data_2KBO
# 
_entry.id   2KBO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KBO         
RCSB  RCSB100920   
WWPDB D_1000100920 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2JYW PDB . 
unspecified 3E1U PDB . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KBO 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-04 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Furukawa, A.'  1  
'Nagata, T.'    2  
'Matsugami, A.' 3  
'Habu, Y.'      4  
'Sugiyama, R.'  5  
'Hayashi, F.'   6  
'Kobayashi, N.' 7  
'Yokoyama, S.'  8  
'Takaku, H.'    9  
'Katahira, M.'  10 
# 
_citation.id                        primary 
_citation.title                     
'Structure, interaction and real-time monitoring of the enzymatic reaction of wild-type APOBEC3G' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            28 
_citation.page_first                440 
_citation.page_last                 451 
_citation.year                      2009 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19153609 
_citation.pdbx_database_id_DOI      10.1038/emboj.2008.290 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Furukawa, A.'  1  
primary 'Nagata, T.'    2  
primary 'Matsugami, A.' 3  
primary 'Habu, Y.'      4  
primary 'Sugiyama, R.'  5  
primary 'Hayashi, F.'   6  
primary 'Kobayashi, N.' 7  
primary 'Yokoyama, S.'  8  
primary 'Takaku, H.'    9  
primary 'Katahira, M.'  10 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA dC->dU-editing enzyme APOBEC-3G' 22926.904 1 3.5.4.- ? 'UNP residues 193-384' ? 
2 non-polymer syn 'ZINC ION'                            65.409    1 ?       ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'APOBEC-related cytidine deaminase, ARCD, APOBEC-related protein, ARP-9, CEM-15, CEM15' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HMLRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWK
LDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTF
VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HMLRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWK
LDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTF
VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   MET n 
1 3   LEU n 
1 4   ARG n 
1 5   HIS n 
1 6   SER n 
1 7   MET n 
1 8   ASP n 
1 9   PRO n 
1 10  PRO n 
1 11  THR n 
1 12  PHE n 
1 13  THR n 
1 14  PHE n 
1 15  ASN n 
1 16  PHE n 
1 17  ASN n 
1 18  ASN n 
1 19  GLU n 
1 20  PRO n 
1 21  TRP n 
1 22  VAL n 
1 23  ARG n 
1 24  GLY n 
1 25  ARG n 
1 26  HIS n 
1 27  GLU n 
1 28  THR n 
1 29  TYR n 
1 30  LEU n 
1 31  CYS n 
1 32  TYR n 
1 33  GLU n 
1 34  VAL n 
1 35  GLU n 
1 36  ARG n 
1 37  MET n 
1 38  HIS n 
1 39  ASN n 
1 40  ASP n 
1 41  THR n 
1 42  TRP n 
1 43  VAL n 
1 44  LEU n 
1 45  LEU n 
1 46  ASN n 
1 47  GLN n 
1 48  ARG n 
1 49  ARG n 
1 50  GLY n 
1 51  PHE n 
1 52  LEU n 
1 53  CYS n 
1 54  ASN n 
1 55  GLN n 
1 56  ALA n 
1 57  PRO n 
1 58  HIS n 
1 59  LYS n 
1 60  HIS n 
1 61  GLY n 
1 62  PHE n 
1 63  LEU n 
1 64  GLU n 
1 65  GLY n 
1 66  ARG n 
1 67  HIS n 
1 68  ALA n 
1 69  GLU n 
1 70  LEU n 
1 71  CYS n 
1 72  PHE n 
1 73  LEU n 
1 74  ASP n 
1 75  VAL n 
1 76  ILE n 
1 77  PRO n 
1 78  PHE n 
1 79  TRP n 
1 80  LYS n 
1 81  LEU n 
1 82  ASP n 
1 83  LEU n 
1 84  ASP n 
1 85  GLN n 
1 86  ASP n 
1 87  TYR n 
1 88  ARG n 
1 89  VAL n 
1 90  THR n 
1 91  CYS n 
1 92  PHE n 
1 93  THR n 
1 94  SER n 
1 95  TRP n 
1 96  SER n 
1 97  PRO n 
1 98  CYS n 
1 99  PHE n 
1 100 SER n 
1 101 CYS n 
1 102 ALA n 
1 103 GLN n 
1 104 GLU n 
1 105 MET n 
1 106 ALA n 
1 107 LYS n 
1 108 PHE n 
1 109 ILE n 
1 110 SER n 
1 111 LYS n 
1 112 ASN n 
1 113 LYS n 
1 114 HIS n 
1 115 VAL n 
1 116 SER n 
1 117 LEU n 
1 118 CYS n 
1 119 ILE n 
1 120 PHE n 
1 121 THR n 
1 122 ALA n 
1 123 ARG n 
1 124 ILE n 
1 125 TYR n 
1 126 ASP n 
1 127 ASP n 
1 128 GLN n 
1 129 GLY n 
1 130 ARG n 
1 131 CYS n 
1 132 GLN n 
1 133 GLU n 
1 134 GLY n 
1 135 LEU n 
1 136 ARG n 
1 137 THR n 
1 138 LEU n 
1 139 ALA n 
1 140 GLU n 
1 141 ALA n 
1 142 GLY n 
1 143 ALA n 
1 144 LYS n 
1 145 ILE n 
1 146 SER n 
1 147 ILE n 
1 148 MET n 
1 149 THR n 
1 150 TYR n 
1 151 SER n 
1 152 GLU n 
1 153 PHE n 
1 154 LYS n 
1 155 HIS n 
1 156 CYS n 
1 157 TRP n 
1 158 ASP n 
1 159 THR n 
1 160 PHE n 
1 161 VAL n 
1 162 ASP n 
1 163 HIS n 
1 164 GLN n 
1 165 GLY n 
1 166 CYS n 
1 167 PRO n 
1 168 PHE n 
1 169 GLN n 
1 170 PRO n 
1 171 TRP n 
1 172 ASP n 
1 173 GLY n 
1 174 LEU n 
1 175 ASP n 
1 176 GLU n 
1 177 HIS n 
1 178 SER n 
1 179 GLN n 
1 180 ASP n 
1 181 LEU n 
1 182 SER n 
1 183 GLY n 
1 184 ARG n 
1 185 LEU n 
1 186 ARG n 
1 187 ALA n 
1 188 ILE n 
1 189 LEU n 
1 190 GLN n 
1 191 ASN n 
1 192 GLN n 
1 193 GLU n 
1 194 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 MDS019 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               'pET15(b)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ABC3G_HUMAN 
_struct_ref.pdbx_db_accession          Q9HC16 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLD
LDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVD
HQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN
;
_struct_ref.pdbx_align_begin           193 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KBO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 194 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9HC16 
_struct_ref_seq.db_align_beg                  193 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  384 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       194 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KBO HIS A 1 ? UNP Q9HC16 ? ? 'EXPRESSION TAG' 1 1 
1 2KBO MET A 2 ? UNP Q9HC16 ? ? 'EXPRESSION TAG' 2 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '3D 1H-15N NOESY' 
1 2  1 '3D 1H-13C NOESY' 
1 3  1 '2D 1H-15N HSQC'  
1 4  1 '2D 1H-13C HSQC'  
1 5  1 '3D CBCA(CO)NH'   
1 6  1 '3D C(CO)NH'      
1 7  1 '3D HNCO'         
1 8  1 '3D HNCA'         
1 9  1 '3D HNCACB'       
1 10 1 '3D HN(CO)CA'     
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      30 
_pdbx_nmr_exptl_sample_conditions.pH                  7.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '0.3mM [U-100% 13C; U-100% 15N] APOBEC3G-1, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker DRX 1 'Bruker DRX' 
600 Bruker DRX 2 'Bruker DRX' 
# 
_pdbx_nmr_refine.entry_id           2KBO 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KBO 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KBO 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe    97.027.12.56 1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis'             NMRDraw    2.4          2 
'Bruker Biospin'                                    collection                  xwinnmr    3.5          3 
'Naohiro Kobayashi'                                 'data analysis'             Kujira     0.9820       4 
'Naohiro Kobayashi'                                 'chemical shift assignment' Kujira     0.9820       5 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution'        X-PLOR_NIH 2.20         6 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  X-PLOR_NIH 2.20         7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KBO 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KBO 
_struct.title                     
'Structure, interaction, and real-time monitoring of the enzymatic reaction of wild type APOBEC3G' 
_struct.pdbx_descriptor           'DNA dC->dU-editing enzyme APOBEC-3G (E.C.3.5.4.-)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KBO 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;Cytidine deaminase, HIV, APOBEC3G, Alternative splicing, Antiviral defense, Cytoplasm, Host-virus interaction, Hydrolase, Metal-binding, Nucleus, Polymorphism, Ubl conjugation, Zinc
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 8   ? ASN A 15  ? ASP A 8   ASN A 15  1 ? 8  
HELX_P HELX_P2 2 HIS A 67  ? LYS A 80  ? HIS A 67  LYS A 80  1 ? 14 
HELX_P HELX_P3 3 CYS A 98  ? LYS A 111 ? CYS A 98  LYS A 111 1 ? 14 
HELX_P HELX_P4 4 GLY A 129 ? CYS A 131 ? GLY A 129 CYS A 131 5 ? 3  
HELX_P HELX_P5 5 GLN A 132 ? GLY A 142 ? GLN A 132 GLY A 142 1 ? 11 
HELX_P HELX_P6 6 THR A 149 ? VAL A 161 ? THR A 149 VAL A 161 1 ? 13 
HELX_P HELX_P7 7 GLY A 173 ? GLN A 190 ? GLY A 173 GLN A 190 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 67  ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 67  A ZN 250 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc2 metalc ? ? A CYS 98  SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 98  A ZN 250 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc3 metalc ? ? A CYS 101 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 101 A ZN 250 1_555 ? ? ? ? ? ? ? 2.291 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 41  ? TRP A 42  ? THR A 41  TRP A 42  
A 2 CYS A 31  ? HIS A 38  ? CYS A 31  HIS A 38  
A 3 ASP A 86  ? PHE A 92  ? ASP A 86  PHE A 92  
A 4 VAL A 115 ? THR A 121 ? VAL A 115 THR A 121 
A 5 ALA A 143 ? ILE A 147 ? ALA A 143 ILE A 147 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 41  ? O THR A 41  N HIS A 38  ? N HIS A 38  
A 2 3 N GLU A 33  ? N GLU A 33  O THR A 90  ? O THR A 90  
A 3 4 N CYS A 91  ? N CYS A 91  O PHE A 120 ? O PHE A 120 
A 4 5 N LEU A 117 ? N LEU A 117 O LYS A 144 ? O LYS A 144 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 250' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 ARG A 23 ? ARG A 23 . ? 1_555 ? 
2 AC1 3 GLY A 65 ? GLY A 65 . ? 1_555 ? 
3 AC1 3 TRP A 95 ? TRP A 95 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2KBO 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . HIS A 1 1   ? 22.155  -25.913 -1.125  1.00 0.00 ? 1   HIS A N    1  
ATOM   2     C  CA   . HIS A 1 1   ? 21.881  -25.528 0.289   1.00 0.00 ? 1   HIS A CA   1  
ATOM   3     C  C    . HIS A 1 1   ? 21.707  -24.015 0.372   1.00 0.00 ? 1   HIS A C    1  
ATOM   4     O  O    . HIS A 1 1   ? 22.677  -23.276 0.534   1.00 0.00 ? 1   HIS A O    1  
ATOM   5     C  CB   . HIS A 1 1   ? 23.051  -25.972 1.174   1.00 0.00 ? 1   HIS A CB   1  
ATOM   6     C  CG   . HIS A 1 1   ? 22.559  -26.236 2.572   1.00 0.00 ? 1   HIS A CG   1  
ATOM   7     N  ND1  . HIS A 1 1   ? 22.166  -27.499 2.990   1.00 0.00 ? 1   HIS A ND1  1  
ATOM   8     C  CD2  . HIS A 1 1   ? 22.387  -25.412 3.656   1.00 0.00 ? 1   HIS A CD2  1  
ATOM   9     C  CE1  . HIS A 1 1   ? 21.781  -27.398 4.276   1.00 0.00 ? 1   HIS A CE1  1  
ATOM   10    N  NE2  . HIS A 1 1   ? 21.897  -26.147 4.731   1.00 0.00 ? 1   HIS A NE2  1  
ATOM   11    H  H1   . HIS A 1 1   ? 22.074  -25.075 -1.735  1.00 0.00 ? 1   HIS A H1   1  
ATOM   12    H  H2   . HIS A 1 1   ? 21.466  -26.632 -1.428  1.00 0.00 ? 1   HIS A H2   1  
ATOM   13    H  H3   . HIS A 1 1   ? 23.117  -26.300 -1.199  1.00 0.00 ? 1   HIS A H3   1  
ATOM   14    H  HA   . HIS A 1 1   ? 20.973  -26.012 0.620   1.00 0.00 ? 1   HIS A HA   1  
ATOM   15    H  HB2  . HIS A 1 1   ? 23.484  -26.875 0.769   1.00 0.00 ? 1   HIS A HB2  1  
ATOM   16    H  HB3  . HIS A 1 1   ? 23.800  -25.194 1.199   1.00 0.00 ? 1   HIS A HB3  1  
ATOM   17    H  HD1  . HIS A 1 1   ? 22.169  -28.315 2.449   1.00 0.00 ? 1   HIS A HD1  1  
ATOM   18    H  HD2  . HIS A 1 1   ? 22.601  -24.353 3.672   1.00 0.00 ? 1   HIS A HD2  1  
ATOM   19    H  HE1  . HIS A 1 1   ? 21.424  -28.227 4.867   1.00 0.00 ? 1   HIS A HE1  1  
ATOM   20    H  HE2  . HIS A 1 1   ? 21.682  -25.819 5.629   1.00 0.00 ? 1   HIS A HE2  1  
ATOM   21    N  N    . MET A 1 2   ? 20.464  -23.564 0.254   1.00 0.00 ? 2   MET A N    1  
ATOM   22    C  CA   . MET A 1 2   ? 20.171  -22.139 0.312   1.00 0.00 ? 2   MET A CA   1  
ATOM   23    C  C    . MET A 1 2   ? 20.742  -21.517 1.582   1.00 0.00 ? 2   MET A C    1  
ATOM   24    O  O    . MET A 1 2   ? 20.981  -22.207 2.573   1.00 0.00 ? 2   MET A O    1  
ATOM   25    C  CB   . MET A 1 2   ? 18.655  -21.910 0.256   1.00 0.00 ? 2   MET A CB   1  
ATOM   26    C  CG   . MET A 1 2   ? 17.995  -22.417 1.544   1.00 0.00 ? 2   MET A CG   1  
ATOM   27    S  SD   . MET A 1 2   ? 18.337  -24.182 1.753   1.00 0.00 ? 2   MET A SD   1  
ATOM   28    C  CE   . MET A 1 2   ? 18.161  -24.235 3.553   1.00 0.00 ? 2   MET A CE   1  
ATOM   29    H  H    . MET A 1 2   ? 19.731  -24.201 0.123   1.00 0.00 ? 2   MET A H    1  
ATOM   30    H  HA   . MET A 1 2   ? 20.624  -21.658 -0.541  1.00 0.00 ? 2   MET A HA   1  
ATOM   31    H  HB2  . MET A 1 2   ? 18.458  -20.853 0.145   1.00 0.00 ? 2   MET A HB2  1  
ATOM   32    H  HB3  . MET A 1 2   ? 18.244  -22.442 -0.589  1.00 0.00 ? 2   MET A HB3  1  
ATOM   33    H  HG2  . MET A 1 2   ? 18.382  -21.873 2.391   1.00 0.00 ? 2   MET A HG2  1  
ATOM   34    H  HG3  . MET A 1 2   ? 16.927  -22.265 1.481   1.00 0.00 ? 2   MET A HG3  1  
ATOM   35    H  HE1  . MET A 1 2   ? 18.832  -23.514 4.001   1.00 0.00 ? 2   MET A HE1  1  
ATOM   36    H  HE2  . MET A 1 2   ? 18.401  -25.228 3.909   1.00 0.00 ? 2   MET A HE2  1  
ATOM   37    H  HE3  . MET A 1 2   ? 17.146  -23.995 3.824   1.00 0.00 ? 2   MET A HE3  1  
ATOM   38    N  N    . LEU A 1 3   ? 20.951  -20.206 1.543   1.00 0.00 ? 3   LEU A N    1  
ATOM   39    C  CA   . LEU A 1 3   ? 21.490  -19.490 2.692   1.00 0.00 ? 3   LEU A CA   1  
ATOM   40    C  C    . LEU A 1 3   ? 20.355  -19.010 3.592   1.00 0.00 ? 3   LEU A C    1  
ATOM   41    O  O    . LEU A 1 3   ? 19.800  -19.781 4.375   1.00 0.00 ? 3   LEU A O    1  
ATOM   42    C  CB   . LEU A 1 3   ? 22.315  -18.289 2.219   1.00 0.00 ? 3   LEU A CB   1  
ATOM   43    C  CG   . LEU A 1 3   ? 23.744  -18.735 1.886   1.00 0.00 ? 3   LEU A CG   1  
ATOM   44    C  CD1  . LEU A 1 3   ? 24.476  -19.165 3.167   1.00 0.00 ? 3   LEU A CD1  1  
ATOM   45    C  CD2  . LEU A 1 3   ? 23.698  -19.907 0.899   1.00 0.00 ? 3   LEU A CD2  1  
ATOM   46    H  H    . LEU A 1 3   ? 20.737  -19.710 0.725   1.00 0.00 ? 3   LEU A H    1  
ATOM   47    H  HA   . LEU A 1 3   ? 22.127  -20.155 3.255   1.00 0.00 ? 3   LEU A HA   1  
ATOM   48    H  HB2  . LEU A 1 3   ? 21.857  -17.865 1.335   1.00 0.00 ? 3   LEU A HB2  1  
ATOM   49    H  HB3  . LEU A 1 3   ? 22.345  -17.543 2.999   1.00 0.00 ? 3   LEU A HB3  1  
ATOM   50    H  HG   . LEU A 1 3   ? 24.275  -17.910 1.436   1.00 0.00 ? 3   LEU A HG   1  
ATOM   51    H  HD11 . LEU A 1 3   ? 24.035  -18.672 4.022   1.00 0.00 ? 3   LEU A HD11 1  
ATOM   52    H  HD12 . LEU A 1 3   ? 25.517  -18.886 3.093   1.00 0.00 ? 3   LEU A HD12 1  
ATOM   53    H  HD13 . LEU A 1 3   ? 24.400  -20.235 3.291   1.00 0.00 ? 3   LEU A HD13 1  
ATOM   54    H  HD21 . LEU A 1 3   ? 23.278  -20.774 1.387   1.00 0.00 ? 3   LEU A HD21 1  
ATOM   55    H  HD22 . LEU A 1 3   ? 24.699  -20.134 0.564   1.00 0.00 ? 3   LEU A HD22 1  
ATOM   56    H  HD23 . LEU A 1 3   ? 23.086  -19.640 0.050   1.00 0.00 ? 3   LEU A HD23 1  
ATOM   57    N  N    . ARG A 1 4   ? 20.011  -17.731 3.469   1.00 0.00 ? 4   ARG A N    1  
ATOM   58    C  CA   . ARG A 1 4   ? 18.936  -17.149 4.268   1.00 0.00 ? 4   ARG A CA   1  
ATOM   59    C  C    . ARG A 1 4   ? 17.818  -16.652 3.359   1.00 0.00 ? 4   ARG A C    1  
ATOM   60    O  O    . ARG A 1 4   ? 18.060  -16.283 2.210   1.00 0.00 ? 4   ARG A O    1  
ATOM   61    C  CB   . ARG A 1 4   ? 19.474  -15.987 5.105   1.00 0.00 ? 4   ARG A CB   1  
ATOM   62    C  CG   . ARG A 1 4   ? 19.983  -14.880 4.179   1.00 0.00 ? 4   ARG A CG   1  
ATOM   63    C  CD   . ARG A 1 4   ? 20.787  -13.859 4.990   1.00 0.00 ? 4   ARG A CD   1  
ATOM   64    N  NE   . ARG A 1 4   ? 20.701  -12.543 4.368   1.00 0.00 ? 4   ARG A NE   1  
ATOM   65    C  CZ   . ARG A 1 4   ? 19.664  -11.743 4.598   1.00 0.00 ? 4   ARG A CZ   1  
ATOM   66    N  NH1  . ARG A 1 4   ? 18.698  -12.136 5.383   1.00 0.00 ? 4   ARG A NH1  1  
ATOM   67    N  NH2  . ARG A 1 4   ? 19.611  -10.568 4.035   1.00 0.00 ? 4   ARG A NH2  1  
ATOM   68    H  H    . ARG A 1 4   ? 20.487  -17.167 2.824   1.00 0.00 ? 4   ARG A H    1  
ATOM   69    H  HA   . ARG A 1 4   ? 18.536  -17.903 4.933   1.00 0.00 ? 4   ARG A HA   1  
ATOM   70    H  HB2  . ARG A 1 4   ? 18.684  -15.598 5.731   1.00 0.00 ? 4   ARG A HB2  1  
ATOM   71    H  HB3  . ARG A 1 4   ? 20.286  -16.336 5.725   1.00 0.00 ? 4   ARG A HB3  1  
ATOM   72    H  HG2  . ARG A 1 4   ? 20.614  -15.312 3.415   1.00 0.00 ? 4   ARG A HG2  1  
ATOM   73    H  HG3  . ARG A 1 4   ? 19.143  -14.386 3.714   1.00 0.00 ? 4   ARG A HG3  1  
ATOM   74    H  HD2  . ARG A 1 4   ? 20.391  -13.804 5.992   1.00 0.00 ? 4   ARG A HD2  1  
ATOM   75    H  HD3  . ARG A 1 4   ? 21.821  -14.171 5.030   1.00 0.00 ? 4   ARG A HD3  1  
ATOM   76    H  HE   . ARG A 1 4   ? 21.420  -12.242 3.775   1.00 0.00 ? 4   ARG A HE   1  
ATOM   77    H  HH11 . ARG A 1 4   ? 18.737  -13.040 5.810   1.00 0.00 ? 4   ARG A HH11 1  
ATOM   78    H  HH12 . ARG A 1 4   ? 17.919  -11.534 5.558   1.00 0.00 ? 4   ARG A HH12 1  
ATOM   79    H  HH21 . ARG A 1 4   ? 20.349  -10.267 3.431   1.00 0.00 ? 4   ARG A HH21 1  
ATOM   80    H  HH22 . ARG A 1 4   ? 18.831  -9.966  4.207   1.00 0.00 ? 4   ARG A HH22 1  
ATOM   81    N  N    . HIS A 1 5   ? 16.595  -16.651 3.876   1.00 0.00 ? 5   HIS A N    1  
ATOM   82    C  CA   . HIS A 1 5   ? 15.448  -16.204 3.094   1.00 0.00 ? 5   HIS A CA   1  
ATOM   83    C  C    . HIS A 1 5   ? 15.381  -14.680 3.045   1.00 0.00 ? 5   HIS A C    1  
ATOM   84    O  O    . HIS A 1 5   ? 14.637  -14.111 2.245   1.00 0.00 ? 5   HIS A O    1  
ATOM   85    C  CB   . HIS A 1 5   ? 14.159  -16.755 3.703   1.00 0.00 ? 5   HIS A CB   1  
ATOM   86    C  CG   . HIS A 1 5   ? 14.375  -18.185 4.116   1.00 0.00 ? 5   HIS A CG   1  
ATOM   87    N  ND1  . HIS A 1 5   ? 13.890  -19.250 3.374   1.00 0.00 ? 5   HIS A ND1  1  
ATOM   88    C  CD2  . HIS A 1 5   ? 15.026  -18.742 5.189   1.00 0.00 ? 5   HIS A CD2  1  
ATOM   89    C  CE1  . HIS A 1 5   ? 14.252  -20.382 4.005   1.00 0.00 ? 5   HIS A CE1  1  
ATOM   90    N  NE2  . HIS A 1 5   ? 14.947  -20.128 5.117   1.00 0.00 ? 5   HIS A NE2  1  
ATOM   91    H  H    . HIS A 1 5   ? 16.460  -16.960 4.795   1.00 0.00 ? 5   HIS A H    1  
ATOM   92    H  HA   . HIS A 1 5   ? 15.545  -16.581 2.088   1.00 0.00 ? 5   HIS A HA   1  
ATOM   93    H  HB2  . HIS A 1 5   ? 13.889  -16.167 4.568   1.00 0.00 ? 5   HIS A HB2  1  
ATOM   94    H  HB3  . HIS A 1 5   ? 13.366  -16.708 2.971   1.00 0.00 ? 5   HIS A HB3  1  
ATOM   95    H  HD1  . HIS A 1 5   ? 13.376  -19.190 2.541   1.00 0.00 ? 5   HIS A HD1  1  
ATOM   96    H  HD2  . HIS A 1 5   ? 15.525  -18.187 5.970   1.00 0.00 ? 5   HIS A HD2  1  
ATOM   97    H  HE1  . HIS A 1 5   ? 14.010  -21.375 3.654   1.00 0.00 ? 5   HIS A HE1  1  
ATOM   98    H  HE2  . HIS A 1 5   ? 15.320  -20.779 5.746   1.00 0.00 ? 5   HIS A HE2  1  
ATOM   99    N  N    . SER A 1 6   ? 16.157  -14.024 3.900   1.00 0.00 ? 6   SER A N    1  
ATOM   100   C  CA   . SER A 1 6   ? 16.165  -12.565 3.931   1.00 0.00 ? 6   SER A CA   1  
ATOM   101   C  C    . SER A 1 6   ? 16.532  -12.008 2.560   1.00 0.00 ? 6   SER A C    1  
ATOM   102   O  O    . SER A 1 6   ? 17.703  -11.757 2.276   1.00 0.00 ? 6   SER A O    1  
ATOM   103   C  CB   . SER A 1 6   ? 17.168  -12.066 4.969   1.00 0.00 ? 6   SER A CB   1  
ATOM   104   O  OG   . SER A 1 6   ? 18.488  -12.333 4.514   1.00 0.00 ? 6   SER A OG   1  
ATOM   105   H  H    . SER A 1 6   ? 16.731  -14.524 4.516   1.00 0.00 ? 6   SER A H    1  
ATOM   106   H  HA   . SER A 1 6   ? 15.180  -12.214 4.199   1.00 0.00 ? 6   SER A HA   1  
ATOM   107   H  HB2  . SER A 1 6   ? 17.049  -11.002 5.102   1.00 0.00 ? 6   SER A HB2  1  
ATOM   108   H  HB3  . SER A 1 6   ? 16.991  -12.568 5.912   1.00 0.00 ? 6   SER A HB3  1  
ATOM   109   H  HG   . SER A 1 6   ? 18.824  -13.085 5.006   1.00 0.00 ? 6   SER A HG   1  
ATOM   110   N  N    . MET A 1 7   ? 15.526  -11.820 1.713   1.00 0.00 ? 7   MET A N    1  
ATOM   111   C  CA   . MET A 1 7   ? 15.760  -11.295 0.374   1.00 0.00 ? 7   MET A CA   1  
ATOM   112   C  C    . MET A 1 7   ? 16.821  -10.199 0.407   1.00 0.00 ? 7   MET A C    1  
ATOM   113   O  O    . MET A 1 7   ? 16.723  -9.243  1.175   1.00 0.00 ? 7   MET A O    1  
ATOM   114   C  CB   . MET A 1 7   ? 14.454  -10.754 -0.231  1.00 0.00 ? 7   MET A CB   1  
ATOM   115   C  CG   . MET A 1 7   ? 14.001  -9.486  0.501   1.00 0.00 ? 7   MET A CG   1  
ATOM   116   S  SD   . MET A 1 7   ? 13.886  -9.811  2.277   1.00 0.00 ? 7   MET A SD   1  
ATOM   117   C  CE   . MET A 1 7   ? 14.368  -8.161  2.833   1.00 0.00 ? 7   MET A CE   1  
ATOM   118   H  H    . MET A 1 7   ? 14.612  -12.039 1.993   1.00 0.00 ? 7   MET A H    1  
ATOM   119   H  HA   . MET A 1 7   ? 16.119  -12.099 -0.251  1.00 0.00 ? 7   MET A HA   1  
ATOM   120   H  HB2  . MET A 1 7   ? 14.615  -10.523 -1.274  1.00 0.00 ? 7   MET A HB2  1  
ATOM   121   H  HB3  . MET A 1 7   ? 13.684  -11.507 -0.148  1.00 0.00 ? 7   MET A HB3  1  
ATOM   122   H  HG2  . MET A 1 7   ? 14.708  -8.692  0.325   1.00 0.00 ? 7   MET A HG2  1  
ATOM   123   H  HG3  . MET A 1 7   ? 13.031  -9.188  0.131   1.00 0.00 ? 7   MET A HG3  1  
ATOM   124   H  HE1  . MET A 1 7   ? 13.666  -7.433  2.451   1.00 0.00 ? 7   MET A HE1  1  
ATOM   125   H  HE2  . MET A 1 7   ? 15.362  -7.935  2.472   1.00 0.00 ? 7   MET A HE2  1  
ATOM   126   H  HE3  . MET A 1 7   ? 14.366  -8.130  3.906   1.00 0.00 ? 7   MET A HE3  1  
ATOM   127   N  N    . ASP A 1 8   ? 17.843  -10.354 -0.430  1.00 0.00 ? 8   ASP A N    1  
ATOM   128   C  CA   . ASP A 1 8   ? 18.928  -9.379  -0.493  1.00 0.00 ? 8   ASP A CA   1  
ATOM   129   C  C    . ASP A 1 8   ? 20.115  -9.946  -1.285  1.00 0.00 ? 8   ASP A C    1  
ATOM   130   O  O    . ASP A 1 8   ? 20.670  -9.265  -2.147  1.00 0.00 ? 8   ASP A O    1  
ATOM   131   C  CB   . ASP A 1 8   ? 19.351  -8.961  0.936   1.00 0.00 ? 8   ASP A CB   1  
ATOM   132   C  CG   . ASP A 1 8   ? 20.874  -8.940  1.091   1.00 0.00 ? 8   ASP A CG   1  
ATOM   133   O  OD1  . ASP A 1 8   ? 21.522  -8.276  0.299   1.00 0.00 ? 8   ASP A OD1  1  
ATOM   134   O  OD2  . ASP A 1 8   ? 21.365  -9.589  2.000   1.00 0.00 ? 8   ASP A OD2  1  
ATOM   135   H  H    . ASP A 1 8   ? 17.870  -11.141 -1.013  1.00 0.00 ? 8   ASP A H    1  
ATOM   136   H  HA   . ASP A 1 8   ? 18.563  -8.505  -1.011  1.00 0.00 ? 8   ASP A HA   1  
ATOM   137   H  HB2  . ASP A 1 8   ? 18.967  -7.973  1.144   1.00 0.00 ? 8   ASP A HB2  1  
ATOM   138   H  HB3  . ASP A 1 8   ? 18.934  -9.652  1.649   1.00 0.00 ? 8   ASP A HB3  1  
ATOM   139   N  N    . PRO A 1 9   ? 20.518  -11.167 -1.009  1.00 0.00 ? 9   PRO A N    1  
ATOM   140   C  CA   . PRO A 1 9   ? 21.665  -11.805 -1.719  1.00 0.00 ? 9   PRO A CA   1  
ATOM   141   C  C    . PRO A 1 9   ? 21.491  -11.843 -3.244  1.00 0.00 ? 9   PRO A C    1  
ATOM   142   O  O    . PRO A 1 9   ? 22.439  -11.565 -3.978  1.00 0.00 ? 9   PRO A O    1  
ATOM   143   C  CB   . PRO A 1 9   ? 21.760  -13.225 -1.133  1.00 0.00 ? 9   PRO A CB   1  
ATOM   144   C  CG   . PRO A 1 9   ? 20.891  -13.244 0.091   1.00 0.00 ? 9   PRO A CG   1  
ATOM   145   C  CD   . PRO A 1 9   ? 19.929  -12.056 0.006   1.00 0.00 ? 9   PRO A CD   1  
ATOM   146   H  HA   . PRO A 1 9   ? 22.571  -11.270 -1.480  1.00 0.00 ? 9   PRO A HA   1  
ATOM   147   H  HB2  . PRO A 1 9   ? 21.415  -13.955 -1.851  1.00 0.00 ? 9   PRO A HB2  1  
ATOM   148   H  HB3  . PRO A 1 9   ? 22.782  -13.440 -0.856  1.00 0.00 ? 9   PRO A HB3  1  
ATOM   149   H  HG2  . PRO A 1 9   ? 20.330  -14.168 0.127   1.00 0.00 ? 9   PRO A HG2  1  
ATOM   150   H  HG3  . PRO A 1 9   ? 21.500  -13.150 0.978   1.00 0.00 ? 9   PRO A HG3  1  
ATOM   151   H  HD2  . PRO A 1 9   ? 18.947  -12.390 -0.295  1.00 0.00 ? 9   PRO A HD2  1  
ATOM   152   H  HD3  . PRO A 1 9   ? 19.879  -11.552 0.956   1.00 0.00 ? 9   PRO A HD3  1  
ATOM   153   N  N    . PRO A 1 10  ? 20.323  -12.183 -3.741  1.00 0.00 ? 10  PRO A N    1  
ATOM   154   C  CA   . PRO A 1 10  ? 20.077  -12.253 -5.208  1.00 0.00 ? 10  PRO A CA   1  
ATOM   155   C  C    . PRO A 1 10  ? 19.756  -10.892 -5.823  1.00 0.00 ? 10  PRO A C    1  
ATOM   156   O  O    . PRO A 1 10  ? 20.311  -10.525 -6.859  1.00 0.00 ? 10  PRO A O    1  
ATOM   157   C  CB   . PRO A 1 10  ? 18.879  -13.192 -5.313  1.00 0.00 ? 10  PRO A CB   1  
ATOM   158   C  CG   . PRO A 1 10  ? 18.109  -12.984 -4.050  1.00 0.00 ? 10  PRO A CG   1  
ATOM   159   C  CD   . PRO A 1 10  ? 19.111  -12.538 -2.979  1.00 0.00 ? 10  PRO A CD   1  
ATOM   160   H  HA   . PRO A 1 10  ? 20.922  -12.698 -5.707  1.00 0.00 ? 10  PRO A HA   1  
ATOM   161   H  HB2  . PRO A 1 10  ? 18.274  -12.933 -6.173  1.00 0.00 ? 10  PRO A HB2  1  
ATOM   162   H  HB3  . PRO A 1 10  ? 19.209  -14.217 -5.380  1.00 0.00 ? 10  PRO A HB3  1  
ATOM   163   H  HG2  . PRO A 1 10  ? 17.358  -12.219 -4.199  1.00 0.00 ? 10  PRO A HG2  1  
ATOM   164   H  HG3  . PRO A 1 10  ? 17.640  -13.907 -3.747  1.00 0.00 ? 10  PRO A HG3  1  
ATOM   165   H  HD2  . PRO A 1 10  ? 18.727  -11.682 -2.448  1.00 0.00 ? 10  PRO A HD2  1  
ATOM   166   H  HD3  . PRO A 1 10  ? 19.318  -13.347 -2.301  1.00 0.00 ? 10  PRO A HD3  1  
ATOM   167   N  N    . THR A 1 11  ? 18.855  -10.149 -5.186  1.00 0.00 ? 11  THR A N    1  
ATOM   168   C  CA   . THR A 1 11  ? 18.468  -8.839  -5.693  1.00 0.00 ? 11  THR A CA   1  
ATOM   169   C  C    . THR A 1 11  ? 19.658  -7.881  -5.690  1.00 0.00 ? 11  THR A C    1  
ATOM   170   O  O    . THR A 1 11  ? 19.737  -6.970  -6.513  1.00 0.00 ? 11  THR A O    1  
ATOM   171   C  CB   . THR A 1 11  ? 17.340  -8.259  -4.831  1.00 0.00 ? 11  THR A CB   1  
ATOM   172   O  OG1  . THR A 1 11  ? 16.676  -7.231  -5.553  1.00 0.00 ? 11  THR A OG1  1  
ATOM   173   C  CG2  . THR A 1 11  ? 17.920  -7.683  -3.536  1.00 0.00 ? 11  THR A CG2  1  
ATOM   174   H  H    . THR A 1 11  ? 18.439  -10.491 -4.368  1.00 0.00 ? 11  THR A H    1  
ATOM   175   H  HA   . THR A 1 11  ? 18.110  -8.950  -6.702  1.00 0.00 ? 11  THR A HA   1  
ATOM   176   H  HB   . THR A 1 11  ? 16.635  -9.039  -4.589  1.00 0.00 ? 11  THR A HB   1  
ATOM   177   H  HG1  . THR A 1 11  ? 17.321  -6.809  -6.127  1.00 0.00 ? 11  THR A HG1  1  
ATOM   178   H  HG21 . THR A 1 11  ? 17.176  -7.732  -2.755  1.00 0.00 ? 11  THR A HG21 1  
ATOM   179   H  HG22 . THR A 1 11  ? 18.208  -6.655  -3.696  1.00 0.00 ? 11  THR A HG22 1  
ATOM   180   H  HG23 . THR A 1 11  ? 18.787  -8.257  -3.244  1.00 0.00 ? 11  THR A HG23 1  
ATOM   181   N  N    . PHE A 1 12  ? 20.571  -8.090  -4.750  1.00 0.00 ? 12  PHE A N    1  
ATOM   182   C  CA   . PHE A 1 12  ? 21.746  -7.238  -4.632  1.00 0.00 ? 12  PHE A CA   1  
ATOM   183   C  C    . PHE A 1 12  ? 22.762  -7.546  -5.729  1.00 0.00 ? 12  PHE A C    1  
ATOM   184   O  O    . PHE A 1 12  ? 23.257  -6.641  -6.401  1.00 0.00 ? 12  PHE A O    1  
ATOM   185   C  CB   . PHE A 1 12  ? 22.393  -7.445  -3.262  1.00 0.00 ? 12  PHE A CB   1  
ATOM   186   C  CG   . PHE A 1 12  ? 23.587  -6.535  -3.122  1.00 0.00 ? 12  PHE A CG   1  
ATOM   187   C  CD1  . PHE A 1 12  ? 23.409  -5.149  -3.049  1.00 0.00 ? 12  PHE A CD1  1  
ATOM   188   C  CD2  . PHE A 1 12  ? 24.875  -7.081  -3.065  1.00 0.00 ? 12  PHE A CD2  1  
ATOM   189   C  CE1  . PHE A 1 12  ? 24.520  -4.307  -2.918  1.00 0.00 ? 12  PHE A CE1  1  
ATOM   190   C  CE2  . PHE A 1 12  ? 25.986  -6.239  -2.934  1.00 0.00 ? 12  PHE A CE2  1  
ATOM   191   C  CZ   . PHE A 1 12  ? 25.808  -4.853  -2.860  1.00 0.00 ? 12  PHE A CZ   1  
ATOM   192   H  H    . PHE A 1 12  ? 20.447  -8.828  -4.117  1.00 0.00 ? 12  PHE A H    1  
ATOM   193   H  HA   . PHE A 1 12  ? 21.441  -6.206  -4.718  1.00 0.00 ? 12  PHE A HA   1  
ATOM   194   H  HB2  . PHE A 1 12  ? 21.674  -7.217  -2.488  1.00 0.00 ? 12  PHE A HB2  1  
ATOM   195   H  HB3  . PHE A 1 12  ? 22.710  -8.472  -3.167  1.00 0.00 ? 12  PHE A HB3  1  
ATOM   196   H  HD1  . PHE A 1 12  ? 22.414  -4.729  -3.093  1.00 0.00 ? 12  PHE A HD1  1  
ATOM   197   H  HD2  . PHE A 1 12  ? 25.010  -8.151  -3.122  1.00 0.00 ? 12  PHE A HD2  1  
ATOM   198   H  HE1  . PHE A 1 12  ? 24.383  -3.237  -2.861  1.00 0.00 ? 12  PHE A HE1  1  
ATOM   199   H  HE2  . PHE A 1 12  ? 26.979  -6.661  -2.890  1.00 0.00 ? 12  PHE A HE2  1  
ATOM   200   H  HZ   . PHE A 1 12  ? 26.666  -4.203  -2.759  1.00 0.00 ? 12  PHE A HZ   1  
ATOM   201   N  N    . THR A 1 13  ? 23.072  -8.826  -5.901  1.00 0.00 ? 13  THR A N    1  
ATOM   202   C  CA   . THR A 1 13  ? 24.035  -9.239  -6.914  1.00 0.00 ? 13  THR A CA   1  
ATOM   203   C  C    . THR A 1 13  ? 23.472  -9.037  -8.318  1.00 0.00 ? 13  THR A C    1  
ATOM   204   O  O    . THR A 1 13  ? 24.114  -8.423  -9.170  1.00 0.00 ? 13  THR A O    1  
ATOM   205   C  CB   . THR A 1 13  ? 24.400  -10.711 -6.713  1.00 0.00 ? 13  THR A CB   1  
ATOM   206   O  OG1  . THR A 1 13  ? 23.231  -11.442 -6.372  1.00 0.00 ? 13  THR A OG1  1  
ATOM   207   C  CG2  . THR A 1 13  ? 25.429  -10.834 -5.588  1.00 0.00 ? 13  THR A CG2  1  
ATOM   208   H  H    . THR A 1 13  ? 22.651  -9.505  -5.334  1.00 0.00 ? 13  THR A H    1  
ATOM   209   H  HA   . THR A 1 13  ? 24.930  -8.643  -6.808  1.00 0.00 ? 13  THR A HA   1  
ATOM   210   H  HB   . THR A 1 13  ? 24.820  -11.106 -7.624  1.00 0.00 ? 13  THR A HB   1  
ATOM   211   H  HG1  . THR A 1 13  ? 22.926  -11.131 -5.517  1.00 0.00 ? 13  THR A HG1  1  
ATOM   212   H  HG21 . THR A 1 13  ? 25.628  -11.877 -5.395  1.00 0.00 ? 13  THR A HG21 1  
ATOM   213   H  HG22 . THR A 1 13  ? 25.041  -10.369 -4.694  1.00 0.00 ? 13  THR A HG22 1  
ATOM   214   H  HG23 . THR A 1 13  ? 26.344  -10.340 -5.882  1.00 0.00 ? 13  THR A HG23 1  
ATOM   215   N  N    . PHE A 1 14  ? 22.273  -9.559  -8.554  1.00 0.00 ? 14  PHE A N    1  
ATOM   216   C  CA   . PHE A 1 14  ? 21.643  -9.429  -9.863  1.00 0.00 ? 14  PHE A CA   1  
ATOM   217   C  C    . PHE A 1 14  ? 21.799  -8.010  -10.398 1.00 0.00 ? 14  PHE A C    1  
ATOM   218   O  O    . PHE A 1 14  ? 22.322  -7.803  -11.494 1.00 0.00 ? 14  PHE A O    1  
ATOM   219   C  CB   . PHE A 1 14  ? 20.156  -9.779  -9.770  1.00 0.00 ? 14  PHE A CB   1  
ATOM   220   C  CG   . PHE A 1 14  ? 19.531  -9.675  -11.141 1.00 0.00 ? 14  PHE A CG   1  
ATOM   221   C  CD1  . PHE A 1 14  ? 19.779  -10.667 -12.099 1.00 0.00 ? 14  PHE A CD1  1  
ATOM   222   C  CD2  . PHE A 1 14  ? 18.707  -8.589  -11.455 1.00 0.00 ? 14  PHE A CD2  1  
ATOM   223   C  CE1  . PHE A 1 14  ? 19.201  -10.571 -13.372 1.00 0.00 ? 14  PHE A CE1  1  
ATOM   224   C  CE2  . PHE A 1 14  ? 18.130  -8.493  -12.728 1.00 0.00 ? 14  PHE A CE2  1  
ATOM   225   C  CZ   . PHE A 1 14  ? 18.377  -9.485  -13.686 1.00 0.00 ? 14  PHE A CZ   1  
ATOM   226   H  H    . PHE A 1 14  ? 21.807  -10.041 -7.840  1.00 0.00 ? 14  PHE A H    1  
ATOM   227   H  HA   . PHE A 1 14  ? 22.118  -10.115 -10.548 1.00 0.00 ? 14  PHE A HA   1  
ATOM   228   H  HB2  . PHE A 1 14  ? 20.045  -10.786 -9.397  1.00 0.00 ? 14  PHE A HB2  1  
ATOM   229   H  HB3  . PHE A 1 14  ? 19.664  -9.090  -9.099  1.00 0.00 ? 14  PHE A HB3  1  
ATOM   230   H  HD1  . PHE A 1 14  ? 20.415  -11.505 -11.856 1.00 0.00 ? 14  PHE A HD1  1  
ATOM   231   H  HD2  . PHE A 1 14  ? 18.515  -7.825  -10.717 1.00 0.00 ? 14  PHE A HD2  1  
ATOM   232   H  HE1  . PHE A 1 14  ? 19.393  -11.335 -14.110 1.00 0.00 ? 14  PHE A HE1  1  
ATOM   233   H  HE2  . PHE A 1 14  ? 17.494  -7.655  -12.971 1.00 0.00 ? 14  PHE A HE2  1  
ATOM   234   H  HZ   . PHE A 1 14  ? 17.932  -9.411  -14.667 1.00 0.00 ? 14  PHE A HZ   1  
ATOM   235   N  N    . ASN A 1 15  ? 21.342  -7.035  -9.620  1.00 0.00 ? 15  ASN A N    1  
ATOM   236   C  CA   . ASN A 1 15  ? 21.436  -5.638  -10.029 1.00 0.00 ? 15  ASN A CA   1  
ATOM   237   C  C    . ASN A 1 15  ? 21.621  -4.732  -8.816  1.00 0.00 ? 15  ASN A C    1  
ATOM   238   O  O    . ASN A 1 15  ? 22.438  -5.012  -7.938  1.00 0.00 ? 15  ASN A O    1  
ATOM   239   C  CB   . ASN A 1 15  ? 20.168  -5.230  -10.782 1.00 0.00 ? 15  ASN A CB   1  
ATOM   240   C  CG   . ASN A 1 15  ? 18.968  -5.283  -9.844  1.00 0.00 ? 15  ASN A CG   1  
ATOM   241   O  OD1  . ASN A 1 15  ? 19.128  -5.482  -8.640  1.00 0.00 ? 15  ASN A OD1  1  
ATOM   242   N  ND2  . ASN A 1 15  ? 17.766  -5.115  -10.326 1.00 0.00 ? 15  ASN A ND2  1  
ATOM   243   H  H    . ASN A 1 15  ? 20.933  -7.257  -8.757  1.00 0.00 ? 15  ASN A H    1  
ATOM   244   H  HA   . ASN A 1 15  ? 22.283  -5.522  -10.686 1.00 0.00 ? 15  ASN A HA   1  
ATOM   245   H  HB2  . ASN A 1 15  ? 20.285  -4.224  -11.160 1.00 0.00 ? 15  ASN A HB2  1  
ATOM   246   H  HB3  . ASN A 1 15  ? 20.008  -5.906  -11.608 1.00 0.00 ? 15  ASN A HB3  1  
ATOM   247   H  HD21 . ASN A 1 15  ? 17.641  -4.957  -11.286 1.00 0.00 ? 15  ASN A HD21 1  
ATOM   248   H  HD22 . ASN A 1 15  ? 16.991  -5.149  -9.729  1.00 0.00 ? 15  ASN A HD22 1  
ATOM   249   N  N    . PHE A 1 16  ? 20.857  -3.644  -8.777  1.00 0.00 ? 16  PHE A N    1  
ATOM   250   C  CA   . PHE A 1 16  ? 20.940  -2.696  -7.669  1.00 0.00 ? 16  PHE A CA   1  
ATOM   251   C  C    . PHE A 1 16  ? 19.543  -2.263  -7.235  1.00 0.00 ? 16  PHE A C    1  
ATOM   252   O  O    . PHE A 1 16  ? 19.277  -1.074  -7.060  1.00 0.00 ? 16  PHE A O    1  
ATOM   253   C  CB   . PHE A 1 16  ? 21.746  -1.466  -8.097  1.00 0.00 ? 16  PHE A CB   1  
ATOM   254   C  CG   . PHE A 1 16  ? 22.362  -0.814  -6.882  1.00 0.00 ? 16  PHE A CG   1  
ATOM   255   C  CD1  . PHE A 1 16  ? 23.341  -1.492  -6.144  1.00 0.00 ? 16  PHE A CD1  1  
ATOM   256   C  CD2  . PHE A 1 16  ? 21.956  0.468   -6.494  1.00 0.00 ? 16  PHE A CD2  1  
ATOM   257   C  CE1  . PHE A 1 16  ? 23.913  -0.886  -5.020  1.00 0.00 ? 16  PHE A CE1  1  
ATOM   258   C  CE2  . PHE A 1 16  ? 22.529  1.073   -5.369  1.00 0.00 ? 16  PHE A CE2  1  
ATOM   259   C  CZ   . PHE A 1 16  ? 23.507  0.396   -4.632  1.00 0.00 ? 16  PHE A CZ   1  
ATOM   260   H  H    . PHE A 1 16  ? 20.225  -3.475  -9.507  1.00 0.00 ? 16  PHE A H    1  
ATOM   261   H  HA   . PHE A 1 16  ? 21.436  -3.169  -6.834  1.00 0.00 ? 16  PHE A HA   1  
ATOM   262   H  HB2  . PHE A 1 16  ? 22.529  -1.769  -8.778  1.00 0.00 ? 16  PHE A HB2  1  
ATOM   263   H  HB3  . PHE A 1 16  ? 21.093  -0.762  -8.590  1.00 0.00 ? 16  PHE A HB3  1  
ATOM   264   H  HD1  . PHE A 1 16  ? 23.654  -2.481  -6.444  1.00 0.00 ? 16  PHE A HD1  1  
ATOM   265   H  HD2  . PHE A 1 16  ? 21.201  0.991   -7.063  1.00 0.00 ? 16  PHE A HD2  1  
ATOM   266   H  HE1  . PHE A 1 16  ? 24.668  -1.410  -4.451  1.00 0.00 ? 16  PHE A HE1  1  
ATOM   267   H  HE2  . PHE A 1 16  ? 22.216  2.062   -5.069  1.00 0.00 ? 16  PHE A HE2  1  
ATOM   268   H  HZ   . PHE A 1 16  ? 23.949  0.862   -3.764  1.00 0.00 ? 16  PHE A HZ   1  
ATOM   269   N  N    . ASN A 1 17  ? 18.655  -3.237  -7.064  1.00 0.00 ? 17  ASN A N    1  
ATOM   270   C  CA   . ASN A 1 17  ? 17.289  -2.947  -6.652  1.00 0.00 ? 17  ASN A CA   1  
ATOM   271   C  C    . ASN A 1 17  ? 16.698  -1.831  -7.509  1.00 0.00 ? 17  ASN A C    1  
ATOM   272   O  O    . ASN A 1 17  ? 15.769  -1.139  -7.094  1.00 0.00 ? 17  ASN A O    1  
ATOM   273   C  CB   . ASN A 1 17  ? 17.268  -2.531  -5.179  1.00 0.00 ? 17  ASN A CB   1  
ATOM   274   C  CG   . ASN A 1 17  ? 17.243  -3.769  -4.288  1.00 0.00 ? 17  ASN A CG   1  
ATOM   275   O  OD1  . ASN A 1 17  ? 17.944  -3.821  -3.277  1.00 0.00 ? 17  ASN A OD1  1  
ATOM   276   N  ND2  . ASN A 1 17  ? 16.472  -4.774  -4.604  1.00 0.00 ? 17  ASN A ND2  1  
ATOM   277   H  H    . ASN A 1 17  ? 18.924  -4.166  -7.219  1.00 0.00 ? 17  ASN A H    1  
ATOM   278   H  HA   . ASN A 1 17  ? 16.689  -3.836  -6.771  1.00 0.00 ? 17  ASN A HA   1  
ATOM   279   H  HB2  . ASN A 1 17  ? 18.151  -1.948  -4.959  1.00 0.00 ? 17  ASN A HB2  1  
ATOM   280   H  HB3  . ASN A 1 17  ? 16.390  -1.936  -4.988  1.00 0.00 ? 17  ASN A HB3  1  
ATOM   281   H  HD21 . ASN A 1 17  ? 15.915  -4.729  -5.412  1.00 0.00 ? 17  ASN A HD21 1  
ATOM   282   H  HD22 . ASN A 1 17  ? 16.452  -5.574  -4.035  1.00 0.00 ? 17  ASN A HD22 1  
ATOM   283   N  N    . ASN A 1 18  ? 17.248  -1.664  -8.709  1.00 0.00 ? 18  ASN A N    1  
ATOM   284   C  CA   . ASN A 1 18  ? 16.772  -0.631  -9.622  1.00 0.00 ? 18  ASN A CA   1  
ATOM   285   C  C    . ASN A 1 18  ? 15.250  -0.657  -9.716  1.00 0.00 ? 18  ASN A C    1  
ATOM   286   O  O    . ASN A 1 18  ? 14.640  0.276   -10.238 1.00 0.00 ? 18  ASN A O    1  
ATOM   287   C  CB   . ASN A 1 18  ? 17.374  -0.851  -11.011 1.00 0.00 ? 18  ASN A CB   1  
ATOM   288   C  CG   . ASN A 1 18  ? 18.873  -0.574  -10.979 1.00 0.00 ? 18  ASN A CG   1  
ATOM   289   O  OD1  . ASN A 1 18  ? 19.297  0.515   -10.589 1.00 0.00 ? 18  ASN A OD1  1  
ATOM   290   N  ND2  . ASN A 1 18  ? 19.707  -1.501  -11.365 1.00 0.00 ? 18  ASN A ND2  1  
ATOM   291   H  H    . ASN A 1 18  ? 17.987  -2.247  -8.985  1.00 0.00 ? 18  ASN A H    1  
ATOM   292   H  HA   . ASN A 1 18  ? 17.085  0.334   -9.255  1.00 0.00 ? 18  ASN A HA   1  
ATOM   293   H  HB2  . ASN A 1 18  ? 17.204  -1.873  -11.316 1.00 0.00 ? 18  ASN A HB2  1  
ATOM   294   H  HB3  . ASN A 1 18  ? 16.902  -0.183  -11.714 1.00 0.00 ? 18  ASN A HB3  1  
ATOM   295   H  HD21 . ASN A 1 18  ? 19.369  -2.367  -11.674 1.00 0.00 ? 18  ASN A HD21 1  
ATOM   296   H  HD22 . ASN A 1 18  ? 20.672  -1.330  -11.347 1.00 0.00 ? 18  ASN A HD22 1  
ATOM   297   N  N    . GLU A 1 19  ? 14.658  -1.739  -9.208  1.00 0.00 ? 19  GLU A N    1  
ATOM   298   C  CA   . GLU A 1 19  ? 13.203  -1.915  -9.223  1.00 0.00 ? 19  GLU A CA   1  
ATOM   299   C  C    . GLU A 1 19  ? 12.474  -0.575  -9.339  1.00 0.00 ? 19  GLU A C    1  
ATOM   300   O  O    . GLU A 1 19  ? 12.145  0.047   -8.329  1.00 0.00 ? 19  GLU A O    1  
ATOM   301   C  CB   . GLU A 1 19  ? 12.759  -2.613  -7.936  1.00 0.00 ? 19  GLU A CB   1  
ATOM   302   C  CG   . GLU A 1 19  ? 13.451  -3.972  -7.827  1.00 0.00 ? 19  GLU A CG   1  
ATOM   303   C  CD   . GLU A 1 19  ? 12.828  -4.783  -6.696  1.00 0.00 ? 19  GLU A CD   1  
ATOM   304   O  OE1  . GLU A 1 19  ? 11.659  -4.570  -6.416  1.00 0.00 ? 19  GLU A OE1  1  
ATOM   305   O  OE2  . GLU A 1 19  ? 13.527  -5.602  -6.124  1.00 0.00 ? 19  GLU A OE2  1  
ATOM   306   H  H    . GLU A 1 19  ? 15.215  -2.441  -8.813  1.00 0.00 ? 19  GLU A H    1  
ATOM   307   H  HA   . GLU A 1 19  ? 12.936  -2.541  -10.059 1.00 0.00 ? 19  GLU A HA   1  
ATOM   308   H  HB2  . GLU A 1 19  ? 13.028  -2.003  -7.086  1.00 0.00 ? 19  GLU A HB2  1  
ATOM   309   H  HB3  . GLU A 1 19  ? 11.689  -2.757  -7.955  1.00 0.00 ? 19  GLU A HB3  1  
ATOM   310   H  HG2  . GLU A 1 19  ? 13.336  -4.509  -8.758  1.00 0.00 ? 19  GLU A HG2  1  
ATOM   311   H  HG3  . GLU A 1 19  ? 14.502  -3.825  -7.624  1.00 0.00 ? 19  GLU A HG3  1  
ATOM   312   N  N    . PRO A 1 20  ? 12.215  -0.122  -10.541 1.00 0.00 ? 20  PRO A N    1  
ATOM   313   C  CA   . PRO A 1 20  ? 11.509  1.171   -10.775 1.00 0.00 ? 20  PRO A CA   1  
ATOM   314   C  C    . PRO A 1 20  ? 10.230  1.285   -9.948  1.00 0.00 ? 20  PRO A C    1  
ATOM   315   O  O    . PRO A 1 20  ? 9.974   0.463   -9.068  1.00 0.00 ? 20  PRO A O    1  
ATOM   316   C  CB   . PRO A 1 20  ? 11.194  1.150   -12.273 1.00 0.00 ? 20  PRO A CB   1  
ATOM   317   C  CG   . PRO A 1 20  ? 12.214  0.243   -12.877 1.00 0.00 ? 20  PRO A CG   1  
ATOM   318   C  CD   . PRO A 1 20  ? 12.564  -0.789  -11.807 1.00 0.00 ? 20  PRO A CD   1  
ATOM   319   H  HA   . PRO A 1 20  ? 12.165  1.998   -10.559 1.00 0.00 ? 20  PRO A HA   1  
ATOM   320   H  HB2  . PRO A 1 20  ? 10.199  0.763   -12.440 1.00 0.00 ? 20  PRO A HB2  1  
ATOM   321   H  HB3  . PRO A 1 20  ? 11.288  2.141   -12.690 1.00 0.00 ? 20  PRO A HB3  1  
ATOM   322   H  HG2  . PRO A 1 20  ? 11.802  -0.246  -13.750 1.00 0.00 ? 20  PRO A HG2  1  
ATOM   323   H  HG3  . PRO A 1 20  ? 13.097  0.803   -13.144 1.00 0.00 ? 20  PRO A HG3  1  
ATOM   324   H  HD2  . PRO A 1 20  ? 11.975  -1.686  -11.943 1.00 0.00 ? 20  PRO A HD2  1  
ATOM   325   H  HD3  . PRO A 1 20  ? 13.618  -1.018  -11.830 1.00 0.00 ? 20  PRO A HD3  1  
ATOM   326   N  N    . TRP A 1 21  ? 9.433   2.309   -10.232 1.00 0.00 ? 21  TRP A N    1  
ATOM   327   C  CA   . TRP A 1 21  ? 8.186   2.519   -9.505  1.00 0.00 ? 21  TRP A CA   1  
ATOM   328   C  C    . TRP A 1 21  ? 7.106   1.561   -9.997  1.00 0.00 ? 21  TRP A C    1  
ATOM   329   O  O    . TRP A 1 21  ? 7.232   0.962   -11.066 1.00 0.00 ? 21  TRP A O    1  
ATOM   330   C  CB   . TRP A 1 21  ? 7.716   3.966   -9.684  1.00 0.00 ? 21  TRP A CB   1  
ATOM   331   C  CG   . TRP A 1 21  ? 8.102   4.452   -11.044 1.00 0.00 ? 21  TRP A CG   1  
ATOM   332   C  CD1  . TRP A 1 21  ? 7.294   4.449   -12.130 1.00 0.00 ? 21  TRP A CD1  1  
ATOM   333   C  CD2  . TRP A 1 21  ? 9.372   5.014   -11.482 1.00 0.00 ? 21  TRP A CD2  1  
ATOM   334   N  NE1  . TRP A 1 21  ? 7.988   4.973   -13.205 1.00 0.00 ? 21  TRP A NE1  1  
ATOM   335   C  CE2  . TRP A 1 21  ? 9.273   5.336   -12.856 1.00 0.00 ? 21  TRP A CE2  1  
ATOM   336   C  CE3  . TRP A 1 21  ? 10.590  5.273   -10.827 1.00 0.00 ? 21  TRP A CE3  1  
ATOM   337   C  CZ2  . TRP A 1 21  ? 10.344  5.894   -13.556 1.00 0.00 ? 21  TRP A CZ2  1  
ATOM   338   C  CZ3  . TRP A 1 21  ? 11.670  5.835   -11.528 1.00 0.00 ? 21  TRP A CZ3  1  
ATOM   339   C  CH2  . TRP A 1 21  ? 11.547  6.146   -12.890 1.00 0.00 ? 21  TRP A CH2  1  
ATOM   340   H  H    . TRP A 1 21  ? 9.688   2.935   -10.942 1.00 0.00 ? 21  TRP A H    1  
ATOM   341   H  HA   . TRP A 1 21  ? 8.360   2.339   -8.455  1.00 0.00 ? 21  TRP A HA   1  
ATOM   342   H  HB2  . TRP A 1 21  ? 6.642   4.015   -9.575  1.00 0.00 ? 21  TRP A HB2  1  
ATOM   343   H  HB3  . TRP A 1 21  ? 8.181   4.589   -8.934  1.00 0.00 ? 21  TRP A HB3  1  
ATOM   344   H  HD1  . TRP A 1 21  ? 6.274   4.095   -12.152 1.00 0.00 ? 21  TRP A HD1  1  
ATOM   345   H  HE1  . TRP A 1 21  ? 7.630   5.080   -14.111 1.00 0.00 ? 21  TRP A HE1  1  
ATOM   346   H  HE3  . TRP A 1 21  ? 10.696  5.038   -9.778  1.00 0.00 ? 21  TRP A HE3  1  
ATOM   347   H  HZ2  . TRP A 1 21  ? 10.244  6.131   -14.605 1.00 0.00 ? 21  TRP A HZ2  1  
ATOM   348   H  HZ3  . TRP A 1 21  ? 12.600  6.030   -11.015 1.00 0.00 ? 21  TRP A HZ3  1  
ATOM   349   H  HH2  . TRP A 1 21  ? 12.380  6.578   -13.424 1.00 0.00 ? 21  TRP A HH2  1  
ATOM   350   N  N    . VAL A 1 22  ? 6.044   1.422   -9.209  1.00 0.00 ? 22  VAL A N    1  
ATOM   351   C  CA   . VAL A 1 22  ? 4.946   0.536   -9.570  1.00 0.00 ? 22  VAL A CA   1  
ATOM   352   C  C    . VAL A 1 22  ? 4.541   0.753   -11.025 1.00 0.00 ? 22  VAL A C    1  
ATOM   353   O  O    . VAL A 1 22  ? 4.964   1.720   -11.658 1.00 0.00 ? 22  VAL A O    1  
ATOM   354   C  CB   . VAL A 1 22  ? 3.746   0.801   -8.659  1.00 0.00 ? 22  VAL A CB   1  
ATOM   355   C  CG1  . VAL A 1 22  ? 4.177   0.696   -7.195  1.00 0.00 ? 22  VAL A CG1  1  
ATOM   356   C  CG2  . VAL A 1 22  ? 3.204   2.205   -8.931  1.00 0.00 ? 22  VAL A CG2  1  
ATOM   357   H  H    . VAL A 1 22  ? 5.997   1.924   -8.371  1.00 0.00 ? 22  VAL A H    1  
ATOM   358   H  HA   . VAL A 1 22  ? 5.263   -0.488  -9.442  1.00 0.00 ? 22  VAL A HA   1  
ATOM   359   H  HB   . VAL A 1 22  ? 2.977   0.071   -8.860  1.00 0.00 ? 22  VAL A HB   1  
ATOM   360   H  HG11 . VAL A 1 22  ? 4.448   -0.325  -6.970  1.00 0.00 ? 22  VAL A HG11 1  
ATOM   361   H  HG12 . VAL A 1 22  ? 3.360   1.000   -6.557  1.00 0.00 ? 22  VAL A HG12 1  
ATOM   362   H  HG13 . VAL A 1 22  ? 5.026   1.340   -7.022  1.00 0.00 ? 22  VAL A HG13 1  
ATOM   363   H  HG21 . VAL A 1 22  ? 4.002   2.926   -8.833  1.00 0.00 ? 22  VAL A HG21 1  
ATOM   364   H  HG22 . VAL A 1 22  ? 2.425   2.433   -8.219  1.00 0.00 ? 22  VAL A HG22 1  
ATOM   365   H  HG23 . VAL A 1 22  ? 2.800   2.249   -9.932  1.00 0.00 ? 22  VAL A HG23 1  
ATOM   366   N  N    . ARG A 1 23  ? 3.720   -0.152  -11.548 1.00 0.00 ? 23  ARG A N    1  
ATOM   367   C  CA   . ARG A 1 23  ? 3.264   -0.047  -12.929 1.00 0.00 ? 23  ARG A CA   1  
ATOM   368   C  C    . ARG A 1 23  ? 4.379   0.488   -13.824 1.00 0.00 ? 23  ARG A C    1  
ATOM   369   O  O    . ARG A 1 23  ? 4.194   1.473   -14.538 1.00 0.00 ? 23  ARG A O    1  
ATOM   370   C  CB   . ARG A 1 23  ? 2.053   0.887   -13.011 1.00 0.00 ? 23  ARG A CB   1  
ATOM   371   C  CG   . ARG A 1 23  ? 0.905   0.324   -12.165 1.00 0.00 ? 23  ARG A CG   1  
ATOM   372   C  CD   . ARG A 1 23  ? 0.047   -0.617  -13.015 1.00 0.00 ? 23  ARG A CD   1  
ATOM   373   N  NE   . ARG A 1 23  ? -0.914  -1.321  -12.174 1.00 0.00 ? 23  ARG A NE   1  
ATOM   374   C  CZ   . ARG A 1 23  ? -1.773  -2.192  -12.693 1.00 0.00 ? 23  ARG A CZ   1  
ATOM   375   N  NH1  . ARG A 1 23  ? -1.770  -2.426  -13.978 1.00 0.00 ? 23  ARG A NH1  1  
ATOM   376   N  NH2  . ARG A 1 23  ? -2.621  -2.813  -11.919 1.00 0.00 ? 23  ARG A NH2  1  
ATOM   377   H  H    . ARG A 1 23  ? 3.415   -0.901  -10.995 1.00 0.00 ? 23  ARG A H    1  
ATOM   378   H  HA   . ARG A 1 23  ? 2.974   -1.026  -13.278 1.00 0.00 ? 23  ARG A HA   1  
ATOM   379   H  HB2  . ARG A 1 23  ? 2.328   1.863   -12.639 1.00 0.00 ? 23  ARG A HB2  1  
ATOM   380   H  HB3  . ARG A 1 23  ? 1.733   0.972   -14.039 1.00 0.00 ? 23  ARG A HB3  1  
ATOM   381   H  HG2  . ARG A 1 23  ? 1.309   -0.220  -11.323 1.00 0.00 ? 23  ARG A HG2  1  
ATOM   382   H  HG3  . ARG A 1 23  ? 0.293   1.138   -11.805 1.00 0.00 ? 23  ARG A HG3  1  
ATOM   383   H  HD2  . ARG A 1 23  ? -0.484  -0.041  -13.758 1.00 0.00 ? 23  ARG A HD2  1  
ATOM   384   H  HD3  . ARG A 1 23  ? 0.687   -1.333  -13.510 1.00 0.00 ? 23  ARG A HD3  1  
ATOM   385   H  HE   . ARG A 1 23  ? -0.924  -1.150  -11.209 1.00 0.00 ? 23  ARG A HE   1  
ATOM   386   H  HH11 . ARG A 1 23  ? -1.120  -1.949  -14.570 1.00 0.00 ? 23  ARG A HH11 1  
ATOM   387   H  HH12 . ARG A 1 23  ? -2.417  -3.079  -14.367 1.00 0.00 ? 23  ARG A HH12 1  
ATOM   388   H  HH21 . ARG A 1 23  ? -2.622  -2.634  -10.935 1.00 0.00 ? 23  ARG A HH21 1  
ATOM   389   H  HH22 . ARG A 1 23  ? -3.267  -3.469  -12.309 1.00 0.00 ? 23  ARG A HH22 1  
ATOM   390   N  N    . GLY A 1 24  ? 5.535   -0.167  -13.779 1.00 0.00 ? 24  GLY A N    1  
ATOM   391   C  CA   . GLY A 1 24  ? 6.671   0.256   -14.589 1.00 0.00 ? 24  GLY A CA   1  
ATOM   392   C  C    . GLY A 1 24  ? 6.390   0.047   -16.073 1.00 0.00 ? 24  GLY A C    1  
ATOM   393   O  O    . GLY A 1 24  ? 5.925   0.957   -16.762 1.00 0.00 ? 24  GLY A O    1  
ATOM   394   H  H    . GLY A 1 24  ? 5.625   -0.945  -13.190 1.00 0.00 ? 24  GLY A H    1  
ATOM   395   H  HA2  . GLY A 1 24  ? 6.867   1.303   -14.408 1.00 0.00 ? 24  GLY A HA2  1  
ATOM   396   H  HA3  . GLY A 1 24  ? 7.541   -0.322  -14.311 1.00 0.00 ? 24  GLY A HA3  1  
ATOM   397   N  N    . ARG A 1 25  ? 6.677   -1.155  -16.561 1.00 0.00 ? 25  ARG A N    1  
ATOM   398   C  CA   . ARG A 1 25  ? 6.454   -1.474  -17.966 1.00 0.00 ? 25  ARG A CA   1  
ATOM   399   C  C    . ARG A 1 25  ? 6.532   -2.981  -18.191 1.00 0.00 ? 25  ARG A C    1  
ATOM   400   O  O    . ARG A 1 25  ? 6.773   -3.440  -19.307 1.00 0.00 ? 25  ARG A O    1  
ATOM   401   C  CB   . ARG A 1 25  ? 7.503   -0.771  -18.831 1.00 0.00 ? 25  ARG A CB   1  
ATOM   402   C  CG   . ARG A 1 25  ? 8.905   -1.144  -18.334 1.00 0.00 ? 25  ARG A CG   1  
ATOM   403   C  CD   . ARG A 1 25  ? 9.966   -0.303  -19.055 1.00 0.00 ? 25  ARG A CD   1  
ATOM   404   N  NE   . ARG A 1 25  ? 11.053  0.021   -18.139 1.00 0.00 ? 25  ARG A NE   1  
ATOM   405   C  CZ   . ARG A 1 25  ? 11.814  -0.932  -17.608 1.00 0.00 ? 25  ARG A CZ   1  
ATOM   406   N  NH1  . ARG A 1 25  ? 11.594  -2.183  -17.907 1.00 0.00 ? 25  ARG A NH1  1  
ATOM   407   N  NH2  . ARG A 1 25  ? 12.779  -0.617  -16.789 1.00 0.00 ? 25  ARG A NH2  1  
ATOM   408   H  H    . ARG A 1 25  ? 7.047   -1.839  -15.966 1.00 0.00 ? 25  ARG A H    1  
ATOM   409   H  HA   . ARG A 1 25  ? 5.473   -1.125  -18.255 1.00 0.00 ? 25  ARG A HA   1  
ATOM   410   H  HB2  . ARG A 1 25  ? 7.388   -1.083  -19.860 1.00 0.00 ? 25  ARG A HB2  1  
ATOM   411   H  HB3  . ARG A 1 25  ? 7.369   0.297   -18.760 1.00 0.00 ? 25  ARG A HB3  1  
ATOM   412   H  HG2  . ARG A 1 25  ? 8.967   -0.964  -17.271 1.00 0.00 ? 25  ARG A HG2  1  
ATOM   413   H  HG3  . ARG A 1 25  ? 9.087   -2.191  -18.531 1.00 0.00 ? 25  ARG A HG3  1  
ATOM   414   H  HD2  . ARG A 1 25  ? 10.360  -0.862  -19.890 1.00 0.00 ? 25  ARG A HD2  1  
ATOM   415   H  HD3  . ARG A 1 25  ? 9.520   0.612   -19.420 1.00 0.00 ? 25  ARG A HD3  1  
ATOM   416   H  HE   . ARG A 1 25  ? 11.226  0.958   -17.909 1.00 0.00 ? 25  ARG A HE   1  
ATOM   417   H  HH11 . ARG A 1 25  ? 10.854  -2.426  -18.533 1.00 0.00 ? 25  ARG A HH11 1  
ATOM   418   H  HH12 . ARG A 1 25  ? 12.168  -2.900  -17.509 1.00 0.00 ? 25  ARG A HH12 1  
ATOM   419   H  HH21 . ARG A 1 25  ? 12.946  0.342   -16.559 1.00 0.00 ? 25  ARG A HH21 1  
ATOM   420   H  HH22 . ARG A 1 25  ? 13.351  -1.333  -16.390 1.00 0.00 ? 25  ARG A HH22 1  
ATOM   421   N  N    . HIS A 1 26  ? 6.333   -3.745  -17.121 1.00 0.00 ? 26  HIS A N    1  
ATOM   422   C  CA   . HIS A 1 26  ? 6.388   -5.202  -17.208 1.00 0.00 ? 26  HIS A CA   1  
ATOM   423   C  C    . HIS A 1 26  ? 5.296   -5.834  -16.350 1.00 0.00 ? 26  HIS A C    1  
ATOM   424   O  O    . HIS A 1 26  ? 4.556   -6.703  -16.812 1.00 0.00 ? 26  HIS A O    1  
ATOM   425   C  CB   . HIS A 1 26  ? 7.760   -5.694  -16.742 1.00 0.00 ? 26  HIS A CB   1  
ATOM   426   C  CG   . HIS A 1 26  ? 7.924   -7.149  -17.090 1.00 0.00 ? 26  HIS A CG   1  
ATOM   427   N  ND1  . HIS A 1 26  ? 6.923   -7.882  -17.706 1.00 0.00 ? 26  HIS A ND1  1  
ATOM   428   C  CD2  . HIS A 1 26  ? 8.971   -8.020  -16.910 1.00 0.00 ? 26  HIS A CD2  1  
ATOM   429   C  CE1  . HIS A 1 26  ? 7.383   -9.137  -17.873 1.00 0.00 ? 26  HIS A CE1  1  
ATOM   430   N  NE2  . HIS A 1 26  ? 8.626   -9.274  -17.406 1.00 0.00 ? 26  HIS A NE2  1  
ATOM   431   H  H    . HIS A 1 26  ? 6.148   -3.321  -16.255 1.00 0.00 ? 26  HIS A H    1  
ATOM   432   H  HA   . HIS A 1 26  ? 6.241   -5.499  -18.233 1.00 0.00 ? 26  HIS A HA   1  
ATOM   433   H  HB2  . HIS A 1 26  ? 8.532   -5.119  -17.230 1.00 0.00 ? 26  HIS A HB2  1  
ATOM   434   H  HB3  . HIS A 1 26  ? 7.842   -5.570  -15.672 1.00 0.00 ? 26  HIS A HB3  1  
ATOM   435   H  HD1  . HIS A 1 26  ? 6.040   -7.549  -17.970 1.00 0.00 ? 26  HIS A HD1  1  
ATOM   436   H  HD2  . HIS A 1 26  ? 9.916   -7.771  -16.454 1.00 0.00 ? 26  HIS A HD2  1  
ATOM   437   H  HE1  . HIS A 1 26  ? 6.815   -9.934  -18.329 1.00 0.00 ? 26  HIS A HE1  1  
ATOM   438   H  HE2  . HIS A 1 26  ? 9.178   -10.085 -17.410 1.00 0.00 ? 26  HIS A HE2  1  
ATOM   439   N  N    . GLU A 1 27  ? 5.204   -5.395  -15.100 1.00 0.00 ? 27  GLU A N    1  
ATOM   440   C  CA   . GLU A 1 27  ? 4.196   -5.927  -14.188 1.00 0.00 ? 27  GLU A CA   1  
ATOM   441   C  C    . GLU A 1 27  ? 4.162   -5.119  -12.893 1.00 0.00 ? 27  GLU A C    1  
ATOM   442   O  O    . GLU A 1 27  ? 5.167   -4.537  -12.486 1.00 0.00 ? 27  GLU A O    1  
ATOM   443   C  CB   . GLU A 1 27  ? 4.499   -7.397  -13.875 1.00 0.00 ? 27  GLU A CB   1  
ATOM   444   C  CG   . GLU A 1 27  ? 6.014   -7.615  -13.839 1.00 0.00 ? 27  GLU A CG   1  
ATOM   445   C  CD   . GLU A 1 27  ? 6.338   -8.902  -13.089 1.00 0.00 ? 27  GLU A CD   1  
ATOM   446   O  OE1  . GLU A 1 27  ? 5.410   -9.539  -12.616 1.00 0.00 ? 27  GLU A OE1  1  
ATOM   447   O  OE2  . GLU A 1 27  ? 7.508   -9.233  -12.997 1.00 0.00 ? 27  GLU A OE2  1  
ATOM   448   H  H    . GLU A 1 27  ? 5.820   -4.703  -14.788 1.00 0.00 ? 27  GLU A H    1  
ATOM   449   H  HA   . GLU A 1 27  ? 3.229   -5.867  -14.662 1.00 0.00 ? 27  GLU A HA   1  
ATOM   450   H  HB2  . GLU A 1 27  ? 4.074   -7.657  -12.917 1.00 0.00 ? 27  GLU A HB2  1  
ATOM   451   H  HB3  . GLU A 1 27  ? 4.067   -8.022  -14.642 1.00 0.00 ? 27  GLU A HB3  1  
ATOM   452   H  HG2  . GLU A 1 27  ? 6.389   -7.685  -14.850 1.00 0.00 ? 27  GLU A HG2  1  
ATOM   453   H  HG3  . GLU A 1 27  ? 6.484   -6.782  -13.339 1.00 0.00 ? 27  GLU A HG3  1  
ATOM   454   N  N    . THR A 1 28  ? 2.996   -5.085  -12.252 1.00 0.00 ? 28  THR A N    1  
ATOM   455   C  CA   . THR A 1 28  ? 2.838   -4.342  -11.007 1.00 0.00 ? 28  THR A CA   1  
ATOM   456   C  C    . THR A 1 28  ? 3.792   -4.875  -9.942  1.00 0.00 ? 28  THR A C    1  
ATOM   457   O  O    . THR A 1 28  ? 4.639   -5.722  -10.222 1.00 0.00 ? 28  THR A O    1  
ATOM   458   C  CB   . THR A 1 28  ? 1.393   -4.453  -10.510 1.00 0.00 ? 28  THR A CB   1  
ATOM   459   O  OG1  . THR A 1 28  ? 1.340   -4.136  -9.126  1.00 0.00 ? 28  THR A OG1  1  
ATOM   460   C  CG2  . THR A 1 28  ? 0.884   -5.877  -10.729 1.00 0.00 ? 28  THR A CG2  1  
ATOM   461   H  H    . THR A 1 28  ? 2.228   -5.566  -12.626 1.00 0.00 ? 28  THR A H    1  
ATOM   462   H  HA   . THR A 1 28  ? 3.064   -3.302  -11.190 1.00 0.00 ? 28  THR A HA   1  
ATOM   463   H  HB   . THR A 1 28  ? 0.770   -3.765  -11.060 1.00 0.00 ? 28  THR A HB   1  
ATOM   464   H  HG1  . THR A 1 28  ? 0.694   -3.437  -9.006  1.00 0.00 ? 28  THR A HG1  1  
ATOM   465   H  HG21 . THR A 1 28  ? -0.006  -6.038  -10.137 1.00 0.00 ? 28  THR A HG21 1  
ATOM   466   H  HG22 . THR A 1 28  ? 1.645   -6.577  -10.429 1.00 0.00 ? 28  THR A HG22 1  
ATOM   467   H  HG23 . THR A 1 28  ? 0.654   -6.021  -11.774 1.00 0.00 ? 28  THR A HG23 1  
ATOM   468   N  N    . TYR A 1 29  ? 3.646   -4.368  -8.721  1.00 0.00 ? 29  TYR A N    1  
ATOM   469   C  CA   . TYR A 1 29  ? 4.495   -4.787  -7.610  1.00 0.00 ? 29  TYR A CA   1  
ATOM   470   C  C    . TYR A 1 29  ? 4.209   -3.923  -6.381  1.00 0.00 ? 29  TYR A C    1  
ATOM   471   O  O    . TYR A 1 29  ? 4.275   -2.695  -6.447  1.00 0.00 ? 29  TYR A O    1  
ATOM   472   C  CB   . TYR A 1 29  ? 5.972   -4.671  -8.011  1.00 0.00 ? 29  TYR A CB   1  
ATOM   473   C  CG   . TYR A 1 29  ? 6.850   -4.666  -6.781  1.00 0.00 ? 29  TYR A CG   1  
ATOM   474   C  CD1  . TYR A 1 29  ? 6.939   -5.810  -5.981  1.00 0.00 ? 29  TYR A CD1  1  
ATOM   475   C  CD2  . TYR A 1 29  ? 7.577   -3.518  -6.447  1.00 0.00 ? 29  TYR A CD2  1  
ATOM   476   C  CE1  . TYR A 1 29  ? 7.756   -5.807  -4.844  1.00 0.00 ? 29  TYR A CE1  1  
ATOM   477   C  CE2  . TYR A 1 29  ? 8.394   -3.514  -5.310  1.00 0.00 ? 29  TYR A CE2  1  
ATOM   478   C  CZ   . TYR A 1 29  ? 8.483   -4.659  -4.509  1.00 0.00 ? 29  TYR A CZ   1  
ATOM   479   O  OH   . TYR A 1 29  ? 9.290   -4.656  -3.389  1.00 0.00 ? 29  TYR A OH   1  
ATOM   480   H  H    . TYR A 1 29  ? 2.951   -3.695  -8.564  1.00 0.00 ? 29  TYR A H    1  
ATOM   481   H  HA   . TYR A 1 29  ? 4.276   -5.817  -7.372  1.00 0.00 ? 29  TYR A HA   1  
ATOM   482   H  HB2  . TYR A 1 29  ? 6.241   -5.511  -8.632  1.00 0.00 ? 29  TYR A HB2  1  
ATOM   483   H  HB3  . TYR A 1 29  ? 6.123   -3.755  -8.561  1.00 0.00 ? 29  TYR A HB3  1  
ATOM   484   H  HD1  . TYR A 1 29  ? 6.377   -6.696  -6.239  1.00 0.00 ? 29  TYR A HD1  1  
ATOM   485   H  HD2  . TYR A 1 29  ? 7.507   -2.636  -7.065  1.00 0.00 ? 29  TYR A HD2  1  
ATOM   486   H  HE1  . TYR A 1 29  ? 7.825   -6.690  -4.227  1.00 0.00 ? 29  TYR A HE1  1  
ATOM   487   H  HE2  . TYR A 1 29  ? 8.955   -2.629  -5.052  1.00 0.00 ? 29  TYR A HE2  1  
ATOM   488   H  HH   . TYR A 1 29  ? 9.493   -3.743  -3.173  1.00 0.00 ? 29  TYR A HH   1  
ATOM   489   N  N    . LEU A 1 30  ? 3.885   -4.571  -5.266  1.00 0.00 ? 30  LEU A N    1  
ATOM   490   C  CA   . LEU A 1 30  ? 3.579   -3.851  -4.034  1.00 0.00 ? 30  LEU A CA   1  
ATOM   491   C  C    . LEU A 1 30  ? 3.379   -4.833  -2.884  1.00 0.00 ? 30  LEU A C    1  
ATOM   492   O  O    . LEU A 1 30  ? 3.059   -5.999  -3.112  1.00 0.00 ? 30  LEU A O    1  
ATOM   493   C  CB   . LEU A 1 30  ? 2.306   -3.020  -4.233  1.00 0.00 ? 30  LEU A CB   1  
ATOM   494   C  CG   . LEU A 1 30  ? 1.066   -3.941  -4.249  1.00 0.00 ? 30  LEU A CG   1  
ATOM   495   C  CD1  . LEU A 1 30  ? 0.360   -3.905  -2.885  1.00 0.00 ? 30  LEU A CD1  1  
ATOM   496   C  CD2  . LEU A 1 30  ? 0.088   -3.472  -5.332  1.00 0.00 ? 30  LEU A CD2  1  
ATOM   497   H  H    . LEU A 1 30  ? 3.841   -5.550  -5.275  1.00 0.00 ? 30  LEU A H    1  
ATOM   498   H  HA   . LEU A 1 30  ? 4.397   -3.189  -3.797  1.00 0.00 ? 30  LEU A HA   1  
ATOM   499   H  HB2  . LEU A 1 30  ? 2.216   -2.309  -3.433  1.00 0.00 ? 30  LEU A HB2  1  
ATOM   500   H  HB3  . LEU A 1 30  ? 2.377   -2.490  -5.173  1.00 0.00 ? 30  LEU A HB3  1  
ATOM   501   H  HG   . LEU A 1 30  ? 1.372   -4.955  -4.461  1.00 0.00 ? 30  LEU A HG   1  
ATOM   502   H  HD11 . LEU A 1 30  ? 0.963   -4.419  -2.153  1.00 0.00 ? 30  LEU A HD11 1  
ATOM   503   H  HD12 . LEU A 1 30  ? -0.601  -4.392  -2.965  1.00 0.00 ? 30  LEU A HD12 1  
ATOM   504   H  HD13 . LEU A 1 30  ? 0.215   -2.880  -2.578  1.00 0.00 ? 30  LEU A HD13 1  
ATOM   505   H  HD21 . LEU A 1 30  ? -0.915  -3.774  -5.069  1.00 0.00 ? 30  LEU A HD21 1  
ATOM   506   H  HD22 . LEU A 1 30  ? 0.362   -3.915  -6.276  1.00 0.00 ? 30  LEU A HD22 1  
ATOM   507   H  HD23 . LEU A 1 30  ? 0.130   -2.396  -5.414  1.00 0.00 ? 30  LEU A HD23 1  
ATOM   508   N  N    . CYS A 1 31  ? 3.552   -4.365  -1.643  1.00 0.00 ? 31  CYS A N    1  
ATOM   509   C  CA   . CYS A 1 31  ? 3.366   -5.237  -0.487  1.00 0.00 ? 31  CYS A CA   1  
ATOM   510   C  C    . CYS A 1 31  ? 2.132   -4.788  0.289   1.00 0.00 ? 31  CYS A C    1  
ATOM   511   O  O    . CYS A 1 31  ? 1.807   -3.601  0.307   1.00 0.00 ? 31  CYS A O    1  
ATOM   512   C  CB   . CYS A 1 31  ? 4.617   -5.216  0.409   1.00 0.00 ? 31  CYS A CB   1  
ATOM   513   S  SG   . CYS A 1 31  ? 5.942   -4.306  -0.423  1.00 0.00 ? 31  CYS A SG   1  
ATOM   514   H  H    . CYS A 1 31  ? 3.795   -3.418  -1.500  1.00 0.00 ? 31  CYS A H    1  
ATOM   515   H  HA   . CYS A 1 31  ? 3.207   -6.246  -0.832  1.00 0.00 ? 31  CYS A HA   1  
ATOM   516   H  HB2  . CYS A 1 31  ? 4.391   -4.739  1.350   1.00 0.00 ? 31  CYS A HB2  1  
ATOM   517   H  HB3  . CYS A 1 31  ? 4.944   -6.232  0.594   1.00 0.00 ? 31  CYS A HB3  1  
ATOM   518   H  HG   . CYS A 1 31  ? 6.674   -4.910  -0.564  1.00 0.00 ? 31  CYS A HG   1  
ATOM   519   N  N    . TYR A 1 32  ? 1.438   -5.732  0.919   1.00 0.00 ? 32  TYR A N    1  
ATOM   520   C  CA   . TYR A 1 32  ? 0.242   -5.388  1.673   1.00 0.00 ? 32  TYR A CA   1  
ATOM   521   C  C    . TYR A 1 32  ? 0.086   -6.327  2.863   1.00 0.00 ? 32  TYR A C    1  
ATOM   522   O  O    . TYR A 1 32  ? 0.229   -7.542  2.738   1.00 0.00 ? 32  TYR A O    1  
ATOM   523   C  CB   . TYR A 1 32  ? -0.997  -5.437  0.748   1.00 0.00 ? 32  TYR A CB   1  
ATOM   524   C  CG   . TYR A 1 32  ? -1.889  -6.612  1.087   1.00 0.00 ? 32  TYR A CG   1  
ATOM   525   C  CD1  . TYR A 1 32  ? -1.534  -7.900  0.677   1.00 0.00 ? 32  TYR A CD1  1  
ATOM   526   C  CD2  . TYR A 1 32  ? -3.067  -6.406  1.814   1.00 0.00 ? 32  TYR A CD2  1  
ATOM   527   C  CE1  . TYR A 1 32  ? -2.358  -8.986  0.993   1.00 0.00 ? 32  TYR A CE1  1  
ATOM   528   C  CE2  . TYR A 1 32  ? -3.891  -7.491  2.130   1.00 0.00 ? 32  TYR A CE2  1  
ATOM   529   C  CZ   . TYR A 1 32  ? -3.536  -8.783  1.720   1.00 0.00 ? 32  TYR A CZ   1  
ATOM   530   O  OH   . TYR A 1 32  ? -4.349  -9.855  2.030   1.00 0.00 ? 32  TYR A OH   1  
ATOM   531   H  H    . TYR A 1 32  ? 1.733   -6.672  0.878   1.00 0.00 ? 32  TYR A H    1  
ATOM   532   H  HA   . TYR A 1 32  ? 0.351   -4.378  2.050   1.00 0.00 ? 32  TYR A HA   1  
ATOM   533   H  HB2  . TYR A 1 32  ? -1.562  -4.523  0.859   1.00 0.00 ? 32  TYR A HB2  1  
ATOM   534   H  HB3  . TYR A 1 32  ? -0.668  -5.525  -0.278  1.00 0.00 ? 32  TYR A HB3  1  
ATOM   535   H  HD1  . TYR A 1 32  ? -0.624  -8.057  0.117   1.00 0.00 ? 32  TYR A HD1  1  
ATOM   536   H  HD2  . TYR A 1 32  ? -3.341  -5.410  2.130   1.00 0.00 ? 32  TYR A HD2  1  
ATOM   537   H  HE1  . TYR A 1 32  ? -2.083  -9.981  0.677   1.00 0.00 ? 32  TYR A HE1  1  
ATOM   538   H  HE2  . TYR A 1 32  ? -4.799  -7.334  2.692   1.00 0.00 ? 32  TYR A HE2  1  
ATOM   539   H  HH   . TYR A 1 32  ? -4.203  -10.082 2.951   1.00 0.00 ? 32  TYR A HH   1  
ATOM   540   N  N    . GLU A 1 33  ? -0.186  -5.742  4.015   1.00 0.00 ? 33  GLU A N    1  
ATOM   541   C  CA   . GLU A 1 33  ? -0.343  -6.499  5.238   1.00 0.00 ? 33  GLU A CA   1  
ATOM   542   C  C    . GLU A 1 33  ? -1.694  -6.204  5.874   1.00 0.00 ? 33  GLU A C    1  
ATOM   543   O  O    . GLU A 1 33  ? -2.016  -5.054  6.161   1.00 0.00 ? 33  GLU A O    1  
ATOM   544   C  CB   . GLU A 1 33  ? 0.790   -6.096  6.173   1.00 0.00 ? 33  GLU A CB   1  
ATOM   545   C  CG   . GLU A 1 33  ? 2.100   -6.686  5.644   1.00 0.00 ? 33  GLU A CG   1  
ATOM   546   C  CD   . GLU A 1 33  ? 3.181   -6.604  6.716   1.00 0.00 ? 33  GLU A CD   1  
ATOM   547   O  OE1  . GLU A 1 33  ? 2.976   -7.165  7.781   1.00 0.00 ? 33  GLU A OE1  1  
ATOM   548   O  OE2  . GLU A 1 33  ? 4.198   -5.980  6.459   1.00 0.00 ? 33  GLU A OE2  1  
ATOM   549   H  H    . GLU A 1 33  ? -0.269  -4.773  4.048   1.00 0.00 ? 33  GLU A H    1  
ATOM   550   H  HA   . GLU A 1 33  ? -0.272  -7.555  5.027   1.00 0.00 ? 33  GLU A HA   1  
ATOM   551   H  HB2  . GLU A 1 33  ? 0.868   -5.023  6.193   1.00 0.00 ? 33  GLU A HB2  1  
ATOM   552   H  HB3  . GLU A 1 33  ? 0.597   -6.456  7.163   1.00 0.00 ? 33  GLU A HB3  1  
ATOM   553   H  HG2  . GLU A 1 33  ? 1.943   -7.716  5.365   1.00 0.00 ? 33  GLU A HG2  1  
ATOM   554   H  HG3  . GLU A 1 33  ? 2.412   -6.127  4.772   1.00 0.00 ? 33  GLU A HG3  1  
ATOM   555   N  N    . VAL A 1 34  ? -2.493  -7.249  6.085   1.00 0.00 ? 34  VAL A N    1  
ATOM   556   C  CA   . VAL A 1 34  ? -3.815  -7.071  6.680   1.00 0.00 ? 34  VAL A CA   1  
ATOM   557   C  C    . VAL A 1 34  ? -4.022  -7.993  7.867   1.00 0.00 ? 34  VAL A C    1  
ATOM   558   O  O    . VAL A 1 34  ? -3.384  -9.039  7.978   1.00 0.00 ? 34  VAL A O    1  
ATOM   559   C  CB   . VAL A 1 34  ? -4.909  -7.358  5.649   1.00 0.00 ? 34  VAL A CB   1  
ATOM   560   C  CG1  . VAL A 1 34  ? -4.699  -8.746  5.040   1.00 0.00 ? 34  VAL A CG1  1  
ATOM   561   C  CG2  . VAL A 1 34  ? -6.275  -7.308  6.349   1.00 0.00 ? 34  VAL A CG2  1  
ATOM   562   H  H    . VAL A 1 34  ? -2.194  -8.146  5.829   1.00 0.00 ? 34  VAL A H    1  
ATOM   563   H  HA   . VAL A 1 34  ? -3.919  -6.051  7.012   1.00 0.00 ? 34  VAL A HA   1  
ATOM   564   H  HB   . VAL A 1 34  ? -4.870  -6.624  4.866   1.00 0.00 ? 34  VAL A HB   1  
ATOM   565   H  HG11 . VAL A 1 34  ? -4.827  -9.500  5.803   1.00 0.00 ? 34  VAL A HG11 1  
ATOM   566   H  HG12 . VAL A 1 34  ? -3.703  -8.813  4.630   1.00 0.00 ? 34  VAL A HG12 1  
ATOM   567   H  HG13 . VAL A 1 34  ? -5.423  -8.906  4.253   1.00 0.00 ? 34  VAL A HG13 1  
ATOM   568   H  HG21 . VAL A 1 34  ? -6.457  -8.250  6.843   1.00 0.00 ? 34  VAL A HG21 1  
ATOM   569   H  HG22 . VAL A 1 34  ? -7.051  -7.123  5.622   1.00 0.00 ? 34  VAL A HG22 1  
ATOM   570   H  HG23 . VAL A 1 34  ? -6.278  -6.516  7.084   1.00 0.00 ? 34  VAL A HG23 1  
ATOM   571   N  N    . GLU A 1 35  ? -4.944  -7.601  8.741   1.00 0.00 ? 35  GLU A N    1  
ATOM   572   C  CA   . GLU A 1 35  ? -5.269  -8.401  9.910   1.00 0.00 ? 35  GLU A CA   1  
ATOM   573   C  C    . GLU A 1 35  ? -6.782  -8.466  10.085  1.00 0.00 ? 35  GLU A C    1  
ATOM   574   O  O    . GLU A 1 35  ? -7.497  -7.522  9.744   1.00 0.00 ? 35  GLU A O    1  
ATOM   575   C  CB   . GLU A 1 35  ? -4.592  -7.820  11.166  1.00 0.00 ? 35  GLU A CB   1  
ATOM   576   C  CG   . GLU A 1 35  ? -5.537  -6.846  11.882  1.00 0.00 ? 35  GLU A CG   1  
ATOM   577   C  CD   . GLU A 1 35  ? -4.744  -5.908  12.789  1.00 0.00 ? 35  GLU A CD   1  
ATOM   578   O  OE1  . GLU A 1 35  ? -3.545  -5.799  12.595  1.00 0.00 ? 35  GLU A OE1  1  
ATOM   579   O  OE2  . GLU A 1 35  ? -5.350  -5.314  13.666  1.00 0.00 ? 35  GLU A OE2  1  
ATOM   580   H  H    . GLU A 1 35  ? -5.429  -6.763  8.586   1.00 0.00 ? 35  GLU A H    1  
ATOM   581   H  HA   . GLU A 1 35  ? -4.903  -9.403  9.750   1.00 0.00 ? 35  GLU A HA   1  
ATOM   582   H  HB2  . GLU A 1 35  ? -4.334  -8.626  11.837  1.00 0.00 ? 35  GLU A HB2  1  
ATOM   583   H  HB3  . GLU A 1 35  ? -3.693  -7.297  10.875  1.00 0.00 ? 35  GLU A HB3  1  
ATOM   584   H  HG2  . GLU A 1 35  ? -6.075  -6.267  11.148  1.00 0.00 ? 35  GLU A HG2  1  
ATOM   585   H  HG3  . GLU A 1 35  ? -6.240  -7.408  12.479  1.00 0.00 ? 35  GLU A HG3  1  
ATOM   586   N  N    . ARG A 1 36  ? -7.265  -9.584  10.609  1.00 0.00 ? 36  ARG A N    1  
ATOM   587   C  CA   . ARG A 1 36  ? -8.697  -9.766  10.815  1.00 0.00 ? 36  ARG A CA   1  
ATOM   588   C  C    . ARG A 1 36  ? -9.047  -9.607  12.290  1.00 0.00 ? 36  ARG A C    1  
ATOM   589   O  O    . ARG A 1 36  ? -8.346  -10.116 13.167  1.00 0.00 ? 36  ARG A O    1  
ATOM   590   C  CB   . ARG A 1 36  ? -9.138  -11.158 10.326  1.00 0.00 ? 36  ARG A CB   1  
ATOM   591   C  CG   . ARG A 1 36  ? -8.149  -11.690 9.278   1.00 0.00 ? 36  ARG A CG   1  
ATOM   592   C  CD   . ARG A 1 36  ? -8.535  -13.121 8.871   1.00 0.00 ? 36  ARG A CD   1  
ATOM   593   N  NE   . ARG A 1 36  ? -7.643  -14.078 9.527   1.00 0.00 ? 36  ARG A NE   1  
ATOM   594   C  CZ   . ARG A 1 36  ? -8.100  -15.047 10.324  1.00 0.00 ? 36  ARG A CZ   1  
ATOM   595   N  NH1  . ARG A 1 36  ? -9.381  -15.191 10.545  1.00 0.00 ? 36  ARG A NH1  1  
ATOM   596   N  NH2  . ARG A 1 36  ? -7.255  -15.863 10.892  1.00 0.00 ? 36  ARG A NH2  1  
ATOM   597   H  H    . ARG A 1 36  ? -6.648  -10.302 10.857  1.00 0.00 ? 36  ARG A H    1  
ATOM   598   H  HA   . ARG A 1 36  ? -9.231  -9.017  10.249  1.00 0.00 ? 36  ARG A HA   1  
ATOM   599   H  HB2  . ARG A 1 36  ? -9.175  -11.844 11.161  1.00 0.00 ? 36  ARG A HB2  1  
ATOM   600   H  HB3  . ARG A 1 36  ? -10.120 -11.084 9.881   1.00 0.00 ? 36  ARG A HB3  1  
ATOM   601   H  HG2  . ARG A 1 36  ? -8.168  -11.049 8.408   1.00 0.00 ? 36  ARG A HG2  1  
ATOM   602   H  HG3  . ARG A 1 36  ? -7.152  -11.699 9.694   1.00 0.00 ? 36  ARG A HG3  1  
ATOM   603   H  HD2  . ARG A 1 36  ? -9.555  -13.318 9.154   1.00 0.00 ? 36  ARG A HD2  1  
ATOM   604   H  HD3  . ARG A 1 36  ? -8.441  -13.224 7.799   1.00 0.00 ? 36  ARG A HD3  1  
ATOM   605   H  HE   . ARG A 1 36  ? -6.678  -14.003 9.382   1.00 0.00 ? 36  ARG A HE   1  
ATOM   606   H  HH11 . ARG A 1 36  ? -10.038 -14.573 10.120  1.00 0.00 ? 36  ARG A HH11 1  
ATOM   607   H  HH12 . ARG A 1 36  ? -9.705  -15.925 11.143  1.00 0.00 ? 36  ARG A HH12 1  
ATOM   608   H  HH21 . ARG A 1 36  ? -6.274  -15.759 10.725  1.00 0.00 ? 36  ARG A HH21 1  
ATOM   609   H  HH22 . ARG A 1 36  ? -7.586  -16.590 11.492  1.00 0.00 ? 36  ARG A HH22 1  
ATOM   610   N  N    . MET A 1 37  ? -10.140 -8.904  12.557  1.00 0.00 ? 37  MET A N    1  
ATOM   611   C  CA   . MET A 1 37  ? -10.579 -8.696  13.928  1.00 0.00 ? 37  MET A CA   1  
ATOM   612   C  C    . MET A 1 37  ? -11.684 -9.672  14.276  1.00 0.00 ? 37  MET A C    1  
ATOM   613   O  O    . MET A 1 37  ? -12.521 -9.988  13.434  1.00 0.00 ? 37  MET A O    1  
ATOM   614   C  CB   . MET A 1 37  ? -11.099 -7.281  14.125  1.00 0.00 ? 37  MET A CB   1  
ATOM   615   C  CG   . MET A 1 37  ? -9.988  -6.265  13.847  1.00 0.00 ? 37  MET A CG   1  
ATOM   616   S  SD   . MET A 1 37  ? -10.499 -4.634  14.441  1.00 0.00 ? 37  MET A SD   1  
ATOM   617   C  CE   . MET A 1 37  ? -10.670 -5.086  16.182  1.00 0.00 ? 37  MET A CE   1  
ATOM   618   H  H    . MET A 1 37  ? -10.663 -8.527  11.819  1.00 0.00 ? 37  MET A H    1  
ATOM   619   H  HA   . MET A 1 37  ? -9.751  -8.854  14.593  1.00 0.00 ? 37  MET A HA   1  
ATOM   620   H  HB2  . MET A 1 37  ? -11.921 -7.105  13.462  1.00 0.00 ? 37  MET A HB2  1  
ATOM   621   H  HB3  . MET A 1 37  ? -11.440 -7.180  15.135  1.00 0.00 ? 37  MET A HB3  1  
ATOM   622   H  HG2  . MET A 1 37  ? -9.087  -6.567  14.358  1.00 0.00 ? 37  MET A HG2  1  
ATOM   623   H  HG3  . MET A 1 37  ? -9.802  -6.219  12.785  1.00 0.00 ? 37  MET A HG3  1  
ATOM   624   H  HE1  . MET A 1 37  ? -11.699 -5.357  16.384  1.00 0.00 ? 37  MET A HE1  1  
ATOM   625   H  HE2  . MET A 1 37  ? -10.383 -4.254  16.799  1.00 0.00 ? 37  MET A HE2  1  
ATOM   626   H  HE3  . MET A 1 37  ? -10.032 -5.929  16.394  1.00 0.00 ? 37  MET A HE3  1  
ATOM   627   N  N    . HIS A 1 38  ? -11.694 -10.124 15.527  1.00 0.00 ? 38  HIS A N    1  
ATOM   628   C  CA   . HIS A 1 38  ? -12.715 -11.050 15.995  1.00 0.00 ? 38  HIS A CA   1  
ATOM   629   C  C    . HIS A 1 38  ? -13.516 -10.373 17.084  1.00 0.00 ? 38  HIS A C    1  
ATOM   630   O  O    . HIS A 1 38  ? -13.079 -10.287 18.225  1.00 0.00 ? 38  HIS A O    1  
ATOM   631   C  CB   . HIS A 1 38  ? -12.066 -12.324 16.544  1.00 0.00 ? 38  HIS A CB   1  
ATOM   632   C  CG   . HIS A 1 38  ? -13.091 -13.127 17.297  1.00 0.00 ? 38  HIS A CG   1  
ATOM   633   N  ND1  . HIS A 1 38  ? -13.723 -12.639 18.430  1.00 0.00 ? 38  HIS A ND1  1  
ATOM   634   C  CD2  . HIS A 1 38  ? -13.607 -14.382 17.090  1.00 0.00 ? 38  HIS A CD2  1  
ATOM   635   C  CE1  . HIS A 1 38  ? -14.577 -13.587 18.858  1.00 0.00 ? 38  HIS A CE1  1  
ATOM   636   N  NE2  . HIS A 1 38  ? -14.545 -14.670 18.076  1.00 0.00 ? 38  HIS A NE2  1  
ATOM   637   H  H    . HIS A 1 38  ? -11.013 -9.808  16.161  1.00 0.00 ? 38  HIS A H    1  
ATOM   638   H  HA   . HIS A 1 38  ? -13.371 -11.309 15.175  1.00 0.00 ? 38  HIS A HA   1  
ATOM   639   H  HB2  . HIS A 1 38  ? -11.679 -12.913 15.725  1.00 0.00 ? 38  HIS A HB2  1  
ATOM   640   H  HB3  . HIS A 1 38  ? -11.257 -12.057 17.211  1.00 0.00 ? 38  HIS A HB3  1  
ATOM   641   H  HD1  . HIS A 1 38  ? -13.574 -11.765 18.846  1.00 0.00 ? 38  HIS A HD1  1  
ATOM   642   H  HD2  . HIS A 1 38  ? -13.326 -15.046 16.286  1.00 0.00 ? 38  HIS A HD2  1  
ATOM   643   H  HE1  . HIS A 1 38  ? -15.210 -13.485 19.726  1.00 0.00 ? 38  HIS A HE1  1  
ATOM   644   H  HE2  . HIS A 1 38  ? -15.073 -15.491 18.174  1.00 0.00 ? 38  HIS A HE2  1  
ATOM   645   N  N    . ASN A 1 39  ? -14.675 -9.862  16.734  1.00 0.00 ? 39  ASN A N    1  
ATOM   646   C  CA   . ASN A 1 39  ? -15.479 -9.173  17.717  1.00 0.00 ? 39  ASN A CA   1  
ATOM   647   C  C    . ASN A 1 39  ? -14.758 -7.907  18.156  1.00 0.00 ? 39  ASN A C    1  
ATOM   648   O  O    . ASN A 1 39  ? -13.896 -7.386  17.448  1.00 0.00 ? 39  ASN A O    1  
ATOM   649   C  CB   . ASN A 1 39  ? -15.705 -10.073 18.937  1.00 0.00 ? 39  ASN A CB   1  
ATOM   650   C  CG   . ASN A 1 39  ? -16.925 -9.610  19.711  1.00 0.00 ? 39  ASN A CG   1  
ATOM   651   O  OD1  . ASN A 1 39  ? -17.604 -8.665  19.305  1.00 0.00 ? 39  ASN A OD1  1  
ATOM   652   N  ND2  . ASN A 1 39  ? -17.248 -10.227 20.809  1.00 0.00 ? 39  ASN A ND2  1  
ATOM   653   H  H    . ASN A 1 39  ? -14.983 -9.929  15.806  1.00 0.00 ? 39  ASN A H    1  
ATOM   654   H  HA   . ASN A 1 39  ? -16.432 -8.912  17.284  1.00 0.00 ? 39  ASN A HA   1  
ATOM   655   H  HB2  . ASN A 1 39  ? -15.861 -11.090 18.612  1.00 0.00 ? 39  ASN A HB2  1  
ATOM   656   H  HB3  . ASN A 1 39  ? -14.837 -10.030 19.587  1.00 0.00 ? 39  ASN A HB3  1  
ATOM   657   H  HD21 . ASN A 1 39  ? -16.703 -10.982 21.126  1.00 0.00 ? 39  ASN A HD21 1  
ATOM   658   H  HD22 . ASN A 1 39  ? -18.030 -9.940  21.315  1.00 0.00 ? 39  ASN A HD22 1  
ATOM   659   N  N    . ASP A 1 40  ? -15.122 -7.427  19.326  1.00 0.00 ? 40  ASP A N    1  
ATOM   660   C  CA   . ASP A 1 40  ? -14.528 -6.222  19.883  1.00 0.00 ? 40  ASP A CA   1  
ATOM   661   C  C    . ASP A 1 40  ? -13.006 -6.310  19.998  1.00 0.00 ? 40  ASP A C    1  
ATOM   662   O  O    . ASP A 1 40  ? -12.402 -5.455  20.645  1.00 0.00 ? 40  ASP A O    1  
ATOM   663   C  CB   . ASP A 1 40  ? -15.098 -5.975  21.277  1.00 0.00 ? 40  ASP A CB   1  
ATOM   664   C  CG   . ASP A 1 40  ? -16.492 -5.368  21.176  1.00 0.00 ? 40  ASP A CG   1  
ATOM   665   O  OD1  . ASP A 1 40  ? -17.042 -5.374  20.087  1.00 0.00 ? 40  ASP A OD1  1  
ATOM   666   O  OD2  . ASP A 1 40  ? -16.989 -4.903  22.189  1.00 0.00 ? 40  ASP A OD2  1  
ATOM   667   H  H    . ASP A 1 40  ? -15.817 -7.891  19.828  1.00 0.00 ? 40  ASP A H    1  
ATOM   668   H  HA   . ASP A 1 40  ? -14.786 -5.385  19.256  1.00 0.00 ? 40  ASP A HA   1  
ATOM   669   H  HB2  . ASP A 1 40  ? -15.150 -6.915  21.810  1.00 0.00 ? 40  ASP A HB2  1  
ATOM   670   H  HB3  . ASP A 1 40  ? -14.448 -5.300  21.813  1.00 0.00 ? 40  ASP A HB3  1  
ATOM   671   N  N    . THR A 1 41  ? -12.369 -7.338  19.418  1.00 0.00 ? 41  THR A N    1  
ATOM   672   C  CA   . THR A 1 41  ? -10.925 -7.459  19.548  1.00 0.00 ? 41  THR A CA   1  
ATOM   673   C  C    . THR A 1 41  ? -10.236 -7.715  18.219  1.00 0.00 ? 41  THR A C    1  
ATOM   674   O  O    . THR A 1 41  ? -10.881 -7.877  17.187  1.00 0.00 ? 41  THR A O    1  
ATOM   675   C  CB   . THR A 1 41  ? -10.603 -8.542  20.565  1.00 0.00 ? 41  THR A CB   1  
ATOM   676   O  OG1  . THR A 1 41  ? -9.343  -8.269  21.162  1.00 0.00 ? 41  THR A OG1  1  
ATOM   677   C  CG2  . THR A 1 41  ? -10.568 -9.918  19.902  1.00 0.00 ? 41  THR A CG2  1  
ATOM   678   H  H    . THR A 1 41  ? -12.864 -8.027  18.929  1.00 0.00 ? 41  THR A H    1  
ATOM   679   H  HA   . THR A 1 41  ? -10.543 -6.533  19.924  1.00 0.00 ? 41  THR A HA   1  
ATOM   680   H  HB   . THR A 1 41  ? -11.370 -8.530  21.320  1.00 0.00 ? 41  THR A HB   1  
ATOM   681   H  HG1  . THR A 1 41  ? -9.475  -7.608  21.846  1.00 0.00 ? 41  THR A HG1  1  
ATOM   682   H  HG21 . THR A 1 41  ? -11.086 -9.888  18.961  1.00 0.00 ? 41  THR A HG21 1  
ATOM   683   H  HG22 . THR A 1 41  ? -11.046 -10.636 20.551  1.00 0.00 ? 41  THR A HG22 1  
ATOM   684   H  HG23 . THR A 1 41  ? -9.545  -10.204 19.736  1.00 0.00 ? 41  THR A HG23 1  
ATOM   685   N  N    . TRP A 1 42  ? -8.912  -7.710  18.270  1.00 0.00 ? 42  TRP A N    1  
ATOM   686   C  CA   . TRP A 1 42  ? -8.090  -7.892  17.069  1.00 0.00 ? 42  TRP A CA   1  
ATOM   687   C  C    . TRP A 1 42  ? -7.359  -9.235  17.036  1.00 0.00 ? 42  TRP A C    1  
ATOM   688   O  O    . TRP A 1 42  ? -7.033  -9.809  18.075  1.00 0.00 ? 42  TRP A O    1  
ATOM   689   C  CB   . TRP A 1 42  ? -7.065  -6.753  16.982  1.00 0.00 ? 42  TRP A CB   1  
ATOM   690   C  CG   . TRP A 1 42  ? -5.896  -7.034  17.875  1.00 0.00 ? 42  TRP A CG   1  
ATOM   691   C  CD1  . TRP A 1 42  ? -5.964  -7.620  19.094  1.00 0.00 ? 42  TRP A CD1  1  
ATOM   692   C  CD2  . TRP A 1 42  ? -4.487  -6.750  17.638  1.00 0.00 ? 42  TRP A CD2  1  
ATOM   693   N  NE1  . TRP A 1 42  ? -4.688  -7.708  19.618  1.00 0.00 ? 42  TRP A NE1  1  
ATOM   694   C  CE2  . TRP A 1 42  ? -3.747  -7.187  18.760  1.00 0.00 ? 42  TRP A CE2  1  
ATOM   695   C  CE3  . TRP A 1 42  ? -3.787  -6.158  16.572  1.00 0.00 ? 42  TRP A CE3  1  
ATOM   696   C  CZ2  . TRP A 1 42  ? -2.364  -7.048  18.824  1.00 0.00 ? 42  TRP A CZ2  1  
ATOM   697   C  CZ3  . TRP A 1 42  ? -2.391  -6.016  16.632  1.00 0.00 ? 42  TRP A CZ3  1  
ATOM   698   C  CH2  . TRP A 1 42  ? -1.680  -6.460  17.756  1.00 0.00 ? 42  TRP A CH2  1  
ATOM   699   H  H    . TRP A 1 42  ? -8.483  -7.560  19.133  1.00 0.00 ? 42  TRP A H    1  
ATOM   700   H  HA   . TRP A 1 42  ? -8.725  -7.829  16.209  1.00 0.00 ? 42  TRP A HA   1  
ATOM   701   H  HB2  . TRP A 1 42  ? -6.719  -6.663  15.963  1.00 0.00 ? 42  TRP A HB2  1  
ATOM   702   H  HB3  . TRP A 1 42  ? -7.533  -5.828  17.284  1.00 0.00 ? 42  TRP A HB3  1  
ATOM   703   H  HD1  . TRP A 1 42  ? -6.862  -7.962  19.580  1.00 0.00 ? 42  TRP A HD1  1  
ATOM   704   H  HE1  . TRP A 1 42  ? -4.457  -8.091  20.489  1.00 0.00 ? 42  TRP A HE1  1  
ATOM   705   H  HE3  . TRP A 1 42  ? -4.325  -5.813  15.702  1.00 0.00 ? 42  TRP A HE3  1  
ATOM   706   H  HZ2  . TRP A 1 42  ? -1.828  -7.394  19.694  1.00 0.00 ? 42  TRP A HZ2  1  
ATOM   707   H  HZ3  . TRP A 1 42  ? -1.862  -5.562  15.807  1.00 0.00 ? 42  TRP A HZ3  1  
ATOM   708   H  HH2  . TRP A 1 42  ? -0.608  -6.348  17.798  1.00 0.00 ? 42  TRP A HH2  1  
ATOM   709   N  N    . VAL A 1 43  ? -7.084  -9.710  15.816  1.00 0.00 ? 43  VAL A N    1  
ATOM   710   C  CA   . VAL A 1 43  ? -6.365  -10.966 15.619  1.00 0.00 ? 43  VAL A CA   1  
ATOM   711   C  C    . VAL A 1 43  ? -5.233  -10.750 14.615  1.00 0.00 ? 43  VAL A C    1  
ATOM   712   O  O    . VAL A 1 43  ? -5.357  -9.933  13.703  1.00 0.00 ? 43  VAL A O    1  
ATOM   713   C  CB   . VAL A 1 43  ? -7.314  -12.049 15.102  1.00 0.00 ? 43  VAL A CB   1  
ATOM   714   C  CG1  . VAL A 1 43  ? -6.803  -13.426 15.530  1.00 0.00 ? 43  VAL A CG1  1  
ATOM   715   C  CG2  . VAL A 1 43  ? -8.712  -11.820 15.682  1.00 0.00 ? 43  VAL A CG2  1  
ATOM   716   H  H    . VAL A 1 43  ? -7.359  -9.193  15.029  1.00 0.00 ? 43  VAL A H    1  
ATOM   717   H  HA   . VAL A 1 43  ? -5.943  -11.283 16.562  1.00 0.00 ? 43  VAL A HA   1  
ATOM   718   H  HB   . VAL A 1 43  ? -7.354  -12.003 14.025  1.00 0.00 ? 43  VAL A HB   1  
ATOM   719   H  HG11 . VAL A 1 43  ? -7.370  -14.193 15.023  1.00 0.00 ? 43  VAL A HG11 1  
ATOM   720   H  HG12 . VAL A 1 43  ? -6.921  -13.537 16.598  1.00 0.00 ? 43  VAL A HG12 1  
ATOM   721   H  HG13 . VAL A 1 43  ? -5.759  -13.518 15.271  1.00 0.00 ? 43  VAL A HG13 1  
ATOM   722   H  HG21 . VAL A 1 43  ? -9.247  -12.757 15.712  1.00 0.00 ? 43  VAL A HG21 1  
ATOM   723   H  HG22 . VAL A 1 43  ? -9.249  -11.117 15.063  1.00 0.00 ? 43  VAL A HG22 1  
ATOM   724   H  HG23 . VAL A 1 43  ? -8.625  -11.424 16.683  1.00 0.00 ? 43  VAL A HG23 1  
ATOM   725   N  N    . LEU A 1 44  ? -4.130  -11.470 14.791  1.00 0.00 ? 44  LEU A N    1  
ATOM   726   C  CA   . LEU A 1 44  ? -2.984  -11.326 13.893  1.00 0.00 ? 44  LEU A CA   1  
ATOM   727   C  C    . LEU A 1 44  ? -2.616  -12.648 13.226  1.00 0.00 ? 44  LEU A C    1  
ATOM   728   O  O    . LEU A 1 44  ? -2.074  -13.551 13.866  1.00 0.00 ? 44  LEU A O    1  
ATOM   729   C  CB   . LEU A 1 44  ? -1.776  -10.809 14.674  1.00 0.00 ? 44  LEU A CB   1  
ATOM   730   C  CG   . LEU A 1 44  ? -0.716  -10.289 13.700  1.00 0.00 ? 44  LEU A CG   1  
ATOM   731   C  CD1  . LEU A 1 44  ? -1.229  -9.029  12.986  1.00 0.00 ? 44  LEU A CD1  1  
ATOM   732   C  CD2  . LEU A 1 44  ? 0.558   -9.955  14.481  1.00 0.00 ? 44  LEU A CD2  1  
ATOM   733   H  H    . LEU A 1 44  ? -4.082  -12.101 15.534  1.00 0.00 ? 44  LEU A H    1  
ATOM   734   H  HA   . LEU A 1 44  ? -3.226  -10.608 13.124  1.00 0.00 ? 44  LEU A HA   1  
ATOM   735   H  HB2  . LEU A 1 44  ? -2.087  -10.010 15.331  1.00 0.00 ? 44  LEU A HB2  1  
ATOM   736   H  HB3  . LEU A 1 44  ? -1.359  -11.614 15.260  1.00 0.00 ? 44  LEU A HB3  1  
ATOM   737   H  HG   . LEU A 1 44  ? -0.498  -11.052 12.966  1.00 0.00 ? 44  LEU A HG   1  
ATOM   738   H  HD11 . LEU A 1 44  ? -1.694  -9.310  12.052  1.00 0.00 ? 44  LEU A HD11 1  
ATOM   739   H  HD12 . LEU A 1 44  ? -0.404  -8.363  12.787  1.00 0.00 ? 44  LEU A HD12 1  
ATOM   740   H  HD13 . LEU A 1 44  ? -1.953  -8.525  13.609  1.00 0.00 ? 44  LEU A HD13 1  
ATOM   741   H  HD21 . LEU A 1 44  ? 1.202   -9.337  13.873  1.00 0.00 ? 44  LEU A HD21 1  
ATOM   742   H  HD22 . LEU A 1 44  ? 1.073   -10.869 14.739  1.00 0.00 ? 44  LEU A HD22 1  
ATOM   743   H  HD23 . LEU A 1 44  ? 0.295   -9.422  15.383  1.00 0.00 ? 44  LEU A HD23 1  
ATOM   744   N  N    . LEU A 1 45  ? -2.898  -12.744 11.933  1.00 0.00 ? 45  LEU A N    1  
ATOM   745   C  CA   . LEU A 1 45  ? -2.580  -13.948 11.170  1.00 0.00 ? 45  LEU A CA   1  
ATOM   746   C  C    . LEU A 1 45  ? -1.074  -14.215 11.201  1.00 0.00 ? 45  LEU A C    1  
ATOM   747   O  O    . LEU A 1 45  ? -0.296  -13.384 11.671  1.00 0.00 ? 45  LEU A O    1  
ATOM   748   C  CB   . LEU A 1 45  ? -3.054  -13.806 9.715   1.00 0.00 ? 45  LEU A CB   1  
ATOM   749   C  CG   . LEU A 1 45  ? -2.715  -12.411 9.169   1.00 0.00 ? 45  LEU A CG   1  
ATOM   750   C  CD1  . LEU A 1 45  ? -1.196  -12.223 9.117   1.00 0.00 ? 45  LEU A CD1  1  
ATOM   751   C  CD2  . LEU A 1 45  ? -3.293  -12.268 7.758   1.00 0.00 ? 45  LEU A CD2  1  
ATOM   752   H  H    . LEU A 1 45  ? -3.319  -11.987 11.484  1.00 0.00 ? 45  LEU A H    1  
ATOM   753   H  HA   . LEU A 1 45  ? -3.088  -14.788 11.620  1.00 0.00 ? 45  LEU A HA   1  
ATOM   754   H  HB2  . LEU A 1 45  ? -2.566  -14.556 9.108   1.00 0.00 ? 45  LEU A HB2  1  
ATOM   755   H  HB3  . LEU A 1 45  ? -4.122  -13.955 9.673   1.00 0.00 ? 45  LEU A HB3  1  
ATOM   756   H  HG   . LEU A 1 45  ? -3.146  -11.657 9.807   1.00 0.00 ? 45  LEU A HG   1  
ATOM   757   H  HD11 . LEU A 1 45  ? -0.849  -11.842 10.065  1.00 0.00 ? 45  LEU A HD11 1  
ATOM   758   H  HD12 . LEU A 1 45  ? -0.945  -11.520 8.337   1.00 0.00 ? 45  LEU A HD12 1  
ATOM   759   H  HD13 . LEU A 1 45  ? -0.722  -13.169 8.914   1.00 0.00 ? 45  LEU A HD13 1  
ATOM   760   H  HD21 . LEU A 1 45  ? -3.167  -11.251 7.418   1.00 0.00 ? 45  LEU A HD21 1  
ATOM   761   H  HD22 . LEU A 1 45  ? -4.344  -12.516 7.772   1.00 0.00 ? 45  LEU A HD22 1  
ATOM   762   H  HD23 . LEU A 1 45  ? -2.775  -12.937 7.086   1.00 0.00 ? 45  LEU A HD23 1  
ATOM   763   N  N    . ASN A 1 46  ? -0.669  -15.383 10.707  1.00 0.00 ? 46  ASN A N    1  
ATOM   764   C  CA   . ASN A 1 46  ? 0.746   -15.751 10.692  1.00 0.00 ? 46  ASN A CA   1  
ATOM   765   C  C    . ASN A 1 46  ? 1.394   -15.383 9.357   1.00 0.00 ? 46  ASN A C    1  
ATOM   766   O  O    . ASN A 1 46  ? 1.843   -16.257 8.615   1.00 0.00 ? 46  ASN A O    1  
ATOM   767   C  CB   . ASN A 1 46  ? 0.895   -17.256 10.930  1.00 0.00 ? 46  ASN A CB   1  
ATOM   768   C  CG   . ASN A 1 46  ? 0.164   -17.655 12.209  1.00 0.00 ? 46  ASN A CG   1  
ATOM   769   O  OD1  . ASN A 1 46  ? -0.591  -16.859 12.765  1.00 0.00 ? 46  ASN A OD1  1  
ATOM   770   N  ND2  . ASN A 1 46  ? 0.345   -18.846 12.710  1.00 0.00 ? 46  ASN A ND2  1  
ATOM   771   H  H    . ASN A 1 46  ? -1.332  -16.012 10.353  1.00 0.00 ? 46  ASN A H    1  
ATOM   772   H  HA   . ASN A 1 46  ? 1.255   -15.222 11.485  1.00 0.00 ? 46  ASN A HA   1  
ATOM   773   H  HB2  . ASN A 1 46  ? 0.475   -17.794 10.094  1.00 0.00 ? 46  ASN A HB2  1  
ATOM   774   H  HB3  . ASN A 1 46  ? 1.943   -17.504 11.026  1.00 0.00 ? 46  ASN A HB3  1  
ATOM   775   H  HD21 . ASN A 1 46  ? 0.947   -19.479 12.267  1.00 0.00 ? 46  ASN A HD21 1  
ATOM   776   H  HD22 . ASN A 1 46  ? -0.121  -19.108 13.533  1.00 0.00 ? 46  ASN A HD22 1  
ATOM   777   N  N    . GLN A 1 47  ? 1.445   -14.089 9.059   1.00 0.00 ? 47  GLN A N    1  
ATOM   778   C  CA   . GLN A 1 47  ? 2.049   -13.627 7.811   1.00 0.00 ? 47  GLN A CA   1  
ATOM   779   C  C    . GLN A 1 47  ? 2.683   -12.250 8.008   1.00 0.00 ? 47  GLN A C    1  
ATOM   780   O  O    . GLN A 1 47  ? 2.061   -11.343 8.563   1.00 0.00 ? 47  GLN A O    1  
ATOM   781   C  CB   . GLN A 1 47  ? 0.983   -13.565 6.701   1.00 0.00 ? 47  GLN A CB   1  
ATOM   782   C  CG   . GLN A 1 47  ? 1.561   -14.085 5.378   1.00 0.00 ? 47  GLN A CG   1  
ATOM   783   C  CD   . GLN A 1 47  ? 2.630   -13.131 4.858   1.00 0.00 ? 47  GLN A CD   1  
ATOM   784   O  OE1  . GLN A 1 47  ? 2.710   -11.985 5.301   1.00 0.00 ? 47  GLN A OE1  1  
ATOM   785   N  NE2  . GLN A 1 47  ? 3.459   -13.536 3.936   1.00 0.00 ? 47  GLN A NE2  1  
ATOM   786   H  H    . GLN A 1 47  ? 1.076   -13.434 9.688   1.00 0.00 ? 47  GLN A H    1  
ATOM   787   H  HA   . GLN A 1 47  ? 2.823   -14.325 7.523   1.00 0.00 ? 47  GLN A HA   1  
ATOM   788   H  HB2  . GLN A 1 47  ? 0.139   -14.177 6.985   1.00 0.00 ? 47  GLN A HB2  1  
ATOM   789   H  HB3  . GLN A 1 47  ? 0.653   -12.545 6.568   1.00 0.00 ? 47  GLN A HB3  1  
ATOM   790   H  HG2  . GLN A 1 47  ? 1.999   -15.061 5.534   1.00 0.00 ? 47  GLN A HG2  1  
ATOM   791   H  HG3  . GLN A 1 47  ? 0.768   -14.164 4.649   1.00 0.00 ? 47  GLN A HG3  1  
ATOM   792   H  HE21 . GLN A 1 47  ? 3.390   -14.447 3.584   1.00 0.00 ? 47  GLN A HE21 1  
ATOM   793   H  HE22 . GLN A 1 47  ? 4.149   -12.928 3.595   1.00 0.00 ? 47  GLN A HE22 1  
ATOM   794   N  N    . ARG A 1 48  ? 3.923   -12.105 7.550   1.00 0.00 ? 48  ARG A N    1  
ATOM   795   C  CA   . ARG A 1 48  ? 4.631   -10.837 7.681   1.00 0.00 ? 48  ARG A CA   1  
ATOM   796   C  C    . ARG A 1 48  ? 4.394   -9.967  6.452   1.00 0.00 ? 48  ARG A C    1  
ATOM   797   O  O    . ARG A 1 48  ? 3.488   -9.137  6.436   1.00 0.00 ? 48  ARG A O    1  
ATOM   798   C  CB   . ARG A 1 48  ? 6.131   -11.097 7.856   1.00 0.00 ? 48  ARG A CB   1  
ATOM   799   C  CG   . ARG A 1 48  ? 6.371   -11.874 9.159   1.00 0.00 ? 48  ARG A CG   1  
ATOM   800   C  CD   . ARG A 1 48  ? 7.571   -12.812 8.997   1.00 0.00 ? 48  ARG A CD   1  
ATOM   801   N  NE   . ARG A 1 48  ? 7.135   -14.111 8.493   1.00 0.00 ? 48  ARG A NE   1  
ATOM   802   C  CZ   . ARG A 1 48  ? 8.009   -14.988 8.007   1.00 0.00 ? 48  ARG A CZ   1  
ATOM   803   N  NH1  . ARG A 1 48  ? 9.280   -14.690 7.973   1.00 0.00 ? 48  ARG A NH1  1  
ATOM   804   N  NH2  . ARG A 1 48  ? 7.598   -16.144 7.561   1.00 0.00 ? 48  ARG A NH2  1  
ATOM   805   H  H    . ARG A 1 48  ? 4.368   -12.860 7.115   1.00 0.00 ? 48  ARG A H    1  
ATOM   806   H  HA   . ARG A 1 48  ? 4.264   -10.318 8.554   1.00 0.00 ? 48  ARG A HA   1  
ATOM   807   H  HB2  . ARG A 1 48  ? 6.495   -11.673 7.016   1.00 0.00 ? 48  ARG A HB2  1  
ATOM   808   H  HB3  . ARG A 1 48  ? 6.657   -10.156 7.901   1.00 0.00 ? 48  ARG A HB3  1  
ATOM   809   H  HG2  . ARG A 1 48  ? 6.569   -11.174 9.961   1.00 0.00 ? 48  ARG A HG2  1  
ATOM   810   H  HG3  . ARG A 1 48  ? 5.493   -12.455 9.403   1.00 0.00 ? 48  ARG A HG3  1  
ATOM   811   H  HD2  . ARG A 1 48  ? 8.274   -12.380 8.304   1.00 0.00 ? 48  ARG A HD2  1  
ATOM   812   H  HD3  . ARG A 1 48  ? 8.051   -12.943 9.957   1.00 0.00 ? 48  ARG A HD3  1  
ATOM   813   H  HE   . ARG A 1 48  ? 6.182   -14.341 8.512   1.00 0.00 ? 48  ARG A HE   1  
ATOM   814   H  HH11 . ARG A 1 48  ? 9.596   -13.805 8.313   1.00 0.00 ? 48  ARG A HH11 1  
ATOM   815   H  HH12 . ARG A 1 48  ? 9.938   -15.350 7.608   1.00 0.00 ? 48  ARG A HH12 1  
ATOM   816   H  HH21 . ARG A 1 48  ? 6.624   -16.373 7.584   1.00 0.00 ? 48  ARG A HH21 1  
ATOM   817   H  HH22 . ARG A 1 48  ? 8.257   -16.803 7.198   1.00 0.00 ? 48  ARG A HH22 1  
ATOM   818   N  N    . ARG A 1 49  ? 5.209   -10.169 5.421   1.00 0.00 ? 49  ARG A N    1  
ATOM   819   C  CA   . ARG A 1 49  ? 5.076   -9.403  4.181   1.00 0.00 ? 49  ARG A CA   1  
ATOM   820   C  C    . ARG A 1 49  ? 4.637   -10.327 3.044   1.00 0.00 ? 49  ARG A C    1  
ATOM   821   O  O    . ARG A 1 49  ? 5.210   -11.399 2.853   1.00 0.00 ? 49  ARG A O    1  
ATOM   822   C  CB   . ARG A 1 49  ? 6.415   -8.726  3.828   1.00 0.00 ? 49  ARG A CB   1  
ATOM   823   C  CG   . ARG A 1 49  ? 7.552   -9.370  4.626   1.00 0.00 ? 49  ARG A CG   1  
ATOM   824   C  CD   . ARG A 1 49  ? 7.649   -10.864 4.286   1.00 0.00 ? 49  ARG A CD   1  
ATOM   825   N  NE   . ARG A 1 49  ? 6.474   -11.295 3.533   1.00 0.00 ? 49  ARG A NE   1  
ATOM   826   C  CZ   . ARG A 1 49  ? 5.908   -12.482 3.745   1.00 0.00 ? 49  ARG A CZ   1  
ATOM   827   N  NH1  . ARG A 1 49  ? 6.397   -13.302 4.637   1.00 0.00 ? 49  ARG A NH1  1  
ATOM   828   N  NH2  . ARG A 1 49  ? 4.859   -12.832 3.050   1.00 0.00 ? 49  ARG A NH2  1  
ATOM   829   H  H    . ARG A 1 49  ? 5.909   -10.850 5.490   1.00 0.00 ? 49  ARG A H    1  
ATOM   830   H  HA   . ARG A 1 49  ? 4.324   -8.640  4.318   1.00 0.00 ? 49  ARG A HA   1  
ATOM   831   H  HB2  . ARG A 1 49  ? 6.614   -8.834  2.770   1.00 0.00 ? 49  ARG A HB2  1  
ATOM   832   H  HB3  . ARG A 1 49  ? 6.363   -7.675  4.074   1.00 0.00 ? 49  ARG A HB3  1  
ATOM   833   H  HG2  . ARG A 1 49  ? 8.485   -8.880  4.380   1.00 0.00 ? 49  ARG A HG2  1  
ATOM   834   H  HG3  . ARG A 1 49  ? 7.357   -9.255  5.683   1.00 0.00 ? 49  ARG A HG3  1  
ATOM   835   H  HD2  . ARG A 1 49  ? 8.532   -11.038 3.689   1.00 0.00 ? 49  ARG A HD2  1  
ATOM   836   H  HD3  . ARG A 1 49  ? 7.722   -11.433 5.200   1.00 0.00 ? 49  ARG A HD3  1  
ATOM   837   H  HE   . ARG A 1 49  ? 6.094   -10.698 2.857   1.00 0.00 ? 49  ARG A HE   1  
ATOM   838   H  HH11 . ARG A 1 49  ? 7.200   -13.045 5.170   1.00 0.00 ? 49  ARG A HH11 1  
ATOM   839   H  HH12 . ARG A 1 49  ? 5.963   -14.192 4.788   1.00 0.00 ? 49  ARG A HH12 1  
ATOM   840   H  HH21 . ARG A 1 49  ? 4.483   -12.209 2.361   1.00 0.00 ? 49  ARG A HH21 1  
ATOM   841   H  HH22 . ARG A 1 49  ? 4.429   -13.721 3.207   1.00 0.00 ? 49  ARG A HH22 1  
ATOM   842   N  N    . GLY A 1 50  ? 3.615   -9.912  2.297   1.00 0.00 ? 50  GLY A N    1  
ATOM   843   C  CA   . GLY A 1 50  ? 3.122   -10.730 1.195   1.00 0.00 ? 50  GLY A CA   1  
ATOM   844   C  C    . GLY A 1 50  ? 2.195   -9.954  0.260   1.00 0.00 ? 50  GLY A C    1  
ATOM   845   O  O    . GLY A 1 50  ? 1.481   -9.036  0.678   1.00 0.00 ? 50  GLY A O    1  
ATOM   846   H  H    . GLY A 1 50  ? 3.188   -9.052  2.492   1.00 0.00 ? 50  GLY A H    1  
ATOM   847   H  HA2  . GLY A 1 50  ? 3.965   -11.095 0.628   1.00 0.00 ? 50  GLY A HA2  1  
ATOM   848   H  HA3  . GLY A 1 50  ? 2.582   -11.572 1.601   1.00 0.00 ? 50  GLY A HA3  1  
ATOM   849   N  N    . PHE A 1 51  ? 2.221   -10.347 -1.012  1.00 0.00 ? 51  PHE A N    1  
ATOM   850   C  CA   . PHE A 1 51  ? 1.387   -9.726  -2.036  1.00 0.00 ? 51  PHE A CA   1  
ATOM   851   C  C    . PHE A 1 51  ? 1.411   -10.571 -3.310  1.00 0.00 ? 51  PHE A C    1  
ATOM   852   O  O    . PHE A 1 51  ? 2.100   -11.590 -3.371  1.00 0.00 ? 51  PHE A O    1  
ATOM   853   C  CB   . PHE A 1 51  ? 1.879   -8.308  -2.319  1.00 0.00 ? 51  PHE A CB   1  
ATOM   854   C  CG   . PHE A 1 51  ? 1.160   -7.741  -3.517  1.00 0.00 ? 51  PHE A CG   1  
ATOM   855   C  CD1  . PHE A 1 51  ? -0.178  -7.348  -3.406  1.00 0.00 ? 51  PHE A CD1  1  
ATOM   856   C  CD2  . PHE A 1 51  ? 1.832   -7.603  -4.737  1.00 0.00 ? 51  PHE A CD2  1  
ATOM   857   C  CE1  . PHE A 1 51  ? -0.845  -6.816  -4.516  1.00 0.00 ? 51  PHE A CE1  1  
ATOM   858   C  CE2  . PHE A 1 51  ? 1.168   -7.071  -5.846  1.00 0.00 ? 51  PHE A CE2  1  
ATOM   859   C  CZ   . PHE A 1 51  ? -0.172  -6.677  -5.736  1.00 0.00 ? 51  PHE A CZ   1  
ATOM   860   H  H    . PHE A 1 51  ? 2.814   -11.081 -1.268  1.00 0.00 ? 51  PHE A H    1  
ATOM   861   H  HA   . PHE A 1 51  ? 0.371   -9.677  -1.673  1.00 0.00 ? 51  PHE A HA   1  
ATOM   862   H  HB2  . PHE A 1 51  ? 1.672   -7.692  -1.460  1.00 0.00 ? 51  PHE A HB2  1  
ATOM   863   H  HB3  . PHE A 1 51  ? 2.943   -8.323  -2.509  1.00 0.00 ? 51  PHE A HB3  1  
ATOM   864   H  HD1  . PHE A 1 51  ? -0.698  -7.456  -2.465  1.00 0.00 ? 51  PHE A HD1  1  
ATOM   865   H  HD2  . PHE A 1 51  ? 2.864   -7.907  -4.820  1.00 0.00 ? 51  PHE A HD2  1  
ATOM   866   H  HE1  . PHE A 1 51  ? -1.878  -6.512  -4.432  1.00 0.00 ? 51  PHE A HE1  1  
ATOM   867   H  HE2  . PHE A 1 51  ? 1.686   -6.965  -6.787  1.00 0.00 ? 51  PHE A HE2  1  
ATOM   868   H  HZ   . PHE A 1 51  ? -0.686  -6.267  -6.593  1.00 0.00 ? 51  PHE A HZ   1  
ATOM   869   N  N    . LEU A 1 52  ? 0.659   -10.152 -4.326  1.00 0.00 ? 52  LEU A N    1  
ATOM   870   C  CA   . LEU A 1 52  ? 0.614   -10.894 -5.584  1.00 0.00 ? 52  LEU A CA   1  
ATOM   871   C  C    . LEU A 1 52  ? 0.561   -9.939  -6.772  1.00 0.00 ? 52  LEU A C    1  
ATOM   872   O  O    . LEU A 1 52  ? -0.216  -8.988  -6.782  1.00 0.00 ? 52  LEU A O    1  
ATOM   873   C  CB   . LEU A 1 52  ? -0.600  -11.831 -5.608  1.00 0.00 ? 52  LEU A CB   1  
ATOM   874   C  CG   . LEU A 1 52  ? -1.880  -11.069 -5.205  1.00 0.00 ? 52  LEU A CG   1  
ATOM   875   C  CD1  . LEU A 1 52  ? -2.642  -10.632 -6.458  1.00 0.00 ? 52  LEU A CD1  1  
ATOM   876   C  CD2  . LEU A 1 52  ? -2.779  -11.981 -4.361  1.00 0.00 ? 52  LEU A CD2  1  
ATOM   877   H  H    . LEU A 1 52  ? 0.126   -9.335  -4.228  1.00 0.00 ? 52  LEU A H    1  
ATOM   878   H  HA   . LEU A 1 52  ? 1.512   -11.490 -5.666  1.00 0.00 ? 52  LEU A HA   1  
ATOM   879   H  HB2  . LEU A 1 52  ? -0.717  -12.235 -6.606  1.00 0.00 ? 52  LEU A HB2  1  
ATOM   880   H  HB3  . LEU A 1 52  ? -0.429  -12.642 -4.916  1.00 0.00 ? 52  LEU A HB3  1  
ATOM   881   H  HG   . LEU A 1 52  ? -1.619  -10.195 -4.628  1.00 0.00 ? 52  LEU A HG   1  
ATOM   882   H  HD11 . LEU A 1 52  ? -3.304  -11.423 -6.775  1.00 0.00 ? 52  LEU A HD11 1  
ATOM   883   H  HD12 . LEU A 1 52  ? -1.942  -10.411 -7.249  1.00 0.00 ? 52  LEU A HD12 1  
ATOM   884   H  HD13 . LEU A 1 52  ? -3.222  -9.748  -6.234  1.00 0.00 ? 52  LEU A HD13 1  
ATOM   885   H  HD21 . LEU A 1 52  ? -3.773  -11.562 -4.314  1.00 0.00 ? 52  LEU A HD21 1  
ATOM   886   H  HD22 . LEU A 1 52  ? -2.375  -12.061 -3.364  1.00 0.00 ? 52  LEU A HD22 1  
ATOM   887   H  HD23 . LEU A 1 52  ? -2.822  -12.963 -4.812  1.00 0.00 ? 52  LEU A HD23 1  
ATOM   888   N  N    . CYS A 1 53  ? 1.402   -10.203 -7.766  1.00 0.00 ? 53  CYS A N    1  
ATOM   889   C  CA   . CYS A 1 53  ? 1.459   -9.360  -8.961  1.00 0.00 ? 53  CYS A CA   1  
ATOM   890   C  C    . CYS A 1 53  ? 0.618   -9.951  -10.091 1.00 0.00 ? 53  CYS A C    1  
ATOM   891   O  O    . CYS A 1 53  ? 0.409   -11.162 -10.157 1.00 0.00 ? 53  CYS A O    1  
ATOM   892   C  CB   . CYS A 1 53  ? 2.912   -9.217  -9.428  1.00 0.00 ? 53  CYS A CB   1  
ATOM   893   S  SG   . CYS A 1 53  ? 4.016   -9.274  -7.996  1.00 0.00 ? 53  CYS A SG   1  
ATOM   894   H  H    . CYS A 1 53  ? 1.999   -10.977 -7.693  1.00 0.00 ? 53  CYS A H    1  
ATOM   895   H  HA   . CYS A 1 53  ? 1.078   -8.381  -8.715  1.00 0.00 ? 53  CYS A HA   1  
ATOM   896   H  HB2  . CYS A 1 53  ? 3.156   -10.025 -10.103 1.00 0.00 ? 53  CYS A HB2  1  
ATOM   897   H  HB3  . CYS A 1 53  ? 3.037   -8.275  -9.939  1.00 0.00 ? 53  CYS A HB3  1  
ATOM   898   H  HG   . CYS A 1 53  ? 4.508   -10.098 -8.034  1.00 0.00 ? 53  CYS A HG   1  
ATOM   899   N  N    . ASN A 1 54  ? 0.149   -9.081  -10.983 1.00 0.00 ? 54  ASN A N    1  
ATOM   900   C  CA   . ASN A 1 54  ? -0.662  -9.517  -12.116 1.00 0.00 ? 54  ASN A CA   1  
ATOM   901   C  C    . ASN A 1 54  ? -1.894  -10.281 -11.641 1.00 0.00 ? 54  ASN A C    1  
ATOM   902   O  O    . ASN A 1 54  ? -1.851  -10.980 -10.629 1.00 0.00 ? 54  ASN A O    1  
ATOM   903   C  CB   . ASN A 1 54  ? 0.172   -10.406 -13.040 1.00 0.00 ? 54  ASN A CB   1  
ATOM   904   C  CG   . ASN A 1 54  ? 1.447   -9.679  -13.451 1.00 0.00 ? 54  ASN A CG   1  
ATOM   905   O  OD1  . ASN A 1 54  ? 1.852   -8.715  -12.799 1.00 0.00 ? 54  ASN A OD1  1  
ATOM   906   N  ND2  . ASN A 1 54  ? 2.107   -10.083 -14.501 1.00 0.00 ? 54  ASN A ND2  1  
ATOM   907   H  H    . ASN A 1 54  ? 0.356   -8.130  -10.879 1.00 0.00 ? 54  ASN A H    1  
ATOM   908   H  HA   . ASN A 1 54  ? -0.983  -8.648  -12.670 1.00 0.00 ? 54  ASN A HA   1  
ATOM   909   H  HB2  . ASN A 1 54  ? 0.429   -11.320 -12.524 1.00 0.00 ? 54  ASN A HB2  1  
ATOM   910   H  HB3  . ASN A 1 54  ? -0.403  -10.643 -13.924 1.00 0.00 ? 54  ASN A HB3  1  
ATOM   911   H  HD21 . ASN A 1 54  ? 1.782   -10.850 -15.018 1.00 0.00 ? 54  ASN A HD21 1  
ATOM   912   H  HD22 . ASN A 1 54  ? 2.928   -9.621  -14.774 1.00 0.00 ? 54  ASN A HD22 1  
ATOM   913   N  N    . GLN A 1 55  ? -2.991  -10.143 -12.382 1.00 0.00 ? 55  GLN A N    1  
ATOM   914   C  CA   . GLN A 1 55  ? -4.236  -10.822 -12.034 1.00 0.00 ? 55  GLN A CA   1  
ATOM   915   C  C    . GLN A 1 55  ? -4.524  -11.943 -13.027 1.00 0.00 ? 55  GLN A C    1  
ATOM   916   O  O    . GLN A 1 55  ? -3.977  -11.964 -14.129 1.00 0.00 ? 55  GLN A O    1  
ATOM   917   C  CB   . GLN A 1 55  ? -5.395  -9.823  -12.044 1.00 0.00 ? 55  GLN A CB   1  
ATOM   918   C  CG   . GLN A 1 55  ? -5.575  -9.264  -13.457 1.00 0.00 ? 55  GLN A CG   1  
ATOM   919   C  CD   . GLN A 1 55  ? -6.672  -8.206  -13.467 1.00 0.00 ? 55  GLN A CD   1  
ATOM   920   O  OE1  . GLN A 1 55  ? -7.669  -8.337  -12.757 1.00 0.00 ? 55  GLN A OE1  1  
ATOM   921   N  NE2  . GLN A 1 55  ? -6.545  -7.157  -14.233 1.00 0.00 ? 55  GLN A NE2  1  
ATOM   922   H  H    . GLN A 1 55  ? -2.963  -9.572  -13.179 1.00 0.00 ? 55  GLN A H    1  
ATOM   923   H  HA   . GLN A 1 55  ? -4.148  -11.244 -11.044 1.00 0.00 ? 55  GLN A HA   1  
ATOM   924   H  HB2  . GLN A 1 55  ? -6.302  -10.321 -11.735 1.00 0.00 ? 55  GLN A HB2  1  
ATOM   925   H  HB3  . GLN A 1 55  ? -5.178  -9.012  -11.364 1.00 0.00 ? 55  GLN A HB3  1  
ATOM   926   H  HG2  . GLN A 1 55  ? -4.646  -8.821  -13.787 1.00 0.00 ? 55  GLN A HG2  1  
ATOM   927   H  HG3  . GLN A 1 55  ? -5.847  -10.066 -14.127 1.00 0.00 ? 55  GLN A HG3  1  
ATOM   928   H  HE21 . GLN A 1 55  ? -5.750  -7.055  -14.796 1.00 0.00 ? 55  GLN A HE21 1  
ATOM   929   H  HE22 . GLN A 1 55  ? -7.247  -6.473  -14.246 1.00 0.00 ? 55  GLN A HE22 1  
ATOM   930   N  N    . ALA A 1 56  ? -5.386  -12.876 -12.632 1.00 0.00 ? 56  ALA A N    1  
ATOM   931   C  CA   . ALA A 1 56  ? -5.736  -13.997 -13.498 1.00 0.00 ? 56  ALA A CA   1  
ATOM   932   C  C    . ALA A 1 56  ? -7.140  -13.808 -14.077 1.00 0.00 ? 56  ALA A C    1  
ATOM   933   O  O    . ALA A 1 56  ? -7.975  -13.122 -13.488 1.00 0.00 ? 56  ALA A O    1  
ATOM   934   C  CB   . ALA A 1 56  ? -5.673  -15.304 -12.702 1.00 0.00 ? 56  ALA A CB   1  
ATOM   935   H  H    . ALA A 1 56  ? -5.792  -12.811 -11.742 1.00 0.00 ? 56  ALA A H    1  
ATOM   936   H  HA   . ALA A 1 56  ? -5.025  -14.050 -14.307 1.00 0.00 ? 56  ALA A HA   1  
ATOM   937   H  HB1  . ALA A 1 56  ? -5.911  -15.107 -11.666 1.00 0.00 ? 56  ALA A HB1  1  
ATOM   938   H  HB2  . ALA A 1 56  ? -4.679  -15.718 -12.769 1.00 0.00 ? 56  ALA A HB2  1  
ATOM   939   H  HB3  . ALA A 1 56  ? -6.384  -16.011 -13.105 1.00 0.00 ? 56  ALA A HB3  1  
ATOM   940   N  N    . PRO A 1 57  ? -7.412  -14.405 -15.211 1.00 0.00 ? 57  PRO A N    1  
ATOM   941   C  CA   . PRO A 1 57  ? -8.745  -14.304 -15.873 1.00 0.00 ? 57  PRO A CA   1  
ATOM   942   C  C    . PRO A 1 57  ? -9.819  -15.081 -15.113 1.00 0.00 ? 57  PRO A C    1  
ATOM   943   O  O    . PRO A 1 57  ? -9.597  -16.218 -14.697 1.00 0.00 ? 57  PRO A O    1  
ATOM   944   C  CB   . PRO A 1 57  ? -8.511  -14.907 -17.260 1.00 0.00 ? 57  PRO A CB   1  
ATOM   945   C  CG   . PRO A 1 57  ? -7.342  -15.822 -17.103 1.00 0.00 ? 57  PRO A CG   1  
ATOM   946   C  CD   . PRO A 1 57  ? -6.478  -15.239 -15.986 1.00 0.00 ? 57  PRO A CD   1  
ATOM   947   H  HA   . PRO A 1 57  ? -9.034  -13.271 -15.973 1.00 0.00 ? 57  PRO A HA   1  
ATOM   948   H  HB2  . PRO A 1 57  ? -9.383  -15.461 -17.581 1.00 0.00 ? 57  PRO A HB2  1  
ATOM   949   H  HB3  . PRO A 1 57  ? -8.277  -14.130 -17.972 1.00 0.00 ? 57  PRO A HB3  1  
ATOM   950   H  HG2  . PRO A 1 57  ? -7.684  -16.813 -16.835 1.00 0.00 ? 57  PRO A HG2  1  
ATOM   951   H  HG3  . PRO A 1 57  ? -6.774  -15.858 -18.020 1.00 0.00 ? 57  PRO A HG3  1  
ATOM   952   H  HD2  . PRO A 1 57  ? -6.071  -16.031 -15.371 1.00 0.00 ? 57  PRO A HD2  1  
ATOM   953   H  HD3  . PRO A 1 57  ? -5.689  -14.631 -16.399 1.00 0.00 ? 57  PRO A HD3  1  
ATOM   954   N  N    . HIS A 1 58  ? -10.981 -14.460 -14.934 1.00 0.00 ? 58  HIS A N    1  
ATOM   955   C  CA   . HIS A 1 58  ? -12.081 -15.103 -14.220 1.00 0.00 ? 58  HIS A CA   1  
ATOM   956   C  C    . HIS A 1 58  ? -13.090 -15.694 -15.200 1.00 0.00 ? 58  HIS A C    1  
ATOM   957   O  O    . HIS A 1 58  ? -14.189 -16.090 -14.810 1.00 0.00 ? 58  HIS A O    1  
ATOM   958   C  CB   . HIS A 1 58  ? -12.780 -14.086 -13.317 1.00 0.00 ? 58  HIS A CB   1  
ATOM   959   C  CG   . HIS A 1 58  ? -11.995 -13.919 -12.044 1.00 0.00 ? 58  HIS A CG   1  
ATOM   960   N  ND1  . HIS A 1 58  ? -10.956 -13.008 -11.931 1.00 0.00 ? 58  HIS A ND1  1  
ATOM   961   C  CD2  . HIS A 1 58  ? -12.085 -14.538 -10.823 1.00 0.00 ? 58  HIS A CD2  1  
ATOM   962   C  CE1  . HIS A 1 58  ? -10.467 -13.105 -10.682 1.00 0.00 ? 58  HIS A CE1  1  
ATOM   963   N  NE2  . HIS A 1 58  ? -11.119 -14.023 -9.964  1.00 0.00 ? 58  HIS A NE2  1  
ATOM   964   H  H    . HIS A 1 58  ? -11.101 -13.554 -15.286 1.00 0.00 ? 58  HIS A H    1  
ATOM   965   H  HA   . HIS A 1 58  ? -11.684 -15.899 -13.606 1.00 0.00 ? 58  HIS A HA   1  
ATOM   966   H  HB2  . HIS A 1 58  ? -12.844 -13.137 -13.827 1.00 0.00 ? 58  HIS A HB2  1  
ATOM   967   H  HB3  . HIS A 1 58  ? -13.774 -14.437 -13.082 1.00 0.00 ? 58  HIS A HB3  1  
ATOM   968   H  HD1  . HIS A 1 58  ? -10.637 -12.403 -12.634 1.00 0.00 ? 58  HIS A HD1  1  
ATOM   969   H  HD2  . HIS A 1 58  ? -12.797 -15.309 -10.566 1.00 0.00 ? 58  HIS A HD2  1  
ATOM   970   H  HE1  . HIS A 1 58  ? -9.646  -12.511 -10.306 1.00 0.00 ? 58  HIS A HE1  1  
ATOM   971   H  HE2  . HIS A 1 58  ? -10.953 -14.277 -9.033  1.00 0.00 ? 58  HIS A HE2  1  
ATOM   972   N  N    . LYS A 1 59  ? -12.712 -15.752 -16.473 1.00 0.00 ? 59  LYS A N    1  
ATOM   973   C  CA   . LYS A 1 59  ? -13.595 -16.299 -17.495 1.00 0.00 ? 59  LYS A CA   1  
ATOM   974   C  C    . LYS A 1 59  ? -14.941 -15.580 -17.476 1.00 0.00 ? 59  LYS A C    1  
ATOM   975   O  O    . LYS A 1 59  ? -15.797 -15.866 -16.638 1.00 0.00 ? 59  LYS A O    1  
ATOM   976   C  CB   . LYS A 1 59  ? -13.816 -17.798 -17.253 1.00 0.00 ? 59  LYS A CB   1  
ATOM   977   C  CG   . LYS A 1 59  ? -12.554 -18.590 -17.623 1.00 0.00 ? 59  LYS A CG   1  
ATOM   978   C  CD   . LYS A 1 59  ? -11.615 -18.667 -16.415 1.00 0.00 ? 59  LYS A CD   1  
ATOM   979   C  CE   . LYS A 1 59  ? -12.014 -19.849 -15.529 1.00 0.00 ? 59  LYS A CE   1  
ATOM   980   N  NZ   . LYS A 1 59  ? -11.560 -19.594 -14.133 1.00 0.00 ? 59  LYS A NZ   1  
ATOM   981   H  H    . LYS A 1 59  ? -11.825 -15.423 -16.728 1.00 0.00 ? 59  LYS A H    1  
ATOM   982   H  HA   . LYS A 1 59  ? -13.143 -16.160 -18.465 1.00 0.00 ? 59  LYS A HA   1  
ATOM   983   H  HB2  . LYS A 1 59  ? -14.047 -17.959 -16.209 1.00 0.00 ? 59  LYS A HB2  1  
ATOM   984   H  HB3  . LYS A 1 59  ? -14.642 -18.140 -17.857 1.00 0.00 ? 59  LYS A HB3  1  
ATOM   985   H  HG2  . LYS A 1 59  ? -12.835 -19.590 -17.922 1.00 0.00 ? 59  LYS A HG2  1  
ATOM   986   H  HG3  . LYS A 1 59  ? -12.044 -18.105 -18.440 1.00 0.00 ? 59  LYS A HG3  1  
ATOM   987   H  HD2  . LYS A 1 59  ? -10.599 -18.800 -16.758 1.00 0.00 ? 59  LYS A HD2  1  
ATOM   988   H  HD3  . LYS A 1 59  ? -11.685 -17.755 -15.845 1.00 0.00 ? 59  LYS A HD3  1  
ATOM   989   H  HE2  . LYS A 1 59  ? -13.087 -19.966 -15.544 1.00 0.00 ? 59  LYS A HE2  1  
ATOM   990   H  HE3  . LYS A 1 59  ? -11.548 -20.751 -15.900 1.00 0.00 ? 59  LYS A HE3  1  
ATOM   991   H  HZ1  . LYS A 1 59  ? -10.623 -19.144 -14.149 1.00 0.00 ? 59  LYS A HZ1  1  
ATOM   992   H  HZ2  . LYS A 1 59  ? -11.500 -20.494 -13.617 1.00 0.00 ? 59  LYS A HZ2  1  
ATOM   993   H  HZ3  . LYS A 1 59  ? -12.239 -18.965 -13.657 1.00 0.00 ? 59  LYS A HZ3  1  
ATOM   994   N  N    . HIS A 1 60  ? -15.120 -14.645 -18.404 1.00 0.00 ? 60  HIS A N    1  
ATOM   995   C  CA   . HIS A 1 60  ? -16.365 -13.889 -18.484 1.00 0.00 ? 60  HIS A CA   1  
ATOM   996   C  C    . HIS A 1 60  ? -16.627 -13.143 -17.179 1.00 0.00 ? 60  HIS A C    1  
ATOM   997   O  O    . HIS A 1 60  ? -17.571 -13.453 -16.453 1.00 0.00 ? 60  HIS A O    1  
ATOM   998   C  CB   . HIS A 1 60  ? -17.533 -14.833 -18.785 1.00 0.00 ? 60  HIS A CB   1  
ATOM   999   C  CG   . HIS A 1 60  ? -17.052 -15.971 -19.642 1.00 0.00 ? 60  HIS A CG   1  
ATOM   1000  N  ND1  . HIS A 1 60  ? -16.579 -15.779 -20.930 1.00 0.00 ? 60  HIS A ND1  1  
ATOM   1001  C  CD2  . HIS A 1 60  ? -16.967 -17.322 -19.408 1.00 0.00 ? 60  HIS A CD2  1  
ATOM   1002  C  CE1  . HIS A 1 60  ? -16.234 -16.984 -21.419 1.00 0.00 ? 60  HIS A CE1  1  
ATOM   1003  N  NE2  . HIS A 1 60  ? -16.450 -17.959 -20.532 1.00 0.00 ? 60  HIS A NE2  1  
ATOM   1004  H  H    . HIS A 1 60  ? -14.402 -14.461 -19.045 1.00 0.00 ? 60  HIS A H    1  
ATOM   1005  H  HA   . HIS A 1 60  ? -16.285 -13.170 -19.287 1.00 0.00 ? 60  HIS A HA   1  
ATOM   1006  H  HB2  . HIS A 1 60  ? -17.930 -15.223 -17.859 1.00 0.00 ? 60  HIS A HB2  1  
ATOM   1007  H  HB3  . HIS A 1 60  ? -18.307 -14.291 -19.308 1.00 0.00 ? 60  HIS A HB3  1  
ATOM   1008  H  HD1  . HIS A 1 60  ? -16.510 -14.922 -21.401 1.00 0.00 ? 60  HIS A HD1  1  
ATOM   1009  H  HD2  . HIS A 1 60  ? -17.258 -17.814 -18.493 1.00 0.00 ? 60  HIS A HD2  1  
ATOM   1010  H  HE1  . HIS A 1 60  ? -15.830 -17.144 -22.408 1.00 0.00 ? 60  HIS A HE1  1  
ATOM   1011  H  HE2  . HIS A 1 60  ? -16.281 -18.917 -20.648 1.00 0.00 ? 60  HIS A HE2  1  
ATOM   1012  N  N    . GLY A 1 61  ? -15.785 -12.157 -16.886 1.00 0.00 ? 61  GLY A N    1  
ATOM   1013  C  CA   . GLY A 1 61  ? -15.936 -11.371 -15.666 1.00 0.00 ? 61  GLY A CA   1  
ATOM   1014  C  C    . GLY A 1 61  ? -14.578 -10.969 -15.101 1.00 0.00 ? 61  GLY A C    1  
ATOM   1015  O  O    . GLY A 1 61  ? -14.236 -11.319 -13.972 1.00 0.00 ? 61  GLY A O    1  
ATOM   1016  H  H    . GLY A 1 61  ? -15.050 -11.951 -17.502 1.00 0.00 ? 61  GLY A H    1  
ATOM   1017  H  HA2  . GLY A 1 61  ? -16.507 -10.480 -15.886 1.00 0.00 ? 61  GLY A HA2  1  
ATOM   1018  H  HA3  . GLY A 1 61  ? -16.464 -11.957 -14.930 1.00 0.00 ? 61  GLY A HA3  1  
ATOM   1019  N  N    . PHE A 1 62  ? -13.808 -10.231 -15.895 1.00 0.00 ? 62  PHE A N    1  
ATOM   1020  C  CA   . PHE A 1 62  ? -12.487 -9.786  -15.462 1.00 0.00 ? 62  PHE A CA   1  
ATOM   1021  C  C    . PHE A 1 62  ? -12.567 -8.390  -14.852 1.00 0.00 ? 62  PHE A C    1  
ATOM   1022  O  O    . PHE A 1 62  ? -13.380 -7.566  -15.270 1.00 0.00 ? 62  PHE A O    1  
ATOM   1023  C  CB   . PHE A 1 62  ? -11.525 -9.772  -16.651 1.00 0.00 ? 62  PHE A CB   1  
ATOM   1024  C  CG   . PHE A 1 62  ? -12.224 -9.195  -17.857 1.00 0.00 ? 62  PHE A CG   1  
ATOM   1025  C  CD1  . PHE A 1 62  ? -12.435 -7.814  -17.950 1.00 0.00 ? 62  PHE A CD1  1  
ATOM   1026  C  CD2  . PHE A 1 62  ? -12.663 -10.040 -18.882 1.00 0.00 ? 62  PHE A CD2  1  
ATOM   1027  C  CE1  . PHE A 1 62  ? -13.083 -7.278  -19.069 1.00 0.00 ? 62  PHE A CE1  1  
ATOM   1028  C  CE2  . PHE A 1 62  ? -13.313 -9.505  -20.002 1.00 0.00 ? 62  PHE A CE2  1  
ATOM   1029  C  CZ   . PHE A 1 62  ? -13.523 -8.124  -20.095 1.00 0.00 ? 62  PHE A CZ   1  
ATOM   1030  H  H    . PHE A 1 62  ? -14.133 -9.981  -16.785 1.00 0.00 ? 62  PHE A H    1  
ATOM   1031  H  HA   . PHE A 1 62  ? -12.112 -10.472 -14.718 1.00 0.00 ? 62  PHE A HA   1  
ATOM   1032  H  HB2  . PHE A 1 62  ? -10.663 -9.167  -16.410 1.00 0.00 ? 62  PHE A HB2  1  
ATOM   1033  H  HB3  . PHE A 1 62  ? -11.207 -10.781 -16.869 1.00 0.00 ? 62  PHE A HB3  1  
ATOM   1034  H  HD1  . PHE A 1 62  ? -12.096 -7.162  -17.158 1.00 0.00 ? 62  PHE A HD1  1  
ATOM   1035  H  HD2  . PHE A 1 62  ? -12.501 -11.105 -18.811 1.00 0.00 ? 62  PHE A HD2  1  
ATOM   1036  H  HE1  . PHE A 1 62  ? -13.245 -6.213  -19.140 1.00 0.00 ? 62  PHE A HE1  1  
ATOM   1037  H  HE2  . PHE A 1 62  ? -13.651 -10.157 -20.793 1.00 0.00 ? 62  PHE A HE2  1  
ATOM   1038  H  HZ   . PHE A 1 62  ? -14.023 -7.710  -20.957 1.00 0.00 ? 62  PHE A HZ   1  
ATOM   1039  N  N    . LEU A 1 63  ? -11.718 -8.133  -13.863 1.00 0.00 ? 63  LEU A N    1  
ATOM   1040  C  CA   . LEU A 1 63  ? -11.703 -6.833  -13.203 1.00 0.00 ? 63  LEU A CA   1  
ATOM   1041  C  C    . LEU A 1 63  ? -10.712 -5.898  -13.889 1.00 0.00 ? 63  LEU A C    1  
ATOM   1042  O  O    . LEU A 1 63  ? -9.944  -6.318  -14.754 1.00 0.00 ? 63  LEU A O    1  
ATOM   1043  C  CB   . LEU A 1 63  ? -11.320 -7.000  -11.731 1.00 0.00 ? 63  LEU A CB   1  
ATOM   1044  C  CG   . LEU A 1 63  ? -12.549 -7.426  -10.920 1.00 0.00 ? 63  LEU A CG   1  
ATOM   1045  C  CD1  . LEU A 1 63  ? -13.566 -6.275  -10.855 1.00 0.00 ? 63  LEU A CD1  1  
ATOM   1046  C  CD2  . LEU A 1 63  ? -13.195 -8.647  -11.582 1.00 0.00 ? 63  LEU A CD2  1  
ATOM   1047  H  H    . LEU A 1 63  ? -11.093 -8.829  -13.572 1.00 0.00 ? 63  LEU A H    1  
ATOM   1048  H  HA   . LEU A 1 63  ? -12.689 -6.400  -13.261 1.00 0.00 ? 63  LEU A HA   1  
ATOM   1049  H  HB2  . LEU A 1 63  ? -10.553 -7.758  -11.646 1.00 0.00 ? 63  LEU A HB2  1  
ATOM   1050  H  HB3  . LEU A 1 63  ? -10.942 -6.064  -11.349 1.00 0.00 ? 63  LEU A HB3  1  
ATOM   1051  H  HG   . LEU A 1 63  ? -12.241 -7.683  -9.917  1.00 0.00 ? 63  LEU A HG   1  
ATOM   1052  H  HD11 . LEU A 1 63  ? -14.077 -6.303  -9.904  1.00 0.00 ? 63  LEU A HD11 1  
ATOM   1053  H  HD12 . LEU A 1 63  ? -14.289 -6.380  -11.651 1.00 0.00 ? 63  LEU A HD12 1  
ATOM   1054  H  HD13 . LEU A 1 63  ? -13.055 -5.329  -10.957 1.00 0.00 ? 63  LEU A HD13 1  
ATOM   1055  H  HD21 . LEU A 1 63  ? -12.423 -9.310  -11.946 1.00 0.00 ? 63  LEU A HD21 1  
ATOM   1056  H  HD22 . LEU A 1 63  ? -13.812 -8.325  -12.409 1.00 0.00 ? 63  LEU A HD22 1  
ATOM   1057  H  HD23 . LEU A 1 63  ? -13.805 -9.168  -10.859 1.00 0.00 ? 63  LEU A HD23 1  
ATOM   1058  N  N    . GLU A 1 64  ? -10.736 -4.628  -13.498 1.00 0.00 ? 64  GLU A N    1  
ATOM   1059  C  CA   . GLU A 1 64  ? -9.835  -3.644  -14.086 1.00 0.00 ? 64  GLU A CA   1  
ATOM   1060  C  C    . GLU A 1 64  ? -8.506  -3.618  -13.336 1.00 0.00 ? 64  GLU A C    1  
ATOM   1061  O  O    . GLU A 1 64  ? -8.250  -4.461  -12.476 1.00 0.00 ? 64  GLU A O    1  
ATOM   1062  C  CB   . GLU A 1 64  ? -10.482 -2.258  -14.045 1.00 0.00 ? 64  GLU A CB   1  
ATOM   1063  C  CG   . GLU A 1 64  ? -11.406 -2.169  -12.840 1.00 0.00 ? 64  GLU A CG   1  
ATOM   1064  C  CD   . GLU A 1 64  ? -11.830 -0.723  -12.609 1.00 0.00 ? 64  GLU A CD   1  
ATOM   1065  O  OE1  . GLU A 1 64  ? -11.271 0.148   -13.256 1.00 0.00 ? 64  GLU A OE1  1  
ATOM   1066  O  OE2  . GLU A 1 64  ? -12.707 -0.506  -11.789 1.00 0.00 ? 64  GLU A OE2  1  
ATOM   1067  H  H    . GLU A 1 64  ? -11.369 -4.348  -12.806 1.00 0.00 ? 64  GLU A H    1  
ATOM   1068  H  HA   . GLU A 1 64  ? -9.651  -3.911  -15.114 1.00 0.00 ? 64  GLU A HA   1  
ATOM   1069  H  HB2  . GLU A 1 64  ? -9.718  -1.496  -13.973 1.00 0.00 ? 64  GLU A HB2  1  
ATOM   1070  H  HB3  . GLU A 1 64  ? -11.058 -2.107  -14.938 1.00 0.00 ? 64  GLU A HB3  1  
ATOM   1071  H  HG2  . GLU A 1 64  ? -12.281 -2.777  -13.014 1.00 0.00 ? 64  GLU A HG2  1  
ATOM   1072  H  HG3  . GLU A 1 64  ? -10.886 -2.532  -11.975 1.00 0.00 ? 64  GLU A HG3  1  
ATOM   1073  N  N    . GLY A 1 65  ? -7.664  -2.646  -13.669 1.00 0.00 ? 65  GLY A N    1  
ATOM   1074  C  CA   . GLY A 1 65  ? -6.362  -2.520  -13.023 1.00 0.00 ? 65  GLY A CA   1  
ATOM   1075  C  C    . GLY A 1 65  ? -6.516  -2.224  -11.535 1.00 0.00 ? 65  GLY A C    1  
ATOM   1076  O  O    . GLY A 1 65  ? -6.430  -1.071  -11.110 1.00 0.00 ? 65  GLY A O    1  
ATOM   1077  H  H    . GLY A 1 65  ? -7.921  -2.002  -14.363 1.00 0.00 ? 65  GLY A H    1  
ATOM   1078  H  HA2  . GLY A 1 65  ? -5.814  -3.442  -13.147 1.00 0.00 ? 65  GLY A HA2  1  
ATOM   1079  H  HA3  . GLY A 1 65  ? -5.813  -1.715  -13.486 1.00 0.00 ? 65  GLY A HA3  1  
ATOM   1080  N  N    . ARG A 1 66  ? -6.742  -3.269  -10.749 1.00 0.00 ? 66  ARG A N    1  
ATOM   1081  C  CA   . ARG A 1 66  ? -6.905  -3.111  -9.309  1.00 0.00 ? 66  ARG A CA   1  
ATOM   1082  C  C    . ARG A 1 66  ? -5.563  -2.817  -8.648  1.00 0.00 ? 66  ARG A C    1  
ATOM   1083  O  O    . ARG A 1 66  ? -4.642  -3.632  -8.702  1.00 0.00 ? 66  ARG A O    1  
ATOM   1084  C  CB   . ARG A 1 66  ? -7.498  -4.387  -8.708  1.00 0.00 ? 66  ARG A CB   1  
ATOM   1085  C  CG   . ARG A 1 66  ? -9.020  -4.362  -8.847  1.00 0.00 ? 66  ARG A CG   1  
ATOM   1086  C  CD   . ARG A 1 66  ? -9.574  -5.766  -8.612  1.00 0.00 ? 66  ARG A CD   1  
ATOM   1087  N  NE   . ARG A 1 66  ? -8.963  -6.710  -9.538  1.00 0.00 ? 66  ARG A NE   1  
ATOM   1088  C  CZ   . ARG A 1 66  ? -9.099  -8.021  -9.370  1.00 0.00 ? 66  ARG A CZ   1  
ATOM   1089  N  NH1  . ARG A 1 66  ? -9.775  -8.480  -8.354  1.00 0.00 ? 66  ARG A NH1  1  
ATOM   1090  N  NH2  . ARG A 1 66  ? -8.552  -8.849  -10.218 1.00 0.00 ? 66  ARG A NH2  1  
ATOM   1091  H  H    . ARG A 1 66  ? -6.801  -4.164  -11.144 1.00 0.00 ? 66  ARG A H    1  
ATOM   1092  H  HA   . ARG A 1 66  ? -7.578  -2.288  -9.118  1.00 0.00 ? 66  ARG A HA   1  
ATOM   1093  H  HB2  . ARG A 1 66  ? -7.103  -5.247  -9.230  1.00 0.00 ? 66  ARG A HB2  1  
ATOM   1094  H  HB3  . ARG A 1 66  ? -7.236  -4.450  -7.662  1.00 0.00 ? 66  ARG A HB3  1  
ATOM   1095  H  HG2  . ARG A 1 66  ? -9.433  -3.682  -8.116  1.00 0.00 ? 66  ARG A HG2  1  
ATOM   1096  H  HG3  . ARG A 1 66  ? -9.287  -4.032  -9.839  1.00 0.00 ? 66  ARG A HG3  1  
ATOM   1097  H  HD2  . ARG A 1 66  ? -9.359  -6.071  -7.599  1.00 0.00 ? 66  ARG A HD2  1  
ATOM   1098  H  HD3  . ARG A 1 66  ? -10.645 -5.756  -8.761  1.00 0.00 ? 66  ARG A HD3  1  
ATOM   1099  H  HE   . ARG A 1 66  ? -8.446  -6.373  -10.300 1.00 0.00 ? 66  ARG A HE   1  
ATOM   1100  H  HH11 . ARG A 1 66  ? -10.192 -7.845  -7.702  1.00 0.00 ? 66  ARG A HH11 1  
ATOM   1101  H  HH12 . ARG A 1 66  ? -9.880  -9.466  -8.226  1.00 0.00 ? 66  ARG A HH12 1  
ATOM   1102  H  HH21 . ARG A 1 66  ? -8.030  -8.497  -10.996 1.00 0.00 ? 66  ARG A HH21 1  
ATOM   1103  H  HH22 . ARG A 1 66  ? -8.656  -9.836  -10.091 1.00 0.00 ? 66  ARG A HH22 1  
ATOM   1104  N  N    . HIS A 1 67  ? -5.462  -1.652  -8.016  1.00 0.00 ? 67  HIS A N    1  
ATOM   1105  C  CA   . HIS A 1 67  ? -4.232  -1.264  -7.340  1.00 0.00 ? 67  HIS A CA   1  
ATOM   1106  C  C    . HIS A 1 67  ? -4.309  -1.646  -5.861  1.00 0.00 ? 67  HIS A C    1  
ATOM   1107  O  O    . HIS A 1 67  ? -5.388  -1.922  -5.341  1.00 0.00 ? 67  HIS A O    1  
ATOM   1108  C  CB   . HIS A 1 67  ? -3.996  0.250   -7.524  1.00 0.00 ? 67  HIS A CB   1  
ATOM   1109  C  CG   . HIS A 1 67  ? -3.065  0.459   -8.696  1.00 0.00 ? 67  HIS A CG   1  
ATOM   1110  N  ND1  . HIS A 1 67  ? -3.371  1.277   -9.794  1.00 0.00 ? 67  HIS A ND1  1  
ATOM   1111  C  CD2  . HIS A 1 67  ? -1.840  -0.096  -8.968  1.00 0.00 ? 67  HIS A CD2  1  
ATOM   1112  C  CE1  . HIS A 1 67  ? -2.335  1.162   -10.653 1.00 0.00 ? 67  HIS A CE1  1  
ATOM   1113  N  NE2  . HIS A 1 67  ? -1.386  0.346   -10.199 1.00 0.00 ? 67  HIS A NE2  1  
ATOM   1114  H  H    . HIS A 1 67  ? -6.229  -1.043  -8.000  1.00 0.00 ? 67  HIS A H    1  
ATOM   1115  H  HA   . HIS A 1 67  ? -3.406  -1.806  -7.778  1.00 0.00 ? 67  HIS A HA   1  
ATOM   1116  H  HB2  . HIS A 1 67  ? -4.939  0.742   -7.717  1.00 0.00 ? 67  HIS A HB2  1  
ATOM   1117  H  HB3  . HIS A 1 67  ? -3.549  0.660   -6.631  1.00 0.00 ? 67  HIS A HB3  1  
ATOM   1118  H  HD2  . HIS A 1 67  ? -1.310  -0.775  -8.318  1.00 0.00 ? 67  HIS A HD2  1  
ATOM   1119  H  HE1  . HIS A 1 67  ? -2.282  1.674   -11.602 1.00 0.00 ? 67  HIS A HE1  1  
ATOM   1120  H  HE2  . HIS A 1 67  ? -0.544  0.107   -10.642 1.00 0.00 ? 67  HIS A HE2  1  
ATOM   1121  N  N    . ALA A 1 68  ? -3.150  -1.694  -5.207  1.00 0.00 ? 68  ALA A N    1  
ATOM   1122  C  CA   . ALA A 1 68  ? -3.075  -2.077  -3.795  1.00 0.00 ? 68  ALA A CA   1  
ATOM   1123  C  C    . ALA A 1 68  ? -4.380  -1.772  -3.055  1.00 0.00 ? 68  ALA A C    1  
ATOM   1124  O  O    . ALA A 1 68  ? -4.926  -2.622  -2.342  1.00 0.00 ? 68  ALA A O    1  
ATOM   1125  C  CB   . ALA A 1 68  ? -1.927  -1.329  -3.124  1.00 0.00 ? 68  ALA A CB   1  
ATOM   1126  H  H    . ALA A 1 68  ? -2.324  -1.488  -5.688  1.00 0.00 ? 68  ALA A H    1  
ATOM   1127  H  HA   . ALA A 1 68  ? -2.875  -3.133  -3.734  1.00 0.00 ? 68  ALA A HA   1  
ATOM   1128  H  HB1  . ALA A 1 68  ? -2.202  -0.295  -2.987  1.00 0.00 ? 68  ALA A HB1  1  
ATOM   1129  H  HB2  . ALA A 1 68  ? -1.046  -1.388  -3.745  1.00 0.00 ? 68  ALA A HB2  1  
ATOM   1130  H  HB3  . ALA A 1 68  ? -1.720  -1.777  -2.163  1.00 0.00 ? 68  ALA A HB3  1  
ATOM   1131  N  N    . GLU A 1 69  ? -4.864  -0.549  -3.235  1.00 0.00 ? 69  GLU A N    1  
ATOM   1132  C  CA   . GLU A 1 69  ? -6.098  -0.103  -2.592  1.00 0.00 ? 69  GLU A CA   1  
ATOM   1133  C  C    . GLU A 1 69  ? -7.204  -1.154  -2.737  1.00 0.00 ? 69  GLU A C    1  
ATOM   1134  O  O    . GLU A 1 69  ? -7.667  -1.731  -1.745  1.00 0.00 ? 69  GLU A O    1  
ATOM   1135  C  CB   . GLU A 1 69  ? -6.551  1.247   -3.200  1.00 0.00 ? 69  GLU A CB   1  
ATOM   1136  C  CG   . GLU A 1 69  ? -5.610  1.649   -4.351  1.00 0.00 ? 69  GLU A CG   1  
ATOM   1137  C  CD   . GLU A 1 69  ? -4.251  2.061   -3.791  1.00 0.00 ? 69  GLU A CD   1  
ATOM   1138  O  OE1  . GLU A 1 69  ? -4.202  2.456   -2.637  1.00 0.00 ? 69  GLU A OE1  1  
ATOM   1139  O  OE2  . GLU A 1 69  ? -3.280  1.978   -4.524  1.00 0.00 ? 69  GLU A OE2  1  
ATOM   1140  H  H    . GLU A 1 69  ? -4.378  0.073   -3.812  1.00 0.00 ? 69  GLU A H    1  
ATOM   1141  H  HA   . GLU A 1 69  ? -5.901  0.043   -1.542  1.00 0.00 ? 69  GLU A HA   1  
ATOM   1142  H  HB2  . GLU A 1 69  ? -7.562  1.162   -3.574  1.00 0.00 ? 69  GLU A HB2  1  
ATOM   1143  H  HB3  . GLU A 1 69  ? -6.522  2.013   -2.436  1.00 0.00 ? 69  GLU A HB3  1  
ATOM   1144  H  HG2  . GLU A 1 69  ? -5.484  0.811   -5.026  1.00 0.00 ? 69  GLU A HG2  1  
ATOM   1145  H  HG3  . GLU A 1 69  ? -6.034  2.482   -4.891  1.00 0.00 ? 69  GLU A HG3  1  
ATOM   1146  N  N    . LEU A 1 70  ? -7.629  -1.395  -3.972  1.00 0.00 ? 70  LEU A N    1  
ATOM   1147  C  CA   . LEU A 1 70  ? -8.685  -2.368  -4.222  1.00 0.00 ? 70  LEU A CA   1  
ATOM   1148  C  C    . LEU A 1 70  ? -8.224  -3.766  -3.830  1.00 0.00 ? 70  LEU A C    1  
ATOM   1149  O  O    . LEU A 1 70  ? -9.037  -4.635  -3.516  1.00 0.00 ? 70  LEU A O    1  
ATOM   1150  C  CB   . LEU A 1 70  ? -9.104  -2.354  -5.693  1.00 0.00 ? 70  LEU A CB   1  
ATOM   1151  C  CG   . LEU A 1 70  ? -9.253  -0.905  -6.202  1.00 0.00 ? 70  LEU A CG   1  
ATOM   1152  C  CD1  . LEU A 1 70  ? -10.006 -0.043  -5.171  1.00 0.00 ? 70  LEU A CD1  1  
ATOM   1153  C  CD2  . LEU A 1 70  ? -7.872  -0.287  -6.482  1.00 0.00 ? 70  LEU A CD2  1  
ATOM   1154  H  H    . LEU A 1 70  ? -7.228  -0.911  -4.721  1.00 0.00 ? 70  LEU A H    1  
ATOM   1155  H  HA   . LEU A 1 70  ? -9.538  -2.104  -3.630  1.00 0.00 ? 70  LEU A HA   1  
ATOM   1156  H  HB2  . LEU A 1 70  ? -8.361  -2.874  -6.281  1.00 0.00 ? 70  LEU A HB2  1  
ATOM   1157  H  HB3  . LEU A 1 70  ? -10.051 -2.863  -5.794  1.00 0.00 ? 70  LEU A HB3  1  
ATOM   1158  H  HG   . LEU A 1 70  ? -9.823  -0.919  -7.120  1.00 0.00 ? 70  LEU A HG   1  
ATOM   1159  H  HD11 . LEU A 1 70  ? -10.163 0.940   -5.577  1.00 0.00 ? 70  LEU A HD11 1  
ATOM   1160  H  HD12 . LEU A 1 70  ? -9.428  0.044   -4.264  1.00 0.00 ? 70  LEU A HD12 1  
ATOM   1161  H  HD13 . LEU A 1 70  ? -10.960 -0.494  -4.951  1.00 0.00 ? 70  LEU A HD13 1  
ATOM   1162  H  HD21 . LEU A 1 70  ? -7.631  0.434   -5.717  1.00 0.00 ? 70  LEU A HD21 1  
ATOM   1163  H  HD22 . LEU A 1 70  ? -7.890  0.201   -7.441  1.00 0.00 ? 70  LEU A HD22 1  
ATOM   1164  H  HD23 . LEU A 1 70  ? -7.119  -1.056  -6.491  1.00 0.00 ? 70  LEU A HD23 1  
ATOM   1165  N  N    . CYS A 1 71  ? -6.912  -3.976  -3.858  1.00 0.00 ? 71  CYS A N    1  
ATOM   1166  C  CA   . CYS A 1 71  ? -6.343  -5.279  -3.512  1.00 0.00 ? 71  CYS A CA   1  
ATOM   1167  C  C    . CYS A 1 71  ? -6.900  -5.805  -2.184  1.00 0.00 ? 71  CYS A C    1  
ATOM   1168  O  O    . CYS A 1 71  ? -7.525  -6.871  -2.147  1.00 0.00 ? 71  CYS A O    1  
ATOM   1169  C  CB   . CYS A 1 71  ? -4.813  -5.195  -3.450  1.00 0.00 ? 71  CYS A CB   1  
ATOM   1170  S  SG   . CYS A 1 71  ? -4.293  -4.353  -1.932  1.00 0.00 ? 71  CYS A SG   1  
ATOM   1171  H  H    . CYS A 1 71  ? -6.316  -3.244  -4.128  1.00 0.00 ? 71  CYS A H    1  
ATOM   1172  H  HA   . CYS A 1 71  ? -6.611  -5.980  -4.289  1.00 0.00 ? 71  CYS A HA   1  
ATOM   1173  H  HB2  . CYS A 1 71  ? -4.399  -6.192  -3.463  1.00 0.00 ? 71  CYS A HB2  1  
ATOM   1174  H  HB3  . CYS A 1 71  ? -4.452  -4.648  -4.309  1.00 0.00 ? 71  CYS A HB3  1  
ATOM   1175  H  HG   . CYS A 1 71  ? -5.026  -4.377  -1.315  1.00 0.00 ? 71  CYS A HG   1  
ATOM   1176  N  N    . PHE A 1 72  ? -6.701  -5.073  -1.089  1.00 0.00 ? 72  PHE A N    1  
ATOM   1177  C  CA   . PHE A 1 72  ? -7.234  -5.555  0.181   1.00 0.00 ? 72  PHE A CA   1  
ATOM   1178  C  C    . PHE A 1 72  ? -8.742  -5.460  0.132   1.00 0.00 ? 72  PHE A C    1  
ATOM   1179  O  O    . PHE A 1 72  ? -9.451  -6.390  0.498   1.00 0.00 ? 72  PHE A O    1  
ATOM   1180  C  CB   . PHE A 1 72  ? -6.678  -4.788  1.384   1.00 0.00 ? 72  PHE A CB   1  
ATOM   1181  C  CG   . PHE A 1 72  ? -6.774  -3.299  1.168   1.00 0.00 ? 72  PHE A CG   1  
ATOM   1182  C  CD1  . PHE A 1 72  ? -8.001  -2.638  1.324   1.00 0.00 ? 72  PHE A CD1  1  
ATOM   1183  C  CD2  . PHE A 1 72  ? -5.628  -2.573  0.824   1.00 0.00 ? 72  PHE A CD2  1  
ATOM   1184  C  CE1  . PHE A 1 72  ? -8.076  -1.262  1.130   1.00 0.00 ? 72  PHE A CE1  1  
ATOM   1185  C  CE2  . PHE A 1 72  ? -5.709  -1.197  0.634   1.00 0.00 ? 72  PHE A CE2  1  
ATOM   1186  C  CZ   . PHE A 1 72  ? -6.931  -0.546  0.785   1.00 0.00 ? 72  PHE A CZ   1  
ATOM   1187  H  H    . PHE A 1 72  ? -6.219  -4.214  -1.142  1.00 0.00 ? 72  PHE A H    1  
ATOM   1188  H  HA   . PHE A 1 72  ? -6.966  -6.598  0.285   1.00 0.00 ? 72  PHE A HA   1  
ATOM   1189  H  HB2  . PHE A 1 72  ? -7.245  -5.056  2.261   1.00 0.00 ? 72  PHE A HB2  1  
ATOM   1190  H  HB3  . PHE A 1 72  ? -5.644  -5.063  1.534   1.00 0.00 ? 72  PHE A HB3  1  
ATOM   1191  H  HD1  . PHE A 1 72  ? -8.887  -3.186  1.596   1.00 0.00 ? 72  PHE A HD1  1  
ATOM   1192  H  HD2  . PHE A 1 72  ? -4.682  -3.071  0.704   1.00 0.00 ? 72  PHE A HD2  1  
ATOM   1193  H  HE1  . PHE A 1 72  ? -9.020  -0.751  1.245   1.00 0.00 ? 72  PHE A HE1  1  
ATOM   1194  H  HE2  . PHE A 1 72  ? -4.826  -0.636  0.369   1.00 0.00 ? 72  PHE A HE2  1  
ATOM   1195  H  HZ   . PHE A 1 72  ? -6.990  0.508   0.637   1.00 0.00 ? 72  PHE A HZ   1  
ATOM   1196  N  N    . LEU A 1 73  ? -9.232  -4.348  -0.379  1.00 0.00 ? 73  LEU A N    1  
ATOM   1197  C  CA   . LEU A 1 73  ? -10.658 -4.171  -0.532  1.00 0.00 ? 73  LEU A CA   1  
ATOM   1198  C  C    . LEU A 1 73  ? -11.278 -5.483  -1.007  1.00 0.00 ? 73  LEU A C    1  
ATOM   1199  O  O    . LEU A 1 73  ? -12.454 -5.763  -0.772  1.00 0.00 ? 73  LEU A O    1  
ATOM   1200  C  CB   . LEU A 1 73  ? -10.858 -3.092  -1.578  1.00 0.00 ? 73  LEU A CB   1  
ATOM   1201  C  CG   . LEU A 1 73  ? -12.139 -2.306  -1.315  1.00 0.00 ? 73  LEU A CG   1  
ATOM   1202  C  CD1  . LEU A 1 73  ? -11.960 -1.398  -0.079  1.00 0.00 ? 73  LEU A CD1  1  
ATOM   1203  C  CD2  . LEU A 1 73  ? -12.433 -1.466  -2.560  1.00 0.00 ? 73  LEU A CD2  1  
ATOM   1204  H  H    . LEU A 1 73  ? -8.624  -3.642  -0.696  1.00 0.00 ? 73  LEU A H    1  
ATOM   1205  H  HA   . LEU A 1 73  ? -11.100 -3.864  0.402   1.00 0.00 ? 73  LEU A HA   1  
ATOM   1206  H  HB2  . LEU A 1 73  ? -10.011 -2.425  -1.535  1.00 0.00 ? 73  LEU A HB2  1  
ATOM   1207  H  HB3  . LEU A 1 73  ? -10.911 -3.545  -2.560  1.00 0.00 ? 73  LEU A HB3  1  
ATOM   1208  H  HG   . LEU A 1 73  ? -12.954 -2.995  -1.142  1.00 0.00 ? 73  LEU A HG   1  
ATOM   1209  H  HD11 . LEU A 1 73  ? -12.643 -1.713  0.694   1.00 0.00 ? 73  LEU A HD11 1  
ATOM   1210  H  HD12 . LEU A 1 73  ? -12.172 -0.373  -0.341  1.00 0.00 ? 73  LEU A HD12 1  
ATOM   1211  H  HD13 . LEU A 1 73  ? -10.948 -1.467  0.291   1.00 0.00 ? 73  LEU A HD13 1  
ATOM   1212  H  HD21 . LEU A 1 73  ? -13.240 -0.782  -2.355  1.00 0.00 ? 73  LEU A HD21 1  
ATOM   1213  H  HD22 . LEU A 1 73  ? -12.710 -2.112  -3.376  1.00 0.00 ? 73  LEU A HD22 1  
ATOM   1214  H  HD23 . LEU A 1 73  ? -11.545 -0.918  -2.833  1.00 0.00 ? 73  LEU A HD23 1  
ATOM   1215  N  N    . ASP A 1 74  ? -10.451 -6.275  -1.690  1.00 0.00 ? 74  ASP A N    1  
ATOM   1216  C  CA   . ASP A 1 74  ? -10.880 -7.562  -2.224  1.00 0.00 ? 74  ASP A CA   1  
ATOM   1217  C  C    . ASP A 1 74  ? -10.564 -8.709  -1.264  1.00 0.00 ? 74  ASP A C    1  
ATOM   1218  O  O    . ASP A 1 74  ? -11.213 -9.750  -1.319  1.00 0.00 ? 74  ASP A O    1  
ATOM   1219  C  CB   . ASP A 1 74  ? -10.195 -7.817  -3.568  1.00 0.00 ? 74  ASP A CB   1  
ATOM   1220  C  CG   . ASP A 1 74  ? -10.984 -8.848  -4.368  1.00 0.00 ? 74  ASP A CG   1  
ATOM   1221  O  OD1  . ASP A 1 74  ? -11.190 -9.936  -3.855  1.00 0.00 ? 74  ASP A OD1  1  
ATOM   1222  O  OD2  . ASP A 1 74  ? -11.369 -8.536  -5.483  1.00 0.00 ? 74  ASP A OD2  1  
ATOM   1223  H  H    . ASP A 1 74  ? -9.529  -5.977  -1.841  1.00 0.00 ? 74  ASP A H    1  
ATOM   1224  H  HA   . ASP A 1 74  ? -11.949 -7.534  -2.380  1.00 0.00 ? 74  ASP A HA   1  
ATOM   1225  H  HB2  . ASP A 1 74  ? -10.145 -6.893  -4.126  1.00 0.00 ? 74  ASP A HB2  1  
ATOM   1226  H  HB3  . ASP A 1 74  ? -9.196  -8.187  -3.397  1.00 0.00 ? 74  ASP A HB3  1  
ATOM   1227  N  N    . VAL A 1 75  ? -9.569  -8.540  -0.387  1.00 0.00 ? 75  VAL A N    1  
ATOM   1228  C  CA   . VAL A 1 75  ? -9.238  -9.613  0.538   1.00 0.00 ? 75  VAL A CA   1  
ATOM   1229  C  C    . VAL A 1 75  ? -10.276 -9.735  1.665   1.00 0.00 ? 75  VAL A C    1  
ATOM   1230  O  O    . VAL A 1 75  ? -10.749 -10.811 1.969   1.00 0.00 ? 75  VAL A O    1  
ATOM   1231  C  CB   . VAL A 1 75  ? -7.850  -9.424  1.148   1.00 0.00 ? 75  VAL A CB   1  
ATOM   1232  C  CG1  . VAL A 1 75  ? -7.899  -8.450  2.328   1.00 0.00 ? 75  VAL A CG1  1  
ATOM   1233  C  CG2  . VAL A 1 75  ? -7.394  -10.782 1.644   1.00 0.00 ? 75  VAL A CG2  1  
ATOM   1234  H  H    . VAL A 1 75  ? -9.054  -7.707  -0.369  1.00 0.00 ? 75  VAL A H    1  
ATOM   1235  H  HA   . VAL A 1 75  ? -9.230  -10.535 -0.023  1.00 0.00 ? 75  VAL A HA   1  
ATOM   1236  H  HB   . VAL A 1 75  ? -7.160  -9.059  0.403   1.00 0.00 ? 75  VAL A HB   1  
ATOM   1237  H  HG11 . VAL A 1 75  ? -8.395  -7.545  2.034   1.00 0.00 ? 75  VAL A HG11 1  
ATOM   1238  H  HG12 . VAL A 1 75  ? -6.894  -8.219  2.644   1.00 0.00 ? 75  VAL A HG12 1  
ATOM   1239  H  HG13 . VAL A 1 75  ? -8.434  -8.906  3.141   1.00 0.00 ? 75  VAL A HG13 1  
ATOM   1240  H  HG21 . VAL A 1 75  ? -6.571  -10.657 2.322   1.00 0.00 ? 75  VAL A HG21 1  
ATOM   1241  H  HG22 . VAL A 1 75  ? -7.091  -11.382 0.801   1.00 0.00 ? 75  VAL A HG22 1  
ATOM   1242  H  HG23 . VAL A 1 75  ? -8.218  -11.266 2.152   1.00 0.00 ? 75  VAL A HG23 1  
ATOM   1243  N  N    . ILE A 1 76  ? -10.609 -8.629  2.300   1.00 0.00 ? 76  ILE A N    1  
ATOM   1244  C  CA   . ILE A 1 76  ? -11.583 -8.666  3.403   1.00 0.00 ? 76  ILE A CA   1  
ATOM   1245  C  C    . ILE A 1 76  ? -12.725 -9.666  3.113   1.00 0.00 ? 76  ILE A C    1  
ATOM   1246  O  O    . ILE A 1 76  ? -12.995 -10.538 3.939   1.00 0.00 ? 76  ILE A O    1  
ATOM   1247  C  CB   . ILE A 1 76  ? -12.169 -7.261  3.693   1.00 0.00 ? 76  ILE A CB   1  
ATOM   1248  C  CG1  . ILE A 1 76  ? -11.264 -6.178  3.106   1.00 0.00 ? 76  ILE A CG1  1  
ATOM   1249  C  CG2  . ILE A 1 76  ? -12.289 -7.030  5.199   1.00 0.00 ? 76  ILE A CG2  1  
ATOM   1250  C  CD1  . ILE A 1 76  ? -9.922  -6.171  3.843   1.00 0.00 ? 76  ILE A CD1  1  
ATOM   1251  H  H    . ILE A 1 76  ? -10.183 -7.792  2.045   1.00 0.00 ? 76  ILE A H    1  
ATOM   1252  H  HA   . ILE A 1 76  ? -11.063 -9.008  4.286   1.00 0.00 ? 76  ILE A HA   1  
ATOM   1253  H  HB   . ILE A 1 76  ? -13.150 -7.180  3.260   1.00 0.00 ? 76  ILE A HB   1  
ATOM   1254  H  HG12 . ILE A 1 76  ? -11.108 -6.374  2.063   1.00 0.00 ? 76  ILE A HG12 1  
ATOM   1255  H  HG13 . ILE A 1 76  ? -11.737 -5.216  3.219   1.00 0.00 ? 76  ILE A HG13 1  
ATOM   1256  H  HG21 . ILE A 1 76  ? -13.056 -7.673  5.604   1.00 0.00 ? 76  ILE A HG21 1  
ATOM   1257  H  HG22 . ILE A 1 76  ? -12.556 -6.001  5.373   1.00 0.00 ? 76  ILE A HG22 1  
ATOM   1258  H  HG23 . ILE A 1 76  ? -11.346 -7.242  5.677   1.00 0.00 ? 76  ILE A HG23 1  
ATOM   1259  H  HD11 . ILE A 1 76  ? -9.606  -7.185  4.031   1.00 0.00 ? 76  ILE A HD11 1  
ATOM   1260  H  HD12 . ILE A 1 76  ? -10.029 -5.649  4.782   1.00 0.00 ? 76  ILE A HD12 1  
ATOM   1261  H  HD13 . ILE A 1 76  ? -9.182  -5.671  3.238   1.00 0.00 ? 76  ILE A HD13 1  
ATOM   1262  N  N    . PRO A 1 77  ? -13.397 -9.577  1.975   1.00 0.00 ? 77  PRO A N    1  
ATOM   1263  C  CA   . PRO A 1 77  ? -14.510 -10.515 1.624   1.00 0.00 ? 77  PRO A CA   1  
ATOM   1264  C  C    . PRO A 1 77  ? -13.980 -11.911 1.330   1.00 0.00 ? 77  PRO A C    1  
ATOM   1265  O  O    . PRO A 1 77  ? -14.734 -12.834 1.026   1.00 0.00 ? 77  PRO A O    1  
ATOM   1266  C  CB   . PRO A 1 77  ? -15.127 -9.883  0.375   1.00 0.00 ? 77  PRO A CB   1  
ATOM   1267  C  CG   . PRO A 1 77  ? -14.023 -9.127  -0.253  1.00 0.00 ? 77  PRO A CG   1  
ATOM   1268  C  CD   . PRO A 1 77  ? -13.183 -8.597  0.900   1.00 0.00 ? 77  PRO A CD   1  
ATOM   1269  H  HA   . PRO A 1 77  ? -15.240 -10.548 2.416   1.00 0.00 ? 77  PRO A HA   1  
ATOM   1270  H  HB2  . PRO A 1 77  ? -15.492 -10.644 -0.299  1.00 0.00 ? 77  PRO A HB2  1  
ATOM   1271  H  HB3  . PRO A 1 77  ? -15.914 -9.207  0.651   1.00 0.00 ? 77  PRO A HB3  1  
ATOM   1272  H  HG2  . PRO A 1 77  ? -13.436 -9.783  -0.881  1.00 0.00 ? 77  PRO A HG2  1  
ATOM   1273  H  HG3  . PRO A 1 77  ? -14.412 -8.303  -0.829  1.00 0.00 ? 77  PRO A HG3  1  
ATOM   1274  H  HD2  . PRO A 1 77  ? -12.163 -8.559  0.618   1.00 0.00 ? 77  PRO A HD2  1  
ATOM   1275  H  HD3  . PRO A 1 77  ? -13.528 -7.637  1.198   1.00 0.00 ? 77  PRO A HD3  1  
ATOM   1276  N  N    . PHE A 1 78  ? -12.667 -12.033 1.421   1.00 0.00 ? 78  PHE A N    1  
ATOM   1277  C  CA   . PHE A 1 78  ? -11.982 -13.306 1.172   1.00 0.00 ? 78  PHE A CA   1  
ATOM   1278  C  C    . PHE A 1 78  ? -12.102 -14.226 2.383   1.00 0.00 ? 78  PHE A C    1  
ATOM   1279  O  O    . PHE A 1 78  ? -12.340 -15.425 2.234   1.00 0.00 ? 78  PHE A O    1  
ATOM   1280  C  CB   . PHE A 1 78  ? -10.507 -13.036 0.865   1.00 0.00 ? 78  PHE A CB   1  
ATOM   1281  C  CG   . PHE A 1 78  ? -9.867  -14.205 0.180   1.00 0.00 ? 78  PHE A CG   1  
ATOM   1282  C  CD1  . PHE A 1 78  ? -10.305 -14.590 -1.085  1.00 0.00 ? 78  PHE A CD1  1  
ATOM   1283  C  CD2  . PHE A 1 78  ? -8.830  -14.896 0.813   1.00 0.00 ? 78  PHE A CD2  1  
