C    2  
ATOM 10395  O O    . GLY B 2 54  ? -22.470 -1.817  -11.414 1.00 1.37  ? 54  GLY B O    2  
ATOM 10396  H H    . GLY B 2 54  ? -21.466 -4.717  -8.861  1.00 1.29  ? 54  GLY B H    2  
ATOM 10397  H HA2  . GLY B 2 54  ? -23.363 -4.106  -11.036 1.00 1.37  ? 54  GLY B HA2  2  
ATOM 10398  H HA3  . GLY B 2 54  ? -23.621 -3.704  -9.346  1.00 1.31  ? 54  GLY B HA3  2  
ATOM 10399  N N    . SER B 2 55  ? -21.508 -1.929  -9.391  1.00 1.21  ? 55  SER B N    2  
ATOM 10400  C CA   . SER B 2 55  ? -20.906 -0.611  -9.508  1.00 1.19  ? 55  SER B CA   2  
ATOM 10401  C C    . SER B 2 55  ? -19.382 -0.686  -9.497  1.00 1.20  ? 55  SER B C    2  
ATOM 10402  O O    . SER B 2 55  ? -18.733 -0.336  -8.508  1.00 1.23  ? 55  SER B O    2  
ATOM 10403  C CB   . SER B 2 55  ? -21.407 0.294   -8.380  1.00 1.21  ? 55  SER B CB   2  
ATOM 10404  O OG   . SER B 2 55  ? -22.811 0.494   -8.469  1.00 1.33  ? 55  SER B OG   2  
ATOM 10405  H H    . SER B 2 55  ? -21.330 -2.472  -8.593  1.00 1.23  ? 55  SER B H    2  
ATOM 10406  H HA   . SER B 2 55  ? -21.220 -0.191  -10.452 1.00 1.21  ? 55  SER B HA   2  
ATOM 10407  H HB2  . SER B 2 55  ? -21.181 -0.163  -7.427  1.00 1.33  ? 55  SER B HB2  2  
ATOM 10408  H HB3  . SER B 2 55  ? -20.912 1.252   -8.443  1.00 1.30  ? 55  SER B HB3  2  
ATOM 10409  H HG   . SER B 2 55  ? -22.985 1.384   -8.799  1.00 1.75  ? 55  SER B HG   2  
ATOM 10410  N N    . LEU B 2 56  ? -18.815 -1.138  -10.609 1.00 1.23  ? 56  LEU B N    2  
ATOM 10411  C CA   . LEU B 2 56  ? -17.366 -1.240  -10.739 1.00 1.27  ? 56  LEU B CA   2  
ATOM 10412  C C    . LEU B 2 56  ? -16.765 0.146   -10.927 1.00 1.31  ? 56  LEU B C    2  
ATOM 10413  O O    . LEU B 2 56  ? -15.565 0.356   -10.731 1.00 1.32  ? 56  LEU B O    2  
ATOM 10414  C CB   . LEU B 2 56  ? -16.980 -2.140  -11.921 1.00 1.34  ? 56  LEU B CB   2  
ATOM 10415  C CG   . LEU B 2 56  ? -17.180 -3.648  -11.711 1.00 1.47  ? 56  LEU B CG   2  
ATOM 10416  C CD1  . LEU B 2 56  ? -16.718 -4.067  -10.321 1.00 1.87  ? 56  LEU B CD1  2  
ATOM 10417  C CD2  . LEU B 2 56  ? -18.634 -4.040  -11.938 1.00 1.87  ? 56  LEU B CD2  2  
ATOM 10418  H H    . LEU B 2 56  ? -19.385 -1.415  -11.358 1.00 1.26  ? 56  LEU B H    2  
ATOM 10419  H HA   . LEU B 2 56  ? -16.980 -1.667  -9.826  1.00 1.25  ? 56  LEU B HA   2  
ATOM 10420  H HB2  . LEU B 2 56  ? -17.567 -1.839  -12.777 1.00 1.47  ? 56  LEU B HB2  2  
ATOM 10421  H HB3  . LEU B 2 56  ? -15.938 -1.968  -12.146 1.00 1.47  ? 56  LEU B HB3  2  
ATOM 10422  H HG   . LEU B 2 56  ? -16.576 -4.181  -12.430 1.00 1.46  ? 56  LEU B HG   2  
ATOM 10423  H HD11 . LEU B 2 56  ? -15.707 -3.724  -10.157 1.00 2.04  ? 56  LEU B HD11 2  
ATOM 10424  H HD12 . LEU B 2 56  ? -16.749 -5.144  -10.243 1.00 2.10  ? 56  LEU B HD12 2  
ATOM 10425  H HD13 . LEU B 2 56  ? -17.371 -3.635  -9.577  1.00 2.17  ? 56  LEU B HD13 2  
ATOM 10426  H HD21 . LEU B 2 56  ? -18.943 -3.720  -12.923 1.00 1.99  ? 56  LEU B HD21 2  
ATOM 10427  H HD22 . LEU B 2 56  ? -19.257 -3.566  -11.194 1.00 2.14  ? 56  LEU B HD22 2  
ATOM 10428  H HD23 . LEU B 2 56  ? -18.733 -5.112  -11.860 1.00 2.18  ? 56  LEU B HD23 2  
ATOM 10429  N N    . ASP B 2 57  ? -17.619 1.095   -11.292 1.00 1.36  ? 57  ASP B N    2  
ATOM 10430  C CA   . ASP B 2 57  ? -17.196 2.472   -11.509 1.00 1.43  ? 57  ASP B CA   2  
ATOM 10431  C C    . ASP B 2 57  ? -16.732 3.098   -10.198 1.00 1.39  ? 57  ASP B C    2  
ATOM 10432  O O    . ASP B 2 57  ? -15.893 3.999   -10.194 1.00 1.43  ? 57  ASP B O    2  
ATOM 10433  C CB   . ASP B 2 57  ? -18.331 3.293   -12.135 1.00 1.51  ? 57  ASP B CB   2  
ATOM 10434  C CG   . ASP B 2 57  ? -19.399 3.696   -11.137 1.00 1.53  ? 57  ASP B CG   2  
ATOM 10435  O OD1  . ASP B 2 57  ? -20.000 2.800   -10.510 1.00 1.53  ? 57  ASP B OD1  2  
ATOM 10436  O OD2  . ASP B 2 57  ? -19.649 4.912   -10.988 1.00 1.70  ? 57  ASP B OD2  2  
ATOM 10437  H H    . ASP B 2 57  ? -18.564 0.864   -11.415 1.00 1.36  ? 57  ASP B H    2  
ATOM 10438  H HA   . ASP B 2 57  ? -16.361 2.451   -12.194 1.00 1.48  ? 57  ASP B HA   2  
ATOM 10439  H HB2  . ASP B 2 57  ? -17.919 4.190   -12.569 1.00 1.67  ? 57  ASP B HB2  2  
ATOM 10440  H HB3  . ASP B 2 57  ? -18.799 2.706   -12.913 1.00 1.50  ? 57  ASP B HB3  2  
ATOM 10441  N N    . GLU B 2 58  ? -17.277 2.606   -9.086  1.00 1.32  ? 58  GLU B N    2  
ATOM 10442  C CA   . GLU B 2 58  ? -16.899 3.093   -7.768  1.00 1.30  ? 58  GLU B CA   2  
ATOM 10443  C C    . GLU B 2 58  ? -15.425 2.796   -7.527  1.00 1.26  ? 58  GLU B C    2  
ATOM 10444  O O    . GLU B 2 58  ? -14.672 3.649   -7.057  1.00 1.31  ? 58  GLU B O    2  
ATOM 10445  C CB   . GLU B 2 58  ? -17.762 2.427   -6.689  1.00 1.27  ? 58  GLU B CB   2  
ATOM 10446  C CG   . GLU B 2 58  ? -17.401 2.833   -5.266  1.00 1.27  ? 58  GLU B CG   2  
ATOM 10447  C CD   . GLU B 2 58  ? -17.930 1.855   -4.235  1.00 1.31  ? 58  GLU B CD   2  
ATOM 10448  O OE1  . GLU B 2 58  ? -17.486 0.689   -4.237  1.00 1.39  ? 58  GLU B OE1  2  
ATOM 10449  O OE2  . GLU B 2 58  ? -18.812 2.236   -3.434  1.00 1.53  ? 58  GLU B OE2  2  
ATOM 10450  H H    . GLU B 2 58  ? -17.957 1.900   -9.160  1.00 1.29  ? 58  GLU B H    2  
ATOM 10451  H HA   . GLU B 2 58  ? -17.055 4.161   -7.744  1.00 1.38  ? 58  GLU B HA   2  
ATOM 10452  H HB2  . GLU B 2 58  ? -18.795 2.688   -6.861  1.00 1.30  ? 58  GLU B HB2  2  
ATOM 10453  H HB3  . GLU B 2 58  ? -17.653 1.355   -6.773  1.00 1.27  ? 58  GLU B HB3  2  
ATOM 10454  H HG2  . GLU B 2 58  ? -16.326 2.879   -5.179  1.00 1.28  ? 58  GLU B HG2  2  
ATOM 10455  H HG3  . GLU B 2 58  ? -17.821 3.807   -5.066  1.00 1.34  ? 58  GLU B HG3  2  
ATOM 10456  N N    . LYS B 2 59  ? -15.017 1.587   -7.895  1.00 1.20  ? 59  LYS B N    2  
ATOM 10457  C CA   . LYS B 2 59  ? -13.634 1.162   -7.732  1.00 1.19  ? 59  LYS B CA   2  
ATOM 10458  C C    . LYS B 2 59  ? -12.738 1.917   -8.704  1.00 1.24  ? 59  LYS B C    2  
ATOM 10459  O O    . LYS B 2 59  ? -11.668 2.393   -8.337  1.00 1.25  ? 59  LYS B O    2  
ATOM 10460  C CB   . LYS B 2 59  ? -13.499 -0.347  -7.963  1.00 1.20  ? 59  LYS B CB   2  
ATOM 10461  C CG   . LYS B 2 59  ? -13.721 -1.190  -6.715  1.00 1.19  ? 59  LYS B CG   2  
ATOM 10462  C CD   . LYS B 2 59  ? -15.155 -1.105  -6.227  1.00 1.32  ? 59  LYS B CD   2  
ATOM 10463  C CE   . LYS B 2 59  ? -15.372 -1.948  -4.984  1.00 1.40  ? 59  LYS B CE   2  
ATOM 10464  N NZ   . LYS B 2 59  ? -16.763 -1.820  -4.482  1.00 1.43  ? 59  LYS B NZ   2  
ATOM 10465  H H    . LYS B 2 59  ? -15.663 0.969   -8.296  1.00 1.19  ? 59  LYS B H    2  
ATOM 10466  H HA   . LYS B 2 59  ? -13.330 1.396   -6.721  1.00 1.17  ? 59  LYS B HA   2  
ATOM 10467  H HB2  . LYS B 2 59  ? -14.223 -0.649  -8.706  1.00 1.26  ? 59  LYS B HB2  2  
ATOM 10468  H HB3  . LYS B 2 59  ? -12.506 -0.552  -8.338  1.00 1.27  ? 59  LYS B HB3  2  
ATOM 10469  H HG2  . LYS B 2 59  ? -13.492 -2.219  -6.942  1.00 1.36  ? 59  LYS B HG2  2  
ATOM 10470  H HG3  . LYS B 2 59  ? -13.063 -0.839  -5.935  1.00 1.31  ? 59  LYS B HG3  2  
ATOM 10471  H HD2  . LYS B 2 59  ? -15.386 -0.076  -5.997  1.00 1.61  ? 59  LYS B HD2  2  
ATOM 10472  H HD3  . LYS B 2 59  ? -15.812 -1.457  -7.007  1.00 1.66  ? 59  LYS B HD3  2  
ATOM 10473  H HE2  . LYS B 2 59  ? -15.176 -2.982  -5.225  1.00 1.64  ? 59  LYS B HE2  2  
ATOM 10474  H HE3  . LYS B 2 59  ? -14.688 -1.620  -4.217  1.00 1.64  ? 59  LYS B HE3  2  
ATOM 10475  H HZ1  . LYS B 2 59  ? -17.436 -2.182  -5.198  1.00 1.47  ? 59  LYS B HZ1  2  
ATOM 10476  H HZ2  . LYS B 2 59  ? -16.985 -0.815  -4.293  1.00 1.69  ? 59  LYS B HZ2  2  
ATOM 10477  H HZ3  . LYS B 2 59  ? -16.881 -2.361  -3.605  1.00 1.74  ? 59  LYS B HZ3  2  
ATOM 10478  N N    . MET B 2 60  ? -13.201 2.038   -9.943  1.00 1.29  ? 60  MET B N    2  
ATOM 10479  C CA   . MET B 2 60  ? -12.452 2.735   -10.986 1.00 1.38  ? 60  MET B CA   2  
ATOM 10480  C C    . MET B 2 60  ? -12.138 4.173   -10.576 1.00 1.40  ? 60  MET B C    2  
ATOM 10481  O O    . MET B 2 60  ? -10.999 4.619   -10.683 1.00 1.45  ? 60  MET B O    2  
ATOM 10482  C CB   . MET B 2 60  ? -13.240 2.729   -12.300 1.00 1.45  ? 60  MET B CB   2  
ATOM 10483  C CG   . MET B 2 60  ? -12.539 3.458   -13.441 1.00 1.57  ? 60  MET B CG   2  
ATOM 10484  S SD   . MET B 2 60  ? -13.550 3.575   -14.931 1.00 1.82  ? 60  MET B SD   2  
ATOM 10485  C CE   . MET B 2 60  ? -14.821 4.722   -14.399 1.00 1.99  ? 60  MET B CE   2  
ATOM 10486  H H    . MET B 2 60  ? -14.070 1.640   -10.166 1.00 1.29  ? 60  MET B H    2  
ATOM 10487  H HA   . MET B 2 60  ? -11.522 2.207   -11.133 1.00 1.39  ? 60  MET B HA   2  
ATOM 10488  H HB2  . MET B 2 60  ? -13.402 1.705   -12.603 1.00 1.47  ? 60  MET B HB2  2  
ATOM 10489  H HB3  . MET B 2 60  ? -14.198 3.201   -12.134 1.00 1.45  ? 60  MET B HB3  2  
ATOM 10490  H HG2  . MET B 2 60  ? -12.297 4.458   -13.112 1.00 1.66  ? 60  MET B HG2  2  
ATOM 10491  H HG3  . MET B 2 60  ? -11.628 2.930   -13.682 1.00 1.69  ? 60  MET B HG3  2  
ATOM 10492  H HE1  . MET B 2 60  ? -15.308 4.333   -13.519 1.00 2.23  ? 60  MET B HE1  2  
ATOM 10493  H HE2  . MET B 2 60  ? -15.547 4.845   -15.188 1.00 2.14  ? 60  MET B HE2  2  
ATOM 10494  H HE3  . MET B 2 60  ? -14.371 5.677   -14.170 1.00 2.28  ? 60  MET B HE3  2  
ATOM 10495  N N    . LYS B 2 61  ? -13.145 4.877   -10.071 1.00 1.39  ? 61  LYS B N    2  
ATOM 10496  C CA   . LYS B 2 61  ? -12.978 6.269   -9.659  1.00 1.44  ? 61  LYS B CA   2  
ATOM 10497  C C    . LYS B 2 61  ? -12.229 6.389   -8.330  1.00 1.40  ? 61  LYS B C    2  
ATOM 10498  O O    . LYS B 2 61  ? -11.954 7.492   -7.864  1.00 1.53  ? 61  LYS B O    2  
ATOM 10499  C CB   . LYS B 2 61  ? -14.341 6.960   -9.560  1.00 1.45  ? 61  LYS B CB   2  
ATOM 10500  C CG   . LYS B 2 61  ? -14.833 7.521   -10.888 1.00 1.53  ? 61  LYS B CG   2  
ATOM 10501  C CD   . LYS B 2 61  ? -16.253 8.060   -10.787 1.00 1.57  ? 61  LYS B CD   2  
ATOM 10502  C CE   . LYS B 2 61  ? -17.270 6.933   -10.714 1.00 1.71  ? 61  LYS B CE   2  
ATOM 10503  N NZ   . LYS B 2 61  ? -18.670 7.428   -10.777 1.00 1.69  ? 61  LYS B NZ   2  