ATOM   1284  C  CE1  . PHE A 1 78  ? -9.707  -15.681 -1.728  1.00 0.00 ? 78  PHE A CE1  1  
ATOM   1285  C  CE2  . PHE A 1 78  ? -8.228  -15.986 0.173   1.00 0.00 ? 78  PHE A CE2  1  
ATOM   1286  C  CZ   . PHE A 1 78  ? -8.669  -16.381 -1.098  1.00 0.00 ? 78  PHE A CZ   1  
ATOM   1287  H  H    . PHE A 1 78  ? -12.143 -11.238 1.660   1.00 0.00 ? 78  PHE A H    1  
ATOM   1288  H  HA   . PHE A 1 78  ? -12.434 -13.788 0.319   1.00 0.00 ? 78  PHE A HA   1  
ATOM   1289  H  HB2  . PHE A 1 78  ? -10.447 -12.191 0.216   1.00 0.00 ? 78  PHE A HB2  1  
ATOM   1290  H  HB3  . PHE A 1 78  ? -9.976  -12.835 1.785   1.00 0.00 ? 78  PHE A HB3  1  
ATOM   1291  H  HD1  . PHE A 1 78  ? -11.100 -14.038 -1.566  1.00 0.00 ? 78  PHE A HD1  1  
ATOM   1292  H  HD2  . PHE A 1 78  ? -8.486  -14.575 1.791   1.00 0.00 ? 78  PHE A HD2  1  
ATOM   1293  H  HE1  . PHE A 1 78  ? -10.045 -15.981 -2.708  1.00 0.00 ? 78  PHE A HE1  1  
ATOM   1294  H  HE2  . PHE A 1 78  ? -7.428  -16.525 0.659   1.00 0.00 ? 78  PHE A HE2  1  
ATOM   1295  H  HZ   . PHE A 1 78  ? -8.208  -17.223 -1.593  1.00 0.00 ? 78  PHE A HZ   1  
ATOM   1296  N  N    . TRP A 1 79  ? -11.951 -13.667 3.585   1.00 0.00 ? 79  TRP A N    1  
ATOM   1297  C  CA   . TRP A 1 79  ? -12.064 -14.474 4.791   1.00 0.00 ? 79  TRP A CA   1  
ATOM   1298  C  C    . TRP A 1 79  ? -13.539 -14.693 5.133   1.00 0.00 ? 79  TRP A C    1  
ATOM   1299  O  O    . TRP A 1 79  ? -13.904 -15.671 5.785   1.00 0.00 ? 79  TRP A O    1  
ATOM   1300  C  CB   . TRP A 1 79  ? -11.366 -13.791 5.973   1.00 0.00 ? 79  TRP A CB   1  
ATOM   1301  C  CG   . TRP A 1 79  ? -10.305 -12.837 5.514   1.00 0.00 ? 79  TRP A CG   1  
ATOM   1302  C  CD1  . TRP A 1 79  ? -9.422  -13.036 4.507   1.00 0.00 ? 79  TRP A CD1  1  
ATOM   1303  C  CD2  . TRP A 1 79  ? -10.007 -11.529 6.065   1.00 0.00 ? 79  TRP A CD2  1  
ATOM   1304  N  NE1  . TRP A 1 79  ? -8.597  -11.921 4.414   1.00 0.00 ? 79  TRP A NE1  1  
ATOM   1305  C  CE2  . TRP A 1 79  ? -8.926  -10.961 5.357   1.00 0.00 ? 79  TRP A CE2  1  
ATOM   1306  C  CE3  . TRP A 1 79  ? -10.577 -10.794 7.108   1.00 0.00 ? 79  TRP A CE3  1  
ATOM   1307  C  CZ2  . TRP A 1 79  ? -8.427  -9.691  5.684   1.00 0.00 ? 79  TRP A CZ2  1  
ATOM   1308  C  CZ3  . TRP A 1 79  ? -10.087 -9.524  7.438   1.00 0.00 ? 79  TRP A CZ3  1  
ATOM   1309  C  CH2  . TRP A 1 79  ? -9.016  -8.975  6.731   1.00 0.00 ? 79  TRP A CH2  1  
ATOM   1310  H  H    . TRP A 1 79  ? -11.773 -12.704 3.660   1.00 0.00 ? 79  TRP A H    1  
ATOM   1311  H  HA   . TRP A 1 79  ? -11.598 -15.434 4.615   1.00 0.00 ? 79  TRP A HA   1  
ATOM   1312  H  HB2  . TRP A 1 79  ? -12.095 -13.236 6.538   1.00 0.00 ? 79  TRP A HB2  1  
ATOM   1313  H  HB3  . TRP A 1 79  ? -10.918 -14.543 6.607   1.00 0.00 ? 79  TRP A HB3  1  
ATOM   1314  H  HD1  . TRP A 1 79  ? -9.366  -13.916 3.883   1.00 0.00 ? 79  TRP A HD1  1  
ATOM   1315  H  HE1  . TRP A 1 79  ? -7.871  -11.808 3.766   1.00 0.00 ? 79  TRP A HE1  1  
ATOM   1316  H  HE3  . TRP A 1 79  ? -11.404 -11.212 7.659   1.00 0.00 ? 79  TRP A HE3  1  
ATOM   1317  H  HZ2  . TRP A 1 79  ? -7.593  -9.267  5.140   1.00 0.00 ? 79  TRP A HZ2  1  
ATOM   1318  H  HZ3  . TRP A 1 79  ? -10.532 -8.972  8.247   1.00 0.00 ? 79  TRP A HZ3  1  
ATOM   1319  H  HH2  . TRP A 1 79  ? -8.656  -7.992  6.990   1.00 0.00 ? 79  TRP A HH2  1  
ATOM   1320  N  N    . LYS A 1 80  ? -14.378 -13.772 4.668   1.00 0.00 ? 80  LYS A N    1  
ATOM   1321  C  CA   . LYS A 1 80  ? -15.814 -13.839 4.894   1.00 0.00 ? 80  LYS A CA   1  
ATOM   1322  C  C    . LYS A 1 80  ? -16.167 -13.966 6.379   1.00 0.00 ? 80  LYS A C    1  
ATOM   1323  O  O    . LYS A 1 80  ? -16.890 -14.880 6.774   1.00 0.00 ? 80  LYS A O    1  
ATOM   1324  C  CB   . LYS A 1 80  ? -16.410 -15.013 4.112   1.00 0.00 ? 80  LYS A CB   1  
ATOM   1325  C  CG   . LYS A 1 80  ? -15.484 -15.383 2.956   1.00 0.00 ? 80  LYS A CG   1  
ATOM   1326  C  CD   . LYS A 1 80  ? -16.284 -16.131 1.883   1.00 0.00 ? 80  LYS A CD   1  
ATOM   1327  C  CE   . LYS A 1 80  ? -15.350 -16.602 0.757   1.00 0.00 ? 80  LYS A CE   1  
ATOM   1328  N  NZ   . LYS A 1 80  ? -15.681 -18.010 0.398   1.00 0.00 ? 80  LYS A NZ   1  
ATOM   1329  H  H    . LYS A 1 80  ? -14.024 -13.029 4.145   1.00 0.00 ? 80  LYS A H    1  
ATOM   1330  H  HA   . LYS A 1 80  ? -16.250 -12.931 4.518   1.00 0.00 ? 80  LYS A HA   1  
ATOM   1331  H  HB2  . LYS A 1 80  ? -16.531 -15.867 4.762   1.00 0.00 ? 80  LYS A HB2  1  
ATOM   1332  H  HB3  . LYS A 1 80  ? -17.366 -14.722 3.716   1.00 0.00 ? 80  LYS A HB3  1  
ATOM   1333  H  HG2  . LYS A 1 80  ? -15.061 -14.486 2.534   1.00 0.00 ? 80  LYS A HG2  1  
ATOM   1334  H  HG3  . LYS A 1 80  ? -14.695 -16.018 3.321   1.00 0.00 ? 80  LYS A HG3  1  
ATOM   1335  H  HD2  . LYS A 1 80  ? -16.767 -16.988 2.330   1.00 0.00 ? 80  LYS A HD2  1  
ATOM   1336  H  HD3  . LYS A 1 80  ? -17.034 -15.471 1.473   1.00 0.00 ? 80  LYS A HD3  1  
ATOM   1337  H  HE2  . LYS A 1 80  ? -15.483 -15.972 -0.110  1.00 0.00 ? 80  LYS A HE2  1  
ATOM   1338  H  HE3  . LYS A 1 80  ? -14.321 -16.549 1.085   1.00 0.00 ? 80  LYS A HE3  1  
ATOM   1339  H  HZ1  . LYS A 1 80  ? -15.298 -18.228 -0.543  1.00 0.00 ? 80  LYS A HZ1  1  
ATOM   1340  H  HZ2  . LYS A 1 80  ? -16.713 -18.132 0.388   1.00 0.00 ? 80  LYS A HZ2  1  
ATOM   1341  H  HZ3  . LYS A 1 80  ? -15.262 -18.654 1.101   1.00 0.00 ? 80  LYS A HZ3  1  
ATOM   1342  N  N    . LEU A 1 81  ? -15.681 -13.035 7.200   1.00 0.00 ? 81  LEU A N    1  
ATOM   1343  C  CA   . LEU A 1 81  ? -15.993 -13.069 8.621   1.00 0.00 ? 81  LEU A CA   1  
ATOM   1344  C  C    . LEU A 1 81  ? -17.476 -12.888 8.847   1.00 0.00 ? 81  LEU A C    1  
ATOM   1345  O  O    . LEU A 1 81  ? -18.321 -13.306 8.055   1.00 0.00 ? 81  LEU A O    1  
ATOM   1346  C  CB   . LEU A 1 81  ? -15.299 -11.938 9.365   1.00 0.00 ? 81  LEU A CB   1  
ATOM   1347  C  CG   . LEU A 1 81  ? -13.897 -11.728 8.807   1.00 0.00 ? 81  LEU A CG   1  
ATOM   1348  C  CD1  . LEU A 1 81  ? -13.941 -10.891 7.512   1.00 0.00 ? 81  LEU A CD1  1  
ATOM   1349  C  CD2  . LEU A 1 81  ? -13.063 -11.026 9.881   1.00 0.00 ? 81  LEU A CD2  1  
ATOM   1350  H  H    . LEU A 1 81  ? -15.123 -12.315 6.847   1.00 0.00 ? 81  LEU A H    1  
ATOM   1351  H  HA   . LEU A 1 81  ? -15.668 -13.996 9.042   1.00 0.00 ? 81  LEU A HA   1  
ATOM   1352  H  HB2  . LEU A 1 81  ? -15.884 -11.018 9.278   1.00 0.00 ? 81  LEU A HB2  1  
ATOM   1353  H  HB3  . LEU A 1 81  ? -15.228 -12.208 10.407  1.00 0.00 ? 81  LEU A HB3  1  
ATOM   1354  H  HG   . LEU A 1 81  ? -13.454 -12.690 8.592   1.00 0.00 ? 81  LEU A HG   1  
ATOM   1355  H  HD11 . LEU A 1 81  ? -14.961 -10.622 7.277   1.00 0.00 ? 81  LEU A HD11 1  
ATOM   1356  H  HD12 . LEU A 1 81  ? -13.536 -11.477 6.701   1.00 0.00 ? 81  LEU A HD12 1  
ATOM   1357  H  HD13 . LEU A 1 81  ? -13.353 -9.996  7.633   1.00 0.00 ? 81  LEU A HD13 1  
ATOM   1358  H  HD21 . LEU A 1 81  ? -12.403 -10.315 9.421   1.00 0.00 ? 81  LEU A HD21 1  
ATOM   1359  H  HD22 . LEU A 1 81  ? -12.488 -11.766 10.415  1.00 0.00 ? 81  LEU A HD22 1  
ATOM   1360  H  HD23 . LEU A 1 81  ? -13.716 -10.512 10.571  1.00 0.00 ? 81  LEU A HD23 1  
ATOM   1361  N  N    . ASP A 1 82  ? -17.750 -12.194 9.933   1.00 0.00 ? 82  ASP A N    1  
ATOM   1362  C  CA   . ASP A 1 82  ? -19.093 -11.842 10.321  1.00 0.00 ? 82  ASP A CA   1  
ATOM   1363  C  C    . ASP A 1 82  ? -19.174 -10.322 10.365  1.00 0.00 ? 82  ASP A C    1  
ATOM   1364  O  O    . ASP A 1 82  ? -18.290 -9.633  9.857   1.00 0.00 ? 82  ASP A O    1  
ATOM   1365  C  CB   . ASP A 1 82  ? -19.416 -12.434 11.696  1.00 0.00 ? 82  ASP A CB   1  
ATOM   1366  C  CG   . ASP A 1 82  ? -20.032 -13.822 11.540  1.00 0.00 ? 82  ASP A CG   1  
ATOM   1367  O  OD1  . ASP A 1 82  ? -21.137 -13.904 11.029  1.00 0.00 ? 82  ASP A OD1  1  
ATOM   1368  O  OD2  . ASP A 1 82  ? -19.389 -14.781 11.934  1.00 0.00 ? 82  ASP A OD2  1  
ATOM   1369  H  H    . ASP A 1 82  ? -16.996 -11.869 10.477  1.00 0.00 ? 82  ASP A H    1  
ATOM   1370  H  HA   . ASP A 1 82  ? -19.794 -12.218 9.590   1.00 0.00 ? 82  ASP A HA   1  
ATOM   1371  H  HB2  . ASP A 1 82  ? -18.506 -12.512 12.271  1.00 0.00 ? 82  ASP A HB2  1  
ATOM   1372  H  HB3  . ASP A 1 82  ? -20.110 -11.791 12.211  1.00 0.00 ? 82  ASP A HB3  1  
ATOM   1373  N  N    . LEU A 1 83  ? -20.219 -9.805  10.970  1.00 0.00 ? 83  LEU A N    1  
ATOM   1374  C  CA   . LEU A 1 83  ? -20.392 -8.360  11.071  1.00 0.00 ? 83  LEU A CA   1  
ATOM   1375  C  C    . LEU A 1 83  ? -19.806 -7.842  12.383  1.00 0.00 ? 83  LEU A C    1  
ATOM   1376  O  O    . LEU A 1 83  ? -19.069 -6.856  12.401  1.00 0.00 ? 83  LEU A O    1  
ATOM   1377  C  CB   . LEU A 1 83  ? -21.888 -8.012  10.976  1.00 0.00 ? 83  LEU A CB   1  
ATOM   1378  C  CG   . LEU A 1 83  ? -22.129 -6.506  11.144  1.00 0.00 ? 83  LEU A CG   1  
ATOM   1379  C  CD1  . LEU A 1 83  ? -21.948 -6.085  12.610  1.00 0.00 ? 83  LEU A CD1  1  
ATOM   1380  C  CD2  . LEU A 1 83  ? -21.158 -5.730  10.255  1.00 0.00 ? 83  LEU A CD2  1  
ATOM   1381  H  H    . LEU A 1 83  ? -20.880 -10.401 11.355  1.00 0.00 ? 83  LEU A H    1  
ATOM   1382  H  HA   . LEU A 1 83  ? -19.869 -7.897  10.251  1.00 0.00 ? 83  LEU A HA   1  
ATOM   1383  H  HB2  . LEU A 1 83  ? -22.258 -8.313  10.013  1.00 0.00 ? 83  LEU A HB2  1  
ATOM   1384  H  HB3  . LEU A 1 83  ? -22.424 -8.543  11.740  1.00 0.00 ? 83  LEU A HB3  1  
ATOM   1385  H  HG   . LEU A 1 83  ? -23.142 -6.279  10.840  1.00 0.00 ? 83  LEU A HG   1  
ATOM   1386  H  HD11 . LEU A 1 83  ? -22.027 -6.949  13.252  1.00 0.00 ? 83  LEU A HD11 1  
ATOM   1387  H  HD12 . LEU A 1 83  ? -22.718 -5.376  12.870  1.00 0.00 ? 83  LEU A HD12 1  
ATOM   1388  H  HD13 . LEU A 1 83  ? -20.980 -5.626  12.741  1.00 0.00 ? 83  LEU A HD13 1  
ATOM   1389  H  HD21 . LEU A 1 83  ? -20.188 -5.695  10.728  1.00 0.00 ? 83  LEU A HD21 1  
ATOM   1390  H  HD22 . LEU A 1 83  ? -21.527 -4.726  10.114  1.00 0.00 ? 83  LEU A HD22 1  
ATOM   1391  H  HD23 . LEU A 1 83  ? -21.078 -6.222  9.298   1.00 0.00 ? 83  LEU A HD23 1  
ATOM   1392  N  N    . ASP A 1 84  ? -20.146 -8.514  13.478  1.00 0.00 ? 84  ASP A N    1  
ATOM   1393  C  CA   . ASP A 1 84  ? -19.660 -8.119  14.799  1.00 0.00 ? 84  ASP A CA   1  
ATOM   1394  C  C    . ASP A 1 84  ? -18.136 -8.026  14.813  1.00 0.00 ? 84  ASP A C    1  
ATOM   1395  O  O    . ASP A 1 84  ? -17.547 -7.456  15.731  1.00 0.00 ? 84  ASP A O    1  
ATOM   1396  C  CB   . ASP A 1 84  ? -20.126 -9.138  15.843  1.00 0.00 ? 84  ASP A CB   1  
ATOM   1397  C  CG   . ASP A 1 84  ? -19.931 -8.582  17.250  1.00 0.00 ? 84  ASP A CG   1  
ATOM   1398  O  OD1  . ASP A 1 84  ? -19.082 -7.722  17.415  1.00 0.00 ? 84  ASP A OD1  1  
ATOM   1399  O  OD2  . ASP A 1 84  ? -20.634 -9.026  18.143  1.00 0.00 ? 84  ASP A OD2  1  
ATOM   1400  H  H    . ASP A 1 84  ? -20.738 -9.288  13.399  1.00 0.00 ? 84  ASP A H    1  
ATOM   1401  H  HA   . ASP A 1 84  ? -20.071 -7.154  15.049  1.00 0.00 ? 84  ASP A HA   1  
ATOM   1402  H  HB2  . ASP A 1 84  ? -21.172 -9.355  15.687  1.00 0.00 ? 84  ASP A HB2  1  
ATOM   1403  H  HB3  . ASP A 1 84  ? -19.554 -10.046 15.736  1.00 0.00 ? 84  ASP A HB3  1  
ATOM   1404  N  N    . GLN A 1 85  ? -17.504 -8.592  13.792  1.00 0.00 ? 85  GLN A N    1  
ATOM   1405  C  CA   . GLN A 1 85  ? -16.048 -8.571  13.696  1.00 0.00 ? 85  GLN A CA   1  
ATOM   1406  C  C    . GLN A 1 85  ? -15.580 -7.323  12.937  1.00 0.00 ? 85  GLN A C    1  
ATOM   1407  O  O    . GLN A 1 85  ? -16.390 -6.455  12.612  1.00 0.00 ? 85  GLN A O    1  
ATOM   1408  C  CB   . GLN A 1 85  ? -15.553 -9.846  12.993  1.00 0.00 ? 85  GLN A CB   1  
ATOM   1409  C  CG   . GLN A 1 85  ? -16.677 -10.882 12.938  1.00 0.00 ? 85  GLN A CG   1  
ATOM   1410  C  CD   . GLN A 1 85  ? -17.152 -11.213 14.351  1.00 0.00 ? 85  GLN A CD   1  
ATOM   1411  O  OE1  . GLN A 1 85  ? -16.398 -11.056 15.311  1.00 0.00 ? 85  GLN A OE1  1  
ATOM   1412  N  NE2  . GLN A 1 85  ? -18.363 -11.663 14.536  1.00 0.00 ? 85  GLN A NE2  1  
ATOM   1413  H  H    . GLN A 1 85  ? -18.023 -9.035  13.095  1.00 0.00 ? 85  GLN A H    1  
ATOM   1414  H  HA   . GLN A 1 85  ? -15.646 -8.544  14.699  1.00 0.00 ? 85  GLN A HA   1  
ATOM   1415  H  HB2  . GLN A 1 85  ? -15.236 -9.610  11.988  1.00 0.00 ? 85  GLN A HB2  1  
ATOM   1416  H  HB3  . GLN A 1 85  ? -14.725 -10.259 13.543  1.00 0.00 ? 85  GLN A HB3  1  
ATOM   1417  H  HG2  . GLN A 1 85  ? -17.500 -10.487 12.364  1.00 0.00 ? 85  GLN A HG2  1  
ATOM   1418  H  HG3  . GLN A 1 85  ? -16.312 -11.782 12.466  1.00 0.00 ? 85  GLN A HG3  1  
ATOM   1419  H  HE21 . GLN A 1 85  ? -18.964 -11.786 13.770  1.00 0.00 ? 85  GLN A HE21 1  
ATOM   1420  H  HE22 . GLN A 1 85  ? -18.671 -11.879 15.444  1.00 0.00 ? 85  GLN A HE22 1  
ATOM   1421  N  N    . ASP A 1 86  ? -14.270 -7.219  12.673  1.00 0.00 ? 86  ASP A N    1  
ATOM   1422  C  CA   . ASP A 1 86  ? -13.740 -6.044  11.970  1.00 0.00 ? 86  ASP A CA   1  
ATOM   1423  C  C    . ASP A 1 86  ? -12.483 -6.391  11.156  1.00 0.00 ? 86  ASP A C    1  
ATOM   1424  O  O    . ASP A 1 86  ? -11.985 -7.515  11.214  1.00 0.00 ? 86  ASP A O    1  
ATOM   1425  C  CB   . ASP A 1 86  ? -13.405 -4.949  12.999  1.00 0.00 ? 86  ASP A CB   1  
ATOM   1426  C  CG   . ASP A 1 86  ? -14.516 -3.901  13.048  1.00 0.00 ? 86  ASP A CG   1  
ATOM   1427  O  OD1  . ASP A 1 86  ? -15.666 -4.279  12.897  1.00 0.00 ? 86  ASP A OD1  1  
ATOM   1428  O  OD2  . ASP A 1 86  ? -14.199 -2.738  13.235  1.00 0.00 ? 86  ASP A OD2  1  
ATOM   1429  H  H    . ASP A 1 86  ? -13.654 -7.927  12.966  1.00 0.00 ? 86  ASP A H    1  
ATOM   1430  H  HA   . ASP A 1 86  ? -14.495 -5.673  11.294  1.00 0.00 ? 86  ASP A HA   1  
ATOM   1431  H  HB2  . ASP A 1 86  ? -13.298 -5.397  13.980  1.00 0.00 ? 86  ASP A HB2  1  
ATOM   1432  H  HB3  . ASP A 1 86  ? -12.478 -4.469  12.728  1.00 0.00 ? 86  ASP A HB3  1  
ATOM   1433  N  N    . TYR A 1 87  ? -11.966 -5.405  10.413  1.00 0.00 ? 87  TYR A N    1  
ATOM   1434  C  CA   . TYR A 1 87  ? -10.754 -5.606  9.614   1.00 0.00 ? 87  TYR A CA   1  
ATOM   1435  C  C    . TYR A 1 87  ? -9.826  -4.399  9.721   1.00 0.00 ? 87  TYR A C    1  
ATOM   1436  O  O    . TYR A 1 87  ? -10.197 -3.284  9.356   1.00 0.00 ? 87  TYR A O    1  
ATOM   1437  C  CB   . TYR A 1 87  ? -11.086 -5.837  8.127   1.00 0.00 ? 87  TYR A CB   1  
ATOM   1438  C  CG   . TYR A 1 87  ? -12.565 -6.021  7.935   1.00 0.00 ? 87  TYR A CG   1  
ATOM   1439  C  CD1  . TYR A 1 87  ? -13.150 -7.263  8.170   1.00 0.00 ? 87  TYR A CD1  1  
ATOM   1440  C  CD2  . TYR A 1 87  ? -13.344 -4.950  7.491   1.00 0.00 ? 87  TYR A CD2  1  
ATOM   1441  C  CE1  . TYR A 1 87  ? -14.520 -7.444  7.963   1.00 0.00 ? 87  TYR A CE1  1  
ATOM   1442  C  CE2  . TYR A 1 87  ? -14.716 -5.124  7.284   1.00 0.00 ? 87  TYR A CE2  1  
ATOM   1443  C  CZ   . TYR A 1 87  ? -15.306 -6.374  7.519   1.00 0.00 ? 87  TYR A CZ   1  
ATOM   1444  O  OH   . TYR A 1 87  ? -16.660 -6.550  7.314   1.00 0.00 ? 87  TYR A OH   1  
ATOM   1445  H  H    . TYR A 1 87  ? -12.398 -4.525  10.418  1.00 0.00 ? 87  TYR A H    1  
ATOM   1446  H  HA   . TYR A 1 87  ? -10.230 -6.475  9.989   1.00 0.00 ? 87  TYR A HA   1  
ATOM   1447  H  HB2  . TYR A 1 87  ? -10.766 -4.984  7.542   1.00 0.00 ? 87  TYR A HB2  1  
ATOM   1448  H  HB3  . TYR A 1 87  ? -10.565 -6.718  7.772   1.00 0.00 ? 87  TYR A HB3  1  
ATOM   1449  H  HD1  . TYR A 1 87  ? -12.546 -8.082  8.517   1.00 0.00 ? 87  TYR A HD1  1  
ATOM   1450  H  HD2  . TYR A 1 87  ? -12.885 -3.987  7.311   1.00 0.00 ? 87  TYR A HD2  1  
ATOM   1451  H  HE1  . TYR A 1 87  ? -14.966 -8.410  8.139   1.00 0.00 ? 87  TYR A HE1  1  
ATOM   1452  H  HE2  . TYR A 1 87  ? -15.316 -4.299  6.938   1.00 0.00 ? 87  TYR A HE2  1  
ATOM   1453  H  HH   . TYR A 1 87  ? -16.880 -6.181  6.456   1.00 0.00 ? 87  TYR A HH   1  
ATOM   1454  N  N    . ARG A 1 88  ? -8.605  -4.644  10.176  1.00 0.00 ? 88  ARG A N    1  
ATOM   1455  C  CA   . ARG A 1 88  ? -7.607  -3.586  10.272  1.00 0.00 ? 88  ARG A CA   1  
ATOM   1456  C  C    . ARG A 1 88  ? -6.556  -3.853  9.205   1.00 0.00 ? 88  ARG A C    1  
ATOM   1457  O  O    . ARG A 1 88  ? -5.638  -4.651  9.404   1.00 0.00 ? 88  ARG A O    1  
ATOM   1458  C  CB   . ARG A 1 88  ? -6.967  -3.573  11.673  1.00 0.00 ? 88  ARG A CB   1  
ATOM   1459  C  CG   . ARG A 1 88  ? -7.476  -2.369  12.470  1.00 0.00 ? 88  ARG A CG   1  
ATOM   1460  C  CD   . ARG A 1 88  ? -6.957  -2.449  13.906  1.00 0.00 ? 88  ARG A CD   1  
ATOM   1461  N  NE   . ARG A 1 88  ? -7.086  -1.152  14.559  1.00 0.00 ? 88  ARG A NE   1  
ATOM   1462  C  CZ   . ARG A 1 88  ? -6.112  -0.249  14.498  1.00 0.00 ? 88  ARG A CZ   1  
ATOM   1463  N  NH1  . ARG A 1 88  ? -5.009  -0.518  13.853  1.00 0.00 ? 88  ARG A NH1  1  
ATOM   1464  N  NH2  . ARG A 1 88  ? -6.260  0.908   15.085  1.00 0.00 ? 88  ARG A NH2  1  
ATOM   1465  H  H    . ARG A 1 88  ? -8.357  -5.561  10.416  1.00 0.00 ? 88  ARG A H    1  
ATOM   1466  H  HA   . ARG A 1 88  ? -8.080  -2.627  10.069  1.00 0.00 ? 88  ARG A HA   1  
ATOM   1467  H  HB2  . ARG A 1 88  ? -7.230  -4.483  12.193  1.00 0.00 ? 88  ARG A HB2  1  
ATOM   1468  H  HB3  . ARG A 1 88  ? -5.891  -3.511  11.585  1.00 0.00 ? 88  ARG A HB3  1  
ATOM   1469  H  HG2  . ARG A 1 88  ? -7.123  -1.457  12.009  1.00 0.00 ? 88  ARG A HG2  1  
ATOM   1470  H  HG3  . ARG A 1 88  ? -8.556  -2.373  12.478  1.00 0.00 ? 88  ARG A HG3  1  
ATOM   1471  H  HD2  . ARG A 1 88  ? -7.531  -3.182  14.453  1.00 0.00 ? 88  ARG A HD2  1  
ATOM   1472  H  HD3  . ARG A 1 88  ? -5.919  -2.746  13.895  1.00 0.00 ? 88  ARG A HD3  1  
ATOM   1473  H  HE   . ARG A 1 88  ? -7.908  -0.940  15.050  1.00 0.00 ? 88  ARG A HE   1  
ATOM   1474  H  HH11 . ARG A 1 88  ? -4.895  -1.403  13.405  1.00 0.00 ? 88  ARG A HH11 1  
ATOM   1475  H  HH12 . ARG A 1 88  ? -4.278  0.165   13.807  1.00 0.00 ? 88  ARG A HH12 1  
ATOM   1476  H  HH21 . ARG A 1 88  ? -7.104  1.113   15.579  1.00 0.00 ? 88  ARG A HH21 1  
ATOM   1477  H  HH22 . ARG A 1 88  ? -5.528  1.588   15.041  1.00 0.00 ? 88  ARG A HH22 1  
ATOM   1478  N  N    . VAL A 1 89  ? -6.729  -3.221  8.055   1.00 0.00 ? 89  VAL A N    1  
ATOM   1479  C  CA   . VAL A 1 89  ? -5.825  -3.435  6.938   1.00 0.00 ? 89  VAL A CA   1  
ATOM   1480  C  C    . VAL A 1 89  ? -4.660  -2.443  6.936   1.00 0.00 ? 89  VAL A C    1  
ATOM   1481  O  O    . VAL A 1 89  ? -4.785  -1.304  7.391   1.00 0.00 ? 89  VAL A O    1  
ATOM   1482  C  CB   . VAL A 1 89  ? -6.616  -3.329  5.635   1.00 0.00 ? 89  VAL A CB   1  
ATOM   1483  C  CG1  . VAL A 1 89  ? -5.988  -4.217  4.550   1.00 0.00 ? 89  VAL A CG1  1  
ATOM   1484  C  CG2  . VAL A 1 89  ? -8.069  -3.766  5.882   1.00 0.00 ? 89  VAL A CG2  1  
ATOM   1485  H  H    . VAL A 1 89  ? -7.502  -2.627  7.943   1.00 0.00 ? 89  VAL A H    1  
ATOM   1486  H  HA   . VAL A 1 89  ? -5.426  -4.428  7.011   1.00 0.00 ? 89  VAL A HA   1  
ATOM   1487  H  HB   . VAL A 1 89  ? -6.601  -2.310  5.310   1.00 0.00 ? 89  VAL A HB   1  
ATOM   1488  H  HG11 . VAL A 1 89  ? -6.048  -3.711  3.599   1.00 0.00 ? 89  VAL A HG11 1  
ATOM   1489  H  HG12 . VAL A 1 89  ? -6.524  -5.155  4.490   1.00 0.00 ? 89  VAL A HG12 1  
ATOM   1490  H  HG13 . VAL A 1 89  ? -4.952  -4.405  4.788   1.00 0.00 ? 89  VAL A HG13 1  
ATOM   1491  H  HG21 . VAL A 1 89  ? -8.574  -3.891  4.936   1.00 0.00 ? 89  VAL A HG21 1  
ATOM   1492  H  HG22 . VAL A 1 89  ? -8.579  -3.015  6.467   1.00 0.00 ? 89  VAL A HG22 1  
ATOM   1493  H  HG23 . VAL A 1 89  ? -8.076  -4.705  6.418   1.00 0.00 ? 89  VAL A HG23 1  
ATOM   1494  N  N    . THR A 1 90  ? -3.527  -2.904  6.411   1.00 0.00 ? 90  THR A N    1  
ATOM   1495  C  CA   . THR A 1 90  ? -2.317  -2.094  6.329   1.00 0.00 ? 90  THR A CA   1  
ATOM   1496  C  C    . THR A 1 90  ? -1.627  -2.348  4.986   1.00 0.00 ? 90  THR A C    1  
ATOM   1497  O  O    . THR A 1 90  ? -1.209  -3.469  4.702   1.00 0.00 ? 90  THR A O    1  
ATOM   1498  C  CB   . THR A 1 90  ? -1.389  -2.459  7.505   1.00 0.00 ? 90  THR A CB   1  
ATOM   1499  O  OG1  . THR A 1 90  ? -1.734  -1.666  8.632   1.00 0.00 ? 90  THR A OG1  1  
ATOM   1500  C  CG2  . THR A 1 90  ? 0.081   -2.214  7.148   1.00 0.00 ? 90  THR A CG2  1  
ATOM   1501  H  H    . THR A 1 90  ? -3.504  -3.819  6.065   1.00 0.00 ? 90  THR A H    1  
ATOM   1502  H  HA   . THR A 1 90  ? -2.580  -1.051  6.399   1.00 0.00 ? 90  THR A HA   1  
ATOM   1503  H  HB   . THR A 1 90  ? -1.522  -3.500  7.754   1.00 0.00 ? 90  THR A HB   1  
ATOM   1504  H  HG1  . THR A 1 90  ? -1.293  -0.817  8.542   1.00 0.00 ? 90  THR A HG1  1  
ATOM   1505  H  HG21 . THR A 1 90  ? 0.378   -2.876  6.354   1.00 0.00 ? 90  THR A HG21 1  
ATOM   1506  H  HG22 . THR A 1 90  ? 0.695   -2.400  8.017   1.00 0.00 ? 90  THR A HG22 1  
ATOM   1507  H  HG23 . THR A 1 90  ? 0.208   -1.192  6.829   1.00 0.00 ? 90  THR A HG23 1  
ATOM   1508  N  N    . CYS A 1 91  ? -1.522  -1.311  4.158   1.00 0.00 ? 91  CYS A N    1  
ATOM   1509  C  CA   . CYS A 1 91  ? -0.892  -1.452  2.845   1.00 0.00 ? 91  CYS A CA   1  
ATOM   1510  C  C    . CYS A 1 91  ? 0.505   -0.839  2.832   1.00 0.00 ? 91  CYS A C    1  
ATOM   1511  O  O    . CYS A 1 91  ? 0.712   0.268   3.328   1.00 0.00 ? 91  CYS A O    1  
ATOM   1512  C  CB   . CYS A 1 91  ? -1.751  -0.763  1.779   1.00 0.00 ? 91  CYS A CB   1  
ATOM   1513  S  SG   . CYS A 1 91  ? -0.924  -0.881  0.174   1.00 0.00 ? 91  CYS A SG   1  
ATOM   1514  H  H    . CYS A 1 91  ? -1.880  -0.443  4.428   1.00 0.00 ? 91  CYS A H    1  
ATOM   1515  H  HA   . CYS A 1 91  ? -0.815  -2.502  2.601   1.00 0.00 ? 91  CYS A HA   1  
ATOM   1516  H  HB2  . CYS A 1 91  ? -2.714  -1.250  1.724   1.00 0.00 ? 91  CYS A HB2  1  
ATOM   1517  H  HB3  . CYS A 1 91  ? -1.886  0.280   2.039   1.00 0.00 ? 91  CYS A HB3  1  
ATOM   1518  H  HG   . CYS A 1 91  ? -1.207  -1.695  -0.248  1.00 0.00 ? 91  CYS A HG   1  
ATOM   1519  N  N    . PHE A 1 92  ? 1.459   -1.561  2.241   1.00 0.00 ? 92  PHE A N    1  
ATOM   1520  C  CA   . PHE A 1 92  ? 2.834   -1.073  2.145   1.00 0.00 ? 92  PHE A CA   1  
ATOM   1521  C  C    . PHE A 1 92  ? 3.262   -0.984  0.688   1.00 0.00 ? 92  PHE A C    1  
ATOM   1522  O  O    . PHE A 1 92  ? 3.621   -1.988  0.071   1.00 0.00 ? 92  PHE A O    1  
ATOM   1523  C  CB   . PHE A 1 92  ? 3.788   -2.002  2.897   1.00 0.00 ? 92  PHE A CB   1  
ATOM   1524  C  CG   . PHE A 1 92  ? 3.562   -1.893  4.388   1.00 0.00 ? 92  PHE A CG   1  
ATOM   1525  C  CD1  . PHE A 1 92  ? 3.815   -0.689  5.055   1.00 0.00 ? 92  PHE A CD1  1  
ATOM   1526  C  CD2  . PHE A 1 92  ? 3.113   -3.007  5.106   1.00 0.00 ? 92  PHE A CD2  1  
ATOM   1527  C  CE1  . PHE A 1 92  ? 3.617   -0.601  6.440   1.00 0.00 ? 92  PHE A CE1  1  
ATOM   1528  C  CE2  . PHE A 1 92  ? 2.913   -2.919  6.488   1.00 0.00 ? 92  PHE A CE2  1  
ATOM   1529  C  CZ   . PHE A 1 92  ? 3.165   -1.716  7.156   1.00 0.00 ? 92  PHE A CZ   1  
ATOM   1530  H  H    . PHE A 1 92  ? 1.231   -2.431  1.851   1.00 0.00 ? 92  PHE A H    1  
ATOM   1531  H  HA   . PHE A 1 92  ? 2.894   -0.092  2.574   1.00 0.00 ? 92  PHE A HA   1  
ATOM   1532  H  HB2  . PHE A 1 92  ? 3.615   -3.018  2.584   1.00 0.00 ? 92  PHE A HB2  1  
ATOM   1533  H  HB3  . PHE A 1 92  ? 4.809   -1.723  2.670   1.00 0.00 ? 92  PHE A HB3  1  
ATOM   1534  H  HD1  . PHE A 1 92  ? 4.163   0.171   4.501   1.00 0.00 ? 92  PHE A HD1  1  
ATOM   1535  H  HD2  . PHE A 1 92  ? 2.915   -3.932  4.591   1.00 0.00 ? 92  PHE A HD2  1  
ATOM   1536  H  HE1  . PHE A 1 92  ? 3.813   0.326   6.956   1.00 0.00 ? 92  PHE A HE1  1  
ATOM   1537  H  HE2  . PHE A 1 92  ? 2.567   -3.781  7.042   1.00 0.00 ? 92  PHE A HE2  1  
ATOM   1538  H  HZ   . PHE A 1 92  ? 3.012   -1.648  8.223   1.00 0.00 ? 92  PHE A HZ   1  
ATOM   1539  N  N    . THR A 1 93  ? 3.230   0.228   0.148   1.00 0.00 ? 93  THR A N    1  
ATOM   1540  C  CA   . THR A 1 93  ? 3.625   0.444   -1.238  1.00 0.00 ? 93  THR A CA   1  
ATOM   1541  C  C    . THR A 1 93  ? 4.193   1.839   -1.413  1.00 0.00 ? 93  THR A C    1  
ATOM   1542  O  O    . THR A 1 93  ? 3.479   2.827   -1.270  1.00 0.00 ? 93  THR A O    1  
ATOM   1543  C  CB   . THR A 1 93  ? 2.424   0.288   -2.165  1.00 0.00 ? 93  THR A CB   1  
ATOM   1544  O  OG1  . THR A 1 93  ? 1.669   -0.851  -1.780  1.00 0.00 ? 93  THR A OG1  1  
ATOM   1545  C  CG2  . THR A 1 93  ? 2.906   0.135   -3.611  1.00 0.00 ? 93  THR A CG2  1  
ATOM   1546  H  H    . THR A 1 93  ? 2.938   0.994   0.692   1.00 0.00 ? 93  THR A H    1  
ATOM   1547  H  HA   . THR A 1 93  ? 4.376   -0.282  -1.509  1.00 0.00 ? 93  THR A HA   1  
ATOM   1548  H  HB   . THR A 1 93  ? 1.810   1.170   -2.092  1.00 0.00 ? 93  THR A HB   1  
ATOM   1549  H  HG1  . THR A 1 93  ? 1.160   -0.620  -0.999  1.00 0.00 ? 93  THR A HG1  1  
ATOM   1550  H  HG21 . THR A 1 93  ? 2.082   -0.184  -4.233  1.00 0.00 ? 93  THR A HG21 1  
ATOM   1551  H  HG22 . THR A 1 93  ? 3.696   -0.598  -3.656  1.00 0.00 ? 93  THR A HG22 1  
ATOM   1552  H  HG23 . THR A 1 93  ? 3.277   1.085   -3.968  1.00 0.00 ? 93  THR A HG23 1  
ATOM   1553  N  N    . SER A 1 94  ? 5.473   1.909   -1.742  1.00 0.00 ? 94  SER A N    1  
ATOM   1554  C  CA   . SER A 1 94  ? 6.130   3.194   -1.950  1.00 0.00 ? 94  SER A CA   1  
ATOM   1555  C  C    . SER A 1 94  ? 5.247   4.108   -2.795  1.00 0.00 ? 94  SER A C    1  
ATOM   1556  O  O    . SER A 1 94  ? 5.506   5.305   -2.914  1.00 0.00 ? 94  SER A O    1  
ATOM   1557  C  CB   . SER A 1 94  ? 7.474   2.982   -2.653  1.00 0.00 ? 94  SER A CB   1  
ATOM   1558  O  OG   . SER A 1 94  ? 7.649   3.978   -3.651  1.00 0.00 ? 94  SER A OG   1  
ATOM   1559  H  H    . SER A 1 94  ? 5.981   1.082   -1.856  1.00 0.00 ? 94  SER A H    1  
ATOM   1560  H  HA   . SER A 1 94  ? 6.304   3.661   -0.992  1.00 0.00 ? 94  SER A HA   1  
ATOM   1561  H  HB2  . SER A 1 94  ? 8.276   3.054   -1.937  1.00 0.00 ? 94  SER A HB2  1  
ATOM   1562  H  HB3  . SER A 1 94  ? 7.488   1.999   -3.106  1.00 0.00 ? 94  SER A HB3  1  
ATOM   1563  H  HG   . SER A 1 94  ? 8.098   3.576   -4.398  1.00 0.00 ? 94  SER A HG   1  
ATOM   1564  N  N    . TRP A 1 95  ? 4.205   3.528   -3.385  1.00 0.00 ? 95  TRP A N    1  
ATOM   1565  C  CA   . TRP A 1 95  ? 3.285   4.282   -4.226  1.00 0.00 ? 95  TRP A CA   1  
ATOM   1566  C  C    . TRP A 1 95  ? 1.926   4.457   -3.535  1.00 0.00 ? 95  TRP A C    1  
ATOM   1567  O  O    . TRP A 1 95  ? 1.441   3.557   -2.849  1.00 0.00 ? 95  TRP A O    1  
ATOM   1568  C  CB   . TRP A 1 95  ? 3.110   3.533   -5.545  1.00 0.00 ? 95  TRP A CB   1  
ATOM   1569  C  CG   . TRP A 1 95  ? 2.636   4.468   -6.606  1.00 0.00 ? 95  TRP A CG   1  
ATOM   1570  C  CD1  . TRP A 1 95  ? 3.369   5.453   -7.172  1.00 0.00 ? 95  TRP A CD1  1  
ATOM   1571  C  CD2  . TRP A 1 95  ? 1.335   4.509   -7.242  1.00 0.00 ? 95  TRP A CD2  1  
ATOM   1572  N  NE1  . TRP A 1 95  ? 2.590   6.095   -8.120  1.00 0.00 ? 95  TRP A NE1  1  
ATOM   1573  C  CE2  . TRP A 1 95  ? 1.331   5.546   -8.197  1.00 0.00 ? 95  TRP A CE2  1  
ATOM   1574  C  CE3  . TRP A 1 95  ? 0.170   3.749   -7.084  1.00 0.00 ? 95  TRP A CE3  1  
ATOM   1575  C  CZ2  . TRP A 1 95  ? 0.207   5.820   -8.967  1.00 0.00 ? 95  TRP A CZ2  1  
ATOM   1576  C  CZ3  . TRP A 1 95  ? -0.963  4.023   -7.858  1.00 0.00 ? 95  TRP A CZ3  1  
ATOM   1577  C  CH2  . TRP A 1 95  ? -0.944  5.058   -8.801  1.00 0.00 ? 95  TRP A CH2  1  
ATOM   1578  H  H    . TRP A 1 95  ? 4.055   2.569   -3.257  1.00 0.00 ? 95  TRP A H    1  
ATOM   1579  H  HA   . TRP A 1 95  ? 3.704   5.255   -4.432  1.00 0.00 ? 95  TRP A HA   1  
ATOM   1580  H  HB2  . TRP A 1 95  ? 4.056   3.108   -5.843  1.00 0.00 ? 95  TRP A HB2  1  
ATOM   1581  H  HB3  . TRP A 1 95  ? 2.386   2.742   -5.415  1.00 0.00 ? 95  TRP A HB3  1  
ATOM   1582  H  HD1  . TRP A 1 95  ? 4.392   5.698   -6.927  1.00 0.00 ? 95  TRP A HD1  1  
ATOM   1583  H  HE1  . TRP A 1 95  ? 2.877   6.848   -8.677  1.00 0.00 ? 95  TRP A HE1  1  
ATOM   1584  H  HE3  . TRP A 1 95  ? 0.147   2.953   -6.357  1.00 0.00 ? 95  TRP A HE3  1  
ATOM   1585  H  HZ2  . TRP A 1 95  ? 0.229   6.614   -9.688  1.00 0.00 ? 95  TRP A HZ2  1  
ATOM   1586  H  HZ3  . TRP A 1 95  ? -1.850  3.433   -7.729  1.00 0.00 ? 95  TRP A HZ3  1  
ATOM   1587  H  HH2  . TRP A 1 95  ? -1.818  5.265   -9.398  1.00 0.00 ? 95  TRP A HH2  1  
ATOM   1588  N  N    . SER A 1 96  ? 1.329   5.632   -3.726  1.00 0.00 ? 96  SER A N    1  
ATOM   1589  C  CA   . SER A 1 96  ? 0.030   5.964   -3.132  1.00 0.00 ? 96  SER A CA   1  
ATOM   1590  C  C    . SER A 1 96  ? -1.115  5.461   -4.040  1.00 0.00 ? 96  SER A C    1  
ATOM   1591  O  O    . SER A 1 96  ? -0.860  4.677   -4.951  1.00 0.00 ? 96  SER A O    1  
ATOM   1592  C  CB   . SER A 1 96  ? -0.018  7.473   -2.909  1.00 0.00 ? 96  SER A CB   1  
ATOM   1593  O  OG   . SER A 1 96  ? -0.713  7.753   -1.701  1.00 0.00 ? 96  SER A OG   1  
ATOM   1594  H  H    . SER A 1 96  ? 1.777   6.304   -4.282  1.00 0.00 ? 96  SER A H    1  
ATOM   1595  H  HA   . SER A 1 96  ? -0.047  5.468   -2.176  1.00 0.00 ? 96  SER A HA   1  
ATOM   1596  H  HB2  . SER A 1 96  ? 0.986   7.845   -2.819  1.00 0.00 ? 96  SER A HB2  1  
ATOM   1597  H  HB3  . SER A 1 96  ? -0.501  7.950   -3.748  1.00 0.00 ? 96  SER A HB3  1  
ATOM   1598  H  HG   . SER A 1 96  ? -0.081  8.108   -1.071  1.00 0.00 ? 96  SER A HG   1  
ATOM   1599  N  N    . PRO A 1 97  ? -2.370  5.832   -3.808  1.00 0.00 ? 97  PRO A N    1  
ATOM   1600  C  CA   . PRO A 1 97  ? -3.510  5.322   -4.629  1.00 0.00 ? 97  PRO A CA   1  
ATOM   1601  C  C    . PRO A 1 97  ? -3.651  6.101   -5.932  1.00 0.00 ? 97  PRO A C    1  
ATOM   1602  O  O    . PRO A 1 97  ? -2.666  6.630   -6.447  1.00 0.00 ? 97  PRO A O    1  
ATOM   1603  C  CB   . PRO A 1 97  ? -4.707  5.539   -3.715  1.00 0.00 ? 97  PRO A CB   1  
ATOM   1604  C  CG   . PRO A 1 97  ? -4.379  6.781   -2.972  1.00 0.00 ? 97  PRO A CG   1  
ATOM   1605  C  CD   . PRO A 1 97  ? -2.860  6.785   -2.785  1.00 0.00 ? 97  PRO A CD   1  
ATOM   1606  H  HA   . PRO A 1 97  ? -3.399  4.270   -4.823  1.00 0.00 ? 97  PRO A HA   1  
ATOM   1607  H  HB2  . PRO A 1 97  ? -5.606  5.665   -4.296  1.00 0.00 ? 97  PRO A HB2  1  
ATOM   1608  H  HB3  . PRO A 1 97  ? -4.812  4.715   -3.028  1.00 0.00 ? 97  PRO A HB3  1  
ATOM   1609  H  HG2  . PRO A 1 97  ? -4.686  7.650   -3.556  1.00 0.00 ? 97  PRO A HG2  1  
ATOM   1610  H  HG3  . PRO A 1 97  ? -4.865  6.781   -2.011  1.00 0.00 ? 97  PRO A HG3  1  
ATOM   1611  H  HD2  . PRO A 1 97  ? -2.498  7.779   -2.977  1.00 0.00 ? 97  PRO A HD2  1  
ATOM   1612  H  HD3  . PRO A 1 97  ? -2.590  6.454   -1.794  1.00 0.00 ? 97  PRO A HD3  1  
ATOM   1613  N  N    . CYS A 1 98  ? -4.869  6.184   -6.468  1.00 0.00 ? 98  CYS A N    1  
ATOM   1614  C  CA   . CYS A 1 98  ? -5.069  6.923   -7.711  1.00 0.00 ? 98  CYS A CA   1  
ATOM   1615  C  C    . CYS A 1 98  ? -6.439  7.591   -7.765  1.00 0.00 ? 98  CYS A C    1  
ATOM   1616  O  O    . CYS A 1 98  ? -7.359  7.224   -7.041  1.00 0.00 ? 98  CYS A O    1  
ATOM   1617  C  CB   . CYS A 1 98  ? -4.918  5.993   -8.925  1.00 0.00 ? 98  CYS A CB   1  
ATOM   1618  S  SG   . CYS A 1 98  ? -4.092  4.462   -8.435  1.00 0.00 ? 98  CYS A SG   1  
ATOM   1619  H  H    . CYS A 1 98  ? -5.629  5.753   -6.027  1.00 0.00 ? 98  CYS A H    1  
ATOM   1620  H  HA   . CYS A 1 98  ? -4.313  7.692   -7.765  1.00 0.00 ? 98  CYS A HA   1  
ATOM   1621  H  HB2  . CYS A 1 98  ? -5.895  5.750   -9.322  1.00 0.00 ? 98  CYS A HB2  1  
ATOM   1622  H  HB3  . CYS A 1 98  ? -4.333  6.487   -9.688  1.00 0.00 ? 98  CYS A HB3  1  
ATOM   1623  N  N    . PHE A 1 99  ? -6.555  8.567   -8.658  1.00 0.00 ? 99  PHE A N    1  
ATOM   1624  C  CA   . PHE A 1 99  ? -7.800  9.301   -8.851  1.00 0.00 ? 99  PHE A CA   1  
ATOM   1625  C  C    . PHE A 1 99  ? -9.011  8.381   -8.777  1.00 0.00 ? 99  PHE A C    1  
ATOM   1626  O  O    . PHE A 1 99  ? -9.964  8.647   -8.044  1.00 0.00 ? 99  PHE A O    1  
ATOM   1627  C  CB   . PHE A 1 99  ? -7.782  9.974   -10.221 1.00 0.00 ? 99  PHE A CB   1  
ATOM   1628  C  CG   . PHE A 1 99  ? -7.851  8.922   -11.303 1.00 0.00 ? 99  PHE A CG   1  
ATOM   1629  C  CD1  . PHE A 1 99  ? -6.759  8.074   -11.527 1.00 0.00 ? 99  PHE A CD1  1  
ATOM   1630  C  CD2  . PHE A 1 99  ? -9.007  8.795   -12.084 1.00 0.00 ? 99  PHE A CD2  1  
ATOM   1631  C  CE1  . PHE A 1 99  ? -6.823  7.101   -12.531 1.00 0.00 ? 99  PHE A CE1  1  
ATOM   1632  C  CE2  . PHE A 1 99  ? -9.070  7.822   -13.088 1.00 0.00 ? 99  PHE A CE2  1  
ATOM   1633  C  CZ   . PHE A 1 99  ? -7.979  6.975   -13.312 1.00 0.00 ? 99  PHE A CZ   1  
ATOM   1634  H  H    . PHE A 1 99  ? -5.780  8.795   -9.213  1.00 0.00 ? 99  PHE A H    1  
ATOM   1635  H  HA   . PHE A 1 99  ? -7.885  10.062  -8.091  1.00 0.00 ? 99  PHE A HA   1  
ATOM   1636  H  HB2  . PHE A 1 99  ? -8.631  10.633  -10.311 1.00 0.00 ? 99  PHE A HB2  1  
ATOM   1637  H  HB3  . PHE A 1 99  ? -6.873  10.537  -10.331 1.00 0.00 ? 99  PHE A HB3  1  
ATOM   1638  H  HD1  . PHE A 1 99  ? -5.868  8.172   -10.926 1.00 0.00 ? 99  PHE A HD1  1  
ATOM   1639  H  HD2  . PHE A 1 99  ? -9.850  9.448   -11.910 1.00 0.00 ? 99  PHE A HD2  1  
ATOM   1640  H  HE1  . PHE A 1 99  ? -5.980  6.448   -12.704 1.00 0.00 ? 99  PHE A HE1  1  
ATOM   1641  H  HE2  . PHE A 1 99  ? -9.962  7.725   -13.690 1.00 0.00 ? 99  PHE A HE2  1  
ATOM   1642  H  HZ   . PHE A 1 99  ? -8.027  6.224   -14.087 1.00 0.00 ? 99  PHE A HZ   1  
ATOM   1643  N  N    . SER A 1 100 ? -8.979  7.314   -9.562  1.00 0.00 ? 100 SER A N    1  
ATOM   1644  C  CA   . SER A 1 100 ? -10.094 6.377   -9.600  1.00 0.00 ? 100 SER A CA   1  
ATOM   1645  C  C    . SER A 1 100 ? -9.941  5.286   -8.544  1.00 0.00 ? 100 SER A C    1  
ATOM   1646  O  O    . SER A 1 100 ? -10.734 5.205   -7.608  1.00 0.00 ? 100 SER A O    1  
ATOM   1647  C  CB   . SER A 1 100 ? -10.194 5.741   -10.987 1.00 0.00 ? 100 SER A CB   1  
ATOM   1648  O  OG   . SER A 1 100 ? -10.936 6.601   -11.842 1.00 0.00 ? 100 SER A OG   1  
ATOM   1649  H  H    . SER A 1 100 ? -8.200  7.165   -10.137 1.00 0.00 ? 100 SER A H    1  
ATOM   1650  H  HA   . SER A 1 100 ? -11.006 6.928   -9.405  1.00 0.00 ? 100 SER A HA   1  
ATOM   1651  H  HB2  . SER A 1 100 ? -9.207  5.601   -11.394 1.00 0.00 ? 100 SER A HB2  1  
ATOM   1652  H  HB3  . SER A 1 100 ? -10.689 4.780   -10.909 1.00 0.00 ? 100 SER A HB3  1  
ATOM   1653  H  HG   . SER A 1 100 ? -11.370 7.259   -11.296 1.00 0.00 ? 100 SER A HG   1  
ATOM   1654  N  N    . CYS A 1 101 ? -8.925  4.440   -8.697  1.00 0.00 ? 101 CYS A N    1  
ATOM   1655  C  CA   . CYS A 1 101 ? -8.707  3.362   -7.734  1.00 0.00 ? 101 CYS A CA   1  
ATOM   1656  C  C    . CYS A 1 101 ? -9.006  3.845   -6.328  1.00 0.00 ? 101 CYS A C    1  
ATOM   1657  O  O    . CYS A 1 101 ? -9.383  3.064   -5.455  1.00 0.00 ? 101 CYS A O    1  
ATOM   1658  C  CB   . CYS A 1 101 ? -7.246  2.906   -7.741  1.00 0.00 ? 101 CYS A CB   1  
ATOM   1659  S  SG   . CYS A 1 101 ? -6.807  2.049   -9.268  1.00 0.00 ? 101 CYS A SG   1  
ATOM   1660  H  H    . CYS A 1 101 ? -8.322  4.539   -9.461  1.00 0.00 ? 101 CYS A H    1  
ATOM   1661  H  HA   . CYS A 1 101 ? -9.353  2.531   -7.970  1.00 0.00 ? 101 CYS A HA   1  
ATOM   1662  H  HB2  . CYS A 1 101 ? -6.611  3.773   -7.637  1.00 0.00 ? 101 CYS A HB2  1  
ATOM   1663  H  HB3  . CYS A 1 101 ? -7.078  2.252   -6.904  1.00 0.00 ? 101 CYS A HB3  1  
ATOM   1664  N  N    . ALA A 1 102 ? -8.818  5.135   -6.105  1.00 0.00 ? 102 ALA A N    1  
ATOM   1665  C  CA   . ALA A 1 102 ? -9.053  5.683   -4.784  1.00 0.00 ? 102 ALA A CA   1  
ATOM   1666  C  C    . ALA A 1 102 ? -10.535 5.763   -4.526  1.00 0.00 ? 102 ALA A C    1  
ATOM   1667  O  O    . ALA A 1 102 ? -11.011 5.446   -3.439  1.00 0.00 ? 102 ALA A O    1  
ATOM   1668  C  CB   . ALA A 1 102 ? -8.415  7.065   -4.650  1.00 0.00 ? 102 ALA A CB   1  
ATOM   1669  H  H    . ALA A 1 102 ? -8.514  5.721   -6.837  1.00 0.00 ? 102 ALA A H    1  
ATOM   1670  H  HA   . ALA A 1 102 ? -8.617  5.017   -4.064  1.00 0.00 ? 102 ALA A HA   1  
ATOM   1671  H  HB1  . ALA A 1 102 ? -8.825  7.721   -5.397  1.00 0.00 ? 102 ALA A HB1  1  
ATOM   1672  H  HB2  . ALA A 1 102 ? -7.350  6.986   -4.786  1.00 0.00 ? 102 ALA A HB2  1  
ATOM   1673  H  HB3  . ALA A 1 102 ? -8.617  7.466   -3.673  1.00 0.00 ? 102 ALA A HB3  1  
ATOM   1674  N  N    . GLN A 1 103 ? -11.261 6.162   -5.545  1.00 0.00 ? 103 GLN A N    1  
ATOM   1675  C  CA   . GLN A 1 103 ? -12.695 6.250   -5.438  1.00 0.00 ? 103 GLN A CA   1  
ATOM   1676  C  C    . GLN A 1 103 ? -13.256 4.886   -5.100  1.00 0.00 ? 103 GLN A C    1  
ATOM   1677  O  O    . GLN A 1 103 ? -13.820 4.690   -4.024  1.00 0.00 ? 103 GLN A O    1  
ATOM   1678  C  CB   . GLN A 1 103 ? -13.271 6.725   -6.759  1.00 0.00 ? 103 GLN A CB   1  
ATOM   1679  C  CG   . GLN A 1 103 ? -13.030 8.219   -6.882  1.00 0.00 ? 103 GLN A CG   1  
ATOM   1680  C  CD   . GLN A 1 103 ? -13.704 8.759   -8.138  1.00 0.00 ? 103 GLN A CD   1  
ATOM   1681  O  OE1  . GLN A 1 103 ? -13.492 9.913   -8.510  1.00 0.00 ? 103 GLN A OE1  1  
ATOM   1682  N  NE2  . GLN A 1 103 ? -14.508 7.988   -8.817  1.00 0.00 ? 103 GLN A NE2  1  
ATOM   1683  H  H    . GLN A 1 103 ? -10.822 6.383   -6.393  1.00 0.00 ? 103 GLN A H    1  
ATOM   1684  H  HA   . GLN A 1 103 ? -12.951 6.947   -4.659  1.00 0.00 ? 103 GLN A HA   1  
ATOM   1685  H  HB2  . GLN A 1 103 ? -12.763 6.213   -7.569  1.00 0.00 ? 103 GLN A HB2  1  
ATOM   1686  H  HB3  . GLN A 1 103 ? -14.331 6.521   -6.797  1.00 0.00 ? 103 GLN A HB3  1  
ATOM   1687  H  HG2  . GLN A 1 103 ? -13.426 8.722   -6.009  1.00 0.00 ? 103 GLN A HG2  1  
ATOM   1688  H  HG3  . GLN A 1 103 ? -11.970 8.385   -6.942  1.00 0.00 ? 103 GLN A HG3  1  
ATOM   1689  H  HE21 . GLN A 1 103 ? -14.674 7.070   -8.518  1.00 0.00 ? 103 GLN A HE21 1  
ATOM   1690  H  HE22 . GLN A 1 103 ? -14.946 8.327   -9.625  1.00 0.00 ? 103 GLN A HE22 1  
ATOM   1691  N  N    . GLU A 1 104 ? -13.065 3.937   -6.018  1.00 0.00 ? 104 GLU A N    1  
ATOM   1692  C  CA   . GLU A 1 104 ? -13.539 2.574   -5.797  1.00 0.00 ? 104 GLU A CA   1  
ATOM   1693  C  C    . GLU A 1 104 ? -13.369 2.221   -4.322  1.00 0.00 ? 104 GLU A C    1  
ATOM   1694  O  O    . GLU A 1 104 ? -14.335 1.908   -3.619  1.00 0.00 ? 104 GLU A O    1  
ATOM   1695  C  CB   . GLU A 1 104 ? -12.739 1.606   -6.673  1.00 0.00 ? 104 GLU A CB   1  
ATOM   1696  C  CG   . GLU A 1 104 ? -13.379 1.516   -8.061  1.00 0.00 ? 104 GLU A CG   1  
ATOM   1697  C  CD   . GLU A 1 104 ? -12.707 0.414   -8.874  1.00 0.00 ? 104 GLU A CD   1  
ATOM   1698  O  OE1  . GLU A 1 104 ? -13.009 -0.742  -8.631  1.00 0.00 ? 104 GLU A OE1  1  
ATOM   1699  O  OE2  . GLU A 1 104 ? -11.899 0.744   -9.727  1.00 0.00 ? 104 GLU A OE2  1  
ATOM   1700  H  H    . GLU A 1 104 ? -12.577 4.157   -6.848  1.00 0.00 ? 104 GLU A H    1  
ATOM   1701  H  HA   . GLU A 1 104 ? -14.582 2.510   -6.059  1.00 0.00 ? 104 GLU A HA   1  
ATOM   1702  H  HB2  . GLU A 1 104 ? -11.730 1.973   -6.774  1.00 0.00 ? 104 GLU A HB2  1  
ATOM   1703  H  HB3  . GLU A 1 104 ? -12.727 0.629   -6.217  1.00 0.00 ? 104 GLU A HB3  1  
ATOM   1704  H  HG2  . GLU A 1 104 ? -14.430 1.295   -7.959  1.00 0.00 ? 104 GLU A HG2  1  
ATOM   1705  H  HG3  . GLU A 1 104 ? -13.258 2.460   -8.572  1.00 0.00 ? 104 GLU A HG3  1  
ATOM   1706  N  N    . MET A 1 105 ? -12.134 2.315   -3.855  1.00 0.00 ? 105 MET A N    1  
ATOM   1707  C  CA   . MET A 1 105 ? -11.835 2.052   -2.469  1.00 0.00 ? 105 MET A CA   1  
ATOM   1708  C  C    . MET A 1 105 ? -12.673 2.979   -1.582  1.00 0.00 ? 105 MET A C    1  
ATOM   1709  O  O    . MET A 1 105 ? -13.616 2.515   -0.952  1.00 0.00 ? 105 MET A O    1  
ATOM   1710  C  CB   . MET A 1 105 ? -10.321 2.220   -2.270  1.00 0.00 ? 105 MET A CB   1  
ATOM   1711  C  CG   . MET A 1 105 ? -9.747  1.187   -1.286  1.00 0.00 ? 105 MET A CG   1  
ATOM   1712  S  SD   . MET A 1 105 ? -9.885  1.802   0.408   1.00 0.00 ? 105 MET A SD   1  
ATOM   1713  C  CE   . MET A 1 105 ? -8.658  3.124   0.285   1.00 0.00 ? 105 MET A CE   1  
ATOM   1714  H  H    . MET A 1 105 ? -11.407 2.591   -4.453  1.00 0.00 ? 105 MET A H    1  
ATOM   1715  H  HA   . MET A 1 105 ? -12.110 1.051   -2.238  1.00 0.00 ? 105 MET A HA   1  
ATOM   1716  H  HB2  . MET A 1 105 ? -9.843  2.076   -3.227  1.00 0.00 ? 105 MET A HB2  1  
ATOM   1717  H  HB3  . MET A 1 105 ? -10.110 3.207   -1.917  1.00 0.00 ? 105 MET A HB3  1  
ATOM   1718  H  HG2  . MET A 1 105 ? -10.276 0.255   -1.376  1.00 0.00 ? 105 MET A HG2  1  
ATOM   1719  H  HG3  . MET A 1 105 ? -8.706  1.019   -1.521  1.00 0.00 ? 105 MET A HG3  1  
ATOM   1720  H  HE1  . MET A 1 105 ? -8.033  2.961   -0.581  1.00 0.00 ? 105 MET A HE1  1  
ATOM   1721  H  HE2  . MET A 1 105 ? -8.050  3.133   1.179   1.00 0.00 ? 105 MET A HE2  1  
ATOM   1722  H  HE3  . MET A 1 105 ? -9.164  4.067   0.189   1.00 0.00 ? 105 MET A HE3  1  
ATOM   1723  N  N    . ALA A 1 106 ? -12.362 4.277   -1.546  1.00 0.00 ? 106 ALA A N    1  
ATOM   1724  C  CA   . ALA A 1 106 ? -13.135 5.209   -0.712  1.00 0.00 ? 106 ALA A CA   1  
ATOM   1725  C  C    . ALA A 1 106 ? -14.597 4.773   -0.574  1.00 0.00 ? 106 ALA A C    1  
ATOM   1726  O  O    . ALA A 1 106 ? -15.123 4.717   0.523   1.00 0.00 ? 106 ALA A O    1  
ATOM   1727  C  CB   . ALA A 1 106 ? -13.150 6.618   -1.301  1.00 0.00 ? 106 ALA A CB   1  
ATOM   1728  H  H    . ALA A 1 106 ? -11.609 4.610   -2.070  1.00 0.00 ? 106 ALA A H    1  
ATOM   1729  H  HA   . ALA A 1 106 ? -12.668 5.249   0.273   1.00 0.00 ? 106 ALA A HA   1  
ATOM   1730  H  HB1  . ALA A 1 106 ? -12.184 6.868   -1.693  1.00 0.00 ? 106 ALA A HB1  1  
ATOM   1731  H  HB2  . ALA A 1 106 ? -13.422 7.319   -0.524  1.00 0.00 ? 106 ALA A HB2  1  
ATOM   1732  H  HB3  . ALA A 1 106 ? -13.882 6.669   -2.093  1.00 0.00 ? 106 ALA A HB3  1  
ATOM   1733  N  N    . LYS A 1 107 ? -15.278 4.468   -1.673  1.00 0.00 ? 107 LYS A N    1  
ATOM   1734  C  CA   . LYS A 1 107 ? -16.666 4.052   -1.543  1.00 0.00 ? 107 LYS A CA   1  
ATOM   1735  C  C    . LYS A 1 107 ? -16.755 2.993   -0.480  1.00 0.00 ? 107 LYS A C    1  
ATOM   1736  O  O    . LYS A 1 107 ? -17.266 3.212   0.618   1.00 0.00 ? 107 LYS A O    1  
ATOM   1737  C  CB   . LYS A 1 107 ? -17.154 3.439   -2.837  1.00 0.00 ? 107 LYS A CB   1  
ATOM   1738  C  CG   . LYS A 1 107 ? -17.493 4.543   -3.857  1.00 0.00 ? 107 LYS A CG   1  
ATOM   1739  C  CD   . LYS A 1 107 ? -16.779 4.260   -5.170  1.00 0.00 ? 107 LYS A CD   1  
ATOM   1740  C  CE   . LYS A 1 107 ? -17.393 3.026   -5.821  1.00 0.00 ? 107 LYS A CE   1  
ATOM   1741  N  NZ   . LYS A 1 107 ? -18.759 3.351   -6.318  1.00 0.00 ? 107 LYS A NZ   1  
ATOM   1742  H  H    . LYS A 1 107 ? -14.857 4.515   -2.559  1.00 0.00 ? 107 LYS A H    1  
ATOM   1743  H  HA   . LYS A 1 107 ? -17.282 4.891   -1.286  1.00 0.00 ? 107 LYS A HA   1  
ATOM   1744  H  HB2  . LYS A 1 107 ? -16.374 2.796   -3.211  1.00 0.00 ? 107 LYS A HB2  1  
ATOM   1745  H  HB3  . LYS A 1 107 ? -18.038 2.847   -2.643  1.00 0.00 ? 107 LYS A HB3  1  
ATOM   1746  H  HG2  . LYS A 1 107 ? -18.560 4.554   -4.030  1.00 0.00 ? 107 LYS A HG2  1  
ATOM   1747  H  HG3  . LYS A 1 107 ? -17.181 5.507   -3.481  1.00 0.00 ? 107 LYS A HG3  1  
ATOM   1748  H  HD2  . LYS A 1 107 ? -16.882 5.103   -5.821  1.00 0.00 ? 107 LYS A HD2  1  
ATOM   1749  H  HD3  . LYS A 1 107 ? -15.740 4.082   -4.978  1.00 0.00 ? 107 LYS A HD3  1  
ATOM   1750  H  HE2  . LYS A 1 107 ? -16.775 2.705   -6.647  1.00 0.00 ? 107 LYS A HE2  1  
ATOM   1751  H  HE3  . LYS A 1 107 ? -17.453 2.239   -5.087  1.00 0.00 ? 107 LYS A HE3  1  
ATOM   1752  H  HZ1  . LYS A 1 107 ? -19.021 2.687   -7.074  1.00 0.00 ? 107 LYS A HZ1  1  
ATOM   1753  H  HZ2  . LYS A 1 107 ? -18.772 4.320   -6.692  1.00 0.00 ? 107 LYS A HZ2  1  
ATOM   1754  H  HZ3  . LYS A 1 107 ? -19.441 3.271   -5.535  1.00 0.00 ? 107 LYS A HZ3  1  
ATOM   1755  N  N    . PHE A 1 108 ? -16.234 1.841   -0.835  1.00 0.00 ? 108 PHE A N    1  
ATOM   1756  C  CA   . PHE A 1 108 ? -16.226 0.706   0.072   1.00 0.00 ? 108 PHE A CA   1  
ATOM   1757  C  C    . PHE A 1 108 ? -16.013 1.180   1.510   1.00 0.00 ? 108 PHE A C    1  
ATOM   1758  O  O    . PHE A 1 108 ? -16.532 0.594   2.460   1.00 0.00 ? 108 PHE A O    1  
ATOM   1759  C  CB   . PHE A 1 108 ? -15.106 -0.237  -0.337  1.00 0.00 ? 108 PHE A CB   1  
ATOM   1760  C  CG   . PHE A 1 108 ? -15.620 -1.127  -1.432  1.00 0.00 ? 108 PHE A CG   1  
ATOM   1761  C  CD1  . PHE A 1 108 ? -16.011 -0.577  -2.658  1.00 0.00 ? 108 PHE A CD1  1  
ATOM   1762  C  CD2  . PHE A 1 108 ? -15.738 -2.492  -1.206  1.00 0.00 ? 108 PHE A CD2  1  
ATOM   1763  C  CE1  . PHE A 1 108 ? -16.519 -1.403  -3.660  1.00 0.00 ? 108 PHE A CE1  1  
ATOM   1764  C  CE2  . PHE A 1 108 ? -16.242 -3.325  -2.206  1.00 0.00 ? 108 PHE A CE2  1  
ATOM   1765  C  CZ   . PHE A 1 108 ? -16.636 -2.782  -3.436  1.00 0.00 ? 108 PHE A CZ   1  
ATOM   1766  H  H    . PHE A 1 108 ? -15.838 1.758   -1.740  1.00 0.00 ? 108 PHE A H    1  
ATOM   1767  H  HA   . PHE A 1 108 ? -17.172 0.180   -0.005  1.00 0.00 ? 108 PHE A HA   1  
ATOM   1768  H  HB2  . PHE A 1 108 ? -14.270 0.339   -0.696  1.00 0.00 ? 108 PHE A HB2  1  
ATOM   1769  H  HB3  . PHE A 1 108 ? -14.805 -0.837  0.507   1.00 0.00 ? 108 PHE A HB3  1  
ATOM   1770  H  HD1  . PHE A 1 108 ? -15.920 0.486   -2.832  1.00 0.00 ? 108 PHE A HD1  1  
ATOM   1771  H  HD2  . PHE A 1 108 ? -15.433 -2.904  -0.260  1.00 0.00 ? 108 PHE A HD2  1  
ATOM   1772  H  HE1  . PHE A 1 108 ? -16.824 -0.977  -4.601  1.00 0.00 ? 108 PHE A HE1  1  
ATOM   1773  H  HE2  . PHE A 1 108 ? -16.333 -4.382  -2.024  1.00 0.00 ? 108 PHE A HE2  1  
ATOM   1774  H  HZ   . PHE A 1 108 ? -17.029 -3.424  -4.211  1.00 0.00 ? 108 PHE A HZ   1  
ATOM   1775  N  N    . ILE A 1 109 ? -15.235 2.249   1.643   1.00 0.00 ? 109 ILE A N    1  
ATOM   1776  C  CA   . ILE A 1 109 ? -14.915 2.834   2.933   1.00 0.00 ? 109 ILE A CA   1  
ATOM   1777  C  C    . ILE A 1 109 ? -16.015 3.806   3.374   1.00 0.00 ? 109 ILE A C    1  
ATOM   1778  O  O    . ILE A 1 109 ? -16.776 3.522   4.298   1.00 0.00 ? 109 ILE A O    1  
ATOM   1779  C  CB   . ILE A 1 109 ? -13.584 3.558   2.755   1.00 0.00 ? 109 ILE A CB   1  
ATOM   1780  C  CG1  . ILE A 1 109 ? -12.461 2.559   2.862   1.00 0.00 ? 109 ILE A CG1  1  
ATOM   1781  C  CG2  . ILE A 1 109 ? -13.387 4.636   3.789   1.00 0.00 ? 109 ILE A CG2  1  
ATOM   1782  C  CD1  . ILE A 1 109 ? -12.723 1.427   1.889   1.00 0.00 ? 109 ILE A CD1  1  
ATOM   1783  H  H    . ILE A 1 109 ? -14.845 2.657   0.845   1.00 0.00 ? 109 ILE A H    1  
ATOM   1784  H  HA   . ILE A 1 109 ? -14.798 2.052   3.671   1.00 0.00 ? 109 ILE A HA   1  
ATOM   1785  H  HB   . ILE A 1 109 ? -13.552 3.997   1.787   1.00 0.00 ? 109 ILE A HB   1  
ATOM   1786  H  HG12 . ILE A 1 109 ? -11.532 3.043   2.612   1.00 0.00 ? 109 ILE A HG12 1  
ATOM   1787  H  HG13 . ILE A 1 109 ? -12.424 2.179   3.860   1.00 0.00 ? 109 ILE A HG13 1  
ATOM   1788  H  HG21 . ILE A 1 109 ? -13.682 4.262   4.752   1.00 0.00 ? 109 ILE A HG21 1  
ATOM   1789  H  HG22 . ILE A 1 109 ? -13.983 5.493   3.523   1.00 0.00 ? 109 ILE A HG22 1  
ATOM   1790  H  HG23 . ILE A 1 109 ? -12.343 4.911   3.806   1.00 0.00 ? 109 ILE A HG23 1  
ATOM   1791  H  HD11 . ILE A 1 109 ? -11.838 0.835   1.771   1.00 0.00 ? 109 ILE A HD11 1  
ATOM   1792  H  HD12 . ILE A 1 109 ? -13.002 1.845   0.946   1.00 0.00 ? 109 ILE A HD12 1  
ATOM   1793  H  HD13 . ILE A 1 109 ? -13.522 0.812   2.261   1.00 0.00 ? 109 ILE A HD13 1  
ATOM   1794  N  N    . SER A 1 110 ? -16.088 4.948   2.697   1.00 0.00 ? 110 SER A N    1  
ATOM   1795  C  CA   . SER A 1 110 ? -17.087 5.964   2.998   1.00 0.00 ? 110 SER A CA   1  
ATOM   1796  C  C    . SER A 1 110 ? -18.456 5.321   3.169   1.00 0.00 ? 110 SER A C    1  
ATOM   1797  O  O    . SER A 1 110 ? -19.200 5.643   4.095   1.00 0.00 ? 110 SER A O    1  
ATOM   1798  C  CB   . SER A 1 110 ? -17.138 6.983   1.853   1.00 0.00 ? 110 SER A CB   1  
ATOM   1799  O  OG   . SER A 1 110 ? -18.398 6.905   1.199   1.00 0.00 ? 110 SER A OG   1  
ATOM   1800  H  H    . SER A 1 110 ? -15.459 5.108   1.981   1.00 0.00 ? 110 SER A H    1  
ATOM   1801  H  HA   . SER A 1 110 ? -16.812 6.471   3.907   1.00 0.00 ? 110 SER A HA   1  
ATOM   1802  H  HB2  . SER A 1 110 ? -17.006 7.980   2.243   1.00 0.00 ? 110 SER A HB2  1  
ATOM   1803  H  HB3  . SER A 1 110 ? -16.343 6.766   1.151   1.00 0.00 ? 110 SER A HB3  1  
ATOM   1804  H  HG   . SER A 1 110 ? -19.075 7.179   1.822   1.00 0.00 ? 110 SER A HG   1  
ATOM   1805  N  N    . LYS A 1 111 ? -18.770 4.401   2.268   1.00 0.00 ? 111 LYS A N    1  
ATOM   1806  C  CA   . LYS A 1 111 ? -20.039 3.697   2.315   1.00 0.00 ? 111 LYS A CA   1  
ATOM   1807  C  C    . LYS A 1 111 ? -20.116 2.870   3.587   1.00 0.00 ? 111 LYS A C    1  
ATOM   1808  O  O    . LYS A 1 111 ? -21.178 2.737   4.196   1.00 0.00 ? 111 LYS A O    1  
ATOM   1809  C  CB   . LYS A 1 111 ? -20.169 2.773   1.107   1.00 0.00 ? 111 LYS A CB   1  
ATOM   1810  C  CG   . LYS A 1 111 ? -20.167 3.531   -0.240  1.00 0.00 ? 111 LYS A CG   1  
ATOM   1811  C  CD   . LYS A 1 111 ? -20.752 4.951   -0.135  1.00 0.00 ? 111 LYS A CD   1  
ATOM   1812  C  CE   . LYS A 1 111 ? -22.228 4.899   0.293   1.00 0.00 ? 111 LYS A CE   1  
ATOM   1813  N  NZ   . LYS A 1 111 ? -22.501 6.002   1.256   1.00 0.00 ? 111 LYS A NZ   1  
ATOM   1814  H  H    . LYS A 1 111 ? -18.127 4.184   1.566   1.00 0.00 ? 111 LYS A H    1  
ATOM   1815  H  HA   . LYS A 1 111 ? -20.844 4.398   2.317   1.00 0.00 ? 111 LYS A HA   1  
ATOM   1816  H  HB2  . LYS A 1 111 ? -19.338 2.093   1.118   1.00 0.00 ? 111 LYS A HB2  1  
ATOM   1817  H  HB3  . LYS A 1 111 ? -21.074 2.209   1.193   1.00 0.00 ? 111 LYS A HB3  1  
ATOM   1818  H  HG2  . LYS A 1 111 ? -19.162 3.601   -0.595  1.00 0.00 ? 111 LYS A HG2  1  
ATOM   1819  H  HG3  . LYS A 1 111 ? -20.745 2.968   -0.953  1.00 0.00 ? 111 LYS A HG3  1  
ATOM   1820  H  HD2  . LYS A 1 111 ? -20.182 5.532   0.573   1.00 0.00 ? 111 LYS A HD2  1  
ATOM   1821  H  HD3  . LYS A 1 111 ? -20.685 5.426   -1.103  1.00 0.00 ? 111 LYS A HD3  1  
ATOM   1822  H  HE2  . LYS A 1 111 ? -22.859 5.018   -0.577  1.00 0.00 ? 111 LYS A HE2  1  
ATOM   1823  H  HE3  . LYS A 1 111 ? -22.442 3.952   0.762   1.00 0.00 ? 111 LYS A HE3  1  
ATOM   1824  H  HZ1  . LYS A 1 111 ? -23.319 5.752   1.847   1.00 0.00 ? 111 LYS A HZ1  1  
ATOM   1825  H  HZ2  . LYS A 1 111 ? -22.710 6.876   0.733   1.00 0.00 ? 111 LYS A HZ2  1  
ATOM   1826  H  HZ3  . LYS A 1 111 ? -21.668 6.150   1.861   1.00 0.00 ? 111 LYS A HZ3  1  
ATOM   1827  N  N    . ASN A 1 112 ? -18.978 2.316   3.982   1.00 0.00 ? 112 ASN A N    1  
ATOM   1828  C  CA   . ASN A 1 112 ? -18.915 1.502   5.187   1.00 0.00 ? 112 ASN A CA   1  
ATOM   1829  C  C    . ASN A 1 112 ? -17.587 1.697   5.915   1.00 0.00 ? 112 ASN A C    1  
ATOM   1830  O  O    . ASN A 1 112 ? -16.647 0.924   5.728   1.00 0.00 ? 112 ASN A O    1  
ATOM   1831  C  CB   . ASN A 1 112 ? -19.088 0.025   4.831   1.00 0.00 ? 112 ASN A CB   1  
ATOM   1832  C  CG   . ASN A 1 112 ? -20.565 -0.292  4.630   1.00 0.00 ? 112 ASN A CG   1  
ATOM   1833  O  OD1  . ASN A 1 112 ? -21.103 -0.080  3.543   1.00 0.00 ? 112 ASN A OD1  1  
ATOM   1834  N  ND2  . ASN A 1 112 ? -21.256 -0.791  5.617   1.00 0.00 ? 112 ASN A ND2  1  
ATOM   1835  H  H    . ASN A 1 112 ? -18.169 2.460   3.452   1.00 0.00 ? 112 ASN A H    1  
ATOM   1836  H  HA   . ASN A 1 112 ? -19.717 1.796   5.844   1.00 0.00 ? 112 ASN A HA   1  
ATOM   1837  H  HB2  . ASN A 1 112 ? -18.547 -0.189  3.921   1.00 0.00 ? 112 ASN A HB2  1  
ATOM   1838  H  HB3  . ASN A 1 112 ? -18.698 -0.584  5.632   1.00 0.00 ? 112 ASN A HB3  1  
ATOM   1839  H  HD21 . ASN A 1 112 ? -20.824 -0.960  6.480   1.00 0.00 ? 112 ASN A HD21 1  
ATOM   1840  H  HD22 . ASN A 1 112 ? -22.206 -0.998  5.495   1.00 0.00 ? 112 ASN A HD22 1  
ATOM   1841  N  N    . LYS A 1 113 ? -17.518 2.731   6.750   1.00 0.00 ? 113 LYS A N    1  
ATOM   1842  C  CA   . LYS A 1 113 ? -16.302 3.010   7.505   1.00 0.00 ? 113 LYS A CA   1  
ATOM   1843  C  C    . LYS A 1 113 ? -15.822 1.750   8.225   1.00 0.00 ? 113 LYS A C    1  
ATOM   1844  O  O    . LYS A 1 113 ? -14.692 1.688   8.708   1.00 0.00 ? 113 LYS A O    1  
ATOM   1845  C  CB   . LYS A 1 113 ? -16.544 4.115   8.538   1.00 0.00 ? 113 LYS A CB   1  
ATOM   1846  C  CG   . LYS A 1 113 ? -17.535 5.156   8.004   1.00 0.00 ? 113 LYS A CG   1  
ATOM   1847  C  CD   . LYS A 1 113 ? -16.957 5.831   6.757   1.00 0.00 ? 113 LYS A CD   1  
ATOM   1848  C  CE   . LYS A 1 113 ? -17.546 7.238   6.610   1.00 0.00 ? 113 LYS A CE   1  
ATOM   1849  N  NZ   . LYS A 1 113 ? -17.307 8.016   7.860   1.00 0.00 ? 113 LYS A NZ   1  
ATOM   1850  H  H    . LYS A 1 113 ? -18.296 3.308   6.860   1.00 0.00 ? 113 LYS A H    1  
ATOM   1851  H  HA   . LYS A 1 113 ? -15.539 3.337   6.828   1.00 0.00 ? 113 LYS A HA   1  
ATOM   1852  H  HB2  . LYS A 1 113 ? -16.938 3.676   9.434   1.00 0.00 ? 113 LYS A HB2  1  
ATOM   1853  H  HB3  . LYS A 1 113 ? -15.606 4.602   8.761   1.00 0.00 ? 113 LYS A HB3  1  
ATOM   1854  H  HG2  . LYS A 1 113 ? -18.470 4.678   7.757   1.00 0.00 ? 113 LYS A HG2  1  
ATOM   1855  H  HG3  . LYS A 1 113 ? -17.708 5.901   8.764   1.00 0.00 ? 113 LYS A HG3  1  
ATOM   1856  H  HD2  . LYS A 1 113 ? -15.883 5.898   6.849   1.00 0.00 ? 113 LYS A HD2  1  
ATOM   1857  H  HD3  . LYS A 1 113 ? -17.206 5.247   5.883   1.00 0.00 ? 113 LYS A HD3  1  
ATOM   1858  H  HE2  . LYS A 1 113 ? -17.074 7.742   5.780   1.00 0.00 ? 113 LYS A HE2  1  
ATOM   1859  H  HE3  . LYS A 1 113 ? -18.608 7.166   6.429   1.00 0.00 ? 113 LYS A HE3  1  
ATOM   1860  H  HZ1  . LYS A 1 113 ? -16.556 7.559   8.415   1.00 0.00 ? 113 LYS A HZ1  1  
ATOM   1861  H  HZ2  . LYS A 1 113 ? -18.181 8.045   8.422   1.00 0.00 ? 113 LYS A HZ2  1  
ATOM   1862  H  HZ3  . LYS A 1 113 ? -17.018 8.985   7.615   1.00 0.00 ? 113 LYS A HZ3  1  
ATOM   1863  N  N    . HIS A 1 114 ? -16.700 0.753   8.297   1.00 0.00 ? 114 HIS A N    1  
ATOM   1864  C  CA   . HIS A 1 114 ? -16.380 -0.507  8.965   1.00 0.00 ? 114 HIS A CA   1  
ATOM   1865  C  C    . HIS A 1 114 ? -14.975 -0.987  8.606   1.00 0.00 ? 114 HIS A C    1  
ATOM   1866  O  O    . HIS A 1 114 ? -14.442 -1.900  9.237   1.00 0.00 ? 114 HIS A O    1  
ATOM   1867  C  CB   . HIS A 1 114 ? -17.403 -1.570  8.561   1.00 0.00 ? 114 HIS A CB   1  
ATOM   1868  C  CG   . HIS A 1 114 ? -17.398 -2.687  9.568   1.00 0.00 ? 114 HIS A CG   1  
ATOM   1869  N  ND1  . HIS A 1 114 ? -16.814 -3.915  9.303   1.00 0.00 ? 114 HIS A ND1  1  
ATOM   1870  C  CD2  . HIS A 1 114 ? -17.908 -2.780  10.840  1.00 0.00 ? 114 HIS A CD2  1  
ATOM   1871  C  CE1  . HIS A 1 114 ? -16.983 -4.688  10.390  1.00 0.00 ? 114 HIS A CE1  1  
ATOM   1872  N  NE2  . HIS A 1 114 ? -17.644 -4.045  11.357  1.00 0.00 ? 114 HIS A NE2  1  
ATOM   1873  H  H    . HIS A 1 114 ? -17.587 0.869   7.897   1.00 0.00 ? 114 HIS A H    1  
ATOM   1874  H  HA   . HIS A 1 114 ? -16.437 -0.360  10.033  1.00 0.00 ? 114 HIS A HA   1  
ATOM   1875  H  HB2  . HIS A 1 114 ? -18.386 -1.125  8.522   1.00 0.00 ? 114 HIS A HB2  1  
ATOM   1876  H  HB3  . HIS A 1 114 ? -17.147 -1.963  7.588   1.00 0.00 ? 114 HIS A HB3  1  
ATOM   1877  H  HD1  . HIS A 1 114 ? -16.361 -4.174  8.473   1.00 0.00 ? 114 HIS A HD1  1  
ATOM   1878  H  HD2  . HIS A 1 114 ? -18.436 -1.994  11.358  1.00 0.00 ? 114 HIS A HD2  1  
ATOM   1879  H  HE1  . HIS A 1 114 ? -16.631 -5.704  10.470  1.00 0.00 ? 114 HIS A HE1  1  
ATOM   1880  H  HE2  . HIS A 1 114 ? -17.890 -4.389  12.241  1.00 0.00 ? 114 HIS A HE2  1  
ATOM   1881  N  N    . VAL A 1 115 ? -14.382 -0.372  7.590   1.00 0.00 ? 115 VAL A N    1  
ATOM   1882  C  CA   . VAL A 1 115 ? -13.043 -0.740  7.146   1.00 0.00 ? 115 VAL A CA   1  
ATOM   1883  C  C    . VAL A 1 115 ? -12.029 0.308   7.608   1.00 0.00 ? 115 VAL A C    1  
ATOM   1884  O  O    . VAL A 1 115 ? -12.356 1.489   7.721   1.00 0.00 ? 115 VAL A O    1  
ATOM   1885  C  CB   . VAL A 1 115 ? -13.057 -0.867  5.606   1.00 0.00 ? 115 VAL A CB   1  
ATOM   1886  C  CG1  . VAL A 1 115 ? -11.756 -0.363  5.002   1.00 0.00 ? 115 VAL A CG1  1  
ATOM   1887  C  CG2  . VAL A 1 115 ? -13.228 -2.330  5.202   1.00 0.00 ? 115 VAL A CG2  1  
ATOM   1888  H  H    . VAL A 1 115 ? -14.851 0.348   7.122   1.00 0.00 ? 115 VAL A H    1  
ATOM   1889  H  HA   . VAL A 1 115 ? -12.775 -1.693  7.574   1.00 0.00 ? 115 VAL A HA   1  
ATOM   1890  H  HB   . VAL A 1 115 ? -13.880 -0.290  5.209   1.00 0.00 ? 115 VAL A HB   1  
ATOM   1891  H  HG11 . VAL A 1 115 ? -11.644 0.681   5.223   1.00 0.00 ? 115 VAL A HG11 1  
ATOM   1892  H  HG12 . VAL A 1 115 ? -11.784 -0.507  3.934   1.00 0.00 ? 115 VAL A HG12 1  
ATOM   1893  H  HG13 . VAL A 1 115 ? -10.929 -0.913  5.422   1.00 0.00 ? 115 VAL A HG13 1  
ATOM   1894  H  HG21 . VAL A 1 115 ? -13.451 -2.386  4.146   1.00 0.00 ? 115 VAL A HG21 1  
ATOM   1895  H  HG22 . VAL A 1 115 ? -14.035 -2.768  5.766   1.00 0.00 ? 115 VAL A HG22 1  
ATOM   1896  H  HG23 . VAL A 1 115 ? -12.311 -2.865  5.403   1.00 0.00 ? 115 VAL A HG23 1  
ATOM   1897  N  N    . SER A 1 116 ? -10.793 -0.127  7.858   1.00 0.00 ? 116 SER A N    1  
ATOM   1898  C  CA   . SER A 1 116 ? -9.747  0.797   8.287   1.00 0.00 ? 116 SER A CA   1  
ATOM   1899  C  C    . SER A 1 116 ? -8.450  0.533   7.527   1.00 0.00 ? 116 SER A C    1  
ATOM   1900  O  O    . SER A 1 116 ? -7.717  -0.404  7.846   1.00 0.00 ? 116 SER A O    1  
ATOM   1901  C  CB   . SER A 1 116 ? -9.497  0.647   9.785   1.00 0.00 ? 116 SER A CB   1  
ATOM   1902  O  OG   . SER A 1 116 ? -10.678 0.991   10.496  1.00 0.00 ? 116 SER A OG   1  
ATOM   1903  H  H    . SER A 1 116 ? -10.578 -1.081  7.745   1.00 0.00 ? 116 SER A H    1  
ATOM   1904  H  HA   . SER A 1 116 ? -10.070 1.810   8.087   1.00 0.00 ? 116 SER A HA   1  
ATOM   1905  H  HB2  . SER A 1 116 ? -9.233  -0.373  10.005  1.00 0.00 ? 116 SER A HB2  1  
ATOM   1906  H  HB3  . SER A 1 116 ? -8.683  1.298   10.077  1.00 0.00 ? 116 SER A HB3  1  
ATOM   1907  H  HG   . SER A 1 116 ? -10.980 1.843   10.175  1.00 0.00 ? 116 SER A HG   1  
ATOM   1908  N  N    . LEU A 1 117 ? -8.162  1.367   6.529   1.00 0.00 ? 117 LEU A N    1  
ATOM   1909  C  CA   . LEU A 1 117 ? -6.943  1.207   5.751   1.00 0.00 ? 117 LEU A CA   1  
ATOM   1910  C  C    . LEU A 1 117 ? -5.845  2.100   6.292   1.00 0.00 ? 117 LEU A C    1  
ATOM   1911  O  O    . LEU A 1 117 ? -6.064  3.285   6.541   1.00 0.00 ? 117 LEU A O    1  
ATOM   1912  C  CB   . LEU A 1 117 ? -7.137  1.608   4.287   1.00 0.00 ? 117 LEU A CB   1  
ATOM   1913  C  CG   . LEU A 1 117 ? -8.334  0.913   3.624   1.00 0.00 ? 117 LEU A CG   1  
ATOM   1914  C  CD1  . LEU A 1 117 ? -8.548  -0.510  4.145   1.00 0.00 ? 117 LEU A CD1  1  
ATOM   1915  C  CD2  . LEU A 1 117 ? -9.585  1.731   3.857   1.00 0.00 ? 117 LEU A CD2  1  
ATOM   1916  H  H    . LEU A 1 117 ? -8.771  2.100   6.320   1.00 0.00 ? 117 LEU A H    1  
ATOM   1917  H  HA   . LEU A 1 117 ? -6.621  0.181   5.793   1.00 0.00 ? 117 LEU A HA   1  
ATOM   1918  H  HB2  . LEU A 1 117 ? -7.281  2.677   4.235   1.00 0.00 ? 117 LEU A HB2  1  
ATOM   1919  H  HB3  . LEU A 1 117 ? -6.243  1.354   3.743   1.00 0.00 ? 117 LEU A HB3  1  
ATOM   1920  H  HG   . LEU A 1 117 ? -8.146  0.864   2.566   1.00 0.00 ? 117 LEU A HG   1  
ATOM   1921  H  HD11 . LEU A 1 117 ? -7.696  -1.111  3.887   1.00 0.00 ? 117 LEU A HD11 1  
ATOM   1922  H  HD12 . LEU A 1 117 ? -9.431  -0.927  3.681   1.00 0.00 ? 117 LEU A HD12 1  
ATOM   1923  H  HD13 . LEU A 1 117 ? -8.683  -0.501  5.215   1.00 0.00 ? 117 LEU A HD13 1  
ATOM   1924  H  HD21 . LEU A 1 117 ? -9.752  1.848   4.913   1.00 0.00 ? 117 LEU A HD21 1  
ATOM   1925  H  HD22 . LEU A 1 117 ? -10.416 1.220   3.415   1.00 0.00 ? 117 LEU A HD22 1  
ATOM   1926  H  HD23 . LEU A 1 117 ? -9.467  2.699   3.399   1.00 0.00 ? 117 LEU A HD23 1  
ATOM   1927  N  N    . CYS A 1 118 ? -4.654  1.545   6.420   1.00 0.00 ? 118 CYS A N    1  
ATOM   1928  C  CA   . CYS A 1 118 ? -3.515  2.317   6.871   1.00 0.00 ? 118 CYS A CA   1  
ATOM   1929  C  C    . CYS A 1 118 ? -2.427  2.213   5.816   1.00 0.00 ? 118 CYS A C    1  
ATOM   1930  O  O    . CYS A 1 118 ? -1.625  1.277   5.825   1.00 0.00 ? 118 CYS A O    1  
ATOM   1931  C  CB   . CYS A 1 118 ? -3.009  1.771   8.200   1.00 0.00 ? 118 CYS A CB   1  
ATOM   1932  S  SG   . CYS A 1 118 ? -4.331  1.861   9.436   1.00 0.00 ? 118 CYS A SG   1  
ATOM   1933  H  H    . CYS A 1 118 ? -4.529  0.608   6.173   1.00 0.00 ? 118 CYS A H    1  
ATOM   1934  H  HA   . CYS A 1 118 ? -3.798  3.354   6.992   1.00 0.00 ? 118 CYS A HA   1  
ATOM   1935  H  HB2  . CYS A 1 118 ? -2.700  0.743   8.076   1.00 0.00 ? 118 CYS A HB2  1  
ATOM   1936  H  HB3  . CYS A 1 118 ? -2.173  2.362   8.526   1.00 0.00 ? 118 CYS A HB3  1  
ATOM   1937  H  HG   . CYS A 1 118 ? -5.163  1.978   8.970   1.00 0.00 ? 118 CYS A HG   1  
ATOM   1938  N  N    . ILE A 1 119 ? -2.431  3.155   4.879   1.00 0.00 ? 119 ILE A N    1  
ATOM   1939  C  CA   . ILE A 1 119 ? -1.479  3.142   3.800   1.00 0.00 ? 119 ILE A CA   1  
ATOM   1940  C  C    . ILE A 1 119 ? -0.193  3.866   4.140   1.00 0.00 ? 119 ILE A C    1  
ATOM   1941  O  O    . ILE A 1 119 ? -0.199  5.020   4.570   1.00 0.00 ? 119 ILE A O    1  
ATOM   1942  C  CB   . ILE A 1 119 ? -2.120  3.786   2.593   1.00 0.00 ? 119 ILE A CB   1  
ATOM   1943  C  CG1  . ILE A 1 119 ? -3.578  3.297   2.519   1.00 0.00 ? 119 ILE A CG1  1  
ATOM   1944  C  CG2  . ILE A 1 119 ? -1.328  3.389   1.344   1.00 0.00 ? 119 ILE A CG2  1  
ATOM   1945  C  CD1  . ILE A 1 119 ? -4.099  3.394   1.097   1.00 0.00 ? 119 ILE A CD1  1  
ATOM   1946  H  H    . ILE A 1 119 ? -3.116  3.854   4.887   1.00 0.00 ? 119 ILE A H    1  
ATOM   1947  H  HA   . ILE A 1 119 ? -1.250  2.124   3.544   1.00 0.00 ? 119 ILE A HA   1  
ATOM   1948  H  HB   . ILE A 1 119 ? -2.102  4.860   2.703   1.00 0.00 ? 119 ILE A HB   1  
ATOM   1949  H  HG12 . ILE A 1 119 ? -3.629  2.267   2.842   1.00 0.00 ? 119 ILE A HG12 1  
ATOM   1950  H  HG13 . ILE A 1 119 ? -4.196  3.908   3.166   1.00 0.00 ? 119 ILE A HG13 1  
ATOM   1951  H  HG21 . ILE A 1 119 ? -1.359  4.197   0.629   1.00 0.00 ? 119 ILE A HG21 1  
ATOM   1952  H  HG22 . ILE A 1 119 ? -1.756  2.502   0.911   1.00 0.00 ? 119 ILE A HG22 1  
ATOM   1953  H  HG23 . ILE A 1 119 ? -0.300  3.192   1.616   1.00 0.00 ? 119 ILE A HG23 1  
ATOM   1954  H  HD11 . ILE A 1 119 ? -3.674  2.597   0.509   1.00 0.00 ? 119 ILE A HD11 1  
ATOM   1955  H  HD12 . ILE A 1 119 ? -3.818  4.347   0.680   1.00 0.00 ? 119 ILE A HD12 1  
ATOM   1956  H  HD13 . ILE A 1 119 ? -5.175  3.304   1.109   1.00 0.00 ? 119 ILE A HD13 1  
ATOM   1957  N  N    . PHE A 1 120 ? 0.912   3.181   3.897   1.00 0.00 ? 120 PHE A N    1  
ATOM   1958  C  CA   . PHE A 1 120 ? 2.227   3.746   4.121   1.00 0.00 ? 120 PHE A CA   1  
ATOM   1959  C  C    . PHE A 1 120 ? 2.931   3.774   2.778   1.00 0.00 ? 120 PHE A C    1  
ATOM   1960  O  O    . PHE A 1 120 ? 3.385   2.744   2.279   1.00 0.00 ? 120 PHE A O    1  
ATOM   1961  C  CB   . PHE A 1 120 ? 3.004   2.880   5.114   1.00 0.00 ? 120 PHE A CB   1  
ATOM   1962  C  CG   . PHE A 1 120 ? 2.690   3.312   6.530   1.00 0.00 ? 120 PHE A CG   1  
ATOM   1963  C  CD1  . PHE A 1 120 ? 1.399   3.742   6.869   1.00 0.00 ? 120 PHE A CD1  1  
ATOM   1964  C  CD2  . PHE A 1 120 ? 3.692   3.274   7.508   1.00 0.00 ? 120 PHE A CD2  1  
ATOM   1965  C  CE1  . PHE A 1 120 ? 1.114   4.134   8.182   1.00 0.00 ? 120 PHE A CE1  1  
ATOM   1966  C  CE2  . PHE A 1 120 ? 3.404   3.665   8.822   1.00 0.00 ? 120 PHE A CE2  1  
ATOM   1967  C  CZ   . PHE A 1 120 ? 2.115   4.095   9.159   1.00 0.00 ? 120 PHE A CZ   1  
ATOM   1968  H  H    . PHE A 1 120 ? 0.841   2.277   3.521   1.00 0.00 ? 120 PHE A H    1  
ATOM   1969  H  HA   . PHE A 1 120 ? 2.137   4.753   4.502   1.00 0.00 ? 120 PHE A HA   1  
ATOM   1970  H  HB2  . PHE A 1 120 ? 2.716   1.848   4.985   1.00 0.00 ? 120 PHE A HB2  1  
ATOM   1971  H  HB3  . PHE A 1 120 ? 4.060   2.985   4.930   1.00 0.00 ? 120 PHE A HB3  1  
ATOM   1972  H  HD1  . PHE A 1 120 ? 0.625   3.774   6.120   1.00 0.00 ? 120 PHE A HD1  1  
ATOM   1973  H  HD2  . PHE A 1 120 ? 4.686   2.943   7.250   1.00 0.00 ? 120 PHE A HD2  1  
ATOM   1974  H  HE1  . PHE A 1 120 ? 0.120   4.466   8.442   1.00 0.00 ? 120 PHE A HE1  1  
ATOM   1975  H  HE2  . PHE A 1 120 ? 4.177   3.634   9.576   1.00 0.00 ? 120 PHE A HE2  1  
ATOM   1976  H  HZ   . PHE A 1 120 ? 1.893   4.397   10.172  1.00 0.00 ? 120 PHE A HZ   1  
ATOM   1977  N  N    . THR A 1 121 ? 2.966   4.950   2.170   1.00 0.00 ? 121 THR A N    1  
ATOM   1978  C  CA   . THR A 1 121 ? 3.554   5.100   0.845   1.00 0.00 ? 121 THR A CA   1  
ATOM   1979  C  C    . THR A 1 121 ? 4.789   6.002   0.878   1.00 0.00 ? 121 THR A C    1  
ATOM   1980  O  O    . THR A 1 121 ? 4.986   6.773   1.818   1.00 0.00 ? 121 THR A O    1  
ATOM   1981  C  CB   . THR A 1 121 ? 2.484   5.656   -0.119  1.00 0.00 ? 121 THR A CB   1  
ATOM   1982  O  OG1  . THR A 1 121 ? 2.953   6.857   -0.710  1.00 0.00 ? 121 THR A OG1  1  
ATOM   1983  C  CG2  . THR A 1 121 ? 1.178   5.932   0.643   1.00 0.00 ? 121 THR A CG2  1  
ATOM   1984  H  H    . THR A 1 121 ? 2.549   5.723   2.599   1.00 0.00 ? 121 THR A H    1  
ATOM   1985  H  HA   . THR A 1 121 ? 3.862   4.130   0.494   1.00 0.00 ? 121 THR A HA   1  
ATOM   1986  H  HB   . THR A 1 121 ? 2.280   4.927   -0.892  1.00 0.00 ? 121 THR A HB   1  
ATOM   1987  H  HG1  . THR A 1 121 ? 2.885   7.555   -0.055  1.00 0.00 ? 121 THR A HG1  1  
ATOM   1988  H  HG21 . THR A 1 121 ? 1.335   6.725   1.359   1.00 0.00 ? 121 THR A HG21 1  
ATOM   1989  H  HG22 . THR A 1 121 ? 0.869   5.039   1.164   1.00 0.00 ? 121 THR A HG22 1  
ATOM   1990  H  HG23 . THR A 1 121 ? 0.405   6.222   -0.053  1.00 0.00 ? 121 THR A HG23 1  
ATOM   1991  N  N    . ALA A 1 122 ? 5.637   5.865   -0.145  1.00 0.00 ? 122 ALA A N    1  
ATOM   1992  C  CA   . ALA A 1 122 ? 6.878   6.637   -0.217  1.00 0.00 ? 122 ALA A CA   1  
ATOM   1993  C  C    . ALA A 1 122 ? 6.729   7.905   -1.050  1.00 0.00 ? 122 ALA A C    1  
ATOM   1994  O  O    . ALA A 1 122 ? 6.856   9.011   -0.524  1.00 0.00 ? 122 ALA A O    1  
ATOM   1995  C  CB   . ALA A 1 122 ? 7.991   5.772   -0.809  1.00 0.00 ? 122 ALA A CB   1  
ATOM   1996  H  H    . ALA A 1 122 ? 5.436   5.215   -0.850  1.00 0.00 ? 122 ALA A H    1  
ATOM   1997  H  HA   . ALA A 1 122 ? 7.164   6.920   0.780   1.00 0.00 ? 122 ALA A HA   1  
ATOM   1998  H  HB1  . ALA A 1 122 ? 8.901   6.351   -0.874  1.00 0.00 ? 122 ALA A HB1  1  
ATOM   1999  H  HB2  . ALA A 1 122 ? 7.705   5.441   -1.796  1.00 0.00 ? 122 ALA A HB2  1  
ATOM   2000  H  HB3  . ALA A 1 122 ? 8.156   4.913   -0.175  1.00 0.00 ? 122 ALA A HB3  1  
ATOM   2001  N  N    . ARG A 1 123 ? 6.493   7.757   -2.352  1.00 0.00 ? 123 ARG A N    1  
ATOM   2002  C  CA   . ARG A 1 123 ? 6.368   8.932   -3.209  1.00 0.00 ? 123 ARG A CA   1  
ATOM   2003  C  C    . ARG A 1 123 ? 5.615   8.631   -4.500  1.00 0.00 ? 123 ARG A C    1  
ATOM   2004  O  O    . ARG A 1 123 ? 5.644   7.513   -5.013  1.00 0.00 ? 123 ARG A O    1  
ATOM   2005  C  CB   . ARG A 1 123 ? 7.760   9.470   -3.549  1.00 0.00 ? 123 ARG A CB   1  
ATOM   2006  C  CG   . ARG A 1 123 ? 8.709   8.297   -3.797  1.00 0.00 ? 123 ARG A CG   1  
ATOM   2007  C  CD   . ARG A 1 123 ? 9.875   8.753   -4.675  1.00 0.00 ? 123 ARG A CD   1  
ATOM   2008  N  NE   . ARG A 1 123 ? 10.873  7.694   -4.778  1.00 0.00 ? 123 ARG A NE   1  
ATOM   2009  C  CZ   . ARG A 1 123 ? 10.785  6.756   -5.715  1.00 0.00 ? 123 ARG A CZ   1  
ATOM   2010  N  NH1  . ARG A 1 123 ? 9.796   6.776   -6.568  1.00 0.00 ? 123 ARG A NH1  1  
ATOM   2011  N  NH2  . ARG A 1 123 ? 11.688  5.816   -5.785  1.00 0.00 ? 123 ARG A NH2  1  
ATOM   2012  H  H    . ARG A 1 123 ? 6.421   6.859   -2.738  1.00 0.00 ? 123 ARG A H    1  
ATOM   2013  H  HA   . ARG A 1 123 ? 5.831   9.692   -2.670  1.00 0.00 ? 123 ARG A HA   1  
ATOM   2014  H  HB2  . ARG A 1 123 ? 7.702   10.083  -4.437  1.00 0.00 ? 123 ARG A HB2  1  
ATOM   2015  H  HB3  . ARG A 1 123 ? 8.129   10.062  -2.725  1.00 0.00 ? 123 ARG A HB3  1  
ATOM   2016  H  HG2  . ARG A 1 123 ? 9.089   7.936   -2.852  1.00 0.00 ? 123 ARG A HG2  1  
ATOM   2017  H  HG3  . ARG A 1 123 ? 8.175   7.502   -4.296  1.00 0.00 ? 123 ARG A HG3  1  
ATOM   2018  H  HD2  . ARG A 1 123 ? 9.508   8.994   -5.661  1.00 0.00 ? 123 ARG A HD2  1  
ATOM   2019  H  HD3  . ARG A 1 123 ? 10.328  9.632   -4.238  1.00 0.00 ? 123 ARG A HD3  1  
ATOM   2020  H  HE   . ARG A 1 123 ? 11.620  7.673   -4.144  1.00 0.00 ? 123 ARG A HE   1  
ATOM   2021  H  HH11 . ARG A 1 123 ? 9.106   7.496   -6.515  1.00 0.00 ? 123 ARG A HH11 1  
ATOM   2022  H  HH12 . ARG A 1 123 ? 9.730   6.069   -7.272  1.00 0.00 ? 123 ARG A HH12 1  
ATOM   2023  H  HH21 . ARG A 1 123 ? 12.446  5.802   -5.134  1.00 0.00 ? 123 ARG A HH21 1  
ATOM   2024  H  HH22 . ARG A 1 123 ? 11.621  5.110   -6.491  1.00 0.00 ? 123 ARG A HH22 1  
ATOM   2025  N  N    . ILE A 1 124 ? 4.944   9.659   -5.011  1.00 0.00 ? 124 ILE A N    1  
ATOM   2026  C  CA   . ILE A 1 124 ? 4.174   9.549   -6.244  1.00 0.00 ? 124 ILE A CA   1  
ATOM   2027  C  C    . ILE A 1 124 ? 4.444   10.759  -7.132  1.00 0.00 ? 124 ILE A C    1  
ATOM   2028  O  O    . ILE A 1 124 ? 4.675   11.860  -6.635  1.00 0.00 ? 124 ILE A O    1  
ATOM   2029  C  CB   . ILE A 1 124 ? 2.686   9.498   -5.908  1.00 0.00 ? 124 ILE A CB   1  
ATOM   2030  C  CG1  . ILE A 1 124 ? 2.319   10.765  -5.097  1.00 0.00 ? 124 ILE A CG1  1  
ATOM   2031  C  CG2  . ILE A 1 124 ? 2.402   8.224   -5.104  1.00 0.00 ? 124 ILE A CG2  1  
ATOM   2032  C  CD1  . ILE A 1 124 ? 1.214   10.468  -4.081  1.00 0.00 ? 124 ILE A CD1  1  
ATOM   2033  H  H    . ILE A 1 124 ? 4.968   10.519  -4.543  1.00 0.00 ? 124 ILE A H    1  
ATOM   2034  H  HA   . ILE A 1 124 ? 4.453   8.646   -6.767  1.00 0.00 ? 124 ILE A HA   1  
ATOM   2035  H  HB   . ILE A 1 124 ? 2.114   9.477   -6.824  1.00 0.00 ? 124 ILE A HB   1  
ATOM   2036  H  HG12 . ILE A 1 124 ? 3.189   11.124  -4.570  1.00 0.00 ? 124 ILE A HG12 1  
ATOM   2037  H  HG13 . ILE A 1 124 ? 1.976   11.531  -5.777  1.00 0.00 ? 124 ILE A HG13 1  
ATOM   2038  H  HG21 . ILE A 1 124 ? 2.883   7.383   -5.583  1.00 0.00 ? 124 ILE A HG21 1  
ATOM   2039  H  HG22 . ILE A 1 124 ? 1.337   8.053   -5.067  1.00 0.00 ? 124 ILE A HG22 1  
ATOM   2040  H  HG23 . ILE A 1 124 ? 2.787   8.337   -4.103  1.00 0.00 ? 124 ILE A HG23 1  
ATOM   2041  H  HD11 . ILE A 1 124 ? 1.643   9.978   -3.219  1.00 0.00 ? 124 ILE A HD11 1  
ATOM   2042  H  HD12 . ILE A 1 124 ? 0.474   9.829   -4.531  1.00 0.00 ? 124 ILE A HD12 1  
ATOM   2043  H  HD13 . ILE A 1 124 ? 0.753   11.395  -3.772  1.00 0.00 ? 124 ILE A HD13 1  
ATOM   2044  N  N    . TYR A 1 125 ? 4.409   10.556  -8.445  1.00 0.00 ? 125 TYR A N    1  
ATOM   2045  C  CA   . TYR A 1 125 ? 4.650   11.653  -9.379  1.00 0.00 ? 125 TYR A CA   1  
ATOM   2046  C  C    . TYR A 1 125 ? 3.664   11.602  -10.542 1.00 0.00 ? 125 TYR A C    1  
ATOM   2047  O  O    . TYR A 1 125 ? 3.701   10.685  -11.363 1.00 0.00 ? 125 TYR A O    1  
ATOM   2048  C  CB   . TYR A 1 125 ? 6.085   11.584  -9.904  1.00 0.00 ? 125 TYR A CB   1  
ATOM   2049  C  CG   . TYR A 1 125 ? 7.023   12.144  -8.860  1.00 0.00 ? 125 TYR A CG   1  
ATOM   2050  C  CD1  . TYR A 1 125 ? 7.580   11.300  -7.893  1.00 0.00 ? 125 TYR A CD1  1  
ATOM   2051  C  CD2  . TYR A 1 125 ? 7.334   13.510  -8.861  1.00 0.00 ? 125 TYR A CD2  1  
ATOM   2052  C  CE1  . TYR A 1 125 ? 8.448   11.821  -6.925  1.00 0.00 ? 125 TYR A CE1  1  
ATOM   2053  C  CE2  . TYR A 1 125 ? 8.202   14.030  -7.893  1.00 0.00 ? 125 TYR A CE2  1  
ATOM   2054  C  CZ   . TYR A 1 125 ? 8.759   13.186  -6.926  1.00 0.00 ? 125 TYR A CZ   1  
ATOM   2055  O  OH   . TYR A 1 125 ? 9.615   13.699  -5.973  1.00 0.00 ? 125 TYR A OH   1  
ATOM   2056  H  H    . TYR A 1 125 ? 4.218   9.659   -8.792  1.00 0.00 ? 125 TYR A H    1  
ATOM   2057  H  HA   . TYR A 1 125 ? 4.518   12.591  -8.859  1.00 0.00 ? 125 TYR A HA   1  
ATOM   2058  H  HB2  . TYR A 1 125 ? 6.345   10.556  -10.109 1.00 0.00 ? 125 TYR A HB2  1  
ATOM   2059  H  HB3  . TYR A 1 125 ? 6.165   12.166  -10.811 1.00 0.00 ? 125 TYR A HB3  1  
ATOM   2060  H  HD1  . TYR A 1 125 ? 7.340   10.248  -7.891  1.00 0.00 ? 125 TYR A HD1  1  
ATOM   2061  H  HD2  . TYR A 1 125 ? 6.904   14.162  -9.605  1.00 0.00 ? 125 TYR A HD2  1  
ATOM   2062  H  HE1  . TYR A 1 125 ? 8.877   11.169  -6.178  1.00 0.00 ? 125 TYR A HE1  1  
ATOM   2063  H  HE2  . TYR A 1 125 ? 8.442   15.083  -7.893  1.00 0.00 ? 125 TYR A HE2  1  
ATOM   2064  H  HH   . TYR A 1 125 ? 9.442   14.640  -5.895  1.00 0.00 ? 125 TYR A HH   1  
ATOM   2065  N  N    . ASP A 1 126 ? 2.783   12.597  -10.605 1.00 0.00 ? 126 ASP A N    1  
ATOM   2066  C  CA   . ASP A 1 126 ? 1.785   12.668  -11.668 1.00 0.00 ? 126 ASP A CA   1  
ATOM   2067  C  C    . ASP A 1 126 ? 1.605   14.109  -12.134 1.00 0.00 ? 126 ASP A C    1  
ATOM   2068  O  O    . ASP A 1 126 ? 1.994   15.048  -11.439 1.00 0.00 ? 126 ASP A O    1  
ATOM   2069  C  CB   . ASP A 1 126 ? 0.448   12.119  -11.168 1.00 0.00 ? 126 ASP A CB   1  
ATOM   2070  C  CG   . ASP A 1 126 ? -0.411  11.683  -12.350 1.00 0.00 ? 126 ASP A CG   1  
ATOM   2071  O  OD1  . ASP A 1 126 ? -0.070  12.038  -13.467 1.00 0.00 ? 126 ASP A OD1  1  
ATOM   2072  O  OD2  . ASP A 1 126 ? -1.397  11.002  -12.122 1.00 0.00 ? 126 ASP A OD2  1  
ATOM   2073  H  H    . ASP A 1 126 ? 2.804   13.299  -9.921  1.00 0.00 ? 126 ASP A H    1  
ATOM   2074  H  HA   . ASP A 1 126 ? 2.118   12.068  -12.502 1.00 0.00 ? 126 ASP A HA   1  
ATOM   2075  H  HB2  . ASP A 1 126 ? 0.626   11.272  -10.522 1.00 0.00 ? 126 ASP A HB2  1  
ATOM   2076  H  HB3  . ASP A 1 126 ? -0.070  12.889  -10.614 1.00 0.00 ? 126 ASP A HB3  1  
ATOM   2077  N  N    . ASP A 1 127 ? 1.015   14.279  -13.316 1.00 0.00 ? 127 ASP A N    1  
ATOM   2078  C  CA   . ASP A 1 127 ? 0.789   15.614  -13.869 1.00 0.00 ? 127 ASP A CA   1  
ATOM   2079  C  C    . ASP A 1 127 ? -0.702  15.873  -14.071 1.00 0.00 ? 127 ASP A C    1  
ATOM   2080  O  O    . ASP A 1 127 ? -1.108  16.458  -15.077 1.00 0.00 ? 127 ASP A O    1  
ATOM   2081  C  CB   . ASP A 1 127 ? 1.515   15.752  -15.208 1.00 0.00 ? 127 ASP A CB   1  
ATOM   2082  C  CG   . ASP A 1 127 ? 1.280   17.142  -15.788 1.00 0.00 ? 127 ASP A CG   1  
ATOM   2083  O  OD1  . ASP A 1 127 ? 1.328   18.095  -15.029 1.00 0.00 ? 127 ASP A OD1  1  
ATOM   2084  O  OD2  . ASP A 1 127 ? 1.057   17.233  -16.984 1.00 0.00 ? 127 ASP A OD2  1  
ATOM   2085  H  H    . ASP A 1 127 ? 0.727   13.493  -13.825 1.00 0.00 ? 127 ASP A H    1  
ATOM   2086  H  HA   . ASP A 1 127 ? 1.180   16.354  -13.185 1.00 0.00 ? 127 ASP A HA   1  
ATOM   2087  H  HB2  . ASP A 1 127 ? 2.574   15.599  -15.058 1.00 0.00 ? 127 ASP A HB2  1  
ATOM   2088  H  HB3  . ASP A 1 127 ? 1.140   15.009  -15.897 1.00 0.00 ? 127 ASP A HB3  1  
ATOM   2089  N  N    . GLN A 1 128 ? -1.514  15.438  -13.112 1.00 0.00 ? 128 GLN A N    1  
ATOM   2090  C  CA   . GLN A 1 128 ? -2.954  15.630  -13.194 1.00 0.00 ? 128 GLN A CA   1  
ATOM   2091  C  C    . GLN A 1 128 ? -3.378  16.843  -12.371 1.00 0.00 ? 128 GLN A C    1  
ATOM   2092  O  O    . GLN A 1 128 ? -3.118  17.983  -12.754 1.00 0.00 ? 128 GLN A O    1  
ATOM   2093  C  CB   . GLN A 1 128 ? -3.678  14.383  -12.685 1.00 0.00 ? 128 GLN A CB   1  
ATOM   2094  C  CG   . GLN A 1 128 ? -3.354  13.199  -13.597 1.00 0.00 ? 128 GLN A CG   1  
ATOM   2095  C  CD   . GLN A 1 128 ? -4.236  13.243  -14.840 1.00 0.00 ? 128 GLN A CD   1  
ATOM   2096  O  OE1  . GLN A 1 128 ? -5.281  13.894  -14.839 1.00 0.00 ? 128 GLN A OE1  1  
ATOM   2097  N  NE2  . GLN A 1 128 ? -3.876  12.584  -15.908 1.00 0.00 ? 128 GLN A NE2  1  
ATOM   2098  H  H    . GLN A 1 128 ? -1.140  14.983  -12.337 1.00 0.00 ? 128 GLN A H    1  
ATOM   2099  H  HA   . GLN A 1 128 ? -3.223  15.791  -14.221 1.00 0.00 ? 128 GLN A HA   1  
ATOM   2100  H  HB2  . GLN A 1 128 ? -3.353  14.164  -11.677 1.00 0.00 ? 128 GLN A HB2  1  
ATOM   2101  H  HB3  . GLN A 1 128 ? -4.742  14.558  -12.691 1.00 0.00 ? 128 GLN A HB3  1  
ATOM   2102  H  HG2  . GLN A 1 128 ? -2.316  13.249  -13.893 1.00 0.00 ? 128 GLN A HG2  1  
ATOM   2103  H  HG3  . GLN A 1 128 ? -3.531  12.277  -13.066 1.00 0.00 ? 128 GLN A HG3  1  
ATOM   2104  H  HE21 . GLN A 1 128 ? -3.044  12.066  -15.907 1.00 0.00 ? 128 GLN A HE21 1  
ATOM   2105  H  HE22 . GLN A 1 128 ? -4.437  12.607  -16.711 1.00 0.00 ? 128 GLN A HE22 1  
ATOM   2106  N  N    . GLY A 1 129 ? -4.028  16.590  -11.237 1.00 0.00 ? 129 GLY A N    1  
ATOM   2107  C  CA   . GLY A 1 129 ? -4.478  17.672  -10.364 1.00 0.00 ? 129 GLY A CA   1  
ATOM   2108  C  C    . GLY A 1 129 ? -5.973  17.564  -10.078 1.00 0.00 ? 129 GLY A C    1  
ATOM   2109  O  O    . GLY A 1 129 ? -6.381  17.344  -8.938  1.00 0.00 ? 129 GLY A O    1  
ATOM   2110  H  H    . GLY A 1 129 ? -4.204  15.661  -10.980 1.00 0.00 ? 129 GLY A H    1  
ATOM   2111  H  HA2  . GLY A 1 129 ? -3.935  17.622  -9.432  1.00 0.00 ? 129 GLY A HA2  1  
ATOM   2112  H  HA3  . GLY A 1 129 ? -4.279  18.622  -10.839 1.00 0.00 ? 129 GLY A HA3  1  
ATOM   2113  N  N    . ARG A 1 130 ? -6.785  17.726  -11.118 1.00 0.00 ? 130 ARG A N    1  
ATOM   2114  C  CA   . ARG A 1 130 ? -8.234  17.649  -10.963 1.00 0.00 ? 130 ARG A CA   1  
ATOM   2115  C  C    . ARG A 1 130 ? -8.673  16.218  -10.666 1.00 0.00 ? 130 ARG A C    1  
ATOM   2116  O  O    . ARG A 1 130 ? -9.694  15.996  -10.017 1.00 0.00 ? 130 ARG A O    1  
ATOM   2117  C  CB   . ARG A 1 130 ? -8.922  18.142  -12.239 1.00 0.00 ? 130 ARG A CB   1  
ATOM   2118  C  CG   . ARG A 1 130 ? -8.763  19.661  -12.350 1.00 0.00 ? 130 ARG A CG   1  
ATOM   2119  C  CD   . ARG A 1 130 ? -9.443  20.155  -13.629 1.00 0.00 ? 130 ARG A CD   1  
ATOM   2120  N  NE   . ARG A 1 130 ? -9.072  19.309  -14.757 1.00 0.00 ? 130 ARG A NE   1  
ATOM   2121  C  CZ   . ARG A 1 130 ? -9.722  19.382  -15.914 1.00 0.00 ? 130 ARG A CZ   1  
ATOM   2122  N  NH1  . ARG A 1 130 ? -10.711 20.223  -16.055 1.00 0.00 ? 130 ARG A NH1  1  
ATOM   2123  N  NH2  . ARG A 1 130 ? -9.372  18.614  -16.908 1.00 0.00 ? 130 ARG A NH2  1  
ATOM   2124  H  H    . ARG A 1 130 ? -6.403  17.904  -12.003 1.00 0.00 ? 130 ARG A H    1  
ATOM   2125  H  HA   . ARG A 1 130 ? -8.531  18.283  -10.142 1.00 0.00 ? 130 ARG A HA   1  
ATOM   2126  H  HB2  . ARG A 1 130 ? -8.470  17.669  -13.098 1.00 0.00 ? 130 ARG A HB2  1  
ATOM   2127  H  HB3  . ARG A 1 130 ? -9.971  17.894  -12.201 1.00 0.00 ? 130 ARG A HB3  1  
ATOM   2128  H  HG2  . ARG A 1 130 ? -9.221  20.134  -11.493 1.00 0.00 ? 130 ARG A HG2  1  
ATOM   2129  H  HG3  . ARG A 1 130 ? -7.714  19.912  -12.383 1.00 0.00 ? 130 ARG A HG3  1  
ATOM   2130  H  HD2  . ARG A 1 130 ? -10.515 20.124  -13.499 1.00 0.00 ? 130 ARG A HD2  1  
ATOM   2131  H  HD3  . ARG A 1 130 ? -9.137  21.172  -13.825 1.00 0.00 ? 130 ARG A HD3  1  
ATOM   2132  H  HE   . ARG A 1 130 ? -8.330  18.676  -14.660 1.00 0.00 ? 130 ARG A HE   1  
ATOM   2133  H  HH11 . ARG A 1 130 ? -10.979 20.813  -15.294 1.00 0.00 ? 130 ARG A HH11 1  
ATOM   2134  H  HH12 . ARG A 1 130 ? -11.199 20.278  -16.927 1.00 0.00 ? 130 ARG A HH12 1  
ATOM   2135  H  HH21 . ARG A 1 130 ? -8.614  17.970  -16.800 1.00 0.00 ? 130 ARG A HH21 1  
ATOM   2136  H  HH22 . ARG A 1 130 ? -9.861  18.667  -17.779 1.00 0.00 ? 130 ARG A HH22 1  
ATOM   2137  N  N    . CYS A 1 131 ? -7.896  15.252  -11.146 1.00 0.00 ? 131 CYS A N    1  
ATOM   2138  C  CA   . CYS A 1 131 ? -8.217  13.845  -10.926 1.00 0.00 ? 131 CYS A CA   1  
ATOM   2139  C  C    . CYS A 1 131 ? -8.013  13.468  -9.459  1.00 0.00 ? 131 CYS A C    1  
ATOM   2140  O  O    . CYS A 1 131 ? -8.549  12.470  -8.983  1.00 0.00 ? 131 CYS A O    1  
ATOM   2141  C  CB   . CYS A 1 131 ? -7.330  12.967  -11.812 1.00 0.00 ? 131 CYS A CB   1  
ATOM   2142  S  SG   . CYS A 1 131 ? -5.706  12.772  -11.037 1.00 0.00 ? 131 CYS A SG   1  
ATOM   2143  H  H    . CYS A 1 131 ? -7.095  15.488  -11.658 1.00 0.00 ? 131 CYS A H    1  
ATOM   2144  H  HA   . CYS A 1 131 ? -9.250  13.675  -11.191 1.00 0.00 ? 131 CYS A HA   1  
ATOM   2145  H  HB2  . CYS A 1 131 ? -7.790  11.999  -11.935 1.00 0.00 ? 131 CYS A HB2  1  
ATOM   2146  H  HB3  . CYS A 1 131 ? -7.214  13.434  -12.778 1.00 0.00 ? 131 CYS A HB3  1  
ATOM   2147  H  HG   . CYS A 1 131 ? -5.838  12.409  -10.158 1.00 0.00 ? 131 CYS A HG   1  
ATOM   2148  N  N    . GLN A 1 132 ? -7.237  14.274  -8.751  1.00 0.00 ? 132 GLN A N    1  
ATOM   2149  C  CA   . GLN A 1 132 ? -6.965  14.023  -7.341  1.00 0.00 ? 132 GLN A CA   1  
ATOM   2150  C  C    . GLN A 1 132 ? -8.256  13.761  -6.561  1.00 0.00 ? 132 GLN A C    1  
ATOM   2151  O  O    . GLN A 1 132 ? -8.213  13.360  -5.396  1.00 0.00 ? 132 GLN A O    1  
ATOM   2152  C  CB   . GLN A 1 132 ? -6.231  15.222  -6.737  1.00 0.00 ? 132 GLN A CB   1  
ATOM   2153  C  CG   . GLN A 1 132 ? -4.812  15.286  -7.308  1.00 0.00 ? 132 GLN A CG   1  
ATOM   2154  C  CD   . GLN A 1 132 ? -4.198  16.654  -7.032  1.00 0.00 ? 132 GLN A CD   1  
ATOM   2155  O  OE1  . GLN A 1 132 ? -4.892  17.671  -7.089  1.00 0.00 ? 132 GLN A OE1  1  
ATOM   2156  N  NE2  . GLN A 1 132 ? -2.931  16.741  -6.733  1.00 0.00 ? 132 GLN A NE2  1  
ATOM   2157  H  H    . GLN A 1 132 ? -6.837  15.057  -9.185  1.00 0.00 ? 132 GLN A H    1  
ATOM   2158  H  HA   . GLN A 1 132 ? -6.330  13.155  -7.260  1.00 0.00 ? 132 GLN A HA   1  
ATOM   2159  H  HB2  . GLN A 1 132 ? -6.762  16.131  -6.982  1.00 0.00 ? 132 GLN A HB2  1  
ATOM   2160  H  HB3  . GLN A 1 132 ? -6.182  15.110  -5.664  1.00 0.00 ? 132 GLN A HB3  1  
ATOM   2161  H  HG2  . GLN A 1 132 ? -4.206  14.521  -6.845  1.00 0.00 ? 132 GLN A HG2  1  
ATOM   2162  H  HG3  . GLN A 1 132 ? -4.848  15.119  -8.374  1.00 0.00 ? 132 GLN A HG3  1  
ATOM   2163  H  HE21 . GLN A 1 132 ? -2.382  15.930  -6.687  1.00 0.00 ? 132 GLN A HE21 1  
ATOM   2164  H  HE22 . GLN A 1 132 ? -2.529  17.616  -6.554  1.00 0.00 ? 132 GLN A HE22 1  
ATOM   2165  N  N    . GLU A 1 133 ? -9.401  14.010  -7.199  1.00 0.00 ? 133 GLU A N    1  
ATOM   2166  C  CA   . GLU A 1 133 ? -10.689 13.815  -6.539  1.00 0.00 ? 133 GLU A CA   1  
ATOM   2167  C  C    . GLU A 1 133 ? -10.646 12.628  -5.574  1.00 0.00 ? 133 GLU A C    1  
ATOM   2168  O  O    . GLU A 1 133 ? -10.712 12.806  -4.359  1.00 0.00 ? 133 GLU A O    1  
ATOM   2169  C  CB   . GLU A 1 133 ? -11.805 13.613  -7.577  1.00 0.00 ? 133 GLU A CB   1  
ATOM   2170  C  CG   . GLU A 1 133 ? -11.243 12.991  -8.846  1.00 0.00 ? 133 GLU A CG   1  
ATOM   2171  C  CD   . GLU A 1 133 ? -12.368 12.737  -9.844  1.00 0.00 ? 133 GLU A CD   1  
ATOM   2172  O  OE1  . GLU A 1 133 ? -13.426 13.318  -9.673  1.00 0.00 ? 133 GLU A OE1  1  
ATOM   2173  O  OE2  . GLU A 1 133 ? -12.154 11.965  -10.763 1.00 0.00 ? 133 GLU A OE2  1  
ATOM   2174  H  H    . GLU A 1 133 ? -9.379  14.342  -8.118  1.00 0.00 ? 133 GLU A H    1  
ATOM   2175  H  HA   . GLU A 1 133 ? -10.913 14.700  -5.974  1.00 0.00 ? 133 GLU A HA   1  
ATOM   2176  H  HB2  . GLU A 1 133 ? -12.555 12.963  -7.176  1.00 0.00 ? 133 GLU A HB2  1  
ATOM   2177  H  HB3  . GLU A 1 133 ? -12.249 14.568  -7.816  1.00 0.00 ? 133 GLU A HB3  1  
ATOM   2178  H  HG2  . GLU A 1 133 ? -10.530 13.665  -9.277  1.00 0.00 ? 133 GLU A HG2  1  
ATOM   2179  H  HG3  . GLU A 1 133 ? -10.762 12.056  -8.606  1.00 0.00 ? 133 GLU A HG3  1  
ATOM   2180  N  N    . GLY A 1 134 ? -10.537 11.422  -6.113  1.00 0.00 ? 134 GLY A N    1  
ATOM   2181  C  CA   . GLY A 1 134 ? -10.493 10.233  -5.278  1.00 0.00 ? 134 GLY A CA   1  
ATOM   2182  C  C    . GLY A 1 134 ? -9.460  10.383  -4.165  1.00 0.00 ? 134 GLY A C    1  
ATOM   2183  O  O    . GLY A 1 134 ? -9.762  10.186  -2.990  1.00 0.00 ? 134 GLY A O    1  
ATOM   2184  H  H    . GLY A 1 134 ? -10.486 11.328  -7.082  1.00 0.00 ? 134 GLY A H    1  
ATOM   2185  H  HA2  . GLY A 1 134 ? -11.466 10.069  -4.842  1.00 0.00 ? 134 GLY A HA2  1  
ATOM   2186  H  HA3  . GLY A 1 134 ? -10.231 9.386   -5.887  1.00 0.00 ? 134 GLY A HA3  1  
ATOM   2187  N  N    . LEU A 1 135 ? -8.240  10.732  -4.551  1.00 0.00 ? 135 LEU A N    1  
ATOM   2188  C  CA   . LEU A 1 135 ? -7.155  10.908  -3.592  1.00 0.00 ? 135 LEU A CA   1  
ATOM   2189  C  C    . LEU A 1 135 ? -7.669  11.464  -2.265  1.00 0.00 ? 135 LEU A C    1  
ATOM   2190  O  O    . LEU A 1 135 ? -7.620  10.787  -1.240  1.00 0.00 ? 135 LEU A O    1  
ATOM   2191  C  CB   . LEU A 1 135 ? -6.102  11.856  -4.186  1.00 0.00 ? 135 LEU A CB   1  
ATOM   2192  C  CG   . LEU A 1 135 ? -4.692  11.396  -3.793  1.00 0.00 ? 135 LEU A CG   1  
ATOM   2193  C  CD1  . LEU A 1 135 ? -3.645  12.328  -4.426  1.00 0.00 ? 135 LEU A CD1  1  
ATOM   2194  C  CD2  . LEU A 1 135 ? -4.555  11.416  -2.265  1.00 0.00 ? 135 LEU A CD2  1  
ATOM   2195  H  H    . LEU A 1 135 ? -8.063  10.872  -5.505  1.00 0.00 ? 135 LEU A H    1  
ATOM   2196  H  HA   . LEU A 1 135 ? -6.698  9.947   -3.403  1.00 0.00 ? 135 LEU A HA   1  
ATOM   2197  H  HB2  . LEU A 1 135 ? -6.190  11.853  -5.262  1.00 0.00 ? 135 LEU A HB2  1  
ATOM   2198  H  HB3  . LEU A 1 135 ? -6.265  12.857  -3.818  1.00 0.00 ? 135 LEU A HB3  1  
ATOM   2199  H  HG   . LEU A 1 135 ? -4.535  10.389  -4.154  1.00 0.00 ? 135 LEU A HG   1  
ATOM   2200  H  HD11 . LEU A 1 135 ? -3.283  13.027  -3.688  1.00 0.00 ? 135 LEU A HD11 1  
ATOM   2201  H  HD12 . LEU A 1 135 ? -4.089  12.874  -5.247  1.00 0.00 ? 135 LEU A HD12 1  
ATOM   2202  H  HD13 . LEU A 1 135 ? -2.821  11.739  -4.795  1.00 0.00 ? 135 LEU A HD13 1  
ATOM   2203  H  HD21 . LEU A 1 135 ? -3.525  11.602  -1.996  1.00 0.00 ? 135 LEU A HD21 1  
ATOM   2204  H  HD22 . LEU A 1 135 ? -4.866  10.464  -1.863  1.00 0.00 ? 135 LEU A HD22 1  
ATOM   2205  H  HD23 . LEU A 1 135 ? -5.178  12.198  -1.857  1.00 0.00 ? 135 LEU A HD23 1  
ATOM   2206  N  N    . ARG A 1 136 ? -8.141  12.704  -2.279  1.00 0.00 ? 136 ARG A N    1  
ATOM   2207  C  CA   . ARG A 1 136 ? -8.632  13.320  -1.055  1.00 0.00 ? 136 ARG A CA   1  
ATOM   2208  C  C    . ARG A 1 136 ? -9.926  12.662  -0.579  1.00 0.00 ? 136 ARG A C    1  
ATOM   2209  O  O    . ARG A 1 136 ? -10.338 12.847  0.567   1.00 0.00 ? 136 ARG A O    1  
ATOM   2210  C  CB   . ARG A 1 136 ? -8.855  14.817  -1.271  1.00 0.00 ? 136 ARG A CB   1  
ATOM   2211  C  CG   . ARG A 1 136 ? -9.571  15.041  -2.596  1.00 0.00 ? 136 ARG A CG   1  
ATOM   2212  C  CD   . ARG A 1 136 ? -10.180 16.445  -2.618  1.00 0.00 ? 136 ARG A CD   1  
ATOM   2213  N  NE   . ARG A 1 136 ? -11.441 16.456  -1.885  1.00 0.00 ? 136 ARG A NE   1  
ATOM   2214  C  CZ   . ARG A 1 136 ? -12.035 17.597  -1.554  1.00 0.00 ? 136 ARG A CZ   1  
ATOM   2215  N  NH1  . ARG A 1 136 ? -11.493 18.737  -1.886  1.00 0.00 ? 136 ARG A NH1  1  
ATOM   2216  N  NH2  . ARG A 1 136 ? -13.161 17.579  -0.893  1.00 0.00 ? 136 ARG A NH2  1  
ATOM   2217  H  H    . ARG A 1 136 ? -8.145  13.216  -3.118  1.00 0.00 ? 136 ARG A H    1  
ATOM   2218  H  HA   . ARG A 1 136 ? -7.885  13.190  -0.293  1.00 0.00 ? 136 ARG A HA   1  
ATOM   2219  H  HB2  . ARG A 1 136 ? -9.456  15.216  -0.467  1.00 0.00 ? 136 ARG A HB2  1  
ATOM   2220  H  HB3  . ARG A 1 136 ? -7.900  15.320  -1.294  1.00 0.00 ? 136 ARG A HB3  1  
ATOM   2221  H  HG2  . ARG A 1 136 ? -8.863  14.939  -3.402  1.00 0.00 ? 136 ARG A HG2  1  
ATOM   2222  H  HG3  . ARG A 1 136 ? -10.356 14.310  -2.706  1.00 0.00 ? 136 ARG A HG3  1  
ATOM   2223  H  HD2  . ARG A 1 136 ? -9.494  17.139  -2.157  1.00 0.00 ? 136 ARG A HD2  1  
ATOM   2224  H  HD3  . ARG A 1 136 ? -10.355 16.741  -3.642  1.00 0.00 ? 136 ARG A HD3  1  
ATOM   2225  H  HE   . ARG A 1 136 ? -11.857 15.606  -1.631  1.00 0.00 ? 136 ARG A HE   1  
ATOM   2226  H  HH11 . ARG A 1 136 ? -10.631 18.752  -2.392  1.00 0.00 ? 136 ARG A HH11 1  
ATOM   2227  H  HH12 . ARG A 1 136 ? -11.942 19.595  -1.638  1.00 0.00 ? 136 ARG A HH12 1  
ATOM   2228  H  HH21 . ARG A 1 136 ? -13.575 16.705  -0.638  1.00 0.00 ? 136 ARG A HH21 1  
ATOM   2229  H  HH22 . ARG A 1 136 ? -13.609 18.436  -0.643  1.00 0.00 ? 136 ARG A HH22 1  
ATOM   2230  N  N    . THR A 1 137 ? -10.566 11.900  -1.459  1.00 0.00 ? 137 THR A N    1  
ATOM   2231  C  CA   . THR A 1 137 ? -11.814 11.233  -1.104  1.00 0.00 ? 137 THR A CA   1  
ATOM   2232  C  C    . THR A 1 137 ? -11.553 9.963   -0.291  1.00 0.00 ? 137 THR A C    1  
ATOM   2233  O  O    . THR A 1 137 ? -12.061 9.844   0.813   1.00 0.00 ? 137 THR A O    1  
ATOM   2234  C  CB   . THR A 1 137 ? -12.641 10.990  -2.386  1.00 0.00 ? 137 THR A CB   1  
ATOM   2235  O  OG1  . THR A 1 137 ? -13.940 11.533  -2.205  1.00 0.00 ? 137 THR A OG1  1  
ATOM   2236  C  CG2  . THR A 1 137 ? -12.769 9.508   -2.726  1.00 0.00 ? 137 THR A CG2  1  
ATOM   2237  H  H    . THR A 1 137 ? -10.198 11.789  -2.363  1.00 0.00 ? 137 THR A H    1  
ATOM   2238  H  HA   . THR A 1 137 ? -12.381 11.891  -0.463  1.00 0.00 ? 137 THR A HA   1  
ATOM   2239  H  HB   . THR A 1 137 ? -12.163 11.497  -3.207  1.00 0.00 ? 137 THR A HB   1  
ATOM   2240  H  HG1  . THR A 1 137 ? -14.254 11.269  -1.337  1.00 0.00 ? 137 THR A HG1  1  
ATOM   2241  H  HG21 . THR A 1 137 ? -13.303 9.400   -3.659  1.00 0.00 ? 137 THR A HG21 1  
ATOM   2242  H  HG22 . THR A 1 137 ? -13.318 9.017   -1.947  1.00 0.00 ? 137 THR A HG22 1  
ATOM   2243  H  HG23 . THR A 1 137 ? -11.791 9.066   -2.822  1.00 0.00 ? 137 THR A HG23 1  
ATOM   2244  N  N    . LEU A 1 138 ? -10.754 9.033   -0.796  1.00 0.00 ? 138 LEU A N    1  
ATOM   2245  C  CA   . LEU A 1 138 ? -10.470 7.821   -0.031  1.00 0.00 ? 138 LEU A CA   1  
ATOM   2246  C  C    . LEU A 1 138 ? -9.597  8.148   1.182   1.00 0.00 ? 138 LEU A C    1  
ATOM   2247  O  O    . LEU A 1 138 ? -9.579  7.403   2.159   1.00 0.00 ? 138 LEU A O    1  
ATOM   2248  C  CB   . LEU A 1 138 ? -9.841  6.742   -0.952  1.00 0.00 ? 138 LEU A CB   1  
ATOM   2249  C  CG   . LEU A 1 138 ? -8.379  6.514   -0.616  1.00 0.00 ? 138 LEU A CG   1  
ATOM   2250  C  CD1  . LEU A 1 138 ? -7.762  5.483   -1.574  1.00 0.00 ? 138 LEU A CD1  1  
ATOM   2251  C  CD2  . LEU A 1 138 ? -7.597  7.837   -0.714  1.00 0.00 ? 138 LEU A CD2  1  
ATOM   2252  H  H    . LEU A 1 138 ? -10.340 9.166   -1.674  1.00 0.00 ? 138 LEU A H    1  
ATOM   2253  H  HA   . LEU A 1 138 ? -11.391 7.437   0.353   1.00 0.00 ? 138 LEU A HA   1  
ATOM   2254  H  HB2  . LEU A 1 138 ? -10.375 5.809   -0.827  1.00 0.00 ? 138 LEU A HB2  1  
ATOM   2255  H  HB3  . LEU A 1 138 ? -9.924  7.059   -1.968  1.00 0.00 ? 138 LEU A HB3  1  
ATOM   2256  H  HG   . LEU A 1 138 ? -8.347  6.138   0.383   1.00 0.00 ? 138 LEU A HG   1  
ATOM   2257  H  HD11 . LEU A 1 138 ? -8.512  4.775   -1.871  1.00 0.00 ? 138 LEU A HD11 1  
ATOM   2258  H  HD12 . LEU A 1 138 ? -6.954  4.966   -1.079  1.00 0.00 ? 138 LEU A HD12 1  
ATOM   2259  H  HD13 . LEU A 1 138 ? -7.377  5.990   -2.449  1.00 0.00 ? 138 LEU A HD13 1  
ATOM   2260  H  HD21 . LEU A 1 138 ? -7.144  8.057   0.240   1.00 0.00 ? 138 LEU A HD21 1  
ATOM   2261  H  HD22 . LEU A 1 138 ? -8.267  8.639   -0.988  1.00 0.00 ? 138 LEU A HD22 1  
ATOM   2262  H  HD23 . LEU A 1 138 ? -6.826  7.756   -1.464  1.00 0.00 ? 138 LEU A HD23 1  
ATOM   2263  N  N    . ALA A 1 139 ? -8.888  9.269   1.120   1.00 0.00 ? 139 ALA A N    1  
ATOM   2264  C  CA   . ALA A 1 139 ? -8.033  9.671   2.224   1.00 0.00 ? 139 ALA A CA   1  
ATOM   2265  C  C    . ALA A 1 139 ? -8.880  10.182  3.386   1.00 0.00 ? 139 ALA A C    1  
ATOM   2266  O  O    . ALA A 1 139 ? -8.655  9.815   4.538   1.00 0.00 ? 139 ALA A O    1  
ATOM   2267  C  CB   . ALA A 1 139 ? -7.060  10.757  1.755   1.00 0.00 ? 139 ALA A CB   1  
ATOM   2268  H  H    . ALA A 1 139 ? -8.943  9.834   0.319   1.00 0.00 ? 139 ALA A H    1  
ATOM   2269  H  HA   . ALA A 1 139 ? -7.465  8.815   2.556   1.00 0.00 ? 139 ALA A HA   1  
ATOM   2270  H  HB1  . ALA A 1 139 ? -6.793  11.388  2.588   1.00 0.00 ? 139 ALA A HB1  1  
ATOM   2271  H  HB2  . ALA A 1 139 ? -7.528  11.351  0.986   1.00 0.00 ? 139 ALA A HB2  1  
ATOM   2272  H  HB3  . ALA A 1 139 ? -6.170  10.291  1.355   1.00 0.00 ? 139 ALA A HB3  1  
ATOM   2273  N  N    . GLU A 1 140 ? -9.856  11.031  3.075   1.00 0.00 ? 140 GLU A N    1  
ATOM   2274  C  CA   . GLU A 1 140 ? -10.730 11.583  4.100   1.00 0.00 ? 140 GLU A CA   1  
ATOM   2275  C  C    . GLU A 1 140 ? -11.906 10.680  4.365   1.00 0.00 ? 140 GLU A C    1  
ATOM   2276  O  O    . GLU A 1 140 ? -12.371 10.552  5.497   1.00 0.00 ? 140 GLU A O    1  
ATOM   2277  C  CB   . GLU A 1 140 ? -11.264 12.920  3.636   1.00 0.00 ? 140 GLU A CB   1  
ATOM   2278  C  CG   . GLU A 1 140 ? -10.142 13.941  3.661   1.00 0.00 ? 140 GLU A CG   1  
ATOM   2279  C  CD   . GLU A 1 140 ? -9.976  14.510  5.066   1.00 0.00 ? 140 GLU A CD   1  
ATOM   2280  O  OE1  . GLU A 1 140 ? -10.833 15.272  5.481   1.00 0.00 ? 140 GLU A OE1  1  
ATOM   2281  O  OE2  . GLU A 1 140 ? -8.992  14.176  5.706   1.00 0.00 ? 140 GLU A OE2  1  
ATOM   2282  H  H    . GLU A 1 140 ? -9.991  11.298  2.138   1.00 0.00 ? 140 GLU A H    1  
ATOM   2283  H  HA   . GLU A 1 140 ? -10.179 11.720  5.003   1.00 0.00 ? 140 GLU A HA   1  
ATOM   2284  H  HB2  . GLU A 1 140 ? -11.633 12.816  2.632   1.00 0.00 ? 140 GLU A HB2  1  
ATOM   2285  H  HB3  . GLU A 1 140 ? -12.065 13.233  4.283   1.00 0.00 ? 140 GLU A HB3  1  
ATOM   2286  H  HG2  . GLU A 1 140 ? -9.229  13.453  3.359   1.00 0.00 ? 140 GLU A HG2  1  
ATOM   2287  H  HG3  . GLU A 1 140 ? -10.370 14.741  2.973   1.00 0.00 ? 140 GLU A HG3  1  
ATOM   2288  N  N    . ALA A 1 141 ? -12.405 10.083  3.308   1.00 0.00 ? 141 ALA A N    1  
ATOM   2289  C  CA   . ALA A 1 141 ? -13.555 9.221   3.431   1.00 0.00 ? 141 ALA A CA   1  
ATOM   2290  C  C    . ALA A 1 141 ? -13.313 8.149   4.479   1.00 0.00 ? 141 ALA A C    1  
ATOM   2291  O  O    . ALA A 1 141 ? -14.262 7.657   5.091   1.00 0.00 ? 141 ALA A O    1  
ATOM   2292  C  CB   . ALA A 1 141 ? -13.901 8.601   2.086   1.00 0.00 ? 141 ALA A CB   1  
ATOM   2293  H  H    . ALA A 1 141 ? -12.002 10.245  2.430   1.00 0.00 ? 141 ALA A H    1  
ATOM   2294  H  HA   . ALA A 1 141 ? -14.386 9.820   3.752   1.00 0.00 ? 141 ALA A HA   1  
ATOM   2295  H  HB1  . ALA A 1 141 ? -13.051 8.059   1.712   1.00 0.00 ? 141 ALA A HB1  1  
ATOM   2296  H  HB2  . ALA A 1 141 ? -14.171 9.384   1.389   1.00 0.00 ? 141 ALA A HB2  1  
ATOM   2297  H  HB3  . ALA A 1 141 ? -14.730 7.931   2.208   1.00 0.00 ? 141 ALA A HB3  1  
ATOM   2298  N  N    . GLY A 1 142 ? -12.050 7.805   4.728   1.00 0.00 ? 142 GLY A N    1  
ATOM   2299  C  CA   . GLY A 1 142 ? -11.779 6.810   5.761   1.00 0.00 ? 142 GLY A CA   1  
ATOM   2300  C  C    . GLY A 1 142 ? -10.424 6.122   5.617   1.00 0.00 ? 142 GLY A C    1  
ATOM   2301  O  O    . GLY A 1 142 ? -10.017 5.387   6.517   1.00 0.00 ? 142 GLY A O    1  
ATOM   2302  H  H    . GLY A 1 142 ? -11.306 8.241   4.238   1.00 0.00 ? 142 GLY A H    1  
ATOM   2303  H  HA2  . GLY A 1 142 ? -11.812 7.298   6.723   1.00 0.00 ? 142 GLY A HA2  1  
ATOM   2304  H  HA3  . GLY A 1 142 ? -12.555 6.060   5.731   1.00 0.00 ? 142 GLY A HA3  1  
ATOM   2305  N  N    . ALA A 1 143 ? -9.711  6.346   4.519   1.00 0.00 ? 143 ALA A N    1  
ATOM   2306  C  CA   . ALA A 1 143 ? -8.406  5.702   4.377   1.00 0.00 ? 143 ALA A CA   1  
ATOM   2307  C  C    . ALA A 1 143 ? -7.321  6.573   4.987   1.00 0.00 ? 143 ALA A C    1  
ATOM   2308  O  O    . ALA A 1 143 ? -7.171  7.739   4.619   1.00 0.00 ? 143 ALA A O    1  
ATOM   2309  C  CB   . ALA A 1 143 ? -8.076  5.439   2.909   1.00 0.00 ? 143 ALA A CB   1  
ATOM   2310  H  H    . ALA A 1 143 ? -10.050 6.944   3.809   1.00 0.00 ? 143 ALA A H    1  
ATOM   2311  H  HA   . ALA A 1 143 ? -8.424  4.756   4.901   1.00 0.00 ? 143 ALA A HA   1  
ATOM   2312  H  HB1  . ALA A 1 143 ? -8.982  5.219   2.366   1.00 0.00 ? 143 ALA A HB1  1  
ATOM   2313  H  HB2  . ALA A 1 143 ? -7.401  4.597   2.838   1.00 0.00 ? 143 ALA A HB2  1  
ATOM   2314  H  HB3  . ALA A 1 143 ? -7.601  6.312   2.486   1.00 0.00 ? 143 ALA A HB3  1  
ATOM   2315  N  N    . LYS A 1 144 ? -6.555  6.005   5.911   1.00 0.00 ? 144 LYS A N    1  
ATOM   2316  C  CA   . LYS A 1 144 ? -5.478  6.744   6.544   1.00 0.00 ? 144 LYS A CA   1  
ATOM   2317  C  C    . LYS A 1 144 ? -4.196  6.598   5.747   1.00 0.00 ? 144 LYS A C    1  
ATOM   2318  O  O    . LYS A 1 144 ? -3.585  5.529   5.713   1.00 0.00 ? 144 LYS A O    1  
ATOM   2319  C  CB   . LYS A 1 144 ? -5.255  6.233   7.950   1.00 0.00 ? 144 LYS A CB   1  
ATOM   2320  C  CG   . LYS A 1 144 ? -6.572  6.251   8.715   1.00 0.00 ? 144 LYS A CG   1  
ATOM   2321  C  CD   . LYS A 1 144 ? -7.139  7.676   8.852   1.00 0.00 ? 144 LYS A CD   1  
ATOM   2322  C  CE   . LYS A 1 144 ? -6.061  8.644   9.355   1.00 0.00 ? 144 LYS A CE   1  
ATOM   2323  N  NZ   . LYS A 1 144 ? -5.256  7.987   10.423  1.00 0.00 ? 144 LYS A NZ   1  
ATOM   2324  H  H    . LYS A 1 144 ? -6.710  5.074   6.167   1.00 0.00 ? 144 LYS A H    1  
ATOM   2325  H  HA   . LYS A 1 144 ? -5.742  7.784   6.591   1.00 0.00 ? 144 LYS A HA   1  
ATOM   2326  H  HB2  . LYS A 1 144 ? -4.880  5.221   7.906   1.00 0.00 ? 144 LYS A HB2  1  
ATOM   2327  H  HB3  . LYS A 1 144 ? -4.543  6.851   8.444   1.00 0.00 ? 144 LYS A HB3  1  
ATOM   2328  H  HG2  . LYS A 1 144 ? -7.279  5.643   8.187   1.00 0.00 ? 144 LYS A HG2  1  
ATOM   2329  H  HG3  . LYS A 1 144 ? -6.409  5.841   9.688   1.00 0.00 ? 144 LYS A HG3  1  
ATOM   2330  H  HD2  . LYS A 1 144 ? -7.512  8.013   7.898   1.00 0.00 ? 144 LYS A HD2  1  
ATOM   2331  H  HD3  . LYS A 1 144 ? -7.954  7.662   9.561   1.00 0.00 ? 144 LYS A HD3  1  
ATOM   2332  H  HE2  . LYS A 1 144 ? -5.417  8.927   8.537   1.00 0.00 ? 144 LYS A HE2  1  
ATOM   2333  H  HE3  . LYS A 1 144 ? -6.536  9.528   9.757   1.00 0.00 ? 144 LYS A HE3  1  
ATOM   2334  H  HZ1  . LYS A 1 144 ? -4.981  7.034   10.116  1.00 0.00 ? 144 LYS A HZ1  1  
ATOM   2335  H  HZ2  . LYS A 1 144 ? -5.824  7.917   11.292  1.00 0.00 ? 144 LYS A HZ2  1  
ATOM   2336  H  HZ3  . LYS A 1 144 ? -4.403  8.553   10.611  1.00 0.00 ? 144 LYS A HZ3  1  
ATOM   2337  N  N    . ILE A 1 145 ? -3.795  7.684   5.109   1.00 0.00 ? 145 ILE A N    1  
ATOM   2338  C  CA   . ILE A 1 145 ? -2.580  7.686   4.308   1.00 0.00 ? 145 ILE A CA   1  
ATOM   2339  C  C    . ILE A 1 145 ? -1.431  8.292   5.105   1.00 0.00 ? 145 ILE A C    1  
ATOM   2340  O  O    . ILE A 1 145 ? -1.637  9.179   5.934   1.00 0.00 ? 145 ILE A O    1  
ATOM   2341  C  CB   . ILE A 1 145 ? -2.782  8.497   3.020   1.00 0.00 ? 145 ILE A CB   1  
ATOM   2342  C  CG1  . ILE A 1 145 ? -4.245  8.462   2.565   1.00 0.00 ? 145 ILE A CG1  1  
ATOM   2343  C  CG2  . ILE A 1 145 ? -1.908  7.930   1.905   1.00 0.00 ? 145 ILE A CG2  1  
ATOM   2344  C  CD1  . ILE A 1 145 ? -4.801  7.034   2.613   1.00 0.00 ? 145 ILE A CD1  1  
ATOM   2345  H  H    . ILE A 1 145 ? -4.326  8.500   5.183   1.00 0.00 ? 145 ILE A H    1  
ATOM   2346  H  HA   . ILE A 1 145 ? -2.325  6.669   4.049   1.00 0.00 ? 145 ILE A HA   1  
ATOM   2347  H  HB   . ILE A 1 145 ? -2.500  9.520   3.210   1.00 0.00 ? 145 ILE A HB   1  
ATOM   2348  H  HG12 . ILE A 1 145 ? -4.826  9.100   3.208   1.00 0.00 ? 145 ILE A HG12 1  
ATOM   2349  H  HG13 . ILE A 1 145 ? -4.307  8.831   1.549   1.00 0.00 ? 145 ILE A HG13 1  
ATOM   2350  H  HG21 . ILE A 1 145 ? -0.901  7.797   2.271   1.00 0.00 ? 145 ILE A HG21 1  
ATOM   2351  H  HG22 . ILE A 1 145 ? -1.902  8.617   1.072   1.00 0.00 ? 145 ILE A HG22 1  
ATOM   2352  H  HG23 . ILE A 1 145 ? -2.306  6.978   1.586   1.00 0.00 ? 145 ILE A HG23 1  
ATOM   2353  H  HD11 . ILE A 1 145 ? -5.341  6.892   3.530   1.00 0.00 ? 145 ILE A HD11 1  
ATOM   2354  H  HD12 . ILE A 1 145 ? -3.994  6.321   2.556   1.00 0.00 ? 145 ILE A HD12 1  
ATOM   2355  H  HD13 . ILE A 1 145 ? -5.474  6.882   1.781   1.00 0.00 ? 145 ILE A HD13 1  
ATOM   2356  N  N    . SER A 1 146 ? -0.221  7.812   4.846   1.00 0.00 ? 146 SER A N    1  
ATOM   2357  C  CA   . SER A 1 146 ? 0.953   8.315   5.536   1.00 0.00 ? 146 SER A CA   1  
ATOM   2358  C  C    . SER A 1 146 ? 2.122   8.455   4.568   1.00 0.00 ? 146 SER A C    1  
ATOM   2359  O  O    . SER A 1 146 ? 2.393   7.562   3.765   1.00 0.00 ? 146 SER A O    1  
ATOM   2360  C  CB   . SER A 1 146 ? 1.323   7.360   6.675   1.00 0.00 ? 146 SER A CB   1  
ATOM   2361  O  OG   . SER A 1 146 ? 0.602   6.146   6.519   1.00 0.00 ? 146 SER A OG   1  
ATOM   2362  H  H    . SER A 1 146 ? -0.116  7.109   4.179   1.00 0.00 ? 146 SER A H    1  
ATOM   2363  H  HA   . SER A 1 146 ? 0.730   9.287   5.951   1.00 0.00 ? 146 SER A HA   1  
ATOM   2364  H  HB2  . SER A 1 146 ? 2.381   7.147   6.659   1.00 0.00 ? 146 SER A HB2  1  
ATOM   2365  H  HB3  . SER A 1 146 ? 1.067   7.820   7.615   1.00 0.00 ? 146 SER A HB3  1  
ATOM   2366  H  HG   . SER A 1 146 ? 0.234   5.908   7.374   1.00 0.00 ? 146 SER A HG   1  
ATOM   2367  N  N    . ILE A 1 147 ? 2.813   9.581   4.663   1.00 0.00 ? 147 ILE A N    1  
ATOM   2368  C  CA   . ILE A 1 147 ? 3.957   9.838   3.809   1.00 0.00 ? 147 ILE A CA   1  
ATOM   2369  C  C    . ILE A 1 147 ? 5.203   9.253   4.468   1.00 0.00 ? 147 ILE A C    1  
ATOM   2370  O  O    . ILE A 1 147 ? 5.726   9.802   5.439   1.00 0.00 ? 147 ILE A O    1  
ATOM   2371  C  CB   . ILE A 1 147 ? 4.144   11.353  3.590   1.00 0.00 ? 147 ILE A CB   1  
ATOM   2372  C  CG1  . ILE A 1 147 ? 2.924   12.032  2.877   1.00 0.00 ? 147 ILE A CG1  1  
ATOM   2373  C  CG2  . ILE A 1 147 ? 5.407   11.591  2.749   1.00 0.00 ? 147 ILE A CG2  1  
ATOM   2374  C  CD1  . ILE A 1 147 ? 1.742   11.083  2.640   1.00 0.00 ? 147 ILE A CD1  1  
ATOM   2375  H  H    . ILE A 1 147 ? 2.552   10.244  5.328   1.00 0.00 ? 147 ILE A H    1  
ATOM   2376  H  HA   . ILE A 1 147 ? 3.818   9.350   2.867   1.00 0.00 ? 147 ILE A HA   1  
ATOM   2377  H  HB   . ILE A 1 147 ? 4.286   11.818  4.559   1.00 0.00 ? 147 ILE A HB   1  
ATOM   2378  H  HG12 . ILE A 1 147 ? 2.579   12.850  3.490   1.00 0.00 ? 147 ILE A HG12 1  
ATOM   2379  H  HG13 . ILE A 1 147 ? 3.241   12.433  1.923   1.00 0.00 ? 147 ILE A HG13 1  
ATOM   2380  H  HG21 . ILE A 1 147 ? 6.233   11.813  3.400   1.00 0.00 ? 147 ILE A HG21 1  
ATOM   2381  H  HG22 . ILE A 1 147 ? 5.245   12.425  2.083   1.00 0.00 ? 147 ILE A HG22 1  
ATOM   2382  H  HG23 . ILE A 1 147 ? 5.637   10.708  2.170   1.00 0.00 ? 147 ILE A HG23 1  
ATOM   2383  H  HD11 . ILE A 1 147 ? 2.065   10.187  2.146   1.00 0.00 ? 147 ILE A HD11 1  
ATOM   2384  H  HD12 . ILE A 1 147 ? 1.027   11.586  2.013   1.00 0.00 ? 147 ILE A HD12 1  
ATOM   2385  H  HD13 . ILE A 1 147 ? 1.277   10.837  3.575   1.00 0.00 ? 147 ILE A HD13 1  
ATOM   2386  N  N    . MET A 1 148 ? 5.654   8.120   3.941   1.00 0.00 ? 148 MET A N    1  
ATOM   2387  C  CA   . MET A 1 148 ? 6.820   7.434   4.485   1.00 0.00 ? 148 MET A CA   1  
ATOM   2388  C  C    . MET A 1 148 ? 8.102   8.231   4.242   1.00 0.00 ? 148 MET A C    1  
ATOM   2389  O  O    . MET A 1 148 ? 8.684   8.173   3.159   1.00 0.00 ? 148 MET A O    1  
ATOM   2390  C  CB   . MET A 1 148 ? 6.937   6.049   3.842   1.00 0.00 ? 148 MET A CB   1  
ATOM   2391  C  CG   . MET A 1 148 ? 7.796   5.135   4.712   1.00 0.00 ? 148 MET A CG   1  
ATOM   2392  S  SD   . MET A 1 148 ? 8.643   3.941   3.649   1.00 0.00 ? 148 MET A SD   1  
ATOM   2393  C  CE   . MET A 1 148 ? 7.165   3.077   3.062   1.00 0.00 ? 148 MET A CE   1  
ATOM   2394  H  H    . MET A 1 148 ? 5.180   7.726   3.180   1.00 0.00 ? 148 MET A H    1  
ATOM   2395  H  HA   . MET A 1 148 ? 6.684   7.309   5.547   1.00 0.00 ? 148 MET A HA   1  
ATOM   2396  H  HB2  . MET A 1 148 ? 5.951   5.619   3.736   1.00 0.00 ? 148 MET A HB2  1  
ATOM   2397  H  HB3  . MET A 1 148 ? 7.391   6.140   2.870   1.00 0.00 ? 148 MET A HB3  1  
ATOM   2398  H  HG2  . MET A 1 148 ? 8.524   5.723   5.249   1.00 0.00 ? 148 MET A HG2  1  
ATOM   2399  H  HG3  . MET A 1 148 ? 7.166   4.608   5.413   1.00 0.00 ? 148 MET A HG3  1  
ATOM   2400  H  HE1  . MET A 1 148 ? 6.454   2.989   3.872   1.00 0.00 ? 148 MET A HE1  1  
ATOM   2401  H  HE2  . MET A 1 148 ? 7.441   2.092   2.709   1.00 0.00 ? 148 MET A HE2  1  
ATOM   2402  H  HE3  . MET A 1 148 ? 6.718   3.633   2.254   1.00 0.00 ? 148 MET A HE3  1  
ATOM   2403  N  N    . THR A 1 149 ? 8.536   8.965   5.264   1.00 0.00 ? 149 THR A N    1  
ATOM   2404  C  CA   . THR A 1 149 ? 9.754   9.764   5.164   1.00 0.00 ? 149 THR A CA   1  
ATOM   2405  C  C    . THR A 1 149 ? 10.947  8.988   5.723   1.00 0.00 ? 149 THR A C    1  
ATOM   2406  O  O    . THR A 1 149 ? 10.798  7.858   6.181   1.00 0.00 ? 149 THR A O    1  
ATOM   2407  C  CB   . THR A 1 149 ? 9.583   11.080  5.937   1.00 0.00 ? 149 THR A CB   1  
ATOM   2408  O  OG1  . THR A 1 149 ? 8.740   10.859  7.058   1.00 0.00 ? 149 THR A OG1  1  
ATOM   2409  C  CG2  . THR A 1 149 ? 8.956   12.148  5.029   1.00 0.00 ? 149 THR A CG2  1  
ATOM   2410  H  H    . THR A 1 149 ? 8.030   8.965   6.103   1.00 0.00 ? 149 THR A H    1  
ATOM   2411  H  HA   . THR A 1 149 ? 9.941   9.989   4.123   1.00 0.00 ? 149 THR A HA   1  
ATOM   2412  H  HB   . THR A 1 149 ? 10.547  11.426  6.276   1.00 0.00 ? 149 THR A HB   1  
ATOM   2413  H  HG1  . THR A 1 149 ? 9.149   11.271  7.822   1.00 0.00 ? 149 THR A HG1  1  
ATOM   2414  H  HG21 . THR A 1 149 ? 8.289   12.767  5.610   1.00 0.00 ? 149 THR A HG21 1  
ATOM   2415  H  HG22 . THR A 1 149 ? 8.402   11.673  4.231   1.00 0.00 ? 149 THR A HG22 1  
ATOM   2416  H  HG23 . THR A 1 149 ? 9.738   12.763  4.609   1.00 0.00 ? 149 THR A HG23 1  
ATOM   2417  N  N    . TYR A 1 150 ? 12.127  9.601   5.671   1.00 0.00 ? 150 TYR A N    1  
ATOM   2418  C  CA   . TYR A 1 150 ? 13.342  8.957   6.165   1.00 0.00 ? 150 TYR A CA   1  
ATOM   2419  C  C    . TYR A 1 150 ? 13.050  8.060   7.373   1.00 0.00 ? 150 TYR A C    1  
ATOM   2420  O  O    . TYR A 1 150 ? 13.278  6.851   7.322   1.00 0.00 ? 150 TYR A O    1  
ATOM   2421  C  CB   . TYR A 1 150 ? 14.391  10.023  6.517   1.00 0.00 ? 150 TYR A CB   1  
ATOM   2422  C  CG   . TYR A 1 150 ? 14.158  10.568  7.903   1.00 0.00 ? 150 TYR A CG   1  
ATOM   2423  C  CD1  . TYR A 1 150 ? 13.156  11.519  8.121   1.00 0.00 ? 150 TYR A CD1  1  
ATOM   2424  C  CD2  . TYR A 1 150 ? 14.951  10.126  8.967   1.00 0.00 ? 150 TYR A CD2  1  
ATOM   2425  C  CE1  . TYR A 1 150 ? 12.944  12.029  9.409   1.00 0.00 ? 150 TYR A CE1  1  
ATOM   2426  C  CE2  . TYR A 1 150 ? 14.741  10.635  10.254  1.00 0.00 ? 150 TYR A CE2  1  
ATOM   2427  C  CZ   . TYR A 1 150 ? 13.738  11.587  10.475  1.00 0.00 ? 150 TYR A CZ   1  
ATOM   2428  O  OH   . TYR A 1 150 ? 13.529  12.088  11.743  1.00 0.00 ? 150 TYR A OH   1  
ATOM   2429  H  H    . TYR A 1 150 ? 12.187  10.500  5.287   1.00 0.00 ? 150 TYR A H    1  
ATOM   2430  H  HA   . TYR A 1 150 ? 13.740  8.338   5.376   1.00 0.00 ? 150 TYR A HA   1  
ATOM   2431  H  HB2  . TYR A 1 150 ? 15.373  9.583   6.471   1.00 0.00 ? 150 TYR A HB2  1  
ATOM   2432  H  HB3  . TYR A 1 150 ? 14.329  10.833  5.805   1.00 0.00 ? 150 TYR A HB3  1  
ATOM   2433  H  HD1  . TYR A 1 150 ? 12.546  11.858  7.297   1.00 0.00 ? 150 TYR A HD1  1  
ATOM   2434  H  HD2  . TYR A 1 150 ? 15.724  9.392   8.795   1.00 0.00 ? 150 TYR A HD2  1  
ATOM   2435  H  HE1  . TYR A 1 150 ? 12.170  12.762  9.578   1.00 0.00 ? 150 TYR A HE1  1  
ATOM   2436  H  HE2  . TYR A 1 150 ? 15.352  10.295  11.077  1.00 0.00 ? 150 TYR A HE2  1  
ATOM   2437  H  HH   . TYR A 1 150 ? 12.584  12.201  11.867  1.00 0.00 ? 150 TYR A HH   1  
ATOM   2438  N  N    . SER A 1 151 ? 12.552  8.650   8.455   1.00 0.00 ? 151 SER A N    1  
ATOM   2439  C  CA   . SER A 1 151 ? 12.244  7.885   9.660   1.00 0.00 ? 151 SER A CA   1  
ATOM   2440  C  C    . SER A 1 151 ? 11.323  6.717   9.337   1.00 0.00 ? 151 SER A C    1  
ATOM   2441  O  O    . SER A 1 151 ? 11.631  5.558   9.628   1.00 0.00 ? 151 SER A O    1  
ATOM   2442  C  CB   . SER A 1 151 ? 11.565  8.786   10.692  1.00 0.00 ? 151 SER A CB   1  
ATOM   2443  O  OG   . SER A 1 151 ? 11.780  8.253   11.993  1.00 0.00 ? 151 SER A OG   1  
ATOM   2444  H  H    . SER A 1 151 ? 12.395  9.615   8.444   1.00 0.00 ? 151 SER A H    1  
ATOM   2445  H  HA   . SER A 1 151 ? 13.158  7.507   10.078  1.00 0.00 ? 151 SER A HA   1  
ATOM   2446  H  HB2  . SER A 1 151 ? 11.982  9.776   10.641  1.00 0.00 ? 151 SER A HB2  1  
ATOM   2447  H  HB3  . SER A 1 151 ? 10.503  8.835   10.483  1.00 0.00 ? 151 SER A HB3  1  
ATOM   2448  H  HG   . SER A 1 151 ? 12.119  8.958   12.550  1.00 0.00 ? 151 SER A HG   1  
ATOM   2449  N  N    . GLU A 1 152 ? 10.190  7.033   8.733   1.00 0.00 ? 152 GLU A N    1  
ATOM   2450  C  CA   . GLU A 1 152 ? 9.221   6.013   8.373   1.00 0.00 ? 152 GLU A CA   1  
ATOM   2451  C  C    . GLU A 1 152 ? 9.813   5.073   7.336   1.00 0.00 ? 152 GLU A C    1  
ATOM   2452  O  O    . GLU A 1 152 ? 9.289   3.983   7.100   1.00 0.00 ? 152 GLU A O    1  
ATOM   2453  C  CB   . GLU A 1 152 ? 7.954   6.669   7.823   1.00 0.00 ? 152 GLU A CB   1  
ATOM   2454  C  CG   . GLU A 1 152 ? 7.079   7.143   8.987   1.00 0.00 ? 152 GLU A CG   1  
ATOM   2455  C  CD   . GLU A 1 152 ? 7.800   8.229   9.777   1.00 0.00 ? 152 GLU A CD   1  
ATOM   2456  O  OE1  . GLU A 1 152 ? 7.758   9.371   9.350   1.00 0.00 ? 152 GLU A OE1  1  
ATOM   2457  O  OE2  . GLU A 1 152 ? 8.384   7.905   10.797  1.00 0.00 ? 152 GLU A OE2  1  
ATOM   2458  H  H    . GLU A 1 152 ? 10.004  7.968   8.526   1.00 0.00 ? 152 GLU A H    1  
ATOM   2459  H  HA   . GLU A 1 152 ? 8.964   5.445   9.253   1.00 0.00 ? 152 GLU A HA   1  
ATOM   2460  H  HB2  . GLU A 1 152 ? 8.227   7.516   7.209   1.00 0.00 ? 152 GLU A HB2  1  
ATOM   2461  H  HB3  . GLU A 1 152 ? 7.406   5.952   7.232   1.00 0.00 ? 152 GLU A HB3  1  
ATOM   2462  H  HG2  . GLU A 1 152 ? 6.151   7.537   8.599   1.00 0.00 ? 152 GLU A HG2  1  
ATOM   2463  H  HG3  . GLU A 1 152 ? 6.869   6.308   9.640   1.00 0.00 ? 152 GLU A HG3  1  
ATOM   2464  N  N    . PHE A 1 153 ? 10.916  5.495   6.727   1.00 0.00 ? 153 PHE A N    1  
ATOM   2465  C  CA   . PHE A 1 153 ? 11.576  4.673   5.728   1.00 0.00 ? 153 PHE A CA   1  
ATOM   2466  C  C    . PHE A 1 153 ? 12.300  3.524   6.425   1.00 0.00 ? 153 PHE A C    1  
ATOM   2467  O  O    . PHE A 1 153 ? 11.825  2.391   6.439   1.00 0.00 ? 153 PHE A O    1  
ATOM   2468  C  CB   . PHE A 1 153 ? 12.577  5.536   4.933   1.00 0.00 ? 153 PHE A CB   1  
ATOM   2469  C  CG   . PHE A 1 153 ? 12.527  5.185   3.464   1.00 0.00 ? 153 PHE A CG   1  
ATOM   2470  C  CD1  . PHE A 1 153 ? 11.390  5.492   2.706   1.00 0.00 ? 153 PHE A CD1  1  
ATOM   2471  C  CD2  . PHE A 1 153 ? 13.620  4.556   2.860   1.00 0.00 ? 153 PHE A CD2  1  
ATOM   2472  C  CE1  . PHE A 1 153 ? 11.348  5.168   1.345   1.00 0.00 ? 153 PHE A CE1  1  
ATOM   2473  C  CE2  . PHE A 1 153 ? 13.578  4.231   1.499   1.00 0.00 ? 153 PHE A CE2  1  
ATOM   2474  C  CZ   . PHE A 1 153 ? 12.442  4.536   0.741   1.00 0.00 ? 153 PHE A CZ   1  
ATOM   2475  H  H    . PHE A 1 153 ? 11.295  6.368   6.961   1.00 0.00 ? 153 PHE A H    1  
ATOM   2476  H  HA   . PHE A 1 153 ? 10.832  4.270   5.055   1.00 0.00 ? 153 PHE A HA   1  
ATOM   2477  H  HB2  . PHE A 1 153 ? 12.324  6.577   5.056   1.00 0.00 ? 153 PHE A HB2  1  
ATOM   2478  H  HB3  . PHE A 1 153 ? 13.579  5.369   5.305   1.00 0.00 ? 153 PHE A HB3  1  
ATOM   2479  H  HD1  . PHE A 1 153 ? 10.546  5.982   3.172   1.00 0.00 ? 153 PHE A HD1  1  
ATOM   2480  H  HD2  . PHE A 1 153 ? 14.497  4.322   3.444   1.00 0.00 ? 153 PHE A HD2  1  
ATOM   2481  H  HE1  . PHE A 1 153 ? 10.471  5.404   0.760   1.00 0.00 ? 153 PHE A HE1  1  
ATOM   2482  H  HE2  . PHE A 1 153 ? 14.424  3.746   1.034   1.00 0.00 ? 153 PHE A HE2  1  
ATOM   2483  H  HZ   . PHE A 1 153 ? 12.410  4.284   -0.308  1.00 0.00 ? 153 PHE A HZ   1  
ATOM   2484  N  N    . LYS A 1 154 ? 13.428  3.830   7.052   1.00 0.00 ? 154 LYS A N    1  
ATOM   2485  C  CA   . LYS A 1 154 ? 14.163  2.801   7.773   1.00 0.00 ? 154 LYS A CA   1  
ATOM   2486  C  C    . LYS A 1 154 ? 13.180  1.971   8.584   1.00 0.00 ? 154 LYS A C    1  
ATOM   2487  O  O    . LYS A 1 154 ? 13.443  0.813   8.918   1.00 0.00 ? 154 LYS A O    1  
ATOM   2488  C  CB   . LYS A 1 154 ? 15.226  3.419   8.698   1.00 0.00 ? 154 LYS A CB   1  
ATOM   2489  C  CG   . LYS A 1 154 ? 14.714  4.732   9.333   1.00 0.00 ? 154 LYS A CG   1  
ATOM   2490  C  CD   . LYS A 1 154 ? 15.630  5.902   8.947   1.00 0.00 ? 154 LYS A CD   1  
ATOM   2491  C  CE   . LYS A 1 154 ? 16.940  5.809   9.731   1.00 0.00 ? 154 LYS A CE   1  
ATOM   2492  N  NZ   . LYS A 1 154 ? 18.020  6.511   8.982   1.00 0.00 ? 154 LYS A NZ   1  
ATOM   2493  H  H    . LYS A 1 154 ? 13.750  4.757   7.053   1.00 0.00 ? 154 LYS A H    1  
ATOM   2494  H  HA   . LYS A 1 154 ? 14.654  2.158   7.056   1.00 0.00 ? 154 LYS A HA   1  
ATOM   2495  H  HB2  . LYS A 1 154 ? 15.460  2.710   9.483   1.00 0.00 ? 154 LYS A HB2  1  
ATOM   2496  H  HB3  . LYS A 1 154 ? 16.119  3.615   8.124   1.00 0.00 ? 154 LYS A HB3  1  
ATOM   2497  H  HG2  . LYS A 1 154 ? 13.713  4.937   8.995   1.00 0.00 ? 154 LYS A HG2  1  
ATOM   2498  H  HG3  . LYS A 1 154 ? 14.709  4.630   10.409  1.00 0.00 ? 154 LYS A HG3  1  
ATOM   2499  H  HD2  . LYS A 1 154 ? 15.840  5.863   7.887   1.00 0.00 ? 154 LYS A HD2  1  
ATOM   2500  H  HD3  . LYS A 1 154 ? 15.140  6.836   9.182   1.00 0.00 ? 154 LYS A HD3  1  
ATOM   2501  H  HE2  . LYS A 1 154 ? 16.815  6.274   10.699  1.00 0.00 ? 154 LYS A HE2  1  
ATOM   2502  H  HE3  . LYS A 1 154 ? 17.209  4.771   9.863   1.00 0.00 ? 154 LYS A HE3  1  
ATOM   2503  H  HZ1  . LYS A 1 154 ? 18.007  7.522   9.220   1.00 0.00 ? 154 LYS A HZ1  1  
ATOM   2504  H  HZ2  . LYS A 1 154 ? 17.864  6.395   7.961   1.00 0.00 ? 154 LYS A HZ2  1  
ATOM   2505  H  HZ3  . LYS A 1 154 ? 18.943  6.104   9.240   1.00 0.00 ? 154 LYS A HZ3  1  
ATOM   2506  N  N    . HIS A 1 155 ? 12.026  2.568   8.872   1.00 0.00 ? 155 HIS A N    1  
ATOM   2507  C  CA   . HIS A 1 155 ? 10.989  1.876   9.617   1.00 0.00 ? 155 HIS A CA   1  
ATOM   2508  C  C    . HIS A 1 155 ? 10.284  0.893   8.695   1.00 0.00 ? 155 HIS A C    1  
ATOM   2509  O  O    . HIS A 1 155 ? 10.058  -0.263  9.050   1.00 0.00 ? 155 HIS A O    1  
ATOM   2510  C  CB   . HIS A 1 155 ? 9.977   2.883   10.164  1.00 0.00 ? 155 HIS A CB   1  
ATOM   2511  C  CG   . HIS A 1 155 ? 9.224   2.270   11.313  1.00 0.00 ? 155 HIS A CG   1  
ATOM   2512  N  ND1  . HIS A 1 155 ? 9.027   2.943   12.508  1.00 0.00 ? 155 HIS A ND1  1  
ATOM   2513  C  CD2  . HIS A 1 155 ? 8.608   1.052   11.463  1.00 0.00 ? 155 HIS A CD2  1  
ATOM   2514  C  CE1  . HIS A 1 155 ? 8.319   2.134   13.318  1.00 0.00 ? 155 HIS A CE1  1  
ATOM   2515  N  NE2  . HIS A 1 155 ? 8.037   0.969   12.729  1.00 0.00 ? 155 HIS A NE2  1  
ATOM   2516  H  H    . HIS A 1 155 ? 11.862  3.485   8.557   1.00 0.00 ? 155 HIS A H    1  
ATOM   2517  H  HA   . HIS A 1 155 ? 11.437  1.340   10.439  1.00 0.00 ? 155 HIS A HA   1  
ATOM   2518  H  HB2  . HIS A 1 155 ? 10.497  3.765   10.503  1.00 0.00 ? 155 HIS A HB2  1  
ATOM   2519  H  HB3  . HIS A 1 155 ? 9.283   3.153   9.382   1.00 0.00 ? 155 HIS A HB3  1  
ATOM   2520  H  HD1  . HIS A 1 155 ? 9.347   3.843   12.724  1.00 0.00 ? 155 HIS A HD1  1  
ATOM   2521  H  HD2  . HIS A 1 155 ? 8.573   0.275   10.713  1.00 0.00 ? 155 HIS A HD2  1  
ATOM   2522  H  HE1  . HIS A 1 155 ? 8.012   2.395   14.319  1.00 0.00 ? 155 HIS A HE1  1  
ATOM   2523  H  HE2  . HIS A 1 155 ? 7.534   0.218   13.106  1.00 0.00 ? 155 HIS A HE2  1  
ATOM   2524  N  N    . CYS A 1 156 ? 9.953   1.369   7.500   1.00 0.00 ? 156 CYS A N    1  
ATOM   2525  C  CA   . CYS A 1 156 ? 9.285   0.533   6.514   1.00 0.00 ? 156 CYS A CA   1  
ATOM   2526  C  C    . CYS A 1 156 ? 9.989   -0.816  6.416   1.00 0.00 ? 156 CYS A C    1  
ATOM   2527  O  O    . CYS A 1 156 ? 9.343   -1.843  6.204   1.00 0.00 ? 156 CYS A O    1  
ATOM   2528  C  CB   . CYS A 1 156 ? 9.262   1.249   5.154   1.00 0.00 ? 156 CYS A CB   1  
ATOM   2529  S  SG   . CYS A 1 156 ? 9.456   0.061   3.795   1.00 0.00 ? 156 CYS A SG   1  
ATOM   2530  H  H    . CYS A 1 156 ? 10.171  2.299   7.277   1.00 0.00 ? 156 CYS A H    1  
ATOM   2531  H  HA   . CYS A 1 156 ? 8.266   0.367   6.835   1.00 0.00 ? 156 CYS A HA   1  
ATOM   2532  H  HB2  . CYS A 1 156 ? 8.317   1.760   5.040   1.00 0.00 ? 156 CYS A HB2  1  
ATOM   2533  H  HB3  . CYS A 1 156 ? 10.065  1.971   5.118   1.00 0.00 ? 156 CYS A HB3  1  
ATOM   2534  H  HG   . CYS A 1 156 ? 10.219  -0.490  3.987   1.00 0.00 ? 156 CYS A HG   1  
ATOM   2535  N  N    . TRP A 1 157 ? 11.308  -0.823  6.608   1.00 0.00 ? 157 TRP A N    1  
ATOM   2536  C  CA   . TRP A 1 157 ? 12.045  -2.075  6.572   1.00 0.00 ? 157 TRP A CA   1  
ATOM   2537  C  C    . TRP A 1 157 ? 11.758  -2.809  7.870   1.00 0.00 ? 157 TRP A C    1  
ATOM   2538  O  O    . TRP A 1 157 ? 11.336  -3.965  7.889   1.00 0.00 ? 157 TRP A O    1  
ATOM   2539  C  CB   . TRP A 1 157 ? 13.557  -1.814  6.470   1.00 0.00 ? 157 TRP A CB   1  
ATOM   2540  C  CG   . TRP A 1 157 ? 13.984  -1.689  5.039   1.00 0.00 ? 157 TRP A CG   1  
ATOM   2541  C  CD1  . TRP A 1 157 ? 14.769  -2.577  4.392   1.00 0.00 ? 157 TRP A CD1  1  
ATOM   2542  C  CD2  . TRP A 1 157 ? 13.696  -0.631  4.082   1.00 0.00 ? 157 TRP A CD2  1  
ATOM   2543  N  NE1  . TRP A 1 157 ? 14.963  -2.144  3.093   1.00 0.00 ? 157 TRP A NE1  1  
ATOM   2544  C  CE2  . TRP A 1 157 ? 14.325  -0.950  2.855   1.00 0.00 ? 157 TRP A CE2  1  
ATOM   2545  C  CE3  . TRP A 1 157 ? 12.954  0.557   4.153   1.00 0.00 ? 157 TRP A CE3  1  
ATOM   2546  C  CZ2  . TRP A 1 157 ? 14.223  -0.121  1.744   1.00 0.00 ? 157 TRP A CZ2  1  
ATOM   2547  C  CZ3  . TRP A 1 157 ? 12.848  1.400   3.034   1.00 0.00 ? 157 TRP A CZ3  1  
ATOM   2548  C  CH2  . TRP A 1 157 ? 13.484  1.059   1.831   1.00 0.00 ? 157 TRP A CH2  1  
ATOM   2549  H  H    . TRP A 1 157 ? 11.785  0.016   6.809   1.00 0.00 ? 157 TRP A H    1  
ATOM   2550  H  HA   . TRP A 1 157 ? 11.716  -2.668  5.732   1.00 0.00 ? 157 TRP A HA   1  
ATOM   2551  H  HB2  . TRP A 1 157 ? 13.801  -0.903  6.995   1.00 0.00 ? 157 TRP A HB2  1  
ATOM   2552  H  HB3  . TRP A 1 157 ? 14.090  -2.637  6.925   1.00 0.00 ? 157 TRP A HB3  1  
ATOM   2553  H  HD1  . TRP A 1 157 ? 15.171  -3.478  4.820   1.00 0.00 ? 157 TRP A HD1  1  
ATOM   2554  H  HE1  . TRP A 1 157 ? 15.487  -2.612  2.410   1.00 0.00 ? 157 TRP A HE1  1  
ATOM   2555  H  HE3  . TRP A 1 157 ? 12.465  0.824   5.072   1.00 0.00 ? 157 TRP A HE3  1  
ATOM   2556  H  HZ2  . TRP A 1 157 ? 14.715  -0.392  0.822   1.00 0.00 ? 157 TRP A HZ2  1  
ATOM   2557  H  HZ3  . TRP A 1 157 ? 12.275  2.314   3.100   1.00 0.00 ? 157 TRP A HZ3  1  
ATOM   2558  H  HH2  . TRP A 1 157 ? 13.402  1.708   0.976   1.00 0.00 ? 157 TRP A HH2  1  
ATOM   2559  N  N    . ASP A 1 158 ? 11.995  -2.089  8.949   1.00 0.00 ? 158 ASP A N    1  
ATOM   2560  C  CA   . ASP A 1 158 ? 11.791  -2.591  10.295  1.00 0.00 ? 158 ASP A CA   1  
ATOM   2561  C  C    . ASP A 1 158 ? 10.392  -3.180  10.488  1.00 0.00 ? 158 ASP A C    1  
ATOM   2562  O  O    . ASP A 1 158 ? 10.074  -3.712  11.549  1.00 0.00 ? 158 ASP A O    1  
ATOM   2563  C  CB   . ASP A 1 158 ? 11.982  -1.416  11.252  1.00 0.00 ? 158 ASP A CB   1  
ATOM   2564  C  CG   . ASP A 1 158 ? 12.145  -1.894  12.692  1.00 0.00 ? 158 ASP A CG   1  
ATOM   2565  O  OD1  . ASP A 1 158 ? 11.632  -2.952  13.011  1.00 0.00 ? 158 ASP A OD1  1  
ATOM   2566  O  OD2  . ASP A 1 158 ? 12.775  -1.185  13.459  1.00 0.00 ? 158 ASP A OD2  1  
ATOM   2567  H  H    . ASP A 1 158 ? 12.325  -1.170  8.836   1.00 0.00 ? 158 ASP A H    1  
ATOM   2568  H  HA   . ASP A 1 158 ? 12.529  -3.338  10.506  1.00 0.00 ? 158 ASP A HA   1  
ATOM   2569  H  HB2  . ASP A 1 158 ? 12.863  -0.863  10.954  1.00 0.00 ? 158 ASP A HB2  1  
ATOM   2570  H  HB3  . ASP A 1 158 ? 11.120  -0.769  11.182  1.00 0.00 ? 158 ASP A HB3  1  
ATOM   2571  N  N    . THR A 1 159 ? 9.549   -3.051  9.477   1.00 0.00 ? 159 THR A N    1  
ATOM   2572  C  CA   . THR A 1 159 ? 8.172   -3.539  9.577   1.00 0.00 ? 159 THR A CA   1  
ATOM   2573  C  C    . THR A 1 159 ? 7.999   -4.966  9.052   1.00 0.00 ? 159 THR A C    1  
ATOM   2574  O  O    . THR A 1 159 ? 7.383   -5.802  9.714   1.00 0.00 ? 159 THR A O    1  
ATOM   2575  C  CB   . THR A 1 159 ? 7.246   -2.594  8.800   1.00 0.00 ? 159 THR A CB   1  
ATOM   2576  O  OG1  . THR A 1 159 ? 7.432   -1.271  9.283   1.00 0.00 ? 159 THR A OG1  1  
ATOM   2577  C  CG2  . THR A 1 159 ? 5.772   -3.000  8.986   1.00 0.00 ? 159 THR A CG2  1  
ATOM   2578  H  H    . THR A 1 159 ? 9.846   -2.597  8.665   1.00 0.00 ? 159 THR A H    1  
ATOM   2579  H  HA   . THR A 1 159 ? 7.877   -3.521  10.615  1.00 0.00 ? 159 THR A HA   1  
ATOM   2580  H  HB   . THR A 1 159 ? 7.497   -2.630  7.750   1.00 0.00 ? 159 THR A HB   1  
ATOM   2581  H  HG1  . THR A 1 159 ? 7.579   -0.695  8.528   1.00 0.00 ? 159 THR A HG1  1  
ATOM   2582  H  HG21 . THR A 1 159 ? 5.255   -2.224  9.535   1.00 0.00 ? 159 THR A HG21 1  
ATOM   2583  H  HG22 . THR A 1 159 ? 5.708   -3.929  9.536   1.00 0.00 ? 159 THR A HG22 1  
ATOM   2584  H  HG23 . THR A 1 159 ? 5.305   -3.124  8.019   1.00 0.00 ? 159 THR A HG23 1  
ATOM   2585  N  N    . PHE A 1 160 ? 8.496   -5.232  7.848   1.00 0.00 ? 160 PHE A N    1  
ATOM   2586  C  CA   . PHE A 1 160 ? 8.335   -6.557  7.237   1.00 0.00 ? 160 PHE A CA   1  
ATOM   2587  C  C    . PHE A 1 160 ? 9.662   -7.302  7.114   1.00 0.00 ? 160 PHE A C    1  
ATOM   2588  O  O    . PHE A 1 160 ? 9.696   -8.532  7.113   1.00 0.00 ? 160 PHE A O    1  
ATOM   2589  C  CB   . PHE A 1 160 ? 7.707   -6.385  5.846   1.00 0.00 ? 160 PHE A CB   1  
ATOM   2590  C  CG   . PHE A 1 160 ? 8.000   -4.993  5.327   1.00 0.00 ? 160 PHE A CG   1  
ATOM   2591  C  CD1  . PHE A 1 160 ? 7.339   -3.889  5.882   1.00 0.00 ? 160 PHE A CD1  1  
ATOM   2592  C  CD2  . PHE A 1 160 ? 8.929   -4.806  4.297   1.00 0.00 ? 160 PHE A CD2  1  
ATOM   2593  C  CE1  . PHE A 1 160 ? 7.608   -2.599  5.404   1.00 0.00 ? 160 PHE A CE1  1  
ATOM   2594  C  CE2  . PHE A 1 160 ? 9.195   -3.515  3.820   1.00 0.00 ? 160 PHE A CE2  1  
ATOM   2595  C  CZ   . PHE A 1 160 ? 8.536   -2.413  4.374   1.00 0.00 ? 160 PHE A CZ   1  
ATOM   2596  H  H    . PHE A 1 160 ? 8.948   -4.522  7.346   1.00 0.00 ? 160 PHE A H    1  
ATOM   2597  H  HA   . PHE A 1 160 ? 7.664   -7.147  7.845   1.00 0.00 ? 160 PHE A HA   1  
ATOM   2598  H  HB2  . PHE A 1 160 ? 8.111   -7.119  5.163   1.00 0.00 ? 160 PHE A HB2  1  
ATOM   2599  H  HB3  . PHE A 1 160 ? 6.644   -6.518  5.921   1.00 0.00 ? 160 PHE A HB3  1  
ATOM   2600  H  HD1  . PHE A 1 160 ? 6.622   -4.032  6.676   1.00 0.00 ? 160 PHE A HD1  1  
ATOM   2601  H  HD2  . PHE A 1 160 ? 9.439   -5.655  3.869   1.00 0.00 ? 160 PHE A HD2  1  
ATOM   2602  H  HE1  . PHE A 1 160 ? 7.100   -1.747  5.833   1.00 0.00 ? 160 PHE A HE1  1  
ATOM   2603  H  HE2  . PHE A 1 160 ? 9.910   -3.372  3.026   1.00 0.00 ? 160 PHE A HE2  1  
ATOM   2604  H  HZ   . PHE A 1 160 ? 8.742   -1.419  4.005   1.00 0.00 ? 160 PHE A HZ   1  
ATOM   2605  N  N    . VAL A 1 161 ? 10.741  -6.556  6.984   1.00 0.00 ? 161 VAL A N    1  
ATOM   2606  C  CA   . VAL A 1 161 ? 12.056  -7.152  6.832   1.00 0.00 ? 161 VAL A CA   1  
ATOM   2607  C  C    . VAL A 1 161 ? 12.448  -7.970  8.067   1.00 0.00 ? 161 VAL A C    1  
ATOM   2608  O  O    . VAL A 1 161 ? 12.171  -7.575  9.200   1.00 0.00 ? 161 VAL A O    1  
ATOM   2609  C  CB   . VAL A 1 161 ? 13.061  -6.037  6.589   1.00 0.00 ? 161 VAL A CB   1  
ATOM   2610  C  CG1  . VAL A 1 161 ? 14.460  -6.623  6.444   1.00 0.00 ? 161 VAL A CG1  1  
ATOM   2611  C  CG2  . VAL A 1 161 ? 12.671  -5.291  5.310   1.00 0.00 ? 161 VAL A CG2  1  
ATOM   2612  H  H    . VAL A 1 161 ? 10.655  -5.584  6.968   1.00 0.00 ? 161 VAL A H    1  
ATOM   2613  H  HA   . VAL A 1 161 ? 12.047  -7.802  5.973   1.00 0.00 ? 161 VAL A HA   1  
ATOM   2614  H  HB   . VAL A 1 161 ? 13.047  -5.355  7.422   1.00 0.00 ? 161 VAL A HB   1  
ATOM   2615  H  HG11 . VAL A 1 161 ? 14.391  -7.636  6.083   1.00 0.00 ? 161 VAL A HG11 1  
ATOM   2616  H  HG12 . VAL A 1 161 ? 14.944  -6.619  7.406   1.00 0.00 ? 161 VAL A HG12 1  
ATOM   2617  H  HG13 . VAL A 1 161 ? 15.032  -6.027  5.748   1.00 0.00 ? 161 VAL A HG13 1  
ATOM   2618  H  HG21 . VAL A 1 161 ? 12.957  -5.875  4.449   1.00 0.00 ? 161 VAL A HG21 1  
ATOM   2619  H  HG22 . VAL A 1 161 ? 13.173  -4.342  5.282   1.00 0.00 ? 161 VAL A HG22 1  
ATOM   2620  H  HG23 . VAL A 1 161 ? 11.603  -5.131  5.297   1.00 0.00 ? 161 VAL A HG23 1  
ATOM   2621  N  N    . ASP A 1 162 ? 13.084  -9.121  7.827   1.00 0.00 ? 162 ASP A N    1  
ATOM   2622  C  CA   . ASP A 1 162 ? 13.500  -10.009 8.914   1.00 0.00 ? 162 ASP A CA   1  
ATOM   2623  C  C    . ASP A 1 162 ? 14.652  -9.413  9.713   1.00 0.00 ? 162 ASP A C    1  
ATOM   2624  O  O    . ASP A 1 162 ? 15.576  -10.117 10.120  1.00 0.00 ? 162 ASP A O    1  
ATOM   2625  C  CB   . ASP A 1 162 ? 13.931  -11.361 8.354   1.00 0.00 ? 162 ASP A CB   1  
ATOM   2626  C  CG   . ASP A 1 162 ? 13.857  -12.421 9.449   1.00 0.00 ? 162 ASP A CG   1  
ATOM   2627  O  OD1  . ASP A 1 162 ? 13.375  -12.101 10.522  1.00 0.00 ? 162 ASP A OD1  1  
ATOM   2628  O  OD2  . ASP A 1 162 ? 14.284  -13.536 9.200   1.00 0.00 ? 162 ASP A OD2  1  
ATOM   2629  H  H    . ASP A 1 162 ? 13.267  -9.384  6.901   1.00 0.00 ? 162 ASP A H    1  
ATOM   2630  H  HA   . ASP A 1 162 ? 12.662  -10.158 9.573   1.00 0.00 ? 162 ASP A HA   1  
ATOM   2631  H  HB2  . ASP A 1 162 ? 13.279  -11.637 7.536   1.00 0.00 ? 162 ASP A HB2  1  
ATOM   2632  H  HB3  . ASP A 1 162 ? 14.945  -11.285 7.997   1.00 0.00 ? 162 ASP A HB3  1  
ATOM   2633  N  N    . HIS A 1 163 ? 14.579  -8.119  9.937   1.00 0.00 ? 163 HIS A N    1  
ATOM   2634  C  CA   . HIS A 1 163 ? 15.603  -7.415  10.697  1.00 0.00 ? 163 HIS A CA   1  
ATOM   2635  C  C    . HIS A 1 163 ? 15.066  -6.075  11.143  1.00 0.00 ? 163 HIS A C    1  
ATOM   2636  O  O    . HIS A 1 163 ? 15.212  -5.070  10.447  1.00 0.00 ? 163 HIS A O    1  
ATOM   2637  C  CB   . HIS A 1 163 ? 16.840  -7.183  9.848   1.00 0.00 ? 163 HIS A CB   1  
ATOM   2638  C  CG   . HIS A 1 163 ? 17.419  -8.497  9.410   1.00 0.00 ? 163 HIS A CG   1  
ATOM   2639  N  ND1  . HIS A 1 163 ? 17.229  -9.006  8.134   1.00 0.00 ? 163 HIS A ND1  1  
ATOM   2640  C  CD2  . HIS A 1 163 ? 18.198  -9.414  10.069  1.00 0.00 ? 163 HIS A CD2  1  
ATOM   2641  C  CE1  . HIS A 1 163 ? 17.881  -10.180 8.068   1.00 0.00 ? 163 HIS A CE1  1  
ATOM   2642  N  NE2  . HIS A 1 163 ? 18.489  -10.476 9.219   1.00 0.00 ? 163 HIS A NE2  1  
ATOM   2643  H  H    . HIS A 1 163 ? 13.813  -7.624  9.593   1.00 0.00 ? 163 HIS A H    1  
ATOM   2644  H  HA   . HIS A 1 163 ? 15.872  -7.999  11.565  1.00 0.00 ? 163 HIS A HA   1  
ATOM   2645  H  HB2  . HIS A 1 163 ? 16.563  -6.603  8.992   1.00 0.00 ? 163 HIS A HB2  1  
ATOM   2646  H  HB3  . HIS A 1 163 ? 17.575  -6.642  10.426  1.00 0.00 ? 163 HIS A HB3  1  
ATOM   2647  H  HD1  . HIS A 1 163 ? 16.716  -8.585  7.412   1.00 0.00 ? 163 HIS A HD1  1  
ATOM   2648  H  HD2  . HIS A 1 163 ? 18.535  -9.323  11.091  1.00 0.00 ? 163 HIS A HD2  1  
ATOM   2649  H  HE1  . HIS A 1 163 ? 17.912  -10.806 7.190   1.00 0.00 ? 163 HIS A HE1  1  
ATOM   2650  H  HE2  . HIS A 1 163 ? 19.025  -11.269 9.424   1.00 0.00 ? 163 HIS A HE2  1  
ATOM   2651  N  N    . GLN A 1 164 ? 14.449  -6.069  12.301  1.00 0.00 ? 164 GLN A N    1  
ATOM   2652  C  CA   . GLN A 1 164 ? 13.888  -4.846  12.844  1.00 0.00 ? 164 GLN A CA   1  
ATOM   2653  C  C    . GLN A 1 164 ? 14.921  -3.721  12.777  1.00 0.00 ? 164 GLN A C    1  
ATOM   2654  O  O    . GLN A 1 164 ? 14.612  -2.558  13.039  1.00 0.00 ? 164 GLN A O    1  
ATOM   2655  C  CB   . GLN A 1 164 ? 13.438  -5.078  14.287  1.00 0.00 ? 164 GLN A CB   1  
ATOM   2656  C  CG   . GLN A 1 164 ? 12.158  -5.920  14.288  1.00 0.00 ? 164 GLN A CG   1  
ATOM   2657  C  CD   . GLN A 1 164 ? 11.543  -5.937  15.682  1.00 0.00 ? 164 GLN A CD   1  
ATOM   2658  O  OE1  . GLN A 1 164 ? 11.561  -4.924  16.381  1.00 0.00 ? 164 GLN A OE1  1  
ATOM   2659  N  NE2  . GLN A 1 164 ? 10.995  -7.033  16.130  1.00 0.00 ? 164 GLN A NE2  1  
ATOM   2660  H  H    . GLN A 1 164 ? 14.370  -6.900  12.799  1.00 0.00 ? 164 GLN A H    1  
ATOM   2661  H  HA   . GLN A 1 164 ? 13.032  -4.571  12.252  1.00 0.00 ? 164 GLN A HA   1  
ATOM   2662  H  HB2  . GLN A 1 164 ? 14.216  -5.599  14.828  1.00 0.00 ? 164 GLN A HB2  1  
ATOM   2663  H  HB3  . GLN A 1 164 ? 13.241  -4.129  14.760  1.00 0.00 ? 164 GLN A HB3  1  
ATOM   2664  H  HG2  . GLN A 1 164 ? 11.447  -5.498  13.589  1.00 0.00 ? 164 GLN A HG2  1  
ATOM   2665  H  HG3  . GLN A 1 164 ? 12.395  -6.932  13.991  1.00 0.00 ? 164 GLN A HG3  1  
ATOM   2666  H  HE21 . GLN A 1 164 ? 10.982  -7.839  15.572  1.00 0.00 ? 164 GLN A HE21 1  
ATOM   2667  H  HE22 . GLN A 1 164 ? 10.598  -7.051  17.025  1.00 0.00 ? 164 GLN A HE22 1  
ATOM   2668  N  N    . GLY A 1 165 ? 16.149  -4.082  12.406  1.00 0.00 ? 165 GLY A N    1  
ATOM   2669  C  CA   . GLY A 1 165 ? 17.229  -3.112  12.278  1.00 0.00 ? 165 GLY A CA   1  
ATOM   2670  C  C    . GLY A 1 165 ? 17.982  -3.331  10.970  1.00 0.00 ? 165 GLY A C    1  