ATOM 10504  H H    . LYS B 2 61  ? -14.027 4.453   -9.974  1.00 1.36  ? 61  LYS B H    2  
ATOM 10505  H HA   . LYS B 2 61  ? -12.397 6.765   -10.424 1.00 1.51  ? 61  LYS B HA   2  
ATOM 10506  H HB2  . LYS B 2 61  ? -15.068 6.248   -9.199  1.00 1.44  ? 61  LYS B HB2  2  
ATOM 10507  H HB3  . LYS B 2 61  ? -14.267 7.775   -8.856  1.00 1.46  ? 61  LYS B HB3  2  
ATOM 10508  H HG2  . LYS B 2 61  ? -14.178 8.324   -11.190 1.00 1.56  ? 61  LYS B HG2  2  
ATOM 10509  H HG3  . LYS B 2 61  ? -14.807 6.737   -11.630 1.00 1.57  ? 61  LYS B HG3  2  
ATOM 10510  H HD2  . LYS B 2 61  ? -16.337 8.666   -9.897  1.00 1.63  ? 61  LYS B HD2  2  
ATOM 10511  H HD3  . LYS B 2 61  ? -16.459 8.665   -11.657 1.00 1.72  ? 61  LYS B HD3  2  
ATOM 10512  H HE2  . LYS B 2 61  ? -17.102 6.262   -11.542 1.00 2.02  ? 61  LYS B HE2  2  
ATOM 10513  H HE3  . LYS B 2 61  ? -17.128 6.398   -9.787  1.00 1.96  ? 61  LYS B HE3  2  
ATOM 10514  H HZ1  . LYS B 2 61  ? -19.327 6.617   -10.846 1.00 1.70  ? 61  LYS B HZ1  2  
ATOM 10515  H HZ2  . LYS B 2 61  ? -18.802 8.036   -11.609 1.00 1.86  ? 61  LYS B HZ2  2  
ATOM 10516  H HZ3  . LYS B 2 61  ? -18.901 7.974   -9.923  1.00 1.88  ? 61  LYS B HZ3  2  
ATOM 10517  N N    . SER B 2 62  ? -11.911 5.260   -7.713  1.00 1.28  ? 62  SER B N    2  
ATOM 10518  C CA   . SER B 2 62  ? -11.180 5.267   -6.457  1.00 1.25  ? 62  SER B CA   2  
ATOM 10519  C C    . SER B 2 62  ? -9.735  4.821   -6.680  1.00 1.26  ? 62  SER B C    2  
ATOM 10520  O O    . SER B 2 62  ? -8.821  5.226   -5.952  1.00 1.28  ? 62  SER B O    2  
ATOM 10521  C CB   . SER B 2 62  ? -11.873 4.370   -5.429  1.00 1.22  ? 62  SER B CB   2  
ATOM 10522  O OG   . SER B 2 62  ? -13.191 4.831   -5.161  1.00 1.23  ? 62  SER B OG   2  
ATOM 10523  H H    . SER B 2 62  ? -12.177 4.406   -8.110  1.00 1.25  ? 62  SER B H    2  
ATOM 10524  H HA   . SER B 2 62  ? -11.174 6.281   -6.087  1.00 1.27  ? 62  SER B HA   2  
ATOM 10525  H HB2  . SER B 2 62  ? -11.926 3.361   -5.811  1.00 1.21  ? 62  SER B HB2  2  
ATOM 10526  H HB3  . SER B 2 62  ? -11.307 4.379   -4.510  1.00 1.21  ? 62  SER B HB3  2  
ATOM 10527  H HG   . SER B 2 62  ? -13.798 4.473   -5.826  1.00 1.22  ? 62  SER B HG   2  
ATOM 10528  N N    . LEU B 2 63  ? -9.532  3.994   -7.699  1.00 1.27  ? 63  LEU B N    2  
ATOM 10529  C CA   . LEU B 2 63  ? -8.205  3.501   -8.034  1.00 1.30  ? 63  LEU B CA   2  
ATOM 10530  C C    . LEU B 2 63  ? -7.504  4.469   -8.977  1.00 1.35  ? 63  LEU B C    2  
ATOM 10531  O O    . LEU B 2 63  ? -6.331  4.797   -8.786  1.00 1.36  ? 63  LEU B O    2  
ATOM 10532  C CB   . LEU B 2 63  ? -8.291  2.114   -8.678  1.00 1.31  ? 63  LEU B CB   2  
ATOM 10533  C CG   . LEU B 2 63  ? -8.862  1.010   -7.787  1.00 1.27  ? 63  LEU B CG   2  
ATOM 10534  C CD1  . LEU B 2 63  ? -8.960  -0.290  -8.564  1.00 1.31  ? 63  LEU B CD1  2  
ATOM 10535  C CD2  . LEU B 2 63  ? -8.007  0.829   -6.540  1.00 1.25  ? 63  LEU B CD2  2  
ATOM 10536  H H    . LEU B 2 63  ? -10.300 3.703   -8.238  1.00 1.29  ? 63  LEU B H    2  
ATOM 10537  H HA   . LEU B 2 63  ? -7.636  3.433   -7.118  1.00 1.27  ? 63  LEU B HA   2  
ATOM 10538  H HB2  . LEU B 2 63  ? -8.909  2.188   -9.560  1.00 1.34  ? 63  LEU B HB2  2  
ATOM 10539  H HB3  . LEU B 2 63  ? -7.296  1.820   -8.982  1.00 1.34  ? 63  LEU B HB3  2  
ATOM 10540  H HG   . LEU B 2 63  ? -9.858  1.287   -7.475  1.00 1.25  ? 63  LEU B HG   2  
ATOM 10541  H HD11 . LEU B 2 63  ? -7.987  -0.550  -8.955  1.00 1.35  ? 63  LEU B HD11 2  
ATOM 10542  H HD12 . LEU B 2 63  ? -9.655  -0.169  -9.382  1.00 1.35  ? 63  LEU B HD12 2  
ATOM 10543  H HD13 . LEU B 2 63  ? -9.306  -1.075  -7.910  1.00 1.30  ? 63  LEU B HD13 2  
ATOM 10544  H HD21 . LEU B 2 63  ? -8.370  -0.012  -5.969  1.00 1.38  ? 63  LEU B HD21 2  
ATOM 10545  H HD22 . LEU B 2 63  ? -8.059  1.723   -5.937  1.00 1.34  ? 63  LEU B HD22 2  
ATOM 10546  H HD23 . LEU B 2 63  ? -6.982  0.651   -6.830  1.00 1.48  ? 63  LEU B HD23 2  
ATOM 10547  N N    . ASP B 2 64  ? -8.234  4.933   -9.984  1.00 1.39  ? 64  ASP B N    2  
ATOM 10548  C CA   . ASP B 2 64  ? -7.689  5.865   -10.957 1.00 1.46  ? 64  ASP B CA   2  
ATOM 10549  C C    . ASP B 2 64  ? -7.778  7.284   -10.420 1.00 1.46  ? 64  ASP B C    2  
ATOM 10550  O O    . ASP B 2 64  ? -8.866  7.848   -10.299 1.00 1.51  ? 64  ASP B O    2  
ATOM 10551  C CB   . ASP B 2 64  ? -8.435  5.759   -12.293 1.00 1.53  ? 64  ASP B CB   2  
ATOM 10552  C CG   . ASP B 2 64  ? -7.871  6.683   -13.358 1.00 1.59  ? 64  ASP B CG   2  
ATOM 10553  O OD1  . ASP B 2 64  ? -6.781  7.258   -13.136 1.00 1.62  ? 64  ASP B OD1  2  
ATOM 10554  O OD2  . ASP B 2 64  ? -8.519  6.846   -14.419 1.00 1.61  ? 64  ASP B OD2  2  
ATOM 10555  H H    . ASP B 2 64  ? -9.171  4.651   -10.071 1.00 1.39  ? 64  ASP B H    2  
ATOM 10556  H HA   . ASP B 2 64  ? -6.651  5.616   -11.111 1.00 1.47  ? 64  ASP B HA   2  
ATOM 10557  H HB2  . ASP B 2 64  ? -8.370  4.744   -12.654 1.00 1.55  ? 64  ASP B HB2  2  
ATOM 10558  H HB3  . ASP B 2 64  ? -9.474  6.013   -12.137 1.00 1.55  ? 64  ASP B HB3  2  
ATOM 10559  N N    . VAL B 2 65  ? -6.632  7.849   -10.081 1.00 1.47  ? 65  VAL B N    2  
ATOM 10560  C CA   . VAL B 2 65  ? -6.578  9.202   -9.553  1.00 1.50  ? 65  VAL B CA   2  
ATOM 10561  C C    . VAL B 2 65  ? -6.338  10.212  -10.667 1.00 1.56  ? 65  VAL B C    2  
ATOM 10562  O O    . VAL B 2 65  ? -6.359  11.420  -10.438 1.00 1.61  ? 65  VAL B O    2  
ATOM 10563  C CB   . VAL B 2 65  ? -5.483  9.352   -8.476  1.00 1.52  ? 65  VAL B CB   2  
ATOM 10564  C CG1  . VAL B 2 65  ? -5.935  8.720   -7.171  1.00 1.49  ? 65  VAL B CG1  2  
ATOM 10565  C CG2  . VAL B 2 65  ? -4.173  8.736   -8.943  1.00 1.57  ? 65  VAL B CG2  2  
ATOM 10566  H H    . VAL B 2 65  ? -5.801  7.344   -10.191 1.00 1.50  ? 65  VAL B H    2  
ATOM 10567  H HA   . VAL B 2 65  ? -7.533  9.413   -9.093  1.00 1.50  ? 65  VAL B HA   2  
ATOM 10568  H HB   . VAL B 2 65  ? -5.321  10.406  -8.303  1.00 1.56  ? 65  VAL B HB   2  
ATOM 10569  H HG11 . VAL B 2 65  ? -5.127  8.750   -6.457  1.00 1.56  ? 65  VAL B HG11 2  
ATOM 10570  H HG12 . VAL B 2 65  ? -6.221  7.693   -7.349  1.00 1.48  ? 65  VAL B HG12 2  
ATOM 10571  H HG13 . VAL B 2 65  ? -6.781  9.268   -6.781  1.00 1.50  ? 65  VAL B HG13 2  
ATOM 10572  H HG21 . VAL B 2 65  ? -3.403  8.934   -8.213  1.00 1.66  ? 65  VAL B HG21 2  
ATOM 10573  H HG22 . VAL B 2 65  ? -3.889  9.168   -9.891  1.00 1.66  ? 65  VAL B HG22 2  
ATOM 10574  H HG23 . VAL B 2 65  ? -4.296  7.668   -9.055  1.00 1.60  ? 65  VAL B HG23 2  
ATOM 10575  N N    . ASN B 2 66  ? -6.106  9.711   -11.874 1.00 1.61  ? 66  ASN B N    2  
ATOM 10576  C CA   . ASN B 2 66  ? -5.874  10.568  -13.030 1.00 1.69  ? 66  ASN B CA   2  
ATOM 10577  C C    . ASN B 2 66  ? -7.190  10.761  -13.773 1.00 1.69  ? 66  ASN B C    2  
ATOM 10578  O O    . ASN B 2 66  ? -7.375  11.736  -14.507 1.00 1.76  ? 66  ASN B O    2  
ATOM 10579  C CB   . ASN B 2 66  ? -4.776  9.962   -13.925 1.00 1.78  ? 66  ASN B CB   2  
ATOM 10580  C CG   . ASN B 2 66  ? -5.254  9.511   -15.297 1.00 1.78  ? 66  ASN B CG   2  
ATOM 10581  O OD1  . ASN B 2 66  ? -5.108  10.228  -16.290 1.00 1.84  ? 66  ASN B OD1  2  
ATOM 10582  N ND2  . ASN B 2 66  ? -5.822  8.319   -15.360 1.00 1.74  ? 66  ASN B ND2  2  
ATOM 10583  H H    . ASN B 2 66  ? -6.103  8.734   -11.997 1.00 1.60  ? 66  ASN B H    2  
ATOM 10584  H HA   . ASN B 2 66  ? -5.543  11.529  -12.665 1.00 1.72  ? 66  ASN B HA   2  
ATOM 10585  H HB2  . ASN B 2 66  ? -4.002  10.698  -14.070 1.00 1.86  ? 66  ASN B HB2  2  
ATOM 10586  H HB3  . ASN B 2 66  ? -4.351  9.108   -13.419 1.00 1.79  ? 66  ASN B HB3  2  
ATOM 10587  H HD21 . ASN B 2 66  ? -5.910  7.798   -14.521 1.00 1.71  ? 66  ASN B HD21 2  
ATOM 10588  H HD22 . ASN B 2 66  ? -6.131  7.985   -16.237 1.00 1.76  ? 66  ASN B HD22 2  
ATOM 10589  N N    . GLN B 2 67  ? -8.100  9.820   -13.532 1.00 1.62  ? 67  GLN B N    2  
ATOM 10590  C CA   . GLN B 2 67  ? -9.438  9.818   -14.111 1.00 1.62  ? 67  GLN B CA   2  
ATOM 10591  C C    . GLN B 2 67  ? -9.409  9.925   -15.630 1.00 1.67  ? 67  GLN B C    2  
ATOM 10592  O O    . GLN B 2 67  ? -9.746  10.963  -16.201 1.00 1.71  ? 67  GLN B O    2  
ATOM 10593  C CB   . GLN B 2 67  ? -10.292 10.936  -13.515 1.00 1.65  ? 67  GLN B CB   2  
ATOM 10594  C CG   . GLN B 2 67  ? -11.783 10.669  -13.620 1.00 1.79  ? 67  GLN B CG   2  
ATOM 10595  C CD   . GLN B 2 67  ? -12.621 11.711  -12.910 1.00 1.89  ? 67  GLN B CD   2  
ATOM 10596  O OE1  . GLN B 2 67  ? -13.699 11.416  -12.394 1.00 2.18  ? 67  GLN B OE1  2  
ATOM 10597  N NE2  . GLN B 2 67  ? -12.139 12.942  -12.886 1.00 1.92  ? 67  GLN B NE2  2  
ATOM 10598  H H    . GLN B 2 67  ? -7.850  9.072   -12.947 1.00 1.58  ? 67  GLN B H    2  
ATOM 10599  H HA   . GLN B 2 67  ? -9.893  8.874   -13.853 1.00 1.60  ? 67  GLN B HA   2  
ATOM 10600  H HB2  . GLN B 2 67  ? -10.038 11.053  -12.473 1.00 1.76  ? 67  GLN B HB2  2  
ATOM 10601  H HB3  . GLN B 2 67  ? -10.077 11.857  -14.037 1.00 1.73  ? 67  GLN B HB3  2  
ATOM 10602  H HG2  . GLN B 2 67  ? -12.059 10.659  -14.662 1.00 1.94  ? 67  GLN B HG2  2  
ATOM 10603  H HG3  . GLN B 2 67  ? -11.994 9.704   -13.184 1.00 2.00  ? 67  GLN B HG3  2  
ATOM 10604  H HE21 . GLN B 2 67  ? -11.276 13.109  -13.322 1.00 1.96  ? 67  GLN B HE21 2  
ATOM 10605  H HE22 . GLN B 2 67  ? -12.658 13.637  -12.431 1.00 2.07  ? 67  GLN B HE22 2  
ATOM 10606  N N    . ASP B 2 68  ? -8.983  8.854   -16.277 1.00 1.68  ? 68  ASP B N    2  
ATOM 10607  C CA   . ASP B 2 68  ? -8.945  8.810   -17.734 1.00 1.75  ? 68  ASP B CA   2  
ATOM 10608  C C    . ASP B 2 68  ? -9.578  7.513   -18.225 1.00 1.73  ? 68  ASP B C    2  
ATOM 10609  O O    . ASP B 2 68  ? -9.647  7.248   -19.429 1.00 1.79  ? 68  ASP B O    2  
ATOM 10610  C CB   . ASP B 2 68  ? -7.511  8.981   -18.258 1.00 1.81  ? 68  ASP B CB   2  
ATOM 10611  C CG   . ASP B 2 68  ? -6.785  7.678   -18.516 1.00 1.84  ? 68  ASP B CG   2  
ATOM 10612  O OD1  . ASP B 2 68  ? -6.530  6.933   -17.551 1.00 1.80  ? 68  ASP B OD1  2  
ATOM 10613  O OD2  . ASP B 2 68  ? -6.441  7.413   -19.686 1.00 2.02  ? 68  ASP B OD2  2  