ATOM   2671  O  O    . GLY A 1 165 ? 19.212  -3.365  10.944  1.00 0.00 ? 165 GLY A O    1  
ATOM   2672  H  H    . GLY A 1 165 ? 16.328  -5.021  12.201  1.00 0.00 ? 165 GLY A H    1  
ATOM   2673  H  HA2  . GLY A 1 165 ? 16.815  -2.113  12.290  1.00 0.00 ? 165 GLY A HA2  1  
ATOM   2674  H  HA3  . GLY A 1 165 ? 17.914  -3.228  13.104  1.00 0.00 ? 165 GLY A HA3  1  
ATOM   2675  N  N    . CYS A 1 166 ? 17.228  -3.491  9.885   1.00 0.00 ? 166 CYS A N    1  
ATOM   2676  C  CA   . CYS A 1 166 ? 17.822  -3.722  8.568   1.00 0.00 ? 166 CYS A CA   1  
ATOM   2677  C  C    . CYS A 1 166 ? 19.001  -2.770  8.337   1.00 0.00 ? 166 CYS A C    1  
ATOM   2678  O  O    . CYS A 1 166 ? 19.163  -1.797  9.072   1.00 0.00 ? 166 CYS A O    1  
ATOM   2679  C  CB   . CYS A 1 166 ? 16.757  -3.533  7.478   1.00 0.00 ? 166 CYS A CB   1  
ATOM   2680  S  SG   . CYS A 1 166 ? 16.736  -1.810  6.915   1.00 0.00 ? 166 CYS A SG   1  
ATOM   2681  H  H    . CYS A 1 166 ? 16.252  -3.463  9.975   1.00 0.00 ? 166 CYS A H    1  
ATOM   2682  H  HA   . CYS A 1 166 ? 18.176  -4.738  8.535   1.00 0.00 ? 166 CYS A HA   1  
ATOM   2683  H  HB2  . CYS A 1 166 ? 16.979  -4.181  6.642   1.00 0.00 ? 166 CYS A HB2  1  
ATOM   2684  H  HB3  . CYS A 1 166 ? 15.788  -3.790  7.880   1.00 0.00 ? 166 CYS A HB3  1  
ATOM   2685  H  HG   . CYS A 1 166 ? 17.647  -1.514  6.830   1.00 0.00 ? 166 CYS A HG   1  
ATOM   2686  N  N    . PRO A 1 167 ? 19.830  -3.024  7.345   1.00 0.00 ? 167 PRO A N    1  
ATOM   2687  C  CA   . PRO A 1 167 ? 21.004  -2.165  7.048   1.00 0.00 ? 167 PRO A CA   1  
ATOM   2688  C  C    . PRO A 1 167 ? 20.704  -1.056  6.035   1.00 0.00 ? 167 PRO A C    1  
ATOM   2689  O  O    . PRO A 1 167 ? 21.621  -0.385  5.562   1.00 0.00 ? 167 PRO A O    1  
ATOM   2690  C  CB   . PRO A 1 167 ? 21.996  -3.163  6.473   1.00 0.00 ? 167 PRO A CB   1  
ATOM   2691  C  CG   . PRO A 1 167 ? 21.156  -4.156  5.732   1.00 0.00 ? 167 PRO A CG   1  
ATOM   2692  C  CD   . PRO A 1 167 ? 19.765  -4.150  6.393   1.00 0.00 ? 167 PRO A CD   1  
ATOM   2693  H  HA   . PRO A 1 167 ? 21.404  -1.746  7.956   1.00 0.00 ? 167 PRO A HA   1  
ATOM   2694  H  HB2  . PRO A 1 167 ? 22.681  -2.666  5.800   1.00 0.00 ? 167 PRO A HB2  1  
ATOM   2695  H  HB3  . PRO A 1 167 ? 22.537  -3.657  7.266   1.00 0.00 ? 167 PRO A HB3  1  
ATOM   2696  H  HG2  . PRO A 1 167 ? 21.076  -3.864  4.693   1.00 0.00 ? 167 PRO A HG2  1  
ATOM   2697  H  HG3  . PRO A 1 167 ? 21.590  -5.139  5.810   1.00 0.00 ? 167 PRO A HG3  1  
ATOM   2698  H  HD2  . PRO A 1 167 ? 18.999  -3.980  5.648   1.00 0.00 ? 167 PRO A HD2  1  
ATOM   2699  H  HD3  . PRO A 1 167 ? 19.597  -5.079  6.909   1.00 0.00 ? 167 PRO A HD3  1  
ATOM   2700  N  N    . PHE A 1 168 ? 19.431  -0.859  5.701   1.00 0.00 ? 168 PHE A N    1  
ATOM   2701  C  CA   . PHE A 1 168 ? 19.072  0.185   4.743   1.00 0.00 ? 168 PHE A CA   1  
ATOM   2702  C  C    . PHE A 1 168 ? 19.418  1.554   5.314   1.00 0.00 ? 168 PHE A C    1  
ATOM   2703  O  O    . PHE A 1 168 ? 19.532  1.717   6.528   1.00 0.00 ? 168 PHE A O    1  
ATOM   2704  C  CB   . PHE A 1 168 ? 17.578  0.134   4.411   1.00 0.00 ? 168 PHE A CB   1  
ATOM   2705  C  CG   . PHE A 1 168 ? 17.311  0.931   3.158   1.00 0.00 ? 168 PHE A CG   1  
ATOM   2706  C  CD1  . PHE A 1 168 ? 17.376  0.310   1.905   1.00 0.00 ? 168 PHE A CD1  1  
ATOM   2707  C  CD2  . PHE A 1 168 ? 16.993  2.290   3.250   1.00 0.00 ? 168 PHE A CD2  1  
ATOM   2708  C  CE1  . PHE A 1 168 ? 17.124  1.050   0.745   1.00 0.00 ? 168 PHE A CE1  1  
ATOM   2709  C  CE2  . PHE A 1 168 ? 16.740  3.030   2.090   1.00 0.00 ? 168 PHE A CE2  1  
ATOM   2710  C  CZ   . PHE A 1 168 ? 16.807  2.411   0.837   1.00 0.00 ? 168 PHE A CZ   1  
ATOM   2711  H  H    . PHE A 1 168 ? 18.729  -1.415  6.102   1.00 0.00 ? 168 PHE A H    1  
ATOM   2712  H  HA   . PHE A 1 168 ? 19.636  0.032   3.834   1.00 0.00 ? 168 PHE A HA   1  
ATOM   2713  H  HB2  . PHE A 1 168 ? 17.277  -0.890  4.253   1.00 0.00 ? 168 PHE A HB2  1  
ATOM   2714  H  HB3  . PHE A 1 168 ? 17.014  0.557   5.227   1.00 0.00 ? 168 PHE A HB3  1  
ATOM   2715  H  HD1  . PHE A 1 168 ? 17.623  -0.739  1.834   1.00 0.00 ? 168 PHE A HD1  1  
ATOM   2716  H  HD2  . PHE A 1 168 ? 16.942  2.768   4.218   1.00 0.00 ? 168 PHE A HD2  1  
ATOM   2717  H  HE1  . PHE A 1 168 ? 17.174  0.572   -0.224  1.00 0.00 ? 168 PHE A HE1  1  
ATOM   2718  H  HE2  . PHE A 1 168 ? 16.496  4.079   2.163   1.00 0.00 ? 168 PHE A HE2  1  
ATOM   2719  H  HZ   . PHE A 1 168 ? 16.611  2.982   -0.059  1.00 0.00 ? 168 PHE A HZ   1  
ATOM   2720  N  N    . GLN A 1 169 ? 19.598  2.534   4.434   1.00 0.00 ? 169 GLN A N    1  
ATOM   2721  C  CA   . GLN A 1 169 ? 19.946  3.882   4.871   1.00 0.00 ? 169 GLN A CA   1  
ATOM   2722  C  C    . GLN A 1 169 ? 19.258  4.946   4.014   1.00 0.00 ? 169 GLN A C    1  
ATOM   2723  O  O    . GLN A 1 169 ? 18.852  4.681   2.882   1.00 0.00 ? 169 GLN A O    1  
ATOM   2724  C  CB   . GLN A 1 169 ? 21.465  4.068   4.814   1.00 0.00 ? 169 GLN A CB   1  
ATOM   2725  C  CG   . GLN A 1 169 ? 22.058  3.831   6.201   1.00 0.00 ? 169 GLN A CG   1  
ATOM   2726  C  CD   . GLN A 1 169 ? 23.566  3.622   6.101   1.00 0.00 ? 169 GLN A CD   1  
ATOM   2727  O  OE1  . GLN A 1 169 ? 24.118  3.583   5.002   1.00 0.00 ? 169 GLN A OE1  1  
ATOM   2728  N  NE2  . GLN A 1 169 ? 24.266  3.483   7.193   1.00 0.00 ? 169 GLN A NE2  1  
ATOM   2729  H  H    . GLN A 1 169 ? 19.503  2.345   3.483   1.00 0.00 ? 169 GLN A H    1  
ATOM   2730  H  HA   . GLN A 1 169 ? 19.623  3.996   5.886   1.00 0.00 ? 169 GLN A HA   1  
ATOM   2731  H  HB2  . GLN A 1 169 ? 21.877  3.357   4.122   1.00 0.00 ? 169 GLN A HB2  1  
ATOM   2732  H  HB3  . GLN A 1 169 ? 21.703  5.072   4.490   1.00 0.00 ? 169 GLN A HB3  1  
ATOM   2733  H  HG2  . GLN A 1 169 ? 21.852  4.687   6.824   1.00 0.00 ? 169 GLN A HG2  1  
ATOM   2734  H  HG3  . GLN A 1 169 ? 21.601  2.954   6.634   1.00 0.00 ? 169 GLN A HG3  1  
ATOM   2735  H  HE21 . GLN A 1 169 ? 23.823  3.514   8.069   1.00 0.00 ? 169 GLN A HE21 1  
ATOM   2736  H  HE22 . GLN A 1 169 ? 25.236  3.348   7.137   1.00 0.00 ? 169 GLN A HE22 1  
ATOM   2737  N  N    . PRO A 1 170 ? 19.124  6.142   4.540   1.00 0.00 ? 170 PRO A N    1  
ATOM   2738  C  CA   . PRO A 1 170 ? 18.477  7.281   3.834   1.00 0.00 ? 170 PRO A CA   1  
ATOM   2739  C  C    . PRO A 1 170 ? 19.454  8.076   2.966   1.00 0.00 ? 170 PRO A C    1  
ATOM   2740  O  O    . PRO A 1 170 ? 20.622  8.235   3.320   1.00 0.00 ? 170 PRO A O    1  
ATOM   2741  C  CB   . PRO A 1 170 ? 18.002  8.134   5.002   1.00 0.00 ? 170 PRO A CB   1  
ATOM   2742  C  CG   . PRO A 1 170 ? 19.083  7.992   6.012   1.00 0.00 ? 170 PRO A CG   1  
ATOM   2743  C  CD   . PRO A 1 170 ? 19.573  6.553   5.888   1.00 0.00 ? 170 PRO A CD   1  
ATOM   2744  H  HA   . PRO A 1 170 ? 17.630  6.949   3.257   1.00 0.00 ? 170 PRO A HA   1  
ATOM   2745  H  HB2  . PRO A 1 170 ? 17.905  9.157   4.704   1.00 0.00 ? 170 PRO A HB2  1  
ATOM   2746  H  HB3  . PRO A 1 170 ? 17.073  7.758   5.398   1.00 0.00 ? 170 PRO A HB3  1  
ATOM   2747  H  HG2  . PRO A 1 170 ? 19.886  8.686   5.797   1.00 0.00 ? 170 PRO A HG2  1  
ATOM   2748  H  HG3  . PRO A 1 170 ? 18.694  8.162   7.003   1.00 0.00 ? 170 PRO A HG3  1  
ATOM   2749  H  HD2  . PRO A 1 170 ? 20.652  6.508   5.969   1.00 0.00 ? 170 PRO A HD2  1  
ATOM   2750  H  HD3  . PRO A 1 170 ? 19.105  5.951   6.637   1.00 0.00 ? 170 PRO A HD3  1  
ATOM   2751  N  N    . TRP A 1 171 ? 18.963  8.587   1.837   1.00 0.00 ? 171 TRP A N    1  
ATOM   2752  C  CA   . TRP A 1 171 ? 19.794  9.380   0.936   1.00 0.00 ? 171 TRP A CA   1  
ATOM   2753  C  C    . TRP A 1 171 ? 19.354  10.846  0.965   1.00 0.00 ? 171 TRP A C    1  
ATOM   2754  O  O    . TRP A 1 171 ? 18.201  11.150  1.277   1.00 0.00 ? 171 TRP A O    1  
ATOM   2755  C  CB   . TRP A 1 171 ? 19.680  8.830   -0.482  1.00 0.00 ? 171 TRP A CB   1  
ATOM   2756  C  CG   . TRP A 1 171 ? 18.284  9.001   -0.971  1.00 0.00 ? 171 TRP A CG   1  
ATOM   2757  C  CD1  . TRP A 1 171 ? 17.884  9.898   -1.896  1.00 0.00 ? 171 TRP A CD1  1  
ATOM   2758  C  CD2  . TRP A 1 171 ? 17.103  8.264   -0.576  1.00 0.00 ? 171 TRP A CD2  1  
ATOM   2759  N  NE1  . TRP A 1 171 ? 16.515  9.765   -2.082  1.00 0.00 ? 171 TRP A NE1  1  
ATOM   2760  C  CE2  . TRP A 1 171 ? 15.994  8.760   -1.294  1.00 0.00 ? 171 TRP A CE2  1  
ATOM   2761  C  CE3  . TRP A 1 171 ? 16.895  7.222   0.331   1.00 0.00 ? 171 TRP A CE3  1  
ATOM   2762  C  CZ2  . TRP A 1 171 ? 14.718  8.231   -1.112  1.00 0.00 ? 171 TRP A CZ2  1  
ATOM   2763  C  CZ3  . TRP A 1 171 ? 15.622  6.688   0.518   1.00 0.00 ? 171 TRP A CZ3  1  
ATOM   2764  C  CH2  . TRP A 1 171 ? 14.535  7.187   -0.200  1.00 0.00 ? 171 TRP A CH2  1  
ATOM   2765  H  H    . TRP A 1 171 ? 18.023  8.435   1.608   1.00 0.00 ? 171 TRP A H    1  
ATOM   2766  H  HA   . TRP A 1 171 ? 20.826  9.317   1.254   1.00 0.00 ? 171 TRP A HA   1  
ATOM   2767  H  HB2  . TRP A 1 171 ? 20.349  9.361   -1.124  1.00 0.00 ? 171 TRP A HB2  1  
ATOM   2768  H  HB3  . TRP A 1 171 ? 19.934  7.781   -0.484  1.00 0.00 ? 171 TRP A HB3  1  
ATOM   2769  H  HD1  . TRP A 1 171 ? 18.526  10.606  -2.398  1.00 0.00 ? 171 TRP A HD1  1  
ATOM   2770  H  HE1  . TRP A 1 171 ? 15.967  10.303  -2.691  1.00 0.00 ? 171 TRP A HE1  1  
ATOM   2771  H  HE3  . TRP A 1 171 ? 17.723  6.831   0.890   1.00 0.00 ? 171 TRP A HE3  1  
ATOM   2772  H  HZ2  . TRP A 1 171 ? 13.880  8.622   -1.670  1.00 0.00 ? 171 TRP A HZ2  1  
ATOM   2773  H  HZ3  . TRP A 1 171 ? 15.479  5.887   1.223   1.00 0.00 ? 171 TRP A HZ3  1  
ATOM   2774  H  HH2  . TRP A 1 171 ? 13.559  6.768   -0.048  1.00 0.00 ? 171 TRP A HH2  1  
ATOM   2775  N  N    . ASP A 1 172 ? 20.283  11.749  0.652   1.00 0.00 ? 172 ASP A N    1  
ATOM   2776  C  CA   . ASP A 1 172 ? 19.985  13.182  0.661   1.00 0.00 ? 172 ASP A CA   1  
ATOM   2777  C  C    . ASP A 1 172 ? 19.025  13.565  -0.460  1.00 0.00 ? 172 ASP A C    1  
ATOM   2778  O  O    . ASP A 1 172 ? 19.196  14.591  -1.120  1.00 0.00 ? 172 ASP A O    1  
ATOM   2779  C  CB   . ASP A 1 172 ? 21.276  13.981  0.516   1.00 0.00 ? 172 ASP A CB   1  
ATOM   2780  C  CG   . ASP A 1 172 ? 21.999  14.055  1.857   1.00 0.00 ? 172 ASP A CG   1  
ATOM   2781  O  OD1  . ASP A 1 172 ? 21.569  13.378  2.777   1.00 0.00 ? 172 ASP A OD1  1  
ATOM   2782  O  OD2  . ASP A 1 172 ? 22.970  14.788  1.945   1.00 0.00 ? 172 ASP A OD2  1  
ATOM   2783  H  H    . ASP A 1 172 ? 21.186  11.448  0.421   1.00 0.00 ? 172 ASP A H    1  
ATOM   2784  H  HA   . ASP A 1 172 ? 19.528  13.435  1.605   1.00 0.00 ? 172 ASP A HA   1  
ATOM   2785  H  HB2  . ASP A 1 172 ? 21.911  13.498  -0.210  1.00 0.00 ? 172 ASP A HB2  1  
ATOM   2786  H  HB3  . ASP A 1 172 ? 21.040  14.979  0.181   1.00 0.00 ? 172 ASP A HB3  1  
ATOM   2787  N  N    . GLY A 1 173 ? 18.008  12.745  -0.653  1.00 0.00 ? 173 GLY A N    1  
ATOM   2788  C  CA   . GLY A 1 173 ? 16.998  13.003  -1.678  1.00 0.00 ? 173 GLY A CA   1  
ATOM   2789  C  C    . GLY A 1 173 ? 15.605  12.914  -1.074  1.00 0.00 ? 173 GLY A C    1  
ATOM   2790  O  O    . GLY A 1 173 ? 14.692  13.635  -1.483  1.00 0.00 ? 173 GLY A O    1  
ATOM   2791  H  H    . GLY A 1 173 ? 17.926  11.957  -0.084  1.00 0.00 ? 173 GLY A H    1  
ATOM   2792  H  HA2  . GLY A 1 173 ? 17.147  13.992  -2.088  1.00 0.00 ? 173 GLY A HA2  1  
ATOM   2793  H  HA3  . GLY A 1 173 ? 17.085  12.276  -2.467  1.00 0.00 ? 173 GLY A HA3  1  
ATOM   2794  N  N    . LEU A 1 174 ? 15.451  12.033  -0.085  1.00 0.00 ? 174 LEU A N    1  
ATOM   2795  C  CA   . LEU A 1 174 ? 14.180  11.865  0.582   1.00 0.00 ? 174 LEU A CA   1  
ATOM   2796  C  C    . LEU A 1 174 ? 13.489  13.210  0.730   1.00 0.00 ? 174 LEU A C    1  
ATOM   2797  O  O    . LEU A 1 174 ? 12.264  13.301  0.818   1.00 0.00 ? 174 LEU A O    1  
ATOM   2798  C  CB   . LEU A 1 174 ? 14.422  11.278  1.958   1.00 0.00 ? 174 LEU A CB   1  
ATOM   2799  C  CG   . LEU A 1 174 ? 14.664  9.779   1.825   1.00 0.00 ? 174 LEU A CG   1  
ATOM   2800  C  CD1  . LEU A 1 174 ? 15.351  9.275   3.079   1.00 0.00 ? 174 LEU A CD1  1  
ATOM   2801  C  CD2  . LEU A 1 174 ? 13.339  9.037   1.641   1.00 0.00 ? 174 LEU A CD2  1  
ATOM   2802  H  H    . LEU A 1 174 ? 16.210  11.490  0.207   1.00 0.00 ? 174 LEU A H    1  
ATOM   2803  H  HA   . LEU A 1 174 ? 13.569  11.188  0.014   1.00 0.00 ? 174 LEU A HA   1  
ATOM   2804  H  HB2  . LEU A 1 174 ? 15.294  11.748  2.395   1.00 0.00 ? 174 LEU A HB2  1  
ATOM   2805  H  HB3  . LEU A 1 174 ? 13.569  11.463  2.583   1.00 0.00 ? 174 LEU A HB3  1  
ATOM   2806  H  HG   . LEU A 1 174 ? 15.301  9.596   0.975   1.00 0.00 ? 174 LEU A HG   1  
ATOM   2807  H  HD11 . LEU A 1 174 ? 14.869  9.703   3.941   1.00 0.00 ? 174 LEU A HD11 1  
ATOM   2808  H  HD12 . LEU A 1 174 ? 16.387  9.573   3.059   1.00 0.00 ? 174 LEU A HD12 1  
ATOM   2809  H  HD13 . LEU A 1 174 ? 15.281  8.201   3.120   1.00 0.00 ? 174 LEU A HD13 1  
ATOM   2810  H  HD21 . LEU A 1 174 ? 13.465  8.007   1.938   1.00 0.00 ? 174 LEU A HD21 1  
ATOM   2811  H  HD22 . LEU A 1 174 ? 13.043  9.078   0.605   1.00 0.00 ? 174 LEU A HD22 1  
ATOM   2812  H  HD23 . LEU A 1 174 ? 12.578  9.494   2.253   1.00 0.00 ? 174 LEU A HD23 1  
ATOM   2813  N  N    . ASP A 1 175 ? 14.307  14.249  0.758   1.00 0.00 ? 175 ASP A N    1  
ATOM   2814  C  CA   . ASP A 1 175 ? 13.826  15.611  0.898   1.00 0.00 ? 175 ASP A CA   1  
ATOM   2815  C  C    . ASP A 1 175 ? 12.861  15.946  -0.222  1.00 0.00 ? 175 ASP A C    1  
ATOM   2816  O  O    . ASP A 1 175 ? 11.670  16.163  0.001   1.00 0.00 ? 175 ASP A O    1  
ATOM   2817  C  CB   . ASP A 1 175 ? 15.014  16.568  0.830   1.00 0.00 ? 175 ASP A CB   1  
ATOM   2818  C  CG   . ASP A 1 175 ? 15.957  16.139  -0.289  1.00 0.00 ? 175 ASP A CG   1  
ATOM   2819  O  OD1  . ASP A 1 175 ? 16.638  15.143  -0.114  1.00 0.00 ? 175 ASP A OD1  1  
ATOM   2820  O  OD2  . ASP A 1 175 ? 15.984  16.814  -1.306  1.00 0.00 ? 175 ASP A OD2  1  
ATOM   2821  H  H    . ASP A 1 175 ? 15.269  14.092  0.680   1.00 0.00 ? 175 ASP A H    1  
ATOM   2822  H  HA   . ASP A 1 175 ? 13.331  15.726  1.849   1.00 0.00 ? 175 ASP A HA   1  
ATOM   2823  H  HB2  . ASP A 1 175 ? 14.657  17.565  0.632   1.00 0.00 ? 175 ASP A HB2  1  
ATOM   2824  H  HB3  . ASP A 1 175 ? 15.543  16.551  1.768   1.00 0.00 ? 175 ASP A HB3  1  
ATOM   2825  N  N    . GLU A 1 176 ? 13.399  15.983  -1.428  1.00 0.00 ? 176 GLU A N    1  
ATOM   2826  C  CA   . GLU A 1 176 ? 12.602  16.290  -2.606  1.00 0.00 ? 176 GLU A CA   1  
ATOM   2827  C  C    . GLU A 1 176 ? 11.423  15.338  -2.707  1.00 0.00 ? 176 GLU A C    1  
ATOM   2828  O  O    . GLU A 1 176 ? 10.282  15.758  -2.899  1.00 0.00 ? 176 GLU A O    1  
ATOM   2829  C  CB   . GLU A 1 176 ? 13.458  16.173  -3.857  1.00 0.00 ? 176 GLU A CB   1  
ATOM   2830  C  CG   . GLU A 1 176 ? 12.774  16.898  -5.016  1.00 0.00 ? 176 GLU A CG   1  
ATOM   2831  C  CD   . GLU A 1 176 ? 13.645  16.831  -6.265  1.00 0.00 ? 176 GLU A CD   1  
ATOM   2832  O  OE1  . GLU A 1 176 ? 14.695  17.451  -6.266  1.00 0.00 ? 176 GLU A OE1  1  
ATOM   2833  O  OE2  . GLU A 1 176 ? 13.249  16.158  -7.204  1.00 0.00 ? 176 GLU A OE2  1  
ATOM   2834  H  H    . GLU A 1 176 ? 14.355  15.797  -1.527  1.00 0.00 ? 176 GLU A H    1  
ATOM   2835  H  HA   . GLU A 1 176 ? 12.240  17.294  -2.531  1.00 0.00 ? 176 GLU A HA   1  
ATOM   2836  H  HB2  . GLU A 1 176 ? 14.427  16.610  -3.673  1.00 0.00 ? 176 GLU A HB2  1  
ATOM   2837  H  HB3  . GLU A 1 176 ? 13.574  15.136  -4.103  1.00 0.00 ? 176 GLU A HB3  1  
ATOM   2838  H  HG2  . GLU A 1 176 ? 11.820  16.431  -5.218  1.00 0.00 ? 176 GLU A HG2  1  
ATOM   2839  H  HG3  . GLU A 1 176 ? 12.616  17.934  -4.747  1.00 0.00 ? 176 GLU A HG3  1  
ATOM   2840  N  N    . HIS A 1 177 ? 11.713  14.053  -2.571  1.00 0.00 ? 177 HIS A N    1  
ATOM   2841  C  CA   . HIS A 1 177 ? 10.672  13.033  -2.644  1.00 0.00 ? 177 HIS A CA   1  
ATOM   2842  C  C    . HIS A 1 177 ? 9.559   13.342  -1.646  1.00 0.00 ? 177 HIS A C    1  
ATOM   2843  O  O    . HIS A 1 177 ? 8.446   13.704  -2.031  1.00 0.00 ? 177 HIS A O    1  
ATOM   2844  C  CB   . HIS A 1 177 ? 11.269  11.657  -2.346  1.00 0.00 ? 177 HIS A CB   1  
ATOM   2845  C  CG   . HIS A 1 177 ? 12.290  11.318  -3.399  1.00 0.00 ? 177 HIS A CG   1  
ATOM   2846  N  ND1  . HIS A 1 177 ? 11.992  11.343  -4.753  1.00 0.00 ? 177 HIS A ND1  1  
ATOM   2847  C  CD2  . HIS A 1 177 ? 13.610  10.948  -3.313  1.00 0.00 ? 177 HIS A CD2  1  
ATOM   2848  C  CE1  . HIS A 1 177 ? 13.108  10.996  -5.420  1.00 0.00 ? 177 HIS A CE1  1  
ATOM   2849  N  NE2  . HIS A 1 177 ? 14.124  10.746  -4.590  1.00 0.00 ? 177 HIS A NE2  1  
ATOM   2850  H  H    . HIS A 1 177 ? 12.645  13.786  -2.415  1.00 0.00 ? 177 HIS A H    1  
ATOM   2851  H  HA   . HIS A 1 177 ? 10.256  13.026  -3.641  1.00 0.00 ? 177 HIS A HA   1  
ATOM   2852  H  HB2  . HIS A 1 177 ? 11.742  11.672  -1.376  1.00 0.00 ? 177 HIS A HB2  1  
ATOM   2853  H  HB3  . HIS A 1 177 ? 10.485  10.915  -2.353  1.00 0.00 ? 177 HIS A HB3  1  
ATOM   2854  H  HD1  . HIS A 1 177 ? 11.126  11.571  -5.151  1.00 0.00 ? 177 HIS A HD1  1  
ATOM   2855  H  HD2  . HIS A 1 177 ? 14.165  10.834  -2.393  1.00 0.00 ? 177 HIS A HD2  1  
ATOM   2856  H  HE1  . HIS A 1 177 ? 13.174  10.929  -6.496  1.00 0.00 ? 177 HIS A HE1  1  
ATOM   2857  H  HE2  . HIS A 1 177 ? 15.035  10.477  -4.829  1.00 0.00 ? 177 HIS A HE2  1  
ATOM   2858  N  N    . SER A 1 178 ? 9.874   13.206  -0.363  1.00 0.00 ? 178 SER A N    1  
ATOM   2859  C  CA   . SER A 1 178 ? 8.903   13.484  0.689   1.00 0.00 ? 178 SER A CA   1  
ATOM   2860  C  C    . SER A 1 178 ? 8.092   14.728  0.343   1.00 0.00 ? 178 SER A C    1  
ATOM   2861  O  O    . SER A 1 178 ? 6.870   14.672  0.213   1.00 0.00 ? 178 SER A O    1  
ATOM   2862  C  CB   . SER A 1 178 ? 9.630   13.702  2.012   1.00 0.00 ? 178 SER A CB   1  
ATOM   2863  O  OG   . SER A 1 178 ? 8.715   14.215  2.971   1.00 0.00 ? 178 SER A OG   1  
ATOM   2864  H  H    . SER A 1 178 ? 10.777  12.922  -0.119  1.00 0.00 ? 178 SER A H    1  
ATOM   2865  H  HA   . SER A 1 178 ? 8.236   12.641  0.791   1.00 0.00 ? 178 SER A HA   1  
ATOM   2866  H  HB2  . SER A 1 178 ? 10.028  12.766  2.363   1.00 0.00 ? 178 SER A HB2  1  
ATOM   2867  H  HB3  . SER A 1 178 ? 10.442  14.403  1.864   1.00 0.00 ? 178 SER A HB3  1  
ATOM   2868  H  HG   . SER A 1 178 ? 8.217   14.923  2.555   1.00 0.00 ? 178 SER A HG   1  
ATOM   2869  N  N    . GLN A 1 179 ? 8.789   15.847  0.188   1.00 0.00 ? 179 GLN A N    1  
ATOM   2870  C  CA   . GLN A 1 179 ? 8.140   17.108  -0.152  1.00 0.00 ? 179 GLN A CA   1  
ATOM   2871  C  C    . GLN A 1 179 ? 7.015   16.880  -1.148  1.00 0.00 ? 179 GLN A C    1  
ATOM   2872  O  O    . GLN A 1 179 ? 5.874   17.290  -0.931  1.00 0.00 ? 179 GLN A O    1  
ATOM   2873  C  CB   . GLN A 1 179 ? 9.162   18.050  -0.786  1.00 0.00 ? 179 GLN A CB   1  
ATOM   2874  C  CG   . GLN A 1 179 ? 8.601   19.474  -0.808  1.00 0.00 ? 179 GLN A CG   1  
ATOM   2875  C  CD   . GLN A 1 179 ? 9.505   20.377  -1.642  1.00 0.00 ? 179 GLN A CD   1  
ATOM   2876  O  OE1  . GLN A 1 179 ? 9.331   20.478  -2.857  1.00 0.00 ? 179 GLN A OE1  1  
ATOM   2877  N  NE2  . GLN A 1 179 ? 10.465  21.044  -1.060  1.00 0.00 ? 179 GLN A NE2  1  
ATOM   2878  H  H    . GLN A 1 179 ? 9.762   15.824  0.298   1.00 0.00 ? 179 GLN A H    1  
ATOM   2879  H  HA   . GLN A 1 179 ? 7.745   17.563  0.742   1.00 0.00 ? 179 GLN A HA   1  
ATOM   2880  H  HB2  . GLN A 1 179 ? 10.077  18.029  -0.212  1.00 0.00 ? 179 GLN A HB2  1  
ATOM   2881  H  HB3  . GLN A 1 179 ? 9.361   17.727  -1.802  1.00 0.00 ? 179 GLN A HB3  1  
ATOM   2882  H  HG2  . GLN A 1 179 ? 7.610   19.462  -1.239  1.00 0.00 ? 179 GLN A HG2  1  
ATOM   2883  H  HG3  . GLN A 1 179 ? 8.549   19.855  0.201   1.00 0.00 ? 179 GLN A HG3  1  
ATOM   2884  H  HE21 . GLN A 1 179 ? 10.601  20.961  -0.090  1.00 0.00 ? 179 GLN A HE21 1  
ATOM   2885  H  HE22 . GLN A 1 179 ? 11.050  21.625  -1.593  1.00 0.00 ? 179 GLN A HE22 1  
ATOM   2886  N  N    . ASP A 1 180 ? 7.365   16.239  -2.250  1.00 0.00 ? 180 ASP A N    1  
ATOM   2887  C  CA   . ASP A 1 180 ? 6.419   15.961  -3.312  1.00 0.00 ? 180 ASP A CA   1  
ATOM   2888  C  C    . ASP A 1 180 ? 5.163   15.272  -2.786  1.00 0.00 ? 180 ASP A C    1  
ATOM   2889  O  O    . ASP A 1 180 ? 4.064   15.820  -2.885  1.00 0.00 ? 180 ASP A O    1  
ATOM   2890  C  CB   . ASP A 1 180 ? 7.108   15.090  -4.355  1.00 0.00 ? 180 ASP A CB   1  
ATOM   2891  C  CG   . ASP A 1 180 ? 6.408   15.228  -5.703  1.00 0.00 ? 180 ASP A CG   1  
ATOM   2892  O  OD1  . ASP A 1 180 ? 6.449   16.313  -6.261  1.00 0.00 ? 180 ASP A OD1  1  
ATOM   2893  O  OD2  . ASP A 1 180 ? 5.842   14.248  -6.158  1.00 0.00 ? 180 ASP A OD2  1  
ATOM   2894  H  H    . ASP A 1 180 ? 8.294   15.954  -2.361  1.00 0.00 ? 180 ASP A H    1  
ATOM   2895  H  HA   . ASP A 1 180 ? 6.137   16.891  -3.776  1.00 0.00 ? 180 ASP A HA   1  
ATOM   2896  H  HB2  . ASP A 1 180 ? 8.140   15.409  -4.447  1.00 0.00 ? 180 ASP A HB2  1  
ATOM   2897  H  HB3  . ASP A 1 180 ? 7.079   14.058  -4.038  1.00 0.00 ? 180 ASP A HB3  1  
ATOM   2898  N  N    . LEU A 1 181 ? 5.316   14.074  -2.229  1.00 0.00 ? 181 LEU A N    1  
ATOM   2899  C  CA   . LEU A 1 181 ? 4.170   13.348  -1.711  1.00 0.00 ? 181 LEU A CA   1  
ATOM   2900  C  C    . LEU A 1 181 ? 3.468   14.165  -0.635  1.00 0.00 ? 181 LEU A C    1  
ATOM   2901  O  O    . LEU A 1 181 ? 2.268   14.414  -0.708  1.00 0.00 ? 181 LEU A O    1  
ATOM   2902  C  CB   . LEU A 1 181 ? 4.633   12.024  -1.109  1.00 0.00 ? 181 LEU A CB   1  
ATOM   2903  C  CG   . LEU A 1 181 ? 3.524   10.945  -1.134  1.00 0.00 ? 181 LEU A CG   1  
ATOM   2904  C  CD1  . LEU A 1 181 ? 3.758   9.967   0.015   1.00 0.00 ? 181 LEU A CD1  1  
ATOM   2905  C  CD2  . LEU A 1 181 ? 2.114   11.535  -0.951  1.00 0.00 ? 181 LEU A CD2  1  
ATOM   2906  H  H    . LEU A 1 181 ? 6.209   13.669  -2.168  1.00 0.00 ? 181 LEU A H    1  
ATOM   2907  H  HA   . LEU A 1 181 ? 3.492   13.156  -2.523  1.00 0.00 ? 181 LEU A HA   1  
ATOM   2908  H  HB2  . LEU A 1 181 ? 5.480   11.668  -1.673  1.00 0.00 ? 181 LEU A HB2  1  
ATOM   2909  H  HB3  . LEU A 1 181 ? 4.944   12.194  -0.095  1.00 0.00 ? 181 LEU A HB3  1  
ATOM   2910  H  HG   . LEU A 1 181 ? 3.577   10.414  -2.071  1.00 0.00 ? 181 LEU A HG   1  
ATOM   2911  H  HD11 . LEU A 1 181 ? 3.870   10.519  0.927   1.00 0.00 ? 181 LEU A HD11 1  
ATOM   2912  H  HD12 . LEU A 1 181 ? 4.649   9.395   -0.168  1.00 0.00 ? 181 LEU A HD12 1  
ATOM   2913  H  HD13 . LEU A 1 181 ? 2.911   9.304   0.104   1.00 0.00 ? 181 LEU A HD13 1  
ATOM   2914  H  HD21 . LEU A 1 181 ? 2.101   12.194  -0.100  1.00 0.00 ? 181 LEU A HD21 1  
ATOM   2915  H  HD22 . LEU A 1 181 ? 1.418   10.727  -0.778  1.00 0.00 ? 181 LEU A HD22 1  
ATOM   2916  H  HD23 . LEU A 1 181 ? 1.811   12.069  -1.834  1.00 0.00 ? 181 LEU A HD23 1  
ATOM   2917  N  N    . SER A 1 182 ? 4.219   14.551  0.384   1.00 0.00 ? 182 SER A N    1  
ATOM   2918  C  CA   . SER A 1 182 ? 3.644   15.309  1.476   1.00 0.00 ? 182 SER A CA   1  
ATOM   2919  C  C    . SER A 1 182 ? 2.951   16.564  0.955   1.00 0.00 ? 182 SER A C    1  
ATOM   2920  O  O    . SER A 1 182 ? 1.731   16.668  0.976   1.00 0.00 ? 182 SER A O    1  
ATOM   2921  C  CB   . SER A 1 182 ? 4.736   15.702  2.471   1.00 0.00 ? 182 SER A CB   1  
ATOM   2922  O  OG   . SER A 1 182 ? 5.684   16.538  1.821   1.00 0.00 ? 182 SER A OG   1  
ATOM   2923  H  H    . SER A 1 182 ? 5.164   14.306  0.410   1.00 0.00 ? 182 SER A H    1  
ATOM   2924  H  HA   . SER A 1 182 ? 2.921   14.688  1.983   1.00 0.00 ? 182 SER A HA   1  
ATOM   2925  H  HB2  . SER A 1 182 ? 4.299   16.237  3.296   1.00 0.00 ? 182 SER A HB2  1  
ATOM   2926  H  HB3  . SER A 1 182 ? 5.222   14.808  2.840   1.00 0.00 ? 182 SER A HB3  1  
ATOM   2927  H  HG   . SER A 1 182 ? 5.982   17.195  2.453   1.00 0.00 ? 182 SER A HG   1  
ATOM   2928  N  N    . GLY A 1 183 ? 3.729   17.513  0.466   1.00 0.00 ? 183 GLY A N    1  
ATOM   2929  C  CA   . GLY A 1 183 ? 3.150   18.745  -0.051  1.00 0.00 ? 183 GLY A CA   1  
ATOM   2930  C  C    . GLY A 1 183 ? 1.864   18.450  -0.799  1.00 0.00 ? 183 GLY A C    1  
ATOM   2931  O  O    . GLY A 1 183 ? 0.932   19.252  -0.790  1.00 0.00 ? 183 GLY A O    1  
ATOM   2932  H  H    . GLY A 1 183 ? 4.695   17.385  0.449   1.00 0.00 ? 183 GLY A H    1  
ATOM   2933  H  HA2  . GLY A 1 183 ? 2.939   19.411  0.772   1.00 0.00 ? 183 GLY A HA2  1  
ATOM   2934  H  HA3  . GLY A 1 183 ? 3.842   19.215  -0.717  1.00 0.00 ? 183 GLY A HA3  1  
ATOM   2935  N  N    . ARG A 1 184 ? 1.813   17.287  -1.436  1.00 0.00 ? 184 ARG A N    1  
ATOM   2936  C  CA   . ARG A 1 184 ? 0.624   16.905  -2.170  1.00 0.00 ? 184 ARG A CA   1  
ATOM   2937  C  C    . ARG A 1 184 ? -0.472  16.430  -1.225  1.00 0.00 ? 184 ARG A C    1  
ATOM   2938  O  O    . ARG A 1 184 ? -1.471  17.121  -1.040  1.00 0.00 ? 184 ARG A O    1  
ATOM   2939  C  CB   . ARG A 1 184 ? 0.932   15.801  -3.172  1.00 0.00 ? 184 ARG A CB   1  
ATOM   2940  C  CG   . ARG A 1 184 ? 1.609   16.400  -4.411  1.00 0.00 ? 184 ARG A CG   1  
ATOM   2941  C  CD   . ARG A 1 184 ? 0.562   16.741  -5.475  1.00 0.00 ? 184 ARG A CD   1  
ATOM   2942  N  NE   . ARG A 1 184 ? 1.217   17.096  -6.729  1.00 0.00 ? 184 ARG A NE   1  
ATOM   2943  C  CZ   . ARG A 1 184 ? 0.517   17.535  -7.770  1.00 0.00 ? 184 ARG A CZ   1  
ATOM   2944  N  NH1  . ARG A 1 184 ? -0.777  17.664  -7.677  1.00 0.00 ? 184 ARG A NH1  1  
ATOM   2945  N  NH2  . ARG A 1 184 ? 1.125   17.840  -8.884  1.00 0.00 ? 184 ARG A NH2  1  
ATOM   2946  H  H    . ARG A 1 184 ? 2.583   16.683  -1.407  1.00 0.00 ? 184 ARG A H    1  
ATOM   2947  H  HA   . ARG A 1 184 ? 0.272   17.762  -2.710  1.00 0.00 ? 184 ARG A HA   1  
ATOM   2948  H  HB2  . ARG A 1 184 ? 1.588   15.075  -2.722  1.00 0.00 ? 184 ARG A HB2  1  
ATOM   2949  H  HB3  . ARG A 1 184 ? 0.004   15.324  -3.456  1.00 0.00 ? 184 ARG A HB3  1  
ATOM   2950  H  HG2  . ARG A 1 184 ? 2.143   17.300  -4.134  1.00 0.00 ? 184 ARG A HG2  1  
ATOM   2951  H  HG3  . ARG A 1 184 ? 2.306   15.684  -4.814  1.00 0.00 ? 184 ARG A HG3  1  
ATOM   2952  H  HD2  . ARG A 1 184 ? -0.075  15.886  -5.638  1.00 0.00 ? 184 ARG A HD2  1  
ATOM   2953  H  HD3  . ARG A 1 184 ? -0.037  17.573  -5.133  1.00 0.00 ? 184 ARG A HD3  1  
ATOM   2954  H  HE   . ARG A 1 184 ? 2.189   17.005  -6.807  1.00 0.00 ? 184 ARG A HE   1  
ATOM   2955  H  HH11 . ARG A 1 184 ? -1.243  17.431  -6.823  1.00 0.00 ? 184 ARG A HH11 1  
ATOM   2956  H  HH12 . ARG A 1 184 ? -1.305  17.996  -8.459  1.00 0.00 ? 184 ARG A HH12 1  
ATOM   2957  H  HH21 . ARG A 1 184 ? 2.118   17.742  -8.954  1.00 0.00 ? 184 ARG A HH21 1  
ATOM   2958  H  HH22 . ARG A 1 184 ? 0.598   18.171  -9.667  1.00 0.00 ? 184 ARG A HH22 1  
ATOM   2959  N  N    . LEU A 1 185 ? -0.275  15.251  -0.622  1.00 0.00 ? 185 LEU A N    1  
ATOM   2960  C  CA   . LEU A 1 185 ? -1.266  14.700  0.305   1.00 0.00 ? 185 LEU A CA   1  
ATOM   2961  C  C    . LEU A 1 185 ? -1.875  15.827  1.109   1.00 0.00 ? 185 LEU A C    1  
ATOM   2962  O  O    . LEU A 1 185 ? -3.088  15.939  1.255   1.00 0.00 ? 185 LEU A O    1  
ATOM   2963  C  CB   . LEU A 1 185 ? -0.631  13.682  1.236   1.00 0.00 ? 185 LEU A CB   1  
ATOM   2964  C  CG   . LEU A 1 185 ? -1.744  12.910  1.980   1.00 0.00 ? 185 LEU A CG   1  
ATOM   2965  C  CD1  . LEU A 1 185 ? -1.805  11.466  1.477   1.00 0.00 ? 185 LEU A CD1  1  
ATOM   2966  C  CD2  . LEU A 1 185 ? -1.464  12.917  3.488   1.00 0.00 ? 185 LEU A CD2  1  
ATOM   2967  H  H    . LEU A 1 185 ? 0.547   14.756  -0.798  1.00 0.00 ? 185 LEU A H    1  
ATOM   2968  H  HA   . LEU A 1 185 ? -2.041  14.206  -0.257  1.00 0.00 ? 185 LEU A HA   1  
ATOM   2969  H  HB2  . LEU A 1 185 ? -0.032  13.006  0.648   1.00 0.00 ? 185 LEU A HB2  1  
ATOM   2970  H  HB3  . LEU A 1 185 ? -0.003  14.184  1.945   1.00 0.00 ? 185 LEU A HB3  1  
ATOM   2971  H  HG   . LEU A 1 185 ? -2.703  13.383  1.797   1.00 0.00 ? 185 LEU A HG   1  
ATOM   2972  H  HD11 . LEU A 1 185 ? -1.560  11.435  0.426   1.00 0.00 ? 185 LEU A HD11 1  
ATOM   2973  H  HD12 . LEU A 1 185 ? -2.801  11.084  1.621   1.00 0.00 ? 185 LEU A HD12 1  
ATOM   2974  H  HD13 . LEU A 1 185 ? -1.102  10.864  2.029   1.00 0.00 ? 185 LEU A HD13 1  
ATOM   2975  H  HD21 . LEU A 1 185 ? -0.431  12.661  3.663   1.00 0.00 ? 185 LEU A HD21 1  
ATOM   2976  H  HD22 . LEU A 1 185 ? -2.104  12.197  3.977   1.00 0.00 ? 185 LEU A HD22 1  
ATOM   2977  H  HD23 . LEU A 1 185 ? -1.664  13.902  3.885   1.00 0.00 ? 185 LEU A HD23 1  
ATOM   2978  N  N    . ARG A 1 186 ? -1.013  16.696  1.576   1.00 0.00 ? 186 ARG A N    1  
ATOM   2979  C  CA   . ARG A 1 186 ? -1.443  17.859  2.299   1.00 0.00 ? 186 ARG A CA   1  
ATOM   2980  C  C    . ARG A 1 186 ? -2.397  18.614  1.437   1.00 0.00 ? 186 ARG A C    1  
ATOM   2981  O  O    . ARG A 1 186 ? -3.577  18.747  1.721   1.00 0.00 ? 186 ARG A O    1  
ATOM   2982  C  CB   . ARG A 1 186 ? -0.216  18.709  2.519   1.00 0.00 ? 186 ARG A CB   1  
ATOM   2983  C  CG   . ARG A 1 186 ? 0.792   18.010  3.452   1.00 0.00 ? 186 ARG A CG   1  
ATOM   2984  C  CD   . ARG A 1 186 ? 0.576   16.486  3.615   1.00 0.00 ? 186 ARG A CD   1  
ATOM   2985  N  NE   . ARG A 1 186 ? 1.371   15.992  4.733   1.00 0.00 ? 186 ARG A NE   1  
ATOM   2986  C  CZ   . ARG A 1 186 ? 0.847   15.847  5.946   1.00 0.00 ? 186 ARG A CZ   1  
ATOM   2987  N  NH1  . ARG A 1 186 ? -0.400  16.164  6.165   1.00 0.00 ? 186 ARG A NH1  1  
ATOM   2988  N  NH2  . ARG A 1 186 ? 1.582   15.387  6.921   1.00 0.00 ? 186 ARG A NH2  1  
ATOM   2989  H  H    . ARG A 1 186 ? -0.050  16.585  1.390   1.00 0.00 ? 186 ARG A H    1  
ATOM   2990  H  HA   . ARG A 1 186 ? -1.906  17.620  3.240   1.00 0.00 ? 186 ARG A HA   1  
ATOM   2991  H  HB2  . ARG A 1 186 ? 0.254   18.893  1.559   1.00 0.00 ? 186 ARG A HB2  1  
ATOM   2992  H  HB3  . ARG A 1 186 ? -0.504  19.653  2.949   1.00 0.00 ? 186 ARG A HB3  1  
ATOM   2993  H  HG2  . ARG A 1 186 ? 1.780   18.156  3.050   1.00 0.00 ? 186 ARG A HG2  1  
ATOM   2994  H  HG3  . ARG A 1 186 ? 0.721   18.473  4.408   1.00 0.00 ? 186 ARG A HG3  1  
ATOM   2995  H  HD2  . ARG A 1 186 ? -0.453  16.251  3.795   1.00 0.00 ? 186 ARG A HD2  1  
ATOM   2996  H  HD3  . ARG A 1 186 ? 0.891   15.993  2.728   1.00 0.00 ? 186 ARG A HD3  1  
ATOM   2997  H  HE   . ARG A 1 186 ? 2.311   15.756  4.586   1.00 0.00 ? 186 ARG A HE   1  
ATOM   2998  H  HH11 . ARG A 1 186 ? -0.966  16.519  5.421   1.00 0.00 ? 186 ARG A HH11 1  
ATOM   2999  H  HH12 . ARG A 1 186 ? -0.790  16.053  7.080   1.00 0.00 ? 186 ARG A HH12 1  
ATOM   3000  H  HH21 . ARG A 1 186 ? 2.538   15.145  6.755   1.00 0.00 ? 186 ARG A HH21 1  
ATOM   3001  H  HH22 . ARG A 1 186 ? 1.190   15.278  7.834   1.00 0.00 ? 186 ARG A HH22 1  
ATOM   3002  N  N    . ALA A 1 187 ? -1.830  19.093  0.373   1.00 0.00 ? 187 ALA A N    1  
ATOM   3003  C  CA   . ALA A 1 187 ? -2.559  19.879  -0.614  1.00 0.00 ? 187 ALA A CA   1  
ATOM   3004  C  C    . ALA A 1 187 ? -3.898  19.262  -0.999  1.00 0.00 ? 187 ALA A C    1  
ATOM   3005  O  O    . ALA A 1 187 ? -4.949  19.861  -0.768  1.00 0.00 ? 187 ALA A O    1  
ATOM   3006  C  CB   . ALA A 1 187 ? -1.727  20.016  -1.875  1.00 0.00 ? 187 ALA A CB   1  
ATOM   3007  H  H    . ALA A 1 187 ? -0.867  18.906  0.249   1.00 0.00 ? 187 ALA A H    1  
ATOM   3008  H  HA   . ALA A 1 187 ? -2.735  20.867  -0.207  1.00 0.00 ? 187 ALA A HA   1  
ATOM   3009  H  HB1  . ALA A 1 187 ? -2.264  20.618  -2.591  1.00 0.00 ? 187 ALA A HB1  1  
ATOM   3010  H  HB2  . ALA A 1 187 ? -1.552  19.035  -2.291  1.00 0.00 ? 187 ALA A HB2  1  
ATOM   3011  H  HB3  . ALA A 1 187 ? -0.788  20.483  -1.638  1.00 0.00 ? 187 ALA A HB3  1  
ATOM   3012  N  N    . ILE A 1 188 ? -3.864  18.093  -1.637  1.00 0.00 ? 188 ILE A N    1  
ATOM   3013  C  CA   . ILE A 1 188 ? -5.097  17.475  -2.091  1.00 0.00 ? 188 ILE A CA   1  
ATOM   3014  C  C    . ILE A 1 188 ? -6.186  17.577  -1.021  1.00 0.00 ? 188 ILE A C    1  
ATOM   3015  O  O    . ILE A 1 188 ? -7.331  17.908  -1.329  1.00 0.00 ? 188 ILE A O    1  
ATOM   3016  C  CB   . ILE A 1 188 ? -4.897  16.002  -2.511  1.00 0.00 ? 188 ILE A CB   1  
ATOM   3017  C  CG1  . ILE A 1 188 ? -3.960  15.269  -1.526  1.00 0.00 ? 188 ILE A CG1  1  
ATOM   3018  C  CG2  . ILE A 1 188 ? -4.290  15.933  -3.918  1.00 0.00 ? 188 ILE A CG2  1  
ATOM   3019  C  CD1  . ILE A 1 188 ? -4.756  14.446  -0.511  1.00 0.00 ? 188 ILE A CD1  1  
ATOM   3020  H  H    . ILE A 1 188 ? -3.005  17.664  -1.833  1.00 0.00 ? 188 ILE A H    1  
ATOM   3021  H  HA   . ILE A 1 188 ? -5.421  18.035  -2.952  1.00 0.00 ? 188 ILE A HA   1  
ATOM   3022  H  HB   . ILE A 1 188 ? -5.859  15.518  -2.535  1.00 0.00 ? 188 ILE A HB   1  
ATOM   3023  H  HG12 . ILE A 1 188 ? -3.300  14.612  -2.074  1.00 0.00 ? 188 ILE A HG12 1  
ATOM   3024  H  HG13 . ILE A 1 188 ? -3.367  15.986  -0.996  1.00 0.00 ? 188 ILE A HG13 1  
ATOM   3025  H  HG21 . ILE A 1 188 ? -4.368  14.921  -4.290  1.00 0.00 ? 188 ILE A HG21 1  
ATOM   3026  H  HG22 . ILE A 1 188 ? -3.250  16.217  -3.879  1.00 0.00 ? 188 ILE A HG22 1  
ATOM   3027  H  HG23 . ILE A 1 188 ? -4.822  16.596  -4.578  1.00 0.00 ? 188 ILE A HG23 1  
ATOM   3028  H  HD11 . ILE A 1 188 ? -4.886  15.025  0.381   1.00 0.00 ? 188 ILE A HD11 1  
ATOM   3029  H  HD12 . ILE A 1 188 ? -4.210  13.547  -0.274  1.00 0.00 ? 188 ILE A HD12 1  
ATOM   3030  H  HD13 . ILE A 1 188 ? -5.721  14.182  -0.910  1.00 0.00 ? 188 ILE A HD13 1  
ATOM   3031  N  N    . LEU A 1 189 ? -5.831  17.305  0.235   1.00 0.00 ? 189 LEU A N    1  
ATOM   3032  C  CA   . LEU A 1 189 ? -6.809  17.390  1.321   1.00 0.00 ? 189 LEU A CA   1  
ATOM   3033  C  C    . LEU A 1 189 ? -7.045  18.858  1.687   1.00 0.00 ? 189 LEU A C    1  
ATOM   3034  O  O    . LEU A 1 189 ? -8.173  19.349  1.647   1.00 0.00 ? 189 LEU A O    1  
ATOM   3035  C  CB   . LEU A 1 189 ? -6.295  16.608  2.546   1.00 0.00 ? 189 LEU A CB   1  
ATOM   3036  C  CG   . LEU A 1 189 ? -7.301  15.518  2.963   1.00 0.00 ? 189 LEU A CG   1  
ATOM   3037  C  CD1  . LEU A 1 189 ? -7.572  14.560  1.788   1.00 0.00 ? 189 LEU A CD1  1  
ATOM   3038  C  CD2  . LEU A 1 189 ? -6.727  14.740  4.158   1.00 0.00 ? 189 LEU A CD2  1  
ATOM   3039  H  H    . LEU A 1 189 ? -4.904  17.051  0.434   1.00 0.00 ? 189 LEU A H    1  
ATOM   3040  H  HA   . LEU A 1 189 ? -7.737  16.961  0.985   1.00 0.00 ? 189 LEU A HA   1  
ATOM   3041  H  HB2  . LEU A 1 189 ? -5.357  16.140  2.291   1.00 0.00 ? 189 LEU A HB2  1  
ATOM   3042  H  HB3  . LEU A 1 189 ? -6.139  17.284  3.377   1.00 0.00 ? 189 LEU A HB3  1  
ATOM   3043  H  HG   . LEU A 1 189 ? -8.231  15.981  3.256   1.00 0.00 ? 189 LEU A HG   1  
ATOM   3044  H  HD11 . LEU A 1 189 ? -8.617  14.606  1.528   1.00 0.00 ? 189 LEU A HD11 1  
ATOM   3045  H  HD12 . LEU A 1 189 ? -7.319  13.548  2.067   1.00 0.00 ? 189 LEU A HD12 1  
ATOM   3046  H  HD13 . LEU A 1 189 ? -6.985  14.848  0.935   1.00 0.00 ? 189 LEU A HD13 1  
ATOM   3047  H  HD21 . LEU A 1 189 ? -7.113  13.732  4.151   1.00 0.00 ? 189 LEU A HD21 1  
ATOM   3048  H  HD22 . LEU A 1 189 ? -7.014  15.228  5.077   1.00 0.00 ? 189 LEU A HD22 1  
ATOM   3049  H  HD23 . LEU A 1 189 ? -5.648  14.711  4.087   1.00 0.00 ? 189 LEU A HD23 1  
ATOM   3050  N  N    . GLN A 1 190 ? -5.964  19.544  2.039   1.00 0.00 ? 190 GLN A N    1  
ATOM   3051  C  CA   . GLN A 1 190 ? -6.020  20.947  2.411   1.00 0.00 ? 190 GLN A CA   1  
ATOM   3052  C  C    . GLN A 1 190 ? -6.407  21.820  1.229   1.00 0.00 ? 190 GLN A C    1  
ATOM   3053  O  O    . GLN A 1 190 ? -6.226  23.038  1.258   1.00 0.00 ? 190 GLN A O    1  
ATOM   3054  C  CB   . GLN A 1 190 ? -4.662  21.383  2.982   1.00 0.00 ? 190 GLN A CB   1  
ATOM   3055  C  CG   . GLN A 1 190 ? -4.687  21.297  4.508   1.00 0.00 ? 190 GLN A CG   1  
ATOM   3056  C  CD   . GLN A 1 190 ? -3.410  21.900  5.087   1.00 0.00 ? 190 GLN A CD   1  
ATOM   3057  O  OE1  . GLN A 1 190 ? -2.836  21.353  6.027   1.00 0.00 ? 190 GLN A OE1  1  
ATOM   3058  N  NE2  . GLN A 1 190 ? -2.930  23.000  4.576   1.00 0.00 ? 190 GLN A NE2  1  
ATOM   3059  H  H    . GLN A 1 190 ? -5.106  19.094  2.056   1.00 0.00 ? 190 GLN A H    1  
ATOM   3060  H  HA   . GLN A 1 190 ? -6.770  21.062  3.154   1.00 0.00 ? 190 GLN A HA   1  
ATOM   3061  H  HB2  . GLN A 1 190 ? -3.899  20.723  2.611   1.00 0.00 ? 190 GLN A HB2  1  
ATOM   3062  H  HB3  . GLN A 1 190 ? -4.441  22.395  2.678   1.00 0.00 ? 190 GLN A HB3  1  
ATOM   3063  H  HG2  . GLN A 1 190 ? -5.541  21.838  4.884   1.00 0.00 ? 190 GLN A HG2  1  
ATOM   3064  H  HG3  . GLN A 1 190 ? -4.758  20.260  4.803   1.00 0.00 ? 190 GLN A HG3  1  
ATOM   3065  H  HE21 . GLN A 1 190 ? -3.391  23.434  3.824   1.00 0.00 ? 190 GLN A HE21 1  
ATOM   3066  H  HE22 . GLN A 1 190 ? -2.108  23.394  4.943   1.00 0.00 ? 190 GLN A HE22 1  
ATOM   3067  N  N    . ASN A 1 191 ? -6.954  21.181  0.210   1.00 0.00 ? 191 ASN A N    1  
ATOM   3068  C  CA   . ASN A 1 191 ? -7.403  21.868  -0.989  1.00 0.00 ? 191 ASN A CA   1  
ATOM   3069  C  C    . ASN A 1 191 ? -6.647  23.179  -1.211  1.00 0.00 ? 191 ASN A C    1  
ATOM   3070  O  O    . ASN A 1 191 ? -7.245  24.250  -1.309  1.00 0.00 ? 191 ASN A O    1  
ATOM   3071  C  CB   . ASN A 1 191 ? -8.903  22.125  -0.874  1.00 0.00 ? 191 ASN A CB   1  
ATOM   3072  C  CG   . ASN A 1 191 ? -9.188  23.313  0.028   1.00 0.00 ? 191 ASN A CG   1  
ATOM   3073  O  OD1  . ASN A 1 191 ? -8.290  23.833  0.688   1.00 0.00 ? 191 ASN A OD1  1  
ATOM   3074  N  ND2  . ASN A 1 191 ? -10.402 23.773  0.096   1.00 0.00 ? 191 ASN A ND2  1  
ATOM   3075  H  H    . ASN A 1 191 ? -7.081  20.221  0.276   1.00 0.00 ? 191 ASN A H    1  
ATOM   3076  H  HA   . ASN A 1 191 ? -7.231  21.224  -1.839  1.00 0.00 ? 191 ASN A HA   1  
ATOM   3077  H  HB2  . ASN A 1 191 ? -9.299  22.318  -1.845  1.00 0.00 ? 191 ASN A HB2  1  
ATOM   3078  H  HB3  . ASN A 1 191 ? -9.384  21.252  -0.461  1.00 0.00 ? 191 ASN A HB3  1  
ATOM   3079  H  HD21 . ASN A 1 191 ? -11.117 23.353  -0.432  1.00 0.00 ? 191 ASN A HD21 1  
ATOM   3080  H  HD22 . ASN A 1 191 ? -10.602 24.531  0.674   1.00 0.00 ? 191 ASN A HD22 1  
ATOM   3081  N  N    . GLN A 1 192 ? -5.326  23.080  -1.297  1.00 0.00 ? 192 GLN A N    1  
ATOM   3082  C  CA   . GLN A 1 192 ? -4.489  24.245  -1.511  1.00 0.00 ? 192 GLN A CA   1  
ATOM   3083  C  C    . GLN A 1 192 ? -5.035  25.103  -2.649  1.00 0.00 ? 192 GLN A C    1  
ATOM   3084  O  O    . GLN A 1 192 ? -4.895  24.757  -3.823  1.00 0.00 ? 192 GLN A O    1  
ATOM   3085  C  CB   . GLN A 1 192 ? -3.076  23.770  -1.842  1.00 0.00 ? 192 GLN A CB   1  
ATOM   3086  C  CG   . GLN A 1 192 ? -2.055  24.807  -1.384  1.00 0.00 ? 192 GLN A CG   1  
ATOM   3087  C  CD   . GLN A 1 192 ? -2.223  26.097  -2.179  1.00 0.00 ? 192 GLN A CD   1  
ATOM   3088  O  OE1  . GLN A 1 192 ? -1.779  26.184  -3.324  1.00 0.00 ? 192 GLN A OE1  1  
ATOM   3089  N  NE2  . GLN A 1 192 ? -2.838  27.112  -1.636  1.00 0.00 ? 192 GLN A NE2  1  
ATOM   3090  H  H    . GLN A 1 192 ? -4.898  22.203  -1.222  1.00 0.00 ? 192 GLN A H    1  
ATOM   3091  H  HA   . GLN A 1 192 ? -4.462  24.831  -0.605  1.00 0.00 ? 192 GLN A HA   1  
ATOM   3092  H  HB2  . GLN A 1 192 ? -2.888  22.835  -1.333  1.00 0.00 ? 192 GLN A HB2  1  
ATOM   3093  H  HB3  . GLN A 1 192 ? -2.990  23.620  -2.905  1.00 0.00 ? 192 GLN A HB3  1  
ATOM   3094  H  HG2  . GLN A 1 192 ? -2.202  25.008  -0.333  1.00 0.00 ? 192 GLN A HG2  1  
ATOM   3095  H  HG3  . GLN A 1 192 ? -1.061  24.416  -1.538  1.00 0.00 ? 192 GLN A HG3  1  
ATOM   3096  H  HE21 . GLN A 1 192 ? -3.190  27.041  -0.724  1.00 0.00 ? 192 GLN A HE21 1  
ATOM   3097  H  HE22 . GLN A 1 192 ? -2.950  27.944  -2.141  1.00 0.00 ? 192 GLN A HE22 1  
ATOM   3098  N  N    . GLU A 1 193 ? -5.658  26.223  -2.294  1.00 0.00 ? 193 GLU A N    1  
ATOM   3099  C  CA   . GLU A 1 193 ? -6.222  27.123  -3.294  1.00 0.00 ? 193 GLU A CA   1  
ATOM   3100  C  C    . GLU A 1 193 ? -5.222  27.380  -4.416  1.00 0.00 ? 193 GLU A C    1  
ATOM   3101  O  O    . GLU A 1 193 ? -4.110  26.852  -4.405  1.00 0.00 ? 193 GLU A O    1  
ATOM   3102  C  CB   . GLU A 1 193 ? -6.609  28.452  -2.642  1.00 0.00 ? 193 GLU A CB   1  
ATOM   3103  C  CG   . GLU A 1 193 ? -7.958  28.301  -1.935  1.00 0.00 ? 193 GLU A CG   1  
ATOM   3104  C  CD   . GLU A 1 193 ? -8.434  29.657  -1.424  1.00 0.00 ? 193 GLU A CD   1  
ATOM   3105  O  OE1  . GLU A 1 193 ? -8.197  30.641  -2.105  1.00 0.00 ? 193 GLU A OE1  1  
ATOM   3106  O  OE2  . GLU A 1 193 ? -9.029  29.691  -0.359  1.00 0.00 ? 193 GLU A OE2  1  
ATOM   3107  H  H    . GLU A 1 193 ? -5.741  26.447  -1.344  1.00 0.00 ? 193 GLU A H    1  
ATOM   3108  H  HA   . GLU A 1 193 ? -7.107  26.669  -3.713  1.00 0.00 ? 193 GLU A HA   1  
ATOM   3109  H  HB2  . GLU A 1 193 ? -5.853  28.733  -1.922  1.00 0.00 ? 193 GLU A HB2  1  
ATOM   3110  H  HB3  . GLU A 1 193 ? -6.688  29.216  -3.402  1.00 0.00 ? 193 GLU A HB3  1  
ATOM   3111  H  HG2  . GLU A 1 193 ? -8.684  27.905  -2.630  1.00 0.00 ? 193 GLU A HG2  1  
ATOM   3112  H  HG3  . GLU A 1 193 ? -7.852  27.622  -1.100  1.00 0.00 ? 193 GLU A HG3  1  
ATOM   3113  N  N    . ASN A 1 194 ? -5.627  28.197  -5.383  1.00 0.00 ? 194 ASN A N    1  
ATOM   3114  C  CA   . ASN A 1 194 ? -4.764  28.522  -6.511  1.00 0.00 ? 194 ASN A CA   1  
ATOM   3115  C  C    . ASN A 1 194 ? -3.362  28.884  -6.031  1.00 0.00 ? 194 ASN A C    1  
ATOM   3116  O  O    . ASN A 1 194 ? -2.477  28.057  -6.173  1.00 0.00 ? 194 ASN A O    1  
ATOM   3117  C  CB   . ASN A 1 194 ? -5.353  29.688  -7.294  1.00 0.00 ? 194 ASN A CB   1  
ATOM   3118  C  CG   . ASN A 1 194 ? -4.602  29.872  -8.608  1.00 0.00 ? 194 ASN A CG   1  
ATOM   3119  O  OD1  . ASN A 1 194 ? -4.808  29.111  -9.554  1.00 0.00 ? 194 ASN A OD1  1  
ATOM   3120  N  ND2  . ASN A 1 194 ? -3.738  30.843  -8.725  1.00 0.00 ? 194 ASN A ND2  1  
ATOM   3121  O  OXT  . ASN A 1 194 ? -3.194  29.983  -5.529  1.00 0.00 ? 194 ASN A OXT  1  
ATOM   3122  H  H    . ASN A 1 194 ? -6.525  28.588  -5.337  1.00 0.00 ? 194 ASN A H    1  
ATOM   3123  H  HA   . ASN A 1 194 ? -4.703  27.672  -7.160  1.00 0.00 ? 194 ASN A HA   1  
ATOM   3124  H  HB2  . ASN A 1 194 ? -6.395  29.492  -7.500  1.00 0.00 ? 194 ASN A HB2  1  
ATOM   3125  H  HB3  . ASN A 1 194 ? -5.267  30.579  -6.707  1.00 0.00 ? 194 ASN A HB3  1  
ATOM   3126  H  HD21 . ASN A 1 194 ? -3.575  31.448  -7.971  1.00 0.00 ? 194 ASN A HD21 1  
ATOM   3127  H  HD22 . ASN A 1 194 ? -3.251  30.968  -9.566  1.00 0.00 ? 194 ASN A HD22 1  
HETATM 3128  ZN ZN   . ZN  B 2 .   ? -4.718  2.774   -9.867  1.00 0.00 ? 250 ZN  A ZN   1  
ATOM   3129  N  N    . HIS A 1 1   ? 25.801  -18.917 0.862   1.00 0.00 ? 1   HIS A N    2  
ATOM   3130  C  CA   . HIS A 1 1   ? 25.327  -20.306 0.610   1.00 0.00 ? 1   HIS A CA   2  
ATOM   3131  C  C    . HIS A 1 1   ? 23.810  -20.358 0.757   1.00 0.00 ? 1   HIS A C    2  
ATOM   3132  O  O    . HIS A 1 1   ? 23.274  -21.210 1.466   1.00 0.00 ? 1   HIS A O    2  
ATOM   3133  C  CB   . HIS A 1 1   ? 25.982  -21.255 1.617   1.00 0.00 ? 1   HIS A CB   2  
ATOM   3134  C  CG   . HIS A 1 1   ? 25.545  -22.666 1.331   1.00 0.00 ? 1   HIS A CG   2  
ATOM   3135  N  ND1  . HIS A 1 1   ? 25.695  -23.247 0.082   1.00 0.00 ? 1   HIS A ND1  2  
ATOM   3136  C  CD2  . HIS A 1 1   ? 24.962  -23.625 2.122   1.00 0.00 ? 1   HIS A CD2  2  
ATOM   3137  C  CE1  . HIS A 1 1   ? 25.211  -24.501 0.156   1.00 0.00 ? 1   HIS A CE1  2  
ATOM   3138  N  NE2  . HIS A 1 1   ? 24.752  -24.782 1.378   1.00 0.00 ? 1   HIS A NE2  2  
ATOM   3139  H  H1   . HIS A 1 1   ? 26.578  -18.934 1.552   1.00 0.00 ? 1   HIS A H1   2  
ATOM   3140  H  H2   . HIS A 1 1   ? 25.015  -18.345 1.237   1.00 0.00 ? 1   HIS A H2   2  
ATOM   3141  H  H3   . HIS A 1 1   ? 26.140  -18.499 -0.028  1.00 0.00 ? 1   HIS A H3   2  
ATOM   3142  H  HA   . HIS A 1 1   ? 25.600  -20.602 -0.392  1.00 0.00 ? 1   HIS A HA   2  
ATOM   3143  H  HB2  . HIS A 1 1   ? 27.057  -21.187 1.531   1.00 0.00 ? 1   HIS A HB2  2  
ATOM   3144  H  HB3  . HIS A 1 1   ? 25.682  -20.982 2.617   1.00 0.00 ? 1   HIS A HB3  2  
ATOM   3145  H  HD1  . HIS A 1 1   ? 26.082  -22.823 -0.712  1.00 0.00 ? 1   HIS A HD1  2  
ATOM   3146  H  HD2  . HIS A 1 1   ? 24.705  -23.499 3.165   1.00 0.00 ? 1   HIS A HD2  2  
ATOM   3147  H  HE1  . HIS A 1 1   ? 25.196  -25.195 -0.670  1.00 0.00 ? 1   HIS A HE1  2  
ATOM   3148  H  HE2  . HIS A 1 1   ? 24.352  -25.622 1.686   1.00 0.00 ? 1   HIS A HE2  2  
ATOM   3149  N  N    . MET A 1 2   ? 23.124  -19.441 0.084   1.00 0.00 ? 2   MET A N    2  
ATOM   3150  C  CA   . MET A 1 2   ? 21.669  -19.391 0.146   1.00 0.00 ? 2   MET A CA   2  
ATOM   3151  C  C    . MET A 1 2   ? 21.199  -19.276 1.593   1.00 0.00 ? 2   MET A C    2  
ATOM   3152  O  O    . MET A 1 2   ? 20.497  -20.150 2.100   1.00 0.00 ? 2   MET A O    2  
ATOM   3153  C  CB   . MET A 1 2   ? 21.074  -20.651 -0.484  1.00 0.00 ? 2   MET A CB   2  
ATOM   3154  C  CG   . MET A 1 2   ? 21.554  -20.772 -1.931  1.00 0.00 ? 2   MET A CG   2  
ATOM   3155  S  SD   . MET A 1 2   ? 23.200  -21.523 -1.959  1.00 0.00 ? 2   MET A SD   2  
ATOM   3156  C  CE   . MET A 1 2   ? 23.423  -21.511 -3.754  1.00 0.00 ? 2   MET A CE   2  
ATOM   3157  H  H    . MET A 1 2   ? 23.605  -18.786 -0.464  1.00 0.00 ? 2   MET A H    2  
ATOM   3158  H  HA   . MET A 1 2   ? 21.323  -18.529 -0.404  1.00 0.00 ? 2   MET A HA   2  
ATOM   3159  H  HB2  . MET A 1 2   ? 21.394  -21.518 0.076   1.00 0.00 ? 2   MET A HB2  2  
ATOM   3160  H  HB3  . MET A 1 2   ? 19.996  -20.588 -0.468  1.00 0.00 ? 2   MET A HB3  2  
ATOM   3161  H  HG2  . MET A 1 2   ? 20.866  -21.391 -2.488  1.00 0.00 ? 2   MET A HG2  2  
ATOM   3162  H  HG3  . MET A 1 2   ? 21.599  -19.791 -2.379  1.00 0.00 ? 2   MET A HG3  2  
ATOM   3163  H  HE1  . MET A 1 2   ? 24.054  -22.340 -4.043  1.00 0.00 ? 2   MET A HE1  2  
ATOM   3164  H  HE2  . MET A 1 2   ? 23.885  -20.579 -4.051  1.00 0.00 ? 2   MET A HE2  2  
ATOM   3165  H  HE3  . MET A 1 2   ? 22.464  -21.604 -4.237  1.00 0.00 ? 2   MET A HE3  2  
ATOM   3166  N  N    . LEU A 1 3   ? 21.592  -18.192 2.252   1.00 0.00 ? 3   LEU A N    2  
ATOM   3167  C  CA   . LEU A 1 3   ? 21.205  -17.973 3.640   1.00 0.00 ? 3   LEU A CA   2  
ATOM   3168  C  C    . LEU A 1 3   ? 19.841  -17.296 3.714   1.00 0.00 ? 3   LEU A C    2  
ATOM   3169  O  O    . LEU A 1 3   ? 19.749  -16.075 3.839   1.00 0.00 ? 3   LEU A O    2  
ATOM   3170  C  CB   . LEU A 1 3   ? 22.251  -17.106 4.343   1.00 0.00 ? 3   LEU A CB   2  
ATOM   3171  C  CG   . LEU A 1 3   ? 23.625  -17.772 4.233   1.00 0.00 ? 3   LEU A CG   2  
ATOM   3172  C  CD1  . LEU A 1 3   ? 24.720  -16.710 4.342   1.00 0.00 ? 3   LEU A CD1  2  
ATOM   3173  C  CD2  . LEU A 1 3   ? 23.791  -18.790 5.364   1.00 0.00 ? 3   LEU A CD2  2  
ATOM   3174  H  H    . LEU A 1 3   ? 22.151  -17.527 1.797   1.00 0.00 ? 3   LEU A H    2  
ATOM   3175  H  HA   . LEU A 1 3   ? 21.150  -18.928 4.142   1.00 0.00 ? 3   LEU A HA   2  
ATOM   3176  H  HB2  . LEU A 1 3   ? 22.284  -16.132 3.875   1.00 0.00 ? 3   LEU A HB2  2  
ATOM   3177  H  HB3  . LEU A 1 3   ? 21.988  -16.996 5.385   1.00 0.00 ? 3   LEU A HB3  2  
ATOM   3178  H  HG   . LEU A 1 3   ? 23.707  -18.273 3.280   1.00 0.00 ? 3   LEU A HG   2  
ATOM   3179  H  HD11 . LEU A 1 3   ? 24.867  -16.244 3.380   1.00 0.00 ? 3   LEU A HD11 2  
ATOM   3180  H  HD12 . LEU A 1 3   ? 25.641  -17.174 4.663   1.00 0.00 ? 3   LEU A HD12 2  
ATOM   3181  H  HD13 . LEU A 1 3   ? 24.425  -15.961 5.064   1.00 0.00 ? 3   LEU A HD13 2  
ATOM   3182  H  HD21 . LEU A 1 3   ? 24.767  -19.247 5.296   1.00 0.00 ? 3   LEU A HD21 2  
ATOM   3183  H  HD22 . LEU A 1 3   ? 23.032  -19.552 5.278   1.00 0.00 ? 3   LEU A HD22 2  
ATOM   3184  H  HD23 . LEU A 1 3   ? 23.694  -18.291 6.317   1.00 0.00 ? 3   LEU A HD23 2  
ATOM   3185  N  N    . ARG A 1 4   ? 18.785  -18.098 3.635   1.00 0.00 ? 4   ARG A N    2  
ATOM   3186  C  CA   . ARG A 1 4   ? 17.429  -17.566 3.692   1.00 0.00 ? 4   ARG A CA   2  
ATOM   3187  C  C    . ARG A 1 4   ? 17.170  -16.634 2.513   1.00 0.00 ? 4   ARG A C    2  
ATOM   3188  O  O    . ARG A 1 4   ? 17.975  -15.749 2.222   1.00 0.00 ? 4   ARG A O    2  
ATOM   3189  C  CB   . ARG A 1 4   ? 17.222  -16.804 5.003   1.00 0.00 ? 4   ARG A CB   2  
ATOM   3190  C  CG   . ARG A 1 4   ? 15.725  -16.626 5.259   1.00 0.00 ? 4   ARG A CG   2  
ATOM   3191  C  CD   . ARG A 1 4   ? 15.518  -15.800 6.530   1.00 0.00 ? 4   ARG A CD   2  
ATOM   3192  N  NE   . ARG A 1 4   ? 16.046  -16.514 7.687   1.00 0.00 ? 4   ARG A NE   2  
ATOM   3193  C  CZ   . ARG A 1 4   ? 15.983  -15.990 8.906   1.00 0.00 ? 4   ARG A CZ   2  
ATOM   3194  N  NH1  . ARG A 1 4   ? 15.440  -14.816 9.085   1.00 0.00 ? 4   ARG A NH1  2  
ATOM   3195  N  NH2  . ARG A 1 4   ? 16.462  -16.650 9.925   1.00 0.00 ? 4   ARG A NH2  2  
ATOM   3196  H  H    . ARG A 1 4   ? 18.919  -19.064 3.535   1.00 0.00 ? 4   ARG A H    2  
ATOM   3197  H  HA   . ARG A 1 4   ? 16.728  -18.387 3.652   1.00 0.00 ? 4   ARG A HA   2  
ATOM   3198  H  HB2  . ARG A 1 4   ? 17.664  -17.361 5.816   1.00 0.00 ? 4   ARG A HB2  2  
ATOM   3199  H  HB3  . ARG A 1 4   ? 17.690  -15.834 4.933   1.00 0.00 ? 4   ARG A HB3  2  
ATOM   3200  H  HG2  . ARG A 1 4   ? 15.274  -16.115 4.420   1.00 0.00 ? 4   ARG A HG2  2  
ATOM   3201  H  HG3  . ARG A 1 4   ? 15.262  -17.593 5.382   1.00 0.00 ? 4   ARG A HG3  2  
ATOM   3202  H  HD2  . ARG A 1 4   ? 16.032  -14.856 6.431   1.00 0.00 ? 4   ARG A HD2  2  
ATOM   3203  H  HD3  . ARG A 1 4   ? 14.462  -15.619 6.670   1.00 0.00 ? 4   ARG A HD3  2  
ATOM   3204  H  HE   . ARG A 1 4   ? 16.455  -17.396 7.562   1.00 0.00 ? 4   ARG A HE   2  
ATOM   3205  H  HH11 . ARG A 1 4   ? 15.073  -14.312 8.304   1.00 0.00 ? 4   ARG A HH11 2  
ATOM   3206  H  HH12 . ARG A 1 4   ? 15.392  -14.423 10.002  1.00 0.00 ? 4   ARG A HH12 2  
ATOM   3207  H  HH21 . ARG A 1 4   ? 16.877  -17.549 9.788   1.00 0.00 ? 4   ARG A HH21 2  
ATOM   3208  H  HH22 . ARG A 1 4   ? 16.414  -16.256 10.843  1.00 0.00 ? 4   ARG A HH22 2  
ATOM   3209  N  N    . HIS A 1 5   ? 16.044  -16.839 1.837   1.00 0.00 ? 5   HIS A N    2  
ATOM   3210  C  CA   . HIS A 1 5   ? 15.692  -16.009 0.691   1.00 0.00 ? 5   HIS A CA   2  
ATOM   3211  C  C    . HIS A 1 5   ? 14.840  -14.822 1.127   1.00 0.00 ? 5   HIS A C    2  
ATOM   3212  O  O    . HIS A 1 5   ? 13.614  -14.918 1.194   1.00 0.00 ? 5   HIS A O    2  
ATOM   3213  C  CB   . HIS A 1 5   ? 14.922  -16.838 -0.339  1.00 0.00 ? 5   HIS A CB   2  
ATOM   3214  C  CG   . HIS A 1 5   ? 15.735  -18.043 -0.727  1.00 0.00 ? 5   HIS A CG   2  
ATOM   3215  N  ND1  . HIS A 1 5   ? 15.517  -19.293 -0.169  1.00 0.00 ? 5   HIS A ND1  2  
ATOM   3216  C  CD2  . HIS A 1 5   ? 16.767  -18.206 -1.618  1.00 0.00 ? 5   HIS A CD2  2  
ATOM   3217  C  CE1  . HIS A 1 5   ? 16.398  -20.144 -0.724  1.00 0.00 ? 5   HIS A CE1  2  
ATOM   3218  N  NE2  . HIS A 1 5   ? 17.184  -19.533 -1.614  1.00 0.00 ? 5   HIS A NE2  2  
ATOM   3219  H  H    . HIS A 1 5   ? 15.440  -17.559 2.114   1.00 0.00 ? 5   HIS A H    2  
ATOM   3220  H  HA   . HIS A 1 5   ? 16.598  -15.641 0.234   1.00 0.00 ? 5   HIS A HA   2  
ATOM   3221  H  HB2  . HIS A 1 5   ? 13.983  -17.160 0.088   1.00 0.00 ? 5   HIS A HB2  2  
ATOM   3222  H  HB3  . HIS A 1 5   ? 14.731  -16.236 -1.215  1.00 0.00 ? 5   HIS A HB3  2  
ATOM   3223  H  HD1  . HIS A 1 5   ? 14.842  -19.515 0.507   1.00 0.00 ? 5   HIS A HD1  2  
ATOM   3224  H  HD2  . HIS A 1 5   ? 17.190  -17.422 -2.230  1.00 0.00 ? 5   HIS A HD2  2  
ATOM   3225  H  HE1  . HIS A 1 5   ? 16.463  -21.194 -0.479  1.00 0.00 ? 5   HIS A HE1  2  
ATOM   3226  H  HE2  . HIS A 1 5   ? 17.901  -19.934 -2.149  1.00 0.00 ? 5   HIS A HE2  2  
ATOM   3227  N  N    . SER A 1 6   ? 15.494  -13.703 1.419   1.00 0.00 ? 6   SER A N    2  
ATOM   3228  C  CA   . SER A 1 6   ? 14.786  -12.498 1.845   1.00 0.00 ? 6   SER A CA   2  
ATOM   3229  C  C    . SER A 1 6   ? 14.738  -11.482 0.709   1.00 0.00 ? 6   SER A C    2  
ATOM   3230  O  O    . SER A 1 6   ? 14.019  -11.668 -0.273  1.00 0.00 ? 6   SER A O    2  
ATOM   3231  C  CB   . SER A 1 6   ? 15.486  -11.880 3.056   1.00 0.00 ? 6   SER A CB   2  
ATOM   3232  O  OG   . SER A 1 6   ? 16.804  -11.492 2.690   1.00 0.00 ? 6   SER A OG   2  
ATOM   3233  H  H    . SER A 1 6   ? 16.472  -13.684 1.345   1.00 0.00 ? 6   SER A H    2  
ATOM   3234  H  HA   . SER A 1 6   ? 13.776  -12.760 2.123   1.00 0.00 ? 6   SER A HA   2  
ATOM   3235  H  HB2  . SER A 1 6   ? 14.940  -11.011 3.386   1.00 0.00 ? 6   SER A HB2  2  
ATOM   3236  H  HB3  . SER A 1 6   ? 15.523  -12.607 3.858   1.00 0.00 ? 6   SER A HB3  2  
ATOM   3237  H  HG   . SER A 1 6   ? 17.100  -10.825 3.314   1.00 0.00 ? 6   SER A HG   2  
ATOM   3238  N  N    . MET A 1 7   ? 15.511  -10.409 0.846   1.00 0.00 ? 7   MET A N    2  
ATOM   3239  C  CA   . MET A 1 7   ? 15.550  -9.373  -0.179  1.00 0.00 ? 7   MET A CA   2  
ATOM   3240  C  C    . MET A 1 7   ? 16.638  -8.350  0.133   1.00 0.00 ? 7   MET A C    2  
ATOM   3241  O  O    . MET A 1 7   ? 16.349  -7.194  0.435   1.00 0.00 ? 7   MET A O    2  
ATOM   3242  C  CB   . MET A 1 7   ? 14.189  -8.672  -0.271  1.00 0.00 ? 7   MET A CB   2  
ATOM   3243  C  CG   . MET A 1 7   ? 13.788  -8.100  1.098   1.00 0.00 ? 7   MET A CG   2  
ATOM   3244  S  SD   . MET A 1 7   ? 13.960  -6.298  1.073   1.00 0.00 ? 7   MET A SD   2  
ATOM   3245  C  CE   . MET A 1 7   ? 14.817  -6.133  2.657   1.00 0.00 ? 7   MET A CE   2  
ATOM   3246  H  H    . MET A 1 7   ? 16.065  -10.314 1.649   1.00 0.00 ? 7   MET A H    2  
ATOM   3247  H  HA   . MET A 1 7   ? 15.767  -9.833  -1.131  1.00 0.00 ? 7   MET A HA   2  
ATOM   3248  H  HB2  . MET A 1 7   ? 14.251  -7.872  -0.994  1.00 0.00 ? 7   MET A HB2  2  
ATOM   3249  H  HB3  . MET A 1 7   ? 13.445  -9.383  -0.592  1.00 0.00 ? 7   MET A HB3  2  
ATOM   3250  H  HG2  . MET A 1 7   ? 12.759  -8.356  1.307   1.00 0.00 ? 7   MET A HG2  2  
ATOM   3251  H  HG3  . MET A 1 7   ? 14.422  -8.512  1.870   1.00 0.00 ? 7   MET A HG3  2  
ATOM   3252  H  HE1  . MET A 1 7   ? 14.355  -6.785  3.384   1.00 0.00 ? 7   MET A HE1  2  
ATOM   3253  H  HE2  . MET A 1 7   ? 14.755  -5.107  2.993   1.00 0.00 ? 7   MET A HE2  2  
ATOM   3254  H  HE3  . MET A 1 7   ? 15.853  -6.408  2.537   1.00 0.00 ? 7   MET A HE3  2  
ATOM   3255  N  N    . ASP A 1 8   ? 17.889  -8.789  0.053   1.00 0.00 ? 8   ASP A N    2  
ATOM   3256  C  CA   . ASP A 1 8   ? 19.017  -7.906  0.327   1.00 0.00 ? 8   ASP A CA   2  
ATOM   3257  C  C    . ASP A 1 8   ? 20.332  -8.686  0.250   1.00 0.00 ? 8   ASP A C    2  
ATOM   3258  O  O    . ASP A 1 8   ? 21.261  -8.278  -0.446  1.00 0.00 ? 8   ASP A O    2  
ATOM   3259  C  CB   . ASP A 1 8   ? 18.855  -7.263  1.717   1.00 0.00 ? 8   ASP A CB   2  
ATOM   3260  C  CG   . ASP A 1 8   ? 18.703  -5.747  1.602   1.00 0.00 ? 8   ASP A CG   2  
ATOM   3261  O  OD1  . ASP A 1 8   ? 18.094  -5.304  0.642   1.00 0.00 ? 8   ASP A OD1  2  
ATOM   3262  O  OD2  . ASP A 1 8   ? 19.200  -5.053  2.474   1.00 0.00 ? 8   ASP A OD2  2  
ATOM   3263  H  H    . ASP A 1 8   ? 18.057  -9.721  -0.195  1.00 0.00 ? 8   ASP A H    2  
ATOM   3264  H  HA   . ASP A 1 8   ? 19.035  -7.129  -0.424  1.00 0.00 ? 8   ASP A HA   2  
ATOM   3265  H  HB2  . ASP A 1 8   ? 17.973  -7.669  2.192   1.00 0.00 ? 8   ASP A HB2  2  
ATOM   3266  H  HB3  . ASP A 1 8   ? 19.720  -7.488  2.326   1.00 0.00 ? 8   ASP A HB3  2  
ATOM   3267  N  N    . PRO A 1 9   ? 20.421  -9.798  0.938   1.00 0.00 ? 9   PRO A N    2  
ATOM   3268  C  CA   . PRO A 1 9   ? 21.653  -10.638 0.925   1.00 0.00 ? 9   PRO A CA   2  
ATOM   3269  C  C    . PRO A 1 9   ? 22.064  -10.954 -0.509  1.00 0.00 ? 9   PRO A C    2  
ATOM   3270  O  O    . PRO A 1 9   ? 21.558  -10.337 -1.446  1.00 0.00 ? 9   PRO A O    2  
ATOM   3271  C  CB   . PRO A 1 9   ? 21.242  -11.913 1.667   1.00 0.00 ? 9   PRO A CB   2  
ATOM   3272  C  CG   . PRO A 1 9   ? 20.049  -11.547 2.488   1.00 0.00 ? 9   PRO A CG   2  
ATOM   3273  C  CD   . PRO A 1 9   ? 19.368  -10.372 1.792   1.00 0.00 ? 9   PRO A CD   2  
ATOM   3274  H  HA   . PRO A 1 9   ? 22.455  -10.146 1.451   1.00 0.00 ? 9   PRO A HA   2  
ATOM   3275  H  HB2  . PRO A 1 9   ? 20.987  -12.690 0.955   1.00 0.00 ? 9   PRO A HB2  2  
ATOM   3276  H  HB3  . PRO A 1 9   ? 22.042  -12.240 2.315   1.00 0.00 ? 9   PRO A HB3  2  
ATOM   3277  H  HG2  . PRO A 1 9   ? 19.371  -12.388 2.546   1.00 0.00 ? 9   PRO A HG2  2  
ATOM   3278  H  HG3  . PRO A 1 9   ? 20.356  -11.250 3.479   1.00 0.00 ? 9   PRO A HG3  2  
ATOM   3279  H  HD2  . PRO A 1 9   ? 18.538  -10.721 1.194   1.00 0.00 ? 9   PRO A HD2  2  
ATOM   3280  H  HD3  . PRO A 1 9   ? 19.038  -9.649  2.517   1.00 0.00 ? 9   PRO A HD3  2  
ATOM   3281  N  N    . PRO A 1 10  ? 22.939  -11.904 -0.713  1.00 0.00 ? 10  PRO A N    2  
ATOM   3282  C  CA   . PRO A 1 10  ? 23.369  -12.287 -2.086  1.00 0.00 ? 10  PRO A CA   2  
ATOM   3283  C  C    . PRO A 1 10  ? 22.178  -12.575 -3.001  1.00 0.00 ? 10  PRO A C    2  
ATOM   3284  O  O    . PRO A 1 10  ? 22.353  -12.962 -4.157  1.00 0.00 ? 10  PRO A O    2  
ATOM   3285  C  CB   . PRO A 1 10  ? 24.205  -13.541 -1.851  1.00 0.00 ? 10  PRO A CB   2  
ATOM   3286  C  CG   . PRO A 1 10  ? 24.751  -13.376 -0.477  1.00 0.00 ? 10  PRO A CG   2  
ATOM   3287  C  CD   . PRO A 1 10  ? 23.634  -12.714 0.313   1.00 0.00 ? 10  PRO A CD   2  
ATOM   3288  H  HA   . PRO A 1 10  ? 23.990  -11.515 -2.512  1.00 0.00 ? 10  PRO A HA   2  
ATOM   3289  H  HB2  . PRO A 1 10  ? 23.584  -14.425 -1.910  1.00 0.00 ? 10  PRO A HB2  2  
ATOM   3290  H  HB3  . PRO A 1 10  ? 25.001  -13.594 -2.558  1.00 0.00 ? 10  PRO A HB3  2  
ATOM   3291  H  HG2  . PRO A 1 10  ? 24.998  -14.341 -0.054  1.00 0.00 ? 10  PRO A HG2  2  
ATOM   3292  H  HG3  . PRO A 1 10  ? 25.618  -12.736 -0.491  1.00 0.00 ? 10  PRO A HG3  2  
ATOM   3293  H  HD2  . PRO A 1 10  ? 22.989  -13.476 0.720   1.00 0.00 ? 10  PRO A HD2  2  
ATOM   3294  H  HD3  . PRO A 1 10  ? 24.032  -12.082 1.091   1.00 0.00 ? 10  PRO A HD3  2  
ATOM   3295  N  N    . THR A 1 11  ? 20.967  -12.379 -2.479  1.00 0.00 ? 11  THR A N    2  
ATOM   3296  C  CA   . THR A 1 11  ? 19.762  -12.616 -3.257  1.00 0.00 ? 11  THR A CA   2  
ATOM   3297  C  C    . THR A 1 11  ? 19.571  -11.515 -4.293  1.00 0.00 ? 11  THR A C    2  
ATOM   3298  O  O    . THR A 1 11  ? 18.925  -11.719 -5.321  1.00 0.00 ? 11  THR A O    2  
ATOM   3299  C  CB   . THR A 1 11  ? 18.544  -12.667 -2.329  1.00 0.00 ? 11  THR A CB   2  
ATOM   3300  O  OG1  . THR A 1 11  ? 17.416  -13.133 -3.057  1.00 0.00 ? 11  THR A OG1  2  
ATOM   3301  C  CG2  . THR A 1 11  ? 18.257  -11.267 -1.778  1.00 0.00 ? 11  THR A CG2  2  
ATOM   3302  H  H    . THR A 1 11  ? 20.883  -12.071 -1.558  1.00 0.00 ? 11  THR A H    2  
ATOM   3303  H  HA   . THR A 1 11  ? 19.855  -13.563 -3.759  1.00 0.00 ? 11  THR A HA   2  
ATOM   3304  H  HB   . THR A 1 11  ? 18.745  -13.337 -1.508  1.00 0.00 ? 11  THR A HB   2  
ATOM   3305  H  HG1  . THR A 1 11  ? 17.160  -12.448 -3.677  1.00 0.00 ? 11  THR A HG1  2  
ATOM   3306  H  HG21 . THR A 1 11  ? 19.187  -10.777 -1.534  1.00 0.00 ? 11  THR A HG21 2  
ATOM   3307  H  HG22 . THR A 1 11  ? 17.649  -11.347 -0.889  1.00 0.00 ? 11  THR A HG22 2  
ATOM   3308  H  HG23 . THR A 1 11  ? 17.730  -10.688 -2.522  1.00 0.00 ? 11  THR A HG23 2  
ATOM   3309  N  N    . PHE A 1 12  ? 20.138  -10.346 -4.013  1.00 0.00 ? 12  PHE A N    2  
ATOM   3310  C  CA   . PHE A 1 12  ? 20.027  -9.214  -4.924  1.00 0.00 ? 12  PHE A CA   2  
ATOM   3311  C  C    . PHE A 1 12  ? 21.170  -9.222  -5.934  1.00 0.00 ? 12  PHE A C    2  
ATOM   3312  O  O    . PHE A 1 12  ? 20.957  -9.014  -7.128  1.00 0.00 ? 12  PHE A O    2  
ATOM   3313  C  CB   . PHE A 1 12  ? 20.051  -7.906  -4.131  1.00 0.00 ? 12  PHE A CB   2  
ATOM   3314  C  CG   . PHE A 1 12  ? 19.416  -6.805  -4.947  1.00 0.00 ? 12  PHE A CG   2  
ATOM   3315  C  CD1  . PHE A 1 12  ? 18.023  -6.685  -4.992  1.00 0.00 ? 12  PHE A CD1  2  
ATOM   3316  C  CD2  . PHE A 1 12  ? 20.221  -5.906  -5.657  1.00 0.00 ? 12  PHE A CD2  2  
ATOM   3317  C  CE1  . PHE A 1 12  ? 17.433  -5.664  -5.747  1.00 0.00 ? 12  PHE A CE1  2  
ATOM   3318  C  CE2  . PHE A 1 12  ? 19.631  -4.886  -6.412  1.00 0.00 ? 12  PHE A CE2  2  
ATOM   3319  C  CZ   . PHE A 1 12  ? 18.237  -4.764  -6.458  1.00 0.00 ? 12  PHE A CZ   2  
ATOM   3320  H  H    . PHE A 1 12  ? 20.640  -10.243 -3.178  1.00 0.00 ? 12  PHE A H    2  
ATOM   3321  H  HA   . PHE A 1 12  ? 19.090  -9.281  -5.455  1.00 0.00 ? 12  PHE A HA   2  
ATOM   3322  H  HB2  . PHE A 1 12  ? 19.502  -8.034  -3.210  1.00 0.00 ? 12  PHE A HB2  2  
ATOM   3323  H  HB3  . PHE A 1 12  ? 21.074  -7.642  -3.905  1.00 0.00 ? 12  PHE A HB3  2  
ATOM   3324  H  HD1  . PHE A 1 12  ? 17.401  -7.379  -4.445  1.00 0.00 ? 12  PHE A HD1  2  
ATOM   3325  H  HD2  . PHE A 1 12  ? 21.296  -5.999  -5.623  1.00 0.00 ? 12  PHE A HD2  2  
ATOM   3326  H  HE1  . PHE A 1 12  ? 16.357  -5.571  -5.783  1.00 0.00 ? 12  PHE A HE1  2  
ATOM   3327  H  HE2  . PHE A 1 12  ? 20.251  -4.191  -6.959  1.00 0.00 ? 12  PHE A HE2  2  
ATOM   3328  H  HZ   . PHE A 1 12  ? 17.782  -3.978  -7.040  1.00 0.00 ? 12  PHE A HZ   2  
ATOM   3329  N  N    . THR A 1 13  ? 22.383  -9.464  -5.446  1.00 0.00 ? 13  THR A N    2  
ATOM   3330  C  CA   . THR A 1 13  ? 23.551  -9.498  -6.315  1.00 0.00 ? 13  THR A CA   2  
ATOM   3331  C  C    . THR A 1 13  ? 23.269  -10.335 -7.558  1.00 0.00 ? 13  THR A C    2  
ATOM   3332  O  O    . THR A 1 13  ? 23.776  -10.044 -8.641  1.00 0.00 ? 13  THR A O    2  
ATOM   3333  C  CB   . THR A 1 13  ? 24.742  -10.089 -5.557  1.00 0.00 ? 13  THR A CB   2  
ATOM   3334  O  OG1  . THR A 1 13  ? 24.310  -11.216 -4.808  1.00 0.00 ? 13  THR A OG1  2  
ATOM   3335  C  CG2  . THR A 1 13  ? 25.320  -9.035  -4.611  1.00 0.00 ? 13  THR A CG2  2  
ATOM   3336  H  H    . THR A 1 13  ? 22.494  -9.623  -4.486  1.00 0.00 ? 13  THR A H    2  
ATOM   3337  H  HA   . THR A 1 13  ? 23.795  -8.491  -6.615  1.00 0.00 ? 13  THR A HA   2  
ATOM   3338  H  HB   . THR A 1 13  ? 25.500  -10.392 -6.258  1.00 0.00 ? 13  THR A HB   2  
ATOM   3339  H  HG1  . THR A 1 13  ? 23.912  -11.843 -5.417  1.00 0.00 ? 13  THR A HG1  2  
ATOM   3340  H  HG21 . THR A 1 13  ? 24.515  -8.545  -4.084  1.00 0.00 ? 13  THR A HG21 2  
ATOM   3341  H  HG22 . THR A 1 13  ? 25.874  -8.305  -5.182  1.00 0.00 ? 13  THR A HG22 2  
ATOM   3342  H  HG23 . THR A 1 13  ? 25.979  -9.513  -3.900  1.00 0.00 ? 13  THR A HG23 2  
ATOM   3343  N  N    . PHE A 1 14  ? 22.456  -11.373 -7.394  1.00 0.00 ? 14  PHE A N    2  
ATOM   3344  C  CA   . PHE A 1 14  ? 22.111  -12.244 -8.511  1.00 0.00 ? 14  PHE A CA   2  
ATOM   3345  C  C    . PHE A 1 14  ? 21.890  -11.423 -9.777  1.00 0.00 ? 14  PHE A C    2  
ATOM   3346  O  O    . PHE A 1 14  ? 21.969  -11.943 -10.890 1.00 0.00 ? 14  PHE A O    2  
ATOM   3347  C  CB   . PHE A 1 14  ? 20.842  -13.032 -8.184  1.00 0.00 ? 14  PHE A CB   2  
ATOM   3348  C  CG   . PHE A 1 14  ? 20.717  -14.204 -9.128  1.00 0.00 ? 14  PHE A CG   2  
ATOM   3349  C  CD1  . PHE A 1 14  ? 21.381  -15.404 -8.847  1.00 0.00 ? 14  PHE A CD1  2  
ATOM   3350  C  CD2  . PHE A 1 14  ? 19.935  -14.091 -10.284 1.00 0.00 ? 14  PHE A CD2  2  
ATOM   3351  C  CE1  . PHE A 1 14  ? 21.264  -16.491 -9.721  1.00 0.00 ? 14  PHE A CE1  2  
ATOM   3352  C  CE2  . PHE A 1 14  ? 19.818  -15.177 -11.159 1.00 0.00 ? 14  PHE A CE2  2  
ATOM   3353  C  CZ   . PHE A 1 14  ? 20.483  -16.378 -10.878 1.00 0.00 ? 14  PHE A CZ   2  
ATOM   3354  H  H    . PHE A 1 14  ? 22.081  -11.556 -6.507  1.00 0.00 ? 14  PHE A H    2  
ATOM   3355  H  HA   . PHE A 1 14  ? 22.920  -12.938 -8.679  1.00 0.00 ? 14  PHE A HA   2  
ATOM   3356  H  HB2  . PHE A 1 14  ? 20.895  -13.394 -7.167  1.00 0.00 ? 14  PHE A HB2  2  
ATOM   3357  H  HB3  . PHE A 1 14  ? 19.981  -12.391 -8.294  1.00 0.00 ? 14  PHE A HB3  2  
ATOM   3358  H  HD1  . PHE A 1 14  ? 21.984  -15.492 -7.955  1.00 0.00 ? 14  PHE A HD1  2  
ATOM   3359  H  HD2  . PHE A 1 14  ? 19.423  -13.165 -10.501 1.00 0.00 ? 14  PHE A HD2  2  
ATOM   3360  H  HE1  . PHE A 1 14  ? 21.776  -17.416 -9.505  1.00 0.00 ? 14  PHE A HE1  2  
ATOM   3361  H  HE2  . PHE A 1 14  ? 19.216  -15.090 -12.051 1.00 0.00 ? 14  PHE A HE2  2  
ATOM   3362  H  HZ   . PHE A 1 14  ? 20.392  -17.216 -11.552 1.00 0.00 ? 14  PHE A HZ   2  
ATOM   3363  N  N    . ASN A 1 15  ? 21.616  -10.136 -9.596  1.00 0.00 ? 15  ASN A N    2  
ATOM   3364  C  CA   . ASN A 1 15  ? 21.386  -9.245  -10.726 1.00 0.00 ? 15  ASN A CA   2  
ATOM   3365  C  C    . ASN A 1 15  ? 21.089  -7.832  -10.236 1.00 0.00 ? 15  ASN A C    2  
ATOM   3366  O  O    . ASN A 1 15  ? 20.258  -7.635  -9.350  1.00 0.00 ? 15  ASN A O    2  
ATOM   3367  C  CB   . ASN A 1 15  ? 20.211  -9.750  -11.563 1.00 0.00 ? 15  ASN A CB   2  
ATOM   3368  C  CG   . ASN A 1 15  ? 19.104  -10.265 -10.651 1.00 0.00 ? 15  ASN A CG   2  
ATOM   3369  O  OD1  . ASN A 1 15  ? 19.227  -10.204 -9.428  1.00 0.00 ? 15  ASN A OD1  2  
ATOM   3370  N  ND2  . ASN A 1 15  ? 18.021  -10.772 -11.175 1.00 0.00 ? 15  ASN A ND2  2  
ATOM   3371  H  H    . ASN A 1 15  ? 21.567  -9.779  -8.685  1.00 0.00 ? 15  ASN A H    2  
ATOM   3372  H  HA   . ASN A 1 15  ? 22.271  -9.223  -11.342 1.00 0.00 ? 15  ASN A HA   2  
ATOM   3373  H  HB2  . ASN A 1 15  ? 19.829  -8.940  -12.168 1.00 0.00 ? 15  ASN A HB2  2  
ATOM   3374  H  HB3  . ASN A 1 15  ? 20.546  -10.550 -12.207 1.00 0.00 ? 15  ASN A HB3  2  
ATOM   3375  H  HD21 . ASN A 1 15  ? 17.924  -10.819 -12.150 1.00 0.00 ? 15  ASN A HD21 2  
ATOM   3376  H  HD22 . ASN A 1 15  ? 17.305  -11.106 -10.595 1.00 0.00 ? 15  ASN A HD22 2  
ATOM   3377  N  N    . PHE A 1 16  ? 21.772  -6.853  -10.818 1.00 0.00 ? 16  PHE A N    2  
ATOM   3378  C  CA   . PHE A 1 16  ? 21.571  -5.463  -10.428 1.00 0.00 ? 16  PHE A CA   2  
ATOM   3379  C  C    . PHE A 1 16  ? 20.080  -5.150  -10.329 1.00 0.00 ? 16  PHE A C    2  
ATOM   3380  O  O    . PHE A 1 16  ? 19.645  -4.429  -9.431  1.00 0.00 ? 16  PHE A O    2  
ATOM   3381  C  CB   . PHE A 1 16  ? 22.233  -4.534  -11.455 1.00 0.00 ? 16  PHE A CB   2  
ATOM   3382  C  CG   . PHE A 1 16  ? 22.725  -3.279  -10.770 1.00 0.00 ? 16  PHE A CG   2  
ATOM   3383  C  CD1  . PHE A 1 16  ? 23.709  -3.364  -9.778  1.00 0.00 ? 16  PHE A CD1  2  
ATOM   3384  C  CD2  . PHE A 1 16  ? 22.199  -2.032  -11.130 1.00 0.00 ? 16  PHE A CD2  2  
ATOM   3385  C  CE1  . PHE A 1 16  ? 24.166  -2.202  -9.144  1.00 0.00 ? 16  PHE A CE1  2  
ATOM   3386  C  CE2  . PHE A 1 16  ? 22.656  -0.870  -10.496 1.00 0.00 ? 16  PHE A CE2  2  
ATOM   3387  C  CZ   . PHE A 1 16  ? 23.640  -0.955  -9.503  1.00 0.00 ? 16  PHE A CZ   2  
ATOM   3388  H  H    . PHE A 1 16  ? 22.422  -7.070  -11.518 1.00 0.00 ? 16  PHE A H    2  
ATOM   3389  H  HA   . PHE A 1 16  ? 22.027  -5.305  -9.463  1.00 0.00 ? 16  PHE A HA   2  
ATOM   3390  H  HB2  . PHE A 1 16  ? 23.069  -5.044  -11.911 1.00 0.00 ? 16  PHE A HB2  2  
ATOM   3391  H  HB3  . PHE A 1 16  ? 21.516  -4.268  -12.218 1.00 0.00 ? 16  PHE A HB3  2  
ATOM   3392  H  HD1  . PHE A 1 16  ? 24.115  -4.325  -9.501  1.00 0.00 ? 16  PHE A HD1  2  
ATOM   3393  H  HD2  . PHE A 1 16  ? 21.441  -1.967  -11.896 1.00 0.00 ? 16  PHE A HD2  2  
ATOM   3394  H  HE1  . PHE A 1 16  ? 24.925  -2.267  -8.378  1.00 0.00 ? 16  PHE A HE1  2  
ATOM   3395  H  HE2  . PHE A 1 16  ? 22.251  0.091   -10.774 1.00 0.00 ? 16  PHE A HE2  2  
ATOM   3396  H  HZ   . PHE A 1 16  ? 23.993  -0.059  -9.015  1.00 0.00 ? 16  PHE A HZ   2  
ATOM   3397  N  N    . ASN A 1 17  ? 19.303  -5.700  -11.257 1.00 0.00 ? 17  ASN A N    2  
ATOM   3398  C  CA   . ASN A 1 17  ? 17.861  -5.481  -11.267 1.00 0.00 ? 17  ASN A CA   2  
ATOM   3399  C  C    . ASN A 1 17  ? 17.529  -4.087  -11.798 1.00 0.00 ? 17  ASN A C    2  
ATOM   3400  O  O    . ASN A 1 17  ? 16.375  -3.789  -12.101 1.00 0.00 ? 17  ASN A O    2  
ATOM   3401  C  CB   . ASN A 1 17  ? 17.298  -5.642  -9.850  1.00 0.00 ? 17  ASN A CB   2  
ATOM   3402  C  CG   . ASN A 1 17  ? 15.856  -6.135  -9.911  1.00 0.00 ? 17  ASN A CG   2  
ATOM   3403  O  OD1  . ASN A 1 17  ? 15.575  -7.163  -10.528 1.00 0.00 ? 17  ASN A OD1  2  
ATOM   3404  N  ND2  . ASN A 1 17  ? 14.918  -5.460  -9.304  1.00 0.00 ? 17  ASN A ND2  2  
ATOM   3405  H  H    . ASN A 1 17  ? 19.708  -6.268  -11.946 1.00 0.00 ? 17  ASN A H    2  
ATOM   3406  H  HA   . ASN A 1 17  ? 17.403  -6.217  -11.910 1.00 0.00 ? 17  ASN A HA   2  
ATOM   3407  H  HB2  . ASN A 1 17  ? 17.899  -6.358  -9.307  1.00 0.00 ? 17  ASN A HB2  2  
ATOM   3408  H  HB3  . ASN A 1 17  ? 17.329  -4.690  -9.340  1.00 0.00 ? 17  ASN A HB3  2  
ATOM   3409  H  HD21 . ASN A 1 17  ? 15.144  -4.640  -8.813  1.00 0.00 ? 17  ASN A HD21 2  
ATOM   3410  H  HD22 . ASN A 1 17  ? 13.987  -5.773  -9.340  1.00 0.00 ? 17  ASN A HD22 2  
ATOM   3411  N  N    . ASN A 1 18  ? 18.548  -3.241  -11.907 1.00 0.00 ? 18  ASN A N    2  
ATOM   3412  C  CA   . ASN A 1 18  ? 18.351  -1.883  -12.406 1.00 0.00 ? 18  ASN A CA   2  
ATOM   3413  C  C    . ASN A 1 18  ? 17.542  -1.056  -11.409 1.00 0.00 ? 18  ASN A C    2  
ATOM   3414  O  O    . ASN A 1 18  ? 17.103  0.052   -11.721 1.00 0.00 ? 18  ASN A O    2  
ATOM   3415  C  CB   . ASN A 1 18  ? 17.622  -1.920  -13.751 1.00 0.00 ? 18  ASN A CB   2  
ATOM   3416  C  CG   . ASN A 1 18  ? 17.867  -0.621  -14.511 1.00 0.00 ? 18  ASN A CG   2  
ATOM   3417  O  OD1  . ASN A 1 18  ? 16.945  -0.075  -15.118 1.00 0.00 ? 18  ASN A OD1  2  
ATOM   3418  N  ND2  . ASN A 1 18  ? 19.059  -0.092  -14.515 1.00 0.00 ? 18  ASN A ND2  2  
ATOM   3419  H  H    . ASN A 1 18  ? 19.447  -3.534  -11.652 1.00 0.00 ? 18  ASN A H    2  
ATOM   3420  H  HA   . ASN A 1 18  ? 19.315  -1.419  -12.545 1.00 0.00 ? 18  ASN A HA   2  
ATOM   3421  H  HB2  . ASN A 1 18  ? 17.989  -2.753  -14.333 1.00 0.00 ? 18  ASN A HB2  2  
ATOM   3422  H  HB3  . ASN A 1 18  ? 16.563  -2.041  -13.580 1.00 0.00 ? 18  ASN A HB3  2  
ATOM   3423  H  HD21 . ASN A 1 18  ? 19.791  -0.529  -14.032 1.00 0.00 ? 18  ASN A HD21 2  
ATOM   3424  H  HD22 . ASN A 1 18  ? 19.223  0.742   -15.002 1.00 0.00 ? 18  ASN A HD22 2  
ATOM   3425  N  N    . GLU A 1 19  ? 17.352  -1.600  -10.213 1.00 0.00 ? 19  GLU A N    2  
ATOM   3426  C  CA   . GLU A 1 19  ? 16.596  -0.902  -9.177  1.00 0.00 ? 19  GLU A CA   2  
ATOM   3427  C  C    . GLU A 1 19  ? 15.270  -0.387  -9.730  1.00 0.00 ? 19  GLU A C    2  
ATOM   3428  O  O    . GLU A 1 19  ? 15.117  0.805   -9.996  1.00 0.00 ? 19  GLU A O    2  
ATOM   3429  C  CB   . GLU A 1 19  ? 17.414  0.272   -8.635  1.00 0.00 ? 19  GLU A CB   2  
ATOM   3430  C  CG   . GLU A 1 19  ? 18.508  -0.253  -7.704  1.00 0.00 ? 19  GLU A CG   2  
ATOM   3431  C  CD   . GLU A 1 19  ? 17.882  -0.830  -6.438  1.00 0.00 ? 19  GLU A CD   2  
ATOM   3432  O  OE1  . GLU A 1 19  ? 16.819  -0.364  -6.061  1.00 0.00 ? 19  GLU A OE1  2  
ATOM   3433  O  OE2  . GLU A 1 19  ? 18.474  -1.729  -5.864  1.00 0.00 ? 19  GLU A OE2  2  
ATOM   3434  H  H    . GLU A 1 19  ? 17.726  -2.485  -10.020 1.00 0.00 ? 19  GLU A H    2  
ATOM   3435  H  HA   . GLU A 1 19  ? 16.396  -1.588  -8.368  1.00 0.00 ? 19  GLU A HA   2  
ATOM   3436  H  HB2  . GLU A 1 19  ? 17.867  0.805   -9.460  1.00 0.00 ? 19  GLU A HB2  2  
ATOM   3437  H  HB3  . GLU A 1 19  ? 16.766  0.940   -8.086  1.00 0.00 ? 19  GLU A HB3  2  
ATOM   3438  H  HG2  . GLU A 1 19  ? 19.069  -1.026  -8.211  1.00 0.00 ? 19  GLU A HG2  2  
ATOM   3439  H  HG3  . GLU A 1 19  ? 19.170  0.558   -7.437  1.00 0.00 ? 19  GLU A HG3  2  
ATOM   3440  N  N    . PRO A 1 20  ? 14.316  -1.263  -9.900  1.00 0.00 ? 20  PRO A N    2  
ATOM   3441  C  CA   . PRO A 1 20  ? 12.973  -0.904  -10.428 1.00 0.00 ? 20  PRO A CA   2  
ATOM   3442  C  C    . PRO A 1 20  ? 12.053  -0.358  -9.336  1.00 0.00 ? 20  PRO A C    2  
ATOM   3443  O  O    . PRO A 1 20  ? 12.017  -0.882  -8.223  1.00 0.00 ? 20  PRO A O    2  
ATOM   3444  C  CB   . PRO A 1 20  ? 12.450  -2.231  -10.975 1.00 0.00 ? 20  PRO A CB   2  
ATOM   3445  C  CG   . PRO A 1 20  ? 13.109  -3.291  -10.149 1.00 0.00 ? 20  PRO A CG   2  
ATOM   3446  C  CD   . PRO A 1 20  ? 14.419  -2.700  -9.609  1.00 0.00 ? 20  PRO A CD   2  
ATOM   3447  H  HA   . PRO A 1 20  ? 13.063  -0.193  -11.233 1.00 0.00 ? 20  PRO A HA   2  
ATOM   3448  H  HB2  . PRO A 1 20  ? 11.375  -2.281  -10.866 1.00 0.00 ? 20  PRO A HB2  2  
ATOM   3449  H  HB3  . PRO A 1 20  ? 12.729  -2.344  -12.012 1.00 0.00 ? 20  PRO A HB3  2  
ATOM   3450  H  HG2  . PRO A 1 20  ? 12.463  -3.572  -9.328  1.00 0.00 ? 20  PRO A HG2  2  
ATOM   3451  H  HG3  . PRO A 1 20  ? 13.327  -4.154  -10.760 1.00 0.00 ? 20  PRO A HG3  2  
ATOM   3452  H  HD2  . PRO A 1 20  ? 14.496  -2.868  -8.544  1.00 0.00 ? 20  PRO A HD2  2  
ATOM   3453  H  HD3  . PRO A 1 20  ? 15.267  -3.124  -10.123 1.00 0.00 ? 20  PRO A HD3  2  
ATOM   3454  N  N    . TRP A 1 21  ? 11.316  0.699   -9.664  1.00 0.00 ? 21  TRP A N    2  
ATOM   3455  C  CA   . TRP A 1 21  ? 10.402  1.310   -8.704  1.00 0.00 ? 21  TRP A CA   2  
ATOM   3456  C  C    . TRP A 1 21  ? 9.142   0.465   -8.544  1.00 0.00 ? 21  TRP A C    2  
ATOM   3457  O  O    . TRP A 1 21  ? 9.187   -0.760  -8.652  1.00 0.00 ? 21  TRP A O    2  
ATOM   3458  C  CB   . TRP A 1 21  ? 10.017  2.714   -9.171  1.00 0.00 ? 21  TRP A CB   2  
ATOM   3459  C  CG   . TRP A 1 21  ? 11.244  3.450   -9.604  1.00 0.00 ? 21  TRP A CG   2  
ATOM   3460  C  CD1  . TRP A 1 21  ? 12.243  3.849   -8.783  1.00 0.00 ? 21  TRP A CD1  2  
ATOM   3461  C  CD2  . TRP A 1 21  ? 11.619  3.882   -10.944 1.00 0.00 ? 21  TRP A CD2  2  
ATOM   3462  N  NE1  . TRP A 1 21  ? 13.206  4.499   -9.534  1.00 0.00 ? 21  TRP A NE1  2  
ATOM   3463  C  CE2  . TRP A 1 21  ? 12.866  4.545   -10.872 1.00 0.00 ? 21  TRP A CE2  2  
ATOM   3464  C  CE3  . TRP A 1 21  ? 11.002  3.765   -12.204 1.00 0.00 ? 21  TRP A CE3  2  
ATOM   3465  C  CZ2  . TRP A 1 21  ? 13.482  5.072   -12.008 1.00 0.00 ? 21  TRP A CZ2  2  
ATOM   3466  C  CZ3  . TRP A 1 21  ? 11.619  4.295   -13.349 1.00 0.00 ? 21  TRP A CZ3  2  
ATOM   3467  C  CH2  . TRP A 1 21  ? 12.856  4.948   -13.251 1.00 0.00 ? 21  TRP A CH2  2  
ATOM   3468  H  H    . TRP A 1 21  ? 11.387  1.075   -10.566 1.00 0.00 ? 21  TRP A H    2  
ATOM   3469  H  HA   . TRP A 1 21  ? 10.897  1.385   -7.748  1.00 0.00 ? 21  TRP A HA   2  
ATOM   3470  H  HB2  . TRP A 1 21  ? 9.330   2.640   -10.001 1.00 0.00 ? 21  TRP A HB2  2  
ATOM   3471  H  HB3  . TRP A 1 21  ? 9.545   3.247   -8.359  1.00 0.00 ? 21  TRP A HB3  2  
ATOM   3472  H  HD1  . TRP A 1 21  ? 12.281  3.687   -7.715  1.00 0.00 ? 21  TRP A HD1  2  
ATOM   3473  H  HE1  . TRP A 1 21  ? 14.034  4.886   -9.179  1.00 0.00 ? 21  TRP A HE1  2  
ATOM   3474  H  HE3  . TRP A 1 21  ? 10.049  3.265   -12.290 1.00 0.00 ? 21  TRP A HE3  2  
ATOM   3475  H  HZ2  . TRP A 1 21  ? 14.435  5.574   -11.927 1.00 0.00 ? 21  TRP A HZ2  2  
ATOM   3476  H  HZ3  . TRP A 1 21  ? 11.137  4.200   -14.310 1.00 0.00 ? 21  TRP A HZ3  2  
ATOM   3477  H  HH2  . TRP A 1 21  ? 13.325  5.352   -14.135 1.00 0.00 ? 21  TRP A HH2  2  
ATOM   3478  N  N    . VAL A 1 22  ? 8.017   1.129   -8.285  1.00 0.00 ? 22  VAL A N    2  
ATOM   3479  C  CA   . VAL A 1 22  ? 6.748   0.428   -8.112  1.00 0.00 ? 22  VAL A CA   2  
ATOM   3480  C  C    . VAL A 1 22  ? 5.923   0.484   -9.395  1.00 0.00 ? 22  VAL A C    2  
ATOM   3481  O  O    . VAL A 1 22  ? 5.420   -0.536  -9.864  1.00 0.00 ? 22  VAL A O    2  
ATOM   3482  C  CB   . VAL A 1 22  ? 5.955   1.058   -6.964  1.00 0.00 ? 22  VAL A CB   2  
ATOM   3483  C  CG1  . VAL A 1 22  ? 4.715   0.209   -6.674  1.00 0.00 ? 22  VAL A CG1  2  
ATOM   3484  C  CG2  . VAL A 1 22  ? 6.833   1.118   -5.712  1.00 0.00 ? 22  VAL A CG2  2  
ATOM   3485  H  H    . VAL A 1 22  ? 8.042   2.105   -8.210  1.00 0.00 ? 22  VAL A H    2  
ATOM   3486  H  HA   . VAL A 1 22  ? 6.948   -0.606  -7.870  1.00 0.00 ? 22  VAL A HA   2  
ATOM   3487  H  HB   . VAL A 1 22  ? 5.650   2.056   -7.242  1.00 0.00 ? 22  VAL A HB   2  
ATOM   3488  H  HG11 . VAL A 1 22  ? 4.964   -0.837  -6.764  1.00 0.00 ? 22  VAL A HG11 2  
ATOM   3489  H  HG12 . VAL A 1 22  ? 3.937   0.455   -7.380  1.00 0.00 ? 22  VAL A HG12 2  
ATOM   3490  H  HG13 . VAL A 1 22  ? 4.367   0.411   -5.670  1.00 0.00 ? 22  VAL A HG13 2  
ATOM   3491  H  HG21 . VAL A 1 22  ? 7.494   1.971   -5.777  1.00 0.00 ? 22  VAL A HG21 2  
ATOM   3492  H  HG22 . VAL A 1 22  ? 7.419   0.214   -5.638  1.00 0.00 ? 22  VAL A HG22 2  
ATOM   3493  H  HG23 . VAL A 1 22  ? 6.206   1.214   -4.838  1.00 0.00 ? 22  VAL A HG23 2  
ATOM   3494  N  N    . ARG A 1 23  ? 5.790   1.680   -9.960  1.00 0.00 ? 23  ARG A N    2  
ATOM   3495  C  CA   . ARG A 1 23  ? 5.025   1.848   -11.191 1.00 0.00 ? 23  ARG A CA   2  
ATOM   3496  C  C    . ARG A 1 23  ? 5.533   0.892   -12.266 1.00 0.00 ? 23  ARG A C    2  
ATOM   3497  O  O    . ARG A 1 23  ? 6.663   1.019   -12.738 1.00 0.00 ? 23  ARG A O    2  
ATOM   3498  C  CB   . ARG A 1 23  ? 5.146   3.290   -11.691 1.00 0.00 ? 23  ARG A CB   2  
ATOM   3499  C  CG   . ARG A 1 23  ? 4.073   3.561   -12.750 1.00 0.00 ? 23  ARG A CG   2  
ATOM   3500  C  CD   . ARG A 1 23  ? 2.788   4.039   -12.071 1.00 0.00 ? 23  ARG A CD   2  
ATOM   3501  N  NE   . ARG A 1 23  ? 1.654   3.889   -12.975 1.00 0.00 ? 23  ARG A NE   2  
ATOM   3502  C  CZ   . ARG A 1 23  ? 1.368   4.821   -13.878 1.00 0.00 ? 23  ARG A CZ   2  
ATOM   3503  N  NH1  . ARG A 1 23  ? 2.111   5.890   -13.973 1.00 0.00 ? 23  ARG A NH1  2  
ATOM   3504  N  NH2  . ARG A 1 23  ? 0.344   4.666   -14.674 1.00 0.00 ? 23  ARG A NH2  2  
ATOM   3505  H  H    . ARG A 1 23  ? 6.213   2.460   -9.545  1.00 0.00 ? 23  ARG A H    2  
ATOM   3506  H  HA   . ARG A 1 23  ? 3.986   1.633   -10.991 1.00 0.00 ? 23  ARG A HA   2  
ATOM   3507  H  HB2  . ARG A 1 23  ? 5.015   3.970   -10.861 1.00 0.00 ? 23  ARG A HB2  2  
ATOM   3508  H  HB3  . ARG A 1 23  ? 6.123   3.438   -12.126 1.00 0.00 ? 23  ARG A HB3  2  
ATOM   3509  H  HG2  . ARG A 1 23  ? 4.425   4.322   -13.431 1.00 0.00 ? 23  ARG A HG2  2  
ATOM   3510  H  HG3  . ARG A 1 23  ? 3.870   2.653   -13.300 1.00 0.00 ? 23  ARG A HG3  2  
ATOM   3511  H  HD2  . ARG A 1 23  ? 2.614   3.454   -11.182 1.00 0.00 ? 23  ARG A HD2  2  
ATOM   3512  H  HD3  . ARG A 1 23  ? 2.896   5.079   -11.798 1.00 0.00 ? 23  ARG A HD3  2  
ATOM   3513  H  HE   . ARG A 1 23  ? 1.092   3.088   -12.914 1.00 0.00 ? 23  ARG A HE   2  
ATOM   3514  H  HH11 . ARG A 1 23  ? 2.897   6.007   -13.365 1.00 0.00 ? 23  ARG A HH11 2  
ATOM   3515  H  HH12 . ARG A 1 23  ? 1.895   6.591   -14.652 1.00 0.00 ? 23  ARG A HH12 2  
ATOM   3516  H  HH21 . ARG A 1 23  ? -0.224  3.847   -14.603 1.00 0.00 ? 23  ARG A HH21 2  
ATOM   3517  H  HH22 . ARG A 1 23  ? 0.129   5.368   -15.353 1.00 0.00 ? 23  ARG A HH22 2  
ATOM   3518  N  N    . GLY A 1 24  ? 4.694   -0.066  -12.647 1.00 0.00 ? 24  GLY A N    2  
ATOM   3519  C  CA   . GLY A 1 24  ? 5.074   -1.038  -13.665 1.00 0.00 ? 24  GLY A CA   2  
ATOM   3520  C  C    . GLY A 1 24  ? 3.861   -1.481  -14.477 1.00 0.00 ? 24  GLY A C    2  
ATOM   3521  O  O    . GLY A 1 24  ? 2.784   -0.894  -14.374 1.00 0.00 ? 24  GLY A O    2  
ATOM   3522  H  H    . GLY A 1 24  ? 3.806   -0.119  -12.236 1.00 0.00 ? 24  GLY A H    2  
ATOM   3523  H  HA2  . GLY A 1 24  ? 5.802   -0.592  -14.327 1.00 0.00 ? 24  GLY A HA2  2  
ATOM   3524  H  HA3  . GLY A 1 24  ? 5.510   -1.901  -13.186 1.00 0.00 ? 24  GLY A HA3  2  
ATOM   3525  N  N    . ARG A 1 25  ? 4.043   -2.522  -15.284 1.00 0.00 ? 25  ARG A N    2  
ATOM   3526  C  CA   . ARG A 1 25  ? 2.958   -3.039  -16.112 1.00 0.00 ? 25  ARG A CA   2  
ATOM   3527  C  C    . ARG A 1 25  ? 2.342   -4.281  -15.476 1.00 0.00 ? 25  ARG A C    2  
ATOM   3528  O  O    . ARG A 1 25  ? 1.637   -4.189  -14.471 1.00 0.00 ? 25  ARG A O    2  
ATOM   3529  C  CB   . ARG A 1 25  ? 3.486   -3.383  -17.506 1.00 0.00 ? 25  ARG A CB   2  
ATOM   3530  C  CG   . ARG A 1 25  ? 3.906   -2.098  -18.222 1.00 0.00 ? 25  ARG A CG   2  
ATOM   3531  C  CD   . ARG A 1 25  ? 4.049   -2.370  -19.720 1.00 0.00 ? 25  ARG A CD   2  
ATOM   3532  N  NE   . ARG A 1 25  ? 4.829   -1.311  -20.352 1.00 0.00 ? 25  ARG A NE   2  
ATOM   3533  C  CZ   . ARG A 1 25  ? 4.343   -0.080  -20.472 1.00 0.00 ? 25  ARG A CZ   2  
ATOM   3534  N  NH1  . ARG A 1 25  ? 3.148   0.197   -20.026 1.00 0.00 ? 25  ARG A NH1  2  
ATOM   3535  N  NH2  . ARG A 1 25  ? 5.060   0.853   -21.038 1.00 0.00 ? 25  ARG A NH2  2  
ATOM   3536  H  H    . ARG A 1 25  ? 4.925   -2.950  -15.325 1.00 0.00 ? 25  ARG A H    2  
ATOM   3537  H  HA   . ARG A 1 25  ? 2.195   -2.280  -16.208 1.00 0.00 ? 25  ARG A HA   2  
ATOM   3538  H  HB2  . ARG A 1 25  ? 4.338   -4.042  -17.416 1.00 0.00 ? 25  ARG A HB2  2  
ATOM   3539  H  HB3  . ARG A 1 25  ? 2.710   -3.873  -18.074 1.00 0.00 ? 25  ARG A HB3  2  
ATOM   3540  H  HG2  . ARG A 1 25  ? 3.155   -1.338  -18.063 1.00 0.00 ? 25  ARG A HG2  2  
ATOM   3541  H  HG3  . ARG A 1 25  ? 4.851   -1.759  -17.828 1.00 0.00 ? 25  ARG A HG3  2  
ATOM   3542  H  HD2  . ARG A 1 25  ? 4.548   -3.316  -19.868 1.00 0.00 ? 25  ARG A HD2  2  
ATOM   3543  H  HD3  . ARG A 1 25  ? 3.067   -2.412  -20.170 1.00 0.00 ? 25  ARG A HD3  2  
ATOM   3544  H  HE   . ARG A 1 25  ? 5.725   -1.510  -20.692 1.00 0.00 ? 25  ARG A HE   2  
ATOM   3545  H  HH11 . ARG A 1 25  ? 2.598   -0.517  -19.593 1.00 0.00 ? 25  ARG A HH11 2  
ATOM   3546  H  HH12 . ARG A 1 25  ? 2.783   1.124   -20.118 1.00 0.00 ? 25  ARG A HH12 2  
ATOM   3547  H  HH21 . ARG A 1 25  ? 5.975   0.642   -21.380 1.00 0.00 ? 25  ARG A HH21 2  
ATOM   3548  H  HH22 . ARG A 1 25  ? 4.693   1.779   -21.128 1.00 0.00 ? 25  ARG A HH22 2  
ATOM   3549  N  N    . HIS A 1 26  ? 2.612   -5.440  -16.066 1.00 0.00 ? 26  HIS A N    2  
ATOM   3550  C  CA   . HIS A 1 26  ? 2.075   -6.692  -15.546 1.00 0.00 ? 26  HIS A CA   2  
ATOM   3551  C  C    . HIS A 1 26  ? 2.850   -7.135  -14.307 1.00 0.00 ? 26  HIS A C    2  
ATOM   3552  O  O    . HIS A 1 26  ? 2.377   -7.966  -13.531 1.00 0.00 ? 26  HIS A O    2  
ATOM   3553  C  CB   . HIS A 1 26  ? 2.158   -7.785  -16.613 1.00 0.00 ? 26  HIS A CB   2  
ATOM   3554  C  CG   . HIS A 1 26  ? 1.907   -7.190  -17.972 1.00 0.00 ? 26  HIS A CG   2  
ATOM   3555  N  ND1  . HIS A 1 26  ? 1.297   -5.957  -18.139 1.00 0.00 ? 26  HIS A ND1  2  
ATOM   3556  C  CD2  . HIS A 1 26  ? 2.176   -7.650  -19.237 1.00 0.00 ? 26  HIS A CD2  2  
ATOM   3557  C  CE1  . HIS A 1 26  ? 1.218   -5.720  -19.462 1.00 0.00 ? 26  HIS A CE1  2  
ATOM   3558  N  NE2  . HIS A 1 26  ? 1.739   -6.720  -20.177 1.00 0.00 ? 26  HIS A NE2  2  
ATOM   3559  H  H    . HIS A 1 26  ? 3.179   -5.455  -16.866 1.00 0.00 ? 26  HIS A H    2  
ATOM   3560  H  HA   . HIS A 1 26  ? 1.039   -6.545  -15.277 1.00 0.00 ? 26  HIS A HA   2  
ATOM   3561  H  HB2  . HIS A 1 26  ? 3.142   -8.232  -16.595 1.00 0.00 ? 26  HIS A HB2  2  
ATOM   3562  H  HB3  . HIS A 1 26  ? 1.416   -8.543  -16.411 1.00 0.00 ? 26  HIS A HB3  2  
ATOM   3563  H  HD1  . HIS A 1 26  ? 0.980   -5.365  -17.425 1.00 0.00 ? 26  HIS A HD1  2  
ATOM   3564  H  HD2  . HIS A 1 26  ? 2.653   -8.590  -19.469 1.00 0.00 ? 26  HIS A HD2  2  
ATOM   3565  H  HE1  . HIS A 1 26  ? 0.786   -4.829  -19.893 1.00 0.00 ? 26  HIS A HE1  2  
ATOM   3566  H  HE2  . HIS A 1 26  ? 1.802   -6.785  -21.152 1.00 0.00 ? 26  HIS A HE2  2  
ATOM   3567  N  N    . GLU A 1 27  ? 4.044   -6.577  -14.130 1.00 0.00 ? 27  GLU A N    2  
ATOM   3568  C  CA   . GLU A 1 27  ? 4.881   -6.926  -12.986 1.00 0.00 ? 27  GLU A CA   2  
ATOM   3569  C  C    . GLU A 1 27  ? 4.696   -5.924  -11.851 1.00 0.00 ? 27  GLU A C    2  
ATOM   3570  O  O    . GLU A 1 27  ? 5.419   -4.932  -11.760 1.00 0.00 ? 27  GLU A O    2  
ATOM   3571  C  CB   . GLU A 1 27  ? 6.350   -6.956  -13.405 1.00 0.00 ? 27  GLU A CB   2  
ATOM   3572  C  CG   . GLU A 1 27  ? 6.527   -7.922  -14.580 1.00 0.00 ? 27  GLU A CG   2  
ATOM   3573  C  CD   . GLU A 1 27  ? 6.531   -9.361  -14.075 1.00 0.00 ? 27  GLU A CD   2  
ATOM   3574  O  OE1  . GLU A 1 27  ? 6.322   -9.552  -12.888 1.00 0.00 ? 27  GLU A OE1  2  
ATOM   3575  O  OE2  . GLU A 1 27  ? 6.743   -10.250 -14.883 1.00 0.00 ? 27  GLU A OE2  2  
ATOM   3576  H  H    . GLU A 1 27  ? 4.371   -5.924  -14.783 1.00 0.00 ? 27  GLU A H    2  
ATOM   3577  H  HA   . GLU A 1 27  ? 4.601   -7.908  -12.634 1.00 0.00 ? 27  GLU A HA   2  
ATOM   3578  H  HB2  . GLU A 1 27  ? 6.659   -5.965  -13.704 1.00 0.00 ? 27  GLU A HB2  2  
ATOM   3579  H  HB3  . GLU A 1 27  ? 6.955   -7.288  -12.576 1.00 0.00 ? 27  GLU A HB3  2  
ATOM   3580  H  HG2  . GLU A 1 27  ? 5.712   -7.789  -15.277 1.00 0.00 ? 27  GLU A HG2  2  
ATOM   3581  H  HG3  . GLU A 1 27  ? 7.462   -7.714  -15.076 1.00 0.00 ? 27  GLU A HG3  2  
ATOM   3582  N  N    . THR A 1 28  ? 3.728   -6.198  -10.982 1.00 0.00 ? 28  THR A N    2  
ATOM   3583  C  CA   . THR A 1 28  ? 3.456   -5.322  -9.848  1.00 0.00 ? 28  THR A CA   2  
ATOM   3584  C  C    . THR A 1 28  ? 4.428   -5.625  -8.709  1.00 0.00 ? 28  THR A C    2  
ATOM   3585  O  O    . THR A 1 28  ? 5.170   -6.606  -8.763  1.00 0.00 ? 28  THR A O    2  
ATOM   3586  C  CB   . THR A 1 28  ? 2.010   -5.527  -9.370  1.00 0.00 ? 28  THR A CB   2  
ATOM   3587  O  OG1  . THR A 1 28  ? 1.220   -5.972  -10.464 1.00 0.00 ? 28  THR A OG1  2  
ATOM   3588  C  CG2  . THR A 1 28  ? 1.440   -4.213  -8.832  1.00 0.00 ? 28  THR A CG2  2  
ATOM   3589  H  H    . THR A 1 28  ? 3.188   -7.007  -11.104 1.00 0.00 ? 28  THR A H    2  
ATOM   3590  H  HA   . THR A 1 28  ? 3.585   -4.295  -10.157 1.00 0.00 ? 28  THR A HA   2  
ATOM   3591  H  HB   . THR A 1 28  ? 1.988   -6.272  -8.588  1.00 0.00 ? 28  THR A HB   2  
ATOM   3592  H  HG1  . THR A 1 28  ? 1.814   -6.300  -11.143 1.00 0.00 ? 28  THR A HG1  2  
ATOM   3593  H  HG21 . THR A 1 28  ? 2.217   -3.664  -8.320  1.00 0.00 ? 28  THR A HG21 2  
ATOM   3594  H  HG22 . THR A 1 28  ? 0.636   -4.425  -8.144  1.00 0.00 ? 28  THR A HG22 2  
ATOM   3595  H  HG23 . THR A 1 28  ? 1.064   -3.620  -9.653  1.00 0.00 ? 28  THR A HG23 2  
ATOM   3596  N  N    . TYR A 1 29  ? 4.422   -4.783  -7.679  1.00 0.00 ? 29  TYR A N    2  
ATOM   3597  C  CA   . TYR A 1 29  ? 5.314   -4.987  -6.543  1.00 0.00 ? 29  TYR A CA   2  
ATOM   3598  C  C    . TYR A 1 29  ? 4.946   -4.060  -5.389  1.00 0.00 ? 29  TYR A C    2  
ATOM   3599  O  O    . TYR A 1 29  ? 5.031   -2.838  -5.508  1.00 0.00 ? 29  TYR A O    2  
ATOM   3600  C  CB   . TYR A 1 29  ? 6.762   -4.732  -6.964  1.00 0.00 ? 29  TYR A CB   2  
ATOM   3601  C  CG   . TYR A 1 29  ? 7.689   -5.186  -5.864  1.00 0.00 ? 29  TYR A CG   2  
ATOM   3602  C  CD1  . TYR A 1 29  ? 7.990   -6.545  -5.723  1.00 0.00 ? 29  TYR A CD1  2  
ATOM   3603  C  CD2  . TYR A 1 29  ? 8.246   -4.250  -4.984  1.00 0.00 ? 29  TYR A CD2  2  
ATOM   3604  C  CE1  . TYR A 1 29  ? 8.848   -6.969  -4.702  1.00 0.00 ? 29  TYR A CE1  2  
ATOM   3605  C  CE2  . TYR A 1 29  ? 9.105   -4.675  -3.964  1.00 0.00 ? 29  TYR A CE2  2  
ATOM   3606  C  CZ   . TYR A 1 29  ? 9.405   -6.034  -3.823  1.00 0.00 ? 29  TYR A CZ   2  
ATOM   3607  O  OH   . TYR A 1 29  ? 10.252  -6.453  -2.817  1.00 0.00 ? 29  TYR A OH   2  
ATOM   3608  H  H    . TYR A 1 29  ? 3.812   -4.017  -7.684  1.00 0.00 ? 29  TYR A H    2  
ATOM   3609  H  HA   . TYR A 1 29  ? 5.227   -6.010  -6.210  1.00 0.00 ? 29  TYR A HA   2  
ATOM   3610  H  HB2  . TYR A 1 29  ? 6.976   -5.283  -7.867  1.00 0.00 ? 29  TYR A HB2  2  
ATOM   3611  H  HB3  . TYR A 1 29  ? 6.904   -3.677  -7.143  1.00 0.00 ? 29  TYR A HB3  2  
ATOM   3612  H  HD1  . TYR A 1 29  ? 7.559   -7.266  -6.402  1.00 0.00 ? 29  TYR A HD1  2  
ATOM   3613  H  HD2  . TYR A 1 29  ? 8.014   -3.201  -5.094  1.00 0.00 ? 29  TYR A HD2  2  
ATOM   3614  H  HE1  . TYR A 1 29  ? 9.079   -8.019  -4.594  1.00 0.00 ? 29  TYR A HE1  2  
ATOM   3615  H  HE2  . TYR A 1 29  ? 9.535   -3.953  -3.284  1.00 0.00 ? 29  TYR A HE2  2  
ATOM   3616  H  HH   . TYR A 1 29  ? 9.712   -6.758  -2.083  1.00 0.00 ? 29  TYR A HH   2  
ATOM   3617  N  N    . LEU A 1 30  ? 4.542   -4.655  -4.270  1.00 0.00 ? 30  LEU A N    2  
ATOM   3618  C  CA   . LEU A 1 30  ? 4.163   -3.883  -3.090  1.00 0.00 ? 30  LEU A CA   2  
ATOM   3619  C  C    . LEU A 1 30  ? 3.844   -4.820  -1.932  1.00 0.00 ? 30  LEU A C    2  
ATOM   3620  O  O    . LEU A 1 30  ? 3.596   -6.005  -2.142  1.00 0.00 ? 30  LEU A O    2  
ATOM   3621  C  CB   . LEU A 1 30  ? 2.938   -3.016  -3.400  1.00 0.00 ? 30  LEU A CB   2  
ATOM   3622  C  CG   . LEU A 1 30  ? 1.685   -3.897  -3.569  1.00 0.00 ? 30  LEU A CG   2  
ATOM   3623  C  CD1  . LEU A 1 30  ? 0.851   -3.883  -2.283  1.00 0.00 ? 30  LEU A CD1  2  
ATOM   3624  C  CD2  . LEU A 1 30  ? 0.831   -3.348  -4.713  1.00 0.00 ? 30  LEU A CD2  2  
ATOM   3625  H  H    . LEU A 1 30  ? 4.499   -5.634  -4.237  1.00 0.00 ? 30  LEU A H    2  
ATOM   3626  H  HA   . LEU A 1 30  ? 4.984   -3.241  -2.809  1.00 0.00 ? 30  LEU A HA   2  
ATOM   3627  H  HB2  . LEU A 1 30  ? 2.783   -2.321  -2.594  1.00 0.00 ? 30  LEU A HB2  2  
ATOM   3628  H  HB3  . LEU A 1 30  ? 3.117   -2.466  -4.312  1.00 0.00 ? 30  LEU A HB3  2  
ATOM   3629  H  HG   . LEU A 1 30  ? 1.980   -4.913  -3.797  1.00 0.00 ? 30  LEU A HG   2  
ATOM   3630  H  HD11 . LEU A 1 30  ? -0.078  -4.408  -2.451  1.00 0.00 ? 30  LEU A HD11 2  
ATOM   3631  H  HD12 . LEU A 1 30  ? 0.639   -2.860  -2.004  1.00 0.00 ? 30  LEU A HD12 2  
ATOM   3632  H  HD13 . LEU A 1 30  ? 1.397   -4.365  -1.488  1.00 0.00 ? 30  LEU A HD13 2  
ATOM   3633  H  HD21 . LEU A 1 30  ? 1.295   -3.592  -5.656  1.00 0.00 ? 30  LEU A HD21 2  
ATOM   3634  H  HD22 . LEU A 1 30  ? 0.753   -2.275  -4.616  1.00 0.00 ? 30  LEU A HD22 2  
ATOM   3635  H  HD23 . LEU A 1 30  ? -0.153  -3.787  -4.668  1.00 0.00 ? 30  LEU A HD23 2  
ATOM   3636  N  N    . CYS A 1 31  ? 3.841   -4.289  -0.709  1.00 0.00 ? 31  CYS A N    2  
ATOM   3637  C  CA   . CYS A 1 31  ? 3.535   -5.110  0.461   1.00 0.00 ? 31  CYS A CA   2  
ATOM   3638  C  C    . CYS A 1 31  ? 2.241   -4.629  1.105   1.00 0.00 ? 31  CYS A C    2  
ATOM   3639  O  O    . CYS A 1 31  ? 1.937   -3.436  1.086   1.00 0.00 ? 31  CYS A O    2  
ATOM   3640  C  CB   . CYS A 1 31  ? 4.695   -5.056  1.472   1.00 0.00 ? 31  CYS A CB   2  
ATOM   3641  S  SG   . CYS A 1 31  ? 5.987   -3.946  0.857   1.00 0.00 ? 31  CYS A SG   2  
ATOM   3642  H  H    . CYS A 1 31  ? 4.037   -3.333  -0.591  1.00 0.00 ? 31  CYS A H    2  
ATOM   3643  H  HA   . CYS A 1 31  ? 3.403   -6.132  0.146   1.00 0.00 ? 31  CYS A HA   2  
ATOM   3644  H  HB2  . CYS A 1 31  ? 4.338   -4.695  2.427   1.00 0.00 ? 31  CYS A HB2  2  
ATOM   3645  H  HB3  . CYS A 1 31  ? 5.107   -6.052  1.598   1.00 0.00 ? 31  CYS A HB3  2  
ATOM   3646  H  HG   . CYS A 1 31  ? 5.873   -3.094  1.286   1.00 0.00 ? 31  CYS A HG   2  
ATOM   3647  N  N    . TYR A 1 32  ? 1.478   -5.555  1.677   1.00 0.00 ? 32  TYR A N    2  
ATOM   3648  C  CA   . TYR A 1 32  ? 0.223   -5.186  2.316   1.00 0.00 ? 32  TYR A CA   2  
ATOM   3649  C  C    . TYR A 1 32  ? 0.005   -6.051  3.545   1.00 0.00 ? 32  TYR A C    2  
ATOM   3650  O  O    . TYR A 1 32  ? 0.141   -7.274  3.500   1.00 0.00 ? 32  TYR A O    2  
ATOM   3651  C  CB   . TYR A 1 32  ? -0.938  -5.312  1.307   1.00 0.00 ? 32  TYR A CB   2  
ATOM   3652  C  CG   . TYR A 1 32  ? -1.910  -6.404  1.706   1.00 0.00 ? 32  TYR A CG   2  
ATOM   3653  C  CD1  . TYR A 1 32  ? -1.575  -7.748  1.512   1.00 0.00 ? 32  TYR A CD1  2  
ATOM   3654  C  CD2  . TYR A 1 32  ? -3.150  -6.067  2.251   1.00 0.00 ? 32  TYR A CD2  2  
ATOM   3655  C  CE1  . TYR A 1 32  ? -2.474  -8.753  1.864   1.00 0.00 ? 32  TYR A CE1  2  
ATOM   3656  C  CE2  . TYR A 1 32  ? -4.057  -7.075  2.600   1.00 0.00 ? 32  TYR A CE2  2  
ATOM   3657  C  CZ   . TYR A 1 32  ? -3.716  -8.420  2.404   1.00 0.00 ? 32  TYR A CZ   2  
ATOM   3658  O  OH   . TYR A 1 32  ? -4.604  -9.415  2.740   1.00 0.00 ? 32  TYR A OH   2  
ATOM   3659  H  H    . TYR A 1 32  ? 1.763   -6.500  1.676   1.00 0.00 ? 32  TYR A H    2  
ATOM   3660  H  HA   . TYR A 1 32  ? 0.290   -4.153  2.640   1.00 0.00 ? 32  TYR A HA   2  
ATOM   3661  H  HB2  . TYR A 1 32  ? -1.470  -4.373  1.256   1.00 0.00 ? 32  TYR A HB2  2  
ATOM   3662  H  HB3  . TYR A 1 32  ? -0.532  -5.539  0.332   1.00 0.00 ? 32  TYR A HB3  2  
ATOM   3663  H  HD1  . TYR A 1 32  ? -0.620  -8.007  1.102   1.00 0.00 ? 32  TYR A HD1  2  
ATOM   3664  H  HD2  . TYR A 1 32  ? -3.408  -5.029  2.403   1.00 0.00 ? 32  TYR A HD2  2  
ATOM   3665  H  HE1  . TYR A 1 32  ? -2.212  -9.789  1.713   1.00 0.00 ? 32  TYR A HE1  2  
ATOM   3666  H  HE2  . TYR A 1 32  ? -5.015  -6.816  3.025   1.00 0.00 ? 32  TYR A HE2  2  
ATOM   3667  H  HH   . TYR A 1 32  ? -4.106  -10.141 3.122   1.00 0.00 ? 32  TYR A HH   2  
ATOM   3668  N  N    . GLU A 1 33  ? -0.307  -5.394  4.644   1.00 0.00 ? 33  GLU A N    2  
ATOM   3669  C  CA   . GLU A 1 33  ? -0.516  -6.071  5.904   1.00 0.00 ? 33  GLU A CA   2  
ATOM   3670  C  C    . GLU A 1 33  ? -1.924  -5.816  6.424   1.00 0.00 ? 33  GLU A C    2  
ATOM   3671  O  O    . GLU A 1 33  ? -2.372  -4.674  6.506   1.00 0.00 ? 33  GLU A O    2  
ATOM   3672  C  CB   . GLU A 1 33  ? 0.533   -5.556  6.883   1.00 0.00 ? 33  GLU A CB   2  
ATOM   3673  C  CG   . GLU A 1 33  ? 1.898   -6.100  6.458   1.00 0.00 ? 33  GLU A CG   2  
ATOM   3674  C  CD   . GLU A 1 33  ? 2.928   -5.851  7.554   1.00 0.00 ? 33  GLU A CD   2  
ATOM   3675  O  OE1  . GLU A 1 33  ? 2.641   -6.176  8.694   1.00 0.00 ? 33  GLU A OE1  2  
ATOM   3676  O  OE2  . GLU A 1 33  ? 3.989   -5.339  7.236   1.00 0.00 ? 33  GLU A OE2  2  
ATOM   3677  H  H    . GLU A 1 33  ? -0.376  -4.421  4.613   1.00 0.00 ? 33  GLU A H    2  
ATOM   3678  H  HA   . GLU A 1 33  ? -0.381  -7.134  5.771   1.00 0.00 ? 33  GLU A HA   2  
ATOM   3679  H  HB2  . GLU A 1 33  ? 0.554   -4.479  6.851   1.00 0.00 ? 33  GLU A HB2  2  
ATOM   3680  H  HB3  . GLU A 1 33  ? 0.301   -5.878  7.878   1.00 0.00 ? 33  GLU A HB3  2  
ATOM   3681  H  HG2  . GLU A 1 33  ? 1.818   -7.161  6.269   1.00 0.00 ? 33  GLU A HG2  2  
ATOM   3682  H  HG3  . GLU A 1 33  ? 2.210   -5.600  5.550   1.00 0.00 ? 33  GLU A HG3  2  
ATOM   3683  N  N    . VAL A 1 34  ? -2.623  -6.893  6.757   1.00 0.00 ? 34  VAL A N    2  
ATOM   3684  C  CA   . VAL A 1 34  ? -3.986  -6.777  7.251   1.00 0.00 ? 34  VAL A CA   2  
ATOM   3685  C  C    . VAL A 1 34  ? -4.268  -7.807  8.329   1.00 0.00 ? 34  VAL A C    2  
ATOM   3686  O  O    . VAL A 1 34  ? -3.682  -8.889  8.339   1.00 0.00 ? 34  VAL A O    2  
ATOM   3687  C  CB   . VAL A 1 34  ? -4.975  -6.977  6.109   1.00 0.00 ? 34  VAL A CB   2  
ATOM   3688  C  CG1  . VAL A 1 34  ? -4.672  -8.282  5.368   1.00 0.00 ? 34  VAL A CG1  2  
ATOM   3689  C  CG2  . VAL A 1 34  ? -6.398  -7.021  6.678   1.00 0.00 ? 34  VAL A CG2  2  
ATOM   3690  H  H    . VAL A 1 34  ? -2.219  -7.780  6.660   1.00 0.00 ? 34  VAL A H    2  
ATOM   3691  H  HA   . VAL A 1 34  ? -4.133  -5.789  7.661   1.00 0.00 ? 34  VAL A HA   2  
ATOM   3692  H  HB   . VAL A 1 34  ? -4.883  -6.162  5.422   1.00 0.00 ? 34  VAL A HB   2  
ATOM   3693  H  HG11 . VAL A 1 34  ? -4.705  -9.109  6.059   1.00 0.00 ? 34  VAL A HG11 2  
ATOM   3694  H  HG12 . VAL A 1 34  ? -3.689  -8.224  4.922   1.00 0.00 ? 34  VAL A HG12 2  
ATOM   3695  H  HG13 . VAL A 1 34  ? -5.410  -8.429  4.593   1.00 0.00 ? 34  VAL A HG13 2  
ATOM   3696  H  HG21 . VAL A 1 34  ? -6.483  -6.320  7.499   1.00 0.00 ? 34  VAL A HG21 2  
ATOM   3697  H  HG22 . VAL A 1 34  ? -6.614  -8.017  7.037   1.00 0.00 ? 34  VAL A HG22 2  
ATOM   3698  H  HG23 . VAL A 1 34  ? -7.104  -6.755  5.906   1.00 0.00 ? 34  VAL A HG23 2  
ATOM   3699  N  N    . GLU A 1 35  ? -5.187  -7.471  9.227   1.00 0.00 ? 35  GLU A N    2  
ATOM   3700  C  CA   . GLU A 1 35  ? -5.561  -8.385  10.295  1.00 0.00 ? 35  GLU A CA   2  
ATOM   3701  C  C    . GLU A 1 35  ? -7.078  -8.444  10.421  1.00 0.00 ? 35  GLU A C    2  
ATOM   3702  O  O    . GLU A 1 35  ? -7.783  -7.519  10.015  1.00 0.00 ? 35  GLU A O    2  
ATOM   3703  C  CB   . GLU A 1 35  ? -4.927  -7.947  11.623  1.00 0.00 ? 35  GLU A CB   2  
ATOM   3704  C  CG   . GLU A 1 35  ? -5.801  -6.888  12.298  1.00 0.00 ? 35  GLU A CG   2  
ATOM   3705  C  CD   . GLU A 1 35  ? -4.952  -6.024  13.223  1.00 0.00 ? 35  GLU A CD   2  
ATOM   3706  O  OE1  . GLU A 1 35  ? -4.228  -5.182  12.716  1.00 0.00 ? 35  GLU A OE1  2  
ATOM   3707  O  OE2  . GLU A 1 35  ? -5.040  -6.216  14.425  1.00 0.00 ? 35  GLU A OE2  2  
ATOM   3708  H  H    . GLU A 1 35  ? -5.631  -6.597  9.160   1.00 0.00 ? 35  GLU A H    2  
ATOM   3709  H  HA   . GLU A 1 35  ? -5.202  -9.372  10.047  1.00 0.00 ? 35  GLU A HA   2  
ATOM   3710  H  HB2  . GLU A 1 35  ? -4.833  -8.805  12.274  1.00 0.00 ? 35  GLU A HB2  2  
ATOM   3711  H  HB3  . GLU A 1 35  ? -3.947  -7.535  11.433  1.00 0.00 ? 35  GLU A HB3  2  
ATOM   3712  H  HG2  . GLU A 1 35  ? -6.255  -6.268  11.541  1.00 0.00 ? 35  GLU A HG2  2  
ATOM   3713  H  HG3  . GLU A 1 35  ? -6.573  -7.376  12.873  1.00 0.00 ? 35  GLU A HG3  2  
ATOM   3714  N  N    . ARG A 1 36  ? -7.572  -9.540  10.980  1.00 0.00 ? 36  ARG A N    2  
ATOM   3715  C  CA   . ARG A 1 36  ? -9.006  -9.718  11.147  1.00 0.00 ? 36  ARG A CA   2  
ATOM   3716  C  C    . ARG A 1 36  ? -9.407  -9.505  12.599  1.00 0.00 ? 36  ARG A C    2  
ATOM   3717  O  O    . ARG A 1 36  ? -8.654  -9.822  13.521  1.00 0.00 ? 36  ARG A O    2  
ATOM   3718  C  CB   . ARG A 1 36  ? -9.403  -11.130 10.712  1.00 0.00 ? 36  ARG A CB   2  
ATOM   3719  C  CG   . ARG A 1 36  ? -8.291  -12.111 11.087  1.00 0.00 ? 36  ARG A CG   2  
ATOM   3720  C  CD   . ARG A 1 36  ? -8.751  -13.538 10.785  1.00 0.00 ? 36  ARG A CD   2  
ATOM   3721  N  NE   . ARG A 1 36  ? -7.918  -14.502 11.496  1.00 0.00 ? 36  ARG A NE   2  
ATOM   3722  C  CZ   . ARG A 1 36  ? -8.250  -14.938 12.709  1.00 0.00 ? 36  ARG A CZ   2  
ATOM   3723  N  NH1  . ARG A 1 36  ? -9.323  -14.486 13.298  1.00 0.00 ? 36  ARG A NH1  2  
ATOM   3724  N  NH2  . ARG A 1 36  ? -7.496  -15.817 13.311  1.00 0.00 ? 36  ARG A NH2  2  
ATOM   3725  H  H    . ARG A 1 36  ? -6.964  -10.244 11.281  1.00 0.00 ? 36  ARG A H    2  
ATOM   3726  H  HA   . ARG A 1 36  ? -9.531  -9.004  10.529  1.00 0.00 ? 36  ARG A HA   2  
ATOM   3727  H  HB2  . ARG A 1 36  ? -10.319 -11.416 11.209  1.00 0.00 ? 36  ARG A HB2  2  
ATOM   3728  H  HB3  . ARG A 1 36  ? -9.551  -11.149 9.642   1.00 0.00 ? 36  ARG A HB3  2  
ATOM   3729  H  HG2  . ARG A 1 36  ? -7.404  -11.887 10.511  1.00 0.00 ? 36  ARG A HG2  2  
ATOM   3730  H  HG3  . ARG A 1 36  ? -8.070  -12.021 12.140  1.00 0.00 ? 36  ARG A HG3  2  
ATOM   3731  H  HD2  . ARG A 1 36  ? -9.778  -13.656 11.097  1.00 0.00 ? 36  ARG A HD2  2  
ATOM   3732  H  HD3  . ARG A 1 36  ? -8.679  -13.717 9.722   1.00 0.00 ? 36  ARG A HD3  2  
ATOM   3733  H  HE   . ARG A 1 36  ? -7.104  -14.840 11.070  1.00 0.00 ? 36  ARG A HE   2  
ATOM   3734  H  HH11 . ARG A 1 36  ? -9.899  -13.809 12.840  1.00 0.00 ? 36  ARG A HH11 2  
ATOM   3735  H  HH12 . ARG A 1 36  ? -9.571  -14.817 14.209  1.00 0.00 ? 36  ARG A HH12 2  
ATOM   3736  H  HH21 . ARG A 1 36  ? -6.670  -16.160 12.862  1.00 0.00 ? 36  ARG A HH21 2  
ATOM   3737  H  HH22 . ARG A 1 36  ? -7.744  -16.147 14.222  1.00 0.00 ? 36  ARG A HH22 2  
ATOM   3738  N  N    . MET A 1 37  ? -10.607 -8.973  12.795  1.00 0.00 ? 37  MET A N    2  
ATOM   3739  C  CA   . MET A 1 37  ? -11.116 -8.731  14.136  1.00 0.00 ? 37  MET A CA   2  
ATOM   3740  C  C    . MET A 1 37  ? -12.182 -9.755  14.473  1.00 0.00 ? 37  MET A C    2  
ATOM   3741  O  O    . MET A 1 37  ? -13.105 -9.980  13.689  1.00 0.00 ? 37  MET A O    2  
ATOM   3742  C  CB   . MET A 1 37  ? -11.703 -7.329  14.238  1.00 0.00 ? 37  MET A CB   2  
ATOM   3743  C  CG   . MET A 1 37  ? -10.602 -6.294  13.986  1.00 0.00 ? 37  MET A CG   2  
ATOM   3744  S  SD   . MET A 1 37  ? -11.166 -4.661  14.522  1.00 0.00 ? 37  MET A SD   2  
ATOM   3745  C  CE   . MET A 1 37  ? -11.394 -5.078  16.262  1.00 0.00 ? 37  MET A CE   2  
ATOM   3746  H  H    . MET A 1 37  ? -11.165 -8.749  12.020  1.00 0.00 ? 37  MET A H    2  
ATOM   3747  H  HA   . MET A 1 37  ? -10.310 -8.819  14.845  1.00 0.00 ? 37  MET A HA   2  
ATOM   3748  H  HB2  . MET A 1 37  ? -12.482 -7.211  13.514  1.00 0.00 ? 37  MET A HB2  2  
ATOM   3749  H  HB3  . MET A 1 37  ? -12.113 -7.194  15.216  1.00 0.00 ? 37  MET A HB3  2  
ATOM   3750  H  HG2  . MET A 1 37  ? -9.716  -6.568  14.540  1.00 0.00 ? 37  MET A HG2  2  
ATOM   3751  H  HG3  . MET A 1 37  ? -10.370 -6.266  12.931  1.00 0.00 ? 37  MET A HG3  2  
ATOM   3752  H  HE1  . MET A 1 37  ? -11.128 -4.233  16.872  1.00 0.00 ? 37  MET A HE1  2  
ATOM   3753  H  HE2  . MET A 1 37  ? -10.765 -5.924  16.509  1.00 0.00 ? 37  MET A HE2  2  
ATOM   3754  H  HE3  . MET A 1 37  ? -12.427 -5.338  16.438  1.00 0.00 ? 37  MET A HE3  2  
ATOM   3755  N  N    . HIS A 1 38  ? -12.060 -10.361 15.650  1.00 0.00 ? 38  HIS A N    2  
ATOM   3756  C  CA   . HIS A 1 38  ? -13.026 -11.355 16.088  1.00 0.00 ? 38  HIS A CA   2  
ATOM   3757  C  C    . HIS A 1 38  ? -13.981 -10.696 17.052  1.00 0.00 ? 38  HIS A C    2  
ATOM   3758  O  O    . HIS A 1 38  ? -13.660 -10.497 18.216  1.00 0.00 ? 38  HIS A O    2  
ATOM   3759  C  CB   . HIS A 1 38  ? -12.307 -12.521 16.773  1.00 0.00 ? 38  HIS A CB   2  
ATOM   3760  C  CG   . HIS A 1 38  ? -13.305 -13.366 17.522  1.00 0.00 ? 38  HIS A CG   2  
ATOM   3761  N  ND1  . HIS A 1 38  ? -14.673 -13.221 17.349  1.00 0.00 ? 38  HIS A ND1  2  
ATOM   3762  C  CD2  . HIS A 1 38  ? -13.148 -14.364 18.451  1.00 0.00 ? 38  HIS A CD2  2  
ATOM   3763  C  CE1  . HIS A 1 38  ? -15.280 -14.111 18.155  1.00 0.00 ? 38  HIS A CE1  2  
ATOM   3764  N  NE2  . HIS A 1 38  ? -14.397 -14.833 18.849  1.00 0.00 ? 38  HIS A NE2  2  
ATOM   3765  H  H    . HIS A 1 38  ? -11.320 -10.118 16.245  1.00 0.00 ? 38  HIS A H    2  
ATOM   3766  H  HA   . HIS A 1 38  ? -13.575 -11.725 15.236  1.00 0.00 ? 38  HIS A HA   2  
ATOM   3767  H  HB2  . HIS A 1 38  ? -11.814 -13.128 16.026  1.00 0.00 ? 38  HIS A HB2  2  
ATOM   3768  H  HB3  . HIS A 1 38  ? -11.573 -12.136 17.467  1.00 0.00 ? 38  HIS A HB3  2  
ATOM   3769  H  HD1  . HIS A 1 38  ? -15.117 -12.587 16.748  1.00 0.00 ? 38  HIS A HD1  2  
ATOM   3770  H  HD2  . HIS A 1 38  ? -12.201 -14.731 18.816  1.00 0.00 ? 38  HIS A HD2  2  
ATOM   3771  H  HE1  . HIS A 1 38  ? -16.351 -14.226 18.232  1.00 0.00 ? 38  HIS A HE1  2  
ATOM   3772  H  HE2  . HIS A 1 38  ? -14.587 -15.542 19.499  1.00 0.00 ? 38  HIS A HE2  2  
ATOM   3773  N  N    . ASN A 1 39  ? -15.143 -10.320 16.565  1.00 0.00 ? 39  ASN A N    2  
ATOM   3774  C  CA   . ASN A 1 39  ? -16.085 -9.650  17.425  1.00 0.00 ? 39  ASN A CA   2  
ATOM   3775  C  C    . ASN A 1 39  ? -15.497 -8.315  17.853  1.00 0.00 ? 39  ASN A C    2  
ATOM   3776  O  O    . ASN A 1 39  ? -14.605 -7.772  17.201  1.00 0.00 ? 39  ASN A O    2  
ATOM   3777  C  CB   . ASN A 1 39  ? -16.359 -10.499 18.670  1.00 0.00 ? 39  ASN A CB   2  
ATOM   3778  C  CG   . ASN A 1 39  ? -17.661 -10.069 19.320  1.00 0.00 ? 39  ASN A CG   2  
ATOM   3779  O  OD1  . ASN A 1 39  ? -18.329 -9.155  18.836  1.00 0.00 ? 39  ASN A OD1  2  
ATOM   3780  N  ND2  . ASN A 1 39  ? -18.061 -10.679 20.394  1.00 0.00 ? 39  ASN A ND2  2  
ATOM   3781  H  H    . ASN A 1 39  ? -15.356 -10.471 15.621  1.00 0.00 ? 39  ASN A H    2  
ATOM   3782  H  HA   . ASN A 1 39  ? -17.009 -9.485  16.892  1.00 0.00 ? 39  ASN A HA   2  
ATOM   3783  H  HB2  . ASN A 1 39  ? -16.431 -11.538 18.391  1.00 0.00 ? 39  ASN A HB2  2  
ATOM   3784  H  HB3  . ASN A 1 39  ? -15.551 -10.371 19.383  1.00 0.00 ? 39  ASN A HB3  2  
ATOM   3785  H  HD21 . ASN A 1 39  ? -17.522 -11.408 20.775  1.00 0.00 ? 39  ASN A HD21 2  
ATOM   3786  H  HD22 . ASN A 1 39  ? -18.895 -10.411 20.823  1.00 0.00 ? 39  ASN A HD22 2  
ATOM   3787  N  N    . ASP A 1 40  ? -16.004 -7.804  18.950  1.00 0.00 ? 40  ASP A N    2  
ATOM   3788  C  CA   . ASP A 1 40  ? -15.550 -6.535  19.493  1.00 0.00 ? 40  ASP A CA   2  
ATOM   3789  C  C    . ASP A 1 40  ? -14.044 -6.508  19.767  1.00 0.00 ? 40  ASP A C    2  
ATOM   3790  O  O    . ASP A 1 40  ? -13.581 -5.608  20.469  1.00 0.00 ? 40  ASP A O    2  
ATOM   3791  C  CB   . ASP A 1 40  ? -16.281 -6.263  20.808  1.00 0.00 ? 40  ASP A CB   2  
ATOM   3792  C  CG   . ASP A 1 40  ? -17.655 -5.663  20.531  1.00 0.00 ? 40  ASP A CG   2  
ATOM   3793  O  OD1  . ASP A 1 40  ? -18.473 -6.352  19.943  1.00 0.00 ? 40  ASP A OD1  2  
ATOM   3794  O  OD2  . ASP A 1 40  ? -17.871 -4.523  20.909  1.00 0.00 ? 40  ASP A OD2  2  
ATOM   3795  H  H    . ASP A 1 40  ? -16.712 -8.291  19.410  1.00 0.00 ? 40  ASP A H    2  
ATOM   3796  H  HA   . ASP A 1 40  ? -15.795 -5.750  18.797  1.00 0.00 ? 40  ASP A HA   2  
ATOM   3797  H  HB2  . ASP A 1 40  ? -16.393 -7.193  21.348  1.00 0.00 ? 40  ASP A HB2  2  
ATOM   3798  H  HB3  . ASP A 1 40  ? -15.702 -5.572  21.405  1.00 0.00 ? 40  ASP A HB3  2  
ATOM   3799  N  N    . THR A 1 41  ? -13.266 -7.478  19.266  1.00 0.00 ? 41  THR A N    2  
ATOM   3800  C  CA   . THR A 1 41  ? -11.839 -7.475  19.552  1.00 0.00 ? 41  THR A CA   2  
ATOM   3801  C  C    . THR A 1 41  ? -10.996 -7.705  18.313  1.00 0.00 ? 41  THR A C    2  
ATOM   3802  O  O    . THR A 1 41  ? -11.510 -7.958  17.229  1.00 0.00 ? 41  THR A O    2  
ATOM   3803  C  CB   . THR A 1 41  ? -11.547 -8.510  20.627  1.00 0.00 ? 41  THR A CB   2  
ATOM   3804  O  OG1  . THR A 1 41  ? -10.386 -8.124  21.350  1.00 0.00 ? 41  THR A OG1  2  
ATOM   3805  C  CG2  . THR A 1 41  ? -11.328 -9.890  20.010  1.00 0.00 ? 41  THR A CG2  2  
ATOM   3806  H  H    . THR A 1 41  ? -13.642 -8.206  18.730  1.00 0.00 ? 41  THR A H    2  
ATOM   3807  H  HA   . THR A 1 41  ? -11.574 -6.516  19.943  1.00 0.00 ? 41  THR A HA   2  
ATOM   3808  H  HB   . THR A 1 41  ? -12.390 -8.547  21.294  1.00 0.00 ? 41  THR A HB   2  
ATOM   3809  H  HG1  . THR A 1 41  ? -9.618  -8.373  20.831  1.00 0.00 ? 41  THR A HG1  2  
ATOM   3810  H  HG21 . THR A 1 41  ? -10.272 -10.091 19.963  1.00 0.00 ? 41  THR A HG21 2  
ATOM   3811  H  HG22 . THR A 1 41  ? -11.741 -9.921  19.019  1.00 0.00 ? 41  THR A HG22 2  
ATOM   3812  H  HG23 . THR A 1 41  ? -11.813 -10.634 20.620  1.00 0.00 ? 41  THR A HG23 2  
ATOM   3813  N  N    . TRP A 1 42  ? -9.693  -7.583  18.498  1.00 0.00 ? 42  TRP A N    2  
ATOM   3814  C  CA   . TRP A 1 42  ? -8.743  -7.734  17.397  1.00 0.00 ? 42  TRP A CA   2  
ATOM   3815  C  C    . TRP A 1 42  ? -7.955  -9.036  17.484  1.00 0.00 ? 42  TRP A C    2  
ATOM   3816  O  O    . TRP A 1 42  ? -7.702  -9.559  18.570  1.00 0.00 ? 42  TRP A O    2  
ATOM   3817  C  CB   . TRP A 1 42  ? -7.770  -6.556  17.411  1.00 0.00 ? 42  TRP A CB   2  
ATOM   3818  C  CG   . TRP A 1 42  ? -7.353  -6.272  18.817  1.00 0.00 ? 42  TRP A CG   2  
ATOM   3819  C  CD1  . TRP A 1 42  ? -6.432  -6.977  19.514  1.00 0.00 ? 42  TRP A CD1  2  
ATOM   3820  C  CD2  . TRP A 1 42  ? -7.825  -5.223  19.712  1.00 0.00 ? 42  TRP A CD2  2  
ATOM   3821  N  NE1  . TRP A 1 42  ? -6.309  -6.425  20.777  1.00 0.00 ? 42  TRP A NE1  2  
ATOM   3822  C  CE2  . TRP A 1 42  ? -7.145  -5.345  20.945  1.00 0.00 ? 42  TRP A CE2  2  
ATOM   3823  C  CE3  . TRP A 1 42  ? -8.767  -4.188  19.574  1.00 0.00 ? 42  TRP A CE3  2  
ATOM   3824  C  CZ2  . TRP A 1 42  ? -7.387  -4.475  22.003  1.00 0.00 ? 42  TRP A CZ2  2  
ATOM   3825  C  CZ3  . TRP A 1 42  ? -9.015  -3.307  20.640  1.00 0.00 ? 42  TRP A CZ3  2  
ATOM   3826  C  CH2  . TRP A 1 42  ? -8.326  -3.450  21.853  1.00 0.00 ? 42  TRP A CH2  2  
ATOM   3827  H  H    . TRP A 1 42  ? -9.365  -7.371  19.395  1.00 0.00 ? 42  TRP A H    2  
ATOM   3828  H  HA   . TRP A 1 42  ? -9.281  -7.716  16.468  1.00 0.00 ? 42  TRP A HA   2  
ATOM   3829  H  HB2  . TRP A 1 42  ? -6.901  -6.802  16.819  1.00 0.00 ? 42  TRP A HB2  2  
ATOM   3830  H  HB3  . TRP A 1 42  ? -8.254  -5.685  16.997  1.00 0.00 ? 42  TRP A HB3  2  
ATOM   3831  H  HD1  . TRP A 1 42  ? -5.883  -7.831  19.145  1.00 0.00 ? 42  TRP A HD1  2  
ATOM   3832  H  HE1  . TRP A 1 42  ? -5.708  -6.746  21.481  1.00 0.00 ? 42  TRP A HE1  2  
ATOM   3833  H  HE3  . TRP A 1 42  ? -9.303  -4.069  18.644  1.00 0.00 ? 42  TRP A HE3  2  
ATOM   3834  H  HZ2  . TRP A 1 42  ? -6.851  -4.594  22.933  1.00 0.00 ? 42  TRP A HZ2  2  
ATOM   3835  H  HZ3  . TRP A 1 42  ? -9.740  -2.515  20.525  1.00 0.00 ? 42  TRP A HZ3  2  
ATOM   3836  H  HH2  . TRP A 1 42  ? -8.520  -2.770  22.670  1.00 0.00 ? 42  TRP A HH2  2  
ATOM   3837  N  N    . VAL A 1 43  ? -7.555  -9.538  16.316  1.00 0.00 ? 43  VAL A N    2  
ATOM   3838  C  CA   . VAL A 1 43  ? -6.773  -10.767 16.229  1.00 0.00 ? 43  VAL A CA   2  
ATOM   3839  C  C    . VAL A 1 43  ? -5.469  -10.491 15.486  1.00 0.00 ? 43  VAL A C    2  
ATOM   3840  O  O    . VAL A 1 43  ? -5.366  -9.515  14.744  1.00 0.00 ? 43  VAL A O    2  
ATOM   3841  C  CB   . VAL A 1 43  ? -7.572  -11.847 15.498  1.00 0.00 ? 43  VAL A CB   2  
ATOM   3842  C  CG1  . VAL A 1 43  ? -7.026  -13.227 15.872  1.00 0.00 ? 43  VAL A CG1  2  
ATOM   3843  C  CG2  . VAL A 1 43  ? -9.043  -11.751 15.913  1.00 0.00 ? 43  VAL A CG2  2  
ATOM   3844  H  H    . VAL A 1 43  ? -7.783  -9.062  15.490  1.00 0.00 ? 43  VAL A H    2  
ATOM   3845  H  HA   . VAL A 1 43  ? -6.542  -11.114 17.226  1.00 0.00 ? 43  VAL A HA   2  
ATOM   3846  H  HB   . VAL A 1 43  ? -7.485  -11.701 14.431  1.00 0.00 ? 43  VAL A HB   2  
ATOM   3847  H  HG11 . VAL A 1 43  ? -5.983  -13.287 15.595  1.00 0.00 ? 43  VAL A HG11 2  
ATOM   3848  H  HG12 . VAL A 1 43  ? -7.581  -13.989 15.348  1.00 0.00 ? 43  VAL A HG12 2  
ATOM   3849  H  HG13 . VAL A 1 43  ? -7.124  -13.376 16.937  1.00 0.00 ? 43  VAL A HG13 2  
ATOM   3850  H  HG21 . VAL A 1 43  ? -9.567  -12.637 15.590  1.00 0.00 ? 43  VAL A HG21 2  
ATOM   3851  H  HG22 . VAL A 1 43  ? -9.490  -10.881 15.455  1.00 0.00 ? 43  VAL A HG22 2  
ATOM   3852  H  HG23 . VAL A 1 43  ? -9.108  -11.665 16.987  1.00 0.00 ? 43  VAL A HG23 2  
ATOM   3853  N  N    . LEU A 1 44  ? -4.470  -11.343 15.695  1.00 0.00 ? 44  LEU A N    2  
ATOM   3854  C  CA   . LEU A 1 44  ? -3.174  -11.163 15.044  1.00 0.00 ? 44  LEU A CA   2  
ATOM   3855  C  C    . LEU A 1 44  ? -2.824  -12.371 14.186  1.00 0.00 ? 44  LEU A C    2  
ATOM   3856  O  O    . LEU A 1 44  ? -2.479  -13.435 14.703  1.00 0.00 ? 44  LEU A O    2  
ATOM   3857  C  CB   . LEU A 1 44  ? -2.090  -10.958 16.104  1.00 0.00 ? 44  LEU A CB   2  
ATOM   3858  C  CG   . LEU A 1 44  ? -2.353  -9.653  16.864  1.00 0.00 ? 44  LEU A CG   2  
ATOM   3859  C  CD1  . LEU A 1 44  ? -1.779  -9.757  18.278  1.00 0.00 ? 44  LEU A CD1  2  
ATOM   3860  C  CD2  . LEU A 1 44  ? -1.683  -8.488  16.131  1.00 0.00 ? 44  LEU A CD2  2  
ATOM   3861  H  H    . LEU A 1 44  ? -4.601  -12.100 16.299  1.00 0.00 ? 44  LEU A H    2  
ATOM   3862  H  HA   . LEU A 1 44  ? -3.211  -10.286 14.413  1.00 0.00 ? 44  LEU A HA   2  
ATOM   3863  H  HB2  . LEU A 1 44  ? -2.104  -11.790 16.795  1.00 0.00 ? 44  LEU A HB2  2  
ATOM   3864  H  HB3  . LEU A 1 44  ? -1.124  -10.907 15.625  1.00 0.00 ? 44  LEU A HB3  2  
ATOM   3865  H  HG   . LEU A 1 44  ? -3.418  -9.479  16.923  1.00 0.00 ? 44  LEU A HG   2  
ATOM   3866  H  HD11 . LEU A 1 44  ? -2.263  -10.567 18.804  1.00 0.00 ? 44  LEU A HD11 2  
ATOM   3867  H  HD12 . LEU A 1 44  ? -1.952  -8.831  18.806  1.00 0.00 ? 44  LEU A HD12 2  
ATOM   3868  H  HD13 . LEU A 1 44  ? -0.718  -9.947  18.223  1.00 0.00 ? 44  LEU A HD13 2  
ATOM   3869  H  HD21 . LEU A 1 44  ? -2.164  -7.562  16.411  1.00 0.00 ? 44  LEU A HD21 2  
ATOM   3870  H  HD22 . LEU A 1 44  ? -1.773  -8.632  15.064  1.00 0.00 ? 44  LEU A HD22 2  
ATOM   3871  H  HD23 . LEU A 1 44  ? -0.638  -8.446  16.402  1.00 0.00 ? 44  LEU A HD23 2  
ATOM   3872  N  N    . LEU A 1 45  ? -2.912  -12.198 12.871  1.00 0.00 ? 45  LEU A N    2  
ATOM   3873  C  CA   . LEU A 1 45  ? -2.597  -13.285 11.951  1.00 0.00 ? 45  LEU A CA   2  
ATOM   3874  C  C    . LEU A 1 45  ? -1.329  -14.011 12.396  1.00 0.00 ? 45  LEU A C    2  
ATOM   3875  O  O    . LEU A 1 45  ? -0.632  -13.564 13.307  1.00 0.00 ? 45  LEU A O    2  
ATOM   3876  C  CB   . LEU A 1 45  ? -2.409  -12.757 10.518  1.00 0.00 ? 45  LEU A CB   2  
ATOM   3877  C  CG   . LEU A 1 45  ? -1.683  -11.397 10.506  1.00 0.00 ? 45  LEU A CG   2  
ATOM   3878  C  CD1  . LEU A 1 45  ? -2.618  -10.269 10.980  1.00 0.00 ? 45  LEU A CD1  2  
ATOM   3879  C  CD2  . LEU A 1 45  ? -0.439  -11.455 11.404  1.00 0.00 ? 45  LEU A CD2  2  
ATOM   3880  H  H    . LEU A 1 45  ? -3.198  -11.331 12.519  1.00 0.00 ? 45  LEU A H    2  
ATOM   3881  H  HA   . LEU A 1 45  ? -3.417  -13.988 11.954  1.00 0.00 ? 45  LEU A HA   2  
ATOM   3882  H  HB2  . LEU A 1 45  ? -1.826  -13.471 9.955   1.00 0.00 ? 45  LEU A HB2  2  
ATOM   3883  H  HB3  . LEU A 1 45  ? -3.377  -12.649 10.050  1.00 0.00 ? 45  LEU A HB3  2  
ATOM   3884  H  HG   . LEU A 1 45  ? -1.372  -11.182 9.494   1.00 0.00 ? 45  LEU A HG   2  
ATOM   3885  H  HD11 . LEU A 1 45  ? -3.633  -10.632 11.029  1.00 0.00 ? 45  LEU A HD11 2  
ATOM   3886  H  HD12 . LEU A 1 45  ? -2.569  -9.449  10.281  1.00 0.00 ? 45  LEU A HD12 2  
ATOM   3887  H  HD13 . LEU A 1 45  ? -2.314  -9.922  11.958  1.00 0.00 ? 45  LEU A HD13 2  
ATOM   3888  H  HD21 . LEU A 1 45  ? -0.739  -11.464 12.440  1.00 0.00 ? 45  LEU A HD21 2  
ATOM   3889  H  HD22 . LEU A 1 45  ? 0.177   -10.587 11.217  1.00 0.00 ? 45  LEU A HD22 2  
ATOM   3890  H  HD23 . LEU A 1 45  ? 0.127   -12.347 11.182  1.00 0.00 ? 45  LEU A HD23 2  
ATOM   3891  N  N    . ASN A 1 46  ? -1.039  -15.139 11.752  1.00 0.00 ? 46  ASN A N    2  
ATOM   3892  C  CA   . ASN A 1 46  ? 0.146   -15.923 12.093  1.00 0.00 ? 46  ASN A CA   2  
ATOM   3893  C  C    . ASN A 1 46  ? 1.263   -15.679 11.082  1.00 0.00 ? 46  ASN A C    2  
ATOM   3894  O  O    . ASN A 1 46  ? 2.175   -16.493 10.943  1.00 0.00 ? 46  ASN A O    2  
ATOM   3895  C  CB   . ASN A 1 46  ? -0.204  -17.413 12.120  1.00 0.00 ? 46  ASN A CB   2  
ATOM   3896  C  CG   . ASN A 1 46  ? -1.374  -17.656 13.068  1.00 0.00 ? 46  ASN A CG   2  
ATOM   3897  O  OD1  . ASN A 1 46  ? -1.424  -17.080 14.154  1.00 0.00 ? 46  ASN A OD1  2  
ATOM   3898  N  ND2  . ASN A 1 46  ? -2.324  -18.482 12.720  1.00 0.00 ? 46  ASN A ND2  2  
ATOM   3899  H  H    . ASN A 1 46  ? -1.633  -15.452 11.037  1.00 0.00 ? 46  ASN A H    2  
ATOM   3900  H  HA   . ASN A 1 46  ? 0.492   -15.630 13.074  1.00 0.00 ? 46  ASN A HA   2  
ATOM   3901  H  HB2  . ASN A 1 46  ? -0.474  -17.735 11.124  1.00 0.00 ? 46  ASN A HB2  2  
ATOM   3902  H  HB3  . ASN A 1 46  ? 0.653   -17.975 12.459  1.00 0.00 ? 46  ASN A HB3  2  
ATOM   3903  H  HD21 . ASN A 1 46  ? -2.284  -18.940 11.855  1.00 0.00 ? 46  ASN A HD21 2  
ATOM   3904  H  HD22 . ASN A 1 46  ? -3.079  -18.642 13.324  1.00 0.00 ? 46  ASN A HD22 2  
ATOM   3905  N  N    . GLN A 1 47  ? 1.186   -14.551 10.379  1.00 0.00 ? 47  GLN A N    2  
ATOM   3906  C  CA   . GLN A 1 47  ? 2.198   -14.205 9.383   1.00 0.00 ? 47  GLN A CA   2  
ATOM   3907  C  C    . GLN A 1 47  ? 2.851   -12.870 9.726   1.00 0.00 ? 47  GLN A C    2  
ATOM   3908  O  O    . GLN A 1 47  ? 2.721   -12.376 10.846  1.00 0.00 ? 47  GLN A O    2  
ATOM   3909  C  CB   . GLN A 1 47  ? 1.557   -14.124 7.996   1.00 0.00 ? 47  GLN A CB   2  
ATOM   3910  C  CG   . GLN A 1 47  ? 1.129   -15.523 7.551   1.00 0.00 ? 47  GLN A CG   2  
ATOM   3911  C  CD   . GLN A 1 47  ? -0.003  -15.424 6.535   1.00 0.00 ? 47  GLN A CD   2  
ATOM   3912  O  OE1  . GLN A 1 47  ? 0.005   -16.131 5.527   1.00 0.00 ? 47  GLN A OE1  2  
ATOM   3913  N  NE2  . GLN A 1 47  ? -0.982  -14.585 6.739   1.00 0.00 ? 47  GLN A NE2  2  
ATOM   3914  H  H    . GLN A 1 47  ? 0.436   -13.940 10.534  1.00 0.00 ? 47  GLN A H    2  
ATOM   3915  H  HA   . GLN A 1 47  ? 2.960   -14.972 9.368   1.00 0.00 ? 47  GLN A HA   2  
ATOM   3916  H  HB2  . GLN A 1 47  ? 0.692   -13.477 8.037   1.00 0.00 ? 47  GLN A HB2  2  
ATOM   3917  H  HB3  . GLN A 1 47  ? 2.270   -13.727 7.291   1.00 0.00 ? 47  GLN A HB3  2  
ATOM   3918  H  HG2  . GLN A 1 47  ? 1.971   -16.028 7.102   1.00 0.00 ? 47  GLN A HG2  2  
ATOM   3919  H  HG3  . GLN A 1 47  ? 0.790   -16.085 8.410   1.00 0.00 ? 47  GLN A HG3  2  
ATOM   3920  H  HE21 . GLN A 1 47  ? -0.987  -14.023 7.542   1.00 0.00 ? 47  GLN A HE21 2  
ATOM   3921  H  HE22 . GLN A 1 47  ? -1.714  -14.520 6.091   1.00 0.00 ? 47  GLN A HE22 2  
ATOM   3922  N  N    . ARG A 1 48  ? 3.553   -12.292 8.756   1.00 0.00 ? 48  ARG A N    2  
ATOM   3923  C  CA   . ARG A 1 48  ? 4.225   -11.011 8.964   1.00 0.00 ? 48  ARG A CA   2  
ATOM   3924  C  C    . ARG A 1 48  ? 3.857   -10.032 7.855   1.00 0.00 ? 48  ARG A C    2  
ATOM   3925  O  O    . ARG A 1 48  ? 3.102   -9.085  8.074   1.00 0.00 ? 48  ARG A O    2  
ATOM   3926  C  CB   . ARG A 1 48  ? 5.742   -11.219 8.985   1.00 0.00 ? 48  ARG A CB   2  
ATOM   3927  C  CG   . ARG A 1 48  ? 6.085   -12.401 9.901   1.00 0.00 ? 48  ARG A CG   2  
ATOM   3928  C  CD   . ARG A 1 48  ? 7.606   -12.493 10.110  1.00 0.00 ? 48  ARG A CD   2  
ATOM   3929  N  NE   . ARG A 1 48  ? 7.912   -12.591 11.532  1.00 0.00 ? 48  ARG A NE   2  
ATOM   3930  C  CZ   . ARG A 1 48  ? 7.394   -13.557 12.285  1.00 0.00 ? 48  ARG A CZ   2  
ATOM   3931  N  NH1  . ARG A 1 48  ? 6.592   -14.440 11.755  1.00 0.00 ? 48  ARG A NH1  2  
ATOM   3932  N  NH2  . ARG A 1 48  ? 7.690   -13.623 13.555  1.00 0.00 ? 48  ARG A NH2  2  
ATOM   3933  H  H    . ARG A 1 48  ? 3.623   -12.734 7.884   1.00 0.00 ? 48  ARG A H    2  
ATOM   3934  H  HA   . ARG A 1 48  ? 3.918   -10.597 9.912   1.00 0.00 ? 48  ARG A HA   2  
ATOM   3935  H  HB2  . ARG A 1 48  ? 6.090   -11.427 7.983   1.00 0.00 ? 48  ARG A HB2  2  
ATOM   3936  H  HB3  . ARG A 1 48  ? 6.223   -10.327 9.356   1.00 0.00 ? 48  ARG A HB3  2  
ATOM   3937  H  HG2  . ARG A 1 48  ? 5.599   -12.263 10.857  1.00 0.00 ? 48  ARG A HG2  2  
ATOM   3938  H  HG3  . ARG A 1 48  ? 5.729   -13.316 9.450   1.00 0.00 ? 48  ARG A HG3  2  
ATOM   3939  H  HD2  . ARG A 1 48  ? 7.985   -13.370 9.606   1.00 0.00 ? 48  ARG A HD2  2  
ATOM   3940  H  HD3  . ARG A 1 48  ? 8.086   -11.614 9.700   1.00 0.00 ? 48  ARG A HD3  2  
ATOM   3941  H  HE   . ARG A 1 48  ? 8.512   -11.933 11.940  1.00 0.00 ? 48  ARG A HE   2  
ATOM   3942  H  HH11 . ARG A 1 48  ? 6.366   -14.390 10.781  1.00 0.00 ? 48  ARG A HH11 2  
ATOM   3943  H  HH12 . ARG A 1 48  ? 6.202   -15.167 12.321  1.00 0.00 ? 48  ARG A HH12 2  
ATOM   3944  H  HH21 . ARG A 1 48  ? 8.306   -12.946 13.960  1.00 0.00 ? 48  ARG A HH21 2  
ATOM   3945  H  HH22 . ARG A 1 48  ? 7.302   -14.350 14.121  1.00 0.00 ? 48  ARG A HH22 2  
ATOM   3946  N  N    . ARG A 1 49  ? 4.391   -10.275 6.666   1.00 0.00 ? 49  ARG A N    2  
ATOM   3947  C  CA   . ARG A 1 49  ? 4.116   -9.419  5.516   1.00 0.00 ? 49  ARG A CA   2  
ATOM   3948  C  C    . ARG A 1 49  ? 3.980   -10.268 4.257   1.00 0.00 ? 49  ARG A C    2  
ATOM   3949  O  O    . ARG A 1 49  ? 4.618   -11.313 4.136   1.00 0.00 ? 49  ARG A O    2  
ATOM   3950  C  CB   . ARG A 1 49  ? 5.252   -8.407  5.336   1.00 0.00 ? 49  ARG A CB   2  
ATOM   3951  C  CG   . ARG A 1 49  ? 6.595   -9.139  5.223   1.00 0.00 ? 49  ARG A CG   2  
ATOM   3952  C  CD   . ARG A 1 49  ? 7.518   -8.374  4.273   1.00 0.00 ? 49  ARG A CD   2  
ATOM   3953  N  NE   . ARG A 1 49  ? 8.907   -8.677  4.581   1.00 0.00 ? 49  ARG A NE   2  
ATOM   3954  C  CZ   . ARG A 1 49  ? 9.853   -8.576  3.655   1.00 0.00 ? 49  ARG A CZ   2  
ATOM   3955  N  NH1  . ARG A 1 49  ? 9.545   -8.198  2.443   1.00 0.00 ? 49  ARG A NH1  2  
ATOM   3956  N  NH2  . ARG A 1 49  ? 11.092  -8.858  3.954   1.00 0.00 ? 49  ARG A NH2  2  
ATOM   3957  H  H    . ARG A 1 49  ? 4.982   -11.049 6.557   1.00 0.00 ? 49  ARG A H    2  
ATOM   3958  H  HA   . ARG A 1 49  ? 3.194   -8.886  5.684   1.00 0.00 ? 49  ARG A HA   2  
ATOM   3959  H  HB2  . ARG A 1 49  ? 5.077   -7.826  4.443   1.00 0.00 ? 49  ARG A HB2  2  
ATOM   3960  H  HB3  . ARG A 1 49  ? 5.279   -7.750  6.192   1.00 0.00 ? 49  ARG A HB3  2  
ATOM   3961  H  HG2  . ARG A 1 49  ? 7.054   -9.196  6.200   1.00 0.00 ? 49  ARG A HG2  2  
ATOM   3962  H  HG3  . ARG A 1 49  ? 6.440   -10.137 4.844   1.00 0.00 ? 49  ARG A HG3  2  
ATOM   3963  H  HD2  . ARG A 1 49  ? 7.308   -8.665  3.254   1.00 0.00 ? 49  ARG A HD2  2  
ATOM   3964  H  HD3  . ARG A 1 49  ? 7.348   -7.313  4.384   1.00 0.00 ? 49  ARG A HD3  2  
ATOM   3965  H  HE   . ARG A 1 49  ? 9.143   -8.961  5.487   1.00 0.00 ? 49  ARG A HE   2  
ATOM   3966  H  HH11 . ARG A 1 49  ? 8.596   -7.985  2.214   1.00 0.00 ? 49  ARG A HH11 2  
ATOM   3967  H  HH12 . ARG A 1 49  ? 10.258  -8.121  1.746   1.00 0.00 ? 49  ARG A HH12 2  
ATOM   3968  H  HH21 . ARG A 1 49  ? 11.328  -9.151  4.880   1.00 0.00 ? 49  ARG A HH21 2  
ATOM   3969  H  HH22 . ARG A 1 49  ? 11.804  -8.781  3.257   1.00 0.00 ? 49  ARG A HH22 2  
ATOM   3970  N  N    . GLY A 1 50  ? 3.144   -9.831  3.322   1.00 0.00 ? 50  GLY A N    2  
ATOM   3971  C  CA   . GLY A 1 50  ? 2.963   -10.598 2.099   1.00 0.00 ? 50  GLY A CA   2  
ATOM   3972  C  C    . GLY A 1 50  ? 2.229   -9.819  1.013   1.00 0.00 ? 50  GLY A C    2  
ATOM   3973  O  O    . GLY A 1 50  ? 1.466   -8.888  1.290   1.00 0.00 ? 50  GLY A O    2  
ATOM   3974  H  H    . GLY A 1 50  ? 2.649   -8.997  3.458   1.00 0.00 ? 50  GLY A H    2  
ATOM   3975  H  HA2  . GLY A 1 50  ? 3.933   -10.888 1.723   1.00 0.00 ? 50  GLY A HA2  2  
ATOM   3976  H  HA3  . GLY A 1 50  ? 2.398   -11.490 2.328   1.00 0.00 ? 50  GLY A HA3  2  
ATOM   3977  N  N    . PHE A 1 51  ? 2.477   -10.231 -0.225  1.00 0.00 ? 51  PHE A N    2  
ATOM   3978  C  CA   . PHE A 1 51  ? 1.850   -9.629  -1.394  1.00 0.00 ? 51  PHE A CA   2  
ATOM   3979  C  C    . PHE A 1 51  ? 2.125   -10.491 -2.624  1.00 0.00 ? 51  PHE A C    2  
ATOM   3980  O  O    . PHE A 1 51  ? 2.812   -11.508 -2.529  1.00 0.00 ? 51  PHE A O    2  
ATOM   3981  C  CB   . PHE A 1 51  ? 2.375   -8.215  -1.611  1.00 0.00 ? 51  PHE A CB   2  
ATOM   3982  C  CG   . PHE A 1 51  ? 1.789   -7.648  -2.879  1.00 0.00 ? 51  PHE A CG   2  
ATOM   3983  C  CD1  . PHE A 1 51  ? 0.460   -7.209  -2.897  1.00 0.00 ? 51  PHE A CD1  2  
ATOM   3984  C  CD2  . PHE A 1 51  ? 2.572   -7.563  -4.037  1.00 0.00 ? 51  PHE A CD2  2  
ATOM   3985  C  CE1  . PHE A 1 51  ? -0.089  -6.684  -4.073  1.00 0.00 ? 51  PHE A CE1  2  
ATOM   3986  C  CE2  . PHE A 1 51  ? 2.023   -7.037  -5.213  1.00 0.00 ? 51  PHE A CE2  2  
ATOM   3987  C  CZ   . PHE A 1 51  ? 0.693   -6.598  -5.231  1.00 0.00 ? 51  PHE A CZ   2  
ATOM   3988  H  H    . PHE A 1 51  ? 3.097   -10.977 -0.354  1.00 0.00 ? 51  PHE A H    2  
ATOM   3989  H  HA   . PHE A 1 51  ? 0.783   -9.584  -1.232  1.00 0.00 ? 51  PHE A HA   2  
ATOM   3990  H  HB2  . PHE A 1 51  ? 2.078   -7.604  -0.778  1.00 0.00 ? 51  PHE A HB2  2  
ATOM   3991  H  HB3  . PHE A 1 51  ? 3.452   -8.236  -1.685  1.00 0.00 ? 51  PHE A HB3  2  
ATOM   3992  H  HD1  . PHE A 1 51  ? -0.143  -7.276  -2.003  1.00 0.00 ? 51  PHE A HD1  2  
ATOM   3993  H  HD2  . PHE A 1 51  ? 3.596   -7.902  -4.023  1.00 0.00 ? 51  PHE A HD2  2  
ATOM   3994  H  HE1  . PHE A 1 51  ? -1.114  -6.345  -4.086  1.00 0.00 ? 51  PHE A HE1  2  
ATOM   3995  H  HE2  . PHE A 1 51  ? 2.625   -6.970  -6.107  1.00 0.00 ? 51  PHE A HE2  2  
ATOM   3996  H  HZ   . PHE A 1 51  ? 0.270   -6.192  -6.138  1.00 0.00 ? 51  PHE A HZ   2  
ATOM   3997  N  N    . LEU A 1 52  ? 1.603   -10.084 -3.775  1.00 0.00 ? 52  LEU A N    2  
ATOM   3998  C  CA   . LEU A 1 52  ? 1.825   -10.845 -5.001  1.00 0.00 ? 52  LEU A CA   2  
ATOM   3999  C  C    . LEU A 1 52  ? 1.611   -9.966  -6.233  1.00 0.00 ? 52  LEU A C    2  
ATOM   4000  O  O    . LEU A 1 52  ? 0.762   -9.074  -6.234  1.00 0.00 ? 52  LEU A O    2  
ATOM   4001  C  CB   . LEU A 1 52  ? 0.892   -12.061 -5.050  1.00 0.00 ? 52  LEU A CB   2  
ATOM   4002  C  CG   . LEU A 1 52  ? -0.375  -11.780 -4.238  1.00 0.00 ? 52  LEU A CG   2  
ATOM   4003  C  CD1  . LEU A 1 52  ? -1.099  -10.566 -4.820  1.00 0.00 ? 52  LEU A CD1  2  
ATOM   4004  C  CD2  . LEU A 1 52  ? -1.296  -13.001 -4.301  1.00 0.00 ? 52  LEU A CD2  2  
ATOM   4005  H  H    . LEU A 1 52  ? 1.068   -9.264  -3.802  1.00 0.00 ? 52  LEU A H    2  
ATOM   4006  H  HA   . LEU A 1 52  ? 2.847   -11.195 -5.004  1.00 0.00 ? 52  LEU A HA   2  
ATOM   4007  H  HB2  . LEU A 1 52  ? 0.622   -12.274 -6.076  1.00 0.00 ? 52  LEU A HB2  2  
ATOM   4008  H  HB3  . LEU A 1 52  ? 1.400   -12.919 -4.629  1.00 0.00 ? 52  LEU A HB3  2  
ATOM   4009  H  HG   . LEU A 1 52  ? -0.107  -11.584 -3.210  1.00 0.00 ? 52  LEU A HG   2  
ATOM   4010  H  HD11 . LEU A 1 52  ? -1.071  -10.612 -5.899  1.00 0.00 ? 52  LEU A HD11 2  
ATOM   4011  H  HD12 . LEU A 1 52  ? -0.610  -9.662  -4.485  1.00 0.00 ? 52  LEU A HD12 2  
ATOM   4012  H  HD13 . LEU A 1 52  ? -2.125  -10.565 -4.485  1.00 0.00 ? 52  LEU A HD13 2  
ATOM   4013  H  HD21 . LEU A 1 52  ? -1.889  -12.958 -5.204  1.00 0.00 ? 52  LEU A HD21 2  
ATOM   4014  H  HD22 . LEU A 1 52  ? -1.950  -13.003 -3.441  1.00 0.00 ? 52  LEU A HD22 2  
ATOM   4015  H  HD23 . LEU A 1 52  ? -0.701  -13.902 -4.304  1.00 0.00 ? 52  LEU A HD23 2  
ATOM   4016  N  N    . CYS A 1 53  ? 2.392   -10.229 -7.278  1.00 0.00 ? 53  CYS A N    2  
ATOM   4017  C  CA   . CYS A 1 53  ? 2.291   -9.462  -8.518  1.00 0.00 ? 53  CYS A CA   2  
ATOM   4018  C  C    . CYS A 1 53  ? 1.551   -10.262 -9.586  1.00 0.00 ? 53  CYS A C    2  
ATOM   4019  O  O    . CYS A 1 53  ? 1.160   -11.406 -9.358  1.00 0.00 ? 53  CYS A O    2  
ATOM   4020  C  CB   . CYS A 1 53  ? 3.692   -9.106  -9.025  1.00 0.00 ? 53  CYS A CB   2  
ATOM   4021  S  SG   . CYS A 1 53  ? 4.538   -10.610 -9.575  1.00 0.00 ? 53  CYS A SG   2  
ATOM   4022  H  H    . CYS A 1 53  ? 3.051   -10.952 -7.214  1.00 0.00 ? 53  CYS A H    2  
ATOM   4023  H  HA   . CYS A 1 53  ? 1.750   -8.548  -8.325  1.00 0.00 ? 53  CYS A HA   2  
ATOM   4024  H  HB2  . CYS A 1 53  ? 3.609   -8.418  -9.853  1.00 0.00 ? 53  CYS A HB2  2  
ATOM   4025  H  HB3  . CYS A 1 53  ? 4.257   -8.646  -8.229  1.00 0.00 ? 53  CYS A HB3  2  
ATOM   4026  H  HG   . CYS A 1 53  ? 5.108   -10.908 -8.862  1.00 0.00 ? 53  CYS A HG   2  
ATOM   4027  N  N    . ASN A 1 54  ? 1.367   -9.651  -10.753 1.00 0.00 ? 54  ASN A N    2  
ATOM   4028  C  CA   . ASN A 1 54  ? 0.676   -10.313 -11.856 1.00 0.00 ? 54  ASN A CA   2  
ATOM   4029  C  C    . ASN A 1 54  ? -0.747  -10.688 -11.460 1.00 0.00 ? 54  ASN A C    2  
ATOM   4030  O  O    . ASN A 1 54  ? -1.068  -11.867 -11.305 1.00 0.00 ? 54  ASN A O    2  
ATOM   4031  C  CB   . ASN A 1 54  ? 1.437   -11.574 -12.271 1.00 0.00 ? 54  ASN A CB   2  
ATOM   4032  C  CG   . ASN A 1 54  ? 2.885   -11.230 -12.594 1.00 0.00 ? 54  ASN A CG   2  
ATOM   4033  O  OD1  . ASN A 1 54  ? 3.359   -10.146 -12.251 1.00 0.00 ? 54  ASN A OD1  2  
ATOM   4034  N  ND2  . ASN A 1 54  ? 3.622   -12.094 -13.238 1.00 0.00 ? 54  ASN A ND2  2  
ATOM   4035  H  H    . ASN A 1 54  ? 1.704   -8.739  -10.876 1.00 0.00 ? 54  ASN A H    2  
ATOM   4036  H  HA   . ASN A 1 54  ? 0.638   -9.639  -12.698 1.00 0.00 ? 54  ASN A HA   2  
ATOM   4037  H  HB2  . ASN A 1 54  ? 1.410   -12.290 -11.464 1.00 0.00 ? 54  ASN A HB2  2  
ATOM   4038  H  HB3  . ASN A 1 54  ? 0.969   -12.003 -13.144 1.00 0.00 ? 54  ASN A HB3  2  
ATOM   4039  H  HD21 . ASN A 1 54  ? 3.243   -12.956 -13.509 1.00 0.00 ? 54  ASN A HD21 2  
ATOM   4040  H  HD22 . ASN A 1 54  ? 4.555   -11.879 -13.450 1.00 0.00 ? 54  ASN A HD22 2  
ATOM   4041  N  N    . GLN A 1 55  ? -1.599  -9.682  -11.305 1.00 0.00 ? 55  GLN A N    2  
ATOM   4042  C  CA   . GLN A 1 55  ? -2.988  -9.921  -10.935 1.00 0.00 ? 55  GLN A CA   2  
ATOM   4043  C  C    . GLN A 1 55  ? -3.839  -10.114 -12.188 1.00 0.00 ? 55  GLN A C    2  
ATOM   4044  O  O    . GLN A 1 55  ? -4.148  -9.154  -12.893 1.00 0.00 ? 55  GLN A O    2  
ATOM   4045  C  CB   . GLN A 1 55  ? -3.518  -8.735  -10.125 1.00 0.00 ? 55  GLN A CB   2  
ATOM   4046  C  CG   . GLN A 1 55  ? -4.919  -9.050  -9.602  1.00 0.00 ? 55  GLN A CG   2  
ATOM   4047  C  CD   . GLN A 1 55  ? -5.494  -7.828  -8.893  1.00 0.00 ? 55  GLN A CD   2  
ATOM   4048  O  OE1  . GLN A 1 55  ? -6.457  -7.228  -9.370  1.00 0.00 ? 55  GLN A OE1  2  
ATOM   4049  N  NE2  . GLN A 1 55  ? -4.955  -7.419  -7.777  1.00 0.00 ? 55  GLN A NE2  2  
ATOM   4050  H  H    . GLN A 1 55  ? -1.289  -8.763  -11.446 1.00 0.00 ? 55  GLN A H    2  
ATOM   4051  H  HA   . GLN A 1 55  ? -3.045  -10.813 -10.328 1.00 0.00 ? 55  GLN A HA   2  
ATOM   4052  H  HB2  . GLN A 1 55  ? -2.857  -8.546  -9.293  1.00 0.00 ? 55  GLN A HB2  2  
ATOM   4053  H  HB3  . GLN A 1 55  ? -3.561  -7.860  -10.756 1.00 0.00 ? 55  GLN A HB3  2  
ATOM   4054  H  HG2  . GLN A 1 55  ? -5.559  -9.320  -10.429 1.00 0.00 ? 55  GLN A HG2  2  
ATOM   4055  H  HG3  . GLN A 1 55  ? -4.865  -9.874  -8.906  1.00 0.00 ? 55  GLN A HG3  2  
ATOM   4056  H  HE21 . GLN A 1 55  ? -4.186  -7.896  -7.400  1.00 0.00 ? 55  GLN A HE21 2  
ATOM   4057  H  HE22 . GLN A 1 55  ? -5.318  -6.635  -7.316  1.00 0.00 ? 55  GLN A HE22 2  