ATOM 10614  H H    . ASP B 2 68  ? -8.665  8.072   -15.757 1.00 1.67  ? 68  ASP B H    2  
ATOM 10615  H HA   . ASP B 2 68  ? -9.545  9.635   -18.093 1.00 1.78  ? 68  ASP B HA   2  
ATOM 10616  H HB2  . ASP B 2 68  ? -7.542  9.535   -19.182 1.00 1.89  ? 68  ASP B HB2  2  
ATOM 10617  H HB3  . ASP B 2 68  ? -6.943  9.544   -17.531 1.00 1.83  ? 68  ASP B HB3  2  
ATOM 10618  N N    . SER B 2 69  ? -10.052 6.719   -17.256 1.00 1.67  ? 69  SER B N    2  
ATOM 10619  C CA   . SER B 2 69  ? -10.723 5.446   -17.516 1.00 1.67  ? 69  SER B CA   2  
ATOM 10620  C C    . SER B 2 69  ? -9.760  4.391   -18.054 1.00 1.71  ? 69  SER B C    2  
ATOM 10621  O O    . SER B 2 69  ? -10.171 3.438   -18.718 1.00 1.76  ? 69  SER B O    2  
ATOM 10622  C CB   . SER B 2 69  ? -11.896 5.652   -18.475 1.00 1.73  ? 69  SER B CB   2  
ATOM 10623  O OG   . SER B 2 69  ? -12.723 6.721   -18.038 1.00 1.73  ? 69  SER B OG   2  
ATOM 10624  H H    . SER B 2 69  ? -9.929  6.999   -16.325 1.00 1.64  ? 69  SER B H    2  
ATOM 10625  H HA   . SER B 2 69  ? -11.112 5.091   -16.572 1.00 1.63  ? 69  SER B HA   2  
ATOM 10626  H HB2  . SER B 2 69  ? -11.517 5.882   -19.458 1.00 1.78  ? 69  SER B HB2  2  
ATOM 10627  H HB3  . SER B 2 69  ? -12.486 4.749   -18.518 1.00 1.74  ? 69  SER B HB3  2  
ATOM 10628  H HG   . SER B 2 69  ? -12.176 7.386   -17.607 1.00 1.83  ? 69  SER B HG   2  
ATOM 10629  N N    . GLU B 2 70  ? -8.484  4.562   -17.753 1.00 1.71  ? 70  GLU B N    2  
ATOM 10630  C CA   . GLU B 2 70  ? -7.466  3.624   -18.185 1.00 1.75  ? 70  GLU B CA   2  
ATOM 10631  C C    . GLU B 2 70  ? -6.539  3.313   -17.013 1.00 1.71  ? 70  GLU B C    2  
ATOM 10632  O O    . GLU B 2 70  ? -5.651  4.098   -16.685 1.00 1.73  ? 70  GLU B O    2  
ATOM 10633  C CB   . GLU B 2 70  ? -6.681  4.202   -19.364 1.00 1.85  ? 70  GLU B CB   2  
ATOM 10634  C CG   . GLU B 2 70  ? -5.695  3.229   -19.983 1.00 2.07  ? 70  GLU B CG   2  
ATOM 10635  C CD   . GLU B 2 70  ? -4.759  3.898   -20.964 1.00 2.21  ? 70  GLU B CD   2  
ATOM 10636  O OE1  . GLU B 2 70  ? -4.002  4.802   -20.552 1.00 2.46  ? 70  GLU B OE1  2  
ATOM 10637  O OE2  . GLU B 2 70  ? -4.766  3.522   -22.149 1.00 2.32  ? 70  GLU B OE2  2  
ATOM 10638  H H    . GLU B 2 70  ? -8.215  5.346   -17.227 1.00 1.70  ? 70  GLU B H    2  
ATOM 10639  H HA   . GLU B 2 70  ? -7.959  2.715   -18.495 1.00 1.77  ? 70  GLU B HA   2  
ATOM 10640  H HB2  . GLU B 2 70  ? -7.379  4.505   -20.131 1.00 1.93  ? 70  GLU B HB2  2  
ATOM 10641  H HB3  . GLU B 2 70  ? -6.134  5.069   -19.025 1.00 1.96  ? 70  GLU B HB3  2  
ATOM 10642  H HG2  . GLU B 2 70  ? -5.107  2.783   -19.195 1.00 2.22  ? 70  GLU B HG2  2  
ATOM 10643  H HG3  . GLU B 2 70  ? -6.245  2.458   -20.501 1.00 2.25  ? 70  GLU B HG3  2  
ATOM 10644  N N    . LEU B 2 71  ? -6.763  2.172   -16.380 1.00 1.68  ? 71  LEU B N    2  
ATOM 10645  C CA   . LEU B 2 71  ? -5.970  1.755   -15.230 1.00 1.64  ? 71  LEU B CA   2  
ATOM 10646  C C    . LEU B 2 71  ? -4.593  1.269   -15.662 1.00 1.68  ? 71  LEU B C    2  
ATOM 10647  O O    . LEU B 2 71  ? -4.460  0.187   -16.228 1.00 1.71  ? 71  LEU B O    2  
ATOM 10648  C CB   . LEU B 2 71  ? -6.681  0.638   -14.451 1.00 1.61  ? 71  LEU B CB   2  
ATOM 10649  C CG   . LEU B 2 71  ? -7.895  1.056   -13.603 1.00 1.56  ? 71  LEU B CG   2  
ATOM 10650  C CD1  . LEU B 2 71  ? -7.573  2.267   -12.740 1.00 1.61  ? 71  LEU B CD1  2  
ATOM 10651  C CD2  . LEU B 2 71  ? -9.110  1.330   -14.479 1.00 1.52  ? 71  LEU B CD2  2  
ATOM 10652  H H    . LEU B 2 71  ? -7.478  1.578   -16.706 1.00 1.69  ? 71  LEU B H    2  
ATOM 10653  H HA   . LEU B 2 71  ? -5.849  2.610   -14.586 1.00 1.62  ? 71  LEU B HA   2  
ATOM 10654  H HB2  . LEU B 2 71  ? -7.011  -0.106  -15.161 1.00 1.62  ? 71  LEU B HB2  2  
ATOM 10655  H HB3  . LEU B 2 71  ? -5.957  0.178   -13.793 1.00 1.64  ? 71  LEU B HB3  2  
ATOM 10656  H HG   . LEU B 2 71  ? -8.148  0.242   -12.938 1.00 1.57  ? 71  LEU B HG   2  
ATOM 10657  H HD11 . LEU B 2 71  ? -8.431  2.512   -12.132 1.00 1.67  ? 71  LEU B HD11 2  
ATOM 10658  H HD12 . LEU B 2 71  ? -7.331  3.107   -13.374 1.00 1.78  ? 71  LEU B HD12 2  
ATOM 10659  H HD13 . LEU B 2 71  ? -6.733  2.043   -12.101 1.00 1.73  ? 71  LEU B HD13 2  
ATOM 10660  H HD21 . LEU B 2 71  ? -9.361  0.440   -15.037 1.00 1.63  ? 71  LEU B HD21 2  
ATOM 10661  H HD22 . LEU B 2 71  ? -8.885  2.133   -15.166 1.00 1.59  ? 71  LEU B HD22 2  
ATOM 10662  H HD23 . LEU B 2 71  ? -9.946  1.611   -13.857 1.00 1.48  ? 71  LEU B HD23 2  
ATOM 10663  N N    . LYS B 2 72  ? -3.572  2.070   -15.403 1.00 1.70  ? 72  LYS B N    2  
ATOM 10664  C CA   . LYS B 2 72  ? -2.211  1.690   -15.752 1.00 1.74  ? 72  LYS B CA   2  
ATOM 10665  C C    . LYS B 2 72  ? -1.681  0.705   -14.720 1.00 1.70  ? 72  LYS B C    2  
ATOM 10666  O O    . LYS B 2 72  ? -2.359  0.423   -13.735 1.00 1.64  ? 72  LYS B O    2  
ATOM 10667  C CB   . LYS B 2 72  ? -1.304  2.920   -15.835 1.00 1.77  ? 72  LYS B CB   2  
ATOM 10668  C CG   . LYS B 2 72  ? -1.146  3.472   -17.247 1.00 1.87  ? 72  LYS B CG   2  
ATOM 10669  C CD   . LYS B 2 72  ? -2.468  3.959   -17.824 1.00 1.92  ? 72  LYS B CD   2  
ATOM 10670  C CE   . LYS B 2 72  ? -2.770  5.393   -17.420 1.00 1.90  ? 72  LYS B CE   2  
ATOM 10671  N NZ   . LYS B 2 72  ? -4.009  5.895   -18.069 1.00 2.05  ? 72  LYS B NZ   2  
ATOM 10672  H H    . LYS B 2 72  ? -3.734  2.929   -14.960 1.00 1.69  ? 72  LYS B H    2  
ATOM 10673  H HA   . LYS B 2 72  ? -2.239  1.203   -16.717 1.00 1.79  ? 72  LYS B HA   2  
ATOM 10674  H HB2  . LYS B 2 72  ? -1.714  3.699   -15.211 1.00 1.74  ? 72  LYS B HB2  2  
ATOM 10675  H HB3  . LYS B 2 72  ? -0.324  2.653   -15.466 1.00 1.79  ? 72  LYS B HB3  2  
ATOM 10676  H HG2  . LYS B 2 72  ? -0.452  4.298   -17.224 1.00 1.93  ? 72  LYS B HG2  2  
ATOM 10677  H HG3  . LYS B 2 72  ? -0.753  2.691   -17.881 1.00 2.00  ? 72  LYS B HG3  2  
ATOM 10678  H HD2  . LYS B 2 72  ? -2.418  3.906   -18.902 1.00 2.15  ? 72  LYS B HD2  2  
ATOM 10679  H HD3  . LYS B 2 72  ? -3.264  3.319   -17.468 1.00 2.10  ? 72  LYS B HD3  2  
ATOM 10680  H HE2  . LYS B 2 72  ? -2.891  5.434   -16.349 1.00 2.06  ? 72  LYS B HE2  2  
ATOM 10681  H HE3  . LYS B 2 72  ? -1.940  6.019   -17.713 1.00 1.95  ? 72  LYS B HE3  2  
ATOM 10682  H HZ1  . LYS B 2 72  ? -4.851  5.493   -17.600 1.00 2.04  ? 72  LYS B HZ1  2  
ATOM 10683  H HZ2  . LYS B 2 72  ? -4.026  5.619   -19.078 1.00 2.38  ? 72  LYS B HZ2  2  
ATOM 10684  H HZ3  . LYS B 2 72  ? -4.055  6.929   -18.005 1.00 2.24  ? 72  LYS B HZ3  2  
ATOM 10685  N N    . PHE B 2 73  ? -0.478  0.191   -14.941 1.00 1.76  ? 73  PHE B N    2  
ATOM 10686  C CA   . PHE B 2 73  ? 0.134   -0.777  -14.029 1.00 1.74  ? 73  PHE B CA   2  
ATOM 10687  C C    . PHE B 2 73  ? 0.158   -0.254  -12.590 1.00 1.67  ? 73  PHE B C    2  
ATOM 10688  O O    . PHE B 2 73  ? -0.064  -1.006  -11.643 1.00 1.63  ? 73  PHE B O    2  
ATOM 10689  C CB   . PHE B 2 73  ? 1.556   -1.106  -14.500 1.00 1.82  ? 73  PHE B CB   2  
ATOM 10690  C CG   . PHE B 2 73  ? 2.267   -2.131  -13.661 1.00 1.84  ? 73  PHE B CG   2  
ATOM 10691  C CD1  . PHE B 2 73  ? 1.949   -3.476  -13.768 1.00 1.90  ? 73  PHE B CD1  2  
ATOM 10692  C CD2  . PHE B 2 73  ? 3.261   -1.749  -12.776 1.00 1.93  ? 73  PHE B CD2  2  
ATOM 10693  C CE1  . PHE B 2 73  ? 2.608   -4.419  -13.005 1.00 1.96  ? 73  PHE B CE1  2  
ATOM 10694  C CE2  . PHE B 2 73  ? 3.925   -2.688  -12.012 1.00 1.97  ? 73  PHE B CE2  2  
ATOM 10695  C CZ   . PHE B 2 73  ? 3.599   -4.025  -12.127 1.00 1.93  ? 73  PHE B CZ   2  
ATOM 10696  H H    . PHE B 2 73  ? 0.013   0.460   -15.747 1.00 1.81  ? 73  PHE B H    2  
ATOM 10697  H HA   . PHE B 2 73  ? -0.460  -1.678  -14.060 1.00 1.74  ? 73  PHE B HA   2  
ATOM 10698  H HB2  . PHE B 2 73  ? 1.512   -1.483  -15.511 1.00 1.86  ? 73  PHE B HB2  2  
ATOM 10699  H HB3  . PHE B 2 73  ? 2.147   -0.200  -14.488 1.00 1.86  ? 73  PHE B HB3  2  
ATOM 10700  H HD1  . PHE B 2 73  ? 1.175   -3.785  -14.454 1.00 2.00  ? 73  PHE B HD1  2  
ATOM 10701  H HD2  . PHE B 2 73  ? 3.515   -0.702  -12.685 1.00 2.07  ? 73  PHE B HD2  2  
ATOM 10702  H HE1  . PHE B 2 73  ? 2.350   -5.464  -13.097 1.00 2.10  ? 73  PHE B HE1  2  
ATOM 10703  H HE2  . PHE B 2 73  ? 4.700   -2.378  -11.325 1.00 2.12  ? 73  PHE B HE2  2  
ATOM 10704  H HZ   . PHE B 2 73  ? 4.119   -4.760  -11.531 1.00 1.99  ? 73  PHE B HZ   2  
ATOM 10705  N N    . ASN B 2 74  ? 0.395   1.044   -12.438 1.00 1.67  ? 74  ASN B N    2  
ATOM 10706  C CA   . ASN B 2 74  ? 0.460   1.670   -11.119 1.00 1.63  ? 74  ASN B CA   2  
ATOM 10707  C C    . ASN B 2 74  ? -0.922  1.748   -10.473 1.00 1.55  ? 74  ASN B C    2  
ATOM 10708  O O    . ASN B 2 74  ? -1.104  1.351   -9.322  1.00 1.51  ? 74  ASN B O    2  
ATOM 10709  C CB   . ASN B 2 74  ? 1.069   3.074   -11.236 1.00 1.66  ? 74  ASN B CB   2  
ATOM 10710  C CG   . ASN B 2 74  ? 1.139   3.798   -9.903  1.00 1.66  ? 74  ASN B CG   2  
ATOM 10711  O OD1  . ASN B 2 74  ? 2.011   3.523   -9.081  1.00 1.71  ? 74  ASN B OD1  2  
ATOM 10712  N ND2  . ASN B 2 74  ? 0.234   4.744   -9.687  1.00 1.64  ? 74  ASN B ND2  2  
ATOM 10713  H H    . ASN B 2 74  ? 0.517   1.599   -13.234 1.00 1.72  ? 74  ASN B H    2  
ATOM 10714  H HA   . ASN B 2 74  ? 1.100   1.063   -10.498 1.00 1.63  ? 74  ASN B HA   2  
ATOM 10715  H HB2  . ASN B 2 74  ? 2.071   2.993   -11.631 1.00 1.72  ? 74  ASN B HB2  2  
ATOM 10716  H HB3  . ASN B 2 74  ? 0.469   3.662   -11.914 1.00 1.67  ? 74  ASN B HB3  2  
ATOM 10717  H HD21 . ASN B 2 74  ? -0.431  4.930   -10.395 1.00 1.64  ? 74  ASN B HD21 2  
ATOM 10718  H HD22 . ASN B 2 74  ? 0.265   5.223   -8.836  1.00 1.67  ? 74  ASN B HD22 2  
ATOM 10719  N N    . GLU B 2 75  ? -1.896  2.244   -11.225 1.00 1.55  ? 75  GLU B N    2  
ATOM 10720  C CA   . GLU B 2 75  ? -3.260  2.391   -10.723 1.00 1.49  ? 75  GLU B CA   2  
ATOM 10721  C C    . GLU B 2 75  ? -3.913  1.032   -10.487 1.00 1.46  ? 75  GLU B C    2  
ATOM 10722  O O    . GLU B 2 75  ? -4.644  0.844   -9.516  1.00 1.41  ? 75  GLU B O    2  