ATOM   4058  N  N    . ALA A 1 56  ? -4.209  -11.364 -12.462 1.00 0.00 ? 56  ALA A N    2  
ATOM   4059  C  CA   . ALA A 1 56  ? -5.020  -11.679 -13.639 1.00 0.00 ? 56  ALA A CA   2  
ATOM   4060  C  C    . ALA A 1 56  ? -6.421  -12.124 -13.216 1.00 0.00 ? 56  ALA A C    2  
ATOM   4061  O  O    . ALA A 1 56  ? -6.632  -12.532 -12.074 1.00 0.00 ? 56  ALA A O    2  
ATOM   4062  C  CB   . ALA A 1 56  ? -4.333  -12.790 -14.451 1.00 0.00 ? 56  ALA A CB   2  
ATOM   4063  H  H    . ALA A 1 56  ? -3.929  -12.089 -11.865 1.00 0.00 ? 56  ALA A H    2  
ATOM   4064  H  HA   . ALA A 1 56  ? -5.104  -10.797 -14.256 1.00 0.00 ? 56  ALA A HA   2  
ATOM   4065  H  HB1  . ALA A 1 56  ? -3.612  -13.295 -13.827 1.00 0.00 ? 56  ALA A HB1  2  
ATOM   4066  H  HB2  . ALA A 1 56  ? -3.828  -12.355 -15.301 1.00 0.00 ? 56  ALA A HB2  2  
ATOM   4067  H  HB3  . ALA A 1 56  ? -5.069  -13.502 -14.799 1.00 0.00 ? 56  ALA A HB3  2  
ATOM   4068  N  N    . PRO A 1 57  ? -7.373  -12.053 -14.111 1.00 0.00 ? 57  PRO A N    2  
ATOM   4069  C  CA   . PRO A 1 57  ? -8.781  -12.456 -13.824 1.00 0.00 ? 57  PRO A CA   2  
ATOM   4070  C  C    . PRO A 1 57  ? -8.948  -13.973 -13.762 1.00 0.00 ? 57  PRO A C    2  
ATOM   4071  O  O    . PRO A 1 57  ? -9.237  -14.615 -14.772 1.00 0.00 ? 57  PRO A O    2  
ATOM   4072  C  CB   . PRO A 1 57  ? -9.565  -11.871 -14.997 1.00 0.00 ? 57  PRO A CB   2  
ATOM   4073  C  CG   . PRO A 1 57  ? -8.591  -11.813 -16.126 1.00 0.00 ? 57  PRO A CG   2  
ATOM   4074  C  CD   . PRO A 1 57  ? -7.215  -11.580 -15.499 1.00 0.00 ? 57  PRO A CD   2  
ATOM   4075  H  HA   . PRO A 1 57  ? -9.119  -12.006 -12.905 1.00 0.00 ? 57  PRO A HA   2  
ATOM   4076  H  HB2  . PRO A 1 57  ? -10.399 -12.511 -15.249 1.00 0.00 ? 57  PRO A HB2  2  
ATOM   4077  H  HB3  . PRO A 1 57  ? -9.911  -10.878 -14.758 1.00 0.00 ? 57  PRO A HB3  2  
ATOM   4078  H  HG2  . PRO A 1 57  ? -8.602  -12.749 -16.670 1.00 0.00 ? 57  PRO A HG2  2  
ATOM   4079  H  HG3  . PRO A 1 57  ? -8.833  -10.994 -16.785 1.00 0.00 ? 57  PRO A HG3  2  
ATOM   4080  H  HD2  . PRO A 1 57  ? -6.460  -12.158 -16.018 1.00 0.00 ? 57  PRO A HD2  2  
ATOM   4081  H  HD3  . PRO A 1 57  ? -6.969  -10.530 -15.512 1.00 0.00 ? 57  PRO A HD3  2  
ATOM   4082  N  N    . HIS A 1 58  ? -8.771  -14.539 -12.572 1.00 0.00 ? 58  HIS A N    2  
ATOM   4083  C  CA   . HIS A 1 58  ? -8.912  -15.982 -12.398 1.00 0.00 ? 58  HIS A CA   2  
ATOM   4084  C  C    . HIS A 1 58  ? -10.386 -16.373 -12.368 1.00 0.00 ? 58  HIS A C    2  
ATOM   4085  O  O    . HIS A 1 58  ? -10.724 -17.541 -12.180 1.00 0.00 ? 58  HIS A O    2  
ATOM   4086  C  CB   . HIS A 1 58  ? -8.239  -16.424 -11.097 1.00 0.00 ? 58  HIS A CB   2  
ATOM   4087  C  CG   . HIS A 1 58  ? -8.353  -17.919 -10.961 1.00 0.00 ? 58  HIS A CG   2  
ATOM   4088  N  ND1  . HIS A 1 58  ? -8.707  -18.530 -9.768  1.00 0.00 ? 58  HIS A ND1  2  
ATOM   4089  C  CD2  . HIS A 1 58  ? -8.166  -18.937 -11.862 1.00 0.00 ? 58  HIS A CD2  2  
ATOM   4090  C  CE1  . HIS A 1 58  ? -8.722  -19.859 -9.981  1.00 0.00 ? 58  HIS A CE1  2  
ATOM   4091  N  NE2  . HIS A 1 58  ? -8.399  -20.161 -11.242 1.00 0.00 ? 58  HIS A NE2  2  
ATOM   4092  H  H    . HIS A 1 58  ? -8.547  -13.979 -11.799 1.00 0.00 ? 58  HIS A H    2  
ATOM   4093  H  HA   . HIS A 1 58  ? -8.433  -16.482 -13.226 1.00 0.00 ? 58  HIS A HA   2  
ATOM   4094  H  HB2  . HIS A 1 58  ? -7.197  -16.142 -11.115 1.00 0.00 ? 58  HIS A HB2  2  
ATOM   4095  H  HB3  . HIS A 1 58  ? -8.728  -15.949 -10.259 1.00 0.00 ? 58  HIS A HB3  2  
ATOM   4096  H  HD1  . HIS A 1 58  ? -8.908  -18.078 -8.921  1.00 0.00 ? 58  HIS A HD1  2  
ATOM   4097  H  HD2  . HIS A 1 58  ? -7.881  -18.807 -12.896 1.00 0.00 ? 58  HIS A HD2  2  
ATOM   4098  H  HE1  . HIS A 1 58  ? -8.966  -20.592 -9.226  1.00 0.00 ? 58  HIS A HE1  2  
ATOM   4099  H  HE2  . HIS A 1 58  ? -8.342  -21.052 -11.645 1.00 0.00 ? 58  HIS A HE2  2  
ATOM   4100  N  N    . LYS A 1 59  ? -11.258 -15.386 -12.552 1.00 0.00 ? 59  LYS A N    2  
ATOM   4101  C  CA   . LYS A 1 59  ? -12.694 -15.636 -12.543 1.00 0.00 ? 59  LYS A CA   2  
ATOM   4102  C  C    . LYS A 1 59  ? -13.438 -14.517 -13.269 1.00 0.00 ? 59  LYS A C    2  
ATOM   4103  O  O    . LYS A 1 59  ? -12.824 -13.663 -13.908 1.00 0.00 ? 59  LYS A O    2  
ATOM   4104  C  CB   . LYS A 1 59  ? -13.199 -15.746 -11.101 1.00 0.00 ? 59  LYS A CB   2  
ATOM   4105  C  CG   . LYS A 1 59  ? -12.910 -14.446 -10.341 1.00 0.00 ? 59  LYS A CG   2  
ATOM   4106  C  CD   . LYS A 1 59  ? -11.396 -14.263 -10.169 1.00 0.00 ? 59  LYS A CD   2  
ATOM   4107  C  CE   . LYS A 1 59  ? -11.108 -13.534 -8.854  1.00 0.00 ? 59  LYS A CE   2  
ATOM   4108  N  NZ   . LYS A 1 59  ? -9.693  -13.067 -8.845  1.00 0.00 ? 59  LYS A NZ   2  
ATOM   4109  H  H    . LYS A 1 59  ? -10.929 -14.474 -12.697 1.00 0.00 ? 59  LYS A H    2  
ATOM   4110  H  HA   . LYS A 1 59  ? -12.888 -16.569 -13.051 1.00 0.00 ? 59  LYS A HA   2  
ATOM   4111  H  HB2  . LYS A 1 59  ? -14.265 -15.927 -11.109 1.00 0.00 ? 59  LYS A HB2  2  
ATOM   4112  H  HB3  . LYS A 1 59  ? -12.701 -16.568 -10.608 1.00 0.00 ? 59  LYS A HB3  2  
ATOM   4113  H  HG2  . LYS A 1 59  ? -13.312 -13.611 -10.895 1.00 0.00 ? 59  LYS A HG2  2  
ATOM   4114  H  HG3  . LYS A 1 59  ? -13.379 -14.491 -9.369  1.00 0.00 ? 59  LYS A HG3  2  
ATOM   4115  H  HD2  . LYS A 1 59  ? -10.911 -15.229 -10.156 1.00 0.00 ? 59  LYS A HD2  2  
ATOM   4116  H  HD3  . LYS A 1 59  ? -11.010 -13.677 -10.989 1.00 0.00 ? 59  LYS A HD3  2  
ATOM   4117  H  HE2  . LYS A 1 59  ? -11.769 -12.686 -8.760  1.00 0.00 ? 59  LYS A HE2  2  
ATOM   4118  H  HE3  . LYS A 1 59  ? -11.269 -14.208 -8.025  1.00 0.00 ? 59  LYS A HE3  2  
ATOM   4119  H  HZ1  . LYS A 1 59  ? -9.639  -12.120 -9.272  1.00 0.00 ? 59  LYS A HZ1  2  
ATOM   4120  H  HZ2  . LYS A 1 59  ? -9.106  -13.726 -9.392  1.00 0.00 ? 59  LYS A HZ2  2  
ATOM   4121  H  HZ3  . LYS A 1 59  ? -9.348  -13.025 -7.864  1.00 0.00 ? 59  LYS A HZ3  2  
ATOM   4122  N  N    . HIS A 1 60  ? -14.764 -14.531 -13.168 1.00 0.00 ? 60  HIS A N    2  
ATOM   4123  C  CA   . HIS A 1 60  ? -15.580 -13.514 -13.822 1.00 0.00 ? 60  HIS A CA   2  
ATOM   4124  C  C    . HIS A 1 60  ? -15.497 -12.190 -13.067 1.00 0.00 ? 60  HIS A C    2  
ATOM   4125  O  O    . HIS A 1 60  ? -15.265 -12.168 -11.859 1.00 0.00 ? 60  HIS A O    2  
ATOM   4126  C  CB   . HIS A 1 60  ? -17.037 -13.975 -13.889 1.00 0.00 ? 60  HIS A CB   2  
ATOM   4127  C  CG   . HIS A 1 60  ? -17.130 -15.235 -14.705 1.00 0.00 ? 60  HIS A CG   2  
ATOM   4128  N  ND1  . HIS A 1 60  ? -16.411 -15.411 -15.877 1.00 0.00 ? 60  HIS A ND1  2  
ATOM   4129  C  CD2  . HIS A 1 60  ? -17.851 -16.390 -14.531 1.00 0.00 ? 60  HIS A CD2  2  
ATOM   4130  C  CE1  . HIS A 1 60  ? -16.714 -16.630 -16.360 1.00 0.00 ? 60  HIS A CE1  2  
ATOM   4131  N  NE2  . HIS A 1 60  ? -17.587 -17.269 -15.578 1.00 0.00 ? 60  HIS A NE2  2  
ATOM   4132  H  H    . HIS A 1 60  ? -15.200 -15.237 -12.648 1.00 0.00 ? 60  HIS A H    2  
ATOM   4133  H  HA   . HIS A 1 60  ? -15.216 -13.366 -14.828 1.00 0.00 ? 60  HIS A HA   2  
ATOM   4134  H  HB2  . HIS A 1 60  ? -17.401 -14.165 -12.889 1.00 0.00 ? 60  HIS A HB2  2  
ATOM   4135  H  HB3  . HIS A 1 60  ? -17.639 -13.204 -14.349 1.00 0.00 ? 60  HIS A HB3  2  
ATOM   4136  H  HD1  . HIS A 1 60  ? -15.796 -14.764 -16.282 1.00 0.00 ? 60  HIS A HD1  2  
ATOM   4137  H  HD2  . HIS A 1 60  ? -18.522 -16.587 -13.708 1.00 0.00 ? 60  HIS A HD2  2  
ATOM   4138  H  HE1  . HIS A 1 60  ? -16.301 -17.040 -17.269 1.00 0.00 ? 60  HIS A HE1  2  
ATOM   4139  H  HE2  . HIS A 1 60  ? -17.962 -18.165 -15.711 1.00 0.00 ? 60  HIS A HE2  2  
ATOM   4140  N  N    . GLY A 1 61  ? -15.689 -11.091 -13.789 1.00 0.00 ? 61  GLY A N    2  
ATOM   4141  C  CA   . GLY A 1 61  ? -15.633 -9.768  -13.176 1.00 0.00 ? 61  GLY A CA   2  
ATOM   4142  C  C    . GLY A 1 61  ? -14.217 -9.205  -13.232 1.00 0.00 ? 61  GLY A C    2  
ATOM   4143  O  O    . GLY A 1 61  ? -13.594 -8.961  -12.198 1.00 0.00 ? 61  GLY A O    2  
ATOM   4144  H  H    . GLY A 1 61  ? -15.870 -11.170 -14.748 1.00 0.00 ? 61  GLY A H    2  
ATOM   4145  H  HA2  . GLY A 1 61  ? -16.301 -9.105  -13.704 1.00 0.00 ? 61  GLY A HA2  2  
ATOM   4146  H  HA3  . GLY A 1 61  ? -15.943 -9.841  -12.144 1.00 0.00 ? 61  GLY A HA3  2  
ATOM   4147  N  N    . PHE A 1 62  ? -13.715 -9.003  -14.445 1.00 0.00 ? 62  PHE A N    2  
ATOM   4148  C  CA   . PHE A 1 62  ? -12.371 -8.470  -14.625 1.00 0.00 ? 62  PHE A CA   2  
ATOM   4149  C  C    . PHE A 1 62  ? -12.394 -6.945  -14.638 1.00 0.00 ? 62  PHE A C    2  
ATOM   4150  O  O    . PHE A 1 62  ? -13.114 -6.332  -15.427 1.00 0.00 ? 62  PHE A O    2  
ATOM   4151  C  CB   . PHE A 1 62  ? -11.780 -8.982  -15.940 1.00 0.00 ? 62  PHE A CB   2  
ATOM   4152  C  CG   . PHE A 1 62  ? -12.679 -8.580  -17.084 1.00 0.00 ? 62  PHE A CG   2  
ATOM   4153  C  CD1  . PHE A 1 62  ? -12.476 -7.358  -17.736 1.00 0.00 ? 62  PHE A CD1  2  
ATOM   4154  C  CD2  . PHE A 1 62  ? -13.716 -9.428  -17.491 1.00 0.00 ? 62  PHE A CD2  2  
ATOM   4155  C  CE1  . PHE A 1 62  ? -13.310 -6.985  -18.796 1.00 0.00 ? 62  PHE A CE1  2  
ATOM   4156  C  CE2  . PHE A 1 62  ? -14.550 -9.055  -18.552 1.00 0.00 ? 62  PHE A CE2  2  
ATOM   4157  C  CZ   . PHE A 1 62  ? -14.347 -7.832  -19.204 1.00 0.00 ? 62  PHE A CZ   2  
ATOM   4158  H  H    . PHE A 1 62  ? -14.258 -9.218  -15.232 1.00 0.00 ? 62  PHE A H    2  
ATOM   4159  H  HA   . PHE A 1 62  ? -11.748 -8.805  -13.810 1.00 0.00 ? 62  PHE A HA   2  
ATOM   4160  H  HB2  . PHE A 1 62  ? -10.798 -8.556  -16.085 1.00 0.00 ? 62  PHE A HB2  2  
ATOM   4161  H  HB3  . PHE A 1 62  ? -11.705 -10.059 -15.906 1.00 0.00 ? 62  PHE A HB3  2  
ATOM   4162  H  HD1  . PHE A 1 62  ? -11.676 -6.705  -17.422 1.00 0.00 ? 62  PHE A HD1  2  
ATOM   4163  H  HD2  . PHE A 1 62  ? -13.871 -10.371 -16.987 1.00 0.00 ? 62  PHE A HD2  2  
ATOM   4164  H  HE1  . PHE A 1 62  ? -13.154 -6.041  -19.300 1.00 0.00 ? 62  PHE A HE1  2  
ATOM   4165  H  HE2  . PHE A 1 62  ? -15.349 -9.708  -18.866 1.00 0.00 ? 62  PHE A HE2  2  
ATOM   4166  H  HZ   . PHE A 1 62  ? -14.990 -7.543  -20.021 1.00 0.00 ? 62  PHE A HZ   2  
ATOM   4167  N  N    . LEU A 1 63  ? -11.599 -6.338  -13.761 1.00 0.00 ? 63  LEU A N    2  
ATOM   4168  C  CA   . LEU A 1 63  ? -11.528 -4.881  -13.680 1.00 0.00 ? 63  LEU A CA   2  
ATOM   4169  C  C    . LEU A 1 63  ? -10.178 -4.387  -14.193 1.00 0.00 ? 63  LEU A C    2  
ATOM   4170  O  O    . LEU A 1 63  ? -9.349  -5.179  -14.641 1.00 0.00 ? 63  LEU A O    2  
ATOM   4171  C  CB   . LEU A 1 63  ? -11.724 -4.429  -12.231 1.00 0.00 ? 63  LEU A CB   2  
ATOM   4172  C  CG   . LEU A 1 63  ? -13.219 -4.438  -11.887 1.00 0.00 ? 63  LEU A CG   2  
ATOM   4173  C  CD1  . LEU A 1 63  ? -13.398 -4.670  -10.385 1.00 0.00 ? 63  LEU A CD1  2  
ATOM   4174  C  CD2  . LEU A 1 63  ? -13.845 -3.093  -12.269 1.00 0.00 ? 63  LEU A CD2  2  
ATOM   4175  H  H    . LEU A 1 63  ? -11.045 -6.880  -13.160 1.00 0.00 ? 63  LEU A H    2  
ATOM   4176  H  HA   . LEU A 1 63  ? -12.311 -4.452  -14.287 1.00 0.00 ? 63  LEU A HA   2  
ATOM   4177  H  HB2  . LEU A 1 63  ? -11.197 -5.104  -11.571 1.00 0.00 ? 63  LEU A HB2  2  
ATOM   4178  H  HB3  . LEU A 1 63  ? -11.334 -3.429  -12.109 1.00 0.00 ? 63  LEU A HB3  2  
ATOM   4179  H  HG   . LEU A 1 63  ? -13.710 -5.232  -12.432 1.00 0.00 ? 63  LEU A HG   2  
ATOM   4180  H  HD11 . LEU A 1 63  ? -14.403 -4.398  -10.096 1.00 0.00 ? 63  LEU A HD11 2  
ATOM   4181  H  HD12 . LEU A 1 63  ? -12.690 -4.064  -9.840  1.00 0.00 ? 63  LEU A HD12 2  
ATOM   4182  H  HD13 . LEU A 1 63  ? -13.229 -5.713  -10.160 1.00 0.00 ? 63  LEU A HD13 2  
ATOM   4183  H  HD21 . LEU A 1 63  ? -13.681 -2.904  -13.319 1.00 0.00 ? 63  LEU A HD21 2  
ATOM   4184  H  HD22 . LEU A 1 63  ? -13.390 -2.305  -11.686 1.00 0.00 ? 63  LEU A HD22 2  
ATOM   4185  H  HD23 . LEU A 1 63  ? -14.906 -3.120  -12.070 1.00 0.00 ? 63  LEU A HD23 2  
ATOM   4186  N  N    . GLU A 1 64  ? -9.966  -3.077  -14.128 1.00 0.00 ? 64  GLU A N    2  
ATOM   4187  C  CA   . GLU A 1 64  ? -8.713  -2.496  -14.597 1.00 0.00 ? 64  GLU A CA   2  
ATOM   4188  C  C    . GLU A 1 64  ? -7.577  -2.774  -13.621 1.00 0.00 ? 64  GLU A C    2  
ATOM   4189  O  O    . GLU A 1 64  ? -7.724  -3.550  -12.676 1.00 0.00 ? 64  GLU A O    2  
ATOM   4190  C  CB   . GLU A 1 64  ? -8.856  -0.984  -14.780 1.00 0.00 ? 64  GLU A CB   2  
ATOM   4191  C  CG   . GLU A 1 64  ? -10.304 -0.641  -15.155 1.00 0.00 ? 64  GLU A CG   2  
ATOM   4192  C  CD   . GLU A 1 64  ? -11.106 -0.295  -13.905 1.00 0.00 ? 64  GLU A CD   2  
ATOM   4193  O  OE1  . GLU A 1 64  ? -11.610 -1.211  -13.276 1.00 0.00 ? 64  GLU A OE1  2  
ATOM   4194  O  OE2  . GLU A 1 64  ? -11.206 0.881   -13.595 1.00 0.00 ? 64  GLU A OE2  2  
ATOM   4195  H  H    . GLU A 1 64  ? -10.663 -2.493  -13.765 1.00 0.00 ? 64  GLU A H    2  
ATOM   4196  H  HA   . GLU A 1 64  ? -8.466  -2.930  -15.552 1.00 0.00 ? 64  GLU A HA   2  
ATOM   4197  H  HB2  . GLU A 1 64  ? -8.583  -0.480  -13.861 1.00 0.00 ? 64  GLU A HB2  2  
ATOM   4198  H  HB3  . GLU A 1 64  ? -8.198  -0.659  -15.573 1.00 0.00 ? 64  GLU A HB3  2  
ATOM   4199  H  HG2  . GLU A 1 64  ? -10.302 0.202   -15.825 1.00 0.00 ? 64  GLU A HG2  2  
ATOM   4200  H  HG3  . GLU A 1 64  ? -10.761 -1.485  -15.651 1.00 0.00 ? 64  GLU A HG3  2  
ATOM   4201  N  N    . GLY A 1 65  ? -6.447  -2.126  -13.867 1.00 0.00 ? 65  GLY A N    2  
ATOM   4202  C  CA   . GLY A 1 65  ? -5.271  -2.285  -13.024 1.00 0.00 ? 65  GLY A CA   2  
ATOM   4203  C  C    . GLY A 1 65  ? -5.612  -2.139  -11.543 1.00 0.00 ? 65  GLY A C    2  
ATOM   4204  O  O    . GLY A 1 65  ? -5.936  -1.048  -11.076 1.00 0.00 ? 65  GLY A O    2  
ATOM   4205  H  H    . GLY A 1 65  ? -6.402  -1.523  -14.637 1.00 0.00 ? 65  GLY A H    2  
ATOM   4206  H  HA2  . GLY A 1 65  ? -4.840  -3.261  -13.196 1.00 0.00 ? 65  GLY A HA2  2  
ATOM   4207  H  HA3  . GLY A 1 65  ? -4.555  -1.527  -13.293 1.00 0.00 ? 65  GLY A HA3  2  
ATOM   4208  N  N    . ARG A 1 66  ? -5.528  -3.245  -10.810 1.00 0.00 ? 66  ARG A N    2  
ATOM   4209  C  CA   . ARG A 1 66  ? -5.820  -3.234  -9.383  1.00 0.00 ? 66  ARG A CA   2  
ATOM   4210  C  C    . ARG A 1 66  ? -4.553  -2.962  -8.576  1.00 0.00 ? 66  ARG A C    2  
ATOM   4211  O  O    . ARG A 1 66  ? -3.595  -3.734  -8.630  1.00 0.00 ? 66  ARG A O    2  
ATOM   4212  C  CB   . ARG A 1 66  ? -6.409  -4.587  -8.970  1.00 0.00 ? 66  ARG A CB   2  
ATOM   4213  C  CG   . ARG A 1 66  ? -7.919  -4.576  -9.194  1.00 0.00 ? 66  ARG A CG   2  
ATOM   4214  C  CD   . ARG A 1 66  ? -8.483  -5.981  -8.978  1.00 0.00 ? 66  ARG A CD   2  
ATOM   4215  N  NE   . ARG A 1 66  ? -9.939  -5.935  -8.916  1.00 0.00 ? 66  ARG A NE   2  
ATOM   4216  C  CZ   . ARG A 1 66  ? -10.566 -5.518  -7.822  1.00 0.00 ? 66  ARG A CZ   2  
ATOM   4217  N  NH1  . ARG A 1 66  ? -9.878  -5.139  -6.781  1.00 0.00 ? 66  ARG A NH1  2  
ATOM   4218  N  NH2  . ARG A 1 66  ? -11.871 -5.487  -7.788  1.00 0.00 ? 66  ARG A NH2  2  
ATOM   4219  H  H    . ARG A 1 66  ? -5.264  -4.085  -11.235 1.00 0.00 ? 66  ARG A H    2  
ATOM   4220  H  HA   . ARG A 1 66  ? -6.541  -2.458  -9.176  1.00 0.00 ? 66  ARG A HA   2  
ATOM   4221  H  HB2  . ARG A 1 66  ? -5.962  -5.372  -9.565  1.00 0.00 ? 66  ARG A HB2  2  
ATOM   4222  H  HB3  . ARG A 1 66  ? -6.204  -4.769  -7.924  1.00 0.00 ? 66  ARG A HB3  2  
ATOM   4223  H  HG2  . ARG A 1 66  ? -8.373  -3.891  -8.495  1.00 0.00 ? 66  ARG A HG2  2  
ATOM   4224  H  HG3  . ARG A 1 66  ? -8.131  -4.255  -10.203 1.00 0.00 ? 66  ARG A HG3  2  
ATOM   4225  H  HD2  . ARG A 1 66  ? -8.182  -6.617  -9.798  1.00 0.00 ? 66  ARG A HD2  2  
ATOM   4226  H  HD3  . ARG A 1 66  ? -8.094  -6.384  -8.054  1.00 0.00 ? 66  ARG A HD3  2  
ATOM   4227  H  HE   . ARG A 1 66  ? -10.464 -6.218  -9.694  1.00 0.00 ? 66  ARG A HE   2  
ATOM   4228  H  HH11 . ARG A 1 66  ? -8.878  -5.163  -6.808  1.00 0.00 ? 66  ARG A HH11 2  
ATOM   4229  H  HH12 . ARG A 1 66  ? -10.348 -4.827  -5.956  1.00 0.00 ? 66  ARG A HH12 2  
ATOM   4230  H  HH21 . ARG A 1 66  ? -12.399 -5.777  -8.586  1.00 0.00 ? 66  ARG A HH21 2  
ATOM   4231  H  HH22 . ARG A 1 66  ? -12.343 -5.174  -6.964  1.00 0.00 ? 66  ARG A HH22 2  
ATOM   4232  N  N    . HIS A 1 67  ? -4.557  -1.866  -7.821  1.00 0.00 ? 67  HIS A N    2  
ATOM   4233  C  CA   . HIS A 1 67  ? -3.406  -1.508  -6.997  1.00 0.00 ? 67  HIS A CA   2  
ATOM   4234  C  C    . HIS A 1 67  ? -3.708  -1.796  -5.524  1.00 0.00 ? 67  HIS A C    2  
ATOM   4235  O  O    . HIS A 1 67  ? -4.864  -1.969  -5.141  1.00 0.00 ? 67  HIS A O    2  
ATOM   4236  C  CB   . HIS A 1 67  ? -3.048  -0.029  -7.214  1.00 0.00 ? 67  HIS A CB   2  
ATOM   4237  C  CG   . HIS A 1 67  ? -3.225  0.319   -8.670  1.00 0.00 ? 67  HIS A CG   2  
ATOM   4238  N  ND1  . HIS A 1 67  ? -3.897  1.462   -9.091  1.00 0.00 ? 67  HIS A ND1  2  
ATOM   4239  C  CD2  . HIS A 1 67  ? -2.823  -0.322  -9.816  1.00 0.00 ? 67  HIS A CD2  2  
ATOM   4240  C  CE1  . HIS A 1 67  ? -3.879  1.465   -10.438 1.00 0.00 ? 67  HIS A CE1  2  
ATOM   4241  N  NE2  . HIS A 1 67  ? -3.237  0.402   -10.930 1.00 0.00 ? 67  HIS A NE2  2  
ATOM   4242  H  H    . HIS A 1 67  ? -5.351  -1.291  -7.813  1.00 0.00 ? 67  HIS A H    2  
ATOM   4243  H  HA   . HIS A 1 67  ? -2.560  -2.112  -7.291  1.00 0.00 ? 67  HIS A HA   2  
ATOM   4244  H  HB2  . HIS A 1 67  ? -3.689  0.595   -6.619  1.00 0.00 ? 67  HIS A HB2  2  
ATOM   4245  H  HB3  . HIS A 1 67  ? -2.020  0.137   -6.930  1.00 0.00 ? 67  HIS A HB3  2  
ATOM   4246  H  HD2  . HIS A 1 67  ? -2.272  -1.250  -9.849  1.00 0.00 ? 67  HIS A HD2  2  
ATOM   4247  H  HE1  . HIS A 1 67  ? -4.331  2.233   -11.048 1.00 0.00 ? 67  HIS A HE1  2  
ATOM   4248  H  HE2  . HIS A 1 67  ? -3.088  0.181   -11.872 1.00 0.00 ? 67  HIS A HE2  2  
ATOM   4249  N  N    . ALA A 1 68  ? -2.654  -1.879  -4.719  1.00 0.00 ? 68  ALA A N    2  
ATOM   4250  C  CA   . ALA A 1 68  ? -2.783  -2.183  -3.292  1.00 0.00 ? 68  ALA A CA   2  
ATOM   4251  C  C    . ALA A 1 68  ? -4.149  -1.769  -2.727  1.00 0.00 ? 68  ALA A C    2  
ATOM   4252  O  O    . ALA A 1 68  ? -4.808  -2.552  -2.040  1.00 0.00 ? 68  ALA A O    2  
ATOM   4253  C  CB   . ALA A 1 68  ? -1.669  -1.479  -2.525  1.00 0.00 ? 68  ALA A CB   2  
ATOM   4254  H  H    . ALA A 1 68  ? -1.760  -1.754  -5.097  1.00 0.00 ? 68  ALA A H    2  
ATOM   4255  H  HA   . ALA A 1 68  ? -2.665  -3.247  -3.156  1.00 0.00 ? 68  ALA A HA   2  
ATOM   4256  H  HB1  . ALA A 1 68  ? -0.783  -1.430  -3.144  1.00 0.00 ? 68  ALA A HB1  2  
ATOM   4257  H  HB2  . ALA A 1 68  ? -1.449  -2.035  -1.627  1.00 0.00 ? 68  ALA A HB2  2  
ATOM   4258  H  HB3  . ALA A 1 68  ? -1.982  -0.480  -2.266  1.00 0.00 ? 68  ALA A HB3  2  
ATOM   4259  N  N    . GLU A 1 69  ? -4.570  -0.545  -3.013  1.00 0.00 ? 69  GLU A N    2  
ATOM   4260  C  CA   . GLU A 1 69  ? -5.861  -0.056  -2.522  1.00 0.00 ? 69  GLU A CA   2  
ATOM   4261  C  C    . GLU A 1 69  ? -6.959  -1.104  -2.759  1.00 0.00 ? 69  GLU A C    2  
ATOM   4262  O  O    . GLU A 1 69  ? -7.551  -1.631  -1.809  1.00 0.00 ? 69  GLU A O    2  
ATOM   4263  C  CB   . GLU A 1 69  ? -6.225  1.280   -3.218  1.00 0.00 ? 69  GLU A CB   2  
ATOM   4264  C  CG   . GLU A 1 69  ? -5.216  1.569   -4.338  1.00 0.00 ? 69  GLU A CG   2  
ATOM   4265  C  CD   . GLU A 1 69  ? -3.897  2.046   -3.738  1.00 0.00 ? 69  GLU A CD   2  
ATOM   4266  O  OE1  . GLU A 1 69  ? -3.898  2.408   -2.572  1.00 0.00 ? 69  GLU A OE1  2  
ATOM   4267  O  OE2  . GLU A 1 69  ? -2.909  2.043   -4.451  1.00 0.00 ? 69  GLU A OE2  2  
ATOM   4268  H  H    . GLU A 1 69  ? -4.009  0.040   -3.562  1.00 0.00 ? 69  GLU A H    2  
ATOM   4269  H  HA   . GLU A 1 69  ? -5.779  0.119   -1.459  1.00 0.00 ? 69  GLU A HA   2  
ATOM   4270  H  HB2  . GLU A 1 69  ? -7.223  1.222   -3.635  1.00 0.00 ? 69  GLU A HB2  2  
ATOM   4271  H  HB3  . GLU A 1 69  ? -6.189  2.086   -2.500  1.00 0.00 ? 69  GLU A HB3  2  
ATOM   4272  H  HG2  . GLU A 1 69  ? -5.048  0.667   -4.902  1.00 0.00 ? 69  GLU A HG2  2  
ATOM   4273  H  HG3  . GLU A 1 69  ? -5.605  2.335   -4.994  1.00 0.00 ? 69  GLU A HG3  2  
ATOM   4274  N  N    . LEU A 1 70  ? -7.226  -1.404  -4.029  1.00 0.00 ? 70  LEU A N    2  
ATOM   4275  C  CA   . LEU A 1 70  ? -8.256  -2.384  -4.374  1.00 0.00 ? 70  LEU A CA   2  
ATOM   4276  C  C    . LEU A 1 70  ? -7.846  -3.782  -3.915  1.00 0.00 ? 70  LEU A C    2  
ATOM   4277  O  O    . LEU A 1 70  ? -8.694  -4.636  -3.653  1.00 0.00 ? 70  LEU A O    2  
ATOM   4278  C  CB   . LEU A 1 70  ? -8.503  -2.398  -5.885  1.00 0.00 ? 70  LEU A CB   2  
ATOM   4279  C  CG   . LEU A 1 70  ? -8.633  -0.959  -6.413  1.00 0.00 ? 70  LEU A CG   2  
ATOM   4280  C  CD1  . LEU A 1 70  ? -9.510  -0.129  -5.462  1.00 0.00 ? 70  LEU A CD1  2  
ATOM   4281  C  CD2  . LEU A 1 70  ? -7.244  -0.306  -6.544  1.00 0.00 ? 70  LEU A CD2  2  
ATOM   4282  H  H    . LEU A 1 70  ? -6.724  -0.962  -4.741  1.00 0.00 ? 70  LEU A H    2  
ATOM   4283  H  HA   . LEU A 1 70  ? -9.173  -2.111  -3.883  1.00 0.00 ? 70  LEU A HA   2  
ATOM   4284  H  HB2  . LEU A 1 70  ? -7.686  -2.899  -6.380  1.00 0.00 ? 70  LEU A HB2  2  
ATOM   4285  H  HB3  . LEU A 1 70  ? -9.419  -2.932  -6.089  1.00 0.00 ? 70  LEU A HB3  2  
ATOM   4286  H  HG   . LEU A 1 70  ? -9.103  -0.987  -7.385  1.00 0.00 ? 70  LEU A HG   2  
ATOM   4287  H  HD11 . LEU A 1 70  ? -9.752  0.815   -5.926  1.00 0.00 ? 70  LEU A HD11 2  
ATOM   4288  H  HD12 . LEU A 1 70  ? -8.977  0.053   -4.541  1.00 0.00 ? 70  LEU A HD12 2  
ATOM   4289  H  HD13 . LEU A 1 70  ? -10.420 -0.667  -5.251  1.00 0.00 ? 70  LEU A HD13 2  
ATOM   4290  H  HD21 . LEU A 1 70  ? -7.169  0.177   -7.504  1.00 0.00 ? 70  LEU A HD21 2  
ATOM   4291  H  HD22 . LEU A 1 70  ? -6.469  -1.052  -6.463  1.00 0.00 ? 70  LEU A HD22 2  
ATOM   4292  H  HD23 . LEU A 1 70  ? -7.110  0.429   -5.765  1.00 0.00 ? 70  LEU A HD23 2  
ATOM   4293  N  N    . CYS A 1 71  ? -6.541  -4.010  -3.841  1.00 0.00 ? 71  CYS A N    2  
ATOM   4294  C  CA   . CYS A 1 71  ? -6.015  -5.315  -3.433  1.00 0.00 ? 71  CYS A CA   2  
ATOM   4295  C  C    . CYS A 1 71  ? -6.646  -5.810  -2.127  1.00 0.00 ? 71  CYS A C    2  
ATOM   4296  O  O    . CYS A 1 71  ? -7.331  -6.839  -2.117  1.00 0.00 ? 71  CYS A O    2  
ATOM   4297  C  CB   . CYS A 1 71  ? -4.495  -5.246  -3.280  1.00 0.00 ? 71  CYS A CB   2  
ATOM   4298  S  SG   . CYS A 1 71  ? -3.824  -6.925  -3.188  1.00 0.00 ? 71  CYS A SG   2  
ATOM   4299  H  H    . CYS A 1 71  ? -5.918  -3.290  -4.081  1.00 0.00 ? 71  CYS A H    2  
ATOM   4300  H  HA   . CYS A 1 71  ? -6.242  -6.028  -4.211  1.00 0.00 ? 71  CYS A HA   2  
ATOM   4301  H  HB2  . CYS A 1 71  ? -4.073  -4.737  -4.133  1.00 0.00 ? 71  CYS A HB2  2  
ATOM   4302  H  HB3  . CYS A 1 71  ? -4.247  -4.709  -2.378  1.00 0.00 ? 71  CYS A HB3  2  
ATOM   4303  H  HG   . CYS A 1 71  ? -4.016  -7.273  -2.314  1.00 0.00 ? 71  CYS A HG   2  
ATOM   4304  N  N    . PHE A 1 72  ? -6.440  -5.100  -1.018  1.00 0.00 ? 72  PHE A N    2  
ATOM   4305  C  CA   . PHE A 1 72  ? -7.044  -5.561  0.226   1.00 0.00 ? 72  PHE A CA   2  
ATOM   4306  C  C    . PHE A 1 72  ? -8.542  -5.451  0.090   1.00 0.00 ? 72  PHE A C    2  
ATOM   4307  O  O    . PHE A 1 72  ? -9.279  -6.360  0.452   1.00 0.00 ? 72  PHE A O    2  
ATOM   4308  C  CB   . PHE A 1 72  ? -6.549  -4.790  1.452   1.00 0.00 ? 72  PHE A CB   2  
ATOM   4309  C  CG   . PHE A 1 72  ? -6.615  -3.305  1.224   1.00 0.00 ? 72  PHE A CG   2  
ATOM   4310  C  CD1  . PHE A 1 72  ? -7.843  -2.633  1.294   1.00 0.00 ? 72  PHE A CD1  2  
ATOM   4311  C  CD2  . PHE A 1 72  ? -5.439  -2.590  0.967   1.00 0.00 ? 72  PHE A CD2  2  
ATOM   4312  C  CE1  . PHE A 1 72  ? -7.889  -1.257  1.099   1.00 0.00 ? 72  PHE A CE1  2  
ATOM   4313  C  CE2  . PHE A 1 72  ? -5.490  -1.215  0.777   1.00 0.00 ? 72  PHE A CE2  2  
ATOM   4314  C  CZ   . PHE A 1 72  ? -6.712  -0.553  0.842   1.00 0.00 ? 72  PHE A CZ   2  
ATOM   4315  H  H    . PHE A 1 72  ? -5.908  -4.276  -1.042  1.00 0.00 ? 72  PHE A H    2  
ATOM   4316  H  HA   . PHE A 1 72  ? -6.793  -6.607  0.354   1.00 0.00 ? 72  PHE A HA   2  
ATOM   4317  H  HB2  . PHE A 1 72  ? -7.163  -5.043  2.302   1.00 0.00 ? 72  PHE A HB2  2  
ATOM   4318  H  HB3  . PHE A 1 72  ? -5.530  -5.071  1.656   1.00 0.00 ? 72  PHE A HB3  2  
ATOM   4319  H  HD1  . PHE A 1 72  ? -8.753  -3.174  1.500   1.00 0.00 ? 72  PHE A HD1  2  
ATOM   4320  H  HD2  . PHE A 1 72  ? -4.493  -3.100  0.917   1.00 0.00 ? 72  PHE A HD2  2  
ATOM   4321  H  HE1  . PHE A 1 72  ? -8.834  -0.738  1.146   1.00 0.00 ? 72  PHE A HE1  2  
ATOM   4322  H  HE2  . PHE A 1 72  ? -4.584  -0.661  0.578   1.00 0.00 ? 72  PHE A HE2  2  
ATOM   4323  H  HZ   . PHE A 1 72  ? -6.746  0.500   0.702   1.00 0.00 ? 72  PHE A HZ   2  
ATOM   4324  N  N    . LEU A 1 73  ? -8.991  -4.352  -0.491  1.00 0.00 ? 73  LEU A N    2  
ATOM   4325  C  CA   . LEU A 1 73  ? -10.403 -4.170  -0.729  1.00 0.00 ? 73  LEU A CA   2  
ATOM   4326  C  C    . LEU A 1 73  ? -11.011 -5.498  -1.181  1.00 0.00 ? 73  LEU A C    2  
ATOM   4327  O  O    . LEU A 1 73  ? -12.192 -5.769  -0.966  1.00 0.00 ? 73  LEU A O    2  
ATOM   4328  C  CB   . LEU A 1 73  ? -10.539 -3.130  -1.826  1.00 0.00 ? 73  LEU A CB   2  
ATOM   4329  C  CG   . LEU A 1 73  ? -11.816 -2.314  -1.645  1.00 0.00 ? 73  LEU A CG   2  
ATOM   4330  C  CD1  . LEU A 1 73  ? -11.662 -1.327  -0.466  1.00 0.00 ? 73  LEU A CD1  2  
ATOM   4331  C  CD2  . LEU A 1 73  ? -12.073 -1.552  -2.947  1.00 0.00 ? 73  LEU A CD2  2  
ATOM   4332  H  H    . LEU A 1 73  ? -8.358  -3.662  -0.802  1.00 0.00 ? 73  LEU A H    2  
ATOM   4333  H  HA   . LEU A 1 73  ? -10.890 -3.823  0.169   1.00 0.00 ? 73  LEU A HA   2  
ATOM   4334  H  HB2  . LEU A 1 73  ? -9.679  -2.478  -1.780  1.00 0.00 ? 73  LEU A HB2  2  
ATOM   4335  H  HB3  . LEU A 1 73  ? -10.562 -3.620  -2.791  1.00 0.00 ? 73  LEU A HB3  2  
ATOM   4336  H  HG   . LEU A 1 73  ? -12.644 -2.980  -1.449  1.00 0.00 ? 73  LEU A HG   2  
ATOM   4337  H  HD11 . LEU A 1 73  ? -12.346 -1.606  0.321   1.00 0.00 ? 73  LEU A HD11 2  
ATOM   4338  H  HD12 . LEU A 1 73  ? -11.888 -0.323  -0.793  1.00 0.00 ? 73  LEU A HD12 2  
ATOM   4339  H  HD13 . LEU A 1 73  ? -10.652 -1.356  -0.086  1.00 0.00 ? 73  LEU A HD13 2  
ATOM   4340  H  HD21 . LEU A 1 73  ? -12.957 -0.943  -2.844  1.00 0.00 ? 73  LEU A HD21 2  
ATOM   4341  H  HD22 . LEU A 1 73  ? -12.211 -2.253  -3.754  1.00 0.00 ? 73  LEU A HD22 2  
ATOM   4342  H  HD23 . LEU A 1 73  ? -11.220 -0.928  -3.163  1.00 0.00 ? 73  LEU A HD23 2  
ATOM   4343  N  N    . ASP A 1 74  ? -10.168 -6.315  -1.816  1.00 0.00 ? 74  ASP A N    2  
ATOM   4344  C  CA   . ASP A 1 74  ? -10.591 -7.620  -2.312  1.00 0.00 ? 74  ASP A CA   2  
ATOM   4345  C  C    . ASP A 1 74  ? -10.303 -8.733  -1.305  1.00 0.00 ? 74  ASP A C    2  
ATOM   4346  O  O    . ASP A 1 74  ? -10.938 -9.786  -1.361  1.00 0.00 ? 74  ASP A O    2  
ATOM   4347  C  CB   . ASP A 1 74  ? -9.889  -7.937  -3.634  1.00 0.00 ? 74  ASP A CB   2  
ATOM   4348  C  CG   . ASP A 1 74  ? -10.304 -6.931  -4.701  1.00 0.00 ? 74  ASP A CG   2  
ATOM   4349  O  OD1  . ASP A 1 74  ? -10.675 -5.828  -4.335  1.00 0.00 ? 74  ASP A OD1  2  
ATOM   4350  O  OD2  . ASP A 1 74  ? -10.247 -7.279  -5.869  1.00 0.00 ? 74  ASP A OD2  2  
ATOM   4351  H  H    . ASP A 1 74  ? -9.240  -6.029  -1.951  1.00 0.00 ? 74  ASP A H    2  
ATOM   4352  H  HA   . ASP A 1 74  ? -11.657 -7.594  -2.489  1.00 0.00 ? 74  ASP A HA   2  
ATOM   4353  H  HB2  . ASP A 1 74  ? -8.820  -7.890  -3.494  1.00 0.00 ? 74  ASP A HB2  2  
ATOM   4354  H  HB3  . ASP A 1 74  ? -10.164 -8.931  -3.956  1.00 0.00 ? 74  ASP A HB3  2  
ATOM   4355  N  N    . VAL A 1 75  ? -9.354  -8.530  -0.387  1.00 0.00 ? 75  VAL A N    2  
ATOM   4356  C  CA   . VAL A 1 75  ? -9.062  -9.576  0.580   1.00 0.00 ? 75  VAL A CA   2  
ATOM   4357  C  C    . VAL A 1 75  ? -10.160 -9.683  1.647   1.00 0.00 ? 75  VAL A C    2  
ATOM   4358  O  O    . VAL A 1 75  ? -10.643 -10.756 1.950   1.00 0.00 ? 75  VAL A O    2  
ATOM   4359  C  CB   . VAL A 1 75  ? -7.713  -9.363  1.269   1.00 0.00 ? 75  VAL A CB   2  
ATOM   4360  C  CG1  . VAL A 1 75  ? -7.842  -8.381  2.435   1.00 0.00 ? 75  VAL A CG1  2  
ATOM   4361  C  CG2  . VAL A 1 75  ? -7.271  -10.713 1.803   1.00 0.00 ? 75  VAL A CG2  2  
ATOM   4362  H  H    . VAL A 1 75  ? -8.850  -7.690  -0.363  1.00 0.00 ? 75  VAL A H    2  
ATOM   4363  H  HA   . VAL A 1 75  ? -9.013  -10.507 0.040   1.00 0.00 ? 75  VAL A HA   2  
ATOM   4364  H  HB   . VAL A 1 75  ? -6.984  -8.995  0.565   1.00 0.00 ? 75  VAL A HB   2  
ATOM   4365  H  HG11 . VAL A 1 75  ? -8.341  -7.487  2.107   1.00 0.00 ? 75  VAL A HG11 2  
ATOM   4366  H  HG12 . VAL A 1 75  ? -6.860  -8.128  2.801   1.00 0.00 ? 75  VAL A HG12 2  
ATOM   4367  H  HG13 . VAL A 1 75  ? -8.411  -8.841  3.223   1.00 0.00 ? 75  VAL A HG13 2  
ATOM   4368  H  HG21 . VAL A 1 75  ? -6.545  -10.572 2.578   1.00 0.00 ? 75  VAL A HG21 2  
ATOM   4369  H  HG22 . VAL A 1 75  ? -6.843  -11.288 0.996   1.00 0.00 ? 75  VAL A HG22 2  
ATOM   4370  H  HG23 . VAL A 1 75  ? -8.132  -11.237 2.202   1.00 0.00 ? 75  VAL A HG23 2  
ATOM   4371  N  N    . ILE A 1 76  ? -10.530 -8.563  2.237   1.00 0.00 ? 76  ILE A N    2  
ATOM   4372  C  CA   . ILE A 1 76  ? -11.561 -8.574  3.287   1.00 0.00 ? 76  ILE A CA   2  
ATOM   4373  C  C    . ILE A 1 76  ? -12.681 -9.591  2.972   1.00 0.00 ? 76  ILE A C    2  
ATOM   4374  O  O    . ILE A 1 76  ? -12.987 -10.436 3.812   1.00 0.00 ? 76  ILE A O    2  
ATOM   4375  C  CB   . ILE A 1 76  ? -12.166 -7.166  3.499   1.00 0.00 ? 76  ILE A CB   2  
ATOM   4376  C  CG1  . ILE A 1 76  ? -11.205 -6.094  2.988   1.00 0.00 ? 76  ILE A CG1  2  
ATOM   4377  C  CG2  . ILE A 1 76  ? -12.427 -6.913  4.981   1.00 0.00 ? 76  ILE A CG2  2  
ATOM   4378  C  CD1  . ILE A 1 76  ? -9.928  -6.098  3.836   1.00 0.00 ? 76  ILE A CD1  2  
ATOM   4379  H  H    . ILE A 1 76  ? -10.092 -7.731  1.985   1.00 0.00 ? 76  ILE A H    2  
ATOM   4380  H  HA   . ILE A 1 76  ? -11.085 -8.882  4.206   1.00 0.00 ? 76  ILE A HA   2  
ATOM   4381  H  HB   . ILE A 1 76  ? -13.100 -7.090  2.975   1.00 0.00 ? 76  ILE A HB   2  
ATOM   4382  H  HG12 . ILE A 1 76  ? -10.964 -6.293  1.962   1.00 0.00 ? 76  ILE A HG12 2  
ATOM   4383  H  HG13 . ILE A 1 76  ? -11.676 -5.126  3.059   1.00 0.00 ? 76  ILE A HG13 2  
ATOM   4384  H  HG21 . ILE A 1 76  ? -11.534 -7.118  5.551   1.00 0.00 ? 76  ILE A HG21 2  
ATOM   4385  H  HG22 . ILE A 1 76  ? -13.231 -7.549  5.321   1.00 0.00 ? 76  ILE A HG22 2  
ATOM   4386  H  HG23 . ILE A 1 76  ? -12.708 -5.881  5.109   1.00 0.00 ? 76  ILE A HG23 2  
ATOM   4387  H  HD11 . ILE A 1 76  ? -9.143  -5.576  3.309   1.00 0.00 ? 76  ILE A HD11 2  
ATOM   4388  H  HD12 . ILE A 1 76  ? -9.622  -7.114  4.024   1.00 0.00 ? 76  ILE A HD12 2  
ATOM   4389  H  HD13 . ILE A 1 76  ? -10.119 -5.603  4.776   1.00 0.00 ? 76  ILE A HD13 2  
ATOM   4390  N  N    . PRO A 1 77  ? -13.293 -9.546  1.799   1.00 0.00 ? 77  PRO A N    2  
ATOM   4391  C  CA   . PRO A 1 77  ? -14.379 -10.508 1.426   1.00 0.00 ? 77  PRO A CA   2  
ATOM   4392  C  C    . PRO A 1 77  ? -13.824 -11.907 1.193   1.00 0.00 ? 77  PRO A C    2  
ATOM   4393  O  O    . PRO A 1 77  ? -14.562 -12.855 0.935   1.00 0.00 ? 77  PRO A O    2  
ATOM   4394  C  CB   . PRO A 1 77  ? -14.942 -9.921  0.130   1.00 0.00 ? 77  PRO A CB   2  
ATOM   4395  C  CG   . PRO A 1 77  ? -13.815 -9.175  -0.470  1.00 0.00 ? 77  PRO A CG   2  
ATOM   4396  C  CD   . PRO A 1 77  ? -13.032 -8.601  0.702   1.00 0.00 ? 77  PRO A CD   2  
ATOM   4397  H  HA   . PRO A 1 77  ? -15.147 -10.526 2.183   1.00 0.00 ? 77  PRO A HA   2  
ATOM   4398  H  HB2  . PRO A 1 77  ? -15.268 -10.707 -0.534  1.00 0.00 ? 77  PRO A HB2  2  
ATOM   4399  H  HB3  . PRO A 1 77  ? -15.747 -9.244  0.348   1.00 0.00 ? 77  PRO A HB3  2  
ATOM   4400  H  HG2  . PRO A 1 77  ? -13.195 -9.845  -1.051  1.00 0.00 ? 77  PRO A HG2  2  
ATOM   4401  H  HG3  . PRO A 1 77  ? -14.184 -8.373  -1.091  1.00 0.00 ? 77  PRO A HG3  2  
ATOM   4402  H  HD2  . PRO A 1 77  ? -12.002 -8.565  0.466   1.00 0.00 ? 77  PRO A HD2  2  
ATOM   4403  H  HD3  . PRO A 1 77  ? -13.396 -7.633  0.950   1.00 0.00 ? 77  PRO A HD3  2  
ATOM   4404  N  N    . PHE A 1 78  ? -12.508 -11.999 1.282   1.00 0.00 ? 78  PHE A N    2  
ATOM   4405  C  CA   . PHE A 1 78  ? -11.796 -13.266 1.084   1.00 0.00 ? 78  PHE A CA   2  
ATOM   4406  C  C    . PHE A 1 78  ? -11.935 -14.167 2.308   1.00 0.00 ? 78  PHE A C    2  
ATOM   4407  O  O    . PHE A 1 78  ? -12.162 -15.369 2.174   1.00 0.00 ? 78  PHE A O    2  
ATOM   4408  C  CB   . PHE A 1 78  ? -10.319 -12.970 0.819   1.00 0.00 ? 78  PHE A CB   2  
ATOM   4409  C  CG   . PHE A 1 78  ? -9.631  -14.124 0.154   1.00 0.00 ? 78  PHE A CG   2  
ATOM   4410  C  CD1  . PHE A 1 78  ? -9.105  -15.156 0.929   1.00 0.00 ? 78  PHE A CD1  2  
ATOM   4411  C  CD2  . PHE A 1 78  ? -9.509  -14.150 -1.238  1.00 0.00 ? 78  PHE A CD2  2  
ATOM   4412  C  CE1  . PHE A 1 78  ? -8.454  -16.231 0.312   1.00 0.00 ? 78  PHE A CE1  2  
ATOM   4413  C  CE2  . PHE A 1 78  ? -8.859  -15.224 -1.860  1.00 0.00 ? 78  PHE A CE2  2  
ATOM   4414  C  CZ   . PHE A 1 78  ? -8.333  -16.266 -1.084  1.00 0.00 ? 78  PHE A CZ   2  
ATOM   4415  H  H    . PHE A 1 78  ? -11.998 -11.184 1.480   1.00 0.00 ? 78  PHE A H    2  
ATOM   4416  H  HA   . PHE A 1 78  ? -12.210 -13.772 0.225   1.00 0.00 ? 78  PHE A HA   2  
ATOM   4417  H  HB2  . PHE A 1 78  ? -10.261 -12.123 0.170   1.00 0.00 ? 78  PHE A HB2  2  
ATOM   4418  H  HB3  . PHE A 1 78  ? -9.820  -12.754 1.752   1.00 0.00 ? 78  PHE A HB3  2  
ATOM   4419  H  HD1  . PHE A 1 78  ? -9.195  -15.117 2.007   1.00 0.00 ? 78  PHE A HD1  2  
ATOM   4420  H  HD2  . PHE A 1 78  ? -9.907  -13.335 -1.829  1.00 0.00 ? 78  PHE A HD2  2  
ATOM   4421  H  HE1  . PHE A 1 78  ? -8.046  -17.032 0.911   1.00 0.00 ? 78  PHE A HE1  2  
ATOM   4422  H  HE2  . PHE A 1 78  ? -8.765  -15.249 -2.935  1.00 0.00 ? 78  PHE A HE2  2  
ATOM   4423  H  HZ   . PHE A 1 78  ? -7.831  -17.095 -1.561  1.00 0.00 ? 78  PHE A HZ   2  
ATOM   4424  N  N    . TRP A 1 79  ? -11.805 -13.589 3.505   1.00 0.00 ? 79  TRP A N    2  
ATOM   4425  C  CA   . TRP A 1 79  ? -11.932 -14.382 4.721   1.00 0.00 ? 79  TRP A CA   2  
ATOM   4426  C  C    . TRP A 1 79  ? -13.408 -14.693 4.995   1.00 0.00 ? 79  TRP A C    2  
ATOM   4427  O  O    . TRP A 1 79  ? -13.740 -15.690 5.637   1.00 0.00 ? 79  TRP A O    2  
ATOM   4428  C  CB   . TRP A 1 79  ? -11.343 -13.637 5.922   1.00 0.00 ? 79  TRP A CB   2  
ATOM   4429  C  CG   . TRP A 1 79  ? -10.254 -12.688 5.518   1.00 0.00 ? 79  TRP A CG   2  
ATOM   4430  C  CD1  . TRP A 1 79  ? -9.261  -12.924 4.628   1.00 0.00 ? 79  TRP A CD1  2  
ATOM   4431  C  CD2  . TRP A 1 79  ? -10.040 -11.345 6.019   1.00 0.00 ? 79  TRP A CD2  2  
ATOM   4432  N  NE1  . TRP A 1 79  ? -8.448  -11.796 4.559   1.00 0.00 ? 79  TRP A NE1  2  
ATOM   4433  C  CE2  . TRP A 1 79  ? -8.894  -10.792 5.404   1.00 0.00 ? 79  TRP A CE2  2  
ATOM   4434  C  CE3  . TRP A 1 79  ? -10.737 -10.567 6.944   1.00 0.00 ? 79  TRP A CE3  2  
ATOM   4435  C  CZ2  . TRP A 1 79  ? -8.456  -9.493  5.713   1.00 0.00 ? 79  TRP A CZ2  2  
ATOM   4436  C  CZ3  . TRP A 1 79  ? -10.310 -9.274  7.256   1.00 0.00 ? 79  TRP A CZ3  2  
ATOM   4437  C  CH2  . TRP A 1 79  ? -9.174  -8.736  6.646   1.00 0.00 ? 79  TRP A CH2  2  
ATOM   4438  H  H    . TRP A 1 79  ? -11.632 -12.625 3.569   1.00 0.00 ? 79  TRP A H    2  
ATOM   4439  H  HA   . TRP A 1 79  ? -11.397 -15.311 4.591   1.00 0.00 ? 79  TRP A HA   2  
ATOM   4440  H  HB2  . TRP A 1 79  ? -12.125 -13.069 6.398   1.00 0.00 ? 79  TRP A HB2  2  
ATOM   4441  H  HB3  . TRP A 1 79  ? -10.945 -14.356 6.626   1.00 0.00 ? 79  TRP A HB3  2  
ATOM   4442  H  HD1  . TRP A 1 79  ? -9.121  -13.836 4.066   1.00 0.00 ? 79  TRP A HD1  2  
ATOM   4443  H  HE1  . TRP A 1 79  ? -7.655  -11.703 3.990   1.00 0.00 ? 79  TRP A HE1  2  
ATOM   4444  H  HE3  . TRP A 1 79  ? -11.614 -10.971 7.418   1.00 0.00 ? 79  TRP A HE3  2  
ATOM   4445  H  HZ2  . TRP A 1 79  ? -7.571  -9.078  5.245   1.00 0.00 ? 79  TRP A HZ2  2  
ATOM   4446  H  HZ3  . TRP A 1 79  ? -10.856 -8.691  7.974   1.00 0.00 ? 79  TRP A HZ3  2  
ATOM   4447  H  HH2  . TRP A 1 79  ? -8.860  -7.736  6.892   1.00 0.00 ? 79  TRP A HH2  2  
ATOM   4448  N  N    . LYS A 1 80  ? -14.281 -13.833 4.477   1.00 0.00 ? 80  LYS A N    2  
ATOM   4449  C  CA   . LYS A 1 80  ? -15.723 -13.994 4.623   1.00 0.00 ? 80  LYS A CA   2  
ATOM   4450  C  C    . LYS A 1 80  ? -16.170 -14.128 6.088   1.00 0.00 ? 80  LYS A C    2  
ATOM   4451  O  O    . LYS A 1 80  ? -16.798 -15.120 6.460   1.00 0.00 ? 80  LYS A O    2  
ATOM   4452  C  CB   . LYS A 1 80  ? -16.192 -15.213 3.819   1.00 0.00 ? 80  LYS A CB   2  
ATOM   4453  C  CG   . LYS A 1 80  ? -15.170 -15.540 2.733   1.00 0.00 ? 80  LYS A CG   2  
ATOM   4454  C  CD   . LYS A 1 80  ? -15.854 -16.321 1.607   1.00 0.00 ? 80  LYS A CD   2  
ATOM   4455  C  CE   . LYS A 1 80  ? -14.794 -16.972 0.717   1.00 0.00 ? 80  LYS A CE   2  
ATOM   4456  N  NZ   . LYS A 1 80  ? -13.837 -15.934 0.239   1.00 0.00 ? 80  LYS A NZ   2  
ATOM   4457  H  H    . LYS A 1 80  ? -13.949 -13.075 3.961   1.00 0.00 ? 80  LYS A H    2  
ATOM   4458  H  HA   . LYS A 1 80  ? -16.195 -13.121 4.206   1.00 0.00 ? 80  LYS A HA   2  
ATOM   4459  H  HB2  . LYS A 1 80  ? -16.304 -16.065 4.473   1.00 0.00 ? 80  LYS A HB2  2  
ATOM   4460  H  HB3  . LYS A 1 80  ? -17.136 -14.986 3.358   1.00 0.00 ? 80  LYS A HB3  2  
ATOM   4461  H  HG2  . LYS A 1 80  ? -14.759 -14.625 2.337   1.00 0.00 ? 80  LYS A HG2  2  
ATOM   4462  H  HG3  . LYS A 1 80  ? -14.381 -16.138 3.154   1.00 0.00 ? 80  LYS A HG3  2  
ATOM   4463  H  HD2  . LYS A 1 80  ? -16.487 -17.086 2.034   1.00 0.00 ? 80  LYS A HD2  2  
ATOM   4464  H  HD3  . LYS A 1 80  ? -16.454 -15.646 1.014   1.00 0.00 ? 80  LYS A HD3  2  
ATOM   4465  H  HE2  . LYS A 1 80  ? -14.259 -17.721 1.282   1.00 0.00 ? 80  LYS A HE2  2  
ATOM   4466  H  HE3  . LYS A 1 80  ? -15.274 -17.437 -0.132  1.00 0.00 ? 80  LYS A HE3  2  
ATOM   4467  H  HZ1  . LYS A 1 80  ? -14.266 -15.400 -0.543  1.00 0.00 ? 80  LYS A HZ1  2  
ATOM   4468  H  HZ2  . LYS A 1 80  ? -12.966 -16.392 -0.094  1.00 0.00 ? 80  LYS A HZ2  2  
ATOM   4469  H  HZ3  . LYS A 1 80  ? -13.611 -15.284 1.021   1.00 0.00 ? 80  LYS A HZ3  2  
ATOM   4470  N  N    . LEU A 1 81  ? -15.881 -13.122 6.916   1.00 0.00 ? 81  LEU A N    2  
ATOM   4471  C  CA   . LEU A 1 81  ? -16.303 -13.168 8.311   1.00 0.00 ? 81  LEU A CA   2  
ATOM   4472  C  C    . LEU A 1 81  ? -17.801 -12.982 8.433   1.00 0.00 ? 81  LEU A C    2  
ATOM   4473  O  O    . LEU A 1 81  ? -18.588 -13.382 7.574   1.00 0.00 ? 81  LEU A O    2  
ATOM   4474  C  CB   . LEU A 1 81  ? -15.660 -12.050 9.115   1.00 0.00 ? 81  LEU A CB   2  
ATOM   4475  C  CG   . LEU A 1 81  ? -14.232 -11.832 8.637   1.00 0.00 ? 81  LEU A CG   2  
ATOM   4476  C  CD1  . LEU A 1 81  ? -14.204 -10.925 7.390   1.00 0.00 ? 81  LEU A CD1  2  
ATOM   4477  C  CD2  . LEU A 1 81  ? -13.463 -11.197 9.784   1.00 0.00 ? 81  LEU A CD2  2  
ATOM   4478  H  H    . LEU A 1 81  ? -15.395 -12.338 6.587   1.00 0.00 ? 81  LEU A H    2  
ATOM   4479  H  HA   . LEU A 1 81  ? -16.014 -14.101 8.745   1.00 0.00 ? 81  LEU A HA   2  
ATOM   4480  H  HB2  . LEU A 1 81  ? -16.241 -11.128 9.012   1.00 0.00 ? 81  LEU A HB2  2  
ATOM   4481  H  HB3  . LEU A 1 81  ? -15.647 -12.339 10.155  1.00 0.00 ? 81  LEU A HB3  2  
ATOM   4482  H  HG   . LEU A 1 81  ? -13.789 -12.787 8.395   1.00 0.00 ? 81  LEU A HG   2  
ATOM   4483  H  HD11 . LEU A 1 81  ? -13.670 -10.015 7.610   1.00 0.00 ? 81  LEU A HD11 2  
ATOM   4484  H  HD12 . LEU A 1 81  ? -15.210 -10.682 7.082   1.00 0.00 ? 81  LEU A HD12 2  
ATOM   4485  H  HD13 . LEU A 1 81  ? -13.705 -11.446 6.588   1.00 0.00 ? 81  LEU A HD13 2  
ATOM   4486  H  HD21 . LEU A 1 81  ? -14.068 -10.417 10.224  1.00 0.00 ? 81  LEU A HD21 2  
ATOM   4487  H  HD22 . LEU A 1 81  ? -12.546 -10.781 9.418   1.00 0.00 ? 81  LEU A HD22 2  
ATOM   4488  H  HD23 . LEU A 1 81  ? -13.254 -11.952 10.526  1.00 0.00 ? 81  LEU A HD23 2  
ATOM   4489  N  N    . ASP A 1 82  ? -18.148 -12.308 9.512   1.00 0.00 ? 82  ASP A N    2  
ATOM   4490  C  CA   . ASP A 1 82  ? -19.512 -11.955 9.814   1.00 0.00 ? 82  ASP A CA   2  
ATOM   4491  C  C    . ASP A 1 82  ? -19.578 -10.437 9.906   1.00 0.00 ? 82  ASP A C    2  
ATOM   4492  O  O    . ASP A 1 82  ? -18.678 -9.740  9.436   1.00 0.00 ? 82  ASP A O    2  
ATOM   4493  C  CB   . ASP A 1 82  ? -19.935 -12.581 11.146  1.00 0.00 ? 82  ASP A CB   2  
ATOM   4494  C  CG   . ASP A 1 82  ? -20.448 -13.998 10.915  1.00 0.00 ? 82  ASP A CG   2  
ATOM   4495  O  OD1  . ASP A 1 82  ? -21.597 -14.135 10.530  1.00 0.00 ? 82  ASP A OD1  2  
ATOM   4496  O  OD2  . ASP A 1 82  ? -19.684 -14.926 11.126  1.00 0.00 ? 82  ASP A OD2  2  
ATOM   4497  H  H    . ASP A 1 82  ? -17.434 -12.001 10.115  1.00 0.00 ? 82  ASP A H    2  
ATOM   4498  H  HA   . ASP A 1 82  ? -20.165 -12.300 9.026   1.00 0.00 ? 82  ASP A HA   2  
ATOM   4499  H  HB2  . ASP A 1 82  ? -19.084 -12.609 11.812  1.00 0.00 ? 82  ASP A HB2  2  
ATOM   4500  H  HB3  . ASP A 1 82  ? -20.716 -11.988 11.594  1.00 0.00 ? 82  ASP A HB3  2  
ATOM   4501  N  N    . LEU A 1 83  ? -20.622 -9.934  10.518  1.00 0.00 ? 83  LEU A N    2  
ATOM   4502  C  CA   . LEU A 1 83  ? -20.783 -8.499  10.680  1.00 0.00 ? 83  LEU A CA   2  
ATOM   4503  C  C    . LEU A 1 83  ? -20.185 -8.054  12.013  1.00 0.00 ? 83  LEU A C    2  
ATOM   4504  O  O    . LEU A 1 83  ? -19.359 -7.145  12.067  1.00 0.00 ? 83  LEU A O    2  
ATOM   4505  C  CB   . LEU A 1 83  ? -22.275 -8.154  10.629  1.00 0.00 ? 83  LEU A CB   2  
ATOM   4506  C  CG   . LEU A 1 83  ? -22.493 -6.693  10.236  1.00 0.00 ? 83  LEU A CG   2  
ATOM   4507  C  CD1  . LEU A 1 83  ? -21.772 -5.781  11.221  1.00 0.00 ? 83  LEU A CD1  2  
ATOM   4508  C  CD2  . LEU A 1 83  ? -21.963 -6.452  8.819   1.00 0.00 ? 83  LEU A CD2  2  
ATOM   4509  H  H    . LEU A 1 83  ? -21.293 -10.535 10.876  1.00 0.00 ? 83  LEU A H    2  
ATOM   4510  H  HA   . LEU A 1 83  ? -20.269 -7.998  9.877   1.00 0.00 ? 83  LEU A HA   2  
ATOM   4511  H  HB2  . LEU A 1 83  ? -22.758 -8.784  9.904   1.00 0.00 ? 83  LEU A HB2  2  
ATOM   4512  H  HB3  . LEU A 1 83  ? -22.709 -8.330  11.595  1.00 0.00 ? 83  LEU A HB3  2  
ATOM   4513  H  HG   . LEU A 1 83  ? -23.552 -6.475  10.262  1.00 0.00 ? 83  LEU A HG   2  
ATOM   4514  H  HD11 . LEU A 1 83  ? -20.730 -5.719  10.954  1.00 0.00 ? 83  LEU A HD11 2  
ATOM   4515  H  HD12 . LEU A 1 83  ? -21.870 -6.183  12.219  1.00 0.00 ? 83  LEU A HD12 2  
ATOM   4516  H  HD13 . LEU A 1 83  ? -22.214 -4.798  11.185  1.00 0.00 ? 83  LEU A HD13 2  
ATOM   4517  H  HD21 . LEU A 1 83  ? -22.584 -5.720  8.328   1.00 0.00 ? 83  LEU A HD21 2  
ATOM   4518  H  HD22 . LEU A 1 83  ? -21.989 -7.378  8.260   1.00 0.00 ? 83  LEU A HD22 2  
ATOM   4519  H  HD23 . LEU A 1 83  ? -20.947 -6.089  8.867   1.00 0.00 ? 83  LEU A HD23 2  
ATOM   4520  N  N    . ASP A 1 84  ? -20.612 -8.712  13.086  1.00 0.00 ? 84  ASP A N    2  
ATOM   4521  C  CA   . ASP A 1 84  ? -20.121 -8.389  14.423  1.00 0.00 ? 84  ASP A CA   2  
ATOM   4522  C  C    . ASP A 1 84  ? -18.600 -8.317  14.435  1.00 0.00 ? 84  ASP A C    2  
ATOM   4523  O  O    . ASP A 1 84  ? -17.997 -7.834  15.394  1.00 0.00 ? 84  ASP A O    2  
ATOM   4524  C  CB   . ASP A 1 84  ? -20.590 -9.450  15.420  1.00 0.00 ? 84  ASP A CB   2  
ATOM   4525  C  CG   . ASP A 1 84  ? -20.256 -9.014  16.843  1.00 0.00 ? 84  ASP A CG   2  
ATOM   4526  O  OD1  . ASP A 1 84  ? -20.051 -7.829  17.046  1.00 0.00 ? 84  ASP A OD1  2  
ATOM   4527  O  OD2  . ASP A 1 84  ? -20.212 -9.872  17.709  1.00 0.00 ? 84  ASP A OD2  2  
ATOM   4528  H  H    . ASP A 1 84  ? -21.266 -9.430  12.976  1.00 0.00 ? 84  ASP A H    2  
ATOM   4529  H  HA   . ASP A 1 84  ? -20.520 -7.431  14.721  1.00 0.00 ? 84  ASP A HA   2  
ATOM   4530  H  HB2  . ASP A 1 84  ? -21.658 -9.582  15.327  1.00 0.00 ? 84  ASP A HB2  2  
ATOM   4531  H  HB3  . ASP A 1 84  ? -20.093 -10.385 15.207  1.00 0.00 ? 84  ASP A HB3  2  
ATOM   4532  N  N    . GLN A 1 85  ? -17.985 -8.804  13.365  1.00 0.00 ? 85  GLN A N    2  
ATOM   4533  C  CA   . GLN A 1 85  ? -16.534 -8.797  13.259  1.00 0.00 ? 85  GLN A CA   2  
ATOM   4534  C  C    . GLN A 1 85  ? -16.061 -7.496  12.611  1.00 0.00 ? 85  GLN A C    2  
ATOM   4535  O  O    . GLN A 1 85  ? -16.877 -6.670  12.207  1.00 0.00 ? 85  GLN A O    2  
ATOM   4536  C  CB   . GLN A 1 85  ? -16.072 -9.982  12.403  1.00 0.00 ? 85  GLN A CB   2  
ATOM   4537  C  CG   . GLN A 1 85  ? -16.671 -11.294 12.937  1.00 0.00 ? 85  GLN A CG   2  
ATOM   4538  C  CD   . GLN A 1 85  ? -15.666 -12.011 13.832  1.00 0.00 ? 85  GLN A CD   2  
ATOM   4539  O  OE1  . GLN A 1 85  ? -15.850 -12.075 15.048  1.00 0.00 ? 85  GLN A OE1  2  
ATOM   4540  N  NE2  . GLN A 1 85  ? -14.608 -12.559 13.299  1.00 0.00 ? 85  GLN A NE2  2  
ATOM   4541  H  H    . GLN A 1 85  ? -18.516 -9.182  12.637  1.00 0.00 ? 85  GLN A H    2  
ATOM   4542  H  HA   . GLN A 1 85  ? -16.112 -8.885  14.249  1.00 0.00 ? 85  GLN A HA   2  
ATOM   4543  H  HB2  . GLN A 1 85  ? -16.398 -9.829  11.384  1.00 0.00 ? 85  GLN A HB2  2  
ATOM   4544  H  HB3  . GLN A 1 85  ? -14.995 -10.041 12.424  1.00 0.00 ? 85  GLN A HB3  2  
ATOM   4545  H  HG2  . GLN A 1 85  ? -17.566 -11.085 13.503  1.00 0.00 ? 85  GLN A HG2  2  
ATOM   4546  H  HG3  . GLN A 1 85  ? -16.920 -11.934 12.103  1.00 0.00 ? 85  GLN A HG3  2  
ATOM   4547  H  HE21 . GLN A 1 85  ? -14.465 -12.506 12.328  1.00 0.00 ? 85  GLN A HE21 2  
ATOM   4548  H  HE22 . GLN A 1 85  ? -13.955 -13.022 13.869  1.00 0.00 ? 85  GLN A HE22 2  
ATOM   4549  N  N    . ASP A 1 86  ? -14.743 -7.311  12.517  1.00 0.00 ? 86  ASP A N    2  
ATOM   4550  C  CA   . ASP A 1 86  ? -14.205 -6.092  11.915  1.00 0.00 ? 86  ASP A CA   2  
ATOM   4551  C  C    . ASP A 1 86  ? -12.876 -6.368  11.198  1.00 0.00 ? 86  ASP A C    2  
ATOM   4552  O  O    . ASP A 1 86  ? -12.345 -7.478  11.259  1.00 0.00 ? 86  ASP A O    2  
ATOM   4553  C  CB   . ASP A 1 86  ? -13.998 -5.028  13.005  1.00 0.00 ? 86  ASP A CB   2  
ATOM   4554  C  CG   . ASP A 1 86  ? -15.196 -4.082  13.064  1.00 0.00 ? 86  ASP A CG   2  
ATOM   4555  O  OD1  . ASP A 1 86  ? -15.245 -3.168  12.255  1.00 0.00 ? 86  ASP A OD1  2  
ATOM   4556  O  OD2  . ASP A 1 86  ? -16.043 -4.283  13.918  1.00 0.00 ? 86  ASP A OD2  2  
ATOM   4557  H  H    . ASP A 1 86  ? -14.126 -7.995  12.859  1.00 0.00 ? 86  ASP A H    2  
ATOM   4558  H  HA   . ASP A 1 86  ? -14.916 -5.721  11.190  1.00 0.00 ? 86  ASP A HA   2  
ATOM   4559  H  HB2  . ASP A 1 86  ? -13.883 -5.513  13.966  1.00 0.00 ? 86  ASP A HB2  2  
ATOM   4560  H  HB3  . ASP A 1 86  ? -13.109 -4.460  12.786  1.00 0.00 ? 86  ASP A HB3  2  
ATOM   4561  N  N    . TYR A 1 87  ? -12.342 -5.344  10.532  1.00 0.00 ? 87  TYR A N    2  
ATOM   4562  C  CA   . TYR A 1 87  ? -11.068 -5.479  9.824   1.00 0.00 ? 87  TYR A CA   2  
ATOM   4563  C  C    . TYR A 1 87  ? -10.192 -4.254  10.051  1.00 0.00 ? 87  TYR A C    2  
ATOM   4564  O  O    . TYR A 1 87  ? -10.671 -3.121  10.058  1.00 0.00 ? 87  TYR A O    2  
ATOM   4565  C  CB   . TYR A 1 87  ? -11.288 -5.644  8.309   1.00 0.00 ? 87  TYR A CB   2  
ATOM   4566  C  CG   . TYR A 1 87  ? -12.727 -5.979  8.024   1.00 0.00 ? 87  TYR A CG   2  
ATOM   4567  C  CD1  . TYR A 1 87  ? -13.268 -7.185  8.466   1.00 0.00 ? 87  TYR A CD1  2  
ATOM   4568  C  CD2  . TYR A 1 87  ? -13.512 -5.081  7.296   1.00 0.00 ? 87  TYR A CD2  2  
ATOM   4569  C  CE1  . TYR A 1 87  ? -14.602 -7.498  8.182   1.00 0.00 ? 87  TYR A CE1  2  
ATOM   4570  C  CE2  . TYR A 1 87  ? -14.844 -5.390  7.011   1.00 0.00 ? 87  TYR A CE2  2  
ATOM   4571  C  CZ   . TYR A 1 87  ? -15.391 -6.600  7.453   1.00 0.00 ? 87  TYR A CZ   2  
ATOM   4572  O  OH   . TYR A 1 87  ? -16.707 -6.907  7.173   1.00 0.00 ? 87  TYR A OH   2  
ATOM   4573  H  H    . TYR A 1 87  ? -12.804 -4.481  10.527  1.00 0.00 ? 87  TYR A H    2  
ATOM   4574  H  HA   . TYR A 1 87  ? -10.546 -6.351  10.193  1.00 0.00 ? 87  TYR A HA   2  
ATOM   4575  H  HB2  . TYR A 1 87  ? -11.038 -4.724  7.798   1.00 0.00 ? 87  TYR A HB2  2  
ATOM   4576  H  HB3  . TYR A 1 87  ? -10.655 -6.437  7.935   1.00 0.00 ? 87  TYR A HB3  2  
ATOM   4577  H  HD1  . TYR A 1 87  ? -12.658 -7.874  9.029   1.00 0.00 ? 87  TYR A HD1  2  
ATOM   4578  H  HD2  . TYR A 1 87  ? -13.086 -4.151  6.952   1.00 0.00 ? 87  TYR A HD2  2  
ATOM   4579  H  HE1  . TYR A 1 87  ? -15.018 -8.432  8.520   1.00 0.00 ? 87  TYR A HE1  2  
ATOM   4580  H  HE2  . TYR A 1 87  ? -15.447 -4.696  6.443   1.00 0.00 ? 87  TYR A HE2  2  
ATOM   4581  H  HH   . TYR A 1 87  ? -16.956 -6.446  6.368   1.00 0.00 ? 87  TYR A HH   2  
ATOM   4582  N  N    . ARG A 1 88  ? -8.898  -4.495  10.185  1.00 0.00 ? 88  ARG A N    2  
ATOM   4583  C  CA   . ARG A 1 88  ? -7.935  -3.417  10.353  1.00 0.00 ? 88  ARG A CA   2  
ATOM   4584  C  C    . ARG A 1 88  ? -6.829  -3.638  9.334   1.00 0.00 ? 88  ARG A C    2  
ATOM   4585  O  O    . ARG A 1 88  ? -5.852  -4.345  9.591   1.00 0.00 ? 88  ARG A O    2  
ATOM   4586  C  CB   . ARG A 1 88  ? -7.369  -3.415  11.779  1.00 0.00 ? 88  ARG A CB   2  
ATOM   4587  C  CG   . ARG A 1 88  ? -8.193  -2.479  12.670  1.00 0.00 ? 88  ARG A CG   2  
ATOM   4588  C  CD   . ARG A 1 88  ? -7.513  -2.343  14.035  1.00 0.00 ? 88  ARG A CD   2  
ATOM   4589  N  NE   . ARG A 1 88  ? -8.077  -1.219  14.772  1.00 0.00 ? 88  ARG A NE   2  
ATOM   4590  C  CZ   . ARG A 1 88  ? -7.891  -1.096  16.083  1.00 0.00 ? 88  ARG A CZ   2  
ATOM   4591  N  NH1  . ARG A 1 88  ? -7.195  -1.991  16.728  1.00 0.00 ? 88  ARG A NH1  2  
ATOM   4592  N  NH2  . ARG A 1 88  ? -8.403  -0.082  16.724  1.00 0.00 ? 88  ARG A NH2  2  
ATOM   4593  H  H    . ARG A 1 88  ? -8.575  -5.420  10.132  1.00 0.00 ? 88  ARG A H    2  
ATOM   4594  H  HA   . ARG A 1 88  ? -8.422  -2.468  10.146  1.00 0.00 ? 88  ARG A HA   2  
ATOM   4595  H  HB2  . ARG A 1 88  ? -7.409  -4.415  12.182  1.00 0.00 ? 88  ARG A HB2  2  
ATOM   4596  H  HB3  . ARG A 1 88  ? -6.342  -3.077  11.761  1.00 0.00 ? 88  ARG A HB3  2  
ATOM   4597  H  HG2  . ARG A 1 88  ? -8.268  -1.506  12.204  1.00 0.00 ? 88  ARG A HG2  2  
ATOM   4598  H  HG3  . ARG A 1 88  ? -9.183  -2.890  12.805  1.00 0.00 ? 88  ARG A HG3  2  
ATOM   4599  H  HD2  . ARG A 1 88  ? -7.662  -3.248  14.601  1.00 0.00 ? 88  ARG A HD2  2  
ATOM   4600  H  HD3  . ARG A 1 88  ? -6.454  -2.183  13.891  1.00 0.00 ? 88  ARG A HD3  2  
ATOM   4601  H  HE   . ARG A 1 88  ? -8.603  -0.544  14.295  1.00 0.00 ? 88  ARG A HE   2  
ATOM   4602  H  HH11 . ARG A 1 88  ? -6.803  -2.769  16.238  1.00 0.00 ? 88  ARG A HH11 2  
ATOM   4603  H  HH12 . ARG A 1 88  ? -7.055  -1.899  17.715  1.00 0.00 ? 88  ARG A HH12 2  
ATOM   4604  H  HH21 . ARG A 1 88  ? -8.937  0.604   16.230  1.00 0.00 ? 88  ARG A HH21 2  
ATOM   4605  H  HH22 . ARG A 1 88  ? -8.261  0.008   17.710  1.00 0.00 ? 88  ARG A HH22 2  
ATOM   4606  N  N    . VAL A 1 89  ? -7.029  -3.071  8.154   1.00 0.00 ? 89  VAL A N    2  
ATOM   4607  C  CA   . VAL A 1 89  ? -6.088  -3.244  7.061   1.00 0.00 ? 89  VAL A CA   2  
ATOM   4608  C  C    . VAL A 1 89  ? -4.971  -2.200  7.086   1.00 0.00 ? 89  VAL A C    2  
ATOM   4609  O  O    . VAL A 1 89  ? -5.183  -1.037  7.438   1.00 0.00 ? 89  VAL A O    2  
ATOM   4610  C  CB   . VAL A 1 89  ? -6.849  -3.165  5.742   1.00 0.00 ? 89  VAL A CB   2  
ATOM   4611  C  CG1  . VAL A 1 89  ? -6.128  -3.974  4.661   1.00 0.00 ? 89  VAL A CG1  2  
ATOM   4612  C  CG2  . VAL A 1 89  ? -8.260  -3.726  5.934   1.00 0.00 ? 89  VAL A CG2  2  
ATOM   4613  H  H    . VAL A 1 89  ? -7.850  -2.556  8.003   1.00 0.00 ? 89  VAL A H    2  
ATOM   4614  H  HA   . VAL A 1 89  ? -5.647  -4.222  7.140   1.00 0.00 ? 89  VAL A HA   2  
ATOM   4615  H  HB   . VAL A 1 89  ? -6.911  -2.139  5.442   1.00 0.00 ? 89  VAL A HB   2  
ATOM   4616  H  HG11 . VAL A 1 89  ? -6.259  -3.491  3.710   1.00 0.00 ? 89  VAL A HG11 2  
ATOM   4617  H  HG12 . VAL A 1 89  ? -6.545  -4.971  4.613   1.00 0.00 ? 89  VAL A HG12 2  
ATOM   4618  H  HG13 . VAL A 1 89  ? -5.075  -4.031  4.890   1.00 0.00 ? 89  VAL A HG13 2  
ATOM   4619  H  HG21 . VAL A 1 89  ? -8.823  -3.077  6.585   1.00 0.00 ? 89  VAL A HG21 2  
ATOM   4620  H  HG22 . VAL A 1 89  ? -8.198  -4.711  6.373   1.00 0.00 ? 89  VAL A HG22 2  
ATOM   4621  H  HG23 . VAL A 1 89  ? -8.753  -3.791  4.975   1.00 0.00 ? 89  VAL A HG23 2  
ATOM   4622  N  N    . THR A 1 90  ? -3.782  -2.641  6.689   1.00 0.00 ? 90  THR A N    2  
ATOM   4623  C  CA   . THR A 1 90  ? -2.606  -1.785  6.640   1.00 0.00 ? 90  THR A CA   2  
ATOM   4624  C  C    . THR A 1 90  ? -1.868  -2.040  5.328   1.00 0.00 ? 90  THR A C    2  
ATOM   4625  O  O    . THR A 1 90  ? -1.444  -3.160  5.059   1.00 0.00 ? 90  THR A O    2  
ATOM   4626  C  CB   . THR A 1 90  ? -1.704  -2.093  7.851   1.00 0.00 ? 90  THR A CB   2  
ATOM   4627  O  OG1  . THR A 1 90  ? -2.155  -1.340  8.968   1.00 0.00 ? 90  THR A OG1  2  
ATOM   4628  C  CG2  . THR A 1 90  ? -0.243  -1.731  7.559   1.00 0.00 ? 90  THR A CG2  2  
ATOM   4629  H  H    . THR A 1 90  ? -3.693  -3.574  6.412   1.00 0.00 ? 90  THR A H    2  
ATOM   4630  H  HA   . THR A 1 90  ? -2.913  -0.751  6.681   1.00 0.00 ? 90  THR A HA   2  
ATOM   4631  H  HB   . THR A 1 90  ? -1.768  -3.145  8.084   1.00 0.00 ? 90  THR A HB   2  
ATOM   4632  H  HG1  . THR A 1 90  ? -1.908  -0.422  8.825   1.00 0.00 ? 90  THR A HG1  2  
ATOM   4633  H  HG21 . THR A 1 90  ? -0.173  -0.686  7.306   1.00 0.00 ? 90  THR A HG21 2  
ATOM   4634  H  HG22 . THR A 1 90  ? 0.125   -2.323  6.738   1.00 0.00 ? 90  THR A HG22 2  
ATOM   4635  H  HG23 . THR A 1 90  ? 0.357   -1.932  8.436   1.00 0.00 ? 90  THR A HG23 2  
ATOM   4636  N  N    . CYS A 1 91  ? -1.731  -1.008  4.504   1.00 0.00 ? 91  CYS A N    2  
ATOM   4637  C  CA   . CYS A 1 91  ? -1.059  -1.159  3.217   1.00 0.00 ? 91  CYS A CA   2  
ATOM   4638  C  C    . CYS A 1 91  ? 0.330   -0.532  3.238   1.00 0.00 ? 91  CYS A C    2  
ATOM   4639  O  O    . CYS A 1 91  ? 0.555   0.501   3.872   1.00 0.00 ? 91  CYS A O    2  
ATOM   4640  C  CB   . CYS A 1 91  ? -1.890  -0.498  2.117   1.00 0.00 ? 91  CYS A CB   2  
ATOM   4641  S  SG   . CYS A 1 91  ? -1.023  -0.646  0.538   1.00 0.00 ? 91  CYS A SG   2  
ATOM   4642  H  H    . CYS A 1 91  ? -2.099  -0.140  4.756   1.00 0.00 ? 91  CYS A H    2  
ATOM   4643  H  HA   . CYS A 1 91  ? -0.961  -2.213  2.993   1.00 0.00 ? 91  CYS A HA   2  
ATOM   4644  H  HB2  . CYS A 1 91  ? -2.850  -0.987  2.047   1.00 0.00 ? 91  CYS A HB2  2  
ATOM   4645  H  HB3  . CYS A 1 91  ? -2.032  0.550   2.350   1.00 0.00 ? 91  CYS A HB3  2  
ATOM   4646  H  HG   . CYS A 1 91  ? -1.168  0.163   0.044   1.00 0.00 ? 91  CYS A HG   2  
ATOM   4647  N  N    . PHE A 1 92  ? 1.252   -1.164  2.518   1.00 0.00 ? 92  PHE A N    2  
ATOM   4648  C  CA   . PHE A 1 92  ? 2.623   -0.674  2.422   1.00 0.00 ? 92  PHE A CA   2  
ATOM   4649  C  C    . PHE A 1 92  ? 3.077   -0.688  0.968   1.00 0.00 ? 92  PHE A C    2  
ATOM   4650  O  O    . PHE A 1 92  ? 3.435   -1.737  0.431   1.00 0.00 ? 92  PHE A O    2  
ATOM   4651  C  CB   . PHE A 1 92  ? 3.568   -1.553  3.249   1.00 0.00 ? 92  PHE A CB   2  
ATOM   4652  C  CG   . PHE A 1 92  ? 3.289   -1.379  4.726   1.00 0.00 ? 92  PHE A CG   2  
ATOM   4653  C  CD1  . PHE A 1 92  ? 3.441   -0.124  5.330   1.00 0.00 ? 92  PHE A CD1  2  
ATOM   4654  C  CD2  . PHE A 1 92  ? 2.888   -2.479  5.496   1.00 0.00 ? 92  PHE A CD2  2  
ATOM   4655  C  CE1  . PHE A 1 92  ? 3.190   0.031   6.698   1.00 0.00 ? 92  PHE A CE1  2  
ATOM   4656  C  CE2  . PHE A 1 92  ? 2.638   -2.323  6.865   1.00 0.00 ? 92  PHE A CE2  2  
ATOM   4657  C  CZ   . PHE A 1 92  ? 2.788   -1.068  7.465   1.00 0.00 ? 92  PHE A CZ   2  
ATOM   4658  H  H    . PHE A 1 92  ? 1.001   -1.972  2.028   1.00 0.00 ? 92  PHE A H    2  
ATOM   4659  H  HA   . PHE A 1 92  ? 2.667   0.335   2.789   1.00 0.00 ? 92  PHE A HA   2  
ATOM   4660  H  HB2  . PHE A 1 92  ? 3.424   -2.589  2.978   1.00 0.00 ? 92  PHE A HB2  2  
ATOM   4661  H  HB3  . PHE A 1 92  ? 4.590   -1.269  3.043   1.00 0.00 ? 92  PHE A HB3  2  
ATOM   4662  H  HD1  . PHE A 1 92  ? 3.753   0.725   4.742   1.00 0.00 ? 92  PHE A HD1  2  
ATOM   4663  H  HD2  . PHE A 1 92  ? 2.767   -3.446  5.033   1.00 0.00 ? 92  PHE A HD2  2  
ATOM   4664  H  HE1  . PHE A 1 92  ? 3.304   0.997   7.161   1.00 0.00 ? 92  PHE A HE1  2  
ATOM   4665  H  HE2  . PHE A 1 92  ? 2.330   -3.173  7.458   1.00 0.00 ? 92  PHE A HE2  2  
ATOM   4666  H  HZ   . PHE A 1 92  ? 2.594   -0.947  8.521   1.00 0.00 ? 92  PHE A HZ   2  
ATOM   4667  N  N    . THR A 1 93  ? 3.058   0.478   0.331   1.00 0.00 ? 93  THR A N    2  
ATOM   4668  C  CA   . THR A 1 93  ? 3.474   0.570   -1.065  1.00 0.00 ? 93  THR A CA   2  
ATOM   4669  C  C    . THR A 1 93  ? 4.073   1.934   -1.355  1.00 0.00 ? 93  THR A C    2  
ATOM   4670  O  O    . THR A 1 93  ? 3.437   2.959   -1.126  1.00 0.00 ? 93  THR A O    2  
ATOM   4671  C  CB   . THR A 1 93  ? 2.274   0.348   -1.990  1.00 0.00 ? 93  THR A CB   2  
ATOM   4672  O  OG1  . THR A 1 93  ? 1.522   -0.767  -1.535  1.00 0.00 ? 93  THR A OG1  2  
ATOM   4673  C  CG2  . THR A 1 93  ? 2.750   0.103   -3.429  1.00 0.00 ? 93  THR A CG2  2  
ATOM   4674  H  H    . THR A 1 93  ? 2.761   1.289   0.806   1.00 0.00 ? 93  THR A H    2  
ATOM   4675  H  HA   . THR A 1 93  ? 4.214   -0.190  -1.258  1.00 0.00 ? 93  THR A HA   2  
ATOM   4676  H  HB   . THR A 1 93  ? 1.652   1.227   -1.974  1.00 0.00 ? 93  THR A HB   2  
ATOM   4677  H  HG1  . THR A 1 93  ? 0.592   -0.531  -1.569  1.00 0.00 ? 93  THR A HG1  2  
ATOM   4678  H  HG21 . THR A 1 93  ? 2.019   -0.497  -3.951  1.00 0.00 ? 93  THR A HG21 2  
ATOM   4679  H  HG22 . THR A 1 93  ? 3.698   -0.412  -3.421  1.00 0.00 ? 93  THR A HG22 2  
ATOM   4680  H  HG23 . THR A 1 93  ? 2.862   1.051   -3.936  1.00 0.00 ? 93  THR A HG23 2  
ATOM   4681  N  N    . SER A 1 94  ? 5.287   1.943   -1.882  1.00 0.00 ? 94  SER A N    2  
ATOM   4682  C  CA   . SER A 1 94  ? 5.947   3.198   -2.216  1.00 0.00 ? 94  SER A CA   2  
ATOM   4683  C  C    . SER A 1 94  ? 5.087   3.998   -3.191  1.00 0.00 ? 94  SER A C    2  
ATOM   4684  O  O    . SER A 1 94  ? 5.487   5.063   -3.659  1.00 0.00 ? 94  SER A O    2  
ATOM   4685  C  CB   . SER A 1 94  ? 7.321   2.923   -2.838  1.00 0.00 ? 94  SER A CB   2  
ATOM   4686  O  OG   . SER A 1 94  ? 7.440   3.639   -4.063  1.00 0.00 ? 94  SER A OG   2  
ATOM   4687  H  H    . SER A 1 94  ? 5.740   1.093   -2.062  1.00 0.00 ? 94  SER A H    2  
ATOM   4688  H  HA   . SER A 1 94  ? 6.078   3.772   -1.313  1.00 0.00 ? 94  SER A HA   2  
ATOM   4689  H  HB2  . SER A 1 94  ? 8.100   3.245   -2.165  1.00 0.00 ? 94  SER A HB2  2  
ATOM   4690  H  HB3  . SER A 1 94  ? 7.424   1.862   -3.019  1.00 0.00 ? 94  SER A HB3  2  
ATOM   4691  H  HG   . SER A 1 94  ? 8.331   3.510   -4.397  1.00 0.00 ? 94  SER A HG   2  
ATOM   4692  N  N    . TRP A 1 95  ? 3.907   3.465   -3.504  1.00 0.00 ? 95  TRP A N    2  
ATOM   4693  C  CA   . TRP A 1 95  ? 2.998   4.118   -4.435  1.00 0.00 ? 95  TRP A CA   2  
ATOM   4694  C  C    . TRP A 1 95  ? 1.640   4.385   -3.777  1.00 0.00 ? 95  TRP A C    2  
ATOM   4695  O  O    . TRP A 1 95  ? 1.129   3.561   -3.018  1.00 0.00 ? 95  TRP A O    2  
ATOM   4696  C  CB   . TRP A 1 95  ? 2.814   3.195   -5.644  1.00 0.00 ? 95  TRP A CB   2  
ATOM   4697  C  CG   . TRP A 1 95  ? 2.573   3.985   -6.889  1.00 0.00 ? 95  TRP A CG   2  
ATOM   4698  C  CD1  . TRP A 1 95  ? 3.471   4.801   -7.489  1.00 0.00 ? 95  TRP A CD1  2  
ATOM   4699  C  CD2  . TRP A 1 95  ? 1.373   4.028   -7.708  1.00 0.00 ? 95  TRP A CD2  2  
ATOM   4700  N  NE1  . TRP A 1 95  ? 2.893   5.337   -8.626  1.00 0.00 ? 95  TRP A NE1  2  
ATOM   4701  C  CE2  . TRP A 1 95  ? 1.603   4.890   -8.801  1.00 0.00 ? 95  TRP A CE2  2  
ATOM   4702  C  CE3  . TRP A 1 95  ? 0.120   3.408   -7.608  1.00 0.00 ? 95  TRP A CE3  2  
ATOM   4703  C  CZ2  . TRP A 1 95  ? 0.626   5.124   -9.762  1.00 0.00 ? 95  TRP A CZ2  2  
ATOM   4704  C  CZ3  . TRP A 1 95  ? -0.869  3.642   -8.576  1.00 0.00 ? 95  TRP A CZ3  2  
ATOM   4705  C  CH2  . TRP A 1 95  ? -0.613  4.499   -9.653  1.00 0.00 ? 95  TRP A CH2  2  
ATOM   4706  H  H    . TRP A 1 95  ? 3.648   2.609   -3.112  1.00 0.00 ? 95  TRP A H    2  
ATOM   4707  H  HA   . TRP A 1 95  ? 3.425   5.053   -4.764  1.00 0.00 ? 95  TRP A HA   2  
ATOM   4708  H  HB2  . TRP A 1 95  ? 3.705   2.600   -5.771  1.00 0.00 ? 95  TRP A HB2  2  
ATOM   4709  H  HB3  . TRP A 1 95  ? 1.973   2.539   -5.469  1.00 0.00 ? 95  TRP A HB3  2  
ATOM   4710  H  HD1  . TRP A 1 95  ? 4.473   4.999   -7.138  1.00 0.00 ? 95  TRP A HD1  2  
ATOM   4711  H  HE1  . TRP A 1 95  ? 3.328   5.959   -9.246  1.00 0.00 ? 95  TRP A HE1  2  
ATOM   4712  H  HE3  . TRP A 1 95  ? -0.085  2.751   -6.778  1.00 0.00 ? 95  TRP A HE3  2  
ATOM   4713  H  HZ2  . TRP A 1 95  ? 0.828   5.781   -10.585 1.00 0.00 ? 95  TRP A HZ2  2  
ATOM   4714  H  HZ3  . TRP A 1 95  ? -1.827  3.160   -8.490  1.00 0.00 ? 95  TRP A HZ3  2  
ATOM   4715  H  HH2  . TRP A 1 95  ? -1.372  4.677   -10.400 1.00 0.00 ? 95  TRP A HH2  2  
ATOM   4716  N  N    . SER A 1 96  ? 1.063   5.541   -4.090  1.00 0.00 ? 96  SER A N    2  
ATOM   4717  C  CA   . SER A 1 96  ? -0.239  5.929   -3.551  1.00 0.00 ? 96  SER A CA   2  
ATOM   4718  C  C    . SER A 1 96  ? -1.357  5.388   -4.462  1.00 0.00 ? 96  SER A C    2  
ATOM   4719  O  O    . SER A 1 96  ? -1.076  4.583   -5.350  1.00 0.00 ? 96  SER A O    2  
ATOM   4720  C  CB   . SER A 1 96  ? -0.277  7.450   -3.439  1.00 0.00 ? 96  SER A CB   2  
ATOM   4721  O  OG   . SER A 1 96  ? -0.880  8.002   -4.603  1.00 0.00 ? 96  SER A OG   2  
ATOM   4722  H  H    . SER A 1 96  ? 1.522   6.153   -4.705  1.00 0.00 ? 96  SER A H    2  
ATOM   4723  H  HA   . SER A 1 96  ? -0.353  5.500   -2.566  1.00 0.00 ? 96  SER A HA   2  
ATOM   4724  H  HB2  . SER A 1 96  ? -0.833  7.738   -2.565  1.00 0.00 ? 96  SER A HB2  2  
ATOM   4725  H  HB3  . SER A 1 96  ? 0.733   7.815   -3.339  1.00 0.00 ? 96  SER A HB3  2  
ATOM   4726  H  HG   . SER A 1 96  ? -1.338  7.298   -5.066  1.00 0.00 ? 96  SER A HG   2  
ATOM   4727  N  N    . PRO A 1 97  ? -2.609  5.763   -4.268  1.00 0.00 ? 97  PRO A N    2  
ATOM   4728  C  CA   . PRO A 1 97  ? -3.726  5.236   -5.103  1.00 0.00 ? 97  PRO A CA   2  
ATOM   4729  C  C    . PRO A 1 97  ? -3.843  6.010   -6.414  1.00 0.00 ? 97  PRO A C    2  
ATOM   4730  O  O    . PRO A 1 97  ? -2.829  6.412   -6.981  1.00 0.00 ? 97  PRO A O    2  
ATOM   4731  C  CB   . PRO A 1 97  ? -4.935  5.432   -4.201  1.00 0.00 ? 97  PRO A CB   2  
ATOM   4732  C  CG   . PRO A 1 97  ? -4.639  6.683   -3.458  1.00 0.00 ? 97  PRO A CG   2  
ATOM   4733  C  CD   . PRO A 1 97  ? -3.119  6.730   -3.270  1.00 0.00 ? 97  PRO A CD   2  
ATOM   4734  H  HA   . PRO A 1 97  ? -3.590  4.186   -5.295  1.00 0.00 ? 97  PRO A HA   2  
ATOM   4735  H  HB2  . PRO A 1 97  ? -5.831  5.532   -4.786  1.00 0.00 ? 97  PRO A HB2  2  
ATOM   4736  H  HB3  . PRO A 1 97  ? -5.025  4.608   -3.510  1.00 0.00 ? 97  PRO A HB3  2  
ATOM   4737  H  HG2  . PRO A 1 97  ? -4.969  7.543   -4.040  1.00 0.00 ? 97  PRO A HG2  2  
ATOM   4738  H  HG3  . PRO A 1 97  ? -5.121  6.670   -2.497  1.00 0.00 ? 97  PRO A HG3  2  
ATOM   4739  H  HD2  . PRO A 1 97  ? -2.774  7.726   -3.483  1.00 0.00 ? 97  PRO A HD2  2  
ATOM   4740  H  HD3  . PRO A 1 97  ? -2.843  6.427   -2.272  1.00 0.00 ? 97  PRO A HD3  2  
ATOM   4741  N  N    . CYS A 1 98  ? -5.063  6.225   -6.909  1.00 0.00 ? 98  CYS A N    2  
ATOM   4742  C  CA   . CYS A 1 98  ? -5.211  6.957   -8.161  1.00 0.00 ? 98  CYS A CA   2  
ATOM   4743  C  C    . CYS A 1 98  ? -6.562  7.658   -8.277  1.00 0.00 ? 98  CYS A C    2  
ATOM   4744  O  O    . CYS A 1 98  ? -7.547  7.265   -7.657  1.00 0.00 ? 98  CYS A O    2  
ATOM   4745  C  CB   . CYS A 1 98  ? -5.040  6.009   -9.345  1.00 0.00 ? 98  CYS A CB   2  
ATOM   4746  S  SG   . CYS A 1 98  ? -3.584  4.971   -9.083  1.00 0.00 ? 98  CYS A SG   2  
ATOM   4747  H  H    . CYS A 1 98  ? -5.854  5.891   -6.439  1.00 0.00 ? 98  CYS A H    2  
ATOM   4748  H  HA   . CYS A 1 98  ? -4.436  7.705   -8.206  1.00 0.00 ? 98  CYS A HA   2  
ATOM   4749  H  HB2  . CYS A 1 98  ? -5.915  5.385   -9.436  1.00 0.00 ? 98  CYS A HB2  2  
ATOM   4750  H  HB3  . CYS A 1 98  ? -4.913  6.583   -10.251 1.00 0.00 ? 98  CYS A HB3  2  
ATOM   4751  N  N    . PHE A 1 99  ? -6.581  8.698   -9.103  1.00 0.00 ? 99  PHE A N    2  
ATOM   4752  C  CA   . PHE A 1 99  ? -7.786  9.481   -9.346  1.00 0.00 ? 99  PHE A CA   2  
ATOM   4753  C  C    . PHE A 1 99  ? -9.035  8.611   -9.334  1.00 0.00 ? 99  PHE A C    2  
ATOM   4754  O  O    . PHE A 1 99  ? -10.011 8.917   -8.658  1.00 0.00 ? 99  PHE A O    2  
ATOM   4755  C  CB   . PHE A 1 99  ? -7.673  10.163  -10.705 1.00 0.00 ? 99  PHE A CB   2  
ATOM   4756  C  CG   . PHE A 1 99  ? -7.786  9.128   -11.797 1.00 0.00 ? 99  PHE A CG   2  
ATOM   4757  C  CD1  . PHE A 1 99  ? -6.723  8.250   -12.041 1.00 0.00 ? 99  PHE A CD1  2  
ATOM   4758  C  CD2  . PHE A 1 99  ? -8.952  9.047   -12.565 1.00 0.00 ? 99  PHE A CD2  2  
ATOM   4759  C  CE1  . PHE A 1 99  ? -6.827  7.290   -13.054 1.00 0.00 ? 99  PHE A CE1  2  
ATOM   4760  C  CE2  . PHE A 1 99  ? -9.057  8.087   -13.579 1.00 0.00 ? 99  PHE A CE2  2  
ATOM   4761  C  CZ   . PHE A 1 99  ? -7.994  7.209   -13.823 1.00 0.00 ? 99  PHE A CZ   2  
ATOM   4762  H  H    . PHE A 1 99  ? -5.757  8.942   -9.572  1.00 0.00 ? 99  PHE A H    2  
ATOM   4763  H  HA   . PHE A 1 99  ? -7.877  10.240  -8.583  1.00 0.00 ? 99  PHE A HA   2  
ATOM   4764  H  HB2  . PHE A 1 99  ? -8.466  10.885  -10.812 1.00 0.00 ? 99  PHE A HB2  2  
ATOM   4765  H  HB3  . PHE A 1 99  ? -6.720  10.657  -10.778 1.00 0.00 ? 99  PHE A HB3  2  
ATOM   4766  H  HD1  . PHE A 1 99  ? -5.822  8.313   -11.447 1.00 0.00 ? 99  PHE A HD1  2  
ATOM   4767  H  HD2  . PHE A 1 99  ? -9.771  9.725   -12.376 1.00 0.00 ? 99  PHE A HD2  2  
ATOM   4768  H  HE1  . PHE A 1 99  ? -6.008  6.613   -13.243 1.00 0.00 ? 99  PHE A HE1  2  
ATOM   4769  H  HE2  . PHE A 1 99  ? -9.957  8.024   -14.171 1.00 0.00 ? 99  PHE A HE2  2  
ATOM   4770  H  HZ   . PHE A 1 99  ? -8.076  6.468   -14.606 1.00 0.00 ? 99  PHE A HZ   2  
ATOM   4771  N  N    . SER A 1 100 ? -9.008  7.539   -10.108 1.00 0.00 ? 100 SER A N    2  
ATOM   4772  C  CA   . SER A 1 100 ? -10.158 6.647   -10.189 1.00 0.00 ? 100 SER A CA   2  
ATOM   4773  C  C    . SER A 1 100 ? -10.037 5.509   -9.185  1.00 0.00 ? 100 SER A C    2  
ATOM   4774  O  O    . SER A 1 100 ? -10.796 5.425   -8.219  1.00 0.00 ? 100 SER A O    2  
ATOM   4775  C  CB   . SER A 1 100 ? -10.256 6.057   -11.594 1.00 0.00 ? 100 SER A CB   2  
ATOM   4776  O  OG   . SER A 1 100 ? -10.974 4.830   -11.540 1.00 0.00 ? 100 SER A OG   2  
ATOM   4777  H  H    . SER A 1 100 ? -8.207  7.355   -10.643 1.00 0.00 ? 100 SER A H    2  
ATOM   4778  H  HA   . SER A 1 100 ? -11.057 7.210   -9.983  1.00 0.00 ? 100 SER A HA   2  
ATOM   4779  H  HB2  . SER A 1 100 ? -10.773 6.742   -12.239 1.00 0.00 ? 100 SER A HB2  2  
ATOM   4780  H  HB3  . SER A 1 100 ? -9.259  5.886   -11.980 1.00 0.00 ? 100 SER A HB3  2  
ATOM   4781  H  HG   . SER A 1 100 ? -11.887 5.009   -11.775 1.00 0.00 ? 100 SER A HG   2  
ATOM   4782  N  N    . CYS A 1 101 ? -9.081  4.631   -9.429  1.00 0.00 ? 101 CYS A N    2  
ATOM   4783  C  CA   . CYS A 1 101 ? -8.866  3.488   -8.552  1.00 0.00 ? 101 CYS A CA   2  
ATOM   4784  C  C    . CYS A 1 101 ? -9.065  3.884   -7.093  1.00 0.00 ? 101 CYS A C    2  
ATOM   4785  O  O    . CYS A 1 101 ? -9.403  3.046   -6.250  1.00 0.00 ? 101 CYS A O    2  
ATOM   4786  C  CB   . CYS A 1 101 ? -7.447  2.925   -8.775  1.00 0.00 ? 101 CYS A CB   2  
ATOM   4787  S  SG   . CYS A 1 101 ? -6.393  3.208   -7.323  1.00 0.00 ? 101 CYS A SG   2  
ATOM   4788  H  H    . CYS A 1 101 ? -8.514  4.749   -10.220 1.00 0.00 ? 101 CYS A H    2  
ATOM   4789  H  HA   . CYS A 1 101 ? -9.587  2.723   -8.801  1.00 0.00 ? 101 CYS A HA   2  
ATOM   4790  H  HB2  . CYS A 1 101 ? -7.509  1.866   -8.961  1.00 0.00 ? 101 CYS A HB2  2  
ATOM   4791  H  HB3  . CYS A 1 101 ? -7.008  3.409   -9.632  1.00 0.00 ? 101 CYS A HB3  2  
ATOM   4792  N  N    . ALA A 1 102 ? -8.862  5.160   -6.791  1.00 0.00 ? 102 ALA A N    2  
ATOM   4793  C  CA   . ALA A 1 102 ? -9.028  5.608   -5.423  1.00 0.00 ? 102 ALA A CA   2  
ATOM   4794  C  C    . ALA A 1 102 ? -10.501 5.621   -5.091  1.00 0.00 ? 102 ALA A C    2  
ATOM   4795  O  O    . ALA A 1 102 ? -10.923 5.147   -4.038  1.00 0.00 ? 102 ALA A O    2  
ATOM   4796  C  CB   . ALA A 1 102 ? -8.434  7.005   -5.214  1.00 0.00 ? 102 ALA A CB   2  
ATOM   4797  H  H    . ALA A 1 102 ? -8.612  5.798   -7.492  1.00 0.00 ? 102 ALA A H    2  
ATOM   4798  H  HA   . ALA A 1 102 ? -8.528  4.905   -4.778  1.00 0.00 ? 102 ALA A HA   2  
ATOM   4799  H  HB1  . ALA A 1 102 ? -7.379  6.988   -5.421  1.00 0.00 ? 102 ALA A HB1  2  
ATOM   4800  H  HB2  . ALA A 1 102 ? -8.588  7.314   -4.193  1.00 0.00 ? 102 ALA A HB2  2  
ATOM   4801  H  HB3  . ALA A 1 102 ? -8.919  7.704   -5.873  1.00 0.00 ? 102 ALA A HB3  2  
ATOM   4802  N  N    . GLN A 1 103 ? -11.282 6.142   -6.021  1.00 0.00 ? 103 GLN A N    2  
ATOM   4803  C  CA   . GLN A 1 103 ? -12.715 6.187   -5.849  1.00 0.00 ? 103 GLN A CA   2  
ATOM   4804  C  C    . GLN A 1 103 ? -13.213 4.795   -5.543  1.00 0.00 ? 103 GLN A C    2  
ATOM   4805  O  O    . GLN A 1 103 ? -13.814 4.559   -4.497  1.00 0.00 ? 103 GLN A O    2  
ATOM   4806  C  CB   . GLN A 1 103 ? -13.364 6.697   -7.125  1.00 0.00 ? 103 GLN A CB   2  
ATOM   4807  C  CG   . GLN A 1 103 ? -13.140 8.196   -7.213  1.00 0.00 ? 103 GLN A CG   2  
ATOM   4808  C  CD   . GLN A 1 103 ? -13.753 8.751   -8.496  1.00 0.00 ? 103 GLN A CD   2  
ATOM   4809  O  OE1  . GLN A 1 103 ? -13.508 8.224   -9.581  1.00 0.00 ? 103 GLN A OE1  2  
ATOM   4810  N  NE2  . GLN A 1 103 ? -14.542 9.789   -8.434  1.00 0.00 ? 103 GLN A NE2  2  
ATOM   4811  H  H    . GLN A 1 103 ? -10.885 6.484   -6.850  1.00 0.00 ? 103 GLN A H    2  
ATOM   4812  H  HA   . GLN A 1 103 ? -12.957 6.847   -5.030  1.00 0.00 ? 103 GLN A HA   2  
ATOM   4813  H  HB2  . GLN A 1 103 ? -12.900 6.212   -7.975  1.00 0.00 ? 103 GLN A HB2  2  
ATOM   4814  H  HB3  . GLN A 1 103 ? -14.424 6.486   -7.110  1.00 0.00 ? 103 GLN A HB3  2  
ATOM   4815  H  HG2  . GLN A 1 103 ? -13.590 8.679   -6.356  1.00 0.00 ? 103 GLN A HG2  2  
ATOM   4816  H  HG3  . GLN A 1 103 ? -12.081 8.379   -7.214  1.00 0.00 ? 103 GLN A HG3  2  
ATOM   4817  H  HE21 . GLN A 1 103 ? -14.736 10.206  -7.569  1.00 0.00 ? 103 GLN A HE21 2  
ATOM   4818  H  HE22 . GLN A 1 103 ? -14.938 10.153  -9.253  1.00 0.00 ? 103 GLN A HE22 2  
ATOM   4819  N  N    . GLU A 1 104 ? -12.917 3.867   -6.457  1.00 0.00 ? 104 GLU A N    2  
ATOM   4820  C  CA   . GLU A 1 104 ? -13.309 2.468   -6.277  1.00 0.00 ? 104 GLU A CA   2  
ATOM   4821  C  C    . GLU A 1 104 ? -13.210 2.132   -4.800  1.00 0.00 ? 104 GLU A C    2  
ATOM   4822  O  O    . GLU A 1 104 ? -14.200 1.809   -4.139  1.00 0.00 ? 104 GLU A O    2  
ATOM   4823  C  CB   . GLU A 1 104 ? -12.379 1.552   -7.080  1.00 0.00 ? 104 GLU A CB   2  
ATOM   4824  C  CG   . GLU A 1 104 ? -12.925 1.381   -8.500  1.00 0.00 ? 104 GLU A CG   2  
ATOM   4825  C  CD   . GLU A 1 104 ? -14.112 0.425   -8.489  1.00 0.00 ? 104 GLU A CD   2  
ATOM   4826  O  OE1  . GLU A 1 104 ? -13.891 -0.761  -8.305  1.00 0.00 ? 104 GLU A OE1  2  
ATOM   4827  O  OE2  . GLU A 1 104 ? -15.226 0.891   -8.664  1.00 0.00 ? 104 GLU A OE2  2  
ATOM   4828  H  H    . GLU A 1 104 ? -12.403 4.130   -7.252  1.00 0.00 ? 104 GLU A H    2  
ATOM   4829  H  HA   . GLU A 1 104 ? -14.324 2.329   -6.612  1.00 0.00 ? 104 GLU A HA   2  
ATOM   4830  H  HB2  . GLU A 1 104 ? -11.393 1.990   -7.124  1.00 0.00 ? 104 GLU A HB2  2  
ATOM   4831  H  HB3  . GLU A 1 104 ? -12.322 0.585   -6.602  1.00 0.00 ? 104 GLU A HB3  2  
ATOM   4832  H  HG2  . GLU A 1 104 ? -13.242 2.344   -8.879  1.00 0.00 ? 104 GLU A HG2  2  
ATOM   4833  H  HG3  . GLU A 1 104 ? -12.149 0.982   -9.137  1.00 0.00 ? 104 GLU A HG3  2  
ATOM   4834  N  N    . MET A 1 105 ? -12.003 2.256   -4.283  1.00 0.00 ? 105 MET A N    2  
ATOM   4835  C  CA   . MET A 1 105 ? -11.769 2.014   -2.891  1.00 0.00 ? 105 MET A CA   2  
ATOM   4836  C  C    . MET A 1 105 ? -12.670 2.915   -2.045  1.00 0.00 ? 105 MET A C    2  
ATOM   4837  O  O    . MET A 1 105 ? -13.607 2.422   -1.430  1.00 0.00 ? 105 MET A O    2  
ATOM   4838  C  CB   . MET A 1 105 ? -10.289 2.231   -2.609  1.00 0.00 ? 105 MET A CB   2  
ATOM   4839  C  CG   . MET A 1 105 ? -9.877  1.425   -1.389  1.00 0.00 ? 105 MET A CG   2  
ATOM   4840  S  SD   . MET A 1 105 ? -8.206  1.892   -0.906  1.00 0.00 ? 105 MET A SD   2  
ATOM   4841  C  CE   . MET A 1 105 ? -8.654  3.338   0.071   1.00 0.00 ? 105 MET A CE   2  
ATOM   4842  H  H    . MET A 1 105 ? -11.255 2.535   -4.850  1.00 0.00 ? 105 MET A H    2  
ATOM   4843  H  HA   . MET A 1 105 ? -12.014 1.003   -2.665  1.00 0.00 ? 105 MET A HA   2  
ATOM   4844  H  HB2  . MET A 1 105 ? -9.718  1.903   -3.461  1.00 0.00 ? 105 MET A HB2  2  
ATOM   4845  H  HB3  . MET A 1 105 ? -10.097 3.264   -2.442  1.00 0.00 ? 105 MET A HB3  2  
ATOM   4846  H  HG2  . MET A 1 105 ? -10.558 1.626   -0.579  1.00 0.00 ? 105 MET A HG2  2  
ATOM   4847  H  HG3  . MET A 1 105 ? -9.899  0.374   -1.633  1.00 0.00 ? 105 MET A HG3  2  
ATOM   4848  H  HE1  . MET A 1 105 ? -7.756  3.825   0.414   1.00 0.00 ? 105 MET A HE1  2  
ATOM   4849  H  HE2  . MET A 1 105 ? -9.251  3.029   0.914   1.00 0.00 ? 105 MET A HE2  2  
ATOM   4850  H  HE3  . MET A 1 105 ? -9.222  4.023   -0.534  1.00 0.00 ? 105 MET A HE3  2  
ATOM   4851  N  N    . ALA A 1 106 ? -12.403 4.223   -2.023  1.00 0.00 ? 106 ALA A N    2  
ATOM   4852  C  CA   . ALA A 1 106 ? -13.225 5.142   -1.224  1.00 0.00 ? 106 ALA A CA   2  
ATOM   4853  C  C    . ALA A 1 106 ? -14.669 4.653   -1.107  1.00 0.00 ? 106 ALA A C    2  
ATOM   4854  O  O    . ALA A 1 106 ? -15.236 4.664   -0.030  1.00 0.00 ? 106 ALA A O    2  
ATOM   4855  C  CB   . ALA A 1 106 ? -13.274 6.540   -1.837  1.00 0.00 ? 106 ALA A CB   2  
ATOM   4856  H  H    . ALA A 1 106 ? -11.645 4.573   -2.531  1.00 0.00 ? 106 ALA A H    2  
ATOM   4857  H  HA   . ALA A 1 106 ? -12.782 5.213   -0.229  1.00 0.00 ? 106 ALA A HA   2  
ATOM   4858  H  HB1  . ALA A 1 106 ? -12.315 6.801   -2.236  1.00 0.00 ? 106 ALA A HB1  2  
ATOM   4859  H  HB2  . ALA A 1 106 ? -13.557 7.249   -1.073  1.00 0.00 ? 106 ALA A HB2  2  
ATOM   4860  H  HB3  . ALA A 1 106 ? -14.010 6.563   -2.628  1.00 0.00 ? 106 ALA A HB3  2  
ATOM   4861  N  N    . LYS A 1 107 ? -15.282 4.220   -2.200  1.00 0.00 ? 107 LYS A N    2  
ATOM   4862  C  CA   . LYS A 1 107 ? -16.650 3.741   -2.092  1.00 0.00 ? 107 LYS A CA   2  
ATOM   4863  C  C    . LYS A 1 107 ? -16.698 2.682   -1.028  1.00 0.00 ? 107 LYS A C    2  
ATOM   4864  O  O    . LYS A 1 107 ? -17.242 2.872   0.059   1.00 0.00 ? 107 LYS A O    2  
ATOM   4865  C  CB   . LYS A 1 107 ? -17.090 3.102   -3.390  1.00 0.00 ? 107 LYS A CB   2  
ATOM   4866  C  CG   . LYS A 1 107 ? -17.423 4.181   -4.436  1.00 0.00 ? 107 LYS A CG   2  
ATOM   4867  C  CD   . LYS A 1 107 ? -16.657 3.900   -5.722  1.00 0.00 ? 107 LYS A CD   2  
ATOM   4868  C  CE   . LYS A 1 107 ? -17.213 2.638   -6.373  1.00 0.00 ? 107 LYS A CE   2  
ATOM   4869  N  NZ   . LYS A 1 107 ? -18.570 2.917   -6.923  1.00 0.00 ? 107 LYS A NZ   2  
ATOM   4870  H  H    . LYS A 1 107 ? -14.823 4.209   -3.067  1.00 0.00 ? 107 LYS A H    2  
ATOM   4871  H  HA   . LYS A 1 107 ? -17.310 4.550   -1.845  1.00 0.00 ? 107 LYS A HA   2  
ATOM   4872  H  HB2  . LYS A 1 107 ? -16.287 2.471   -3.731  1.00 0.00 ? 107 LYS A HB2  2  
ATOM   4873  H  HB3  . LYS A 1 107 ? -17.966 2.494   -3.210  1.00 0.00 ? 107 LYS A HB3  2  
ATOM   4874  H  HG2  . LYS A 1 107 ? -18.483 4.162   -4.644  1.00 0.00 ? 107 LYS A HG2  2  
ATOM   4875  H  HG3  . LYS A 1 107 ? -17.149 5.159   -4.063  1.00 0.00 ? 107 LYS A HG3  2  
ATOM   4876  H  HD2  . LYS A 1 107 ? -16.762 4.731   -6.389  1.00 0.00 ? 107 LYS A HD2  2  
ATOM   4877  H  HD3  . LYS A 1 107 ? -15.622 3.754   -5.493  1.00 0.00 ? 107 LYS A HD3  2  
ATOM   4878  H  HE2  . LYS A 1 107 ? -16.556 2.324   -7.171  1.00 0.00 ? 107 LYS A HE2  2  
ATOM   4879  H  HE3  . LYS A 1 107 ? -17.278 1.861   -5.631  1.00 0.00 ? 107 LYS A HE3  2  
ATOM   4880  H  HZ1  . LYS A 1 107 ? -18.795 3.924   -6.800  1.00 0.00 ? 107 LYS A HZ1  2  
ATOM   4881  H  HZ2  . LYS A 1 107 ? -19.273 2.343   -6.418  1.00 0.00 ? 107 LYS A HZ2  2  
ATOM   4882  H  HZ3  . LYS A 1 107 ? -18.588 2.678   -7.936  1.00 0.00 ? 107 LYS A HZ3  2  
ATOM   4883  N  N    . PHE A 1 108 ? -16.102 1.562   -1.370  1.00 0.00 ? 108 PHE A N    2  
ATOM   4884  C  CA   . PHE A 1 108 ? -16.042 0.429   -0.460  1.00 0.00 ? 108 PHE A CA   2  
ATOM   4885  C  C    . PHE A 1 108 ? -15.889 0.918   0.979   1.00 0.00 ? 108 PHE A C    2  
ATOM   4886  O  O    . PHE A 1 108 ? -16.359 0.285   1.925   1.00 0.00 ? 108 PHE A O    2  
ATOM   4887  C  CB   . PHE A 1 108 ? -14.856 -0.444  -0.845  1.00 0.00 ? 108 PHE A CB   2  
ATOM   4888  C  CG   . PHE A 1 108 ? -15.296 -1.363  -1.945  1.00 0.00 ? 108 PHE A CG   2  
ATOM   4889  C  CD1  . PHE A 1 108 ? -15.689 -0.838  -3.180  1.00 0.00 ? 108 PHE A CD1  2  
ATOM   4890  C  CD2  . PHE A 1 108 ? -15.345 -2.732  -1.714  1.00 0.00 ? 108 PHE A CD2  2  
ATOM   4891  C  CE1  . PHE A 1 108 ? -16.128 -1.694  -4.189  1.00 0.00 ? 108 PHE A CE1  2  
ATOM   4892  C  CE2  . PHE A 1 108 ? -15.788 -3.593  -2.718  1.00 0.00 ? 108 PHE A CE2  2  
ATOM   4893  C  CZ   . PHE A 1 108 ? -16.181 -3.076  -3.960  1.00 0.00 ? 108 PHE A CZ   2  
ATOM   4894  H  H    . PHE A 1 108 ? -15.684 1.502   -2.266  1.00 0.00 ? 108 PHE A H    2  
ATOM   4895  H  HA   . PHE A 1 108 ? -16.952 -0.154  -0.554  1.00 0.00 ? 108 PHE A HA   2  
ATOM   4896  H  HB2  . PHE A 1 108 ? -14.048 0.181   -1.192  1.00 0.00 ? 108 PHE A HB2  2  
ATOM   4897  H  HB3  . PHE A 1 108 ? -14.534 -1.022  0.006   1.00 0.00 ? 108 PHE A HB3  2  
ATOM   4898  H  HD1  . PHE A 1 108 ? -15.646 0.228   -3.357  1.00 0.00 ? 108 PHE A HD1  2  
ATOM   4899  H  HD2  . PHE A 1 108 ? -15.038 -3.124  -0.758  1.00 0.00 ? 108 PHE A HD2  2  
ATOM   4900  H  HE1  . PHE A 1 108 ? -16.433 -1.287  -5.140  1.00 0.00 ? 108 PHE A HE1  2  
ATOM   4901  H  HE2  . PHE A 1 108 ? -15.830 -4.653  -2.534  1.00 0.00 ? 108 PHE A HE2  2  
ATOM   4902  H  HZ   . PHE A 1 108 ? -16.524 -3.741  -4.740  1.00 0.00 ? 108 PHE A HZ   2  
ATOM   4903  N  N    . ILE A 1 109 ? -15.216 2.053   1.118   1.00 0.00 ? 109 ILE A N    2  
ATOM   4904  C  CA   . ILE A 1 109 ? -14.961 2.670   2.406   1.00 0.00 ? 109 ILE A CA   2  
ATOM   4905  C  C    . ILE A 1 109 ? -16.125 3.584   2.814   1.00 0.00 ? 109 ILE A C    2  
ATOM   4906  O  O    . ILE A 1 109 ? -16.891 3.269   3.725   1.00 0.00 ? 109 ILE A O    2  
ATOM   4907  C  CB   . ILE A 1 109 ? -13.672 3.470   2.237   1.00 0.00 ? 109 ILE A CB   2  
ATOM   4908  C  CG1  . ILE A 1 109 ? -12.490 2.548   2.404   1.00 0.00 ? 109 ILE A CG1  2  
ATOM   4909  C  CG2  . ILE A 1 109 ? -13.566 4.594   3.239   1.00 0.00 ? 109 ILE A CG2  2  
ATOM   4910  C  CD1  . ILE A 1 109 ? -12.630 1.393   1.432   1.00 0.00 ? 109 ILE A CD1  2  
ATOM   4911  H  H    . ILE A 1 109 ? -14.860 2.493   0.322   1.00 0.00 ? 109 ILE A H    2  
ATOM   4912  H  HA   . ILE A 1 109 ? -14.812 1.905   3.156   1.00 0.00 ? 109 ILE A HA   2  
ATOM   4913  H  HB   . ILE A 1 109 ? -13.646 3.879   1.252   1.00 0.00 ? 109 ILE A HB   2  
ATOM   4914  H  HG12 . ILE A 1 109 ? -11.585 3.091   2.195   1.00 0.00 ? 109 ILE A HG12 2  
ATOM   4915  H  HG13 . ILE A 1 109 ? -12.478 2.178   3.408   1.00 0.00 ? 109 ILE A HG13 2  
ATOM   4916  H  HG21 . ILE A 1 109 ? -14.182 5.415   2.918   1.00 0.00 ? 109 ILE A HG21 2  
ATOM   4917  H  HG22 . ILE A 1 109 ? -12.535 4.913   3.290   1.00 0.00 ? 109 ILE A HG22 2  
ATOM   4918  H  HG23 . ILE A 1 109 ? -13.889 4.243   4.203   1.00 0.00 ? 109 ILE A HG23 2  
ATOM   4919  H  HD11 . ILE A 1 109 ? -12.987 1.767   0.496   1.00 0.00 ? 109 ILE A HD11 2  
ATOM   4920  H  HD12 . ILE A 1 109 ? -13.332 0.679   1.825   1.00 0.00 ? 109 ILE A HD12 2  
ATOM   4921  H  HD13 . ILE A 1 109 ? -11.672 0.925   1.286   1.00 0.00 ? 109 ILE A HD13 2  
ATOM   4922  N  N    . SER A 1 110 ? -16.239 4.713   2.124   1.00 0.00 ? 110 SER A N    2  
ATOM   4923  C  CA   . SER A 1 110 ? -17.290 5.688   2.384   1.00 0.00 ? 110 SER A CA   2  
ATOM   4924  C  C    . SER A 1 110 ? -18.648 5.001   2.497   1.00 0.00 ? 110 SER A C    2  
ATOM   4925  O  O    . SER A 1 110 ? -19.476 5.364   3.333   1.00 0.00 ? 110 SER A O    2  
ATOM   4926  C  CB   . SER A 1 110 ? -17.323 6.712   1.243   1.00 0.00 ? 110 SER A CB   2  
ATOM   4927  O  OG   . SER A 1 110 ? -18.545 6.587   0.525   1.00 0.00 ? 110 SER A OG   2  
ATOM   4928  H  H    . SER A 1 110 ? -15.598 4.896   1.425   1.00 0.00 ? 110 SER A H    2  
ATOM   4929  H  HA   . SER A 1 110 ? -17.068 6.204   3.306   1.00 0.00 ? 110 SER A HA   2  
ATOM   4930  H  HB2  . SER A 1 110 ? -17.251 7.711   1.642   1.00 0.00 ? 110 SER A HB2  2  
ATOM   4931  H  HB3  . SER A 1 110 ? -16.487 6.531   0.580   1.00 0.00 ? 110 SER A HB3  2  
ATOM   4932  H  HG   . SER A 1 110 ? -19.255 6.901   1.089   1.00 0.00 ? 110 SER A HG   2  
ATOM   4933  N  N    . LYS A 1 111 ? -18.865 4.007   1.643   1.00 0.00 ? 111 LYS A N    2  
ATOM   4934  C  CA   . LYS A 1 111 ? -20.120 3.264   1.636   1.00 0.00 ? 111 LYS A CA   2  
ATOM   4935  C  C    . LYS A 1 111 ? -20.225 2.392   2.877   1.00 0.00 ? 111 LYS A C    2  
ATOM   4936  O  O    . LYS A 1 111 ? -21.306 2.221   3.441   1.00 0.00 ? 111 LYS A O    2  
ATOM   4937  C  CB   . LYS A 1 111 ? -20.187 2.367   0.404   1.00 0.00 ? 111 LYS A CB   2  
ATOM   4938  C  CG   . LYS A 1 111 ? -20.128 3.160   -0.920  1.00 0.00 ? 111 LYS A CG   2  
ATOM   4939  C  CD   . LYS A 1 111 ? -20.746 4.565   -0.808  1.00 0.00 ? 111 LYS A CD   2  
ATOM   4940  C  CE   . LYS A 1 111 ? -22.240 4.479   -0.454  1.00 0.00 ? 111 LYS A CE   2  
ATOM   4941  N  NZ   . LYS A 1 111 ? -23.051 4.832   -1.653  1.00 0.00 ? 111 LYS A NZ   2  
ATOM   4942  H  H    . LYS A 1 111 ? -18.165 3.767   1.006   1.00 0.00 ? 111 LYS A H    2  
ATOM   4943  H  HA   . LYS A 1 111 ? -20.944 3.940   1.624   1.00 0.00 ? 111 LYS A HA   2  
ATOM   4944  H  HB2  . LYS A 1 111 ? -19.354 1.691   0.435   1.00 0.00 ? 111 LYS A HB2  2  
ATOM   4945  H  HB3  . LYS A 1 111 ? -21.092 1.799   0.433   1.00 0.00 ? 111 LYS A HB3  2  
ATOM   4946  H  HG2  . LYS A 1 111 ? -19.107 3.257   -1.215  1.00 0.00 ? 111 LYS A HG2  2  
ATOM   4947  H  HG3  . LYS A 1 111 ? -20.653 2.604   -1.679  1.00 0.00 ? 111 LYS A HG3  2  
ATOM   4948  H  HD2  . LYS A 1 111 ? -20.220 5.138   -0.062  1.00 0.00 ? 111 LYS A HD2  2  
ATOM   4949  H  HD3  . LYS A 1 111 ? -20.644 5.063   -1.761  1.00 0.00 ? 111 LYS A HD3  2  
ATOM   4950  H  HE2  . LYS A 1 111 ? -22.488 3.479   -0.134  1.00 0.00 ? 111 LYS A HE2  2  
ATOM   4951  H  HE3  . LYS A 1 111 ? -22.460 5.174   0.344   1.00 0.00 ? 111 LYS A HE3  2  
ATOM   4952  H  HZ1  . LYS A 1 111 ? -22.474 4.713   -2.510  1.00 0.00 ? 111 LYS A HZ1  2  
ATOM   4953  H  HZ2  . LYS A 1 111 ? -23.363 5.821   -1.583  1.00 0.00 ? 111 LYS A HZ2  2  
ATOM   4954  H  HZ3  . LYS A 1 111 ? -23.883 4.208   -1.704  1.00 0.00 ? 111 LYS A HZ3  2  
ATOM   4955  N  N    . ASN A 1 112 ? -19.094 1.843   3.296   1.00 0.00 ? 112 ASN A N    2  
ATOM   4956  C  CA   . ASN A 1 112 ? -19.062 0.986   4.474   1.00 0.00 ? 112 ASN A CA   2  
ATOM   4957  C  C    . ASN A 1 112 ? -17.788 1.219   5.277   1.00 0.00 ? 112 ASN A C    2  
ATOM   4958  O  O    . ASN A 1 112 ? -16.786 0.530   5.090   1.00 0.00 ? 112 ASN A O    2  
ATOM   4959  C  CB   . ASN A 1 112 ? -19.144 -0.482  4.052   1.00 0.00 ? 112 ASN A CB   2  
ATOM   4960  C  CG   . ASN A 1 112 ? -20.091 -0.630  2.868   1.00 0.00 ? 112 ASN A CG   2  
ATOM   4961  O  OD1  . ASN A 1 112 ? -19.695 -1.128  1.814   1.00 0.00 ? 112 ASN A OD1  2  
ATOM   4962  N  ND2  . ASN A 1 112 ? -21.325 -0.220  2.977   1.00 0.00 ? 112 ASN A ND2  2  
ATOM   4963  H  H    . ASN A 1 112 ? -18.270 2.015   2.802   1.00 0.00 ? 112 ASN A H    2  
ATOM   4964  H  HA   . ASN A 1 112 ? -19.912 1.216   5.094   1.00 0.00 ? 112 ASN A HA   2  
ATOM   4965  H  HB2  . ASN A 1 112 ? -18.160 -0.830  3.773   1.00 0.00 ? 112 ASN A HB2  2  
ATOM   4966  H  HB3  . ASN A 1 112 ? -19.511 -1.072  4.879   1.00 0.00 ? 112 ASN A HB3  2  
ATOM   4967  H  HD21 . ASN A 1 112 ? -21.636 0.177   3.817   1.00 0.00 ? 112 ASN A HD21 2  
ATOM   4968  H  HD22 . ASN A 1 112 ? -21.940 -0.311  2.221   1.00 0.00 ? 112 ASN A HD22 2  
ATOM   4969  N  N    . LYS A 1 113 ? -17.838 2.196   6.176   1.00 0.00 ? 113 LYS A N    2  
ATOM   4970  C  CA   . LYS A 1 113 ? -16.683 2.514   7.008   1.00 0.00 ? 113 LYS A CA   2  
ATOM   4971  C  C    . LYS A 1 113 ? -16.234 1.281   7.795   1.00 0.00 ? 113 LYS A C    2  
ATOM   4972  O  O    . LYS A 1 113 ? -15.217 1.313   8.487   1.00 0.00 ? 113 LYS A O    2  
ATOM   4973  C  CB   . LYS A 1 113 ? -16.996 3.678   7.973   1.00 0.00 ? 113 LYS A CB   2  
ATOM   4974  C  CG   . LYS A 1 113 ? -18.477 4.053   7.895   1.00 0.00 ? 113 LYS A CG   2  
ATOM   4975  C  CD   . LYS A 1 113 ? -19.331 2.904   8.440   1.00 0.00 ? 113 LYS A CD   2  
ATOM   4976  C  CE   . LYS A 1 113 ? -20.708 2.925   7.770   1.00 0.00 ? 113 LYS A CE   2  
ATOM   4977  N  NZ   . LYS A 1 113 ? -21.520 1.775   8.261   1.00 0.00 ? 113 LYS A NZ   2  
ATOM   4978  H  H    . LYS A 1 113 ? -18.663 2.706   6.279   1.00 0.00 ? 113 LYS A H    2  
ATOM   4979  H  HA   . LYS A 1 113 ? -15.881 2.815   6.364   1.00 0.00 ? 113 LYS A HA   2  
ATOM   4980  H  HB2  . LYS A 1 113 ? -16.755 3.386   8.984   1.00 0.00 ? 113 LYS A HB2  2  
ATOM   4981  H  HB3  . LYS A 1 113 ? -16.399 4.540   7.702   1.00 0.00 ? 113 LYS A HB3  2  
ATOM   4982  H  HG2  . LYS A 1 113 ? -18.648 4.939   8.488   1.00 0.00 ? 113 LYS A HG2  2  
ATOM   4983  H  HG3  . LYS A 1 113 ? -18.746 4.253   6.869   1.00 0.00 ? 113 LYS A HG3  2  
ATOM   4984  H  HD2  . LYS A 1 113 ? -18.843 1.961   8.237   1.00 0.00 ? 113 LYS A HD2  2  
ATOM   4985  H  HD3  . LYS A 1 113 ? -19.452 3.021   9.507   1.00 0.00 ? 113 LYS A HD3  2  
ATOM   4986  H  HE2  . LYS A 1 113 ? -21.211 3.850   8.011   1.00 0.00 ? 113 LYS A HE2  2  
ATOM   4987  H  HE3  . LYS A 1 113 ? -20.588 2.850   6.700   1.00 0.00 ? 113 LYS A HE3  2  
ATOM   4988  H  HZ1  . LYS A 1 113 ? -21.765 1.926   9.260   1.00 0.00 ? 113 LYS A HZ1  2  
ATOM   4989  H  HZ2  . LYS A 1 113 ? -20.970 0.898   8.169   1.00 0.00 ? 113 LYS A HZ2  2  
ATOM   4990  H  HZ3  . LYS A 1 113 ? -22.391 1.701   7.697   1.00 0.00 ? 113 LYS A HZ3  2  
ATOM   4991  N  N    . HIS A 1 114 ? -16.994 0.196   7.680   1.00 0.00 ? 114 HIS A N    2  
ATOM   4992  C  CA   . HIS A 1 114 ? -16.655 -1.038  8.383   1.00 0.00 ? 114 HIS A CA   2  
ATOM   4993  C  C    . HIS A 1 114 ? -15.214 -1.440  8.075   1.00 0.00 ? 114 HIS A C    2  
ATOM   4994  O  O    . HIS A 1 114 ? -14.682 -2.385  8.658   1.00 0.00 ? 114 HIS A O    2  
ATOM   4995  C  CB   . HIS A 1 114 ? -17.605 -2.158  7.951   1.00 0.00 ? 114 HIS A CB   2  
ATOM   4996  C  CG   . HIS A 1 114 ? -17.686 -3.201  9.031   1.00 0.00 ? 114 HIS A CG   2  
ATOM   4997  N  ND1  . HIS A 1 114 ? -17.632 -4.558  8.754   1.00 0.00 ? 114 HIS A ND1  2  
ATOM   4998  C  CD2  . HIS A 1 114 ? -17.821 -3.103  10.394  1.00 0.00 ? 114 HIS A CD2  2  
ATOM   4999  C  CE1  . HIS A 1 114 ? -17.735 -5.216  9.922   1.00 0.00 ? 114 HIS A CE1  2  
ATOM   5000  N  NE2  . HIS A 1 114 ? -17.853 -4.376  10.954  1.00 0.00 ? 114 HIS A NE2  2  
ATOM   5001  H  H    . HIS A 1 114 ? -17.791 0.223   7.112   1.00 0.00 ? 114 HIS A H    2  
ATOM   5002  H  HA   . HIS A 1 114 ? -16.758 -0.878  9.445   1.00 0.00 ? 114 HIS A HA   2  
ATOM   5003  H  HB2  . HIS A 1 114 ? -18.588 -1.747  7.775   1.00 0.00 ? 114 HIS A HB2  2  
ATOM   5004  H  HB3  . HIS A 1 114 ? -17.236 -2.611  7.042   1.00 0.00 ? 114 HIS A HB3  2  
ATOM   5005  H  HD1  . HIS A 1 114 ? -17.537 -4.963  7.867   1.00 0.00 ? 114 HIS A HD1  2  
ATOM   5006  H  HD2  . HIS A 1 114 ? -17.894 -2.178  10.948  1.00 0.00 ? 114 HIS A HD2  2  
ATOM   5007  H  HE1  . HIS A 1 114 ? -17.724 -6.291  10.015  1.00 0.00 ? 114 HIS A HE1  2  
ATOM   5008  H  HE2  . HIS A 1 114 ? -17.943 -4.608  11.902  1.00 0.00 ? 114 HIS A HE2  2  
ATOM   5009  N  N    . VAL A 1 115 ? -14.595 -0.709  7.153   1.00 0.00 ? 115 VAL A N    2  
ATOM   5010  C  CA   . VAL A 1 115 ? -13.220 -0.970  6.750   1.00 0.00 ? 115 VAL A CA   2  
ATOM   5011  C  C    . VAL A 1 115 ? -12.300 0.135   7.273   1.00 0.00 ? 115 VAL A C    2  
ATOM   5012  O  O    . VAL A 1 115 ? -12.702 1.294   7.367   1.00 0.00 ? 115 VAL A O    2  
ATOM   5013  C  CB   . VAL A 1 115 ? -13.166 -1.040  5.208   1.00 0.00 ? 115 VAL A CB   2  
ATOM   5014  C  CG1  . VAL A 1 115 ? -11.875 -0.431  4.685   1.00 0.00 ? 115 VAL A CG1  2  
ATOM   5015  C  CG2  . VAL A 1 115 ? -13.222 -2.490  4.742   1.00 0.00 ? 115 VAL A CG2  2  
ATOM   5016  H  H    . VAL A 1 115 ? -15.076 0.028   6.726   1.00 0.00 ? 115 VAL A H    2  
ATOM   5017  H  HA   . VAL A 1 115 ? -12.898 -1.911  7.158   1.00 0.00 ? 115 VAL A HA   2  
ATOM   5018  H  HB   . VAL A 1 115 ? -14.006 -0.500  4.797   1.00 0.00 ? 115 VAL A HB   2  
ATOM   5019  H  HG11 . VAL A 1 115 ? -11.794 -0.626  3.628   1.00 0.00 ? 115 VAL A HG11 2  
ATOM   5020  H  HG12 . VAL A 1 115 ? -11.037 -0.869  5.203   1.00 0.00 ? 115 VAL A HG12 2  
ATOM   5021  H  HG13 . VAL A 1 115 ? -11.895 0.628   4.859   1.00 0.00 ? 115 VAL A HG13 2  
ATOM   5022  H  HG21 . VAL A 1 115 ? -12.324 -3.000  5.056   1.00 0.00 ? 115 VAL A HG21 2  
ATOM   5023  H  HG22 . VAL A 1 115 ? -13.289 -2.513  3.664   1.00 0.00 ? 115 VAL A HG22 2  
ATOM   5024  H  HG23 . VAL A 1 115 ? -14.084 -2.972  5.171   1.00 0.00 ? 115 VAL A HG23 2  
ATOM   5025  N  N    . SER A 1 116 ? -11.058 -0.230  7.596   1.00 0.00 ? 116 SER A N    2  
ATOM   5026  C  CA   . SER A 1 116 ? -10.092 0.747   8.086   1.00 0.00 ? 116 SER A CA   2  
ATOM   5027  C  C    . SER A 1 116 ? -8.741  0.563   7.396   1.00 0.00 ? 116 SER A C    2  
ATOM   5028  O  O    . SER A 1 116 ? -7.977  -0.338  7.746   1.00 0.00 ? 116 SER A O    2  
ATOM   5029  C  CB   . SER A 1 116 ? -9.919  0.594   9.595   1.00 0.00 ? 116 SER A CB   2  
ATOM   5030  O  OG   . SER A 1 116 ? -11.176 0.778   10.233  1.00 0.00 ? 116 SER A OG   2  
ATOM   5031  H  H    . SER A 1 116 ? -10.783 -1.169  7.494   1.00 0.00 ? 116 SER A H    2  
ATOM   5032  H  HA   . SER A 1 116 ? -10.459 1.742   7.877   1.00 0.00 ? 116 SER A HA   2  
ATOM   5033  H  HB2  . SER A 1 116 ? -9.549  -0.391  9.817   1.00 0.00 ? 116 SER A HB2  2  
ATOM   5034  H  HB3  . SER A 1 116 ? -9.210  1.332   9.949   1.00 0.00 ? 116 SER A HB3  2  
ATOM   5035  H  HG   . SER A 1 116 ? -11.834 0.939   9.552   1.00 0.00 ? 116 SER A HG   2  
ATOM   5036  N  N    . LEU A 1 117 ? -8.447  1.423   6.418   1.00 0.00 ? 117 LEU A N    2  
ATOM   5037  C  CA   . LEU A 1 117 ? -7.182  1.340   5.700   1.00 0.00 ? 117 LEU A CA   2  
ATOM   5038  C  C    . LEU A 1 117 ? -6.165  2.298   6.282   1.00 0.00 ? 117 LEU A C    2  
ATOM   5039  O  O    . LEU A 1 117 ? -6.452  3.480   6.479   1.00 0.00 ? 117 LEU A O    2  
ATOM   5040  C  CB   . LEU A 1 117 ? -7.319  1.740   4.228   1.00 0.00 ? 117 LEU A CB   2  
ATOM   5041  C  CG   . LEU A 1 117 ? -8.426  0.984   3.494   1.00 0.00 ? 117 LEU A CG   2  
ATOM   5042  C  CD1  . LEU A 1 117 ? -8.566  -0.457  3.979   1.00 0.00 ? 117 LEU A CD1  2  
ATOM   5043  C  CD2  . LEU A 1 117 ? -9.741  1.711   3.677   1.00 0.00 ? 117 LEU A CD2  2  
ATOM   5044  H  H    . LEU A 1 117 ? -9.086  2.122   6.182   1.00 0.00 ? 117 LEU A H    2  
ATOM   5045  H  HA   . LEU A 1 117 ? -6.800  0.336   5.756   1.00 0.00 ? 117 LEU A HA   2  
ATOM   5046  H  HB2  . LEU A 1 117 ? -7.523  2.800   4.172   1.00 0.00 ? 117 LEU A HB2  2  
ATOM   5047  H  HB3  . LEU A 1 117 ? -6.382  1.545   3.736   1.00 0.00 ? 117 LEU A HB3  2  
ATOM   5048  H  HG   . LEU A 1 117 ? -8.182  0.972   2.446   1.00 0.00 ? 117 LEU A HG   2  
ATOM   5049  H  HD11 . LEU A 1 117 ? -7.658  -0.989  3.762   1.00 0.00 ? 117 LEU A HD11 2  
ATOM   5050  H  HD12 . LEU A 1 117 ? -9.387  -0.929  3.456   1.00 0.00 ? 117 LEU A HD12 2  
ATOM   5051  H  HD13 . LEU A 1 117 ? -8.763  -0.478  5.038   1.00 0.00 ? 117 LEU A HD13 2  
ATOM   5052  H  HD21 . LEU A 1 117 ? -10.508 1.170   3.161   1.00 0.00 ? 117 LEU A HD21 2  
ATOM   5053  H  HD22 . LEU A 1 117 ? -9.658  2.704   3.267   1.00 0.00 ? 117 LEU A HD22 2  
ATOM   5054  H  HD23 . LEU A 1 117 ? -9.980  1.773   4.724   1.00 0.00 ? 117 LEU A HD23 2  
ATOM   5055  N  N    . CYS A 1 118 ? -4.959  1.805   6.488   1.00 0.00 ? 118 CYS A N    2  
ATOM   5056  C  CA   . CYS A 1 118 ? -3.884  2.645   6.966   1.00 0.00 ? 118 CYS A CA   2  
ATOM   5057  C  C    . CYS A 1 118 ? -2.760  2.567   5.947   1.00 0.00 ? 118 CYS A C    2  
ATOM   5058  O  O    . CYS A 1 118 ? -1.909  1.680   6.011   1.00 0.00 ? 118 CYS A O    2  
ATOM   5059  C  CB   . CYS A 1 118 ? -3.398  2.147   8.324   1.00 0.00 ? 118 CYS A CB   2  
ATOM   5060  S  SG   . CYS A 1 118 ? -4.795  2.057   9.472   1.00 0.00 ? 118 CYS A SG   2  
ATOM   5061  H  H    . CYS A 1 118 ? -4.774  0.871   6.267   1.00 0.00 ? 118 CYS A H    2  
ATOM   5062  H  HA   . CYS A 1 118 ? -4.223  3.670   7.054   1.00 0.00 ? 118 CYS A HA   2  
ATOM   5063  H  HB2  . CYS A 1 118 ? -2.960  1.166   8.213   1.00 0.00 ? 118 CYS A HB2  2  
ATOM   5064  H  HB3  . CYS A 1 118 ? -2.664  2.830   8.706   1.00 0.00 ? 118 CYS A HB3  2  
ATOM   5065  H  HG   . CYS A 1 118 ? -5.600  1.984   8.955   1.00 0.00 ? 118 CYS A HG   2  
ATOM   5066  N  N    . ILE A 1 119 ? -2.790  3.472   4.972   1.00 0.00 ? 119 ILE A N    2  
ATOM   5067  C  CA   . ILE A 1 119 ? -1.809  3.464   3.919   1.00 0.00 ? 119 ILE A CA   2  
ATOM   5068  C  C    . ILE A 1 119 ? -0.598  4.312   4.233   1.00 0.00 ? 119 ILE A C    2  
ATOM   5069  O  O    . ILE A 1 119 ? -0.704  5.507   4.509   1.00 0.00 ? 119 ILE A O    2  
ATOM   5070  C  CB   . ILE A 1 119 ? -2.458  3.971   2.651   1.00 0.00 ? 119 ILE A CB   2  
ATOM   5071  C  CG1  . ILE A 1 119 ? -3.888  3.412   2.606   1.00 0.00 ? 119 ILE A CG1  2  
ATOM   5072  C  CG2  . ILE A 1 119 ? -1.632  3.504   1.447   1.00 0.00 ? 119 ILE A CG2  2  
ATOM   5073  C  CD1  . ILE A 1 119 ? -4.415  3.416   1.184   1.00 0.00 ? 119 ILE A CD1  2  
ATOM   5074  H  H    . ILE A 1 119 ? -3.515  4.131   4.931   1.00 0.00 ? 119 ILE A H    2  
ATOM   5075  H  HA   . ILE A 1 119 ? -1.494  2.452   3.743   1.00 0.00 ? 119 ILE A HA   2  
ATOM   5076  H  HB   . ILE A 1 119 ? -2.490  5.047   2.667   1.00 0.00 ? 119 ILE A HB   2  
ATOM   5077  H  HG12 . ILE A 1 119 ? -3.892  2.399   2.983   1.00 0.00 ? 119 ILE A HG12 2  
ATOM   5078  H  HG13 . ILE A 1 119 ? -4.528  4.027   3.225   1.00 0.00 ? 119 ILE A HG13 2  
ATOM   5079  H  HG21 . ILE A 1 119 ? -1.659  4.262   0.679   1.00 0.00 ? 119 ILE A HG21 2  
ATOM   5080  H  HG22 . ILE A 1 119 ? -2.036  2.584   1.065   1.00 0.00 ? 119 ILE A HG22 2  
ATOM   5081  H  HG23 . ILE A 1 119 ? -0.606  3.343   1.752   1.00 0.00 ? 119 ILE A HG23 2  
ATOM   5082  H  HD11 . ILE A 1 119 ? -5.493  3.378   1.204   1.00 0.00 ? 119 ILE A HD11 2  
ATOM   5083  H  HD12 . ILE A 1 119 ? -4.033  2.552   0.664   1.00 0.00 ? 119 ILE A HD12 2  
ATOM   5084  H  HD13 . ILE A 1 119 ? -4.090  4.314   0.686   1.00 0.00 ? 119 ILE A HD13 2  
ATOM   5085  N  N    . PHE A 1 120 ? 0.560   3.687   4.115   1.00 0.00 ? 120 PHE A N    2  
ATOM   5086  C  CA   . PHE A 1 120 ? 1.820   4.380   4.310   1.00 0.00 ? 120 PHE A CA   2  
ATOM   5087  C  C    . PHE A 1 120 ? 2.586   4.245   3.014   1.00 0.00 ? 120 PHE A C    2  
ATOM   5088  O  O    . PHE A 1 120 ? 3.150   3.192   2.712   1.00 0.00 ? 120 PHE A O    2  
ATOM   5089  C  CB   . PHE A 1 120 ? 2.612   3.769   5.468   1.00 0.00 ? 120 PHE A CB   2  
ATOM   5090  C  CG   . PHE A 1 120 ? 3.862   4.584   5.707   1.00 0.00 ? 120 PHE A CG   2  
ATOM   5091  C  CD1  . PHE A 1 120 ? 4.873   4.611   4.740   1.00 0.00 ? 120 PHE A CD1  2  
ATOM   5092  C  CD2  . PHE A 1 120 ? 4.007   5.315   6.895   1.00 0.00 ? 120 PHE A CD2  2  
ATOM   5093  C  CE1  . PHE A 1 120 ? 6.030   5.367   4.957   1.00 0.00 ? 120 PHE A CE1  2  
ATOM   5094  C  CE2  . PHE A 1 120 ? 5.166   6.072   7.112   1.00 0.00 ? 120 PHE A CE2  2  
ATOM   5095  C  CZ   . PHE A 1 120 ? 6.178   6.097   6.143   1.00 0.00 ? 120 PHE A CZ   2  
ATOM   5096  H  H    . PHE A 1 120 ? 0.566   2.743   3.836   1.00 0.00 ? 120 PHE A H    2  
ATOM   5097  H  HA   . PHE A 1 120 ? 1.635   5.429   4.508   1.00 0.00 ? 120 PHE A HA   2  
ATOM   5098  H  HB2  . PHE A 1 120 ? 2.005   3.770   6.362   1.00 0.00 ? 120 PHE A HB2  2  
ATOM   5099  H  HB3  . PHE A 1 120 ? 2.886   2.757   5.223   1.00 0.00 ? 120 PHE A HB3  2  
ATOM   5100  H  HD1  . PHE A 1 120 ? 4.763   4.049   3.824   1.00 0.00 ? 120 PHE A HD1  2  
ATOM   5101  H  HD2  . PHE A 1 120 ? 3.226   5.294   7.643   1.00 0.00 ? 120 PHE A HD2  2  
ATOM   5102  H  HE1  . PHE A 1 120 ? 6.809   5.385   4.212   1.00 0.00 ? 120 PHE A HE1  2  
ATOM   5103  H  HE2  . PHE A 1 120 ? 5.280   6.635   8.028   1.00 0.00 ? 120 PHE A HE2  2  
ATOM   5104  H  HZ   . PHE A 1 120 ? 7.071   6.680   6.310   1.00 0.00 ? 120 PHE A HZ   2  
ATOM   5105  N  N    . THR A 1 121 ? 2.547   5.300   2.221   1.00 0.00 ? 121 THR A N    2  
ATOM   5106  C  CA   . THR A 1 121 ? 3.179   5.294   0.914   1.00 0.00 ? 121 THR A CA   2  
ATOM   5107  C  C    . THR A 1 121 ? 4.434   6.164   0.910   1.00 0.00 ? 121 THR A C    2  
ATOM   5108  O  O    . THR A 1 121 ? 4.577   7.069   1.731   1.00 0.00 ? 121 THR A O    2  
ATOM   5109  C  CB   . THR A 1 121 ? 2.158   5.772   -0.135  1.00 0.00 ? 121 THR A CB   2  
ATOM   5110  O  OG1  . THR A 1 121 ? 2.633   6.957   -0.757  1.00 0.00 ? 121 THR A OG1  2  
ATOM   5111  C  CG2  . THR A 1 121 ? 0.805   6.047   0.540   1.00 0.00 ? 121 THR A CG2  2  
ATOM   5112  H  H    . THR A 1 121 ? 2.041   6.086   2.502   1.00 0.00 ? 121 THR A H    2  
ATOM   5113  H  HA   . THR A 1 121 ? 3.471   4.284   0.677   1.00 0.00 ? 121 THR A HA   2  
ATOM   5114  H  HB   . THR A 1 121 ? 2.015   5.000   -0.879  1.00 0.00 ? 121 THR A HB   2  
ATOM   5115  H  HG1  . THR A 1 121 ? 3.585   6.876   -0.860  1.00 0.00 ? 121 THR A HG1  2  
ATOM   5116  H  HG21 . THR A 1 121 ? 0.896   6.889   1.209   1.00 0.00 ? 121 THR A HG21 2  
ATOM   5117  H  HG22 . THR A 1 121 ? 0.502   5.175   1.102   1.00 0.00 ? 121 THR A HG22 2  
ATOM   5118  H  HG23 . THR A 1 121 ? 0.062   6.260   -0.213  1.00 0.00 ? 121 THR A HG23 2  
ATOM   5119  N  N    . ALA A 1 122 ? 5.356   5.852   0.003   1.00 0.00 ? 122 ALA A N    2  
ATOM   5120  C  CA   . ALA A 1 122 ? 6.621   6.579   -0.074  1.00 0.00 ? 122 ALA A CA   2  
ATOM   5121  C  C    . ALA A 1 122 ? 6.554   7.782   -1.010  1.00 0.00 ? 122 ALA A C    2  
ATOM   5122  O  O    . ALA A 1 122 ? 6.835   8.905   -0.591  1.00 0.00 ? 122 ALA A O    2  
ATOM   5123  C  CB   . ALA A 1 122 ? 7.734   5.640   -0.539  1.00 0.00 ? 122 ALA A CB   2  
ATOM   5124  H  H    . ALA A 1 122 ? 5.195   5.103   -0.605  1.00 0.00 ? 122 ALA A H    2  
ATOM   5125  H  HA   . ALA A 1 122 ? 6.870   6.932   0.915   1.00 0.00 ? 122 ALA A HA   2  
ATOM   5126  H  HB1  . ALA A 1 122 ? 7.676   4.713   0.011   1.00 0.00 ? 122 ALA A HB1  2  
ATOM   5127  H  HB2  . ALA A 1 122 ? 8.693   6.105   -0.361  1.00 0.00 ? 122 ALA A HB2  2  
ATOM   5128  H  HB3  . ALA A 1 122 ? 7.620   5.441   -1.595  1.00 0.00 ? 122 ALA A HB3  2  
ATOM   5129  N  N    . ARG A 1 123 ? 6.217   7.558   -2.279  1.00 0.00 ? 123 ARG A N    2  
ATOM   5130  C  CA   . ARG A 1 123 ? 6.168   8.672   -3.223  1.00 0.00 ? 123 ARG A CA   2  
ATOM   5131  C  C    . ARG A 1 123 ? 5.498   8.297   -4.542  1.00 0.00 ? 123 ARG A C    2  
ATOM   5132  O  O    . ARG A 1 123 ? 5.474   7.134   -4.945  1.00 0.00 ? 123 ARG A O    2  
ATOM   5133  C  CB   . ARG A 1 123 ? 7.594   9.166   -3.494  1.00 0.00 ? 123 ARG A CB   2  
ATOM   5134  C  CG   . ARG A 1 123 ? 8.561   7.981   -3.407  1.00 0.00 ? 123 ARG A CG   2  
ATOM   5135  C  CD   . ARG A 1 123 ? 9.808   8.264   -4.244  1.00 0.00 ? 123 ARG A CD   2  
ATOM   5136  N  NE   . ARG A 1 123 ? 10.873  7.330   -3.889  1.00 0.00 ? 123 ARG A NE   2  
ATOM   5137  C  CZ   . ARG A 1 123 ? 11.983  7.245   -4.615  1.00 0.00 ? 123 ARG A CZ   2  
ATOM   5138  N  NH1  . ARG A 1 123 ? 12.134  7.999   -5.668  1.00 0.00 ? 123 ARG A NH1  2  
ATOM   5139  N  NH2  . ARG A 1 123 ? 12.921  6.402   -4.277  1.00 0.00 ? 123 ARG A NH2  2  
ATOM   5140  H  H    . ARG A 1 123 ? 6.021   6.647   -2.583  1.00 0.00 ? 123 ARG A H    2  
ATOM   5141  H  HA   . ARG A 1 123 ? 5.608   9.472   -2.775  1.00 0.00 ? 123 ARG A HA   2  
ATOM   5142  H  HB2  . ARG A 1 123 ? 7.647   9.606   -4.482  1.00 0.00 ? 123 ARG A HB2  2  
ATOM   5143  H  HB3  . ARG A 1 123 ? 7.866   9.904   -2.756  1.00 0.00 ? 123 ARG A HB3  2  
ATOM   5144  H  HG2  . ARG A 1 123 ? 8.847   7.828   -2.377  1.00 0.00 ? 123 ARG A HG2  2  
ATOM   5145  H  HG3  . ARG A 1 123 ? 8.075   7.092   -3.780  1.00 0.00 ? 123 ARG A HG3  2  
ATOM   5146  H  HD2  . ARG A 1 123 ? 9.573   8.150   -5.291  1.00 0.00 ? 123 ARG A HD2  2  
ATOM   5147  H  HD3  . ARG A 1 123 ? 10.142  9.274   -4.061  1.00 0.00 ? 123 ARG A HD3  2  
ATOM   5148  H  HE   . ARG A 1 123 ? 10.767  6.755   -3.102  1.00 0.00 ? 123 ARG A HE   2  
ATOM   5149  H  HH11 . ARG A 1 123 ? 11.414  8.642   -5.930  1.00 0.00 ? 123 ARG A HH11 2  
ATOM   5150  H  HH12 . ARG A 1 123 ? 12.970  7.935   -6.212  1.00 0.00 ? 123 ARG A HH12 2  
ATOM   5151  H  HH21 . ARG A 1 123 ? 12.805  5.822   -3.472  1.00 0.00 ? 123 ARG A HH21 2  
ATOM   5152  H  HH22 . ARG A 1 123 ? 13.757  6.339   -4.824  1.00 0.00 ? 123 ARG A HH22 2  
ATOM   5153  N  N    . ILE A 1 124 ? 4.965   9.321   -5.206  1.00 0.00 ? 124 ILE A N    2  
ATOM   5154  C  CA   . ILE A 1 124 ? 4.292   9.157   -6.491  1.00 0.00 ? 124 ILE A CA   2  
ATOM   5155  C  C    . ILE A 1 124 ? 4.737   10.255  -7.452  1.00 0.00 ? 124 ILE A C    2  
ATOM   5156  O  O    . ILE A 1 124 ? 4.946   11.397  -7.043  1.00 0.00 ? 124 ILE A O    2  
ATOM   5157  C  CB   . ILE A 1 124 ? 2.777   9.245   -6.295  1.00 0.00 ? 124 ILE A CB   2  
ATOM   5158  C  CG1  . ILE A 1 124 ? 2.439   10.551  -5.530  1.00 0.00 ? 124 ILE A CG1  2  
ATOM   5159  C  CG2  . ILE A 1 124 ? 2.302   8.006   -5.528  1.00 0.00 ? 124 ILE A CG2  2  
ATOM   5160  C  CD1  . ILE A 1 124 ? 1.278   10.344  -4.550  1.00 0.00 ? 124 ILE A CD1  2  
ATOM   5161  H  H    . ILE A 1 124 ? 5.030   10.219  -4.819  1.00 0.00 ? 124 ILE A H    2  
ATOM   5162  H  HA   . ILE A 1 124 ? 4.542   8.194   -6.906  1.00 0.00 ? 124 ILE A HA   2  
ATOM   5163  H  HB   . ILE A 1 124 ? 2.297   9.264   -7.265  1.00 0.00 ? 124 ILE A HB   2  
ATOM   5164  H  HG12 . ILE A 1 124 ? 3.302   10.884  -4.977  1.00 0.00 ? 124 ILE A HG12 2  
ATOM   5165  H  HG13 . ILE A 1 124 ? 2.163   11.314  -6.242  1.00 0.00 ? 124 ILE A HG13 2  
ATOM   5166  H  HG21 . ILE A 1 124 ? 1.223   7.971   -5.535  1.00 0.00 ? 124 ILE A HG21 2  
ATOM   5167  H  HG22 . ILE A 1 124 ? 2.658   8.051   -4.511  1.00 0.00 ? 124 ILE A HG22 2  
ATOM   5168  H  HG23 . ILE A 1 124 ? 2.692   7.116   -6.005  1.00 0.00 ? 124 ILE A HG23 2  
ATOM   5169  H  HD11 . ILE A 1 124 ? 1.643   9.851   -3.662  1.00 0.00 ? 124 ILE A HD11 2  
ATOM   5170  H  HD12 . ILE A 1 124 ? 0.518   9.739   -5.014  1.00 0.00 ? 124 ILE A HD12 2  
ATOM   5171  H  HD13 . ILE A 1 124 ? 0.861   11.303  -4.280  1.00 0.00 ? 124 ILE A HD13 2  
ATOM   5172  N  N    . TYR A 1 125 ? 4.877   9.912   -8.729  1.00 0.00 ? 125 TYR A N    2  
ATOM   5173  C  CA   . TYR A 1 125 ? 5.293   10.893  -9.728  1.00 0.00 ? 125 TYR A CA   2  
ATOM   5174  C  C    . TYR A 1 125 ? 4.468   10.737  -11.003 1.00 0.00 ? 125 TYR A C    2  
ATOM   5175  O  O    . TYR A 1 125 ? 4.858   10.021  -11.926 1.00 0.00 ? 125 TYR A O    2  
ATOM   5176  C  CB   . TYR A 1 125 ? 6.790   10.720  -10.040 1.00 0.00 ? 125 TYR A CB   2  
ATOM   5177  C  CG   . TYR A 1 125 ? 7.611   11.646  -9.169  1.00 0.00 ? 125 TYR A CG   2  
ATOM   5178  C  CD1  . TYR A 1 125 ? 7.750   11.387  -7.798  1.00 0.00 ? 125 TYR A CD1  2  
ATOM   5179  C  CD2  . TYR A 1 125 ? 8.236   12.766  -9.733  1.00 0.00 ? 125 TYR A CD2  2  
ATOM   5180  C  CE1  . TYR A 1 125 ? 8.512   12.247  -6.997  1.00 0.00 ? 125 TYR A CE1  2  
ATOM   5181  C  CE2  . TYR A 1 125 ? 8.998   13.624  -8.932  1.00 0.00 ? 125 TYR A CE2  2  
ATOM   5182  C  CZ   . TYR A 1 125 ? 9.135   13.365  -7.563  1.00 0.00 ? 125 TYR A CZ   2  
ATOM   5183  O  OH   . TYR A 1 125 ? 9.887   14.210  -6.773  1.00 0.00 ? 125 TYR A OH   2  
ATOM   5184  H  H    . TYR A 1 125 ? 4.695   8.990   -9.005  1.00 0.00 ? 125 TYR A H    2  
ATOM   5185  H  HA   . TYR A 1 125 ? 5.130   11.887  -9.334  1.00 0.00 ? 125 TYR A HA   2  
ATOM   5186  H  HB2  . TYR A 1 125 ? 7.078   9.697   -9.845  1.00 0.00 ? 125 TYR A HB2  2  
ATOM   5187  H  HB3  . TYR A 1 125 ? 6.974   10.951  -11.080 1.00 0.00 ? 125 TYR A HB3  2  
ATOM   5188  H  HD1  . TYR A 1 125 ? 7.268   10.527  -7.358  1.00 0.00 ? 125 TYR A HD1  2  
ATOM   5189  H  HD2  . TYR A 1 125 ? 8.129   12.967  -10.788 1.00 0.00 ? 125 TYR A HD2  2  
ATOM   5190  H  HE1  . TYR A 1 125 ? 8.619   12.048  -5.941  1.00 0.00 ? 125 TYR A HE1  2  
ATOM   5191  H  HE2  . TYR A 1 125 ? 9.479   14.487  -9.369  1.00 0.00 ? 125 TYR A HE2  2  
ATOM   5192  H  HH   . TYR A 1 125 ? 9.780   13.935  -5.860  1.00 0.00 ? 125 TYR A HH   2  
ATOM   5193  N  N    . ASP A 1 126 ? 3.322   11.415  -11.047 1.00 0.00 ? 126 ASP A N    2  
ATOM   5194  C  CA   . ASP A 1 126 ? 2.444   11.350  -12.212 1.00 0.00 ? 126 ASP A CA   2  
ATOM   5195  C  C    . ASP A 1 126 ? 1.963   12.744  -12.599 1.00 0.00 ? 126 ASP A C    2  
ATOM   5196  O  O    . ASP A 1 126 ? 2.190   13.714  -11.875 1.00 0.00 ? 126 ASP A O    2  
ATOM   5197  C  CB   . ASP A 1 126 ? 1.238   10.458  -11.908 1.00 0.00 ? 126 ASP A CB   2  
ATOM   5198  C  CG   . ASP A 1 126 ? 0.504   10.975  -10.676 1.00 0.00 ? 126 ASP A CG   2  
ATOM   5199  O  OD1  . ASP A 1 126 ? 0.743   12.112  -10.301 1.00 0.00 ? 126 ASP A OD1  2  
ATOM   5200  O  OD2  . ASP A 1 126 ? -0.287  10.228  -10.124 1.00 0.00 ? 126 ASP A OD2  2  
ATOM   5201  H  H    . ASP A 1 126 ? 3.065   11.970  -10.281 1.00 0.00 ? 126 ASP A H    2  
ATOM   5202  H  HA   . ASP A 1 126 ? 2.988   10.925  -13.042 1.00 0.00 ? 126 ASP A HA   2  
ATOM   5203  H  HB2  . ASP A 1 126 ? 0.566   10.463  -12.753 1.00 0.00 ? 126 ASP A HB2  2  
ATOM   5204  H  HB3  . ASP A 1 126 ? 1.575   9.449   -11.724 1.00 0.00 ? 126 ASP A HB3  2  
ATOM   5205  N  N    . ASP A 1 127 ? 1.303   12.839  -13.751 1.00 0.00 ? 127 ASP A N    2  
ATOM   5206  C  CA   . ASP A 1 127 ? 0.796   14.122  -14.239 1.00 0.00 ? 127 ASP A CA   2  
ATOM   5207  C  C    . ASP A 1 127 ? -0.729  14.165  -14.176 1.00 0.00 ? 127 ASP A C    2  
ATOM   5208  O  O    . ASP A 1 127 ? -1.382  14.649  -15.101 1.00 0.00 ? 127 ASP A O    2  
ATOM   5209  C  CB   . ASP A 1 127 ? 1.255   14.346  -15.682 1.00 0.00 ? 127 ASP A CB   2  
ATOM   5210  C  CG   . ASP A 1 127 ? 2.634   13.731  -15.894 1.00 0.00 ? 127 ASP A CG   2  
ATOM   5211  O  OD1  . ASP A 1 127 ? 3.605   14.345  -15.484 1.00 0.00 ? 127 ASP A OD1  2  
ATOM   5212  O  OD2  . ASP A 1 127 ? 2.699   12.655  -16.465 1.00 0.00 ? 127 ASP A OD2  2  
ATOM   5213  H  H    . ASP A 1 127 ? 1.157   12.032  -14.287 1.00 0.00 ? 127 ASP A H    2  
ATOM   5214  H  HA   . ASP A 1 127 ? 1.193   14.915  -13.622 1.00 0.00 ? 127 ASP A HA   2  
ATOM   5215  H  HB2  . ASP A 1 127 ? 0.549   13.887  -16.358 1.00 0.00 ? 127 ASP A HB2  2  
ATOM   5216  H  HB3  . ASP A 1 127 ? 1.303   15.407  -15.880 1.00 0.00 ? 127 ASP A HB3  2  
ATOM   5217  N  N    . GLN A 1 128 ? -1.292  13.661  -13.083 1.00 0.00 ? 128 GLN A N    2  
ATOM   5218  C  CA   . GLN A 1 128 ? -2.737  13.652  -12.916 1.00 0.00 ? 128 GLN A CA   2  
ATOM   5219  C  C    . GLN A 1 128 ? -3.257  15.079  -12.814 1.00 0.00 ? 128 GLN A C    2  
ATOM   5220  O  O    . GLN A 1 128 ? -3.584  15.705  -13.823 1.00 0.00 ? 128 GLN A O    2  
ATOM   5221  C  CB   . GLN A 1 128 ? -3.112  12.875  -11.654 1.00 0.00 ? 128 GLN A CB   2  
ATOM   5222  C  CG   . GLN A 1 128 ? -3.028  11.373  -11.934 1.00 0.00 ? 128 GLN A CG   2  
ATOM   5223  C  CD   . GLN A 1 128 ? -4.168  10.948  -12.852 1.00 0.00 ? 128 GLN A CD   2  
ATOM   5224  O  OE1  . GLN A 1 128 ? -4.204  9.807   -13.314 1.00 0.00 ? 128 GLN A OE1  2  
ATOM   5225  N  NE2  . GLN A 1 128 ? -5.110  11.803  -13.144 1.00 0.00 ? 128 GLN A NE2  2  
ATOM   5226  H  H    . GLN A 1 128 ? -0.731  13.294  -12.377 1.00 0.00 ? 128 GLN A H    2  
ATOM   5227  H  HA   . GLN A 1 128 ? -3.183  13.173  -13.770 1.00 0.00 ? 128 GLN A HA   2  
ATOM   5228  H  HB2  . GLN A 1 128 ? -2.430  13.132  -10.857 1.00 0.00 ? 128 GLN A HB2  2  
ATOM   5229  H  HB3  . GLN A 1 128 ? -4.119  13.129  -11.360 1.00 0.00 ? 128 GLN A HB3  2  
ATOM   5230  H  HG2  . GLN A 1 128 ? -2.083  11.150  -12.409 1.00 0.00 ? 128 GLN A HG2  2  
ATOM   5231  H  HG3  . GLN A 1 128 ? -3.097  10.831  -11.003 1.00 0.00 ? 128 GLN A HG3  2  
ATOM   5232  H  HE21 . GLN A 1 128 ? -5.079  12.710  -12.775 1.00 0.00 ? 128 GLN A HE21 2  
ATOM   5233  H  HE22 . GLN A 1 128 ? -5.846  11.539  -13.735 1.00 0.00 ? 128 GLN A HE22 2  
ATOM   5234  N  N    . GLY A 1 129 ? -3.319  15.594  -11.590 1.00 0.00 ? 129 GLY A N    2  
ATOM   5235  C  CA   . GLY A 1 129 ? -3.788  16.954  -11.370 1.00 0.00 ? 129 GLY A CA   2  
ATOM   5236  C  C    . GLY A 1 129 ? -5.224  16.974  -10.854 1.00 0.00 ? 129 GLY A C    2  
ATOM   5237  O  O    . GLY A 1 129 ? -5.583  16.206  -9.963  1.00 0.00 ? 129 GLY A O    2  
ATOM   5238  H  H    . GLY A 1 129 ? -3.037  15.051  -10.825 1.00 0.00 ? 129 GLY A H    2  
ATOM   5239  H  HA2  . GLY A 1 129 ? -3.145  17.435  -10.646 1.00 0.00 ? 129 GLY A HA2  2  
ATOM   5240  H  HA3  . GLY A 1 129 ? -3.738  17.499  -12.300 1.00 0.00 ? 129 GLY A HA3  2  
ATOM   5241  N  N    . ARG A 1 130 ? -6.034  17.868  -11.416 1.00 0.00 ? 130 ARG A N    2  
ATOM   5242  C  CA   . ARG A 1 130 ? -7.431  18.002  -11.008 1.00 0.00 ? 130 ARG A CA   2  
ATOM   5243  C  C    . ARG A 1 130 ? -8.067  16.642  -10.728 1.00 0.00 ? 130 ARG A C    2  
ATOM   5244  O  O    . ARG A 1 130 ? -8.904  16.513  -9.835  1.00 0.00 ? 130 ARG A O    2  
ATOM   5245  C  CB   . ARG A 1 130 ? -8.224  18.718  -12.104 1.00 0.00 ? 130 ARG A CB   2  
ATOM   5246  C  CG   . ARG A 1 130 ? -7.459  19.962  -12.562 1.00 0.00 ? 130 ARG A CG   2  
ATOM   5247  C  CD   . ARG A 1 130 ? -8.356  20.805  -13.469 1.00 0.00 ? 130 ARG A CD   2  
ATOM   5248  N  NE   . ARG A 1 130 ? -9.025  19.957  -14.448 1.00 0.00 ? 130 ARG A NE   2  
ATOM   5249  C  CZ   . ARG A 1 130 ? -9.912  20.460  -15.301 1.00 0.00 ? 130 ARG A CZ   2  
ATOM   5250  N  NH1  . ARG A 1 130 ? -10.199 21.733  -15.269 1.00 0.00 ? 130 ARG A NH1  2  
ATOM   5251  N  NH2  . ARG A 1 130 ? -10.496 19.681  -16.170 1.00 0.00 ? 130 ARG A NH2  2  
ATOM   5252  H  H    . ARG A 1 130 ? -5.683  18.455  -12.118 1.00 0.00 ? 130 ARG A H    2  
ATOM   5253  H  HA   . ARG A 1 130 ? -7.474  18.597  -10.108 1.00 0.00 ? 130 ARG A HA   2  
ATOM   5254  H  HB2  . ARG A 1 130 ? -8.362  18.051  -12.942 1.00 0.00 ? 130 ARG A HB2  2  
ATOM   5255  H  HB3  . ARG A 1 130 ? -9.188  19.013  -11.717 1.00 0.00 ? 130 ARG A HB3  2  
ATOM   5256  H  HG2  . ARG A 1 130 ? -7.169  20.543  -11.698 1.00 0.00 ? 130 ARG A HG2  2  
ATOM   5257  H  HG3  . ARG A 1 130 ? -6.577  19.662  -13.108 1.00 0.00 ? 130 ARG A HG3  2  
ATOM   5258  H  HD2  . ARG A 1 130 ? -9.098  21.309  -12.870 1.00 0.00 ? 130 ARG A HD2  2  
ATOM   5259  H  HD3  . ARG A 1 130 ? -7.753  21.542  -13.982 1.00 0.00 ? 130 ARG A HD3  2  
ATOM   5260  H  HE   . ARG A 1 130 ? -8.816  19.000  -14.479 1.00 0.00 ? 130 ARG A HE   2  
ATOM   5261  H  HH11 . ARG A 1 130 ? -9.751  22.329  -14.602 1.00 0.00 ? 130 ARG A HH11 2  
ATOM   5262  H  HH12 . ARG A 1 130 ? -10.865 22.111  -15.911 1.00 0.00 ? 130 ARG A HH12 2  
ATOM   5263  H  HH21 . ARG A 1 130 ? -10.276 18.706  -16.193 1.00 0.00 ? 130 ARG A HH21 2  
ATOM   5264  H  HH22 . ARG A 1 130 ? -11.163 20.059  -16.811 1.00 0.00 ? 130 ARG A HH22 2  
ATOM   5265  N  N    . CYS A 1 131 ? -7.675  15.634  -11.498 1.00 0.00 ? 131 CYS A N    2  
ATOM   5266  C  CA   . CYS A 1 131 ? -8.224  14.292  -11.324 1.00 0.00 ? 131 CYS A CA   2  
ATOM   5267  C  C    . CYS A 1 131 ? -8.069  13.821  -9.875  1.00 0.00 ? 131 CYS A C    2  
ATOM   5268  O  O    . CYS A 1 131 ? -8.527  12.741  -9.509  1.00 0.00 ? 131 CYS A O    2  
ATOM   5269  C  CB   . CYS A 1 131 ? -7.517  13.319  -12.278 1.00 0.00 ? 131 CYS A CB   2  
ATOM   5270  S  SG   . CYS A 1 131 ? -8.739  12.221  -13.043 1.00 0.00 ? 131 CYS A SG   2  
ATOM   5271  H  H    . CYS A 1 131 ? -7.009  15.794  -12.200 1.00 0.00 ? 131 CYS A H    2  
ATOM   5272  H  HA   . CYS A 1 131 ? -9.275  14.315  -11.571 1.00 0.00 ? 131 CYS A HA   2  
ATOM   5273  H  HB2  . CYS A 1 131 ? -7.011  13.880  -13.050 1.00 0.00 ? 131 CYS A HB2  2  
ATOM   5274  H  HB3  . CYS A 1 131 ? -6.795  12.728  -11.733 1.00 0.00 ? 131 CYS A HB3  2  
ATOM   5275  H  HG   . CYS A 1 131 ? -8.526  11.320  -12.791 1.00 0.00 ? 131 CYS A HG   2  
ATOM   5276  N  N    . GLN A 1 132 ? -7.421  14.641  -9.058  1.00 0.00 ? 132 GLN A N    2  
ATOM   5277  C  CA   . GLN A 1 132 ? -7.204  14.307  -7.652  1.00 0.00 ? 132 GLN A CA   2  
ATOM   5278  C  C    . GLN A 1 132 ? -8.511  13.926  -6.954  1.00 0.00 ? 132 GLN A C    2  
ATOM   5279  O  O    . GLN A 1 132 ? -8.495  13.461  -5.814  1.00 0.00 ? 132 GLN A O    2  
ATOM   5280  C  CB   . GLN A 1 132 ? -6.579  15.498  -6.926  1.00 0.00 ? 132 GLN A CB   2  
ATOM   5281  C  CG   . GLN A 1 132 ? -7.276  16.789  -7.363  1.00 0.00 ? 132 GLN A CG   2  
ATOM   5282  C  CD   . GLN A 1 132 ? -7.017  17.893  -6.344  1.00 0.00 ? 132 GLN A CD   2  
ATOM   5283  O  OE1  . GLN A 1 132 ? -7.877  18.186  -5.513  1.00 0.00 ? 132 GLN A OE1  2  
ATOM   5284  N  NE2  . GLN A 1 132 ? -5.877  18.527  -6.358  1.00 0.00 ? 132 GLN A NE2  2  
ATOM   5285  H  H    . GLN A 1 132 ? -7.077  15.489  -9.406  1.00 0.00 ? 132 GLN A H    2  
ATOM   5286  H  HA   . GLN A 1 132 ? -6.523  13.473  -7.594  1.00 0.00 ? 132 GLN A HA   2  
ATOM   5287  H  HB2  . GLN A 1 132 ? -6.697  15.368  -5.860  1.00 0.00 ? 132 GLN A HB2  2  
ATOM   5288  H  HB3  . GLN A 1 132 ? -5.528  15.558  -7.169  1.00 0.00 ? 132 GLN A HB3  2  
ATOM   5289  H  HG2  . GLN A 1 132 ? -6.896  17.094  -8.325  1.00 0.00 ? 132 GLN A HG2  2  
ATOM   5290  H  HG3  . GLN A 1 132 ? -8.339  16.613  -7.437  1.00 0.00 ? 132 GLN A HG3  2  
ATOM   5291  H  HE21 . GLN A 1 132 ? -5.194  18.293  -7.021  1.00 0.00 ? 132 GLN A HE21 2  
ATOM   5292  H  HE22 . GLN A 1 132 ? -5.705  19.240  -5.708  1.00 0.00 ? 132 GLN A HE22 2  
ATOM   5293  N  N    . GLU A 1 133 ? -9.637  14.149  -7.625  1.00 0.00 ? 133 GLU A N    2  
ATOM   5294  C  CA   . GLU A 1 133 ? -10.942 13.852  -7.038  1.00 0.00 ? 133 GLU A CA   2  
ATOM   5295  C  C    . GLU A 1 133 ? -10.879 12.634  -6.111  1.00 0.00 ? 133 GLU A C    2  
ATOM   5296  O  O    . GLU A 1 133 ? -11.048 12.765  -4.898  1.00 0.00 ? 133 GLU A O    2  
ATOM   5297  C  CB   . GLU A 1 133 ? -11.979 13.623  -8.147  1.00 0.00 ? 133 GLU A CB   2  
ATOM   5298  C  CG   . GLU A 1 133 ? -11.294 13.099  -9.399  1.00 0.00 ? 133 GLU A CG   2  
ATOM   5299  C  CD   . GLU A 1 133 ? -12.336 12.734  -10.452 1.00 0.00 ? 133 GLU A CD   2  
ATOM   5300  O  OE1  . GLU A 1 133 ? -12.996 13.635  -10.942 1.00 0.00 ? 133 GLU A OE1  2  
ATOM   5301  O  OE2  . GLU A 1 133 ? -12.460 11.557  -10.751 1.00 0.00 ? 133 GLU A OE2  2  
ATOM   5302  H  H    . GLU A 1 133 ? -9.593  14.541  -8.522  1.00 0.00 ? 133 GLU A H    2  
ATOM   5303  H  HA   . GLU A 1 133 ? -11.251 14.702  -6.458  1.00 0.00 ? 133 GLU A HA   2  
ATOM   5304  H  HB2  . GLU A 1 133 ? -12.704 12.907  -7.820  1.00 0.00 ? 133 GLU A HB2  2  
ATOM   5305  H  HB3  . GLU A 1 133 ? -12.471 14.556  -8.376  1.00 0.00 ? 133 GLU A HB3  2  
ATOM   5306  H  HG2  . GLU A 1 133 ? -10.645 13.860  -9.788  1.00 0.00 ? 133 GLU A HG2  2  
ATOM   5307  H  HG3  . GLU A 1 133 ? -10.718 12.224  -9.150  1.00 0.00 ? 133 GLU A HG3  2  
ATOM   5308  N  N    . GLY A 1 134 ? -10.640 11.457  -6.676  1.00 0.00 ? 134 GLY A N    2  
ATOM   5309  C  CA   . GLY A 1 134 ? -10.566 10.239  -5.875  1.00 0.00 ? 134 GLY A CA   2  
ATOM   5310  C  C    . GLY A 1 134 ? -9.613  10.409  -4.698  1.00 0.00 ? 134 GLY A C    2  
ATOM   5311  O  O    . GLY A 1 134 ? -10.001 10.245  -3.542  1.00 0.00 ? 134 GLY A O    2  
ATOM   5312  H  H    . GLY A 1 134 ? -10.513 11.403  -7.643  1.00 0.00 ? 134 GLY A H    2  
ATOM   5313  H  HA2  . GLY A 1 134 ? -11.551 9.995   -5.507  1.00 0.00 ? 134 GLY A HA2  2  
ATOM   5314  H  HA3  . GLY A 1 134 ? -10.214 9.436   -6.492  1.00 0.00 ? 134 GLY A HA3  2  
ATOM   5315  N  N    . LEU A 1 135 ? -8.362  10.729  -5.008  1.00 0.00 ? 135 LEU A N    2  
ATOM   5316  C  CA   . LEU A 1 135 ? -7.341  10.915  -3.982  1.00 0.00 ? 135 LEU A CA   2  
ATOM   5317  C  C    . LEU A 1 135 ? -7.950  11.504  -2.709  1.00 0.00 ? 135 LEU A C    2  
ATOM   5318  O  O    . LEU A 1 135 ? -7.969  10.864  -1.659  1.00 0.00 ? 135 LEU A O    2  
ATOM   5319  C  CB   . LEU A 1 135 ? -6.251  11.860  -4.524  1.00 0.00 ? 135 LEU A CB   2  
ATOM   5320  C  CG   . LEU A 1 135 ? -4.859  11.247  -4.331  1.00 0.00 ? 135 LEU A CG   2  
ATOM   5321  C  CD1  . LEU A 1 135 ? -3.815  12.144  -5.005  1.00 0.00 ? 135 LEU A CD1  2  
ATOM   5322  C  CD2  . LEU A 1 135 ? -4.543  11.127  -2.832  1.00 0.00 ? 135 LEU A CD2  2  
ATOM   5323  H  H    . LEU A 1 135 ? -8.116  10.839  -5.950  1.00 0.00 ? 135 LEU A H    2  
ATOM   5324  H  HA   . LEU A 1 135 ? -6.901  9.956   -3.749  1.00 0.00 ? 135 LEU A HA   2  
ATOM   5325  H  HB2  . LEU A 1 135 ? -6.422  12.023  -5.578  1.00 0.00 ? 135 LEU A HB2  2  
ATOM   5326  H  HB3  . LEU A 1 135 ? -6.296  12.809  -4.008  1.00 0.00 ? 135 LEU A HB3  2  
ATOM   5327  H  HG   . LEU A 1 135 ? -4.833  10.267  -4.785  1.00 0.00 ? 135 LEU A HG   2  
ATOM   5328  H  HD11 . LEU A 1 135 ? -2.975  11.546  -5.315  1.00 0.00 ? 135 LEU A HD11 2  
ATOM   5329  H  HD12 . LEU A 1 135 ? -3.482  12.896  -4.305  1.00 0.00 ? 135 LEU A HD12 2  
ATOM   5330  H  HD13 . LEU A 1 135 ? -4.252  12.627  -5.867  1.00 0.00 ? 135 LEU A HD13 2  
ATOM   5331  H  HD21 . LEU A 1 135 ? -5.463  11.059  -2.270  1.00 0.00 ? 135 LEU A HD21 2  
ATOM   5332  H  HD22 . LEU A 1 135 ? -3.986  11.994  -2.505  1.00 0.00 ? 135 LEU A HD22 2  
ATOM   5333  H  HD23 . LEU A 1 135 ? -3.952  10.239  -2.661  1.00 0.00 ? 135 LEU A HD23 2  
ATOM   5334  N  N    . ARG A 1 136 ? -8.427  12.735  -2.810  1.00 0.00 ? 136 ARG A N    2  
ATOM   5335  C  CA   . ARG A 1 136 ? -9.018  13.414  -1.676  1.00 0.00 ? 136 ARG A CA   2  
ATOM   5336  C  C    . ARG A 1 136 ? -10.256 12.682  -1.160  1.00 0.00 ? 136 ARG A C    2  
ATOM   5337  O  O    . ARG A 1 136 ? -10.639 12.834  0.001   1.00 0.00 ? 136 ARG A O    2  
ATOM   5338  C  CB   . ARG A 1 136 ? -9.402  14.837  -2.093  1.00 0.00 ? 136 ARG A CB   2  
ATOM   5339  C  CG   . ARG A 1 136 ? -10.077 15.557  -0.919  1.00 0.00 ? 136 ARG A CG   2  
ATOM   5340  C  CD   . ARG A 1 136 ? -11.600 15.565  -1.107  1.00 0.00 ? 136 ARG A CD   2  
ATOM   5341  N  NE   . ARG A 1 136 ? -12.243 16.279  -0.010  1.00 0.00 ? 136 ARG A NE   2  
ATOM   5342  C  CZ   . ARG A 1 136 ? -13.550 16.173  0.205   1.00 0.00 ? 136 ARG A CZ   2  
ATOM   5343  N  NH1  . ARG A 1 136 ? -14.280 15.421  -0.573  1.00 0.00 ? 136 ARG A NH1  2  
ATOM   5344  N  NH2  . ARG A 1 136 ? -14.105 16.818  1.193   1.00 0.00 ? 136 ARG A NH2  2  
ATOM   5345  H  H    . ARG A 1 136 ? -8.371  13.203  -3.663  1.00 0.00 ? 136 ARG A H    2  
ATOM   5346  H  HA   . ARG A 1 136 ? -8.289  13.472  -0.886  1.00 0.00 ? 136 ARG A HA   2  
ATOM   5347  H  HB2  . ARG A 1 136 ? -8.509  15.375  -2.382  1.00 0.00 ? 136 ARG A HB2  2  
ATOM   5348  H  HB3  . ARG A 1 136 ? -10.081 14.794  -2.933  1.00 0.00 ? 136 ARG A HB3  2  
ATOM   5349  H  HG2  . ARG A 1 136 ? -9.830  15.045  -0.004  1.00 0.00 ? 136 ARG A HG2  2  
ATOM   5350  H  HG3  . ARG A 1 136 ? -9.719  16.575  -0.868  1.00 0.00 ? 136 ARG A HG3  2  
ATOM   5351  H  HD2  . ARG A 1 136 ? -11.842 16.051  -2.038  1.00 0.00 ? 136 ARG A HD2  2  
ATOM   5352  H  HD3  . ARG A 1 136 ? -11.963 14.548  -1.133  1.00 0.00 ? 136 ARG A HD3  2  
ATOM   5353  H  HE   . ARG A 1 136 ? -11.701 16.845  0.579   1.00 0.00 ? 136 ARG A HE   2  
ATOM   5354  H  HH11 . ARG A 1 136 ? -13.855 14.925  -1.330  1.00 0.00 ? 136 ARG A HH11 2  
ATOM   5355  H  HH12 . ARG A 1 136 ? -15.263 15.342  -0.413  1.00 0.00 ? 136 ARG A HH12 2  
ATOM   5356  H  HH21 . ARG A 1 136 ? -13.547 17.394  1.791   1.00 0.00 ? 136 ARG A HH21 2  
ATOM   5357  H  HH22 . ARG A 1 136 ? -15.090 16.738  1.353   1.00 0.00 ? 136 ARG A HH22 2  
ATOM   5358  N  N    . THR A 1 137 ? -10.890 11.908  -2.032  1.00 0.00 ? 137 THR A N    2  
ATOM   5359  C  CA   . THR A 1 137 ? -12.099 11.184  -1.660  1.00 0.00 ? 137 THR A CA   2  
ATOM   5360  C  C    . THR A 1 137 ? -11.782 9.927   -0.845  1.00 0.00 ? 137 THR A C    2  
ATOM   5361  O  O    . THR A 1 137 ? -12.296 9.780   0.251   1.00 0.00 ? 137 THR A O    2  
ATOM   5362  C  CB   . THR A 1 137 ? -12.921 10.904  -2.938  1.00 0.00 ? 137 THR A CB   2  
ATOM   5363  O  OG1  . THR A 1 137 ? -14.125 11.655  -2.886  1.00 0.00 ? 137 THR A OG1  2  
ATOM   5364  C  CG2  . THR A 1 137 ? -13.267 9.425   -3.093  1.00 0.00 ? 137 THR A CG2  2  
ATOM   5365  H  H    . THR A 1 137 ? -10.551 11.836  -2.949  1.00 0.00 ? 137 THR A H    2  
ATOM   5366  H  HA   . THR A 1 137 ? -12.693 11.819  -1.019  1.00 0.00 ? 137 THR A HA   2  
ATOM   5367  H  HB   . THR A 1 137 ? -12.349 11.223  -3.795  1.00 0.00 ? 137 THR A HB   2  
ATOM   5368  H  HG1  . THR A 1 137 ? -13.938 12.539  -3.211  1.00 0.00 ? 137 THR A HG1  2  
ATOM   5369  H  HG21 . THR A 1 137 ? -13.855 9.287   -3.989  1.00 0.00 ? 137 THR A HG21 2  
ATOM   5370  H  HG22 . THR A 1 137 ? -13.838 9.103   -2.239  1.00 0.00 ? 137 THR A HG22 2  
ATOM   5371  H  HG23 . THR A 1 137 ? -12.361 8.848   -3.168  1.00 0.00 ? 137 THR A HG23 2  
ATOM   5372  N  N    . LEU A 1 138 ? -10.941 9.032   -1.343  1.00 0.00 ? 138 LEU A N    2  
ATOM   5373  C  CA   . LEU A 1 138 ? -10.620 7.830   -0.571  1.00 0.00 ? 138 LEU A CA   2  
ATOM   5374  C  C    . LEU A 1 138 ? -9.768  8.180   0.652   1.00 0.00 ? 138 LEU A C    2  
ATOM   5375  O  O    . LEU A 1 138 ? -9.752  7.437   1.630   1.00 0.00 ? 138 LEU A O    2  
ATOM   5376  C  CB   . LEU A 1 138 ? -9.958  6.764   -1.486  1.00 0.00 ? 138 LEU A CB   2  
ATOM   5377  C  CG   . LEU A 1 138 ? -8.501  6.545   -1.117  1.00 0.00 ? 138 LEU A CG   2  
ATOM   5378  C  CD1  . LEU A 1 138 ? -7.853  5.512   -2.069  1.00 0.00 ? 138 LEU A CD1  2  
ATOM   5379  C  CD2  . LEU A 1 138 ? -7.736  7.880   -1.202  1.00 0.00 ? 138 LEU A CD2  2  
ATOM   5380  H  H    . LEU A 1 138 ? -10.527 9.179   -2.220  1.00 0.00 ? 138 LEU A H    2  
ATOM   5381  H  HA   . LEU A 1 138 ? -11.535 7.421   -0.191  1.00 0.00 ? 138 LEU A HA   2  
ATOM   5382  H  HB2  . LEU A 1 138 ? -10.484 5.824   -1.383  1.00 0.00 ? 138 LEU A HB2  2  
ATOM   5383  H  HB3  . LEU A 1 138 ? -10.017 7.091   -2.502  1.00 0.00 ? 138 LEU A HB3  2  
ATOM   5384  H  HG   . LEU A 1 138 ? -8.484  6.169   -0.111  1.00 0.00 ? 138 LEU A HG   2  
ATOM   5385  H  HD11 . LEU A 1 138 ? -7.184  4.875   -1.511  1.00 0.00 ? 138 LEU A HD11 2  
ATOM   5386  H  HD12 . LEU A 1 138 ? -7.292  6.026   -2.838  1.00 0.00 ? 138 LEU A HD12 2  
ATOM   5387  H  HD13 . LEU A 1 138 ? -8.616  4.912   -2.531  1.00 0.00 ? 138 LEU A HD13 2  
ATOM   5388  H  HD21 . LEU A 1 138 ? -6.956  7.811   -1.941  1.00 0.00 ? 138 LEU A HD21 2  
ATOM   5389  H  HD22 . LEU A 1 138 ? -7.302  8.106   -0.242  1.00 0.00 ? 138 LEU A HD22 2  
ATOM   5390  H  HD23 . LEU A 1 138 ? -8.414  8.671   -1.488  1.00 0.00 ? 138 LEU A HD23 2  
ATOM   5391  N  N    . ALA A 1 139 ? -9.073  9.311   0.601   1.00 0.00 ? 139 ALA A N    2  
ATOM   5392  C  CA   . ALA A 1 139 ? -8.241  9.723   1.721   1.00 0.00 ? 139 ALA A CA   2  
ATOM   5393  C  C    . ALA A 1 139 ? -9.111  10.240  2.859   1.00 0.00 ? 139 ALA A C    2  
ATOM   5394  O  O    . ALA A 1 139 ? -8.865  9.942   4.028   1.00 0.00 ? 139 ALA A O    2  
ATOM   5395  C  CB   . ALA A 1 139 ? -7.260  10.811  1.275   1.00 0.00 ? 139 ALA A CB   2  
ATOM   5396  H  H    . ALA A 1 139 ? -9.123  9.875   -0.197  1.00 0.00 ? 139 ALA A H    2  
ATOM   5397  H  HA   . ALA A 1 139 ? -7.679  8.870   2.069   1.00 0.00 ? 139 ALA A HA   2  
ATOM   5398  H  HB1  . ALA A 1 139 ? -6.691  10.456  0.428   1.00 0.00 ? 139 ALA A HB1  2  
ATOM   5399  H  HB2  . ALA A 1 139 ? -6.586  11.043  2.086   1.00 0.00 ? 139 ALA A HB2  2  
ATOM   5400  H  HB3  . ALA A 1 139 ? -7.807  11.697  0.993   1.00 0.00 ? 139 ALA A HB3  2  
ATOM   5401  N  N    . GLU A 1 140 ? -10.131 11.017  2.508   1.00 0.00 ? 140 GLU A N    2  
ATOM   5402  C  CA   . GLU A 1 140 ? -11.034 11.576  3.502   1.00 0.00 ? 140 GLU A CA   2  
ATOM   5403  C  C    . GLU A 1 140 ? -12.207 10.666  3.761   1.00 0.00 ? 140 GLU A C    2  
ATOM   5404  O  O    . GLU A 1 140 ? -12.687 10.550  4.888   1.00 0.00 ? 140 GLU A O    2  
ATOM   5405  C  CB   . GLU A 1 140 ? -11.568 12.899  2.999   1.00 0.00 ? 140 GLU A CB   2  
ATOM   5406  C  CG   . GLU A 1 140 ? -10.442 13.920  2.995   1.00 0.00 ? 140 GLU A CG   2  
ATOM   5407  C  CD   . GLU A 1 140 ? -10.240 14.487  4.397   1.00 0.00 ? 140 GLU A CD   2  
ATOM   5408  O  OE1  . GLU A 1 140 ? -9.494  13.889  5.155   1.00 0.00 ? 140 GLU A OE1  2  
ATOM   5409  O  OE2  . GLU A 1 140 ? -10.834 15.511  4.693   1.00 0.00 ? 140 GLU A OE2  2  
ATOM   5410  H  H    . GLU A 1 140 ? -10.277 11.228  1.559   1.00 0.00 ? 140 GLU A H    2  
ATOM   5411  H  HA   . GLU A 1 140 ? -10.504 11.736  4.415   1.00 0.00 ? 140 GLU A HA   2  
ATOM   5412  H  HB2  . GLU A 1 140 ? -11.936 12.766  1.998   1.00 0.00 ? 140 GLU A HB2  2  
ATOM   5413  H  HB3  . GLU A 1 140 ? -12.367 13.230  3.637   1.00 0.00 ? 140 GLU A HB3  2  
ATOM   5414  H  HG2  . GLU A 1 140 ? -9.540  13.430  2.669   1.00 0.00 ? 140 GLU A HG2  2  
ATOM   5415  H  HG3  . GLU A 1 140 ? -10.683 14.721  2.313   1.00 0.00 ? 140 GLU A HG3  2  
ATOM   5416  N  N    . ALA A 1 141 ? -12.685 10.049  2.706   1.00 0.00 ? 141 ALA A N    2  
ATOM   5417  C  CA   . ALA A 1 141 ? -13.831 9.178   2.826   1.00 0.00 ? 141 ALA A CA   2  
ATOM   5418  C  C    . ALA A 1 141 ? -13.597 8.134   3.902   1.00 0.00 ? 141 ALA A C    2  
ATOM   5419  O  O    . ALA A 1 141 ? -14.550 7.644   4.508   1.00 0.00 ? 141 ALA A O    2  
ATOM   5420  C  CB   . ALA A 1 141 ? -14.144 8.520   1.491   1.00 0.00 ? 141 ALA A CB   2  
ATOM   5421  H  H    . ALA A 1 141 ? -12.273 10.201  1.833   1.00 0.00 ? 141 ALA A H    2  
ATOM   5422  H  HA   . ALA A 1 141 ? -14.675 9.775   3.116   1.00 0.00 ? 141 ALA A HA   2  
ATOM   5423  H  HB1  . ALA A 1 141 ? -13.280 7.978   1.146   1.00 0.00 ? 141 ALA A HB1  2  
ATOM   5424  H  HB2  . ALA A 1 141 ? -14.410 9.283   0.772   1.00 0.00 ? 141 ALA A HB2  2  
ATOM   5425  H  HB3  . ALA A 1 141 ? -14.970 7.845   1.615   1.00 0.00 ? 141 ALA A HB3  2  
ATOM   5426  N  N    . GLY A 1 142 ? -12.334 7.812   4.177   1.00 0.00 ? 142 GLY A N    2  
ATOM   5427  C  CA   . GLY A 1 142 ? -12.066 6.844   5.233   1.00 0.00 ? 142 GLY A CA   2  
ATOM   5428  C  C    . GLY A 1 142 ? -10.690 6.197   5.138   1.00 0.00 ? 142 GLY A C    2  
ATOM   5429  O  O    . GLY A 1 142 ? -10.292 5.476   6.055   1.00 0.00 ? 142 GLY A O    2  
ATOM   5430  H  H    . GLY A 1 142 ? -11.588 8.245   3.689   1.00 0.00 ? 142 GLY A H    2  
ATOM   5431  H  HA2  . GLY A 1 142 ? -12.140 7.349   6.184   1.00 0.00 ? 142 GLY A HA2  2  
ATOM   5432  H  HA3  . GLY A 1 142 ? -12.819 6.072   5.196   1.00 0.00 ? 142 GLY A HA3  2  
ATOM   5433  N  N    . ALA A 1 143 ? -9.945  6.435   4.062   1.00 0.00 ? 143 ALA A N    2  
ATOM   5434  C  CA   . ALA A 1 143 ? -8.621  5.826   3.966   1.00 0.00 ? 143 ALA A CA   2  
ATOM   5435  C  C    . ALA A 1 143 ? -7.569  6.741   4.573   1.00 0.00 ? 143 ALA A C    2  
ATOM   5436  O  O    . ALA A 1 143 ? -7.355  7.856   4.096   1.00 0.00 ? 143 ALA A O    2  
ATOM   5437  C  CB   . ALA A 1 143 ? -8.257  5.524   2.511   1.00 0.00 ? 143 ALA A CB   2  
ATOM   5438  H  H    . ALA A 1 143 ? -10.278 7.020   3.336   1.00 0.00 ? 143 ALA A H    2  
ATOM   5439  H  HA   . ALA A 1 143 ? -8.627  4.895   4.517   1.00 0.00 ? 143 ALA A HA   2  
ATOM   5440  H  HB1  . ALA A 1 143 ? -7.563  4.698   2.486   1.00 0.00 ? 143 ALA A HB1  2  
ATOM   5441  H  HB2  . ALA A 1 143 ? -7.795  6.392   2.064   1.00 0.00 ? 143 ALA A HB2  2  
ATOM   5442  H  HB3  . ALA A 1 143 ? -9.148  5.262   1.961   1.00 0.00 ? 143 ALA A HB3  2  
ATOM   5443  N  N    . LYS A 1 144 ? -6.908  6.269   5.626   1.00 0.00 ? 144 LYS A N    2  
ATOM   5444  C  CA   . LYS A 1 144 ? -5.879  7.054   6.274   1.00 0.00 ? 144 LYS A CA   2  
ATOM   5445  C  C    . LYS A 1 144 ? -4.558  6.907   5.537   1.00 0.00 ? 144 LYS A C    2  
ATOM   5446  O  O    . LYS A 1 144 ? -3.929  5.850   5.566   1.00 0.00 ? 144 LYS A O    2  
ATOM   5447  C  CB   . LYS A 1 144 ? -5.727  6.598   7.713   1.00 0.00 ? 144 LYS A CB   2  
ATOM   5448  C  CG   . LYS A 1 144 ? -7.098  6.683   8.413   1.00 0.00 ? 144 LYS A CG   2  
ATOM   5449  C  CD   . LYS A 1 144 ? -7.413  5.364   9.099   1.00 0.00 ? 144 LYS A CD   2  
ATOM   5450  C  CE   . LYS A 1 144 ? -8.837  5.397   9.663   1.00 0.00 ? 144 LYS A CE   2  
ATOM   5451  N  NZ   . LYS A 1 144 ? -8.830  6.059   11.000  1.00 0.00 ? 144 LYS A NZ   2  
ATOM   5452  H  H    . LYS A 1 144 ? -7.117  5.380   5.976   1.00 0.00 ? 144 LYS A H    2  
ATOM   5453  H  HA   . LYS A 1 144 ? -6.177  8.086   6.270   1.00 0.00 ? 144 LYS A HA   2  
ATOM   5454  H  HB2  . LYS A 1 144 ? -5.356  5.580   7.731   1.00 0.00 ? 144 LYS A HB2  2  
ATOM   5455  H  HB3  . LYS A 1 144 ? -5.025  7.245   8.210   1.00 0.00 ? 144 LYS A HB3  2  
ATOM   5456  H  HG2  . LYS A 1 144 ? -7.074  7.457   9.144   1.00 0.00 ? 144 LYS A HG2  2  
ATOM   5457  H  HG3  . LYS A 1 144 ? -7.874  6.898   7.689   1.00 0.00 ? 144 LYS A HG3  2  
ATOM   5458  H  HD2  . LYS A 1 144 ? -7.328  4.580   8.374   1.00 0.00 ? 144 LYS A HD2  2  
ATOM   5459  H  HD3  . LYS A 1 144 ? -6.710  5.195   9.900   1.00 0.00 ? 144 LYS A HD3  2  
ATOM   5460  H  HE2  . LYS A 1 144 ? -9.478  5.948   8.993   1.00 0.00 ? 144 LYS A HE2  2  
ATOM   5461  H  HE3  . LYS A 1 144 ? -9.207  4.387   9.765   1.00 0.00 ? 144 LYS A HE3  2  
ATOM   5462  H  HZ1  . LYS A 1 144 ? -9.759  6.488   11.180  1.00 0.00 ? 144 LYS A HZ1  2  
ATOM   5463  H  HZ2  . LYS A 1 144 ? -8.100  6.798   11.017  1.00 0.00 ? 144 LYS A HZ2  2  
ATOM   5464  H  HZ3  . LYS A 1 144 ? -8.626  5.351   11.735  1.00 0.00 ? 144 LYS A HZ3  2  
ATOM   5465  N  N    . ILE A 1 145 ? -4.154  7.973   4.860   1.00 0.00 ? 145 ILE A N    2  
ATOM   5466  C  CA   . ILE A 1 145 ? -2.915  7.960   4.096   1.00 0.00 ? 145 ILE A CA   2  
ATOM   5467  C  C    . ILE A 1 145 ? -1.770  8.560   4.902   1.00 0.00 ? 145 ILE A C    2  
ATOM   5468  O  O    . ILE A 1 145 ? -1.981  9.414   5.762   1.00 0.00 ? 145 ILE A O    2  
ATOM   5469  C  CB   . ILE A 1 145 ? -3.087  8.762   2.801   1.00 0.00 ? 145 ILE A CB   2  
ATOM   5470  C  CG1  . ILE A 1 145 ? -4.524  8.659   2.285   1.00 0.00 ? 145 ILE A CG1  2  
ATOM   5471  C  CG2  . ILE A 1 145 ? -2.139  8.231   1.730   1.00 0.00 ? 145 ILE A CG2  2  
ATOM   5472  C  CD1  . ILE A 1 145 ? -4.987  7.197   2.278   1.00 0.00 ? 145 ILE A CD1  2  
ATOM   5473  H  H    . ILE A 1 145 ? -4.705  8.779   4.870   1.00 0.00 ? 145 ILE A H    2  
ATOM   5474  H  HA   . ILE A 1 145 ? -2.668  6.943   3.846   1.00 0.00 ? 145 ILE A HA   2  
ATOM   5475  H  HB   . ILE A 1 145 ? -2.856  9.798   3.002   1.00 0.00 ? 145 ILE A HB   2  
ATOM   5476  H  HG12 . ILE A 1 145 ? -5.165  9.242   2.922   1.00 0.00 ? 145 ILE A HG12 2  
ATOM   5477  H  HG13 . ILE A 1 145 ? -4.571  9.051   1.279   1.00 0.00 ? 145 ILE A HG13 2  
ATOM   5478  H  HG21 . ILE A 1 145 ? -1.120  8.374   2.051   1.00 0.00 ? 145 ILE A HG21 2  
ATOM   5479  H  HG22 . ILE A 1 145 ? -2.307  8.768   0.807   1.00 0.00 ? 145 ILE A HG22 2  
ATOM   5480  H  HG23 . ILE A 1 145 ? -2.328  7.179   1.575   1.00 0.00 ? 145 ILE A HG23 2  
ATOM   5481  H  HD11 . ILE A 1 145 ? -4.138  6.545   2.146   1.00 0.00 ? 145 ILE A HD11 2  
ATOM   5482  H  HD12 . ILE A 1 145 ? -5.684  7.046   1.468   1.00 0.00 ? 145 ILE A HD12 2  
ATOM   5483  H  HD13 . ILE A 1 145 ? -5.472  6.966   3.208   1.00 0.00 ? 145 ILE A HD13 2  
ATOM   5484  N  N    . SER A 1 146 ? -0.556  8.111   4.606   1.00 0.00 ? 146 SER A N    2  
ATOM   5485  C  CA   . SER A 1 146 ? 0.621   8.608   5.291   1.00 0.00 ? 146 SER A CA   2  
ATOM   5486  C  C    . SER A 1 146 ? 1.805   8.671   4.329   1.00 0.00 ? 146 SER A C    2  
ATOM   5487  O  O    . SER A 1 146 ? 2.040   7.747   3.550   1.00 0.00 ? 146 SER A O    2  
ATOM   5488  C  CB   . SER A 1 146 ? 0.945   7.696   6.477   1.00 0.00 ? 146 SER A CB   2  
ATOM   5489  O  OG   . SER A 1 146 ? 0.146   6.522   6.395   1.00 0.00 ? 146 SER A OG   2  
ATOM   5490  H  H    . SER A 1 146 ? -0.450  7.436   3.913   1.00 0.00 ? 146 SER A H    2  
ATOM   5491  H  HA   . SER A 1 146 ? 0.417   9.604   5.656   1.00 0.00 ? 146 SER A HA   2  
ATOM   5492  H  HB2  . SER A 1 146 ? 1.985   7.418   6.464   1.00 0.00 ? 146 SER A HB2  2  
ATOM   5493  H  HB3  . SER A 1 146 ? 0.728   8.222   7.392   1.00 0.00 ? 146 SER A HB3  2  
ATOM   5494  H  HG   . SER A 1 146 ? 0.728   5.781   6.208   1.00 0.00 ? 146 SER A HG   2  
ATOM   5495  N  N    . ILE A 1 147 ? 2.543   9.768   4.401   1.00 0.00 ? 147 ILE A N    2  
ATOM   5496  C  CA   . ILE A 1 147 ? 3.704   9.965   3.550   1.00 0.00 ? 147 ILE A CA   2  
ATOM   5497  C  C    . ILE A 1 147 ? 4.946   9.464   4.276   1.00 0.00 ? 147 ILE A C    2  
ATOM   5498  O  O    . ILE A 1 147 ? 5.395   10.066  5.251   1.00 0.00 ? 147 ILE A O    2  
ATOM   5499  C  CB   . ILE A 1 147 ? 3.871   11.458  3.213   1.00 0.00 ? 147 ILE A CB   2  
ATOM   5500  C  CG1  . ILE A 1 147 ? 2.654   12.048  2.426   1.00 0.00 ? 147 ILE A CG1  2  
ATOM   5501  C  CG2  . ILE A 1 147 ? 5.157   11.660  2.388   1.00 0.00 ? 147 ILE A CG2  2  
ATOM   5502  C  CD1  . ILE A 1 147 ? 1.543   11.024  2.142   1.00 0.00 ? 147 ILE A CD1  2  
ATOM   5503  H  H    . ILE A 1 147 ? 2.301   10.460  5.043   1.00 0.00 ? 147 ILE A H    2  
ATOM   5504  H  HA   . ILE A 1 147 ? 3.592   9.401   2.645   1.00 0.00 ? 147 ILE A HA   2  
ATOM   5505  H  HB   . ILE A 1 147 ? 3.979   11.999  4.146   1.00 0.00 ? 147 ILE A HB   2  
ATOM   5506  H  HG12 . ILE A 1 147 ? 2.230   12.855  3.001   1.00 0.00 ? 147 ILE A HG12 2  
ATOM   5507  H  HG13 . ILE A 1 147 ? 3.002   12.447  1.483   1.00 0.00 ? 147 ILE A HG13 2  
ATOM   5508  H  HG21 . ILE A 1 147 ? 4.973   12.385  1.608   1.00 0.00 ? 147 ILE A HG21 2  
ATOM   5509  H  HG22 . ILE A 1 147 ? 5.464   10.725  1.943   1.00 0.00 ? 147 ILE A HG22 2  
ATOM   5510  H  HG23 . ILE A 1 147 ? 5.942   12.023  3.028   1.00 0.00 ? 147 ILE A HG23 2  
ATOM   5511  H  HD11 . ILE A 1 147 ? 0.835   11.469  1.471   1.00 0.00 ? 147 ILE A HD11 2  
ATOM   5512  H  HD12 . ILE A 1 147 ? 1.042   10.767  3.056   1.00 0.00 ? 147 ILE A HD12 2  
ATOM   5513  H  HD13 . ILE A 1 147 ? 1.944   10.143  1.681   1.00 0.00 ? 147 ILE A HD13 2  
ATOM   5514  N  N    . MET A 1 148 ? 5.485   8.347   3.800   1.00 0.00 ? 148 MET A N    2  
ATOM   5515  C  CA   . MET A 1 148 ? 6.664   7.752   4.417   1.00 0.00 ? 148 MET A CA   2  
ATOM   5516  C  C    . MET A 1 148 ? 7.937   8.488   4.004   1.00 0.00 ? 148 MET A C    2  
ATOM   5517  O  O    . MET A 1 148 ? 8.414   8.342   2.880   1.00 0.00 ? 148 MET A O    2  
ATOM   5518  C  CB   . MET A 1 148 ? 6.767   6.281   4.009   1.00 0.00 ? 148 MET A CB   2  
ATOM   5519  C  CG   . MET A 1 148 ? 7.560   5.505   5.060   1.00 0.00 ? 148 MET A CG   2  
ATOM   5520  S  SD   . MET A 1 148 ? 8.345   4.083   4.265   1.00 0.00 ? 148 MET A SD   2  
ATOM   5521  C  CE   . MET A 1 148 ? 6.826   3.276   3.702   1.00 0.00 ? 148 MET A CE   2  
ATOM   5522  H  H    . MET A 1 148 ? 5.074   7.908   3.028   1.00 0.00 ? 148 MET A H    2  
ATOM   5523  H  HA   . MET A 1 148 ? 6.558   7.806   5.487   1.00 0.00 ? 148 MET A HA   2  
ATOM   5524  H  HB2  . MET A 1 148 ? 5.775   5.863   3.928   1.00 0.00 ? 148 MET A HB2  2  
ATOM   5525  H  HB3  . MET A 1 148 ? 7.268   6.205   3.056   1.00 0.00 ? 148 MET A HB3  2  
ATOM   5526  H  HG2  . MET A 1 148 ? 8.317   6.145   5.496   1.00 0.00 ? 148 MET A HG2  2  
ATOM   5527  H  HG3  . MET A 1 148 ? 6.890   5.161   5.833   1.00 0.00 ? 148 MET A HG3  2  
ATOM   5528  H  HE1  . MET A 1 148 ? 6.021   3.501   4.390   1.00 0.00 ? 148 MET A HE1  2  
ATOM   5529  H  HE2  . MET A 1 148 ? 6.982   2.207   3.659   1.00 0.00 ? 148 MET A HE2  2  
ATOM   5530  H  HE3  . MET A 1 148 ? 6.566   3.638   2.720   1.00 0.00 ? 148 MET A HE3  2  
ATOM   5531  N  N    . THR A 1 149 ? 8.483   9.274   4.927   1.00 0.00 ? 149 THR A N    2  
ATOM   5532  C  CA   . THR A 1 149 ? 9.708   10.029  4.659   1.00 0.00 ? 149 THR A CA   2  
ATOM   5533  C  C    . THR A 1 149 ? 10.905  9.364   5.322   1.00 0.00 ? 149 THR A C    2  
ATOM   5534  O  O    . THR A 1 149 ? 10.771  8.332   5.965   1.00 0.00 ? 149 THR A O    2  
ATOM   5535  C  CB   . THR A 1 149 ? 9.578   11.449  5.204   1.00 0.00 ? 149 THR A CB   2  
ATOM   5536  O  OG1  . THR A 1 149 ? 9.250   11.394  6.584   1.00 0.00 ? 149 THR A OG1  2  
ATOM   5537  C  CG2  . THR A 1 149 ? 8.483   12.194  4.452   1.00 0.00 ? 149 THR A CG2  2  
ATOM   5538  H  H    . THR A 1 149 ? 8.056   9.350   5.805   1.00 0.00 ? 149 THR A H    2  
ATOM   5539  H  HA   . THR A 1 149 ? 9.872   10.075  3.594   1.00 0.00 ? 149 THR A HA   2  
ATOM   5540  H  HB   . THR A 1 149 ? 10.515  11.970  5.077   1.00 0.00 ? 149 THR A HB   2  
ATOM   5541  H  HG1  . THR A 1 149 ? 9.002   10.490  6.794   1.00 0.00 ? 149 THR A HG1  2  
ATOM   5542  H  HG21 . THR A 1 149 ? 8.702   13.250  4.462   1.00 0.00 ? 149 THR A HG21 2  
ATOM   5543  H  HG22 . THR A 1 149 ? 7.534   12.017  4.934   1.00 0.00 ? 149 THR A HG22 2  
ATOM   5544  H  HG23 . THR A 1 149 ? 8.441   11.843  3.433   1.00 0.00 ? 149 THR A HG23 2  
ATOM   5545  N  N    . TYR A 1 150 ? 12.074  9.974   5.159   1.00 0.00 ? 150 TYR A N    2  
ATOM   5546  C  CA   . TYR A 1 150 ? 13.302  9.448   5.749   1.00 0.00 ? 150 TYR A CA   2  
ATOM   5547  C  C    . TYR A 1 150 ? 13.032  8.778   7.101   1.00 0.00 ? 150 TYR A C    2  
ATOM   5548  O  O    . TYR A 1 150 ? 13.309  7.590   7.279   1.00 0.00 ? 150 TYR A O    2  
ATOM   5549  C  CB   . TYR A 1 150 ? 14.314  10.588  5.922   1.00 0.00 ? 150 TYR A CB   2  
ATOM   5550  C  CG   . TYR A 1 150 ? 13.886  11.474  7.062   1.00 0.00 ? 150 TYR A CG   2  
ATOM   5551  C  CD1  . TYR A 1 150 ? 12.962  12.498  6.834   1.00 0.00 ? 150 TYR A CD1  2  
ATOM   5552  C  CD2  . TYR A 1 150 ? 14.406  11.269  8.345   1.00 0.00 ? 150 TYR A CD2  2  
ATOM   5553  C  CE1  . TYR A 1 150 ? 12.552  13.318  7.891   1.00 0.00 ? 150 TYR A CE1  2  
ATOM   5554  C  CE2  . TYR A 1 150 ? 13.998  12.090  9.404   1.00 0.00 ? 150 TYR A CE2  2  
ATOM   5555  C  CZ   . TYR A 1 150 ? 13.069  13.114  9.176   1.00 0.00 ? 150 TYR A CZ   2  
ATOM   5556  O  OH   . TYR A 1 150 ? 12.662  13.922  10.218  1.00 0.00 ? 150 TYR A OH   2  
ATOM   5557  H  H    . TYR A 1 150 ? 12.113  10.801  4.632   1.00 0.00 ? 150 TYR A H    2  
ATOM   5558  H  HA   . TYR A 1 150 ? 13.721  8.713   5.079   1.00 0.00 ? 150 TYR A HA   2  
ATOM   5559  H  HB2  . TYR A 1 150 ? 15.289  10.178  6.128   1.00 0.00 ? 150 TYR A HB2  2  
ATOM   5560  H  HB3  . TYR A 1 150 ? 14.352  11.176  5.016   1.00 0.00 ? 150 TYR A HB3  2  
ATOM   5561  H  HD1  . TYR A 1 150 ? 12.564  12.652  5.840   1.00 0.00 ? 150 TYR A HD1  2  
ATOM   5562  H  HD2  . TYR A 1 150 ? 15.124  10.478  8.516   1.00 0.00 ? 150 TYR A HD2  2  
ATOM   5563  H  HE1  . TYR A 1 150 ? 11.838  14.110  7.715   1.00 0.00 ? 150 TYR A HE1  2  
ATOM   5564  H  HE2  . TYR A 1 150 ? 14.397  11.932  10.396  1.00 0.00 ? 150 TYR A HE2  2  
ATOM   5565  H  HH   . TYR A 1 150 ? 11.942  14.474  9.902   1.00 0.00 ? 150 TYR A HH   2  
ATOM   5566  N  N    . SER A 1 151 ? 12.502  9.540   8.053   1.00 0.00 ? 151 SER A N    2  
ATOM   5567  C  CA   . SER A 1 151 ? 12.211  8.999   9.376   1.00 0.00 ? 151 SER A CA   2  
ATOM   5568  C  C    . SER A 1 151 ? 11.282  7.798   9.260   1.00 0.00 ? 151 SER A C    2  
ATOM   5569  O  O    . SER A 1 151 ? 11.655  6.666   9.583   1.00 0.00 ? 151 SER A O    2  
ATOM   5570  C  CB   . SER A 1 151 ? 11.563  10.074  10.247  1.00 0.00 ? 151 SER A CB   2  
ATOM   5571  O  OG   . SER A 1 151 ? 10.604  10.784  9.475   1.00 0.00 ? 151 SER A OG   2  
ATOM   5572  H  H    . SER A 1 151 ? 12.307  10.479  7.866   1.00 0.00 ? 151 SER A H    2  
ATOM   5573  H  HA   . SER A 1 151 ? 13.134  8.687   9.835   1.00 0.00 ? 151 SER A HA   2  
ATOM   5574  H  HB2  . SER A 1 151 ? 11.071  9.613   11.087  1.00 0.00 ? 151 SER A HB2  2  
ATOM   5575  H  HB3  . SER A 1 151 ? 12.325  10.753  10.609  1.00 0.00 ? 151 SER A HB3  2  
ATOM   5576  H  HG   . SER A 1 151 ? 11.051  11.143  8.704   1.00 0.00 ? 151 SER A HG   2  
ATOM   5577  N  N    . GLU A 1 152 ? 10.071  8.055   8.784   1.00 0.00 ? 152 GLU A N    2  
ATOM   5578  C  CA   . GLU A 1 152 ? 9.086   6.997   8.607   1.00 0.00 ? 152 GLU A CA   2  
ATOM   5579  C  C    . GLU A 1 152 ? 9.722   5.809   7.906   1.00 0.00 ? 152 GLU A C    2  
ATOM   5580  O  O    . GLU A 1 152 ? 9.342   4.665   8.133   1.00 0.00 ? 152 GLU A O    2  
ATOM   5581  C  CB   . GLU A 1 152 ? 7.924   7.510   7.764   1.00 0.00 ? 152 GLU A CB   2  
ATOM   5582  C  CG   . GLU A 1 152 ? 7.115   8.529   8.567   1.00 0.00 ? 152 GLU A CG   2  
ATOM   5583  C  CD   . GLU A 1 152 ? 6.088   7.810   9.436   1.00 0.00 ? 152 GLU A CD   2  
ATOM   5584  O  OE1  . GLU A 1 152 ? 5.042   7.461   8.915   1.00 0.00 ? 152 GLU A OE1  2  
ATOM   5585  O  OE2  . GLU A 1 152 ? 6.363   7.622   10.609  1.00 0.00 ? 152 GLU A OE2  2  
ATOM   5586  H  H    . GLU A 1 152 ? 9.842   8.973   8.537   1.00 0.00 ? 152 GLU A H    2  
ATOM   5587  H  HA   . GLU A 1 152 ? 8.714   6.686   9.567   1.00 0.00 ? 152 GLU A HA   2  
ATOM   5588  H  HB2  . GLU A 1 152 ? 8.317   7.982   6.878   1.00 0.00 ? 152 GLU A HB2  2  
ATOM   5589  H  HB3  . GLU A 1 152 ? 7.289   6.682   7.485   1.00 0.00 ? 152 GLU A HB3  2  
ATOM   5590  H  HG2  . GLU A 1 152 ? 7.781   9.102   9.196   1.00 0.00 ? 152 GLU A HG2  2  
ATOM   5591  H  HG3  . GLU A 1 152 ? 6.604   9.194   7.885   1.00 0.00 ? 152 GLU A HG3  2  
ATOM   5592  N  N    . PHE A 1 153 ? 10.703  6.099   7.060   1.00 0.00 ? 153 PHE A N    2  
ATOM   5593  C  CA   . PHE A 1 153 ? 11.401  5.059   6.324   1.00 0.00 ? 153 PHE A CA   2  
ATOM   5594  C  C    . PHE A 1 153 ? 11.998  4.058   7.308   1.00 0.00 ? 153 PHE A C    2  
ATOM   5595  O  O    . PHE A 1 153 ? 11.562  2.906   7.391   1.00 0.00 ? 153 PHE A O    2  
ATOM   5596  C  CB   . PHE A 1 153 ? 12.508  5.698   5.462   1.00 0.00 ? 153 PHE A CB   2  
ATOM   5597  C  CG   . PHE A 1 153 ? 12.475  5.118   4.070   1.00 0.00 ? 153 PHE A CG   2  
ATOM   5598  C  CD1  . PHE A 1 153 ? 11.608  5.653   3.111   1.00 0.00 ? 153 PHE A CD1  2  
ATOM   5599  C  CD2  . PHE A 1 153 ? 13.305  4.045   3.742   1.00 0.00 ? 153 PHE A CD2  2  
ATOM   5600  C  CE1  . PHE A 1 153 ? 11.571  5.110   1.822   1.00 0.00 ? 153 PHE A CE1  2  
ATOM   5601  C  CE2  . PHE A 1 153 ? 13.272  3.502   2.454   1.00 0.00 ? 153 PHE A CE2  2  
ATOM   5602  C  CZ   . PHE A 1 153 ? 12.405  4.033   1.493   1.00 0.00 ? 153 PHE A CZ   2  
ATOM   5603  H  H    . PHE A 1 153 ? 10.965  7.030   6.933   1.00 0.00 ? 153 PHE A H    2  
ATOM   5604  H  HA   . PHE A 1 153 ? 10.699  4.552   5.683   1.00 0.00 ? 153 PHE A HA   2  
ATOM   5605  H  HB2  . PHE A 1 153 ? 12.340  6.762   5.403   1.00 0.00 ? 153 PHE A HB2  2  
ATOM   5606  H  HB3  . PHE A 1 153 ? 13.476  5.512   5.906   1.00 0.00 ? 153 PHE A HB3  2  
ATOM   5607  H  HD1  . PHE A 1 153 ? 10.969  6.486   3.368   1.00 0.00 ? 153 PHE A HD1  2  
ATOM   5608  H  HD2  . PHE A 1 153 ? 13.971  3.638   4.484   1.00 0.00 ? 153 PHE A HD2  2  
ATOM   5609  H  HE1  . PHE A 1 153 ? 10.902  5.521   1.082   1.00 0.00 ? 153 PHE A HE1  2  
ATOM   5610  H  HE2  . PHE A 1 153 ? 13.915  2.672   2.202   1.00 0.00 ? 153 PHE A HE2  2  
ATOM   5611  H  HZ   . PHE A 1 153 ? 12.378  3.613   0.499   1.00 0.00 ? 153 PHE A HZ   2  
ATOM   5612  N  N    . LYS A 1 154 ? 12.989  4.517   8.059   1.00 0.00 ? 154 LYS A N    2  
ATOM   5613  C  CA   . LYS A 1 154 ? 13.638  3.669   9.050   1.00 0.00 ? 154 LYS A CA   2  
ATOM   5614  C  C    . LYS A 1 154 ? 12.601  2.822   9.783   1.00 0.00 ? 154 LYS A C    2  
ATOM   5615  O  O    . LYS A 1 154 ? 12.814  1.634   10.039  1.00 0.00 ? 154 LYS A O    2  
ATOM   5616  C  CB   . LYS A 1 154 ? 14.403  4.521   10.067  1.00 0.00 ? 154 LYS A CB   2  
ATOM   5617  C  CG   . LYS A 1 154 ? 15.066  5.712   9.369   1.00 0.00 ? 154 LYS A CG   2  
ATOM   5618  C  CD   . LYS A 1 154 ? 15.906  5.224   8.188   1.00 0.00 ? 154 LYS A CD   2  
ATOM   5619  C  CE   . LYS A 1 154 ? 16.666  6.407   7.581   1.00 0.00 ? 154 LYS A CE   2  
ATOM   5620  N  NZ   . LYS A 1 154 ? 15.771  7.598   7.526   1.00 0.00 ? 154 LYS A NZ   2  
ATOM   5621  H  H    . LYS A 1 154 ? 13.283  5.445   7.947   1.00 0.00 ? 154 LYS A H    2  
ATOM   5622  H  HA   . LYS A 1 154 ? 14.333  3.018   8.551   1.00 0.00 ? 154 LYS A HA   2  
ATOM   5623  H  HB2  . LYS A 1 154 ? 13.716  4.885   10.818  1.00 0.00 ? 154 LYS A HB2  2  
ATOM   5624  H  HB3  . LYS A 1 154 ? 15.162  3.917   10.541  1.00 0.00 ? 154 LYS A HB3  2  
ATOM   5625  H  HG2  . LYS A 1 154 ? 14.305  6.386   9.014   1.00 0.00 ? 154 LYS A HG2  2  
ATOM   5626  H  HG3  . LYS A 1 154 ? 15.703  6.228   10.072  1.00 0.00 ? 154 LYS A HG3  2  
ATOM   5627  H  HD2  . LYS A 1 154 ? 16.612  4.483   8.532   1.00 0.00 ? 154 LYS A HD2  2  
ATOM   5628  H  HD3  . LYS A 1 154 ? 15.259  4.790   7.439   1.00 0.00 ? 154 LYS A HD3  2  
ATOM   5629  H  HE2  . LYS A 1 154 ? 17.527  6.632   8.192   1.00 0.00 ? 154 LYS A HE2  2  
ATOM   5630  H  HE3  . LYS A 1 154 ? 16.990  6.154   6.582   1.00 0.00 ? 154 LYS A HE3  2  
ATOM   5631  H  HZ1  . LYS A 1 154 ? 15.381  7.782   8.471   1.00 0.00 ? 154 LYS A HZ1  2  
ATOM   5632  H  HZ2  . LYS A 1 154 ? 14.993  7.418   6.862   1.00 0.00 ? 154 LYS A HZ2  2  
ATOM   5633  H  HZ3  . LYS A 1 154 ? 16.317  8.426   7.207   1.00 0.00 ? 154 LYS A HZ3  2  
ATOM   5634  N  N    . HIS A 1 155 ? 11.469  3.441   10.112  1.00 0.00 ? 155 HIS A N    2  
ATOM   5635  C  CA   . HIS A 1 155 ? 10.401  2.731   10.807  1.00 0.00 ? 155 HIS A CA   2  
ATOM   5636  C  C    . HIS A 1 155 ? 9.783   1.713   9.873   1.00 0.00 ? 155 HIS A C    2  
ATOM   5637  O  O    . HIS A 1 155 ? 9.470   0.588   10.261  1.00 0.00 ? 155 HIS A O    2  
ATOM   5638  C  CB   . HIS A 1 155 ? 9.322   3.714   11.255  1.00 0.00 ? 155 HIS A CB   2  
ATOM   5639  C  CG   . HIS A 1 155 ? 8.398   3.037   12.230  1.00 0.00 ? 155 HIS A CG   2  
ATOM   5640  N  ND1  . HIS A 1 155 ? 7.320   3.693   12.806  1.00 0.00 ? 155 HIS A ND1  2  
ATOM   5641  C  CD2  . HIS A 1 155 ? 8.374   1.761   12.738  1.00 0.00 ? 155 HIS A CD2  2  
ATOM   5642  C  CE1  . HIS A 1 155 ? 6.699   2.817   13.617  1.00 0.00 ? 155 HIS A CE1  2  
ATOM   5643  N  NE2  . HIS A 1 155 ? 7.301   1.625   13.613  1.00 0.00 ? 155 HIS A NE2  2  
ATOM   5644  H  H    . HIS A 1 155 ? 11.345  4.387   9.870   1.00 0.00 ? 155 HIS A H    2  
ATOM   5645  H  HA   . HIS A 1 155 ? 10.807  2.229   11.672  1.00 0.00 ? 155 HIS A HA   2  
ATOM   5646  H  HB2  . HIS A 1 155 ? 9.787   4.566   11.723  1.00 0.00 ? 155 HIS A HB2  2  
ATOM   5647  H  HB3  . HIS A 1 155 ? 8.758   4.042   10.397  1.00 0.00 ? 155 HIS A HB3  2  
ATOM   5648  H  HD1  . HIS A 1 155 ? 7.057   4.626   12.651  1.00 0.00 ? 155 HIS A HD1  2  
ATOM   5649  H  HD2  . HIS A 1 155 ? 9.081   0.981   12.496  1.00 0.00 ? 155 HIS A HD2  2  
ATOM   5650  H  HE1  . HIS A 1 155 ? 5.820   3.051   14.201  1.00 0.00 ? 155 HIS A HE1  2  
ATOM   5651  H  HE2  . HIS A 1 155 ? 7.044   0.826   14.119  1.00 0.00 ? 155 HIS A HE2  2  
ATOM   5652  N  N    . CYS A 1 156 ? 9.619   2.136   8.634   1.00 0.00 ? 156 CYS A N    2  
ATOM   5653  C  CA   . CYS A 1 156 ? 9.042   1.290   7.606   1.00 0.00 ? 156 CYS A CA   2  
ATOM   5654  C  C    . CYS A 1 156 ? 9.812   -0.022  7.500   1.00 0.00 ? 156 CYS A C    2  
ATOM   5655  O  O    . CYS A 1 156 ? 9.260   -1.038  7.084   1.00 0.00 ? 156 CYS A O    2  
ATOM   5656  C  CB   . CYS A 1 156 ? 9.046   2.057   6.279   1.00 0.00 ? 156 CYS A CB   2  
ATOM   5657  S  SG   . CYS A 1 156 ? 10.332  1.427   5.162   1.00 0.00 ? 156 CYS A SG   2  
ATOM   5658  H  H    . CYS A 1 156 ? 9.895   3.048   8.405   1.00 0.00 ? 156 CYS A H    2  
ATOM   5659  H  HA   . CYS A 1 156 ? 8.019   1.068   7.875   1.00 0.00 ? 156 CYS A HA   2  
ATOM   5660  H  HB2  . CYS A 1 156 ? 8.081   1.965   5.801   1.00 0.00 ? 156 CYS A HB2  2  
ATOM   5661  H  HB3  . CYS A 1 156 ? 9.238   3.095   6.494   1.00 0.00 ? 156 CYS A HB3  2  
ATOM   5662  H  HG   . CYS A 1 156 ? 10.114  0.518   4.943   1.00 0.00 ? 156 CYS A HG   2  
ATOM   5663  N  N    . TRP A 1 157 ? 11.077  -0.008  7.916   1.00 0.00 ? 157 TRP A N    2  
ATOM   5664  C  CA   . TRP A 1 157 ? 11.868  -1.230  7.889   1.00 0.00 ? 157 TRP A CA   2  
ATOM   5665  C  C    . TRP A 1 157 ? 11.466  -2.052  9.092   1.00 0.00 ? 157 TRP A C    2  
ATOM   5666  O  O    . TRP A 1 157 ? 11.158  -3.239  9.000   1.00 0.00 ? 157 TRP A O    2  
ATOM   5667  C  CB   . TRP A 1 157 ? 13.370  -0.934  7.987   1.00 0.00 ? 157 TRP A CB   2  
ATOM   5668  C  CG   . TRP A 1 157 ? 13.839  -0.056  6.866   1.00 0.00 ? 157 TRP A CG   2  
ATOM   5669  C  CD1  . TRP A 1 157 ? 13.297  0.013   5.627   1.00 0.00 ? 157 TRP A CD1  2  
ATOM   5670  C  CD2  . TRP A 1 157 ? 14.967  0.867   6.867   1.00 0.00 ? 157 TRP A CD2  2  
ATOM   5671  N  NE1  . TRP A 1 157 ? 14.024  0.922   4.874   1.00 0.00 ? 157 TRP A NE1  2  
ATOM   5672  C  CE2  . TRP A 1 157 ? 15.056  1.474   5.595   1.00 0.00 ? 157 TRP A CE2  2  
ATOM   5673  C  CE3  . TRP A 1 157 ? 15.913  1.236   7.841   1.00 0.00 ? 157 TRP A CE3  2  
ATOM   5674  C  CZ2  . TRP A 1 157 ? 16.043  2.408   5.296   1.00 0.00 ? 157 TRP A CZ2  2  
ATOM   5675  C  CZ3  . TRP A 1 157 ? 16.910  2.178   7.545   1.00 0.00 ? 157 TRP A CZ3  2  
ATOM   5676  C  CH2  . TRP A 1 157 ? 16.976  2.764   6.273   1.00 0.00 ? 157 TRP A CH2  2  
ATOM   5677  H  H    . TRP A 1 157 ? 11.467  0.819   8.277   1.00 0.00 ? 157 TRP A H    2  
ATOM   5678  H  HA   . TRP A 1 157 ? 11.660  -1.783  6.989   1.00 0.00 ? 157 TRP A HA   2  
ATOM   5679  H  HB2  . TRP A 1 157 ? 13.574  -0.442  8.925   1.00 0.00 ? 157 TRP A HB2  2  
ATOM   5680  H  HB3  . TRP A 1 157 ? 13.913  -1.868  7.956   1.00 0.00 ? 157 TRP A HB3  2  
ATOM   5681  H  HD1  . TRP A 1 157 ? 12.442  -0.547  5.280   1.00 0.00 ? 157 TRP A HD1  2  
ATOM   5682  H  HE1  . TRP A 1 157 ? 13.846  1.158   3.941   1.00 0.00 ? 157 TRP A HE1  2  
ATOM   5683  H  HE3  . TRP A 1 157 ? 15.867  0.797   8.824   1.00 0.00 ? 157 TRP A HE3  2  
ATOM   5684  H  HZ2  . TRP A 1 157 ? 16.084  2.852   4.313   1.00 0.00 ? 157 TRP A HZ2  2  
ATOM   5685  H  HZ3  . TRP A 1 157 ? 17.632  2.451   8.300   1.00 0.00 ? 157 TRP A HZ3  2  
ATOM   5686  H  HH2  . TRP A 1 157 ? 17.746  3.487   6.049   1.00 0.00 ? 157 TRP A HH2  2  
ATOM   5687  N  N    . ASP A 1 158 ? 11.462  -1.374  10.221  1.00 0.00 ? 158 ASP A N    2  
ATOM   5688  C  CA   . ASP A 1 158 ? 11.094  -1.976  11.483  1.00 0.00 ? 158 ASP A CA   2  
ATOM   5689  C  C    . ASP A 1 158 ? 9.715   -2.622  11.407  1.00 0.00 ? 158 ASP A C    2  
ATOM   5690  O  O    . ASP A 1 158 ? 9.290   -3.307  12.338  1.00 0.00 ? 158 ASP A O    2  
ATOM   5691  C  CB   . ASP A 1 158 ? 11.086  -0.882  12.543  1.00 0.00 ? 158 ASP A CB   2  
ATOM   5692  C  CG   . ASP A 1 158 ? 10.803  -1.478  13.919  1.00 0.00 ? 158 ASP A CG   2  
ATOM   5693  O  OD1  . ASP A 1 158 ? 9.647   -1.749  14.198  1.00 0.00 ? 158 ASP A OD1  2  
ATOM   5694  O  OD2  . ASP A 1 158 ? 11.747  -1.651  14.673  1.00 0.00 ? 158 ASP A OD2  2  
ATOM   5695  H  H    . ASP A 1 158 ? 11.711  -0.422  10.205  1.00 0.00 ? 158 ASP A H    2  
ATOM   5696  H  HA   . ASP A 1 158 ? 11.819  -2.716  11.753  1.00 0.00 ? 158 ASP A HA   2  
ATOM   5697  H  HB2  . ASP A 1 158 ? 12.050  -0.392  12.550  1.00 0.00 ? 158 ASP A HB2  2  
ATOM   5698  H  HB3  . ASP A 1 158 ? 10.321  -0.159  12.299  1.00 0.00 ? 158 ASP A HB3  2  
ATOM   5699  N  N    . THR A 1 159 ? 8.996   -2.368  10.318  1.00 0.00 ? 159 THR A N    2  
ATOM   5700  C  CA   . THR A 1 159 ? 7.645   -2.901  10.178  1.00 0.00 ? 159 THR A CA   2  
ATOM   5701  C  C    . THR A 1 159 ? 7.564   -4.228  9.413   1.00 0.00 ? 159 THR A C    2  
ATOM   5702  O  O    . THR A 1 159 ? 6.929   -5.168  9.891   1.00 0.00 ? 159 THR A O    2  
ATOM   5703  C  CB   . THR A 1 159 ? 6.766   -1.861  9.479   1.00 0.00 ? 159 THR A CB   2  
ATOM   5704  O  OG1  . THR A 1 159 ? 6.564   -0.755  10.350  1.00 0.00 ? 159 THR A OG1  2  
ATOM   5705  C  CG2  . THR A 1 159 ? 5.415   -2.477  9.113   1.00 0.00 ? 159 THR A CG2  2  
ATOM   5706  H  H    . THR A 1 159 ? 9.364   -1.792  9.616   1.00 0.00 ? 159 THR A H    2  
ATOM   5707  H  HA   . THR A 1 159 ? 7.249   -3.064  11.166  1.00 0.00 ? 159 THR A HA   2  
ATOM   5708  H  HB   . THR A 1 159 ? 7.258   -1.521  8.580   1.00 0.00 ? 159 THR A HB   2  
ATOM   5709  H  HG1  . THR A 1 159 ? 7.052   -0.921  11.159  1.00 0.00 ? 159 THR A HG1  2  
ATOM   5710  H  HG21 . THR A 1 159 ? 4.665   -1.701  9.073   1.00 0.00 ? 159 THR A HG21 2  
ATOM   5711  H  HG22 . THR A 1 159 ? 5.138   -3.206  9.859   1.00 0.00 ? 159 THR A HG22 2  
ATOM   5712  H  HG23 . THR A 1 159 ? 5.489   -2.956  8.149   1.00 0.00 ? 159 THR A HG23 2  
ATOM   5713  N  N    . PHE A 1 160 ? 8.142   -4.300  8.212   1.00 0.00 ? 160 PHE A N    2  
ATOM   5714  C  CA   . PHE A 1 160 ? 8.034   -5.519  7.410   1.00 0.00 ? 160 PHE A CA   2  
ATOM   5715  C  C    . PHE A 1 160 ? 9.385   -6.109  7.006   1.00 0.00 ? 160 PHE A C    2  
ATOM   5716  O  O    . PHE A 1 160 ? 9.462   -7.288  6.657   1.00 0.00 ? 160 PHE A O    2  
ATOM   5717  C  CB   . PHE A 1 160 ? 7.218   -5.202  6.155   1.00 0.00 ? 160 PHE A CB   2  
ATOM   5718  C  CG   . PHE A 1 160 ? 8.104   -4.596  5.089   1.00 0.00 ? 160 PHE A CG   2  
ATOM   5719  C  CD1  . PHE A 1 160 ? 8.451   -3.241  5.151   1.00 0.00 ? 160 PHE A CD1  2  
ATOM   5720  C  CD2  . PHE A 1 160 ? 8.579   -5.394  4.043   1.00 0.00 ? 160 PHE A CD2  2  
ATOM   5721  C  CE1  . PHE A 1 160 ? 9.275   -2.684  4.164   1.00 0.00 ? 160 PHE A CE1  2  
ATOM   5722  C  CE2  . PHE A 1 160 ? 9.403   -4.838  3.057   1.00 0.00 ? 160 PHE A CE2  2  
ATOM   5723  C  CZ   . PHE A 1 160 ? 9.752   -3.484  3.118   1.00 0.00 ? 160 PHE A CZ   2  
ATOM   5724  H  H    . PHE A 1 160 ? 8.597   -3.522  7.840   1.00 0.00 ? 160 PHE A H    2  
ATOM   5725  H  HA   . PHE A 1 160 ? 7.496   -6.266  7.974   1.00 0.00 ? 160 PHE A HA   2  
ATOM   5726  H  HB2  . PHE A 1 160 ? 6.785   -6.107  5.782   1.00 0.00 ? 160 PHE A HB2  2  
ATOM   5727  H  HB3  . PHE A 1 160 ? 6.431   -4.506  6.405   1.00 0.00 ? 160 PHE A HB3  2  
ATOM   5728  H  HD1  . PHE A 1 160 ? 8.082   -2.626  5.958   1.00 0.00 ? 160 PHE A HD1  2  
ATOM   5729  H  HD2  . PHE A 1 160 ? 8.310   -6.441  3.996   1.00 0.00 ? 160 PHE A HD2  2  
ATOM   5730  H  HE1  . PHE A 1 160 ? 9.545   -1.638  4.211   1.00 0.00 ? 160 PHE A HE1  2  
ATOM   5731  H  HE2  . PHE A 1 160 ? 9.771   -5.454  2.250   1.00 0.00 ? 160 PHE A HE2  2  
ATOM   5732  H  HZ   . PHE A 1 160 ? 10.388  -3.054  2.359   1.00 0.00 ? 160 PHE A HZ   2  
ATOM   5733  N  N    . VAL A 1 161 ? 10.441  -5.311  7.034   1.00 0.00 ? 161 VAL A N    2  
ATOM   5734  C  CA   . VAL A 1 161 ? 11.742  -5.820  6.643   1.00 0.00 ? 161 VAL A CA   2  
ATOM   5735  C  C    . VAL A 1 161 ? 12.187  -6.926  7.593   1.00 0.00 ? 161 VAL A C    2  
ATOM   5736  O  O    . VAL A 1 161 ? 12.021  -6.816  8.809   1.00 0.00 ? 161 VAL A O    2  
ATOM   5737  C  CB   . VAL A 1 161 ? 12.763  -4.685  6.642   1.00 0.00 ? 161 VAL A CB   2  
ATOM   5738  C  CG1  . VAL A 1 161 ? 14.169  -5.266  6.527   1.00 0.00 ? 161 VAL A CG1  2  
ATOM   5739  C  CG2  . VAL A 1 161 ? 12.490  -3.759  5.454   1.00 0.00 ? 161 VAL A CG2  2  
ATOM   5740  H  H    . VAL A 1 161 ? 10.348  -4.375  7.309   1.00 0.00 ? 161 VAL A H    2  
ATOM   5741  H  HA   . VAL A 1 161 ? 11.671  -6.223  5.644   1.00 0.00 ? 161 VAL A HA   2  
ATOM   5742  H  HB   . VAL A 1 161 ? 12.680  -4.127  7.561   1.00 0.00 ? 161 VAL A HB   2  
ATOM   5743  H  HG11 . VAL A 1 161 ? 14.552  -5.465  7.517   1.00 0.00 ? 161 VAL A HG11 2  
ATOM   5744  H  HG12 . VAL A 1 161 ? 14.809  -4.560  6.026   1.00 0.00 ? 161 VAL A HG12 2  
ATOM   5745  H  HG13 . VAL A 1 161 ? 14.135  -6.186  5.962   1.00 0.00 ? 161 VAL A HG13 2  
ATOM   5746  H  HG21 . VAL A 1 161 ? 12.759  -4.263  4.536   1.00 0.00 ? 161 VAL A HG21 2  
ATOM   5747  H  HG22 . VAL A 1 161 ? 13.079  -2.858  5.556   1.00 0.00 ? 161 VAL A HG22 2  
ATOM   5748  H  HG23 . VAL A 1 161 ? 11.441  -3.505  5.431   1.00 0.00 ? 161 VAL A HG23 2  
ATOM   5749  N  N    . ASP A 1 162 ? 12.746  -7.999  7.034   1.00 0.00 ? 162 ASP A N    2  
ATOM   5750  C  CA   . ASP A 1 162 ? 13.198  -9.121  7.851   1.00 0.00 ? 162 ASP A CA   2  
ATOM   5751  C  C    . ASP A 1 162 ? 14.433  -8.743  8.655   1.00 0.00 ? 162 ASP A C    2  
ATOM   5752  O  O    . ASP A 1 162 ? 15.219  -9.599  9.060   1.00 0.00 ? 162 ASP A O    2  
ATOM   5753  C  CB   . ASP A 1 162 ? 13.506  -10.328 6.965   1.00 0.00 ? 162 ASP A CB   2  
ATOM   5754  C  CG   . ASP A 1 162 ? 13.404  -11.610 7.786   1.00 0.00 ? 162 ASP A CG   2  
ATOM   5755  O  OD1  . ASP A 1 162 ? 13.214  -11.508 8.986   1.00 0.00 ? 162 ASP A OD1  2  
ATOM   5756  O  OD2  . ASP A 1 162 ? 13.519  -12.674 7.201   1.00 0.00 ? 162 ASP A OD2  2  
ATOM   5757  H  H    . ASP A 1 162 ? 12.848  -8.038  6.060   1.00 0.00 ? 162 ASP A H    2  
ATOM   5758  H  HA   . ASP A 1 162 ? 12.414  -9.381  8.537   1.00 0.00 ? 162 ASP A HA   2  
ATOM   5759  H  HB2  . ASP A 1 162 ? 12.795  -10.365 6.152   1.00 0.00 ? 162 ASP A HB2  2  
ATOM   5760  H  HB3  . ASP A 1 162 ? 14.506  -10.237 6.568   1.00 0.00 ? 162 ASP A HB3  2  
ATOM   5761  N  N    . HIS A 1 163 ? 14.578  -7.451  8.889   1.00 0.00 ? 163 HIS A N    2  
ATOM   5762  C  CA   . HIS A 1 163 ? 15.699  -6.924  9.659   1.00 0.00 ? 163 HIS A CA   2  
ATOM   5763  C  C    . HIS A 1 163 ? 15.381  -5.502  10.095  1.00 0.00 ? 163 HIS A C    2  
ATOM   5764  O  O    . HIS A 1 163 ? 15.601  -4.549  9.346   1.00 0.00 ? 163 HIS A O    2  
ATOM   5765  C  CB   . HIS A 1 163 ? 16.986  -6.914  8.832   1.00 0.00 ? 163 HIS A CB   2  
ATOM   5766  C  CG   . HIS A 1 163 ? 17.012  -8.082  7.884   1.00 0.00 ? 163 HIS A CG   2  
ATOM   5767  N  ND1  . HIS A 1 163 ? 17.513  -9.322  8.252   1.00 0.00 ? 163 HIS A ND1  2  
ATOM   5768  C  CD2  . HIS A 1 163 ? 16.615  -8.212  6.575   1.00 0.00 ? 163 HIS A CD2  2  
ATOM   5769  C  CE1  . HIS A 1 163 ? 17.406  -10.136 7.185   1.00 0.00 ? 163 HIS A CE1  2  
ATOM   5770  N  NE2  . HIS A 1 163 ? 16.866  -9.510  6.137   1.00 0.00 ? 163 HIS A NE2  2  
ATOM   5771  H  H    . HIS A 1 163 ? 13.906  -6.834  8.546   1.00 0.00 ? 163 HIS A H    2  
ATOM   5772  H  HA   . HIS A 1 163 ? 15.845  -7.539  10.534  1.00 0.00 ? 163 HIS A HA   2  
ATOM   5773  H  HB2  . HIS A 1 163 ? 17.036  -5.996  8.272   1.00 0.00 ? 163 HIS A HB2  2  
ATOM   5774  H  HB3  . HIS A 1 163 ? 17.837  -6.973  9.494   1.00 0.00 ? 163 HIS A HB3  2  
ATOM   5775  H  HD1  . HIS A 1 163 ? 17.877  -9.562  9.129   1.00 0.00 ? 163 HIS A HD1  2  
ATOM   5776  H  HD2  . HIS A 1 163 ? 16.173  -7.430  5.979   1.00 0.00 ? 163 HIS A HD2  2  
ATOM   5777  H  HE1  . HIS A 1 163 ? 17.721  -11.169 7.178   1.00 0.00 ? 163 HIS A HE1  2  
ATOM   5778  H  HE2  . HIS A 1 163 ? 16.686  -9.882  5.248   1.00 0.00 ? 163 HIS A HE2  2  
ATOM   5779  N  N    . GLN A 1 164 ? 14.851  -5.365  11.295  1.00 0.00 ? 164 GLN A N    2  
ATOM   5780  C  CA   . GLN A 1 164 ? 14.491  -4.056  11.809  1.00 0.00 ? 164 GLN A CA   2  
ATOM   5781  C  C    . GLN A 1 164 ? 15.694  -3.116  11.793  1.00 0.00 ? 164 GLN A C    2  
ATOM   5782  O  O    . GLN A 1 164 ? 15.581  -1.938  12.134  1.00 0.00 ? 164 GLN A O    2  
ATOM   5783  C  CB   . GLN A 1 164 ? 13.936  -4.184  13.229  1.00 0.00 ? 164 GLN A CB   2  
ATOM   5784  C  CG   . GLN A 1 164 ? 12.752  -5.162  13.239  1.00 0.00 ? 164 GLN A CG   2  
ATOM   5785  C  CD   . GLN A 1 164 ? 12.280  -5.383  14.668  1.00 0.00 ? 164 GLN A CD   2  
ATOM   5786  O  OE1  . GLN A 1 164 ? 12.693  -4.666  15.579  1.00 0.00 ? 164 GLN A OE1  2  
ATOM   5787  N  NE2  . GLN A 1 164 ? 11.433  -6.340  14.922  1.00 0.00 ? 164 GLN A NE2  2  
ATOM   5788  H  H    . GLN A 1 164 ? 14.689  -6.156  11.838  1.00 0.00 ? 164 GLN A H    2  
ATOM   5789  H  HA   . GLN A 1 164 ? 13.729  -3.644  11.174  1.00 0.00 ? 164 GLN A HA   2  
ATOM   5790  H  HB2  . GLN A 1 164 ? 14.712  -4.551  13.886  1.00 0.00 ? 164 GLN A HB2  2  
ATOM   5791  H  HB3  . GLN A 1 164 ? 13.601  -3.216  13.571  1.00 0.00 ? 164 GLN A HB3  2  
ATOM   5792  H  HG2  . GLN A 1 164 ? 11.934  -4.759  12.651  1.00 0.00 ? 164 GLN A HG2  2  
ATOM   5793  H  HG3  . GLN A 1 164 ? 13.064  -6.107  12.822  1.00 0.00 ? 164 GLN A HG3  2  
ATOM   5794  H  HE21 . GLN A 1 164 ? 11.106  -6.911  14.194  1.00 0.00 ? 164 GLN A HE21 2  
ATOM   5795  H  HE22 . GLN A 1 164 ? 11.125  -6.490  15.836  1.00 0.00 ? 164 GLN A HE22 2  
ATOM   5796  N  N    . GLY A 1 165 ? 16.840  -3.643  11.375  1.00 0.00 ? 165 GLY A N    2  
ATOM   5797  C  CA   . GLY A 1 165 ? 18.064  -2.849  11.289  1.00 0.00 ? 165 GLY A CA   2  
ATOM   5798  C  C    . GLY A 1 165 ? 18.688  -3.019  9.912   1.00 0.00 ? 165 GLY A C    2  
ATOM   5799  O  O    . GLY A 1 165 ? 19.898  -3.202  9.777   1.00 0.00 ? 165 GLY A O    2  
ATOM   5800  H  H    . GLY A 1 165 ? 16.862  -4.585  11.105  1.00 0.00 ? 165 GLY A H    2  
ATOM   5801  H  HA2  . GLY A 1 165 ? 17.828  -1.806  11.450  1.00 0.00 ? 165 GLY A HA2  2  
ATOM   5802  H  HA3  . GLY A 1 165 ? 18.764  -3.182  12.037  1.00 0.00 ? 165 GLY A HA3  2  
ATOM   5803  N  N    . CYS A 1 166 ? 17.839  -2.966  8.893   1.00 0.00 ? 166 CYS A N    2  
ATOM   5804  C  CA   . CYS A 1 166 ? 18.286  -3.126  7.516   1.00 0.00 ? 166 CYS A CA   2  
ATOM   5805  C  C    . CYS A 1 166 ? 19.513  -2.251  7.232   1.00 0.00 ? 166 CYS A C    2  
ATOM   5806  O  O    . CYS A 1 166 ? 19.582  -1.111  7.691   1.00 0.00 ? 166 CYS A O    2  
ATOM   5807  C  CB   . CYS A 1 166 ? 17.149  -2.748  6.566   1.00 0.00 ? 166 CYS A CB   2  
ATOM   5808  S  SG   . CYS A 1 166 ? 17.115  -0.953  6.334   1.00 0.00 ? 166 CYS A SG   2  
ATOM   5809  H  H    . CYS A 1 166 ? 16.887  -2.826  9.075   1.00 0.00 ? 166 CYS A H    2  
ATOM   5810  H  HA   . CYS A 1 166 ? 18.534  -4.161  7.361   1.00 0.00 ? 166 CYS A HA   2  
ATOM   5811  H  HB2  . CYS A 1 166 ? 17.299  -3.230  5.611   1.00 0.00 ? 166 CYS A HB2  2  
ATOM   5812  H  HB3  . CYS A 1 166 ? 16.210  -3.071  6.990   1.00 0.00 ? 166 CYS A HB3  2  
ATOM   5813  H  HG   . CYS A 1 166 ? 16.200  -0.688  6.211   1.00 0.00 ? 166 CYS A HG   2  
ATOM   5814  N  N    . PRO A 1 167 ? 20.471  -2.750  6.482   1.00 0.00 ? 167 PRO A N    2  
ATOM   5815  C  CA   . PRO A 1 167 ? 21.703  -1.978  6.141   1.00 0.00 ? 167 PRO A CA   2  
ATOM   5816  C  C    . PRO A 1 167 ? 21.431  -0.908  5.088   1.00 0.00 ? 167 PRO A C    2  
ATOM   5817  O  O    . PRO A 1 167 ? 22.360  -0.336  4.517   1.00 0.00 ? 167 PRO A O    2  
ATOM   5818  C  CB   . PRO A 1 167 ? 22.656  -3.042  5.597   1.00 0.00 ? 167 PRO A CB   2  
ATOM   5819  C  CG   . PRO A 1 167 ? 21.772  -4.104  5.036   1.00 0.00 ? 167 PRO A CG   2  
ATOM   5820  C  CD   . PRO A 1 167 ? 20.496  -4.096  5.876   1.00 0.00 ? 167 PRO A CD   2  
ATOM   5821  H  HA   . PRO A 1 167 ? 22.125  -1.534  7.028   1.00 0.00 ? 167 PRO A HA   2  
ATOM   5822  H  HB2  . PRO A 1 167 ? 23.283  -2.622  4.821   1.00 0.00 ? 167 PRO A HB2  2  
ATOM   5823  H  HB3  . PRO A 1 167 ? 23.262  -3.447  6.393   1.00 0.00 ? 167 PRO A HB3  2  
ATOM   5824  H  HG2  . PRO A 1 167 ? 21.541  -3.883  4.002   1.00 0.00 ? 167 PRO A HG2  2  
ATOM   5825  H  HG3  . PRO A 1 167 ? 22.252  -5.066  5.112   1.00 0.00 ? 167 PRO A HG3  2  
ATOM   5826  H  HD2  . PRO A 1 167 ? 19.629  -4.248  5.247   1.00 0.00 ? 167 PRO A HD2  2  
ATOM   5827  H  HD3  . PRO A 1 167 ? 20.548  -4.851  6.644   1.00 0.00 ? 167 PRO A HD3  2  
ATOM   5828  N  N    . PHE A 1 168 ? 20.154  -0.640  4.836   1.00 0.00 ? 168 PHE A N    2  
ATOM   5829  C  CA   . PHE A 1 168 ? 19.781  0.364   3.849   1.00 0.00 ? 168 PHE A CA   2  
ATOM   5830  C  C    . PHE A 1 168 ? 20.242  1.737   4.308   1.00 0.00 ? 168 PHE A C    2  
ATOM   5831  O  O    . PHE A 1 168 ? 20.440  1.975   5.500   1.00 0.00 ? 168 PHE A O    2  
ATOM   5832  C  CB   . PHE A 1 168 ? 18.266  0.368   3.643   1.00 0.00 ? 168 PHE A CB   2  
ATOM   5833  C  CG   . PHE A 1 168 ? 17.905  1.147   2.399   1.00 0.00 ? 168 PHE A CG   2  
ATOM   5834  C  CD1  . PHE A 1 168 ? 17.866  2.548   2.432   1.00 0.00 ? 168 PHE A CD1  2  
ATOM   5835  C  CD2  . PHE A 1 168 ? 17.586  0.468   1.217   1.00 0.00 ? 168 PHE A CD2  2  
ATOM   5836  C  CE1  . PHE A 1 168 ? 17.511  3.265   1.282   1.00 0.00 ? 168 PHE A CE1  2  
ATOM   5837  C  CE2  . PHE A 1 168 ? 17.235  1.186   0.067   1.00 0.00 ? 168 PHE A CE2  2  
ATOM   5838  C  CZ   . PHE A 1 168 ? 17.196  2.585   0.101   1.00 0.00 ? 168 PHE A CZ   2  
ATOM   5839  H  H    . PHE A 1 168 ? 19.453  -1.125  5.321   1.00 0.00 ? 168 PHE A H    2  
ATOM   5840  H  HA   . PHE A 1 168 ? 20.261  0.128   2.911   1.00 0.00 ? 168 PHE A HA   2  
ATOM   5841  H  HB2  . PHE A 1 168 ? 17.916  -0.646  3.540   1.00 0.00 ? 168 PHE A HB2  2  
ATOM   5842  H  HB3  . PHE A 1 168 ? 17.794  0.822   4.497   1.00 0.00 ? 168 PHE A HB3  2  
ATOM   5843  H  HD1  . PHE A 1 168 ? 18.116  3.073   3.341   1.00 0.00 ? 168 PHE A HD1  2  
ATOM   5844  H  HD2  . PHE A 1 168 ? 17.616  -0.612  1.191   1.00 0.00 ? 168 PHE A HD2  2  
ATOM   5845  H  HE1  . PHE A 1 168 ? 17.477  4.343   1.308   1.00 0.00 ? 168 PHE A HE1  2  
ATOM   5846  H  HE2  . PHE A 1 168 ? 16.992  0.660   -0.844  1.00 0.00 ? 168 PHE A HE2  2  
ATOM   5847  H  HZ   . PHE A 1 168 ? 16.921  3.139   -0.784  1.00 0.00 ? 168 PHE A HZ   2  
ATOM   5848  N  N    . GLN A 1 169 ? 20.427  2.632   3.351   1.00 0.00 ? 169 GLN A N    2  
ATOM   5849  C  CA   . GLN A 1 169 ? 20.883  3.975   3.640   1.00 0.00 ? 169 GLN A CA   2  
ATOM   5850  C  C    . GLN A 1 169 ? 19.989  5.002   2.937   1.00 0.00 ? 169 GLN A C    2  
ATOM   5851  O  O    . GLN A 1 169 ? 19.648  4.820   1.770   1.00 0.00 ? 169 GLN A O    2  
ATOM   5852  C  CB   . GLN A 1 169 ? 22.315  4.114   3.140   1.00 0.00 ? 169 GLN A CB   2  
ATOM   5853  C  CG   . GLN A 1 169 ? 22.861  5.446   3.599   1.00 0.00 ? 169 GLN A CG   2  
ATOM   5854  C  CD   . GLN A 1 169 ? 24.251  5.675   3.019   1.00 0.00 ? 169 GLN A CD   2  
ATOM   5855  O  OE1  . GLN A 1 169 ? 24.755  4.842   2.265   1.00 0.00 ? 169 GLN A OE1  2  
ATOM   5856  N  NE2  . GLN A 1 169 ? 24.904  6.761   3.327   1.00 0.00 ? 169 GLN A NE2  2  
ATOM   5857  H  H    . GLN A 1 169 ? 20.265  2.381   2.428   1.00 0.00 ? 169 GLN A H    2  
ATOM   5858  H  HA   . GLN A 1 169 ? 20.863  4.139   4.707   1.00 0.00 ? 169 GLN A HA   2  
ATOM   5859  H  HB2  . GLN A 1 169 ? 22.918  3.314   3.546   1.00 0.00 ? 169 GLN A HB2  2  
ATOM   5860  H  HB3  . GLN A 1 169 ? 22.328  4.070   2.061   1.00 0.00 ? 169 GLN A HB3  2  
ATOM   5861  H  HG2  . GLN A 1 169 ? 22.194  6.228   3.267   1.00 0.00 ? 169 GLN A HG2  2  
ATOM   5862  H  HG3  . GLN A 1 169 ? 22.916  5.446   4.676   1.00 0.00 ? 169 GLN A HG3  2  
ATOM   5863  H  HE21 . GLN A 1 169 ? 24.499  7.423   3.928   1.00 0.00 ? 169 GLN A HE21 2  
ATOM   5864  H  HE22 . GLN A 1 169 ? 25.799  6.914   2.957   1.00 0.00 ? 169 GLN A HE22 2  
ATOM   5865  N  N    . PRO A 1 170 ? 19.597  6.065   3.605   1.00 0.00 ? 170 PRO A N    2  
ATOM   5866  C  CA   . PRO A 1 170 ? 18.721  7.099   2.995   1.00 0.00 ? 170 PRO A CA   2  
ATOM   5867  C  C    . PRO A 1 170 ? 19.470  7.951   1.973   1.00 0.00 ? 170 PRO A C    2  
ATOM   5868  O  O    . PRO A 1 170 ? 20.661  8.218   2.126   1.00 0.00 ? 170 PRO A O    2  
ATOM   5869  C  CB   . PRO A 1 170 ? 18.261  7.932   4.192   1.00 0.00 ? 170 PRO A CB   2  
ATOM   5870  C  CG   . PRO A 1 170 ? 19.329  7.784   5.213   1.00 0.00 ? 170 PRO A CG   2  
ATOM   5871  C  CD   . PRO A 1 170 ? 19.939  6.406   5.000   1.00 0.00 ? 170 PRO A CD   2  
ATOM   5872  H  HA   . PRO A 1 170 ? 17.867  6.634   2.535   1.00 0.00 ? 170 PRO A HA   2  
ATOM   5873  H  HB2  . PRO A 1 170 ? 18.160  8.959   3.911   1.00 0.00 ? 170 PRO A HB2  2  
ATOM   5874  H  HB3  . PRO A 1 170 ? 17.328  7.552   4.577   1.00 0.00 ? 170 PRO A HB3  2  
ATOM   5875  H  HG2  . PRO A 1 170 ? 20.080  8.553   5.076   1.00 0.00 ? 170 PRO A HG2  2  
ATOM   5876  H  HG3  . PRO A 1 170 ? 18.908  7.846   6.203   1.00 0.00 ? 170 PRO A HG3  2  
ATOM   5877  H  HD2  . PRO A 1 170 ? 21.003  6.444   5.144   1.00 0.00 ? 170 PRO A HD2  2  
ATOM   5878  H  HD3  . PRO A 1 170 ? 19.495  5.702   5.664   1.00 0.00 ? 170 PRO A HD3  2  
ATOM   5879  N  N    . TRP A 1 171 ? 18.764  8.361   0.923   1.00 0.00 ? 171 TRP A N    2  
ATOM   5880  C  CA   . TRP A 1 171 ? 19.368  9.167   -0.128  1.00 0.00 ? 171 TRP A CA   2  
ATOM   5881  C  C    . TRP A 1 171 ? 18.899  10.620  -0.035  1.00 0.00 ? 171 TRP A C    2  
ATOM   5882  O  O    . TRP A 1 171 ? 17.827  10.905  0.502   1.00 0.00 ? 171 TRP A O    2  
ATOM   5883  C  CB   . TRP A 1 171 ? 18.990  8.579   -1.487  1.00 0.00 ? 171 TRP A CB   2  
ATOM   5884  C  CG   . TRP A 1 171 ? 17.514  8.672   -1.672  1.00 0.00 ? 171 TRP A CG   2  
ATOM   5885  C  CD1  . TRP A 1 171 ? 16.891  9.520   -2.514  1.00 0.00 ? 171 TRP A CD1  2  
ATOM   5886  C  CD2  . TRP A 1 171 ? 16.475  7.900   -1.021  1.00 0.00 ? 171 TRP A CD2  2  
ATOM   5887  N  NE1  . TRP A 1 171 ? 15.521  9.331   -2.403  1.00 0.00 ? 171 TRP A NE1  2  
ATOM   5888  C  CE2  . TRP A 1 171 ? 15.220  8.334   -1.498  1.00 0.00 ? 171 TRP A CE2  2  
ATOM   5889  C  CE3  . TRP A 1 171 ? 16.505  6.877   -0.065  1.00 0.00 ? 171 TRP A CE3  2  
ATOM   5890  C  CZ2  . TRP A 1 171 ? 14.034  7.766   -1.039  1.00 0.00 ? 171 TRP A CZ2  2  
ATOM   5891  C  CZ3  . TRP A 1 171 ? 15.320  6.303   0.397   1.00 0.00 ? 171 TRP A CZ3  2  
ATOM   5892  C  CH2  . TRP A 1 171 ? 14.088  6.745   -0.086  1.00 0.00 ? 171 TRP A CH2  2  
ATOM   5893  H  H    . TRP A 1 171 ? 17.823  8.110   0.848   1.00 0.00 ? 171 TRP A H    2  
ATOM   5894  H  HA   . TRP A 1 171 ? 20.443  9.138   -0.026  1.00 0.00 ? 171 TRP A HA   2  
ATOM   5895  H  HB2  . TRP A 1 171 ? 19.482  9.128   -2.261  1.00 0.00 ? 171 TRP A HB2  2  
ATOM   5896  H  HB3  . TRP A 1 171 ? 19.293  7.544   -1.529  1.00 0.00 ? 171 TRP A HB3  2  
ATOM   5897  H  HD1  . TRP A 1 171 ? 17.382  10.234  -3.157  1.00 0.00 ? 171 TRP A HD1  2  
ATOM   5898  H  HE1  . TRP A 1 171 ? 14.834  9.829   -2.894  1.00 0.00 ? 171 TRP A HE1  2  
ATOM   5899  H  HE3  . TRP A 1 171 ? 17.444  6.529   0.311   1.00 0.00 ? 171 TRP A HE3  2  
ATOM   5900  H  HZ2  . TRP A 1 171 ? 13.083  8.111   -1.416  1.00 0.00 ? 171 TRP A HZ2  2  
ATOM   5901  H  HZ3  . TRP A 1 171 ? 15.360  5.517   1.135   1.00 0.00 ? 171 TRP A HZ3  2  
ATOM   5902  H  HH2  . TRP A 1 171 ? 13.184  6.298   0.275   1.00 0.00 ? 171 TRP A HH2  2  
ATOM   5903  N  N    . ASP A 1 172 ? 19.722  11.531  -0.553  1.00 0.00 ? 172 ASP A N    2  
ATOM   5904  C  CA   . ASP A 1 172 ? 19.405  12.958  -0.516  1.00 0.00 ? 172 ASP A CA   2  
ATOM   5905  C  C    . ASP A 1 172 ? 18.217  13.291  -1.407  1.00 0.00 ? 172 ASP A C    2  
ATOM   5906  O  O    . ASP A 1 172 ? 18.197  14.326  -2.073  1.00 0.00 ? 172 ASP A O    2  
ATOM   5907  C  CB   . ASP A 1 172 ? 20.611  13.768  -0.976  1.00 0.00 ? 172 ASP A CB   2  
ATOM   5908  C  CG   . ASP A 1 172 ? 21.711  13.716  0.078   1.00 0.00 ? 172 ASP A CG   2  
ATOM   5909  O  OD1  . ASP A 1 172 ? 21.809  12.706  0.754   1.00 0.00 ? 172 ASP A OD1  2  
ATOM   5910  O  OD2  . ASP A 1 172 ? 22.440  14.688  0.193   1.00 0.00 ? 172 ASP A OD2  2  
ATOM   5911  H  H    . ASP A 1 172 ? 20.564  11.239  -0.958  1.00 0.00 ? 172 ASP A H    2  
ATOM   5912  H  HA   . ASP A 1 172 ? 19.164  13.237  0.498   1.00 0.00 ? 172 ASP A HA   2  
ATOM   5913  H  HB2  . ASP A 1 172 ? 20.979  13.357  -1.904  1.00 0.00 ? 172 ASP A HB2  2  
ATOM   5914  H  HB3  . ASP A 1 172 ? 20.309  14.793  -1.131  1.00 0.00 ? 172 ASP A HB3  2  
ATOM   5915  N  N    . GLY A 1 173 ? 17.228  12.418  -1.399  1.00 0.00 ? 173 GLY A N    2  
ATOM   5916  C  CA   . GLY A 1 173 ? 16.021  12.628  -2.195  1.00 0.00 ? 173 GLY A CA   2  
ATOM   5917  C  C    . GLY A 1 173 ? 14.789  12.549  -1.312  1.00 0.00 ? 173 GLY A C    2  
ATOM   5918  O  O    . GLY A 1 173 ? 13.811  13.261  -1.538  1.00 0.00 ? 173 GLY A O    2  
ATOM   5919  H  H    . GLY A 1 173 ? 17.304  11.624  -0.837  1.00 0.00 ? 173 GLY A H    2  
ATOM   5920  H  HA2  . GLY A 1 173 ? 16.062  13.606  -2.657  1.00 0.00 ? 173 GLY A HA2  2  
ATOM   5921  H  HA3  . GLY A 1 173 ? 15.952  11.878  -2.962  1.00 0.00 ? 173 GLY A HA3  2  
ATOM   5922  N  N    . LEU A 1 174 ? 14.842  11.687  -0.296  1.00 0.00 ? 174 LEU A N    2  
ATOM   5923  C  CA   . LEU A 1 174 ? 13.728  11.543  0.615   1.00 0.00 ? 174 LEU A CA   2  
ATOM   5924  C  C    . LEU A 1 174 ? 13.097  12.902  0.873   1.00 0.00 ? 174 LEU A C    2  
ATOM   5925  O  O    . LEU A 1 174 ? 11.903  13.019  1.147   1.00 0.00 ? 174 LEU A O    2  
ATOM   5926  C  CB   . LEU A 1 174 ? 14.230  10.965  1.925   1.00 0.00 ? 174 LEU A CB   2  
ATOM   5927  C  CG   . LEU A 1 174 ? 14.422  9.456   1.769   1.00 0.00 ? 174 LEU A CG   2  
ATOM   5928  C  CD1  . LEU A 1 174 ? 15.308  8.934   2.897   1.00 0.00 ? 174 LEU A CD1  2  
ATOM   5929  C  CD2  . LEU A 1 174 ? 13.066  8.741   1.801   1.00 0.00 ? 174 LEU A CD2  2  
ATOM   5930  H  H    . LEU A 1 174 ? 15.645  11.146  -0.150  1.00 0.00 ? 174 LEU A H    2  
ATOM   5931  H  HA   . LEU A 1 174 ? 13.010  10.872  0.188   1.00 0.00 ? 174 LEU A HA   2  
ATOM   5932  H  HB2  . LEU A 1 174 ? 15.176  11.424  2.178   1.00 0.00 ? 174 LEU A HB2  2  
ATOM   5933  H  HB3  . LEU A 1 174 ? 13.517  11.166  2.704   1.00 0.00 ? 174 LEU A HB3  2  
ATOM   5934  H  HG   . LEU A 1 174 ? 14.907  9.261   0.825   1.00 0.00 ? 174 LEU A HG   2  
ATOM   5935  H  HD11 . LEU A 1 174 ? 15.284  9.620   3.726   1.00 0.00 ? 174 LEU A HD11 2  
ATOM   5936  H  HD12 . LEU A 1 174 ? 16.319  8.845   2.536   1.00 0.00 ? 174 LEU A HD12 2  
ATOM   5937  H  HD13 . LEU A 1 174 ? 14.955  7.966   3.220   1.00 0.00 ? 174 LEU A HD13 2  
ATOM   5938  H  HD21 . LEU A 1 174 ? 12.621  8.766   0.818   1.00 0.00 ? 174 LEU A HD21 2  
ATOM   5939  H  HD22 . LEU A 1 174 ? 12.413  9.230   2.506   1.00 0.00 ? 174 LEU A HD22 2  
ATOM   5940  H  HD23 . LEU A 1 174 ? 13.215  7.716   2.099   1.00 0.00 ? 174 LEU A HD23 2  
ATOM   5941  N  N    . ASP A 1 175 ? 13.934  13.926  0.773   1.00 0.00 ? 175 ASP A N    2  
ATOM   5942  C  CA   . ASP A 1 175 ? 13.507  15.298  0.984   1.00 0.00 ? 175 ASP A CA   2  
ATOM   5943  C  C    . ASP A 1 175 ? 12.614  15.760  -0.156  1.00 0.00 ? 175 ASP A C    2  
ATOM   5944  O  O    . ASP A 1 175 ? 11.416  15.978  0.020   1.00 0.00 ? 175 ASP A O    2  
ATOM   5945  C  CB   . ASP A 1 175 ? 14.738  16.201  1.048   1.00 0.00 ? 175 ASP A CB   2  
ATOM   5946  C  CG   . ASP A 1 175 ? 15.701  15.848  -0.080  1.00 0.00 ? 175 ASP A CG   2  
ATOM   5947  O  OD1  . ASP A 1 175 ? 16.194  14.731  -0.083  1.00 0.00 ? 175 ASP A OD1  2  
ATOM   5948  O  OD2  . ASP A 1 175 ? 15.933  16.698  -0.923  1.00 0.00 ? 175 ASP A OD2  2  
ATOM   5949  H  H    . ASP A 1 175 ? 14.871  13.751  0.547   1.00 0.00 ? 175 ASP A H    2  
ATOM   5950  H  HA   . ASP A 1 175 ? 12.968  15.369  1.915   1.00 0.00 ? 175 ASP A HA   2  
ATOM   5951  H  HB2  . ASP A 1 175 ? 14.432  17.229  0.947   1.00 0.00 ? 175 ASP A HB2  2  
ATOM   5952  H  HB3  . ASP A 1 175 ? 15.235  16.061  1.994   1.00 0.00 ? 175 ASP A HB3  2  
ATOM   5953  N  N    . GLU A 1 176 ? 13.218  15.903  -1.325  1.00 0.00 ? 176 GLU A N    2  
ATOM   5954  C  CA   . GLU A 1 176 ? 12.492  16.337  -2.506  1.00 0.00 ? 176 GLU A CA   2  
ATOM   5955  C  C    . GLU A 1 176 ? 11.298  15.429  -2.752  1.00 0.00 ? 176 GLU A C    2  
ATOM   5956  O  O    . GLU A 1 176 ? 10.171  15.892  -2.922  1.00 0.00 ? 176 GLU A O    2  
ATOM   5957  C  CB   . GLU A 1 176 ? 13.409  16.310  -3.715  1.00 0.00 ? 176 GLU A CB   2  
ATOM   5958  C  CG   . GLU A 1 176 ? 12.806  17.167  -4.827  1.00 0.00 ? 176 GLU A CG   2  
ATOM   5959  C  CD   . GLU A 1 176 ? 12.906  18.643  -4.459  1.00 0.00 ? 176 GLU A CD   2  
ATOM   5960  O  OE1  . GLU A 1 176 ? 13.939  19.035  -3.941  1.00 0.00 ? 176 GLU A OE1  2  
ATOM   5961  O  OE2  . GLU A 1 176 ? 11.950  19.361  -4.702  1.00 0.00 ? 176 GLU A OE2  2  
ATOM   5962  H  H    . GLU A 1 176 ? 14.174  15.709  -1.394  1.00 0.00 ? 176 GLU A H    2  
ATOM   5963  H  HA   . GLU A 1 176 ? 12.148  17.339  -2.362  1.00 0.00 ? 176 GLU A HA   2  
ATOM   5964  H  HB2  . GLU A 1 176 ? 14.378  16.698  -3.441  1.00 0.00 ? 176 GLU A HB2  2  
ATOM   5965  H  HB3  . GLU A 1 176 ? 13.509  15.299  -4.055  1.00 0.00 ? 176 GLU A HB3  2  
ATOM   5966  H  HG2  . GLU A 1 176 ? 13.342  16.989  -5.744  1.00 0.00 ? 176 GLU A HG2  2  
ATOM   5967  H  HG3  . GLU A 1 176 ? 11.766  16.902  -4.959  1.00 0.00 ? 176 GLU A HG3  2  
ATOM   5968  N  N    . HIS A 1 177 ? 11.560  14.130  -2.757  1.00 0.00 ? 177 HIS A N    2  
ATOM   5969  C  CA   . HIS A 1 177 ? 10.503  13.151  -2.970  1.00 0.00 ? 177 HIS A CA   2  
ATOM   5970  C  C    . HIS A 1 177 ? 9.328   13.448  -2.048  1.00 0.00 ? 177 HIS A C    2  
ATOM   5971  O  O    . HIS A 1 177 ? 8.217   13.721  -2.505  1.00 0.00 ? 177 HIS A O    2  
ATOM   5972  C  CB   . HIS A 1 177 ? 11.032  11.745  -2.689  1.00 0.00 ? 177 HIS A CB   2  
ATOM   5973  C  CG   . HIS A 1 177 ? 11.973  11.332  -3.788  1.00 0.00 ? 177 HIS A CG   2  
ATOM   5974  N  ND1  . HIS A 1 177 ? 13.345  11.269  -3.601  1.00 0.00 ? 177 HIS A ND1  2  
ATOM   5975  C  CD2  . HIS A 1 177 ? 11.754  10.954  -5.090  1.00 0.00 ? 177 HIS A CD2  2  
ATOM   5976  C  CE1  . HIS A 1 177 ? 13.895  10.868  -4.763  1.00 0.00 ? 177 HIS A CE1  2  
ATOM   5977  N  NE2  . HIS A 1 177 ? 12.968  10.662  -5.703  1.00 0.00 ? 177 HIS A NE2  2  
ATOM   5978  H  H    . HIS A 1 177 ? 12.481  13.828  -2.606  1.00 0.00 ? 177 HIS A H    2  
ATOM   5979  H  HA   . HIS A 1 177 ? 10.172  13.205  -3.996  1.00 0.00 ? 177 HIS A HA   2  
ATOM   5980  H  HB2  . HIS A 1 177 ? 11.556  11.741  -1.744  1.00 0.00 ? 177 HIS A HB2  2  
ATOM   5981  H  HB3  . HIS A 1 177 ? 10.204  11.053  -2.644  1.00 0.00 ? 177 HIS A HB3  2  
ATOM   5982  H  HD1  . HIS A 1 177 ? 13.827  11.481  -2.775  1.00 0.00 ? 177 HIS A HD1  2  
ATOM   5983  H  HD2  . HIS A 1 177 ? 10.786  10.891  -5.565  1.00 0.00 ? 177 HIS A HD2  2  
ATOM   5984  H  HE1  . HIS A 1 177 ? 14.954  10.727  -4.914  1.00 0.00 ? 177 HIS A HE1  2  
ATOM   5985  H  HE2  . HIS A 1 177 ? 13.114  10.369  -6.627  1.00 0.00 ? 177 HIS A HE2  2  
ATOM   5986  N  N    . SER A 1 178 ? 9.588   13.404  -0.746  1.00 0.00 ? 178 SER A N    2  
ATOM   5987  C  CA   . SER A 1 178 ? 8.554   13.682  0.239   1.00 0.00 ? 178 SER A CA   2  
ATOM   5988  C  C    . SER A 1 178 ? 7.756   14.910  -0.176  1.00 0.00 ? 178 SER A C    2  
ATOM   5989  O  O    . SER A 1 178 ? 6.546   14.843  -0.381  1.00 0.00 ? 178 SER A O    2  
ATOM   5990  C  CB   . SER A 1 178 ? 9.195   13.934  1.602   1.00 0.00 ? 178 SER A CB   2  
ATOM   5991  O  OG   . SER A 1 178 ? 8.191   14.333  2.524   1.00 0.00 ? 178 SER A OG   2  
ATOM   5992  H  H    . SER A 1 178 ? 10.495  13.190  -0.445  1.00 0.00 ? 178 SER A H    2  
ATOM   5993  H  HA   . SER A 1 178 ? 7.891   12.834  0.312   1.00 0.00 ? 178 SER A HA   2  
ATOM   5994  H  HB2  . SER A 1 178 ? 9.666   13.033  1.954   1.00 0.00 ? 178 SER A HB2  2  
ATOM   5995  H  HB3  . SER A 1 178 ? 9.942   14.714  1.508   1.00 0.00 ? 178 SER A HB3  2  
ATOM   5996  H  HG   . SER A 1 178 ? 7.601   14.942  2.075   1.00 0.00 ? 178 SER A HG   2  
ATOM   5997  N  N    . GLN A 1 179 ? 8.454   16.030  -0.303  1.00 0.00 ? 179 GLN A N    2  
ATOM   5998  C  CA   . GLN A 1 179 ? 7.822   17.279  -0.701  1.00 0.00 ? 179 GLN A CA   2  
ATOM   5999  C  C    . GLN A 1 179 ? 6.727   17.025  -1.724  1.00 0.00 ? 179 GLN A C    2  
ATOM   6000  O  O    . GLN A 1 179 ? 5.614   17.539  -1.609  1.00 0.00 ? 179 GLN A O    2  
ATOM   6001  C  CB   . GLN A 1 179 ? 8.864   18.202  -1.330  1.00 0.00 ? 179 GLN A CB   2  
ATOM   6002  C  CG   . GLN A 1 179 ? 8.360   19.649  -1.295  1.00 0.00 ? 179 GLN A CG   2  
ATOM   6003  C  CD   . GLN A 1 179 ? 8.923   20.430  -2.479  1.00 0.00 ? 179 GLN A CD   2  
ATOM   6004  O  OE1  . GLN A 1 179 ? 8.261   21.324  -3.005  1.00 0.00 ? 179 GLN A OE1  2  
ATOM   6005  N  NE2  . GLN A 1 179 ? 10.113  20.142  -2.931  1.00 0.00 ? 179 GLN A NE2  2  
ATOM   6006  H  H    . GLN A 1 179 ? 9.419   16.015  -0.131  1.00 0.00 ? 179 GLN A H    2  
ATOM   6007  H  HA   . GLN A 1 179 ? 7.400   17.761  0.166   1.00 0.00 ? 179 GLN A HA   2  
ATOM   6008  H  HB2  . GLN A 1 179 ? 9.791   18.128  -0.777  1.00 0.00 ? 179 GLN A HB2  2  
ATOM   6009  H  HB3  . GLN A 1 179 ? 9.030   17.901  -2.358  1.00 0.00 ? 179 GLN A HB3  2  
ATOM   6010  H  HG2  . GLN A 1 179 ? 7.280   19.658  -1.345  1.00 0.00 ? 179 GLN A HG2  2  
ATOM   6011  H  HG3  . GLN A 1 179 ? 8.678   20.117  -0.376  1.00 0.00 ? 179 GLN A HG3  2  
ATOM   6012  H  HE21 . GLN A 1 179 ? 10.638  19.427  -2.510  1.00 0.00 ? 179 GLN A HE21 2  
ATOM   6013  H  HE22 . GLN A 1 179 ? 10.481  20.640  -3.694  1.00 0.00 ? 179 GLN A HE22 2  
ATOM   6014  N  N    . ASP A 1 180 ? 7.068   16.248  -2.740  1.00 0.00 ? 180 ASP A N    2  
ATOM   6015  C  CA   . ASP A 1 180 ? 6.140   15.942  -3.808  1.00 0.00 ? 180 ASP A CA   2  
ATOM   6016  C  C    . ASP A 1 180 ? 4.906   15.204  -3.291  1.00 0.00 ? 180 ASP A C    2  
ATOM   6017  O  O    . ASP A 1 180 ? 3.785   15.702  -3.417  1.00 0.00 ? 180 ASP A O    2  
ATOM   6018  C  CB   . ASP A 1 180 ? 6.867   15.109  -4.861  1.00 0.00 ? 180 ASP A CB   2  
ATOM   6019  C  CG   . ASP A 1 180 ? 6.232   15.323  -6.233  1.00 0.00 ? 180 ASP A CG   2  
ATOM   6020  O  OD1  . ASP A 1 180 ? 5.015   15.328  -6.306  1.00 0.00 ? 180 ASP A OD1  2  
ATOM   6021  O  OD2  . ASP A 1 180 ? 6.974   15.481  -7.188  1.00 0.00 ? 180 ASP A OD2  2  
ATOM   6022  H  H    . ASP A 1 180 ? 7.975   15.886  -2.784  1.00 0.00 ? 180 ASP A H    2  
ATOM   6023  H  HA   . ASP A 1 180 ? 5.826   16.867  -4.263  1.00 0.00 ? 180 ASP A HA   2  
ATOM   6024  H  HB2  . ASP A 1 180 ? 7.905   15.418  -4.890  1.00 0.00 ? 180 ASP A HB2  2  
ATOM   6025  H  HB3  . ASP A 1 180 ? 6.811   14.063  -4.597  1.00 0.00 ? 180 ASP A HB3  2  
ATOM   6026  N  N    . LEU A 1 181 ? 5.102   14.023  -2.710  1.00 0.00 ? 181 LEU A N    2  
ATOM   6027  C  CA   . LEU A 1 181 ? 3.982   13.258  -2.196  1.00 0.00 ? 181 LEU A CA   2  
ATOM   6028  C  C    . LEU A 1 181 ? 3.229   14.063  -1.146  1.00 0.00 ? 181 LEU A C    2  
ATOM   6029  O  O    . LEU A 1 181 ? 2.020   14.247  -1.240  1.00 0.00 ? 181 LEU A O    2  
ATOM   6030  C  CB   . LEU A 1 181 ? 4.501   11.967  -1.566  1.00 0.00 ? 181 LEU A CB   2  
ATOM   6031  C  CG   . LEU A 1 181 ? 3.428   10.853  -1.519  1.00 0.00 ? 181 LEU A CG   2  
ATOM   6032  C  CD1  . LEU A 1 181 ? 3.703   9.945   -0.322  1.00 0.00 ? 181 LEU A CD1  2  
ATOM   6033  C  CD2  . LEU A 1 181 ? 1.998   11.402  -1.361  1.00 0.00 ? 181 LEU A CD2  2  
ATOM   6034  H  H    . LEU A 1 181 ? 6.008   13.658  -2.623  1.00 0.00 ? 181 LEU A H    2  
ATOM   6035  H  HA   . LEU A 1 181 ? 3.329   13.022  -3.016  1.00 0.00 ? 181 LEU A HA   2  
ATOM   6036  H  HB2  . LEU A 1 181 ? 5.341   11.618  -2.145  1.00 0.00 ? 181 LEU A HB2  2  
ATOM   6037  H  HB3  . LEU A 1 181 ? 4.837   12.182  -0.570  1.00 0.00 ? 181 LEU A HB3  2  
ATOM   6038  H  HG   . LEU A 1 181 ? 3.495   10.273  -2.421  1.00 0.00 ? 181 LEU A HG   2  
ATOM   6039  H  HD11 . LEU A 1 181 ? 3.785   10.547  0.564   1.00 0.00 ? 181 LEU A HD11 2  
ATOM   6040  H  HD12 . LEU A 1 181 ? 4.624   9.410   -0.475  1.00 0.00 ? 181 LEU A HD12 2  
ATOM   6041  H  HD13 . LEU A 1 181 ? 2.891   9.245   -0.203  1.00 0.00 ? 181 LEU A HD13 2  
ATOM   6042  H  HD21 . LEU A 1 181 ? 1.950   12.053  -0.504  1.00 0.00 ? 181 LEU A HD21 2  
ATOM   6043  H  HD22 . LEU A 1 181 ? 1.321   10.574  -1.210  1.00 0.00 ? 181 LEU A HD22 2  
ATOM   6044  H  HD23 . LEU A 1 181 ? 1.698   11.938  -2.244  1.00 0.00 ? 181 LEU A HD23 2  
ATOM   6045  N  N    . SER A 1 182 ? 3.948   14.519  -0.128  1.00 0.00 ? 182 SER A N    2  
ATOM   6046  C  CA   . SER A 1 182 ? 3.326   15.277  0.943   1.00 0.00 ? 182 SER A CA   2  
ATOM   6047  C  C    . SER A 1 182 ? 2.625   16.518  0.401   1.00 0.00 ? 182 SER A C    2  
ATOM   6048  O  O    . SER A 1 182 ? 1.402   16.590  0.387   1.00 0.00 ? 182 SER A O    2  
ATOM   6049  C  CB   . SER A 1 182 ? 4.383   15.692  1.964   1.00 0.00 ? 182 SER A CB   2  
ATOM   6050  O  OG   . SER A 1 182 ? 3.743   16.268  3.095   1.00 0.00 ? 182 SER A OG   2  
ATOM   6051  H  H    . SER A 1 182 ? 4.905   14.325  -0.087  1.00 0.00 ? 182 SER A H    2  
ATOM   6052  H  HA   . SER A 1 182 ? 2.600   14.651  1.433   1.00 0.00 ? 182 SER A HA   2  
ATOM   6053  H  HB2  . SER A 1 182 ? 4.942   14.827  2.276   1.00 0.00 ? 182 SER A HB2  2  
ATOM   6054  H  HB3  . SER A 1 182 ? 5.055   16.410  1.513   1.00 0.00 ? 182 SER A HB3  2  
ATOM   6055  H  HG   . SER A 1 182 ? 4.266   17.021  3.380   1.00 0.00 ? 182 SER A HG   2  
ATOM   6056  N  N    . GLY A 1 183 ? 3.395   17.490  -0.061  1.00 0.00 ? 183 GLY A N    2  
ATOM   6057  C  CA   . GLY A 1 183 ? 2.803   18.711  -0.589  1.00 0.00 ? 183 GLY A CA   2  
ATOM   6058  C  C    . GLY A 1 183 ? 1.536   18.387  -1.358  1.00 0.00 ? 183 GLY A C    2  
ATOM   6059  O  O    . GLY A 1 183 ? 0.591   19.172  -1.378  1.00 0.00 ? 183 GLY A O    2  
ATOM   6060  H  H    . GLY A 1 183 ? 4.365   17.385  -0.047  1.00 0.00 ? 183 GLY A H    2  
ATOM   6061  H  HA2  . GLY A 1 183 ? 2.562   19.373  0.231   1.00 0.00 ? 183 GLY A HA2  2  
ATOM   6062  H  HA3  . GLY A 1 183 ? 3.497   19.197  -1.244  1.00 0.00 ? 183 GLY A HA3  2  
ATOM   6063  N  N    . ARG A 1 184 ? 1.516   17.212  -1.976  1.00 0.00 ? 184 ARG A N    2  
ATOM   6064  C  CA   . ARG A 1 184 ? 0.351   16.792  -2.722  1.00 0.00 ? 184 ARG A CA   2  
ATOM   6065  C  C    . ARG A 1 184 ? -0.737  16.277  -1.786  1.00 0.00 ? 184 ARG A C    2  
ATOM   6066  O  O    . ARG A 1 184 ? -1.798  16.884  -1.673  1.00 0.00 ? 184 ARG A O    2  
ATOM   6067  C  CB   . ARG A 1 184 ? 0.717   15.698  -3.719  1.00 0.00 ? 184 ARG A CB   2  
ATOM   6068  C  CG   . ARG A 1 184 ? 1.293   16.327  -4.998  1.00 0.00 ? 184 ARG A CG   2  
ATOM   6069  C  CD   . ARG A 1 184 ? 0.213   16.386  -6.078  1.00 0.00 ? 184 ARG A CD   2  
ATOM   6070  N  NE   . ARG A 1 184 ? 0.723   17.053  -7.269  1.00 0.00 ? 184 ARG A NE   2  
ATOM   6071  C  CZ   . ARG A 1 184 ? -0.083  17.376  -8.275  1.00 0.00 ? 184 ARG A CZ   2  
ATOM   6072  N  NH1  . ARG A 1 184 ? -1.351  17.078  -8.214  1.00 0.00 ? 184 ARG A NH1  2  
ATOM   6073  N  NH2  . ARG A 1 184 ? 0.393   17.992  -9.321  1.00 0.00 ? 184 ARG A NH2  2  
ATOM   6074  H  H    . ARG A 1 184 ? 2.294   16.620  -1.922  1.00 0.00 ? 184 ARG A H    2  
ATOM   6075  H  HA   . ARG A 1 184 ? -0.026  17.636  -3.264  1.00 0.00 ? 184 ARG A HA   2  
ATOM   6076  H  HB2  . ARG A 1 184 ? 1.454   15.043  -3.278  1.00 0.00 ? 184 ARG A HB2  2  
ATOM   6077  H  HB3  . ARG A 1 184 ? -0.175  15.132  -3.958  1.00 0.00 ? 184 ARG A HB3  2  
ATOM   6078  H  HG2  . ARG A 1 184 ? 1.646   17.328  -4.789  1.00 0.00 ? 184 ARG A HG2  2  
ATOM   6079  H  HG3  . ARG A 1 184 ? 2.116   15.725  -5.351  1.00 0.00 ? 184 ARG A HG3  2  
ATOM   6080  H  HD2  . ARG A 1 184 ? -0.087  15.382  -6.330  1.00 0.00 ? 184 ARG A HD2  2  
ATOM   6081  H  HD3  . ARG A 1 184 ? -0.642  16.928  -5.699  1.00 0.00 ? 184 ARG A HD3  2  
ATOM   6082  H  HE   . ARG A 1 184 ? 1.677   17.274  -7.326  1.00 0.00 ? 184 ARG A HE   2  
ATOM   6083  H  HH11 . ARG A 1 184 ? -1.717  16.606  -7.411  1.00 0.00 ? 184 ARG A HH11 2  
ATOM   6084  H  HH12 . ARG A 1 184 ? -1.958  17.319  -8.972  1.00 0.00 ? 184 ARG A HH12 2  
ATOM   6085  H  HH21 . ARG A 1 184 ? 1.366   18.221  -9.367  1.00 0.00 ? 184 ARG A HH21 2  
ATOM   6086  H  HH22 . ARG A 1 184 ? -0.214  18.236  -10.078 1.00 0.00 ? 184 ARG A HH22 2  
ATOM   6087  N  N    . LEU A 1 185 ? -0.469  15.153  -1.119  1.00 0.00 ? 185 LEU A N    2  
ATOM   6088  C  CA   . LEU A 1 185 ? -1.449  14.573  -0.206  1.00 0.00 ? 185 LEU A CA   2  
ATOM   6089  C  C    . LEU A 1 185 ? -2.138  15.679  0.559   1.00 0.00 ? 185 LEU A C    2  
ATOM   6090  O  O    . LEU A 1 185 ? -3.354  15.690  0.722   1.00 0.00 ? 185 LEU A O    2  
ATOM   6091  C  CB   . LEU A 1 185 ? -0.789  13.603  0.755   1.00 0.00 ? 185 LEU A CB   2  
ATOM   6092  C  CG   . LEU A 1 185 ? -1.885  12.841  1.535   1.00 0.00 ? 185 LEU A CG   2  
ATOM   6093  C  CD1  . LEU A 1 185 ? -1.976  11.393  1.039   1.00 0.00 ? 185 LEU A CD1  2  
ATOM   6094  C  CD2  . LEU A 1 185 ? -1.562  12.857  3.034   1.00 0.00 ? 185 LEU A CD2  2  
ATOM   6095  H  H    . LEU A 1 185 ? 0.394   14.719  -1.241  1.00 0.00 ? 185 LEU A H    2  
ATOM   6096  H  HA   . LEU A 1 185 ? -2.180  14.032  -0.780  1.00 0.00 ? 185 LEU A HA   2  
ATOM   6097  H  HB2  . LEU A 1 185 ? -0.187  12.919  0.183   1.00 0.00 ? 185 LEU A HB2  2  
ATOM   6098  H  HB3  . LEU A 1 185 ? -0.161  14.141  1.439   1.00 0.00 ? 185 LEU A HB3  2  
ATOM   6099  H  HG   . LEU A 1 185 ? -2.843  13.321  1.378   1.00 0.00 ? 185 LEU A HG   2  
ATOM   6100  H  HD11 . LEU A 1 185 ? -1.697  11.345  -0.003  1.00 0.00 ? 185 LEU A HD11 2  
ATOM   6101  H  HD12 . LEU A 1 185 ? -2.989  11.045  1.148   1.00 0.00 ? 185 LEU A HD12 2  
ATOM   6102  H  HD13 . LEU A 1 185 ? -1.312  10.769  1.619   1.00 0.00 ? 185 LEU A HD13 2  
ATOM   6103  H  HD21 . LEU A 1 185 ? -0.643  12.321  3.211   1.00 0.00 ? 185 LEU A HD21 2  
ATOM   6104  H  HD22 . LEU A 1 185 ? -2.366  12.388  3.580   1.00 0.00 ? 185 LEU A HD22 2  
ATOM   6105  H  HD23 . LEU A 1 185 ? -1.453  13.880  3.364   1.00 0.00 ? 185 LEU A HD23 2  
ATOM   6106  N  N    . ARG A 1 186 ? -1.343  16.637  0.977   1.00 0.00 ? 186 ARG A N    2  
ATOM   6107  C  CA   . ARG A 1 186 ? -1.847  17.799  1.658   1.00 0.00 ? 186 ARG A CA   2  
ATOM   6108  C  C    . ARG A 1 186 ? -2.805  18.492  0.747   1.00 0.00 ? 186 ARG A C    2  
ATOM   6109  O  O    . ARG A 1 186 ? -3.998  18.575  0.988   1.00 0.00 ? 186 ARG A O    2  
ATOM   6110  C  CB   . ARG A 1 186 ? -0.662  18.704  1.885   1.00 0.00 ? 186 ARG A CB   2  
ATOM   6111  C  CG   . ARG A 1 186 ? 0.338   18.081  2.873   1.00 0.00 ? 186 ARG A CG   2  
ATOM   6112  C  CD   . ARG A 1 186 ? 0.189   16.553  3.066   1.00 0.00 ? 186 ARG A CD   2  
ATOM   6113  N  NE   . ARG A 1 186 ? 0.985   16.122  4.208   1.00 0.00 ? 186 ARG A NE   2  
ATOM   6114  C  CZ   . ARG A 1 186 ? 0.536   16.258  5.452   1.00 0.00 ? 186 ARG A CZ   2  
ATOM   6115  N  NH1  . ARG A 1 186 ? -0.641  16.780  5.668   1.00 0.00 ? 186 ARG A NH1  2  
ATOM   6116  N  NH2  . ARG A 1 186 ? 1.270   15.867  6.459   1.00 0.00 ? 186 ARG A NH2  2  
ATOM   6117  H  H    . ARG A 1 186 ? -0.375  16.588  0.786   1.00 0.00 ? 186 ARG A H    2  
ATOM   6118  H  HA   . ARG A 1 186 ? -2.327  17.565  2.592   1.00 0.00 ? 186 ARG A HA   2  
ATOM   6119  H  HB2  . ARG A 1 186 ? -0.170  18.872  0.933   1.00 0.00 ? 186 ARG A HB2  2  
ATOM   6120  H  HB3  . ARG A 1 186 ? -1.002  19.652  2.267   1.00 0.00 ? 186 ARG A HB3  2  
ATOM   6121  H  HG2  . ARG A 1 186 ? 1.333   18.268  2.508   1.00 0.00 ? 186 ARG A HG2  2  
ATOM   6122  H  HG3  . ARG A 1 186 ? 0.206   18.562  3.814   1.00 0.00 ? 186 ARG A HG3  2  
ATOM   6123  H  HD2  . ARG A 1 186 ? -0.833  16.277  3.236   1.00 0.00 ? 186 ARG A HD2  2  
ATOM   6124  H  HD3  . ARG A 1 186 ? 0.543   16.058  2.195   1.00 0.00 ? 186 ARG A HD3  2  
ATOM   6125  H  HE   . ARG A 1 186 ? 1.869   15.725  4.057   1.00 0.00 ? 186 ARG A HE   2  
ATOM   6126  H  HH11 . ARG A 1 186 ? -1.204  17.077  4.898   1.00 0.00 ? 186 ARG A HH11 2  
ATOM   6127  H  HH12 . ARG A 1 186 ? -0.978  16.883  6.604   1.00 0.00 ? 186 ARG A HH12 2  
ATOM   6128  H  HH21 . ARG A 1 186 ? 2.171   15.465  6.294   1.00 0.00 ? 186 ARG A HH21 2  
ATOM   6129  H  HH22 . ARG A 1 186 ? 0.932   15.970  7.394   1.00 0.00 ? 186 ARG A HH22 2  
ATOM   6130  N  N    . ALA A 1 187 ? -2.227  18.971  -0.311  1.00 0.00 ? 187 ALA A N    2  
ATOM   6131  C  CA   . ALA A 1 187 ? -2.963  19.691  -1.340  1.00 0.00 ? 187 ALA A CA   2  
ATOM   6132  C  C    . ALA A 1 187 ? -4.285  19.021  -1.688  1.00 0.00 ? 187 ALA A C    2  
ATOM   6133  O  O    . ALA A 1 187 ? -5.348  19.626  -1.546  1.00 0.00 ? 187 ALA A O    2  
ATOM   6134  C  CB   . ALA A 1 187 ? -2.126  19.759  -2.604  1.00 0.00 ? 187 ALA A CB   2  
ATOM   6135  H  H    . ALA A 1 187 ? -1.254  18.824  -0.402  1.00 0.00 ? 187 ALA A H    2  
ATOM   6136  H  HA   . ALA A 1 187 ? -3.159  20.701  -0.995  1.00 0.00 ? 187 ALA A HA   2  
ATOM   6137  H  HB1  . ALA A 1 187 ? -1.174  20.207  -2.380  1.00 0.00 ? 187 ALA A HB1  2  
ATOM   6138  H  HB2  . ALA A 1 187 ? -2.643  20.348  -3.344  1.00 0.00 ? 187 ALA A HB2  2  
ATOM   6139  H  HB3  . ALA A 1 187 ? -1.977  18.759  -2.982  1.00 0.00 ? 187 ALA A HB3  2  
ATOM   6140  N  N    . ILE A 1 188 ? -4.221  17.788  -2.185  1.00 0.00 ? 188 ILE A N    2  
ATOM   6141  C  CA   . ILE A 1 188 ? -5.433  17.102  -2.587  1.00 0.00 ? 188 ILE A CA   2  
ATOM   6142  C  C    . ILE A 1 188 ? -6.471  17.121  -1.461  1.00 0.00 ? 188 ILE A C    2  
ATOM   6143  O  O    . ILE A 1 188 ? -7.648  17.387  -1.705  1.00 0.00 ? 188 ILE A O    2  
ATOM   6144  C  CB   . ILE A 1 188 ? -5.144  15.650  -3.039  1.00 0.00 ? 188 ILE A CB   2  
ATOM   6145  C  CG1  . ILE A 1 188 ? -4.191  14.953  -2.045  1.00 0.00 ? 188 ILE A CG1  2  
ATOM   6146  C  CG2  . ILE A 1 188 ? -4.498  15.642  -4.436  1.00 0.00 ? 188 ILE A CG2  2  
ATOM   6147  C  CD1  . ILE A 1 188 ? -4.978  14.019  -1.122  1.00 0.00 ? 188 ILE A CD1  2  
ATOM   6148  H  H    . ILE A 1 188 ? -3.355  17.351  -2.309  1.00 0.00 ? 188 ILE A H    2  
ATOM   6149  H  HA   . ILE A 1 188 ? -5.835  17.650  -3.424  1.00 0.00 ? 188 ILE A HA   2  
ATOM   6150  H  HB   . ILE A 1 188 ? -6.078  15.109  -3.087  1.00 0.00 ? 188 ILE A HB   2  
ATOM   6151  H  HG12 . ILE A 1 188 ? -3.454  14.376  -2.589  1.00 0.00 ? 188 ILE A HG12 2  
ATOM   6152  H  HG13 . ILE A 1 188 ? -3.688  15.690  -1.454  1.00 0.00 ? 188 ILE A HG13 2  
ATOM   6153  H  HG21 . ILE A 1 188 ? -4.882  16.455  -5.028  1.00 0.00 ? 188 ILE A HG21 2  
ATOM   6154  H  HG22 . ILE A 1 188 ? -4.721  14.704  -4.926  1.00 0.00 ? 188 ILE A HG22 2  
ATOM   6155  H  HG23 . ILE A 1 188 ? -3.426  15.742  -4.336  1.00 0.00 ? 188 ILE A HG23 2  
ATOM   6156  H  HD11 . ILE A 1 188 ? -4.294  13.417  -0.545  1.00 0.00 ? 188 ILE A HD11 2  
ATOM   6157  H  HD12 . ILE A 1 188 ? -5.609  13.377  -1.713  1.00 0.00 ? 188 ILE A HD12 2  
ATOM   6158  H  HD13 . ILE A 1 188 ? -5.587  14.605  -0.456  1.00 0.00 ? 188 ILE A HD13 2  
ATOM   6159  N  N    . LEU A 1 189 ? -6.037  16.853  -0.230  1.00 0.00 ? 189 LEU A N    2  
ATOM   6160  C  CA   . LEU A 1 189 ? -6.953  16.860  0.909   1.00 0.00 ? 189 LEU A CA   2  
ATOM   6161  C  C    . LEU A 1 189 ? -7.396  18.296  1.194   1.00 0.00 ? 189 LEU A C    2  
ATOM   6162  O  O    . LEU A 1 189 ? -8.584  18.613  1.186   1.00 0.00 ? 189 LEU A O    2  
ATOM   6163  C  CB   . LEU A 1 189 ? -6.238  16.280  2.142   1.00 0.00 ? 189 LEU A CB   2  
ATOM   6164  C  CG   . LEU A 1 189 ? -7.106  15.220  2.832   1.00 0.00 ? 189 LEU A CG   2  
ATOM   6165  C  CD1  . LEU A 1 189 ? -7.095  13.918  2.030   1.00 0.00 ? 189 LEU A CD1  2  
ATOM   6166  C  CD2  . LEU A 1 189 ? -6.539  14.947  4.221   1.00 0.00 ? 189 LEU A CD2  2  
ATOM   6167  H  H    . LEU A 1 189 ? -5.089  16.655  -0.082  1.00 0.00 ? 189 LEU A H    2  
ATOM   6168  H  HA   . LEU A 1 189 ? -7.815  16.258  0.675   1.00 0.00 ? 189 LEU A HA   2  
ATOM   6169  H  HB2  . LEU A 1 189 ? -5.312  15.830  1.830   1.00 0.00 ? 189 LEU A HB2  2  
ATOM   6170  H  HB3  . LEU A 1 189 ? -6.022  17.073  2.848   1.00 0.00 ? 189 LEU A HB3  2  
ATOM   6171  H  HG   . LEU A 1 189 ? -8.122  15.581  2.919   1.00 0.00 ? 189 LEU A HG   2  
ATOM   6172  H  HD11 . LEU A 1 189 ? -7.313  13.094  2.692   1.00 0.00 ? 189 LEU A HD11 2  
ATOM   6173  H  HD12 . LEU A 1 189 ? -6.124  13.769  1.584   1.00 0.00 ? 189 LEU A HD12 2  
ATOM   6174  H  HD13 . LEU A 1 189 ? -7.844  13.967  1.259   1.00 0.00 ? 189 LEU A HD13 2  
ATOM   6175  H  HD21 . LEU A 1 189 ? -7.186  14.259  4.743   1.00 0.00 ? 189 LEU A HD21 2  
ATOM   6176  H  HD22 . LEU A 1 189 ? -6.473  15.873  4.771   1.00 0.00 ? 189 LEU A HD22 2  
ATOM   6177  H  HD23 . LEU A 1 189 ? -5.554  14.513  4.124   1.00 0.00 ? 189 LEU A HD23 2  
ATOM   6178  N  N    . GLN A 1 190 ? -6.408  19.147  1.437   1.00 0.00 ? 190 GLN A N    2  
ATOM   6179  C  CA   . GLN A 1 190 ? -6.632  20.551  1.721   1.00 0.00 ? 190 GLN A CA   2  
ATOM   6180  C  C    . GLN A 1 190 ? -7.163  21.277  0.495   1.00 0.00 ? 190 GLN A C    2  
ATOM   6181  O  O    . GLN A 1 190 ? -7.156  22.506  0.430   1.00 0.00 ? 190 GLN A O    2  
ATOM   6182  C  CB   . GLN A 1 190 ? -5.312  21.175  2.185   1.00 0.00 ? 190 GLN A CB   2  
ATOM   6183  C  CG   . GLN A 1 190 ? -5.279  21.247  3.710   1.00 0.00 ? 190 GLN A CG   2  
ATOM   6184  C  CD   . GLN A 1 190 ? -5.944  22.531  4.195   1.00 0.00 ? 190 GLN A CD   2  
ATOM   6185  O  OE1  . GLN A 1 190 ? -7.084  22.504  4.658   1.00 0.00 ? 190 GLN A OE1  2  
ATOM   6186  N  NE2  . GLN A 1 190 ? -5.296  23.662  4.118   1.00 0.00 ? 190 GLN A NE2  2  
ATOM   6187  H  H    . GLN A 1 190 ? -5.496  18.818  1.428   1.00 0.00 ? 190 GLN A H    2  
ATOM   6188  H  HA   . GLN A 1 190 ? -7.355  20.628  2.497   1.00 0.00 ? 190 GLN A HA   2  
ATOM   6189  H  HB2  . GLN A 1 190 ? -4.497  20.553  1.853   1.00 0.00 ? 190 GLN A HB2  2  
ATOM   6190  H  HB3  . GLN A 1 190 ? -5.199  22.165  1.769   1.00 0.00 ? 190 GLN A HB3  2  
ATOM   6191  H  HG2  . GLN A 1 190 ? -5.803  20.393  4.116   1.00 0.00 ? 190 GLN A HG2  2  
ATOM   6192  H  HG3  . GLN A 1 190 ? -4.255  21.225  4.039   1.00 0.00 ? 190 GLN A HG3  2  
ATOM   6193  H  HE21 . GLN A 1 190 ? -4.386  23.682  3.749   1.00 0.00 ? 190 GLN A HE21 2  
ATOM   6194  H  HE22 . GLN A 1 190 ? -5.720  24.492  4.430   1.00 0.00 ? 190 GLN A HE22 2  
ATOM   6195  N  N    . ASN A 1 191 ? -7.630  20.493  -0.458  1.00 0.00 ? 191 ASN A N    2  
ATOM   6196  C  CA   . ASN A 1 191 ? -8.186  21.020  -1.699  1.00 0.00 ? 191 ASN A CA   2  
ATOM   6197  C  C    . ASN A 1 191 ? -7.542  22.360  -2.050  1.00 0.00 ? 191 ASN A C    2  
ATOM   6198  O  O    . ASN A 1 191 ? -8.104  23.424  -1.792  1.00 0.00 ? 191 ASN A O    2  
ATOM   6199  C  CB   . ASN A 1 191 ? -9.700  21.153  -1.541  1.00 0.00 ? 191 ASN A CB   2  
ATOM   6200  C  CG   . ASN A 1 191 ? -10.267 22.252  -2.426  1.00 0.00 ? 191 ASN A CG   2  
ATOM   6201  O  OD1  . ASN A 1 191 ? -9.661  22.628  -3.430  1.00 0.00 ? 191 ASN A OD1  2  
ATOM   6202  N  ND2  . ASN A 1 191 ? -11.408 22.787  -2.111  1.00 0.00 ? 191 ASN A ND2  2  
ATOM   6203  H  H    . ASN A 1 191 ? -7.611  19.535  -0.314  1.00 0.00 ? 191 ASN A H    2  
ATOM   6204  H  HA   . ASN A 1 191 ? -7.987  20.321  -2.490  1.00 0.00 ? 191 ASN A HA   2  
ATOM   6205  H  HB2  . ASN A 1 191 ? -10.170 20.221  -1.810  1.00 0.00 ? 191 ASN A HB2  2  
ATOM   6206  H  HB3  . ASN A 1 191 ? -9.912  21.373  -0.514  1.00 0.00 ? 191 ASN A HB3  2  
ATOM   6207  H  HD21 . ASN A 1 191 ? -11.890 22.482  -1.311  1.00 0.00 ? 191 ASN A HD21 2  
ATOM   6208  H  HD22 . ASN A 1 191 ? -11.788 23.484  -2.676  1.00 0.00 ? 191 ASN A HD22 2  
ATOM   6209  N  N    . GLN A 1 192 ? -6.349  22.293  -2.628  1.00 0.00 ? 192 GLN A N    2  
ATOM   6210  C  CA   . GLN A 1 192 ? -5.619  23.487  -3.001  1.00 0.00 ? 192 GLN A CA   2  
ATOM   6211  C  C    . GLN A 1 192 ? -6.294  24.184  -4.181  1.00 0.00 ? 192 GLN A C    2  
ATOM   6212  O  O    . GLN A 1 192 ? -6.142  23.769  -5.331  1.00 0.00 ? 192 GLN A O    2  
ATOM   6213  C  CB   . GLN A 1 192 ? -4.187  23.083  -3.368  1.00 0.00 ? 192 GLN A CB   2  
ATOM   6214  C  CG   . GLN A 1 192 ? -3.202  24.163  -2.918  1.00 0.00 ? 192 GLN A CG   2  
ATOM   6215  C  CD   . GLN A 1 192 ? -1.974  24.165  -3.823  1.00 0.00 ? 192 GLN A CD   2  
ATOM   6216  O  OE1  . GLN A 1 192 ? -1.748  25.122  -4.563  1.00 0.00 ? 192 GLN A OE1  2  
ATOM   6217  N  NE2  . GLN A 1 192 ? -1.163  23.143  -3.806  1.00 0.00 ? 192 GLN A NE2  2  
ATOM   6218  H  H    . GLN A 1 192 ? -5.944  21.419  -2.799  1.00 0.00 ? 192 GLN A H    2  
ATOM   6219  H  HA   . GLN A 1 192 ? -5.593  24.161  -2.159  1.00 0.00 ? 192 GLN A HA   2  
ATOM   6220  H  HB2  . GLN A 1 192 ? -3.946  22.154  -2.871  1.00 0.00 ? 192 GLN A HB2  2  
ATOM   6221  H  HB3  . GLN A 1 192 ? -4.114  22.945  -4.434  1.00 0.00 ? 192 GLN A HB3  2  
ATOM   6222  H  HG2  . GLN A 1 192 ? -3.684  25.127  -2.961  1.00 0.00 ? 192 GLN A HG2  2  
ATOM   6223  H  HG3  . GLN A 1 192 ? -2.896  23.959  -1.901  1.00 0.00 ? 192 GLN A HG3  2  
ATOM   6224  H  HE21 . GLN A 1 192 ? -1.345  22.383  -3.215  1.00 0.00 ? 192 GLN A HE21 2  
ATOM   6225  H  HE22 . GLN A 1 192 ? -0.372  23.136  -4.385  1.00 0.00 ? 192 GLN A HE22 2  
ATOM   6226  N  N    . GLU A 1 193 ? -7.041  25.243  -3.887  1.00 0.00 ? 193 GLU A N    2  
ATOM   6227  C  CA   . GLU A 1 193 ? -7.740  25.992  -4.925  1.00 0.00 ? 193 GLU A CA   2  
ATOM   6228  C  C    . GLU A 1 193 ? -6.803  26.316  -6.084  1.00 0.00 ? 193 GLU A C    2  
ATOM   6229  O  O    . GLU A 1 193 ? -5.651  25.886  -6.104  1.00 0.00 ? 193 GLU A O    2  
ATOM   6230  C  CB   . GLU A 1 193 ? -8.297  27.294  -4.343  1.00 0.00 ? 193 GLU A CB   2  
ATOM   6231  C  CG   . GLU A 1 193 ? -9.607  27.011  -3.606  1.00 0.00 ? 193 GLU A CG   2  
ATOM   6232  C  CD   . GLU A 1 193 ? -10.276 28.323  -3.210  1.00 0.00 ? 193 GLU A CD   2  
ATOM   6233  O  OE1  . GLU A 1 193 ? -9.951  28.835  -2.151  1.00 0.00 ? 193 GLU A OE1  2  
ATOM   6234  O  OE2  . GLU A 1 193 ? -11.103 28.797  -3.972  1.00 0.00 ? 193 GLU A OE2  2  
ATOM   6235  H  H    . GLU A 1 193 ? -7.127  25.524  -2.952  1.00 0.00 ? 193 GLU A H    2  
ATOM   6236  H  HA   . GLU A 1 193 ? -8.559  25.396  -5.296  1.00 0.00 ? 193 GLU A HA   2  
ATOM   6237  H  HB2  . GLU A 1 193 ? -7.579  27.715  -3.654  1.00 0.00 ? 193 GLU A HB2  2  
ATOM   6238  H  HB3  . GLU A 1 193 ? -8.483  27.995  -5.144  1.00 0.00 ? 193 GLU A HB3  2  
ATOM   6239  H  HG2  . GLU A 1 193 ? -10.270 26.453  -4.251  1.00 0.00 ? 193 GLU A HG2  2  
ATOM   6240  H  HG3  . GLU A 1 193 ? -9.400  26.434  -2.716  1.00 0.00 ? 193 GLU A HG3  2  
ATOM   6241  N  N    . ASN A 1 194 ? -7.310  27.079  -7.046  1.00 0.00 ? 194 ASN A N    2  
ATOM   6242  C  CA   . ASN A 1 194 ? -6.514  27.459  -8.206  1.00 0.00 ? 194 ASN A CA   2  
ATOM   6243  C  C    . ASN A 1 194 ? -5.097  27.839  -7.788  1.00 0.00 ? 194 ASN A C    2  
ATOM   6244  O  O    . ASN A 1 194 ? -4.178  27.136  -8.175  1.00 0.00 ? 194 ASN A O    2  
ATOM   6245  C  CB   . ASN A 1 194 ? -7.168  28.632  -8.926  1.00 0.00 ? 194 ASN A CB   2  
ATOM   6246  C  CG   . ASN A 1 194 ? -6.212  29.209  -9.966  1.00 0.00 ? 194 ASN A CG   2  
ATOM   6247  O  OD1  . ASN A 1 194 ? -5.485  28.465  -10.622 1.00 0.00 ? 194 ASN A OD1  2  
ATOM   6248  N  ND2  . ASN A 1 194 ? -6.171  30.500  -10.154 1.00 0.00 ? 194 ASN A ND2  2  
ATOM   6249  O  OXT  . ASN A 1 194 ? -4.953  28.826  -7.085  1.00 0.00 ? 194 ASN A OXT  2  
ATOM   6250  H  H    . ASN A 1 194 ? -8.236  27.393  -6.974  1.00 0.00 ? 194 ASN A H    2  
ATOM   6251  H  HA   . ASN A 1 194 ? -6.468  26.629  -8.883  1.00 0.00 ? 194 ASN A HA   2  
ATOM   6252  H  HB2  . ASN A 1 194 ? -8.070  28.295  -9.415  1.00 0.00 ? 194 ASN A HB2  2  
ATOM   6253  H  HB3  . ASN A 1 194 ? -7.413  29.388  -8.208  1.00 0.00 ? 194 ASN A HB3  2  
ATOM   6254  H  HD21 . ASN A 1 194 ? -6.750  31.091  -9.631  1.00 0.00 ? 194 ASN A HD21 2  
ATOM   6255  H  HD22 . ASN A 1 194 ? -5.558  30.878  -10.821 1.00 0.00 ? 194 ASN A HD22 2  
HETATM 6256  ZN ZN   . ZN  B 2 .   ? -4.179  3.070   -7.929  1.00 0.00 ? 250 ZN  A ZN   2  
ATOM   6257  N  N    . HIS A 1 1   ? 20.549  -24.359 2.300   1.00 0.00 ? 1   HIS A N    3  
ATOM   6258  C  CA   . HIS A 1 1   ? 19.550  -23.665 3.161   1.00 0.00 ? 1   HIS A CA   3  
ATOM   6259  C  C    . HIS A 1 1   ? 20.252  -23.099 4.392   1.00 0.00 ? 1   HIS A C    3  
ATOM   6260  O  O    . HIS A 1 1   ? 19.610  -22.535 5.279   1.00 0.00 ? 1   HIS A O    3  
ATOM   6261  C  CB   . HIS A 1 1   ? 18.468  -24.658 3.586   1.00 0.00 ? 1   HIS A CB   3  
ATOM   6262  C  CG   . HIS A 1 1   ? 19.094  -25.776 4.374   1.00 0.00 ? 1   HIS A CG   3  
ATOM   6263  N  ND1  . HIS A 1 1   ? 19.561  -25.598 5.667   1.00 0.00 ? 1   HIS A ND1  3  
ATOM   6264  C  CD2  . HIS A 1 1   ? 19.337  -27.093 4.066   1.00 0.00 ? 1   HIS A CD2  3  
ATOM   6265  C  CE1  . HIS A 1 1   ? 20.057  -26.777 6.085   1.00 0.00 ? 1   HIS A CE1  3  
ATOM   6266  N  NE2  . HIS A 1 1   ? 19.945  -27.722 5.148   1.00 0.00 ? 1   HIS A NE2  3  
ATOM   6267  H  H1   . HIS A 1 1   ? 21.093  -25.033 2.874   1.00 0.00 ? 1   HIS A H1   3  
ATOM   6268  H  H2   . HIS A 1 1   ? 21.194  -23.657 1.882   1.00 0.00 ? 1   HIS A H2   3  
ATOM   6269  H  H3   . HIS A 1 1   ? 20.056  -24.872 1.542   1.00 0.00 ? 1   HIS A H3   3  
ATOM   6270  H  HA   . HIS A 1 1   ? 19.098  -22.857 2.605   1.00 0.00 ? 1   HIS A HA   3  
ATOM   6271  H  HB2  . HIS A 1 1   ? 17.735  -24.154 4.198   1.00 0.00 ? 1   HIS A HB2  3  
ATOM   6272  H  HB3  . HIS A 1 1   ? 17.987  -25.064 2.708   1.00 0.00 ? 1   HIS A HB3  3  
ATOM   6273  H  HD1  . HIS A 1 1   ? 19.535  -24.765 6.182   1.00 0.00 ? 1   HIS A HD1  3  
ATOM   6274  H  HD2  . HIS A 1 1   ? 19.094  -27.566 3.126   1.00 0.00 ? 1   HIS A HD2  3  
ATOM   6275  H  HE1  . HIS A 1 1   ? 20.492  -26.939 7.060   1.00 0.00 ? 1   HIS A HE1  3  
ATOM   6276  H  HE2  . HIS A 1 1   ? 20.230  -28.657 5.209   1.00 0.00 ? 1   HIS A HE2  3  
ATOM   6277  N  N    . MET A 1 2   ? 21.570  -23.254 4.440   1.00 0.00 ? 2   MET A N    3  
ATOM   6278  C  CA   . MET A 1 2   ? 22.348  -22.755 5.568   1.00 0.00 ? 2   MET A CA   3  
ATOM   6279  C  C    . MET A 1 2   ? 22.457  -21.235 5.512   1.00 0.00 ? 2   MET A C    3  
ATOM   6280  O  O    . MET A 1 2   ? 22.544  -20.570 6.544   1.00 0.00 ? 2   MET A O    3  
ATOM   6281  C  CB   . MET A 1 2   ? 23.749  -23.370 5.551   1.00 0.00 ? 2   MET A CB   3  
ATOM   6282  C  CG   . MET A 1 2   ? 24.622  -22.683 6.602   1.00 0.00 ? 2   MET A CG   3  
ATOM   6283  S  SD   . MET A 1 2   ? 26.122  -23.661 6.874   1.00 0.00 ? 2   MET A SD   3  
ATOM   6284  C  CE   . MET A 1 2   ? 27.044  -22.411 7.802   1.00 0.00 ? 2   MET A CE   3  
ATOM   6285  H  H    . MET A 1 2   ? 22.029  -23.712 3.705   1.00 0.00 ? 2   MET A H    3  
ATOM   6286  H  HA   . MET A 1 2   ? 21.855  -23.037 6.486   1.00 0.00 ? 2   MET A HA   3  
ATOM   6287  H  HB2  . MET A 1 2   ? 23.681  -24.426 5.772   1.00 0.00 ? 2   MET A HB2  3  
ATOM   6288  H  HB3  . MET A 1 2   ? 24.190  -23.235 4.575   1.00 0.00 ? 2   MET A HB3  3  
ATOM   6289  H  HG2  . MET A 1 2   ? 24.894  -21.696 6.255   1.00 0.00 ? 2   MET A HG2  3  
ATOM   6290  H  HG3  . MET A 1 2   ? 24.074  -22.600 7.528   1.00 0.00 ? 2   MET A HG3  3  
ATOM   6291  H  HE1  . MET A 1 2   ? 28.097  -22.654 7.782   1.00 0.00 ? 2   MET A HE1  3  
ATOM   6292  H  HE2  . MET A 1 2   ? 26.692  -22.392 8.824   1.00 0.00 ? 2   MET A HE2  3  
ATOM   6293  H  HE3  . MET A 1 2   ? 26.891  -21.443 7.354   1.00 0.00 ? 2   MET A HE3  3  
ATOM   6294  N  N    . LEU A 1 3   ? 22.449  -20.691 4.299   1.00 0.00 ? 3   LEU A N    3  
ATOM   6295  C  CA   . LEU A 1 3   ? 22.547  -19.248 4.119   1.00 0.00 ? 3   LEU A CA   3  
ATOM   6296  C  C    . LEU A 1 3   ? 21.181  -18.594 4.301   1.00 0.00 ? 3   LEU A C    3  
ATOM   6297  O  O    . LEU A 1 3   ? 20.567  -18.138 3.337   1.00 0.00 ? 3   LEU A O    3  
ATOM   6298  C  CB   . LEU A 1 3   ? 23.090  -18.929 2.720   1.00 0.00 ? 3   LEU A CB   3  
ATOM   6299  C  CG   . LEU A 1 3   ? 22.588  -19.979 1.720   1.00 0.00 ? 3   LEU A CG   3  
ATOM   6300  C  CD1  . LEU A 1 3   ? 22.480  -19.352 0.327   1.00 0.00 ? 3   LEU A CD1  3  
ATOM   6301  C  CD2  . LEU A 1 3   ? 23.570  -21.155 1.671   1.00 0.00 ? 3   LEU A CD2  3  
ATOM   6302  H  H    . LEU A 1 3   ? 22.378  -21.271 3.513   1.00 0.00 ? 3   LEU A H    3  
ATOM   6303  H  HA   . LEU A 1 3   ? 23.228  -18.848 4.855   1.00 0.00 ? 3   LEU A HA   3  
ATOM   6304  H  HB2  . LEU A 1 3   ? 22.749  -17.949 2.419   1.00 0.00 ? 3   LEU A HB2  3  
ATOM   6305  H  HB3  . LEU A 1 3   ? 24.169  -18.943 2.743   1.00 0.00 ? 3   LEU A HB3  3  
ATOM   6306  H  HG   . LEU A 1 3   ? 21.614  -20.334 2.027   1.00 0.00 ? 3   LEU A HG   3  
ATOM   6307  H  HD11 . LEU A 1 3   ? 23.371  -18.778 0.121   1.00 0.00 ? 3   LEU A HD11 3  
ATOM   6308  H  HD12 . LEU A 1 3   ? 21.618  -18.702 0.291   1.00 0.00 ? 3   LEU A HD12 3  
ATOM   6309  H  HD13 . LEU A 1 3   ? 22.374  -20.132 -0.412  1.00 0.00 ? 3   LEU A HD13 3  
ATOM   6310  H  HD21 . LEU A 1 3   ? 23.045  -22.049 1.365   1.00 0.00 ? 3   LEU A HD21 3  
ATOM   6311  H  HD22 . LEU A 1 3   ? 23.999  -21.308 2.649   1.00 0.00 ? 3   LEU A HD22 3  
ATOM   6312  H  HD23 . LEU A 1 3   ? 24.357  -20.940 0.963   1.00 0.00 ? 3   LEU A HD23 3  
ATOM   6313  N  N    . ARG A 1 4   ? 20.710  -18.554 5.544   1.00 0.00 ? 4   ARG A N    3  
ATOM   6314  C  CA   . ARG A 1 4   ? 19.414  -17.955 5.839   1.00 0.00 ? 4   ARG A CA   3  
ATOM   6315  C  C    . ARG A 1 4   ? 18.346  -18.503 4.897   1.00 0.00 ? 4   ARG A C    3  
ATOM   6316  O  O    . ARG A 1 4   ? 18.595  -19.447 4.146   1.00 0.00 ? 4   ARG A O    3  
ATOM   6317  C  CB   . ARG A 1 4   ? 19.496  -16.434 5.690   1.00 0.00 ? 4   ARG A CB   3  
ATOM   6318  C  CG   . ARG A 1 4   ? 20.711  -15.909 6.460   1.00 0.00 ? 4   ARG A CG   3  
ATOM   6319  C  CD   . ARG A 1 4   ? 20.813  -14.393 6.279   1.00 0.00 ? 4   ARG A CD   3  
ATOM   6320  N  NE   . ARG A 1 4   ? 22.074  -13.903 6.826   1.00 0.00 ? 4   ARG A NE   3  
ATOM   6321  C  CZ   . ARG A 1 4   ? 23.217  -14.068 6.170   1.00 0.00 ? 4   ARG A CZ   3  
ATOM   6322  N  NH1  . ARG A 1 4   ? 23.227  -14.682 5.019   1.00 0.00 ? 4   ARG A NH1  3  
ATOM   6323  N  NH2  . ARG A 1 4   ? 24.332  -13.616 6.678   1.00 0.00 ? 4   ARG A NH2  3  
ATOM   6324  H  H    . ARG A 1 4   ? 21.242  -18.934 6.273   1.00 0.00 ? 4   ARG A H    3  
ATOM   6325  H  HA   . ARG A 1 4   ? 19.141  -18.192 6.856   1.00 0.00 ? 4   ARG A HA   3  
ATOM   6326  H  HB2  . ARG A 1 4   ? 19.593  -16.179 4.645   1.00 0.00 ? 4   ARG A HB2  3  
ATOM   6327  H  HB3  . ARG A 1 4   ? 18.599  -15.984 6.088   1.00 0.00 ? 4   ARG A HB3  3  
ATOM   6328  H  HG2  . ARG A 1 4   ? 20.600  -16.141 7.509   1.00 0.00 ? 4   ARG A HG2  3  
ATOM   6329  H  HG3  . ARG A 1 4   ? 21.607  -16.376 6.079   1.00 0.00 ? 4   ARG A HG3  3  
ATOM   6330  H  HD2  . ARG A 1 4   ? 20.765  -14.154 5.228   1.00 0.00 ? 4   ARG A HD2  3  
ATOM   6331  H  HD3  . ARG A 1 4   ? 19.989  -13.917 6.791   1.00 0.00 ? 4   ARG A HD3  3  
ATOM   6332  H  HE   . ARG A 1 4   ? 22.076  -13.442 7.691   1.00 0.00 ? 4   ARG A HE   3  
ATOM   6333  H  HH11 . ARG A 1 4   ? 22.373  -15.029 4.631   1.00 0.00 ? 4   ARG A HH11 3  
ATOM   6334  H  HH12 . ARG A 1 4   ? 24.088  -14.806 4.526   1.00 0.00 ? 4   ARG A HH12 3  
ATOM   6335  H  HH21 . ARG A 1 4   ? 24.325  -13.146 7.561   1.00 0.00 ? 4   ARG A HH21 3  
ATOM   6336  H  HH22 . ARG A 1 4   ? 25.193  -13.741 6.185   1.00 0.00 ? 4   ARG A HH22 3  
ATOM   6337  N  N    . HIS A 1 5   ? 17.160  -17.906 4.942   1.00 0.00 ? 5   HIS A N    3  
ATOM   6338  C  CA   . HIS A 1 5   ? 16.063  -18.344 4.085   1.00 0.00 ? 5   HIS A CA   3  
ATOM   6339  C  C    . HIS A 1 5   ? 15.210  -17.154 3.660   1.00 0.00 ? 5   HIS A C    3  
ATOM   6340  O  O    . HIS A 1 5   ? 14.461  -17.230 2.686   1.00 0.00 ? 5   HIS A O    3  
ATOM   6341  C  CB   . HIS A 1 5   ? 15.192  -19.360 4.825   1.00 0.00 ? 5   HIS A CB   3  
ATOM   6342  C  CG   . HIS A 1 5   ? 14.928  -18.873 6.223   1.00 0.00 ? 5   HIS A CG   3  
ATOM   6343  N  ND1  . HIS A 1 5   ? 13.908  -17.982 6.516   1.00 0.00 ? 5   HIS A ND1  3  
ATOM   6344  C  CD2  . HIS A 1 5   ? 15.544  -19.143 7.420   1.00 0.00 ? 5   HIS A CD2  3  
ATOM   6345  C  CE1  . HIS A 1 5   ? 13.940  -17.749 7.840   1.00 0.00 ? 5   HIS A CE1  3  
ATOM   6346  N  NE2  . HIS A 1 5   ? 14.918  -18.433 8.440   1.00 0.00 ? 5   HIS A NE2  3  
ATOM   6347  H  H    . HIS A 1 5   ? 17.020  -17.158 5.559   1.00 0.00 ? 5   HIS A H    3  
ATOM   6348  H  HA   . HIS A 1 5   ? 16.473  -18.814 3.203   1.00 0.00 ? 5   HIS A HA   3  
ATOM   6349  H  HB2  . HIS A 1 5   ? 14.254  -19.478 4.302   1.00 0.00 ? 5   HIS A HB2  3  
ATOM   6350  H  HB3  . HIS A 1 5   ? 15.703  -20.311 4.866   1.00 0.00 ? 5   HIS A HB3  3  
ATOM   6351  H  HD1  . HIS A 1 5   ? 13.277  -17.592 5.875   1.00 0.00 ? 5   HIS A HD1  3  
ATOM   6352  H  HD2  . HIS A 1 5   ? 16.386  -19.808 7.550   1.00 0.00 ? 5   HIS A HD2  3  
ATOM   6353  H  HE1  . HIS A 1 5   ? 13.257  -17.091 8.358   1.00 0.00 ? 5   HIS A HE1  3  
ATOM   6354  H  HE2  . HIS A 1 5   ? 15.146  -18.434 9.393   1.00 0.00 ? 5   HIS A HE2  3  
ATOM   6355  N  N    . SER A 1 6   ? 15.329  -16.054 4.397   1.00 0.00 ? 6   SER A N    3  
ATOM   6356  C  CA   . SER A 1 6   ? 14.564  -14.853 4.087   1.00 0.00 ? 6   SER A CA   3  
ATOM   6357  C  C    . SER A 1 6   ? 14.715  -14.489 2.615   1.00 0.00 ? 6   SER A C    3  
ATOM   6358  O  O    . SER A 1 6   ? 14.077  -15.087 1.749   1.00 0.00 ? 6   SER A O    3  
ATOM   6359  C  CB   . SER A 1 6   ? 15.044  -13.689 4.954   1.00 0.00 ? 6   SER A CB   3  
ATOM   6360  O  OG   . SER A 1 6   ? 14.658  -12.463 4.349   1.00 0.00 ? 6   SER A OG   3  
ATOM   6361  H  H    . SER A 1 6   ? 15.942  -16.051 5.161   1.00 0.00 ? 6   SER A H    3  
ATOM   6362  H  HA   . SER A 1 6   ? 13.521  -15.037 4.298   1.00 0.00 ? 6   SER A HA   3  
ATOM   6363  H  HB2  . SER A 1 6   ? 14.598  -13.757 5.933   1.00 0.00 ? 6   SER A HB2  3  
ATOM   6364  H  HB3  . SER A 1 6   ? 16.123  -13.733 5.048   1.00 0.00 ? 6   SER A HB3  3  
ATOM   6365  H  HG   . SER A 1 6   ? 13.832  -12.609 3.882   1.00 0.00 ? 6   SER A HG   3  
ATOM   6366  N  N    . MET A 1 7   ? 15.564  -13.504 2.336   1.00 0.00 ? 7   MET A N    3  
ATOM   6367  C  CA   . MET A 1 7   ? 15.791  -13.071 0.963   1.00 0.00 ? 7   MET A CA   3  
ATOM   6368  C  C    . MET A 1 7   ? 16.858  -11.981 0.910   1.00 0.00 ? 7   MET A C    3  
ATOM   6369  O  O    . MET A 1 7   ? 16.732  -10.943 1.556   1.00 0.00 ? 7   MET A O    3  
ATOM   6370  C  CB   . MET A 1 7   ? 14.488  -12.544 0.353   1.00 0.00 ? 7   MET A CB   3  
ATOM   6371  C  CG   . MET A 1 7   ? 13.899  -11.444 1.240   1.00 0.00 ? 7   MET A CG   3  
ATOM   6372  S  SD   . MET A 1 7   ? 14.512  -9.833  0.692   1.00 0.00 ? 7   MET A SD   3  
ATOM   6373  C  CE   . MET A 1 7   ? 14.712  -9.107  2.336   1.00 0.00 ? 7   MET A CE   3  
ATOM   6374  H  H    . MET A 1 7   ? 16.046  -13.063 3.067   1.00 0.00 ? 7   MET A H    3  
ATOM   6375  H  HA   . MET A 1 7   ? 16.129  -13.916 0.381   1.00 0.00 ? 7   MET A HA   3  
ATOM   6376  H  HB2  . MET A 1 7   ? 14.689  -12.143 -0.630  1.00 0.00 ? 7   MET A HB2  3  
ATOM   6377  H  HB3  . MET A 1 7   ? 13.780  -13.352 0.272   1.00 0.00 ? 7   MET A HB3  3  
ATOM   6378  H  HG2  . MET A 1 7   ? 12.821  -11.463 1.163   1.00 0.00 ? 7   MET A HG2  3  
ATOM   6379  H  HG3  . MET A 1 7   ? 14.187  -11.610 2.266   1.00 0.00 ? 7   MET A HG3  3  
ATOM   6380  H  HE1  . MET A 1 7   ? 15.333  -9.754  2.940   1.00 0.00 ? 7   MET A HE1  3  
ATOM   6381  H  HE2  . MET A 1 7   ? 13.742  -8.996  2.798   1.00 0.00 ? 7   MET A HE2  3  
ATOM   6382  H  HE3  . MET A 1 7   ? 15.181  -8.141  2.248   1.00 0.00 ? 7   MET A HE3  3  
ATOM   6383  N  N    . ASP A 1 8   ? 17.909  -12.227 0.132   1.00 0.00 ? 8   ASP A N    3  
ATOM   6384  C  CA   . ASP A 1 8   ? 18.990  -11.257 -0.003  1.00 0.00 ? 8   ASP A CA   3  
ATOM   6385  C  C    . ASP A 1 8   ? 20.166  -11.862 -0.783  1.00 0.00 ? 8   ASP A C    3  
ATOM   6386  O  O    . ASP A 1 8   ? 20.684  -11.240 -1.707  1.00 0.00 ? 8   ASP A O    3  
ATOM   6387  C  CB   . ASP A 1 8   ? 19.428  -10.759 1.396   1.00 0.00 ? 8   ASP A CB   3  
ATOM   6388  C  CG   . ASP A 1 8   ? 20.951  -10.770 1.552   1.00 0.00 ? 8   ASP A CG   3  
ATOM   6389  O  OD1  . ASP A 1 8   ? 21.593  -9.915  0.963   1.00 0.00 ? 8   ASP A OD1  3  
ATOM   6390  O  OD2  . ASP A 1 8   ? 21.449  -11.632 2.257   1.00 0.00 ? 8   ASP A OD2  3  
ATOM   6391  H  H    . ASP A 1 8   ? 17.955  -13.071 -0.362  1.00 0.00 ? 8   ASP A H    3  
ATOM   6392  H  HA   . ASP A 1 8   ? 18.615  -10.413 -0.564  1.00 0.00 ? 8   ASP A HA   3  
ATOM   6393  H  HB2  . ASP A 1 8   ? 19.073  -9.748  1.540   1.00 0.00 ? 8   ASP A HB2  3  
ATOM   6394  H  HB3  . ASP A 1 8   ? 18.989  -11.390 2.153   1.00 0.00 ? 8   ASP A HB3  3  
ATOM   6395  N  N    . PRO A 1 9   ? 20.595  -13.048 -0.430  1.00 0.00 ? 9   PRO A N    3  
ATOM   6396  C  CA   . PRO A 1 9   ? 21.735  -13.717 -1.124  1.00 0.00 ? 9   PRO A CA   3  
ATOM   6397  C  C    . PRO A 1 9   ? 21.518  -13.882 -2.637  1.00 0.00 ? 9   PRO A C    3  
ATOM   6398  O  O    . PRO A 1 9   ? 22.438  -13.645 -3.420  1.00 0.00 ? 9   PRO A O    3  
ATOM   6399  C  CB   . PRO A 1 9   ? 21.879  -15.083 -0.433  1.00 0.00 ? 9   PRO A CB   3  
ATOM   6400  C  CG   . PRO A 1 9   ? 21.042  -15.027 0.812   1.00 0.00 ? 9   PRO A CG   3  
ATOM   6401  C  CD   . PRO A 1 9   ? 20.053  -13.867 0.665   1.00 0.00 ? 9   PRO A CD   3  
ATOM   6402  H  HA   . PRO A 1 9   ? 22.636  -13.147 -0.957  1.00 0.00 ? 9   PRO A HA   3  
ATOM   6403  H  HB2  . PRO A 1 9   ? 21.533  -15.873 -1.085  1.00 0.00 ? 9   PRO A HB2  3  
ATOM   6404  H  HB3  . PRO A 1 9   ? 22.912  -15.256 -0.171  1.00 0.00 ? 9   PRO A HB3  3  
ATOM   6405  H  HG2  . PRO A 1 9   ? 20.503  -15.957 0.934   1.00 0.00 ? 9   PRO A HG2  3  
ATOM   6406  H  HG3  . PRO A 1 9   ? 21.673  -14.855 1.672   1.00 0.00 ? 9   PRO A HG3  3  
ATOM   6407  H  HD2  . PRO A 1 9   ? 19.069  -14.239 0.420   1.00 0.00 ? 9   PRO A HD2  3  
ATOM   6408  H  HD3  . PRO A 1 9   ? 20.020  -13.292 1.575   1.00 0.00 ? 9   PRO A HD3  3  
ATOM   6409  N  N    . PRO A 1 10  ? 20.346  -14.291 -3.069  1.00 0.00 ? 10  PRO A N    3  
ATOM   6410  C  CA   . PRO A 1 10  ? 20.057  -14.495 -4.517  1.00 0.00 ? 10  PRO A CA   3  
ATOM   6411  C  C    . PRO A 1 10  ? 19.660  -13.208 -5.241  1.00 0.00 ? 10  PRO A C    3  
ATOM   6412  O  O    . PRO A 1 10  ? 20.105  -12.956 -6.361  1.00 0.00 ? 10  PRO A O    3  
ATOM   6413  C  CB   . PRO A 1 10  ? 18.893  -15.481 -4.496  1.00 0.00 ? 10  PRO A CB   3  
ATOM   6414  C  CG   . PRO A 1 10  ? 18.149  -15.177 -3.238  1.00 0.00 ? 10  PRO A CG   3  
ATOM   6415  C  CD   . PRO A 1 10  ? 19.168  -14.609 -2.241  1.00 0.00 ? 10  PRO A CD   3  
ATOM   6416  H  HA   . PRO A 1 10  ? 20.901  -14.952 -5.005  1.00 0.00 ? 10  PRO A HA   3  
ATOM   6417  H  HB2  . PRO A 1 10  ? 18.258  -15.329 -5.358  1.00 0.00 ? 10  PRO A HB2  3  
ATOM   6418  H  HB3  . PRO A 1 10  ? 19.260  -16.495 -4.472  1.00 0.00 ? 10  PRO A HB3  3  
ATOM   6419  H  HG2  . PRO A 1 10  ? 17.374  -14.448 -3.436  1.00 0.00 ? 10  PRO A HG2  3  
ATOM   6420  H  HG3  . PRO A 1 10  ? 17.715  -16.080 -2.838  1.00 0.00 ? 10  PRO A HG3  3  
ATOM   6421  H  HD2  . PRO A 1 10  ? 18.775  -13.718 -1.776  1.00 0.00 ? 10  PRO A HD2  3  
ATOM   6422  H  HD3  . PRO A 1 10  ? 19.416  -15.349 -1.502  1.00 0.00 ? 10  PRO A HD3  3  
ATOM   6423  N  N    . THR A 1 11  ? 18.815  -12.403 -4.605  1.00 0.00 ? 11  THR A N    3  
ATOM   6424  C  CA   . THR A 1 11  ? 18.362  -11.157 -5.212  1.00 0.00 ? 11  THR A CA   3  
ATOM   6425  C  C    . THR A 1 11  ? 19.544  -10.236 -5.483  1.00 0.00 ? 11  THR A C    3  
ATOM   6426  O  O    . THR A 1 11  ? 19.597  -9.557  -6.509  1.00 0.00 ? 11  THR A O    3  
ATOM   6427  C  CB   . THR A 1 11  ? 17.356  -10.456 -4.289  1.00 0.00 ? 11  THR A CB   3  
ATOM   6428  O  OG1  . THR A 1 11  ? 16.596  -9.525  -5.045  1.00 0.00 ? 11  THR A OG1  3  
ATOM   6429  C  CG2  . THR A 1 11  ? 18.100  -9.720  -3.171  1.00 0.00 ? 11  THR A CG2  3  
ATOM   6430  H  H    . THR A 1 11  ? 18.489  -12.653 -3.719  1.00 0.00 ? 11  THR A H    3  
ATOM   6431  H  HA   . THR A 1 11  ? 17.876  -11.386 -6.144  1.00 0.00 ? 11  THR A HA   3  
ATOM   6432  H  HB   . THR A 1 11  ? 16.696  -11.190 -3.853  1.00 0.00 ? 11  THR A HB   3  
ATOM   6433  H  HG1  . THR A 1 11  ? 16.271  -9.973  -5.829  1.00 0.00 ? 11  THR A HG1  3  
ATOM   6434  H  HG21 . THR A 1 11  ? 17.420  -9.521  -2.355  1.00 0.00 ? 11  THR A HG21 3  
ATOM   6435  H  HG22 . THR A 1 11  ? 18.488  -8.787  -3.551  1.00 0.00 ? 11  THR A HG22 3  
ATOM   6436  H  HG23 . THR A 1 11  ? 18.915  -10.332 -2.820  1.00 0.00 ? 11  THR A HG23 3  
ATOM   6437  N  N    . PHE A 1 12  ? 20.487  -10.223 -4.554  1.00 0.00 ? 12  PHE A N    3  
ATOM   6438  C  CA   . PHE A 1 12  ? 21.671  -9.389  -4.684  1.00 0.00 ? 12  PHE A CA   3  
ATOM   6439  C  C    . PHE A 1 12  ? 22.122  -9.307  -6.139  1.00 0.00 ? 12  PHE A C    3  
ATOM   6440  O  O    . PHE A 1 12  ? 22.137  -8.230  -6.733  1.00 0.00 ? 12  PHE A O    3  
ATOM   6441  C  CB   . PHE A 1 12  ? 22.794  -9.970  -3.828  1.00 0.00 ? 12  PHE A CB   3  
ATOM   6442  C  CG   . PHE A 1 12  ? 23.848  -8.916  -3.594  1.00 0.00 ? 12  PHE A CG   3  
ATOM   6443  C  CD1  . PHE A 1 12  ? 24.690  -8.523  -4.640  1.00 0.00 ? 12  PHE A CD1  3  
ATOM   6444  C  CD2  . PHE A 1 12  ? 23.980  -8.332  -2.329  1.00 0.00 ? 12  PHE A CD2  3  
ATOM   6445  C  CE1  . PHE A 1 12  ? 25.667  -7.545  -4.421  1.00 0.00 ? 12  PHE A CE1  3  
ATOM   6446  C  CE2  . PHE A 1 12  ? 24.957  -7.354  -2.109  1.00 0.00 ? 12  PHE A CE2  3  
ATOM   6447  C  CZ   . PHE A 1 12  ? 25.801  -6.960  -3.154  1.00 0.00 ? 12  PHE A CZ   3  
ATOM   6448  H  H    . PHE A 1 12  ? 20.384  -10.788 -3.759  1.00 0.00 ? 12  PHE A H    3  
ATOM   6449  H  HA   . PHE A 1 12  ? 21.443  -8.396  -4.330  1.00 0.00 ? 12  PHE A HA   3  
ATOM   6450  H  HB2  . PHE A 1 12  ? 22.393  -10.291 -2.880  1.00 0.00 ? 12  PHE A HB2  3  
ATOM   6451  H  HB3  . PHE A 1 12  ? 23.232  -10.814 -4.336  1.00 0.00 ? 12  PHE A HB3  3  
ATOM   6452  H  HD1  . PHE A 1 12  ? 24.586  -8.973  -5.615  1.00 0.00 ? 12  PHE A HD1  3  
ATOM   6453  H  HD2  . PHE A 1 12  ? 23.328  -8.636  -1.522  1.00 0.00 ? 12  PHE A HD2  3  
ATOM   6454  H  HE1  . PHE A 1 12  ? 26.318  -7.240  -5.226  1.00 0.00 ? 12  PHE A HE1  3  
ATOM   6455  H  HE2  . PHE A 1 12  ? 25.061  -6.903  -1.133  1.00 0.00 ? 12  PHE A HE2  3  
ATOM   6456  H  HZ   . PHE A 1 12  ? 26.555  -6.206  -2.985  1.00 0.00 ? 12  PHE A HZ   3  
ATOM   6457  N  N    . THR A 1 13  ? 22.497  -10.450 -6.706  1.00 0.00 ? 13  THR A N    3  
ATOM   6458  C  CA   . THR A 1 13  ? 22.955  -10.492 -8.090  1.00 0.00 ? 13  THR A CA   3  
ATOM   6459  C  C    . THR A 1 13  ? 21.797  -10.778 -9.042  1.00 0.00 ? 13  THR A C    3  
ATOM   6460  O  O    . THR A 1 13  ? 21.542  -10.010 -9.970  1.00 0.00 ? 13  THR A O    3  
ATOM   6461  C  CB   . THR A 1 13  ? 24.024  -11.575 -8.250  1.00 0.00 ? 13  THR A CB   3  
ATOM   6462  O  OG1  . THR A 1 13  ? 23.671  -12.707 -7.467  1.00 0.00 ? 13  THR A OG1  3  
ATOM   6463  C  CG2  . THR A 1 13  ? 25.378  -11.034 -7.788  1.00 0.00 ? 13  THR A CG2  3  
ATOM   6464  H  H    . THR A 1 13  ? 22.471  -11.278 -6.184  1.00 0.00 ? 13  THR A H    3  
ATOM   6465  H  HA   . THR A 1 13  ? 23.388  -9.536  -8.344  1.00 0.00 ? 13  THR A HA   3  
ATOM   6466  H  HB   . THR A 1 13  ? 24.090  -11.862 -9.286  1.00 0.00 ? 13  THR A HB   3  
ATOM   6467  H  HG1  . THR A 1 13  ? 23.577  -13.458 -8.057  1.00 0.00 ? 13  THR A HG1  3  
ATOM   6468  H  HG21 . THR A 1 13  ? 25.345  -10.838 -6.727  1.00 0.00 ? 13  THR A HG21 3  
ATOM   6469  H  HG22 . THR A 1 13  ? 25.599  -10.118 -8.316  1.00 0.00 ? 13  THR A HG22 3  
ATOM   6470  H  HG23 . THR A 1 13  ? 26.147  -11.764 -7.996  1.00 0.00 ? 13  THR A HG23 3  
ATOM   6471  N  N    . PHE A 1 14  ? 21.106  -11.890 -8.811  1.00 0.00 ? 14  PHE A N    3  
ATOM   6472  C  CA   . PHE A 1 14  ? 19.981  -12.277 -9.657  1.00 0.00 ? 14  PHE A CA   3  
ATOM   6473  C  C    . PHE A 1 14  ? 19.226  -11.048 -10.156 1.00 0.00 ? 14  PHE A C    3  
ATOM   6474  O  O    . PHE A 1 14  ? 18.634  -11.069 -11.235 1.00 0.00 ? 14  PHE A O    3  
ATOM   6475  C  CB   . PHE A 1 14  ? 19.028  -13.183 -8.876  1.00 0.00 ? 14  PHE A CB   3  
ATOM   6476  C  CG   . PHE A 1 14  ? 17.999  -13.765 -9.817  1.00 0.00 ? 14  PHE A CG   3  
ATOM   6477  C  CD1  . PHE A 1 14  ? 18.393  -14.665 -10.815 1.00 0.00 ? 14  PHE A CD1  3  
ATOM   6478  C  CD2  . PHE A 1 14  ? 16.652  -13.403 -9.692  1.00 0.00 ? 14  PHE A CD2  3  
ATOM   6479  C  CE1  . PHE A 1 14  ? 17.438  -15.204 -11.687 1.00 0.00 ? 14  PHE A CE1  3  
ATOM   6480  C  CE2  . PHE A 1 14  ? 15.699  -13.943 -10.564 1.00 0.00 ? 14  PHE A CE2  3  
ATOM   6481  C  CZ   . PHE A 1 14  ? 16.092  -14.843 -11.562 1.00 0.00 ? 14  PHE A CZ   3  
ATOM   6482  H  H    . PHE A 1 14  ? 21.361  -12.465 -8.059  1.00 0.00 ? 14  PHE A H    3  
ATOM   6483  H  HA   . PHE A 1 14  ? 20.359  -12.823 -10.509 1.00 0.00 ? 14  PHE A HA   3  
ATOM   6484  H  HB2  . PHE A 1 14  ? 19.589  -13.984 -8.417  1.00 0.00 ? 14  PHE A HB2  3  
ATOM   6485  H  HB3  . PHE A 1 14  ? 18.530  -12.608 -8.111  1.00 0.00 ? 14  PHE A HB3  3  
ATOM   6486  H  HD1  . PHE A 1 14  ? 19.431  -14.944 -10.912 1.00 0.00 ? 14  PHE A HD1  3  
ATOM   6487  H  HD2  . PHE A 1 14  ? 16.350  -12.709 -8.923  1.00 0.00 ? 14  PHE A HD2  3  
ATOM   6488  H  HE1  . PHE A 1 14  ? 17.742  -15.899 -12.456 1.00 0.00 ? 14  PHE A HE1  3  
ATOM   6489  H  HE2  . PHE A 1 14  ? 14.660  -13.664 -10.468 1.00 0.00 ? 14  PHE A HE2  3  
ATOM   6490  H  HZ   . PHE A 1 14  ? 15.356  -15.258 -12.234 1.00 0.00 ? 14  PHE A HZ   3  
ATOM   6491  N  N    . ASN A 1 15  ? 19.254  -9.978  -9.365  1.00 0.00 ? 15  ASN A N    3  
ATOM   6492  C  CA   . ASN A 1 15  ? 18.568  -8.741  -9.736  1.00 0.00 ? 15  ASN A CA   3  
ATOM   6493  C  C    . ASN A 1 15  ? 19.567  -7.594  -9.856  1.00 0.00 ? 15  ASN A C    3  
ATOM   6494  O  O    . ASN A 1 15  ? 20.640  -7.751  -10.439 1.00 0.00 ? 15  ASN A O    3  
ATOM   6495  C  CB   . ASN A 1 15  ? 17.513  -8.393  -8.683  1.00 0.00 ? 15  ASN A CB   3  
ATOM   6496  C  CG   . ASN A 1 15  ? 16.539  -9.554  -8.518  1.00 0.00 ? 15  ASN A CG   3  
ATOM   6497  O  OD1  . ASN A 1 15  ? 15.931  -9.710  -7.458  1.00 0.00 ? 15  ASN A OD1  3  
ATOM   6498  N  ND2  . ASN A 1 15  ? 16.354  -10.384 -9.508  1.00 0.00 ? 15  ASN A ND2  3  
ATOM   6499  H  H    . ASN A 1 15  ? 19.743  -10.020 -8.518  1.00 0.00 ? 15  ASN A H    3  
ATOM   6500  H  HA   . ASN A 1 15  ? 18.077  -8.877  -10.689 1.00 0.00 ? 15  ASN A HA   3  
ATOM   6501  H  HB2  . ASN A 1 15  ? 18.000  -8.194  -7.740  1.00 0.00 ? 15  ASN A HB2  3  
ATOM   6502  H  HB3  . ASN A 1 15  ? 16.970  -7.514  -8.998  1.00 0.00 ? 15  ASN A HB3  3  
ATOM   6503  H  HD21 . ASN A 1 15  ? 16.840  -10.259 -10.349 1.00 0.00 ? 15  ASN A HD21 3  
ATOM   6504  H  HD22 . ASN A 1 15  ? 15.728  -11.131 -9.410  1.00 0.00 ? 15  ASN A HD22 3  
ATOM   6505  N  N    . PHE A 1 16  ? 19.207  -6.440  -9.299  1.00 0.00 ? 16  PHE A N    3  
ATOM   6506  C  CA   . PHE A 1 16  ? 20.079  -5.267  -9.348  1.00 0.00 ? 16  PHE A CA   3  
ATOM   6507  C  C    . PHE A 1 16  ? 20.319  -4.716  -7.945  1.00 0.00 ? 16  PHE A C    3  
ATOM   6508  O  O    . PHE A 1 16  ? 20.373  -3.502  -7.747  1.00 0.00 ? 16  PHE A O    3  
ATOM   6509  C  CB   . PHE A 1 16  ? 19.445  -4.184  -10.222 1.00 0.00 ? 16  PHE A CB   3  
ATOM   6510  C  CG   . PHE A 1 16  ? 19.206  -4.733  -11.610 1.00 0.00 ? 16  PHE A CG   3  
ATOM   6511  C  CD1  . PHE A 1 16  ? 20.237  -4.715  -12.557 1.00 0.00 ? 16  PHE A CD1  3  
ATOM   6512  C  CD2  . PHE A 1 16  ? 17.952  -5.258  -11.949 1.00 0.00 ? 16  PHE A CD2  3  
ATOM   6513  C  CE1  . PHE A 1 16  ? 20.014  -5.222  -13.843 1.00 0.00 ? 16  PHE A CE1  3  
ATOM   6514  C  CE2  . PHE A 1 16  ? 17.730  -5.764  -13.235 1.00 0.00 ? 16  PHE A CE2  3  
ATOM   6515  C  CZ   . PHE A 1 16  ? 18.761  -5.747  -14.181 1.00 0.00 ? 16  PHE A CZ   3  
ATOM   6516  H  H    . PHE A 1 16  ? 18.339  -6.374  -8.847  1.00 0.00 ? 16  PHE A H    3  
ATOM   6517  H  HA   . PHE A 1 16  ? 21.029  -5.549  -9.777  1.00 0.00 ? 16  PHE A HA   3  
ATOM   6518  H  HB2  . PHE A 1 16  ? 18.505  -3.876  -9.790  1.00 0.00 ? 16  PHE A HB2  3  
ATOM   6519  H  HB3  . PHE A 1 16  ? 20.110  -3.335  -10.282 1.00 0.00 ? 16  PHE A HB3  3  
ATOM   6520  H  HD1  . PHE A 1 16  ? 21.203  -4.311  -12.296 1.00 0.00 ? 16  PHE A HD1  3  
ATOM   6521  H  HD2  . PHE A 1 16  ? 17.157  -5.271  -11.218 1.00 0.00 ? 16  PHE A HD2  3  
ATOM   6522  H  HE1  . PHE A 1 16  ? 20.810  -5.208  -14.574 1.00 0.00 ? 16  PHE A HE1  3  
ATOM   6523  H  HE2  . PHE A 1 16  ? 16.764  -6.169  -13.497 1.00 0.00 ? 16  PHE A HE2  3  
ATOM   6524  H  HZ   . PHE A 1 16  ? 18.590  -6.138  -15.174 1.00 0.00 ? 16  PHE A HZ   3  
ATOM   6525  N  N    . ASN A 1 17  ? 20.462  -5.615  -6.976  1.00 0.00 ? 17  ASN A N    3  
ATOM   6526  C  CA   . ASN A 1 17  ? 20.696  -5.210  -5.593  1.00 0.00 ? 17  ASN A CA   3  
ATOM   6527  C  C    . ASN A 1 17  ? 19.440  -4.588  -4.997  1.00 0.00 ? 17  ASN A C    3  
ATOM   6528  O  O    . ASN A 1 17  ? 18.888  -5.094  -4.019  1.00 0.00 ? 17  ASN A O    3  
ATOM   6529  C  CB   . ASN A 1 17  ? 21.845  -4.201  -5.527  1.00 0.00 ? 17  ASN A CB   3  
ATOM   6530  C  CG   . ASN A 1 17  ? 22.459  -4.200  -4.131  1.00 0.00 ? 17  ASN A CG   3  
ATOM   6531  O  OD1  . ASN A 1 17  ? 23.682  -4.186  -3.990  1.00 0.00 ? 17  ASN A OD1  3  
ATOM   6532  N  ND2  . ASN A 1 17  ? 21.680  -4.212  -3.083  1.00 0.00 ? 17  ASN A ND2  3  
ATOM   6533  H  H    . ASN A 1 17  ? 20.408  -6.569  -7.195  1.00 0.00 ? 17  ASN A H    3  
ATOM   6534  H  HA   . ASN A 1 17  ? 20.962  -6.079  -5.014  1.00 0.00 ? 17  ASN A HA   3  
ATOM   6535  H  HB2  . ASN A 1 17  ? 22.600  -4.470  -6.251  1.00 0.00 ? 17  ASN A HB2  3  
ATOM   6536  H  HB3  . ASN A 1 17  ? 21.468  -3.214  -5.752  1.00 0.00 ? 17  ASN A HB3  3  
ATOM   6537  H  HD21 . ASN A 1 17  ? 20.704  -4.221  -3.198  1.00 0.00 ? 17  ASN A HD21 3  
ATOM   6538  H  HD22 . ASN A 1 17  ? 22.070  -4.210  -2.181  1.00 0.00 ? 17  ASN A HD22 3  
ATOM   6539  N  N    . ASN A 1 18  ? 18.993  -3.488  -5.591  1.00 0.00 ? 18  ASN A N    3  
ATOM   6540  C  CA   . ASN A 1 18  ? 17.799  -2.803  -5.109  1.00 0.00 ? 18  ASN A CA   3  
ATOM   6541  C  C    . ASN A 1 18  ? 17.152  -1.994  -6.230  1.00 0.00 ? 18  ASN A C    3  
ATOM   6542  O  O    . ASN A 1 18  ? 16.566  -2.556  -7.155  1.00 0.00 ? 18  ASN A O    3  
ATOM   6543  C  CB   . ASN A 1 18  ? 18.163  -1.877  -3.947  1.00 0.00 ? 18  ASN A CB   3  
ATOM   6544  C  CG   . ASN A 1 18  ? 18.590  -2.703  -2.738  1.00 0.00 ? 18  ASN A CG   3  
ATOM   6545  O  OD1  . ASN A 1 18  ? 17.764  -3.380  -2.125  1.00 0.00 ? 18  ASN A OD1  3  
ATOM   6546  N  ND2  . ASN A 1 18  ? 19.838  -2.688  -2.355  1.00 0.00 ? 18  ASN A ND2  3  
ATOM   6547  H  H    . ASN A 1 18  ? 19.475  -3.132  -6.365  1.00 0.00 ? 18  ASN A H    3  
ATOM   6548  H  HA   . ASN A 1 18  ? 17.093  -3.539  -4.759  1.00 0.00 ? 18  ASN A HA   3  
ATOM   6549  H  HB2  . ASN A 1 18  ? 18.974  -1.229  -4.244  1.00 0.00 ? 18  ASN A HB2  3  
ATOM   6550  H  HB3  . ASN A 1 18  ? 17.304  -1.278  -3.684  1.00 0.00 ? 18  ASN A HB3  3  
ATOM   6551  H  HD21 . ASN A 1 18  ? 20.493  -2.147  -2.843  1.00 0.00 ? 18  ASN A HD21 3  
ATOM   6552  H  HD22 . ASN A 1 18  ? 20.118  -3.215  -1.579  1.00 0.00 ? 18  ASN A HD22 3  
ATOM   6553  N  N    . GLU A 1 19  ? 17.257  -0.671  -6.137  1.00 0.00 ? 19  GLU A N    3  
ATOM   6554  C  CA   . GLU A 1 19  ? 16.672  0.206   -7.147  1.00 0.00 ? 19  GLU A CA   3  
ATOM   6555  C  C    . GLU A 1 19  ? 15.263  -0.253  -7.509  1.00 0.00 ? 19  GLU A C    3  
ATOM   6556  O  O    . GLU A 1 19  ? 14.980  -0.568  -8.665  1.00 0.00 ? 19  GLU A O    3  
ATOM   6557  C  CB   . GLU A 1 19  ? 17.546  0.213   -8.404  1.00 0.00 ? 19  GLU A CB   3  
ATOM   6558  C  CG   . GLU A 1 19  ? 19.014  0.362   -8.004  1.00 0.00 ? 19  GLU A CG   3  
ATOM   6559  C  CD   . GLU A 1 19  ? 19.814  0.943   -9.166  1.00 0.00 ? 19  GLU A CD   3  
ATOM   6560  O  OE1  . GLU A 1 19  ? 19.809  2.154   -9.314  1.00 0.00 ? 19  GLU A OE1  3  
ATOM   6561  O  OE2  . GLU A 1 19  ? 20.418  0.170   -9.891  1.00 0.00 ? 19  GLU A OE2  3  
ATOM   6562  H  H    . GLU A 1 19  ? 17.733  -0.279  -5.376  1.00 0.00 ? 19  GLU A H    3  
ATOM   6563  H  HA   . GLU A 1 19  ? 16.624  1.210   -6.751  1.00 0.00 ? 19  GLU A HA   3  
ATOM   6564  H  HB2  . GLU A 1 19  ? 17.410  -0.715  -8.943  1.00 0.00 ? 19  GLU A HB2  3  
ATOM   6565  H  HB3  . GLU A 1 19  ? 17.261  1.042   -9.035  1.00 0.00 ? 19  GLU A HB3  3  
ATOM   6566  H  HG2  . GLU A 1 19  ? 19.088  1.022   -7.152  1.00 0.00 ? 19  GLU A HG2  3  
ATOM   6567  H  HG3  . GLU A 1 19  ? 19.416  -0.607  -7.745  1.00 0.00 ? 19  GLU A HG3  3  
ATOM   6568  N  N    . PRO A 1 20  ? 14.380  -0.293  -6.545  1.00 0.00 ? 20  PRO A N    3  
ATOM   6569  C  CA   . PRO A 1 20  ? 12.968  -0.719  -6.761  1.00 0.00 ? 20  PRO A CA   3  
ATOM   6570  C  C    . PRO A 1 20  ? 12.363  -0.097  -8.019  1.00 0.00 ? 20  PRO A C    3  
ATOM   6571  O  O    . PRO A 1 20  ? 12.882  0.888   -8.546  1.00 0.00 ? 20  PRO A O    3  
ATOM   6572  C  CB   . PRO A 1 20  ? 12.249  -0.225  -5.507  1.00 0.00 ? 20  PRO A CB   3  
ATOM   6573  C  CG   . PRO A 1 20  ? 13.295  -0.181  -4.441  1.00 0.00 ? 20  PRO A CG   3  
ATOM   6574  C  CD   . PRO A 1 20  ? 14.634  0.064   -5.141  1.00 0.00 ? 20  PRO A CD   3  
ATOM   6575  H  HA   . PRO A 1 20  ? 12.907  -1.794  -6.811  1.00 0.00 ? 20  PRO A HA   3  
ATOM   6576  H  HB2  . PRO A 1 20  ? 11.842  0.762   -5.674  1.00 0.00 ? 20  PRO A HB2  3  
ATOM   6577  H  HB3  . PRO A 1 20  ? 11.466  -0.912  -5.226  1.00 0.00 ? 20  PRO A HB3  3  
ATOM   6578  H  HG2  . PRO A 1 20  ? 13.082  0.624   -3.749  1.00 0.00 ? 20  PRO A HG2  3  
ATOM   6579  H  HG3  . PRO A 1 20  ? 13.329  -1.124  -3.915  1.00 0.00 ? 20  PRO A HG3  3  
ATOM   6580  H  HD2  . PRO A 1 20  ? 14.920  1.104   -5.055  1.00 0.00 ? 20  PRO A HD2  3  
ATOM   6581  H  HD3  . PRO A 1 20  ? 15.397  -0.574  -4.726  1.00 0.00 ? 20  PRO A HD3  3  
ATOM   6582  N  N    . TRP A 1 21  ? 11.263  -0.676  -8.493  1.00 0.00 ? 21  TRP A N    3  
ATOM   6583  C  CA   . TRP A 1 21  ? 10.599  -0.165  -9.689  1.00 0.00 ? 21  TRP A CA   3  
ATOM   6584  C  C    . TRP A 1 21  ? 9.090   -0.387  -9.606  1.00 0.00 ? 21  TRP A C    3  
ATOM   6585  O  O    . TRP A 1 21  ? 8.422   -0.558  -10.625 1.00 0.00 ? 21  TRP A O    3  
ATOM   6586  C  CB   . TRP A 1 21  ? 11.156  -0.860  -10.934 1.00 0.00 ? 21  TRP A CB   3  
ATOM   6587  C  CG   . TRP A 1 21  ? 10.799  -2.311  -10.905 1.00 0.00 ? 21  TRP A CG   3  
ATOM   6588  C  CD1  . TRP A 1 21  ? 9.696   -2.851  -11.472 1.00 0.00 ? 21  TRP A CD1  3  
ATOM   6589  C  CD2  . TRP A 1 21  ? 11.526  -3.416  -10.290 1.00 0.00 ? 21  TRP A CD2  3  
ATOM   6590  N  NE1  . TRP A 1 21  ? 9.697   -4.214  -11.245 1.00 0.00 ? 21  TRP A NE1  3  
ATOM   6591  C  CE2  . TRP A 1 21  ? 10.804  -4.611  -10.520 1.00 0.00 ? 21  TRP A CE2  3  
ATOM   6592  C  CE3  . TRP A 1 21  ? 12.727  -3.495  -9.561  1.00 0.00 ? 21  TRP A CE3  3  
ATOM   6593  C  CZ2  . TRP A 1 21  ? 11.258  -5.842  -10.046 1.00 0.00 ? 21  TRP A CZ2  3  
ATOM   6594  C  CZ3  . TRP A 1 21  ? 13.186  -4.734  -9.083  1.00 0.00 ? 21  TRP A CZ3  3  
ATOM   6595  C  CH2  . TRP A 1 21  ? 12.455  -5.904  -9.325  1.00 0.00 ? 21  TRP A CH2  3  
ATOM   6596  H  H    . TRP A 1 21  ? 10.893  -1.457  -8.032  1.00 0.00 ? 21  TRP A H    3  
ATOM   6597  H  HA   . TRP A 1 21  ? 10.791  0.895   -9.768  1.00 0.00 ? 21  TRP A HA   3  
ATOM   6598  H  HB2  . TRP A 1 21  ? 10.734  -0.405  -11.819 1.00 0.00 ? 21  TRP A HB2  3  
ATOM   6599  H  HB3  . TRP A 1 21  ? 12.230  -0.754  -10.955 1.00 0.00 ? 21  TRP A HB3  3  
ATOM   6600  H  HD1  . TRP A 1 21  ? 8.938   -2.306  -12.015 1.00 0.00 ? 21  TRP A HD1  3  
ATOM   6601  H  HE1  . TRP A 1 21  ? 9.008   -4.840  -11.551 1.00 0.00 ? 21  TRP A HE1  3  
ATOM   6602  H  HE3  . TRP A 1 21  ? 13.298  -2.600  -9.369  1.00 0.00 ? 21  TRP A HE3  3  
ATOM   6603  H  HZ2  . TRP A 1 21  ? 10.689  -6.740  -10.235 1.00 0.00 ? 21  TRP A HZ2  3  
ATOM   6604  H  HZ3  . TRP A 1 21  ? 14.110  -4.784  -8.525  1.00 0.00 ? 21  TRP A HZ3  3  
ATOM   6605  H  HH2  . TRP A 1 21  ? 12.814  -6.853  -8.954  1.00 0.00 ? 21  TRP A HH2  3  
ATOM   6606  N  N    . VAL A 1 22  ? 8.563   -0.379  -8.386  1.00 0.00 ? 22  VAL A N    3  
ATOM   6607  C  CA   . VAL A 1 22  ? 7.132   -0.579  -8.178  1.00 0.00 ? 22  VAL A CA   3  
ATOM   6608  C  C    . VAL A 1 22  ? 6.325   0.123   -9.267  1.00 0.00 ? 22  VAL A C    3  
ATOM   6609  O  O    . VAL A 1 22  ? 5.487   -0.493  -9.926  1.00 0.00 ? 22  VAL A O    3  
ATOM   6610  C  CB   . VAL A 1 22  ? 6.727   -0.035  -6.805  1.00 0.00 ? 22  VAL A CB   3  
ATOM   6611  C  CG1  . VAL A 1 22  ? 5.405   -0.670  -6.367  1.00 0.00 ? 22  VAL A CG1  3  
ATOM   6612  C  CG2  . VAL A 1 22  ? 7.816   -0.372  -5.784  1.00 0.00 ? 22  VAL A CG2  3  
ATOM   6613  H  H    . VAL A 1 22  ? 9.146   -0.235  -7.611  1.00 0.00 ? 22  VAL A H    3  
ATOM   6614  H  HA   . VAL A 1 22  ? 6.917   -1.636  -8.209  1.00 0.00 ? 22  VAL A HA   3  
ATOM   6615  H  HB   . VAL A 1 22  ? 6.607   1.038   -6.865  1.00 0.00 ? 22  VAL A HB   3  
ATOM   6616  H  HG11 . VAL A 1 22  ? 4.755   -0.777  -7.224  1.00 0.00 ? 22  VAL A HG11 3  
ATOM   6617  H  HG12 . VAL A 1 22  ? 4.929   -0.041  -5.630  1.00 0.00 ? 22  VAL A HG12 3  
ATOM   6618  H  HG13 . VAL A 1 22  ? 5.598   -1.643  -5.938  1.00 0.00 ? 22  VAL A HG13 3  
ATOM   6619  H  HG21 . VAL A 1 22  ? 7.389   -0.385  -4.793  1.00 0.00 ? 22  VAL A HG21 3  
ATOM   6620  H  HG22 . VAL A 1 22  ? 8.596   0.374   -5.830  1.00 0.00 ? 22  VAL A HG22 3  
ATOM   6621  H  HG23 . VAL A 1 22  ? 8.232   -1.342  -6.011  1.00 0.00 ? 22  VAL A HG23 3  
ATOM   6622  N  N    . ARG A 1 23  ? 6.582   1.415   -9.451  1.00 0.00 ? 23  ARG A N    3  
ATOM   6623  C  CA   . ARG A 1 23  ? 5.873   2.190   -10.463 1.00 0.00 ? 23  ARG A CA   3  
ATOM   6624  C  C    . ARG A 1 23  ? 6.386   1.847   -11.858 1.00 0.00 ? 23  ARG A C    3  
ATOM   6625  O  O    . ARG A 1 23  ? 7.452   1.250   -12.008 1.00 0.00 ? 23  ARG A O    3  
ATOM   6626  C  CB   . ARG A 1 23  ? 6.061   3.686   -10.204 1.00 0.00 ? 23  ARG A CB   3  
ATOM   6627  C  CG   . ARG A 1 23  ? 5.416   4.059   -8.866  1.00 0.00 ? 23  ARG A CG   3  
ATOM   6628  C  CD   . ARG A 1 23  ? 6.110   5.296   -8.294  1.00 0.00 ? 23  ARG A CD   3  
ATOM   6629  N  NE   . ARG A 1 23  ? 6.533   6.180   -9.372  1.00 0.00 ? 23  ARG A NE   3  
ATOM   6630  C  CZ   . ARG A 1 23  ? 5.721   7.116   -9.853  1.00 0.00 ? 23  ARG A CZ   3  
ATOM   6631  N  NH1  . ARG A 1 23  ? 4.520   7.255   -9.362  1.00 0.00 ? 23  ARG A NH1  3  
ATOM   6632  N  NH2  . ARG A 1 23  ? 6.123   7.896   -10.820 1.00 0.00 ? 23  ARG A NH2  3  
ATOM   6633  H  H    . ARG A 1 23  ? 7.260   1.854   -8.895  1.00 0.00 ? 23  ARG A H    3  
ATOM   6634  H  HA   . ARG A 1 23  ? 4.820   1.957   -10.411 1.00 0.00 ? 23  ARG A HA   3  
ATOM   6635  H  HB2  . ARG A 1 23  ? 7.116   3.914   -10.174 1.00 0.00 ? 23  ARG A HB2  3  
ATOM   6636  H  HB3  . ARG A 1 23  ? 5.592   4.250   -10.996 1.00 0.00 ? 23  ARG A HB3  3  
ATOM   6637  H  HG2  . ARG A 1 23  ? 4.368   4.271   -9.019  1.00 0.00 ? 23  ARG A HG2  3  
ATOM   6638  H  HG3  . ARG A 1 23  ? 5.520   3.238   -8.173  1.00 0.00 ? 23  ARG A HG3  3  
ATOM   6639  H  HD2  . ARG A 1 23  ? 5.424   5.824   -7.648  1.00 0.00 ? 23  ARG A HD2  3  
ATOM   6640  H  HD3  . ARG A 1 23  ? 6.972   4.987   -7.719  1.00 0.00 ? 23  ARG A HD3  3  
ATOM   6641  H  HE   . ARG A 1 23  ? 7.433   6.083   -9.749  1.00 0.00 ? 23  ARG A HE   3  
ATOM   6642  H  HH11 . ARG A 1 23  ? 4.210   6.658   -8.621  1.00 0.00 ? 23  ARG A HH11 3  
ATOM   6643  H  HH12 . ARG A 1 23  ? 3.907   7.958   -9.727  1.00 0.00 ? 23  ARG A HH12 3  
ATOM   6644  H  HH21 . ARG A 1 23  ? 7.043   7.790   -11.198 1.00 0.00 ? 23  ARG A HH21 3  
ATOM   6645  H  HH22 . ARG A 1 23  ? 5.511   8.599   -11.182 1.00 0.00 ? 23  ARG A HH22 3  
ATOM   6646  N  N    . GLY A 1 24  ? 5.619   2.228   -12.875 1.00 0.00 ? 24  GLY A N    3  
ATOM   6647  C  CA   . GLY A 1 24  ? 6.000   1.958   -14.259 1.00 0.00 ? 24  GLY A CA   3  
ATOM   6648  C  C    . GLY A 1 24  ? 4.841   1.328   -15.023 1.00 0.00 ? 24  GLY A C    3  
ATOM   6649  O  O    . GLY A 1 24  ? 4.664   0.109   -15.008 1.00 0.00 ? 24  GLY A O    3  
ATOM   6650  H  H    . GLY A 1 24  ? 4.779   2.700   -12.693 1.00 0.00 ? 24  GLY A H    3  
ATOM   6651  H  HA2  . GLY A 1 24  ? 6.281   2.885   -14.738 1.00 0.00 ? 24  GLY A HA2  3  
ATOM   6652  H  HA3  . GLY A 1 24  ? 6.841   1.281   -14.276 1.00 0.00 ? 24  GLY A HA3  3  
ATOM   6653  N  N    . ARG A 1 25  ? 4.049   2.166   -15.686 1.00 0.00 ? 25  ARG A N    3  
ATOM   6654  C  CA   . ARG A 1 25  ? 2.906   1.678   -16.447 1.00 0.00 ? 25  ARG A CA   3  
ATOM   6655  C  C    . ARG A 1 25  ? 2.104   0.687   -15.614 1.00 0.00 ? 25  ARG A C    3  
ATOM   6656  O  O    . ARG A 1 25  ? 1.590   1.033   -14.550 1.00 0.00 ? 25  ARG A O    3  
ATOM   6657  C  CB   . ARG A 1 25  ? 3.384   1.009   -17.739 1.00 0.00 ? 25  ARG A CB   3  
ATOM   6658  C  CG   . ARG A 1 25  ? 2.186   0.750   -18.660 1.00 0.00 ? 25  ARG A CG   3  
ATOM   6659  C  CD   . ARG A 1 25  ? 2.489   -0.444  -19.569 1.00 0.00 ? 25  ARG A CD   3  
ATOM   6660  N  NE   . ARG A 1 25  ? 3.889   -0.425  -19.978 1.00 0.00 ? 25  ARG A NE   3  
ATOM   6661  C  CZ   . ARG A 1 25  ? 4.405   -1.405  -20.711 1.00 0.00 ? 25  ARG A CZ   3  
ATOM   6662  N  NH1  . ARG A 1 25  ? 3.659   -2.413  -21.074 1.00 0.00 ? 25  ARG A NH1  3  
ATOM   6663  N  NH2  . ARG A 1 25  ? 5.659   -1.361  -21.068 1.00 0.00 ? 25  ARG A NH2  3  
ATOM   6664  H  H    . ARG A 1 25  ? 4.236   3.128   -15.660 1.00 0.00 ? 25  ARG A H    3  
ATOM   6665  H  HA   . ARG A 1 25  ? 2.270   2.513   -16.700 1.00 0.00 ? 25  ARG A HA   3  
ATOM   6666  H  HB2  . ARG A 1 25  ? 4.087   1.659   -18.239 1.00 0.00 ? 25  ARG A HB2  3  
ATOM   6667  H  HB3  . ARG A 1 25  ? 3.865   0.072   -17.503 1.00 0.00 ? 25  ARG A HB3  3  
ATOM   6668  H  HG2  . ARG A 1 25  ? 1.311   0.536   -18.065 1.00 0.00 ? 25  ARG A HG2  3  
ATOM   6669  H  HG3  . ARG A 1 25  ? 2.004   1.623   -19.268 1.00 0.00 ? 25  ARG A HG3  3  
ATOM   6670  H  HD2  . ARG A 1 25  ? 2.286   -1.359  -19.035 1.00 0.00 ? 25  ARG A HD2  3  
ATOM   6671  H  HD3  . ARG A 1 25  ? 1.858   -0.395  -20.445 1.00 0.00 ? 25  ARG A HD3  3  
ATOM   6672  H  HE   . ARG A 1 25  ? 4.458   0.325   -19.707 1.00 0.00 ? 25  ARG A HE   3  
ATOM   6673  H  HH11 . ARG A 1 25  ? 2.698   -2.448  -20.799 1.00 0.00 ? 25  ARG A HH11 3  
ATOM   6674  H  HH12 . ARG A 1 25  ? 4.048   -3.150  -21.626 1.00 0.00 ? 25  ARG A HH12 3  
ATOM   6675  H  HH21 . ARG A 1 25  ? 6.232   -0.589  -20.788 1.00 0.00 ? 25  ARG A HH21 3  
ATOM   6676  H  HH22 . ARG A 1 25  ? 6.048   -2.098  -21.621 1.00 0.00 ? 25  ARG A HH22 3  
ATOM   6677  N  N    . HIS A 1 26  ? 2.001   -0.544  -16.096 1.00 0.00 ? 26  HIS A N    3  
ATOM   6678  C  CA   . HIS A 1 26  ? 1.260   -1.567  -15.372 1.00 0.00 ? 26  HIS A CA   3  
ATOM   6679  C  C    . HIS A 1 26  ? 1.844   -1.754  -13.977 1.00 0.00 ? 26  HIS A C    3  
ATOM   6680  O  O    . HIS A 1 26  ? 2.867   -2.419  -13.811 1.00 0.00 ? 26  HIS A O    3  
ATOM   6681  C  CB   . HIS A 1 26  ? 1.319   -2.892  -16.131 1.00 0.00 ? 26  HIS A CB   3  
ATOM   6682  C  CG   . HIS A 1 26  ? 0.454   -3.903  -15.431 1.00 0.00 ? 26  HIS A CG   3  
ATOM   6683  N  ND1  . HIS A 1 26  ? -0.272  -3.587  -14.294 1.00 0.00 ? 26  HIS A ND1  3  
ATOM   6684  C  CD2  . HIS A 1 26  ? 0.189   -5.223  -15.693 1.00 0.00 ? 26  HIS A CD2  3  
ATOM   6685  C  CE1  . HIS A 1 26  ? -0.933  -4.697  -13.916 1.00 0.00 ? 26  HIS A CE1  3  
ATOM   6686  N  NE2  . HIS A 1 26  ? -0.687  -5.724  -14.734 1.00 0.00 ? 26  HIS A NE2  3  
ATOM   6687  H  H    . HIS A 1 26  ? 2.430   -0.769  -16.947 1.00 0.00 ? 26  HIS A H    3  
ATOM   6688  H  HA   . HIS A 1 26  ? 0.229   -1.260  -15.284 1.00 0.00 ? 26  HIS A HA   3  
ATOM   6689  H  HB2  . HIS A 1 26  ? 0.962   -2.746  -17.140 1.00 0.00 ? 26  HIS A HB2  3  
ATOM   6690  H  HB3  . HIS A 1 26  ? 2.338   -3.246  -16.154 1.00 0.00 ? 26  HIS A HB3  3  
ATOM   6691  H  HD1  . HIS A 1 26  ? -0.299  -2.717  -13.846 1.00 0.00 ? 26  HIS A HD1  3  
ATOM   6692  H  HD2  . HIS A 1 26  ? 0.599   -5.788  -16.517 1.00 0.00 ? 26  HIS A HD2  3  
ATOM   6693  H  HE1  . HIS A 1 26  ? -1.584  -4.751  -13.055 1.00 0.00 ? 26  HIS A HE1  3  
ATOM   6694  H  HE2  . HIS A 1 26  ? -1.044  -6.633  -14.671 1.00 0.00 ? 26  HIS A HE2  3  
ATOM   6695  N  N    . GLU A 1 27  ? 1.188   -1.154  -12.986 1.00 0.00 ? 27  GLU A N    3  
ATOM   6696  C  CA   . GLU A 1 27  ? 1.639   -1.243  -11.596 1.00 0.00 ? 27  GLU A CA   3  
ATOM   6697  C  C    . GLU A 1 27  ? 2.419   -2.533  -11.349 1.00 0.00 ? 27  GLU A C    3  
ATOM   6698  O  O    . GLU A 1 27  ? 3.630   -2.583  -11.560 1.00 0.00 ? 27  GLU A O    3  
ATOM   6699  C  CB   . GLU A 1 27  ? 0.431   -1.187  -10.656 1.00 0.00 ? 27  GLU A CB   3  
ATOM   6700  C  CG   . GLU A 1 27  ? -0.768  -1.857  -11.329 1.00 0.00 ? 27  GLU A CG   3  
ATOM   6701  C  CD   . GLU A 1 27  ? -1.473  -0.864  -12.246 1.00 0.00 ? 27  GLU A CD   3  
ATOM   6702  O  OE1  . GLU A 1 27  ? -1.545  0.298   -11.883 1.00 0.00 ? 27  GLU A OE1  3  
ATOM   6703  O  OE2  . GLU A 1 27  ? -1.930  -1.279  -13.298 1.00 0.00 ? 27  GLU A OE2  3  
ATOM   6704  H  H    . GLU A 1 27  ? 0.384   -0.633  -13.194 1.00 0.00 ? 27  GLU A H    3  
ATOM   6705  H  HA   . GLU A 1 27  ? 2.281   -0.403  -11.385 1.00 0.00 ? 27  GLU A HA   3  
ATOM   6706  H  HB2  . GLU A 1 27  ? 0.663   -1.701  -9.734  1.00 0.00 ? 27  GLU A HB2  3  
ATOM   6707  H  HB3  . GLU A 1 27  ? 0.190   -0.156  -10.442 1.00 0.00 ? 27  GLU A HB3  3  
ATOM   6708  H  HG2  . GLU A 1 27  ? -0.427  -2.703  -11.910 1.00 0.00 ? 27  GLU A HG2  3  
ATOM   6709  H  HG3  . GLU A 1 27  ? -1.459  -2.198  -10.573 1.00 0.00 ? 27  GLU A HG3  3  
ATOM   6710  N  N    . THR A 1 28  ? 1.719   -3.574  -10.910 1.00 0.00 ? 28  THR A N    3  
ATOM   6711  C  CA   . THR A 1 28  ? 2.361   -4.858  -10.648 1.00 0.00 ? 28  THR A CA   3  
ATOM   6712  C  C    . THR A 1 28  ? 3.487   -4.702  -9.623  1.00 0.00 ? 28  THR A C    3  
ATOM   6713  O  O    . THR A 1 28  ? 4.349   -3.837  -9.760  1.00 0.00 ? 28  THR A O    3  
ATOM   6714  C  CB   . THR A 1 28  ? 2.917   -5.431  -11.962 1.00 0.00 ? 28  THR A CB   3  
ATOM   6715  O  OG1  . THR A 1 28  ? 1.856   -6.021  -12.700 1.00 0.00 ? 28  THR A OG1  3  
ATOM   6716  C  CG2  . THR A 1 28  ? 3.985   -6.489  -11.670 1.00 0.00 ? 28  THR A CG2  3  
ATOM   6717  H  H    . THR A 1 28  ? 0.754   -3.480  -10.764 1.00 0.00 ? 28  THR A H    3  
ATOM   6718  H  HA   . THR A 1 28  ? 1.625   -5.543  -10.257 1.00 0.00 ? 28  THR A HA   3  
ATOM   6719  H  HB   . THR A 1 28  ? 3.356   -4.634  -12.542 1.00 0.00 ? 28  THR A HB   3  
ATOM   6720  H  HG1  . THR A 1 28  ? 1.559   -5.386  -13.354 1.00 0.00 ? 28  THR A HG1  3  
ATOM   6721  H  HG21 . THR A 1 28  ? 4.136   -7.100  -12.549 1.00 0.00 ? 28  THR A HG21 3  
ATOM   6722  H  HG22 . THR A 1 28  ? 3.662   -7.113  -10.850 1.00 0.00 ? 28  THR A HG22 3  
ATOM   6723  H  HG23 . THR A 1 28  ? 4.912   -6.001  -11.407 1.00 0.00 ? 28  THR A HG23 3  
ATOM   6724  N  N    . TYR A 1 29  ? 3.468   -5.563  -8.606  1.00 0.00 ? 29  TYR A N    3  
ATOM   6725  C  CA   . TYR A 1 29  ? 4.491   -5.541  -7.560  1.00 0.00 ? 29  TYR A CA   3  
ATOM   6726  C  C    . TYR A 1 29  ? 4.133   -4.560  -6.446  1.00 0.00 ? 29  TYR A C    3  
ATOM   6727  O  O    . TYR A 1 29  ? 4.138   -3.346  -6.646  1.00 0.00 ? 29  TYR A O    3  
ATOM   6728  C  CB   . TYR A 1 29  ? 5.852   -5.163  -8.153  1.00 0.00 ? 29  TYR A CB   3  
ATOM   6729  C  CG   . TYR A 1 29  ? 6.954   -5.765  -7.312  1.00 0.00 ? 29  TYR A CG   3  
ATOM   6730  C  CD1  . TYR A 1 29  ? 7.317   -7.105  -7.487  1.00 0.00 ? 29  TYR A CD1  3  
ATOM   6731  C  CD2  . TYR A 1 29  ? 7.609   -4.982  -6.353  1.00 0.00 ? 29  TYR A CD2  3  
ATOM   6732  C  CE1  . TYR A 1 29  ? 8.333   -7.664  -6.705  1.00 0.00 ? 29  TYR A CE1  3  
ATOM   6733  C  CE2  . TYR A 1 29  ? 8.629   -5.541  -5.571  1.00 0.00 ? 29  TYR A CE2  3  
ATOM   6734  C  CZ   . TYR A 1 29  ? 8.989   -6.882  -5.747  1.00 0.00 ? 29  TYR A CZ   3  
ATOM   6735  O  OH   . TYR A 1 29  ? 9.993   -7.434  -4.975  1.00 0.00 ? 29  TYR A OH   3  
ATOM   6736  H  H    . TYR A 1 29  ? 2.757   -6.235  -8.563  1.00 0.00 ? 29  TYR A H    3  
ATOM   6737  H  HA   . TYR A 1 29  ? 4.563   -6.532  -7.136  1.00 0.00 ? 29  TYR A HA   3  
ATOM   6738  H  HB2  . TYR A 1 29  ? 5.923   -5.539  -9.163  1.00 0.00 ? 29  TYR A HB2  3  
ATOM   6739  H  HB3  . TYR A 1 29  ? 5.958   -4.088  -8.161  1.00 0.00 ? 29  TYR A HB3  3  
ATOM   6740  H  HD1  . TYR A 1 29  ? 6.810   -7.709  -8.226  1.00 0.00 ? 29  TYR A HD1  3  
ATOM   6741  H  HD2  . TYR A 1 29  ? 7.330   -3.948  -6.217  1.00 0.00 ? 29  TYR A HD2  3  
ATOM   6742  H  HE1  . TYR A 1 29  ? 8.612   -8.698  -6.840  1.00 0.00 ? 29  TYR A HE1  3  
ATOM   6743  H  HE2  . TYR A 1 29  ? 9.134   -4.937  -4.832  1.00 0.00 ? 29  TYR A HE2  3  
ATOM   6744  H  HH   . TYR A 1 29  ? 9.992   -8.383  -5.123  1.00 0.00 ? 29  TYR A HH   3  
ATOM   6745  N  N    . LEU A 1 30  ? 3.842   -5.103  -5.266  1.00 0.00 ? 30  LEU A N    3  
ATOM   6746  C  CA   . LEU A 1 30  ? 3.500   -4.283  -4.108  1.00 0.00 ? 30  LEU A CA   3  
ATOM   6747  C  C    . LEU A 1 30  ? 3.381   -5.166  -2.873  1.00 0.00 ? 30  LEU A C    3  
ATOM   6748  O  O    . LEU A 1 30  ? 3.473   -6.389  -2.973  1.00 0.00 ? 30  LEU A O    3  
ATOM   6749  C  CB   . LEU A 1 30  ? 2.183   -3.532  -4.353  1.00 0.00 ? 30  LEU A CB   3  
ATOM   6750  C  CG   . LEU A 1 30  ? 0.991   -4.510  -4.366  1.00 0.00 ? 30  LEU A CG   3  
ATOM   6751  C  CD1  . LEU A 1 30  ? 0.224   -4.435  -3.037  1.00 0.00 ? 30  LEU A CD1  3  
ATOM   6752  C  CD2  . LEU A 1 30  ? 0.037   -4.133  -5.501  1.00 0.00 ? 30  LEU A CD2  3  
ATOM   6753  H  H    . LEU A 1 30  ? 3.867   -6.081  -5.170  1.00 0.00 ? 30  LEU A H    3  
ATOM   6754  H  HA   . LEU A 1 30  ? 4.288   -3.563  -3.948  1.00 0.00 ? 30  LEU A HA   3  
ATOM   6755  H  HB2  . LEU A 1 30  ? 2.041   -2.802  -3.572  1.00 0.00 ? 30  LEU A HB2  3  
ATOM   6756  H  HB3  . LEU A 1 30  ? 2.245   -3.022  -5.304  1.00 0.00 ? 30  LEU A HB3  3  
ATOM   6757  H  HG   . LEU A 1 30  ? 1.349   -5.520  -4.519  1.00 0.00 ? 30  LEU A HG   3  
ATOM   6758  H  HD11 . LEU A 1 30  ? -0.004  -3.406  -2.809  1.00 0.00 ? 30  LEU A HD11 3  
ATOM   6759  H  HD12 . LEU A 1 30  ? 0.826   -4.852  -2.246  1.00 0.00 ? 30  LEU A HD12 3  
ATOM   6760  H  HD13 . LEU A 1 30  ? -0.698  -4.994  -3.119  1.00 0.00 ? 30  LEU A HD13 3  
ATOM   6761  H  HD21 . LEU A 1 30  ? 0.505   -4.349  -6.449  1.00 0.00 ? 30  LEU A HD21 3  
ATOM   6762  H  HD22 . LEU A 1 30  ? -0.185  -3.076  -5.442  1.00 0.00 ? 30  LEU A HD22 3  
ATOM   6763  H  HD23 . LEU A 1 30  ? -0.875  -4.700  -5.408  1.00 0.00 ? 30  LEU A HD23 3  
ATOM   6764  N  N    . CYS A 1 31  ? 3.182   -4.553  -1.709  1.00 0.00 ? 31  CYS A N    3  
ATOM   6765  C  CA   . CYS A 1 31  ? 3.056   -5.319  -0.473  1.00 0.00 ? 31  CYS A CA   3  
ATOM   6766  C  C    . CYS A 1 31  ? 1.766   -4.933  0.231   1.00 0.00 ? 31  CYS A C    3  
ATOM   6767  O  O    . CYS A 1 31  ? 1.247   -3.836  0.026   1.00 0.00 ? 31  CYS A O    3  
ATOM   6768  C  CB   . CYS A 1 31  ? 4.252   -5.042  0.438   1.00 0.00 ? 31  CYS A CB   3  
ATOM   6769  S  SG   . CYS A 1 31  ? 3.880   -5.613  2.114   1.00 0.00 ? 31  CYS A SG   3  
ATOM   6770  H  H    . CYS A 1 31  ? 3.118   -3.571  -1.677  1.00 0.00 ? 31  CYS A H    3  
ATOM   6771  H  HA   . CYS A 1 31  ? 3.025   -6.376  -0.707  1.00 0.00 ? 31  CYS A HA   3  
ATOM   6772  H  HB2  . CYS A 1 31  ? 5.118   -5.568  0.064   1.00 0.00 ? 31  CYS A HB2  3  
ATOM   6773  H  HB3  . CYS A 1 31  ? 4.454   -3.982  0.456   1.00 0.00 ? 31  CYS A HB3  3  
ATOM   6774  H  HG   . CYS A 1 31  ? 3.275   -6.355  2.047   1.00 0.00 ? 31  CYS A HG   3  
ATOM   6775  N  N    . TYR A 1 32  ? 1.236   -5.832  1.051   1.00 0.00 ? 32  TYR A N    3  
ATOM   6776  C  CA   . TYR A 1 32  ? -0.003  -5.534  1.746   1.00 0.00 ? 32  TYR A CA   3  
ATOM   6777  C  C    . TYR A 1 32  ? -0.075  -6.303  3.057   1.00 0.00 ? 32  TYR A C    3  
ATOM   6778  O  O    . TYR A 1 32  ? 0.153   -7.512  3.107   1.00 0.00 ? 32  TYR A O    3  
ATOM   6779  C  CB   . TYR A 1 32  ? -1.191  -5.858  0.813   1.00 0.00 ? 32  TYR A CB   3  
ATOM   6780  C  CG   . TYR A 1 32  ? -2.097  -6.924  1.392   1.00 0.00 ? 32  TYR A CG   3  
ATOM   6781  C  CD1  . TYR A 1 32  ? -1.657  -8.249  1.498   1.00 0.00 ? 32  TYR A CD1  3  
ATOM   6782  C  CD2  . TYR A 1 32  ? -3.382  -6.581  1.803   1.00 0.00 ? 32  TYR A CD2  3  
ATOM   6783  C  CE1  . TYR A 1 32  ? -2.506  -9.228  2.019   1.00 0.00 ? 32  TYR A CE1  3  
ATOM   6784  C  CE2  . TYR A 1 32  ? -4.237  -7.560  2.319   1.00 0.00 ? 32  TYR A CE2  3  
ATOM   6785  C  CZ   . TYR A 1 32  ? -3.799  -8.887  2.428   1.00 0.00 ? 32  TYR A CZ   3  
ATOM   6786  O  OH   . TYR A 1 32  ? -4.641  -9.855  2.933   1.00 0.00 ? 32  TYR A OH   3  
ATOM   6787  H  H    . TYR A 1 32  ? 1.677   -6.705  1.185   1.00 0.00 ? 32  TYR A H    3  
ATOM   6788  H  HA   . TYR A 1 32  ? -0.025  -4.473  1.977   1.00 0.00 ? 32  TYR A HA   3  
ATOM   6789  H  HB2  . TYR A 1 32  ? -1.772  -4.961  0.650   1.00 0.00 ? 32  TYR A HB2  3  
ATOM   6790  H  HB3  . TYR A 1 32  ? -0.806  -6.200  -0.137  1.00 0.00 ? 32  TYR A HB3  3  
ATOM   6791  H  HD1  . TYR A 1 32  ? -0.660  -8.511  1.190   1.00 0.00 ? 32  TYR A HD1  3  
ATOM   6792  H  HD2  . TYR A 1 32  ? -3.716  -5.560  1.721   1.00 0.00 ? 32  TYR A HD2  3  
ATOM   6793  H  HE1  . TYR A 1 32  ? -2.166  -10.250 2.100   1.00 0.00 ? 32  TYR A HE1  3  
ATOM   6794  H  HE2  . TYR A 1 32  ? -5.229  -7.290  2.637   1.00 0.00 ? 32  TYR A HE2  3  
ATOM   6795  H  HH   . TYR A 1 32  ? -4.905  -10.427 2.209   1.00 0.00 ? 32  TYR A HH   3  
ATOM   6796  N  N    . GLU A 1 33  ? -0.379  -5.575  4.116   1.00 0.00 ? 33  GLU A N    3  
ATOM   6797  C  CA   . GLU A 1 33  ? -0.475  -6.148  5.440   1.00 0.00 ? 33  GLU A CA   3  
ATOM   6798  C  C    . GLU A 1 33  ? -1.823  -5.820  6.044   1.00 0.00 ? 33  GLU A C    3  
ATOM   6799  O  O    . GLU A 1 33  ? -2.185  -4.652  6.173   1.00 0.00 ? 33  GLU A O    3  
ATOM   6800  C  CB   . GLU A 1 33  ? 0.639   -5.556  6.290   1.00 0.00 ? 33  GLU A CB   3  
ATOM   6801  C  CG   . GLU A 1 33  ? 1.956   -6.201  5.879   1.00 0.00 ? 33  GLU A CG   3  
ATOM   6802  C  CD   . GLU A 1 33  ? 3.046   -5.867  6.890   1.00 0.00 ? 33  GLU A CD   3  
ATOM   6803  O  OE1  . GLU A 1 33  ? 3.035   -6.454  7.959   1.00 0.00 ? 33  GLU A OE1  3  
ATOM   6804  O  OE2  . GLU A 1 33  ? 3.875   -5.027  6.582   1.00 0.00 ? 33  GLU A OE2  3  
ATOM   6805  H  H    . GLU A 1 33  ? -0.528  -4.619  4.009   1.00 0.00 ? 33  GLU A H    3  
ATOM   6806  H  HA   . GLU A 1 33  ? -0.358  -7.219  5.387   1.00 0.00 ? 33  GLU A HA   3  
ATOM   6807  H  HB2  . GLU A 1 33  ? 0.693   -4.494  6.115   1.00 0.00 ? 33  GLU A HB2  3  
ATOM   6808  H  HB3  . GLU A 1 33  ? 0.448   -5.737  7.330   1.00 0.00 ? 33  GLU A HB3  3  
ATOM   6809  H  HG2  . GLU A 1 33  ? 1.823   -7.270  5.825   1.00 0.00 ? 33  GLU A HG2  3  
ATOM   6810  H  HG3  . GLU A 1 33  ? 2.240   -5.832  4.903   1.00 0.00 ? 33  GLU A HG3  3  
ATOM   6811  N  N    . VAL A 1 34  ? -2.577  -6.848  6.409   1.00 0.00 ? 34  VAL A N    3  
ATOM   6812  C  CA   . VAL A 1 34  ? -3.891  -6.621  6.985   1.00 0.00 ? 34  VAL A CA   3  
ATOM   6813  C  C    . VAL A 1 34  ? -4.107  -7.423  8.251   1.00 0.00 ? 34  VAL A C    3  
ATOM   6814  O  O    . VAL A 1 34  ? -3.728  -8.589  8.346   1.00 0.00 ? 34  VAL A O    3  
ATOM   6815  C  CB   . VAL A 1 34  ? -4.987  -6.969  5.978   1.00 0.00 ? 34  VAL A CB   3  
ATOM   6816  C  CG1  . VAL A 1 34  ? -4.728  -8.345  5.359   1.00 0.00 ? 34  VAL A CG1  3  
ATOM   6817  C  CG2  . VAL A 1 34  ? -6.340  -6.963  6.703   1.00 0.00 ? 34  VAL A CG2  3  
ATOM   6818  H  H    . VAL A 1 34  ? -2.250  -7.763  6.281   1.00 0.00 ? 34  VAL A H    3  
ATOM   6819  H  HA   . VAL A 1 34  ? -3.984  -5.579  7.235   1.00 0.00 ? 34  VAL A HA   3  
ATOM   6820  H  HB   . VAL A 1 34  ? -4.993  -6.236  5.195   1.00 0.00 ? 34  VAL A HB   3  
ATOM   6821  H  HG11 . VAL A 1 34  ? -4.783  -9.105  6.120   1.00 0.00 ? 34  VAL A HG11 3  
ATOM   6822  H  HG12 . VAL A 1 34  ? -3.747  -8.358  4.905   1.00 0.00 ? 34  VAL A HG12 3  
ATOM   6823  H  HG13 . VAL A 1 34  ? -5.474  -8.541  4.599   1.00 0.00 ? 34  VAL A HG13 3  
ATOM   6824  H  HG21 . VAL A 1 34  ? -6.482  -7.913  7.197   1.00 0.00 ? 34  VAL A HG21 3  
ATOM   6825  H  HG22 . VAL A 1 34  ? -7.135  -6.799  5.993   1.00 0.00 ? 34  VAL A HG22 3  
ATOM   6826  H  HG23 . VAL A 1 34  ? -6.351  -6.172  7.443   1.00 0.00 ? 34  VAL A HG23 3  
ATOM   6827  N  N    . GLU A 1 35  ? -4.757  -6.780  9.214   1.00 0.00 ? 35  GLU A N    3  
ATOM   6828  C  CA   . GLU A 1 35  ? -5.071  -7.416  10.477  1.00 0.00 ? 35  GLU A CA   3  
ATOM   6829  C  C    . GLU A 1 35  ? -6.574  -7.576  10.609  1.00 0.00 ? 35  GLU A C    3  
ATOM   6830  O  O    . GLU A 1 35  ? -7.343  -6.822  10.009  1.00 0.00 ? 35  GLU A O    3  