ATOM 10723  C CB   . GLU B 2 75  ? -4.111  3.216   -11.695 1.00 1.51  ? 75  GLU B CB   2  
ATOM 10724  C CG   . GLU B 2 75  ? -3.759  4.698   -11.729 1.00 1.52  ? 75  GLU B CG   2  
ATOM 10725  C CD   . GLU B 2 75  ? -2.359  4.959   -12.245 1.00 1.65  ? 75  GLU B CD   2  
ATOM 10726  O OE1  . GLU B 2 75  ? -2.010  4.430   -13.320 1.00 1.86  ? 75  GLU B OE1  2  
ATOM 10727  O OE2  . GLU B 2 75  ? -1.595  5.680   -11.571 1.00 2.00  ? 75  GLU B OE2  2  
ATOM 10728  H H    . GLU B 2 75  ? -1.694  2.524   -12.144 1.00 1.59  ? 75  GLU B H    2  
ATOM 10729  H HA   . GLU B 2 75  ? -3.205  2.913   -9.780  1.00 1.46  ? 75  GLU B HA   2  
ATOM 10730  H HB2  . GLU B 2 75  ? -3.986  2.818   -12.691 1.00 1.56  ? 75  GLU B HB2  2  
ATOM 10731  H HB3  . GLU B 2 75  ? -5.148  3.123   -11.409 1.00 1.51  ? 75  GLU B HB3  2  
ATOM 10732  H HG2  . GLU B 2 75  ? -4.462  5.207   -12.374 1.00 1.58  ? 75  GLU B HG2  2  
ATOM 10733  H HG3  . GLU B 2 75  ? -3.838  5.098   -10.729 1.00 1.51  ? 75  GLU B HG3  2  
ATOM 10734  N N    . TYR B 2 76  ? -3.638  0.089   -11.376 1.00 1.51  ? 76  TYR B N    2  
ATOM 10735  C CA   . TYR B 2 76  ? -4.194  -1.254  -11.275 1.00 1.50  ? 76  TYR B CA   2  
ATOM 10736  C C    . TYR B 2 76  ? -3.646  -1.978  -10.049 1.00 1.48  ? 76  TYR B C    2  
ATOM 10737  O O    . TYR B 2 76  ? -4.369  -2.711  -9.375  1.00 1.46  ? 76  TYR B O    2  
ATOM 10738  C CB   . TYR B 2 76  ? -3.882  -2.055  -12.544 1.00 1.58  ? 76  TYR B CB   2  
ATOM 10739  C CG   . TYR B 2 76  ? -4.308  -3.508  -12.476 1.00 1.59  ? 76  TYR B CG   2  
ATOM 10740  C CD1  . TYR B 2 76  ? -5.633  -3.875  -12.671 1.00 1.58  ? 76  TYR B CD1  2  
ATOM 10741  C CD2  . TYR B 2 76  ? -3.383  -4.511  -12.213 1.00 1.62  ? 76  TYR B CD2  2  
ATOM 10742  C CE1  . TYR B 2 76  ? -6.024  -5.199  -12.606 1.00 1.60  ? 76  TYR B CE1  2  
ATOM 10743  C CE2  . TYR B 2 76  ? -3.766  -5.836  -12.147 1.00 1.64  ? 76  TYR B CE2  2  
ATOM 10744  C CZ   . TYR B 2 76  ? -5.088  -6.176  -12.345 1.00 1.63  ? 76  TYR B CZ   2  
ATOM 10745  O OH   . TYR B 2 76  ? -5.473  -7.497  -12.278 1.00 1.66  ? 76  TYR B OH   2  
ATOM 10746  H H    . TYR B 2 76  ? -3.047  0.306   -12.134 1.00 1.55  ? 76  TYR B H    2  
ATOM 10747  H HA   . TYR B 2 76  ? -5.265  -1.163  -11.171 1.00 1.47  ? 76  TYR B HA   2  
ATOM 10748  H HB2  . TYR B 2 76  ? -4.390  -1.600  -13.380 1.00 1.60  ? 76  TYR B HB2  2  
ATOM 10749  H HB3  . TYR B 2 76  ? -2.816  -2.029  -12.720 1.00 1.61  ? 76  TYR B HB3  2  
ATOM 10750  H HD1  . TYR B 2 76  ? -6.365  -3.108  -12.874 1.00 1.57  ? 76  TYR B HD1  2  
ATOM 10751  H HD2  . TYR B 2 76  ? -2.348  -4.243  -12.061 1.00 1.64  ? 76  TYR B HD2  2  
ATOM 10752  H HE1  . TYR B 2 76  ? -7.059  -5.465  -12.763 1.00 1.61  ? 76  TYR B HE1  2  
ATOM 10753  H HE2  . TYR B 2 76  ? -3.032  -6.601  -11.940 1.00 1.68  ? 76  TYR B HE2  2  
ATOM 10754  H HH   . TYR B 2 76  ? -6.061  -7.698  -13.010 1.00 1.73  ? 76  TYR B HH   2  
ATOM 10755  N N    . TRP B 2 77  ? -2.369  -1.754  -9.753  1.00 1.49  ? 77  TRP B N    2  
ATOM 10756  C CA   . TRP B 2 77  ? -1.731  -2.394  -8.609  1.00 1.48  ? 77  TRP B CA   2  
ATOM 10757  C C    . TRP B 2 77  ? -2.387  -1.958  -7.303  1.00 1.41  ? 77  TRP B C    2  
ATOM 10758  O O    . TRP B 2 77  ? -2.349  -2.683  -6.308  1.00 1.39  ? 77  TRP B O    2  
ATOM 10759  C CB   . TRP B 2 77  ? -0.236  -2.075  -8.583  1.00 1.51  ? 77  TRP B CB   2  
ATOM 10760  C CG   . TRP B 2 77  ? 0.570   -3.101  -7.847  1.00 1.59  ? 77  TRP B CG   2  
ATOM 10761  C CD1  . TRP B 2 77  ? 0.955   -3.061  -6.539  1.00 1.68  ? 77  TRP B CD1  2  
ATOM 10762  C CD2  . TRP B 2 77  ? 1.086   -4.324  -8.382  1.00 1.77  ? 77  TRP B CD2  2  
ATOM 10763  N NE1  . TRP B 2 77  ? 1.677   -4.187  -6.227  1.00 1.85  ? 77  TRP B NE1  2  
ATOM 10764  C CE2  . TRP B 2 77  ? 1.772   -4.978  -7.341  1.00 1.92  ? 77  TRP B CE2  2  
ATOM 10765  C CE3  . TRP B 2 77  ? 1.034   -4.932  -9.642  1.00 1.95  ? 77  TRP B CE3  2  
ATOM 10766  C CZ2  . TRP B 2 77  ? 2.398   -6.207  -7.522  1.00 2.21  ? 77  TRP B CZ2  2  
ATOM 10767  C CZ3  . TRP B 2 77  ? 1.656   -6.153  -9.817  1.00 2.26  ? 77  TRP B CZ3  2  
ATOM 10768  C CH2  . TRP B 2 77  ? 2.329   -6.779  -8.762  1.00 2.37  ? 77  TRP B CH2  2  
ATOM 10769  H H    . TRP B 2 77  ? -1.841  -1.148  -10.317 1.00 1.52  ? 77  TRP B H    2  
ATOM 10770  H HA   . TRP B 2 77  ? -1.857  -3.461  -8.717  1.00 1.51  ? 77  TRP B HA   2  
ATOM 10771  H HB2  . TRP B 2 77  ? 0.133   -2.025  -9.596  1.00 1.58  ? 77  TRP B HB2  2  
ATOM 10772  H HB3  . TRP B 2 77  ? -0.086  -1.120  -8.102  1.00 1.51  ? 77  TRP B HB3  2  
ATOM 10773  H HD1  . TRP B 2 77  ? 0.722   -2.255  -5.861  1.00 1.72  ? 77  TRP B HD1  2  
ATOM 10774  H HE1  . TRP B 2 77  ? 2.062   -4.390  -5.351  1.00 1.99  ? 77  TRP B HE1  2  
ATOM 10775  H HE3  . TRP B 2 77  ? 0.517   -4.463  -10.469 1.00 1.94  ? 77  TRP B HE3  2  
ATOM 10776  H HZ2  . TRP B 2 77  ? 2.919   -6.707  -6.719  1.00 2.37  ? 77  TRP B HZ2  2  
ATOM 10777  H HZ3  . TRP B 2 77  ? 1.623   -6.641  -10.781 1.00 2.48  ? 77  TRP B HZ3  2  
ATOM 10778  H HH2  . TRP B 2 77  ? 2.799   -7.734  -8.944  1.00 2.65  ? 77  TRP B HH2  2  
ATOM 10779  N N    . ARG B 2 78  ? -3.012  -0.782  -7.317  1.00 1.38  ? 78  ARG B N    2  
ATOM 10780  C CA   . ARG B 2 78  ? -3.685  -0.267  -6.131  1.00 1.32  ? 78  ARG B CA   2  
ATOM 10781  C C    . ARG B 2 78  ? -4.847  -1.182  -5.740  1.00 1.30  ? 78  ARG B C    2  
ATOM 10782  O O    . ARG B 2 78  ? -5.230  -1.251  -4.571  1.00 1.27  ? 78  ARG B O    2  
ATOM 10783  C CB   . ARG B 2 78  ? -4.178  1.164   -6.365  1.00 1.31  ? 78  ARG B CB   2  
ATOM 10784  C CG   . ARG B 2 78  ? -3.056  2.161   -6.623  1.00 1.37  ? 78  ARG B CG   2  
ATOM 10785  C CD   . ARG B 2 78  ? -3.577  3.589   -6.684  1.00 1.35  ? 78  ARG B CD   2  
ATOM 10786  N NE   . ARG B 2 78  ? -3.921  4.100   -5.357  1.00 1.32  ? 78  ARG B NE   2  
ATOM 10787  C CZ   . ARG B 2 78  ? -5.089  4.665   -5.047  1.00 1.32  ? 78  ARG B CZ   2  
ATOM 10788  N NH1  . ARG B 2 78  ? -6.013  4.853   -5.982  1.00 1.38  ? 78  ARG B NH1  2  
ATOM 10789  N NH2  . ARG B 2 78  ? -5.319  5.068   -3.803  1.00 1.41  ? 78  ARG B NH2  2  
ATOM 10790  H H    . ARG B 2 78  ? -3.018  -0.253  -8.143  1.00 1.40  ? 78  ARG B H    2  
ATOM 10791  H HA   . ARG B 2 78  ? -2.965  -0.263  -5.327  1.00 1.31  ? 78  ARG B HA   2  
ATOM 10792  H HB2  . ARG B 2 78  ? -4.841  1.170   -7.217  1.00 1.34  ? 78  ARG B HB2  2  
ATOM 10793  H HB3  . ARG B 2 78  ? -4.726  1.491   -5.493  1.00 1.29  ? 78  ARG B HB3  2  
ATOM 10794  H HG2  . ARG B 2 78  ? -2.333  2.089   -5.825  1.00 1.39  ? 78  ARG B HG2  2  
ATOM 10795  H HG3  . ARG B 2 78  ? -2.582  1.919   -7.564  1.00 1.45  ? 78  ARG B HG3  2  
ATOM 10796  H HD2  . ARG B 2 78  ? -2.814  4.219   -7.116  1.00 1.44  ? 78  ARG B HD2  2  
ATOM 10797  H HD3  . ARG B 2 78  ? -4.458  3.612   -7.308  1.00 1.38  ? 78  ARG B HD3  2  
ATOM 10798  H HE   . ARG B 2 78  ? -3.239  4.008   -4.650  1.00 1.38  ? 78  ARG B HE   2  
ATOM 10799  H HH11 . ARG B 2 78  ? -5.838  4.574   -6.930  1.00 1.44  ? 78  ARG B HH11 2  
ATOM 10800  H HH12 . ARG B 2 78  ? -6.897  5.269   -5.744  1.00 1.43  ? 78  ARG B HH12 2  
ATOM 10801  H HH21 . ARG B 2 78  ? -4.612  4.951   -3.093  1.00 1.51  ? 78  ARG B HH21 2  
ATOM 10802  H HH22 . ARG B 2 78  ? -6.193  5.484   -3.562  1.00 1.45  ? 78  ARG B HH22 2  
ATOM 10803  N N    . LEU B 2 79  ? -5.392  -1.895  -6.724  1.00 1.34  ? 79  LEU B N    2  
ATOM 10804  C CA   . LEU B 2 79  ? -6.491  -2.820  -6.479  1.00 1.33  ? 79  LEU B CA   2  
ATOM 10805  C C    . LEU B 2 79  ? -6.006  -3.979  -5.618  1.00 1.35  ? 79  LEU B C    2  
ATOM 10806  O O    . LEU B 2 79  ? -6.667  -4.376  -4.659  1.00 1.32  ? 79  LEU B O    2  
ATOM 10807  C CB   . LEU B 2 79  ? -7.051  -3.357  -7.800  1.00 1.37  ? 79  LEU B CB   2  
ATOM 10808  C CG   . LEU B 2 79  ? -8.097  -4.468  -7.659  1.00 1.39  ? 79  LEU B CG   2  
ATOM 10809  C CD1  . LEU B 2 79  ? -9.433  -3.896  -7.203  1.00 1.35  ? 79  LEU B CD1  2  
ATOM 10810  C CD2  . LEU B 2 79  ? -8.258  -5.222  -8.970  1.00 1.45  ? 79  LEU B CD2  2  
ATOM 10811  H H    . LEU B 2 79  ? -5.044  -1.799  -7.636  1.00 1.37  ? 79  LEU B H    2  
ATOM 10812  H HA   . LEU B 2 79  ? -7.267  -2.289  -5.951  1.00 1.30  ? 79  LEU B HA   2  
ATOM 10813  H HB2  . LEU B 2 79  ? -7.499  -2.535  -8.338  1.00 1.37  ? 79  LEU B HB2  2  
ATOM 10814  H HB3  . LEU B 2 79  ? -6.229  -3.743  -8.386  1.00 1.41  ? 79  LEU B HB3  2  
ATOM 10815  H HG   . LEU B 2 79  ? -7.764  -5.169  -6.907  1.00 1.40  ? 79  LEU B HG   2  
ATOM 10816  H HD11 . LEU B 2 79  ? -9.798  -3.202  -7.946  1.00 1.41  ? 79  LEU B HD11 2  
ATOM 10817  H HD12 . LEU B 2 79  ? -9.302  -3.380  -6.263  1.00 1.46  ? 79  LEU B HD12 2  
ATOM 10818  H HD13 . LEU B 2 79  ? -10.144 -4.698  -7.078  1.00 1.40  ? 79  LEU B HD13 2  
ATOM 10819  H HD21 . LEU B 2 79  ? -7.301  -5.619  -9.277  1.00 1.52  ? 79  LEU B HD21 2  
ATOM 10820  H HD22 . LEU B 2 79  ? -8.627  -4.550  -9.731  1.00 1.47  ? 79  LEU B HD22 2  
ATOM 10821  H HD23 . LEU B 2 79  ? -8.960  -6.031  -8.838  1.00 1.53  ? 79  LEU B HD23 2  
ATOM 10822  N N    . ILE B 2 80  ? -4.829  -4.495  -5.957  1.00 1.42  ? 80  ILE B N    2  
ATOM 10823  C CA   . ILE B 2 80  ? -4.235  -5.611  -5.229  1.00 1.45  ? 80  ILE B CA   2  
ATOM 10824  C C    . ILE B 2 80  ? -3.964  -5.216  -3.781  1.00 1.42  ? 80  ILE B C    2  
ATOM 10825  O O    . ILE B 2 80  ? -4.093  -6.034  -2.866  1.00 1.42  ? 80  ILE B O    2  
ATOM 10826  C CB   . ILE B 2 80  ? -2.923  -6.086  -5.893  1.00 1.53  ? 80  ILE B CB   2  
ATOM 10827  C CG1  . ILE B 2 80  ? -3.132  -6.268  -7.401  1.00 1.59  ? 80  ILE B CG1  2  
ATOM 10828  C CG2  . ILE B 2 80  ? -2.446  -7.388  -5.262  1.00 1.58  ? 80  ILE B CG2  2  
ATOM 10829  C CD1  . ILE B 2 80  ? -1.868  -6.618  -8.152  1.00 1.66  ? 80  ILE B CD1  2  
ATOM 10830  H H    . ILE B 2 80  ? -4.343  -4.108  -6.715  1.00 1.45  ? 80  ILE B H    2  
ATOM 10831  H HA   . ILE B 2 80  ? -4.939  -6.430  -5.241  1.00 1.46  ? 80  ILE B HA   2  
ATOM 10832  H HB   . ILE B 2 80  ? -2.167  -5.334  -5.730  1.00 1.53  ? 80  ILE B HB   2  