ATOM   6831  C  CB   . GLU A 1 35  ? -4.536  -6.579  11.638  1.00 0.00 ? 35  GLU A CB   3  
ATOM   6832  C  CG   . GLU A 1 35  ? -3.015  -6.497  11.537  1.00 0.00 ? 35  GLU A CG   3  
ATOM   6833  C  CD   . GLU A 1 35  ? -2.418  -6.183  12.904  1.00 0.00 ? 35  GLU A CD   3  
ATOM   6834  O  OE1  . GLU A 1 35  ? -3.128  -5.625  13.724  1.00 0.00 ? 35  GLU A OE1  3  
ATOM   6835  O  OE2  . GLU A 1 35  ? -1.258  -6.504  13.110  1.00 0.00 ? 35  GLU A OE2  3  
ATOM   6836  H  H    . GLU A 1 35  ? -5.045  -5.858  9.061   1.00 0.00 ? 35  GLU A H    3  
ATOM   6837  H  HA   . GLU A 1 35  ? -4.615  -8.392  10.501  1.00 0.00 ? 35  GLU A HA   3  
ATOM   6838  H  HB2  . GLU A 1 35  ? -4.956  -5.584  11.589  1.00 0.00 ? 35  GLU A HB2  3  
ATOM   6839  H  HB3  . GLU A 1 35  ? -4.808  -7.042  12.574  1.00 0.00 ? 35  GLU A HB3  3  
ATOM   6840  H  HG2  . GLU A 1 35  ? -2.635  -7.444  11.186  1.00 0.00 ? 35  GLU A HG2  3  
ATOM   6841  H  HG3  . GLU A 1 35  ? -2.743  -5.719  10.838  1.00 0.00 ? 35  GLU A HG3  3  
ATOM   6842  N  N    . ARG A 1 36  ? -6.991  -8.565  11.382  1.00 0.00 ? 36  ARG A N    3  
ATOM   6843  C  CA   . ARG A 1 36  ? -8.413  -8.824  11.572  1.00 0.00 ? 36  ARG A CA   3  
ATOM   6844  C  C    . ARG A 1 36  ? -8.813  -8.647  13.033  1.00 0.00 ? 36  ARG A C    3  
ATOM   6845  O  O    . ARG A 1 36  ? -8.081  -9.032  13.946  1.00 0.00 ? 36  ARG A O    3  
ATOM   6846  C  CB   . ARG A 1 36  ? -8.738  -10.252 11.113  1.00 0.00 ? 36  ARG A CB   3  
ATOM   6847  C  CG   . ARG A 1 36  ? -7.484  -11.124 11.224  1.00 0.00 ? 36  ARG A CG   3  
ATOM   6848  C  CD   . ARG A 1 36  ? -7.833  -12.588 10.900  1.00 0.00 ? 36  ARG A CD   3  
ATOM   6849  N  NE   . ARG A 1 36  ? -9.262  -12.730 10.643  1.00 0.00 ? 36  ARG A NE   3  
ATOM   6850  C  CZ   . ARG A 1 36  ? -9.877  -13.896 10.808  1.00 0.00 ? 36  ARG A CZ   3  
ATOM   6851  N  NH1  . ARG A 1 36  ? -9.204  -14.940 11.209  1.00 0.00 ? 36  ARG A NH1  3  
ATOM   6852  N  NH2  . ARG A 1 36  ? -11.157 -13.997 10.571  1.00 0.00 ? 36  ARG A NH2  3  
ATOM   6853  H  H    . ARG A 1 36  ? -6.331  -9.137  11.828  1.00 0.00 ? 36  ARG A H    3  
ATOM   6854  H  HA   . ARG A 1 36  ? -8.985  -8.131  10.971  1.00 0.00 ? 36  ARG A HA   3  
ATOM   6855  H  HB2  . ARG A 1 36  ? -9.522  -10.665 11.734  1.00 0.00 ? 36  ARG A HB2  3  
ATOM   6856  H  HB3  . ARG A 1 36  ? -9.068  -10.232 10.085  1.00 0.00 ? 36  ARG A HB3  3  
ATOM   6857  H  HG2  . ARG A 1 36  ? -6.739  -10.765 10.527  1.00 0.00 ? 36  ARG A HG2  3  
ATOM   6858  H  HG3  . ARG A 1 36  ? -7.093  -11.061 12.229  1.00 0.00 ? 36  ARG A HG3  3  
ATOM   6859  H  HD2  . ARG A 1 36  ? -7.283  -12.903 10.026  1.00 0.00 ? 36  ARG A HD2  3  
ATOM   6860  H  HD3  . ARG A 1 36  ? -7.556  -13.216 11.737  1.00 0.00 ? 36  ARG A HD3  3  
ATOM   6861  H  HE   . ARG A 1 36  ? -9.776  -11.952 10.341  1.00 0.00 ? 36  ARG A HE   3  
ATOM   6862  H  HH11 . ARG A 1 36  ? -8.224  -14.862 11.391  1.00 0.00 ? 36  ARG A HH11 3  
ATOM   6863  H  HH12 . ARG A 1 36  ? -9.667  -15.817 11.335  1.00 0.00 ? 36  ARG A HH12 3  
ATOM   6864  H  HH21 . ARG A 1 36  ? -11.673 -13.198 10.263  1.00 0.00 ? 36  ARG A HH21 3  
ATOM   6865  H  HH22 . ARG A 1 36  ? -11.621 -14.875 10.696  1.00 0.00 ? 36  ARG A HH22 3  
ATOM   6866  N  N    . MET A 1 37  ? -9.998  -8.082  13.242  1.00 0.00 ? 37  MET A N    3  
ATOM   6867  C  CA   . MET A 1 37  ? -10.511 -7.881  14.588  1.00 0.00 ? 37  MET A CA   3  
ATOM   6868  C  C    . MET A 1 37  ? -11.604 -8.895  14.867  1.00 0.00 ? 37  MET A C    3  
ATOM   6869  O  O    . MET A 1 37  ? -12.384 -9.229  13.976  1.00 0.00 ? 37  MET A O    3  
ATOM   6870  C  CB   . MET A 1 37  ? -11.080 -6.480  14.756  1.00 0.00 ? 37  MET A CB   3  
ATOM   6871  C  CG   . MET A 1 37  ? -9.968  -5.438  14.591  1.00 0.00 ? 37  MET A CG   3  
ATOM   6872  S  SD   . MET A 1 37  ? -10.551 -3.829  15.181  1.00 0.00 ? 37  MET A SD   3  
ATOM   6873  C  CE   . MET A 1 37  ? -10.879 -4.325  16.888  1.00 0.00 ? 37  MET A CE   3  
ATOM   6874  H  H    . MET A 1 37  ? -10.543 -7.811  12.474  1.00 0.00 ? 37  MET A H    3  
ATOM   6875  H  HA   . MET A 1 37  ? -9.717  -8.020  15.299  1.00 0.00 ? 37  MET A HA   3  
ATOM   6876  H  HB2  . MET A 1 37  ? -11.841 -6.311  14.021  1.00 0.00 ? 37  MET A HB2  3  
ATOM   6877  H  HB3  . MET A 1 37  ? -11.512 -6.402  15.734  1.00 0.00 ? 37  MET A HB3  3  
ATOM   6878  H  HG2  . MET A 1 37  ? -9.103  -5.739  15.161  1.00 0.00 ? 37  MET A HG2  3  
ATOM   6879  H  HG3  . MET A 1 37  ? -9.700  -5.362  13.548  1.00 0.00 ? 37  MET A HG3  3  
ATOM   6880  H  HE1  . MET A 1 37  ? -10.663 -3.505  17.548  1.00 0.00 ? 37  MET A HE1  3  
ATOM   6881  H  HE2  . MET A 1 37  ? -10.255 -5.173  17.139  1.00 0.00 ? 37  MET A HE2  3  
ATOM   6882  H  HE3  . MET A 1 37  ? -11.917 -4.604  16.990  1.00 0.00 ? 37  MET A HE3  3  
ATOM   6883  N  N    . HIS A 1 38  ? -11.667 -9.374  16.105  1.00 0.00 ? 38  HIS A N    3  
ATOM   6884  C  CA   . HIS A 1 38  ? -12.678 -10.349 16.484  1.00 0.00 ? 38  HIS A CA   3  
ATOM   6885  C  C    . HIS A 1 38  ? -13.570 -9.757  17.552  1.00 0.00 ? 38  HIS A C    3  
ATOM   6886  O  O    . HIS A 1 38  ? -13.195 -9.691  18.715  1.00 0.00 ? 38  HIS A O    3  
ATOM   6887  C  CB   . HIS A 1 38  ? -12.007 -11.616 17.017  1.00 0.00 ? 38  HIS A CB   3  
ATOM   6888  C  CG   . HIS A 1 38  ? -13.058 -12.644 17.328  1.00 0.00 ? 38  HIS A CG   3  
ATOM   6889  N  ND1  . HIS A 1 38  ? -13.680 -13.387 16.338  1.00 0.00 ? 38  HIS A ND1  3  
ATOM   6890  C  CD2  . HIS A 1 38  ? -13.608 -13.065 18.514  1.00 0.00 ? 38  HIS A CD2  3  
ATOM   6891  C  CE1  . HIS A 1 38  ? -14.560 -14.210 16.939  1.00 0.00 ? 38  HIS A CE1  3  
ATOM   6892  N  NE2  . HIS A 1 38  ? -14.556 -14.053 18.265  1.00 0.00 ? 38  HIS A NE2  3  
ATOM   6893  H  H    . HIS A 1 38  ? -11.030 -9.056  16.782  1.00 0.00 ? 38  HIS A H    3  
ATOM   6894  H  HA   . HIS A 1 38  ? -13.276 -10.603 15.624  1.00 0.00 ? 38  HIS A HA   3  
ATOM   6895  H  HB2  . HIS A 1 38  ? -11.333 -12.008 16.268  1.00 0.00 ? 38  HIS A HB2  3  
ATOM   6896  H  HB3  . HIS A 1 38  ? -11.456 -11.382 17.915  1.00 0.00 ? 38  HIS A HB3  3  
ATOM   6897  H  HD1  . HIS A 1 38  ? -13.511 -13.326 15.374  1.00 0.00 ? 38  HIS A HD1  3  
ATOM   6898  H  HD2  . HIS A 1 38  ? -13.346 -12.685 19.491  1.00 0.00 ? 38  HIS A HD2  3  
ATOM   6899  H  HE1  . HIS A 1 38  ? -15.191 -14.910 16.413  1.00 0.00 ? 38  HIS A HE1  3  
ATOM   6900  H  HE2  . HIS A 1 38  ? -15.104 -14.532 18.922  1.00 0.00 ? 38  HIS A HE2  3  
ATOM   6901  N  N    . ASN A 1 39  ? -14.742 -9.306  17.160  1.00 0.00 ? 39  ASN A N    3  
ATOM   6902  C  CA   . ASN A 1 39  ? -15.633 -8.708  18.126  1.00 0.00 ? 39  ASN A CA   3  
ATOM   6903  C  C    . ASN A 1 39  ? -15.024 -7.412  18.640  1.00 0.00 ? 39  ASN A C    3  
ATOM   6904  O  O    . ASN A 1 39  ? -14.179 -6.802  17.986  1.00 0.00 ? 39  ASN A O    3  
ATOM   6905  C  CB   . ASN A 1 39  ? -15.844 -9.664  19.304  1.00 0.00 ? 39  ASN A CB   3  
ATOM   6906  C  CG   . ASN A 1 39  ? -17.140 -9.338  20.022  1.00 0.00 ? 39  ASN A CG   3  
ATOM   6907  O  OD1  . ASN A 1 39  ? -17.805 -8.353  19.700  1.00 0.00 ? 39  ASN A OD1  3  
ATOM   6908  N  ND2  . ASN A 1 39  ? -17.537 -10.114 20.986  1.00 0.00 ? 39  ASN A ND2  3  
ATOM   6909  H  H    . ASN A 1 39  ? -15.001 -9.361  16.217  1.00 0.00 ? 39  ASN A H    3  
ATOM   6910  H  HA   . ASN A 1 39  ? -16.585 -8.499  17.660  1.00 0.00 ? 39  ASN A HA   3  
ATOM   6911  H  HB2  . ASN A 1 39  ? -15.889 -10.679 18.939  1.00 0.00 ? 39  ASN A HB2  3  
ATOM   6912  H  HB3  . ASN A 1 39  ? -15.019 -9.568  20.002  1.00 0.00 ? 39  ASN A HB3  3  
ATOM   6913  H  HD21 . ASN A 1 39  ? -17.001 -10.897 21.240  1.00 0.00 ? 39  ASN A HD21 3  
ATOM   6914  H  HD22 . ASN A 1 39  ? -18.366 -9.915  21.458  1.00 0.00 ? 39  ASN A HD22 3  
ATOM   6915  N  N    . ASP A 1 40  ? -15.468 -7.006  19.809  1.00 0.00 ? 40  ASP A N    3  
ATOM   6916  C  CA   . ASP A 1 40  ? -14.984 -5.787  20.435  1.00 0.00 ? 40  ASP A CA   3  
ATOM   6917  C  C    . ASP A 1 40  ? -13.465 -5.780  20.620  1.00 0.00 ? 40  ASP A C    3  
ATOM   6918  O  O    . ASP A 1 40  ? -12.952 -4.915  21.330  1.00 0.00 ? 40  ASP A O    3  
ATOM   6919  C  CB   . ASP A 1 40  ? -15.641 -5.630  21.806  1.00 0.00 ? 40  ASP A CB   3  
ATOM   6920  C  CG   . ASP A 1 40  ? -17.034 -5.029  21.653  1.00 0.00 ? 40  ASP A CG   3  
ATOM   6921  O  OD1  . ASP A 1 40  ? -17.974 -5.791  21.498  1.00 0.00 ? 40  ASP A OD1  3  
ATOM   6922  O  OD2  . ASP A 1 40  ? -17.142 -3.814  21.693  1.00 0.00 ? 40  ASP A OD2  3  
ATOM   6923  H  H    . ASP A 1 40  ? -16.144 -7.541  20.270  1.00 0.00 ? 40  ASP A H    3  
ATOM   6924  H  HA   . ASP A 1 40  ? -15.267 -4.948  19.823  1.00 0.00 ? 40  ASP A HA   3  
ATOM   6925  H  HB2  . ASP A 1 40  ? -15.716 -6.601  22.277  1.00 0.00 ? 40  ASP A HB2  3  
ATOM   6926  H  HB3  . ASP A 1 40  ? -15.036 -4.981  22.422  1.00 0.00 ? 40  ASP A HB3  3  
ATOM   6927  N  N    . THR A 1 41  ? -12.732 -6.737  20.032  1.00 0.00 ? 41  THR A N    3  
ATOM   6928  C  CA   . THR A 1 41  ? -11.291 -6.764  20.231  1.00 0.00 ? 41  THR A CA   3  
ATOM   6929  C  C    . THR A 1 41  ? -10.519 -6.974  18.940  1.00 0.00 ? 41  THR A C    3  
ATOM   6930  O  O    . THR A 1 41  ? -11.094 -7.164  17.869  1.00 0.00 ? 41  THR A O    3  
ATOM   6931  C  CB   . THR A 1 41  ? -10.950 -7.832  21.261  1.00 0.00 ? 41  THR A CB   3  
ATOM   6932  O  OG1  . THR A 1 41  ? -9.747  -7.480  21.930  1.00 0.00 ? 41  THR A OG1  3  
ATOM   6933  C  CG2  . THR A 1 41  ? -10.783 -9.190  20.589  1.00 0.00 ? 41  THR A CG2  3  
ATOM   6934  H  H    . THR A 1 41  ? -13.152 -7.438  19.493  1.00 0.00 ? 41  THR A H    3  
ATOM   6935  H  HA   . THR A 1 41  ? -10.989 -5.817  20.628  1.00 0.00 ? 41  THR A HA   3  
ATOM   6936  H  HB   . THR A 1 41  ? -11.756 -7.885  21.972  1.00 0.00 ? 41  THR A HB   3  
ATOM   6937  H  HG1  . THR A 1 41  ? -9.839  -6.582  22.254  1.00 0.00 ? 41  THR A HG1  3  
ATOM   6938  H  HG21 . THR A 1 41  ? -11.329 -9.208  19.665  1.00 0.00 ? 41  THR A HG21 3  
ATOM   6939  H  HG22 . THR A 1 41  ? -11.160 -9.960  21.242  1.00 0.00 ? 41  THR A HG22 3  
ATOM   6940  H  HG23 . THR A 1 41  ? -9.739  -9.360  20.389  1.00 0.00 ? 41  THR A HG23 3  
ATOM   6941  N  N    . TRP A 1 42  ? -9.202  -6.894  19.068  1.00 0.00 ? 42  TRP A N    3  
ATOM   6942  C  CA   . TRP A 1 42  ? -8.304  -7.027  17.924  1.00 0.00 ? 42  TRP A CA   3  
ATOM   6943  C  C    . TRP A 1 42  ? -7.520  -8.337  17.948  1.00 0.00 ? 42  TRP A C    3  
ATOM   6944  O  O    . TRP A 1 42  ? -7.309  -8.935  19.003  1.00 0.00 ? 42  TRP A O    3  
ATOM   6945  C  CB   . TRP A 1 42  ? -7.328  -5.851  17.922  1.00 0.00 ? 42  TRP A CB   3  
ATOM   6946  C  CG   . TRP A 1 42  ? -7.003  -5.476  19.332  1.00 0.00 ? 42  TRP A CG   3  
ATOM   6947  C  CD1  . TRP A 1 42  ? -6.184  -6.173  20.154  1.00 0.00 ? 42  TRP A CD1  3  
ATOM   6948  C  CD2  . TRP A 1 42  ? -7.480  -4.334  20.101  1.00 0.00 ? 42  TRP A CD2  3  
ATOM   6949  N  NE1  . TRP A 1 42  ? -6.128  -5.528  21.378  1.00 0.00 ? 42  TRP A NE1  3  
ATOM   6950  C  CE2  . TRP A 1 42  ? -6.908  -4.393  21.393  1.00 0.00 ? 42  TRP A CE2  3  
ATOM   6951  C  CE3  . TRP A 1 42  ? -8.342  -3.264  19.806  1.00 0.00 ? 42  TRP A CE3  3  
ATOM   6952  C  CZ2  . TRP A 1 42  ? -7.180  -3.429  22.358  1.00 0.00 ? 42  TRP A CZ2  3  
ATOM   6953  C  CZ3  . TRP A 1 42  ? -8.620  -2.287  20.777  1.00 0.00 ? 42  TRP A CZ3  3  
ATOM   6954  C  CH2  . TRP A 1 42  ? -8.039  -2.371  22.051  1.00 0.00 ? 42  TRP A CH2  3  
ATOM   6955  H  H    . TRP A 1 42  ? -8.829  -6.722  19.956  1.00 0.00 ? 42  TRP A H    3  
ATOM   6956  H  HA   . TRP A 1 42  ? -8.881  -6.986  17.025  1.00 0.00 ? 42  TRP A HA   3  
ATOM   6957  H  HB2  . TRP A 1 42  ? -6.422  -6.130  17.405  1.00 0.00 ? 42  TRP A HB2  3  
ATOM   6958  H  HB3  . TRP A 1 42  ? -7.783  -5.009  17.424  1.00 0.00 ? 42  TRP A HB3  3  
ATOM   6959  H  HD1  . TRP A 1 42  ? -5.660  -7.082  19.897  1.00 0.00 ? 42  TRP A HD1  3  
ATOM   6960  H  HE1  . TRP A 1 42  ? -5.606  -5.822  22.151  1.00 0.00 ? 42  TRP A HE1  3  
ATOM   6961  H  HE3  . TRP A 1 42  ? -8.793  -3.192  18.828  1.00 0.00 ? 42  TRP A HE3  3  
ATOM   6962  H  HZ2  . TRP A 1 42  ? -6.729  -3.501  23.335  1.00 0.00 ? 42  TRP A HZ2  3  
ATOM   6963  H  HZ3  . TRP A 1 42  ? -9.284  -1.470  20.541  1.00 0.00 ? 42  TRP A HZ3  3  
ATOM   6964  H  HH2  . TRP A 1 42  ? -8.257  -1.618  22.794  1.00 0.00 ? 42  TRP A HH2  3  
ATOM   6965  N  N    . VAL A 1 43  ? -7.077  -8.763  16.762  1.00 0.00 ? 43  VAL A N    3  
ATOM   6966  C  CA   . VAL A 1 43  ? -6.294  -9.990  16.625  1.00 0.00 ? 43  VAL A CA   3  
ATOM   6967  C  C    . VAL A 1 43  ? -5.004  -9.700  15.861  1.00 0.00 ? 43  VAL A C    3  
ATOM   6968  O  O    . VAL A 1 43  ? -4.935  -8.746  15.085  1.00 0.00 ? 43  VAL A O    3  
ATOM   6969  C  CB   . VAL A 1 43  ? -7.107  -11.048 15.880  1.00 0.00 ? 43  VAL A CB   3  
ATOM   6970  C  CG1  . VAL A 1 43  ? -6.561  -12.438 16.214  1.00 0.00 ? 43  VAL A CG1  3  
ATOM   6971  C  CG2  . VAL A 1 43  ? -8.573  -10.961 16.309  1.00 0.00 ? 43  VAL A CG2  3  
ATOM   6972  H  H    . VAL A 1 43  ? -7.272  -8.232  15.959  1.00 0.00 ? 43  VAL A H    3  
ATOM   6973  H  HA   . VAL A 1 43  ? -6.045  -10.364 17.607  1.00 0.00 ? 43  VAL A HA   3  
ATOM   6974  H  HB   . VAL A 1 43  ? -7.029  -10.879 14.817  1.00 0.00 ? 43  VAL A HB   3  
ATOM   6975  H  HG11 . VAL A 1 43  ? -7.080  -13.180 15.624  1.00 0.00 ? 43  VAL A HG11 3  
ATOM   6976  H  HG12 . VAL A 1 43  ? -6.715  -12.642 17.263  1.00 0.00 ? 43  VAL A HG12 3  
ATOM   6977  H  HG13 . VAL A 1 43  ? -5.506  -12.473 15.990  1.00 0.00 ? 43  VAL A HG13 3  
ATOM   6978  H  HG21 . VAL A 1 43  ? -9.063  -10.170 15.760  1.00 0.00 ? 43  VAL A HG21 3  
ATOM   6979  H  HG22 . VAL A 1 43  ? -8.627  -10.752 17.367  1.00 0.00 ? 43  VAL A HG22 3  
ATOM   6980  H  HG23 . VAL A 1 43  ? -9.063  -11.900 16.102  1.00 0.00 ? 43  VAL A HG23 3  
ATOM   6981  N  N    . LEU A 1 44  ? -3.979  -10.519 16.087  1.00 0.00 ? 44  LEU A N    3  
ATOM   6982  C  CA   . LEU A 1 44  ? -2.692  -10.328 15.418  1.00 0.00 ? 44  LEU A CA   3  
ATOM   6983  C  C    . LEU A 1 44  ? -2.364  -11.515 14.516  1.00 0.00 ? 44  LEU A C    3  
ATOM   6984  O  O    . LEU A 1 44  ? -1.960  -12.574 14.996  1.00 0.00 ? 44  LEU A O    3  
ATOM   6985  C  CB   . LEU A 1 44  ? -1.575  -10.177 16.459  1.00 0.00 ? 44  LEU A CB   3  
ATOM   6986  C  CG   . LEU A 1 44  ? -1.883  -9.021  17.425  1.00 0.00 ? 44  LEU A CG   3  
ATOM   6987  C  CD1  . LEU A 1 44  ? -2.219  -7.755  16.628  1.00 0.00 ? 44  LEU A CD1  3  
ATOM   6988  C  CD2  . LEU A 1 44  ? -3.066  -9.391  18.342  1.00 0.00 ? 44  LEU A CD2  3  
ATOM   6989  H  H    . LEU A 1 44  ? -4.086  -11.259 16.716  1.00 0.00 ? 44  LEU A H    3  
ATOM   6990  H  HA   . LEU A 1 44  ? -2.731  -9.434  14.815  1.00 0.00 ? 44  LEU A HA   3  
ATOM   6991  H  HB2  . LEU A 1 44  ? -1.484  -11.097 17.018  1.00 0.00 ? 44  LEU A HB2  3  
ATOM   6992  H  HB3  . LEU A 1 44  ? -0.642  -9.977  15.952  1.00 0.00 ? 44  LEU A HB3  3  
ATOM   6993  H  HG   . LEU A 1 44  ? -1.009  -8.829  18.032  1.00 0.00 ? 44  LEU A HG   3  
ATOM   6994  H  HD11 . LEU A 1 44  ? -1.584  -7.698  15.756  1.00 0.00 ? 44  LEU A HD11 3  
ATOM   6995  H  HD12 . LEU A 1 44  ? -2.056  -6.886  17.249  1.00 0.00 ? 44  LEU A HD12 3  
ATOM   6996  H  HD13 . LEU A 1 44  ? -3.253  -7.788  16.320  1.00 0.00 ? 44  LEU A HD13 3  
ATOM   6997  H  HD21 . LEU A 1 44  ? -3.230  -10.460 18.317  1.00 0.00 ? 44  LEU A HD21 3  
ATOM   6998  H  HD22 . LEU A 1 44  ? -3.961  -8.884  18.012  1.00 0.00 ? 44  LEU A HD22 3  
ATOM   6999  H  HD23 . LEU A 1 44  ? -2.839  -9.090  19.353  1.00 0.00 ? 44  LEU A HD23 3  
ATOM   7000  N  N    . LEU A 1 45  ? -2.529  -11.332 13.208  1.00 0.00 ? 45  LEU A N    3  
ATOM   7001  C  CA   . LEU A 1 45  ? -2.231  -12.401 12.259  1.00 0.00 ? 45  LEU A CA   3  
ATOM   7002  C  C    . LEU A 1 45  ? -0.899  -13.065 12.605  1.00 0.00 ? 45  LEU A C    3  
ATOM   7003  O  O    . LEU A 1 45  ? -0.164  -12.584 13.467  1.00 0.00 ? 45  LEU A O    3  
ATOM   7004  C  CB   . LEU A 1 45  ? -2.173  -11.848 10.832  1.00 0.00 ? 45  LEU A CB   3  
ATOM   7005  C  CG   . LEU A 1 45  ? -1.486  -10.477 10.827  1.00 0.00 ? 45  LEU A CG   3  
ATOM   7006  C  CD1  . LEU A 1 45  ? -0.037  -10.623 11.304  1.00 0.00 ? 45  LEU A CD1  3  
ATOM   7007  C  CD2  . LEU A 1 45  ? -1.504  -9.901  9.403   1.00 0.00 ? 45  LEU A CD2  3  
ATOM   7008  H  H    . LEU A 1 45  ? -2.849  -10.465 12.878  1.00 0.00 ? 45  LEU A H    3  
ATOM   7009  H  HA   . LEU A 1 45  ? -3.014  -13.143 12.313  1.00 0.00 ? 45  LEU A HA   3  
ATOM   7010  H  HB2  . LEU A 1 45  ? -1.616  -12.530 10.206  1.00 0.00 ? 45  LEU A HB2  3  
ATOM   7011  H  HB3  . LEU A 1 45  ? -3.176  -11.746 10.447  1.00 0.00 ? 45  LEU A HB3  3  
ATOM   7012  H  HG   . LEU A 1 45  ? -2.015  -9.808  11.489  1.00 0.00 ? 45  LEU A HG   3  
ATOM   7013  H  HD11 . LEU A 1 45  ? -0.007  -10.574 12.382  1.00 0.00 ? 45  LEU A HD11 3  
ATOM   7014  H  HD12 . LEU A 1 45  ? 0.561   -9.824  10.892  1.00 0.00 ? 45  LEU A HD12 3  
ATOM   7015  H  HD13 . LEU A 1 45  ? 0.357   -11.573 10.976  1.00 0.00 ? 45  LEU A HD13 3  
ATOM   7016  H  HD21 . LEU A 1 45  ? -1.610  -8.828  9.454   1.00 0.00 ? 45  LEU A HD21 3  
ATOM   7017  H  HD22 . LEU A 1 45  ? -2.335  -10.318 8.854   1.00 0.00 ? 45  LEU A HD22 3  
ATOM   7018  H  HD23 . LEU A 1 45  ? -0.582  -10.147 8.899   1.00 0.00 ? 45  LEU A HD23 3  
ATOM   7019  N  N    . ASN A 1 46  ? -0.595  -14.175 11.934  1.00 0.00 ? 46  ASN A N    3  
ATOM   7020  C  CA   . ASN A 1 46  ? 0.654   -14.894 12.187  1.00 0.00 ? 46  ASN A CA   3  
ATOM   7021  C  C    . ASN A 1 46  ? 1.278   -15.379 10.879  1.00 0.00 ? 46  ASN A C    3  
ATOM   7022  O  O    . ASN A 1 46  ? 0.967   -16.471 10.400  1.00 0.00 ? 46  ASN A O    3  
ATOM   7023  C  CB   . ASN A 1 46  ? 0.389   -16.092 13.106  1.00 0.00 ? 46  ASN A CB   3  
ATOM   7024  C  CG   . ASN A 1 46  ? 1.647   -16.434 13.898  1.00 0.00 ? 46  ASN A CG   3  
ATOM   7025  O  OD1  . ASN A 1 46  ? 2.087   -17.584 13.903  1.00 0.00 ? 46  ASN A OD1  3  
ATOM   7026  N  ND2  . ASN A 1 46  ? 2.257   -15.497 14.573  1.00 0.00 ? 46  ASN A ND2  3  
ATOM   7027  H  H    . ASN A 1 46  ? -1.219  -14.517 11.259  1.00 0.00 ? 46  ASN A H    3  
ATOM   7028  H  HA   . ASN A 1 46  ? 1.349   -14.229 12.678  1.00 0.00 ? 46  ASN A HA   3  
ATOM   7029  H  HB2  . ASN A 1 46  ? -0.410  -15.848 13.791  1.00 0.00 ? 46  ASN A HB2  3  
ATOM   7030  H  HB3  . ASN A 1 46  ? 0.100   -16.945 12.509  1.00 0.00 ? 46  ASN A HB3  3  
ATOM   7031  H  HD21 . ASN A 1 46  ? 1.906   -14.582 14.569  1.00 0.00 ? 46  ASN A HD21 3  
ATOM   7032  H  HD22 . ASN A 1 46  ? 3.067   -15.708 15.084  1.00 0.00 ? 46  ASN A HD22 3  
ATOM   7033  N  N    . GLN A 1 47  ? 2.164   -14.561 10.311  1.00 0.00 ? 47  GLN A N    3  
ATOM   7034  C  CA   . GLN A 1 47  ? 2.835   -14.910 9.058   1.00 0.00 ? 47  GLN A CA   3  
ATOM   7035  C  C    . GLN A 1 47  ? 3.825   -13.812 8.664   1.00 0.00 ? 47  GLN A C    3  
ATOM   7036  O  O    . GLN A 1 47  ? 4.282   -13.047 9.515   1.00 0.00 ? 47  GLN A O    3  
ATOM   7037  C  CB   . GLN A 1 47  ? 1.797   -15.095 7.945   1.00 0.00 ? 47  GLN A CB   3  
ATOM   7038  C  CG   . GLN A 1 47  ? 0.963   -13.819 7.801   1.00 0.00 ? 47  GLN A CG   3  
ATOM   7039  C  CD   . GLN A 1 47  ? 0.134   -13.879 6.523   1.00 0.00 ? 47  GLN A CD   3  
ATOM   7040  O  OE1  . GLN A 1 47  ? 0.684   -13.836 5.423   1.00 0.00 ? 47  GLN A OE1  3  
ATOM   7041  N  NE2  . GLN A 1 47  ? -1.164  -13.978 6.603   1.00 0.00 ? 47  GLN A NE2  3  
ATOM   7042  H  H    . GLN A 1 47  ? 2.372   -13.707 10.745  1.00 0.00 ? 47  GLN A H    3  
ATOM   7043  H  HA   . GLN A 1 47  ? 3.372   -15.836 9.194   1.00 0.00 ? 47  GLN A HA   3  
ATOM   7044  H  HB2  . GLN A 1 47  ? 2.301   -15.304 7.014   1.00 0.00 ? 47  GLN A HB2  3  
ATOM   7045  H  HB3  . GLN A 1 47  ? 1.147   -15.920 8.193   1.00 0.00 ? 47  GLN A HB3  3  
ATOM   7046  H  HG2  . GLN A 1 47  ? 0.303   -13.726 8.651   1.00 0.00 ? 47  GLN A HG2  3  
ATOM   7047  H  HG3  . GLN A 1 47  ? 1.618   -12.962 7.761   1.00 0.00 ? 47  GLN A HG3  3  
ATOM   7048  H  HE21 . GLN A 1 47  ? -1.599  -14.013 7.480   1.00 0.00 ? 47  GLN A HE21 3  
ATOM   7049  H  HE22 . GLN A 1 47  ? -1.705  -14.015 5.786   1.00 0.00 ? 47  GLN A HE22 3  
ATOM   7050  N  N    . ARG A 1 48  ? 4.140   -13.726 7.371   1.00 0.00 ? 48  ARG A N    3  
ATOM   7051  C  CA   . ARG A 1 48  ? 5.056   -12.706 6.881   1.00 0.00 ? 48  ARG A CA   3  
ATOM   7052  C  C    . ARG A 1 48  ? 4.255   -11.514 6.377   1.00 0.00 ? 48  ARG A C    3  
ATOM   7053  O  O    . ARG A 1 48  ? 3.141   -11.267 6.837   1.00 0.00 ? 48  ARG A O    3  
ATOM   7054  C  CB   . ARG A 1 48  ? 5.908   -13.262 5.735   1.00 0.00 ? 48  ARG A CB   3  
ATOM   7055  C  CG   . ARG A 1 48  ? 6.634   -14.529 6.189   1.00 0.00 ? 48  ARG A CG   3  
ATOM   7056  C  CD   . ARG A 1 48  ? 7.669   -14.922 5.133   1.00 0.00 ? 48  ARG A CD   3  
ATOM   7057  N  NE   . ARG A 1 48  ? 8.124   -16.290 5.355   1.00 0.00 ? 48  ARG A NE   3  
ATOM   7058  C  CZ   . ARG A 1 48  ? 9.274   -16.721 4.849   1.00 0.00 ? 48  ARG A CZ   3  
ATOM   7059  N  NH1  . ARG A 1 48  ? 10.023  -15.916 4.145   1.00 0.00 ? 48  ARG A NH1  3  
ATOM   7060  N  NH2  . ARG A 1 48  ? 9.657   -17.950 5.057   1.00 0.00 ? 48  ARG A NH2  3  
ATOM   7061  H  H    . ARG A 1 48  ? 3.741   -14.348 6.733   1.00 0.00 ? 48  ARG A H    3  
ATOM   7062  H  HA   . ARG A 1 48  ? 5.704   -12.391 7.685   1.00 0.00 ? 48  ARG A HA   3  
ATOM   7063  H  HB2  . ARG A 1 48  ? 5.267   -13.497 4.896   1.00 0.00 ? 48  ARG A HB2  3  
ATOM   7064  H  HB3  . ARG A 1 48  ? 6.634   -12.521 5.435   1.00 0.00 ? 48  ARG A HB3  3  
ATOM   7065  H  HG2  . ARG A 1 48  ? 7.130   -14.343 7.130   1.00 0.00 ? 48  ARG A HG2  3  
ATOM   7066  H  HG3  . ARG A 1 48  ? 5.922   -15.330 6.308   1.00 0.00 ? 48  ARG A HG3  3  
ATOM   7067  H  HD2  . ARG A 1 48  ? 7.223   -14.854 4.152   1.00 0.00 ? 48  ARG A HD2  3  
ATOM   7068  H  HD3  . ARG A 1 48  ? 8.512   -14.248 5.188   1.00 0.00 ? 48  ARG A HD3  3  
ATOM   7069  H  HE   . ARG A 1 48  ? 7.573   -16.900 5.886   1.00 0.00 ? 48  ARG A HE   3  
ATOM   7070  H  HH11 . ARG A 1 48  ? 9.731   -14.972 3.988   1.00 0.00 ? 48  ARG A HH11 3  
ATOM   7071  H  HH12 . ARG A 1 48  ? 10.887  -16.242 3.764   1.00 0.00 ? 48  ARG A HH12 3  
ATOM   7072  H  HH21 . ARG A 1 48  ? 9.084   -18.566 5.599   1.00 0.00 ? 48  ARG A HH21 3  
ATOM   7073  H  HH22 . ARG A 1 48  ? 10.521  -18.277 4.675   1.00 0.00 ? 48  ARG A HH22 3  
ATOM   7074  N  N    . ARG A 1 49  ? 4.813   -10.789 5.415   1.00 0.00 ? 49  ARG A N    3  
ATOM   7075  C  CA   . ARG A 1 49  ? 4.109   -9.643  4.850   1.00 0.00 ? 49  ARG A CA   3  
ATOM   7076  C  C    . ARG A 1 49  ? 4.653   -9.269  3.476   1.00 0.00 ? 49  ARG A C    3  
ATOM   7077  O  O    . ARG A 1 49  ? 5.823   -8.918  3.325   1.00 0.00 ? 49  ARG A O    3  
ATOM   7078  C  CB   . ARG A 1 49  ? 4.234   -8.431  5.783   1.00 0.00 ? 49  ARG A CB   3  
ATOM   7079  C  CG   . ARG A 1 49  ? 5.673   -8.306  6.335   1.00 0.00 ? 49  ARG A CG   3  
ATOM   7080  C  CD   . ARG A 1 49  ? 5.655   -8.381  7.864   1.00 0.00 ? 49  ARG A CD   3  
ATOM   7081  N  NE   . ARG A 1 49  ? 5.011   -9.615  8.285   1.00 0.00 ? 49  ARG A NE   3  
ATOM   7082  C  CZ   . ARG A 1 49  ? 4.188   -9.653  9.330   1.00 0.00 ? 49  ARG A CZ   3  
ATOM   7083  N  NH1  . ARG A 1 49  ? 3.995   -8.585  10.056  1.00 0.00 ? 49  ARG A NH1  3  
ATOM   7084  N  NH2  . ARG A 1 49  ? 3.579   -10.766 9.636   1.00 0.00 ? 49  ARG A NH2  3  
ATOM   7085  H  H    . ARG A 1 49  ? 5.693   -11.041 5.070   1.00 0.00 ? 49  ARG A H    3  
ATOM   7086  H  HA   . ARG A 1 49  ? 3.063   -9.892  4.753   1.00 0.00 ? 49  ARG A HA   3  
ATOM   7087  H  HB2  . ARG A 1 49  ? 3.992   -7.539  5.224   1.00 0.00 ? 49  ARG A HB2  3  
ATOM   7088  H  HB3  . ARG A 1 49  ? 3.537   -8.541  6.600   1.00 0.00 ? 49  ARG A HB3  3  
ATOM   7089  H  HG2  . ARG A 1 49  ? 6.292   -9.100  5.945   1.00 0.00 ? 49  ARG A HG2  3  
ATOM   7090  H  HG3  . ARG A 1 49  ? 6.086   -7.359  6.038   1.00 0.00 ? 49  ARG A HG3  3  
ATOM   7091  H  HD2  . ARG A 1 49  ? 6.668   -8.360  8.237   1.00 0.00 ? 49  ARG A HD2  3  
ATOM   7092  H  HD3  . ARG A 1 49  ? 5.111   -7.535  8.255   1.00 0.00 ? 49  ARG A HD3  3  
ATOM   7093  H  HE   . ARG A 1 49  ? 5.171   -10.430 7.771   1.00 0.00 ? 49  ARG A HE   3  
ATOM   7094  H  HH11 . ARG A 1 49  ? 4.466   -7.734  9.832   1.00 0.00 ? 49  ARG A HH11 3  
ATOM   7095  H  HH12 . ARG A 1 49  ? 3.373   -8.620  10.839  1.00 0.00 ? 49  ARG A HH12 3  
ATOM   7096  H  HH21 . ARG A 1 49  ? 3.732   -11.586 9.086   1.00 0.00 ? 49  ARG A HH21 3  
ATOM   7097  H  HH22 . ARG A 1 49  ? 2.958   -10.799 10.419  1.00 0.00 ? 49  ARG A HH22 3  
ATOM   7098  N  N    . GLY A 1 50  ? 3.773   -9.328  2.485   1.00 0.00 ? 50  GLY A N    3  
ATOM   7099  C  CA   . GLY A 1 50  ? 4.123   -8.975  1.115   1.00 0.00 ? 50  GLY A CA   3  
ATOM   7100  C  C    . GLY A 1 50  ? 2.872   -8.993  0.249   1.00 0.00 ? 50  GLY A C    3  
ATOM   7101  O  O    . GLY A 1 50  ? 1.756   -9.090  0.762   1.00 0.00 ? 50  GLY A O    3  
ATOM   7102  H  H    . GLY A 1 50  ? 2.852   -9.596  2.685   1.00 0.00 ? 50  GLY A H    3  
ATOM   7103  H  HA2  . GLY A 1 50  ? 4.561   -7.986  1.099   1.00 0.00 ? 50  GLY A HA2  3  
ATOM   7104  H  HA3  . GLY A 1 50  ? 4.833   -9.690  0.729   1.00 0.00 ? 50  GLY A HA3  3  
ATOM   7105  N  N    . PHE A 1 51  ? 3.060   -8.955  -1.065  1.00 0.00 ? 51  PHE A N    3  
ATOM   7106  C  CA   . PHE A 1 51  ? 1.931   -9.046  -1.980  1.00 0.00 ? 51  PHE A CA   3  
ATOM   7107  C  C    . PHE A 1 51  ? 2.397   -9.230  -3.416  1.00 0.00 ? 51  PHE A C    3  
ATOM   7108  O  O    . PHE A 1 51  ? 3.289   -8.529  -3.893  1.00 0.00 ? 51  PHE A O    3  
ATOM   7109  C  CB   . PHE A 1 51  ? 0.990   -7.843  -1.887  1.00 0.00 ? 51  PHE A CB   3  
ATOM   7110  C  CG   . PHE A 1 51  ? -0.369  -8.280  -2.388  1.00 0.00 ? 51  PHE A CG   3  
ATOM   7111  C  CD1  . PHE A 1 51  ? -1.089  -9.254  -1.681  1.00 0.00 ? 51  PHE A CD1  3  
ATOM   7112  C  CD2  . PHE A 1 51  ? -0.895  -7.744  -3.569  1.00 0.00 ? 51  PHE A CD2  3  
ATOM   7113  C  CE1  . PHE A 1 51  ? -2.330  -9.688  -2.154  1.00 0.00 ? 51  PHE A CE1  3  
ATOM   7114  C  CE2  . PHE A 1 51  ? -2.141  -8.176  -4.040  1.00 0.00 ? 51  PHE A CE2  3  
ATOM   7115  C  CZ   . PHE A 1 51  ? -2.857  -9.149  -3.331  1.00 0.00 ? 51  PHE A CZ   3  
ATOM   7116  H  H    . PHE A 1 51  ? 3.971   -8.918  -1.423  1.00 0.00 ? 51  PHE A H    3  
ATOM   7117  H  HA   . PHE A 1 51  ? 1.372   -9.930  -1.707  1.00 0.00 ? 51  PHE A HA   3  
ATOM   7118  H  HB2  . PHE A 1 51  ? 0.918   -7.512  -0.861  1.00 0.00 ? 51  PHE A HB2  3  
ATOM   7119  H  HB3  . PHE A 1 51  ? 1.360   -7.042  -2.504  1.00 0.00 ? 51  PHE A HB3  3  
ATOM   7120  H  HD1  . PHE A 1 51  ? -0.684  -9.669  -0.770  1.00 0.00 ? 51  PHE A HD1  3  
ATOM   7121  H  HD2  . PHE A 1 51  ? -0.343  -6.997  -4.116  1.00 0.00 ? 51  PHE A HD2  3  
ATOM   7122  H  HE1  . PHE A 1 51  ? -2.882  -10.438 -1.609  1.00 0.00 ? 51  PHE A HE1  3  
ATOM   7123  H  HE2  . PHE A 1 51  ? -2.549  -7.759  -4.949  1.00 0.00 ? 51  PHE A HE2  3  
ATOM   7124  H  HZ   . PHE A 1 51  ? -3.817  -9.486  -3.697  1.00 0.00 ? 51  PHE A HZ   3  
ATOM   7125  N  N    . LEU A 1 52  ? 1.769   -10.177 -4.098  1.00 0.00 ? 52  LEU A N    3  
ATOM   7126  C  CA   . LEU A 1 52  ? 2.092   -10.466 -5.489  1.00 0.00 ? 52  LEU A CA   3  
ATOM   7127  C  C    . LEU A 1 52  ? 0.923   -10.060 -6.377  1.00 0.00 ? 52  LEU A C    3  
ATOM   7128  O  O    . LEU A 1 52  ? -0.213  -10.478 -6.155  1.00 0.00 ? 52  LEU A O    3  
ATOM   7129  C  CB   . LEU A 1 52  ? 2.371   -11.961 -5.677  1.00 0.00 ? 52  LEU A CB   3  
ATOM   7130  C  CG   . LEU A 1 52  ? 3.337   -12.467 -4.595  1.00 0.00 ? 52  LEU A CG   3  
ATOM   7131  C  CD1  . LEU A 1 52  ? 4.583   -11.575 -4.564  1.00 0.00 ? 52  LEU A CD1  3  
ATOM   7132  C  CD2  . LEU A 1 52  ? 2.651   -12.457 -3.216  1.00 0.00 ? 52  LEU A CD2  3  
ATOM   7133  H  H    . LEU A 1 52  ? 1.063   -10.687 -3.657  1.00 0.00 ? 52  LEU A H    3  
ATOM   7134  H  HA   . LEU A 1 52  ? 2.969   -9.905  -5.779  1.00 0.00 ? 52  LEU A HA   3  
ATOM   7135  H  HB2  . LEU A 1 52  ? 1.442   -12.507 -5.614  1.00 0.00 ? 52  LEU A HB2  3  
ATOM   7136  H  HB3  . LEU A 1 52  ? 2.813   -12.122 -6.650  1.00 0.00 ? 52  LEU A HB3  3  
ATOM   7137  H  HG   . LEU A 1 52  ? 3.636   -13.477 -4.837  1.00 0.00 ? 52  LEU A HG   3  
ATOM   7138  H  HD11 . LEU A 1 52  ? 4.826   -11.261 -5.569  1.00 0.00 ? 52  LEU A HD11 3  
ATOM   7139  H  HD12 . LEU A 1 52  ? 5.412   -12.130 -4.151  1.00 0.00 ? 52  LEU A HD12 3  
ATOM   7140  H  HD13 . LEU A 1 52  ? 4.391   -10.708 -3.952  1.00 0.00 ? 52  LEU A HD13 3  
ATOM   7141  H  HD21 . LEU A 1 52  ? 1.578   -12.440 -3.340  1.00 0.00 ? 52  LEU A HD21 3  
ATOM   7142  H  HD22 . LEU A 1 52  ? 2.962   -11.585 -2.657  1.00 0.00 ? 52  LEU A HD22 3  
ATOM   7143  H  HD23 . LEU A 1 52  ? 2.931   -13.346 -2.671  1.00 0.00 ? 52  LEU A HD23 3  
ATOM   7144  N  N    . CYS A 1 53  ? 1.205   -9.240  -7.380  1.00 0.00 ? 53  CYS A N    3  
ATOM   7145  C  CA   . CYS A 1 53  ? 0.164   -8.780  -8.293  1.00 0.00 ? 53  CYS A CA   3  
ATOM   7146  C  C    . CYS A 1 53  ? 0.695   -8.713  -9.718  1.00 0.00 ? 53  CYS A C    3  
ATOM   7147  O  O    . CYS A 1 53  ? 1.779   -8.185  -9.965  1.00 0.00 ? 53  CYS A O    3  
ATOM   7148  C  CB   . CYS A 1 53  ? -0.333  -7.398  -7.867  1.00 0.00 ? 53  CYS A CB   3  
ATOM   7149  S  SG   . CYS A 1 53  ? -1.823  -6.974  -8.805  1.00 0.00 ? 53  CYS A SG   3  
ATOM   7150  H  H    . CYS A 1 53  ? 2.127   -8.939  -7.508  1.00 0.00 ? 53  CYS A H    3  
ATOM   7151  H  HA   . CYS A 1 53  ? -0.665  -9.471  -8.261  1.00 0.00 ? 53  CYS A HA   3  
ATOM   7152  H  HB2  . CYS A 1 53  ? -0.563  -7.408  -6.812  1.00 0.00 ? 53  CYS A HB2  3  
ATOM   7153  H  HB3  . CYS A 1 53  ? 0.435   -6.664  -8.061  1.00 0.00 ? 53  CYS A HB3  3  
ATOM   7154  H  HG   . CYS A 1 53  ? -2.456  -6.586  -8.196  1.00 0.00 ? 53  CYS A HG   3  
ATOM   7155  N  N    . ASN A 1 54  ? -0.078  -9.253  -10.648 1.00 0.00 ? 54  ASN A N    3  
ATOM   7156  C  CA   . ASN A 1 54  ? 0.315   -9.255  -12.050 1.00 0.00 ? 54  ASN A CA   3  
ATOM   7157  C  C    . ASN A 1 54  ? -0.799  -9.843  -12.909 1.00 0.00 ? 54  ASN A C    3  
ATOM   7158  O  O    . ASN A 1 54  ? -1.079  -11.040 -12.843 1.00 0.00 ? 54  ASN A O    3  
ATOM   7159  C  CB   . ASN A 1 54  ? 1.594   -10.075 -12.234 1.00 0.00 ? 54  ASN A CB   3  
ATOM   7160  C  CG   . ASN A 1 54  ? 1.350   -11.520 -11.815 1.00 0.00 ? 54  ASN A CG   3  
ATOM   7161  O  OD1  . ASN A 1 54  ? 1.348   -11.830 -10.624 1.00 0.00 ? 54  ASN A OD1  3  
ATOM   7162  N  ND2  . ASN A 1 54  ? 1.141   -12.428 -12.729 1.00 0.00 ? 54  ASN A ND2  3  
ATOM   7163  H  H    . ASN A 1 54  ? -0.932  -9.658  -10.388 1.00 0.00 ? 54  ASN A H    3  
ATOM   7164  H  HA   . ASN A 1 54  ? 0.503   -8.238  -12.364 1.00 0.00 ? 54  ASN A HA   3  
ATOM   7165  H  HB2  . ASN A 1 54  ? 1.892   -10.046 -13.273 1.00 0.00 ? 54  ASN A HB2  3  
ATOM   7166  H  HB3  . ASN A 1 54  ? 2.379   -9.654  -11.624 1.00 0.00 ? 54  ASN A HB3  3  
ATOM   7167  H  HD21 . ASN A 1 54  ? 1.140   -12.179 -13.676 1.00 0.00 ? 54  ASN A HD21 3  
ATOM   7168  H  HD22 . ASN A 1 54  ? 0.986   -13.360 -12.467 1.00 0.00 ? 54  ASN A HD22 3  
ATOM   7169  N  N    . GLN A 1 55  ? -1.434  -8.993  -13.704 1.00 0.00 ? 55  GLN A N    3  
ATOM   7170  C  CA   . GLN A 1 55  ? -2.523  -9.434  -14.567 1.00 0.00 ? 55  GLN A CA   3  
ATOM   7171  C  C    . GLN A 1 55  ? -1.979  -10.126 -15.814 1.00 0.00 ? 55  GLN A C    3  
ATOM   7172  O  O    . GLN A 1 55  ? -0.946  -9.728  -16.356 1.00 0.00 ? 55  GLN A O    3  
ATOM   7173  C  CB   . GLN A 1 55  ? -3.376  -8.232  -14.973 1.00 0.00 ? 55  GLN A CB   3  
ATOM   7174  C  CG   . GLN A 1 55  ? -4.150  -7.723  -13.755 1.00 0.00 ? 55  GLN A CG   3  
ATOM   7175  C  CD   . GLN A 1 55  ? -5.439  -8.519  -13.586 1.00 0.00 ? 55  GLN A CD   3  
ATOM   7176  O  OE1  . GLN A 1 55  ? -5.409  -9.660  -13.123 1.00 0.00 ? 55  GLN A OE1  3  
ATOM   7177  N  NE2  . GLN A 1 55  ? -6.577  -7.984  -13.935 1.00 0.00 ? 55  GLN A NE2  3  
ATOM   7178  H  H    . GLN A 1 55  ? -1.169  -8.049  -13.709 1.00 0.00 ? 55  GLN A H    3  
ATOM   7179  H  HA   . GLN A 1 55  ? -3.141  -10.132 -14.022 1.00 0.00 ? 55  GLN A HA   3  
ATOM   7180  H  HB2  . GLN A 1 55  ? -2.735  -7.447  -15.348 1.00 0.00 ? 55  GLN A HB2  3  
ATOM   7181  H  HB3  . GLN A 1 55  ? -4.072  -8.527  -15.743 1.00 0.00 ? 55  GLN A HB3  3  
ATOM   7182  H  HG2  . GLN A 1 55  ? -3.540  -7.836  -12.869 1.00 0.00 ? 55  GLN A HG2  3  
ATOM   7183  H  HG3  . GLN A 1 55  ? -4.391  -6.679  -13.893 1.00 0.00 ? 55  GLN A HG3  3  
ATOM   7184  H  HE21 . GLN A 1 55  ? -6.599  -7.077  -14.304 1.00 0.00 ? 55  GLN A HE21 3  
ATOM   7185  H  HE22 . GLN A 1 55  ? -7.410  -8.489  -13.828 1.00 0.00 ? 55  GLN A HE22 3  
ATOM   7186  N  N    . ALA A 1 56  ? -2.681  -11.161 -16.266 1.00 0.00 ? 56  ALA A N    3  
ATOM   7187  C  CA   . ALA A 1 56  ? -2.258  -11.900 -17.450 1.00 0.00 ? 56  ALA A CA   3  
ATOM   7188  C  C    . ALA A 1 56  ? -3.475  -12.413 -18.223 1.00 0.00 ? 56  ALA A C    3  
ATOM   7189  O  O    . ALA A 1 56  ? -4.556  -12.580 -17.657 1.00 0.00 ? 56  ALA A O    3  
ATOM   7190  C  CB   . ALA A 1 56  ? -1.367  -13.077 -17.037 1.00 0.00 ? 56  ALA A CB   3  
ATOM   7191  H  H    . ALA A 1 56  ? -3.496  -11.433 -15.794 1.00 0.00 ? 56  ALA A H    3  
ATOM   7192  H  HA   . ALA A 1 56  ? -1.690  -11.239 -18.084 1.00 0.00 ? 56  ALA A HA   3  
ATOM   7193  H  HB1  . ALA A 1 56  ? -0.331  -12.776 -17.082 1.00 0.00 ? 56  ALA A HB1  3  
ATOM   7194  H  HB2  . ALA A 1 56  ? -1.528  -13.911 -17.706 1.00 0.00 ? 56  ALA A HB2  3  
ATOM   7195  H  HB3  . ALA A 1 56  ? -1.611  -13.374 -16.028 1.00 0.00 ? 56  ALA A HB3  3  
ATOM   7196  N  N    . PRO A 1 57  ? -3.319  -12.662 -19.501 1.00 0.00 ? 57  PRO A N    3  
ATOM   7197  C  CA   . PRO A 1 57  ? -4.426  -13.165 -20.367 1.00 0.00 ? 57  PRO A CA   3  
ATOM   7198  C  C    . PRO A 1 57  ? -4.710  -14.652 -20.149 1.00 0.00 ? 57  PRO A C    3  
ATOM   7199  O  O    . PRO A 1 57  ? -5.153  -15.347 -21.063 1.00 0.00 ? 57  PRO A O    3  
ATOM   7200  C  CB   . PRO A 1 57  ? -3.902  -12.920 -21.781 1.00 0.00 ? 57  PRO A CB   3  
ATOM   7201  C  CG   . PRO A 1 57  ? -2.419  -13.014 -21.659 1.00 0.00 ? 57  PRO A CG   3  
ATOM   7202  C  CD   . PRO A 1 57  ? -2.069  -12.491 -20.264 1.00 0.00 ? 57  PRO A CD   3  
ATOM   7203  H  HA   . PRO A 1 57  ? -5.320  -12.586 -20.209 1.00 0.00 ? 57  PRO A HA   3  
ATOM   7204  H  HB2  . PRO A 1 57  ? -4.277  -13.676 -22.458 1.00 0.00 ? 57  PRO A HB2  3  
ATOM   7205  H  HB3  . PRO A 1 57  ? -4.184  -11.935 -22.121 1.00 0.00 ? 57  PRO A HB3  3  
ATOM   7206  H  HG2  . PRO A 1 57  ? -2.104  -14.044 -21.764 1.00 0.00 ? 57  PRO A HG2  3  
ATOM   7207  H  HG3  . PRO A 1 57  ? -1.943  -12.398 -22.408 1.00 0.00 ? 57  PRO A HG3  3  
ATOM   7208  H  HD2  . PRO A 1 57  ? -1.269  -13.077 -19.831 1.00 0.00 ? 57  PRO A HD2  3  
ATOM   7209  H  HD3  . PRO A 1 57  ? -1.799  -11.448 -20.313 1.00 0.00 ? 57  PRO A HD3  3  
ATOM   7210  N  N    . HIS A 1 58  ? -4.450  -15.135 -18.937 1.00 0.00 ? 58  HIS A N    3  
ATOM   7211  C  CA   . HIS A 1 58  ? -4.681  -16.543 -18.616 1.00 0.00 ? 58  HIS A CA   3  
ATOM   7212  C  C    . HIS A 1 58  ? -5.836  -16.689 -17.630 1.00 0.00 ? 58  HIS A C    3  
ATOM   7213  O  O    . HIS A 1 58  ? -6.584  -17.666 -17.677 1.00 0.00 ? 58  HIS A O    3  
ATOM   7214  C  CB   . HIS A 1 58  ? -3.414  -17.154 -18.014 1.00 0.00 ? 58  HIS A CB   3  
ATOM   7215  C  CG   . HIS A 1 58  ? -3.627  -18.625 -17.781 1.00 0.00 ? 58  HIS A CG   3  
ATOM   7216  N  ND1  . HIS A 1 58  ? -4.285  -19.432 -18.695 1.00 0.00 ? 58  HIS A ND1  3  
ATOM   7217  C  CD2  . HIS A 1 58  ? -3.271  -19.450 -16.742 1.00 0.00 ? 58  HIS A CD2  3  
ATOM   7218  C  CE1  . HIS A 1 58  ? -4.304  -20.681 -18.194 1.00 0.00 ? 58  HIS A CE1  3  
ATOM   7219  N  NE2  . HIS A 1 58  ? -3.699  -20.747 -17.006 1.00 0.00 ? 58  HIS A NE2  3  
ATOM   7220  H  H    . HIS A 1 58  ? -4.096  -14.536 -18.246 1.00 0.00 ? 58  HIS A H    3  
ATOM   7221  H  HA   . HIS A 1 58  ? -4.926  -17.077 -19.523 1.00 0.00 ? 58  HIS A HA   3  
ATOM   7222  H  HB2  . HIS A 1 58  ? -2.588  -17.014 -18.696 1.00 0.00 ? 58  HIS A HB2  3  
ATOM   7223  H  HB3  . HIS A 1 58  ? -3.190  -16.670 -17.075 1.00 0.00 ? 58  HIS A HB3  3  
ATOM   7224  H  HD1  . HIS A 1 58  ? -4.667  -19.145 -19.550 1.00 0.00 ? 58  HIS A HD1  3  
ATOM   7225  H  HD2  . HIS A 1 58  ? -2.739  -19.138 -15.854 1.00 0.00 ? 58  HIS A HD2  3  
ATOM   7226  H  HE1  . HIS A 1 58  ? -4.754  -21.526 -18.693 1.00 0.00 ? 58  HIS A HE1  3  
ATOM   7227  H  HE2  . HIS A 1 58  ? -3.581  -21.540 -16.441 1.00 0.00 ? 58  HIS A HE2  3  
ATOM   7228  N  N    . LYS A 1 59  ? -5.974  -15.715 -16.738 1.00 0.00 ? 59  LYS A N    3  
ATOM   7229  C  CA   . LYS A 1 59  ? -7.040  -15.746 -15.743 1.00 0.00 ? 59  LYS A CA   3  
ATOM   7230  C  C    . LYS A 1 59  ? -8.377  -16.088 -16.396 1.00 0.00 ? 59  LYS A C    3  
ATOM   7231  O  O    . LYS A 1 59  ? -8.810  -15.417 -17.332 1.00 0.00 ? 59  LYS A O    3  
ATOM   7232  C  CB   . LYS A 1 59  ? -7.142  -14.387 -15.042 1.00 0.00 ? 59  LYS A CB   3  
ATOM   7233  C  CG   . LYS A 1 59  ? -5.779  -14.009 -14.452 1.00 0.00 ? 59  LYS A CG   3  
ATOM   7234  C  CD   . LYS A 1 59  ? -5.628  -14.627 -13.059 1.00 0.00 ? 59  LYS A CD   3  
ATOM   7235  C  CE   . LYS A 1 59  ? -6.235  -13.693 -12.012 1.00 0.00 ? 59  LYS A CE   3  
ATOM   7236  N  NZ   . LYS A 1 59  ? -5.997  -14.251 -10.651 1.00 0.00 ? 59  LYS A NZ   3  
ATOM   7237  H  H    . LYS A 1 59  ? -5.347  -14.961 -16.748 1.00 0.00 ? 59  LYS A H    3  
ATOM   7238  H  HA   . LYS A 1 59  ? -6.808  -16.501 -15.006 1.00 0.00 ? 59  LYS A HA   3  
ATOM   7239  H  HB2  . LYS A 1 59  ? -7.446  -13.637 -15.757 1.00 0.00 ? 59  LYS A HB2  3  
ATOM   7240  H  HB3  . LYS A 1 59  ? -7.871  -14.446 -14.248 1.00 0.00 ? 59  LYS A HB3  3  
ATOM   7241  H  HG2  . LYS A 1 59  ? -4.993  -14.374 -15.095 1.00 0.00 ? 59  LYS A HG2  3  
ATOM   7242  H  HG3  . LYS A 1 59  ? -5.708  -12.934 -14.375 1.00 0.00 ? 59  LYS A HG3  3  
ATOM   7243  H  HD2  . LYS A 1 59  ? -6.138  -15.580 -13.030 1.00 0.00 ? 59  LYS A HD2  3  
ATOM   7244  H  HD3  . LYS A 1 59  ? -4.580  -14.774 -12.842 1.00 0.00 ? 59  LYS A HD3  3  
ATOM   7245  H  HE2  . LYS A 1 59  ? -5.774  -12.718 -12.088 1.00 0.00 ? 59  LYS A HE2  3  
ATOM   7246  H  HE3  . LYS A 1 59  ? -7.298  -13.601 -12.183 1.00 0.00 ? 59  LYS A HE3  3  
ATOM   7247  H  HZ1  . LYS A 1 59  ? -5.785  -15.266 -10.725 1.00 0.00 ? 59  LYS A HZ1  3  
ATOM   7248  H  HZ2  . LYS A 1 59  ? -6.847  -14.118 -10.068 1.00 0.00 ? 59  LYS A HZ2  3  
ATOM   7249  H  HZ3  . LYS A 1 59  ? -5.193  -13.759 -10.211 1.00 0.00 ? 59  LYS A HZ3  3  
ATOM   7250  N  N    . HIS A 1 60  ? -9.021  -17.137 -15.895 1.00 0.00 ? 60  HIS A N    3  
ATOM   7251  C  CA   . HIS A 1 60  ? -10.307 -17.569 -16.435 1.00 0.00 ? 60  HIS A CA   3  
ATOM   7252  C  C    . HIS A 1 60  ? -11.140 -16.372 -16.886 1.00 0.00 ? 60  HIS A C    3  
ATOM   7253  O  O    . HIS A 1 60  ? -11.899 -16.463 -17.851 1.00 0.00 ? 60  HIS A O    3  
ATOM   7254  C  CB   . HIS A 1 60  ? -11.078 -18.358 -15.374 1.00 0.00 ? 60  HIS A CB   3  
ATOM   7255  C  CG   . HIS A 1 60  ? -10.224 -19.489 -14.872 1.00 0.00 ? 60  HIS A CG   3  
ATOM   7256  N  ND1  . HIS A 1 60  ? -9.846  -20.548 -15.684 1.00 0.00 ? 60  HIS A ND1  3  
ATOM   7257  C  CD2  . HIS A 1 60  ? -9.665  -19.741 -13.644 1.00 0.00 ? 60  HIS A CD2  3  
ATOM   7258  C  CE1  . HIS A 1 60  ? -9.093  -21.380 -14.940 1.00 0.00 ? 60  HIS A CE1  3  
ATOM   7259  N  NE2  . HIS A 1 60  ? -8.951  -20.935 -13.690 1.00 0.00 ? 60  HIS A NE2  3  
ATOM   7260  H  H    . HIS A 1 60  ? -8.623  -17.633 -15.149 1.00 0.00 ? 60  HIS A H    3  
ATOM   7261  H  HA   . HIS A 1 60  ? -10.132 -18.211 -17.284 1.00 0.00 ? 60  HIS A HA   3  
ATOM   7262  H  HB2  . HIS A 1 60  ? -11.330 -17.704 -14.551 1.00 0.00 ? 60  HIS A HB2  3  
ATOM   7263  H  HB3  . HIS A 1 60  ? -11.984 -18.756 -15.807 1.00 0.00 ? 60  HIS A HB3  3  
ATOM   7264  H  HD1  . HIS A 1 60  ? -10.085 -20.669 -16.627 1.00 0.00 ? 60  HIS A HD1  3  
ATOM   7265  H  HD2  . HIS A 1 60  ? -9.763  -19.109 -12.774 1.00 0.00 ? 60  HIS A HD2  3  
ATOM   7266  H  HE1  . HIS A 1 60  ? -8.656  -22.295 -15.311 1.00 0.00 ? 60  HIS A HE1  3  
ATOM   7267  H  HE2  . HIS A 1 60  ? -8.451  -21.358 -12.960 1.00 0.00 ? 60  HIS A HE2  3  
ATOM   7268  N  N    . GLY A 1 61  ? -10.996 -15.253 -16.183 1.00 0.00 ? 61  GLY A N    3  
ATOM   7269  C  CA   . GLY A 1 61  ? -11.745 -14.045 -16.522 1.00 0.00 ? 61  GLY A CA   3  
ATOM   7270  C  C    . GLY A 1 61  ? -10.861 -12.806 -16.414 1.00 0.00 ? 61  GLY A C    3  
ATOM   7271  O  O    . GLY A 1 61  ? -9.966  -12.743 -15.572 1.00 0.00 ? 61  GLY A O    3  
ATOM   7272  H  H    . GLY A 1 61  ? -10.378 -15.238 -15.423 1.00 0.00 ? 61  GLY A H    3  
ATOM   7273  H  HA2  . GLY A 1 61  ? -12.116 -14.128 -17.534 1.00 0.00 ? 61  GLY A HA2  3  
ATOM   7274  H  HA3  . GLY A 1 61  ? -12.578 -13.942 -15.845 1.00 0.00 ? 61  GLY A HA3  3  
ATOM   7275  N  N    . PHE A 1 62  ? -11.120 -11.826 -17.274 1.00 0.00 ? 62  PHE A N    3  
ATOM   7276  C  CA   . PHE A 1 62  ? -10.341 -10.591 -17.270 1.00 0.00 ? 62  PHE A CA   3  
ATOM   7277  C  C    . PHE A 1 62  ? -11.053 -9.504  -16.474 1.00 0.00 ? 62  PHE A C    3  
ATOM   7278  O  O    . PHE A 1 62  ? -12.169 -9.104  -16.808 1.00 0.00 ? 62  PHE A O    3  
ATOM   7279  C  CB   . PHE A 1 62  ? -10.118 -10.109 -18.705 1.00 0.00 ? 62  PHE A CB   3  
ATOM   7280  C  CG   . PHE A 1 62  ? -11.446 -10.011 -19.420 1.00 0.00 ? 62  PHE A CG   3  
ATOM   7281  C  CD1  . PHE A 1 62  ? -12.190 -8.828  -19.356 1.00 0.00 ? 62  PHE A CD1  3  
ATOM   7282  C  CD2  . PHE A 1 62  ? -11.929 -11.105 -20.149 1.00 0.00 ? 62  PHE A CD2  3  
ATOM   7283  C  CE1  . PHE A 1 62  ? -13.418 -8.737  -20.021 1.00 0.00 ? 62  PHE A CE1  3  
ATOM   7284  C  CE2  . PHE A 1 62  ? -13.158 -11.014 -20.813 1.00 0.00 ? 62  PHE A CE2  3  
ATOM   7285  C  CZ   . PHE A 1 62  ? -13.902 -9.830  -20.751 1.00 0.00 ? 62  PHE A CZ   3  
ATOM   7286  H  H    . PHE A 1 62  ? -11.845 -11.934 -17.924 1.00 0.00 ? 62  PHE A H    3  
ATOM   7287  H  HA   . PHE A 1 62  ? -9.380  -10.784 -16.816 1.00 0.00 ? 62  PHE A HA   3  
ATOM   7288  H  HB2  . PHE A 1 62  ? -9.647  -9.138  -18.688 1.00 0.00 ? 62  PHE A HB2  3  
ATOM   7289  H  HB3  . PHE A 1 62  ? -9.481  -10.808 -19.225 1.00 0.00 ? 62  PHE A HB3  3  
ATOM   7290  H  HD1  . PHE A 1 62  ? -11.817 -7.985  -18.794 1.00 0.00 ? 62  PHE A HD1  3  
ATOM   7291  H  HD2  . PHE A 1 62  ? -11.354 -12.017 -20.198 1.00 0.00 ? 62  PHE A HD2  3  
ATOM   7292  H  HE1  . PHE A 1 62  ? -13.993 -7.824  -19.973 1.00 0.00 ? 62  PHE A HE1  3  
ATOM   7293  H  HE2  . PHE A 1 62  ? -13.531 -11.857 -21.376 1.00 0.00 ? 62  PHE A HE2  3  
ATOM   7294  H  HZ   . PHE A 1 62  ? -14.851 -9.761  -21.264 1.00 0.00 ? 62  PHE A HZ   3  
ATOM   7295  N  N    . LEU A 1 63  ? -10.397 -9.023  -15.421 1.00 0.00 ? 63  LEU A N    3  
ATOM   7296  C  CA   . LEU A 1 63  ? -10.968 -7.973  -14.580 1.00 0.00 ? 63  LEU A CA   3  
ATOM   7297  C  C    . LEU A 1 63  ? -10.174 -6.680  -14.741 1.00 0.00 ? 63  LEU A C    3  
ATOM   7298  O  O    . LEU A 1 63  ? -9.125  -6.664  -15.384 1.00 0.00 ? 63  LEU A O    3  
ATOM   7299  C  CB   . LEU A 1 63  ? -10.951 -8.412  -13.114 1.00 0.00 ? 63  LEU A CB   3  
ATOM   7300  C  CG   . LEU A 1 63  ? -11.792 -9.681  -12.946 1.00 0.00 ? 63  LEU A CG   3  
ATOM   7301  C  CD1  . LEU A 1 63  ? -11.569 -10.262 -11.548 1.00 0.00 ? 63  LEU A CD1  3  
ATOM   7302  C  CD2  . LEU A 1 63  ? -13.278 -9.349  -13.122 1.00 0.00 ? 63  LEU A CD2  3  
ATOM   7303  H  H    . LEU A 1 63  ? -9.509  -9.378  -15.207 1.00 0.00 ? 63  LEU A H    3  
ATOM   7304  H  HA   . LEU A 1 63  ? -11.991 -7.795  -14.880 1.00 0.00 ? 63  LEU A HA   3  
ATOM   7305  H  HB2  . LEU A 1 63  ? -9.932  -8.614  -12.812 1.00 0.00 ? 63  LEU A HB2  3  
ATOM   7306  H  HB3  . LEU A 1 63  ? -11.358 -7.626  -12.497 1.00 0.00 ? 63  LEU A HB3  3  
ATOM   7307  H  HG   . LEU A 1 63  ? -11.495 -10.409 -13.686 1.00 0.00 ? 63  LEU A HG   3  
ATOM   7308  H  HD11 . LEU A 1 63  ? -10.538 -10.566 -11.444 1.00 0.00 ? 63  LEU A HD11 3  
ATOM   7309  H  HD12 . LEU A 1 63  ? -12.213 -11.119 -11.407 1.00 0.00 ? 63  LEU A HD12 3  
ATOM   7310  H  HD13 . LEU A 1 63  ? -11.800 -9.513  -10.805 1.00 0.00 ? 63  LEU A HD13 3  
ATOM   7311  H  HD21 . LEU A 1 63  ? -13.489 -8.385  -12.680 1.00 0.00 ? 63  LEU A HD21 3  
ATOM   7312  H  HD22 . LEU A 1 63  ? -13.876 -10.105 -12.634 1.00 0.00 ? 63  LEU A HD22 3  
ATOM   7313  H  HD23 . LEU A 1 63  ? -13.520 -9.323  -14.173 1.00 0.00 ? 63  LEU A HD23 3  
ATOM   7314  N  N    . GLU A 1 64  ? -10.680 -5.597  -14.159 1.00 0.00 ? 64  GLU A N    3  
ATOM   7315  C  CA   . GLU A 1 64  ? -10.004 -4.307  -14.253 1.00 0.00 ? 64  GLU A CA   3  
ATOM   7316  C  C    . GLU A 1 64  ? -8.647  -4.358  -13.560 1.00 0.00 ? 64  GLU A C    3  
ATOM   7317  O  O    . GLU A 1 64  ? -8.179  -5.424  -13.160 1.00 0.00 ? 64  GLU A O    3  
ATOM   7318  C  CB   . GLU A 1 64  ? -10.862 -3.209  -13.615 1.00 0.00 ? 64  GLU A CB   3  
ATOM   7319  C  CG   . GLU A 1 64  ? -11.616 -3.780  -12.412 1.00 0.00 ? 64  GLU A CG   3  
ATOM   7320  C  CD   . GLU A 1 64  ? -12.947 -4.371  -12.862 1.00 0.00 ? 64  GLU A CD   3  
ATOM   7321  O  OE1  . GLU A 1 64  ? -13.609 -3.742  -13.672 1.00 0.00 ? 64  GLU A OE1  3  
ATOM   7322  O  OE2  . GLU A 1 64  ? -13.287 -5.444  -12.390 1.00 0.00 ? 64  GLU A OE2  3  
ATOM   7323  H  H    . GLU A 1 64  ? -11.522 -5.667  -13.661 1.00 0.00 ? 64  GLU A H    3  
ATOM   7324  H  HA   . GLU A 1 64  ? -9.855  -4.068  -15.292 1.00 0.00 ? 64  GLU A HA   3  
ATOM   7325  H  HB2  . GLU A 1 64  ? -10.224 -2.396  -13.290 1.00 0.00 ? 64  GLU A HB2  3  
ATOM   7326  H  HB3  . GLU A 1 64  ? -11.571 -2.841  -14.343 1.00 0.00 ? 64  GLU A HB3  3  
ATOM   7327  H  HG2  . GLU A 1 64  ? -11.019 -4.552  -11.950 1.00 0.00 ? 64  GLU A HG2  3  
ATOM   7328  H  HG3  . GLU A 1 64  ? -11.798 -2.991  -11.698 1.00 0.00 ? 64  GLU A HG3  3  
ATOM   7329  N  N    . GLY A 1 65  ? -8.021  -3.193  -13.425 1.00 0.00 ? 65  GLY A N    3  
ATOM   7330  C  CA   . GLY A 1 65  ? -6.718  -3.105  -12.783 1.00 0.00 ? 65  GLY A CA   3  
ATOM   7331  C  C    . GLY A 1 65  ? -6.864  -2.840  -11.289 1.00 0.00 ? 65  GLY A C    3  
ATOM   7332  O  O    . GLY A 1 65  ? -6.736  -1.701  -10.836 1.00 0.00 ? 65  GLY A O    3  
ATOM   7333  H  H    . GLY A 1 65  ? -8.445  -2.377  -13.765 1.00 0.00 ? 65  GLY A H    3  
ATOM   7334  H  HA2  . GLY A 1 65  ? -6.185  -4.034  -12.931 1.00 0.00 ? 65  GLY A HA2  3  
ATOM   7335  H  HA3  . GLY A 1 65  ? -6.160  -2.299  -13.230 1.00 0.00 ? 65  GLY A HA3  3  
ATOM   7336  N  N    . ARG A 1 66  ? -7.131  -3.895  -10.529 1.00 0.00 ? 66  ARG A N    3  
ATOM   7337  C  CA   . ARG A 1 66  ? -7.292  -3.762  -9.085  1.00 0.00 ? 66  ARG A CA   3  
ATOM   7338  C  C    . ARG A 1 66  ? -5.980  -3.332  -8.437  1.00 0.00 ? 66  ARG A C    3  
ATOM   7339  O  O    . ARG A 1 66  ? -4.977  -4.042  -8.507  1.00 0.00 ? 66  ARG A O    3  
ATOM   7340  C  CB   . ARG A 1 66  ? -7.751  -5.098  -8.482  1.00 0.00 ? 66  ARG A CB   3  
ATOM   7341  C  CG   . ARG A 1 66  ? -9.280  -5.176  -8.494  1.00 0.00 ? 66  ARG A CG   3  
ATOM   7342  C  CD   . ARG A 1 66  ? -9.725  -6.569  -8.041  1.00 0.00 ? 66  ARG A CD   3  
ATOM   7343  N  NE   . ARG A 1 66  ? -11.168 -6.717  -8.198  1.00 0.00 ? 66  ARG A NE   3  
ATOM   7344  C  CZ   . ARG A 1 66  ? -11.770 -7.879  -7.964  1.00 0.00 ? 66  ARG A CZ   3  
ATOM   7345  N  NH1  . ARG A 1 66  ? -11.071 -8.913  -7.583  1.00 0.00 ? 66  ARG A NH1  3  
ATOM   7346  N  NH2  . ARG A 1 66  ? -13.063 -7.984  -8.114  1.00 0.00 ? 66  ARG A NH2  3  
ATOM   7347  H  H    . ARG A 1 66  ? -7.222  -4.777  -10.946 1.00 0.00 ? 66  ARG A H    3  
ATOM   7348  H  HA   . ARG A 1 66  ? -8.042  -3.011  -8.885  1.00 0.00 ? 66  ARG A HA   3  
ATOM   7349  H  HB2  . ARG A 1 66  ? -7.345  -5.912  -9.064  1.00 0.00 ? 66  ARG A HB2  3  
ATOM   7350  H  HB3  . ARG A 1 66  ? -7.399  -5.175  -7.462  1.00 0.00 ? 66  ARG A HB3  3  
ATOM   7351  H  HG2  . ARG A 1 66  ? -9.683  -4.431  -7.820  1.00 0.00 ? 66  ARG A HG2  3  
ATOM   7352  H  HG3  . ARG A 1 66  ? -9.643  -4.991  -9.493  1.00 0.00 ? 66  ARG A HG3  3  
ATOM   7353  H  HD2  . ARG A 1 66  ? -9.223  -7.316  -8.637  1.00 0.00 ? 66  ARG A HD2  3  
ATOM   7354  H  HD3  . ARG A 1 66  ? -9.460  -6.708  -7.002  1.00 0.00 ? 66  ARG A HD3  3  
ATOM   7355  H  HE   . ARG A 1 66  ? -11.702 -5.946  -8.482  1.00 0.00 ? 66  ARG A HE   3  
ATOM   7356  H  HH11 . ARG A 1 66  ? -10.081 -8.833  -7.468  1.00 0.00 ? 66  ARG A HH11 3  
ATOM   7357  H  HH12 . ARG A 1 66  ? -11.525 -9.786  -7.407  1.00 0.00 ? 66  ARG A HH12 3  
ATOM   7358  H  HH21 . ARG A 1 66  ? -13.599 -7.191  -8.405  1.00 0.00 ? 66  ARG A HH21 3  
ATOM   7359  H  HH22 . ARG A 1 66  ? -13.518 -8.858  -7.937  1.00 0.00 ? 66  ARG A HH22 3  
ATOM   7360  N  N    . HIS A 1 67  ? -5.999  -2.167  -7.798  1.00 0.00 ? 67  HIS A N    3  
ATOM   7361  C  CA   . HIS A 1 67  ? -4.816  -1.649  -7.131  1.00 0.00 ? 67  HIS A CA   3  
ATOM   7362  C  C    . HIS A 1 67  ? -4.845  -2.041  -5.654  1.00 0.00 ? 67  HIS A C    3  
ATOM   7363  O  O    . HIS A 1 67  ? -5.911  -2.269  -5.085  1.00 0.00 ? 67  HIS A O    3  
ATOM   7364  C  CB   . HIS A 1 67  ? -4.782  -0.125  -7.277  1.00 0.00 ? 67  HIS A CB   3  
ATOM   7365  C  CG   . HIS A 1 67  ? -4.375  0.268   -8.674  1.00 0.00 ? 67  HIS A CG   3  
ATOM   7366  N  ND1  . HIS A 1 67  ? -4.518  1.571   -9.133  1.00 0.00 ? 67  HIS A ND1  3  
ATOM   7367  C  CD2  . HIS A 1 67  ? -3.848  -0.445  -9.727  1.00 0.00 ? 67  HIS A CD2  3  
ATOM   7368  C  CE1  . HIS A 1 67  ? -4.085  1.600   -10.407 1.00 0.00 ? 67  HIS A CE1  3  
ATOM   7369  N  NE2  . HIS A 1 67  ? -3.666  0.401   -10.817 1.00 0.00 ? 67  HIS A NE2  3  
ATOM   7370  H  H    . HIS A 1 67  ? -6.827  -1.645  -7.769  1.00 0.00 ? 67  HIS A H    3  
ATOM   7371  H  HA   . HIS A 1 67  ? -3.935  -2.071  -7.584  1.00 0.00 ? 67  HIS A HA   3  
ATOM   7372  H  HB2  . HIS A 1 67  ? -5.765  0.268   -7.088  1.00 0.00 ? 67  HIS A HB2  3  
ATOM   7373  H  HB3  . HIS A 1 67  ? -4.082  0.291   -6.568  1.00 0.00 ? 67  HIS A HB3  3  
ATOM   7374  H  HD2  . HIS A 1 67  ? -3.612  -1.498  -9.715  1.00 0.00 ? 67  HIS A HD2  3  
ATOM   7375  H  HE1  . HIS A 1 67  ? -4.076  2.488   -11.022 1.00 0.00 ? 67  HIS A HE1  3  
ATOM   7376  H  HE2  . HIS A 1 67  ? -3.308  0.164   -11.698 1.00 0.00 ? 67  HIS A HE2  3  
ATOM   7377  N  N    . ALA A 1 68  ? -3.667  -2.131  -5.046  1.00 0.00 ? 68  ALA A N    3  
ATOM   7378  C  CA   . ALA A 1 68  ? -3.562  -2.510  -3.638  1.00 0.00 ? 68  ALA A CA   3  
ATOM   7379  C  C    . ALA A 1 68  ? -4.776  -2.030  -2.836  1.00 0.00 ? 68  ALA A C    3  
ATOM   7380  O  O    . ALA A 1 68  ? -5.229  -2.704  -1.908  1.00 0.00 ? 68  ALA A O    3  
ATOM   7381  C  CB   . ALA A 1 68  ? -2.278  -1.929  -3.049  1.00 0.00 ? 68  ALA A CB   3  
ATOM   7382  H  H    . ALA A 1 68  ? -2.850  -1.948  -5.556  1.00 0.00 ? 68  ALA A H    3  
ATOM   7383  H  HA   . ALA A 1 68  ? -3.510  -3.586  -3.575  1.00 0.00 ? 68  ALA A HA   3  
ATOM   7384  H  HB1  . ALA A 1 68  ? -1.487  -1.993  -3.784  1.00 0.00 ? 68  ALA A HB1  3  
ATOM   7385  H  HB2  . ALA A 1 68  ? -1.999  -2.491  -2.170  1.00 0.00 ? 68  ALA A HB2  3  
ATOM   7386  H  HB3  . ALA A 1 68  ? -2.438  -0.896  -2.784  1.00 0.00 ? 68  ALA A HB3  3  
ATOM   7387  N  N    . GLU A 1 69  ? -5.308  -0.867  -3.202  1.00 0.00 ? 69  GLU A N    3  
ATOM   7388  C  CA   . GLU A 1 69  ? -6.477  -0.327  -2.508  1.00 0.00 ? 69  GLU A CA   3  
ATOM   7389  C  C    . GLU A 1 69  ? -7.642  -1.314  -2.614  1.00 0.00 ? 69  GLU A C    3  
ATOM   7390  O  O    . GLU A 1 69  ? -8.103  -1.862  -1.611  1.00 0.00 ? 69  GLU A O    3  
ATOM   7391  C  CB   . GLU A 1 69  ? -6.882  1.043   -3.100  1.00 0.00 ? 69  GLU A CB   3  
ATOM   7392  C  CG   . GLU A 1 69  ? -5.937  1.411   -4.241  1.00 0.00 ? 69  GLU A CG   3  
ATOM   7393  C  CD   . GLU A 1 69  ? -4.527  1.642   -3.703  1.00 0.00 ? 69  GLU A CD   3  
ATOM   7394  O  OE1  . GLU A 1 69  ? -4.412  2.085   -2.572  1.00 0.00 ? 69  GLU A OE1  3  
ATOM   7395  O  OE2  . GLU A 1 69  ? -3.586  1.373   -4.430  1.00 0.00 ? 69  GLU A OE2  3  
ATOM   7396  H  H    . GLU A 1 69  ? -4.914  -0.372  -3.948  1.00 0.00 ? 69  GLU A H    3  
ATOM   7397  H  HA   . GLU A 1 69  ? -6.229  -0.195  -1.469  1.00 0.00 ? 69  GLU A HA   3  
ATOM   7398  H  HB2  . GLU A 1 69  ? -7.895  0.998   -3.477  1.00 0.00 ? 69  GLU A HB2  3  
ATOM   7399  H  HB3  . GLU A 1 69  ? -6.825  1.802   -2.331  1.00 0.00 ? 69  GLU A HB3  3  
ATOM   7400  H  HG2  . GLU A 1 69  ? -5.919  0.605   -4.957  1.00 0.00 ? 69  GLU A HG2  3  
ATOM   7401  H  HG3  . GLU A 1 69  ? -6.288  2.314   -4.722  1.00 0.00 ? 69  GLU A HG3  3  
ATOM   7402  N  N    . LEU A 1 70  ? -8.101  -1.537  -3.843  1.00 0.00 ? 70  LEU A N    3  
ATOM   7403  C  CA   . LEU A 1 70  ? -9.207  -2.459  -4.086  1.00 0.00 ? 70  LEU A CA   3  
ATOM   7404  C  C    . LEU A 1 70  ? -8.803  -3.879  -3.703  1.00 0.00 ? 70  LEU A C    3  
ATOM   7405  O  O    . LEU A 1 70  ? -9.655  -4.743  -3.495  1.00 0.00 ? 70  LEU A O    3  
ATOM   7406  C  CB   . LEU A 1 70  ? -9.633  -2.436  -5.558  1.00 0.00 ? 70  LEU A CB   3  
ATOM   7407  C  CG   . LEU A 1 70  ? -9.698  -0.989  -6.084  1.00 0.00 ? 70  LEU A CG   3  
ATOM   7408  C  CD1  . LEU A 1 70  ? -10.410 -0.082  -5.066  1.00 0.00 ? 70  LEU A CD1  3  
ATOM   7409  C  CD2  . LEU A 1 70  ? -8.280  -0.455  -6.360  1.00 0.00 ? 70  LEU A CD2  3  
ATOM   7410  H  H    . LEU A 1 70  ? -7.685  -1.078  -4.595  1.00 0.00 ? 70  LEU A H    3  
ATOM   7411  H  HA   . LEU A 1 70  ? -10.045 -2.160  -3.488  1.00 0.00 ? 70  LEU A HA   3  
ATOM   7412  H  HB2  . LEU A 1 70  ? -8.930  -3.005  -6.147  1.00 0.00 ? 70  LEU A HB2  3  
ATOM   7413  H  HB3  . LEU A 1 70  ? -10.611 -2.885  -5.647  1.00 0.00 ? 70  LEU A HB3  3  
ATOM   7414  H  HG   . LEU A 1 70  ? -10.260 -0.982  -7.006  1.00 0.00 ? 70  LEU A HG   3  
ATOM   7415  H  HD11 . LEU A 1 70  ? -9.821  -0.007  -4.164  1.00 0.00 ? 70  LEU A HD11 3  
ATOM   7416  H  HD12 . LEU A 1 70  ? -11.378 -0.494  -4.830  1.00 0.00 ? 70  LEU A HD12 3  
ATOM   7417  H  HD13 . LEU A 1 70  ? -10.535 0.902   -5.490  1.00 0.00 ? 70  LEU A HD13 3  
ATOM   7418  H  HD21 . LEU A 1 70  ? -7.558  -1.252  -6.272  1.00 0.00 ? 70  LEU A HD21 3  
ATOM   7419  H  HD22 . LEU A 1 70  ? -8.039  0.325   -5.654  1.00 0.00 ? 70  LEU A HD22 3  
ATOM   7420  H  HD23 . LEU A 1 70  ? -8.242  -0.055  -7.358  1.00 0.00 ? 70  LEU A HD23 3  
ATOM   7421  N  N    . CYS A 1 71  ? -7.497  -4.114  -3.623  1.00 0.00 ? 71  CYS A N    3  
ATOM   7422  C  CA   . CYS A 1 71  ? -6.989  -5.440  -3.276  1.00 0.00 ? 71  CYS A CA   3  
ATOM   7423  C  C    . CYS A 1 71  ? -7.488  -5.896  -1.902  1.00 0.00 ? 71  CYS A C    3  
ATOM   7424  O  O    . CYS A 1 71  ? -8.247  -6.867  -1.804  1.00 0.00 ? 71  CYS A O    3  
ATOM   7425  C  CB   . CYS A 1 71  ? -5.461  -5.455  -3.306  1.00 0.00 ? 71  CYS A CB   3  
ATOM   7426  S  SG   . CYS A 1 71  ? -4.887  -7.158  -3.132  1.00 0.00 ? 71  CYS A SG   3  
ATOM   7427  H  H    . CYS A 1 71  ? -6.865  -3.386  -3.813  1.00 0.00 ? 71  CYS A H    3  
ATOM   7428  H  HA   . CYS A 1 71  ? -7.348  -6.142  -4.016  1.00 0.00 ? 71  CYS A HA   3  
ATOM   7429  H  HB2  . CYS A 1 71  ? -5.117  -5.054  -4.248  1.00 0.00 ? 71  CYS A HB2  3  
ATOM   7430  H  HB3  . CYS A 1 71  ? -5.071  -4.861  -2.495  1.00 0.00 ? 71  CYS A HB3  3  
ATOM   7431  H  HG   . CYS A 1 71  ? -5.549  -7.735  -3.520  1.00 0.00 ? 71  CYS A HG   3  
ATOM   7432  N  N    . PHE A 1 72  ? -7.091  -5.207  -0.832  1.00 0.00 ? 72  PHE A N    3  
ATOM   7433  C  CA   . PHE A 1 72  ? -7.570  -5.622  0.482   1.00 0.00 ? 72  PHE A CA   3  
ATOM   7434  C  C    . PHE A 1 72  ? -9.073  -5.479  0.492   1.00 0.00 ? 72  PHE A C    3  
ATOM   7435  O  O    . PHE A 1 72  ? -9.795  -6.355  0.953   1.00 0.00 ? 72  PHE A O    3  
ATOM   7436  C  CB   . PHE A 1 72  ? -6.939  -4.824  1.625   1.00 0.00 ? 72  PHE A CB   3  
ATOM   7437  C  CG   . PHE A 1 72  ? -7.002  -3.342  1.361   1.00 0.00 ? 72  PHE A CG   3  
ATOM   7438  C  CD1  . PHE A 1 72  ? -8.204  -2.643  1.538   1.00 0.00 ? 72  PHE A CD1  3  
ATOM   7439  C  CD2  . PHE A 1 72  ? -5.847  -2.658  0.964   1.00 0.00 ? 72  PHE A CD2  3  
ATOM   7440  C  CE1  . PHE A 1 72  ? -8.246  -1.271  1.313   1.00 0.00 ? 72  PHE A CE1  3  
ATOM   7441  C  CE2  . PHE A 1 72  ? -5.895  -1.288  0.741   1.00 0.00 ? 72  PHE A CE2  3  
ATOM   7442  C  CZ   . PHE A 1 72  ? -7.093  -0.597  0.915   1.00 0.00 ? 72  PHE A CZ   3  
ATOM   7443  H  H    . PHE A 1 72  ? -6.503  -4.424  -0.930  1.00 0.00 ? 72  PHE A H    3  
ATOM   7444  H  HA   . PHE A 1 72  ? -7.328  -6.669  0.614   1.00 0.00 ? 72  PHE A HA   3  
ATOM   7445  H  HB2  . PHE A 1 72  ? -7.466  -5.041  2.538   1.00 0.00 ? 72  PHE A HB2  3  
ATOM   7446  H  HB3  . PHE A 1 72  ? -5.911  -5.122  1.735   1.00 0.00 ? 72  PHE A HB3  3  
ATOM   7447  H  HD1  . PHE A 1 72  ? -9.097  -3.160  1.848   1.00 0.00 ? 72  PHE A HD1  3  
ATOM   7448  H  HD2  . PHE A 1 72  ? -4.920  -3.187  0.831   1.00 0.00 ? 72  PHE A HD2  3  
ATOM   7449  H  HE1  . PHE A 1 72  ? -9.168  -0.730  1.448   1.00 0.00 ? 72  PHE A HE1  3  
ATOM   7450  H  HE2  . PHE A 1 72  ? -5.006  -0.759  0.433   1.00 0.00 ? 72  PHE A HE2  3  
ATOM   7451  H  HZ   . PHE A 1 72  ? -7.127  0.454   0.744   1.00 0.00 ? 72  PHE A HZ   3  
ATOM   7452  N  N    . LEU A 1 73  ? -9.542  -4.389  -0.082  1.00 0.00 ? 73  LEU A N    3  
ATOM   7453  C  CA   . LEU A 1 73  ? -10.961 -4.161  -0.203  1.00 0.00 ? 73  LEU A CA   3  
ATOM   7454  C  C    . LEU A 1 73  ? -11.648 -5.478  -0.559  1.00 0.00 ? 73  LEU A C    3  
ATOM   7455  O  O    . LEU A 1 73  ? -12.814 -5.703  -0.235  1.00 0.00 ? 73  LEU A O    3  
ATOM   7456  C  CB   . LEU A 1 73  ? -11.147 -3.152  -1.323  1.00 0.00 ? 73  LEU A CB   3  
ATOM   7457  C  CG   . LEU A 1 73  ? -12.365 -2.265  -1.072  1.00 0.00 ? 73  LEU A CG   3  
ATOM   7458  C  CD1  . LEU A 1 73  ? -12.084 -1.293  0.094   1.00 0.00 ? 73  LEU A CD1  3  
ATOM   7459  C  CD2  . LEU A 1 73  ? -12.656 -1.486  -2.363  1.00 0.00 ? 73  LEU A CD2  3  
ATOM   7460  H  H    . LEU A 1 73  ? -8.918  -3.738  -0.475  1.00 0.00 ? 73  LEU A H    3  
ATOM   7461  H  HA   . LEU A 1 73  ? -11.358 -3.767  0.719   1.00 0.00 ? 73  LEU A HA   3  
ATOM   7462  H  HB2  . LEU A 1 73  ? -10.260 -2.541  -1.368  1.00 0.00 ? 73  LEU A HB2  3  
ATOM   7463  H  HB3  . LEU A 1 73  ? -11.269 -3.672  -2.263  1.00 0.00 ? 73  LEU A HB3  3  
ATOM   7464  H  HG   . LEU A 1 73  ? -13.215 -2.885  -0.826  1.00 0.00 ? 73  LEU A HG   3  
ATOM   7465  H  HD11 . LEU A 1 73  ? -12.377 -0.294  -0.179  1.00 0.00 ? 73  LEU A HD11 3  
ATOM   7466  H  HD12 . LEU A 1 73  ? -11.033 -1.298  0.334   1.00 0.00 ? 73  LEU A HD12 3  
ATOM   7467  H  HD13 . LEU A 1 73  ? -12.646 -1.603  0.962   1.00 0.00 ? 73  LEU A HD13 3  
ATOM   7468  H  HD21 . LEU A 1 73  ? -11.774 -0.939  -2.655  1.00 0.00 ? 73  LEU A HD21 3  
ATOM   7469  H  HD22 . LEU A 1 73  ? -13.473 -0.804  -2.202  1.00 0.00 ? 73  LEU A HD22 3  
ATOM   7470  H  HD23 . LEU A 1 73  ? -12.917 -2.175  -3.149  1.00 0.00 ? 73  LEU A HD23 3  
ATOM   7471  N  N    . ASP A 1 74  ? -10.891 -6.335  -1.241  1.00 0.00 ? 74  ASP A N    3  
ATOM   7472  C  CA   . ASP A 1 74  ? -11.392 -7.636  -1.668  1.00 0.00 ? 74  ASP A CA   3  
ATOM   7473  C  C    . ASP A 1 74  ? -11.047 -8.736  -0.665  1.00 0.00 ? 74  ASP A C    3  
ATOM   7474  O  O    . ASP A 1 74  ? -11.702 -9.776  -0.647  1.00 0.00 ? 74  ASP A O    3  
ATOM   7475  C  CB   . ASP A 1 74  ? -10.807 -7.993  -3.035  1.00 0.00 ? 74  ASP A CB   3  
ATOM   7476  C  CG   . ASP A 1 74  ? -11.528 -9.208  -3.612  1.00 0.00 ? 74  ASP A CG   3  
ATOM   7477  O  OD1  . ASP A 1 74  ? -12.719 -9.332  -3.380  1.00 0.00 ? 74  ASP A OD1  3  
ATOM   7478  O  OD2  . ASP A 1 74  ? -10.877 -9.995  -4.281  1.00 0.00 ? 74  ASP A OD2  3  
ATOM   7479  H  H    . ASP A 1 74  ? -9.971  -6.082  -1.467  1.00 0.00 ? 74  ASP A H    3  
ATOM   7480  H  HA   . ASP A 1 74  ? -12.468 -7.583  -1.756  1.00 0.00 ? 74  ASP A HA   3  
ATOM   7481  H  HB2  . ASP A 1 74  ? -10.927 -7.154  -3.705  1.00 0.00 ? 74  ASP A HB2  3  
ATOM   7482  H  HB3  . ASP A 1 74  ? -9.757  -8.219  -2.928  1.00 0.00 ? 74  ASP A HB3  3  
ATOM   7483  N  N    . VAL A 1 75  ? -10.020 -8.535  0.164   1.00 0.00 ? 75  VAL A N    3  
ATOM   7484  C  CA   . VAL A 1 75  ? -9.665  -9.568  1.120   1.00 0.00 ? 75  VAL A CA   3  
ATOM   7485  C  C    . VAL A 1 75  ? -10.655 -9.623  2.292   1.00 0.00 ? 75  VAL A C    3  
ATOM   7486  O  O    . VAL A 1 75  ? -11.138 -10.676 2.664   1.00 0.00 ? 75  VAL A O    3  
ATOM   7487  C  CB   . VAL A 1 75  ? -8.247  -9.372  1.664   1.00 0.00 ? 75  VAL A CB   3  
ATOM   7488  C  CG1  . VAL A 1 75  ? -8.239  -8.385  2.834   1.00 0.00 ? 75  VAL A CG1  3  
ATOM   7489  C  CG2  . VAL A 1 75  ? -7.764  -10.725 2.148   1.00 0.00 ? 75  VAL A CG2  3  
ATOM   7490  H  H    . VAL A 1 75  ? -9.499  -7.708  0.124   1.00 0.00 ? 75  VAL A H    3  
ATOM   7491  H  HA   . VAL A 1 75  ? -9.692  -10.512 0.600   1.00 0.00 ? 75  VAL A HA   3  
ATOM   7492  H  HB   . VAL A 1 75  ? -7.594  -9.013  0.886   1.00 0.00 ? 75  VAL A HB   3  
ATOM   7493  H  HG11 . VAL A 1 75  ? -8.720  -7.470  2.541   1.00 0.00 ? 75  VAL A HG11 3  
ATOM   7494  H  HG12 . VAL A 1 75  ? -7.222  -8.178  3.121   1.00 0.00 ? 75  VAL A HG12 3  
ATOM   7495  H  HG13 . VAL A 1 75  ? -8.761  -8.814  3.669   1.00 0.00 ? 75  VAL A HG13 3  
ATOM   7496  H  HG21 . VAL A 1 75  ? -8.576  -11.226 2.662   1.00 0.00 ? 75  VAL A HG21 3  
ATOM   7497  H  HG22 . VAL A 1 75  ? -6.938  -10.592 2.819   1.00 0.00 ? 75  VAL A HG22 3  
ATOM   7498  H  HG23 . VAL A 1 75  ? -7.460  -11.316 1.298   1.00 0.00 ? 75  VAL A HG23 3  
ATOM   7499  N  N    . ILE A 1 76  ? -10.930 -8.482  2.891   1.00 0.00 ? 76  ILE A N    3  
ATOM   7500  C  CA   . ILE A 1 76  ? -11.848 -8.440  4.038   1.00 0.00 ? 76  ILE A CA   3  
ATOM   7501  C  C    . ILE A 1 76  ? -13.022 -9.424  3.857   1.00 0.00 ? 76  ILE A C    3  
ATOM   7502  O  O    . ILE A 1 76  ? -13.268 -10.245 4.740   1.00 0.00 ? 76  ILE A O    3  
ATOM   7503  C  CB   . ILE A 1 76  ? -12.385 -7.011  4.281   1.00 0.00 ? 76  ILE A CB   3  
ATOM   7504  C  CG1  . ILE A 1 76  ? -11.483 -5.982  3.603   1.00 0.00 ? 76  ILE A CG1  3  
ATOM   7505  C  CG2  . ILE A 1 76  ? -12.429 -6.706  5.776   1.00 0.00 ? 76  ILE A CG2  3  
ATOM   7506  C  CD1  . ILE A 1 76  ? -10.105 -5.982  4.271   1.00 0.00 ? 76  ILE A CD1  3  
ATOM   7507  H  H    . ILE A 1 76  ? -10.493 -7.670  2.581   1.00 0.00 ? 76  ILE A H    3  
ATOM   7508  H  HA   . ILE A 1 76  ? -11.292 -8.750  4.911   1.00 0.00 ? 76  ILE A HA   3  
ATOM   7509  H  HB   . ILE A 1 76  ? -13.383 -6.927  3.888   1.00 0.00 ? 76  ILE A HB   3  
ATOM   7510  H  HG12 . ILE A 1 76  ? -11.386 -6.227  2.564   1.00 0.00 ? 76  ILE A HG12 3  
ATOM   7511  H  HG13 . ILE A 1 76  ? -11.923 -5.002  3.698   1.00 0.00 ? 76  ILE A HG13 3  
ATOM   7512  H  HG21 . ILE A 1 76  ? -11.465 -6.909  6.219   1.00 0.00 ? 76  ILE A HG21 3  
ATOM   7513  H  HG22 . ILE A 1 76  ? -13.181 -7.318  6.248   1.00 0.00 ? 76  ILE A HG22 3  
ATOM   7514  H  HG23 . ILE A 1 76  ? -12.673 -5.665  5.913   1.00 0.00 ? 76  ILE A HG23 3  
ATOM   7515  H  HD11 . ILE A 1 76  ? -9.822  -6.992  4.521   1.00 0.00 ? 76  ILE A HD11 3  
ATOM   7516  H  HD12 . ILE A 1 76  ? -10.141 -5.386  5.171   1.00 0.00 ? 76  ILE A HD12 3  
ATOM   7517  H  HD13 . ILE A 1 76  ? -9.380  -5.563  3.594   1.00 0.00 ? 76  ILE A HD13 3  
ATOM   7518  N  N    . PRO A 1 77  ? -13.745 -9.380  2.753   1.00 0.00 ? 77  PRO A N    3  
ATOM   7519  C  CA   . PRO A 1 77  ? -14.890 -10.313 2.516   1.00 0.00 ? 77  PRO A CA   3  
ATOM   7520  C  C    . PRO A 1 77  ? -14.396 -11.740 2.323   1.00 0.00 ? 77  PRO A C    3  
ATOM   7521  O  O    . PRO A 1 77  ? -15.174 -12.692 2.318   1.00 0.00 ? 77  PRO A O    3  
ATOM   7522  C  CB   . PRO A 1 77  ? -15.538 -9.772  1.238   1.00 0.00 ? 77  PRO A CB   3  
ATOM   7523  C  CG   . PRO A 1 77  ? -14.455 -9.057  0.528   1.00 0.00 ? 77  PRO A CG   3  
ATOM   7524  C  CD   . PRO A 1 77  ? -13.570 -8.464  1.614   1.00 0.00 ? 77  PRO A CD   3  
ATOM   7525  H  HA   . PRO A 1 77  ? -15.592 -10.264 3.332   1.00 0.00 ? 77  PRO A HA   3  
ATOM   7526  H  HB2  . PRO A 1 77  ? -15.915 -10.581 0.629   1.00 0.00 ? 77  PRO A HB2  3  
ATOM   7527  H  HB3  . PRO A 1 77  ? -16.322 -9.080  1.485   1.00 0.00 ? 77  PRO A HB3  3  
ATOM   7528  H  HG2  . PRO A 1 77  ? -13.894 -9.751  -0.082  1.00 0.00 ? 77  PRO A HG2  3  
ATOM   7529  H  HG3  . PRO A 1 77  ? -14.864 -8.267  -0.081  1.00 0.00 ? 77  PRO A HG3  3  
ATOM   7530  H  HD2  . PRO A 1 77  ? -12.563 -8.446  1.286   1.00 0.00 ? 77  PRO A HD2  3  
ATOM   7531  H  HD3  . PRO A 1 77  ? -13.903 -7.484  1.869   1.00 0.00 ? 77  PRO A HD3  3  
ATOM   7532  N  N    . PHE A 1 78  ? -13.087 -11.857 2.164   1.00 0.00 ? 78  PHE A N    3  
ATOM   7533  C  CA   . PHE A 1 78  ? -12.434 -13.156 1.970   1.00 0.00 ? 78  PHE A CA   3  
ATOM   7534  C  C    . PHE A 1 78  ? -12.511 -14.000 3.237   1.00 0.00 ? 78  PHE A C    3  
ATOM   7535  O  O    . PHE A 1 78  ? -12.869 -15.178 3.180   1.00 0.00 ? 78  PHE A O    3  
ATOM   7536  C  CB   . PHE A 1 78  ? -10.971 -12.928 1.583   1.00 0.00 ? 78  PHE A CB   3  
ATOM   7537  C  CG   . PHE A 1 78  ? -10.394 -14.126 0.894   1.00 0.00 ? 78  PHE A CG   3  
ATOM   7538  C  CD1  . PHE A 1 78  ? -10.534 -14.262 -0.487  1.00 0.00 ? 78  PHE A CD1  3  
ATOM   7539  C  CD2  . PHE A 1 78  ? -9.716  -15.094 1.635   1.00 0.00 ? 78  PHE A CD2  3  
ATOM   7540  C  CE1  . PHE A 1 78  ? -9.996  -15.380 -1.137  1.00 0.00 ? 78  PHE A CE1  3  
ATOM   7541  C  CE2  . PHE A 1 78  ? -9.177  -16.214 0.992   1.00 0.00 ? 78  PHE A CE2  3  
ATOM   7542  C  CZ   . PHE A 1 78  ? -9.319  -16.358 -0.396  1.00 0.00 ? 78  PHE A CZ   3  
ATOM   7543  H  H    . PHE A 1 78  ? -12.542 -11.040 2.176   1.00 0.00 ? 78  PHE A H    3  
ATOM   7544  H  HA   . PHE A 1 78  ? -12.929 -13.680 1.166   1.00 0.00 ? 78  PHE A HA   3  
ATOM   7545  H  HB2  . PHE A 1 78  ? -10.928 -12.100 0.912   1.00 0.00 ? 78  PHE A HB2  3  
ATOM   7546  H  HB3  . PHE A 1 78  ? -10.389 -12.717 2.470   1.00 0.00 ? 78  PHE A HB3  3  
ATOM   7547  H  HD1  . PHE A 1 78  ? -11.047 -13.495 -1.054  1.00 0.00 ? 78  PHE A HD1  3  
ATOM   7548  H  HD2  . PHE A 1 78  ? -9.602  -14.969 2.705   1.00 0.00 ? 78  PHE A HD2  3  
ATOM   7549  H  HE1  . PHE A 1 78  ? -10.106 -15.489 -2.205  1.00 0.00 ? 78  PHE A HE1  3  
ATOM   7550  H  HE2  . PHE A 1 78  ? -8.651  -16.965 1.563   1.00 0.00 ? 78  PHE A HE2  3  
ATOM   7551  H  HZ   . PHE A 1 78  ? -8.904  -17.222 -0.895  1.00 0.00 ? 78  PHE A HZ   3  
ATOM   7552  N  N    . TRP A 1 79  ? -12.187 -13.403 4.386   1.00 0.00 ? 79  TRP A N    3  
ATOM   7553  C  CA   . TRP A 1 79  ? -12.247 -14.141 5.638   1.00 0.00 ? 79  TRP A CA   3  
ATOM   7554  C  C    . TRP A 1 79  ? -13.710 -14.336 6.045   1.00 0.00 ? 79  TRP A C    3  
ATOM   7555  O  O    . TRP A 1 79  ? -14.040 -15.212 6.845   1.00 0.00 ? 79  TRP A O    3  
ATOM   7556  C  CB   . TRP A 1 79  ? -11.501 -13.397 6.751   1.00 0.00 ? 79  TRP A CB   3  
ATOM   7557  C  CG   . TRP A 1 79  ? -10.450 -12.479 6.203   1.00 0.00 ? 79  TRP A CG   3  
ATOM   7558  C  CD1  . TRP A 1 79  ? -9.625  -12.719 5.157   1.00 0.00 ? 79  TRP A CD1  3  
ATOM   7559  C  CD2  . TRP A 1 79  ? -10.106 -11.163 6.699   1.00 0.00 ? 79  TRP A CD2  3  
ATOM   7560  N  NE1  . TRP A 1 79  ? -8.791  -11.617 4.989   1.00 0.00 ? 79  TRP A NE1  3  
ATOM   7561  C  CE2  . TRP A 1 79  ? -9.058  -10.628 5.920   1.00 0.00 ? 79  TRP A CE2  3  
ATOM   7562  C  CE3  . TRP A 1 79  ? -10.613 -10.396 7.748   1.00 0.00 ? 79  TRP A CE3  3  
ATOM   7563  C  CZ2  . TRP A 1 79  ? -8.530  -9.355  6.187   1.00 0.00 ? 79  TRP A CZ2  3  
ATOM   7564  C  CZ3  . TRP A 1 79  ? -10.095 -9.124  8.020   1.00 0.00 ? 79  TRP A CZ3  3  
ATOM   7565  C  CH2  . TRP A 1 79  ? -9.059  -8.604  7.244   1.00 0.00 ? 79  TRP A CH2  3  
ATOM   7566  H  H    . TRP A 1 79  ? -11.917 -12.460 4.392   1.00 0.00 ? 79  TRP A H    3  
ATOM   7567  H  HA   . TRP A 1 79  ? -11.790 -15.110 5.496   1.00 0.00 ? 79  TRP A HA   3  
ATOM   7568  H  HB2  . TRP A 1 79  ? -12.207 -12.805 7.309   1.00 0.00 ? 79  TRP A HB2  3  
ATOM   7569  H  HB3  . TRP A 1 79  ? -11.037 -14.117 7.412   1.00 0.00 ? 79  TRP A HB3  3  
ATOM   7570  H  HD1  . TRP A 1 79  ? -9.613  -13.616 4.555   1.00 0.00 ? 79  TRP A HD1  3  
ATOM   7571  H  HE1  . TRP A 1 79  ? -8.098  -11.531 4.302   1.00 0.00 ? 79  TRP A HE1  3  
ATOM   7572  H  HE3  . TRP A 1 79  ? -11.410 -10.794 8.349   1.00 0.00 ? 79  TRP A HE3  3  
ATOM   7573  H  HZ2  . TRP A 1 79  ? -7.721  -8.955  5.589   1.00 0.00 ? 79  TRP A HZ2  3  
ATOM   7574  H  HZ3  . TRP A 1 79  ? -10.494 -8.547  8.836   1.00 0.00 ? 79  TRP A HZ3  3  
ATOM   7575  H  HH2  . TRP A 1 79  ? -8.677  -7.618  7.457   1.00 0.00 ? 79  TRP A HH2  3  
ATOM   7576  N  N    . LYS A 1 80  ? -14.575 -13.514 5.460   1.00 0.00 ? 80  LYS A N    3  
ATOM   7577  C  CA   . LYS A 1 80  ? -16.008 -13.573 5.711   1.00 0.00 ? 80  LYS A CA   3  
ATOM   7578  C  C    . LYS A 1 80  ? -16.367 -13.463 7.201   1.00 0.00 ? 80  LYS A C    3  
ATOM   7579  O  O    . LYS A 1 80  ? -17.078 -14.316 7.731   1.00 0.00 ? 80  LYS A O    3  
ATOM   7580  C  CB   . LYS A 1 80  ? -16.583 -14.871 5.130   1.00 0.00 ? 80  LYS A CB   3  
ATOM   7581  C  CG   . LYS A 1 80  ? -15.643 -15.429 4.062   1.00 0.00 ? 80  LYS A CG   3  
ATOM   7582  C  CD   . LYS A 1 80  ? -16.432 -16.333 3.110   1.00 0.00 ? 80  LYS A CD   3  
ATOM   7583  C  CE   . LYS A 1 80  ? -17.092 -15.481 2.020   1.00 0.00 ? 80  LYS A CE   3  
ATOM   7584  N  NZ   . LYS A 1 80  ? -18.349 -16.143 1.568   1.00 0.00 ? 80  LYS A NZ   3  
ATOM   7585  H  H    . LYS A 1 80  ? -14.244 -12.856 4.821   1.00 0.00 ? 80  LYS A H    3  
ATOM   7586  H  HA   . LYS A 1 80  ? -16.466 -12.749 5.193   1.00 0.00 ? 80  LYS A HA   3  
ATOM   7587  H  HB2  . LYS A 1 80  ? -16.706 -15.604 5.913   1.00 0.00 ? 80  LYS A HB2  3  
ATOM   7588  H  HB3  . LYS A 1 80  ? -17.538 -14.663 4.683   1.00 0.00 ? 80  LYS A HB3  3  
ATOM   7589  H  HG2  . LYS A 1 80  ? -15.203 -14.616 3.505   1.00 0.00 ? 80  LYS A HG2  3  
ATOM   7590  H  HG3  . LYS A 1 80  ? -14.866 -16.002 4.536   1.00 0.00 ? 80  LYS A HG3  3  
ATOM   7591  H  HD2  . LYS A 1 80  ? -15.762 -17.046 2.653   1.00 0.00 ? 80  LYS A HD2  3  
ATOM   7592  H  HD3  . LYS A 1 80  ? -17.195 -16.859 3.664   1.00 0.00 ? 80  LYS A HD3  3  
ATOM   7593  H  HE2  . LYS A 1 80  ? -17.325 -14.503 2.415   1.00 0.00 ? 80  LYS A HE2  3  
ATOM   7594  H  HE3  . LYS A 1 80  ? -16.418 -15.381 1.184   1.00 0.00 ? 80  LYS A HE3  3  
ATOM   7595  H  HZ1  . LYS A 1 80  ? -19.069 -16.066 2.313   1.00 0.00 ? 80  LYS A HZ1  3  
ATOM   7596  H  HZ2  . LYS A 1 80  ? -18.162 -17.146 1.371   1.00 0.00 ? 80  LYS A HZ2  3  
ATOM   7597  H  HZ3  . LYS A 1 80  ? -18.692 -15.677 0.702   1.00 0.00 ? 80  LYS A HZ3  3  
ATOM   7598  N  N    . LEU A 1 81  ? -15.912 -12.404 7.874   1.00 0.00 ? 81  LEU A N    3  
ATOM   7599  C  CA   . LEU A 1 81  ? -16.253 -12.232 9.280   1.00 0.00 ? 81  LEU A CA   3  
ATOM   7600  C  C    . LEU A 1 81  ? -17.739 -11.998 9.443   1.00 0.00 ? 81  LEU A C    3  
ATOM   7601  O  O    . LEU A 1 81  ? -18.574 -12.508 8.695   1.00 0.00 ? 81  LEU A O    3  
ATOM   7602  C  CB   . LEU A 1 81  ? -15.561 -11.015 9.878   1.00 0.00 ? 81  LEU A CB   3  
ATOM   7603  C  CG   . LEU A 1 81  ? -14.128 -10.915 9.373   1.00 0.00 ? 81  LEU A CG   3  
ATOM   7604  C  CD1  . LEU A 1 81  ? -14.081 -10.308 7.956   1.00 0.00 ? 81  LEU A CD1  3  
ATOM   7605  C  CD2  . LEU A 1 81  ? -13.374 -10.039 10.361  1.00 0.00 ? 81  LEU A CD2  3  
ATOM   7606  H  H    . LEU A 1 81  ? -15.365 -11.727 7.425   1.00 0.00 ? 81  LEU A H    3  
ATOM   7607  H  HA   . LEU A 1 81  ? -15.953 -13.096 9.836   1.00 0.00 ? 81  LEU A HA   3  
ATOM   7608  H  HB2  . LEU A 1 81  ? -16.116 -10.108 9.628   1.00 0.00 ? 81  LEU A HB2  3  
ATOM   7609  H  HB3  . LEU A 1 81  ? -15.548 -11.124 10.951  1.00 0.00 ? 81  LEU A HB3  3  
ATOM   7610  H  HG   . LEU A 1 81  ? -13.685 -11.900 9.356   1.00 0.00 ? 81  LEU A HG   3  
ATOM   7611  H  HD11 . LEU A 1 81  ? -15.067 -9.981  7.658   1.00 0.00 ? 81  LEU A HD11 3  
ATOM   7612  H  HD12 . LEU A 1 81  ? -13.734 -11.059 7.263   1.00 0.00 ? 81  LEU A HD12 3  
ATOM   7613  H  HD13 . LEU A 1 81  ? -13.402 -9.468  7.938   1.00 0.00 ? 81  LEU A HD13 3  
ATOM   7614  H  HD21 . LEU A 1 81  ? -12.438 -9.737  9.941   1.00 0.00 ? 81  LEU A HD21 3  
ATOM   7615  H  HD22 . LEU A 1 81  ? -13.204 -10.602 11.267  1.00 0.00 ? 81  LEU A HD22 3  
ATOM   7616  H  HD23 . LEU A 1 81  ? -13.971 -9.169  10.583  1.00 0.00 ? 81  LEU A HD23 3  
ATOM   7617  N  N    . ASP A 1 82  ? -18.020 -11.153 10.413  1.00 0.00 ? 82  ASP A N    3  
ATOM   7618  C  CA   . ASP A 1 82  ? -19.354 -10.720 10.724  1.00 0.00 ? 82  ASP A CA   3  
ATOM   7619  C  C    . ASP A 1 82  ? -19.314 -9.201  10.810  1.00 0.00 ? 82  ASP A C    3  
ATOM   7620  O  O    . ASP A 1 82  ? -18.367 -8.569  10.342  1.00 0.00 ? 82  ASP A O    3  
ATOM   7621  C  CB   . ASP A 1 82  ? -19.809 -11.317 12.062  1.00 0.00 ? 82  ASP A CB   3  
ATOM   7622  C  CG   . ASP A 1 82  ? -20.568 -12.618 11.824  1.00 0.00 ? 82  ASP A CG   3  
ATOM   7623  O  OD1  . ASP A 1 82  ? -19.945 -13.573 11.390  1.00 0.00 ? 82  ASP A OD1  3  
ATOM   7624  O  OD2  . ASP A 1 82  ? -21.761 -12.641 12.079  1.00 0.00 ? 82  ASP A OD2  3  
ATOM   7625  H  H    . ASP A 1 82  ? -17.272 -10.772 10.921  1.00 0.00 ? 82  ASP A H    3  
ATOM   7626  H  HA   . ASP A 1 82  ? -20.030 -11.021 9.936   1.00 0.00 ? 82  ASP A HA   3  
ATOM   7627  H  HB2  . ASP A 1 82  ? -18.944 -11.518 12.676  1.00 0.00 ? 82  ASP A HB2  3  
ATOM   7628  H  HB3  . ASP A 1 82  ? -20.454 -10.617 12.574  1.00 0.00 ? 82  ASP A HB3  3  
ATOM   7629  N  N    . LEU A 1 83  ? -20.321 -8.626  11.415  1.00 0.00 ? 83  LEU A N    3  
ATOM   7630  C  CA   . LEU A 1 83  ? -20.381 -7.186  11.574  1.00 0.00 ? 83  LEU A CA   3  
ATOM   7631  C  C    . LEU A 1 83  ? -19.765 -6.774  12.909  1.00 0.00 ? 83  LEU A C    3  
ATOM   7632  O  O    . LEU A 1 83  ? -19.053 -5.775  12.998  1.00 0.00 ? 83  LEU A O    3  
ATOM   7633  C  CB   . LEU A 1 83  ? -21.832 -6.734  11.509  1.00 0.00 ? 83  LEU A CB   3  
ATOM   7634  C  CG   . LEU A 1 83  ? -21.894 -5.285  11.020  1.00 0.00 ? 83  LEU A CG   3  
ATOM   7635  C  CD1  . LEU A 1 83  ? -23.346 -4.896  10.793  1.00 0.00 ? 83  LEU A CD1  3  
ATOM   7636  C  CD2  . LEU A 1 83  ? -21.261 -4.352  12.063  1.00 0.00 ? 83  LEU A CD2  3  
ATOM   7637  H  H    . LEU A 1 83  ? -21.031 -9.180  11.773  1.00 0.00 ? 83  LEU A H    3  
ATOM   7638  H  HA   . LEU A 1 83  ? -19.833 -6.719  10.773  1.00 0.00 ? 83  LEU A HA   3  
ATOM   7639  H  HB2  . LEU A 1 83  ? -22.374 -7.370  10.820  1.00 0.00 ? 83  LEU A HB2  3  
ATOM   7640  H  HB3  . LEU A 1 83  ? -22.273 -6.808  12.491  1.00 0.00 ? 83  LEU A HB3  3  
ATOM   7641  H  HG   . LEU A 1 83  ? -21.354 -5.198  10.086  1.00 0.00 ? 83  LEU A HG   3  
ATOM   7642  H  HD11 . LEU A 1 83  ? -23.393 -3.874  10.456  1.00 0.00 ? 83  LEU A HD11 3  
ATOM   7643  H  HD12 . LEU A 1 83  ? -23.892 -5.001  11.717  1.00 0.00 ? 83  LEU A HD12 3  
ATOM   7644  H  HD13 . LEU A 1 83  ? -23.774 -5.544  10.042  1.00 0.00 ? 83  LEU A HD13 3  
ATOM   7645  H  HD21 . LEU A 1 83  ? -21.347 -4.793  13.046  1.00 0.00 ? 83  LEU A HD21 3  
ATOM   7646  H  HD22 . LEU A 1 83  ? -21.767 -3.398  12.052  1.00 0.00 ? 83  LEU A HD22 3  
ATOM   7647  H  HD23 . LEU A 1 83  ? -20.218 -4.205  11.825  1.00 0.00 ? 83  LEU A HD23 3  
ATOM   7648  N  N    . ASP A 1 84  ? -20.051 -7.555  13.946  1.00 0.00 ? 84  ASP A N    3  
ATOM   7649  C  CA   . ASP A 1 84  ? -19.532 -7.270  15.280  1.00 0.00 ? 84  ASP A CA   3  
ATOM   7650  C  C    . ASP A 1 84  ? -18.007 -7.217  15.281  1.00 0.00 ? 84  ASP A C    3  
ATOM   7651  O  O    . ASP A 1 84  ? -17.399 -6.637  16.180  1.00 0.00 ? 84  ASP A O    3  
ATOM   7652  C  CB   . ASP A 1 84  ? -20.007 -8.345  16.259  1.00 0.00 ? 84  ASP A CB   3  
ATOM   7653  C  CG   . ASP A 1 84  ? -19.765 -7.886  17.693  1.00 0.00 ? 84  ASP A CG   3  
ATOM   7654  O  OD1  . ASP A 1 84  ? -18.645 -7.503  17.990  1.00 0.00 ? 84  ASP A OD1  3  
ATOM   7655  O  OD2  . ASP A 1 84  ? -20.704 -7.923  18.472  1.00 0.00 ? 84  ASP A OD2  3  
ATOM   7656  H  H    . ASP A 1 84  ? -20.627 -8.335  13.812  1.00 0.00 ? 84  ASP A H    3  
ATOM   7657  H  HA   . ASP A 1 84  ? -19.914 -6.314  15.606  1.00 0.00 ? 84  ASP A HA   3  
ATOM   7658  H  HB2  . ASP A 1 84  ? -21.062 -8.522  16.113  1.00 0.00 ? 84  ASP A HB2  3  
ATOM   7659  H  HB3  . ASP A 1 84  ? -19.462 -9.260  16.080  1.00 0.00 ? 84  ASP A HB3  3  
ATOM   7660  N  N    . GLN A 1 85  ? -17.389 -7.827  14.274  1.00 0.00 ? 85  GLN A N    3  
ATOM   7661  C  CA   . GLN A 1 85  ? -15.935 -7.841  14.184  1.00 0.00 ? 85  GLN A CA   3  
ATOM   7662  C  C    . GLN A 1 85  ? -15.449 -6.627  13.384  1.00 0.00 ? 85  GLN A C    3  
ATOM   7663  O  O    . GLN A 1 85  ? -16.257 -5.796  12.968  1.00 0.00 ? 85  GLN A O    3  
ATOM   7664  C  CB   . GLN A 1 85  ? -15.457 -9.151  13.528  1.00 0.00 ? 85  GLN A CB   3  
ATOM   7665  C  CG   . GLN A 1 85  ? -16.589 -10.185 13.533  1.00 0.00 ? 85  GLN A CG   3  
ATOM   7666  C  CD   . GLN A 1 85  ? -16.019 -11.592 13.384  1.00 0.00 ? 85  GLN A CD   3  
ATOM   7667  O  OE1  . GLN A 1 85  ? -16.532 -12.389 12.599  1.00 0.00 ? 85  GLN A OE1  3  
ATOM   7668  N  NE2  . GLN A 1 85  ? -14.983 -11.947 14.092  1.00 0.00 ? 85  GLN A NE2  3  
ATOM   7669  H  H    . GLN A 1 85  ? -17.915 -8.278  13.589  1.00 0.00 ? 85  GLN A H    3  
ATOM   7670  H  HA   . GLN A 1 85  ? -15.535 -7.783  15.183  1.00 0.00 ? 85  GLN A HA   3  
ATOM   7671  H  HB2  . GLN A 1 85  ? -15.156 -8.959  12.509  1.00 0.00 ? 85  GLN A HB2  3  
ATOM   7672  H  HB3  . GLN A 1 85  ? -14.619 -9.544  14.082  1.00 0.00 ? 85  GLN A HB3  3  
ATOM   7673  H  HG2  . GLN A 1 85  ? -17.131 -10.121 14.465  1.00 0.00 ? 85  GLN A HG2  3  
ATOM   7674  H  HG3  . GLN A 1 85  ? -17.259 -9.982  12.711  1.00 0.00 ? 85  GLN A HG3  3  
ATOM   7675  H  HE21 . GLN A 1 85  ? -14.576 -11.310 14.717  1.00 0.00 ? 85  GLN A HE21 3  
ATOM   7676  H  HE22 . GLN A 1 85  ? -14.611 -12.852 13.998  1.00 0.00 ? 85  GLN A HE22 3  
ATOM   7677  N  N    . ASP A 1 86  ? -14.135 -6.513  13.180  1.00 0.00 ? 86  ASP A N    3  
ATOM   7678  C  CA   . ASP A 1 86  ? -13.597 -5.369  12.436  1.00 0.00 ? 86  ASP A CA   3  
ATOM   7679  C  C    . ASP A 1 86  ? -12.353 -5.767  11.632  1.00 0.00 ? 86  ASP A C    3  
ATOM   7680  O  O    . ASP A 1 86  ? -11.871 -6.893  11.736  1.00 0.00 ? 86  ASP A O    3  
ATOM   7681  C  CB   . ASP A 1 86  ? -13.250 -4.232  13.422  1.00 0.00 ? 86  ASP A CB   3  
ATOM   7682  C  CG   . ASP A 1 86  ? -14.268 -3.097  13.316  1.00 0.00 ? 86  ASP A CG   3  
ATOM   7683  O  OD1  . ASP A 1 86  ? -15.272 -3.162  14.007  1.00 0.00 ? 86  ASP A OD1  3  
ATOM   7684  O  OD2  . ASP A 1 86  ? -14.028 -2.182  12.546  1.00 0.00 ? 86  ASP A OD2  3  
ATOM   7685  H  H    . ASP A 1 86  ? -13.522 -7.192  13.538  1.00 0.00 ? 86  ASP A H    3  
ATOM   7686  H  HA   . ASP A 1 86  ? -14.352 -5.019  11.747  1.00 0.00 ? 86  ASP A HA   3  
ATOM   7687  H  HB2  . ASP A 1 86  ? -13.258 -4.620  14.434  1.00 0.00 ? 86  ASP A HB2  3  
ATOM   7688  H  HB3  . ASP A 1 86  ? -12.267 -3.846  13.199  1.00 0.00 ? 86  ASP A HB3  3  
ATOM   7689  N  N    . TYR A 1 87  ? -11.839 -4.826  10.839  1.00 0.00 ? 87  TYR A N    3  
ATOM   7690  C  CA   . TYR A 1 87  ? -10.647 -5.085  10.029  1.00 0.00 ? 87  TYR A CA   3  
ATOM   7691  C  C    . TYR A 1 87  ? -9.708  -3.879  10.032  1.00 0.00 ? 87  TYR A C    3  
ATOM   7692  O  O    . TYR A 1 87  ? -10.068 -2.798  9.566   1.00 0.00 ? 87  TYR A O    3  
ATOM   7693  C  CB   . TYR A 1 87  ? -11.033 -5.414  8.573   1.00 0.00 ? 87  TYR A CB   3  
ATOM   7694  C  CG   . TYR A 1 87  ? -12.526 -5.581  8.450   1.00 0.00 ? 87  TYR A CG   3  
ATOM   7695  C  CD1  . TYR A 1 87  ? -13.122 -6.811  8.733   1.00 0.00 ? 87  TYR A CD1  3  
ATOM   7696  C  CD2  . TYR A 1 87  ? -13.310 -4.503  8.031   1.00 0.00 ? 87  TYR A CD2  3  
ATOM   7697  C  CE1  . TYR A 1 87  ? -14.505 -6.968  8.598   1.00 0.00 ? 87  TYR A CE1  3  
ATOM   7698  C  CE2  . TYR A 1 87  ? -14.693 -4.656  7.894   1.00 0.00 ? 87  TYR A CE2  3  
ATOM   7699  C  CZ   . TYR A 1 87  ? -15.292 -5.890  8.177   1.00 0.00 ? 87  TYR A CZ   3  
ATOM   7700  O  OH   . TYR A 1 87  ? -16.657 -6.041  8.041   1.00 0.00 ? 87  TYR A OH   3  
ATOM   7701  H  H    . TYR A 1 87  ? -12.263 -3.942  10.800  1.00 0.00 ? 87  TYR A H    3  
ATOM   7702  H  HA   . TYR A 1 87  ? -10.119 -5.931  10.445  1.00 0.00 ? 87  TYR A HA   3  
ATOM   7703  H  HB2  . TYR A 1 87  ? -10.719 -4.611  7.919   1.00 0.00 ? 87  TYR A HB2  3  
ATOM   7704  H  HB3  . TYR A 1 87  ? -10.542 -6.328  8.264   1.00 0.00 ? 87  TYR A HB3  3  
ATOM   7705  H  HD1  . TYR A 1 87  ? -12.518 -7.639  9.058   1.00 0.00 ? 87  TYR A HD1  3  
ATOM   7706  H  HD2  . TYR A 1 87  ? -12.847 -3.553  7.811   1.00 0.00 ? 87  TYR A HD2  3  
ATOM   7707  H  HE1  . TYR A 1 87  ? -14.962 -7.922  8.813   1.00 0.00 ? 87  TYR A HE1  3  
ATOM   7708  H  HE2  . TYR A 1 87  ? -15.296 -3.826  7.566   1.00 0.00 ? 87  TYR A HE2  3  
ATOM   7709  H  HH   . TYR A 1 87  ? -16.867 -6.017  7.104   1.00 0.00 ? 87  TYR A HH   3  
ATOM   7710  N  N    . ARG A 1 88  ? -8.490  -4.089  10.518  1.00 0.00 ? 88  ARG A N    3  
ATOM   7711  C  CA   . ARG A 1 88  ? -7.487  -3.030  10.528  1.00 0.00 ? 88  ARG A CA   3  
ATOM   7712  C  C    . ARG A 1 88  ? -6.491  -3.321  9.414   1.00 0.00 ? 88  ARG A C    3  
ATOM   7713  O  O    . ARG A 1 88  ? -5.504  -4.029  9.618   1.00 0.00 ? 88  ARG A O    3  
ATOM   7714  C  CB   . ARG A 1 88  ? -6.761  -2.997  11.876  1.00 0.00 ? 88  ARG A CB   3  
ATOM   7715  C  CG   . ARG A 1 88  ? -7.522  -2.102  12.857  1.00 0.00 ? 88  ARG A CG   3  
ATOM   7716  C  CD   . ARG A 1 88  ? -6.794  -2.096  14.203  1.00 0.00 ? 88  ARG A CD   3  
ATOM   7717  N  NE   . ARG A 1 88  ? -5.636  -1.209  14.144  1.00 0.00 ? 88  ARG A NE   3  
ATOM   7718  C  CZ   . ARG A 1 88  ? -4.558  -1.433  14.890  1.00 0.00 ? 88  ARG A CZ   3  
ATOM   7719  N  NH1  . ARG A 1 88  ? -4.522  -2.461  15.693  1.00 0.00 ? 88  ARG A NH1  3  
ATOM   7720  N  NH2  . ARG A 1 88  ? -3.537  -0.625  14.819  1.00 0.00 ? 88  ARG A NH2  3  
ATOM   7721  H  H    . ARG A 1 88  ? -8.250  -4.981  10.846  1.00 0.00 ? 88  ARG A H    3  
ATOM   7722  H  HA   . ARG A 1 88  ? -7.966  -2.074  10.345  1.00 0.00 ? 88  ARG A HA   3  
ATOM   7723  H  HB2  . ARG A 1 88  ? -6.703  -4.000  12.276  1.00 0.00 ? 88  ARG A HB2  3  
ATOM   7724  H  HB3  . ARG A 1 88  ? -5.764  -2.608  11.739  1.00 0.00 ? 88  ARG A HB3  3  
ATOM   7725  H  HG2  . ARG A 1 88  ? -7.569  -1.096  12.465  1.00 0.00 ? 88  ARG A HG2  3  
ATOM   7726  H  HG3  . ARG A 1 88  ? -8.522  -2.484  12.994  1.00 0.00 ? 88  ARG A HG3  3  
ATOM   7727  H  HD2  . ARG A 1 88  ? -7.466  -1.754  14.973  1.00 0.00 ? 88  ARG A HD2  3  
ATOM   7728  H  HD3  . ARG A 1 88  ? -6.467  -3.099  14.434  1.00 0.00 ? 88  ARG A HD3  3  
ATOM   7729  H  HE   . ARG A 1 88  ? -5.653  -0.435  13.545  1.00 0.00 ? 88  ARG A HE   3  
ATOM   7730  H  HH11 . ARG A 1 88  ? -5.304  -3.081  15.750  1.00 0.00 ? 88  ARG A HH11 3  
ATOM   7731  H  HH12 . ARG A 1 88  ? -3.710  -2.629  16.254  1.00 0.00 ? 88  ARG A HH12 3  
ATOM   7732  H  HH21 . ARG A 1 88  ? -3.564  0.163   14.204  1.00 0.00 ? 88  ARG A HH21 3  
ATOM   7733  H  HH22 . ARG A 1 88  ? -2.726  -0.793  15.380  1.00 0.00 ? 88  ARG A HH22 3  
ATOM   7734  N  N    . VAL A 1 89  ? -6.782  -2.811  8.225   1.00 0.00 ? 89  VAL A N    3  
ATOM   7735  C  CA   . VAL A 1 89  ? -5.937  -3.067  7.068   1.00 0.00 ? 89  VAL A CA   3  
ATOM   7736  C  C    . VAL A 1 89  ? -4.775  -2.074  6.951   1.00 0.00 ? 89  VAL A C    3  
ATOM   7737  O  O    . VAL A 1 89  ? -4.878  -0.918  7.364   1.00 0.00 ? 89  VAL A O    3  
ATOM   7738  C  CB   . VAL A 1 89  ? -6.794  -3.013  5.808   1.00 0.00 ? 89  VAL A CB   3  
ATOM   7739  C  CG1  . VAL A 1 89  ? -6.211  -3.929  4.728   1.00 0.00 ? 89  VAL A CG1  3  
ATOM   7740  C  CG2  . VAL A 1 89  ? -8.222  -3.459  6.142   1.00 0.00 ? 89  VAL A CG2  3  
ATOM   7741  H  H    . VAL A 1 89  ? -7.601  -2.285  8.116   1.00 0.00 ? 89  VAL A H    3  
ATOM   7742  H  HA   . VAL A 1 89  ? -5.535  -4.055  7.159   1.00 0.00 ? 89  VAL A HA   3  
ATOM   7743  H  HB   . VAL A 1 89  ? -6.811  -2.006  5.449   1.00 0.00 ? 89  VAL A HB   3  
ATOM   7744  H  HG11 . VAL A 1 89  ? -5.154  -4.058  4.894   1.00 0.00 ? 89  VAL A HG11 3  
ATOM   7745  H  HG12 . VAL A 1 89  ? -6.364  -3.480  3.764   1.00 0.00 ? 89  VAL A HG12 3  
ATOM   7746  H  HG13 . VAL A 1 89  ? -6.706  -4.890  4.756   1.00 0.00 ? 89  VAL A HG13 3  
ATOM   7747  H  HG21 . VAL A 1 89  ? -8.193  -4.429  6.618   1.00 0.00 ? 89  VAL A HG21 3  
ATOM   7748  H  HG22 . VAL A 1 89  ? -8.801  -3.523  5.232   1.00 0.00 ? 89  VAL A HG22 3  
ATOM   7749  H  HG23 . VAL A 1 89  ? -8.678  -2.744  6.808   1.00 0.00 ? 89  VAL A HG23 3  
ATOM   7750  N  N    . THR A 1 90  ? -3.668  -2.550  6.373   1.00 0.00 ? 90  THR A N    3  
ATOM   7751  C  CA   . THR A 1 90  ? -2.474  -1.729  6.182   1.00 0.00 ? 90  THR A CA   3  
ATOM   7752  C  C    . THR A 1 90  ? -1.806  -2.076  4.843   1.00 0.00 ? 90  THR A C    3  
ATOM   7753  O  O    . THR A 1 90  ? -1.330  -3.193  4.653   1.00 0.00 ? 90  THR A O    3  
ATOM   7754  C  CB   . THR A 1 90  ? -1.501  -1.973  7.349   1.00 0.00 ? 90  THR A CB   3  
ATOM   7755  O  OG1  . THR A 1 90  ? -1.891  -1.171  8.454   1.00 0.00 ? 90  THR A OG1  3  
ATOM   7756  C  CG2  . THR A 1 90  ? -0.066  -1.614  6.948   1.00 0.00 ? 90  THR A CG2  3  
ATOM   7757  H  H    . THR A 1 90  ? -3.657  -3.479  6.062   1.00 0.00 ? 90  THR A H    3  
ATOM   7758  H  HA   . THR A 1 90  ? -2.759  -0.688  6.174   1.00 0.00 ? 90  THR A HA   3  
ATOM   7759  H  HB   . THR A 1 90  ? -1.539  -3.012  7.635   1.00 0.00 ? 90  THR A HB   3  
ATOM   7760  H  HG1  . THR A 1 90  ? -1.097  -0.801  8.848   1.00 0.00 ? 90  THR A HG1  3  
ATOM   7761  H  HG21 . THR A 1 90  ? 0.284   -2.305  6.200   1.00 0.00 ? 90  THR A HG21 3  
ATOM   7762  H  HG22 . THR A 1 90  ? 0.574   -1.677  7.817   1.00 0.00 ? 90  THR A HG22 3  
ATOM   7763  H  HG23 . THR A 1 90  ? -0.040  -0.613  6.553   1.00 0.00 ? 90  THR A HG23 3  
ATOM   7764  N  N    . CYS A 1 91  ? -1.774  -1.120  3.917   1.00 0.00 ? 91  CYS A N    3  
ATOM   7765  C  CA   . CYS A 1 91  ? -1.165  -1.355  2.608   1.00 0.00 ? 91  CYS A CA   3  
ATOM   7766  C  C    . CYS A 1 91  ? 0.239   -0.759  2.534   1.00 0.00 ? 91  CYS A C    3  
ATOM   7767  O  O    . CYS A 1 91  ? 0.464   0.380   2.943   1.00 0.00 ? 91  CYS A O    3  
ATOM   7768  C  CB   . CYS A 1 91  ? -2.034  -0.733  1.510   1.00 0.00 ? 91  CYS A CB   3  
ATOM   7769  S  SG   . CYS A 1 91  ? -1.274  -1.043  -0.103  1.00 0.00 ? 91  CYS A SG   3  
ATOM   7770  H  H    . CYS A 1 91  ? -2.167  -0.249  4.110   1.00 0.00 ? 91  CYS A H    3  
ATOM   7771  H  HA   . CYS A 1 91  ? -1.102  -2.420  2.438   1.00 0.00 ? 91  CYS A HA   3  
ATOM   7772  H  HB2  . CYS A 1 91  ? -3.018  -1.177  1.535   1.00 0.00 ? 91  CYS A HB2  3  
ATOM   7773  H  HB3  . CYS A 1 91  ? -2.115  0.337   1.670   1.00 0.00 ? 91  CYS A HB3  3  
ATOM   7774  H  HG   . CYS A 1 91  ? -1.599  -1.886  -0.427  1.00 0.00 ? 91  CYS A HG   3  
ATOM   7775  N  N    . PHE A 1 92  ? 1.176   -1.534  1.989   1.00 0.00 ? 92  PHE A N    3  
ATOM   7776  C  CA   . PHE A 1 92  ? 2.558   -1.076  1.839   1.00 0.00 ? 92  PHE A CA   3  
ATOM   7777  C  C    . PHE A 1 92  ? 2.954   -1.082  0.368   1.00 0.00 ? 92  PHE A C    3  
ATOM   7778  O  O    . PHE A 1 92  ? 3.254   -2.134  -0.196  1.00 0.00 ? 92  PHE A O    3  
ATOM   7779  C  CB   . PHE A 1 92  ? 3.519   -1.984  2.612   1.00 0.00 ? 92  PHE A CB   3  
ATOM   7780  C  CG   . PHE A 1 92  ? 3.416   -1.737  4.103   1.00 0.00 ? 92  PHE A CG   3  
ATOM   7781  C  CD1  . PHE A 1 92  ? 3.883   -0.538  4.656   1.00 0.00 ? 92  PHE A CD1  3  
ATOM   7782  C  CD2  . PHE A 1 92  ? 2.880   -2.725  4.936   1.00 0.00 ? 92  PHE A CD2  3  
ATOM   7783  C  CE1  . PHE A 1 92  ? 3.812   -0.331  6.041   1.00 0.00 ? 92  PHE A CE1  3  
ATOM   7784  C  CE2  . PHE A 1 92  ? 2.807   -2.516  6.319   1.00 0.00 ? 92  PHE A CE2  3  
ATOM   7785  C  CZ   . PHE A 1 92  ? 3.274   -1.321  6.871   1.00 0.00 ? 92  PHE A CZ   3  
ATOM   7786  H  H    . PHE A 1 92  ? 0.932   -2.429  1.670   1.00 0.00 ? 92  PHE A H    3  
ATOM   7787  H  HA   . PHE A 1 92  ? 2.643   -0.074  2.215   1.00 0.00 ? 92  PHE A HA   3  
ATOM   7788  H  HB2  . PHE A 1 92  ? 3.279   -3.017  2.405   1.00 0.00 ? 92  PHE A HB2  3  
ATOM   7789  H  HB3  . PHE A 1 92  ? 4.531   -1.781  2.289   1.00 0.00 ? 92  PHE A HB3  3  
ATOM   7790  H  HD1  . PHE A 1 92  ? 4.297   0.228   4.017   1.00 0.00 ? 92  PHE A HD1  3  
ATOM   7791  H  HD2  . PHE A 1 92  ? 2.516   -3.644  4.510   1.00 0.00 ? 92  PHE A HD2  3  
ATOM   7792  H  HE1  . PHE A 1 92  ? 4.173   0.591   6.469   1.00 0.00 ? 92  PHE A HE1  3  
ATOM   7793  H  HE2  . PHE A 1 92  ? 2.397   -3.283  6.961   1.00 0.00 ? 92  PHE A HE2  3  
ATOM   7794  H  HZ   . PHE A 1 92  ? 3.219   -1.160  7.938   1.00 0.00 ? 92  PHE A HZ   3  
ATOM   7795  N  N    . THR A 1 93  ? 2.960   0.093   -0.253  1.00 0.00 ? 93  THR A N    3  
ATOM   7796  C  CA   . THR A 1 93  ? 3.331   0.192   -1.664  1.00 0.00 ? 93  THR A CA   3  
ATOM   7797  C  C    . THR A 1 93  ? 4.154   1.450   -1.916  1.00 0.00 ? 93  THR A C    3  
ATOM   7798  O  O    . THR A 1 93  ? 4.322   2.279   -1.024  1.00 0.00 ? 93  THR A O    3  
ATOM   7799  C  CB   . THR A 1 93  ? 2.075   0.206   -2.541  1.00 0.00 ? 93  THR A CB   3  
ATOM   7800  O  OG1  . THR A 1 93  ? 1.171   -0.790  -2.086  1.00 0.00 ? 93  THR A OG1  3  
ATOM   7801  C  CG2  . THR A 1 93  ? 2.457   -0.075  -3.998  1.00 0.00 ? 93  THR A CG2  3  
ATOM   7802  H  H    . THR A 1 93  ? 2.712   0.907   0.243   1.00 0.00 ? 93  THR A H    3  
ATOM   7803  H  HA   . THR A 1 93  ? 3.927   -0.669  -1.925  1.00 0.00 ? 93  THR A HA   3  
ATOM   7804  H  HB   . THR A 1 93  ? 1.604   1.176   -2.479  1.00 0.00 ? 93  THR A HB   3  
ATOM   7805  H  HG1  . THR A 1 93  ? 0.338   -0.362  -1.877  1.00 0.00 ? 93  THR A HG1  3  
ATOM   7806  H  HG21 . THR A 1 93  ? 2.892   0.811   -4.430  1.00 0.00 ? 93  THR A HG21 3  
ATOM   7807  H  HG22 . THR A 1 93  ? 1.574   -0.348  -4.555  1.00 0.00 ? 93  THR A HG22 3  
ATOM   7808  H  HG23 . THR A 1 93  ? 3.171   -0.884  -4.038  1.00 0.00 ? 93  THR A HG23 3  
ATOM   7809  N  N    . SER A 1 94  ? 4.679   1.578   -3.130  1.00 0.00 ? 94  SER A N    3  
ATOM   7810  C  CA   . SER A 1 94  ? 5.494   2.736   -3.478  1.00 0.00 ? 94  SER A CA   3  
ATOM   7811  C  C    . SER A 1 94  ? 4.638   3.864   -4.051  1.00 0.00 ? 94  SER A C    3  
ATOM   7812  O  O    . SER A 1 94  ? 5.080   5.012   -4.106  1.00 0.00 ? 94  SER A O    3  
ATOM   7813  C  CB   . SER A 1 94  ? 6.562   2.338   -4.496  1.00 0.00 ? 94  SER A CB   3  
ATOM   7814  O  OG   . SER A 1 94  ? 5.973   1.524   -5.500  1.00 0.00 ? 94  SER A OG   3  
ATOM   7815  H  H    . SER A 1 94  ? 4.523   0.880   -3.800  1.00 0.00 ? 94  SER A H    3  
ATOM   7816  H  HA   . SER A 1 94  ? 5.984   3.094   -2.586  1.00 0.00 ? 94  SER A HA   3  
ATOM   7817  H  HB2  . SER A 1 94  ? 6.974   3.221   -4.953  1.00 0.00 ? 94  SER A HB2  3  
ATOM   7818  H  HB3  . SER A 1 94  ? 7.353   1.794   -3.993  1.00 0.00 ? 94  SER A HB3  3  
ATOM   7819  H  HG   . SER A 1 94  ? 6.354   0.646   -5.431  1.00 0.00 ? 94  SER A HG   3  
ATOM   7820  N  N    . TRP A 1 95  ? 3.415   3.544   -4.482  1.00 0.00 ? 95  TRP A N    3  
ATOM   7821  C  CA   . TRP A 1 95  ? 2.532   4.565   -5.050  1.00 0.00 ? 95  TRP A CA   3  
ATOM   7822  C  C    . TRP A 1 95  ? 1.202   4.642   -4.304  1.00 0.00 ? 95  TRP A C    3  
ATOM   7823  O  O    . TRP A 1 95  ? 0.698   3.648   -3.780  1.00 0.00 ? 95  TRP A O    3  
ATOM   7824  C  CB   . TRP A 1 95  ? 2.269   4.284   -6.535  1.00 0.00 ? 95  TRP A CB   3  
ATOM   7825  C  CG   . TRP A 1 95  ? 2.052   2.827   -6.746  1.00 0.00 ? 95  TRP A CG   3  
ATOM   7826  C  CD1  . TRP A 1 95  ? 3.023   1.902   -6.689  1.00 0.00 ? 95  TRP A CD1  3  
ATOM   7827  C  CD2  . TRP A 1 95  ? 0.819   2.111   -7.055  1.00 0.00 ? 95  TRP A CD2  3  
ATOM   7828  N  NE1  . TRP A 1 95  ? 2.472   0.656   -6.925  1.00 0.00 ? 95  TRP A NE1  3  
ATOM   7829  C  CE2  . TRP A 1 95  ? 1.117   0.735   -7.159  1.00 0.00 ? 95  TRP A CE2  3  
ATOM   7830  C  CE3  . TRP A 1 95  ? -0.515  2.512   -7.249  1.00 0.00 ? 95  TRP A CE3  3  
ATOM   7831  C  CZ2  . TRP A 1 95  ? 0.135   -0.208  -7.442  1.00 0.00 ? 95  TRP A CZ2  3  
ATOM   7832  C  CZ3  . TRP A 1 95  ? -1.507  1.557   -7.536  1.00 0.00 ? 95  TRP A CZ3  3  
ATOM   7833  C  CH2  . TRP A 1 95  ? -1.180  0.203   -7.629  1.00 0.00 ? 95  TRP A CH2  3  
ATOM   7834  H  H    . TRP A 1 95  ? 3.107   2.615   -4.422  1.00 0.00 ? 95  TRP A H    3  
ATOM   7835  H  HA   . TRP A 1 95  ? 3.017   5.527   -4.971  1.00 0.00 ? 95  TRP A HA   3  
ATOM   7836  H  HB2  . TRP A 1 95  ? 1.395   4.818   -6.850  1.00 0.00 ? 95  TRP A HB2  3  
ATOM   7837  H  HB3  . TRP A 1 95  ? 3.117   4.609   -7.118  1.00 0.00 ? 95  TRP A HB3  3  
ATOM   7838  H  HD1  . TRP A 1 95  ? 4.057   2.106   -6.483  1.00 0.00 ? 95  TRP A HD1  3  
ATOM   7839  H  HE1  . TRP A 1 95  ? 2.963   -0.191  -6.933  1.00 0.00 ? 95  TRP A HE1  3  
ATOM   7840  H  HE3  . TRP A 1 95  ? -0.778  3.555   -7.182  1.00 0.00 ? 95  TRP A HE3  3  
ATOM   7841  H  HZ2  . TRP A 1 95  ? 0.392   -1.246  -7.511  1.00 0.00 ? 95  TRP A HZ2  3  
ATOM   7842  H  HZ3  . TRP A 1 95  ? -2.524  1.868   -7.682  1.00 0.00 ? 95  TRP A HZ3  3  
ATOM   7843  H  HH2  . TRP A 1 95  ? -1.948  -0.525  -7.850  1.00 0.00 ? 95  TRP A HH2  3  
ATOM   7844  N  N    . SER A 1 96  ? 0.644   5.848   -4.284  1.00 0.00 ? 96  SER A N    3  
ATOM   7845  C  CA   . SER A 1 96  ? -0.632  6.119   -3.634  1.00 0.00 ? 96  SER A CA   3  
ATOM   7846  C  C    . SER A 1 96  ? -1.772  5.587   -4.519  1.00 0.00 ? 96  SER A C    3  
ATOM   7847  O  O    . SER A 1 96  ? -1.502  4.835   -5.452  1.00 0.00 ? 96  SER A O    3  
ATOM   7848  C  CB   . SER A 1 96  ? -0.736  7.624   -3.388  1.00 0.00 ? 96  SER A CB   3  
ATOM   7849  O  OG   . SER A 1 96  ? -1.425  7.861   -2.168  1.00 0.00 ? 96  SER A OG   3  
ATOM   7850  H  H    . SER A 1 96  ? 1.106   6.583   -4.732  1.00 0.00 ? 96  SER A H    3  
ATOM   7851  H  HA   . SER A 1 96  ? -0.656  5.604   -2.684  1.00 0.00 ? 96  SER A HA   3  
ATOM   7852  H  HB2  . SER A 1 96  ? 0.255   8.037   -3.306  1.00 0.00 ? 96  SER A HB2  3  
ATOM   7853  H  HB3  . SER A 1 96  ? -1.247  8.096   -4.216  1.00 0.00 ? 96  SER A HB3  3  
ATOM   7854  H  HG   . SER A 1 96  ? -0.839  8.345   -1.583  1.00 0.00 ? 96  SER A HG   3  
ATOM   7855  N  N    . PRO A 1 97  ? -3.029  5.892   -4.254  1.00 0.00 ? 97  PRO A N    3  
ATOM   7856  C  CA   . PRO A 1 97  ? -4.150  5.343   -5.066  1.00 0.00 ? 97  PRO A CA   3  
ATOM   7857  C  C    . PRO A 1 97  ? -4.332  6.135   -6.355  1.00 0.00 ? 97  PRO A C    3  
ATOM   7858  O  O    . PRO A 1 97  ? -3.356  6.637   -6.913  1.00 0.00 ? 97  PRO A O    3  
ATOM   7859  C  CB   . PRO A 1 97  ? -5.343  5.480   -4.132  1.00 0.00 ? 97  PRO A CB   3  
ATOM   7860  C  CG   . PRO A 1 97  ? -5.062  6.712   -3.354  1.00 0.00 ? 97  PRO A CG   3  
ATOM   7861  C  CD   . PRO A 1 97  ? -3.542  6.798   -3.203  1.00 0.00 ? 97  PRO A CD   3  
ATOM   7862  H  HA   . PRO A 1 97  ? -3.985  4.303   -5.281  1.00 0.00 ? 97  PRO A HA   3  
ATOM   7863  H  HB2  . PRO A 1 97  ? -6.253  5.580   -4.695  1.00 0.00 ? 97  PRO A HB2  3  
ATOM   7864  H  HB3  . PRO A 1 97  ? -5.401  4.631   -3.469  1.00 0.00 ? 97  PRO A HB3  3  
ATOM   7865  H  HG2  . PRO A 1 97  ? -5.434  7.582   -3.896  1.00 0.00 ? 97  PRO A HG2  3  
ATOM   7866  H  HG3  . PRO A 1 97  ? -5.519  6.648   -2.380  1.00 0.00 ? 97  PRO A HG3  3  
ATOM   7867  H  HD2  . PRO A 1 97  ? -3.236  7.813   -3.386  1.00 0.00 ? 97  PRO A HD2  3  
ATOM   7868  H  HD3  . PRO A 1 97  ? -3.231  6.465   -2.226  1.00 0.00 ? 97  PRO A HD3  3  
ATOM   7869  N  N    . CYS A 1 98  ? -5.565  6.258   -6.838  1.00 0.00 ? 98  CYS A N    3  
ATOM   7870  C  CA   . CYS A 1 98  ? -5.786  7.005   -8.068  1.00 0.00 ? 98  CYS A CA   3  
ATOM   7871  C  C    . CYS A 1 98  ? -7.176  7.635   -8.120  1.00 0.00 ? 98  CYS A C    3  
ATOM   7872  O  O    . CYS A 1 98  ? -8.107  7.188   -7.457  1.00 0.00 ? 98  CYS A O    3  
ATOM   7873  C  CB   . CYS A 1 98  ? -5.598  6.088   -9.277  1.00 0.00 ? 98  CYS A CB   3  
ATOM   7874  S  SG   . CYS A 1 98  ? -4.119  5.071   -9.041  1.00 0.00 ? 98  CYS A SG   3  
ATOM   7875  H  H    . CYS A 1 98  ? -6.322  5.846   -6.373  1.00 0.00 ? 98  CYS A H    3  
ATOM   7876  H  HA   . CYS A 1 98  ? -5.052  7.794   -8.115  1.00 0.00 ? 98  CYS A HA   3  
ATOM   7877  H  HB2  . CYS A 1 98  ? -6.463  5.449   -9.380  1.00 0.00 ? 98  CYS A HB2  3  
ATOM   7878  H  HB3  . CYS A 1 98  ? -5.485  6.687   -10.168 1.00 0.00 ? 98  CYS A HB3  3  
ATOM   7879  N  N    . PHE A 1 99  ? -7.287  8.684   -8.928  1.00 0.00 ? 99  PHE A N    3  
ATOM   7880  C  CA   . PHE A 1 99  ? -8.541  9.414   -9.101  1.00 0.00 ? 99  PHE A CA   3  
ATOM   7881  C  C    . PHE A 1 99  ? -9.756  8.503   -8.982  1.00 0.00 ? 99  PHE A C    3  
ATOM   7882  O  O    . PHE A 1 99  ? -10.655 8.755   -8.183  1.00 0.00 ? 99  PHE A O    3  
ATOM   7883  C  CB   . PHE A 1 99  ? -8.551  10.074  -10.478 1.00 0.00 ? 99  PHE A CB   3  
ATOM   7884  C  CG   . PHE A 1 99  ? -8.515  9.007   -11.545 1.00 0.00 ? 99  PHE A CG   3  
ATOM   7885  C  CD1  . PHE A 1 99  ? -7.326  8.312   -11.798 1.00 0.00 ? 99  PHE A CD1  3  
ATOM   7886  C  CD2  . PHE A 1 99  ? -9.669  8.710   -12.280 1.00 0.00 ? 99  PHE A CD2  3  
ATOM   7887  C  CE1  . PHE A 1 99  ? -7.289  7.321   -12.786 1.00 0.00 ? 99  PHE A CE1  3  
ATOM   7888  C  CE2  . PHE A 1 99  ? -9.632  7.719   -13.269 1.00 0.00 ? 99  PHE A CE2  3  
ATOM   7889  C  CZ   . PHE A 1 99  ? -8.443  7.024   -13.521 1.00 0.00 ? 99  PHE A CZ   3  
ATOM   7890  H  H    . PHE A 1 99  ? -6.497  8.980   -9.427  1.00 0.00 ? 99  PHE A H    3  
ATOM   7891  H  HA   . PHE A 1 99  ? -8.604  10.185  -8.350  1.00 0.00 ? 99  PHE A HA   3  
ATOM   7892  H  HB2  . PHE A 1 99  ? -9.447  10.667  -10.589 1.00 0.00 ? 99  PHE A HB2  3  
ATOM   7893  H  HB3  . PHE A 1 99  ? -7.686  10.705  -10.578 1.00 0.00 ? 99  PHE A HB3  3  
ATOM   7894  H  HD1  . PHE A 1 99  ? -6.435  8.542   -11.230 1.00 0.00 ? 99  PHE A HD1  3  
ATOM   7895  H  HD2  . PHE A 1 99  ? -10.586 9.245   -12.086 1.00 0.00 ? 99  PHE A HD2  3  
ATOM   7896  H  HE1  . PHE A 1 99  ? -6.372  6.786   -12.980 1.00 0.00 ? 99  PHE A HE1  3  
ATOM   7897  H  HE2  . PHE A 1 99  ? -10.521 7.489   -13.837 1.00 0.00 ? 99  PHE A HE2  3  
ATOM   7898  H  HZ   . PHE A 1 99  ? -8.416  6.260   -14.283 1.00 0.00 ? 99  PHE A HZ   3  
ATOM   7899  N  N    . SER A 1 100 ? -9.792  7.461   -9.797  1.00 0.00 ? 100 SER A N    3  
ATOM   7900  C  CA   . SER A 1 100 ? -10.926 6.543   -9.782  1.00 0.00 ? 100 SER A CA   3  
ATOM   7901  C  C    . SER A 1 100 ? -10.707 5.411   -8.784  1.00 0.00 ? 100 SER A C    3  
ATOM   7902  O  O    . SER A 1 100 ? -11.434 5.287   -7.799  1.00 0.00 ? 100 SER A O    3  
ATOM   7903  C  CB   . SER A 1 100 ? -11.140 5.954   -11.177 1.00 0.00 ? 100 SER A CB   3  
ATOM   7904  O  OG   . SER A 1 100 ? -11.780 6.920   -12.002 1.00 0.00 ? 100 SER A OG   3  
ATOM   7905  H  H    . SER A 1 100 ? -9.058  7.319   -10.429 1.00 0.00 ? 100 SER A H    3  
ATOM   7906  H  HA   . SER A 1 100 ? -11.812 7.094   -9.499  1.00 0.00 ? 100 SER A HA   3  
ATOM   7907  H  HB2  . SER A 1 100 ? -10.190 5.692   -11.610 1.00 0.00 ? 100 SER A HB2  3  
ATOM   7908  H  HB3  . SER A 1 100 ? -11.756 5.067   -11.102 1.00 0.00 ? 100 SER A HB3  3  
ATOM   7909  H  HG   . SER A 1 100 ? -12.064 7.647   -11.443 1.00 0.00 ? 100 SER A HG   3  
ATOM   7910  N  N    . CYS A 1 101 ? -9.711  4.579   -9.047  1.00 0.00 ? 101 CYS A N    3  
ATOM   7911  C  CA   . CYS A 1 101 ? -9.424  3.455   -8.165  1.00 0.00 ? 101 CYS A CA   3  
ATOM   7912  C  C    . CYS A 1 101 ? -9.559  3.876   -6.707  1.00 0.00 ? 101 CYS A C    3  
ATOM   7913  O  O    . CYS A 1 101 ? -9.837  3.050   -5.828  1.00 0.00 ? 101 CYS A O    3  
ATOM   7914  C  CB   . CYS A 1 101 ? -8.008  2.916   -8.458  1.00 0.00 ? 101 CYS A CB   3  
ATOM   7915  S  SG   . CYS A 1 101 ? -6.846  3.329   -7.126  1.00 0.00 ? 101 CYS A SG   3  
ATOM   7916  H  H    . CYS A 1 101 ? -9.164  4.718   -9.849  1.00 0.00 ? 101 CYS A H    3  
ATOM   7917  H  HA   . CYS A 1 101 ? -10.143 2.674   -8.361  1.00 0.00 ? 101 CYS A HA   3  
ATOM   7918  H  HB2  . CYS A 1 101 ? -8.050  1.847   -8.562  1.00 0.00 ? 101 CYS A HB2  3  
ATOM   7919  H  HB3  . CYS A 1 101 ? -7.654  3.349   -9.379  1.00 0.00 ? 101 CYS A HB3  3  
ATOM   7920  N  N    . ALA A 1 102 ? -9.383  5.163   -6.453  1.00 0.00 ? 102 ALA A N    3  
ATOM   7921  C  CA   . ALA A 1 102 ? -9.498  5.656   -5.095  1.00 0.00 ? 102 ALA A CA   3  
ATOM   7922  C  C    . ALA A 1 102 ? -10.957 5.679   -4.704  1.00 0.00 ? 102 ALA A C    3  
ATOM   7923  O  O    . ALA A 1 102 ? -11.330 5.270   -3.607  1.00 0.00 ? 102 ALA A O    3  
ATOM   7924  C  CB   . ALA A 1 102 ? -8.902  7.062   -4.969  1.00 0.00 ? 102 ALA A CB   3  
ATOM   7925  H  H    . ALA A 1 102 ? -9.192  5.786   -7.188  1.00 0.00 ? 102 ALA A H    3  
ATOM   7926  H  HA   . ALA A 1 102 ? -8.970  4.978   -4.444  1.00 0.00 ? 102 ALA A HA   3  
ATOM   7927  H  HB1  . ALA A 1 102 ? -9.042  7.426   -3.965  1.00 0.00 ? 102 ALA A HB1  3  
ATOM   7928  H  HB2  . ALA A 1 102 ? -9.397  7.723   -5.657  1.00 0.00 ? 102 ALA A HB2  3  
ATOM   7929  H  HB3  . ALA A 1 102 ? -7.851  7.033   -5.194  1.00 0.00 ? 102 ALA A HB3  3  
ATOM   7930  N  N    . GLN A 1 103 ? -11.780 6.144   -5.626  1.00 0.00 ? 103 GLN A N    3  
ATOM   7931  C  CA   . GLN A 1 103 ? -13.204 6.199   -5.391  1.00 0.00 ? 103 GLN A CA   3  
ATOM   7932  C  C    . GLN A 1 103 ? -13.703 4.821   -5.020  1.00 0.00 ? 103 GLN A C    3  
ATOM   7933  O  O    . GLN A 1 103 ? -14.225 4.618   -3.924  1.00 0.00 ? 103 GLN A O    3  
ATOM   7934  C  CB   . GLN A 1 103 ? -13.910 6.682   -6.647  1.00 0.00 ? 103 GLN A CB   3  
ATOM   7935  C  CG   . GLN A 1 103 ? -13.694 8.179   -6.773  1.00 0.00 ? 103 GLN A CG   3  
ATOM   7936  C  CD   . GLN A 1 103 ? -14.443 8.722   -7.985  1.00 0.00 ? 103 GLN A CD   3  
ATOM   7937  O  OE1  . GLN A 1 103 ? -14.359 9.912   -8.286  1.00 0.00 ? 103 GLN A OE1  3  
ATOM   7938  N  NE2  . GLN A 1 103 ? -15.176 7.915   -8.701  1.00 0.00 ? 103 GLN A NE2  3  
ATOM   7939  H  H    . GLN A 1 103 ? -11.420 6.442   -6.488  1.00 0.00 ? 103 GLN A H    3  
ATOM   7940  H  HA   . GLN A 1 103 ? -13.404 6.884   -4.583  1.00 0.00 ? 103 GLN A HA   3  
ATOM   7941  H  HB2  . GLN A 1 103 ? -13.481 6.183   -7.508  1.00 0.00 ? 103 GLN A HB2  3  
ATOM   7942  H  HB3  . GLN A 1 103 ? -14.966 6.469   -6.584  1.00 0.00 ? 103 GLN A HB3  3  
ATOM   7943  H  HG2  . GLN A 1 103 ? -14.049 8.671   -5.875  1.00 0.00 ? 103 GLN A HG2  3  
ATOM   7944  H  HG3  . GLN A 1 103 ? -12.641 8.359   -6.890  1.00 0.00 ? 103 GLN A HG3  3  
ATOM   7945  H  HE21 . GLN A 1 103 ? -15.243 6.967   -8.458  1.00 0.00 ? 103 GLN A HE21 3  
ATOM   7946  H  HE22 . GLN A 1 103 ? -15.662 8.255   -9.480  1.00 0.00 ? 103 GLN A HE22 3  
ATOM   7947  N  N    . GLU A 1 104 ? -13.509 3.870   -5.935  1.00 0.00 ? 104 GLU A N    3  
ATOM   7948  C  CA   . GLU A 1 104 ? -13.922 2.487   -5.687  1.00 0.00 ? 104 GLU A CA   3  
ATOM   7949  C  C    . GLU A 1 104 ? -13.707 2.171   -4.213  1.00 0.00 ? 104 GLU A C    3  
ATOM   7950  O  O    . GLU A 1 104 ? -14.650 1.871   -3.470  1.00 0.00 ? 104 GLU A O    3  
ATOM   7951  C  CB   . GLU A 1 104 ? -13.098 1.528   -6.556  1.00 0.00 ? 104 GLU A CB   3  
ATOM   7952  C  CG   . GLU A 1 104 ? -13.805 1.309   -7.896  1.00 0.00 ? 104 GLU A CG   3  
ATOM   7953  C  CD   . GLU A 1 104 ? -14.965 0.334   -7.719  1.00 0.00 ? 104 GLU A CD   3  
ATOM   7954  O  OE1  . GLU A 1 104 ? -16.043 0.785   -7.369  1.00 0.00 ? 104 GLU A OE1  3  
ATOM   7955  O  OE2  . GLU A 1 104 ? -14.757 -0.848  -7.937  1.00 0.00 ? 104 GLU A OE2  3  
ATOM   7956  H  H    . GLU A 1 104 ? -13.058 4.103   -6.780  1.00 0.00 ? 104 GLU A H    3  
ATOM   7957  H  HA   . GLU A 1 104 ? -14.969 2.377   -5.927  1.00 0.00 ? 104 GLU A HA   3  
ATOM   7958  H  HB2  . GLU A 1 104 ? -12.121 1.955   -6.732  1.00 0.00 ? 104 GLU A HB2  3  
ATOM   7959  H  HB3  . GLU A 1 104 ? -12.991 0.581   -6.049  1.00 0.00 ? 104 GLU A HB3  3  
ATOM   7960  H  HG2  . GLU A 1 104 ? -14.183 2.254   -8.260  1.00 0.00 ? 104 GLU A HG2  3  
ATOM   7961  H  HG3  . GLU A 1 104 ? -13.103 0.903   -8.610  1.00 0.00 ? 104 GLU A HG3  3  
ATOM   7962  N  N    . MET A 1 105 ? -12.455 2.281   -3.791  1.00 0.00 ? 105 MET A N    3  
ATOM   7963  C  CA   . MET A 1 105 ? -12.114 2.050   -2.411  1.00 0.00 ? 105 MET A CA   3  
ATOM   7964  C  C    . MET A 1 105 ? -12.935 2.986   -1.515  1.00 0.00 ? 105 MET A C    3  
ATOM   7965  O  O    . MET A 1 105 ? -13.831 2.521   -0.822  1.00 0.00 ? 105 MET A O    3  
ATOM   7966  C  CB   . MET A 1 105 ? -10.598 2.233   -2.261  1.00 0.00 ? 105 MET A CB   3  
ATOM   7967  C  CG   . MET A 1 105 ? -10.002 1.253   -1.240  1.00 0.00 ? 105 MET A CG   3  
ATOM   7968  S  SD   . MET A 1 105 ? -10.121 1.955   0.419   1.00 0.00 ? 105 MET A SD   3  
ATOM   7969  C  CE   . MET A 1 105 ? -8.945  3.304   0.175   1.00 0.00 ? 105 MET A CE   3  
ATOM   7970  H  H    . MET A 1 105 ? -11.746 2.541   -4.422  1.00 0.00 ? 105 MET A H    3  
ATOM   7971  H  HA   . MET A 1 105 ? -12.374 1.051   -2.156  1.00 0.00 ? 105 MET A HA   3  
ATOM   7972  H  HB2  . MET A 1 105 ? -10.143 2.043   -3.221  1.00 0.00 ? 105 MET A HB2  3  
ATOM   7973  H  HB3  . MET A 1 105 ? -10.382 3.238   -1.960  1.00 0.00 ? 105 MET A HB3  3  
ATOM   7974  H  HG2  . MET A 1 105 ? -10.522 0.315   -1.274  1.00 0.00 ? 105 MET A HG2  3  
ATOM   7975  H  HG3  . MET A 1 105 ? -8.963  1.085   -1.478  1.00 0.00 ? 105 MET A HG3  3  
ATOM   7976  H  HE1  . MET A 1 105 ? -8.389  3.141   -0.737  1.00 0.00 ? 105 MET A HE1  3  
ATOM   7977  H  HE2  . MET A 1 105 ? -8.265  3.345   1.014   1.00 0.00 ? 105 MET A HE2  3  
ATOM   7978  H  HE3  . MET A 1 105 ? -9.481  4.233   0.104   1.00 0.00 ? 105 MET A HE3  3  
ATOM   7979  N  N    . ALA A 1 106 ? -12.661 4.292   -1.537  1.00 0.00 ? 106 ALA A N    3  
ATOM   7980  C  CA   . ALA A 1 106 ? -13.422 5.229   -0.696  1.00 0.00 ? 106 ALA A CA   3  
ATOM   7981  C  C    . ALA A 1 106 ? -14.865 4.758   -0.481  1.00 0.00 ? 106 ALA A C    3  
ATOM   7982  O  O    . ALA A 1 106 ? -15.338 4.705   0.640   1.00 0.00 ? 106 ALA A O    3  
ATOM   7983  C  CB   . ALA A 1 106 ? -13.504 6.620   -1.321  1.00 0.00 ? 106 ALA A CB   3  
ATOM   7984  H  H    . ALA A 1 106 ? -11.945 4.629   -2.109  1.00 0.00 ? 106 ALA A H    3  
ATOM   7985  H  HA   . ALA A 1 106 ? -12.916 5.308   0.268   1.00 0.00 ? 106 ALA A HA   3  
ATOM   7986  H  HB1  . ALA A 1 106 ? -14.282 6.636   -2.068  1.00 0.00 ? 106 ALA A HB1  3  
ATOM   7987  H  HB2  . ALA A 1 106 ? -12.569 6.881   -1.775  1.00 0.00 ? 106 ALA A HB2  3  
ATOM   7988  H  HB3  . ALA A 1 106 ? -13.746 7.331   -0.544  1.00 0.00 ? 106 ALA A HB3  3  
ATOM   7989  N  N    . LYS A 1 107 ? -15.587 4.423   -1.543  1.00 0.00 ? 107 LYS A N    3  
ATOM   7990  C  CA   . LYS A 1 107 ? -16.956 3.978   -1.342  1.00 0.00 ? 107 LYS A CA   3  
ATOM   7991  C  C    . LYS A 1 107 ? -16.973 2.941   -0.257  1.00 0.00 ? 107 LYS A C    3  
ATOM   7992  O  O    . LYS A 1 107 ? -17.430 3.172   0.860   1.00 0.00 ? 107 LYS A O    3  
ATOM   7993  C  CB   . LYS A 1 107 ? -17.482 3.321   -2.597  1.00 0.00 ? 107 LYS A CB   3  
ATOM   7994  C  CG   . LYS A 1 107 ? -17.877 4.390   -3.632  1.00 0.00 ? 107 LYS A CG   3  
ATOM   7995  C  CD   . LYS A 1 107 ? -17.208 4.081   -4.964  1.00 0.00 ? 107 LYS A CD   3  
ATOM   7996  C  CE   . LYS A 1 107 ? -17.825 2.817   -5.549  1.00 0.00 ? 107 LYS A CE   3  
ATOM   7997  N  NZ   . LYS A 1 107 ? -19.217 3.104   -5.998  1.00 0.00 ? 107 LYS A NZ   3  
ATOM   7998  H  H    . LYS A 1 107 ? -15.210 4.469   -2.448  1.00 0.00 ? 107 LYS A H    3  
ATOM   7999  H  HA   . LYS A 1 107 ? -17.582 4.805   -1.077  1.00 0.00 ? 107 LYS A HA   3  
ATOM   8000  H  HB2  . LYS A 1 107 ? -16.704 2.680   -2.983  1.00 0.00 ? 107 LYS A HB2  3  
ATOM   8001  H  HB3  . LYS A 1 107 ? -18.349 2.720   -2.354  1.00 0.00 ? 107 LYS A HB3  3  
ATOM   8002  H  HG2  . LYS A 1 107 ? -18.949 4.382   -3.763  1.00 0.00 ? 107 LYS A HG2  3  
ATOM   8003  H  HG3  . LYS A 1 107 ? -17.564 5.369   -3.294  1.00 0.00 ? 107 LYS A HG3  3  
ATOM   8004  H  HD2  . LYS A 1 107 ? -17.354 4.902   -5.635  1.00 0.00 ? 107 LYS A HD2  3  
ATOM   8005  H  HD3  . LYS A 1 107 ? -16.160 3.925   -4.807  1.00 0.00 ? 107 LYS A HD3  3  
ATOM   8006  H  HE2  . LYS A 1 107 ? -17.235 2.482   -6.389  1.00 0.00 ? 107 LYS A HE2  3  
ATOM   8007  H  HE3  . LYS A 1 107 ? -17.842 2.052   -4.792  1.00 0.00 ? 107 LYS A HE3  3  
ATOM   8008  H  HZ1  . LYS A 1 107 ? -19.476 4.073   -5.726  1.00 0.00 ? 107 LYS A HZ1  3  
ATOM   8009  H  HZ2  . LYS A 1 107 ? -19.872 2.434   -5.549  1.00 0.00 ? 107 LYS A HZ2  3  
ATOM   8010  H  HZ3  . LYS A 1 107 ? -19.274 3.005   -7.032  1.00 0.00 ? 107 LYS A HZ3  3  
ATOM   8011  N  N    . PHE A 1 108 ? -16.447 1.793   -0.617  1.00 0.00 ? 108 PHE A N    3  
ATOM   8012  C  CA   . PHE A 1 108 ? -16.371 0.677   0.307   1.00 0.00 ? 108 PHE A CA   3  
ATOM   8013  C  C    . PHE A 1 108 ? -16.113 1.183   1.727   1.00 0.00 ? 108 PHE A C    3  
ATOM   8014  O  O    . PHE A 1 108 ? -16.533 0.571   2.709   1.00 0.00 ? 108 PHE A O    3  
ATOM   8015  C  CB   . PHE A 1 108 ? -15.240 -0.236  -0.133  1.00 0.00 ? 108 PHE A CB   3  
ATOM   8016  C  CG   . PHE A 1 108 ? -15.772 -1.175  -1.174  1.00 0.00 ? 108 PHE A CG   3  
ATOM   8017  C  CD1  . PHE A 1 108 ? -16.235 -0.677  -2.397  1.00 0.00 ? 108 PHE A CD1  3  
ATOM   8018  C  CD2  . PHE A 1 108 ? -15.834 -2.536  -0.900  1.00 0.00 ? 108 PHE A CD2  3  
ATOM   8019  C  CE1  . PHE A 1 108 ? -16.757 -1.552  -3.349  1.00 0.00 ? 108 PHE A CE1  3  
ATOM   8020  C  CE2  . PHE A 1 108 ? -16.358 -3.415  -1.846  1.00 0.00 ? 108 PHE A CE2  3  
ATOM   8021  C  CZ   . PHE A 1 108 ? -16.822 -2.926  -3.076  1.00 0.00 ? 108 PHE A CZ   3  
ATOM   8022  H  H    . PHE A 1 108 ? -16.096 1.701   -1.539  1.00 0.00 ? 108 PHE A H    3  
ATOM   8023  H  HA   . PHE A 1 108 ? -17.302 0.122   0.278   1.00 0.00 ? 108 PHE A HA   3  
ATOM   8024  H  HB2  . PHE A 1 108 ? -14.451 0.361   -0.550  1.00 0.00 ? 108 PHE A HB2  3  
ATOM   8025  H  HB3  . PHE A 1 108 ? -14.871 -0.798  0.711   1.00 0.00 ? 108 PHE A HB3  3  
ATOM   8026  H  HD1  . PHE A 1 108 ? -16.182 0.385   -2.609  1.00 0.00 ? 108 PHE A HD1  3  
ATOM   8027  H  HD2  . PHE A 1 108 ? -15.470 -2.906  0.044   1.00 0.00 ? 108 PHE A HD2  3  
ATOM   8028  H  HE1  . PHE A 1 108 ? -17.117 -1.167  -4.290  1.00 0.00 ? 108 PHE A HE1  3  
ATOM   8029  H  HE2  . PHE A 1 108 ? -16.408 -4.468  -1.628  1.00 0.00 ? 108 PHE A HE2  3  
ATOM   8030  H  HZ   . PHE A 1 108 ? -17.229 -3.605  -3.810  1.00 0.00 ? 108 PHE A HZ   3  
ATOM   8031  N  N    . ILE A 1 109 ? -15.405 2.306   1.809   1.00 0.00 ? 109 ILE A N    3  
ATOM   8032  C  CA   . ILE A 1 109 ? -15.059 2.923   3.075   1.00 0.00 ? 109 ILE A CA   3  
ATOM   8033  C  C    . ILE A 1 109 ? -16.160 3.889   3.528   1.00 0.00 ? 109 ILE A C    3  
ATOM   8034  O  O    . ILE A 1 109 ? -16.892 3.614   4.479   1.00 0.00 ? 109 ILE A O    3  
ATOM   8035  C  CB   . ILE A 1 109 ? -13.740 3.661   2.848   1.00 0.00 ? 109 ILE A CB   3  
ATOM   8036  C  CG1  . ILE A 1 109 ? -12.600 2.688   2.987   1.00 0.00 ? 109 ILE A CG1  3  
ATOM   8037  C  CG2  . ILE A 1 109 ? -13.548 4.791   3.830   1.00 0.00 ? 109 ILE A CG2  3  
ATOM   8038  C  CD1  . ILE A 1 109 ? -12.814 1.539   2.020   1.00 0.00 ? 109 ILE A CD1  3  
ATOM   8039  H  H    . ILE A 1 109 ? -15.089 2.731   0.989   1.00 0.00 ? 109 ILE A H    3  
ATOM   8040  H  HA   . ILE A 1 109 ? -14.913 2.158   3.826   1.00 0.00 ? 109 ILE A HA   3  
ATOM   8041  H  HB   . ILE A 1 109 ? -13.725 4.057   1.860   1.00 0.00 ? 109 ILE A HB   3  
ATOM   8042  H  HG12 . ILE A 1 109 ? -11.677 3.190   2.754   1.00 0.00 ? 109 ILE A HG12 3  
ATOM   8043  H  HG13 . ILE A 1 109 ? -12.579 2.317   3.989   1.00 0.00 ? 109 ILE A HG13 3  
ATOM   8044  H  HG21 . ILE A 1 109 ? -14.145 5.632   3.523   1.00 0.00 ? 109 ILE A HG21 3  
ATOM   8045  H  HG22 . ILE A 1 109 ? -12.504 5.071   3.835   1.00 0.00 ? 109 ILE A HG22 3  
ATOM   8046  H  HG23 . ILE A 1 109 ? -13.846 4.463   4.809   1.00 0.00 ? 109 ILE A HG23 3  
ATOM   8047  H  HD11 . ILE A 1 109 ? -13.030 1.939   1.053   1.00 0.00 ? 109 ILE A HD11 3  
ATOM   8048  H  HD12 . ILE A 1 109 ? -13.640 0.938   2.355   1.00 0.00 ? 109 ILE A HD12 3  
ATOM   8049  H  HD13 . ILE A 1 109 ? -11.928 0.936   1.967   1.00 0.00 ? 109 ILE A HD13 3  
ATOM   8050  N  N    . SER A 1 110 ? -16.269 5.014   2.829   1.00 0.00 ? 110 SER A N    3  
ATOM   8051  C  CA   . SER A 1 110 ? -17.273 6.025   3.136   1.00 0.00 ? 110 SER A CA   3  
ATOM   8052  C  C    . SER A 1 110 ? -18.636 5.375   3.342   1.00 0.00 ? 110 SER A C    3  
ATOM   8053  O  O    . SER A 1 110 ? -19.438 5.828   4.157   1.00 0.00 ? 110 SER A O    3  
ATOM   8054  C  CB   . SER A 1 110 ? -17.349 7.033   1.983   1.00 0.00 ? 110 SER A CB   3  
ATOM   8055  O  OG   . SER A 1 110 ? -18.636 6.976   1.383   1.00 0.00 ? 110 SER A OG   3  
ATOM   8056  H  H    . SER A 1 110 ? -15.660 5.170   2.092   1.00 0.00 ? 110 SER A H    3  
ATOM   8057  H  HA   . SER A 1 110 ? -16.988 6.543   4.036   1.00 0.00 ? 110 SER A HA   3  
ATOM   8058  H  HB2  . SER A 1 110 ? -17.178 8.030   2.355   1.00 0.00 ? 110 SER A HB2  3  
ATOM   8059  H  HB3  . SER A 1 110 ? -16.590 6.790   1.251   1.00 0.00 ? 110 SER A HB3  3  
ATOM   8060  H  HG   . SER A 1 110 ? -19.148 7.720   1.708   1.00 0.00 ? 110 SER A HG   3  
ATOM   8061  N  N    . LYS A 1 111 ? -18.887 4.308   2.597   1.00 0.00 ? 111 LYS A N    3  
ATOM   8062  C  CA   . LYS A 1 111 ? -20.149 3.595   2.702   1.00 0.00 ? 111 LYS A CA   3  
ATOM   8063  C  C    . LYS A 1 111 ? -20.169 2.754   3.974   1.00 0.00 ? 111 LYS A C    3  
ATOM   8064  O  O    . LYS A 1 111 ? -21.205 2.613   4.623   1.00 0.00 ? 111 LYS A O    3  
ATOM   8065  C  CB   . LYS A 1 111 ? -20.338 2.675   1.496   1.00 0.00 ? 111 LYS A CB   3  
ATOM   8066  C  CG   . LYS A 1 111 ? -20.372 3.437   0.150   1.00 0.00 ? 111 LYS A CG   3  
ATOM   8067  C  CD   . LYS A 1 111 ? -20.894 4.878   0.287   1.00 0.00 ? 111 LYS A CD   3  
ATOM   8068  C  CE   . LYS A 1 111 ? -22.353 4.881   0.769   1.00 0.00 ? 111 LYS A CE   3  
ATOM   8069  N  NZ   . LYS A 1 111 ? -23.253 5.156   -0.386  1.00 0.00 ? 111 LYS A NZ   3  
ATOM   8070  H  H    . LYS A 1 111 ? -18.208 3.991   1.970   1.00 0.00 ? 111 LYS A H    3  
ATOM   8071  H  HA   . LYS A 1 111 ? -20.956 4.292   2.744   1.00 0.00 ? 111 LYS A HA   3  
ATOM   8072  H  HB2  . LYS A 1 111 ? -19.523 1.979   1.476   1.00 0.00 ? 111 LYS A HB2  3  
ATOM   8073  H  HB3  . LYS A 1 111 ? -21.251 2.133   1.614   1.00 0.00 ? 111 LYS A HB3  3  
ATOM   8074  H  HG2  . LYS A 1 111 ? -19.385 3.467   -0.256  1.00 0.00 ? 111 LYS A HG2  3  
ATOM   8075  H  HG3  . LYS A 1 111 ? -21.006 2.899   -0.534  1.00 0.00 ? 111 LYS A HG3  3  
ATOM   8076  H  HD2  . LYS A 1 111 ? -20.275 5.428   0.976   1.00 0.00 ? 111 LYS A HD2  3  
ATOM   8077  H  HD3  . LYS A 1 111 ? -20.847 5.357   -0.680  1.00 0.00 ? 111 LYS A HD3  3  
ATOM   8078  H  HE2  . LYS A 1 111 ? -22.600 3.920   1.197   1.00 0.00 ? 111 LYS A HE2  3  
ATOM   8079  H  HE3  . LYS A 1 111 ? -22.482 5.650   1.516   1.00 0.00 ? 111 LYS A HE3  3  
ATOM   8080  H  HZ1  . LYS A 1 111 ? -23.350 4.296   -0.963  1.00 0.00 ? 111 LYS A HZ1  3  
ATOM   8081  H  HZ2  . LYS A 1 111 ? -22.848 5.917   -0.968  1.00 0.00 ? 111 LYS A HZ2  3  
ATOM   8082  H  HZ3  . LYS A 1 111 ? -24.188 5.446   -0.034  1.00 0.00 ? 111 LYS A HZ3  3  
ATOM   8083  N  N    . ASN A 1 112 ? -19.013 2.199   4.320   1.00 0.00 ? 112 ASN A N    3  
ATOM   8084  C  CA   . ASN A 1 112 ? -18.894 1.369   5.517   1.00 0.00 ? 112 ASN A CA   3  
ATOM   8085  C  C    . ASN A 1 112 ? -17.645 1.737   6.314   1.00 0.00 ? 112 ASN A C    3  
ATOM   8086  O  O    . ASN A 1 112 ? -16.599 1.102   6.180   1.00 0.00 ? 112 ASN A O    3  
ATOM   8087  C  CB   . ASN A 1 112 ? -18.831 -0.107  5.126   1.00 0.00 ? 112 ASN A CB   3  
ATOM   8088  C  CG   . ASN A 1 112 ? -20.084 -0.495  4.352   1.00 0.00 ? 112 ASN A CG   3  
ATOM   8089  O  OD1  . ASN A 1 112 ? -20.211 -0.174  3.170   1.00 0.00 ? 112 ASN A OD1  3  
ATOM   8090  N  ND2  . ASN A 1 112 ? -21.025 -1.170  4.952   1.00 0.00 ? 112 ASN A ND2  3  
ATOM   8091  H  H    . ASN A 1 112 ? -18.228 2.349   3.758   1.00 0.00 ? 112 ASN A H    3  
ATOM   8092  H  HA   . ASN A 1 112 ? -19.761 1.526   6.138   1.00 0.00 ? 112 ASN A HA   3  
ATOM   8093  H  HB2  . ASN A 1 112 ? -17.961 -0.278  4.509   1.00 0.00 ? 112 ASN A HB2  3  
ATOM   8094  H  HB3  . ASN A 1 112 ? -18.763 -0.709  6.018   1.00 0.00 ? 112 ASN A HB3  3  
ATOM   8095  H  HD21 . ASN A 1 112 ? -20.922 -1.424  5.894   1.00 0.00 ? 112 ASN A HD21 3  
ATOM   8096  H  HD22 . ASN A 1 112 ? -21.834 -1.426  4.463   1.00 0.00 ? 112 ASN A HD22 3  
ATOM   8097  N  N    . LYS A 1 113 ? -17.766 2.769   7.141   1.00 0.00 ? 113 LYS A N    3  
ATOM   8098  C  CA   . LYS A 1 113 ? -16.650 3.228   7.959   1.00 0.00 ? 113 LYS A CA   3  
ATOM   8099  C  C    . LYS A 1 113 ? -16.087 2.103   8.831   1.00 0.00 ? 113 LYS A C    3  
ATOM   8100  O  O    . LYS A 1 113 ? -15.144 2.321   9.591   1.00 0.00 ? 113 LYS A O    3  
ATOM   8101  C  CB   . LYS A 1 113 ? -17.112 4.366   8.862   1.00 0.00 ? 113 LYS A CB   3  
ATOM   8102  C  CG   . LYS A 1 113 ? -17.219 5.670   8.061   1.00 0.00 ? 113 LYS A CG   3  
ATOM   8103  C  CD   . LYS A 1 113 ? -18.427 5.618   7.114   1.00 0.00 ? 113 LYS A CD   3  
ATOM   8104  C  CE   . LYS A 1 113 ? -19.007 7.026   6.941   1.00 0.00 ? 113 LYS A CE   3  
ATOM   8105  N  NZ   . LYS A 1 113 ? -17.895 8.003   6.762   1.00 0.00 ? 113 LYS A NZ   3  
ATOM   8106  H  H    . LYS A 1 113 ? -18.621 3.236   7.199   1.00 0.00 ? 113 LYS A H    3  
ATOM   8107  H  HA   . LYS A 1 113 ? -15.877 3.595   7.316   1.00 0.00 ? 113 LYS A HA   3  
ATOM   8108  H  HB2  . LYS A 1 113 ? -18.071 4.116   9.275   1.00 0.00 ? 113 LYS A HB2  3  
ATOM   8109  H  HB3  . LYS A 1 113 ? -16.400 4.497   9.663   1.00 0.00 ? 113 LYS A HB3  3  
ATOM   8110  H  HG2  . LYS A 1 113 ? -17.334 6.497   8.747   1.00 0.00 ? 113 LYS A HG2  3  
ATOM   8111  H  HG3  . LYS A 1 113 ? -16.318 5.811   7.483   1.00 0.00 ? 113 LYS A HG3  3  
ATOM   8112  H  HD2  . LYS A 1 113 ? -18.111 5.239   6.152   1.00 0.00 ? 113 LYS A HD2  3  
ATOM   8113  H  HD3  . LYS A 1 113 ? -19.186 4.968   7.521   1.00 0.00 ? 113 LYS A HD3  3  
ATOM   8114  H  HE2  . LYS A 1 113 ? -19.650 7.049   6.075   1.00 0.00 ? 113 LYS A HE2  3  
ATOM   8115  H  HE3  . LYS A 1 113 ? -19.577 7.289   7.820   1.00 0.00 ? 113 LYS A HE3  3  
ATOM   8116  H  HZ1  . LYS A 1 113 ? -17.001 7.572   7.071   1.00 0.00 ? 113 LYS A HZ1  3  
ATOM   8117  H  HZ2  . LYS A 1 113 ? -18.084 8.852   7.331   1.00 0.00 ? 113 LYS A HZ2  3  
ATOM   8118  H  HZ3  . LYS A 1 113 ? -17.826 8.267   5.757   1.00 0.00 ? 113 LYS A HZ3  3  
ATOM   8119  N  N    . HIS A 1 114 ? -16.668 0.910   8.735   1.00 0.00 ? 114 HIS A N    3  
ATOM   8120  C  CA   . HIS A 1 114 ? -16.200 -0.215  9.545   1.00 0.00 ? 114 HIS A CA   3  
ATOM   8121  C  C    . HIS A 1 114 ? -14.844 -0.718  9.057   1.00 0.00 ? 114 HIS A C    3  
ATOM   8122  O  O    . HIS A 1 114 ? -14.351 -1.746  9.521   1.00 0.00 ? 114 HIS A O    3  
ATOM   8123  C  CB   . HIS A 1 114 ? -17.220 -1.357  9.514   1.00 0.00 ? 114 HIS A CB   3  
ATOM   8124  C  CG   . HIS A 1 114 ? -17.340 -1.910  8.118   1.00 0.00 ? 114 HIS A CG   3  
ATOM   8125  N  ND1  . HIS A 1 114 ? -16.389 -1.675  7.139   1.00 0.00 ? 114 HIS A ND1  3  
ATOM   8126  C  CD2  . HIS A 1 114 ? -18.297 -2.699  7.530   1.00 0.00 ? 114 HIS A CD2  3  
ATOM   8127  C  CE1  . HIS A 1 114 ? -16.790 -2.311  6.022   1.00 0.00 ? 114 HIS A CE1  3  
ATOM   8128  N  NE2  . HIS A 1 114 ? -17.948 -2.950  6.206   1.00 0.00 ? 114 HIS A NE2  3  
ATOM   8129  H  H    . HIS A 1 114 ? -17.422 0.785   8.123   1.00 0.00 ? 114 HIS A H    3  
ATOM   8130  H  HA   . HIS A 1 114 ? -16.094 0.120   10.566  1.00 0.00 ? 114 HIS A HA   3  
ATOM   8131  H  HB2  . HIS A 1 114 ? -16.896 -2.143  10.182  1.00 0.00 ? 114 HIS A HB2  3  
ATOM   8132  H  HB3  . HIS A 1 114 ? -18.181 -0.987  9.838   1.00 0.00 ? 114 HIS A HB3  3  
ATOM   8133  H  HD1  . HIS A 1 114 ? -15.573 -1.142  7.238   1.00 0.00 ? 114 HIS A HD1  3  
ATOM   8134  H  HD2  . HIS A 1 114 ? -19.189 -3.067  8.018   1.00 0.00 ? 114 HIS A HD2  3  
ATOM   8135  H  HE1  . HIS A 1 114 ? -16.243 -2.302  5.091   1.00 0.00 ? 114 HIS A HE1  3  
ATOM   8136  H  HE2  . HIS A 1 114 ? -18.444 -3.483  5.550   1.00 0.00 ? 114 HIS A HE2  3  
ATOM   8137  N  N    . VAL A 1 115 ? -14.248 0.011   8.120   1.00 0.00 ? 115 VAL A N    3  
ATOM   8138  C  CA   . VAL A 1 115 ? -12.952 -0.360  7.570   1.00 0.00 ? 115 VAL A CA   3  
ATOM   8139  C  C    . VAL A 1 115 ? -11.901 0.689   7.932   1.00 0.00 ? 115 VAL A C    3  
ATOM   8140  O  O    . VAL A 1 115 ? -12.208 1.877   8.037   1.00 0.00 ? 115 VAL A O    3  
ATOM   8141  C  CB   . VAL A 1 115 ? -13.091 -0.499  6.039   1.00 0.00 ? 115 VAL A CB   3  
ATOM   8142  C  CG1  . VAL A 1 115 ? -11.831 -0.025  5.333   1.00 0.00 ? 115 VAL A CG1  3  
ATOM   8143  C  CG2  . VAL A 1 115 ? -13.318 -1.962  5.667   1.00 0.00 ? 115 VAL A CG2  3  
ATOM   8144  H  H    . VAL A 1 115 ? -14.687 0.819   7.786   1.00 0.00 ? 115 VAL A H    3  
ATOM   8145  H  HA   . VAL A 1 115 ? -12.646 -1.307  7.982   1.00 0.00 ? 115 VAL A HA   3  
ATOM   8146  H  HB   . VAL A 1 115 ? -13.931 0.089   5.702   1.00 0.00 ? 115 VAL A HB   3  
ATOM   8147  H  HG11 . VAL A 1 115 ? -10.981 -0.561  5.720   1.00 0.00 ? 115 VAL A HG11 3  
ATOM   8148  H  HG12 . VAL A 1 115 ? -11.703 1.029   5.504   1.00 0.00 ? 115 VAL A HG12 3  
ATOM   8149  H  HG13 . VAL A 1 115 ? -11.929 -0.214  4.276   1.00 0.00 ? 115 VAL A HG13 3  
ATOM   8150  H  HG21 . VAL A 1 115 ? -13.615 -2.026  4.632   1.00 0.00 ? 115 VAL A HG21 3  
ATOM   8151  H  HG22 . VAL A 1 115 ? -14.091 -2.375  6.292   1.00 0.00 ? 115 VAL A HG22 3  
ATOM   8152  H  HG23 . VAL A 1 115 ? -12.400 -2.514  5.814   1.00 0.00 ? 115 VAL A HG23 3  
ATOM   8153  N  N    . SER A 1 116 ? -10.659 0.242   8.109   1.00 0.00 ? 116 SER A N    3  
ATOM   8154  C  CA   . SER A 1 116 ? -9.571  1.155   8.444   1.00 0.00 ? 116 SER A CA   3  
ATOM   8155  C  C    . SER A 1 116 ? -8.328  0.847   7.609   1.00 0.00 ? 116 SER A C    3  
ATOM   8156  O  O    . SER A 1 116 ? -7.581  -0.082  7.920   1.00 0.00 ? 116 SER A O    3  
ATOM   8157  C  CB   . SER A 1 116 ? -9.227  1.034   9.926   1.00 0.00 ? 116 SER A CB   3  
ATOM   8158  O  OG   . SER A 1 116 ? -10.324 1.498   10.702  1.00 0.00 ? 116 SER A OG   3  
ATOM   8159  H  H    . SER A 1 116 ? -10.469 -0.718  8.005   1.00 0.00 ? 116 SER A H    3  
ATOM   8160  H  HA   . SER A 1 116 ? -9.883  2.168   8.242   1.00 0.00 ? 116 SER A HA   3  
ATOM   8161  H  HB2  . SER A 1 116 ? -9.031  0.004   10.167  1.00 0.00 ? 116 SER A HB2  3  
ATOM   8162  H  HB3  . SER A 1 116 ? -8.346  1.625   10.137  1.00 0.00 ? 116 SER A HB3  3  
ATOM   8163  H  HG   . SER A 1 116 ? -10.309 1.035   11.543  1.00 0.00 ? 116 SER A HG   3  
ATOM   8164  N  N    . LEU A 1 117 ? -8.101  1.634   6.560   1.00 0.00 ? 117 LEU A N    3  
ATOM   8165  C  CA   . LEU A 1 117 ? -6.936  1.431   5.712   1.00 0.00 ? 117 LEU A CA   3  
ATOM   8166  C  C    . LEU A 1 117 ? -5.807  2.342   6.146   1.00 0.00 ? 117 LEU A C    3  
ATOM   8167  O  O    . LEU A 1 117 ? -6.008  3.536   6.360   1.00 0.00 ? 117 LEU A O    3  
ATOM   8168  C  CB   . LEU A 1 117 ? -7.211  1.772   4.244   1.00 0.00 ? 117 LEU A CB   3  
ATOM   8169  C  CG   . LEU A 1 117 ? -8.455  1.081   3.674   1.00 0.00 ? 117 LEU A CG   3  
ATOM   8170  C  CD1  . LEU A 1 117 ? -8.663  -0.330  4.232   1.00 0.00 ? 117 LEU A CD1  3  
ATOM   8171  C  CD2  . LEU A 1 117 ? -9.678  1.925   3.965   1.00 0.00 ? 117 LEU A CD2  3  
ATOM   8172  H  H    . LEU A 1 117 ? -8.716  2.365   6.361   1.00 0.00 ? 117 LEU A H    3  
ATOM   8173  H  HA   . LEU A 1 117 ? -6.614  0.407   5.781   1.00 0.00 ? 117 LEU A HA   3  
ATOM   8174  H  HB2  . LEU A 1 117 ? -7.337  2.842   4.155   1.00 0.00 ? 117 LEU A HB2  3  
ATOM   8175  H  HB3  . LEU A 1 117 ? -6.354  1.478   3.662   1.00 0.00 ? 117 LEU A HB3  3  
ATOM   8176  H  HG   . LEU A 1 117 ? -8.335  1.011   2.606   1.00 0.00 ? 117 LEU A HG   3  
ATOM   8177  H  HD11 . LEU A 1 117 ? -8.677  -0.310  5.310   1.00 0.00 ? 117 LEU A HD11 3  
ATOM   8178  H  HD12 . LEU A 1 117 ? -7.870  -0.966  3.883   1.00 0.00 ? 117 LEU A HD12 3  
ATOM   8179  H  HD13 . LEU A 1 117 ? -9.607  -0.715  3.872   1.00 0.00 ? 117 LEU A HD13 3  
ATOM   8180  H  HD21 . LEU A 1 117 ? -10.541 1.413   3.599   1.00 0.00 ? 117 LEU A HD21 3  
ATOM   8181  H  HD22 . LEU A 1 117 ? -9.580  2.875   3.466   1.00 0.00 ? 117 LEU A HD22 3  
ATOM   8182  H  HD23 . LEU A 1 117 ? -9.771  2.078   5.025   1.00 0.00 ? 117 LEU A HD23 3  
ATOM   8183  N  N    . CYS A 1 118 ? -4.610  1.790   6.216   1.00 0.00 ? 118 CYS A N    3  
ATOM   8184  C  CA   . CYS A 1 118 ? -3.438  2.577   6.555   1.00 0.00 ? 118 CYS A CA   3  
ATOM   8185  C  C    . CYS A 1 118 ? -2.430  2.411   5.430   1.00 0.00 ? 118 CYS A C    3  
ATOM   8186  O  O    . CYS A 1 118 ? -1.642  1.464   5.420   1.00 0.00 ? 118 CYS A O    3  
ATOM   8187  C  CB   . CYS A 1 118 ? -2.841  2.094   7.874   1.00 0.00 ? 118 CYS A CB   3  
ATOM   8188  S  SG   . CYS A 1 118 ? -3.765  2.809   9.256   1.00 0.00 ? 118 CYS A SG   3  
ATOM   8189  H  H    . CYS A 1 118 ? -4.504  0.842   5.994   1.00 0.00 ? 118 CYS A H    3  
ATOM   8190  H  HA   . CYS A 1 118 ? -3.711  3.620   6.641   1.00 0.00 ? 118 CYS A HA   3  
ATOM   8191  H  HB2  . CYS A 1 118 ? -2.896  1.016   7.922   1.00 0.00 ? 118 CYS A HB2  3  
ATOM   8192  H  HB3  . CYS A 1 118 ? -1.812  2.404   7.930   1.00 0.00 ? 118 CYS A HB3  3  
ATOM   8193  H  HG   . CYS A 1 118 ? -4.682  2.537   9.172   1.00 0.00 ? 118 CYS A HG   3  
ATOM   8194  N  N    . ILE A 1 119 ? -2.498  3.309   4.454   1.00 0.00 ? 119 ILE A N    3  
ATOM   8195  C  CA   . ILE A 1 119 ? -1.638  3.232   3.302   1.00 0.00 ? 119 ILE A CA   3  
ATOM   8196  C  C    . ILE A 1 119 ? -0.312  3.938   3.489   1.00 0.00 ? 119 ILE A C    3  
ATOM   8197  O  O    . ILE A 1 119 ? -0.258  5.114   3.850   1.00 0.00 ? 119 ILE A O    3  
ATOM   8198  C  CB   . ILE A 1 119 ? -2.367  3.851   2.132   1.00 0.00 ? 119 ILE A CB   3  
ATOM   8199  C  CG1  . ILE A 1 119 ? -3.826  3.369   2.179   1.00 0.00 ? 119 ILE A CG1  3  
ATOM   8200  C  CG2  . ILE A 1 119 ? -1.674  3.418   0.837   1.00 0.00 ? 119 ILE A CG2  3  
ATOM   8201  C  CD1  . ILE A 1 119 ? -4.447  3.426   0.797   1.00 0.00 ? 119 ILE A CD1  3  
ATOM   8202  H  H    . ILE A 1 119 ? -3.177  4.015   4.481   1.00 0.00 ? 119 ILE A H    3  
ATOM   8203  H  HA   . ILE A 1 119 ? -1.457  2.201   3.063   1.00 0.00 ? 119 ILE A HA   3  
ATOM   8204  H  HB   . ILE A 1 119 ? -2.336  4.927   2.217   1.00 0.00 ? 119 ILE A HB   3  
ATOM   8205  H  HG12 . ILE A 1 119 ? -3.859  2.350   2.540   1.00 0.00 ? 119 ILE A HG12 3  
ATOM   8206  H  HG13 . ILE A 1 119 ? -4.392  4.004   2.849   1.00 0.00 ? 119 ILE A HG13 3  
ATOM   8207  H  HG21 . ILE A 1 119 ? -0.626  3.230   1.034   1.00 0.00 ? 119 ILE A HG21 3  
ATOM   8208  H  HG22 . ILE A 1 119 ? -1.766  4.204   0.104   1.00 0.00 ? 119 ILE A HG22 3  
ATOM   8209  H  HG23 . ILE A 1 119 ? -2.132  2.518   0.467   1.00 0.00 ? 119 ILE A HG23 3  
ATOM   8210  H  HD11 . ILE A 1 119 ? -5.518  3.340   0.886   1.00 0.00 ? 119 ILE A HD11 3  
ATOM   8211  H  HD12 . ILE A 1 119 ? -4.065  2.608   0.206   1.00 0.00 ? 119 ILE A HD12 3  
ATOM   8212  H  HD13 . ILE A 1 119 ? -4.192  4.364   0.331   1.00 0.00 ? 119 ILE A HD13 3  
ATOM   8213  N  N    . PHE A 1 120 ? 0.752   3.213   3.179   1.00 0.00 ? 120 PHE A N    3  
ATOM   8214  C  CA   . PHE A 1 120 ? 2.092   3.760   3.244   1.00 0.00 ? 120 PHE A CA   3  
ATOM   8215  C  C    . PHE A 1 120 ? 2.626   3.811   1.824   1.00 0.00 ? 120 PHE A C    3  
ATOM   8216  O  O    . PHE A 1 120 ? 3.012   2.792   1.252   1.00 0.00 ? 120 PHE A O    3  
ATOM   8217  C  CB   . PHE A 1 120 ? 2.976   2.879   4.125   1.00 0.00 ? 120 PHE A CB   3  
ATOM   8218  C  CG   . PHE A 1 120 ? 2.783   3.270   5.570   1.00 0.00 ? 120 PHE A CG   3  
ATOM   8219  C  CD1  . PHE A 1 120 ? 3.225   4.518   6.024   1.00 0.00 ? 120 PHE A CD1  3  
ATOM   8220  C  CD2  . PHE A 1 120 ? 2.152   2.387   6.456   1.00 0.00 ? 120 PHE A CD2  3  
ATOM   8221  C  CE1  . PHE A 1 120 ? 3.039   4.882   7.362   1.00 0.00 ? 120 PHE A CE1  3  
ATOM   8222  C  CE2  . PHE A 1 120 ? 1.965   2.755   7.794   1.00 0.00 ? 120 PHE A CE2  3  
ATOM   8223  C  CZ   . PHE A 1 120 ? 2.409   4.002   8.246   1.00 0.00 ? 120 PHE A CZ   3  
ATOM   8224  H  H    . PHE A 1 120 ? 0.630   2.296   2.858   1.00 0.00 ? 120 PHE A H    3  
ATOM   8225  H  HA   . PHE A 1 120 ? 2.058   4.763   3.648   1.00 0.00 ? 120 PHE A HA   3  
ATOM   8226  H  HB2  . PHE A 1 120 ? 2.698   1.845   3.991   1.00 0.00 ? 120 PHE A HB2  3  
ATOM   8227  H  HB3  . PHE A 1 120 ? 4.009   3.014   3.850   1.00 0.00 ? 120 PHE A HB3  3  
ATOM   8228  H  HD1  . PHE A 1 120 ? 3.711   5.197   5.341   1.00 0.00 ? 120 PHE A HD1  3  
ATOM   8229  H  HD2  . PHE A 1 120 ? 1.810   1.425   6.109   1.00 0.00 ? 120 PHE A HD2  3  
ATOM   8230  H  HE1  . PHE A 1 120 ? 3.381   5.844   7.711   1.00 0.00 ? 120 PHE A HE1  3  
ATOM   8231  H  HE2  . PHE A 1 120 ? 1.479   2.076   8.477   1.00 0.00 ? 120 PHE A HE2  3  
ATOM   8232  H  HZ   . PHE A 1 120 ? 2.263   4.285   9.278   1.00 0.00 ? 120 PHE A HZ   3  
ATOM   8233  N  N    . THR A 1 121 ? 2.592   5.000   1.245   1.00 0.00 ? 121 THR A N    3  
ATOM   8234  C  CA   . THR A 1 121 ? 3.019   5.193   -0.135  1.00 0.00 ? 121 THR A CA   3  
ATOM   8235  C  C    . THR A 1 121 ? 4.268   6.071   -0.196  1.00 0.00 ? 121 THR A C    3  
ATOM   8236  O  O    . THR A 1 121 ? 4.364   7.084   0.498   1.00 0.00 ? 121 THR A O    3  
ATOM   8237  C  CB   . THR A 1 121 ? 1.858   5.817   -0.936  1.00 0.00 ? 121 THR A CB   3  
ATOM   8238  O  OG1  . THR A 1 121 ? 2.277   7.050   -1.503  1.00 0.00 ? 121 THR A OG1  3  
ATOM   8239  C  CG2  . THR A 1 121 ? 0.652   6.056   -0.012  1.00 0.00 ? 121 THR A CG2  3  
ATOM   8240  H  H    . THR A 1 121 ? 2.237   5.762   1.745   1.00 0.00 ? 121 THR A H    3  
ATOM   8241  H  HA   . THR A 1 121 ? 3.256   4.232   -0.565  1.00 0.00 ? 121 THR A HA   3  
ATOM   8242  H  HB   . THR A 1 121 ? 1.556   5.139   -1.723  1.00 0.00 ? 121 THR A HB   3  
ATOM   8243  H  HG1  . THR A 1 121 ? 1.527   7.433   -1.962  1.00 0.00 ? 121 THR A HG1  3  
ATOM   8244  H  HG21 . THR A 1 121 ? 0.905   6.796   0.732   1.00 0.00 ? 121 THR A HG21 3  
ATOM   8245  H  HG22 . THR A 1 121 ? 0.389   5.133   0.479   1.00 0.00 ? 121 THR A HG22 3  
ATOM   8246  H  HG23 . THR A 1 121 ? -0.188  6.401   -0.595  1.00 0.00 ? 121 THR A HG23 3  
ATOM   8247  N  N    . ALA A 1 122 ? 5.233   5.651   -1.011  1.00 0.00 ? 122 ALA A N    3  
ATOM   8248  C  CA   . ALA A 1 122 ? 6.494   6.375   -1.141  1.00 0.00 ? 122 ALA A CA   3  
ATOM   8249  C  C    . ALA A 1 122 ? 6.330   7.693   -1.890  1.00 0.00 ? 122 ALA A C    3  
ATOM   8250  O  O    . ALA A 1 122 ? 6.425   8.763   -1.290  1.00 0.00 ? 122 ALA A O    3  
ATOM   8251  C  CB   . ALA A 1 122 ? 7.522   5.501   -1.858  1.00 0.00 ? 122 ALA A CB   3  
ATOM   8252  H  H    . ALA A 1 122 ? 5.103   4.823   -1.520  1.00 0.00 ? 122 ALA A H    3  
ATOM   8253  H  HA   . ALA A 1 122 ? 6.867   6.592   -0.153  1.00 0.00 ? 122 ALA A HA   3  
ATOM   8254  H  HB1  . ALA A 1 122 ? 8.414   6.080   -2.053  1.00 0.00 ? 122 ALA A HB1  3  
ATOM   8255  H  HB2  . ALA A 1 122 ? 7.107   5.150   -2.790  1.00 0.00 ? 122 ALA A HB2  3  
ATOM   8256  H  HB3  . ALA A 1 122 ? 7.771   4.656   -1.233  1.00 0.00 ? 122 ALA A HB3  3  
ATOM   8257  N  N    . ARG A 1 123 ? 6.114   7.627   -3.203  1.00 0.00 ? 123 ARG A N    3  
ATOM   8258  C  CA   . ARG A 1 123 ? 5.974   8.851   -3.983  1.00 0.00 ? 123 ARG A CA   3  
ATOM   8259  C  C    . ARG A 1 123 ? 5.114   8.646   -5.229  1.00 0.00 ? 123 ARG A C    3  
ATOM   8260  O  O    . ARG A 1 123 ? 5.121   7.577   -5.837  1.00 0.00 ? 123 ARG A O    3  
ATOM   8261  C  CB   . ARG A 1 123 ? 7.360   9.354   -4.392  1.00 0.00 ? 123 ARG A CB   3  
ATOM   8262  C  CG   . ARG A 1 123 ? 7.860   8.554   -5.601  1.00 0.00 ? 123 ARG A CG   3  
ATOM   8263  C  CD   . ARG A 1 123 ? 9.391   8.536   -5.620  1.00 0.00 ? 123 ARG A CD   3  
ATOM   8264  N  NE   . ARG A 1 123 ? 9.885   7.317   -4.991  1.00 0.00 ? 123 ARG A NE   3  
ATOM   8265  C  CZ   . ARG A 1 123 ? 9.604   6.120   -5.497  1.00 0.00 ? 123 ARG A CZ   3  
ATOM   8266  N  NH1  . ARG A 1 123 ? 8.858   6.021   -6.563  1.00 0.00 ? 123 ARG A NH1  3  
ATOM   8267  N  NH2  . ARG A 1 123 ? 10.072  5.046   -4.925  1.00 0.00 ? 123 ARG A NH2  3  
ATOM   8268  H  H    . ARG A 1 123 ? 6.068   6.756   -3.649  1.00 0.00 ? 123 ARG A H    3  
ATOM   8269  H  HA   . ARG A 1 123 ? 5.510   9.598   -3.366  1.00 0.00 ? 123 ARG A HA   3  
ATOM   8270  H  HB2  . ARG A 1 123 ? 7.303   10.402  -4.648  1.00 0.00 ? 123 ARG A HB2  3  
ATOM   8271  H  HB3  . ARG A 1 123 ? 8.045   9.222   -3.569  1.00 0.00 ? 123 ARG A HB3  3  
ATOM   8272  H  HG2  . ARG A 1 123 ? 7.491   7.540   -5.538  1.00 0.00 ? 123 ARG A HG2  3  
ATOM   8273  H  HG3  . ARG A 1 123 ? 7.496   9.012   -6.509  1.00 0.00 ? 123 ARG A HG3  3  
ATOM   8274  H  HD2  . ARG A 1 123 ? 9.733   8.569   -6.642  1.00 0.00 ? 123 ARG A HD2  3  
ATOM   8275  H  HD3  . ARG A 1 123 ? 9.773   9.396   -5.089  1.00 0.00 ? 123 ARG A HD3  3  
ATOM   8276  H  HE   . ARG A 1 123 ? 10.438  7.381   -4.184  1.00 0.00 ? 123 ARG A HE   3  
ATOM   8277  H  HH11 . ARG A 1 123 ? 8.496   6.845   -6.999  1.00 0.00 ? 123 ARG A HH11 3  
ATOM   8278  H  HH12 . ARG A 1 123 ? 8.646   5.119   -6.942  1.00 0.00 ? 123 ARG A HH12 3  
ATOM   8279  H  HH21 . ARG A 1 123 ? 10.640  5.122   -4.105  1.00 0.00 ? 123 ARG A HH21 3  
ATOM   8280  H  HH22 . ARG A 1 123 ? 9.863   4.145   -5.306  1.00 0.00 ? 123 ARG A HH22 3  
ATOM   8281  N  N    . ILE A 1 124 ? 4.382   9.695   -5.599  1.00 0.00 ? 124 ILE A N    3  
ATOM   8282  C  CA   . ILE A 1 124 ? 3.516   9.658   -6.772  1.00 0.00 ? 124 ILE A CA   3  
ATOM   8283  C  C    . ILE A 1 124 ? 3.774   10.873  -7.657  1.00 0.00 ? 124 ILE A C    3  
ATOM   8284  O  O    . ILE A 1 124 ? 3.627   12.012  -7.216  1.00 0.00 ? 124 ILE A O    3  
ATOM   8285  C  CB   . ILE A 1 124 ? 2.060   9.669   -6.326  1.00 0.00 ? 124 ILE A CB   3  
ATOM   8286  C  CG1  . ILE A 1 124 ? 1.815   10.925  -5.469  1.00 0.00 ? 124 ILE A CG1  3  
ATOM   8287  C  CG2  . ILE A 1 124 ? 1.777   8.404   -5.514  1.00 0.00 ? 124 ILE A CG2  3  
ATOM   8288  C  CD1  . ILE A 1 124 ? 0.640   10.703  -4.517  1.00 0.00 ? 124 ILE A CD1  3  
ATOM   8289  H  H    . ILE A 1 124 ? 4.425   10.519  -5.068  1.00 0.00 ? 124 ILE A H    3  
ATOM   8290  H  HA   . ILE A 1 124 ? 3.707   8.757   -7.335  1.00 0.00 ? 124 ILE A HA   3  
ATOM   8291  H  HB   . ILE A 1 124 ? 1.416   9.690   -7.194  1.00 0.00 ? 124 ILE A HB   3  
ATOM   8292  H  HG12 . ILE A 1 124 ? 2.701   11.148  -4.893  1.00 0.00 ? 124 ILE A HG12 3  
ATOM   8293  H  HG13 . ILE A 1 124 ? 1.595   11.760  -6.118  1.00 0.00 ? 124 ILE A HG13 3  
ATOM   8294  H  HG21 . ILE A 1 124 ? 2.303   7.569   -5.954  1.00 0.00 ? 124 ILE A HG21 3  
ATOM   8295  H  HG22 . ILE A 1 124 ? 0.717   8.204   -5.519  1.00 0.00 ? 124 ILE A HG22 3  
ATOM   8296  H  HG23 . ILE A 1 124 ? 2.115   8.548   -4.499  1.00 0.00 ? 124 ILE A HG23 3  
ATOM   8297  H  HD11 . ILE A 1 124 ? -0.121  10.121  -5.013  1.00 0.00 ? 124 ILE A HD11 3  
ATOM   8298  H  HD12 . ILE A 1 124 ? 0.231   11.658  -4.223  1.00 0.00 ? 124 ILE A HD12 3  
ATOM   8299  H  HD13 . ILE A 1 124 ? 0.983   10.174  -3.641  1.00 0.00 ? 124 ILE A HD13 3  
ATOM   8300  N  N    . TYR A 1 125 ? 4.158   10.626  -8.907  1.00 0.00 ? 125 TYR A N    3  
ATOM   8301  C  CA   . TYR A 1 125 ? 4.432   11.717  -9.841  1.00 0.00 ? 125 TYR A CA   3  
ATOM   8302  C  C    . TYR A 1 125 ? 3.453   11.676  -11.011 1.00 0.00 ? 125 TYR A C    3  
ATOM   8303  O  O    . TYR A 1 125 ? 3.617   10.893  -11.946 1.00 0.00 ? 125 TYR A O    3  
ATOM   8304  C  CB   . TYR A 1 125 ? 5.875   11.605  -10.360 1.00 0.00 ? 125 TYR A CB   3  
ATOM   8305  C  CG   . TYR A 1 125 ? 6.792   12.465  -9.518  1.00 0.00 ? 125 TYR A CG   3  
ATOM   8306  C  CD1  . TYR A 1 125 ? 7.031   12.133  -8.179  1.00 0.00 ? 125 TYR A CD1  3  
ATOM   8307  C  CD2  . TYR A 1 125 ? 7.398   13.594  -10.079 1.00 0.00 ? 125 TYR A CD2  3  
ATOM   8308  C  CE1  . TYR A 1 125 ? 7.878   12.932  -7.401  1.00 0.00 ? 125 TYR A CE1  3  
ATOM   8309  C  CE2  . TYR A 1 125 ? 8.244   14.394  -9.302  1.00 0.00 ? 125 TYR A CE2  3  
ATOM   8310  C  CZ   . TYR A 1 125 ? 8.485   14.062  -7.962  1.00 0.00 ? 125 TYR A CZ   3  
ATOM   8311  O  OH   . TYR A 1 125 ? 9.318   14.852  -7.196  1.00 0.00 ? 125 TYR A OH   3  
ATOM   8312  H  H    . TYR A 1 125 ? 4.261   9.700   -9.206  1.00 0.00 ? 125 TYR A H    3  
ATOM   8313  H  HA   . TYR A 1 125 ? 4.314   12.662  -9.327  1.00 0.00 ? 125 TYR A HA   3  
ATOM   8314  H  HB2  . TYR A 1 125 ? 6.197   10.576  -10.304 1.00 0.00 ? 125 TYR A HB2  3  
ATOM   8315  H  HB3  . TYR A 1 125 ? 5.918   11.939  -11.388 1.00 0.00 ? 125 TYR A HB3  3  
ATOM   8316  H  HD1  . TYR A 1 125 ? 6.563   11.262  -7.746  1.00 0.00 ? 125 TYR A HD1  3  
ATOM   8317  H  HD2  . TYR A 1 125 ? 7.214   13.849  -11.112 1.00 0.00 ? 125 TYR A HD2  3  
ATOM   8318  H  HE1  . TYR A 1 125 ? 8.063   12.676  -6.368  1.00 0.00 ? 125 TYR A HE1  3  
ATOM   8319  H  HE2  . TYR A 1 125 ? 8.712   15.265  -9.734  1.00 0.00 ? 125 TYR A HE2  3  
ATOM   8320  H  HH   . TYR A 1 125 ? 10.049  14.307  -6.896  1.00 0.00 ? 125 TYR A HH   3  
ATOM   8321  N  N    . ASP A 1 126 ? 2.443   12.541  -10.957 1.00 0.00 ? 126 ASP A N    3  
ATOM   8322  C  CA   . ASP A 1 126 ? 1.447   12.617  -12.018 1.00 0.00 ? 126 ASP A CA   3  
ATOM   8323  C  C    . ASP A 1 126 ? 1.656   13.894  -12.821 1.00 0.00 ? 126 ASP A C    3  
ATOM   8324  O  O    . ASP A 1 126 ? 2.700   14.537  -12.713 1.00 0.00 ? 126 ASP A O    3  
ATOM   8325  C  CB   . ASP A 1 126 ? 0.038   12.602  -11.418 1.00 0.00 ? 126 ASP A CB   3  
ATOM   8326  C  CG   . ASP A 1 126 ? -0.411  11.165  -11.174 1.00 0.00 ? 126 ASP A CG   3  
ATOM   8327  O  OD1  . ASP A 1 126 ? 0.411   10.373  -10.746 1.00 0.00 ? 126 ASP A OD1  3  
ATOM   8328  O  OD2  . ASP A 1 126 ? -1.572  10.879  -11.420 1.00 0.00 ? 126 ASP A OD2  3  
ATOM   8329  H  H    . ASP A 1 126 ? 2.373   13.149  -10.191 1.00 0.00 ? 126 ASP A H    3  
ATOM   8330  H  HA   . ASP A 1 126 ? 1.559   11.765  -12.675 1.00 0.00 ? 126 ASP A HA   3  
ATOM   8331  H  HB2  . ASP A 1 126 ? 0.041   13.141  -10.482 1.00 0.00 ? 126 ASP A HB2  3  
ATOM   8332  H  HB3  . ASP A 1 126 ? -0.649  13.079  -12.102 1.00 0.00 ? 126 ASP A HB3  3  
ATOM   8333  N  N    . ASP A 1 127 ? 0.666   14.263  -13.626 1.00 0.00 ? 127 ASP A N    3  
ATOM   8334  C  CA   . ASP A 1 127 ? 0.767   15.472  -14.436 1.00 0.00 ? 127 ASP A CA   3  
ATOM   8335  C  C    . ASP A 1 127 ? -0.081  16.592  -13.839 1.00 0.00 ? 127 ASP A C    3  
ATOM   8336  O  O    . ASP A 1 127 ? -0.349  17.598  -14.495 1.00 0.00 ? 127 ASP A O    3  
ATOM   8337  C  CB   . ASP A 1 127 ? 0.307   15.181  -15.867 1.00 0.00 ? 127 ASP A CB   3  
ATOM   8338  C  CG   . ASP A 1 127 ? 1.438   14.524  -16.649 1.00 0.00 ? 127 ASP A CG   3  
ATOM   8339  O  OD1  . ASP A 1 127 ? 2.315   13.956  -16.020 1.00 0.00 ? 127 ASP A OD1  3  
ATOM   8340  O  OD2  . ASP A 1 127 ? 1.411   14.599  -17.867 1.00 0.00 ? 127 ASP A OD2  3  
ATOM   8341  H  H    . ASP A 1 127 ? -0.145  13.714  -13.674 1.00 0.00 ? 127 ASP A H    3  
ATOM   8342  H  HA   . ASP A 1 127 ? 1.798   15.792  -14.463 1.00 0.00 ? 127 ASP A HA   3  
ATOM   8343  H  HB2  . ASP A 1 127 ? -0.545  14.517  -15.840 1.00 0.00 ? 127 ASP A HB2  3  
ATOM   8344  H  HB3  . ASP A 1 127 ? 0.027   16.106  -16.350 1.00 0.00 ? 127 ASP A HB3  3  
ATOM   8345  N  N    . GLN A 1 128 ? -0.497  16.411  -12.590 1.00 0.00 ? 128 GLN A N    3  
ATOM   8346  C  CA   . GLN A 1 128 ? -1.313  17.413  -11.914 1.00 0.00 ? 128 GLN A CA   3  
ATOM   8347  C  C    . GLN A 1 128 ? -2.658  17.558  -12.612 1.00 0.00 ? 128 GLN A C    3  
ATOM   8348  O  O    . GLN A 1 128 ? -2.785  18.294  -13.590 1.00 0.00 ? 128 GLN A O    3  
ATOM   8349  C  CB   . GLN A 1 128 ? -0.592  18.761  -11.907 1.00 0.00 ? 128 GLN A CB   3  
ATOM   8350  C  CG   . GLN A 1 128 ? 0.909   18.539  -11.712 1.00 0.00 ? 128 GLN A CG   3  
ATOM   8351  C  CD   . GLN A 1 128 ? 1.548   19.789  -11.118 1.00 0.00 ? 128 GLN A CD   3  
ATOM   8352  O  OE1  . GLN A 1 128 ? 2.507   19.695  -10.354 1.00 0.00 ? 128 GLN A OE1  3  
ATOM   8353  N  NE2  . GLN A 1 128 ? 1.068   20.964  -11.427 1.00 0.00 ? 128 GLN A NE2  3  
ATOM   8354  H  H    . GLN A 1 128 ? -0.254  15.590  -12.115 1.00 0.00 ? 128 GLN A H    3  
ATOM   8355  H  HA   . GLN A 1 128 ? -1.479  17.101  -10.894 1.00 0.00 ? 128 GLN A HA   3  
ATOM   8356  H  HB2  . GLN A 1 128 ? -0.762  19.264  -12.849 1.00 0.00 ? 128 GLN A HB2  3  
ATOM   8357  H  HB3  . GLN A 1 128 ? -0.971  19.369  -11.100 1.00 0.00 ? 128 GLN A HB3  3  
ATOM   8358  H  HG2  . GLN A 1 128 ? 1.064   17.704  -11.042 1.00 0.00 ? 128 GLN A HG2  3  
ATOM   8359  H  HG3  . GLN A 1 128 ? 1.367   18.322  -12.665 1.00 0.00 ? 128 GLN A HG3  3  
ATOM   8360  H  HE21 . GLN A 1 128 ? 0.304   21.037  -12.036 1.00 0.00 ? 128 GLN A HE21 3  
ATOM   8361  H  HE22 . GLN A 1 128 ? 1.472   21.773  -11.050 1.00 0.00 ? 128 GLN A HE22 3  
ATOM   8362  N  N    . GLY A 1 129 ? -3.659  16.848  -12.104 1.00 0.00 ? 129 GLY A N    3  
ATOM   8363  C  CA   . GLY A 1 129 ? -4.996  16.899  -12.688 1.00 0.00 ? 129 GLY A CA   3  
ATOM   8364  C  C    . GLY A 1 129 ? -6.061  16.968  -11.601 1.00 0.00 ? 129 GLY A C    3  
ATOM   8365  O  O    . GLY A 1 129 ? -5.904  16.390  -10.525 1.00 0.00 ? 129 GLY A O    3  
ATOM   8366  H  H    . GLY A 1 129 ? -3.497  16.276  -11.324 1.00 0.00 ? 129 GLY A H    3  
ATOM   8367  H  HA2  . GLY A 1 129 ? -5.076  17.772  -13.321 1.00 0.00 ? 129 GLY A HA2  3  
ATOM   8368  H  HA3  . GLY A 1 129 ? -5.154  16.013  -13.282 1.00 0.00 ? 129 GLY A HA3  3  
ATOM   8369  N  N    . ARG A 1 130 ? -7.146  17.682  -11.888 1.00 0.00 ? 130 ARG A N    3  
ATOM   8370  C  CA   . ARG A 1 130 ? -8.232  17.822  -10.924 1.00 0.00 ? 130 ARG A CA   3  
ATOM   8371  C  C    . ARG A 1 130 ? -8.900  16.473  -10.660 1.00 0.00 ? 130 ARG A C    3  
ATOM   8372  O  O    . ARG A 1 130 ? -9.874  16.389  -9.912  1.00 0.00 ? 130 ARG A O    3  
ATOM   8373  C  CB   . ARG A 1 130 ? -9.271  18.821  -11.440 1.00 0.00 ? 130 ARG A CB   3  
ATOM   8374  C  CG   . ARG A 1 130 ? -9.633  18.493  -12.890 1.00 0.00 ? 130 ARG A CG   3  
ATOM   8375  C  CD   . ARG A 1 130 ? -10.639 19.522  -13.408 1.00 0.00 ? 130 ARG A CD   3  
ATOM   8376  N  NE   . ARG A 1 130 ? -10.942 19.274  -14.813 1.00 0.00 ? 130 ARG A NE   3  
ATOM   8377  C  CZ   . ARG A 1 130 ? -11.721 18.262  -15.181 1.00 0.00 ? 130 ARG A CZ   3  
ATOM   8378  N  NH1  . ARG A 1 130 ? -12.219 17.462  -14.278 1.00 0.00 ? 130 ARG A NH1  3  
ATOM   8379  N  NH2  . ARG A 1 130 ? -11.988 18.071  -16.443 1.00 0.00 ? 130 ARG A NH2  3  
ATOM   8380  H  H    . ARG A 1 130 ? -7.215  18.121  -12.760 1.00 0.00 ? 130 ARG A H    3  
ATOM   8381  H  HA   . ARG A 1 130 ? -7.825  18.195  -9.997  1.00 0.00 ? 130 ARG A HA   3  
ATOM   8382  H  HB2  . ARG A 1 130 ? -10.159 18.765  -10.826 1.00 0.00 ? 130 ARG A HB2  3  
ATOM   8383  H  HB3  . ARG A 1 130 ? -8.864  19.820  -11.391 1.00 0.00 ? 130 ARG A HB3  3  
ATOM   8384  H  HG2  . ARG A 1 130 ? -8.742  18.522  -13.500 1.00 0.00 ? 130 ARG A HG2  3  
ATOM   8385  H  HG3  . ARG A 1 130 ? -10.071 17.507  -12.938 1.00 0.00 ? 130 ARG A HG3  3  
ATOM   8386  H  HD2  . ARG A 1 130 ? -11.550 19.453  -12.831 1.00 0.00 ? 130 ARG A HD2  3  
ATOM   8387  H  HD3  . ARG A 1 130 ? -10.223 20.513  -13.299 1.00 0.00 ? 130 ARG A HD3  3  
ATOM   8388  H  HE   . ARG A 1 130 ? -10.568 19.867  -15.498 1.00 0.00 ? 130 ARG A HE   3  
ATOM   8389  H  HH11 . ARG A 1 130 ? -12.013 17.610  -13.311 1.00 0.00 ? 130 ARG A HH11 3  
ATOM   8390  H  HH12 . ARG A 1 130 ? -12.805 16.700  -14.554 1.00 0.00 ? 130 ARG A HH12 3  
ATOM   8391  H  HH21 . ARG A 1 130 ? -11.604 18.683  -17.134 1.00 0.00 ? 130 ARG A HH21 3  
ATOM   8392  H  HH22 . ARG A 1 130 ? -12.575 17.310  -16.721 1.00 0.00 ? 130 ARG A HH22 3  
ATOM   8393  N  N    . CYS A 1 131 ? -8.365  15.421  -11.274 1.00 0.00 ? 131 CYS A N    3  
ATOM   8394  C  CA   . CYS A 1 131 ? -8.916  14.080  -11.092 1.00 0.00 ? 131 CYS A CA   3  
ATOM   8395  C  C    . CYS A 1 131 ? -8.704  13.609  -9.656  1.00 0.00 ? 131 CYS A C    3  
ATOM   8396  O  O    . CYS A 1 131 ? -9.143  12.525  -9.272  1.00 0.00 ? 131 CYS A O    3  
ATOM   8397  C  CB   . CYS A 1 131 ? -8.239  13.103  -12.055 1.00 0.00 ? 131 CYS A CB   3  
ATOM   8398  S  SG   . CYS A 1 131 ? -7.990  13.909  -13.656 1.00 0.00 ? 131 CYS A SG   3  
ATOM   8399  H  H    . CYS A 1 131 ? -7.587  15.546  -11.855 1.00 0.00 ? 131 CYS A H    3  
ATOM   8400  H  HA   . CYS A 1 131 ? -9.973  14.104  -11.303 1.00 0.00 ? 131 CYS A HA   3  
ATOM   8401  H  HB2  . CYS A 1 131 ? -7.284  12.803  -11.650 1.00 0.00 ? 131 CYS A HB2  3  
ATOM   8402  H  HB3  . CYS A 1 131 ? -8.867  12.233  -12.184 1.00 0.00 ? 131 CYS A HB3  3  
ATOM   8403  H  HG   . CYS A 1 131 ? -8.623  14.626  -13.730 1.00 0.00 ? 131 CYS A HG   3  
ATOM   8404  N  N    . GLN A 1 132 ? -8.026  14.436  -8.871  1.00 0.00 ? 132 GLN A N    3  
ATOM   8405  C  CA   . GLN A 1 132 ? -7.746  14.117  -7.475  1.00 0.00 ? 132 GLN A CA   3  
ATOM   8406  C  C    . GLN A 1 132 ? -9.030  13.805  -6.708  1.00 0.00 ? 132 GLN A C    3  
ATOM   8407  O  O    . GLN A 1 132 ? -8.975  13.373  -5.556  1.00 0.00 ? 132 GLN A O    3  
ATOM   8408  C  CB   . GLN A 1 132 ? -7.024  15.286  -6.804  1.00 0.00 ? 132 GLN A CB   3  
ATOM   8409  C  CG   . GLN A 1 132 ? -7.675  16.602  -7.228  1.00 0.00 ? 132 GLN A CG   3  
ATOM   8410  C  CD   . GLN A 1 132 ? -7.335  17.699  -6.223  1.00 0.00 ? 132 GLN A CD   3  
ATOM   8411  O  OE1  . GLN A 1 132 ? -6.509  18.566  -6.506  1.00 0.00 ? 132 GLN A OE1  3  
ATOM   8412  N  NE2  . GLN A 1 132 ? -7.928  17.713  -5.061  1.00 0.00 ? 132 GLN A NE2  3  
ATOM   8413  H  H    . GLN A 1 132 ? -7.702  15.285  -9.240  1.00 0.00 ? 132 GLN A H    3  
ATOM   8414  H  HA   . GLN A 1 132 ? -7.104  13.250  -7.441  1.00 0.00 ? 132 GLN A HA   3  
ATOM   8415  H  HB2  . GLN A 1 132 ? -7.091  15.179  -5.731  1.00 0.00 ? 132 GLN A HB2  3  
ATOM   8416  H  HB3  . GLN A 1 132 ? -5.987  15.286  -7.102  1.00 0.00 ? 132 GLN A HB3  3  
ATOM   8417  H  HG2  . GLN A 1 132 ? -7.308  16.884  -8.204  1.00 0.00 ? 132 GLN A HG2  3  
ATOM   8418  H  HG3  . GLN A 1 132 ? -8.746  16.476  -7.270  1.00 0.00 ? 132 GLN A HG3  3  
ATOM   8419  H  HE21 . GLN A 1 132 ? -8.587  17.022  -4.838  1.00 0.00 ? 132 GLN A HE21 3  
ATOM   8420  H  HE22 . GLN A 1 132 ? -7.715  18.414  -4.411  1.00 0.00 ? 132 GLN A HE22 3  
ATOM   8421  N  N    . GLU A 1 133 ? -10.178 14.051  -7.336  1.00 0.00 ? 133 GLU A N    3  
ATOM   8422  C  CA   . GLU A 1 133 ? -11.463 13.816  -6.684  1.00 0.00 ? 133 GLU A CA   3  
ATOM   8423  C  C    . GLU A 1 133 ? -11.384 12.633  -5.719  1.00 0.00 ? 133 GLU A C    3  
ATOM   8424  O  O    . GLU A 1 133 ? -11.470 12.812  -4.504  1.00 0.00 ? 133 GLU A O    3  
ATOM   8425  C  CB   . GLU A 1 133 ? -12.551 13.566  -7.739  1.00 0.00 ? 133 GLU A CB   3  
ATOM   8426  C  CG   . GLU A 1 133 ? -11.927 12.996  -9.004  1.00 0.00 ? 133 GLU A CG   3  
ATOM   8427  C  CD   . GLU A 1 133 ? -13.020 12.592  -9.987  1.00 0.00 ? 133 GLU A CD   3  
ATOM   8428  O  OE1  . GLU A 1 133 ? -13.970 13.346  -10.129 1.00 0.00 ? 133 GLU A OE1  3  
ATOM   8429  O  OE2  . GLU A 1 133 ? -12.895 11.535  -10.583 1.00 0.00 ? 133 GLU A OE2  3  
ATOM   8430  H  H    . GLU A 1 133 ? -10.161 14.414  -8.246  1.00 0.00 ? 133 GLU A H    3  
ATOM   8431  H  HA   . GLU A 1 133 ? -11.728 14.695  -6.127  1.00 0.00 ? 133 GLU A HA   3  
ATOM   8432  H  HB2  . GLU A 1 133 ? -13.269 12.866  -7.361  1.00 0.00 ? 133 GLU A HB2  3  
ATOM   8433  H  HB3  . GLU A 1 133 ? -13.046 14.495  -7.974  1.00 0.00 ? 133 GLU A HB3  3  
ATOM   8434  H  HG2  . GLU A 1 133 ? -11.302 13.744  -9.452  1.00 0.00 ? 133 GLU A HG2  3  
ATOM   8435  H  HG3  . GLU A 1 133 ? -11.335 12.132  -8.753  1.00 0.00 ? 133 GLU A HG3  3  
ATOM   8436  N  N    . GLY A 1 134 ? -11.213 11.433  -6.257  1.00 0.00 ? 134 GLY A N    3  
ATOM   8437  C  CA   . GLY A 1 134 ? -11.120 10.245  -5.421  1.00 0.00 ? 134 GLY A CA   3  
ATOM   8438  C  C    . GLY A 1 134 ? -10.085 10.435  -4.319  1.00 0.00 ? 134 GLY A C    3  
ATOM   8439  O  O    . GLY A 1 134 ? -10.394 10.309  -3.136  1.00 0.00 ? 134 GLY A O    3  
ATOM   8440  H  H    . GLY A 1 134 ? -11.145 11.343  -7.227  1.00 0.00 ? 134 GLY A H    3  
ATOM   8441  H  HA2  . GLY A 1 134 ? -12.084 10.043  -4.978  1.00 0.00 ? 134 GLY A HA2  3  
ATOM   8442  H  HA3  . GLY A 1 134 ? -10.831 9.409   -6.030  1.00 0.00 ? 134 GLY A HA3  3  
ATOM   8443  N  N    . LEU A 1 135 ? -8.857  10.738  -4.724  1.00 0.00 ? 135 LEU A N    3  
ATOM   8444  C  CA   . LEU A 1 135 ? -7.767  10.943  -3.773  1.00 0.00 ? 135 LEU A CA   3  
ATOM   8445  C  C    . LEU A 1 135 ? -8.287  11.567  -2.478  1.00 0.00 ? 135 LEU A C    3  
ATOM   8446  O  O    . LEU A 1 135 ? -8.231  10.959  -1.413  1.00 0.00 ? 135 LEU A O    3  
ATOM   8447  C  CB   . LEU A 1 135 ? -6.711  11.870  -4.407  1.00 0.00 ? 135 LEU A CB   3  
ATOM   8448  C  CG   . LEU A 1 135 ? -5.307  11.257  -4.290  1.00 0.00 ? 135 LEU A CG   3  
ATOM   8449  C  CD1  . LEU A 1 135 ? -4.297  12.181  -4.985  1.00 0.00 ? 135 LEU A CD1  3  
ATOM   8450  C  CD2  . LEU A 1 135 ? -4.921  11.085  -2.806  1.00 0.00 ? 135 LEU A CD2  3  
ATOM   8451  H  H    . LEU A 1 135 ? -8.677  10.822  -5.682  1.00 0.00 ? 135 LEU A H    3  
ATOM   8452  H  HA   . LEU A 1 135 ? -7.316  9.987   -3.549  1.00 0.00 ? 135 LEU A HA   3  
ATOM   8453  H  HB2  . LEU A 1 135 ? -6.948  12.008  -5.452  1.00 0.00 ? 135 LEU A HB2  3  
ATOM   8454  H  HB3  . LEU A 1 135 ? -6.720  12.831  -3.914  1.00 0.00 ? 135 LEU A HB3  3  
ATOM   8455  H  HG   . LEU A 1 135 ? -5.300  10.291  -4.777  1.00 0.00 ? 135 LEU A HG   3  
ATOM   8456  H  HD11 . LEU A 1 135 ? -3.871  12.860  -4.262  1.00 0.00 ? 135 LEU A HD11 3  
ATOM   8457  H  HD12 . LEU A 1 135 ? -4.795  12.748  -5.760  1.00 0.00 ? 135 LEU A HD12 3  
ATOM   8458  H  HD13 . LEU A 1 135 ? -3.513  11.585  -5.425  1.00 0.00 ? 135 LEU A HD13 3  
ATOM   8459  H  HD21 . LEU A 1 135 ? -4.210  11.848  -2.521  1.00 0.00 ? 135 LEU A HD21 3  
ATOM   8460  H  HD22 . LEU A 1 135 ? -4.476  10.112  -2.666  1.00 0.00 ? 135 LEU A HD22 3  
ATOM   8461  H  HD23 . LEU A 1 135 ? -5.800  11.168  -2.185  1.00 0.00 ? 135 LEU A HD23 3  
ATOM   8462  N  N    . ARG A 1 136 ? -8.777  12.793  -2.581  1.00 0.00 ? 136 ARG A N    3  
ATOM   8463  C  CA   . ARG A 1 136 ? -9.291  13.498  -1.426  1.00 0.00 ? 136 ARG A CA   3  
ATOM   8464  C  C    . ARG A 1 136 ? -10.487 12.769  -0.820  1.00 0.00 ? 136 ARG A C    3  
ATOM   8465  O  O    . ARG A 1 136 ? -10.802 12.943  0.359   1.00 0.00 ? 136 ARG A O    3  
ATOM   8466  C  CB   . ARG A 1 136 ? -9.711  14.912  -1.842  1.00 0.00 ? 136 ARG A CB   3  
ATOM   8467  C  CG   . ARG A 1 136 ? -10.151 15.706  -0.606  1.00 0.00 ? 136 ARG A CG   3  
ATOM   8468  C  CD   . ARG A 1 136 ? -11.680 15.740  -0.508  1.00 0.00 ? 136 ARG A CD   3  
ATOM   8469  N  NE   . ARG A 1 136 ? -12.094 16.647  0.556   1.00 0.00 ? 136 ARG A NE   3  
ATOM   8470  C  CZ   . ARG A 1 136 ? -12.109 17.964  0.370   1.00 0.00 ? 136 ARG A CZ   3  
ATOM   8471  N  NH1  . ARG A 1 136 ? -11.758 18.464  -0.783  1.00 0.00 ? 136 ARG A NH1  3  
ATOM   8472  N  NH2  . ARG A 1 136 ? -12.475 18.756  1.341   1.00 0.00 ? 136 ARG A NH2  3  
ATOM   8473  H  H    . ARG A 1 136 ? -8.783  13.240  -3.448  1.00 0.00 ? 136 ARG A H    3  
ATOM   8474  H  HA   . ARG A 1 136 ? -8.511  13.572  -0.690  1.00 0.00 ? 136 ARG A HA   3  
ATOM   8475  H  HB2  . ARG A 1 136 ? -8.872  15.409  -2.311  1.00 0.00 ? 136 ARG A HB2  3  
ATOM   8476  H  HB3  . ARG A 1 136 ? -10.529 14.849  -2.547  1.00 0.00 ? 136 ARG A HB3  3  
ATOM   8477  H  HG2  . ARG A 1 136 ? -9.745  15.239  0.275   1.00 0.00 ? 136 ARG A HG2  3  
ATOM   8478  H  HG3  . ARG A 1 136 ? -9.779  16.716  -0.678  1.00 0.00 ? 136 ARG A HG3  3  
ATOM   8479  H  HD2  . ARG A 1 136 ? -12.093 16.082  -1.445  1.00 0.00 ? 136 ARG A HD2  3  
ATOM   8480  H  HD3  . ARG A 1 136 ? -12.048 14.746  -0.298  1.00 0.00 ? 136 ARG A HD3  3  
ATOM   8481  H  HE   . ARG A 1 136 ? -12.364 16.280  1.424   1.00 0.00 ? 136 ARG A HE   3  
ATOM   8482  H  HH11 . ARG A 1 136 ? -11.478 17.858  -1.528  1.00 0.00 ? 136 ARG A HH11 3  
ATOM   8483  H  HH12 . ARG A 1 136 ? -11.770 19.455  -0.922  1.00 0.00 ? 136 ARG A HH12 3  
ATOM   8484  H  HH21 . ARG A 1 136 ? -12.744 18.373  2.224   1.00 0.00 ? 136 ARG A HH21 3  
ATOM   8485  H  HH22 . ARG A 1 136 ? -12.486 19.746  1.201   1.00 0.00 ? 136 ARG A HH22 3  
ATOM   8486  N  N    . THR A 1 137 ? -11.160 11.970  -1.637  1.00 0.00 ? 137 THR A N    3  
ATOM   8487  C  CA   . THR A 1 137 ? -12.338 11.242  -1.186  1.00 0.00 ? 137 THR A CA   3  
ATOM   8488  C  C    . THR A 1 137 ? -11.968 9.986   -0.394  1.00 0.00 ? 137 THR A C    3  
ATOM   8489  O  O    . THR A 1 137 ? -12.406 9.844   0.733   1.00 0.00 ? 137 THR A O    3  
ATOM   8490  C  CB   . THR A 1 137 ? -13.242 10.964  -2.406  1.00 0.00 ? 137 THR A CB   3  
ATOM   8491  O  OG1  . THR A 1 137 ? -14.486 11.619  -2.210  1.00 0.00 ? 137 THR A OG1  3  
ATOM   8492  C  CG2  . THR A 1 137 ? -13.499 9.474   -2.626  1.00 0.00 ? 137 THR A CG2  3  
ATOM   8493  H  H    . THR A 1 137 ? -10.870 11.881  -2.570  1.00 0.00 ? 137 THR A H    3  
ATOM   8494  H  HA   . THR A 1 137 ? -12.889 11.876  -0.507  1.00 0.00 ? 137 THR A HA   3  
ATOM   8495  H  HB   . THR A 1 137 ? -12.769 11.373  -3.283  1.00 0.00 ? 137 THR A HB   3  
ATOM   8496  H  HG1  . THR A 1 137 ? -14.372 12.546  -2.433  1.00 0.00 ? 137 THR A HG1  3  
ATOM   8497  H  HG21 . THR A 1 137 ? -14.094 9.344   -3.518  1.00 0.00 ? 137 THR A HG21 3  
ATOM   8498  H  HG22 . THR A 1 137 ? -14.035 9.082   -1.783  1.00 0.00 ? 137 THR A HG22 3  
ATOM   8499  H  HG23 . THR A 1 137 ? -12.564 8.953   -2.743  1.00 0.00 ? 137 THR A HG23 3  
ATOM   8500  N  N    . LEU A 1 138 ? -11.166 9.089   -0.947  1.00 0.00 ? 138 LEU A N    3  
ATOM   8501  C  CA   . LEU A 1 138 ? -10.796 7.886   -0.199  1.00 0.00 ? 138 LEU A CA   3  
ATOM   8502  C  C    . LEU A 1 138 ? -9.874  8.235   0.971   1.00 0.00 ? 138 LEU A C    3  
ATOM   8503  O  O    . LEU A 1 138 ? -9.812  7.498   1.951   1.00 0.00 ? 138 LEU A O    3  
ATOM   8504  C  CB   . LEU A 1 138 ? -10.188 6.827   -1.156  1.00 0.00 ? 138 LEU A CB   3  
ATOM   8505  C  CG   . LEU A 1 138 ? -8.707  6.638   -0.892  1.00 0.00 ? 138 LEU A CG   3  
ATOM   8506  C  CD1  . LEU A 1 138 ? -8.117  5.595   -1.863  1.00 0.00 ? 138 LEU A CD1  3  
ATOM   8507  C  CD2  . LEU A 1 138 ? -7.974  7.982   -1.059  1.00 0.00 ? 138 LEU A CD2  3  
ATOM   8508  H  H    . LEU A 1 138 ? -10.814 9.233   -1.849  1.00 0.00 ? 138 LEU A H    3  
ATOM   8509  H  HA   . LEU A 1 138 ? -11.684 7.473   0.233   1.00 0.00 ? 138 LEU A HA   3  
ATOM   8510  H  HB2  . LEU A 1 138 ? -10.691 5.880   -1.014  1.00 0.00 ? 138 LEU A HB2  3  
ATOM   8511  H  HB3  . LEU A 1 138 ? -10.326 7.150   -2.167  1.00 0.00 ? 138 LEU A HB3  3  
ATOM   8512  H  HG   . LEU A 1 138 ? -8.610  6.286   0.114   1.00 0.00 ? 138 LEU A HG   3  
ATOM   8513  H  HD11 . LEU A 1 138 ? -7.710  6.095   -2.732  1.00 0.00 ? 138 LEU A HD11 3  
ATOM   8514  H  HD12 . LEU A 1 138 ? -8.887  4.910   -2.176  1.00 0.00 ? 138 LEU A HD12 3  
ATOM   8515  H  HD13 . LEU A 1 138 ? -7.328  5.047   -1.369  1.00 0.00 ? 138 LEU A HD13 3  
ATOM   8516  H  HD21 . LEU A 1 138 ? -7.449  8.219   -0.148  1.00 0.00 ? 138 LEU A HD21 3  
ATOM   8517  H  HD22 . LEU A 1 138 ? -8.686  8.763   -1.279  1.00 0.00 ? 138 LEU A HD22 3  
ATOM   8518  H  HD23 . LEU A 1 138 ? -7.269  7.920   -1.872  1.00 0.00 ? 138 LEU A HD23 3  
ATOM   8519  N  N    . ALA A 1 139 ? -9.175  9.361   0.877   1.00 0.00 ? 139 ALA A N    3  
ATOM   8520  C  CA   . ALA A 1 139 ? -8.279  9.772   1.949   1.00 0.00 ? 139 ALA A CA   3  
ATOM   8521  C  C    . ALA A 1 139 ? -9.080  10.332  3.116   1.00 0.00 ? 139 ALA A C    3  
ATOM   8522  O  O    . ALA A 1 139 ? -8.777  10.061  4.278   1.00 0.00 ? 139 ALA A O    3  
ATOM   8523  C  CB   . ALA A 1 139 ? -7.300  10.833  1.441   1.00 0.00 ? 139 ALA A CB   3  
ATOM   8524  H  H    . ALA A 1 139 ? -9.265  9.923   0.079   1.00 0.00 ? 139 ALA A H    3  
ATOM   8525  H  HA   . ALA A 1 139 ? -7.718  8.914   2.286   1.00 0.00 ? 139 ALA A HA   3  
ATOM   8526  H  HB1  . ALA A 1 139 ? -7.851  11.702  1.113   1.00 0.00 ? 139 ALA A HB1  3  
ATOM   8527  H  HB2  . ALA A 1 139 ? -6.732  10.433  0.615   1.00 0.00 ? 139 ALA A HB2  3  
ATOM   8528  H  HB3  . ALA A 1 139 ? -6.626  11.111  2.238   1.00 0.00 ? 139 ALA A HB3  3  
ATOM   8529  N  N    . GLU A 1 140 ? -10.103 11.116  2.797   1.00 0.00 ? 140 GLU A N    3  
ATOM   8530  C  CA   . GLU A 1 140 ? -10.943 11.715  3.822   1.00 0.00 ? 140 GLU A CA   3  
ATOM   8531  C  C    . GLU A 1 140 ? -12.075 10.797  4.198   1.00 0.00 ? 140 GLU A C    3  
ATOM   8532  O  O    . GLU A 1 140 ? -12.469 10.709  5.361   1.00 0.00 ? 140 GLU A O    3  
ATOM   8533  C  CB   . GLU A 1 140 ? -11.533 13.005  3.291   1.00 0.00 ? 140 GLU A CB   3  
ATOM   8534  C  CG   . GLU A 1 140 ? -10.426 14.037  3.139   1.00 0.00 ? 140 GLU A CG   3  
ATOM   8535  C  CD   . GLU A 1 140 ? -10.124 14.682  4.487   1.00 0.00 ? 140 GLU A CD   3  
ATOM   8536  O  OE1  . GLU A 1 140 ? -10.942 15.465  4.942   1.00 0.00 ? 140 GLU A OE1  3  
ATOM   8537  O  OE2  . GLU A 1 140 ? -9.081  14.384  5.044   1.00 0.00 ? 140 GLU A OE2  3  
ATOM   8538  H  H    . GLU A 1 140 ? -10.296 11.302  1.852   1.00 0.00 ? 140 GLU A H    3  
ATOM   8539  H  HA   . GLU A 1 140 ? -10.356 11.925  4.687   1.00 0.00 ? 140 GLU A HA   3  
ATOM   8540  H  HB2  . GLU A 1 140 ? -11.980 12.812  2.333   1.00 0.00 ? 140 GLU A HB2  3  
ATOM   8541  H  HB3  . GLU A 1 140 ? -12.282 13.365  3.974   1.00 0.00 ? 140 GLU A HB3  3  
ATOM   8542  H  HG2  . GLU A 1 140 ? -9.546  13.541  2.766   1.00 0.00 ? 140 GLU A HG2  3  
ATOM   8543  H  HG3  . GLU A 1 140 ? -10.734 14.796  2.436   1.00 0.00 ? 140 GLU A HG3  3  
ATOM   8544  N  N    . ALA A 1 141 ? -12.612 10.138  3.198   1.00 0.00 ? 141 ALA A N    3  
ATOM   8545  C  CA   . ALA A 1 141 ? -13.725 9.248   3.416   1.00 0.00 ? 141 ALA A CA   3  
ATOM   8546  C  C    . ALA A 1 141 ? -13.390 8.227   4.489   1.00 0.00 ? 141 ALA A C    3  
ATOM   8547  O  O    . ALA A 1 141 ? -14.287 7.730   5.171   1.00 0.00 ? 141 ALA A O    3  
ATOM   8548  C  CB   . ALA A 1 141 ? -14.118 8.565   2.117   1.00 0.00 ? 141 ALA A CB   3  
ATOM   8549  H  H    . ALA A 1 141 ? -12.261 10.271  2.297   1.00 0.00 ? 141 ALA A H    3  
ATOM   8550  H  HA   . ALA A 1 141 ? -14.556 9.833   3.759   1.00 0.00 ? 141 ALA A HA   3  
ATOM   8551  H  HB1  . ALA A 1 141 ? -14.908 7.866   2.309   1.00 0.00 ? 141 ALA A HB1  3  
ATOM   8552  H  HB2  . ALA A 1 141 ? -13.269 8.044   1.713   1.00 0.00 ? 141 ALA A HB2  3  
ATOM   8553  H  HB3  . ALA A 1 141 ? -14.461 9.310   1.409   1.00 0.00 ? 141 ALA A HB3  3  
ATOM   8554  N  N    . GLY A 1 142 ? -12.105 7.927   4.674   1.00 0.00 ? 142 GLY A N    3  
ATOM   8555  C  CA   . GLY A 1 142 ? -11.746 6.978   5.722   1.00 0.00 ? 142 GLY A CA   3  
ATOM   8556  C  C    . GLY A 1 142 ? -10.403 6.290   5.504   1.00 0.00 ? 142 GLY A C    3  
ATOM   8557  O  O    . GLY A 1 142 ? -9.932  5.582   6.395   1.00 0.00 ? 142 GLY A O    3  
ATOM   8558  H  H    . GLY A 1 142 ? -11.404 8.362   4.125   1.00 0.00 ? 142 GLY A H    3  
ATOM   8559  H  HA2  . GLY A 1 142 ? -11.710 7.506   6.664   1.00 0.00 ? 142 GLY A HA2  3  
ATOM   8560  H  HA3  . GLY A 1 142 ? -12.517 6.223   5.784   1.00 0.00 ? 142 GLY A HA3  3  
ATOM   8561  N  N    . ALA A 1 143 ? -9.769  6.475   4.351   1.00 0.00 ? 143 ALA A N    3  
ATOM   8562  C  CA   . ALA A 1 143 ? -8.479  5.820   4.144   1.00 0.00 ? 143 ALA A CA   3  
ATOM   8563  C  C    . ALA A 1 143 ? -7.356  6.654   4.737   1.00 0.00 ? 143 ALA A C    3  
ATOM   8564  O  O    . ALA A 1 143 ? -7.134  7.790   4.319   1.00 0.00 ? 143 ALA A O    3  
ATOM   8565  C  CB   . ALA A 1 143 ? -8.202  5.601   2.659   1.00 0.00 ? 143 ALA A CB   3  
ATOM   8566  H  H    . ALA A 1 143 ? -10.158 7.047   3.644   1.00 0.00 ? 143 ALA A H    3  
ATOM   8567  H  HA   . ALA A 1 143 ? -8.498  4.858   4.636   1.00 0.00 ? 143 ALA A HA   3  
ATOM   8568  H  HB1  . ALA A 1 143 ? -7.810  6.510   2.232   1.00 0.00 ? 143 ALA A HB1  3  
ATOM   8569  H  HB2  . ALA A 1 143 ? -9.115  5.324   2.155   1.00 0.00 ? 143 ALA A HB2  3  
ATOM   8570  H  HB3  . ALA A 1 143 ? -7.472  4.812   2.547   1.00 0.00 ? 143 ALA A HB3  3  
ATOM   8571  N  N    . LYS A 1 144 ? -6.641  6.088   5.708   1.00 0.00 ? 144 LYS A N    3  
ATOM   8572  C  CA   . LYS A 1 144 ? -5.542  6.799   6.327   1.00 0.00 ? 144 LYS A CA   3  
ATOM   8573  C  C    . LYS A 1 144 ? -4.295  6.686   5.469   1.00 0.00 ? 144 LYS A C    3  
ATOM   8574  O  O    . LYS A 1 144 ? -3.661  5.633   5.408   1.00 0.00 ? 144 LYS A O    3  
ATOM   8575  C  CB   . LYS A 1 144 ? -5.262  6.236   7.698   1.00 0.00 ? 144 LYS A CB   3  
ATOM   8576  C  CG   . LYS A 1 144 ? -6.495  6.451   8.568   1.00 0.00 ? 144 LYS A CG   3  
ATOM   8577  C  CD   . LYS A 1 144 ? -6.432  5.526   9.764   1.00 0.00 ? 144 LYS A CD   3  
ATOM   8578  C  CE   . LYS A 1 144 ? -7.786  5.501   10.472  1.00 0.00 ? 144 LYS A CE   3  
ATOM   8579  N  NZ   . LYS A 1 144 ? -8.180  6.892   10.837  1.00 0.00 ? 144 LYS A NZ   3  
ATOM   8580  H  H    . LYS A 1 144 ? -6.852  5.182   6.010   1.00 0.00 ? 144 LYS A H    3  
ATOM   8581  H  HA   . LYS A 1 144 ? -5.810  7.831   6.435   1.00 0.00 ? 144 LYS A HA   3  
ATOM   8582  H  HB2  . LYS A 1 144 ? -5.042  5.184   7.615   1.00 0.00 ? 144 LYS A HB2  3  
ATOM   8583  H  HB3  . LYS A 1 144 ? -4.421  6.751   8.124   1.00 0.00 ? 144 LYS A HB3  3  
ATOM   8584  H  HG2  . LYS A 1 144 ? -6.522  7.466   8.904   1.00 0.00 ? 144 LYS A HG2  3  
ATOM   8585  H  HG3  . LYS A 1 144 ? -7.386  6.236   7.996   1.00 0.00 ? 144 LYS A HG3  3  
ATOM   8586  H  HD2  . LYS A 1 144 ? -6.188  4.547   9.414   1.00 0.00 ? 144 LYS A HD2  3  
ATOM   8587  H  HD3  . LYS A 1 144 ? -5.672  5.867   10.449  1.00 0.00 ? 144 LYS A HD3  3  
ATOM   8588  H  HE2  . LYS A 1 144 ? -8.529  5.076   9.814   1.00 0.00 ? 144 LYS A HE2  3  
ATOM   8589  H  HE3  . LYS A 1 144 ? -7.712  4.902   11.368  1.00 0.00 ? 144 LYS A HE3  3  
ATOM   8590  H  HZ1  . LYS A 1 144 ? -7.360  7.524   10.731  1.00 0.00 ? 144 LYS A HZ1  3  
ATOM   8591  H  HZ2  . LYS A 1 144 ? -8.506  6.915   11.823  1.00 0.00 ? 144 LYS A HZ2  3  
ATOM   8592  H  HZ3  . LYS A 1 144 ? -8.947  7.210   10.209  1.00 0.00 ? 144 LYS A HZ3  3  
ATOM   8593  N  N    . ILE A 1 145 ? -3.952  7.774   4.802   1.00 0.00 ? 145 ILE A N    3  
ATOM   8594  C  CA   . ILE A 1 145 ? -2.784  7.786   3.940   1.00 0.00 ? 145 ILE A CA   3  
ATOM   8595  C  C    . ILE A 1 145 ? -1.571  8.301   4.703   1.00 0.00 ? 145 ILE A C    3  
ATOM   8596  O  O    . ILE A 1 145 ? -1.691  9.163   5.574   1.00 0.00 ? 145 ILE A O    3  
ATOM   8597  C  CB   . ILE A 1 145 ? -3.031  8.690   2.730   1.00 0.00 ? 145 ILE A CB   3  
ATOM   8598  C  CG1  . ILE A 1 145 ? -4.493  8.620   2.278   1.00 0.00 ? 145 ILE A CG1  3  
ATOM   8599  C  CG2  . ILE A 1 145 ? -2.134  8.254   1.577   1.00 0.00 ? 145 ILE A CG2  3  
ATOM   8600  C  CD1  . ILE A 1 145 ? -4.974  7.165   2.234   1.00 0.00 ? 145 ILE A CD1  3  
ATOM   8601  H  H    . ILE A 1 145 ? -4.498  8.579   4.889   1.00 0.00 ? 145 ILE A H    3  
ATOM   8602  H  HA   . ILE A 1 145 ? -2.584  6.783   3.596   1.00 0.00 ? 145 ILE A HA   3  
ATOM   8603  H  HB   . ILE A 1 145 ? -2.793  9.706   3.005   1.00 0.00 ? 145 ILE A HB   3  
ATOM   8604  H  HG12 . ILE A 1 145 ? -5.101  9.186   2.963   1.00 0.00 ? 145 ILE A HG12 3  
ATOM   8605  H  HG13 . ILE A 1 145 ? -4.579  9.050   1.290   1.00 0.00 ? 145 ILE A HG13 3  
ATOM   8606  H  HG21 . ILE A 1 145 ? -2.391  7.246   1.286   1.00 0.00 ? 145 ILE A HG21 3  
ATOM   8607  H  HG22 . ILE A 1 145 ? -1.102  8.286   1.891   1.00 0.00 ? 145 ILE A HG22 3  
ATOM   8608  H  HG23 . ILE A 1 145 ? -2.280  8.918   0.739   1.00 0.00 ? 145 ILE A HG23 3  
ATOM   8609  H  HD11 . ILE A 1 145 ? -5.378  6.886   3.193   1.00 0.00 ? 145 ILE A HD11 3  
ATOM   8610  H  HD12 . ILE A 1 145 ? -4.149  6.516   1.990   1.00 0.00 ? 145 ILE A HD12 3  
ATOM   8611  H  HD13 . ILE A 1 145 ? -5.742  7.065   1.482   1.00 0.00 ? 145 ILE A HD13 3  
ATOM   8612  N  N    . SER A 1 146 ? -0.400  7.776   4.364   1.00 0.00 ? 146 SER A N    3  
ATOM   8613  C  CA   . SER A 1 146 ? 0.829   8.196   5.013   1.00 0.00 ? 146 SER A CA   3  
ATOM   8614  C  C    . SER A 1 146 ? 1.949   8.339   3.992   1.00 0.00 ? 146 SER A C    3  
ATOM   8615  O  O    . SER A 1 146 ? 2.179   7.453   3.170   1.00 0.00 ? 146 SER A O    3  
ATOM   8616  C  CB   . SER A 1 146 ? 1.215   7.180   6.091   1.00 0.00 ? 146 SER A CB   3  
ATOM   8617  O  OG   . SER A 1 146 ? 0.404   6.020   5.955   1.00 0.00 ? 146 SER A OG   3  
ATOM   8618  H  H    . SER A 1 146 ? -0.360  7.096   3.664   1.00 0.00 ? 146 SER A H    3  
ATOM   8619  H  HA   . SER A 1 146 ? 0.665   9.158   5.481   1.00 0.00 ? 146 SER A HA   3  
ATOM   8620  H  HB2  . SER A 1 146 ? 2.252   6.901   5.989   1.00 0.00 ? 146 SER A HB2  3  
ATOM   8621  H  HB3  . SER A 1 146 ? 1.060   7.625   7.061   1.00 0.00 ? 146 SER A HB3  3  
ATOM   8622  H  HG   . SER A 1 146 ? 0.785   5.473   5.266   1.00 0.00 ? 146 SER A HG   3  
ATOM   8623  N  N    . ILE A 1 147 ? 2.645   9.462   4.064   1.00 0.00 ? 147 ILE A N    3  
ATOM   8624  C  CA   . ILE A 1 147 ? 3.749   9.731   3.161   1.00 0.00 ? 147 ILE A CA   3  
ATOM   8625  C  C    . ILE A 1 147 ? 5.027   9.135   3.745   1.00 0.00 ? 147 ILE A C    3  
ATOM   8626  O  O    . ILE A 1 147 ? 5.563   9.637   4.734   1.00 0.00 ? 147 ILE A O    3  
ATOM   8627  C  CB   . ILE A 1 147 ? 3.921   11.251  2.959   1.00 0.00 ? 147 ILE A CB   3  
ATOM   8628  C  CG1  . ILE A 1 147 ? 2.659   11.938  2.338   1.00 0.00 ? 147 ILE A CG1  3  
ATOM   8629  C  CG2  . ILE A 1 147 ? 5.135   11.516  2.047   1.00 0.00 ? 147 ILE A CG2  3  
ATOM   8630  C  CD1  . ILE A 1 147 ? 1.482   10.982  2.102   1.00 0.00 ? 147 ILE A CD1  3  
ATOM   8631  H  H    . ILE A 1 147 ? 2.414   10.120  4.746   1.00 0.00 ? 147 ILE A H    3  
ATOM   8632  H  HA   . ILE A 1 147 ? 3.564   9.260   2.218   1.00 0.00 ? 147 ILE A HA   3  
ATOM   8633  H  HB   . ILE A 1 147 ? 4.118   11.697  3.928   1.00 0.00 ? 147 ILE A HB   3  
ATOM   8634  H  HG12 . ILE A 1 147 ? 2.329   12.722  3.002   1.00 0.00 ? 147 ILE A HG12 3  
ATOM   8635  H  HG13 . ILE A 1 147 ? 2.931   12.387  1.392   1.00 0.00 ? 147 ILE A HG13 3  
ATOM   8636  H  HG21 . ILE A 1 147 ? 5.958   11.870  2.642   1.00 0.00 ? 147 ILE A HG21 3  
ATOM   8637  H  HG22 . ILE A 1 147 ? 4.879   12.268  1.315   1.00 0.00 ? 147 ILE A HG22 3  
ATOM   8638  H  HG23 . ILE A 1 147 ? 5.423   10.606  1.540   1.00 0.00 ? 147 ILE A HG23 3  
ATOM   8639  H  HD11 . ILE A 1 147 ? 1.801   10.104  1.575   1.00 0.00 ? 147 ILE A HD11 3  
ATOM   8640  H  HD12 . ILE A 1 147 ? 0.747   11.494  1.504   1.00 0.00 ? 147 ILE A HD12 3  
ATOM   8641  H  HD13 . ILE A 1 147 ? 1.042   10.707  3.041   1.00 0.00 ? 147 ILE A HD13 3  
ATOM   8642  N  N    . MET A 1 148 ? 5.493   8.043   3.140   1.00 0.00 ? 148 MET A N    3  
ATOM   8643  C  CA   . MET A 1 148 ? 6.690   7.364   3.624   1.00 0.00 ? 148 MET A CA   3  
ATOM   8644  C  C    . MET A 1 148 ? 7.956   8.180   3.361   1.00 0.00 ? 148 MET A C    3  
ATOM   8645  O  O    . MET A 1 148 ? 8.495   8.170   2.255   1.00 0.00 ? 148 MET A O    3  
ATOM   8646  C  CB   . MET A 1 148 ? 6.814   5.984   2.964   1.00 0.00 ? 148 MET A CB   3  
ATOM   8647  C  CG   . MET A 1 148 ? 7.645   5.060   3.861   1.00 0.00 ? 148 MET A CG   3  
ATOM   8648  S  SD   . MET A 1 148 ? 8.533   3.868   2.828   1.00 0.00 ? 148 MET A SD   3  
ATOM   8649  C  CE   . MET A 1 148 ? 7.082   2.969   2.229   1.00 0.00 ? 148 MET A CE   3  
ATOM   8650  H  H    . MET A 1 148 ? 5.010   7.677   2.369   1.00 0.00 ? 148 MET A H    3  
ATOM   8651  H  HA   . MET A 1 148 ? 6.588   7.222   4.687   1.00 0.00 ? 148 MET A HA   3  
ATOM   8652  H  HB2  . MET A 1 148 ? 5.828   5.561   2.829   1.00 0.00 ? 148 MET A HB2  3  
ATOM   8653  H  HB3  . MET A 1 148 ? 7.299   6.078   2.002   1.00 0.00 ? 148 MET A HB3  3  
ATOM   8654  H  HG2  . MET A 1 148 ? 8.355   5.643   4.430   1.00 0.00 ? 148 MET A HG2  3  
ATOM   8655  H  HG3  . MET A 1 148 ? 6.990   4.529   4.537   1.00 0.00 ? 148 MET A HG3  3  
ATOM   8656  H  HE1  . MET A 1 148 ? 7.360   1.951   1.994   1.00 0.00 ? 148 MET A HE1  3  
ATOM   8657  H  HE2  . MET A 1 148 ? 6.698   3.455   1.342   1.00 0.00 ? 148 MET A HE2  3  
ATOM   8658  H  HE3  . MET A 1 148 ? 6.319   2.965   2.991   1.00 0.00 ? 148 MET A HE3  3  
ATOM   8659  N  N    . THR A 1 149 ? 8.430   8.872   4.397   1.00 0.00 ? 149 THR A N    3  
ATOM   8660  C  CA   . THR A 1 149 ? 9.644   9.679   4.291   1.00 0.00 ? 149 THR A CA   3  
ATOM   8661  C  C    . THR A 1 149 ? 10.836  8.924   4.887   1.00 0.00 ? 149 THR A C    3  
ATOM   8662  O  O    . THR A 1 149 ? 10.694  7.789   5.340   1.00 0.00 ? 149 THR A O    3  
ATOM   8663  C  CB   . THR A 1 149 ? 9.451   11.007  5.033   1.00 0.00 ? 149 THR A CB   3  
ATOM   8664  O  OG1  . THR A 1 149 ? 8.560   10.810  6.121   1.00 0.00 ? 149 THR A OG1  3  
ATOM   8665  C  CG2  . THR A 1 149 ? 8.868   12.052  4.080   1.00 0.00 ? 149 THR A CG2  3  
ATOM   8666  H  H    . THR A 1 149 ? 7.959   8.830   5.253   1.00 0.00 ? 149 THR A H    3  
ATOM   8667  H  HA   . THR A 1 149 ? 9.843   9.881   3.248   1.00 0.00 ? 149 THR A HA   3  
ATOM   8668  H  HB   . THR A 1 149 ? 10.401  11.358  5.405   1.00 0.00 ? 149 THR A HB   3  
ATOM   8669  H  HG1  . THR A 1 149 ? 7.783   11.354  5.971   1.00 0.00 ? 149 THR A HG1  3  
ATOM   8670  H  HG21 . THR A 1 149 ? 8.502   12.894  4.651   1.00 0.00 ? 149 THR A HG21 3  
ATOM   8671  H  HG22 . THR A 1 149 ? 8.054   11.616  3.520   1.00 0.00 ? 149 THR A HG22 3  
ATOM   8672  H  HG23 . THR A 1 149 ? 9.636   12.384  3.401   1.00 0.00 ? 149 THR A HG23 3  
ATOM   8673  N  N    . TYR A 1 150 ? 12.009  9.560   4.871   1.00 0.00 ? 150 TYR A N    3  
ATOM   8674  C  CA   . TYR A 1 150 ? 13.222  8.939   5.400   1.00 0.00 ? 150 TYR A CA   3  
ATOM   8675  C  C    . TYR A 1 150 ? 12.925  8.033   6.594   1.00 0.00 ? 150 TYR A C    3  
ATOM   8676  O  O    . TYR A 1 150 ? 13.106  6.818   6.513   1.00 0.00 ? 150 TYR A O    3  
ATOM   8677  C  CB   . TYR A 1 150 ? 14.228  10.021  5.808   1.00 0.00 ? 150 TYR A CB   3  
ATOM   8678  C  CG   . TYR A 1 150 ? 13.598  10.968  6.792   1.00 0.00 ? 150 TYR A CG   3  
ATOM   8679  C  CD1  . TYR A 1 150 ? 12.761  11.991  6.334   1.00 0.00 ? 150 TYR A CD1  3  
ATOM   8680  C  CD2  . TYR A 1 150 ? 13.859  10.829  8.156   1.00 0.00 ? 150 TYR A CD2  3  
ATOM   8681  C  CE1  . TYR A 1 150 ? 12.181  12.878  7.247   1.00 0.00 ? 150 TYR A CE1  3  
ATOM   8682  C  CE2  . TYR A 1 150 ? 13.281  11.716  9.071   1.00 0.00 ? 150 TYR A CE2  3  
ATOM   8683  C  CZ   . TYR A 1 150 ? 12.442  12.741  8.617   1.00 0.00 ? 150 TYR A CZ   3  
ATOM   8684  O  OH   . TYR A 1 150 ? 11.871  13.616  9.519   1.00 0.00 ? 150 TYR A OH   3  
ATOM   8685  H  H    . TYR A 1 150 ? 12.063  10.460  4.491   1.00 0.00 ? 150 TYR A H    3  
ATOM   8686  H  HA   . TYR A 1 150 ? 13.664  8.340   4.622   1.00 0.00 ? 150 TYR A HA   3  
ATOM   8687  H  HB2  . TYR A 1 150 ? 15.087  9.557   6.260   1.00 0.00 ? 150 TYR A HB2  3  
ATOM   8688  H  HB3  . TYR A 1 150 ? 14.539  10.575  4.940   1.00 0.00 ? 150 TYR A HB3  3  
ATOM   8689  H  HD1  . TYR A 1 150 ? 12.564  12.094  5.274   1.00 0.00 ? 150 TYR A HD1  3  
ATOM   8690  H  HD2  . TYR A 1 150 ? 14.508  10.037  8.501   1.00 0.00 ? 150 TYR A HD2  3  
ATOM   8691  H  HE1  . TYR A 1 150 ? 11.535  13.668  6.897   1.00 0.00 ? 150 TYR A HE1  3  
ATOM   8692  H  HE2  . TYR A 1 150 ? 13.483  11.610  10.127  1.00 0.00 ? 150 TYR A HE2  3  
ATOM   8693  H  HH   . TYR A 1 150 ? 10.951  13.365  9.632   1.00 0.00 ? 150 TYR A HH   3  
ATOM   8694  N  N    . SER A 1 151 ? 12.479  8.619   7.699   1.00 0.00 ? 151 SER A N    3  
ATOM   8695  C  CA   . SER A 1 151 ? 12.177  7.833   8.892   1.00 0.00 ? 151 SER A CA   3  
ATOM   8696  C  C    . SER A 1 151 ? 11.243  6.684   8.540   1.00 0.00 ? 151 SER A C    3  
ATOM   8697  O  O    . SER A 1 151 ? 11.568  5.511   8.741   1.00 0.00 ? 151 SER A O    3  
ATOM   8698  C  CB   . SER A 1 151 ? 11.527  8.721   9.958   1.00 0.00 ? 151 SER A CB   3  
ATOM   8699  O  OG   . SER A 1 151 ? 10.138  8.423   10.039  1.00 0.00 ? 151 SER A OG   3  
ATOM   8700  H  H    . SER A 1 151 ? 12.354  9.588   7.717   1.00 0.00 ? 151 SER A H    3  
ATOM   8701  H  HA   . SER A 1 151 ? 13.096  7.430   9.283   1.00 0.00 ? 151 SER A HA   3  
ATOM   8702  H  HB2  . SER A 1 151 ? 11.983  8.532   10.916  1.00 0.00 ? 151 SER A HB2  3  
ATOM   8703  H  HB3  . SER A 1 151 ? 11.668  9.760   9.694   1.00 0.00 ? 151 SER A HB3  3  
ATOM   8704  H  HG   . SER A 1 151 ? 10.046  7.473   10.138  1.00 0.00 ? 151 SER A HG   3  
ATOM   8705  N  N    . GLU A 1 152 ? 10.087  7.036   8.005   1.00 0.00 ? 152 GLU A N    3  
ATOM   8706  C  CA   . GLU A 1 152 ? 9.100   6.046   7.608   1.00 0.00 ? 152 GLU A CA   3  
ATOM   8707  C  C    . GLU A 1 152 ? 9.714   5.068   6.616   1.00 0.00 ? 152 GLU A C    3  
ATOM   8708  O  O    . GLU A 1 152 ? 9.177   3.988   6.375   1.00 0.00 ? 152 GLU A O    3  
ATOM   8709  C  CB   . GLU A 1 152 ? 7.908   6.747   6.967   1.00 0.00 ? 152 GLU A CB   3  
ATOM   8710  C  CG   . GLU A 1 152 ? 7.202   7.623   8.006   1.00 0.00 ? 152 GLU A CG   3  
ATOM   8711  C  CD   . GLU A 1 152 ? 6.167   6.801   8.767   1.00 0.00 ? 152 GLU A CD   3  
ATOM   8712  O  OE1  . GLU A 1 152 ? 6.565   6.034   9.629   1.00 0.00 ? 152 GLU A OE1  3  
ATOM   8713  O  OE2  . GLU A 1 152 ? 4.992   6.951   8.477   1.00 0.00 ? 152 GLU A OE2  3  
ATOM   8714  H  H    . GLU A 1 152 ? 9.899   7.984   7.864   1.00 0.00 ? 152 GLU A H    3  
ATOM   8715  H  HA   . GLU A 1 152 ? 8.765   5.506   8.479   1.00 0.00 ? 152 GLU A HA   3  
ATOM   8716  H  HB2  . GLU A 1 152 ? 8.262   7.364   6.159   1.00 0.00 ? 152 GLU A HB2  3  
ATOM   8717  H  HB3  . GLU A 1 152 ? 7.215   6.010   6.586   1.00 0.00 ? 152 GLU A HB3  3  
ATOM   8718  H  HG2  . GLU A 1 152 ? 7.931   8.014   8.701   1.00 0.00 ? 152 GLU A HG2  3  
ATOM   8719  H  HG3  . GLU A 1 152 ? 6.708   8.443   7.507   1.00 0.00 ? 152 GLU A HG3  3  
ATOM   8720  N  N    . PHE A 1 153 ? 10.846  5.458   6.044   1.00 0.00 ? 153 PHE A N    3  
ATOM   8721  C  CA   . PHE A 1 153 ? 11.531  4.610   5.083   1.00 0.00 ? 153 PHE A CA   3  
ATOM   8722  C  C    . PHE A 1 153 ? 12.246  3.476   5.812   1.00 0.00 ? 153 PHE A C    3  
ATOM   8723  O  O    . PHE A 1 153 ? 11.815  2.323   5.776   1.00 0.00 ? 153 PHE A O    3  
ATOM   8724  C  CB   . PHE A 1 153 ? 12.540  5.447   4.278   1.00 0.00 ? 153 PHE A CB   3  
ATOM   8725  C  CG   . PHE A 1 153 ? 12.536  5.009   2.832   1.00 0.00 ? 153 PHE A CG   3  
ATOM   8726  C  CD1  . PHE A 1 153 ? 11.403  5.222   2.037   1.00 0.00 ? 153 PHE A CD1  3  
ATOM   8727  C  CD2  . PHE A 1 153 ? 13.664  4.386   2.294   1.00 0.00 ? 153 PHE A CD2  3  
ATOM   8728  C  CE1  . PHE A 1 153 ? 11.402  4.807   0.701   1.00 0.00 ? 153 PHE A CE1  3  
ATOM   8729  C  CE2  . PHE A 1 153 ? 13.663  3.972   0.958   1.00 0.00 ? 153 PHE A CE2  3  
ATOM   8730  C  CZ   . PHE A 1 153 ? 12.532  4.182   0.160   1.00 0.00 ? 153 PHE A CZ   3  
ATOM   8731  H  H    . PHE A 1 153 ? 11.229  6.330   6.273   1.00 0.00 ? 153 PHE A H    3  
ATOM   8732  H  HA   . PHE A 1 153 ? 10.799  4.188   4.409   1.00 0.00 ? 153 PHE A HA   3  
ATOM   8733  H  HB2  . PHE A 1 153 ? 12.269  6.488   4.335   1.00 0.00 ? 153 PHE A HB2  3  
ATOM   8734  H  HB3  . PHE A 1 153 ? 13.531  5.315   4.688   1.00 0.00 ? 153 PHE A HB3  3  
ATOM   8735  H  HD1  . PHE A 1 153 ? 10.533  5.709   2.456   1.00 0.00 ? 153 PHE A HD1  3  
ATOM   8736  H  HD2  . PHE A 1 153 ? 14.537  4.228   2.908   1.00 0.00 ? 153 PHE A HD2  3  
ATOM   8737  H  HE1  . PHE A 1 153 ? 10.528  4.970   0.086   1.00 0.00 ? 153 PHE A HE1  3  
ATOM   8738  H  HE2  . PHE A 1 153 ? 14.536  3.494   0.541   1.00 0.00 ? 153 PHE A HE2  3  
ATOM   8739  H  HZ   . PHE A 1 153 ? 12.533  3.861   -0.871  1.00 0.00 ? 153 PHE A HZ   3  
ATOM   8740  N  N    . LYS A 1 154 ? 13.330  3.806   6.499   1.00 0.00 ? 154 LYS A N    3  
ATOM   8741  C  CA   . LYS A 1 154 ? 14.057  2.797   7.233   1.00 0.00 ? 154 LYS A CA   3  
ATOM   8742  C  C    . LYS A 1 154 ? 13.048  1.966   8.029   1.00 0.00 ? 154 LYS A C    3  
ATOM   8743  O  O    . LYS A 1 154 ? 13.334  0.841   8.442   1.00 0.00 ? 154 LYS A O    3  
ATOM   8744  C  CB   . LYS A 1 154 ? 15.134  3.482   8.119   1.00 0.00 ? 154 LYS A CB   3  
ATOM   8745  C  CG   . LYS A 1 154 ? 14.954  3.175   9.611   1.00 0.00 ? 154 LYS A CG   3  
ATOM   8746  C  CD   . LYS A 1 154 ? 13.875  4.087   10.201  1.00 0.00 ? 154 LYS A CD   3  
ATOM   8747  C  CE   . LYS A 1 154 ? 13.841  3.920   11.721  1.00 0.00 ? 154 LYS A CE   3  
ATOM   8748  N  NZ   . LYS A 1 154 ? 12.601  4.544   12.264  1.00 0.00 ? 154 LYS A NZ   3  
ATOM   8749  H  H    . LYS A 1 154 ? 13.630  4.737   6.527   1.00 0.00 ? 154 LYS A H    3  
ATOM   8750  H  HA   . LYS A 1 154 ? 14.548  2.146   6.522   1.00 0.00 ? 154 LYS A HA   3  
ATOM   8751  H  HB2  . LYS A 1 154 ? 16.112  3.140   7.813   1.00 0.00 ? 154 LYS A HB2  3  
ATOM   8752  H  HB3  . LYS A 1 154 ? 15.077  4.550   7.970   1.00 0.00 ? 154 LYS A HB3  3  
ATOM   8753  H  HG2  . LYS A 1 154 ? 14.677  2.146   9.737   1.00 0.00 ? 154 LYS A HG2  3  
ATOM   8754  H  HG3  . LYS A 1 154 ? 15.886  3.357   10.123  1.00 0.00 ? 154 LYS A HG3  3  
ATOM   8755  H  HD2  . LYS A 1 154 ? 14.101  5.116   9.959   1.00 0.00 ? 154 LYS A HD2  3  
ATOM   8756  H  HD3  . LYS A 1 154 ? 12.913  3.824   9.792   1.00 0.00 ? 154 LYS A HD3  3  
ATOM   8757  H  HE2  . LYS A 1 154 ? 13.853  2.868   11.968  1.00 0.00 ? 154 LYS A HE2  3  
ATOM   8758  H  HE3  . LYS A 1 154 ? 14.705  4.402   12.155  1.00 0.00 ? 154 LYS A HE3  3  
ATOM   8759  H  HZ1  . LYS A 1 154 ? 12.308  5.329   11.649  1.00 0.00 ? 154 LYS A HZ1  3  
ATOM   8760  H  HZ2  . LYS A 1 154 ? 12.785  4.907   13.220  1.00 0.00 ? 154 LYS A HZ2  3  
ATOM   8761  H  HZ3  . LYS A 1 154 ? 11.842  3.832   12.303  1.00 0.00 ? 154 LYS A HZ3  3  
ATOM   8762  N  N    . HIS A 1 155 ? 11.852  2.525   8.204   1.00 0.00 ? 155 HIS A N    3  
ATOM   8763  C  CA   . HIS A 1 155 ? 10.790  1.829   8.917   1.00 0.00 ? 155 HIS A CA   3  
ATOM   8764  C  C    . HIS A 1 155 ? 10.172  0.807   7.990   1.00 0.00 ? 155 HIS A C    3  
ATOM   8765  O  O    . HIS A 1 155 ? 9.890   -0.328  8.377   1.00 0.00 ? 155 HIS A O    3  
ATOM   8766  C  CB   . HIS A 1 155 ? 9.719   2.821   9.365   1.00 0.00 ? 155 HIS A CB   3  
ATOM   8767  C  CG   . HIS A 1 155 ? 8.758   2.139   10.302  1.00 0.00 ? 155 HIS A CG   3  
ATOM   8768  N  ND1  . HIS A 1 155 ? 9.104   1.792   11.598  1.00 0.00 ? 155 HIS A ND1  3  
ATOM   8769  C  CD2  . HIS A 1 155 ? 7.455   1.734   10.140  1.00 0.00 ? 155 HIS A CD2  3  
ATOM   8770  C  CE1  . HIS A 1 155 ? 8.031   1.206   12.161  1.00 0.00 ? 155 HIS A CE1  3  
ATOM   8771  N  NE2  . HIS A 1 155 ? 6.999   1.145   11.316  1.00 0.00 ? 155 HIS A NE2  3  
ATOM   8772  H  H    . HIS A 1 155 ? 11.674  3.413   7.824   1.00 0.00 ? 155 HIS A H    3  
ATOM   8773  H  HA   . HIS A 1 155 ? 11.202  1.334   9.782   1.00 0.00 ? 155 HIS A HA   3  
ATOM   8774  H  HB2  . HIS A 1 155 ? 10.185  3.652   9.863   1.00 0.00 ? 155 HIS A HB2  3  
ATOM   8775  H  HB3  . HIS A 1 155 ? 9.180   3.179   8.501   1.00 0.00 ? 155 HIS A HB3  3  
ATOM   8776  H  HD1  . HIS A 1 155 ? 9.971   1.946   12.027  1.00 0.00 ? 155 HIS A HD1  3  
ATOM   8777  H  HD2  . HIS A 1 155 ? 6.873   1.854   9.239   1.00 0.00 ? 155 HIS A HD2  3  
ATOM   8778  H  HE1  . HIS A 1 155 ? 8.008   0.831   13.174  1.00 0.00 ? 155 HIS A HE1  3  
ATOM   8779  H  HE2  . HIS A 1 155 ? 6.111   0.766   11.486  1.00 0.00 ? 155 HIS A HE2  3  
ATOM   8780  N  N    . CYS A 1 156 ? 9.976   1.230   6.750   1.00 0.00 ? 156 CYS A N    3  
ATOM   8781  C  CA   . CYS A 1 156 ? 9.402   0.364   5.737   1.00 0.00 ? 156 CYS A CA   3  
ATOM   8782  C  C    . CYS A 1 156 ? 10.209  -0.926  5.632   1.00 0.00 ? 156 CYS A C    3  
ATOM   8783  O  O    . CYS A 1 156 ? 9.681   -1.960  5.222   1.00 0.00 ? 156 CYS A O    3  
ATOM   8784  C  CB   . CYS A 1 156 ? 9.374   1.089   4.389   1.00 0.00 ? 156 CYS A CB   3  
ATOM   8785  S  SG   . CYS A 1 156 ? 9.293   -0.118  3.041   1.00 0.00 ? 156 CYS A SG   3  
ATOM   8786  H  H    . CYS A 1 156 ? 10.232  2.147   6.515   1.00 0.00 ? 156 CYS A H    3  
ATOM   8787  H  HA   . CYS A 1 156 ? 8.391   0.119   6.022   1.00 0.00 ? 156 CYS A HA   3  
ATOM   8788  H  HB2  . CYS A 1 156 ? 8.504   1.731   4.347   1.00 0.00 ? 156 CYS A HB2  3  
ATOM   8789  H  HB3  . CYS A 1 156 ? 10.267  1.689   4.286   1.00 0.00 ? 156 CYS A HB3  3  
ATOM   8790  H  HG   . CYS A 1 156 ? 9.865   0.189   2.334   1.00 0.00 ? 156 CYS A HG   3  
ATOM   8791  N  N    . TRP A 1 157 ? 11.479  -0.874  6.033   1.00 0.00 ? 157 TRP A N    3  
ATOM   8792  C  CA   . TRP A 1 157 ? 12.310  -2.064  6.003   1.00 0.00 ? 157 TRP A CA   3  
ATOM   8793  C  C    . TRP A 1 157 ? 12.005  -2.871  7.247   1.00 0.00 ? 157 TRP A C    3  
ATOM   8794  O  O    . TRP A 1 157 ? 11.522  -3.999  7.191   1.00 0.00 ? 157 TRP A O    3  
ATOM   8795  C  CB   . TRP A 1 157 ? 13.800  -1.681  6.014   1.00 0.00 ? 157 TRP A CB   3  
ATOM   8796  C  CG   . TRP A 1 157 ? 14.324  -1.606  4.620   1.00 0.00 ? 157 TRP A CG   3  
ATOM   8797  C  CD1  . TRP A 1 157 ? 15.240  -2.444  4.097   1.00 0.00 ? 157 TRP A CD1  3  
ATOM   8798  C  CD2  . TRP A 1 157 ? 13.994  -0.659  3.577   1.00 0.00 ? 157 TRP A CD2  3  
ATOM   8799  N  NE1  . TRP A 1 157 ? 15.483  -2.078  2.786   1.00 0.00 ? 157 TRP A NE1  3  
ATOM   8800  C  CE2  . TRP A 1 157 ? 14.738  -0.983  2.422   1.00 0.00 ? 157 TRP A CE2  3  
ATOM   8801  C  CE3  . TRP A 1 157 ? 13.123  0.437   3.521   1.00 0.00 ? 157 TRP A CE3  3  
ATOM   8802  C  CZ2  . TRP A 1 157 ? 14.624  -0.249  1.249   1.00 0.00 ? 157 TRP A CZ2  3  
ATOM   8803  C  CZ3  . TRP A 1 157 ? 13.003  1.187   2.340   1.00 0.00 ? 157 TRP A CZ3  3  
ATOM   8804  C  CH2  . TRP A 1 157 ? 13.754  0.841   1.204   1.00 0.00 ? 157 TRP A CH2  3  
ATOM   8805  H  H    . TRP A 1 157 ? 11.857  -0.032  6.382   1.00 0.00 ? 157 TRP A H    3  
ATOM   8806  H  HA   . TRP A 1 157 ? 12.082  -2.647  5.123   1.00 0.00 ? 157 TRP A HA   3  
ATOM   8807  H  HB2  . TRP A 1 157 ? 13.918  -0.722  6.491   1.00 0.00 ? 157 TRP A HB2  3  
ATOM   8808  H  HB3  . TRP A 1 157 ? 14.360  -2.424  6.563   1.00 0.00 ? 157 TRP A HB3  3  
ATOM   8809  H  HD1  . TRP A 1 157 ? 15.701  -3.262  4.617   1.00 0.00 ? 157 TRP A HD1  3  
ATOM   8810  H  HE1  . TRP A 1 157 ? 16.104  -2.526  2.176   1.00 0.00 ? 157 TRP A HE1  3  
ATOM   8811  H  HE3  . TRP A 1 157 ? 12.548  0.707   4.396   1.00 0.00 ? 157 TRP A HE3  3  
ATOM   8812  H  HZ2  . TRP A 1 157 ? 15.205  -0.523  0.382   1.00 0.00 ? 157 TRP A HZ2  3  
ATOM   8813  H  HZ3  . TRP A 1 157 ? 12.330  2.030   2.305   1.00 0.00 ? 157 TRP A HZ3  3  
ATOM   8814  H  HH2  . TRP A 1 157 ? 13.660  1.417   0.299   1.00 0.00 ? 157 TRP A HH2  3  
ATOM   8815  N  N    . ASP A 1 158 ? 12.289  -2.239  8.367   1.00 0.00 ? 158 ASP A N    3  
ATOM   8816  C  CA   . ASP A 1 158 ? 12.068  -2.819  9.677   1.00 0.00 ? 158 ASP A CA   3  
ATOM   8817  C  C    . ASP A 1 158 ? 10.684  -3.448  9.778   1.00 0.00 ? 158 ASP A C    3  
ATOM   8818  O  O    . ASP A 1 158 ? 10.403  -4.221  10.692  1.00 0.00 ? 158 ASP A O    3  
ATOM   8819  C  CB   . ASP A 1 158 ? 12.205  -1.686  10.694  1.00 0.00 ? 158 ASP A CB   3  
ATOM   8820  C  CG   . ASP A 1 158 ? 11.530  -2.036  12.019  1.00 0.00 ? 158 ASP A CG   3  
ATOM   8821  O  OD1  . ASP A 1 158 ? 10.340  -2.305  12.007  1.00 0.00 ? 158 ASP A OD1  3  
ATOM   8822  O  OD2  . ASP A 1 158 ? 12.210  -2.012  13.027  1.00 0.00 ? 158 ASP A OD2  3  
ATOM   8823  H  H    . ASP A 1 158 ? 12.660  -1.331  8.311   1.00 0.00 ? 158 ASP A H    3  
ATOM   8824  H  HA   . ASP A 1 158 ? 12.818  -3.564  9.866   1.00 0.00 ? 158 ASP A HA   3  
ATOM   8825  H  HB2  . ASP A 1 158 ? 13.252  -1.486  10.862  1.00 0.00 ? 158 ASP A HB2  3  
ATOM   8826  H  HB3  . ASP A 1 158 ? 11.741  -0.799  10.284  1.00 0.00 ? 158 ASP A HB3  3  
ATOM   8827  N  N    . THR A 1 159 ? 9.823   -3.084  8.848   1.00 0.00 ? 159 THR A N    3  
ATOM   8828  C  CA   . THR A 1 159 ? 8.452   -3.583  8.843   1.00 0.00 ? 159 THR A CA   3  
ATOM   8829  C  C    . THR A 1 159 ? 8.332   -4.920  8.109   1.00 0.00 ? 159 THR A C    3  
ATOM   8830  O  O    . THR A 1 159 ? 7.607   -5.811  8.551   1.00 0.00 ? 159 THR A O    3  
ATOM   8831  C  CB   . THR A 1 159 ? 7.545   -2.540  8.177   1.00 0.00 ? 159 THR A CB   3  
ATOM   8832  O  OG1  . THR A 1 159 ? 7.547   -1.355  8.959   1.00 0.00 ? 159 THR A OG1  3  
ATOM   8833  C  CG2  . THR A 1 159 ? 6.114   -3.073  8.061   1.00 0.00 ? 159 THR A CG2  3  
ATOM   8834  H  H    . THR A 1 159 ? 10.109  -2.448  8.166   1.00 0.00 ? 159 THR A H    3  
ATOM   8835  H  HA   . THR A 1 159 ? 8.132   -3.716  9.866   1.00 0.00 ? 159 THR A HA   3  
ATOM   8836  H  HB   . THR A 1 159 ? 7.922   -2.318  7.190   1.00 0.00 ? 159 THR A HB   3  
ATOM   8837  H  HG1  . THR A 1 159 ? 7.154   -0.653  8.435   1.00 0.00 ? 159 THR A HG1  3  
ATOM   8838  H  HG21 . THR A 1 159 ? 5.905   -3.733  8.889   1.00 0.00 ? 159 THR A HG21 3  
ATOM   8839  H  HG22 . THR A 1 159 ? 6.005   -3.613  7.132   1.00 0.00 ? 159 THR A HG22 3  
ATOM   8840  H  HG23 . THR A 1 159 ? 5.420   -2.243  8.078   1.00 0.00 ? 159 THR A HG23 3  
ATOM   8841  N  N    . PHE A 1 160 ? 9.023   -5.051  6.978   1.00 0.00 ? 160 PHE A N    3  
ATOM   8842  C  CA   . PHE A 1 160 ? 8.957   -6.281  6.186   1.00 0.00 ? 160 PHE A CA   3  
ATOM   8843  C  C    . PHE A 1 160 ? 10.311  -6.998  6.159   1.00 0.00 ? 160 PHE A C    3  
ATOM   8844  O  O    . PHE A 1 160 ? 10.433  -8.082  5.587   1.00 0.00 ? 160 PHE A O    3  
ATOM   8845  C  CB   . PHE A 1 160 ? 8.488   -5.925  4.755   1.00 0.00 ? 160 PHE A CB   3  
ATOM   8846  C  CG   . PHE A 1 160 ? 9.470   -6.416  3.711   1.00 0.00 ? 160 PHE A CG   3  
ATOM   8847  C  CD1  . PHE A 1 160 ? 9.393   -7.733  3.244   1.00 0.00 ? 160 PHE A CD1  3  
ATOM   8848  C  CD2  . PHE A 1 160 ? 10.456  -5.554  3.217   1.00 0.00 ? 160 PHE A CD2  3  
ATOM   8849  C  CE1  . PHE A 1 160 ? 10.302  -8.187  2.282   1.00 0.00 ? 160 PHE A CE1  3  
ATOM   8850  C  CE2  . PHE A 1 160 ? 11.365  -6.008  2.255   1.00 0.00 ? 160 PHE A CE2  3  
ATOM   8851  C  CZ   . PHE A 1 160 ? 11.288  -7.325  1.787   1.00 0.00 ? 160 PHE A CZ   3  
ATOM   8852  H  H    . PHE A 1 160 ? 9.571   -4.305  6.660   1.00 0.00 ? 160 PHE A H    3  
ATOM   8853  H  HA   . PHE A 1 160 ? 8.232   -6.945  6.632   1.00 0.00 ? 160 PHE A HA   3  
ATOM   8854  H  HB2  . PHE A 1 160 ? 7.526   -6.373  4.572   1.00 0.00 ? 160 PHE A HB2  3  
ATOM   8855  H  HB3  . PHE A 1 160 ? 8.396   -4.851  4.675   1.00 0.00 ? 160 PHE A HB3  3  
ATOM   8856  H  HD1  . PHE A 1 160 ? 8.633   -8.398  3.627   1.00 0.00 ? 160 PHE A HD1  3  
ATOM   8857  H  HD2  . PHE A 1 160 ? 10.516  -4.537  3.580   1.00 0.00 ? 160 PHE A HD2  3  
ATOM   8858  H  HE1  . PHE A 1 160 ? 10.243  -9.204  1.921   1.00 0.00 ? 160 PHE A HE1  3  
ATOM   8859  H  HE2  . PHE A 1 160 ? 12.125  -5.344  1.874   1.00 0.00 ? 160 PHE A HE2  3  
ATOM   8860  H  HZ   . PHE A 1 160 ? 11.988  -7.676  1.045   1.00 0.00 ? 160 PHE A HZ   3  
ATOM   8861  N  N    . VAL A 1 161 ? 11.320  -6.384  6.756   1.00 0.00 ? 161 VAL A N    3  
ATOM   8862  C  CA   . VAL A 1 161 ? 12.649  -6.958  6.775   1.00 0.00 ? 161 VAL A CA   3  
ATOM   8863  C  C    . VAL A 1 161 ? 12.916  -7.669  8.098   1.00 0.00 ? 161 VAL A C    3  
ATOM   8864  O  O    . VAL A 1 161 ? 12.508  -7.197  9.160   1.00 0.00 ? 161 VAL A O    3  
ATOM   8865  C  CB   . VAL A 1 161 ? 13.657  -5.835  6.571   1.00 0.00 ? 161 VAL A CB   3  
ATOM   8866  C  CG1  . VAL A 1 161 ? 15.067  -6.390  6.666   1.00 0.00 ? 161 VAL A CG1  3  
ATOM   8867  C  CG2  . VAL A 1 161 ? 13.443  -5.206  5.189   1.00 0.00 ? 161 VAL A CG2  3  
ATOM   8868  H  H    . VAL A 1 161 ? 11.175  -5.521  7.181   1.00 0.00 ? 161 VAL A H    3  
ATOM   8869  H  HA   . VAL A 1 161 ? 12.746  -7.667  5.967   1.00 0.00 ? 161 VAL A HA   3  
ATOM   8870  H  HB   . VAL A 1 161 ? 13.519  -5.085  7.335   1.00 0.00 ? 161 VAL A HB   3  
ATOM   8871  H  HG11 . VAL A 1 161 ? 15.135  -7.293  6.083   1.00 0.00 ? 161 VAL A HG11 3  
ATOM   8872  H  HG12 . VAL A 1 161 ? 15.294  -6.605  7.700   1.00 0.00 ? 161 VAL A HG12 3  
ATOM   8873  H  HG13 . VAL A 1 161 ? 15.763  -5.659  6.287   1.00 0.00 ? 161 VAL A HG13 3  
ATOM   8874  H  HG21 . VAL A 1 161 ? 14.029  -5.735  4.453   1.00 0.00 ? 161 VAL A HG21 3  
ATOM   8875  H  HG22 . VAL A 1 161 ? 13.749  -4.175  5.219   1.00 0.00 ? 161 VAL A HG22 3  
ATOM   8876  H  HG23 . VAL A 1 161 ? 12.397  -5.260  4.924   1.00 0.00 ? 161 VAL A HG23 3  
ATOM   8877  N  N    . ASP A 1 162 ? 13.605  -8.805  8.026   1.00 0.00 ? 162 ASP A N    3  
ATOM   8878  C  CA   . ASP A 1 162 ? 13.923  -9.572  9.226   1.00 0.00 ? 162 ASP A CA   3  
ATOM   8879  C  C    . ASP A 1 162 ? 14.993  -8.864  10.044  1.00 0.00 ? 162 ASP A C    3  
ATOM   8880  O  O    . ASP A 1 162 ? 15.771  -9.494  10.759  1.00 0.00 ? 162 ASP A O    3  
ATOM   8881  C  CB   . ASP A 1 162 ? 14.407  -10.972 8.844   1.00 0.00 ? 162 ASP A CB   3  
ATOM   8882  C  CG   . ASP A 1 162 ? 14.727  -11.776 10.100  1.00 0.00 ? 162 ASP A CG   3  
ATOM   8883  O  OD1  . ASP A 1 162 ? 13.794  -12.226 10.744  1.00 0.00 ? 162 ASP A OD1  3  
ATOM   8884  O  OD2  . ASP A 1 162 ? 15.900  -11.929 10.399  1.00 0.00 ? 162 ASP A OD2  3  
ATOM   8885  H  H    . ASP A 1 162 ? 13.906  -9.130  7.152   1.00 0.00 ? 162 ASP A H    3  
ATOM   8886  H  HA   . ASP A 1 162 ? 13.034  -9.660  9.826   1.00 0.00 ? 162 ASP A HA   3  
ATOM   8887  H  HB2  . ASP A 1 162 ? 13.635  -11.476 8.280   1.00 0.00 ? 162 ASP A HB2  3  
ATOM   8888  H  HB3  . ASP A 1 162 ? 15.297  -10.886 8.238   1.00 0.00 ? 162 ASP A HB3  3  
ATOM   8889  N  N    . HIS A 1 163 ? 15.009  -7.548  9.931   1.00 0.00 ? 163 HIS A N    3  
ATOM   8890  C  CA   . HIS A 1 163 ? 15.967  -6.728  10.656  1.00 0.00 ? 163 HIS A CA   3  
ATOM   8891  C  C    . HIS A 1 163 ? 15.395  -5.335  10.894  1.00 0.00 ? 163 HIS A C    3  
ATOM   8892  O  O    . HIS A 1 163 ? 15.233  -4.548  9.962   1.00 0.00 ? 163 HIS A O    3  
ATOM   8893  C  CB   . HIS A 1 163 ? 17.267  -6.608  9.867   1.00 0.00 ? 163 HIS A CB   3  
ATOM   8894  C  CG   . HIS A 1 163 ? 17.667  -7.961  9.342   1.00 0.00 ? 163 HIS A CG   3  
ATOM   8895  N  ND1  . HIS A 1 163 ? 17.551  -8.303  8.002   1.00 0.00 ? 163 HIS A ND1  3  
ATOM   8896  C  CD2  . HIS A 1 163 ? 18.186  -9.067  9.967   1.00 0.00 ? 163 HIS A CD2  3  
ATOM   8897  C  CE1  . HIS A 1 163 ? 17.992  -9.569  7.869   1.00 0.00 ? 163 HIS A CE1  3  
ATOM   8898  N  NE2  . HIS A 1 163 ? 18.390  -10.081 9.036   1.00 0.00 ? 163 HIS A NE2  3  
ATOM   8899  H  H    . HIS A 1 163 ? 14.353  -7.117  9.349   1.00 0.00 ? 163 HIS A H    3  
ATOM   8900  H  HA   . HIS A 1 163 ? 16.178  -7.192  11.608  1.00 0.00 ? 163 HIS A HA   3  
ATOM   8901  H  HB2  . HIS A 1 163 ? 17.118  -5.927  9.046   1.00 0.00 ? 163 HIS A HB2  3  
ATOM   8902  H  HB3  . HIS A 1 163 ? 18.046  -6.228  10.511  1.00 0.00 ? 163 HIS A HB3  3  
ATOM   8903  H  HD1  . HIS A 1 163 ? 17.216  -7.728  7.283   1.00 0.00 ? 163 HIS A HD1  3  
ATOM   8904  H  HD2  . HIS A 1 163 ? 18.402  -9.140  11.024  1.00 0.00 ? 163 HIS A HD2  3  
ATOM   8905  H  HE1  . HIS A 1 163 ? 18.020  -10.106 6.932   1.00 0.00 ? 163 HIS A HE1  3  
ATOM   8906  H  HE2  . HIS A 1 163 ? 18.749  -10.978 9.201   1.00 0.00 ? 163 HIS A HE2  3  
ATOM   8907  N  N    . GLN A 1 164 ? 15.095  -5.044  12.149  1.00 0.00 ? 164 GLN A N    3  
ATOM   8908  C  CA   . GLN A 1 164 ? 14.541  -3.750  12.520  1.00 0.00 ? 164 GLN A CA   3  
ATOM   8909  C  C    . GLN A 1 164 ? 15.609  -2.666  12.405  1.00 0.00 ? 164 GLN A C    3  
ATOM   8910  O  O    . GLN A 1 164 ? 15.421  -1.542  12.870  1.00 0.00 ? 164 GLN A O    3  
ATOM   8911  C  CB   . GLN A 1 164 ? 14.008  -3.809  13.956  1.00 0.00 ? 164 GLN A CB   3  
ATOM   8912  C  CG   . GLN A 1 164 ? 12.662  -4.553  13.987  1.00 0.00 ? 164 GLN A CG   3  
ATOM   8913  C  CD   . GLN A 1 164 ? 11.890  -4.181  15.248  1.00 0.00 ? 164 GLN A CD   3  
ATOM   8914  O  OE1  . GLN A 1 164 ? 11.306  -3.099  15.324  1.00 0.00 ? 164 GLN A OE1  3  
ATOM   8915  N  NE2  . GLN A 1 164 ? 11.848  -5.020  16.245  1.00 0.00 ? 164 GLN A NE2  3  
ATOM   8916  H  H    . GLN A 1 164 ? 15.248  -5.712  12.838  1.00 0.00 ? 164 GLN A H    3  
ATOM   8917  H  HA   . GLN A 1 164 ? 13.730  -3.513  11.854  1.00 0.00 ? 164 GLN A HA   3  
ATOM   8918  H  HB2  . GLN A 1 164 ? 14.720  -4.334  14.579  1.00 0.00 ? 164 GLN A HB2  3  
ATOM   8919  H  HB3  . GLN A 1 164 ? 13.874  -2.807  14.332  1.00 0.00 ? 164 GLN A HB3  3  
ATOM   8920  H  HG2  . GLN A 1 164 ? 12.071  -4.289  13.118  1.00 0.00 ? 164 GLN A HG2  3  
ATOM   8921  H  HG3  . GLN A 1 164 ? 12.845  -5.618  13.985  1.00 0.00 ? 164 GLN A HG3  3  
ATOM   8922  H  HE21 . GLN A 1 164 ? 12.311  -5.881  16.181  1.00 0.00 ? 164 GLN A HE21 3  
ATOM   8923  H  HE22 . GLN A 1 164 ? 11.355  -4.789  17.060  1.00 0.00 ? 164 GLN A HE22 3  
ATOM   8924  N  N    . GLY A 1 165 ? 16.726  -3.014  11.773  1.00 0.00 ? 165 GLY A N    3  
ATOM   8925  C  CA   . GLY A 1 165 ? 17.822  -2.068  11.591  1.00 0.00 ? 165 GLY A CA   3  
ATOM   8926  C  C    . GLY A 1 165 ? 18.568  -2.348  10.291  1.00 0.00 ? 165 GLY A C    3  
ATOM   8927  O  O    . GLY A 1 165 ? 19.798  -2.375  10.259  1.00 0.00 ? 165 GLY A O    3  
ATOM   8928  H  H    . GLY A 1 165 ? 16.816  -3.924  11.420  1.00 0.00 ? 165 GLY A H    3  
ATOM   8929  H  HA2  . GLY A 1 165 ? 17.420  -1.065  11.560  1.00 0.00 ? 165 GLY A HA2  3  
ATOM   8930  H  HA3  . GLY A 1 165 ? 18.509  -2.155  12.417  1.00 0.00 ? 165 GLY A HA3  3  
ATOM   8931  N  N    . CYS A 1 166 ? 17.808  -2.559  9.224   1.00 0.00 ? 166 CYS A N    3  
ATOM   8932  C  CA   . CYS A 1 166 ? 18.390  -2.841  7.914   1.00 0.00 ? 166 CYS A CA   3  
ATOM   8933  C  C    . CYS A 1 166 ? 19.506  -1.841  7.594   1.00 0.00 ? 166 CYS A C    3  
ATOM   8934  O  O    . CYS A 1 166 ? 19.479  -0.706  8.070   1.00 0.00 ? 166 CYS A O    3  
ATOM   8935  C  CB   . CYS A 1 166 ? 17.296  -2.766  6.847   1.00 0.00 ? 166 CYS A CB   3  
ATOM   8936  S  SG   . CYS A 1 166 ? 17.027  -1.040  6.370   1.00 0.00 ? 166 CYS A SG   3  
ATOM   8937  H  H    . CYS A 1 166 ? 16.834  -2.525  9.318   1.00 0.00 ? 166 CYS A H    3  
ATOM   8938  H  HA   . CYS A 1 166 ? 18.798  -3.839  7.925   1.00 0.00 ? 166 CYS A HA   3  
ATOM   8939  H  HB2  . CYS A 1 166 ? 17.593  -3.339  5.982   1.00 0.00 ? 166 CYS A HB2  3  
ATOM   8940  H  HB3  . CYS A 1 166 ? 16.381  -3.174  7.250   1.00 0.00 ? 166 CYS A HB3  3  
ATOM   8941  H  HG   . CYS A 1 166 ? 16.562  -1.033  5.530   1.00 0.00 ? 166 CYS A HG   3  
ATOM   8942  N  N    . PRO A 1 167 ? 20.486  -2.235  6.812   1.00 0.00 ? 167 PRO A N    3  
ATOM   8943  C  CA   . PRO A 1 167 ? 21.629  -1.345  6.447   1.00 0.00 ? 167 PRO A CA   3  
ATOM   8944  C  C    . PRO A 1 167 ? 21.262  -0.289  5.402   1.00 0.00 ? 167 PRO A C    3  
ATOM   8945  O  O    . PRO A 1 167 ? 22.127  0.449   4.932   1.00 0.00 ? 167 PRO A O    3  
ATOM   8946  C  CB   . PRO A 1 167 ? 22.668  -2.317  5.889   1.00 0.00 ? 167 PRO A CB   3  
ATOM   8947  C  CG   . PRO A 1 167 ? 21.875  -3.446  5.325   1.00 0.00 ? 167 PRO A CG   3  
ATOM   8948  C  CD   . PRO A 1 167 ? 20.623  -3.570  6.193   1.00 0.00 ? 167 PRO A CD   3  
ATOM   8949  H  HA   . PRO A 1 167 ? 22.024  -0.871  7.328   1.00 0.00 ? 167 PRO A HA   3  
ATOM   8950  H  HB2  . PRO A 1 167 ? 23.253  -1.839  5.115   1.00 0.00 ? 167 PRO A HB2  3  
ATOM   8951  H  HB3  . PRO A 1 167 ? 23.308  -2.675  6.680   1.00 0.00 ? 167 PRO A HB3  3  
ATOM   8952  H  HG2  . PRO A 1 167 ? 21.602  -3.229  4.300   1.00 0.00 ? 167 PRO A HG2  3  
ATOM   8953  H  HG3  . PRO A 1 167 ? 22.444  -4.361  5.374   1.00 0.00 ? 167 PRO A HG3  3  
ATOM   8954  H  HD2  . PRO A 1 167 ? 19.763  -3.802  5.581   1.00 0.00 ? 167 PRO A HD2  3  
ATOM   8955  H  HD3  . PRO A 1 167 ? 20.766  -4.323  6.952   1.00 0.00 ? 167 PRO A HD3  3  
ATOM   8956  N  N    . PHE A 1 168 ? 19.983  -0.213  5.042   1.00 0.00 ? 168 PHE A N    3  
ATOM   8957  C  CA   . PHE A 1 168 ? 19.546  0.771   4.054   1.00 0.00 ? 168 PHE A CA   3  
ATOM   8958  C  C    . PHE A 1 168 ? 19.736  2.182   4.595   1.00 0.00 ? 168 PHE A C    3  
ATOM   8959  O  O    . PHE A 1 168 ? 19.802  2.389   5.806   1.00 0.00 ? 168 PHE A O    3  
ATOM   8960  C  CB   . PHE A 1 168 ? 18.074  0.562   3.695   1.00 0.00 ? 168 PHE A CB   3  
ATOM   8961  C  CG   . PHE A 1 168 ? 17.779  1.217   2.367   1.00 0.00 ? 168 PHE A CG   3  
ATOM   8962  C  CD1  . PHE A 1 168 ? 17.483  2.584   2.311   1.00 0.00 ? 168 PHE A CD1  3  
ATOM   8963  C  CD2  . PHE A 1 168 ? 17.797  0.456   1.191   1.00 0.00 ? 168 PHE A CD2  3  
ATOM   8964  C  CE1  . PHE A 1 168 ? 17.205  3.190   1.080   1.00 0.00 ? 168 PHE A CE1  3  
ATOM   8965  C  CE2  . PHE A 1 168 ? 17.519  1.063   -0.041  1.00 0.00 ? 168 PHE A CE2  3  
ATOM   8966  C  CZ   . PHE A 1 168 ? 17.223  2.430   -0.096  1.00 0.00 ? 168 PHE A CZ   3  
ATOM   8967  H  H    . PHE A 1 168 ? 19.329  -0.820  5.447   1.00 0.00 ? 168 PHE A H    3  
ATOM   8968  H  HA   . PHE A 1 168 ? 20.142  0.656   3.161   1.00 0.00 ? 168 PHE A HA   3  
ATOM   8969  H  HB2  . PHE A 1 168 ? 17.865  -0.493  3.629   1.00 0.00 ? 168 PHE A HB2  3  
ATOM   8970  H  HB3  . PHE A 1 168 ? 17.453  1.009   4.457   1.00 0.00 ? 168 PHE A HB3  3  
ATOM   8971  H  HD1  . PHE A 1 168 ? 17.470  3.171   3.217   1.00 0.00 ? 168 PHE A HD1  3  
ATOM   8972  H  HD2  . PHE A 1 168 ? 18.026  -0.599  1.234   1.00 0.00 ? 168 PHE A HD2  3  
ATOM   8973  H  HE1  . PHE A 1 168 ? 16.978  4.243   1.038   1.00 0.00 ? 168 PHE A HE1  3  
ATOM   8974  H  HE2  . PHE A 1 168 ? 17.532  0.476   -0.947  1.00 0.00 ? 168 PHE A HE2  3  
ATOM   8975  H  HZ   . PHE A 1 168 ? 17.006  2.899   -1.045  1.00 0.00 ? 168 PHE A HZ   3  
ATOM   8976  N  N    . GLN A 1 169 ? 19.833  3.151   3.690   1.00 0.00 ? 169 GLN A N    3  
ATOM   8977  C  CA   . GLN A 1 169 ? 20.023  4.542   4.090   1.00 0.00 ? 169 GLN A CA   3  
ATOM   8978  C  C    . GLN A 1 169 ? 19.183  5.487   3.225   1.00 0.00 ? 169 GLN A C    3  
ATOM   8979  O  O    . GLN A 1 169 ? 18.797  5.143   2.109   1.00 0.00 ? 169 GLN A O    3  
ATOM   8980  C  CB   . GLN A 1 169 ? 21.507  4.910   3.980   1.00 0.00 ? 169 GLN A CB   3  
ATOM   8981  C  CG   . GLN A 1 169 ? 22.144  4.882   5.369   1.00 0.00 ? 169 GLN A CG   3  
ATOM   8982  C  CD   . GLN A 1 169 ? 23.635  5.176   5.273   1.00 0.00 ? 169 GLN A CD   3  
ATOM   8983  O  OE1  . GLN A 1 169 ? 24.056  6.000   4.461   1.00 0.00 ? 169 GLN A OE1  3  
ATOM   8984  N  NE2  . GLN A 1 169 ? 24.462  4.549   6.060   1.00 0.00 ? 169 GLN A NE2  3  
ATOM   8985  H  H    . GLN A 1 169 ? 19.779  2.926   2.743   1.00 0.00 ? 169 GLN A H    3  
ATOM   8986  H  HA   . GLN A 1 169 ? 19.716  4.640   5.111   1.00 0.00 ? 169 GLN A HA   3  
ATOM   8987  H  HB2  . GLN A 1 169 ? 22.000  4.191   3.348   1.00 0.00 ? 169 GLN A HB2  3  
ATOM   8988  H  HB3  . GLN A 1 169 ? 21.616  5.900   3.557   1.00 0.00 ? 169 GLN A HB3  3  
ATOM   8989  H  HG2  . GLN A 1 169 ? 21.669  5.624   5.991   1.00 0.00 ? 169 GLN A HG2  3  
ATOM   8990  H  HG3  . GLN A 1 169 ? 21.998  3.904   5.803   1.00 0.00 ? 169 GLN A HG3  3  
ATOM   8991  H  HE21 . GLN A 1 169 ? 24.122  3.892   6.707   1.00 0.00 ? 169 GLN A HE21 3  
ATOM   8992  H  HE22 . GLN A 1 169 ? 25.423  4.733   6.005   1.00 0.00 ? 169 GLN A HE22 3  
ATOM   8993  N  N    . PRO A 1 170 ? 18.897  6.665   3.727   1.00 0.00 ? 170 PRO A N    3  
ATOM   8994  C  CA   . PRO A 1 170 ? 18.091  7.688   3.004   1.00 0.00 ? 170 PRO A CA   3  
ATOM   8995  C  C    . PRO A 1 170 ? 18.946  8.579   2.103   1.00 0.00 ? 170 PRO A C    3  
ATOM   8996  O  O    . PRO A 1 170 ? 19.980  9.089   2.531   1.00 0.00 ? 170 PRO A O    3  
ATOM   8997  C  CB   . PRO A 1 170 ? 17.520  8.499   4.161   1.00 0.00 ? 170 PRO A CB   3  
ATOM   8998  C  CG   . PRO A 1 170 ? 18.618  8.526   5.159   1.00 0.00 ? 170 PRO A CG   3  
ATOM   8999  C  CD   . PRO A 1 170 ? 19.307  7.170   5.055   1.00 0.00 ? 170 PRO A CD   3  
ATOM   9000  H  HA   . PRO A 1 170 ? 17.290  7.229   2.450   1.00 0.00 ? 170 PRO A HA   3  
ATOM   9001  H  HB2  . PRO A 1 170 ? 17.285  9.492   3.844   1.00 0.00 ? 170 PRO A HB2  3  
ATOM   9002  H  HB3  . PRO A 1 170 ? 16.652  8.013   4.577   1.00 0.00 ? 170 PRO A HB3  3  
ATOM   9003  H  HG2  . PRO A 1 170 ? 19.313  9.322   4.925   1.00 0.00 ? 170 PRO A HG2  3  
ATOM   9004  H  HG3  . PRO A 1 170 ? 18.218  8.659   6.151   1.00 0.00 ? 170 PRO A HG3  3  
ATOM   9005  H  HD2  . PRO A 1 170 ? 20.380  7.282   5.113   1.00 0.00 ? 170 PRO A HD2  3  
ATOM   9006  H  HD3  . PRO A 1 170 ? 18.944  6.525   5.826   1.00 0.00 ? 170 PRO A HD3  3  
ATOM   9007  N  N    . TRP A 1 171 ? 18.508  8.776   0.860   1.00 0.00 ? 171 TRP A N    3  
ATOM   9008  C  CA   . TRP A 1 171 ? 19.252  9.623   -0.067  1.00 0.00 ? 171 TRP A CA   3  
ATOM   9009  C  C    . TRP A 1 171 ? 18.738  11.061  -0.003  1.00 0.00 ? 171 TRP A C    3  
ATOM   9010  O  O    . TRP A 1 171 ? 17.588  11.305  0.373   1.00 0.00 ? 171 TRP A O    3  
ATOM   9011  C  CB   . TRP A 1 171 ? 19.130  9.087   -1.494  1.00 0.00 ? 171 TRP A CB   3  
ATOM   9012  C  CG   . TRP A 1 171 ? 17.706  9.131   -1.926  1.00 0.00 ? 171 TRP A CG   3  
ATOM   9013  C  CD1  . TRP A 1 171 ? 17.171  10.030  -2.781  1.00 0.00 ? 171 TRP A CD1  3  
ATOM   9014  C  CD2  . TRP A 1 171 ? 16.635  8.242   -1.542  1.00 0.00 ? 171 TRP A CD2  3  
ATOM   9015  N  NE1  . TRP A 1 171 ? 15.818  9.753   -2.925  1.00 0.00 ? 171 TRP A NE1  3  
ATOM   9016  C  CE2  . TRP A 1 171 ? 15.447  8.650   -2.184  1.00 0.00 ? 171 TRP A CE2  3  
ATOM   9017  C  CE3  . TRP A 1 171 ? 16.586  7.132   -0.699  1.00 0.00 ? 171 TRP A CE3  3  
ATOM   9018  C  CZ2  . TRP A 1 171 ? 14.246  7.967   -1.989  1.00 0.00 ? 171 TRP A CZ2  3  
ATOM   9019  C  CZ3  . TRP A 1 171 ? 15.396  6.445   -0.499  1.00 0.00 ? 171 TRP A CZ3  3  
ATOM   9020  C  CH2  . TRP A 1 171 ? 14.226  6.856   -1.142  1.00 0.00 ? 171 TRP A CH2  3  
ATOM   9021  H  H    . TRP A 1 171 ? 17.673  8.356   0.564   1.00 0.00 ? 171 TRP A H    3  
ATOM   9022  H  HA   . TRP A 1 171 ? 20.294  9.617   0.216   1.00 0.00 ? 171 TRP A HA   3  
ATOM   9023  H  HB2  . TRP A 1 171 ? 19.721  9.692   -2.152  1.00 0.00 ? 171 TRP A HB2  3  
ATOM   9024  H  HB3  . TRP A 1 171 ? 19.484  8.067   -1.527  1.00 0.00 ? 171 TRP A HB3  3  
ATOM   9025  H  HD1  . TRP A 1 171 ? 17.709  10.834  -3.258  1.00 0.00 ? 171 TRP A HD1  3  
ATOM   9026  H  HE1  . TRP A 1 171 ? 15.188  10.261  -3.479  1.00 0.00 ? 171 TRP A HE1  3  
ATOM   9027  H  HE3  . TRP A 1 171 ? 17.476  6.804   -0.198  1.00 0.00 ? 171 TRP A HE3  3  
ATOM   9028  H  HZ2  . TRP A 1 171 ? 13.345  8.290   -2.488  1.00 0.00 ? 171 TRP A HZ2  3  
ATOM   9029  H  HZ3  . TRP A 1 171 ? 15.380  5.594   0.155   1.00 0.00 ? 171 TRP A HZ3  3  
ATOM   9030  H  HH2  . TRP A 1 171 ? 13.314  6.317   -0.979  1.00 0.00 ? 171 TRP A HH2  3  
ATOM   9031  N  N    . ASP A 1 172 ? 19.604  12.006  -0.359  1.00 0.00 ? 172 ASP A N    3  
ATOM   9032  C  CA   . ASP A 1 172 ? 19.249  13.423  -0.323  1.00 0.00 ? 172 ASP A CA   3  
ATOM   9033  C  C    . ASP A 1 172 ? 18.208  13.775  -1.380  1.00 0.00 ? 172 ASP A C    3  
ATOM   9034  O  O    . ASP A 1 172 ? 18.303  14.809  -2.042  1.00 0.00 ? 172 ASP A O    3  
ATOM   9035  C  CB   . ASP A 1 172 ? 20.494  14.272  -0.545  1.00 0.00 ? 172 ASP A CB   3  
ATOM   9036  C  CG   . ASP A 1 172 ? 21.397  14.206  0.682   1.00 0.00 ? 172 ASP A CG   3  
ATOM   9037  O  OD1  . ASP A 1 172 ? 21.329  13.215  1.391   1.00 0.00 ? 172 ASP A OD1  3  
ATOM   9038  O  OD2  . ASP A 1 172 ? 22.143  15.147  0.896   1.00 0.00 ? 172 ASP A OD2  3  
ATOM   9039  H  H    . ASP A 1 172 ? 20.507  11.747  -0.636  1.00 0.00 ? 172 ASP A H    3  
ATOM   9040  H  HA   . ASP A 1 172 ? 18.842  13.656  0.649   1.00 0.00 ? 172 ASP A HA   3  
ATOM   9041  H  HB2  . ASP A 1 172 ? 21.027  13.897  -1.407  1.00 0.00 ? 172 ASP A HB2  3  
ATOM   9042  H  HB3  . ASP A 1 172 ? 20.198  15.294  -0.720  1.00 0.00 ? 172 ASP A HB3  3  
ATOM   9043  N  N    . GLY A 1 173 ? 17.208  12.922  -1.512  1.00 0.00 ? 173 GLY A N    3  
ATOM   9044  C  CA   . GLY A 1 173 ? 16.128  13.149  -2.471  1.00 0.00 ? 173 GLY A CA   3  
ATOM   9045  C  C    . GLY A 1 173 ? 14.781  12.959  -1.791  1.00 0.00 ? 173 GLY A C    3  
ATOM   9046  O  O    . GLY A 1 173 ? 13.809  13.642  -2.116  1.00 0.00 ? 173 GLY A O    3  
ATOM   9047  H  H    . GLY A 1 173 ? 17.189  12.130  -0.944  1.00 0.00 ? 173 GLY A H    3  
ATOM   9048  H  HA2  . GLY A 1 173 ? 16.194  14.158  -2.854  1.00 0.00 ? 173 GLY A HA2  3  
ATOM   9049  H  HA3  . GLY A 1 173 ? 16.210  12.454  -3.288  1.00 0.00 ? 173 GLY A HA3  3  
ATOM   9050  N  N    . LEU A 1 174 ? 14.731  12.034  -0.834  1.00 0.00 ? 174 LEU A N    3  
ATOM   9051  C  CA   . LEU A 1 174 ? 13.508  11.774  -0.108  1.00 0.00 ? 174 LEU A CA   3  
ATOM   9052  C  C    . LEU A 1 174 ? 12.782  13.081  0.171   1.00 0.00 ? 174 LEU A C    3  
ATOM   9053  O  O    . LEU A 1 174 ? 11.553  13.134  0.236   1.00 0.00 ? 174 LEU A O    3  
ATOM   9054  C  CB   . LEU A 1 174 ? 13.847  11.103  1.208   1.00 0.00 ? 174 LEU A CB   3  
ATOM   9055  C  CG   . LEU A 1 174 ? 14.211  9.645   0.937   1.00 0.00 ? 174 LEU A CG   3  
ATOM   9056  C  CD1  . LEU A 1 174 ? 15.020  9.106   2.103   1.00 0.00 ? 174 LEU A CD1  3  
ATOM   9057  C  CD2  . LEU A 1 174 ? 12.946  8.802   0.755   1.00 0.00 ? 174 LEU A CD2  3  
ATOM   9058  H  H    . LEU A 1 174 ? 15.534  11.525  -0.606  1.00 0.00 ? 174 LEU A H    3  
ATOM   9059  H  HA   . LEU A 1 174 ? 12.888  11.114  -0.687  1.00 0.00 ? 174 LEU A HA   3  
ATOM   9060  H  HB2  . LEU A 1 174 ? 14.689  11.607  1.660   1.00 0.00 ? 174 LEU A HB2  3  
ATOM   9061  H  HB3  . LEU A 1 174 ? 13.002  11.156  1.868   1.00 0.00 ? 174 LEU A HB3  3  
ATOM   9062  H  HG   . LEU A 1 174 ? 14.808  9.593   0.043   1.00 0.00 ? 174 LEU A HG   3  
ATOM   9063  H  HD11 . LEU A 1 174 ? 14.671  9.557   3.012   1.00 0.00 ? 174 LEU A HD11 3  
ATOM   9064  H  HD12 . LEU A 1 174 ? 16.057  9.350   1.954   1.00 0.00 ? 174 LEU A HD12 3  
ATOM   9065  H  HD13 . LEU A 1 174 ? 14.901  8.036   2.162   1.00 0.00 ? 174 LEU A HD13 3  
ATOM   9066  H  HD21 . LEU A 1 174 ? 12.178  9.143   1.430   1.00 0.00 ? 174 LEU A HD21 3  
ATOM   9067  H  HD22 . LEU A 1 174 ? 13.176  7.768   0.966   1.00 0.00 ? 174 LEU A HD22 3  
ATOM   9068  H  HD23 . LEU A 1 174 ? 12.600  8.893   -0.262  1.00 0.00 ? 174 LEU A HD23 3  
ATOM   9069  N  N    . ASP A 1 175 ? 13.574  14.130  0.338   1.00 0.00 ? 175 ASP A N    3  
ATOM   9070  C  CA   . ASP A 1 175 ? 13.051  15.455  0.617   1.00 0.00 ? 175 ASP A CA   3  
ATOM   9071  C  C    . ASP A 1 175 ? 12.150  15.916  -0.512  1.00 0.00 ? 175 ASP A C    3  
ATOM   9072  O  O    . ASP A 1 175 ? 10.941  16.075  -0.343  1.00 0.00 ? 175 ASP A O    3  
ATOM   9073  C  CB   . ASP A 1 175 ? 14.214  16.434  0.759   1.00 0.00 ? 175 ASP A CB   3  
ATOM   9074  C  CG   . ASP A 1 175 ? 15.262  16.158  -0.314  1.00 0.00 ? 175 ASP A CG   3  
ATOM   9075  O  OD1  . ASP A 1 175 ? 15.722  15.030  -0.387  1.00 0.00 ? 175 ASP A OD1  3  
ATOM   9076  O  OD2  . ASP A 1 175 ? 15.589  17.078  -1.044  1.00 0.00 ? 175 ASP A OD2  3  
ATOM   9077  H  H    . ASP A 1 175 ? 14.542  14.008  0.269   1.00 0.00 ? 175 ASP A H    3  
ATOM   9078  H  HA   . ASP A 1 175 ? 12.491  15.435  1.539   1.00 0.00 ? 175 ASP A HA   3  
ATOM   9079  H  HB2  . ASP A 1 175 ? 13.849  17.442  0.649   1.00 0.00 ? 175 ASP A HB2  3  
ATOM   9080  H  HB3  . ASP A 1 175 ? 14.665  16.316  1.730   1.00 0.00 ? 175 ASP A HB3  3  
ATOM   9081  N  N    . GLU A 1 176 ? 12.760  16.124  -1.667  1.00 0.00 ? 176 GLU A N    3  
ATOM   9082  C  CA   . GLU A 1 176 ? 12.024  16.566  -2.841  1.00 0.00 ? 176 GLU A CA   3  
ATOM   9083  C  C    . GLU A 1 176 ? 10.836  15.656  -3.081  1.00 0.00 ? 176 GLU A C    3  
ATOM   9084  O  O    . GLU A 1 176 ? 9.702   16.113  -3.223  1.00 0.00 ? 176 GLU A O    3  
ATOM   9085  C  CB   . GLU A 1 176 ? 12.930  16.546  -4.062  1.00 0.00 ? 176 GLU A CB   3  
ATOM   9086  C  CG   . GLU A 1 176 ? 12.261  17.307  -5.209  1.00 0.00 ? 176 GLU A CG   3  
ATOM   9087  C  CD   . GLU A 1 176 ? 13.122  17.224  -6.464  1.00 0.00 ? 176 GLU A CD   3  
ATOM   9088  O  OE1  . GLU A 1 176 ? 13.046  16.215  -7.146  1.00 0.00 ? 176 GLU A OE1  3  
ATOM   9089  O  OE2  . GLU A 1 176 ? 13.846  18.171  -6.725  1.00 0.00 ? 176 GLU A OE2  3  
ATOM   9090  H  H    . GLU A 1 176 ? 13.724  15.970  -1.727  1.00 0.00 ? 176 GLU A H    3  
ATOM   9091  H  HA   . GLU A 1 176 ? 11.679  17.567  -2.685  1.00 0.00 ? 176 GLU A HA   3  
ATOM   9092  H  HB2  . GLU A 1 176 ? 13.874  17.009  -3.819  1.00 0.00 ? 176 GLU A HB2  3  
ATOM   9093  H  HB3  . GLU A 1 176 ? 13.095  15.530  -4.357  1.00 0.00 ? 176 GLU A HB3  3  
ATOM   9094  H  HG2  . GLU A 1 176 ? 11.292  16.869  -5.410  1.00 0.00 ? 176 GLU A HG2  3  
ATOM   9095  H  HG3  . GLU A 1 176 ? 12.136  18.342  -4.928  1.00 0.00 ? 176 GLU A HG3  3  
ATOM   9096  N  N    . HIS A 1 177 ? 11.110  14.362  -3.114  1.00 0.00 ? 177 HIS A N    3  
ATOM   9097  C  CA   . HIS A 1 177 ? 10.058  13.378  -3.328  1.00 0.00 ? 177 HIS A CA   3  
ATOM   9098  C  C    . HIS A 1 177 ? 8.917   13.621  -2.349  1.00 0.00 ? 177 HIS A C    3  
ATOM   9099  O  O    . HIS A 1 177 ? 7.753   13.691  -2.741  1.00 0.00 ? 177 HIS A O    3  
ATOM   9100  C  CB   . HIS A 1 177 ? 10.614  11.964  -3.147  1.00 0.00 ? 177 HIS A CB   3  
ATOM   9101  C  CG   . HIS A 1 177 ? 11.557  11.656  -4.276  1.00 0.00 ? 177 HIS A CG   3  
ATOM   9102  N  ND1  . HIS A 1 177 ? 12.923  11.533  -4.085  1.00 0.00 ? 177 HIS A ND1  3  
ATOM   9103  C  CD2  . HIS A 1 177 ? 11.346  11.457  -5.618  1.00 0.00 ? 177 HIS A CD2  3  
ATOM   9104  C  CE1  . HIS A 1 177 ? 13.479  11.271  -5.281  1.00 0.00 ? 177 HIS A CE1  3  
ATOM   9105  N  NE2  . HIS A 1 177 ? 12.562  11.214  -6.251  1.00 0.00 ? 177 HIS A NE2  3  
ATOM   9106  H  H    . HIS A 1 177 ? 12.037  14.065  -2.985  1.00 0.00 ? 177 HIS A H    3  
ATOM   9107  H  HA   . HIS A 1 177 ? 9.682   13.480  -4.335  1.00 0.00 ? 177 HIS A HA   3  
ATOM   9108  H  HB2  . HIS A 1 177 ? 11.142  11.902  -2.207  1.00 0.00 ? 177 HIS A HB2  3  
ATOM   9109  H  HB3  . HIS A 1 177 ? 9.800   11.254  -3.152  1.00 0.00 ? 177 HIS A HB3  3  
ATOM   9110  H  HD1  . HIS A 1 177 ? 13.399  11.620  -3.232  1.00 0.00 ? 177 HIS A HD1  3  
ATOM   9111  H  HD2  . HIS A 1 177 ? 10.384  11.484  -6.109  1.00 0.00 ? 177 HIS A HD2  3  
ATOM   9112  H  HE1  . HIS A 1 177 ? 14.537  11.126  -5.439  1.00 0.00 ? 177 HIS A HE1  3  
ATOM   9113  H  HE2  . HIS A 1 177 ? 12.713  11.042  -7.204  1.00 0.00 ? 177 HIS A HE2  3  
ATOM   9114  N  N    . SER A 1 178 ? 9.261   13.769  -1.074  1.00 0.00 ? 178 SER A N    3  
ATOM   9115  C  CA   . SER A 1 178 ? 8.257   14.027  -0.050  1.00 0.00 ? 178 SER A CA   3  
ATOM   9116  C  C    . SER A 1 178 ? 7.379   15.197  -0.477  1.00 0.00 ? 178 SER A C    3  
ATOM   9117  O  O    . SER A 1 178 ? 6.185   15.038  -0.719  1.00 0.00 ? 178 SER A O    3  
ATOM   9118  C  CB   . SER A 1 178 ? 8.937   14.359  1.276   1.00 0.00 ? 178 SER A CB   3  
ATOM   9119  O  OG   . SER A 1 178 ? 7.961   14.376  2.307   1.00 0.00 ? 178 SER A OG   3  
ATOM   9120  H  H    . SER A 1 178 ? 10.205  13.718  -0.820  1.00 0.00 ? 178 SER A H    3  
ATOM   9121  H  HA   . SER A 1 178 ? 7.644   13.147  0.077   1.00 0.00 ? 178 SER A HA   3  
ATOM   9122  H  HB2  . SER A 1 178 ? 9.679   13.614  1.499   1.00 0.00 ? 178 SER A HB2  3  
ATOM   9123  H  HB3  . SER A 1 178 ? 9.414   15.327  1.200   1.00 0.00 ? 178 SER A HB3  3  
ATOM   9124  H  HG   . SER A 1 178 ? 7.157   14.756  1.945   1.00 0.00 ? 178 SER A HG   3  
ATOM   9125  N  N    . GLN A 1 179 ? 7.993   16.370  -0.581  1.00 0.00 ? 179 GLN A N    3  
ATOM   9126  C  CA   . GLN A 1 179 ? 7.281   17.572  -0.997  1.00 0.00 ? 179 GLN A CA   3  
ATOM   9127  C  C    . GLN A 1 179 ? 6.219   17.230  -2.028  1.00 0.00 ? 179 GLN A C    3  
ATOM   9128  O  O    . GLN A 1 179 ? 5.095   17.729  -1.983  1.00 0.00 ? 179 GLN A O    3  
ATOM   9129  C  CB   . GLN A 1 179 ? 8.268   18.548  -1.634  1.00 0.00 ? 179 GLN A CB   3  
ATOM   9130  C  CG   . GLN A 1 179 ? 7.614   19.924  -1.774  1.00 0.00 ? 179 GLN A CG   3  
ATOM   9131  C  CD   . GLN A 1 179 ? 8.560   20.879  -2.493  1.00 0.00 ? 179 GLN A CD   3  
ATOM   9132  O  OE1  . GLN A 1 179 ? 8.470   22.094  -2.313  1.00 0.00 ? 179 GLN A OE1  3  
ATOM   9133  N  NE2  . GLN A 1 179 ? 9.464   20.403  -3.303  1.00 0.00 ? 179 GLN A NE2  3  
ATOM   9134  H  H    . GLN A 1 179 ? 8.951   16.427  -0.386  1.00 0.00 ? 179 GLN A H    3  
ATOM   9135  H  HA   . GLN A 1 179 ? 6.820   18.039  -0.141  1.00 0.00 ? 179 GLN A HA   3  
ATOM   9136  H  HB2  . GLN A 1 179 ? 9.150   18.626  -1.012  1.00 0.00 ? 179 GLN A HB2  3  
ATOM   9137  H  HB3  . GLN A 1 179 ? 8.546   18.177  -2.617  1.00 0.00 ? 179 GLN A HB3  3  
ATOM   9138  H  HG2  . GLN A 1 179 ? 6.700   19.829  -2.342  1.00 0.00 ? 179 GLN A HG2  3  
ATOM   9139  H  HG3  . GLN A 1 179 ? 7.389   20.315  -0.794  1.00 0.00 ? 179 GLN A HG3  3  
ATOM   9140  H  HE21 . GLN A 1 179 ? 9.532   19.433  -3.445  1.00 0.00 ? 179 GLN A HE21 3  
ATOM   9141  H  HE22 . GLN A 1 179 ? 10.077  21.014  -3.769  1.00 0.00 ? 179 GLN A HE22 3  
ATOM   9142  N  N    . ASP A 1 180 ? 6.609   16.387  -2.969  1.00 0.00 ? 180 ASP A N    3  
ATOM   9143  C  CA   . ASP A 1 180 ? 5.726   15.977  -4.041  1.00 0.00 ? 180 ASP A CA   3  
ATOM   9144  C  C    . ASP A 1 180 ? 4.513   15.221  -3.504  1.00 0.00 ? 180 ASP A C    3  
ATOM   9145  O  O    . ASP A 1 180 ? 3.390   15.722  -3.568  1.00 0.00 ? 180 ASP A O    3  
ATOM   9146  C  CB   . ASP A 1 180 ? 6.515   15.115  -5.020  1.00 0.00 ? 180 ASP A CB   3  
ATOM   9147  C  CG   . ASP A 1 180 ? 5.868   15.163  -6.401  1.00 0.00 ? 180 ASP A CG   3  
ATOM   9148  O  OD1  . ASP A 1 180 ? 5.625   16.257  -6.882  1.00 0.00 ? 180 ASP A OD1  3  
ATOM   9149  O  OD2  . ASP A 1 180 ? 5.624   14.104  -6.956  1.00 0.00 ? 180 ASP A OD2  3  
ATOM   9150  H  H    . ASP A 1 180 ? 7.522   16.042  -2.950  1.00 0.00 ? 180 ASP A H    3  
ATOM   9151  H  HA   . ASP A 1 180 ? 5.384   16.856  -4.559  1.00 0.00 ? 180 ASP A HA   3  
ATOM   9152  H  HB2  . ASP A 1 180 ? 7.527   15.501  -5.081  1.00 0.00 ? 180 ASP A HB2  3  
ATOM   9153  H  HB3  . ASP A 1 180 ? 6.538   14.096  -4.666  1.00 0.00 ? 180 ASP A HB3  3  
ATOM   9154  N  N    . LEU A 1 181 ? 4.732   14.024  -2.967  1.00 0.00 ? 181 LEU A N    3  
ATOM   9155  C  CA   . LEU A 1 181 ? 3.630   13.248  -2.433  1.00 0.00 ? 181 LEU A CA   3  
ATOM   9156  C  C    . LEU A 1 181 ? 2.937   14.027  -1.331  1.00 0.00 ? 181 LEU A C    3  
ATOM   9157  O  O    . LEU A 1 181 ? 1.726   14.214  -1.349  1.00 0.00 ? 181 LEU A O    3  
ATOM   9158  C  CB   . LEU A 1 181 ? 4.160   11.943  -1.855  1.00 0.00 ? 181 LEU A CB   3  
ATOM   9159  C  CG   . LEU A 1 181 ? 3.052   10.875  -1.722  1.00 0.00 ? 181 LEU A CG   3  
ATOM   9160  C  CD1  . LEU A 1 181 ? 3.404   9.933   -0.571  1.00 0.00 ? 181 LEU A CD1  3  
ATOM   9161  C  CD2  . LEU A 1 181 ? 1.670   11.483  -1.414  1.00 0.00 ? 181 LEU A CD2  3  
ATOM   9162  H  H    . LEU A 1 181 ? 5.638   13.656  -2.924  1.00 0.00 ? 181 LEU A H    3  
ATOM   9163  H  HA   . LEU A 1 181 ? 2.941   13.038  -3.232  1.00 0.00 ? 181 LEU A HA   3  
ATOM   9164  H  HB2  . LEU A 1 181 ? 4.933   11.569  -2.505  1.00 0.00 ? 181 LEU A HB2  3  
ATOM   9165  H  HB3  . LEU A 1 181 ? 4.586   12.140  -0.887  1.00 0.00 ? 181 LEU A HB3  3  
ATOM   9166  H  HG   . LEU A 1 181 ? 3.007   10.316  -2.642  1.00 0.00 ? 181 LEU A HG   3  
ATOM   9167  H  HD11 . LEU A 1 181 ? 2.580   9.258   -0.393  1.00 0.00 ? 181 LEU A HD11 3  
ATOM   9168  H  HD12 . LEU A 1 181 ? 3.584   10.513  0.315   1.00 0.00 ? 181 LEU A HD12 3  
ATOM   9169  H  HD13 . LEU A 1 181 ? 4.287   9.370   -0.816  1.00 0.00 ? 181 LEU A HD13 3  
ATOM   9170  H  HD21 . LEU A 1 181 ? 0.953   10.682  -1.306  1.00 0.00 ? 181 LEU A HD21 3  
ATOM   9171  H  HD22 . LEU A 1 181 ? 1.353   12.129  -2.213  1.00 0.00 ? 181 LEU A HD22 3  
ATOM   9172  H  HD23 . LEU A 1 181 ? 1.713   12.038  -0.492  1.00 0.00 ? 181 LEU A HD23 3  
ATOM   9173  N  N    . SER A 1 182 ? 3.720   14.460  -0.354  1.00 0.00 ? 182 SER A N    3  
ATOM   9174  C  CA   . SER A 1 182 ? 3.173   15.200  0.765   1.00 0.00 ? 182 SER A CA   3  
ATOM   9175  C  C    . SER A 1 182 ? 2.492   16.472  0.282   1.00 0.00 ? 182 SER A C    3  
ATOM   9176  O  O    . SER A 1 182 ? 1.274   16.590  0.326   1.00 0.00 ? 182 SER A O    3  
ATOM   9177  C  CB   . SER A 1 182 ? 4.285   15.562  1.747   1.00 0.00 ? 182 SER A CB   3  
ATOM   9178  O  OG   . SER A 1 182 ? 3.733   16.304  2.826   1.00 0.00 ? 182 SER A OG   3  
ATOM   9179  H  H    . SER A 1 182 ? 4.676   14.266  -0.380  1.00 0.00 ? 182 SER A H    3  
ATOM   9180  H  HA   . SER A 1 182 ? 2.453   14.580  1.270   1.00 0.00 ? 182 SER A HA   3  
ATOM   9181  H  HB2  . SER A 1 182 ? 4.739   14.663  2.128   1.00 0.00 ? 182 SER A HB2  3  
ATOM   9182  H  HB3  . SER A 1 182 ? 5.036   16.152  1.236   1.00 0.00 ? 182 SER A HB3  3  
ATOM   9183  H  HG   . SER A 1 182 ? 4.458   16.710  3.307   1.00 0.00 ? 182 SER A HG   3  
ATOM   9184  N  N    . GLY A 1 183 ? 3.277   17.422  -0.199  1.00 0.00 ? 183 GLY A N    3  
ATOM   9185  C  CA   . GLY A 1 183 ? 2.710   18.676  -0.679  1.00 0.00 ? 183 GLY A CA   3  
ATOM   9186  C  C    . GLY A 1 183 ? 1.398   18.417  -1.390  1.00 0.00 ? 183 GLY A C    3  
ATOM   9187  O  O    . GLY A 1 183 ? 0.497   19.253  -1.376  1.00 0.00 ? 183 GLY A O    3  
ATOM   9188  H  H    . GLY A 1 183 ? 4.241   17.280  -0.234  1.00 0.00 ? 183 GLY A H    3  
ATOM   9189  H  HA2  . GLY A 1 183 ? 2.538   19.332  0.163   1.00 0.00 ? 183 GLY A HA2  3  
ATOM   9190  H  HA3  . GLY A 1 183 ? 3.392   19.144  -1.358  1.00 0.00 ? 183 GLY A HA3  3  
ATOM   9191  N  N    . ARG A 1 184 ? 1.288   17.241  -1.995  1.00 0.00 ? 184 ARG A N    3  
ATOM   9192  C  CA   . ARG A 1 184 ? 0.071   16.880  -2.688  1.00 0.00 ? 184 ARG A CA   3  
ATOM   9193  C  C    . ARG A 1 184 ? -0.979  16.372  -1.713  1.00 0.00 ? 184 ARG A C    3  
ATOM   9194  O  O    . ARG A 1 184 ? -2.018  17.003  -1.540  1.00 0.00 ? 184 ARG A O    3  
ATOM   9195  C  CB   . ARG A 1 184 ? 0.343   15.809  -3.728  1.00 0.00 ? 184 ARG A CB   3  
ATOM   9196  C  CG   . ARG A 1 184 ? 1.028   16.443  -4.941  1.00 0.00 ? 184 ARG A CG   3  
ATOM   9197  C  CD   . ARG A 1 184 ? -0.029  16.922  -5.933  1.00 0.00 ? 184 ARG A CD   3  
ATOM   9198  N  NE   . ARG A 1 184 ? 0.576   17.789  -6.939  1.00 0.00 ? 184 ARG A NE   3  
ATOM   9199  C  CZ   . ARG A 1 184 ? -0.157  18.666  -7.618  1.00 0.00 ? 184 ARG A CZ   3  
ATOM   9200  N  NH1  . ARG A 1 184 ? -1.439  18.753  -7.397  1.00 0.00 ? 184 ARG A NH1  3  
ATOM   9201  N  NH2  . ARG A 1 184 ? 0.406   19.436  -8.508  1.00 0.00 ? 184 ARG A NH2  3  
ATOM   9202  H  H    . ARG A 1 184 ? 2.034   16.608  -1.970  1.00 0.00 ? 184 ARG A H    3  
ATOM   9203  H  HA   . ARG A 1 184 ? -0.305  17.749  -3.187  1.00 0.00 ? 184 ARG A HA   3  
ATOM   9204  H  HB2  . ARG A 1 184 ? 0.983   15.049  -3.308  1.00 0.00 ? 184 ARG A HB2  3  
ATOM   9205  H  HB3  . ARG A 1 184 ? -0.598  15.368  -4.027  1.00 0.00 ? 184 ARG A HB3  3  
ATOM   9206  H  HG2  . ARG A 1 184 ? 1.631   17.284  -4.621  1.00 0.00 ? 184 ARG A HG2  3  
ATOM   9207  H  HG3  . ARG A 1 184 ? 1.658   15.711  -5.414  1.00 0.00 ? 184 ARG A HG3  3  
ATOM   9208  H  HD2  . ARG A 1 184 ? -0.470  16.068  -6.417  1.00 0.00 ? 184 ARG A HD2  3  
ATOM   9209  H  HD3  . ARG A 1 184 ? -0.796  17.467  -5.402  1.00 0.00 ? 184 ARG A HD3  3  
ATOM   9210  H  HE   . ARG A 1 184 ? 1.538   17.727  -7.114  1.00 0.00 ? 184 ARG A HE   3  
ATOM   9211  H  HH11 . ARG A 1 184 ? -1.872  18.162  -6.716  1.00 0.00 ? 184 ARG A HH11 3  
ATOM   9212  H  HH12 . ARG A 1 184 ? -1.992  19.413  -7.907  1.00 0.00 ? 184 ARG A HH12 3  
ATOM   9213  H  HH21 . ARG A 1 184 ? 1.390   19.367  -8.679  1.00 0.00 ? 184 ARG A HH21 3  
ATOM   9214  H  HH22 . ARG A 1 184 ? -0.144  20.096  -9.019  1.00 0.00 ? 184 ARG A HH22 3  
ATOM   9215  N  N    . LEU A 1 185 ? -0.699  15.231  -1.072  1.00 0.00 ? 185 LEU A N    3  
ATOM   9216  C  CA   . LEU A 1 185 ? -1.640  14.656  -0.111  1.00 0.00 ? 185 LEU A CA   3  
ATOM   9217  C  C    . LEU A 1 185 ? -2.275  15.779  0.675   1.00 0.00 ? 185 LEU A C    3  
ATOM   9218  O  O    . LEU A 1 185 ? -3.484  15.823  0.883   1.00 0.00 ? 185 LEU A O    3  
ATOM   9219  C  CB   . LEU A 1 185 ? -0.937  13.693  0.832   1.00 0.00 ? 185 LEU A CB   3  
ATOM   9220  C  CG   . LEU A 1 185 ? -1.994  12.909  1.638   1.00 0.00 ? 185 LEU A CG   3  
ATOM   9221  C  CD1  . LEU A 1 185 ? -2.081  11.466  1.128   1.00 0.00 ? 185 LEU A CD1  3  
ATOM   9222  C  CD2  . LEU A 1 185 ? -1.620  12.914  3.126   1.00 0.00 ? 185 LEU A CD2  3  
ATOM   9223  H  H    . LEU A 1 185 ? 0.150   14.784  -1.240  1.00 0.00 ? 185 LEU A H    3  
ATOM   9224  H  HA   . LEU A 1 185 ? -2.405  14.115  -0.646  1.00 0.00 ? 185 LEU A HA   3  
ATOM   9225  H  HB2  . LEU A 1 185 ? -0.334  13.019  0.249   1.00 0.00 ? 185 LEU A HB2  3  
ATOM   9226  H  HB3  . LEU A 1 185 ? -0.304  14.242  1.502   1.00 0.00 ? 185 LEU A HB3  3  
ATOM   9227  H  HG   . LEU A 1 185 ? -2.963  13.377  1.519   1.00 0.00 ? 185 LEU A HG   3  
ATOM   9228  H  HD11 . LEU A 1 185 ? -1.383  10.847  1.669   1.00 0.00 ? 185 LEU A HD11 3  
ATOM   9229  H  HD12 . LEU A 1 185 ? -1.845  11.436  0.073   1.00 0.00 ? 185 LEU A HD12 3  
ATOM   9230  H  HD13 . LEU A 1 185 ? -3.081  11.098  1.276   1.00 0.00 ? 185 LEU A HD13 3  
ATOM   9231  H  HD21 . LEU A 1 185 ? -1.742  13.914  3.522   1.00 0.00 ? 185 LEU A HD21 3  
ATOM   9232  H  HD22 . LEU A 1 185 ? -0.593  12.607  3.241   1.00 0.00 ? 185 LEU A HD22 3  
ATOM   9233  H  HD23 . LEU A 1 185 ? -2.265  12.235  3.662   1.00 0.00 ? 185 LEU A HD23 3  
ATOM   9234  N  N    . ARG A 1 186 ? -1.442  16.721  1.051   1.00 0.00 ? 186 ARG A N    3  
ATOM   9235  C  CA   . ARG A 1 186 ? -1.894  17.897  1.737   1.00 0.00 ? 186 ARG A CA   3  
ATOM   9236  C  C    . ARG A 1 186 ? -2.882  18.587  0.857   1.00 0.00 ? 186 ARG A C    3  
ATOM   9237  O  O    . ARG A 1 186 ? -4.068  18.657  1.130   1.00 0.00 ? 186 ARG A O    3  
ATOM   9238  C  CB   . ARG A 1 186 ? -0.687  18.790  1.898   1.00 0.00 ? 186 ARG A CB   3  
ATOM   9239  C  CG   . ARG A 1 186 ? 0.348   18.167  2.849   1.00 0.00 ? 186 ARG A CG   3  
ATOM   9240  C  CD   . ARG A 1 186 ? 0.192   16.644  3.064   1.00 0.00 ? 186 ARG A CD   3  
ATOM   9241  N  NE   . ARG A 1 186 ? 1.034   16.217  4.174   1.00 0.00 ? 186 ARG A NE   3  
ATOM   9242  C  CZ   . ARG A 1 186 ? 0.625   16.336  5.432   1.00 0.00 ? 186 ARG A CZ   3  
ATOM   9243  N  NH1  . ARG A 1 186 ? -0.548  16.849  5.691   1.00 0.00 ? 186 ARG A NH1  3  
ATOM   9244  N  NH2  . ARG A 1 186 ? 1.395   15.941  6.408   1.00 0.00 ? 186 ARG A NH2  3  
ATOM   9245  H  H    . ARG A 1 186 ? -0.484  16.650  0.818   1.00 0.00 ? 186 ARG A H    3  
ATOM   9246  H  HA   . ARG A 1 186 ? -2.334  17.682  2.693   1.00 0.00 ? 186 ARG A HA   3  
ATOM   9247  H  HB2  . ARG A 1 186 ? -0.232  18.939  0.924   1.00 0.00 ? 186 ARG A HB2  3  
ATOM   9248  H  HB3  . ARG A 1 186 ? -0.995  19.747  2.283   1.00 0.00 ? 186 ARG A HB3  3  
ATOM   9249  H  HG2  . ARG A 1 186 ? 1.328   18.338  2.438   1.00 0.00 ? 186 ARG A HG2  3  
ATOM   9250  H  HG3  . ARG A 1 186 ? 0.263   18.659  3.789   1.00 0.00 ? 186 ARG A HG3  3  
ATOM   9251  H  HD2  . ARG A 1 186 ? -0.825  16.377  3.281   1.00 0.00 ? 186 ARG A HD2  3  
ATOM   9252  H  HD3  . ARG A 1 186 ? 0.503   16.136  2.184   1.00 0.00 ? 186 ARG A HD3  3  
ATOM   9253  H  HE   . ARG A 1 186 ? 1.917   15.834  3.989   1.00 0.00 ? 186 ARG A HE   3  
ATOM   9254  H  HH11 . ARG A 1 186 ? -1.137  17.152  4.943   1.00 0.00 ? 186 ARG A HH11 3  
ATOM   9255  H  HH12 . ARG A 1 186 ? -0.856  16.939  6.639   1.00 0.00 ? 186 ARG A HH12 3  
ATOM   9256  H  HH21 . ARG A 1 186 ? 2.294   15.549  6.208   1.00 0.00 ? 186 ARG A HH21 3  
ATOM   9257  H  HH22 . ARG A 1 186 ? 1.088   16.030  7.356   1.00 0.00 ? 186 ARG A HH22 3  
ATOM   9258  N  N    . ALA A 1 187 ? -2.339  19.071  -0.217  1.00 0.00 ? 187 ALA A N    3  
ATOM   9259  C  CA   . ALA A 1 187 ? -3.109  19.784  -1.224  1.00 0.00 ? 187 ALA A CA   3  
ATOM   9260  C  C    . ALA A 1 187 ? -4.460  19.135  -1.487  1.00 0.00 ? 187 ALA A C    3  
ATOM   9261  O  O    . ALA A 1 187 ? -5.503  19.745  -1.250  1.00 0.00 ? 187 ALA A O    3  
ATOM   9262  C  CB   . ALA A 1 187 ? -2.340  19.807  -2.532  1.00 0.00 ? 187 ALA A CB   3  
ATOM   9263  H  H    . ALA A 1 187 ? -1.370  18.932  -0.338  1.00 0.00 ? 187 ALA A H    3  
ATOM   9264  H  HA   . ALA A 1 187 ? -3.266  20.804  -0.893  1.00 0.00 ? 187 ALA A HA   3  
ATOM   9265  H  HB1  . ALA A 1 187 ? -2.842  20.459  -3.229  1.00 0.00 ? 187 ALA A HB1  3  
ATOM   9266  H  HB2  . ALA A 1 187 ? -2.303  18.806  -2.937  1.00 0.00 ? 187 ALA A HB2  3  
ATOM   9267  H  HB3  . ALA A 1 187 ? -1.342  20.164  -2.355  1.00 0.00 ? 187 ALA A HB3  3  
ATOM   9268  N  N    . ILE A 1 188 ? -4.444  17.916  -2.022  1.00 0.00 ? 188 ILE A N    3  
ATOM   9269  C  CA   . ILE A 1 188 ? -5.688  17.250  -2.351  1.00 0.00 ? 188 ILE A CA   3  
ATOM   9270  C  C    . ILE A 1 188 ? -6.674  17.331  -1.181  1.00 0.00 ? 188 ILE A C    3  
ATOM   9271  O  O    . ILE A 1 188 ? -7.839  17.672  -1.375  1.00 0.00 ? 188 ILE A O    3  
ATOM   9272  C  CB   . ILE A 1 188 ? -5.462  15.775  -2.767  1.00 0.00 ? 188 ILE A CB   3  
ATOM   9273  C  CG1  . ILE A 1 188 ? -4.448  15.093  -1.828  1.00 0.00 ? 188 ILE A CG1  3  
ATOM   9274  C  CG2  . ILE A 1 188 ? -4.935  15.695  -4.210  1.00 0.00 ? 188 ILE A CG2  3  
ATOM   9275  C  CD1  . ILE A 1 188 ? -5.189  14.214  -0.821  1.00 0.00 ? 188 ILE A CD1  3  
ATOM   9276  H  H    . ILE A 1 188 ? -3.592  17.477  -2.221  1.00 0.00 ? 188 ILE A H    3  
ATOM   9277  H  HA   . ILE A 1 188 ? -6.112  17.781  -3.185  1.00 0.00 ? 188 ILE A HA   3  
ATOM   9278  H  HB   . ILE A 1 188 ? -6.408  15.252  -2.718  1.00 0.00 ? 188 ILE A HB   3  
ATOM   9279  H  HG12 . ILE A 1 188 ? -3.765  14.481  -2.404  1.00 0.00 ? 188 ILE A HG12 3  
ATOM   9280  H  HG13 . ILE A 1 188 ? -3.889  15.836  -1.298  1.00 0.00 ? 188 ILE A HG13 3  
ATOM   9281  H  HG21 . ILE A 1 188 ? -5.418  16.438  -4.823  1.00 0.00 ? 188 ILE A HG21 3  
ATOM   9282  H  HG22 . ILE A 1 188 ? -5.143  14.713  -4.611  1.00 0.00 ? 188 ILE A HG22 3  
ATOM   9283  H  HG23 . ILE A 1 188 ? -3.868  15.861  -4.212  1.00 0.00 ? 188 ILE A HG23 3  
ATOM   9284  H  HD11 . ILE A 1 188 ? -6.075  14.728  -0.488  1.00 0.00 ? 188 ILE A HD11 3  
ATOM   9285  H  HD12 . ILE A 1 188 ? -4.550  14.014  0.024   1.00 0.00 ? 188 ILE A HD12 3  
ATOM   9286  H  HD13 . ILE A 1 188 ? -5.463  13.286  -1.292  1.00 0.00 ? 188 ILE A HD13 3  
ATOM   9287  N  N    . LEU A 1 189 ? -6.205  17.030  0.032   1.00 0.00 ? 189 LEU A N    3  
ATOM   9288  C  CA   . LEU A 1 189 ? -7.072  17.089  1.211   1.00 0.00 ? 189 LEU A CA   3  
ATOM   9289  C  C    . LEU A 1 189 ? -7.433  18.544  1.528   1.00 0.00 ? 189 LEU A C    3  
ATOM   9290  O  O    . LEU A 1 189 ? -8.606  18.913  1.590   1.00 0.00 ? 189 LEU A O    3  
ATOM   9291  C  CB   . LEU A 1 189 ? -6.335  16.463  2.413   1.00 0.00 ? 189 LEU A CB   3  
ATOM   9292  C  CG   . LEU A 1 189 ? -7.164  15.327  3.028   1.00 0.00 ? 189 LEU A CG   3  
ATOM   9293  C  CD1  . LEU A 1 189 ? -7.121  14.097  2.122   1.00 0.00 ? 189 LEU A CD1  3  
ATOM   9294  C  CD2  . LEU A 1 189 ? -6.581  14.962  4.392   1.00 0.00 ? 189 LEU A CD2  3  
ATOM   9295  H  H    . LEU A 1 189 ? -5.267  16.770  0.138   1.00 0.00 ? 189 LEU A H    3  
ATOM   9296  H  HA   . LEU A 1 189 ? -7.972  16.534  1.015   1.00 0.00 ? 189 LEU A HA   3  
ATOM   9297  H  HB2  . LEU A 1 189 ? -5.392  16.072  2.077   1.00 0.00 ? 189 LEU A HB2  3  
ATOM   9298  H  HB3  . LEU A 1 189 ? -6.154  17.218  3.169   1.00 0.00 ? 189 LEU A HB3  3  
ATOM   9299  H  HG   . LEU A 1 189 ? -8.190  15.651  3.147   1.00 0.00 ? 189 LEU A HG   3  
ATOM   9300  H  HD11 . LEU A 1 189 ? -7.873  14.192  1.358   1.00 0.00 ? 189 LEU A HD11 3  
ATOM   9301  H  HD12 . LEU A 1 189 ? -7.317  13.215  2.712   1.00 0.00 ? 189 LEU A HD12 3  
ATOM   9302  H  HD13 . LEU A 1 189 ? -6.148  14.011  1.665   1.00 0.00 ? 189 LEU A HD13 3  
ATOM   9303  H  HD21 . LEU A 1 189 ? -6.860  13.949  4.643   1.00 0.00 ? 189 LEU A HD21 3  
ATOM   9304  H  HD22 . LEU A 1 189 ? -6.964  15.638  5.140   1.00 0.00 ? 189 LEU A HD22 3  
ATOM   9305  H  HD23 . LEU A 1 189 ? -5.504  15.039  4.353   1.00 0.00 ? 189 LEU A HD23 3  
ATOM   9306  N  N    . GLN A 1 190 ? -6.400  19.350  1.734   1.00 0.00 ? 190 GLN A N    3  
ATOM   9307  C  CA   . GLN A 1 190 ? -6.546  20.760  2.055   1.00 0.00 ? 190 GLN A CA   3  
ATOM   9308  C  C    . GLN A 1 190 ? -7.242  21.532  0.947   1.00 0.00 ? 190 GLN A C    3  
ATOM   9309  O  O    . GLN A 1 190 ? -7.197  22.762  0.918   1.00 0.00 ? 190 GLN A O    3  
ATOM   9310  C  CB   . GLN A 1 190 ? -5.157  21.350  2.338   1.00 0.00 ? 190 GLN A CB   3  
ATOM   9311  C  CG   . GLN A 1 190 ? -4.922  21.432  3.844   1.00 0.00 ? 190 GLN A CG   3  
ATOM   9312  C  CD   . GLN A 1 190 ? -3.605  22.147  4.131   1.00 0.00 ? 190 GLN A CD   3  
ATOM   9313  O  OE1  . GLN A 1 190 ? -2.541  21.530  4.090   1.00 0.00 ? 190 GLN A OE1  3  
ATOM   9314  N  NE2  . GLN A 1 190 ? -3.612  23.420  4.419   1.00 0.00 ? 190 GLN A NE2  3  
ATOM   9315  H  H    . GLN A 1 190 ? -5.507  18.983  1.683   1.00 0.00 ? 190 GLN A H    3  
ATOM   9316  H  HA   . GLN A 1 190 ? -7.147  20.837  2.927   1.00 0.00 ? 190 GLN A HA   3  
ATOM   9317  H  HB2  . GLN A 1 190 ? -4.409  20.706  1.907   1.00 0.00 ? 190 GLN A HB2  3  
ATOM   9318  H  HB3  . GLN A 1 190 ? -5.077  22.335  1.903   1.00 0.00 ? 190 GLN A HB3  3  
ATOM   9319  H  HG2  . GLN A 1 190 ? -5.735  21.973  4.302   1.00 0.00 ? 190 GLN A HG2  3  
ATOM   9320  H  HG3  . GLN A 1 190 ? -4.882  20.431  4.249   1.00 0.00 ? 190 GLN A HG3  3  
ATOM   9321  H  HE21 . GLN A 1 190 ? -4.462  23.911  4.452   1.00 0.00 ? 190 GLN A HE21 3  
ATOM   9322  H  HE22 . GLN A 1 190 ? -2.766  23.886  4.604   1.00 0.00 ? 190 GLN A HE22 3  
ATOM   9323  N  N    . ASN A 1 191 ? -7.898  20.804  0.063   1.00 0.00 ? 191 ASN A N    3  
ATOM   9324  C  CA   . ASN A 1 191 ? -8.630  21.404  -1.039  1.00 0.00 ? 191 ASN A CA   3  
ATOM   9325  C  C    . ASN A 1 191 ? -8.019  22.744  -1.448  1.00 0.00 ? 191 ASN A C    3  
ATOM   9326  O  O    . ASN A 1 191 ? -8.728  23.729  -1.660  1.00 0.00 ? 191 ASN A O    3  
ATOM   9327  C  CB   . ASN A 1 191 ? -10.091 21.577  -0.622  1.00 0.00 ? 191 ASN A CB   3  
ATOM   9328  C  CG   . ASN A 1 191 ? -10.299 22.873  0.148   1.00 0.00 ? 191 ASN A CG   3  
ATOM   9329  O  OD1  . ASN A 1 191 ? -9.340  23.513  0.576   1.00 0.00 ? 191 ASN A OD1  3  
ATOM   9330  N  ND2  . ASN A 1 191 ? -11.511 23.294  0.353   1.00 0.00 ? 191 ASN A ND2  3  
ATOM   9331  H  H    . ASN A 1 191 ? -7.906  19.840  0.166   1.00 0.00 ? 191 ASN A H    3  
ATOM   9332  H  HA   . ASN A 1 191 ? -8.590  20.735  -1.884  1.00 0.00 ? 191 ASN A HA   3  
ATOM   9333  H  HB2  . ASN A 1 191 ? -10.705 21.585  -1.496  1.00 0.00 ? 191 ASN A HB2  3  
ATOM   9334  H  HB3  . ASN A 1 191 ? -10.383 20.751  0.008   1.00 0.00 ? 191 ASN A HB3  3  
ATOM   9335  H  HD21 . ASN A 1 191 ? -12.275 22.778  0.012   1.00 0.00 ? 191 ASN A HD21 3  
ATOM   9336  H  HD22 . ASN A 1 191 ? -11.659 24.119  0.850   1.00 0.00 ? 191 ASN A HD22 3  
ATOM   9337  N  N    . GLN A 1 192 ? -6.697  22.767  -1.547  1.00 0.00 ? 192 GLN A N    3  
ATOM   9338  C  CA   . GLN A 1 192 ? -5.979  23.971  -1.915  1.00 0.00 ? 192 GLN A CA   3  
ATOM   9339  C  C    . GLN A 1 192 ? -6.502  24.545  -3.231  1.00 0.00 ? 192 GLN A C    3  
ATOM   9340  O  O    . GLN A 1 192 ? -6.175  24.050  -4.309  1.00 0.00 ? 192 GLN A O    3  
ATOM   9341  C  CB   . GLN A 1 192 ? -4.498  23.626  -2.044  1.00 0.00 ? 192 GLN A CB   3  
ATOM   9342  C  CG   . GLN A 1 192 ? -3.646  24.839  -1.685  1.00 0.00 ? 192 GLN A CG   3  
ATOM   9343  C  CD   . GLN A 1 192 ? -3.999  26.015  -2.588  1.00 0.00 ? 192 GLN A CD   3  
ATOM   9344  O  OE1  . GLN A 1 192 ? -4.627  26.975  -2.142  1.00 0.00 ? 192 GLN A OE1  3  
ATOM   9345  N  NE2  . GLN A 1 192 ? -3.632  26.000  -3.840  1.00 0.00 ? 192 GLN A NE2  3  
ATOM   9346  H  H    . GLN A 1 192 ? -6.185  21.955  -1.364  1.00 0.00 ? 192 GLN A H    3  
ATOM   9347  H  HA   . GLN A 1 192 ? -6.102  24.707  -1.135  1.00 0.00 ? 192 GLN A HA   3  
ATOM   9348  H  HB2  . GLN A 1 192 ? -4.263  22.813  -1.370  1.00 0.00 ? 192 GLN A HB2  3  
ATOM   9349  H  HB3  . GLN A 1 192 ? -4.288  23.320  -3.055  1.00 0.00 ? 192 GLN A HB3  3  
ATOM   9350  H  HG2  . GLN A 1 192 ? -3.829  25.107  -0.656  1.00 0.00 ? 192 GLN A HG2  3  
ATOM   9351  H  HG3  . GLN A 1 192 ? -2.604  24.589  -1.811  1.00 0.00 ? 192 GLN A HG3  3  
ATOM   9352  H  HE21 . GLN A 1 192 ? -3.131  25.235  -4.194  1.00 0.00 ? 192 GLN A HE21 3  
ATOM   9353  H  HE22 . GLN A 1 192 ? -3.856  26.751  -4.427  1.00 0.00 ? 192 GLN A HE22 3  
ATOM   9354  N  N    . GLU A 1 193 ? -7.313  25.594  -3.131  1.00 0.00 ? 193 GLU A N    3  
ATOM   9355  C  CA   . GLU A 1 193 ? -7.874  26.233  -4.314  1.00 0.00 ? 193 GLU A CA   3  
ATOM   9356  C  C    . GLU A 1 193 ? -6.786  26.505  -5.346  1.00 0.00 ? 193 GLU A C    3  
ATOM   9357  O  O    . GLU A 1 193 ? -5.627  26.139  -5.153  1.00 0.00 ? 193 GLU A O    3  
ATOM   9358  C  CB   . GLU A 1 193 ? -8.546  27.550  -3.923  1.00 0.00 ? 193 GLU A CB   3  
ATOM   9359  C  CG   . GLU A 1 193 ? -9.908  27.256  -3.298  1.00 0.00 ? 193 GLU A CG   3  
ATOM   9360  C  CD   . GLU A 1 193 ? -10.586 28.557  -2.887  1.00 0.00 ? 193 GLU A CD   3  
ATOM   9361  O  OE1  . GLU A 1 193 ? -11.286 29.124  -3.710  1.00 0.00 ? 193 GLU A OE1  3  
ATOM   9362  O  OE2  . GLU A 1 193 ? -10.396 28.971  -1.755  1.00 0.00 ? 193 GLU A OE2  3  
ATOM   9363  H  H    . GLU A 1 193 ? -7.539  25.946  -2.244  1.00 0.00 ? 193 GLU A H    3  
ATOM   9364  H  HA   . GLU A 1 193 ? -8.616  25.579  -4.748  1.00 0.00 ? 193 GLU A HA   3  
ATOM   9365  H  HB2  . GLU A 1 193 ? -7.924  28.072  -3.208  1.00 0.00 ? 193 GLU A HB2  3  
ATOM   9366  H  HB3  . GLU A 1 193 ? -8.680  28.161  -4.803  1.00 0.00 ? 193 GLU A HB3  3  
ATOM   9367  H  HG2  . GLU A 1 193 ? -10.523 26.740  -4.020  1.00 0.00 ? 193 GLU A HG2  3  
ATOM   9368  H  HG3  . GLU A 1 193 ? -9.775  26.631  -2.427  1.00 0.00 ? 193 GLU A HG3  3  
ATOM   9369  N  N    . ASN A 1 194 ? -7.170  27.148  -6.443  1.00 0.00 ? 194 ASN A N    3  
ATOM   9370  C  CA   . ASN A 1 194 ? -6.222  27.464  -7.501  1.00 0.00 ? 194 ASN A CA   3  
ATOM   9371  C  C    . ASN A 1 194 ? -5.152  28.428  -6.999  1.00 0.00 ? 194 ASN A C    3  
ATOM   9372  O  O    . ASN A 1 194 ? -5.516  29.418  -6.387  1.00 0.00 ? 194 ASN A O    3  
ATOM   9373  C  CB   . ASN A 1 194 ? -6.949  28.081  -8.690  1.00 0.00 ? 194 ASN A CB   3  
ATOM   9374  C  CG   . ASN A 1 194 ? -5.947  28.467  -9.773  1.00 0.00 ? 194 ASN A CG   3  
ATOM   9375  O  OD1  . ASN A 1 194 ? -5.165  29.400  -9.591  1.00 0.00 ? 194 ASN A OD1  3  
ATOM   9376  N  ND2  . ASN A 1 194 ? -5.925  27.802  -10.895 1.00 0.00 ? 194 ASN A ND2  3  
ATOM   9377  O  OXT  . ASN A 1 194 ? -3.985  28.162  -7.235  1.00 0.00 ? 194 ASN A OXT  3  
ATOM   9378  H  H    . ASN A 1 194 ? -8.106  27.412  -6.543  1.00 0.00 ? 194 ASN A H    3  
ATOM   9379  H  HA   . ASN A 1 194 ? -5.753  26.559  -7.824  1.00 0.00 ? 194 ASN A HA   3  
ATOM   9380  H  HB2  . ASN A 1 194 ? -7.654  27.366  -9.090  1.00 0.00 ? 194 ASN A HB2  3  
ATOM   9381  H  HB3  . ASN A 1 194 ? -7.474  28.955  -8.361  1.00 0.00 ? 194 ASN A HB3  3  
ATOM   9382  H  HD21 . ASN A 1 194 ? -6.548  27.060  -11.038 1.00 0.00 ? 194 ASN A HD21 3  
ATOM   9383  H  HD22 . ASN A 1 194 ? -5.284  28.046  -11.596 1.00 0.00 ? 194 ASN A HD22 3  
HETATM 9384  ZN ZN   . ZN  B 2 .   ? -4.681  3.152   -7.905  1.00 0.00 ? 250 ZN  A ZN   3  
ATOM   9385  N  N    . HIS A 1 1   ? 20.782  -24.328 3.085   1.00 0.00 ? 1   HIS A N    4  
ATOM   9386  C  CA   . HIS A 1 1   ? 20.243  -23.782 1.809   1.00 0.00 ? 1   HIS A CA   4  
ATOM   9387  C  C    . HIS A 1 1   ? 18.808  -23.315 2.026   1.00 0.00 ? 1   HIS A C    4  
ATOM   9388  O  O    . HIS A 1 1   ? 18.368  -23.138 3.162   1.00 0.00 ? 1   HIS A O    4  
ATOM   9389  C  CB   . HIS A 1 1   ? 20.280  -24.870 0.733   1.00 0.00 ? 1   HIS A CB   4  
ATOM   9390  C  CG   . HIS A 1 1   ? 21.708  -25.160 0.360   1.00 0.00 ? 1   HIS A CG   4  
ATOM   9391  N  ND1  . HIS A 1 1   ? 22.431  -26.185 0.948   1.00 0.00 ? 1   HIS A ND1  4  
ATOM   9392  C  CD2  . HIS A 1 1   ? 22.559  -24.567 -0.540  1.00 0.00 ? 1   HIS A CD2  4  
ATOM   9393  C  CE1  . HIS A 1 1   ? 23.660  -26.180 0.399   1.00 0.00 ? 1   HIS A CE1  4  
ATOM   9394  N  NE2  . HIS A 1 1   ? 23.791  -25.214 -0.514  1.00 0.00 ? 1   HIS A NE2  4  
ATOM   9395  H  H1   . HIS A 1 1   ? 21.586  -23.748 3.399   1.00 0.00 ? 1   HIS A H1   4  
ATOM   9396  H  H2   . HIS A 1 1   ? 21.100  -25.308 2.936   1.00 0.00 ? 1   HIS A H2   4  
ATOM   9397  H  H3   . HIS A 1 1   ? 20.040  -24.311 3.812   1.00 0.00 ? 1   HIS A H3   4  
ATOM   9398  H  HA   . HIS A 1 1   ? 20.848  -22.944 1.493   1.00 0.00 ? 1   HIS A HA   4  
ATOM   9399  H  HB2  . HIS A 1 1   ? 19.818  -25.768 1.115   1.00 0.00 ? 1   HIS A HB2  4  
ATOM   9400  H  HB3  . HIS A 1 1   ? 19.742  -24.532 -0.140  1.00 0.00 ? 1   HIS A HB3  4  
ATOM   9401  H  HD1  . HIS A 1 1   ? 22.107  -26.801 1.636   1.00 0.00 ? 1   HIS A HD1  4  
ATOM   9402  H  HD2  . HIS A 1 1   ? 22.311  -23.727 -1.171  1.00 0.00 ? 1   HIS A HD2  4  
ATOM   9403  H  HE1  . HIS A 1 1   ? 24.445  -26.872 0.665   1.00 0.00 ? 1   HIS A HE1  4  
ATOM   9404  H  HE2  . HIS A 1 1   ? 24.585  -25.004 -1.050  1.00 0.00 ? 1   HIS A HE2  4  
ATOM   9405  N  N    . MET A 1 2   ? 18.083  -23.120 0.931   1.00 0.00 ? 2   MET A N    4  
ATOM   9406  C  CA   . MET A 1 2   ? 16.698  -22.674 1.014   1.00 0.00 ? 2   MET A CA   4  
ATOM   9407  C  C    . MET A 1 2   ? 16.560  -21.530 2.014   1.00 0.00 ? 2   MET A C    4  
ATOM   9408  O  O    . MET A 1 2   ? 16.036  -21.714 3.114   1.00 0.00 ? 2   MET A O    4  
ATOM   9409  C  CB   . MET A 1 2   ? 15.800  -23.838 1.441   1.00 0.00 ? 2   MET A CB   4  
ATOM   9410  C  CG   . MET A 1 2   ? 15.677  -24.837 0.289   1.00 0.00 ? 2   MET A CG   4  
ATOM   9411  S  SD   . MET A 1 2   ? 14.555  -26.173 0.770   1.00 0.00 ? 2   MET A SD   4  
ATOM   9412  C  CE   . MET A 1 2   ? 14.716  -27.159 -0.738  1.00 0.00 ? 2   MET A CE   4  
ATOM   9413  H  H    . MET A 1 2   ? 18.486  -23.277 0.052   1.00 0.00 ? 2   MET A H    4  
ATOM   9414  H  HA   . MET A 1 2   ? 16.381  -22.329 0.042   1.00 0.00 ? 2   MET A HA   4  
ATOM   9415  H  HB2  . MET A 1 2   ? 16.232  -24.328 2.301   1.00 0.00 ? 2   MET A HB2  4  
ATOM   9416  H  HB3  . MET A 1 2   ? 14.820  -23.462 1.694   1.00 0.00 ? 2   MET A HB3  4  
ATOM   9417  H  HG2  . MET A 1 2   ? 15.287  -24.336 -0.584  1.00 0.00 ? 2   MET A HG2  4  
ATOM   9418  H  HG3  . MET A 1 2   ? 16.651  -25.247 0.064   1.00 0.00 ? 2   MET A HG3  4  
ATOM   9419  H  HE1  . MET A 1 2   ? 15.760  -27.225 -1.016  1.00 0.00 ? 2   MET A HE1  4  
ATOM   9420  H  HE2  . MET A 1 2   ? 14.155  -26.690 -1.535  1.00 0.00 ? 2   MET A HE2  4  
ATOM   9421  H  HE3  . MET A 1 2   ? 14.329  -28.151 -0.566  1.00 0.00 ? 2   MET A HE3  4  
ATOM   9422  N  N    . LEU A 1 3   ? 17.033  -20.351 1.627   1.00 0.00 ? 3   LEU A N    4  
ATOM   9423  C  CA   . LEU A 1 3   ? 16.956  -19.184 2.499   1.00 0.00 ? 3   LEU A CA   4  
ATOM   9424  C  C    . LEU A 1 3   ? 15.556  -18.581 2.459   1.00 0.00 ? 3   LEU A C    4  
ATOM   9425  O  O    . LEU A 1 3   ? 14.654  -19.121 1.819   1.00 0.00 ? 3   LEU A O    4  
ATOM   9426  C  CB   . LEU A 1 3   ? 17.978  -18.132 2.058   1.00 0.00 ? 3   LEU A CB   4  
ATOM   9427  C  CG   . LEU A 1 3   ? 19.389  -18.578 2.460   1.00 0.00 ? 3   LEU A CG   4  
ATOM   9428  C  CD1  . LEU A 1 3   ? 19.529  -18.570 3.989   1.00 0.00 ? 3   LEU A CD1  4  
ATOM   9429  C  CD2  . LEU A 1 3   ? 19.647  -19.990 1.926   1.00 0.00 ? 3   LEU A CD2  4  
ATOM   9430  H  H    . LEU A 1 3   ? 17.439  -20.263 0.739   1.00 0.00 ? 3   LEU A H    4  
ATOM   9431  H  HA   . LEU A 1 3   ? 17.178  -19.487 3.509   1.00 0.00 ? 3   LEU A HA   4  
ATOM   9432  H  HB2  . LEU A 1 3   ? 17.931  -18.015 0.986   1.00 0.00 ? 3   LEU A HB2  4  
ATOM   9433  H  HB3  . LEU A 1 3   ? 17.751  -17.190 2.533   1.00 0.00 ? 3   LEU A HB3  4  
ATOM   9434  H  HG   . LEU A 1 3   ? 20.111  -17.895 2.034   1.00 0.00 ? 3   LEU A HG   4  
ATOM   9435  H  HD11 . LEU A 1 3   ? 19.274  -19.543 4.383   1.00 0.00 ? 3   LEU A HD11 4  
ATOM   9436  H  HD12 . LEU A 1 3   ? 18.868  -17.828 4.411   1.00 0.00 ? 3   LEU A HD12 4  
ATOM   9437  H  HD13 . LEU A 1 3   ? 20.549  -18.333 4.253   1.00 0.00 ? 3   LEU A HD13 4  
ATOM   9438  H  HD21 . LEU A 1 3   ? 19.254  -20.073 0.923   1.00 0.00 ? 3   LEU A HD21 4  
ATOM   9439  H  HD22 . LEU A 1 3   ? 19.159  -20.711 2.565   1.00 0.00 ? 3   LEU A HD22 4  
ATOM   9440  H  HD23 . LEU A 1 3   ? 20.710  -20.180 1.913   1.00 0.00 ? 3   LEU A HD23 4  
ATOM   9441  N  N    . ARG A 1 4   ? 15.381  -17.457 3.148   1.00 0.00 ? 4   ARG A N    4  
ATOM   9442  C  CA   . ARG A 1 4   ? 14.085  -16.789 3.185   1.00 0.00 ? 4   ARG A CA   4  
ATOM   9443  C  C    . ARG A 1 4   ? 13.978  -15.768 2.055   1.00 0.00 ? 4   ARG A C    4  
ATOM   9444  O  O    . ARG A 1 4   ? 14.558  -14.684 2.128   1.00 0.00 ? 4   ARG A O    4  
ATOM   9445  C  CB   . ARG A 1 4   ? 13.895  -16.085 4.532   1.00 0.00 ? 4   ARG A CB   4  
ATOM   9446  C  CG   . ARG A 1 4   ? 13.853  -17.123 5.661   1.00 0.00 ? 4   ARG A CG   4  
ATOM   9447  C  CD   . ARG A 1 4   ? 15.264  -17.354 6.207   1.00 0.00 ? 4   ARG A CD   4  
ATOM   9448  N  NE   . ARG A 1 4   ? 15.824  -16.101 6.702   1.00 0.00 ? 4   ARG A NE   4  
ATOM   9449  C  CZ   . ARG A 1 4   ? 17.139  -15.909 6.754   1.00 0.00 ? 4   ARG A CZ   4  
ATOM   9450  N  NH1  . ARG A 1 4   ? 17.952  -16.851 6.359   1.00 0.00 ? 4   ARG A NH1  4  
ATOM   9451  N  NH2  . ARG A 1 4   ? 17.615  -14.779 7.200   1.00 0.00 ? 4   ARG A NH2  4  
ATOM   9452  H  H    . ARG A 1 4   ? 16.135  -17.071 3.640   1.00 0.00 ? 4   ARG A H    4  
ATOM   9453  H  HA   . ARG A 1 4   ? 13.307  -17.527 3.064   1.00 0.00 ? 4   ARG A HA   4  
ATOM   9454  H  HB2  . ARG A 1 4   ? 14.715  -15.401 4.698   1.00 0.00 ? 4   ARG A HB2  4  
ATOM   9455  H  HB3  . ARG A 1 4   ? 12.966  -15.534 4.520   1.00 0.00 ? 4   ARG A HB3  4  
ATOM   9456  H  HG2  . ARG A 1 4   ? 13.216  -16.762 6.455   1.00 0.00 ? 4   ARG A HG2  4  
ATOM   9457  H  HG3  . ARG A 1 4   ? 13.459  -18.056 5.283   1.00 0.00 ? 4   ARG A HG3  4  
ATOM   9458  H  HD2  . ARG A 1 4   ? 15.223  -18.067 7.016   1.00 0.00 ? 4   ARG A HD2  4  
ATOM   9459  H  HD3  . ARG A 1 4   ? 15.893  -17.744 5.420   1.00 0.00 ? 4   ARG A HD3  4  
ATOM   9460  H  HE   . ARG A 1 4   ? 15.221  -15.388 7.000   1.00 0.00 ? 4   ARG A HE   4  
ATOM   9461  H  HH11 . ARG A 1 4   ? 17.586  -17.716 6.017   1.00 0.00 ? 4   ARG A HH11 4  
ATOM   9462  H  HH12 . ARG A 1 4   ? 18.940  -16.706 6.399   1.00 0.00 ? 4   ARG A HH12 4  
ATOM   9463  H  HH21 . ARG A 1 4   ? 16.992  -14.059 7.503   1.00 0.00 ? 4   ARG A HH21 4  
ATOM   9464  H  HH22 . ARG A 1 4   ? 18.604  -14.635 7.239   1.00 0.00 ? 4   ARG A HH22 4  
ATOM   9465  N  N    . HIS A 1 5   ? 13.233  -16.122 1.013   1.00 0.00 ? 5   HIS A N    4  
ATOM   9466  C  CA   . HIS A 1 5   ? 13.057  -15.229 -0.127  1.00 0.00 ? 5   HIS A CA   4  
ATOM   9467  C  C    . HIS A 1 5   ? 12.376  -13.934 0.305   1.00 0.00 ? 5   HIS A C    4  
ATOM   9468  O  O    . HIS A 1 5   ? 11.154  -13.879 0.440   1.00 0.00 ? 5   HIS A O    4  
ATOM   9469  C  CB   . HIS A 1 5   ? 12.215  -15.916 -1.204  1.00 0.00 ? 5   HIS A CB   4  
ATOM   9470  C  CG   . HIS A 1 5   ? 12.640  -17.353 -1.331  1.00 0.00 ? 5   HIS A CG   4  
ATOM   9471  N  ND1  . HIS A 1 5   ? 12.217  -18.331 -0.445  1.00 0.00 ? 5   HIS A ND1  4  
ATOM   9472  C  CD2  . HIS A 1 5   ? 13.450  -17.993 -2.237  1.00 0.00 ? 5   HIS A CD2  4  
ATOM   9473  C  CE1  . HIS A 1 5   ? 12.768  -19.495 -0.832  1.00 0.00 ? 5   HIS A CE1  4  
ATOM   9474  N  NE2  . HIS A 1 5   ? 13.529  -19.345 -1.920  1.00 0.00 ? 5   HIS A NE2  4  
ATOM   9475  H  H    . HIS A 1 5   ? 12.794  -16.998 1.010   1.00 0.00 ? 5   HIS A H    4  
ATOM   9476  H  HA   . HIS A 1 5   ? 14.026  -14.995 -0.541  1.00 0.00 ? 5   HIS A HA   4  
ATOM   9477  H  HB2  . HIS A 1 5   ? 11.171  -15.872 -0.926  1.00 0.00 ? 5   HIS A HB2  4  
ATOM   9478  H  HB3  . HIS A 1 5   ? 12.358  -15.413 -2.148  1.00 0.00 ? 5   HIS A HB3  4  
ATOM   9479  H  HD1  . HIS A 1 5   ? 11.623  -18.198 0.324   1.00 0.00 ? 5   HIS A HD1  4  
ATOM   9480  H  HD2  . HIS A 1 5   ? 13.950  -17.518 -3.068  1.00 0.00 ? 5   HIS A HD2  4  
ATOM   9481  H  HE1  . HIS A 1 5   ? 12.614  -20.437 -0.326  1.00 0.00 ? 5   HIS A HE1  4  
ATOM   9482  H  HE2  . HIS A 1 5   ? 14.034  -20.039 -2.392  1.00 0.00 ? 5   HIS A HE2  4  
ATOM   9483  N  N    . SER A 1 6   ? 13.177  -12.892 0.518   1.00 0.00 ? 6   SER A N    4  
ATOM   9484  C  CA   . SER A 1 6   ? 12.647  -11.596 0.934   1.00 0.00 ? 6   SER A CA   4  
ATOM   9485  C  C    . SER A 1 6   ? 12.885  -10.551 -0.151  1.00 0.00 ? 6   SER A C    4  
ATOM   9486  O  O    . SER A 1 6   ? 12.113  -10.444 -1.103  1.00 0.00 ? 6   SER A O    4  
ATOM   9487  C  CB   . SER A 1 6   ? 13.322  -11.149 2.231   1.00 0.00 ? 6   SER A CB   4  
ATOM   9488  O  OG   . SER A 1 6   ? 12.933  -12.020 3.285   1.00 0.00 ? 6   SER A OG   4  
ATOM   9489  H  H    . SER A 1 6   ? 14.143  -12.997 0.393   1.00 0.00 ? 6   SER A H    4  
ATOM   9490  H  HA   . SER A 1 6   ? 11.584  -11.684 1.108   1.00 0.00 ? 6   SER A HA   4  
ATOM   9491  H  HB2  . SER A 1 6   ? 14.392  -11.189 2.114   1.00 0.00 ? 6   SER A HB2  4  
ATOM   9492  H  HB3  . SER A 1 6   ? 13.022  -10.133 2.459   1.00 0.00 ? 6   SER A HB3  4  
ATOM   9493  H  HG   . SER A 1 6   ? 12.025  -12.290 3.127   1.00 0.00 ? 6   SER A HG   4  
ATOM   9494  N  N    . MET A 1 7   ? 13.959  -9.783  -0.000  1.00 0.00 ? 7   MET A N    4  
ATOM   9495  C  CA   . MET A 1 7   ? 14.286  -8.750  -0.975  1.00 0.00 ? 7   MET A CA   4  
ATOM   9496  C  C    . MET A 1 7   ? 15.712  -8.243  -0.767  1.00 0.00 ? 7   MET A C    4  
ATOM   9497  O  O    . MET A 1 7   ? 16.097  -7.206  -1.307  1.00 0.00 ? 7   MET A O    4  
ATOM   9498  C  CB   . MET A 1 7   ? 13.303  -7.581  -0.854  1.00 0.00 ? 7   MET A CB   4  
ATOM   9499  C  CG   . MET A 1 7   ? 13.104  -7.219  0.620   1.00 0.00 ? 7   MET A CG   4  
ATOM   9500  S  SD   . MET A 1 7   ? 14.640  -6.538  1.291   1.00 0.00 ? 7   MET A SD   4  
ATOM   9501  C  CE   . MET A 1 7   ? 14.528  -7.305  2.926   1.00 0.00 ? 7   MET A CE   4  
ATOM   9502  H  H    . MET A 1 7   ? 14.540  -9.912  0.778   1.00 0.00 ? 7   MET A H    4  
ATOM   9503  H  HA   . MET A 1 7   ? 14.205  -9.168  -1.966  1.00 0.00 ? 7   MET A HA   4  
ATOM   9504  H  HB2  . MET A 1 7   ? 13.694  -6.726  -1.385  1.00 0.00 ? 7   MET A HB2  4  
ATOM   9505  H  HB3  . MET A 1 7   ? 12.354  -7.866  -1.281  1.00 0.00 ? 7   MET A HB3  4  
ATOM   9506  H  HG2  . MET A 1 7   ? 12.318  -6.483  0.705   1.00 0.00 ? 7   MET A HG2  4  
ATOM   9507  H  HG3  . MET A 1 7   ? 12.830  -8.103  1.176   1.00 0.00 ? 7   MET A HG3  4  
ATOM   9508  H  HE1  . MET A 1 7   ? 14.606  -8.379  2.824   1.00 0.00 ? 7   MET A HE1  4  
ATOM   9509  H  HE2  . MET A 1 7   ? 13.579  -7.049  3.377   1.00 0.00 ? 7   MET A HE2  4  
ATOM   9510  H  HE3  . MET A 1 7   ? 15.329  -6.945  3.550   1.00 0.00 ? 7   MET A HE3  4  
ATOM   9511  N  N    . ASP A 1 8   ? 16.486  -8.973  0.035   1.00 0.00 ? 8   ASP A N    4  
ATOM   9512  C  CA   . ASP A 1 8   ? 17.867  -8.582  0.327   1.00 0.00 ? 8   ASP A CA   4  
ATOM   9513  C  C    . ASP A 1 8   ? 18.878  -9.643  -0.128  1.00 0.00 ? 8   ASP A C    4  
ATOM   9514  O  O    . ASP A 1 8   ? 19.920  -9.304  -0.689  1.00 0.00 ? 8   ASP A O    4  
ATOM   9515  C  CB   . ASP A 1 8   ? 18.010  -8.340  1.834   1.00 0.00 ? 8   ASP A CB   4  
ATOM   9516  C  CG   . ASP A 1 8   ? 18.790  -7.054  2.105   1.00 0.00 ? 8   ASP A CG   4  
ATOM   9517  O  OD1  . ASP A 1 8   ? 18.255  -5.992  1.836   1.00 0.00 ? 8   ASP A OD1  4  
ATOM   9518  O  OD2  . ASP A 1 8   ? 19.911  -7.153  2.577   1.00 0.00 ? 8   ASP A OD2  4  
ATOM   9519  H  H    . ASP A 1 8   ? 16.120  -9.777  0.450   1.00 0.00 ? 8   ASP A H    4  
ATOM   9520  H  HA   . ASP A 1 8   ? 18.083  -7.660  -0.195  1.00 0.00 ? 8   ASP A HA   4  
ATOM   9521  H  HB2  . ASP A 1 8   ? 17.025  -8.256  2.262   1.00 0.00 ? 8   ASP A HB2  4  
ATOM   9522  H  HB3  . ASP A 1 8   ? 18.527  -9.173  2.290   1.00 0.00 ? 8   ASP A HB3  4  
ATOM   9523  N  N    . PRO A 1 9   ? 18.611  -10.905 0.108   1.00 0.00 ? 9   PRO A N    4  
ATOM   9524  C  CA   . PRO A 1 9   ? 19.549  -11.999 -0.287  1.00 0.00 ? 9   PRO A CA   4  
ATOM   9525  C  C    . PRO A 1 9   ? 19.890  -11.908 -1.770  1.00 0.00 ? 9   PRO A C    4  
ATOM   9526  O  O    . PRO A 1 9   ? 19.643  -10.878 -2.395  1.00 0.00 ? 9   PRO A O    4  
ATOM   9527  C  CB   . PRO A 1 9   ? 18.774  -13.280 0.026   1.00 0.00 ? 9   PRO A CB   4  
ATOM   9528  C  CG   . PRO A 1 9   ? 17.751  -12.890 1.041   1.00 0.00 ? 9   PRO A CG   4  
ATOM   9529  C  CD   . PRO A 1 9   ? 17.400  -11.434 0.758   1.00 0.00 ? 9   PRO A CD   4  
ATOM   9530  H  HA   . PRO A 1 9   ? 20.447  -11.959 0.309   1.00 0.00 ? 9   PRO A HA   4  
ATOM   9531  H  HB2  . PRO A 1 9   ? 18.296  -13.652 -0.873  1.00 0.00 ? 9   PRO A HB2  4  
ATOM   9532  H  HB3  . PRO A 1 9   ? 19.433  -14.026 0.443   1.00 0.00 ? 9   PRO A HB3  4  
ATOM   9533  H  HG2  . PRO A 1 9   ? 16.873  -13.514 0.938   1.00 0.00 ? 9   PRO A HG2  4  
ATOM   9534  H  HG3  . PRO A 1 9   ? 18.159  -12.979 2.034   1.00 0.00 ? 9   PRO A HG3  4  
ATOM   9535  H  HD2  . PRO A 1 9   ? 16.552  -11.386 0.090   1.00 0.00 ? 9   PRO A HD2  4  
ATOM   9536  H  HD3  . PRO A 1 9   ? 17.199  -10.904 1.675   1.00 0.00 ? 9   PRO A HD3  4  
ATOM   9537  N  N    . PRO A 1 10  ? 20.432  -12.944 -2.355  1.00 0.00 ? 10  PRO A N    4  
ATOM   9538  C  CA   . PRO A 1 10  ? 20.770  -12.938 -3.807  1.00 0.00 ? 10  PRO A CA   4  
ATOM   9539  C  C    . PRO A 1 10  ? 19.580  -12.533 -4.684  1.00 0.00 ? 10  PRO A C    4  
ATOM   9540  O  O    . PRO A 1 10  ? 19.650  -12.612 -5.911  1.00 0.00 ? 10  PRO A O    4  
ATOM   9541  C  CB   . PRO A 1 10  ? 21.185  -14.383 -4.073  1.00 0.00 ? 10  PRO A CB   4  
ATOM   9542  C  CG   . PRO A 1 10  ? 21.703  -14.870 -2.767  1.00 0.00 ? 10  PRO A CG   4  
ATOM   9543  C  CD   . PRO A 1 10  ? 20.803  -14.231 -1.724  1.00 0.00 ? 10  PRO A CD   4  
ATOM   9544  H  HA   . PRO A 1 10  ? 21.607  -12.286 -3.991  1.00 0.00 ? 10  PRO A HA   4  
ATOM   9545  H  HB2  . PRO A 1 10  ? 20.333  -14.969 -4.387  1.00 0.00 ? 10  PRO A HB2  4  
ATOM   9546  H  HB3  . PRO A 1 10  ? 21.956  -14.417 -4.808  1.00 0.00 ? 10  PRO A HB3  4  
ATOM   9547  H  HG2  . PRO A 1 10  ? 21.637  -15.949 -2.718  1.00 0.00 ? 10  PRO A HG2  4  
ATOM   9548  H  HG3  . PRO A 1 10  ? 22.721  -14.546 -2.620  1.00 0.00 ? 10  PRO A HG3  4  
ATOM   9549  H  HD2  . PRO A 1 10  ? 19.941  -14.859 -1.567  1.00 0.00 ? 10  PRO A HD2  4  
ATOM   9550  H  HD3  . PRO A 1 10  ? 21.338  -14.062 -0.803  1.00 0.00 ? 10  PRO A HD3  4  
ATOM   9551  N  N    . THR A 1 11  ? 18.495  -12.094 -4.049  1.00 0.00 ? 11  THR A N    4  
ATOM   9552  C  CA   . THR A 1 11  ? 17.307  -11.675 -4.778  1.00 0.00 ? 11  THR A CA   4  
ATOM   9553  C  C    . THR A 1 11  ? 17.643  -10.535 -5.730  1.00 0.00 ? 11  THR A C    4  
ATOM   9554  O  O    . THR A 1 11  ? 17.017  -10.380 -6.779  1.00 0.00 ? 11  THR A O    4  
ATOM   9555  C  CB   . THR A 1 11  ? 16.227  -11.213 -3.791  1.00 0.00 ? 11  THR A CB   4  
ATOM   9556  O  OG1  . THR A 1 11  ? 15.080  -10.793 -4.516  1.00 0.00 ? 11  THR A OG1  4  
ATOM   9557  C  CG2  . THR A 1 11  ? 16.748  -10.041 -2.934  1.00 0.00 ? 11  THR A CG2  4  
ATOM   9558  H  H    . THR A 1 11  ? 18.492  -12.047 -3.074  1.00 0.00 ? 11  THR A H    4  
ATOM   9559  H  HA   . THR A 1 11  ? 16.929  -12.511 -5.343  1.00 0.00 ? 11  THR A HA   4  
ATOM   9560  H  HB   . THR A 1 11  ? 15.959  -12.035 -3.145  1.00 0.00 ? 11  THR A HB   4  
ATOM   9561  H  HG1  . THR A 1 11  ? 15.376  -10.391 -5.335  1.00 0.00 ? 11  THR A HG1  4  
ATOM   9562  H  HG21 . THR A 1 11  ? 16.675  -10.299 -1.888  1.00 0.00 ? 11  THR A HG21 4  
ATOM   9563  H  HG22 . THR A 1 11  ? 16.152  -9.161  -3.127  1.00 0.00 ? 11  THR A HG22 4  
ATOM   9564  H  HG23 . THR A 1 11  ? 17.778  -9.830  -3.176  1.00 0.00 ? 11  THR A HG23 4  
ATOM   9565  N  N    . PHE A 1 12  ? 18.631  -9.736  -5.349  1.00 0.00 ? 12  PHE A N    4  
ATOM   9566  C  CA   . PHE A 1 12  ? 19.049  -8.604  -6.163  1.00 0.00 ? 12  PHE A CA   4  
ATOM   9567  C  C    . PHE A 1 12  ? 20.230  -8.981  -7.051  1.00 0.00 ? 12  PHE A C    4  
ATOM   9568  O  O    . PHE A 1 12  ? 20.384  -8.452  -8.152  1.00 0.00 ? 12  PHE A O    4  
ATOM   9569  C  CB   . PHE A 1 12  ? 19.440  -7.439  -5.253  1.00 0.00 ? 12  PHE A CB   4  
ATOM   9570  C  CG   . PHE A 1 12  ? 19.605  -6.188  -6.079  1.00 0.00 ? 12  PHE A CG   4  
ATOM   9571  C  CD1  . PHE A 1 12  ? 20.767  -5.998  -6.836  1.00 0.00 ? 12  PHE A CD1  4  
ATOM   9572  C  CD2  . PHE A 1 12  ? 18.596  -5.218  -6.088  1.00 0.00 ? 12  PHE A CD2  4  
ATOM   9573  C  CE1  . PHE A 1 12  ? 20.920  -4.838  -7.603  1.00 0.00 ? 12  PHE A CE1  4  
ATOM   9574  C  CE2  . PHE A 1 12  ? 18.750  -4.056  -6.855  1.00 0.00 ? 12  PHE A CE2  4  
ATOM   9575  C  CZ   . PHE A 1 12  ? 19.912  -3.866  -7.613  1.00 0.00 ? 12  PHE A CZ   4  
ATOM   9576  H  H    . PHE A 1 12  ? 19.086  -9.910  -4.499  1.00 0.00 ? 12  PHE A H    4  
ATOM   9577  H  HA   . PHE A 1 12  ? 18.224  -8.295  -6.787  1.00 0.00 ? 12  PHE A HA   4  
ATOM   9578  H  HB2  . PHE A 1 12  ? 18.666  -7.283  -4.516  1.00 0.00 ? 12  PHE A HB2  4  
ATOM   9579  H  HB3  . PHE A 1 12  ? 20.370  -7.669  -4.755  1.00 0.00 ? 12  PHE A HB3  4  
ATOM   9580  H  HD1  . PHE A 1 12  ? 21.544  -6.749  -6.828  1.00 0.00 ? 12  PHE A HD1  4  
ATOM   9581  H  HD2  . PHE A 1 12  ? 17.700  -5.365  -5.504  1.00 0.00 ? 12  PHE A HD2  4  
ATOM   9582  H  HE1  . PHE A 1 12  ? 21.817  -4.690  -8.187  1.00 0.00 ? 12  PHE A HE1  4  
ATOM   9583  H  HE2  . PHE A 1 12  ? 17.972  -3.308  -6.862  1.00 0.00 ? 12  PHE A HE2  4  
ATOM   9584  H  HZ   . PHE A 1 12  ? 20.031  -2.970  -8.203  1.00 0.00 ? 12  PHE A HZ   4  
ATOM   9585  N  N    . THR A 1 13  ? 21.060  -9.900  -6.568  1.00 0.00 ? 13  THR A N    4  
ATOM   9586  C  CA   . THR A 1 13  ? 22.222  -10.339 -7.327  1.00 0.00 ? 13  THR A CA   4  
ATOM   9587  C  C    . THR A 1 13  ? 21.806  -10.800 -8.720  1.00 0.00 ? 13  THR A C    4  
ATOM   9588  O  O    . THR A 1 13  ? 22.558  -10.652 -9.683  1.00 0.00 ? 13  THR A O    4  
ATOM   9589  C  CB   . THR A 1 13  ? 22.917  -11.485 -6.593  1.00 0.00 ? 13  THR A CB   4  
ATOM   9590  O  OG1  . THR A 1 13  ? 21.972  -12.506 -6.306  1.00 0.00 ? 13  THR A OG1  4  
ATOM   9591  C  CG2  . THR A 1 13  ? 23.524  -10.964 -5.289  1.00 0.00 ? 13  THR A CG2  4  
ATOM   9592  H  H    . THR A 1 13  ? 20.890  -10.289 -5.685  1.00 0.00 ? 13  THR A H    4  
ATOM   9593  H  HA   . THR A 1 13  ? 22.913  -9.514  -7.422  1.00 0.00 ? 13  THR A HA   4  
ATOM   9594  H  HB   . THR A 1 13  ? 23.701  -11.885 -7.214  1.00 0.00 ? 13  THR A HB   4  
ATOM   9595  H  HG1  . THR A 1 13  ? 21.874  -13.049 -7.092  1.00 0.00 ? 13  THR A HG1  4  
ATOM   9596  H  HG21 . THR A 1 13  ? 24.399  -10.370 -5.511  1.00 0.00 ? 13  THR A HG21 4  
ATOM   9597  H  HG22 . THR A 1 13  ? 23.803  -11.798 -4.664  1.00 0.00 ? 13  THR A HG22 4  
ATOM   9598  H  HG23 . THR A 1 13  ? 22.797  -10.354 -4.773  1.00 0.00 ? 13  THR A HG23 4  
ATOM   9599  N  N    . PHE A 1 14  ? 20.604  -11.357 -8.820  1.00 0.00 ? 14  PHE A N    4  
ATOM   9600  C  CA   . PHE A 1 14  ? 20.099  -11.833 -10.101 1.00 0.00 ? 14  PHE A CA   4  
ATOM   9601  C  C    . PHE A 1 14  ? 20.519  -10.887 -11.221 1.00 0.00 ? 14  PHE A C    4  
ATOM   9602  O  O    . PHE A 1 14  ? 21.241  -11.277 -12.139 1.00 0.00 ? 14  PHE A O    4  
ATOM   9603  C  CB   . PHE A 1 14  ? 18.570  -11.931 -10.058 1.00 0.00 ? 14  PHE A CB   4  
ATOM   9604  C  CG   . PHE A 1 14  ? 18.160  -13.261 -9.470  1.00 0.00 ? 14  PHE A CG   4  