ATOM 10833  H HG12 . ILE B 2 80  ? -3.844  -7.062  -7.563  1.00 1.61  ? 80  ILE B HG12 2  
ATOM 10834  H HG13 . ILE B 2 80  ? -3.523  -5.351  -7.817  1.00 1.56  ? 80  ILE B HG13 2  
ATOM 10835  H HG21 . ILE B 2 80  ? -1.501  -7.675  -5.700  1.00 1.65  ? 80  ILE B HG21 2  
ATOM 10836  H HG22 . ILE B 2 80  ? -3.176  -8.163  -5.441  1.00 1.62  ? 80  ILE B HG22 2  
ATOM 10837  H HG23 . ILE B 2 80  ? -2.322  -7.249  -4.199  1.00 1.57  ? 80  ILE B HG23 2  
ATOM 10838  H HD11 . ILE B 2 80  ? -2.090  -6.722  -9.202  1.00 1.76  ? 80  ILE B HD11 2  
ATOM 10839  H HD12 . ILE B 2 80  ? -1.472  -7.547  -7.773  1.00 1.92  ? 80  ILE B HD12 2  
ATOM 10840  H HD13 . ILE B 2 80  ? -1.138  -5.832  -8.013  1.00 1.83  ? 80  ILE B HD13 2  
ATOM 10841  N N    . GLY B 2 81  ? -3.611  -3.950  -3.582  1.00 1.40  ? 81  GLY B N    2  
ATOM 10842  C CA   . GLY B 2 81  ? -3.350  -3.449  -2.247  1.00 1.38  ? 81  GLY B CA   2  
ATOM 10843  C C    . GLY B 2 81  ? -4.583  -3.530  -1.370  1.00 1.33  ? 81  GLY B C    2  
ATOM 10844  O O    . GLY B 2 81  ? -4.506  -3.913  -0.201  1.00 1.35  ? 81  GLY B O    2  
ATOM 10845  H H    . GLY B 2 81  ? -3.526  -3.350  -4.355  1.00 1.41  ? 81  GLY B H    2  
ATOM 10846  H HA2  . GLY B 2 81  ? -2.559  -4.032  -1.798  1.00 1.42  ? 81  GLY B HA2  2  
ATOM 10847  H HA3  . GLY B 2 81  ? -3.034  -2.418  -2.312  1.00 1.37  ? 81  GLY B HA3  2  
ATOM 10848  N N    . GLU B 2 82  ? -5.729  -3.181  -1.944  1.00 1.29  ? 82  GLU B N    2  
ATOM 10849  C CA   . GLU B 2 82  ? -6.990  -3.227  -1.218  1.00 1.26  ? 82  GLU B CA   2  
ATOM 10850  C C    . GLU B 2 82  ? -7.453  -4.671  -1.056  1.00 1.29  ? 82  GLU B C    2  
ATOM 10851  O O    . GLU B 2 82  ? -8.056  -5.025  -0.043  1.00 1.30  ? 82  GLU B O    2  
ATOM 10852  C CB   . GLU B 2 82  ? -8.064  -2.405  -1.941  1.00 1.21  ? 82  GLU B CB   2  
ATOM 10853  C CG   . GLU B 2 82  ? -7.815  -0.904  -1.909  1.00 1.22  ? 82  GLU B CG   2  
ATOM 10854  C CD   . GLU B 2 82  ? -7.617  -0.377  -0.501  1.00 1.32  ? 82  GLU B CD   2  
ATOM 10855  O OE1  . GLU B 2 82  ? -8.348  -0.811  0.414   1.00 1.77  ? 82  GLU B OE1  2  
ATOM 10856  O OE2  . GLU B 2 82  ? -6.711  0.461   -0.294  1.00 1.69  ? 82  GLU B OE2  2  
ATOM 10857  H H    . GLU B 2 82  ? -5.725  -2.886  -2.880  1.00 1.29  ? 82  GLU B H    2  
ATOM 10858  H HA   . GLU B 2 82  ? -6.823  -2.805  -0.238  1.00 1.26  ? 82  GLU B HA   2  
ATOM 10859  H HB2  . GLU B 2 82  ? -8.105  -2.719  -2.973  1.00 1.21  ? 82  GLU B HB2  2  
ATOM 10860  H HB3  . GLU B 2 82  ? -9.020  -2.600  -1.478  1.00 1.22  ? 82  GLU B HB3  2  
ATOM 10861  H HG2  . GLU B 2 82  ? -6.929  -0.685  -2.486  1.00 1.27  ? 82  GLU B HG2  2  
ATOM 10862  H HG3  . GLU B 2 82  ? -8.664  -0.400  -2.351  1.00 1.20  ? 82  GLU B HG3  2  
ATOM 10863  N N    . LEU B 2 83  ? -7.151  -5.497  -2.057  1.00 1.33  ? 83  LEU B N    2  
ATOM 10864  C CA   . LEU B 2 83  ? -7.524  -6.910  -2.043  1.00 1.38  ? 83  LEU B CA   2  
ATOM 10865  C C    . LEU B 2 83  ? -6.904  -7.632  -0.852  1.00 1.43  ? 83  LEU B C    2  
ATOM 10866  O O    . LEU B 2 83  ? -7.588  -8.349  -0.122  1.00 1.47  ? 83  LEU B O    2  
ATOM 10867  C CB   . LEU B 2 83  ? -7.070  -7.600  -3.332  1.00 1.44  ? 83  LEU B CB   2  
ATOM 10868  C CG   . LEU B 2 83  ? -7.794  -7.169  -4.608  1.00 1.42  ? 83  LEU B CG   2  
ATOM 10869  C CD1  . LEU B 2 83  ? -7.378  -8.047  -5.775  1.00 1.49  ? 83  LEU B CD1  2  
ATOM 10870  C CD2  . LEU B 2 83  ? -9.300  -7.220  -4.416  1.00 1.40  ? 83  LEU B CD2  2  
ATOM 10871  H H    . LEU B 2 83  ? -6.671  -5.141  -2.838  1.00 1.33  ? 83  LEU B H    2  
ATOM 10872  H HA   . LEU B 2 83  ? -8.599  -6.970  -1.968  1.00 1.37  ? 83  LEU B HA   2  
ATOM 10873  H HB2  . LEU B 2 83  ? -6.015  -7.408  -3.462  1.00 1.46  ? 83  LEU B HB2  2  
ATOM 10874  H HB3  . LEU B 2 83  ? -7.210  -8.664  -3.211  1.00 1.49  ? 83  LEU B HB3  2  
ATOM 10875  H HG   . LEU B 2 83  ? -7.519  -6.149  -4.842  1.00 1.40  ? 83  LEU B HG   2  
ATOM 10876  H HD11 . LEU B 2 83  ? -7.593  -9.079  -5.542  1.00 1.65  ? 83  LEU B HD11 2  
ATOM 10877  H HD12 . LEU B 2 83  ? -6.320  -7.931  -5.955  1.00 1.60  ? 83  LEU B HD12 2  
ATOM 10878  H HD13 . LEU B 2 83  ? -7.927  -7.755  -6.658  1.00 1.57  ? 83  LEU B HD13 2  
ATOM 10879  H HD21 . LEU B 2 83  ? -9.576  -8.180  -4.006  1.00 1.41  ? 83  LEU B HD21 2  
ATOM 10880  H HD22 . LEU B 2 83  ? -9.787  -7.084  -5.370  1.00 1.43  ? 83  LEU B HD22 2  
ATOM 10881  H HD23 . LEU B 2 83  ? -9.604  -6.437  -3.740  1.00 1.36  ? 83  LEU B HD23 2  
ATOM 10882  N N    . ALA B 2 84  ? -5.604  -7.433  -0.666  1.00 1.45  ? 84  ALA B N    2  
ATOM 10883  C CA   . ALA B 2 84  ? -4.876  -8.064  0.428   1.00 1.51  ? 84  ALA B CA   2  
ATOM 10884  C C    . ALA B 2 84  ? -5.454  -7.663  1.781   1.00 1.49  ? 84  ALA B C    2  
ATOM 10885  O O    . ALA B 2 84  ? -5.492  -8.459  2.715   1.00 1.57  ? 84  ALA B O    2  
ATOM 10886  C CB   . ALA B 2 84  ? -3.402  -7.702  0.356   1.00 1.54  ? 84  ALA B CB   2  
ATOM 10887  H H    . ALA B 2 84  ? -5.117  -6.850  -1.289  1.00 1.42  ? 84  ALA B H    2  
ATOM 10888  H HA   . ALA B 2 84  ? -4.965  -9.135  0.314   1.00 1.56  ? 84  ALA B HA   2  
ATOM 10889  H HB1  . ALA B 2 84  ? -3.285  -6.640  0.505   1.00 1.58  ? 84  ALA B HB1  2  
ATOM 10890  H HB2  . ALA B 2 84  ? -3.012  -7.977  -0.613  1.00 1.55  ? 84  ALA B HB2  2  
ATOM 10891  H HB3  . ALA B 2 84  ? -2.863  -8.235  1.125   1.00 1.62  ? 84  ALA B HB3  2  
ATOM 10892  N N    . LYS B 2 85  ? -5.917  -6.429  1.880   1.00 1.42  ? 85  LYS B N    2  
ATOM 10893  C CA   . LYS B 2 85  ? -6.498  -5.942  3.119   1.00 1.42  ? 85  LYS B CA   2  
ATOM 10894  C C    . LYS B 2 85  ? -7.915  -6.476  3.295   1.00 1.42  ? 85  LYS B C    2  
ATOM 10895  O O    . LYS B 2 85  ? -8.396  -6.622  4.413   1.00 1.43  ? 85  LYS B O    2  
ATOM 10896  C CB   . LYS B 2 85  ? -6.503  -4.415  3.147   1.00 1.38  ? 85  LYS B CB   2  
ATOM 10897  C CG   . LYS B 2 85  ? -5.118  -3.806  3.291   1.00 1.52  ? 85  LYS B CG   2  
ATOM 10898  C CD   . LYS B 2 85  ? -5.175  -2.288  3.340   1.00 1.51  ? 85  LYS B CD   2  
ATOM 10899  C CE   . LYS B 2 85  ? -5.604  -1.706  2.004   1.00 1.52  ? 85  LYS B CE   2  
ATOM 10900  N NZ   . LYS B 2 85  ? -5.724  -0.224  2.051   1.00 1.50  ? 85  LYS B NZ   2  
ATOM 10901  H H    . LYS B 2 85  ? -5.866  -5.832  1.102   1.00 1.39  ? 85  LYS B H    2  
ATOM 10902  H HA   . LYS B 2 85  ? -5.888  -6.303  3.933   1.00 1.48  ? 85  LYS B HA   2  
ATOM 10903  H HB2  . LYS B 2 85  ? -6.943  -4.052  2.231   1.00 1.53  ? 85  LYS B HB2  2  
ATOM 10904  H HB3  . LYS B 2 85  ? -7.106  -4.086  3.981   1.00 1.49  ? 85  LYS B HB3  2  
ATOM 10905  H HG2  . LYS B 2 85  ? -4.668  -4.170  4.202   1.00 1.73  ? 85  LYS B HG2  2  
ATOM 10906  H HG3  . LYS B 2 85  ? -4.516  -4.107  2.447   1.00 1.77  ? 85  LYS B HG3  2  
ATOM 10907  H HD2  . LYS B 2 85  ? -5.885  -1.989  4.097   1.00 1.49  ? 85  LYS B HD2  2  
ATOM 10908  H HD3  . LYS B 2 85  ? -4.195  -1.906  3.593   1.00 1.76  ? 85  LYS B HD3  2  
ATOM 10909  H HE2  . LYS B 2 85  ? -4.873  -1.974  1.256   1.00 1.77  ? 85  LYS B HE2  2  
ATOM 10910  H HE3  . LYS B 2 85  ? -6.562  -2.125  1.737   1.00 1.54  ? 85  LYS B HE3  2  
ATOM 10911  H HZ1  . LYS B 2 85  ? -6.221  0.119   1.196   1.00 1.52  ? 85  LYS B HZ1  2  
ATOM 10912  H HZ2  . LYS B 2 85  ? -4.785  0.211   2.090   1.00 1.74  ? 85  LYS B HZ2  2  
ATOM 10913  H HZ3  . LYS B 2 85  ? -6.263  0.066   2.891   1.00 1.83  ? 85  LYS B HZ3  2  
ATOM 10914  N N    . GLU B 2 86  ? -8.577  -6.788  2.189   1.00 1.44  ? 86  GLU B N    2  
ATOM 10915  C CA   . GLU B 2 86  ? -9.942  -7.300  2.236   1.00 1.45  ? 86  GLU B CA   2  
ATOM 10916  C C    . GLU B 2 86  ? -9.989  -8.757  2.695   1.00 1.43  ? 86  GLU B C    2  
ATOM 10917  O O    . GLU B 2 86  ? -11.068 -9.296  2.941   1.00 1.47  ? 86  GLU B O    2  
ATOM 10918  C CB   . GLU B 2 86  ? -10.618 -7.166  0.869   1.00 1.52  ? 86  GLU B CB   2  
ATOM 10919  C CG   . GLU B 2 86  ? -11.423 -5.884  0.707   1.00 1.62  ? 86  GLU B CG   2  
ATOM 10920  C CD   . GLU B 2 86  ? -12.491 -5.720  1.774   1.00 1.67  ? 86  GLU B CD   2  
ATOM 10921  O OE1  . GLU B 2 86  ? -13.394 -6.582  1.863   1.00 1.79  ? 86  GLU B OE1  2  
ATOM 10922  O OE2  . GLU B 2 86  ? -12.439 -4.727  2.530   1.00 1.71  ? 86  GLU B OE2  2  
ATOM 10923  H H    . GLU B 2 86  ? -8.142  -6.666  1.316   1.00 1.46  ? 86  GLU B H    2  
ATOM 10924  H HA   . GLU B 2 86  ? -10.488 -6.700  2.950   1.00 1.45  ? 86  GLU B HA   2  
ATOM 10925  H HB2  . GLU B 2 86  ? -9.859  -7.187  0.102   1.00 1.56  ? 86  GLU B HB2  2  
ATOM 10926  H HB3  . GLU B 2 86  ? -11.285 -8.003  0.726   1.00 1.53  ? 86  GLU B HB3  2  
ATOM 10927  H HG2  . GLU B 2 86  ? -10.750 -5.041  0.760   1.00 1.66  ? 86  GLU B HG2  2  
ATOM 10928  H HG3  . GLU B 2 86  ? -11.903 -5.899  -0.261  1.00 1.68  ? 86  GLU B HG3  2  
ATOM 10929  N N    . ILE B 2 87  ? -8.831  -9.398  2.804   1.00 1.41  ? 87  ILE B N    2  
ATOM 10930  C CA   . ILE B 2 87  ? -8.787  -10.787 3.243   1.00 1.42  ? 87  ILE B CA   2  
ATOM 10931  C C    . ILE B 2 87  ? -8.540  -10.882 4.753   1.00 1.38  ? 87  ILE B C    2  
ATOM 10932  O O    . ILE B 2 87  ? -8.808  -11.908 5.370   1.00 1.44  ? 87  ILE B O    2  
ATOM 10933  C CB   . ILE B 2 87  ? -7.721  -11.606 2.465   1.00 1.44  ? 87  ILE B CB   2  
ATOM 10934  C CG1  . ILE B 2 87  ? -8.085  -13.091 2.473   1.00 1.47  ? 87  ILE B CG1  2  
ATOM 10935  C CG2  . ILE B 2 87  ? -6.327  -11.397 3.045   1.00 1.43  ? 87  ILE B CG2  2  
ATOM 10936  C CD1  . ILE B 2 87  ? -7.291  -13.919 1.484   1.00 1.63  ? 87  ILE B CD1  2  
ATOM 10937  H H    . ILE B 2 87  ? -7.999  -8.939  2.571   1.00 1.42  ? 87  ILE B H    2  
ATOM 10938  H HA   . ILE B 2 87  ? -9.755  -11.221 3.033   1.00 1.48  ? 87  ILE B HA   2  
ATOM 10939  H HB   . ILE B 2 87  ? -7.710  -11.256 1.446   1.00 1.48  ? 87  ILE B HB   2  
ATOM 10940  H HG12 . ILE B 2 87  ? -7.904  -13.491 3.459   1.00 1.55  ? 87  ILE B HG12 2  
ATOM 10941  H HG13 . ILE B 2 87  ? -9.133  -13.198 2.233   1.00 1.54  ? 87  ILE B HG13 2  
ATOM 10942  H HG21 . ILE B 2 87  ? -6.106  -10.341 3.075   1.00 1.42  ? 87  ILE B HG21 2  
ATOM 10943  H HG22 . ILE B 2 87  ? -5.601  -11.899 2.422   1.00 1.47  ? 87  ILE B HG22 2  
ATOM 10944  H HG23 . ILE B 2 87  ? -6.288  -11.803 4.044   1.00 1.43  ? 87  ILE B HG23 2  
ATOM 10945  H HD11 . ILE B 2 87  ? -7.513  -13.593 0.478   1.00 1.79  ? 87  ILE B HD11 2  
ATOM 10946  H HD12 . ILE B 2 87  ? -7.557  -14.961 1.592   1.00 1.85  ? 87  ILE B HD12 2  
ATOM 10947  H HD13 . ILE B 2 87  ? -6.234  -13.796 1.676   1.00 1.91  ? 87  ILE B HD13 2  
ATOM 10948  N N    . ARG B 2 88  ? -8.058  -9.795  5.347   1.00 1.33  ? 88  ARG B N    2  
ATOM 10949  C CA   . ARG B 2 88  ? -7.776  -9.772  6.780   1.00 1.35  ? 88  ARG B CA   2  
ATOM 10950  C C    . ARG B 2 88  ? -8.656  -8.750  7.489   1.00 1.36  ? 88  ARG B C    2  
ATOM 10951  O O    . ARG B 2 88  ? -9.149  -8.993  8.591   1.00 1.46  ? 88  ARG B O    2  
ATOM 10952  C CB   . ARG B 2 88  ? -6.297  -9.445  7.029   1.00 1.35  ? 88  ARG B CB   2  
ATOM 10953  C CG   . ARG B 2 88  ? -5.841  -9.702  8.460   1.00 1.51  ? 88  ARG B CG   2  
ATOM 10954  C CD   . ARG B 2 88  ? -5.619  -8.406  9.230   1.00 1.53  ? 88  ARG B CD   2  
ATOM 10955  N NE   . ARG B 2 88  ? -6.854  -7.892  9.828   1.00 1.56  ? 88  ARG B NE   2  
ATOM 10956  C CZ   . ARG B 2 88  ? -6.921  -6.804  10.599  1.00 1.78  ? 88  ARG B CZ   2  
ATOM 10957  N NH1  . ARG B 2 88  ? -5.821  -6.113  10.877  1.00 2.14  ? 88  ARG B NH1  2  
ATOM 10958  N NH2  . ARG B 2 88  ? -8.086  -6.407  11.098  1.00 1.88  ? 88  ARG B NH2  2  
ATOM 10959  H H    . ARG B 2 88  ? -7.894  -8.992  4.812   1.00 1.32  ? 88  ARG B H    2  
ATOM 10960  H HA   . ARG B 2 88  ? -7.992  -10.753 7.176   1.00 1.43  ? 88  ARG B HA   2  
ATOM 10961  H HB2  . ARG B 2 88  ? -5.691  -10.050 6.371   1.00 1.42  ? 88  ARG B HB2  2  
ATOM 10962  H HB3  . ARG B 2 88  ? -6.128  -8.403  6.800   1.00 1.28  ? 88  ARG B HB3  2  
ATOM 10963  H HG2  . ARG B 2 88  ? -6.597  -10.282 8.967   1.00 1.63  ? 88  ARG B HG2  2  
ATOM 10964  H HG3  . ARG B 2 88  ? -4.917  -10.258 8.435   1.00 1.61  ? 88  ARG B HG3  2  
ATOM 10965  H HD2  . ARG B 2 88  ? -4.902  -8.590  10.017  1.00 1.71  ? 88  ARG B HD2  2  
ATOM 10966  H HD3  . ARG B 2 88  ? -5.223  -7.663  8.553   1.00 1.50  ? 88  ARG B HD3  2  
ATOM 10967  H HE   . ARG B 2 88  ? -7.686  -8.392  9.639   1.00 1.60  ? 88  ARG B HE   2  
ATOM 10968  H HH11 . ARG B 2 88  ? -4.935  -6.403  10.508  1.00 2.19  ? 88  ARG B HH11 2  
ATOM 10969  H HH12 . ARG B 2 88  ? -5.871  -5.303  11.463  1.00 2.47  ? 88  ARG B HH12 2  
ATOM 10970  H HH21 . ARG B 2 88  ? -8.929  -6.923  10.900  1.00 1.85  ? 88  ARG B HH21 2  
ATOM 10971  H HH22 . ARG B 2 88  ? -8.137  -5.592  11.680  1.00 2.13  ? 88  ARG B HH22 2  
ATOM 10972  N N    . LYS B 2 89  ? -8.821  -7.598  6.863   1.00 1.36  ? 89  LYS B N    2  
ATOM 10973  C CA   . LYS B 2 89  ? -9.634  -6.528  7.422   1.00 1.43  ? 89  LYS B CA   2  
ATOM 10974  C C    . LYS B 2 89  ? -11.079 -6.674  6.971   1.00 1.46  ? 89  LYS B C    2  
ATOM 10975  O O    . LYS B 2 89  ? -11.982 -6.759  7.800   1.00 1.51  ? 89  LYS B O    2  
ATOM 10976  C CB   . LYS B 2 89  ? -9.069  -5.156  7.002   1.00 1.49  ? 89  LYS B CB   2  
ATOM 10977  C CG   . LYS B 2 89  ? -10.129 -4.085  6.745   1.00 1.53  ? 89  LYS B CG   2  
ATOM 10978  C CD   . LYS B 2 89  ? -9.623  -3.014  5.786   1.00 1.72  ? 89  LYS B CD   2  
ATOM 10979  C CE   . LYS B 2 89  ? -10.743 -2.086  5.338   1.00 1.89  ? 89  LYS B CE   2  
ATOM 10980  N NZ   . LYS B 2 89  ? -11.543 -2.661  4.222   1.00 2.00  ? 89  LYS B NZ   2  
ATOM 10981  H H    . LYS B 2 89  ? -8.389  -7.463  5.992   1.00 1.38  ? 89  LYS B H    2  
ATOM 10982  H HA   . LYS B 2 89  ? -9.595  -6.610  8.497   1.00 1.47  ? 89  LYS B HA   2  
ATOM 10983  H HB2  . LYS B 2 89  ? -8.416  -4.798  7.784   1.00 1.57  ? 89  LYS B HB2  2  
ATOM 10984  H HB3  . LYS B 2 89  ? -8.491  -5.282  6.099   1.00 1.55  ? 89  LYS B HB3  2  
ATOM 10985  H HG2  . LYS B 2 89  ? -11.004 -4.552  6.316   1.00 1.53  ? 89  LYS B HG2  2  
ATOM 10986  H HG3  . LYS B 2 89  ? -10.392 -3.621  7.682   1.00 1.60  ? 89  LYS B HG3  2  
ATOM 10987  H HD2  . LYS B 2 89  ? -8.863  -2.427  6.282   1.00 1.88  ? 89  LYS B HD2  2  
ATOM 10988  H HD3  . LYS B 2 89  ? -9.198  -3.494  4.917   1.00 1.82  ? 89  LYS B HD3  2  
ATOM 10989  H HE2  . LYS B 2 89  ? -11.399 -1.905  6.178   1.00 2.14  ? 89  LYS B HE2  2  
ATOM 10990  H HE3  . LYS B 2 89  ? -10.309 -1.152  5.015   1.00 1.95  ? 89  LYS B HE3  2  
ATOM 10991  H HZ1  . LYS B 2 89  ? -12.210 -1.952  3.859   1.00 2.29  ? 89  LYS B HZ1  2  
ATOM 10992  H HZ2  . LYS B 2 89  ? -12.086 -3.488  4.552   1.00 2.28  ? 89  LYS B HZ2  2  
ATOM 10993  H HZ3  . LYS B 2 89  ? -10.917 -2.962  3.446   1.00 2.05  ? 89  LYS B HZ3  2  
ATOM 10994  N N    . LYS B 2 90  ? -11.276 -6.727  5.652   1.00 1.46  ? 90  LYS B N    2  
ATOM 10995  C CA   . LYS B 2 90  ? -12.606 -6.836  5.065   1.00 1.50  ? 90  LYS B CA   2  
ATOM 10996  C C    . LYS B 2 90  ? -13.510 -5.739  5.628   1.00 1.49  ? 90  LYS B C    2  
ATOM 10997  O O    . LYS B 2 90  ? -13.389 -4.573  5.246   1.00 1.61  ? 90  LYS B O    2  
ATOM 10998  C CB   . LYS B 2 90  ? -13.196 -8.234  5.302   1.00 1.59  ? 90  LYS B CB   2  
ATOM 10999  C CG   . LYS B 2 90  ? -14.415 -8.532  4.442   1.00 1.65  ? 90  LYS B CG   2  
ATOM 11000  C CD   . LYS B 2 90  ? -14.393 -9.957  3.914   1.00 1.73  ? 90  LYS B CD   2  
ATOM 11001  C CE   . LYS B 2 90  ? -14.555 -9.989  2.401   1.00 1.89  ? 90  LYS B CE   2  
ATOM 11002  N NZ   . LYS B 2 90  ? -13.481 -9.225  1.707   1.00 2.21  ? 90  LYS B NZ   2  
ATOM 11003  H H    . LYS B 2 90  ? -10.498 -6.693  5.060   1.00 1.44  ? 90  LYS B H    2  
ATOM 11004  H HA   . LYS B 2 90  ? -12.503 -6.677  4.002   1.00 1.51  ? 90  LYS B HA   2  
ATOM 11005  H HB2  . LYS B 2 90  ? -12.439 -8.971  5.084   1.00 1.69  ? 90  LYS B HB2  2  
ATOM 11006  H HB3  . LYS B 2 90  ? -13.481 -8.323  6.339   1.00 1.63  ? 90  LYS B HB3  2  
ATOM 11007  H HG2  . LYS B 2 90  ? -15.306 -8.393  5.036   1.00 1.81  ? 90  LYS B HG2  2  
ATOM 11008  H HG3  . LYS B 2 90  ? -14.427 -7.849  3.606   1.00 1.80  ? 90  LYS B HG3  2  
ATOM 11009  H HD2  . LYS B 2 90  ? -13.450 -10.414 4.176   1.00 1.94  ? 90  LYS B HD2  2  
ATOM 11010  H HD3  . LYS B 2 90  ? -15.202 -10.511 4.366   1.00 1.86  ? 90  LYS B HD3  2  
ATOM 11011  H HE2  . LYS B 2 90  ? -14.522 -11.015 2.069   1.00 2.06  ? 90  LYS B HE2  2  
ATOM 11012  H HE3  . LYS B 2 90  ? -15.512 -9.559  2.145   1.00 1.98  ? 90  LYS B HE3  2  
ATOM 11013  H HZ1  . LYS B 2 90  ? -12.548 -9.498  2.082   1.00 2.45  ? 90  LYS B HZ1  2  
ATOM 11014  H HZ2  . LYS B 2 90  ? -13.612 -8.197  1.853   1.00 2.29  ? 90  LYS B HZ2  2  
ATOM 11015  H HZ3  . LYS B 2 90  ? -13.503 -9.423  0.683   1.00 2.49  ? 90  LYS B HZ3  2  
ATOM 11016  N N    . LYS B 2 91  ? -14.391 -6.101  6.544   1.00 1.43  ? 91  LYS B N    2  
ATOM 11017  C CA   . LYS B 2 91  ? -15.279 -5.138  7.166   1.00 1.42  ? 91  LYS B CA   2  
ATOM 11018  C C    . LYS B 2 91  ? -15.193 -5.288  8.681   1.00 1.44  ? 91  LYS B C    2  
ATOM 11019  O O    . LYS B 2 91  ? -16.192 -5.556  9.355   1.00 1.50  ? 91  LYS B O    2  
ATOM 11020  C CB   . LYS B 2 91  ? -16.720 -5.310  6.665   1.00 1.48  ? 91  LYS B CB   2  
ATOM 11021  C CG   . LYS B 2 91  ? -16.972 -4.683  5.299   1.00 1.40  ? 91  LYS B CG   2  
ATOM 11022  C CD   . LYS B 2 91  ? -16.588 -5.621  4.164   1.00 1.77  ? 91  LYS B CD   2  
ATOM 11023  C CE   . LYS B 2 91  ? -16.380 -4.861  2.864   1.00 1.88  ? 91  LYS B CE   2  
ATOM 11024  N NZ   . LYS B 2 91  ? -15.069 -4.156  2.835   1.00 2.77  ? 91  LYS B NZ   2  
ATOM 11025  H H    . LYS B 2 91  ? -14.440 -7.042  6.821   1.00 1.44  ? 91  LYS B H    2  
ATOM 11026  H HA   . LYS B 2 91  ? -14.928 -4.152  6.899   1.00 1.39  ? 91  LYS B HA   2  
ATOM 11027  H HB2  . LYS B 2 91  ? -16.939 -6.366  6.597   1.00 1.71  ? 91  LYS B HB2  2  
ATOM 11028  H HB3  . LYS B 2 91  ? -17.392 -4.856  7.375   1.00 1.57  ? 91  LYS B HB3  2  
ATOM 11029  H HG2  . LYS B 2 91  ? -18.021 -4.447  5.210   1.00 1.59  ? 91  LYS B HG2  2  
ATOM 11030  H HG3  . LYS B 2 91  ? -16.390 -3.778  5.216   1.00 1.71  ? 91  LYS B HG3  2  
ATOM 11031  H HD2  . LYS B 2 91  ? -15.671 -6.127  4.425   1.00 2.20  ? 91  LYS B HD2  2  
ATOM 11032  H HD3  . LYS B 2 91  ? -17.376 -6.345  4.026   1.00 2.13  ? 91  LYS B HD3  2  
ATOM 11033  H HE2  . LYS B 2 91  ? -16.422 -5.560  2.041   1.00 2.08  ? 91  LYS B HE2  2  
ATOM 11034  H HE3  . LYS B 2 91  ? -17.170 -4.134  2.761   1.00 1.88  ? 91  LYS B HE3  2  
ATOM 11035  H HZ1  . LYS B 2 91  ? -14.929 -3.618  3.714   1.00 3.23  ? 91  LYS B HZ1  2  
ATOM 11036  H HZ2  . LYS B 2 91  ? -15.032 -3.497  2.035   1.00 3.21  ? 91  LYS B HZ2  2  
ATOM 11037  H HZ3  . LYS B 2 91  ? -14.287 -4.843  2.735   1.00 3.08  ? 91  LYS B HZ3  2  
ATOM 11038  N N    . ASP B 2 92  ? -13.967 -5.129  9.190   1.00 1.43  ? 92  ASP B N    2  
ATOM 11039  C CA   . ASP B 2 92  ? -13.672 -5.244  10.620  1.00 1.48  ? 92  ASP B CA   2  
ATOM 11040  C C    . ASP B 2 92  ? -14.385 -4.156  11.420  1.00 1.47  ? 92  ASP B C    2  
ATOM 11041  O O    . ASP B 2 92  ? -13.788 -3.157  11.827  1.00 1.50  ? 92  ASP B O    2  
ATOM 11042  C CB   . ASP B 2 92  ? -12.157 -5.177  10.854  1.00 1.52  ? 92  ASP B CB   2  
ATOM 11043  C CG   . ASP B 2 92  ? -11.722 -5.944  12.091  1.00 1.59  ? 92  ASP B CG   2  
ATOM 11044  O OD1  . ASP B 2 92  ? -12.362 -5.791  13.153  1.00 1.82  ? 92  ASP B OD1  2  
ATOM 11045  O OD2  . ASP B 2 92  ? -10.736 -6.707  12.010  1.00 2.01  ? 92  ASP B OD2  2  
ATOM 11046  H H    . ASP B 2 92  ? -13.229 -4.937  8.578   1.00 1.43  ? 92  ASP B H    2  
ATOM 11047  H HA   . ASP B 2 92  ? -14.032 -6.207  10.953  1.00 1.54  ? 92  ASP B HA   2  
ATOM 11048  H HB2  . ASP B 2 92  ? -11.649 -5.600  9.999   1.00 1.63  ? 92  ASP B HB2  2  
ATOM 11049  H HB3  . ASP B 2 92  ? -11.859 -4.145  10.968  1.00 1.57  ? 92  ASP B HB3  2  
ATOM 11050  N N    . LEU B 2 93  ? -15.672 -4.365  11.613  1.00 1.48  ? 93  LEU B N    2  
ATOM 11051  C CA   . LEU B 2 93  ? -16.523 -3.455  12.353  1.00 1.51  ? 93  LEU B CA   2  
ATOM 11052  C C    . LEU B 2 93  ? -17.764 -4.214  12.792  1.00 1.66  ? 93  LEU B C    2  
ATOM 11053  O O    . LEU B 2 93  ? -18.249 -4.052  13.911  1.00 1.78  ? 93  LEU B O    2  
ATOM 11054  C CB   . LEU B 2 93  ? -16.912 -2.257  11.479  1.00 1.43  ? 93  LEU B CB   2  
ATOM 11055  C CG   . LEU B 2 93  ? -17.590 -1.100  12.215  1.00 1.45  ? 93  LEU B CG   2  
ATOM 11056  C CD1  . LEU B 2 93  ? -16.587 -0.346  13.072  1.00 1.53  ? 93  LEU B CD1  2  
ATOM 11057  C CD2  . LEU B 2 93  ? -18.264 -0.159  11.227  1.00 1.48  ? 93  LEU B CD2  2  
ATOM 11058  H H    . LEU B 2 93  ? -16.073 -5.171  11.227  1.00 1.50  ? 93  LEU B H    2  
ATOM 11059  H HA   . LEU B 2 93  ? -15.982 -3.113  13.222  1.00 1.54  ? 93  LEU B HA   2  
ATOM 11060  H HB2  . LEU B 2 93  ? -16.017 -1.880  11.006  1.00 1.41  ? 93  LEU B HB2  2  
ATOM 11061  H HB3  . LEU B 2 93  ? -17.584 -2.607  10.711  1.00 1.45  ? 93  LEU B HB3  2  
ATOM 11062  H HG   . LEU B 2 93  ? -18.352 -1.499  12.870  1.00 1.48  ? 93  LEU B HG   2  
ATOM 11063  H HD11 . LEU B 2 93  ? -16.165 -1.018  13.804  1.00 1.67  ? 93  LEU B HD11 2  
ATOM 11064  H HD12 . LEU B 2 93  ? -17.085 0.469   13.577  1.00 1.67  ? 93  LEU B HD12 2  
ATOM 11065  H HD13 . LEU B 2 93  ? -15.800 0.044   12.446  1.00 1.59  ? 93  LEU B HD13 2  
ATOM 11066  H HD21 . LEU B 2 93  ? -19.029 -0.695  10.686  1.00 1.60  ? 93  LEU B HD21 2  
ATOM 11067  H HD22 . LEU B 2 93  ? -17.529 0.223   10.533  1.00 1.58  ? 93  LEU B HD22 2  
ATOM 11068  H HD23 . LEU B 2 93  ? -18.711 0.662   11.765  1.00 1.65  ? 93  LEU B HD23 2  
ATOM 11069  N N    . LYS B 2 94  ? -18.260 -5.058  11.894  1.00 1.71  ? 94  LYS B N    2  
ATOM 11070  C CA   . LYS B 2 94  ? -19.427 -5.883  12.169  1.00 1.90  ? 94  LYS B CA   2  
ATOM 11071  C C    . LYS B 2 94  ? -19.128 -7.339  11.818  1.00 1.98  ? 94  LYS B C    2  
ATOM 11072  O O    . LYS B 2 94  ? -19.141 -8.208  12.687  1.00 2.20  ? 94  LYS B O    2  
ATOM 11073  C CB   . LYS B 2 94  ? -20.643 -5.393  11.380  1.00 1.98  ? 94  LYS B CB   2  
ATOM 11074  C CG   . LYS B 2 94  ? -21.442 -4.306  12.084  1.00 1.96  ? 94  LYS B CG   2  
ATOM 11075  C CD   . LYS B 2 94  ? -22.208 -4.861  13.278  1.00 2.06  ? 94  LYS B CD   2  
ATOM 11076  C CE   . LYS B 2 94  ? -23.058 -3.790  13.947  1.00 1.96  ? 94  LYS B CE   2  
ATOM 11077  N NZ   . LYS B 2 94  ? -23.795 -4.319  15.127  1.00 2.17  ? 94  LYS B NZ   2  
ATOM 11078  H H    . LYS B 2 94  ? -17.830 -5.124  11.014  1.00 1.64  ? 94  LYS B H    2  
ATOM 11079  H HA   . LYS B 2 94  ? -19.639 -5.815  13.224  1.00 1.97  ? 94  LYS B HA   2  
ATOM 11080  H HB2  . LYS B 2 94  ? -20.307 -5.003  10.431  1.00 1.94  ? 94  LYS B HB2  2  
ATOM 11081  H HB3  . LYS B 2 94  ? -21.298 -6.232  11.201  1.00 2.15  ? 94  LYS B HB3  2  
ATOM 11082  H HG2  . LYS B 2 94  ? -20.764 -3.542  12.429  1.00 1.92  ? 94  LYS B HG2  2  
ATOM 11083  H HG3  . LYS B 2 94  ? -22.144 -3.880  11.382  1.00 2.05  ? 94  LYS B HG3  2  
ATOM 11084  H HD2  . LYS B 2 94  ? -22.853 -5.658  12.940  1.00 2.25  ? 94  LYS B HD2  2  
ATOM 11085  H HD3  . LYS B 2 94  ? -21.503 -5.248  13.997  1.00 2.21  ? 94  LYS B HD3  2  
ATOM 11086  H HE2  . LYS B 2 94  ? -22.412 -2.989  14.271  1.00 2.01  ? 94  LYS B HE2  2  
ATOM 11087  H HE3  . LYS B 2 94  ? -23.769 -3.411  13.226  1.00 1.96  ? 94  LYS B HE3  2  
ATOM 11088  H HZ1  . LYS B 2 94  ? -23.152 -4.867  15.737  1.00 2.40  ? 94  LYS B HZ1  2  
ATOM 11089  H HZ2  . LYS B 2 94  ? -24.569 -4.939  14.817  1.00 2.37  ? 94  LYS B HZ2  2  
ATOM 11090  H HZ3  . LYS B 2 94  ? -24.198 -3.536  15.681  1.00 2.37  ? 94  LYS B HZ3  2  
ATOM 11091  N N    . ILE B 2 95  ? -18.850 -7.597  10.544  1.00 1.91  ? 95  ILE B N    2  
ATOM 11092  C CA   . ILE B 2 95  ? -18.538 -8.945  10.086  1.00 2.00  ? 95  ILE B CA   2  
ATOM 11093  C C    . ILE B 2 95  ? -17.110 -9.009  9.551   1.00 1.68  ? 95  ILE B C    2  
ATOM 11094  O O    . ILE B 2 95  ? -16.762 -8.319  8.593   1.00 1.68  ? 95  ILE B O    2  
ATOM 11095  C CB   . ILE B 2 95  ? -19.521 -9.419  8.990   1.00 2.32  ? 95  ILE B CB   2  
ATOM 11096  C CG1  . ILE B 2 95  ? -20.927 -9.596  9.576   1.00 2.62  ? 95  ILE B CG1  2  
ATOM 11097  C CG2  . ILE B 2 95  ? -19.041 -10.719 8.359   1.00 2.65  ? 95  ILE B CG2  2  
ATOM 11098  C CD1  . ILE B 2 95  ? -21.976 -9.977  8.549   1.00 2.91  ? 95  ILE B CD1  2  
ATOM 11099  H H    . ILE B 2 95  ? -18.865 -6.864  9.890   1.00 1.87  ? 95  ILE B H    2  
ATOM 11100  H HA   . ILE B 2 95  ? -18.624 -9.612  10.931  1.00 2.20  ? 95  ILE B HA   2  
ATOM 11101  H HB   . ILE B 2 95  ? -19.554 -8.665  8.218   1.00 2.45  ? 95  ILE B HB   2  
ATOM 11102  H HG12 . ILE B 2 95  ? -20.901 -10.374 10.323  1.00 2.83  ? 95  ILE B HG12 2  
ATOM 11103  H HG13 . ILE B 2 95  ? -21.235 -8.671  10.038  1.00 2.85  ? 95  ILE B HG13 2  
ATOM 11104  H HG21 . ILE B 2 95  ? -18.992 -11.491 9.112   1.00 2.90  ? 95  ILE B HG21 2  
ATOM 11105  H HG22 . ILE B 2 95  ? -18.058 -10.570 7.934   1.00 2.81  ? 95  ILE B HG22 2  
ATOM 11106  H HG23 . ILE B 2 95  ? -19.727 -11.017 7.580   1.00 3.03  ? 95  ILE B HG23 2  
ATOM 11107  H HD11 . ILE B 2 95  ? -22.906 -10.200 9.052   1.00 3.11  ? 95  ILE B HD11 2  
ATOM 11108  H HD12 . ILE B 2 95  ? -21.645 -10.844 8.000   1.00 3.13  ? 95  ILE B HD12 2  
ATOM 11109  H HD13 . ILE B 2 95  ? -22.126 -9.153  7.866   1.00 3.22  ? 95  ILE B HD13 2  
ATOM 11110  N N    . ARG B 2 96  ? -16.293 -9.840  10.183  1.00 1.63  ? 96  ARG B N    2  
ATOM 11111  C CA   . ARG B 2 96  ? -14.899 -10.006 9.784   1.00 1.48  ? 96  ARG B CA   2  
ATOM 11112  C C    . ARG B 2 96  ? -14.714 -11.343 9.080   1.00 1.48  ? 96  ARG B C    2  
ATOM 11113  O O    . ARG B 2 96  ? -15.682 -11.928 8.588   1.00 1.89  ? 96  ARG B O    2  
ATOM 11114  C CB   . ARG B 2 96  ? -13.972 -9.941  11.005  1.00 1.65  ? 96  ARG B CB   2  
ATOM 11115  C CG   . ARG B 2 96  ? -14.501 -9.082  12.139  1.00 1.87  ? 96  ARG B CG   2  
ATOM 11116  C CD   . ARG B 2 96  ? -14.826 -9.918  13.368  1.00 2.36  ? 96  ARG B CD   2  
ATOM 11117  N NE   . ARG B 2 96  ? -16.066 -10.680 13.208  1.00 2.59  ? 96  ARG B NE   2  
ATOM 11118  C CZ   . ARG B 2 96  ? -17.188 -10.428 13.889  1.00 2.99  ? 96  ARG B CZ   2  
ATOM 11119  N NH1  . ARG B 2 96  ? -17.211 -9.468  14.810  1.00 3.38  ? 96  ARG B NH1  2  
ATOM 11120  N NH2  . ARG B 2 96  ? -18.283 -11.146 13.658  1.00 3.45  ? 96  ARG B NH2  2  
ATOM 11121  H H    . ARG B 2 96  ? -16.641 -10.369 10.927  1.00 1.85  ? 96  ARG B H    2  
ATOM 11122  H HA   . ARG B 2 96  ? -14.647 -9.209  9.102   1.00 1.50  ? 96  ARG B HA   2  
ATOM 11123  H HB2  . ARG B 2 96  ? -13.823 -10.943 11.380  1.00 1.93  ? 96  ARG B HB2  2  
ATOM 11124  H HB3  . ARG B 2 96  ? -13.018 -9.540  10.692  1.00 1.90  ? 96  ARG B HB3  2  
ATOM 11125  H HG2  . ARG B 2 96  ? -13.754 -8.346  12.402  1.00 2.16  ? 96  ARG B HG2  2  
ATOM 11126  H HG3  . ARG B 2 96  ? -15.398 -8.584  11.805  1.00 1.96  ? 96  ARG B HG3  2  
ATOM 11127  H HD2  . ARG B 2 96  ? -14.011 -10.604 13.546  1.00 2.64  ? 96  ARG B HD2  2  
ATOM 11128  H HD3  . ARG B 2 96  ? -14.927 -9.258  14.215  1.00 2.80  ? 96  ARG B HD3  2  
ATOM 11129  H HE   . ARG B 2 96  ? -16.063 -11.417 12.559  1.00 2.81  ? 96  ARG B HE   2  
ATOM 11130  H HH11 . ARG B 2 96  ? -16.388 -8.928  15.002  1.00 3.40  ? 96  ARG B HH11 2  
ATOM 11131  H HH12 . ARG B 2 96  ? -18.055 -9.278  15.317  1.00 3.92  ? 96  ARG B HH12 2  
ATOM 11132  H HH21 . ARG B 2 96  ? -18.272 -11.877 12.970  1.00 3.63  ? 96  ARG B HH21 2  
ATOM 11133  H HH22 . ARG B 2 96  ? -19.125 -10.963 14.172  1.00 3.86  ? 96  ARG B HH22 2  
ATOM 11134  N N    . LYS B 2 97  ? -13.467 -11.818 9.047   1.00 1.85  ? 97  LYS B N    2  
ATOM 11135  C CA   . LYS B 2 97  ? -13.120 -13.094 8.425   1.00 2.00  ? 97  LYS B CA   2  
ATOM 11136  C C    . LYS B 2 97  ? -13.338 -13.056 6.914   1.00 1.91  ? 97  LYS B C    2  
ATOM 11137  O O    . LYS B 2 97  ? -13.427 -11.986 6.314   1.00 2.47  ? 97  LYS B O    2  
ATOM 11138  C CB   . LYS B 2 97  ? -13.943 -14.233 9.036   1.00 2.51  ? 97  LYS B CB   2  
ATOM 11139  C CG   . LYS B 2 97  ? -13.522 -14.619 10.446  1.00 3.25  ? 97  LYS B CG   2  
ATOM 11140  C CD   . LYS B 2 97  ? -14.722 -14.729 11.376  1.00 3.73  ? 97  LYS B CD   2  
ATOM 11141  C CE   . LYS B 2 97  ? -15.743 -15.742 10.877  1.00 3.96  ? 97  LYS B CE   2  
ATOM 11142  N NZ   . LYS B 2 97  ? -15.243 -17.136 10.982  1.00 4.34  ? 97  LYS B NZ   2  
ATOM 11143  H H    . LYS B 2 97  ? -12.752 -11.284 9.449   1.00 2.40  ? 97  LYS B H    2  
ATOM 11144  H HA   . LYS B 2 97  ? -12.074 -13.281 8.615   1.00 2.43  ? 97  LYS B HA   2  
ATOM 11145  H HB2  . LYS B 2 97  ? -14.977 -13.930 9.064   1.00 2.72  ? 97  LYS B HB2  2  
ATOM 11146  H HB3  . LYS B 2 97  ? -13.850 -15.104 8.407   1.00 2.81  ? 97  LYS B HB3  2  
ATOM 11147  H HG2  . LYS B 2 97  ? -13.019 -15.573 10.412  1.00 3.50  ? 97  LYS B HG2  2  
ATOM 11148  H HG3  . LYS B 2 97  ? -12.848 -13.867 10.831  1.00 3.69  ? 97  LYS B HG3  2  
ATOM 11149  H HD2  . LYS B 2 97  ? -14.379 -15.034 12.353  1.00 4.16  ? 97  LYS B HD2  2  
ATOM 11150  H HD3  . LYS B 2 97  ? -15.194 -13.759 11.448  1.00 3.99  ? 97  LYS B HD3  2  
ATOM 11151  H HE2  . LYS B 2 97  ? -16.641 -15.647 11.466  1.00 4.23  ? 97  LYS B HE2  2  
ATOM 11152  H HE3  . LYS B 2 97  ? -15.967 -15.529 9.843   1.00 4.07  ? 97  LYS B HE3  2  
ATOM 11153  H HZ1  . LYS B 2 97  ? -16.006 -17.807 10.755  1.00 4.59  ? 97  LYS B HZ1  2  
ATOM 11154  H HZ2  . LYS B 2 97  ? -14.911 -17.326 11.947  1.00 4.57  ? 97  LYS B HZ2  2  
ATOM 11155  H HZ3  . LYS B 2 97  ? -14.458 -17.288 10.319  1.00 4.58  ? 97  LYS B HZ3  2  
ATOM 11156  N N    . LYS B 2 98  ? -13.407 -14.238 6.313   1.00 1.87  ? 98  LYS B N    2  
ATOM 11157  C CA   . LYS B 2 98  ? -13.615 -14.365 4.877   1.00 2.23  ? 98  LYS B CA   2  
ATOM 11158  C C    . LYS B 2 98  ? -14.651 -15.448 4.589   1.00 2.54  ? 98  LYS B C    2  
ATOM 11159  O O    . LYS B 2 98  ? -15.140 -16.111 5.513   1.00 2.77  ? 98  LYS B O    2  
ATOM 11160  C CB   . LYS B 2 98  ? -12.293 -14.676 4.161   1.00 2.56  ? 98  LYS B CB   2  
ATOM 11161  C CG   . LYS B 2 98  ? -11.220 -15.292 5.054   1.00 2.88  ? 98  LYS B CG   2  
ATOM 11162  C CD   . LYS B 2 98  ? -11.538 -16.730 5.410   1.00 3.33  ? 98  LYS B CD   2  
ATOM 11163  C CE   . LYS B 2 98  ? -10.530 -17.286 6.397   1.00 3.56  ? 98  LYS B CE   2  
ATOM 11164  N NZ   . LYS B 2 98  ? -10.896 -18.647 6.851   1.00 3.47  ? 98  LYS B NZ   2  
ATOM 11165  H H    . LYS B 2 98  ? -13.323 -15.052 6.851   1.00 2.06  ? 98  LYS B H    2  
ATOM 11166  H HA   . LYS B 2 98  ? -13.996 -13.419 4.517   1.00 2.67  ? 98  LYS B HA   2  
ATOM 11167  H HB2  . LYS B 2 98  ? -12.491 -15.364 3.354   1.00 2.88  ? 98  LYS B HB2  2  
ATOM 11168  H HB3  . LYS B 2 98  ? -11.901 -13.757 3.746   1.00 3.01  ? 98  LYS B HB3  2  
ATOM 11169  H HG2  . LYS B 2 98  ? -10.275 -15.270 4.531   1.00 3.25  ? 98  LYS B HG2  2  
ATOM 11170  H HG3  . LYS B 2 98  ? -11.143 -14.711 5.965   1.00 3.12  ? 98  LYS B HG3  2  
ATOM 11171  H HD2  . LYS B 2 98  ? -12.525 -16.777 5.846   1.00 3.85  ? 98  LYS B HD2  2  
ATOM 11172  H HD3  . LYS B 2 98  ? -11.511 -17.326 4.509   1.00 3.57  ? 98  LYS B HD3  2  
ATOM 11173  H HE2  . LYS B 2 98  ? -9.563  -17.326 5.922   1.00 3.98  ? 98  LYS B HE2  2  
ATOM 11174  H HE3  . LYS B 2 98  ? -10.483 -16.631 7.254   1.00 3.89  ? 98  LYS B HE3  2  
ATOM 11175  H HZ1  . LYS B 2 98  ? -11.519 -18.597 7.681   1.00 3.80  ? 98  LYS B HZ1  2  
ATOM 11176  H HZ2  . LYS B 2 98  ? -10.040 -19.181 7.106   1.00 3.50  ? 98  LYS B HZ2  2  
ATOM 11177  H HZ3  . LYS B 2 98  ? -11.393 -19.157 6.086   1.00 3.57  ? 98  LYS B HZ3  2  
ATOM 11178  N N    . MET C 2 1   ? -7.014  -15.579 11.042  1.00 1.94  ? 1   MET C N    2  
ATOM 11179  C CA   . MET C 2 1   ? -6.820  -16.773 11.859  1.00 1.87  ? 1   MET C CA   2  
ATOM 11180  C C    . MET C 2 1   ? -6.276  -17.922 11.017  1.00 1.90  ? 1   MET C C    2  
ATOM 11181  O O    . MET C 2 1   ? -5.259  -18.527 11.359  1.00 2.24  ? 1   MET C O    2  
ATOM 11182  C CB   . MET C 2 1   ? -8.144  -17.183 12.515  1.00 2.20  ? 1   MET C CB   2  
ATOM 11183  C CG   . MET C 2 1   ? -8.008  -17.682 13.949  1.00 2.38  ? 1   MET C CG   2  
ATOM 11184  S SD   . MET C 2 1   ? -7.166  -19.273 14.077  1.00 2.85  ? 1   MET C SD   2  
ATOM 11185  C CE   . MET C 2 1   ? -7.264  -19.553 15.847  1.00 3.33  ? 1   MET C CE   2  
ATOM 11186  H H1   . MET C 2 1   ? -6.248  -14.988 10.884  1.00 2.34  ? 1   MET C H1   2  
ATOM 11187  H HA   . MET C 2 1   ? -6.104  -16.533 12.631  1.00 2.02  ? 1   MET C HA   2  
ATOM 11188  H HB2  . MET C 2 1   ? -8.805  -16.330 12.519  1.00 2.48  ? 1   MET C HB2  2  
ATOM 11189  H HB3  . MET C 2 1   ? -8.591  -17.968 11.925  1.00 2.62  ? 1   MET C HB3  2  
ATOM 11190  H HG2  . MET C 2 1   ? -7.452  -16.953 14.518  1.00 2.53  ? 1   MET C HG2  2  
ATOM 11191  H HG3  . MET C 2 1   ? -8.997  -17.782 14.370  1.00 2.86  ? 1   MET C HG3  2  
ATOM 11192  H HE1  . MET C 2 1   ? -6.786  -20.492 16.090  1.00 3.54  ? 1   MET C HE1  2  
ATOM 11193  H HE2  . MET C 2 1   ? -8.299  -19.588 16.149  1.00 3.81  ? 1   MET C HE2  2  
ATOM 11194  H HE3  . MET C 2 1   ? -6.764  -18.749 16.367  1.00 3.56  ? 1   MET C HE3  2  
ATOM 11195  N N    . ALA C 2 2   ? -6.944  -18.206 9.910   1.00 1.83  ? 2   ALA C N    2  
ATOM 11196  C CA   . ALA C 2 2   ? -6.529  -19.278 9.015   1.00 1.93  ? 2   ALA C CA   2  
ATOM 11197  C C    . ALA C 2 2   ? -6.966  -18.973 7.588   1.00 1.86  ? 2   ALA C C    2  
ATOM 11198  O O    . ALA C 2 2   ? -7.818  -18.114 7.368   1.00 1.97  ? 2   ALA C O    2  
ATOM 11199  C CB   . ALA C 2 2   ? -7.100  -20.612 9.472   1.00 2.28  ? 2   ALA C CB   2  
ATOM 11200  H H    . ALA C 2 2   ? -7.732  -17.668 9.675   1.00 1.90  ? 2   ALA C H    2  
ATOM 11201  H HA   . ALA C 2 2   ? -5.447  -19.340 9.046   1.00 2.11  ? 2   ALA C HA   2  
ATOM 11202  H HB1  . ALA C 2 2   ? -8.174  -20.546 9.520   1.00 2.45  ? 2   ALA C HB1  2  
ATOM 11203  H HB2  . ALA C 2 2   ? -6.710  -20.858 10.450  1.00 2.46  ? 2   ALA C HB2  2  
ATOM 11204  H HB3  . ALA C 2 2   ? -6.818  -21.384 8.770   1.00 2.54  ? 2   ALA C HB3  2  
ATOM 11205  N N    . ALA C 2 3   ? -6.388  -19.679 6.623   1.00 1.94  ? 3   ALA C N    2  
ATOM 11206  C CA   . ALA C 2 3   ? -6.718  -19.469 5.219   1.00 2.05  ? 3   ALA C CA   2  
ATOM 11207  C C    . ALA C 2 3   ? -7.429  -20.684 4.627   1.00 2.00  ? 3   ALA C C    2  
ATOM 11208  O O    . ALA C 2 3   ? -7.464  -21.755 5.237   1.00 2.09  ? 3   ALA C O    2  
ATOM 11209  C CB   . ALA C 2 3   ? -5.462  -19.153 4.421   1.00 2.43  ? 3   ALA C CB   2  
ATOM 11210  H H    . ALA C 2 3   ? -5.732  -20.371 6.865   1.00 2.09  ? 3   ALA C H    2  
ATOM 11211  H HA   . ALA C 2 3   ? -7.380  -18.616 5.159   1.00 2.12  ? 3   ALA C HA   2  
ATOM 11212  H HB1  . ALA C 2 3   ? -5.737  -18.881 3.414   1.00 2.69  ? 3   ALA C HB1  2  
ATOM 11213  H HB2  . ALA C 2 3   ? -4.822  -20.023 4.395   1.00 2.56  ? 3   ALA C HB2  2  
ATOM 11214  H HB3  . ALA C 2 3   ? -4.938  -18.332 4.885   1.00 2.64  ? 3   ALA C HB3  2  
ATOM 11215  N N    . GLU C 2 4   ? -7.992  -20.507 3.438   1.00 1.99  ? 4   GLU C N    2  
ATOM 11216  C CA   . GLU C 2 4   ? -8.712  -21.569 2.743   1.00 1.98  ? 4   GLU C CA   2  
ATOM 11217  C C    . GLU C 2 4   ? -8.360  -21.543 1.258   1.00 1.96  ? 4   GLU C C    2  
ATOM 11218  O O    . GLU C 2 4   ? -7.944  -20.507 0.743   1.00 1.96  ? 4   GLU C O    2  
ATOM 11219  C CB   . GLU C 2 4   ? -10.224 -21.384 2.917   1.00 1.98  ? 4   GLU C CB   2  
ATOM 11220  C CG   . GLU C 2 4   ? -10.744 -21.723 4.308   1.00 2.08  ? 4   GLU C CG   2  
ATOM 11221  C CD   . GLU C 2 4   ? -12.095 -21.100 4.596   1.00 2.25  ? 4   GLU C CD   2  
ATOM 11222  O OE1  . GLU C 2 4   ? -12.147 -19.886 4.885   1.00 2.75  ? 4   GLU C OE1  2  
ATOM 11223  O OE2  . GLU C 2 4   ? -13.116 -21.821 4.553   1.00 2.55  ? 4   GLU C OE2  2  
ATOM 11224  H H    . GLU C 2 4   ? -7.913  -19.635 3.000   1.00 2.10  ? 4   GLU C H    2  
ATOM 11225  H HA   . GLU C 2 4   ? -8.413  -22.517 3.165   1.00 2.04  ? 4   GLU C HA   2  
ATOM 11226  H HB2  . GLU C 2 4   ? -10.469 -20.352 2.709   1.00 2.10  ? 4   GLU C HB2  2  
ATOM 11227  H HB3  . GLU C 2 4   ? -10.737 -22.011 2.203   1.00 2.03  ? 4   GLU C HB3  2  
ATOM 11228  H HG2  . GLU C 2 4   ? -10.836 -22.795 4.393   1.00 2.23  ? 4   GLU C HG2  2  
ATOM 11229  H HG3  . GLU C 2 4   ? -10.037 -21.363 5.040   1.00 2.34  ? 4   GLU C HG3  2  
ATOM 11230  N N    . PRO C 2 5   ? -8.484  -22.684 0.562   1.00 2.00  ? 5   PRO C N    2  
ATOM 11231  C CA   . PRO C 2 5   ? -8.199  -22.766 -0.875  1.00 2.01  ? 5   PRO C CA   2  
ATOM 11232  C C    . PRO C 2 5   ? -9.101  -21.835 -1.683  1.00 1.93  ? 5   PRO C C    2  
ATOM 11233  O O    . PRO C 2 5   ? -10.327 -21.973 -1.669  1.00 1.95  ? 5   PRO C O    2  
ATOM 11234  C CB   . PRO C 2 5   ? -8.486  -24.228 -1.224  1.00 2.13  ? 5   PRO C CB   2  
ATOM 11235  C CG   . PRO C 2 5   ? -9.317  -24.748 -0.097  1.00 2.22  ? 5   PRO C CG   2  
ATOM 11236  C CD   . PRO C 2 5   ? -8.888  -23.984 1.118   1.00 2.09  ? 5   PRO C CD   2  
ATOM 11237  H HA   . PRO C 2 5   ? -7.164  -22.536 -1.086  1.00 2.03  ? 5   PRO C HA   2  
ATOM 11238  H HB2  . PRO C 2 5   ? -9.019  -24.277 -2.163  1.00 2.13  ? 5   PRO C HB2  2  
ATOM 11239  H HB3  . PRO C 2 5   ? -7.552  -24.766 -1.308  1.00 2.23  ? 5   PRO C HB3  2  
ATOM 11240  H HG2  . PRO C 2 5   ? -10.363 -24.573 -0.299  1.00 2.39  ? 5   PRO C HG2  2  
ATOM 11241  H HG3  . PRO C 2 5   ? -9.131  -25.802 0.041   1.00 2.34  ? 5   PRO C HG3  2  
ATOM 11242  H HD2  . PRO C 2 5   ? -9.714  -23.874 1.806   1.00 2.16  ? 5   PRO C HD2  2  
ATOM 11243  H HD3  . PRO C 2 5   ? -8.056  -24.475 1.601   1.00 2.11  ? 5   PRO C HD3  2  
ATOM 11244  N N    . LEU C 2 6   ? -8.491  -20.897 -2.395  1.00 1.90  ? 6   LEU C N    2  
ATOM 11245  C CA   . LEU C 2 6   ? -9.244  -19.926 -3.169  1.00 1.86  ? 6   LEU C CA   2  
ATOM 11246  C C    . LEU C 2 6   ? -8.772  -19.882 -4.622  1.00 1.88  ? 6   LEU C C    2  
ATOM 11247  O O    . LEU C 2 6   ? -8.120  -20.813 -5.099  1.00 1.94  ? 6   LEU C O    2  
ATOM 11248  C CB   . LEU C 2 6   ? -9.112  -18.547 -2.519  1.00 1.83  ? 6   LEU C CB   2  
ATOM 11249  C CG   . LEU C 2 6   ? -9.435  -18.493 -1.023  1.00 1.85  ? 6   LEU C CG   2  
ATOM 11250  C CD1  . LEU C 2 6   ? -9.097  -17.128 -0.448  1.00 1.95  ? 6   LEU C CD1  2  
ATOM 11251  C CD2  . LEU C 2 6   ? -10.896 -18.822 -0.781  1.00 2.03  ? 6   LEU C CD2  2  
ATOM 11252  H H    . LEU C 2 6   ? -7.514  -20.869 -2.412  1.00 1.93  ? 6   LEU C H    2  
ATOM 11253  H HA   . LEU C 2 6   ? -10.279 -20.224 -3.151  1.00 1.91  ? 6   LEU C HA   2  
ATOM 11254  H HB2  . LEU C 2 6   ? -8.096  -18.204 -2.658  1.00 1.85  ? 6   LEU C HB2  2  
ATOM 11255  H HB3  . LEU C 2 6   ? -9.777  -17.866 -3.032  1.00 1.86  ? 6   LEU C HB3  2  
ATOM 11256  H HG   . LEU C 2 6   ? -8.836  -19.231 -0.505  1.00 1.86  ? 6   LEU C HG   2  
ATOM 11257  H HD11 . LEU C 2 6   ? -8.031  -16.963 -0.512  1.00 2.07  ? 6   LEU C HD11 2  
ATOM 11258  H HD12 . LEU C 2 6   ? -9.406  -17.086 0.585   1.00 2.19  ? 6   LEU C HD12 2  
ATOM 11259  H HD13 . LEU C 2 6   ? -9.612  -16.364 -1.010  1.00 2.08  ? 6   LEU C HD13 2  
ATOM 11260  H HD21 . LEU C 2 6   ? -11.515 -18.162 -1.371  1.00 2.36  ? 6   LEU C HD21 2  
ATOM 11261  H HD22 . LEU C 2 6   ? -11.125 -18.690 0.266   1.00 2.21  ? 6   LEU C HD22 2  
ATOM 11262  H HD23 . LEU C 2 6   ? -11.087 -19.846 -1.067  1.00 2.25  ? 6   LEU C HD23 2  
ATOM 11263  N N    . THR C 2 7   ? -9.110  -18.804 -5.325  1.00 1.83  ? 7   THR C N    2  
ATOM 11264  C CA   . THR C 2 7   ? -8.720  -18.653 -6.720  1.00 1.85  ? 7   THR C CA   2  
ATOM 11265  C C    . THR C 2 7   ? -7.241  -18.274 -6.832  1.00 1.85  ? 7   THR C C    2  
ATOM 11266  O O    . THR C 2 7   ? -6.601  -17.946 -5.832  1.00 1.82  ? 7   THR C O    2  
ATOM 11267  C CB   . THR C 2 7   ? -9.595  -17.604 -7.449  1.00 1.82  ? 7   THR C CB   2  
ATOM 11268  O OG1  . THR C 2 7   ? -9.416  -17.707 -8.867  1.00 1.88  ? 7   THR C OG1  2  
ATOM 11269  C CG2  . THR C 2 7   ? -9.247  -16.193 -7.012  1.00 1.75  ? 7   THR C CG2  2  
ATOM 11270  H H    . THR C 2 7   ? -9.625  -18.087 -4.888  1.00 1.79