ATOM   9605  C  CD1  . PHE A 1 14  ? 18.087  -14.394 -10.290 1.00 0.00 ? 14  PHE A CD1  4  
ATOM   9606  C  CD2  . PHE A 1 14  ? 17.855  -13.362 -8.108  1.00 0.00 ? 14  PHE A CD2  4  
ATOM   9607  C  CE1  . PHE A 1 14  ? 17.709  -15.627 -9.747  1.00 0.00 ? 14  PHE A CE1  4  
ATOM   9608  C  CE2  . PHE A 1 14  ? 17.475  -14.596 -7.565  1.00 0.00 ? 14  PHE A CE2  4  
ATOM   9609  C  CZ   . PHE A 1 14  ? 17.402  -15.728 -8.384  1.00 0.00 ? 14  PHE A CZ   4  
ATOM   9610  H  H    . PHE A 1 14  ? 20.047  -11.448 -8.018  1.00 0.00 ? 14  PHE A H    4  
ATOM   9611  H  HA   . PHE A 1 14  ? 20.507  -12.813 -10.299 1.00 0.00 ? 14  PHE A HA   4  
ATOM   9612  H  HB2  . PHE A 1 14  ? 18.176  -11.132 -9.446  1.00 0.00 ? 14  PHE A HB2  4  
ATOM   9613  H  HB3  . PHE A 1 14  ? 18.173  -11.844 -11.059 1.00 0.00 ? 14  PHE A HB3  4  
ATOM   9614  H  HD1  . PHE A 1 14  ? 18.324  -14.317 -11.341 1.00 0.00 ? 14  PHE A HD1  4  
ATOM   9615  H  HD2  . PHE A 1 14  ? 17.911  -12.489 -7.475  1.00 0.00 ? 14  PHE A HD2  4  
ATOM   9616  H  HE1  . PHE A 1 14  ? 17.652  -16.501 -10.379 1.00 0.00 ? 14  PHE A HE1  4  
ATOM   9617  H  HE2  . PHE A 1 14  ? 17.240  -14.674 -6.514  1.00 0.00 ? 14  PHE A HE2  4  
ATOM   9618  H  HZ   . PHE A 1 14  ? 17.110  -16.680 -7.965  1.00 0.00 ? 14  PHE A HZ   4  
ATOM   9619  N  N    . ASN A 1 15  ? 20.062  -9.641  -11.138 1.00 0.00 ? 15  ASN A N    4  
ATOM   9620  C  CA   . ASN A 1 15  ? 20.395  -8.640  -12.147 1.00 0.00 ? 15  ASN A CA   4  
ATOM   9621  C  C    . ASN A 1 15  ? 20.677  -7.294  -11.489 1.00 0.00 ? 15  ASN A C    4  
ATOM   9622  O  O    . ASN A 1 15  ? 21.557  -7.182  -10.635 1.00 0.00 ? 15  ASN A O    4  
ATOM   9623  C  CB   . ASN A 1 15  ? 19.238  -8.494  -13.137 1.00 0.00 ? 15  ASN A CB   4  
ATOM   9624  C  CG   . ASN A 1 15  ? 18.987  -9.820  -13.846 1.00 0.00 ? 15  ASN A CG   4  
ATOM   9625  O  OD1  . ASN A 1 15  ? 17.856  -10.111 -14.240 1.00 0.00 ? 15  ASN A OD1  4  
ATOM   9626  N  ND2  . ASN A 1 15  ? 19.978  -10.647 -14.035 1.00 0.00 ? 15  ASN A ND2  4  
ATOM   9627  H  H    . ASN A 1 15  ? 19.491  -9.390  -10.383 1.00 0.00 ? 15  ASN A H    4  
ATOM   9628  H  HA   . ASN A 1 15  ? 21.275  -8.960  -12.684 1.00 0.00 ? 15  ASN A HA   4  
ATOM   9629  H  HB2  . ASN A 1 15  ? 18.347  -8.198  -12.604 1.00 0.00 ? 15  ASN A HB2  4  
ATOM   9630  H  HB3  . ASN A 1 15  ? 19.486  -7.739  -13.869 1.00 0.00 ? 15  ASN A HB3  4  
ATOM   9631  H  HD21 . ASN A 1 15  ? 20.877  -10.414 -13.722 1.00 0.00 ? 15  ASN A HD21 4  
ATOM   9632  H  HD22 . ASN A 1 15  ? 19.823  -11.502 -14.489 1.00 0.00 ? 15  ASN A HD22 4  
ATOM   9633  N  N    . PHE A 1 16  ? 19.925  -6.274  -11.890 1.00 0.00 ? 16  PHE A N    4  
ATOM   9634  C  CA   . PHE A 1 16  ? 20.102  -4.940  -11.329 1.00 0.00 ? 16  PHE A CA   4  
ATOM   9635  C  C    . PHE A 1 16  ? 18.778  -4.185  -11.317 1.00 0.00 ? 16  PHE A C    4  
ATOM   9636  O  O    . PHE A 1 16  ? 18.737  -2.978  -11.556 1.00 0.00 ? 16  PHE A O    4  
ATOM   9637  C  CB   . PHE A 1 16  ? 21.131  -4.159  -12.149 1.00 0.00 ? 16  PHE A CB   4  
ATOM   9638  C  CG   . PHE A 1 16  ? 21.647  -2.998  -11.332 1.00 0.00 ? 16  PHE A CG   4  
ATOM   9639  C  CD1  . PHE A 1 16  ? 22.607  -3.216  -10.336 1.00 0.00 ? 16  PHE A CD1  4  
ATOM   9640  C  CD2  . PHE A 1 16  ? 21.166  -1.705  -11.570 1.00 0.00 ? 16  PHE A CD2  4  
ATOM   9641  C  CE1  . PHE A 1 16  ? 23.085  -2.141  -9.578  1.00 0.00 ? 16  PHE A CE1  4  
ATOM   9642  C  CE2  . PHE A 1 16  ? 21.646  -0.630  -10.812 1.00 0.00 ? 16  PHE A CE2  4  
ATOM   9643  C  CZ   . PHE A 1 16  ? 22.605  -0.848  -9.816  1.00 0.00 ? 16  PHE A CZ   4  
ATOM   9644  H  H    . PHE A 1 16  ? 19.237  -6.423  -12.573 1.00 0.00 ? 16  PHE A H    4  
ATOM   9645  H  HA   . PHE A 1 16  ? 20.462  -5.030  -10.316 1.00 0.00 ? 16  PHE A HA   4  
ATOM   9646  H  HB2  . PHE A 1 16  ? 21.951  -4.810  -12.411 1.00 0.00 ? 16  PHE A HB2  4  
ATOM   9647  H  HB3  . PHE A 1 16  ? 20.665  -3.785  -13.049 1.00 0.00 ? 16  PHE A HB3  4  
ATOM   9648  H  HD1  . PHE A 1 16  ? 22.977  -4.214  -10.153 1.00 0.00 ? 16  PHE A HD1  4  
ATOM   9649  H  HD2  . PHE A 1 16  ? 20.427  -1.537  -12.338 1.00 0.00 ? 16  PHE A HD2  4  
ATOM   9650  H  HE1  . PHE A 1 16  ? 23.825  -2.310  -8.809  1.00 0.00 ? 16  PHE A HE1  4  
ATOM   9651  H  HE2  . PHE A 1 16  ? 21.275  0.368   -10.996 1.00 0.00 ? 16  PHE A HE2  4  
ATOM   9652  H  HZ   . PHE A 1 16  ? 22.974  -0.019  -9.231  1.00 0.00 ? 16  PHE A HZ   4  
ATOM   9653  N  N    . ASN A 1 17  ? 17.698  -4.903  -11.031 1.00 0.00 ? 17  ASN A N    4  
ATOM   9654  C  CA   . ASN A 1 17  ? 16.377  -4.292  -10.985 1.00 0.00 ? 17  ASN A CA   4  
ATOM   9655  C  C    . ASN A 1 17  ? 16.106  -3.497  -12.257 1.00 0.00 ? 17  ASN A C    4  
ATOM   9656  O  O    . ASN A 1 17  ? 15.455  -3.986  -13.180 1.00 0.00 ? 17  ASN A O    4  
ATOM   9657  C  CB   . ASN A 1 17  ? 16.277  -3.372  -9.768  1.00 0.00 ? 17  ASN A CB   4  
ATOM   9658  C  CG   . ASN A 1 17  ? 15.947  -4.187  -8.524  1.00 0.00 ? 17  ASN A CG   4  
ATOM   9659  O  OD1  . ASN A 1 17  ? 16.250  -5.380  -8.463  1.00 0.00 ? 17  ASN A OD1  4  
ATOM   9660  N  ND2  . ASN A 1 17  ? 15.340  -3.615  -7.521  1.00 0.00 ? 17  ASN A ND2  4  
ATOM   9661  H  H    . ASN A 1 17  ? 17.792  -5.859  -10.846 1.00 0.00 ? 17  ASN A H    4  
ATOM   9662  H  HA   . ASN A 1 17  ? 15.635  -5.070  -10.894 1.00 0.00 ? 17  ASN A HA   4  
ATOM   9663  H  HB2  . ASN A 1 17  ? 17.221  -2.864  -9.626  1.00 0.00 ? 17  ASN A HB2  4  
ATOM   9664  H  HB3  . ASN A 1 17  ? 15.500  -2.644  -9.934  1.00 0.00 ? 17  ASN A HB3  4  
ATOM   9665  H  HD21 . ASN A 1 17  ? 15.100  -2.663  -7.572  1.00 0.00 ? 17  ASN A HD21 4  
ATOM   9666  H  HD22 . ASN A 1 17  ? 15.125  -4.135  -6.716  1.00 0.00 ? 17  ASN A HD22 4  
ATOM   9667  N  N    . ASN A 1 18  ? 16.607  -2.267  -12.298 1.00 0.00 ? 18  ASN A N    4  
ATOM   9668  C  CA   . ASN A 1 18  ? 16.410  -1.412  -13.463 1.00 0.00 ? 18  ASN A CA   4  
ATOM   9669  C  C    . ASN A 1 18  ? 14.925  -1.278  -13.783 1.00 0.00 ? 18  ASN A C    4  
ATOM   9670  O  O    . ASN A 1 18  ? 14.549  -0.748  -14.828 1.00 0.00 ? 18  ASN A O    4  
ATOM   9671  C  CB   . ASN A 1 18  ? 17.144  -1.997  -14.671 1.00 0.00 ? 18  ASN A CB   4  
ATOM   9672  C  CG   . ASN A 1 18  ? 17.092  -1.016  -15.837 1.00 0.00 ? 18  ASN A CG   4  
ATOM   9673  O  OD1  . ASN A 1 18  ? 16.162  -1.055  -16.643 1.00 0.00 ? 18  ASN A OD1  4  
ATOM   9674  N  ND2  . ASN A 1 18  ? 18.042  -0.134  -15.978 1.00 0.00 ? 18  ASN A ND2  4  
ATOM   9675  H  H    . ASN A 1 18  ? 17.115  -1.929  -11.532 1.00 0.00 ? 18  ASN A H    4  
ATOM   9676  H  HA   . ASN A 1 18  ? 16.813  -0.432  -13.252 1.00 0.00 ? 18  ASN A HA   4  
ATOM   9677  H  HB2  . ASN A 1 18  ? 18.174  -2.187  -14.406 1.00 0.00 ? 18  ASN A HB2  4  
ATOM   9678  H  HB3  . ASN A 1 18  ? 16.671  -2.923  -14.962 1.00 0.00 ? 18  ASN A HB3  4  
ATOM   9679  H  HD21 . ASN A 1 18  ? 18.783  -0.105  -15.335 1.00 0.00 ? 18  ASN A HD21 4  
ATOM   9680  H  HD22 . ASN A 1 18  ? 18.017  0.501   -16.725 1.00 0.00 ? 18  ASN A HD22 4  
ATOM   9681  N  N    . GLU A 1 19  ? 14.086  -1.763  -12.873 1.00 0.00 ? 19  GLU A N    4  
ATOM   9682  C  CA   . GLU A 1 19  ? 12.640  -1.698  -13.062 1.00 0.00 ? 19  GLU A CA   4  
ATOM   9683  C  C    . GLU A 1 19  ? 11.949  -1.337  -11.751 1.00 0.00 ? 19  GLU A C    4  
ATOM   9684  O  O    . GLU A 1 19  ? 11.151  -2.112  -11.223 1.00 0.00 ? 19  GLU A O    4  
ATOM   9685  C  CB   . GLU A 1 19  ? 12.117  -3.046  -13.562 1.00 0.00 ? 19  GLU A CB   4  
ATOM   9686  C  CG   . GLU A 1 19  ? 12.515  -3.238  -15.027 1.00 0.00 ? 19  GLU A CG   4  
ATOM   9687  C  CD   . GLU A 1 19  ? 12.343  -4.699  -15.428 1.00 0.00 ? 19  GLU A CD   4  
ATOM   9688  O  OE1  . GLU A 1 19  ? 11.220  -5.089  -15.700 1.00 0.00 ? 19  GLU A OE1  4  
ATOM   9689  O  OE2  . GLU A 1 19  ? 13.337  -5.405  -15.455 1.00 0.00 ? 19  GLU A OE2  4  
ATOM   9690  H  H    . GLU A 1 19  ? 14.444  -2.174  -12.060 1.00 0.00 ? 19  GLU A H    4  
ATOM   9691  H  HA   . GLU A 1 19  ? 12.413  -0.941  -13.799 1.00 0.00 ? 19  GLU A HA   4  
ATOM   9692  H  HB2  . GLU A 1 19  ? 12.545  -3.840  -12.965 1.00 0.00 ? 19  GLU A HB2  4  
ATOM   9693  H  HB3  . GLU A 1 19  ? 11.041  -3.068  -13.478 1.00 0.00 ? 19  GLU A HB3  4  
ATOM   9694  H  HG2  . GLU A 1 19  ? 11.888  -2.618  -15.652 1.00 0.00 ? 19  GLU A HG2  4  
ATOM   9695  H  HG3  . GLU A 1 19  ? 13.548  -2.950  -15.158 1.00 0.00 ? 19  GLU A HG3  4  
ATOM   9696  N  N    . PRO A 1 20  ? 12.242  -0.179  -11.225 1.00 0.00 ? 20  PRO A N    4  
ATOM   9697  C  CA   . PRO A 1 20  ? 11.643  0.300   -9.947  1.00 0.00 ? 20  PRO A CA   4  
ATOM   9698  C  C    . PRO A 1 20  ? 10.170  0.671   -10.107 1.00 0.00 ? 20  PRO A C    4  
ATOM   9699  O  O    . PRO A 1 20  ? 9.562   0.403   -11.143 1.00 0.00 ? 20  PRO A O    4  
ATOM   9700  C  CB   . PRO A 1 20  ? 12.486  1.525   -9.584  1.00 0.00 ? 20  PRO A CB   4  
ATOM   9701  C  CG   . PRO A 1 20  ? 13.055  2.016   -10.875 1.00 0.00 ? 20  PRO A CG   4  
ATOM   9702  C  CD   . PRO A 1 20  ? 13.179  0.800   -11.795 1.00 0.00 ? 20  PRO A CD   4  
ATOM   9703  H  HA   . PRO A 1 20  ? 11.753  -0.451  -9.181  1.00 0.00 ? 20  PRO A HA   4  
ATOM   9704  H  HB2  . PRO A 1 20  ? 11.865  2.287   -9.133  1.00 0.00 ? 20  PRO A HB2  4  
ATOM   9705  H  HB3  . PRO A 1 20  ? 13.284  1.245   -8.914  1.00 0.00 ? 20  PRO A HB3  4  
ATOM   9706  H  HG2  . PRO A 1 20  ? 12.391  2.750   -11.314 1.00 0.00 ? 20  PRO A HG2  4  
ATOM   9707  H  HG3  . PRO A 1 20  ? 14.030  2.447   -10.711 1.00 0.00 ? 20  PRO A HG3  4  
ATOM   9708  H  HD2  . PRO A 1 20  ? 12.893  1.060   -12.805 1.00 0.00 ? 20  PRO A HD2  4  
ATOM   9709  H  HD3  . PRO A 1 20  ? 14.185  0.409   -11.773 1.00 0.00 ? 20  PRO A HD3  4  
ATOM   9710  N  N    . TRP A 1 21  ? 9.604   1.286   -9.075  1.00 0.00 ? 21  TRP A N    4  
ATOM   9711  C  CA   . TRP A 1 21  ? 8.203   1.686   -9.112  1.00 0.00 ? 21  TRP A CA   4  
ATOM   9712  C  C    . TRP A 1 21  ? 7.303   0.460   -9.230  1.00 0.00 ? 21  TRP A C    4  
ATOM   9713  O  O    . TRP A 1 21  ? 7.706   -0.568  -9.775  1.00 0.00 ? 21  TRP A O    4  
ATOM   9714  C  CB   . TRP A 1 21  ? 7.955   2.619   -10.298 1.00 0.00 ? 21  TRP A CB   4  
ATOM   9715  C  CG   . TRP A 1 21  ? 9.039   3.646   -10.363 1.00 0.00 ? 21  TRP A CG   4  
ATOM   9716  C  CD1  . TRP A 1 21  ? 9.478   4.381   -9.315  1.00 0.00 ? 21  TRP A CD1  4  
ATOM   9717  C  CD2  . TRP A 1 21  ? 9.828   4.063   -11.514 1.00 0.00 ? 21  TRP A CD2  4  
ATOM   9718  N  NE1  . TRP A 1 21  ? 10.485  5.222   -9.750  1.00 0.00 ? 21  TRP A NE1  4  
ATOM   9719  C  CE2  . TRP A 1 21  ? 10.737  5.064   -11.098 1.00 0.00 ? 21  TRP A CE2  4  
ATOM   9720  C  CE3  . TRP A 1 21  ? 9.842   3.675   -12.866 1.00 0.00 ? 21  TRP A CE3  4  
ATOM   9721  C  CZ2  . TRP A 1 21  ? 11.628  5.658   -11.992 1.00 0.00 ? 21  TRP A CZ2  4  
ATOM   9722  C  CZ3  . TRP A 1 21  ? 10.738  4.270   -13.768 1.00 0.00 ? 21  TRP A CZ3  4  
ATOM   9723  C  CH2  . TRP A 1 21  ? 11.629  5.260   -13.331 1.00 0.00 ? 21  TRP A CH2  4  
ATOM   9724  H  H    . TRP A 1 21  ? 10.137  1.472   -8.273  1.00 0.00 ? 21  TRP A H    4  
ATOM   9725  H  HA   . TRP A 1 21  ? 7.963   2.210   -8.200  1.00 0.00 ? 21  TRP A HA   4  
ATOM   9726  H  HB2  . TRP A 1 21  ? 7.948   2.044   -11.213 1.00 0.00 ? 21  TRP A HB2  4  
ATOM   9727  H  HB3  . TRP A 1 21  ? 7.001   3.111   -10.176 1.00 0.00 ? 21  TRP A HB3  4  
ATOM   9728  H  HD1  . TRP A 1 21  ? 9.102   4.319   -8.304  1.00 0.00 ? 21  TRP A HD1  4  
ATOM   9729  H  HE1  . TRP A 1 21  ? 10.972  5.860   -9.187  1.00 0.00 ? 21  TRP A HE1  4  
ATOM   9730  H  HE3  . TRP A 1 21  ? 9.159   2.913   -13.212 1.00 0.00 ? 21  TRP A HE3  4  
ATOM   9731  H  HZ2  . TRP A 1 21  ? 12.313  6.420   -11.650 1.00 0.00 ? 21  TRP A HZ2  4  
ATOM   9732  H  HZ3  . TRP A 1 21  ? 10.741  3.964   -14.803 1.00 0.00 ? 21  TRP A HZ3  4  
ATOM   9733  H  HH2  . TRP A 1 21  ? 12.317  5.715   -14.029 1.00 0.00 ? 21  TRP A HH2  4  
ATOM   9734  N  N    . VAL A 1 22  ? 6.084   0.576   -8.715  1.00 0.00 ? 22  VAL A N    4  
ATOM   9735  C  CA   . VAL A 1 22  ? 5.135   -0.528  -8.766  1.00 0.00 ? 22  VAL A CA   4  
ATOM   9736  C  C    . VAL A 1 22  ? 4.811   -0.898  -10.210 1.00 0.00 ? 22  VAL A C    4  
ATOM   9737  O  O    . VAL A 1 22  ? 4.351   -2.005  -10.488 1.00 0.00 ? 22  VAL A O    4  
ATOM   9738  C  CB   . VAL A 1 22  ? 3.852   -0.135  -8.036  1.00 0.00 ? 22  VAL A CB   4  
ATOM   9739  C  CG1  . VAL A 1 22  ? 4.171   0.172   -6.572  1.00 0.00 ? 22  VAL A CG1  4  
ATOM   9740  C  CG2  . VAL A 1 22  ? 3.250   1.108   -8.697  1.00 0.00 ? 22  VAL A CG2  4  
ATOM   9741  H  H    . VAL A 1 22  ? 5.817   1.417   -8.291  1.00 0.00 ? 22  VAL A H    4  
ATOM   9742  H  HA   . VAL A 1 22  ? 5.567   -1.386  -8.272  1.00 0.00 ? 22  VAL A HA   4  
ATOM   9743  H  HB   . VAL A 1 22  ? 3.147   -0.950  -8.087  1.00 0.00 ? 22  VAL A HB   4  
ATOM   9744  H  HG11 . VAL A 1 22  ? 3.277   0.515   -6.073  1.00 0.00 ? 22  VAL A HG11 4  
ATOM   9745  H  HG12 . VAL A 1 22  ? 4.928   0.941   -6.523  1.00 0.00 ? 22  VAL A HG12 4  
ATOM   9746  H  HG13 . VAL A 1 22  ? 4.534   -0.722  -6.088  1.00 0.00 ? 22  VAL A HG13 4  
ATOM   9747  H  HG21 . VAL A 1 22  ? 2.927   0.862   -9.697  1.00 0.00 ? 22  VAL A HG21 4  
ATOM   9748  H  HG22 . VAL A 1 22  ? 3.995   1.888   -8.740  1.00 0.00 ? 22  VAL A HG22 4  
ATOM   9749  H  HG23 . VAL A 1 22  ? 2.404   1.449   -8.118  1.00 0.00 ? 22  VAL A HG23 4  
ATOM   9750  N  N    . ARG A 1 23  ? 5.056   0.035   -11.126 1.00 0.00 ? 23  ARG A N    4  
ATOM   9751  C  CA   . ARG A 1 23  ? 4.785   -0.209  -12.538 1.00 0.00 ? 23  ARG A CA   4  
ATOM   9752  C  C    . ARG A 1 23  ? 5.865   -1.097  -13.146 1.00 0.00 ? 23  ARG A C    4  
ATOM   9753  O  O    . ARG A 1 23  ? 6.262   -2.101  -12.555 1.00 0.00 ? 23  ARG A O    4  
ATOM   9754  C  CB   . ARG A 1 23  ? 4.725   1.118   -13.297 1.00 0.00 ? 23  ARG A CB   4  
ATOM   9755  C  CG   . ARG A 1 23  ? 3.919   0.933   -14.585 1.00 0.00 ? 23  ARG A CG   4  
ATOM   9756  C  CD   . ARG A 1 23  ? 4.279   2.041   -15.578 1.00 0.00 ? 23  ARG A CD   4  
ATOM   9757  N  NE   . ARG A 1 23  ? 5.606   1.806   -16.140 1.00 0.00 ? 23  ARG A NE   4  
ATOM   9758  C  CZ   . ARG A 1 23  ? 5.995   2.409   -17.259 1.00 0.00 ? 23  ARG A CZ   4  
ATOM   9759  N  NH1  . ARG A 1 23  ? 5.185   3.225   -17.877 1.00 0.00 ? 23  ARG A NH1  4  
ATOM   9760  N  NH2  . ARG A 1 23  ? 7.186   2.185   -17.741 1.00 0.00 ? 23  ARG A NH2  4  
ATOM   9761  H  H    . ARG A 1 23  ? 5.423   0.899   -10.848 1.00 0.00 ? 23  ARG A H    4  
ATOM   9762  H  HA   . ARG A 1 23  ? 3.830   -0.705  -12.631 1.00 0.00 ? 23  ARG A HA   4  
ATOM   9763  H  HB2  . ARG A 1 23  ? 4.250   1.866   -12.679 1.00 0.00 ? 23  ARG A HB2  4  
ATOM   9764  H  HB3  . ARG A 1 23  ? 5.726   1.437   -13.544 1.00 0.00 ? 23  ARG A HB3  4  
ATOM   9765  H  HG2  . ARG A 1 23  ? 4.150   -0.029  -15.019 1.00 0.00 ? 23  ARG A HG2  4  
ATOM   9766  H  HG3  . ARG A 1 23  ? 2.865   0.983   -14.360 1.00 0.00 ? 23  ARG A HG3  4  
ATOM   9767  H  HD2  . ARG A 1 23  ? 3.553   2.053   -16.377 1.00 0.00 ? 23  ARG A HD2  4  
ATOM   9768  H  HD3  . ARG A 1 23  ? 4.266   2.993   -15.070 1.00 0.00 ? 23  ARG A HD3  4  
ATOM   9769  H  HE   . ARG A 1 23  ? 6.221   1.195   -15.683 1.00 0.00 ? 23  ARG A HE   4  
ATOM   9770  H  HH11 . ARG A 1 23  ? 4.271   3.397   -17.508 1.00 0.00 ? 23  ARG A HH11 4  
ATOM   9771  H  HH12 . ARG A 1 23  ? 5.479   3.679   -18.719 1.00 0.00 ? 23  ARG A HH12 4  
ATOM   9772  H  HH21 . ARG A 1 23  ? 7.807   1.559   -17.269 1.00 0.00 ? 23  ARG A HH21 4  
ATOM   9773  H  HH22 . ARG A 1 23  ? 7.479   2.638   -18.584 1.00 0.00 ? 23  ARG A HH22 4  
ATOM   9774  N  N    . GLY A 1 24  ? 6.335   -0.722  -14.331 1.00 0.00 ? 24  GLY A N    4  
ATOM   9775  C  CA   . GLY A 1 24  ? 7.367   -1.495  -15.011 1.00 0.00 ? 24  GLY A CA   4  
ATOM   9776  C  C    . GLY A 1 24  ? 6.774   -2.740  -15.658 1.00 0.00 ? 24  GLY A C    4  
ATOM   9777  O  O    . GLY A 1 24  ? 7.259   -3.852  -15.447 1.00 0.00 ? 24  GLY A O    4  
ATOM   9778  H  H    . GLY A 1 24  ? 5.979   0.086   -14.757 1.00 0.00 ? 24  GLY A H    4  
ATOM   9779  H  HA2  . GLY A 1 24  ? 7.826   -0.881  -15.773 1.00 0.00 ? 24  GLY A HA2  4  
ATOM   9780  H  HA3  . GLY A 1 24  ? 8.118   -1.793  -14.295 1.00 0.00 ? 24  GLY A HA3  4  
ATOM   9781  N  N    . ARG A 1 25  ? 5.721   -2.546  -16.446 1.00 0.00 ? 25  ARG A N    4  
ATOM   9782  C  CA   . ARG A 1 25  ? 5.066   -3.663  -17.118 1.00 0.00 ? 25  ARG A CA   4  
ATOM   9783  C  C    . ARG A 1 25  ? 4.588   -4.695  -16.101 1.00 0.00 ? 25  ARG A C    4  
ATOM   9784  O  O    . ARG A 1 25  ? 4.137   -4.343  -15.012 1.00 0.00 ? 25  ARG A O    4  
ATOM   9785  C  CB   . ARG A 1 25  ? 6.035   -4.324  -18.100 1.00 0.00 ? 25  ARG A CB   4  
ATOM   9786  C  CG   . ARG A 1 25  ? 6.865   -3.248  -18.805 1.00 0.00 ? 25  ARG A CG   4  
ATOM   9787  C  CD   . ARG A 1 25  ? 7.484   -3.832  -20.076 1.00 0.00 ? 25  ARG A CD   4  
ATOM   9788  N  NE   . ARG A 1 25  ? 8.314   -4.987  -19.751 1.00 0.00 ? 25  ARG A NE   4  
ATOM   9789  C  CZ   . ARG A 1 25  ? 9.106   -5.544  -20.661 1.00 0.00 ? 25  ARG A CZ   4  
ATOM   9790  N  NH1  . ARG A 1 25  ? 9.149   -5.059  -21.872 1.00 0.00 ? 25  ARG A NH1  4  
ATOM   9791  N  NH2  . ARG A 1 25  ? 9.840   -6.576  -20.345 1.00 0.00 ? 25  ARG A NH2  4  
ATOM   9792  H  H    . ARG A 1 25  ? 5.378   -1.638  -16.576 1.00 0.00 ? 25  ARG A H    4  
ATOM   9793  H  HA   . ARG A 1 25  ? 4.215   -3.290  -17.666 1.00 0.00 ? 25  ARG A HA   4  
ATOM   9794  H  HB2  . ARG A 1 25  ? 6.693   -4.991  -17.563 1.00 0.00 ? 25  ARG A HB2  4  
ATOM   9795  H  HB3  . ARG A 1 25  ? 5.477   -4.884  -18.835 1.00 0.00 ? 25  ARG A HB3  4  
ATOM   9796  H  HG2  . ARG A 1 25  ? 6.227   -2.415  -19.063 1.00 0.00 ? 25  ARG A HG2  4  
ATOM   9797  H  HG3  . ARG A 1 25  ? 7.650   -2.910  -18.147 1.00 0.00 ? 25  ARG A HG3  4  
ATOM   9798  H  HD2  . ARG A 1 25  ? 6.697   -4.138  -20.749 1.00 0.00 ? 25  ARG A HD2  4  
ATOM   9799  H  HD3  . ARG A 1 25  ? 8.090   -3.077  -20.557 1.00 0.00 ? 25  ARG A HD3  4  
ATOM   9800  H  HE   . ARG A 1 25  ? 8.287   -5.358  -18.844 1.00 0.00 ? 25  ARG A HE   4  
ATOM   9801  H  HH11 . ARG A 1 25  ? 8.586   -4.270  -22.116 1.00 0.00 ? 25  ARG A HH11 4  
ATOM   9802  H  HH12 . ARG A 1 25  ? 9.745   -5.478  -22.558 1.00 0.00 ? 25  ARG A HH12 4  
ATOM   9803  H  HH21 . ARG A 1 25  ? 9.806   -6.948  -19.418 1.00 0.00 ? 25  ARG A HH21 4  
ATOM   9804  H  HH22 . ARG A 1 25  ? 10.436  -6.993  -21.031 1.00 0.00 ? 25  ARG A HH22 4  
ATOM   9805  N  N    . HIS A 1 26  ? 4.690   -5.968  -16.466 1.00 0.00 ? 26  HIS A N    4  
ATOM   9806  C  CA   . HIS A 1 26  ? 4.265   -7.044  -15.577 1.00 0.00 ? 26  HIS A CA   4  
ATOM   9807  C  C    . HIS A 1 26  ? 5.302   -7.278  -14.484 1.00 0.00 ? 26  HIS A C    4  
ATOM   9808  O  O    . HIS A 1 26  ? 6.032   -8.269  -14.511 1.00 0.00 ? 26  HIS A O    4  
ATOM   9809  C  CB   . HIS A 1 26  ? 4.061   -8.332  -16.376 1.00 0.00 ? 26  HIS A CB   4  
ATOM   9810  C  CG   . HIS A 1 26  ? 3.079   -8.082  -17.488 1.00 0.00 ? 26  HIS A CG   4  
ATOM   9811  N  ND1  . HIS A 1 26  ? 2.347   -6.909  -17.575 1.00 0.00 ? 26  HIS A ND1  4  
ATOM   9812  C  CD2  . HIS A 1 26  ? 2.697   -8.842  -18.565 1.00 0.00 ? 26  HIS A CD2  4  
ATOM   9813  C  CE1  . HIS A 1 26  ? 1.569   -6.996  -18.670 1.00 0.00 ? 26  HIS A CE1  4  
ATOM   9814  N  NE2  . HIS A 1 26  ? 1.744   -8.155  -19.309 1.00 0.00 ? 26  HIS A NE2  4  
ATOM   9815  H  H    . HIS A 1 26  ? 5.058   -6.189  -17.348 1.00 0.00 ? 26  HIS A H    4  
ATOM   9816  H  HA   . HIS A 1 26  ? 3.328   -6.767  -15.117 1.00 0.00 ? 26  HIS A HA   4  
ATOM   9817  H  HB2  . HIS A 1 26  ? 5.005   -8.649  -16.794 1.00 0.00 ? 26  HIS A HB2  4  
ATOM   9818  H  HB3  . HIS A 1 26  ? 3.677   -9.104  -15.725 1.00 0.00 ? 26  HIS A HB3  4  
ATOM   9819  H  HD1  . HIS A 1 26  ? 2.388   -6.152  -16.952 1.00 0.00 ? 26  HIS A HD1  4  
ATOM   9820  H  HD2  . HIS A 1 26  ? 3.079   -9.826  -18.798 1.00 0.00 ? 26  HIS A HD2  4  
ATOM   9821  H  HE1  . HIS A 1 26  ? 0.887   -6.223  -18.992 1.00 0.00 ? 26  HIS A HE1  4  
ATOM   9822  H  HE2  . HIS A 1 26  ? 1.297   -8.457  -20.127 1.00 0.00 ? 26  HIS A HE2  4  
ATOM   9823  N  N    . GLU A 1 27  ? 5.361   -6.362  -13.524 1.00 0.00 ? 27  GLU A N    4  
ATOM   9824  C  CA   . GLU A 1 27  ? 6.315   -6.480  -12.427 1.00 0.00 ? 27  GLU A CA   4  
ATOM   9825  C  C    . GLU A 1 27  ? 5.887   -5.611  -11.249 1.00 0.00 ? 27  GLU A C    4  
ATOM   9826  O  O    . GLU A 1 27  ? 6.299   -4.457  -11.136 1.00 0.00 ? 27  GLU A O    4  
ATOM   9827  C  CB   . GLU A 1 27  ? 7.707   -6.057  -12.897 1.00 0.00 ? 27  GLU A CB   4  
ATOM   9828  C  CG   . GLU A 1 27  ? 8.744   -6.426  -11.833 1.00 0.00 ? 27  GLU A CG   4  
ATOM   9829  C  CD   . GLU A 1 27  ? 9.203   -7.867  -12.028 1.00 0.00 ? 27  GLU A CD   4  
ATOM   9830  O  OE1  . GLU A 1 27  ? 9.418   -8.250  -13.166 1.00 0.00 ? 27  GLU A OE1  4  
ATOM   9831  O  OE2  . GLU A 1 27  ? 9.336   -8.566  -11.037 1.00 0.00 ? 27  GLU A OE2  4  
ATOM   9832  H  H    . GLU A 1 27  ? 4.755   -5.593  -13.554 1.00 0.00 ? 27  GLU A H    4  
ATOM   9833  H  HA   . GLU A 1 27  ? 6.353   -7.510  -12.106 1.00 0.00 ? 27  GLU A HA   4  
ATOM   9834  H  HB2  . GLU A 1 27  ? 7.945   -6.564  -13.821 1.00 0.00 ? 27  GLU A HB2  4  
ATOM   9835  H  HB3  . GLU A 1 27  ? 7.725   -4.990  -13.059 1.00 0.00 ? 27  GLU A HB3  4  
ATOM   9836  H  HG2  . GLU A 1 27  ? 9.594   -5.765  -11.917 1.00 0.00 ? 27  GLU A HG2  4  
ATOM   9837  H  HG3  . GLU A 1 27  ? 8.304   -6.321  -10.852 1.00 0.00 ? 27  GLU A HG3  4  
ATOM   9838  N  N    . THR A 1 28  ? 5.060   -6.172  -10.373 1.00 0.00 ? 28  THR A N    4  
ATOM   9839  C  CA   . THR A 1 28  ? 4.587   -5.438  -9.207  1.00 0.00 ? 28  THR A CA   4  
ATOM   9840  C  C    . THR A 1 28  ? 5.690   -5.337  -8.159  1.00 0.00 ? 28  THR A C    4  
ATOM   9841  O  O    . THR A 1 28  ? 6.768   -5.909  -8.322  1.00 0.00 ? 28  THR A O    4  
ATOM   9842  C  CB   . THR A 1 28  ? 3.369   -6.142  -8.604  1.00 0.00 ? 28  THR A CB   4  
ATOM   9843  O  OG1  . THR A 1 28  ? 3.543   -7.549  -8.698  1.00 0.00 ? 28  THR A OG1  4  
ATOM   9844  C  CG2  . THR A 1 28  ? 2.108   -5.730  -9.364  1.00 0.00 ? 28  THR A CG2  4  
ATOM   9845  H  H    . THR A 1 28  ? 4.765   -7.096  -10.512 1.00 0.00 ? 28  THR A H    4  
ATOM   9846  H  HA   . THR A 1 28  ? 4.300   -4.442  -9.512  1.00 0.00 ? 28  THR A HA   4  
ATOM   9847  H  HB   . THR A 1 28  ? 3.269   -5.860  -7.567  1.00 0.00 ? 28  THR A HB   4  
ATOM   9848  H  HG1  . THR A 1 28  ? 4.245   -7.719  -9.332  1.00 0.00 ? 28  THR A HG1  4  
ATOM   9849  H  HG21 . THR A 1 28  ? 1.247   -6.205  -8.916  1.00 0.00 ? 28  THR A HG21 4  
ATOM   9850  H  HG22 . THR A 1 28  ? 2.193   -6.035  -10.395 1.00 0.00 ? 28  THR A HG22 4  
ATOM   9851  H  HG23 . THR A 1 28  ? 1.993   -4.657  -9.314  1.00 0.00 ? 28  THR A HG23 4  
ATOM   9852  N  N    . TYR A 1 29  ? 5.415   -4.605  -7.086  1.00 0.00 ? 29  TYR A N    4  
ATOM   9853  C  CA   . TYR A 1 29  ? 6.393   -4.436  -6.019  1.00 0.00 ? 29  TYR A CA   4  
ATOM   9854  C  C    . TYR A 1 29  ? 5.803   -3.612  -4.879  1.00 0.00 ? 29  TYR A C    4  
ATOM   9855  O  O    . TYR A 1 29  ? 6.142   -2.440  -4.708  1.00 0.00 ? 29  TYR A O    4  
ATOM   9856  C  CB   . TYR A 1 29  ? 7.643   -3.741  -6.563  1.00 0.00 ? 29  TYR A CB   4  
ATOM   9857  C  CG   . TYR A 1 29  ? 8.579   -3.414  -5.423  1.00 0.00 ? 29  TYR A CG   4  
ATOM   9858  C  CD1  . TYR A 1 29  ? 9.155   -4.445  -4.674  1.00 0.00 ? 29  TYR A CD1  4  
ATOM   9859  C  CD2  . TYR A 1 29  ? 8.868   -2.079  -5.118  1.00 0.00 ? 29  TYR A CD2  4  
ATOM   9860  C  CE1  . TYR A 1 29  ? 10.023  -4.142  -3.617  1.00 0.00 ? 29  TYR A CE1  4  
ATOM   9861  C  CE2  . TYR A 1 29  ? 9.736   -1.776  -4.062  1.00 0.00 ? 29  TYR A CE2  4  
ATOM   9862  C  CZ   . TYR A 1 29  ? 10.313  -2.807  -3.312  1.00 0.00 ? 29  TYR A CZ   4  
ATOM   9863  O  OH   . TYR A 1 29  ? 11.168  -2.507  -2.270  1.00 0.00 ? 29  TYR A OH   4  
ATOM   9864  H  H    . TYR A 1 29  ? 4.540   -4.171  -7.010  1.00 0.00 ? 29  TYR A H    4  
ATOM   9865  H  HA   . TYR A 1 29  ? 6.671   -5.408  -5.641  1.00 0.00 ? 29  TYR A HA   4  
ATOM   9866  H  HB2  . TYR A 1 29  ? 8.143   -4.397  -7.261  1.00 0.00 ? 29  TYR A HB2  4  
ATOM   9867  H  HB3  . TYR A 1 29  ? 7.358   -2.829  -7.066  1.00 0.00 ? 29  TYR A HB3  4  
ATOM   9868  H  HD1  . TYR A 1 29  ? 8.933   -5.475  -4.909  1.00 0.00 ? 29  TYR A HD1  4  
ATOM   9869  H  HD2  . TYR A 1 29  ? 8.422   -1.283  -5.697  1.00 0.00 ? 29  TYR A HD2  4  
ATOM   9870  H  HE1  . TYR A 1 29  ? 10.469  -4.938  -3.038  1.00 0.00 ? 29  TYR A HE1  4  
ATOM   9871  H  HE2  . TYR A 1 29  ? 9.959   -0.745  -3.826  1.00 0.00 ? 29  TYR A HE2  4  
ATOM   9872  H  HH   . TYR A 1 29  ? 10.657  -2.502  -1.458  1.00 0.00 ? 29  TYR A HH   4  
ATOM   9873  N  N    . LEU A 1 30  ? 4.919   -4.230  -4.101  1.00 0.00 ? 30  LEU A N    4  
ATOM   9874  C  CA   . LEU A 1 30  ? 4.291   -3.539  -2.981  1.00 0.00 ? 30  LEU A CA   4  
ATOM   9875  C  C    . LEU A 1 30  ? 3.952   -4.517  -1.865  1.00 0.00 ? 30  LEU A C    4  
ATOM   9876  O  O    . LEU A 1 30  ? 3.536   -5.645  -2.124  1.00 0.00 ? 30  LEU A O    4  
ATOM   9877  C  CB   . LEU A 1 30  ? 3.016   -2.827  -3.447  1.00 0.00 ? 30  LEU A CB   4  
ATOM   9878  C  CG   . LEU A 1 30  ? 1.918   -3.853  -3.794  1.00 0.00 ? 30  LEU A CG   4  
ATOM   9879  C  CD1  . LEU A 1 30  ? 0.947   -4.021  -2.615  1.00 0.00 ? 30  LEU A CD1  4  
ATOM   9880  C  CD2  . LEU A 1 30  ? 1.127   -3.362  -5.007  1.00 0.00 ? 30  LEU A CD2  4  
ATOM   9881  H  H    . LEU A 1 30  ? 4.686   -5.166  -4.284  1.00 0.00 ? 30  LEU A H    4  
ATOM   9882  H  HA   . LEU A 1 30  ? 4.979   -2.800  -2.599  1.00 0.00 ? 30  LEU A HA   4  
ATOM   9883  H  HB2  . LEU A 1 30  ? 2.668   -2.181  -2.662  1.00 0.00 ? 30  LEU A HB2  4  
ATOM   9884  H  HB3  . LEU A 1 30  ? 3.243   -2.235  -4.321  1.00 0.00 ? 30  LEU A HB3  4  
ATOM   9885  H  HG   . LEU A 1 30  ? 2.372   -4.808  -4.023  1.00 0.00 ? 30  LEU A HG   4  
ATOM   9886  H  HD11 . LEU A 1 30  ? 1.428   -4.570  -1.822  1.00 0.00 ? 30  LEU A HD11 4  
ATOM   9887  H  HD12 . LEU A 1 30  ? 0.072   -4.561  -2.945  1.00 0.00 ? 30  LEU A HD12 4  
ATOM   9888  H  HD13 . LEU A 1 30  ? 0.649   -3.050  -2.251  1.00 0.00 ? 30  LEU A HD13 4  
ATOM   9889  H  HD21 . LEU A 1 30  ? 1.765   -3.366  -5.877  1.00 0.00 ? 30  LEU A HD21 4  
ATOM   9890  H  HD22 . LEU A 1 30  ? 0.776   -2.356  -4.822  1.00 0.00 ? 30  LEU A HD22 4  
ATOM   9891  H  HD23 . LEU A 1 30  ? 0.283   -4.012  -5.174  1.00 0.00 ? 30  LEU A HD23 4  
ATOM   9892  N  N    . CYS A 1 31  ? 4.123   -4.077  -0.620  1.00 0.00 ? 31  CYS A N    4  
ATOM   9893  C  CA   . CYS A 1 31  ? 3.823   -4.925  0.527   1.00 0.00 ? 31  CYS A CA   4  
ATOM   9894  C  C    . CYS A 1 31  ? 2.427   -4.601  1.058   1.00 0.00 ? 31  CYS A C    4  
ATOM   9895  O  O    . CYS A 1 31  ? 1.945   -3.480  0.903   1.00 0.00 ? 31  CYS A O    4  
ATOM   9896  C  CB   . CYS A 1 31  ? 4.875   -4.706  1.623   1.00 0.00 ? 31  CYS A CB   4  
ATOM   9897  S  SG   . CYS A 1 31  ? 5.673   -3.100  1.375   1.00 0.00 ? 31  CYS A SG   4  
ATOM   9898  H  H    . CYS A 1 31  ? 4.449   -3.163  -0.471  1.00 0.00 ? 31  CYS A H    4  
ATOM   9899  H  HA   . CYS A 1 31  ? 3.851   -5.958  0.218   1.00 0.00 ? 31  CYS A HA   4  
ATOM   9900  H  HB2  . CYS A 1 31  ? 4.405   -4.729  2.595   1.00 0.00 ? 31  CYS A HB2  4  
ATOM   9901  H  HB3  . CYS A 1 31  ? 5.620   -5.487  1.567   1.00 0.00 ? 31  CYS A HB3  4  
ATOM   9902  H  HG   . CYS A 1 31  ? 5.730   -2.939  0.431   1.00 0.00 ? 31  CYS A HG   4  
ATOM   9903  N  N    . TYR A 1 32  ? 1.781   -5.582  1.684   1.00 0.00 ? 32  TYR A N    4  
ATOM   9904  C  CA   . TYR A 1 32  ? 0.444   -5.364  2.224   1.00 0.00 ? 32  TYR A CA   4  
ATOM   9905  C  C    . TYR A 1 32  ? 0.278   -6.151  3.519   1.00 0.00 ? 32  TYR A C    4  
ATOM   9906  O  O    . TYR A 1 32  ? 0.570   -7.345  3.580   1.00 0.00 ? 32  TYR A O    4  
ATOM   9907  C  CB   . TYR A 1 32  ? -0.614  -5.773  1.170   1.00 0.00 ? 32  TYR A CB   4  
ATOM   9908  C  CG   . TYR A 1 32  ? -1.487  -6.905  1.674   1.00 0.00 ? 32  TYR A CG   4  
ATOM   9909  C  CD1  . TYR A 1 32  ? -1.070  -8.234  1.523   1.00 0.00 ? 32  TYR A CD1  4  
ATOM   9910  C  CD2  . TYR A 1 32  ? -2.709  -6.622  2.296   1.00 0.00 ? 32  TYR A CD2  4  
ATOM   9911  C  CE1  . TYR A 1 32  ? -1.876  -9.277  1.993   1.00 0.00 ? 32  TYR A CE1  4  
ATOM   9912  C  CE2  . TYR A 1 32  ? -3.513  -7.666  2.765   1.00 0.00 ? 32  TYR A CE2  4  
ATOM   9913  C  CZ   . TYR A 1 32  ? -3.097  -8.994  2.614   1.00 0.00 ? 32  TYR A CZ   4  
ATOM   9914  O  OH   . TYR A 1 32  ? -3.890  -10.023 3.080   1.00 0.00 ? 32  TYR A OH   4  
ATOM   9915  H  H    . TYR A 1 32  ? 2.208   -6.464  1.790   1.00 0.00 ? 32  TYR A H    4  
ATOM   9916  H  HA   . TYR A 1 32  ? 0.323   -4.307  2.448   1.00 0.00 ? 32  TYR A HA   4  
ATOM   9917  H  HB2  . TYR A 1 32  ? -1.240  -4.923  0.943   1.00 0.00 ? 32  TYR A HB2  4  
ATOM   9918  H  HB3  . TYR A 1 32  ? -0.109  -6.090  0.270   1.00 0.00 ? 32  TYR A HB3  4  
ATOM   9919  H  HD1  . TYR A 1 32  ? -0.128  -8.453  1.042   1.00 0.00 ? 32  TYR A HD1  4  
ATOM   9920  H  HD2  . TYR A 1 32  ? -3.030  -5.598  2.413   1.00 0.00 ? 32  TYR A HD2  4  
ATOM   9921  H  HE1  . TYR A 1 32  ? -1.555  -10.301 1.877   1.00 0.00 ? 32  TYR A HE1  4  
ATOM   9922  H  HE2  . TYR A 1 32  ? -4.455  -7.447  3.243   1.00 0.00 ? 32  TYR A HE2  4  
ATOM   9923  H  HH   . TYR A 1 32  ? -3.659  -10.185 3.996   1.00 0.00 ? 32  TYR A HH   4  
ATOM   9924  N  N    . GLU A 1 33  ? -0.178  -5.462  4.550   1.00 0.00 ? 33  GLU A N    4  
ATOM   9925  C  CA   . GLU A 1 33  ? -0.372  -6.067  5.851   1.00 0.00 ? 33  GLU A CA   4  
ATOM   9926  C  C    . GLU A 1 33  ? -1.781  -5.803  6.360   1.00 0.00 ? 33  GLU A C    4  
ATOM   9927  O  O    . GLU A 1 33  ? -2.200  -4.653  6.479   1.00 0.00 ? 33  GLU A O    4  
ATOM   9928  C  CB   . GLU A 1 33  ? 0.654   -5.464  6.800   1.00 0.00 ? 33  GLU A CB   4  
ATOM   9929  C  CG   . GLU A 1 33  ? 2.029   -6.023  6.446   1.00 0.00 ? 33  GLU A CG   4  
ATOM   9930  C  CD   . GLU A 1 33  ? 3.031   -5.693  7.548   1.00 0.00 ? 33  GLU A CD   4  
ATOM   9931  O  OE1  . GLU A 1 33  ? 2.597   -5.442  8.660   1.00 0.00 ? 33  GLU A OE1  4  
ATOM   9932  O  OE2  . GLU A 1 33  ? 4.217   -5.696  7.264   1.00 0.00 ? 33  GLU A OE2  4  
ATOM   9933  H  H    . GLU A 1 33  ? -0.370  -4.514  4.440   1.00 0.00 ? 33  GLU A H    4  
ATOM   9934  H  HA   . GLU A 1 33  ? -0.214  -7.132  5.784   1.00 0.00 ? 33  GLU A HA   4  
ATOM   9935  H  HB2  . GLU A 1 33  ? 0.663   -4.393  6.677   1.00 0.00 ? 33  GLU A HB2  4  
ATOM   9936  H  HB3  . GLU A 1 33  ? 0.407   -5.706  7.813   1.00 0.00 ? 33  GLU A HB3  4  
ATOM   9937  H  HG2  . GLU A 1 33  ? 1.960   -7.091  6.328   1.00 0.00 ? 33  GLU A HG2  4  
ATOM   9938  H  HG3  . GLU A 1 33  ? 2.360   -5.585  5.515   1.00 0.00 ? 33  GLU A HG3  4  
ATOM   9939  N  N    . VAL A 1 34  ? -2.520  -6.872  6.656   1.00 0.00 ? 34  VAL A N    4  
ATOM   9940  C  CA   . VAL A 1 34  ? -3.885  -6.717  7.145   1.00 0.00 ? 34  VAL A CA   4  
ATOM   9941  C  C    . VAL A 1 34  ? -4.141  -7.542  8.391   1.00 0.00 ? 34  VAL A C    4  
ATOM   9942  O  O    . VAL A 1 34  ? -3.574  -8.620  8.575   1.00 0.00 ? 34  VAL A O    4  
ATOM   9943  C  CB   . VAL A 1 34  ? -4.898  -7.126  6.075   1.00 0.00 ? 34  VAL A CB   4  
ATOM   9944  C  CG1  . VAL A 1 34  ? -4.607  -8.546  5.581   1.00 0.00 ? 34  VAL A CG1  4  
ATOM   9945  C  CG2  . VAL A 1 34  ? -6.305  -7.076  6.689   1.00 0.00 ? 34  VAL A CG2  4  
ATOM   9946  H  H    . VAL A 1 34  ? -2.143  -7.770  6.541   1.00 0.00 ? 34  VAL A H    4  
ATOM   9947  H  HA   . VAL A 1 34  ? -4.049  -5.683  7.388   1.00 0.00 ? 34  VAL A HA   4  
ATOM   9948  H  HB   . VAL A 1 34  ? -4.838  -6.447  5.246   1.00 0.00 ? 34  VAL A HB   4  
ATOM   9949  H  HG11 . VAL A 1 34  ? -5.342  -8.825  4.838   1.00 0.00 ? 34  VAL A HG11 4  
ATOM   9950  H  HG12 . VAL A 1 34  ? -4.656  -9.234  6.410   1.00 0.00 ? 34  VAL A HG12 4  
ATOM   9951  H  HG13 . VAL A 1 34  ? -3.621  -8.580  5.141   1.00 0.00 ? 34  VAL A HG13 4  
ATOM   9952  H  HG21 . VAL A 1 34  ? -6.379  -6.230  7.359   1.00 0.00 ? 34  VAL A HG21 4  
ATOM   9953  H  HG22 . VAL A 1 34  ? -6.482  -7.986  7.244   1.00 0.00 ? 34  VAL A HG22 4  
ATOM   9954  H  HG23 . VAL A 1 34  ? -7.041  -6.979  5.907   1.00 0.00 ? 34  VAL A HG23 4  
ATOM   9955  N  N    . GLU A 1 35  ? -5.029  -7.026  9.236   1.00 0.00 ? 35  GLU A N    4  
ATOM   9956  C  CA   . GLU A 1 35  ? -5.401  -7.709  10.461  1.00 0.00 ? 35  GLU A CA   4  
ATOM   9957  C  C    . GLU A 1 35  ? -6.912  -7.801  10.566  1.00 0.00 ? 35  GLU A C    4  
ATOM   9958  O  O    . GLU A 1 35  ? -7.634  -6.911  10.116  1.00 0.00 ? 35  GLU A O    4  
ATOM   9959  C  CB   . GLU A 1 35  ? -4.838  -6.968  11.675  1.00 0.00 ? 35  GLU A CB   4  
ATOM   9960  C  CG   . GLU A 1 35  ? -3.310  -6.974  11.604  1.00 0.00 ? 35  GLU A CG   4  
ATOM   9961  C  CD   . GLU A 1 35  ? -2.715  -6.958  13.009  1.00 0.00 ? 35  GLU A CD   4  
ATOM   9962  O  OE1  . GLU A 1 35  ? -2.867  -5.954  13.685  1.00 0.00 ? 35  GLU A OE1  4  
ATOM   9963  O  OE2  . GLU A 1 35  ? -2.116  -7.951  13.388  1.00 0.00 ? 35  GLU A OE2  4  
ATOM   9964  H  H    . GLU A 1 35  ? -5.451  -6.171  9.021   1.00 0.00 ? 35  GLU A H    4  
ATOM   9965  H  HA   . GLU A 1 35  ? -4.998  -8.708  10.439  1.00 0.00 ? 35  GLU A HA   4  
ATOM   9966  H  HB2  . GLU A 1 35  ? -5.198  -5.949  11.673  1.00 0.00 ? 35  GLU A HB2  4  
ATOM   9967  H  HB3  . GLU A 1 35  ? -5.158  -7.464  12.579  1.00 0.00 ? 35  GLU A HB3  4  
ATOM   9968  H  HG2  . GLU A 1 35  ? -2.982  -7.862  11.084  1.00 0.00 ? 35  GLU A HG2  4  
ATOM   9969  H  HG3  . GLU A 1 35  ? -2.974  -6.100  11.064  1.00 0.00 ? 35  GLU A HG3  4  
ATOM   9970  N  N    . ARG A 1 36  ? -7.383  -8.892  11.148  1.00 0.00 ? 36  ARG A N    4  
ATOM   9971  C  CA   . ARG A 1 36  ? -8.815  -9.111  11.294  1.00 0.00 ? 36  ARG A CA   4  
ATOM   9972  C  C    . ARG A 1 36  ? -9.263  -8.878  12.732  1.00 0.00 ? 36  ARG A C    4  
ATOM   9973  O  O    . ARG A 1 36  ? -8.586  -9.274  13.683  1.00 0.00 ? 36  ARG A O    4  
ATOM   9974  C  CB   . ARG A 1 36  ? -9.161  -10.542 10.878  1.00 0.00 ? 36  ARG A CB   4  
ATOM   9975  C  CG   . ARG A 1 36  ? -8.013  -11.479 11.258  1.00 0.00 ? 36  ARG A CG   4  
ATOM   9976  C  CD   . ARG A 1 36  ? -8.448  -12.929 11.041  1.00 0.00 ? 36  ARG A CD   4  
ATOM   9977  N  NE   . ARG A 1 36  ? -7.510  -13.842 11.683  1.00 0.00 ? 36  ARG A NE   4  
ATOM   9978  C  CZ   . ARG A 1 36  ? -7.574  -15.152 11.469  1.00 0.00 ? 36  ARG A CZ   4  
ATOM   9979  N  NH1  . ARG A 1 36  ? -8.484  -15.638 10.670  1.00 0.00 ? 36  ARG A NH1  4  
ATOM   9980  N  NH2  . ARG A 1 36  ? -6.727  -15.953 12.058  1.00 0.00 ? 36  ARG A NH2  4  
ATOM   9981  H  H    . ARG A 1 36  ? -6.753  -9.570  11.476  1.00 0.00 ? 36  ARG A H    4  
ATOM   9982  H  HA   . ARG A 1 36  ? -9.346  -8.427  10.649  1.00 0.00 ? 36  ARG A HA   4  
ATOM   9983  H  HB2  . ARG A 1 36  ? -10.064 -10.857 11.382  1.00 0.00 ? 36  ARG A HB2  4  
ATOM   9984  H  HB3  . ARG A 1 36  ? -9.314  -10.579 9.809   1.00 0.00 ? 36  ARG A HB3  4  
ATOM   9985  H  HG2  . ARG A 1 36  ? -7.153  -11.263 10.642  1.00 0.00 ? 36  ARG A HG2  4  
ATOM   9986  H  HG3  . ARG A 1 36  ? -7.758  -11.333 12.297  1.00 0.00 ? 36  ARG A HG3  4  
ATOM   9987  H  HD2  . ARG A 1 36  ? -9.430  -13.074 11.464  1.00 0.00 ? 36  ARG A HD2  4  
ATOM   9988  H  HD3  . ARG A 1 36  ? -8.484  -13.135 9.981   1.00 0.00 ? 36  ARG A HD3  4  
ATOM   9989  H  HE   . ARG A 1 36  ? -6.822  -13.484 12.282  1.00 0.00 ? 36  ARG A HE   4  
ATOM   9990  H  HH11 . ARG A 1 36  ? -9.132  -15.026 10.219  1.00 0.00 ? 36  ARG A HH11 4  
ATOM   9991  H  HH12 . ARG A 1 36  ? -8.533  -16.625 10.510  1.00 0.00 ? 36  ARG A HH12 4  
ATOM   9992  H  HH21 . ARG A 1 36  ? -6.029  -15.580 12.669  1.00 0.00 ? 36  ARG A HH21 4  
ATOM   9993  H  HH22 . ARG A 1 36  ? -6.776  -16.938 11.897  1.00 0.00 ? 36  ARG A HH22 4  
ATOM   9994  N  N    . MET A 1 37  ? -10.423 -8.248  12.878  1.00 0.00 ? 37  MET A N    4  
ATOM   9995  C  CA   . MET A 1 37  ? -10.977 -7.986  14.197  1.00 0.00 ? 37  MET A CA   4  
ATOM   9996  C  C    . MET A 1 37  ? -12.079 -8.983  14.493  1.00 0.00 ? 37  MET A C    4  
ATOM   9997  O  O    . MET A 1 37  ? -12.849 -9.342  13.602  1.00 0.00 ? 37  MET A O    4  
ATOM   9998  C  CB   . MET A 1 37  ? -11.550 -6.578  14.275  1.00 0.00 ? 37  MET A CB   4  
ATOM   9999  C  CG   . MET A 1 37  ? -10.438 -5.548  14.053  1.00 0.00 ? 37  MET A CG   4  
ATOM   10000 S  SD   . MET A 1 37  ? -11.029 -3.902  14.523  1.00 0.00 ? 37  MET A SD   4  
ATOM   10001 C  CE   . MET A 1 37  ? -11.385 -4.281  16.254  1.00 0.00 ? 37  MET A CE   4  
ATOM   10002 H  H    . MET A 1 37  ? -10.922 -7.971  12.083  1.00 0.00 ? 37  MET A H    4  
ATOM   10003 H  HA   . MET A 1 37  ? -10.204 -8.086  14.939  1.00 0.00 ? 37  MET A HA   4  
ATOM   10004 H  HB2  . MET A 1 37  ? -12.307 -6.457  13.530  1.00 0.00 ? 37  MET A HB2  4  
ATOM   10005 H  HB3  . MET A 1 37  ? -11.988 -6.440  15.241  1.00 0.00 ? 37  MET A HB3  4  
ATOM   10006 H  HG2  . MET A 1 37  ? -9.580  -5.808  14.653  1.00 0.00 ? 37  MET A HG2  4  
ATOM   10007 H  HG3  . MET A 1 37  ? -10.158 -5.543  13.010  1.00 0.00 ? 37  MET A HG3  4  
ATOM   10008 H  HE1  . MET A 1 37  ? -10.764 -5.106  16.574  1.00 0.00 ? 37  MET A HE1  4  
ATOM   10009 H  HE2  . MET A 1 37  ? -12.429 -4.552  16.355  1.00 0.00 ? 37  MET A HE2  4  
ATOM   10010 H  HE3  . MET A 1 37  ? -11.178 -3.423  16.862  1.00 0.00 ? 37  MET A HE3  4  
ATOM   10011 N  N    . HIS A 1 38  ? -12.164 -9.418  15.745  1.00 0.00 ? 38  HIS A N    4  
ATOM   10012 C  CA   . HIS A 1 38  ? -13.188 -10.370 16.148  1.00 0.00 ? 38  HIS A CA   4  
ATOM   10013 C  C    . HIS A 1 38  ? -14.121 -9.701  17.131  1.00 0.00 ? 38  HIS A C    4  
ATOM   10014 O  O    . HIS A 1 38  ? -13.796 -9.549  18.301  1.00 0.00 ? 38  HIS A O    4  
ATOM   10015 C  CB   . HIS A 1 38  ? -12.543 -11.593 16.804  1.00 0.00 ? 38  HIS A CB   4  
ATOM   10016 C  CG   . HIS A 1 38  ? -13.608 -12.443 17.441  1.00 0.00 ? 38  HIS A CG   4  
ATOM   10017 N  ND1  . HIS A 1 38  ? -13.847 -12.429 18.805  1.00 0.00 ? 38  HIS A ND1  4  
ATOM   10018 C  CD2  . HIS A 1 38  ? -14.506 -13.337 16.912  1.00 0.00 ? 38  HIS A CD2  4  
ATOM   10019 C  CE1  . HIS A 1 38  ? -14.851 -13.291 19.051  1.00 0.00 ? 38  HIS A CE1  4  
ATOM   10020 N  NE2  . HIS A 1 38  ? -15.289 -13.872 17.930  1.00 0.00 ? 38  HIS A NE2  4  
ATOM   10021 H  H    . HIS A 1 38  ? -11.536 -9.077  16.421  1.00 0.00 ? 38  HIS A H    4  
ATOM   10022 H  HA   . HIS A 1 38  ? -13.751 -10.688 15.282  1.00 0.00 ? 38  HIS A HA   4  
ATOM   10023 H  HB2  . HIS A 1 38  ? -12.023 -12.171 16.054  1.00 0.00 ? 38  HIS A HB2  4  
ATOM   10024 H  HB3  . HIS A 1 38  ? -11.843 -11.267 17.562  1.00 0.00 ? 38  HIS A HB3  4  
ATOM   10025 H  HD1  . HIS A 1 38  ? -13.371 -11.890 19.472  1.00 0.00 ? 38  HIS A HD1  4  
ATOM   10026 H  HD2  . HIS A 1 38  ? -14.590 -13.589 15.865  1.00 0.00 ? 38  HIS A HD2  4  
ATOM   10027 H  HE1  . HIS A 1 38  ? -15.252 -13.489 20.033  1.00 0.00 ? 38  HIS A HE1  4  
ATOM   10028 H  HE2  . HIS A 1 38  ? -16.007 -14.533 17.845  1.00 0.00 ? 38  HIS A HE2  4  
ATOM   10029 N  N    . ASN A 1 39  ? -15.270 -9.274  16.655  1.00 0.00 ? 39  ASN A N    4  
ATOM   10030 C  CA   . ASN A 1 39  ? -16.198 -8.603  17.533  1.00 0.00 ? 39  ASN A CA   4  
ATOM   10031 C  C    . ASN A 1 39  ? -15.603 -7.276  17.979  1.00 0.00 ? 39  ASN A C    4  
ATOM   10032 O  O    . ASN A 1 39  ? -14.723 -6.718  17.324  1.00 0.00 ? 39  ASN A O    4  
ATOM   10033 C  CB   . ASN A 1 39  ? -16.469 -9.469  18.767  1.00 0.00 ? 39  ASN A CB   4  
ATOM   10034 C  CG   . ASN A 1 39  ? -17.787 -9.074  19.404  1.00 0.00 ? 39  ASN A CG   4  
ATOM   10035 O  OD1  . ASN A 1 39  ? -18.472 -8.174  18.920  1.00 0.00 ? 39  ASN A OD1  4  
ATOM   10036 N  ND2  . ASN A 1 39  ? -18.184 -9.702  20.471  1.00 0.00 ? 39  ASN A ND2  4  
ATOM   10037 H  H    . ASN A 1 39  ? -15.488 -9.396  15.707  1.00 0.00 ? 39  ASN A H    4  
ATOM   10038 H  HA   . ASN A 1 39  ? -17.126 -8.425  17.011  1.00 0.00 ? 39  ASN A HA   4  
ATOM   10039 H  HB2  . ASN A 1 39  ? -16.515 -10.507 18.478  1.00 0.00 ? 39  ASN A HB2  4  
ATOM   10040 H  HB3  . ASN A 1 39  ? -15.672 -9.331  19.491  1.00 0.00 ? 39  ASN A HB3  4  
ATOM   10041 H  HD21 . ASN A 1 39  ? -17.632 -10.420 20.853  1.00 0.00 ? 39  ASN A HD21 4  
ATOM   10042 H  HD22 . ASN A 1 39  ? -19.030 -9.458  20.891  1.00 0.00 ? 39  ASN A HD22 4  
ATOM   10043 N  N    . ASP A 1 40  ? -16.096 -6.787  19.096  1.00 0.00 ? 40  ASP A N    4  
ATOM   10044 C  CA   . ASP A 1 40  ? -15.636 -5.528  19.656  1.00 0.00 ? 40  ASP A CA   4  
ATOM   10045 C  C    . ASP A 1 40  ? -14.126 -5.507  19.911  1.00 0.00 ? 40  ASP A C    4  
ATOM   10046 O  O    . ASP A 1 40  ? -13.645 -4.593  20.582  1.00 0.00 ? 40  ASP A O    4  
ATOM   10047 C  CB   . ASP A 1 40  ? -16.347 -5.279  20.983  1.00 0.00 ? 40  ASP A CB   4  
ATOM   10048 C  CG   . ASP A 1 40  ? -17.764 -4.777  20.732  1.00 0.00 ? 40  ASP A CG   4  
ATOM   10049 O  OD1  . ASP A 1 40  ? -17.926 -3.577  20.574  1.00 0.00 ? 40  ASP A OD1  4  
ATOM   10050 O  OD2  . ASP A 1 40  ? -18.667 -5.596  20.701  1.00 0.00 ? 40  ASP A OD2  4  
ATOM   10051 H  H    . ASP A 1 40  ? -16.796 -7.285  19.560  1.00 0.00 ? 40  ASP A H    4  
ATOM   10052 H  HA   . ASP A 1 40  ? -15.889 -4.731  18.978  1.00 0.00 ? 40  ASP A HA   4  
ATOM   10053 H  HB2  . ASP A 1 40  ? -16.385 -6.204  21.543  1.00 0.00 ? 40  ASP A HB2  4  
ATOM   10054 H  HB3  . ASP A 1 40  ? -15.799 -4.541  21.551  1.00 0.00 ? 40  ASP A HB3  4  
ATOM   10055 N  N    . THR A 1 41  ? -13.369 -6.503  19.428  1.00 0.00 ? 41  THR A N    4  
ATOM   10056 C  CA   . THR A 1 41  ? -11.939 -6.515  19.698  1.00 0.00 ? 41  THR A CA   4  
ATOM   10057 C  C    . THR A 1 41  ? -11.110 -6.792  18.459  1.00 0.00 ? 41  THR A C    4  
ATOM   10058 O  O    . THR A 1 41  ? -11.637 -7.056  17.381  1.00 0.00 ? 41  THR A O    4  
ATOM   10059 C  CB   . THR A 1 41  ? -11.647 -7.525  20.796  1.00 0.00 ? 41  THR A CB   4  
ATOM   10060 O  OG1  . THR A 1 41  ? -10.473 -7.138  21.496  1.00 0.00 ? 41  THR A OG1  4  
ATOM   10061 C  CG2  . THR A 1 41  ? -11.454 -8.921  20.206  1.00 0.00 ? 41  THR A CG2  4  
ATOM   10062 H  H    . THR A 1 41  ? -13.765 -7.241  18.921  1.00 0.00 ? 41  THR A H    4  
ATOM   10063 H  HA   . THR A 1 41  ? -11.655 -5.548  20.058  1.00 0.00 ? 41  THR A HA   4  
ATOM   10064 H  HB   . THR A 1 41  ? -12.482 -7.538  21.473  1.00 0.00 ? 41  THR A HB   4  
ATOM   10065 H  HG1  . THR A 1 41  ? -9.770  -7.017  20.853  1.00 0.00 ? 41  THR A HG1  4  
ATOM   10066 H  HG21 . THR A 1 41  ? -11.885 -9.651  20.871  1.00 0.00 ? 41  THR A HG21 4  
ATOM   10067 H  HG22 . THR A 1 41  ? -10.403 -9.115  20.087  1.00 0.00 ? 41  THR A HG22 4  
ATOM   10068 H  HG23 . THR A 1 41  ? -11.939 -8.981  19.249  1.00 0.00 ? 41  THR A HG23 4  
ATOM   10069 N  N    . TRP A 1 42  ? -9.800  -6.697  18.636  1.00 0.00 ? 42  TRP A N    4  
ATOM   10070 C  CA   . TRP A 1 42  ? -8.856  -6.897  17.539  1.00 0.00 ? 42  TRP A CA   4  
ATOM   10071 C  C    . TRP A 1 42  ? -8.075  -8.198  17.681  1.00 0.00 ? 42  TRP A C    4  
ATOM   10072 O  O    . TRP A 1 42  ? -7.797  -8.655  18.790  1.00 0.00 ? 42  TRP A O    4  
ATOM   10073 C  CB   . TRP A 1 42  ? -7.877  -5.723  17.487  1.00 0.00 ? 42  TRP A CB   4  
ATOM   10074 C  CG   . TRP A 1 42  ? -6.943  -5.799  18.652  1.00 0.00 ? 42  TRP A CG   4  
ATOM   10075 C  CD1  . TRP A 1 42  ? -7.294  -5.601  19.944  1.00 0.00 ? 42  TRP A CD1  4  
ATOM   10076 C  CD2  . TRP A 1 42  ? -5.515  -6.086  18.657  1.00 0.00 ? 42  TRP A CD2  4  
ATOM   10077 N  NE1  . TRP A 1 42  ? -6.172  -5.751  20.739  1.00 0.00 ? 42  TRP A NE1  4  
ATOM   10078 C  CE2  . TRP A 1 42  ? -5.054  -6.050  19.993  1.00 0.00 ? 42  TRP A CE2  4  
ATOM   10079 C  CE3  . TRP A 1 42  ? -4.582  -6.373  17.643  1.00 0.00 ? 42  TRP A CE3  4  
ATOM   10080 C  CZ2  . TRP A 1 42  ? -3.723  -6.287  20.316  1.00 0.00 ? 42  TRP A CZ2  4  
ATOM   10081 C  CZ3  . TRP A 1 42  ? -3.236  -6.614  17.964  1.00 0.00 ? 42  TRP A CZ3  4  
ATOM   10082 C  CH2  . TRP A 1 42  ? -2.807  -6.571  19.299  1.00 0.00 ? 42  TRP A CH2  4  
ATOM   10083 H  H    . TRP A 1 42  ? -9.466  -6.474  19.529  1.00 0.00 ? 42  TRP A H    4  
ATOM   10084 H  HA   . TRP A 1 42  ? -9.400  -6.922  16.615  1.00 0.00 ? 42  TRP A HA   4  
ATOM   10085 H  HB2  . TRP A 1 42  ? -7.309  -5.768  16.568  1.00 0.00 ? 42  TRP A HB2  4  
ATOM   10086 H  HB3  . TRP A 1 42  ? -8.426  -4.794  17.526  1.00 0.00 ? 42  TRP A HB3  4  
ATOM   10087 H  HD1  . TRP A 1 42  ? -8.288  -5.366  20.297  1.00 0.00 ? 42  TRP A HD1  4  
ATOM   10088 H  HE1  . TRP A 1 42  ? -6.151  -5.661  21.714  1.00 0.00 ? 42  TRP A HE1  4  
ATOM   10089 H  HE3  . TRP A 1 42  ? -4.903  -6.407  16.612  1.00 0.00 ? 42  TRP A HE3  4  
ATOM   10090 H  HZ2  . TRP A 1 42  ? -3.403  -6.253  21.346  1.00 0.00 ? 42  TRP A HZ2  4  
ATOM   10091 H  HZ3  . TRP A 1 42  ? -2.528  -6.833  17.180  1.00 0.00 ? 42  TRP A HZ3  4  
ATOM   10092 H  HH2  . TRP A 1 42  ? -1.770  -6.757  19.541  1.00 0.00 ? 42  TRP A HH2  4  
ATOM   10093 N  N    . VAL A 1 43  ? -7.710  -8.778  16.536  1.00 0.00 ? 43  VAL A N    4  
ATOM   10094 C  CA   . VAL A 1 43  ? -6.942  -10.018 16.515  1.00 0.00 ? 43  VAL A CA   4  
ATOM   10095 C  C    . VAL A 1 43  ? -5.683  -9.833  15.672  1.00 0.00 ? 43  VAL A C    4  
ATOM   10096 O  O    . VAL A 1 43  ? -5.661  -9.022  14.747  1.00 0.00 ? 43  VAL A O    4  
ATOM   10097 C  CB   . VAL A 1 43  ? -7.790  -11.152 15.928  1.00 0.00 ? 43  VAL A CB   4  
ATOM   10098 C  CG1  . VAL A 1 43  ? -7.322  -12.493 16.498  1.00 0.00 ? 43  VAL A CG1  4  
ATOM   10099 C  CG2  . VAL A 1 43  ? -9.259  -10.928 16.293  1.00 0.00 ? 43  VAL A CG2  4  
ATOM   10100 H  H    . VAL A 1 43  ? -7.955  -8.355  15.686  1.00 0.00 ? 43  VAL A H    4  
ATOM   10101 H  HA   . VAL A 1 43  ? -6.656  -10.278 17.524  1.00 0.00 ? 43  VAL A HA   4  
ATOM   10102 H  HB   . VAL A 1 43  ? -7.682  -11.162 14.853  1.00 0.00 ? 43  VAL A HB   4  
ATOM   10103 H  HG11 . VAL A 1 43  ? -7.652  -13.293 15.851  1.00 0.00 ? 43  VAL A HG11 4  
ATOM   10104 H  HG12 . VAL A 1 43  ? -7.740  -12.632 17.484  1.00 0.00 ? 43  VAL A HG12 4  
ATOM   10105 H  HG13 . VAL A 1 43  ? -6.244  -12.503 16.559  1.00 0.00 ? 43  VAL A HG13 4  
ATOM   10106 H  HG21 . VAL A 1 43  ? -9.323  -10.487 17.277  1.00 0.00 ? 43  VAL A HG21 4  
ATOM   10107 H  HG22 . VAL A 1 43  ? -9.778  -11.874 16.288  1.00 0.00 ? 43  VAL A HG22 4  
ATOM   10108 H  HG23 . VAL A 1 43  ? -9.710  -10.264 15.571  1.00 0.00 ? 43  VAL A HG23 4  
ATOM   10109 N  N    . LEU A 1 44  ? -4.636  -10.585 15.997  1.00 0.00 ? 44  LEU A N    4  
ATOM   10110 C  CA   . LEU A 1 44  ? -3.379  -10.492 15.267  1.00 0.00 ? 44  LEU A CA   4  
ATOM   10111 C  C    . LEU A 1 44  ? -3.079  -11.807 14.557  1.00 0.00 ? 44  LEU A C    4  
ATOM   10112 O  O    . LEU A 1 44  ? -2.643  -12.774 15.180  1.00 0.00 ? 44  LEU A O    4  
ATOM   10113 C  CB   . LEU A 1 44  ? -2.242  -10.165 16.236  1.00 0.00 ? 44  LEU A CB   4  
ATOM   10114 C  CG   . LEU A 1 44  ? -2.438  -10.934 17.550  1.00 0.00 ? 44  LEU A CG   4  
ATOM   10115 C  CD1  . LEU A 1 44  ? -1.076  -11.237 18.179  1.00 0.00 ? 44  LEU A CD1  4  
ATOM   10116 C  CD2  . LEU A 1 44  ? -3.269  -10.090 18.523  1.00 0.00 ? 44  LEU A CD2  4  
ATOM   10117 H  H    . LEU A 1 44  ? -4.707  -11.211 16.743  1.00 0.00 ? 44  LEU A H    4  
ATOM   10118 H  HA   . LEU A 1 44  ? -3.448  -9.703  14.532  1.00 0.00 ? 44  LEU A HA   4  
ATOM   10119 H  HB2  . LEU A 1 44  ? -1.301  -10.449 15.788  1.00 0.00 ? 44  LEU A HB2  4  
ATOM   10120 H  HB3  . LEU A 1 44  ? -2.237  -9.104  16.438  1.00 0.00 ? 44  LEU A HB3  4  
ATOM   10121 H  HG   . LEU A 1 44  ? -2.953  -11.864 17.350  1.00 0.00 ? 44  LEU A HG   4  
ATOM   10122 H  HD11 . LEU A 1 44  ? -1.219  -11.743 19.123  1.00 0.00 ? 44  LEU A HD11 4  
ATOM   10123 H  HD12 . LEU A 1 44  ? -0.541  -10.313 18.343  1.00 0.00 ? 44  LEU A HD12 4  
ATOM   10124 H  HD13 . LEU A 1 44  ? -0.505  -11.870 17.515  1.00 0.00 ? 44  LEU A HD13 4  
ATOM   10125 H  HD21 . LEU A 1 44  ? -3.988  -9.504  17.971  1.00 0.00 ? 44  LEU A HD21 4  
ATOM   10126 H  HD22 . LEU A 1 44  ? -2.616  -9.428  19.076  1.00 0.00 ? 44  LEU A HD22 4  
ATOM   10127 H  HD23 . LEU A 1 44  ? -3.787  -10.739 19.213  1.00 0.00 ? 44  LEU A HD23 4  
ATOM   10128 N  N    . LEU A 1 45  ? -3.317  -11.836 13.250  1.00 0.00 ? 45  LEU A N    4  
ATOM   10129 C  CA   . LEU A 1 45  ? -3.068  -13.043 12.472  1.00 0.00 ? 45  LEU A CA   4  
ATOM   10130 C  C    . LEU A 1 45  ? -1.724  -13.654 12.856  1.00 0.00 ? 45  LEU A C    4  
ATOM   10131 O  O    . LEU A 1 45  ? -0.930  -13.035 13.565  1.00 0.00 ? 45  LEU A O    4  
ATOM   10132 C  CB   . LEU A 1 45  ? -3.082  -12.718 10.975  1.00 0.00 ? 45  LEU A CB   4  
ATOM   10133 C  CG   . LEU A 1 45  ? -2.525  -11.311 10.746  1.00 0.00 ? 45  LEU A CG   4  
ATOM   10134 C  CD1  . LEU A 1 45  ? -1.140  -11.197 11.383  1.00 0.00 ? 45  LEU A CD1  4  
ATOM   10135 C  CD2  . LEU A 1 45  ? -2.416  -11.051 9.246   1.00 0.00 ? 45  LEU A CD2  4  
ATOM   10136 H  H    . LEU A 1 45  ? -3.667  -11.035 12.804  1.00 0.00 ? 45  LEU A H    4  
ATOM   10137 H  HA   . LEU A 1 45  ? -3.849  -13.759 12.679  1.00 0.00 ? 45  LEU A HA   4  
ATOM   10138 H  HB2  . LEU A 1 45  ? -2.475  -13.436 10.443  1.00 0.00 ? 45  LEU A HB2  4  
ATOM   10139 H  HB3  . LEU A 1 45  ? -4.096  -12.764 10.608  1.00 0.00 ? 45  LEU A HB3  4  
ATOM   10140 H  HG   . LEU A 1 45  ? -3.187  -10.583 11.190  1.00 0.00 ? 45  LEU A HG   4  
ATOM   10141 H  HD11 . LEU A 1 45  ? -0.616  -10.354 10.958  1.00 0.00 ? 45  LEU A HD11 4  
ATOM   10142 H  HD12 . LEU A 1 45  ? -0.579  -12.101 11.194  1.00 0.00 ? 45  LEU A HD12 4  
ATOM   10143 H  HD13 . LEU A 1 45  ? -1.244  -11.054 12.450  1.00 0.00 ? 45  LEU A HD13 4  
ATOM   10144 H  HD21 . LEU A 1 45  ? -1.892  -10.121 9.081   1.00 0.00 ? 45  LEU A HD21 4  
ATOM   10145 H  HD22 . LEU A 1 45  ? -3.406  -10.986 8.820   1.00 0.00 ? 45  LEU A HD22 4  
ATOM   10146 H  HD23 . LEU A 1 45  ? -1.874  -11.859 8.780   1.00 0.00 ? 45  LEU A HD23 4  
ATOM   10147 N  N    . ASN A 1 46  ? -1.476  -14.874 12.390  1.00 0.00 ? 46  ASN A N    4  
ATOM   10148 C  CA   . ASN A 1 46  ? -0.226  -15.560 12.697  1.00 0.00 ? 46  ASN A CA   4  
ATOM   10149 C  C    . ASN A 1 46  ? 0.276   -16.335 11.483  1.00 0.00 ? 46  ASN A C    4  
ATOM   10150 O  O    . ASN A 1 46  ? 0.102   -17.551 11.397  1.00 0.00 ? 46  ASN A O    4  
ATOM   10151 C  CB   . ASN A 1 46  ? -0.435  -16.524 13.867  1.00 0.00 ? 46  ASN A CB   4  
ATOM   10152 C  CG   . ASN A 1 46  ? 0.907   -16.879 14.498  1.00 0.00 ? 46  ASN A CG   4  
ATOM   10153 O  OD1  . ASN A 1 46  ? 1.160   -16.536 15.654  1.00 0.00 ? 46  ASN A OD1  4  
ATOM   10154 N  ND2  . ASN A 1 46  ? 1.786   -17.550 13.806  1.00 0.00 ? 46  ASN A ND2  4  
ATOM   10155 H  H    . ASN A 1 46  ? -2.147  -15.322 11.832  1.00 0.00 ? 46  ASN A H    4  
ATOM   10156 H  HA   . ASN A 1 46  ? 0.519   -14.830 12.976  1.00 0.00 ? 46  ASN A HA   4  
ATOM   10157 H  HB2  . ASN A 1 46  ? -1.067  -16.054 14.607  1.00 0.00 ? 46  ASN A HB2  4  
ATOM   10158 H  HB3  . ASN A 1 46  ? -0.911  -17.424 13.510  1.00 0.00 ? 46  ASN A HB3  4  
ATOM   10159 H  HD21 . ASN A 1 46  ? 1.582   -17.823 12.888  1.00 0.00 ? 46  ASN A HD21 4  
ATOM   10160 H  HD22 . ASN A 1 46  ? 2.650   -17.782 14.206  1.00 0.00 ? 46  ASN A HD22 4  
ATOM   10161 N  N    . GLN A 1 47  ? 0.900   -15.625 10.549  1.00 0.00 ? 47  GLN A N    4  
ATOM   10162 C  CA   . GLN A 1 47  ? 1.423   -16.263 9.346   1.00 0.00 ? 47  GLN A CA   4  
ATOM   10163 C  C    . GLN A 1 47  ? 2.681   -15.549 8.859   1.00 0.00 ? 47  GLN A C    4  
ATOM   10164 O  O    . GLN A 1 47  ? 3.793   -16.025 9.075   1.00 0.00 ? 47  GLN A O    4  
ATOM   10165 C  CB   . GLN A 1 47  ? 0.360   -16.259 8.243   1.00 0.00 ? 47  GLN A CB   4  
ATOM   10166 C  CG   . GLN A 1 47  ? 0.647   -17.390 7.252   1.00 0.00 ? 47  GLN A CG   4  
ATOM   10167 C  CD   . GLN A 1 47  ? 0.021   -18.689 7.747   1.00 0.00 ? 47  GLN A CD   4  
ATOM   10168 O  OE1  . GLN A 1 47  ? -1.195  -18.765 7.923   1.00 0.00 ? 47  GLN A OE1  4  
ATOM   10169 N  NE2  . GLN A 1 47  ? 0.783   -19.722 7.983   1.00 0.00 ? 47  GLN A NE2  4  
ATOM   10170 H  H    . GLN A 1 47  ? 1.011   -14.660 10.670  1.00 0.00 ? 47  GLN A H    4  
ATOM   10171 H  HA   . GLN A 1 47  ? 1.675   -17.285 9.578   1.00 0.00 ? 47  GLN A HA   4  
ATOM   10172 H  HB2  . GLN A 1 47  ? -0.615  -16.405 8.684   1.00 0.00 ? 47  GLN A HB2  4  
ATOM   10173 H  HB3  . GLN A 1 47  ? 0.381   -15.314 7.723   1.00 0.00 ? 47  GLN A HB3  4  
ATOM   10174 H  HG2  . GLN A 1 47  ? 0.230   -17.136 6.288   1.00 0.00 ? 47  GLN A HG2  4  
ATOM   10175 H  HG3  . GLN A 1 47  ? 1.714   -17.523 7.157   1.00 0.00 ? 47  GLN A HG3  4  
ATOM   10176 H  HE21 . GLN A 1 47  ? 1.751   -19.659 7.841   1.00 0.00 ? 47  GLN A HE21 4  
ATOM   10177 H  HE22 . GLN A 1 47  ? 0.388   -20.561 8.301   1.00 0.00 ? 47  GLN A HE22 4  
ATOM   10178 N  N    . ARG A 1 48  ? 2.496   -14.406 8.202   1.00 0.00 ? 48  ARG A N    4  
ATOM   10179 C  CA   . ARG A 1 48  ? 3.618   -13.635 7.685   1.00 0.00 ? 48  ARG A CA   4  
ATOM   10180 C  C    . ARG A 1 48  ? 3.113   -12.438 6.887   1.00 0.00 ? 48  ARG A C    4  
ATOM   10181 O  O    . ARG A 1 48  ? 2.083   -12.515 6.217   1.00 0.00 ? 48  ARG A O    4  
ATOM   10182 C  CB   . ARG A 1 48  ? 4.499   -14.505 6.780   1.00 0.00 ? 48  ARG A CB   4  
ATOM   10183 C  CG   . ARG A 1 48  ? 3.625   -15.268 5.780   1.00 0.00 ? 48  ARG A CG   4  
ATOM   10184 C  CD   . ARG A 1 48  ? 4.447   -16.385 5.132   1.00 0.00 ? 48  ARG A CD   4  
ATOM   10185 N  NE   . ARG A 1 48  ? 5.705   -15.855 4.617   1.00 0.00 ? 48  ARG A NE   4  
ATOM   10186 C  CZ   . ARG A 1 48  ? 6.472   -16.577 3.806   1.00 0.00 ? 48  ARG A CZ   4  
ATOM   10187 N  NH1  . ARG A 1 48  ? 6.104   -17.780 3.459   1.00 0.00 ? 48  ARG A NH1  4  
ATOM   10188 N  NH2  . ARG A 1 48  ? 7.594   -16.084 3.356   1.00 0.00 ? 48  ARG A NH2  4  
ATOM   10189 H  H    . ARG A 1 48  ? 1.587   -14.074 8.062   1.00 0.00 ? 48  ARG A H    4  
ATOM   10190 H  HA   . ARG A 1 48  ? 4.212   -13.279 8.513   1.00 0.00 ? 48  ARG A HA   4  
ATOM   10191 H  HB2  . ARG A 1 48  ? 5.190   -13.873 6.242   1.00 0.00 ? 48  ARG A HB2  4  
ATOM   10192 H  HB3  . ARG A 1 48  ? 5.054   -15.208 7.382   1.00 0.00 ? 48  ARG A HB3  4  
ATOM   10193 H  HG2  . ARG A 1 48  ? 2.778   -15.698 6.293   1.00 0.00 ? 48  ARG A HG2  4  
ATOM   10194 H  HG3  . ARG A 1 48  ? 3.277   -14.591 5.016   1.00 0.00 ? 48  ARG A HG3  4  
ATOM   10195 H  HD2  . ARG A 1 48  ? 4.657   -17.146 5.867   1.00 0.00 ? 48  ARG A HD2  4  
ATOM   10196 H  HD3  . ARG A 1 48  ? 3.879   -16.819 4.321   1.00 0.00 ? 48  ARG A HD3  4  
ATOM   10197 H  HE   . ARG A 1 48  ? 5.989   -14.953 4.873   1.00 0.00 ? 48  ARG A HE   4  
ATOM   10198 H  HH11 . ARG A 1 48  ? 5.245   -18.158 3.802   1.00 0.00 ? 48  ARG A HH11 4  
ATOM   10199 H  HH12 . ARG A 1 48  ? 6.681   -18.322 2.848   1.00 0.00 ? 48  ARG A HH12 4  
ATOM   10200 H  HH21 . ARG A 1 48  ? 7.878   -15.163 3.623   1.00 0.00 ? 48  ARG A HH21 4  
ATOM   10201 H  HH22 . ARG A 1 48  ? 8.170   -16.628 2.746   1.00 0.00 ? 48  ARG A HH22 4  
ATOM   10202 N  N    . ARG A 1 49  ? 3.851   -11.339 6.955   1.00 0.00 ? 49  ARG A N    4  
ATOM   10203 C  CA   . ARG A 1 49  ? 3.476   -10.131 6.227   1.00 0.00 ? 49  ARG A CA   4  
ATOM   10204 C  C    . ARG A 1 49  ? 4.261   -10.047 4.920   1.00 0.00 ? 49  ARG A C    4  
ATOM   10205 O  O    . ARG A 1 49  ? 5.492   -10.082 4.922   1.00 0.00 ? 49  ARG A O    4  
ATOM   10206 C  CB   . ARG A 1 49  ? 3.766   -8.895  7.087   1.00 0.00 ? 49  ARG A CB   4  
ATOM   10207 C  CG   . ARG A 1 49  ? 4.949   -9.179  8.018   1.00 0.00 ? 49  ARG A CG   4  
ATOM   10208 C  CD   . ARG A 1 49  ? 4.444   -9.813  9.317   1.00 0.00 ? 49  ARG A CD   4  
ATOM   10209 N  NE   . ARG A 1 49  ? 4.075   -8.776  10.272  1.00 0.00 ? 49  ARG A NE   4  
ATOM   10210 C  CZ   . ARG A 1 49  ? 3.353   -9.059  11.352  1.00 0.00 ? 49  ARG A CZ   4  
ATOM   10211 N  NH1  . ARG A 1 49  ? 2.958   -10.283 11.569  1.00 0.00 ? 49  ARG A NH1  4  
ATOM   10212 N  NH2  . ARG A 1 49  ? 3.039   -8.112  12.194  1.00 0.00 ? 49  ARG A NH2  4  
ATOM   10213 H  H    . ARG A 1 49  ? 4.662   -11.342 7.501   1.00 0.00 ? 49  ARG A H    4  
ATOM   10214 H  HA   . ARG A 1 49  ? 2.420   -10.164 6.003   1.00 0.00 ? 49  ARG A HA   4  
ATOM   10215 H  HB2  . ARG A 1 49  ? 4.008   -8.057  6.448   1.00 0.00 ? 49  ARG A HB2  4  
ATOM   10216 H  HB3  . ARG A 1 49  ? 2.895   -8.657  7.678   1.00 0.00 ? 49  ARG A HB3  4  
ATOM   10217 H  HG2  . ARG A 1 49  ? 5.639   -9.854  7.532   1.00 0.00 ? 49  ARG A HG2  4  
ATOM   10218 H  HG3  . ARG A 1 49  ? 5.455   -8.254  8.248   1.00 0.00 ? 49  ARG A HG3  4  
ATOM   10219 H  HD2  . ARG A 1 49  ? 3.580   -10.425 9.106   1.00 0.00 ? 49  ARG A HD2  4  
ATOM   10220 H  HD3  . ARG A 1 49  ? 5.223   -10.431 9.739   1.00 0.00 ? 49  ARG A HD3  4  
ATOM   10221 H  HE   . ARG A 1 49  ? 4.367   -7.853  10.117  1.00 0.00 ? 49  ARG A HE   4  
ATOM   10222 H  HH11 . ARG A 1 49  ? 3.198   -11.008 10.924  1.00 0.00 ? 49  ARG A HH11 4  
ATOM   10223 H  HH12 . ARG A 1 49  ? 2.414   -10.496 12.382  1.00 0.00 ? 49  ARG A HH12 4  
ATOM   10224 H  HH21 . ARG A 1 49  ? 3.342   -7.173  12.025  1.00 0.00 ? 49  ARG A HH21 4  
ATOM   10225 H  HH22 . ARG A 1 49  ? 2.496   -8.324  13.005  1.00 0.00 ? 49  ARG A HH22 4  
ATOM   10226 N  N    . GLY A 1 50  ? 3.542   -9.944  3.805   1.00 0.00 ? 50  GLY A N    4  
ATOM   10227 C  CA   . GLY A 1 50  ? 4.187   -9.866  2.500   1.00 0.00 ? 50  GLY A CA   4  
ATOM   10228 C  C    . GLY A 1 50  ? 3.194   -9.468  1.413   1.00 0.00 ? 50  GLY A C    4  
ATOM   10229 O  O    . GLY A 1 50  ? 2.181   -8.818  1.682   1.00 0.00 ? 50  GLY A O    4  
ATOM   10230 H  H    . GLY A 1 50  ? 2.564   -9.924  3.861   1.00 0.00 ? 50  GLY A H    4  
ATOM   10231 H  HA2  . GLY A 1 50  ? 4.980   -9.132  2.541   1.00 0.00 ? 50  GLY A HA2  4  
ATOM   10232 H  HA3  . GLY A 1 50  ? 4.609   -10.829 2.255   1.00 0.00 ? 50  GLY A HA3  4  
ATOM   10233 N  N    . PHE A 1 51  ? 3.501   -9.870  0.183   1.00 0.00 ? 51  PHE A N    4  
ATOM   10234 C  CA   . PHE A 1 51  ? 2.641   -9.574  -0.958  1.00 0.00 ? 51  PHE A CA   4  
ATOM   10235 C  C    . PHE A 1 51  ? 3.056   -10.422 -2.157  1.00 0.00 ? 51  PHE A C    4  
ATOM   10236 O  O    . PHE A 1 51  ? 4.000   -11.207 -2.074  1.00 0.00 ? 51  PHE A O    4  
ATOM   10237 C  CB   . PHE A 1 51  ? 2.727   -8.091  -1.310  1.00 0.00 ? 51  PHE A CB   4  
ATOM   10238 C  CG   . PHE A 1 51  ? 1.857   -7.803  -2.510  1.00 0.00 ? 51  PHE A CG   4  
ATOM   10239 C  CD1  . PHE A 1 51  ? 0.469   -7.972  -2.422  1.00 0.00 ? 51  PHE A CD1  4  
ATOM   10240 C  CD2  . PHE A 1 51  ? 2.434   -7.370  -3.709  1.00 0.00 ? 51  PHE A CD2  4  
ATOM   10241 C  CE1  . PHE A 1 51  ? -0.340  -7.707  -3.533  1.00 0.00 ? 51  PHE A CE1  4  
ATOM   10242 C  CE2  . PHE A 1 51  ? 1.624   -7.105  -4.820  1.00 0.00 ? 51  PHE A CE2  4  
ATOM   10243 C  CZ   . PHE A 1 51  ? 0.238   -7.273  -4.732  1.00 0.00 ? 51  PHE A CZ   4  
ATOM   10244 H  H    . PHE A 1 51  ? 4.322   -10.384 0.039   1.00 0.00 ? 51  PHE A H    4  
ATOM   10245 H  HA   . PHE A 1 51  ? 1.621   -9.812  -0.697  1.00 0.00 ? 51  PHE A HA   4  
ATOM   10246 H  HB2  . PHE A 1 51  ? 2.383   -7.507  -0.472  1.00 0.00 ? 51  PHE A HB2  4  
ATOM   10247 H  HB3  . PHE A 1 51  ? 3.751   -7.834  -1.537  1.00 0.00 ? 51  PHE A HB3  4  
ATOM   10248 H  HD1  . PHE A 1 51  ? 0.023   -8.308  -1.497  1.00 0.00 ? 51  PHE A HD1  4  
ATOM   10249 H  HD2  . PHE A 1 51  ? 3.504   -7.239  -3.777  1.00 0.00 ? 51  PHE A HD2  4  
ATOM   10250 H  HE1  . PHE A 1 51  ? -1.410  -7.837  -3.465  1.00 0.00 ? 51  PHE A HE1  4  
ATOM   10251 H  HE2  . PHE A 1 51  ? 2.070   -6.770  -5.745  1.00 0.00 ? 51  PHE A HE2  4  
ATOM   10252 H  HZ   . PHE A 1 51  ? -0.386  -7.068  -5.589  1.00 0.00 ? 51  PHE A HZ   4  
ATOM   10253 N  N    . LEU A 1 52  ? 2.345   -10.266 -3.270  1.00 0.00 ? 52  LEU A N    4  
ATOM   10254 C  CA   . LEU A 1 52  ? 2.652   -11.031 -4.476  1.00 0.00 ? 52  LEU A CA   4  
ATOM   10255 C  C    . LEU A 1 52  ? 3.419   -10.172 -5.478  1.00 0.00 ? 52  LEU A C    4  
ATOM   10256 O  O    . LEU A 1 52  ? 3.221   -8.961  -5.551  1.00 0.00 ? 52  LEU A O    4  
ATOM   10257 C  CB   . LEU A 1 52  ? 1.358   -11.534 -5.124  1.00 0.00 ? 52  LEU A CB   4  
ATOM   10258 C  CG   . LEU A 1 52  ? 0.524   -12.316 -4.097  1.00 0.00 ? 52  LEU A CG   4  
ATOM   10259 C  CD1  . LEU A 1 52  ? 1.391   -13.401 -3.453  1.00 0.00 ? 52  LEU A CD1  4  
ATOM   10260 C  CD2  . LEU A 1 52  ? -0.007  -11.364 -3.011  1.00 0.00 ? 52  LEU A CD2  4  
ATOM   10261 H  H    . LEU A 1 52  ? 1.601   -9.630  -3.281  1.00 0.00 ? 52  LEU A H    4  
ATOM   10262 H  HA   . LEU A 1 52  ? 3.262   -11.881 -4.210  1.00 0.00 ? 52  LEU A HA   4  
ATOM   10263 H  HB2  . LEU A 1 52  ? 0.785   -10.691 -5.485  1.00 0.00 ? 52  LEU A HB2  4  
ATOM   10264 H  HB3  . LEU A 1 52  ? 1.602   -12.183 -5.953  1.00 0.00 ? 52  LEU A HB3  4  
ATOM   10265 H  HG   . LEU A 1 52  ? -0.309  -12.784 -4.603  1.00 0.00 ? 52  LEU A HG   4  
ATOM   10266 H  HD11 . LEU A 1 52  ? 1.977   -12.968 -2.656  1.00 0.00 ? 52  LEU A HD11 4  
ATOM   10267 H  HD12 . LEU A 1 52  ? 2.051   -13.824 -4.196  1.00 0.00 ? 52  LEU A HD12 4  
ATOM   10268 H  HD13 . LEU A 1 52  ? 0.756   -14.178 -3.052  1.00 0.00 ? 52  LEU A HD13 4  
ATOM   10269 H  HD21 . LEU A 1 52  ? 0.640   -11.397 -2.146  1.00 0.00 ? 52  LEU A HD21 4  
ATOM   10270 H  HD22 . LEU A 1 52  ? -1.002  -11.672 -2.724  1.00 0.00 ? 52  LEU A HD22 4  
ATOM   10271 H  HD23 . LEU A 1 52  ? -0.043  -10.355 -3.393  1.00 0.00 ? 52  LEU A HD23 4  
ATOM   10272 N  N    . CYS A 1 53  ? 4.297   -10.812 -6.247  1.00 0.00 ? 53  CYS A N    4  
ATOM   10273 C  CA   . CYS A 1 53  ? 5.093   -10.101 -7.246  1.00 0.00 ? 53  CYS A CA   4  
ATOM   10274 C  C    . CYS A 1 53  ? 4.968   -10.776 -8.609  1.00 0.00 ? 53  CYS A C    4  
ATOM   10275 O  O    . CYS A 1 53  ? 4.404   -11.865 -8.724  1.00 0.00 ? 53  CYS A O    4  
ATOM   10276 C  CB   . CYS A 1 53  ? 6.564   -10.080 -6.821  1.00 0.00 ? 53  CYS A CB   4  
ATOM   10277 S  SG   . CYS A 1 53  ? 7.242   -11.755 -6.912  1.00 0.00 ? 53  CYS A SG   4  
ATOM   10278 H  H    . CYS A 1 53  ? 4.411   -11.780 -6.143  1.00 0.00 ? 53  CYS A H    4  
ATOM   10279 H  HA   . CYS A 1 53  ? 4.740   -9.085  -7.326  1.00 0.00 ? 53  CYS A HA   4  
ATOM   10280 H  HB2  . CYS A 1 53  ? 7.120   -9.429  -7.480  1.00 0.00 ? 53  CYS A HB2  4  
ATOM   10281 H  HB3  . CYS A 1 53  ? 6.639   -9.715  -5.807  1.00 0.00 ? 53  CYS A HB3  4  
ATOM   10282 H  HG   . CYS A 1 53  ? 6.640   -12.346 -6.454  1.00 0.00 ? 53  CYS A HG   4  
ATOM   10283 N  N    . ASN A 1 54  ? 5.499   -10.123 -9.638  1.00 0.00 ? 54  ASN A N    4  
ATOM   10284 C  CA   . ASN A 1 54  ? 5.440   -10.669 -10.990 1.00 0.00 ? 54  ASN A CA   4  
ATOM   10285 C  C    . ASN A 1 54  ? 4.018   -11.099 -11.333 1.00 0.00 ? 54  ASN A C    4  
ATOM   10286 O  O    . ASN A 1 54  ? 3.146   -10.262 -11.569 1.00 0.00 ? 54  ASN A O    4  
ATOM   10287 C  CB   . ASN A 1 54  ? 6.381   -11.868 -11.112 1.00 0.00 ? 54  ASN A CB   4  
ATOM   10288 C  CG   . ASN A 1 54  ? 7.832   -11.400 -11.077 1.00 0.00 ? 54  ASN A CG   4  
ATOM   10289 O  OD1  . ASN A 1 54  ? 8.355   -10.925 -12.085 1.00 0.00 ? 54  ASN A OD1  4  
ATOM   10290 N  ND2  . ASN A 1 54  ? 8.515   -11.503 -9.971  1.00 0.00 ? 54  ASN A ND2  4  
ATOM   10291 H  H    . ASN A 1 54  ? 5.936   -9.259  -9.487  1.00 0.00 ? 54  ASN A H    4  
ATOM   10292 H  HA   . ASN A 1 54  ? 5.754   -9.908  -11.689 1.00 0.00 ? 54  ASN A HA   4  
ATOM   10293 H  HB2  . ASN A 1 54  ? 6.204   -12.548 -10.291 1.00 0.00 ? 54  ASN A HB2  4  
ATOM   10294 H  HB3  . ASN A 1 54  ? 6.193   -12.378 -12.045 1.00 0.00 ? 54  ASN A HB3  4  
ATOM   10295 H  HD21 . ASN A 1 54  ? 8.096   -11.882 -9.170  1.00 0.00 ? 54  ASN A HD21 4  
ATOM   10296 H  HD22 . ASN A 1 54  ? 9.448   -11.204 -9.941  1.00 0.00 ? 54  ASN A HD22 4  
ATOM   10297 N  N    . GLN A 1 55  ? 3.791   -12.408 -11.361 1.00 0.00 ? 55  GLN A N    4  
ATOM   10298 C  CA   . GLN A 1 55  ? 2.469   -12.936 -11.677 1.00 0.00 ? 55  GLN A CA   4  
ATOM   10299 C  C    . GLN A 1 55  ? 1.420   -12.357 -10.733 1.00 0.00 ? 55  GLN A C    4  
ATOM   10300 O  O    . GLN A 1 55  ? 1.752   -11.832 -9.670  1.00 0.00 ? 55  GLN A O    4  
ATOM   10301 C  CB   . GLN A 1 55  ? 2.474   -14.462 -11.563 1.00 0.00 ? 55  GLN A CB   4  
ATOM   10302 C  CG   . GLN A 1 55  ? 3.131   -14.874 -10.244 1.00 0.00 ? 55  GLN A CG   4  
ATOM   10303 C  CD   . GLN A 1 55  ? 4.646   -14.928 -10.409 1.00 0.00 ? 55  GLN A CD   4  
ATOM   10304 O  OE1  . GLN A 1 55  ? 5.142   -15.189 -11.504 1.00 0.00 ? 55  GLN A OE1  4  
ATOM   10305 N  NE2  . GLN A 1 55  ? 5.413   -14.696 -9.380  1.00 0.00 ? 55  GLN A NE2  4  
ATOM   10306 H  H    . GLN A 1 55  ? 4.523   -13.028 -11.165 1.00 0.00 ? 55  GLN A H    4  
ATOM   10307 H  HA   . GLN A 1 55  ? 2.216   -12.664 -12.691 1.00 0.00 ? 55  GLN A HA   4  
ATOM   10308 H  HB2  . GLN A 1 55  ? 1.459   -14.829 -11.591 1.00 0.00 ? 55  GLN A HB2  4  
ATOM   10309 H  HB3  . GLN A 1 55  ? 3.032   -14.883 -12.386 1.00 0.00 ? 55  GLN A HB3  4  
ATOM   10310 H  HG2  . GLN A 1 55  ? 2.879   -14.154 -9.478  1.00 0.00 ? 55  GLN A HG2  4  
ATOM   10311 H  HG3  . GLN A 1 55  ? 2.768   -15.849 -9.953  1.00 0.00 ? 55  GLN A HG3  4  
ATOM   10312 H  HE21 . GLN A 1 55  ? 5.016   -14.489 -8.509  1.00 0.00 ? 55  GLN A HE21 4  
ATOM   10313 H  HE22 . GLN A 1 55  ? 6.389   -14.728 -9.479  1.00 0.00 ? 55  GLN A HE22 4  
ATOM   10314 N  N    . ALA A 1 56  ? 0.155   -12.455 -11.127 1.00 0.00 ? 56  ALA A N    4  
ATOM   10315 C  CA   . ALA A 1 56  ? -0.932  -11.936 -10.307 1.00 0.00 ? 56  ALA A CA   4  
ATOM   10316 C  C    . ALA A 1 56  ? -2.228  -12.695 -10.597 1.00 0.00 ? 56  ALA A C    4  
ATOM   10317 O  O    . ALA A 1 56  ? -2.398  -13.255 -11.680 1.00 0.00 ? 56  ALA A O    4  
ATOM   10318 C  CB   . ALA A 1 56  ? -1.127  -10.443 -10.591 1.00 0.00 ? 56  ALA A CB   4  
ATOM   10319 H  H    . ALA A 1 56  ? -0.049  -12.884 -11.984 1.00 0.00 ? 56  ALA A H    4  
ATOM   10320 H  HA   . ALA A 1 56  ? -0.673  -12.062 -9.268  1.00 0.00 ? 56  ALA A HA   4  
ATOM   10321 H  HB1  . ALA A 1 56  ? -0.831  -10.228 -11.607 1.00 0.00 ? 56  ALA A HB1  4  
ATOM   10322 H  HB2  . ALA A 1 56  ? -0.518  -9.865  -9.911  1.00 0.00 ? 56  ALA A HB2  4  
ATOM   10323 H  HB3  . ALA A 1 56  ? -2.166  -10.177 -10.456 1.00 0.00 ? 56  ALA A HB3  4  
ATOM   10324 N  N    . PRO A 1 57  ? -3.136  -12.721 -9.655  1.00 0.00 ? 57  PRO A N    4  
ATOM   10325 C  CA   . PRO A 1 57  ? -4.441  -13.427 -9.817  1.00 0.00 ? 57  PRO A CA   4  
ATOM   10326 C  C    . PRO A 1 57  ? -5.351  -12.724 -10.821 1.00 0.00 ? 57  PRO A C    4  
ATOM   10327 O  O    . PRO A 1 57  ? -6.307  -12.047 -10.439 1.00 0.00 ? 57  PRO A O    4  
ATOM   10328 C  CB   . PRO A 1 57  ? -5.048  -13.403 -8.411  1.00 0.00 ? 57  PRO A CB   4  
ATOM   10329 C  CG   . PRO A 1 57  ? -4.411  -12.241 -7.723  1.00 0.00 ? 57  PRO A CG   4  
ATOM   10330 C  CD   . PRO A 1 57  ? -3.019  -12.083 -8.334  1.00 0.00 ? 57  PRO A CD   4  
ATOM   10331 H  HA   . PRO A 1 57  ? -4.276  -14.449 -10.118 1.00 0.00 ? 57  PRO A HA   4  
ATOM   10332 H  HB2  . PRO A 1 57  ? -6.120  -13.266 -8.467  1.00 0.00 ? 57  PRO A HB2  4  
ATOM   10333 H  HB3  . PRO A 1 57  ? -4.814  -14.315 -7.885  1.00 0.00 ? 57  PRO A HB3  4  
ATOM   10334 H  HG2  . PRO A 1 57  ? -4.997  -11.347 -7.890  1.00 0.00 ? 57  PRO A HG2  4  
ATOM   10335 H  HG3  . PRO A 1 57  ? -4.323  -12.439 -6.666  1.00 0.00 ? 57  PRO A HG3  4  
ATOM   10336 H  HD2  . PRO A 1 57  ? -2.768  -11.035 -8.434  1.00 0.00 ? 57  PRO A HD2  4  
ATOM   10337 H  HD3  . PRO A 1 57  ? -2.282  -12.596 -7.736  1.00 0.00 ? 57  PRO A HD3  4  
ATOM   10338 N  N    . HIS A 1 58  ? -5.048  -12.888 -12.105 1.00 0.00 ? 58  HIS A N    4  
ATOM   10339 C  CA   . HIS A 1 58  ? -5.845  -12.266 -13.156 1.00 0.00 ? 58  HIS A CA   4  
ATOM   10340 C  C    . HIS A 1 58  ? -6.855  -13.258 -13.723 1.00 0.00 ? 58  HIS A C    4  
ATOM   10341 O  O    . HIS A 1 58  ? -7.540  -12.970 -14.704 1.00 0.00 ? 58  HIS A O    4  
ATOM   10342 C  CB   . HIS A 1 58  ? -4.931  -11.770 -14.278 1.00 0.00 ? 58  HIS A CB   4  
ATOM   10343 C  CG   . HIS A 1 58  ? -4.035  -12.891 -14.727 1.00 0.00 ? 58  HIS A CG   4  
ATOM   10344 N  ND1  . HIS A 1 58  ? -4.494  -14.190 -14.877 1.00 0.00 ? 58  HIS A ND1  4  
ATOM   10345 C  CD2  . HIS A 1 58  ? -2.704  -12.922 -15.063 1.00 0.00 ? 58  HIS A CD2  4  
ATOM   10346 C  CE1  . HIS A 1 58  ? -3.456  -14.943 -15.287 1.00 0.00 ? 58  HIS A CE1  4  
ATOM   10347 N  NE2  . HIS A 1 58  ? -2.341  -14.218 -15.417 1.00 0.00 ? 58  HIS A NE2  4  
ATOM   10348 H  H    . HIS A 1 58  ? -4.275  -13.439 -12.349 1.00 0.00 ? 58  HIS A H    4  
ATOM   10349 H  HA   . HIS A 1 58  ? -6.377  -11.422 -12.743 1.00 0.00 ? 58  HIS A HA   4  
ATOM   10350 H  HB2  . HIS A 1 58  ? -5.531  -11.434 -15.110 1.00 0.00 ? 58  HIS A HB2  4  
ATOM   10351 H  HB3  . HIS A 1 58  ? -4.327  -10.952 -13.915 1.00 0.00 ? 58  HIS A HB3  4  
ATOM   10352 H  HD1  . HIS A 1 58  ? -5.408  -14.504 -14.713 1.00 0.00 ? 58  HIS A HD1  4  
ATOM   10353 H  HD2  . HIS A 1 58  ? -2.039  -12.071 -15.054 1.00 0.00 ? 58  HIS A HD2  4  
ATOM   10354 H  HE1  . HIS A 1 58  ? -3.518  -16.002 -15.488 1.00 0.00 ? 58  HIS A HE1  4  
ATOM   10355 H  HE2  . HIS A 1 58  ? -1.458  -14.533 -15.701 1.00 0.00 ? 58  HIS A HE2  4  
ATOM   10356 N  N    . LYS A 1 59  ? -6.939  -14.429 -13.098 1.00 0.00 ? 59  LYS A N    4  
ATOM   10357 C  CA   . LYS A 1 59  ? -7.868  -15.458 -13.549 1.00 0.00 ? 59  LYS A CA   4  
ATOM   10358 C  C    . LYS A 1 59  ? -9.306  -15.052 -13.243 1.00 0.00 ? 59  LYS A C    4  
ATOM   10359 O  O    . LYS A 1 59  ? -9.548  -14.104 -12.496 1.00 0.00 ? 59  LYS A O    4  
ATOM   10360 C  CB   . LYS A 1 59  ? -7.551  -16.786 -12.859 1.00 0.00 ? 59  LYS A CB   4  
ATOM   10361 C  CG   . LYS A 1 59  ? -6.186  -17.292 -13.329 1.00 0.00 ? 59  LYS A CG   4  
ATOM   10362 C  CD   . LYS A 1 59  ? -5.680  -18.369 -12.366 1.00 0.00 ? 59  LYS A CD   4  
ATOM   10363 C  CE   . LYS A 1 59  ? -6.792  -19.387 -12.109 1.00 0.00 ? 59  LYS A CE   4  
ATOM   10364 N  NZ   . LYS A 1 59  ? -6.201  -20.642 -11.563 1.00 0.00 ? 59  LYS A NZ   4  
ATOM   10365 H  H    . LYS A 1 59  ? -6.367  -14.604 -12.322 1.00 0.00 ? 59  LYS A H    4  
ATOM   10366 H  HA   . LYS A 1 59  ? -7.760  -15.586 -14.616 1.00 0.00 ? 59  LYS A HA   4  
ATOM   10367 H  HB2  . LYS A 1 59  ? -7.534  -16.640 -11.788 1.00 0.00 ? 59  LYS A HB2  4  
ATOM   10368 H  HB3  . LYS A 1 59  ? -8.309  -17.513 -13.111 1.00 0.00 ? 59  LYS A HB3  4  
ATOM   10369 H  HG2  . LYS A 1 59  ? -6.279  -17.708 -14.320 1.00 0.00 ? 59  LYS A HG2  4  
ATOM   10370 H  HG3  . LYS A 1 59  ? -5.485  -16.471 -13.346 1.00 0.00 ? 59  LYS A HG3  4  
ATOM   10371 H  HD2  . LYS A 1 59  ? -4.827  -18.868 -12.802 1.00 0.00 ? 59  LYS A HD2  4  
ATOM   10372 H  HD3  . LYS A 1 59  ? -5.391  -17.910 -11.432 1.00 0.00 ? 59  LYS A HD3  4  
ATOM   10373 H  HE2  . LYS A 1 59  ? -7.495  -18.981 -11.396 1.00 0.00 ? 59  LYS A HE2  4  
ATOM   10374 H  HE3  . LYS A 1 59  ? -7.304  -19.603 -13.035 1.00 0.00 ? 59  LYS A HE3  4  
ATOM   10375 H  HZ1  . LYS A 1 59  ? -5.991  -21.295 -12.344 1.00 0.00 ? 59  LYS A HZ1  4  
ATOM   10376 H  HZ2  . LYS A 1 59  ? -6.876  -21.089 -10.912 1.00 0.00 ? 59  LYS A HZ2  4  
ATOM   10377 H  HZ3  . LYS A 1 59  ? -5.322  -20.416 -11.054 1.00 0.00 ? 59  LYS A HZ3  4  
ATOM   10378 N  N    . HIS A 1 60  ? -10.258 -15.776 -13.824 1.00 0.00 ? 60  HIS A N    4  
ATOM   10379 C  CA   . HIS A 1 60  ? -11.669 -15.480 -13.606 1.00 0.00 ? 60  HIS A CA   4  
ATOM   10380 C  C    . HIS A 1 60  ? -11.966 -14.021 -13.937 1.00 0.00 ? 60  HIS A C    4  
ATOM   10381 O  O    . HIS A 1 60  ? -11.916 -13.154 -13.064 1.00 0.00 ? 60  HIS A O    4  
ATOM   10382 C  CB   . HIS A 1 60  ? -12.043 -15.761 -12.149 1.00 0.00 ? 60  HIS A CB   4  
ATOM   10383 C  CG   . HIS A 1 60  ? -11.779 -17.207 -11.832 1.00 0.00 ? 60  HIS A CG   4  
ATOM   10384 N  ND1  . HIS A 1 60  ? -11.250 -17.613 -10.617 1.00 0.00 ? 60  HIS A ND1  4  
ATOM   10385 C  CD2  . HIS A 1 60  ? -11.967 -18.354 -12.561 1.00 0.00 ? 60  HIS A CD2  4  
ATOM   10386 C  CE1  . HIS A 1 60  ? -11.139 -18.953 -10.650 1.00 0.00 ? 60  HIS A CE1  4  
ATOM   10387 N  NE2  . HIS A 1 60  ? -11.562 -19.456 -11.812 1.00 0.00 ? 60  HIS A NE2  4  
ATOM   10388 H  H    . HIS A 1 60  ? -10.007 -16.520 -14.410 1.00 0.00 ? 60  HIS A H    4  
ATOM   10389 H  HA   . HIS A 1 60  ? -12.265 -16.112 -14.246 1.00 0.00 ? 60  HIS A HA   4  
ATOM   10390 H  HB2  . HIS A 1 60  ? -11.449 -15.135 -11.498 1.00 0.00 ? 60  HIS A HB2  4  
ATOM   10391 H  HB3  . HIS A 1 60  ? -13.091 -15.545 -11.998 1.00 0.00 ? 60  HIS A HB3  4  
ATOM   10392 H  HD1  . HIS A 1 60  ? -11.002 -17.029 -9.869  1.00 0.00 ? 60  HIS A HD1  4  
ATOM   10393 H  HD2  . HIS A 1 60  ? -12.368 -18.397 -13.563 1.00 0.00 ? 60  HIS A HD2  4  
ATOM   10394 H  HE1  . HIS A 1 60  ? -10.755 -19.549 -9.835  1.00 0.00 ? 60  HIS A HE1  4  
ATOM   10395 H  HE2  . HIS A 1 60  ? -11.584 -20.398 -12.080 1.00 0.00 ? 60  HIS A HE2  4  
ATOM   10396 N  N    . GLY A 1 61  ? -12.273 -13.756 -15.202 1.00 0.00 ? 61  GLY A N    4  
ATOM   10397 C  CA   . GLY A 1 61  ? -12.576 -12.397 -15.637 1.00 0.00 ? 61  GLY A CA   4  
ATOM   10398 C  C    . GLY A 1 61  ? -11.331 -11.519 -15.577 1.00 0.00 ? 61  GLY A C    4  
ATOM   10399 O  O    . GLY A 1 61  ? -10.470 -11.705 -14.717 1.00 0.00 ? 61  GLY A O    4  
ATOM   10400 H  H    . GLY A 1 61  ? -12.297 -14.487 -15.855 1.00 0.00 ? 61  GLY A H    4  
ATOM   10401 H  HA2  . GLY A 1 61  ? -12.944 -12.423 -16.653 1.00 0.00 ? 61  GLY A HA2  4  
ATOM   10402 H  HA3  . GLY A 1 61  ? -13.334 -11.978 -14.993 1.00 0.00 ? 61  GLY A HA3  4  
ATOM   10403 N  N    . PHE A 1 62  ? -11.241 -10.562 -16.495 1.00 0.00 ? 62  PHE A N    4  
ATOM   10404 C  CA   . PHE A 1 62  ? -10.095 -9.659  -16.537 1.00 0.00 ? 62  PHE A CA   4  
ATOM   10405 C  C    . PHE A 1 62  ? -10.418 -8.348  -15.829 1.00 0.00 ? 62  PHE A C    4  
ATOM   10406 O  O    . PHE A 1 62  ? -11.260 -7.574  -16.288 1.00 0.00 ? 62  PHE A O    4  
ATOM   10407 C  CB   . PHE A 1 62  ? -9.704  -9.375  -17.988 1.00 0.00 ? 62  PHE A CB   4  
ATOM   10408 C  CG   . PHE A 1 62  ? -8.533  -8.424  -18.017 1.00 0.00 ? 62  PHE A CG   4  
ATOM   10409 C  CD1  . PHE A 1 62  ? -7.282  -8.838  -17.542 1.00 0.00 ? 62  PHE A CD1  4  
ATOM   10410 C  CD2  . PHE A 1 62  ? -8.696  -7.127  -18.519 1.00 0.00 ? 62  PHE A CD2  4  
ATOM   10411 C  CE1  . PHE A 1 62  ? -6.195  -7.955  -17.570 1.00 0.00 ? 62  PHE A CE1  4  
ATOM   10412 C  CE2  . PHE A 1 62  ? -7.610  -6.245  -18.547 1.00 0.00 ? 62  PHE A CE2  4  
ATOM   10413 C  CZ   . PHE A 1 62  ? -6.359  -6.659  -18.071 1.00 0.00 ? 62  PHE A CZ   4  
ATOM   10414 H  H    . PHE A 1 62  ? -11.957 -10.461 -17.156 1.00 0.00 ? 62  PHE A H    4  
ATOM   10415 H  HA   . PHE A 1 62  ? -9.259  -10.129 -16.038 1.00 0.00 ? 62  PHE A HA   4  
ATOM   10416 H  HB2  . PHE A 1 62  ? -9.431  -10.300 -18.475 1.00 0.00 ? 62  PHE A HB2  4  
ATOM   10417 H  HB3  . PHE A 1 62  ? -10.541 -8.930  -18.505 1.00 0.00 ? 62  PHE A HB3  4  
ATOM   10418 H  HD1  . PHE A 1 62  ? -7.156  -9.838  -17.155 1.00 0.00 ? 62  PHE A HD1  4  
ATOM   10419 H  HD2  . PHE A 1 62  ? -9.660  -6.808  -18.886 1.00 0.00 ? 62  PHE A HD2  4  
ATOM   10420 H  HE1  . PHE A 1 62  ? -5.231  -8.275  -17.203 1.00 0.00 ? 62  PHE A HE1  4  
ATOM   10421 H  HE2  . PHE A 1 62  ? -7.735  -5.244  -18.934 1.00 0.00 ? 62  PHE A HE2  4  
ATOM   10422 H  HZ   . PHE A 1 62  ? -5.521  -5.979  -18.093 1.00 0.00 ? 62  PHE A HZ   4  
ATOM   10423 N  N    . LEU A 1 63  ? -9.744  -8.103  -14.711 1.00 0.00 ? 63  LEU A N    4  
ATOM   10424 C  CA   . LEU A 1 63  ? -9.965  -6.881  -13.947 1.00 0.00 ? 63  LEU A CA   4  
ATOM   10425 C  C    . LEU A 1 63  ? -8.976  -5.801  -14.375 1.00 0.00 ? 63  LEU A C    4  
ATOM   10426 O  O    . LEU A 1 63  ? -8.012  -6.076  -15.088 1.00 0.00 ? 63  LEU A O    4  
ATOM   10427 C  CB   . LEU A 1 63  ? -9.802  -7.160  -12.450 1.00 0.00 ? 63  LEU A CB   4  
ATOM   10428 C  CG   . LEU A 1 63  ? -11.009 -7.947  -11.930 1.00 0.00 ? 63  LEU A CG   4  
ATOM   10429 C  CD1  . LEU A 1 63  ? -12.271 -7.077  -11.990 1.00 0.00 ? 63  LEU A CD1  4  
ATOM   10430 C  CD2  . LEU A 1 63  ? -11.209 -9.201  -12.788 1.00 0.00 ? 63  LEU A CD2  4  
ATOM   10431 H  H    . LEU A 1 63  ? -9.084  -8.756  -14.394 1.00 0.00 ? 63  LEU A H    4  
ATOM   10432 H  HA   . LEU A 1 63  ? -10.968 -6.530  -14.130 1.00 0.00 ? 63  LEU A HA   4  
ATOM   10433 H  HB2  . LEU A 1 63  ? -8.902  -7.737  -12.291 1.00 0.00 ? 63  LEU A HB2  4  
ATOM   10434 H  HB3  . LEU A 1 63  ? -9.727  -6.225  -11.916 1.00 0.00 ? 63  LEU A HB3  4  
ATOM   10435 H  HG   . LEU A 1 63  ? -10.829 -8.240  -10.905 1.00 0.00 ? 63  LEU A HG   4  
ATOM   10436 H  HD11 . LEU A 1 63  ? -12.000 -6.036  -11.882 1.00 0.00 ? 63  LEU A HD11 4  
ATOM   10437 H  HD12 . LEU A 1 63  ? -12.938 -7.357  -11.188 1.00 0.00 ? 63  LEU A HD12 4  
ATOM   10438 H  HD13 . LEU A 1 63  ? -12.771 -7.222  -12.937 1.00 0.00 ? 63  LEU A HD13 4  
ATOM   10439 H  HD21 . LEU A 1 63  ? -11.817 -9.912  -12.249 1.00 0.00 ? 63  LEU A HD21 4  
ATOM   10440 H  HD22 . LEU A 1 63  ? -10.249 -9.642  -13.009 1.00 0.00 ? 63  LEU A HD22 4  
ATOM   10441 H  HD23 . LEU A 1 63  ? -11.703 -8.930  -13.709 1.00 0.00 ? 63  LEU A HD23 4  
ATOM   10442 N  N    . GLU A 1 64  ? -9.223  -4.571  -13.936 1.00 0.00 ? 64  GLU A N    4  
ATOM   10443 C  CA   . GLU A 1 64  ? -8.346  -3.458  -14.283 1.00 0.00 ? 64  GLU A CA   4  
ATOM   10444 C  C    . GLU A 1 64  ? -7.072  -3.494  -13.446 1.00 0.00 ? 64  GLU A C    4  
ATOM   10445 O  O    . GLU A 1 64  ? -6.866  -4.410  -12.649 1.00 0.00 ? 64  GLU A O    4  
ATOM   10446 C  CB   . GLU A 1 64  ? -9.067  -2.129  -14.053 1.00 0.00 ? 64  GLU A CB   4  
ATOM   10447 C  CG   . GLU A 1 64  ? -9.887  -2.212  -12.764 1.00 0.00 ? 64  GLU A CG   4  
ATOM   10448 C  CD   . GLU A 1 64  ? -11.264 -2.797  -13.058 1.00 0.00 ? 64  GLU A CD   4  
ATOM   10449 O  OE1  . GLU A 1 64  ? -11.970 -2.221  -13.869 1.00 0.00 ? 64  GLU A OE1  4  
ATOM   10450 O  OE2  . GLU A 1 64  ? -11.593 -3.812  -12.467 1.00 0.00 ? 64  GLU A OE2  4  
ATOM   10451 H  H    . GLU A 1 64  ? -10.007 -4.408  -13.371 1.00 0.00 ? 64  GLU A H    4  
ATOM   10452 H  HA   . GLU A 1 64  ? -8.082  -3.533  -15.325 1.00 0.00 ? 64  GLU A HA   4  
ATOM   10453 H  HB2  . GLU A 1 64  ? -8.338  -1.335  -13.966 1.00 0.00 ? 64  GLU A HB2  4  
ATOM   10454 H  HB3  . GLU A 1 64  ? -9.725  -1.926  -14.886 1.00 0.00 ? 64  GLU A HB3  4  
ATOM   10455 H  HG2  . GLU A 1 64  ? -9.373  -2.843  -12.055 1.00 0.00 ? 64  GLU A HG2  4  
ATOM   10456 H  HG3  . GLU A 1 64  ? -10.001 -1.222  -12.348 1.00 0.00 ? 64  GLU A HG3  4  
ATOM   10457 N  N    . GLY A 1 65  ? -6.221  -2.491  -13.634 1.00 0.00 ? 65  GLY A N    4  
ATOM   10458 C  CA   . GLY A 1 65  ? -4.969  -2.413  -12.893 1.00 0.00 ? 65  GLY A CA   4  
ATOM   10459 C  C    . GLY A 1 65  ? -5.225  -2.199  -11.406 1.00 0.00 ? 65  GLY A C    4  
ATOM   10460 O  O    . GLY A 1 65  ? -4.953  -1.127  -10.865 1.00 0.00 ? 65  GLY A O    4  
ATOM   10461 H  H    . GLY A 1 65  ? -6.440  -1.790  -14.283 1.00 0.00 ? 65  GLY A H    4  
ATOM   10462 H  HA2  . GLY A 1 65  ? -4.416  -3.331  -13.030 1.00 0.00 ? 65  GLY A HA2  4  
ATOM   10463 H  HA3  . GLY A 1 65  ? -4.385  -1.589  -13.270 1.00 0.00 ? 65  GLY A HA3  4  
ATOM   10464 N  N    . ARG A 1 66  ? -5.749  -3.227  -10.751 1.00 0.00 ? 66  ARG A N    4  
ATOM   10465 C  CA   . ARG A 1 66  ? -6.039  -3.146  -9.324  1.00 0.00 ? 66  ARG A CA   4  
ATOM   10466 C  C    . ARG A 1 66  ? -4.759  -2.902  -8.531  1.00 0.00 ? 66  ARG A C    4  
ATOM   10467 O  O    . ARG A 1 66  ? -3.846  -3.727  -8.541  1.00 0.00 ? 66  ARG A O    4  
ATOM   10468 C  CB   . ARG A 1 66  ? -6.694  -4.449  -8.850  1.00 0.00 ? 66  ARG A CB   4  
ATOM   10469 C  CG   . ARG A 1 66  ? -8.209  -4.372  -9.051  1.00 0.00 ? 66  ARG A CG   4  
ATOM   10470 C  CD   . ARG A 1 66  ? -8.818  -5.759  -8.851  1.00 0.00 ? 66  ARG A CD   4  
ATOM   10471 N  NE   . ARG A 1 66  ? -8.170  -6.435  -7.733  1.00 0.00 ? 66  ARG A NE   4  
ATOM   10472 C  CZ   . ARG A 1 66  ? -8.405  -7.716  -7.475  1.00 0.00 ? 66  ARG A CZ   4  
ATOM   10473 N  NH1  . ARG A 1 66  ? -9.228  -8.392  -8.228  1.00 0.00 ? 66  ARG A NH1  4  
ATOM   10474 N  NH2  . ARG A 1 66  ? -7.812  -8.297  -6.469  1.00 0.00 ? 66  ARG A NH2  4  
ATOM   10475 H  H    . ARG A 1 66  ? -5.943  -4.056  -11.236 1.00 0.00 ? 66  ARG A H    4  
ATOM   10476 H  HA   . ARG A 1 66  ? -6.721  -2.328  -9.150  1.00 0.00 ? 66  ARG A HA   4  
ATOM   10477 H  HB2  . ARG A 1 66  ? -6.297  -5.277  -9.420  1.00 0.00 ? 66  ARG A HB2  4  
ATOM   10478 H  HB3  . ARG A 1 66  ? -6.482  -4.601  -7.802  1.00 0.00 ? 66  ARG A HB3  4  
ATOM   10479 H  HG2  . ARG A 1 66  ? -8.631  -3.685  -8.333  1.00 0.00 ? 66  ARG A HG2  4  
ATOM   10480 H  HG3  . ARG A 1 66  ? -8.423  -4.026  -10.051 1.00 0.00 ? 66  ARG A HG3  4  
ATOM   10481 H  HD2  . ARG A 1 66  ? -9.873  -5.661  -8.645  1.00 0.00 ? 66  ARG A HD2  4  
ATOM   10482 H  HD3  . ARG A 1 66  ? -8.683  -6.342  -9.751  1.00 0.00 ? 66  ARG A HD3  4  
ATOM   10483 H  HE   . ARG A 1 66  ? -7.551  -5.934  -7.161  1.00 0.00 ? 66  ARG A HE   4  
ATOM   10484 H  HH11 . ARG A 1 66  ? -9.682  -7.946  -8.999  1.00 0.00 ? 66  ARG A HH11 4  
ATOM   10485 H  HH12 . ARG A 1 66  ? -9.405  -9.357  -8.035  1.00 0.00 ? 66  ARG A HH12 4  
ATOM   10486 H  HH21 . ARG A 1 66  ? -7.181  -7.777  -5.892  1.00 0.00 ? 66  ARG A HH21 4  
ATOM   10487 H  HH22 . ARG A 1 66  ? -7.987  -9.263  -6.274  1.00 0.00 ? 66  ARG A HH22 4  
ATOM   10488 N  N    . HIS A 1 67  ? -4.703  -1.768  -7.837  1.00 0.00 ? 67  HIS A N    4  
ATOM   10489 C  CA   . HIS A 1 67  ? -3.533  -1.435  -7.032  1.00 0.00 ? 67  HIS A CA   4  
ATOM   10490 C  C    . HIS A 1 67  ? -3.790  -1.778  -5.565  1.00 0.00 ? 67  HIS A C    4  
ATOM   10491 O  O    . HIS A 1 67  ? -4.934  -1.948  -5.146  1.00 0.00 ? 67  HIS A O    4  
ATOM   10492 C  CB   . HIS A 1 67  ? -3.186  0.052   -7.194  1.00 0.00 ? 67  HIS A CB   4  
ATOM   10493 C  CG   . HIS A 1 67  ? -3.282  0.433   -8.645  1.00 0.00 ? 67  HIS A CG   4  
ATOM   10494 N  ND1  . HIS A 1 67  ? -4.004  1.541   -9.077  1.00 0.00 ? 67  HIS A ND1  4  
ATOM   10495 C  CD2  . HIS A 1 67  ? -2.758  -0.139  -9.777  1.00 0.00 ? 67  HIS A CD2  4  
ATOM   10496 C  CE1  . HIS A 1 67  ? -3.894  1.592   -10.418 1.00 0.00 ? 67  HIS A CE1  4  
ATOM   10497 N  NE2  . HIS A 1 67  ? -3.146  0.594   -10.895 1.00 0.00 ? 67  HIS A NE2  4  
ATOM   10498 H  H    . HIS A 1 67  ? -5.463  -1.151  -7.858  1.00 0.00 ? 67  HIS A H    4  
ATOM   10499 H  HA   . HIS A 1 67  ? -2.693  -2.023  -7.374  1.00 0.00 ? 67  HIS A HA   4  
ATOM   10500 H  HB2  . HIS A 1 67  ? -3.872  0.649   -6.628  1.00 0.00 ? 67  HIS A HB2  4  
ATOM   10501 H  HB3  . HIS A 1 67  ? -2.180  0.228   -6.844  1.00 0.00 ? 67  HIS A HB3  4  
ATOM   10502 H  HD2  . HIS A 1 67  ? -2.139  -1.024  -9.798  1.00 0.00 ? 67  HIS A HD2  4  
ATOM   10503 H  HE1  . HIS A 1 67  ? -4.355  2.350   -11.034 1.00 0.00 ? 67  HIS A HE1  4  
ATOM   10504 H  HE2  . HIS A 1 67  ? -2.918  0.415   -11.831 1.00 0.00 ? 67  HIS A HE2  4  
ATOM   10505 N  N    . ALA A 1 68  ? -2.713  -1.908  -4.805  1.00 0.00 ? 68  ALA A N    4  
ATOM   10506 C  CA   . ALA A 1 68  ? -2.796  -2.265  -3.389  1.00 0.00 ? 68  ALA A CA   4  
ATOM   10507 C  C    . ALA A 1 68  ? -4.126  -1.842  -2.748  1.00 0.00 ? 68  ALA A C    4  
ATOM   10508 O  O    . ALA A 1 68  ? -4.694  -2.581  -1.941  1.00 0.00 ? 68  ALA A O    4  
ATOM   10509 C  CB   . ALA A 1 68  ? -1.631  -1.629  -2.639  1.00 0.00 ? 68  ALA A CB   4  
ATOM   10510 H  H    . ALA A 1 68  ? -1.831  -1.780  -5.210  1.00 0.00 ? 68  ALA A H    4  
ATOM   10511 H  HA   . ALA A 1 68  ? -2.703  -3.335  -3.303  1.00 0.00 ? 68  ALA A HA   4  
ATOM   10512 H  HB1  . ALA A 1 68  ? -1.398  -2.226  -1.773  1.00 0.00 ? 68  ALA A HB1  4  
ATOM   10513 H  HB2  . ALA A 1 68  ? -1.901  -0.631  -2.332  1.00 0.00 ? 68  ALA A HB2  4  
ATOM   10514 H  HB3  . ALA A 1 68  ? -0.767  -1.586  -3.290  1.00 0.00 ? 68  ALA A HB3  4  
ATOM   10515 N  N    . GLU A 1 69  ? -4.622  -0.660  -3.097  1.00 0.00 ? 69  GLU A N    4  
ATOM   10516 C  CA   . GLU A 1 69  ? -5.885  -0.182  -2.526  1.00 0.00 ? 69  GLU A CA   4  
ATOM   10517 C  C    . GLU A 1 69  ? -6.994  -1.220  -2.746  1.00 0.00 ? 69  GLU A C    4  
ATOM   10518 O  O    . GLU A 1 69  ? -7.561  -1.764  -1.788  1.00 0.00 ? 69  GLU A O    4  
ATOM   10519 C  CB   . GLU A 1 69  ? -6.288  1.178   -3.147  1.00 0.00 ? 69  GLU A CB   4  
ATOM   10520 C  CG   . GLU A 1 69  ? -5.272  1.566   -4.224  1.00 0.00 ? 69  GLU A CG   4  
ATOM   10521 C  CD   . GLU A 1 69  ? -3.930  1.899   -3.581  1.00 0.00 ? 69  GLU A CD   4  
ATOM   10522 O  OE1  . GLU A 1 69  ? -3.900  2.790   -2.749  1.00 0.00 ? 69  GLU A OE1  4  
ATOM   10523 O  OE2  . GLU A 1 69  ? -2.953  1.258   -3.929  1.00 0.00 ? 69  GLU A OE2  4  
ATOM   10524 H  H    . GLU A 1 69  ? -4.136  -0.102  -3.737  1.00 0.00 ? 69  GLU A H    4  
ATOM   10525 H  HA   . GLU A 1 69  ? -5.747  -0.047  -1.469  1.00 0.00 ? 69  GLU A HA   4  
ATOM   10526 H  HB2  . GLU A 1 69  ? -7.274  1.108   -3.588  1.00 0.00 ? 69  GLU A HB2  4  
ATOM   10527 H  HB3  . GLU A 1 69  ? -6.299  1.940   -2.378  1.00 0.00 ? 69  GLU A HB3  4  
ATOM   10528 H  HG2  . GLU A 1 69  ? -5.149  0.736   -4.897  1.00 0.00 ? 69  GLU A HG2  4  
ATOM   10529 H  HG3  . GLU A 1 69  ? -5.626  2.426   -4.778  1.00 0.00 ? 69  GLU A HG3  4  
ATOM   10530 N  N    . LEU A 1 70  ? -7.292  -1.498  -4.012  1.00 0.00 ? 70  LEU A N    4  
ATOM   10531 C  CA   . LEU A 1 70  ? -8.328  -2.469  -4.346  1.00 0.00 ? 70  LEU A CA   4  
ATOM   10532 C  C    . LEU A 1 70  ? -7.908  -3.869  -3.907  1.00 0.00 ? 70  LEU A C    4  
ATOM   10533 O  O    . LEU A 1 70  ? -8.746  -4.745  -3.694  1.00 0.00 ? 70  LEU A O    4  
ATOM   10534 C  CB   . LEU A 1 70  ? -8.600  -2.468  -5.850  1.00 0.00 ? 70  LEU A CB   4  
ATOM   10535 C  CG   . LEU A 1 70  ? -8.738  -1.023  -6.365  1.00 0.00 ? 70  LEU A CG   4  
ATOM   10536 C  CD1  . LEU A 1 70  ? -9.595  -0.197  -5.389  1.00 0.00 ? 70  LEU A CD1  4  
ATOM   10537 C  CD2  . LEU A 1 70  ? -7.350  -0.370  -6.516  1.00 0.00 ? 70  LEU A CD2  4  
ATOM   10538 H  H    . LEU A 1 70  ? -6.805  -1.047  -4.729  1.00 0.00 ? 70  LEU A H    4  
ATOM   10539 H  HA   . LEU A 1 70  ? -9.236  -2.198  -3.839  1.00 0.00 ? 70  LEU A HA   4  
ATOM   10540 H  HB2  . LEU A 1 70  ? -7.789  -2.963  -6.360  1.00 0.00 ? 70  LEU A HB2  4  
ATOM   10541 H  HB3  . LEU A 1 70  ? -9.518  -3.001  -6.045  1.00 0.00 ? 70  LEU A HB3  4  
ATOM   10542 H  HG   . LEU A 1 70  ? -9.227  -1.041  -7.327  1.00 0.00 ? 70  LEU A HG   4  
ATOM   10543 H  HD11 . LEU A 1 70  ? -9.046  -0.026  -4.475  1.00 0.00 ? 70  LEU A HD11 4  
ATOM   10544 H  HD12 . LEU A 1 70  ? -10.504 -0.732  -5.167  1.00 0.00 ? 70  LEU A HD12 4  
ATOM   10545 H  HD13 . LEU A 1 70  ? -9.841  0.753   -5.840  1.00 0.00 ? 70  LEU A HD13 4  
ATOM   10546 H  HD21 . LEU A 1 70  ? -7.197  0.346   -5.726  1.00 0.00 ? 70  LEU A HD21 4  
ATOM   10547 H  HD22 . LEU A 1 70  ? -7.298  0.133   -7.467  1.00 0.00 ? 70  LEU A HD22 4  
ATOM   10548 H  HD23 . LEU A 1 70  ? -6.577  -1.121  -6.471  1.00 0.00 ? 70  LEU A HD23 4  
ATOM   10549 N  N    . CYS A 1 71  ? -6.602  -4.073  -3.791  1.00 0.00 ? 71  CYS A N    4  
ATOM   10550 C  CA   . CYS A 1 71  ? -6.068  -5.378  -3.393  1.00 0.00 ? 71  CYS A CA   4  
ATOM   10551 C  C    . CYS A 1 71  ? -6.663  -5.865  -2.065  1.00 0.00 ? 71  CYS A C    4  
ATOM   10552 O  O    . CYS A 1 71  ? -7.358  -6.887  -2.031  1.00 0.00 ? 71  CYS A O    4  
ATOM   10553 C  CB   . CYS A 1 71  ? -4.544  -5.318  -3.284  1.00 0.00 ? 71  CYS A CB   4  
ATOM   10554 S  SG   . CYS A 1 71  ? -3.885  -6.997  -3.124  1.00 0.00 ? 71  CYS A SG   4  
ATOM   10555 H  H    . CYS A 1 71  ? -5.985  -3.337  -3.993  1.00 0.00 ? 71  CYS A H    4  
ATOM   10556 H  HA   . CYS A 1 71  ? -6.323  -6.094  -4.160  1.00 0.00 ? 71  CYS A HA   4  
ATOM   10557 H  HB2  . CYS A 1 71  ? -4.140  -4.857  -4.172  1.00 0.00 ? 71  CYS A HB2  4  
ATOM   10558 H  HB3  . CYS A 1 71  ? -4.265  -4.741  -2.417  1.00 0.00 ? 71  CYS A HB3  4  
ATOM   10559 H  HG   . CYS A 1 71  ? -4.046  -7.459  -3.950  1.00 0.00 ? 71  CYS A HG   4  
ATOM   10560 N  N    . PHE A 1 72  ? -6.413  -5.154  -0.964  1.00 0.00 ? 72  PHE A N    4  
ATOM   10561 C  CA   . PHE A 1 72  ? -6.980  -5.611  0.301   1.00 0.00 ? 72  PHE A CA   4  
ATOM   10562 C  C    . PHE A 1 72  ? -8.485  -5.551  0.190   1.00 0.00 ? 72  PHE A C    4  
ATOM   10563 O  O    . PHE A 1 72  ? -9.190  -6.461  0.611   1.00 0.00 ? 72  PHE A O    4  
ATOM   10564 C  CB   . PHE A 1 72  ? -6.490  -4.803  1.507   1.00 0.00 ? 72  PHE A CB   4  
ATOM   10565 C  CG   . PHE A 1 72  ? -6.596  -3.325  1.248   1.00 0.00 ? 72  PHE A CG   4  
ATOM   10566 C  CD1  . PHE A 1 72  ? -7.843  -2.684  1.285   1.00 0.00 ? 72  PHE A CD1  4  
ATOM   10567 C  CD2  . PHE A 1 72  ? -5.439  -2.589  0.972   1.00 0.00 ? 72  PHE A CD2  4  
ATOM   10568 C  CE1  . PHE A 1 72  ? -7.925  -1.316  1.045   1.00 0.00 ? 72  PHE A CE1  4  
ATOM   10569 C  CE2  . PHE A 1 72  ? -5.526  -1.224  0.735   1.00 0.00 ? 72  PHE A CE2  4  
ATOM   10570 C  CZ   . PHE A 1 72  ? -6.766  -0.589  0.770   1.00 0.00 ? 72  PHE A CZ   4  
ATOM   10571 H  H    . PHE A 1 72  ? -5.873  -4.335  -1.006  1.00 0.00 ? 72  PHE A H    4  
ATOM   10572 H  HA   . PHE A 1 72  ? -6.695  -6.645  0.442   1.00 0.00 ? 72  PHE A HA   4  
ATOM   10573 H  HB2  . PHE A 1 72  ? -7.094  -5.056  2.364   1.00 0.00 ? 72  PHE A HB2  4  
ATOM   10574 H  HB3  . PHE A 1 72  ? -5.460  -5.057  1.711   1.00 0.00 ? 72  PHE A HB3  4  
ATOM   10575 H  HD1  . PHE A 1 72  ? -8.739  -3.241  1.504   1.00 0.00 ? 72  PHE A HD1  4  
ATOM   10576 H  HD2  . PHE A 1 72  ? -4.480  -3.074  0.948   1.00 0.00 ? 72  PHE A HD2  4  
ATOM   10577 H  HE1  . PHE A 1 72  ? -8.881  -0.818  1.072   1.00 0.00 ? 72  PHE A HE1  4  
ATOM   10578 H  HE2  . PHE A 1 72  ? -4.633  -0.654  0.523   1.00 0.00 ? 72  PHE A HE2  4  
ATOM   10579 H  HZ   . PHE A 1 72  ? -6.827  0.456   0.581   1.00 0.00 ? 72  PHE A HZ   4  
ATOM   10580 N  N    . LEU A 1 73  ? -8.977  -4.498  -0.437  1.00 0.00 ? 73  LEU A N    4  
ATOM   10581 C  CA   . LEU A 1 73  ? -10.400 -4.373  -0.656  1.00 0.00 ? 73  LEU A CA   4  
ATOM   10582 C  C    . LEU A 1 73  ? -10.958 -5.740  -1.051  1.00 0.00 ? 73  LEU A C    4  
ATOM   10583 O  O    . LEU A 1 73  ? -12.128 -6.048  -0.823  1.00 0.00 ? 73  LEU A O    4  
ATOM   10584 C  CB   . LEU A 1 73  ? -10.589 -3.376  -1.786  1.00 0.00 ? 73  LEU A CB   4  
ATOM   10585 C  CG   . LEU A 1 73  ? -11.874 -2.571  -1.595  1.00 0.00 ? 73  LEU A CG   4  
ATOM   10586 C  CD1  . LEU A 1 73  ? -11.741 -1.635  -0.375  1.00 0.00 ? 73  LEU A CD1  4  
ATOM   10587 C  CD2  . LEU A 1 73  ? -12.116 -1.755  -2.872  1.00 0.00 ? 73  LEU A CD2  4  
ATOM   10588 H  H    . LEU A 1 73  ? -8.371  -3.809  -0.795  1.00 0.00 ? 73  LEU A H    4  
ATOM   10589 H  HA   . LEU A 1 73  ? -10.885 -4.016  0.239   1.00 0.00 ? 73  LEU A HA   4  
ATOM   10590 H  HB2  . LEU A 1 73  ? -9.740  -2.708  -1.784  1.00 0.00 ? 73  LEU A HB2  4  
ATOM   10591 H  HB3  . LEU A 1 73  ? -10.632 -3.900  -2.731  1.00 0.00 ? 73  LEU A HB3  4  
ATOM   10592 H  HG   . LEU A 1 73  ? -12.701 -3.248  -1.439  1.00 0.00 ? 73  LEU A HG   4  
ATOM   10593 H  HD11 . LEU A 1 73  ? -12.321 -2.032  0.444   1.00 0.00 ? 73  LEU A HD11 4  
ATOM   10594 H  HD12 . LEU A 1 73  ? -12.106 -0.652  -0.624  1.00 0.00 ? 73  LEU A HD12 4  
ATOM   10595 H  HD13 . LEU A 1 73  ? -10.706 -1.562  -0.075  1.00 0.00 ? 73  LEU A HD13 4  
ATOM   10596 H  HD21 . LEU A 1 73  ? -11.242 -1.158  -3.084  1.00 0.00 ? 73  LEU A HD21 4  
ATOM   10597 H  HD22 . LEU A 1 73  ? -12.972 -1.115  -2.737  1.00 0.00 ? 73  LEU A HD22 4  
ATOM   10598 H  HD23 . LEU A 1 73  ? -12.296 -2.422  -3.699  1.00 0.00 ? 73  LEU A HD23 4  
ATOM   10599 N  N    . ASP A 1 74  ? -10.082 -6.549  -1.650  1.00 0.00 ? 74  ASP A N    4  
ATOM   10600 C  CA   . ASP A 1 74  ? -10.444 -7.893  -2.094  1.00 0.00 ? 74  ASP A CA   4  
ATOM   10601 C  C    . ASP A 1 74  ? -10.094 -8.955  -1.050  1.00 0.00 ? 74  ASP A C    4  
ATOM   10602 O  O    . ASP A 1 74  ? -10.661 -10.044 -1.072  1.00 0.00 ? 74  ASP A O    4  
ATOM   10603 C  CB   . ASP A 1 74  ? -9.727  -8.216  -3.407  1.00 0.00 ? 74  ASP A CB   4  
ATOM   10604 C  CG   . ASP A 1 74  ? -10.479 -9.311  -4.155  1.00 0.00 ? 74  ASP A CG   4  
ATOM   10605 O  OD1  . ASP A 1 74  ? -11.629 -9.089  -4.494  1.00 0.00 ? 74  ASP A OD1  4  
ATOM   10606 O  OD2  . ASP A 1 74  ? -9.893  -10.358 -4.378  1.00 0.00 ? 74  ASP A OD2  4  
ATOM   10607 H  H    . ASP A 1 74  ? -9.167  -6.230  -1.796  1.00 0.00 ? 74  ASP A H    4  
ATOM   10608 H  HA   . ASP A 1 74  ? -11.511 -7.928  -2.267  1.00 0.00 ? 74  ASP A HA   4  
ATOM   10609 H  HB2  . ASP A 1 74  ? -9.686  -7.327  -4.020  1.00 0.00 ? 74  ASP A HB2  4  
ATOM   10610 H  HB3  . ASP A 1 74  ? -8.723  -8.552  -3.194  1.00 0.00 ? 74  ASP A HB3  4  
ATOM   10611 N  N    . VAL A 1 75  ? -9.157  -8.666  -0.144  1.00 0.00 ? 75  VAL A N    4  
ATOM   10612 C  CA   . VAL A 1 75  ? -8.798  -9.659  0.858   1.00 0.00 ? 75  VAL A CA   4  
ATOM   10613 C  C    . VAL A 1 75  ? -9.877  -9.787  1.943   1.00 0.00 ? 75  VAL A C    4  
ATOM   10614 O  O    . VAL A 1 75  ? -10.302 -10.874 2.289   1.00 0.00 ? 75  VAL A O    4  
ATOM   10615 C  CB   . VAL A 1 75  ? -7.455  -9.336  1.515   1.00 0.00 ? 75  VAL A CB   4  
ATOM   10616 C  CG1  . VAL A 1 75  ? -7.624  -8.303  2.632   1.00 0.00 ? 75  VAL A CG1  4  
ATOM   10617 C  CG2  . VAL A 1 75  ? -6.929  -10.625 2.113   1.00 0.00 ? 75  VAL A CG2  4  
ATOM   10618 H  H    . VAL A 1 75  ? -8.702  -7.798  -0.155  1.00 0.00 ? 75  VAL A H    4  
ATOM   10619 H  HA   . VAL A 1 75  ? -8.701  -10.609 0.353   1.00 0.00 ? 75  VAL A HA   4  
ATOM   10620 H  HB   . VAL A 1 75  ? -6.757  -8.967  0.782   1.00 0.00 ? 75  VAL A HB   4  
ATOM   10621 H  HG11 . VAL A 1 75  ? -6.652  -7.982  2.972   1.00 0.00 ? 75  VAL A HG11 4  
ATOM   10622 H  HG12 . VAL A 1 75  ? -8.160  -8.748  3.449   1.00 0.00 ? 75  VAL A HG12 4  
ATOM   10623 H  HG13 . VAL A 1 75  ? -8.172  -7.456  2.266   1.00 0.00 ? 75  VAL A HG13 4  
ATOM   10624 H  HG21 . VAL A 1 75  ? -7.735  -11.123 2.635   1.00 0.00 ? 75  VAL A HG21 4  
ATOM   10625 H  HG22 . VAL A 1 75  ? -6.135  -10.404 2.799   1.00 0.00 ? 75  VAL A HG22 4  
ATOM   10626 H  HG23 . VAL A 1 75  ? -6.569  -11.261 1.320   1.00 0.00 ? 75  VAL A HG23 4  
ATOM   10627 N  N    . ILE A 1 76  ? -10.302 -8.668  2.494   1.00 0.00 ? 76  ILE A N    4  
ATOM   10628 C  CA   . ILE A 1 76  ? -11.318 -8.693  3.556   1.00 0.00 ? 76  ILE A CA   4  
ATOM   10629 C  C    . ILE A 1 76  ? -12.372 -9.787  3.301   1.00 0.00 ? 76  ILE A C    4  
ATOM   10630 O  O    . ILE A 1 76  ? -12.611 -10.617 4.179   1.00 0.00 ? 76  ILE A O    4  
ATOM   10631 C  CB   . ILE A 1 76  ? -12.010 -7.321  3.706   1.00 0.00 ? 76  ILE A CB   4  
ATOM   10632 C  CG1  . ILE A 1 76  ? -11.135 -6.220  3.111   1.00 0.00 ? 76  ILE A CG1  4  
ATOM   10633 C  CG2  . ILE A 1 76  ? -12.253 -7.004  5.178   1.00 0.00 ? 76  ILE A CG2  4  
ATOM   10634 C  CD1  . ILE A 1 76  ? -9.837  -6.098  3.914   1.00 0.00 ? 76  ILE A CD1  4  
ATOM   10635 H  H    . ILE A 1 76  ? -9.912  -7.824  2.206   1.00 0.00 ? 76  ILE A H    4  
ATOM   10636 H  HA   . ILE A 1 76  ? -10.817 -8.927  4.484   1.00 0.00 ? 76  ILE A HA   4  
ATOM   10637 H  HB   . ILE A 1 76  ? -12.960 -7.334  3.203   1.00 0.00 ? 76  ILE A HB   4  
ATOM   10638 H  HG12 . ILE A 1 76  ? -10.912 -6.457  2.090   1.00 0.00 ? 76  ILE A HG12 4  
ATOM   10639 H  HG13 . ILE A 1 76  ? -11.666 -5.281  3.150   1.00 0.00 ? 76  ILE A HG13 4  
ATOM   10640 H  HG21 . ILE A 1 76  ? -12.630 -5.999  5.257   1.00 0.00 ? 76  ILE A HG21 4  
ATOM   10641 H  HG22 . ILE A 1 76  ? -11.327 -7.086  5.727   1.00 0.00 ? 76  ILE A HG22 4  
ATOM   10642 H  HG23 . ILE A 1 76  ? -12.978 -7.694  5.583   1.00 0.00 ? 76  ILE A HG23 4  
ATOM   10643 H  HD11 . ILE A 1 76  ? -9.495  -7.079  4.203   1.00 0.00 ? 76  ILE A HD11 4  
ATOM   10644 H  HD12 . ILE A 1 76  ? -10.018 -5.507  4.800   1.00 0.00 ? 76  ILE A HD12 4  
ATOM   10645 H  HD13 . ILE A 1 76  ? -9.084  -5.618  3.310   1.00 0.00 ? 76  ILE A HD13 4  
ATOM   10646 N  N    . PRO A 1 77  ? -13.002 -9.831  2.140   1.00 0.00 ? 77  PRO A N    4  
ATOM   10647 C  CA   . PRO A 1 77  ? -14.024 -10.878 1.838   1.00 0.00 ? 77  PRO A CA   4  
ATOM   10648 C  C    . PRO A 1 77  ? -13.376 -12.254 1.755   1.00 0.00 ? 77  PRO A C    4  
ATOM   10649 O  O    . PRO A 1 77  ? -14.043 -13.282 1.873   1.00 0.00 ? 77  PRO A O    4  
ATOM   10650 C  CB   . PRO A 1 77  ? -14.601 -10.444 0.487   1.00 0.00 ? 77  PRO A CB   4  
ATOM   10651 C  CG   . PRO A 1 77  ? -13.540 -9.630  -0.146  1.00 0.00 ? 77  PRO A CG   4  
ATOM   10652 C  CD   . PRO A 1 77  ? -12.826 -8.921  0.995   1.00 0.00 ? 77  PRO A CD   4  
ATOM   10653 H  HA   . PRO A 1 77  ? -14.800 -10.874 2.586   1.00 0.00 ? 77  PRO A HA   4  
ATOM   10654 H  HB2  . PRO A 1 77  ? -14.827 -11.302 -0.126  1.00 0.00 ? 77  PRO A HB2  4  
ATOM   10655 H  HB3  . PRO A 1 77  ? -15.475 -9.839  0.636   1.00 0.00 ? 77  PRO A HB3  4  
ATOM   10656 H  HG2  . PRO A 1 77  ? -12.859 -10.272 -0.682  1.00 0.00 ? 77  PRO A HG2  4  
ATOM   10657 H  HG3  . PRO A 1 77  ? -13.973 -8.902  -0.813  1.00 0.00 ? 77  PRO A HG3  4  
ATOM   10658 H  HD2  . PRO A 1 77  ? -11.800 -8.793  0.756   1.00 0.00 ? 77  PRO A HD2  4  
ATOM   10659 H  HD3  . PRO A 1 77  ? -13.286 -7.980  1.191   1.00 0.00 ? 77  PRO A HD3  4  
ATOM   10660 N  N    . PHE A 1 78  ? -12.063 -12.248 1.569   1.00 0.00 ? 78  PHE A N    4  
ATOM   10661 C  CA   . PHE A 1 78  ? -11.294 -13.489 1.491   1.00 0.00 ? 78  PHE A CA   4  
ATOM   10662 C  C    . PHE A 1 78  ? -11.572 -14.341 2.719   1.00 0.00 ? 78  PHE A C    4  
ATOM   10663 O  O    . PHE A 1 78  ? -11.771 -15.551 2.613   1.00 0.00 ? 78  PHE A O    4  
ATOM   10664 C  CB   . PHE A 1 78  ? -9.804  -13.161 1.399   1.00 0.00 ? 78  PHE A CB   4  
ATOM   10665 C  CG   . PHE A 1 78  ? -9.017  -14.327 0.884   1.00 0.00 ? 78  PHE A CG   4  
ATOM   10666 C  CD1  . PHE A 1 78  ? -8.809  -15.436 1.699   1.00 0.00 ? 78  PHE A CD1  4  
ATOM   10667 C  CD2  . PHE A 1 78  ? -8.488  -14.287 -0.410  1.00 0.00 ? 78  PHE A CD2  4  
ATOM   10668 C  CE1  . PHE A 1 78  ? -8.069  -16.525 1.222   1.00 0.00 ? 78  PHE A CE1  4  
ATOM   10669 C  CE2  . PHE A 1 78  ? -7.750  -15.374 -0.893  1.00 0.00 ? 78  PHE A CE2  4  
ATOM   10670 C  CZ   . PHE A 1 78  ? -7.540  -16.495 -0.077  1.00 0.00 ? 78  PHE A CZ   4  
ATOM   10671 H  H    . PHE A 1 78  ? -11.600 -11.383 1.499   1.00 0.00 ? 78  PHE A H    4  
ATOM   10672 H  HA   . PHE A 1 78  ? -11.591 -14.034 0.607   1.00 0.00 ? 78  PHE A HA   4  
ATOM   10673 H  HB2  . PHE A 1 78  ? -9.681  -12.349 0.721   1.00 0.00 ? 78  PHE A HB2  4  
ATOM   10674 H  HB3  . PHE A 1 78  ? -9.431  -12.885 2.376   1.00 0.00 ? 78  PHE A HB3  4  
ATOM   10675 H  HD1  . PHE A 1 78  ? -9.212  -15.446 2.700   1.00 0.00 ? 78  PHE A HD1  4  
ATOM   10676 H  HD2  . PHE A 1 78  ? -8.648  -13.412 -1.033  1.00 0.00 ? 78  PHE A HD2  4  
ATOM   10677 H  HE1  . PHE A 1 78  ? -7.909  -17.388 1.851   1.00 0.00 ? 78  PHE A HE1  4  
ATOM   10678 H  HE2  . PHE A 1 78  ? -7.339  -15.348 -1.892  1.00 0.00 ? 78  PHE A HE2  4  
ATOM   10679 H  HZ   . PHE A 1 78  ? -6.971  -17.334 -0.447  1.00 0.00 ? 78  PHE A HZ   4  
ATOM   10680 N  N    . TRP A 1 79  ? -11.618 -13.699 3.886   1.00 0.00 ? 79  TRP A N    4  
ATOM   10681 C  CA   . TRP A 1 79  ? -11.910 -14.420 5.108   1.00 0.00 ? 79  TRP A CA   4  
ATOM   10682 C  C    . TRP A 1 79  ? -13.429 -14.469 5.296   1.00 0.00 ? 79  TRP A C    4  
ATOM   10683 O  O    . TRP A 1 79  ? -13.969 -15.381 5.920   1.00 0.00 ? 79  TRP A O    4  
ATOM   10684 C  CB   . TRP A 1 79  ? -11.258 -13.726 6.315   1.00 0.00 ? 79  TRP A CB   4  
ATOM   10685 C  CG   . TRP A 1 79  ? -10.181 -12.776 5.885   1.00 0.00 ? 79  TRP A CG   4  
ATOM   10686 C  CD1  . TRP A 1 79  ? -9.225  -13.010 4.957   1.00 0.00 ? 79  TRP A CD1  4  
ATOM   10687 C  CD2  . TRP A 1 79  ? -9.942  -11.434 6.387   1.00 0.00 ? 79  TRP A CD2  4  
ATOM   10688 N  NE1  . TRP A 1 79  ? -8.415  -11.885 4.858   1.00 0.00 ? 79  TRP A NE1  4  
ATOM   10689 C  CE2  . TRP A 1 79  ? -8.822  -10.883 5.723   1.00 0.00 ? 79  TRP A CE2  4  
ATOM   10690 C  CE3  . TRP A 1 79  ? -10.595 -10.653 7.347   1.00 0.00 ? 79  TRP A CE3  4  
ATOM   10691 C  CZ2  . TRP A 1 79  ? -8.368  -9.587  6.014   1.00 0.00 ? 79  TRP A CZ2  4  
ATOM   10692 C  CZ3  . TRP A 1 79  ? -10.148 -9.360  7.639   1.00 0.00 ? 79  TRP A CZ3  4  
ATOM   10693 C  CH2  . TRP A 1 79  ? -9.040  -8.827  6.977   1.00 0.00 ? 79  TRP A CH2  4  
ATOM   10694 H  H    . TRP A 1 79  ? -11.478 -12.729 3.920   1.00 0.00 ? 79  TRP A H    4  
ATOM   10695 H  HA   . TRP A 1 79  ? -11.529 -15.427 5.025   1.00 0.00 ? 79  TRP A HA   4  
ATOM   10696 H  HB2  . TRP A 1 79  ? -12.009 -13.165 6.845   1.00 0.00 ? 79  TRP A HB2  4  
ATOM   10697 H  HB3  . TRP A 1 79  ? -10.835 -14.472 6.973   1.00 0.00 ? 79  TRP A HB3  4  
ATOM   10698 H  HD1  . TRP A 1 79  ? -9.109  -13.921 4.389   1.00 0.00 ? 79  TRP A HD1  4  
ATOM   10699 H  HE1  . TRP A 1 79  ? -7.647  -11.792 4.257   1.00 0.00 ? 79  TRP A HE1  4  
ATOM   10700 H  HE3  . TRP A 1 79  ? -11.451 -11.055 7.864   1.00 0.00 ? 79  TRP A HE3  4  
ATOM   10701 H  HZ2  . TRP A 1 79  ? -7.504  -9.175  5.507   1.00 0.00 ? 79  TRP A HZ2  4  
ATOM   10702 H  HZ3  . TRP A 1 79  ? -10.656 -8.772  8.382   1.00 0.00 ? 79  TRP A HZ3  4  
ATOM   10703 H  HH2  . TRP A 1 79  ? -8.711  -7.826  7.207   1.00 0.00 ? 79  TRP A HH2  4  
ATOM   10704 N  N    . LYS A 1 80  ? -14.100 -13.478 4.711   1.00 0.00 ? 80  LYS A N    4  
ATOM   10705 C  CA   . LYS A 1 80  ? -15.545 -13.379 4.757   1.00 0.00 ? 80  LYS A CA   4  
ATOM   10706 C  C    . LYS A 1 80  ? -16.093 -13.492 6.187   1.00 0.00 ? 80  LYS A C    4  
ATOM   10707 O  O    . LYS A 1 80  ? -16.865 -14.399 6.498   1.00 0.00 ? 80  LYS A O    4  
ATOM   10708 C  CB   . LYS A 1 80  ? -16.134 -14.463 3.846   1.00 0.00 ? 80  LYS A CB   4  
ATOM   10709 C  CG   . LYS A 1 80  ? -17.211 -13.860 2.938   1.00 0.00 ? 80  LYS A CG   4  
ATOM   10710 C  CD   . LYS A 1 80  ? -17.700 -14.917 1.942   1.00 0.00 ? 80  LYS A CD   4  
ATOM   10711 C  CE   . LYS A 1 80  ? -18.861 -15.705 2.554   1.00 0.00 ? 80  LYS A CE   4  
ATOM   10712 N  NZ   . LYS A 1 80  ? -19.429 -16.628 1.532   1.00 0.00 ? 80  LYS A NZ   4  
ATOM   10713 H  H    . LYS A 1 80  ? -13.610 -12.808 4.209   1.00 0.00 ? 80  LYS A H    4  
ATOM   10714 H  HA   . LYS A 1 80  ? -15.824 -12.411 4.368   1.00 0.00 ? 80  LYS A HA   4  
ATOM   10715 H  HB2  . LYS A 1 80  ? -15.345 -14.876 3.235   1.00 0.00 ? 80  LYS A HB2  4  
ATOM   10716 H  HB3  . LYS A 1 80  ? -16.560 -15.242 4.441   1.00 0.00 ? 80  LYS A HB3  4  
ATOM   10717 H  HG2  . LYS A 1 80  ? -18.039 -13.515 3.540   1.00 0.00 ? 80  LYS A HG2  4  
ATOM   10718 H  HG3  . LYS A 1 80  ? -16.785 -13.027 2.395   1.00 0.00 ? 80  LYS A HG3  4  
ATOM   10719 H  HD2  . LYS A 1 80  ? -18.034 -14.430 1.037   1.00 0.00 ? 80  LYS A HD2  4  
ATOM   10720 H  HD3  . LYS A 1 80  ? -16.893 -15.595 1.708   1.00 0.00 ? 80  LYS A HD3  4  
ATOM   10721 H  HE2  . LYS A 1 80  ? -18.503 -16.278 3.396   1.00 0.00 ? 80  LYS A HE2  4  
ATOM   10722 H  HE3  . LYS A 1 80  ? -19.627 -15.019 2.886   1.00 0.00 ? 80  LYS A HE3  4  
ATOM   10723 H  HZ1  . LYS A 1 80  ? -20.154 -17.229 1.971   1.00 0.00 ? 80  LYS A HZ1  4  
ATOM   10724 H  HZ2  . LYS A 1 80  ? -18.673 -17.226 1.144   1.00 0.00 ? 80  LYS A HZ2  4  
ATOM   10725 H  HZ3  . LYS A 1 80  ? -19.859 -16.071 0.764   1.00 0.00 ? 80  LYS A HZ3  4  
ATOM   10726 N  N    . LEU A 1 81  ? -15.708 -12.552 7.050   1.00 0.00 ? 81  LEU A N    4  
ATOM   10727 C  CA   . LEU A 1 81  ? -16.191 -12.557 8.423   1.00 0.00 ? 81  LEU A CA   4  
ATOM   10728 C  C    . LEU A 1 81  ? -17.671 -12.256 8.480   1.00 0.00 ? 81  LEU A C    4  
ATOM   10729 O  O    . LEU A 1 81  ? -18.448 -12.594 7.586   1.00 0.00 ? 81  LEU A O    4  
ATOM   10730 C  CB   . LEU A 1 81  ? -15.497 -11.483 9.247   1.00 0.00 ? 81  LEU A CB   4  
ATOM   10731 C  CG   . LEU A 1 81  ? -14.040 -11.365 8.820   1.00 0.00 ? 81  LEU A CG   4  
ATOM   10732 C  CD1  . LEU A 1 81  ? -13.911 -10.493 7.553   1.00 0.00 ? 81  LEU A CD1  4  
ATOM   10733 C  CD2  . LEU A 1 81  ? -13.255 -10.757 9.981   1.00 0.00 ? 81  LEU A CD2  4  
ATOM   10734 H  H    . LEU A 1 81  ? -15.102 -11.843 6.758   1.00 0.00 ? 81  LEU A H    4  
ATOM   10735 H  HA   . LEU A 1 81  ? -15.992 -13.506 8.874   1.00 0.00 ? 81  LEU A HA   4  
ATOM   10736 H  HB2  . LEU A 1 81  ? -16.007 -10.525 9.122   1.00 0.00 ? 81  LEU A HB2  4  
ATOM   10737 H  HB3  . LEU A 1 81  ? -15.538 -11.768 10.289  1.00 0.00 ? 81  LEU A HB3  4  
ATOM   10738 H  HG   . LEU A 1 81  ? -13.654 -12.352 8.608   1.00 0.00 ? 81  LEU A HG   4  
ATOM   10739 H  HD11 . LEU A 1 81  ? -13.296 -9.633  7.760   1.00 0.00 ? 81  LEU A HD11 4  
ATOM   10740 H  HD12 . LEU A 1 81  ? -14.886 -10.166 7.224   1.00 0.00 ? 81  LEU A HD12 4  
ATOM   10741 H  HD13 . LEU A 1 81  ? -13.453 -11.079 6.768   1.00 0.00 ? 81  LEU A HD13 4  
ATOM   10742 H  HD21 . LEU A 1 81  ? -12.807 -11.553 10.553  1.00 0.00 ? 81  LEU A HD21 4  
ATOM   10743 H  HD22 . LEU A 1 81  ? -13.922 -10.190 10.615  1.00 0.00 ? 81  LEU A HD22 4  
ATOM   10744 H  HD23 . LEU A 1 81  ? -12.490 -10.107 9.599   1.00 0.00 ? 81  LEU A HD23 4  
ATOM   10745 N  N    . ASP A 1 82  ? -18.012 -11.549 9.539   1.00 0.00 ? 82  ASP A N    4  
ATOM   10746 C  CA   . ASP A 1 82  ? -19.356 -11.087 9.774   1.00 0.00 ? 82  ASP A CA   4  
ATOM   10747 C  C    . ASP A 1 82  ? -19.305 -9.572  9.874   1.00 0.00 ? 82  ASP A C    4  
ATOM   10748 O  O    . ASP A 1 82  ? -18.309 -8.947  9.507   1.00 0.00 ? 82  ASP A O    4  
ATOM   10749 C  CB   . ASP A 1 82  ? -19.903 -11.677 11.077  1.00 0.00 ? 82  ASP A CB   4  
ATOM   10750 C  CG   . ASP A 1 82  ? -20.575 -13.019 10.801  1.00 0.00 ? 82  ASP A CG   4  
ATOM   10751 O  OD1  . ASP A 1 82  ? -21.708 -13.010 10.348  1.00 0.00 ? 82  ASP A OD1  4  
ATOM   10752 O  OD2  . ASP A 1 82  ? -19.946 -14.036 11.045  1.00 0.00 ? 82  ASP A OD2  4  
ATOM   10753 H  H    . ASP A 1 82  ? -17.302 -11.293 10.173  1.00 0.00 ? 82  ASP A H    4  
ATOM   10754 H  HA   . ASP A 1 82  ? -19.992 -11.375 8.949   1.00 0.00 ? 82  ASP A HA   4  
ATOM   10755 H  HB2  . ASP A 1 82  ? -19.090 -11.819 11.774  1.00 0.00 ? 82  ASP A HB2  4  
ATOM   10756 H  HB3  . ASP A 1 82  ? -20.627 -10.997 11.505  1.00 0.00 ? 82  ASP A HB3  4  
ATOM   10757 N  N    . LEU A 1 83  ? -20.365 -8.991  10.376  1.00 0.00 ? 83  LEU A N    4  
ATOM   10758 C  CA   . LEU A 1 83  ? -20.433 -7.551  10.538  1.00 0.00 ? 83  LEU A CA   4  
ATOM   10759 C  C    . LEU A 1 83  ? -19.956 -7.147  11.929  1.00 0.00 ? 83  LEU A C    4  
ATOM   10760 O  O    . LEU A 1 83  ? -19.146 -6.232  12.082  1.00 0.00 ? 83  LEU A O    4  
ATOM   10761 C  CB   . LEU A 1 83  ? -21.865 -7.085  10.327  1.00 0.00 ? 83  LEU A CB   4  
ATOM   10762 C  CG   . LEU A 1 83  ? -21.863 -5.618  9.893   1.00 0.00 ? 83  LEU A CG   4  
ATOM   10763 C  CD1  . LEU A 1 83  ? -23.276 -5.205  9.513   1.00 0.00 ? 83  LEU A CD1  4  
ATOM   10764 C  CD2  . LEU A 1 83  ? -21.355 -4.735  11.040  1.00 0.00 ? 83  LEU A CD2  4  
ATOM   10765 H  H    . LEU A 1 83  ? -21.114 -9.542  10.655  1.00 0.00 ? 83  LEU A H    4  
ATOM   10766 H  HA   . LEU A 1 83  ? -19.804 -7.083  9.800   1.00 0.00 ? 83  LEU A HA   4  
ATOM   10767 H  HB2  . LEU A 1 83  ? -22.328 -7.688  9.558   1.00 0.00 ? 83  LEU A HB2  4  
ATOM   10768 H  HB3  . LEU A 1 83  ? -22.414 -7.193  11.250  1.00 0.00 ? 83  LEU A HB3  4  
ATOM   10769 H  HG   . LEU A 1 83  ? -21.217 -5.498  9.034   1.00 0.00 ? 83  LEU A HG   4  
ATOM   10770 H  HD11 . LEU A 1 83  ? -23.970 -5.607  10.234  1.00 0.00 ? 83  LEU A HD11 4  
ATOM   10771 H  HD12 . LEU A 1 83  ? -23.507 -5.590  8.532   1.00 0.00 ? 83  LEU A HD12 4  
ATOM   10772 H  HD13 . LEU A 1 83  ? -23.343 -4.129  9.507   1.00 0.00 ? 83  LEU A HD13 4  
ATOM   10773 H  HD21 . LEU A 1 83  ? -21.824 -3.763  10.985  1.00 0.00 ? 83  LEU A HD21 4  
ATOM   10774 H  HD22 . LEU A 1 83  ? -20.286 -4.619  10.954  1.00 0.00 ? 83  LEU A HD22 4  
ATOM   10775 H  HD23 . LEU A 1 83  ? -21.591 -5.196  11.987  1.00 0.00 ? 83  LEU A HD23 4  
ATOM   10776 N  N    . ASP A 1 84  ? -20.462 -7.839  12.943  1.00 0.00 ? 84  ASP A N    4  
ATOM   10777 C  CA   . ASP A 1 84  ? -20.086 -7.549  14.323  1.00 0.00 ? 84  ASP A CA   4  
ATOM   10778 C  C    . ASP A 1 84  ? -18.572 -7.450  14.450  1.00 0.00 ? 84  ASP A C    4  
ATOM   10779 O  O    . ASP A 1 84  ? -18.054 -6.853  15.394  1.00 0.00 ? 84  ASP A O    4  
ATOM   10780 C  CB   . ASP A 1 84  ? -20.609 -8.649  15.247  1.00 0.00 ? 84  ASP A CB   4  
ATOM   10781 C  CG   . ASP A 1 84  ? -20.409 -8.246  16.704  1.00 0.00 ? 84  ASP A CG   4  
ATOM   10782 O  OD1  . ASP A 1 84  ? -19.783 -7.225  16.936  1.00 0.00 ? 84  ASP A OD1  4  
ATOM   10783 O  OD2  . ASP A 1 84  ? -20.885 -8.965  17.567  1.00 0.00 ? 84  ASP A OD2  4  
ATOM   10784 H  H    . ASP A 1 84  ? -21.099 -8.558  12.760  1.00 0.00 ? 84  ASP A H    4  
ATOM   10785 H  HA   . ASP A 1 84  ? -20.526 -6.607  14.615  1.00 0.00 ? 84  ASP A HA   4  
ATOM   10786 H  HB2  . ASP A 1 84  ? -21.662 -8.803  15.059  1.00 0.00 ? 84  ASP A HB2  4  
ATOM   10787 H  HB3  . ASP A 1 84  ? -20.072 -9.565  15.053  1.00 0.00 ? 84  ASP A HB3  4  
ATOM   10788 N  N    . GLN A 1 85  ? -17.868 -8.041  13.492  1.00 0.00 ? 85  GLN A N    4  
ATOM   10789 C  CA   . GLN A 1 85  ? -16.413 -8.019  13.497  1.00 0.00 ? 85  GLN A CA   4  
ATOM   10790 C  C    . GLN A 1 85  ? -15.907 -6.793  12.729  1.00 0.00 ? 85  GLN A C    4  
ATOM   10791 O  O    . GLN A 1 85  ? -16.702 -5.953  12.308  1.00 0.00 ? 85  GLN A O    4  
ATOM   10792 C  CB   . GLN A 1 85  ? -15.866 -9.312  12.866  1.00 0.00 ? 85  GLN A CB   4  
ATOM   10793 C  CG   . GLN A 1 85  ? -16.981 -10.356 12.772  1.00 0.00 ? 85  GLN A CG   4  
ATOM   10794 C  CD   . GLN A 1 85  ? -17.594 -10.591 14.148  1.00 0.00 ? 85  GLN A CD   4  
ATOM   10795 O  OE1  . GLN A 1 85  ? -17.424 -9.774  15.053  1.00 0.00 ? 85  GLN A OE1  4  
ATOM   10796 N  NE2  . GLN A 1 85  ? -18.300 -11.667 14.362  1.00 0.00 ? 85  GLN A NE2  4  
ATOM   10797 H  H    . GLN A 1 85  ? -18.337 -8.501  12.769  1.00 0.00 ? 85  GLN A H    4  
ATOM   10798 H  HA   . GLN A 1 85  ? -16.079 -7.958  14.520  1.00 0.00 ? 85  GLN A HA   4  
ATOM   10799 H  HB2  . GLN A 1 85  ? -15.486 -9.104  11.875  1.00 0.00 ? 85  GLN A HB2  4  
ATOM   10800 H  HB3  . GLN A 1 85  ? -15.070 -9.702  13.480  1.00 0.00 ? 85  GLN A HB3  4  
ATOM   10801 H  HG2  . GLN A 1 85  ? -17.745 -10.004 12.093  1.00 0.00 ? 85  GLN A HG2  4  
ATOM   10802 H  HG3  . GLN A 1 85  ? -16.572 -11.283 12.400  1.00 0.00 ? 85  GLN A HG3  4  
ATOM   10803 H  HE21 . GLN A 1 85  ? -18.432 -12.317 13.639  1.00 0.00 ? 85  GLN A HE21 4  
ATOM   10804 H  HE22 . GLN A 1 85  ? -18.697 -11.826 15.247  1.00 0.00 ? 85  GLN A HE22 4  
ATOM   10805 N  N    . ASP A 1 86  ? -14.588 -6.684  12.558  1.00 0.00 ? 86  ASP A N    4  
ATOM   10806 C  CA   . ASP A 1 86  ? -14.024 -5.538  11.845  1.00 0.00 ? 86  ASP A CA   4  
ATOM   10807 C  C    . ASP A 1 86  ? -12.709 -5.917  11.152  1.00 0.00 ? 86  ASP A C    4  
ATOM   10808 O  O    . ASP A 1 86  ? -12.215 -7.033  11.309  1.00 0.00 ? 86  ASP A O    4  
ATOM   10809 C  CB   . ASP A 1 86  ? -13.785 -4.387  12.839  1.00 0.00 ? 86  ASP A CB   4  
ATOM   10810 C  CG   . ASP A 1 86  ? -14.897 -3.346  12.728  1.00 0.00 ? 86  ASP A CG   4  
ATOM   10811 O  OD1  . ASP A 1 86  ? -14.886 -2.597  11.764  1.00 0.00 ? 86  ASP A OD1  4  
ATOM   10812 O  OD2  . ASP A 1 86  ? -15.743 -3.314  13.606  1.00 0.00 ? 86  ASP A OD2  4  
ATOM   10813 H  H    . ASP A 1 86  ? -13.989 -7.371  12.922  1.00 0.00 ? 86  ASP A H    4  
ATOM   10814 H  HA   . ASP A 1 86  ? -14.728 -5.216  11.094  1.00 0.00 ? 86  ASP A HA   4  
ATOM   10815 H  HB2  . ASP A 1 86  ? -13.769 -4.781  13.847  1.00 0.00 ? 86  ASP A HB2  4  
ATOM   10816 H  HB3  . ASP A 1 86  ? -12.837 -3.918  12.627  1.00 0.00 ? 86  ASP A HB3  4  
ATOM   10817 N  N    . TYR A 1 87  ? -12.143 -4.974  10.398  1.00 0.00 ? 87  TYR A N    4  
ATOM   10818 C  CA   . TYR A 1 87  ? -10.880 -5.220  9.702   1.00 0.00 ? 87  TYR A CA   4  
ATOM   10819 C  C    . TYR A 1 87  ? -9.986  -3.985  9.740   1.00 0.00 ? 87  TYR A C    4  
ATOM   10820 O  O    . TYR A 1 87  ? -10.336 -2.936  9.198   1.00 0.00 ? 87  TYR A O    4  
ATOM   10821 C  CB   . TYR A 1 87  ? -11.125 -5.609  8.233   1.00 0.00 ? 87  TYR A CB   4  
ATOM   10822 C  CG   . TYR A 1 87  ? -12.587 -5.863  7.991   1.00 0.00 ? 87  TYR A CG   4  
ATOM   10823 C  CD1  . TYR A 1 87  ? -13.171 -7.066  8.393   1.00 0.00 ? 87  TYR A CD1  4  
ATOM   10824 C  CD2  . TYR A 1 87  ? -13.349 -4.898  7.336   1.00 0.00 ? 87  TYR A CD2  4  
ATOM   10825 C  CE1  . TYR A 1 87  ? -14.523 -7.304  8.135   1.00 0.00 ? 87  TYR A CE1  4  
ATOM   10826 C  CE2  . TYR A 1 87  ? -14.698 -5.134  7.071   1.00 0.00 ? 87  TYR A CE2  4  
ATOM   10827 C  CZ   . TYR A 1 87  ? -15.290 -6.339  7.471   1.00 0.00 ? 87  TYR A CZ   4  
ATOM   10828 O  OH   . TYR A 1 87  ? -16.625 -6.574  7.211   1.00 0.00 ? 87  TYR A OH   4  
ATOM   10829 H  H    . TYR A 1 87  ? -12.577 -4.099  10.316  1.00 0.00 ? 87  TYR A H    4  
ATOM   10830 H  HA   . TYR A 1 87  ? -10.363 -6.033  10.192  1.00 0.00 ? 87  TYR A HA   4  
ATOM   10831 H  HB2  . TYR A 1 87  ? -10.801 -4.807  7.583   1.00 0.00 ? 87  TYR A HB2  4  
ATOM   10832 H  HB3  . TYR A 1 87  ? -10.563 -6.501  7.993   1.00 0.00 ? 87  TYR A HB3  4  
ATOM   10833 H  HD1  . TYR A 1 87  ? -12.582 -7.803  8.907   1.00 0.00 ? 87  TYR A HD1  4  
ATOM   10834 H  HD2  . TYR A 1 87  ? -12.891 -3.974  7.031   1.00 0.00 ? 87  TYR A HD2  4  
ATOM   10835 H  HE1  . TYR A 1 87  ? -14.972 -8.236  8.442   1.00 0.00 ? 87  TYR A HE1  4  
ATOM   10836 H  HE2  . TYR A 1 87  ? -15.284 -4.388  6.556   1.00 0.00 ? 87  TYR A HE2  4  
ATOM   10837 H  HH   . TYR A 1 87  ? -16.696 -6.937  6.326   1.00 0.00 ? 87  TYR A HH   4  
ATOM   10838 N  N    . ARG A 1 88  ? -8.813  -4.132  10.339  1.00 0.00 ? 88  ARG A N    4  
ATOM   10839 C  CA   . ARG A 1 88  ? -7.851  -3.041  10.392  1.00 0.00 ? 88  ARG A CA   4  
ATOM   10840 C  C    . ARG A 1 88  ? -6.750  -3.342  9.387   1.00 0.00 ? 88  ARG A C    4  
ATOM   10841 O  O    . ARG A 1 88  ? -5.772  -4.024  9.699   1.00 0.00 ? 88  ARG A O    4  
ATOM   10842 C  CB   . ARG A 1 88  ? -7.263  -2.911  11.799  1.00 0.00 ? 88  ARG A CB   4  
ATOM   10843 C  CG   . ARG A 1 88  ? -8.347  -2.416  12.759  1.00 0.00 ? 88  ARG A CG   4  
ATOM   10844 C  CD   . ARG A 1 88  ? -7.737  -2.174  14.141  1.00 0.00 ? 88  ARG A CD   4  
ATOM   10845 N  NE   . ARG A 1 88  ? -6.598  -1.269  14.037  1.00 0.00 ? 88  ARG A NE   4  
ATOM   10846 C  CZ   . ARG A 1 88  ? -6.772  0.036   13.848  1.00 0.00 ? 88  ARG A CZ   4  
ATOM   10847 N  NH1  . ARG A 1 88  ? -7.977  0.526   13.754  1.00 0.00 ? 88  ARG A NH1  4  
ATOM   10848 N  NH2  . ARG A 1 88  ? -5.737  0.825   13.758  1.00 0.00 ? 88  ARG A NH2  4  
ATOM   10849 H  H    . ARG A 1 88  ? -8.575  -5.003  10.722  1.00 0.00 ? 88  ARG A H    4  
ATOM   10850 H  HA   . ARG A 1 88  ? -8.341  -2.115  10.117  1.00 0.00 ? 88  ARG A HA   4  
ATOM   10851 H  HB2  . ARG A 1 88  ? -6.900  -3.874  12.129  1.00 0.00 ? 88  ARG A HB2  4  
ATOM   10852 H  HB3  . ARG A 1 88  ? -6.448  -2.203  11.785  1.00 0.00 ? 88  ARG A HB3  4  
ATOM   10853 H  HG2  . ARG A 1 88  ? -8.767  -1.495  12.384  1.00 0.00 ? 88  ARG A HG2  4  
ATOM   10854 H  HG3  . ARG A 1 88  ? -9.126  -3.161  12.838  1.00 0.00 ? 88  ARG A HG3  4  
ATOM   10855 H  HD2  . ARG A 1 88  ? -8.481  -1.736  14.789  1.00 0.00 ? 88  ARG A HD2  4  
ATOM   10856 H  HD3  . ARG A 1 88  ? -7.412  -3.116  14.558  1.00 0.00 ? 88  ARG A HD3  4  
ATOM   10857 H  HE   . ARG A 1 88  ? -5.689  -1.628  14.110  1.00 0.00 ? 88  ARG A HE   4  
ATOM   10858 H  HH11 . ARG A 1 88  ? -8.770  -0.079  13.825  1.00 0.00 ? 88  ARG A HH11 4  
ATOM   10859 H  HH12 . ARG A 1 88  ? -8.108  1.507   13.610  1.00 0.00 ? 88  ARG A HH12 4  
ATOM   10860 H  HH21 . ARG A 1 88  ? -4.813  0.449   13.832  1.00 0.00 ? 88  ARG A HH21 4  
ATOM   10861 H  HH22 . ARG A 1 88  ? -5.868  1.806   13.615  1.00 0.00 ? 88  ARG A HH22 4  
ATOM   10862 N  N    . VAL A 1 89  ? -6.946  -2.873  8.162   1.00 0.00 ? 89  VAL A N    4  
ATOM   10863 C  CA   . VAL A 1 89  ? -5.994  -3.139  7.095   1.00 0.00 ? 89  VAL A CA   4  
ATOM   10864 C  C    . VAL A 1 89  ? -4.862  -2.109  7.055   1.00 0.00 ? 89  VAL A C    4  
ATOM   10865 O  O    . VAL A 1 89  ? -5.043  -0.940  7.405   1.00 0.00 ? 89  VAL A O    4  
ATOM   10866 C  CB   . VAL A 1 89  ? -6.727  -3.158  5.752   1.00 0.00 ? 89  VAL A CB   4  
ATOM   10867 C  CG1  . VAL A 1 89  ? -6.018  -4.096  4.764   1.00 0.00 ? 89  VAL A CG1  4  
ATOM   10868 C  CG2  . VAL A 1 89  ? -8.170  -3.632  5.954   1.00 0.00 ? 89  VAL A CG2  4  
ATOM   10869 H  H    . VAL A 1 89  ? -7.763  -2.369  7.964   1.00 0.00 ? 89  VAL A H    4  
ATOM   10870 H  HA   . VAL A 1 89  ? -5.568  -4.108  7.262   1.00 0.00 ? 89  VAL A HA   4  
ATOM   10871 H  HB   . VAL A 1 89  ? -6.732  -2.165  5.354   1.00 0.00 ? 89  VAL A HB   4  
ATOM   10872 H  HG11 . VAL A 1 89  ? -6.050  -3.662  3.778   1.00 0.00 ? 89  VAL A HG11 4  
ATOM   10873 H  HG12 . VAL A 1 89  ? -6.518  -5.057  4.749   1.00 0.00 ? 89  VAL A HG12 4  
ATOM   10874 H  HG13 . VAL A 1 89  ? -4.991  -4.229  5.062   1.00 0.00 ? 89  VAL A HG13 4  
ATOM   10875 H  HG21 . VAL A 1 89  ? -8.694  -2.939  6.593   1.00 0.00 ? 89  VAL A HG21 4  
ATOM   10876 H  HG22 . VAL A 1 89  ? -8.166  -4.613  6.411   1.00 0.00 ? 89  VAL A HG22 4  
ATOM   10877 H  HG23 . VAL A 1 89  ? -8.667  -3.685  4.996   1.00 0.00 ? 89  VAL A HG23 4  
ATOM   10878 N  N    . THR A 1 90  ? -3.695  -2.567  6.609   1.00 0.00 ? 90  THR A N    4  
ATOM   10879 C  CA   . THR A 1 90  ? -2.515  -1.717  6.501   1.00 0.00 ? 90  THR A CA   4  
ATOM   10880 C  C    . THR A 1 90  ? -1.787  -2.030  5.194   1.00 0.00 ? 90  THR A C    4  
ATOM   10881 O  O    . THR A 1 90  ? -1.309  -3.145  4.996   1.00 0.00 ? 90  THR A O    4  
ATOM   10882 C  CB   . THR A 1 90  ? -1.598  -1.967  7.711   1.00 0.00 ? 90  THR A CB   4  
ATOM   10883 O  OG1  . THR A 1 90  ? -2.062  -1.198  8.812   1.00 0.00 ? 90  THR A OG1  4  
ATOM   10884 C  CG2  . THR A 1 90  ? -0.152  -1.571  7.394   1.00 0.00 ? 90  THR A CG2  4  
ATOM   10885 H  H    . THR A 1 90  ? -3.626  -3.505  6.339   1.00 0.00 ? 90  THR A H    4  
ATOM   10886 H  HA   . THR A 1 90  ? -2.823  -0.681  6.497   1.00 0.00 ? 90  THR A HA   4  
ATOM   10887 H  HB   . THR A 1 90  ? -1.628  -3.013  7.972   1.00 0.00 ? 90  THR A HB   4  
ATOM   10888 H  HG1  . THR A 1 90  ? -1.570  -0.373  8.827   1.00 0.00 ? 90  THR A HG1  4  
ATOM   10889 H  HG21 . THR A 1 90  ? -0.124  -0.546  7.061   1.00 0.00 ? 90  THR A HG21 4  
ATOM   10890 H  HG22 . THR A 1 90  ? 0.239   -2.211  6.623   1.00 0.00 ? 90  THR A HG22 4  
ATOM   10891 H  HG23 . THR A 1 90  ? 0.451   -1.678  8.283   1.00 0.00 ? 90  THR A HG23 4  
ATOM   10892 N  N    . CYS A 1 91  ? -1.718  -1.050  4.298   1.00 0.00 ? 91  CYS A N    4  
ATOM   10893 C  CA   . CYS A 1 91  ? -1.060  -1.248  3.012   1.00 0.00 ? 91  CYS A CA   4  
ATOM   10894 C  C    . CYS A 1 91  ? 0.295   -0.555  2.970   1.00 0.00 ? 91  CYS A C    4  
ATOM   10895 O  O    . CYS A 1 91  ? 0.395   0.653   3.190   1.00 0.00 ? 91  CYS A O    4  
ATOM   10896 C  CB   . CYS A 1 91  ? -1.936  -0.684  1.893   1.00 0.00 ? 91  CYS A CB   4  
ATOM   10897 S  SG   . CYS A 1 91  ? -1.021  -0.745  0.334   1.00 0.00 ? 91  CYS A SG   4  
ATOM   10898 H  H    . CYS A 1 91  ? -2.122  -0.186  4.497   1.00 0.00 ? 91  CYS A H    4  
ATOM   10899 H  HA   . CYS A 1 91  ? -0.918  -2.307  2.843   1.00 0.00 ? 91  CYS A HA   4  
ATOM   10900 H  HB2  . CYS A 1 91  ? -2.839  -1.271  1.806   1.00 0.00 ? 91  CYS A HB2  4  
ATOM   10901 H  HB3  . CYS A 1 91  ? -2.191  0.342   2.118   1.00 0.00 ? 91  CYS A HB3  4  
ATOM   10902 H  HG   . CYS A 1 91  ? -0.475  0.043   0.280   1.00 0.00 ? 91  CYS A HG   4  
ATOM   10903 N  N    . PHE A 1 92  ? 1.332   -1.323  2.653   1.00 0.00 ? 92  PHE A N    4  
ATOM   10904 C  CA   . PHE A 1 92  ? 2.677   -0.773  2.545   1.00 0.00 ? 92  PHE A CA   4  
ATOM   10905 C  C    . PHE A 1 92  ? 3.082   -0.727  1.079   1.00 0.00 ? 92  PHE A C    4  
ATOM   10906 O  O    . PHE A 1 92  ? 3.472   -1.742  0.503   1.00 0.00 ? 92  PHE A O    4  
ATOM   10907 C  CB   . PHE A 1 92  ? 3.671   -1.641  3.317   1.00 0.00 ? 92  PHE A CB   4  
ATOM   10908 C  CG   . PHE A 1 92  ? 3.478   -1.454  4.802   1.00 0.00 ? 92  PHE A CG   4  
ATOM   10909 C  CD1  . PHE A 1 92  ? 3.878   -0.263  5.420   1.00 0.00 ? 92  PHE A CD1  4  
ATOM   10910 C  CD2  . PHE A 1 92  ? 2.910   -2.478  5.564   1.00 0.00 ? 92  PHE A CD2  4  
ATOM   10911 C  CE1  . PHE A 1 92  ? 3.706   -0.100  6.800   1.00 0.00 ? 92  PHE A CE1  4  
ATOM   10912 C  CE2  . PHE A 1 92  ? 2.740   -2.315  6.944   1.00 0.00 ? 92  PHE A CE2  4  
ATOM   10913 C  CZ   . PHE A 1 92  ? 3.137   -1.126  7.562   1.00 0.00 ? 92  PHE A CZ   4  
ATOM   10914 H  H    . PHE A 1 92  ? 1.185   -2.274  2.467   1.00 0.00 ? 92  PHE A H    4  
ATOM   10915 H  HA   . PHE A 1 92  ? 2.694   0.227   2.947   1.00 0.00 ? 92  PHE A HA   4  
ATOM   10916 H  HB2  . PHE A 1 92  ? 3.511   -2.679  3.064   1.00 0.00 ? 92  PHE A HB2  4  
ATOM   10917 H  HB3  . PHE A 1 92  ? 4.676   -1.357  3.049   1.00 0.00 ? 92  PHE A HB3  4  
ATOM   10918 H  HD1  . PHE A 1 92  ? 4.316   0.530   4.832   1.00 0.00 ? 92  PHE A HD1  4  
ATOM   10919 H  HD2  . PHE A 1 92  ? 2.601   -3.392  5.087   1.00 0.00 ? 92  PHE A HD2  4  
ATOM   10920 H  HE1  . PHE A 1 92  ? 4.013   0.816   7.277   1.00 0.00 ? 92  PHE A HE1  4  
ATOM   10921 H  HE2  . PHE A 1 92  ? 2.303   -3.110  7.533   1.00 0.00 ? 92  PHE A HE2  4  
ATOM   10922 H  HZ   . PHE A 1 92  ? 3.003   -0.999  8.625   1.00 0.00 ? 92  PHE A HZ   4  
ATOM   10923 N  N    . THR A 1 93  ? 2.978   0.451   0.474   1.00 0.00 ? 93  THR A N    4  
ATOM   10924 C  CA   . THR A 1 93  ? 3.333   0.597   -0.931  1.00 0.00 ? 93  THR A CA   4  
ATOM   10925 C  C    . THR A 1 93  ? 3.897   1.977   -1.202  1.00 0.00 ? 93  THR A C    4  
ATOM   10926 O  O    . THR A 1 93  ? 3.210   2.978   -1.027  1.00 0.00 ? 93  THR A O    4  
ATOM   10927 C  CB   . THR A 1 93  ? 2.098   0.393   -1.806  1.00 0.00 ? 93  THR A CB   4  
ATOM   10928 O  OG1  . THR A 1 93  ? 1.407   -0.777  -1.393  1.00 0.00 ? 93  THR A OG1  4  
ATOM   10929 C  CG2  . THR A 1 93  ? 2.511   0.264   -3.276  1.00 0.00 ? 93  THR A CG2  4  
ATOM   10930 H  H    . THR A 1 93  ? 2.652   1.231   0.979   1.00 0.00 ? 93  THR A H    4  
ATOM   10931 H  HA   . THR A 1 93  ? 4.072   -0.146  -1.186  1.00 0.00 ? 93  THR A HA   4  
ATOM   10932 H  HB   . THR A 1 93  ? 1.453   1.247   -1.699  1.00 0.00 ? 93  THR A HB   4  
ATOM   10933 H  HG1  . THR A 1 93  ? 0.482   -0.673  -1.631  1.00 0.00 ? 93  THR A HG1  4  
ATOM   10934 H  HG21 . THR A 1 93  ? 3.493   -0.181  -3.347  1.00 0.00 ? 93  THR A HG21 4  
ATOM   10935 H  HG22 . THR A 1 93  ? 2.529   1.241   -3.728  1.00 0.00 ? 93  THR A HG22 4  
ATOM   10936 H  HG23 . THR A 1 93  ? 1.798   -0.359  -3.796  1.00 0.00 ? 93  THR A HG23 4  
ATOM   10937 N  N    . SER A 1 94  ? 5.140   2.019   -1.650  1.00 0.00 ? 94  SER A N    4  
ATOM   10938 C  CA   . SER A 1 94  ? 5.794   3.285   -1.959  1.00 0.00 ? 94  SER A CA   4  
ATOM   10939 C  C    . SER A 1 94  ? 4.947   4.112   -2.925  1.00 0.00 ? 94  SER A C    4  
ATOM   10940 O  O    . SER A 1 94  ? 5.338   5.210   -3.323  1.00 0.00 ? 94  SER A O    4  
ATOM   10941 C  CB   . SER A 1 94  ? 7.163   3.021   -2.585  1.00 0.00 ? 94  SER A CB   4  
ATOM   10942 O  OG   . SER A 1 94  ? 7.517   4.116   -3.420  1.00 0.00 ? 94  SER A OG   4  
ATOM   10943 H  H    . SER A 1 94  ? 5.625   1.181   -1.785  1.00 0.00 ? 94  SER A H    4  
ATOM   10944 H  HA   . SER A 1 94  ? 5.932   3.840   -1.047  1.00 0.00 ? 94  SER A HA   4  
ATOM   10945 H  HB2  . SER A 1 94  ? 7.902   2.913   -1.809  1.00 0.00 ? 94  SER A HB2  4  
ATOM   10946 H  HB3  . SER A 1 94  ? 7.122   2.109   -3.167  1.00 0.00 ? 94  SER A HB3  4  
ATOM   10947 H  HG   . SER A 1 94  ? 8.443   4.319   -3.266  1.00 0.00 ? 94  SER A HG   4  
ATOM   10948 N  N    . TRP A 1 95  ? 3.796   3.570   -3.309  1.00 0.00 ? 95  TRP A N    4  
ATOM   10949 C  CA   . TRP A 1 95  ? 2.906   4.250   -4.244  1.00 0.00 ? 95  TRP A CA   4  
ATOM   10950 C  C    . TRP A 1 95  ? 1.531   4.493   -3.613  1.00 0.00 ? 95  TRP A C    4  
ATOM   10951 O  O    . TRP A 1 95  ? 1.007   3.646   -2.890  1.00 0.00 ? 95  TRP A O    4  
ATOM   10952 C  CB   . TRP A 1 95  ? 2.756   3.365   -5.482  1.00 0.00 ? 95  TRP A CB   4  
ATOM   10953 C  CG   . TRP A 1 95  ? 2.516   4.181   -6.709  1.00 0.00 ? 95  TRP A CG   4  
ATOM   10954 C  CD1  . TRP A 1 95  ? 3.411   5.008   -7.298  1.00 0.00 ? 95  TRP A CD1  4  
ATOM   10955 C  CD2  . TRP A 1 95  ? 1.317   4.227   -7.523  1.00 0.00 ? 95  TRP A CD2  4  
ATOM   10956 N  NE1  . TRP A 1 95  ? 2.827   5.556   -8.427  1.00 0.00 ? 95  TRP A NE1  4  
ATOM   10957 C  CE2  . TRP A 1 95  ? 1.538   5.103   -8.605  1.00 0.00 ? 95  TRP A CE2  4  
ATOM   10958 C  CE3  . TRP A 1 95  ? 0.069   3.597   -7.425  1.00 0.00 ? 95  TRP A CE3  4  
ATOM   10959 C  CZ2  . TRP A 1 95  ? 0.558   5.343   -9.558  1.00 0.00 ? 95  TRP A CZ2  4  
ATOM   10960 C  CZ3  . TRP A 1 95  ? -0.924  3.835   -8.385  1.00 0.00 ? 95  TRP A CZ3  4  
ATOM   10961 C  CH2  . TRP A 1 95  ? -0.677  4.708   -9.453  1.00 0.00 ? 95  TRP A CH2  4  
ATOM   10962 H  H    . TRP A 1 95  ? 3.546   2.689   -2.972  1.00 0.00 ? 95  TRP A H    4  
ATOM   10963 H  HA   . TRP A 1 95  ? 3.337   5.197   -4.534  1.00 0.00 ? 95  TRP A HA   4  
ATOM   10964 H  HB2  . TRP A 1 95  ? 3.659   2.789   -5.616  1.00 0.00 ? 95  TRP A HB2  4  
ATOM   10965 H  HB3  . TRP A 1 95  ? 1.925   2.690   -5.341  1.00 0.00 ? 95  TRP A HB3  4  
ATOM   10966 H  HD1  . TRP A 1 95  ? 4.413   5.207   -6.946  1.00 0.00 ? 95  TRP A HD1  4  
ATOM   10967 H  HE1  . TRP A 1 95  ? 3.255   6.190   -9.040  1.00 0.00 ? 95  TRP A HE1  4  
ATOM   10968 H  HE3  . TRP A 1 95  ? -0.127  2.930   -6.601  1.00 0.00 ? 95  TRP A HE3  4  
ATOM   10969 H  HZ2  . TRP A 1 95  ? 0.752   6.011   -10.373 1.00 0.00 ? 95  TRP A HZ2  4  
ATOM   10970 H  HZ3  . TRP A 1 95  ? -1.881  3.344   -8.302  1.00 0.00 ? 95  TRP A HZ3  4  
ATOM   10971 H  HH2  . TRP A 1 95  ? -1.437  4.890   -10.197 1.00 0.00 ? 95  TRP A HH2  4  
ATOM   10972 N  N    . SER A 1 96  ? 0.957   5.656   -3.906  1.00 0.00 ? 96  SER A N    4  
ATOM   10973 C  CA   . SER A 1 96  ? -0.359  6.025   -3.387  1.00 0.00 ? 96  SER A CA   4  
ATOM   10974 C  C    . SER A 1 96  ? -1.461  5.472   -4.312  1.00 0.00 ? 96  SER A C    4  
ATOM   10975 O  O    . SER A 1 96  ? -1.161  4.671   -5.197  1.00 0.00 ? 96  SER A O    4  
ATOM   10976 C  CB   . SER A 1 96  ? -0.422  7.543   -3.278  1.00 0.00 ? 96  SER A CB   4  
ATOM   10977 O  OG   . SER A 1 96  ? -1.044  8.074   -4.440  1.00 0.00 ? 96  SER A OG   4  
ATOM   10978 H  H    . SER A 1 96  ? 1.431   6.289   -4.491  1.00 0.00 ? 96  SER A H    4  
ATOM   10979 H  HA   . SER A 1 96  ? -0.480  5.596   -2.404  1.00 0.00 ? 96  SER A HA   4  
ATOM   10980 H  HB2  . SER A 1 96  ? -0.978  7.824   -2.402  1.00 0.00 ? 96  SER A HB2  4  
ATOM   10981 H  HB3  . SER A 1 96  ? 0.581   7.925   -3.190  1.00 0.00 ? 96  SER A HB3  4  
ATOM   10982 H  HG   . SER A 1 96  ? -1.408  8.933   -4.215  1.00 0.00 ? 96  SER A HG   4  
ATOM   10983 N  N    . PRO A 1 97  ? -2.722  5.837   -4.130  1.00 0.00 ? 97  PRO A N    4  
ATOM   10984 C  CA   . PRO A 1 97  ? -3.828  5.303   -4.978  1.00 0.00 ? 97  PRO A CA   4  
ATOM   10985 C  C    . PRO A 1 97  ? -3.948  6.076   -6.292  1.00 0.00 ? 97  PRO A C    4  
ATOM   10986 O  O    . PRO A 1 97  ? -2.935  6.476   -6.864  1.00 0.00 ? 97  PRO A O    4  
ATOM   10987 C  CB   . PRO A 1 97  ? -5.047  5.485   -4.085  1.00 0.00 ? 97  PRO A CB   4  
ATOM   10988 C  CG   . PRO A 1 97  ? -4.769  6.739   -3.338  1.00 0.00 ? 97  PRO A CG   4  
ATOM   10989 C  CD   . PRO A 1 97  ? -3.253  6.797   -3.133  1.00 0.00 ? 97  PRO A CD   4  
ATOM   10990 H  HA   . PRO A 1 97  ? -3.681  4.254   -5.169  1.00 0.00 ? 97  PRO A HA   4  
ATOM   10991 H  HB2  . PRO A 1 97  ? -5.940  5.578   -4.677  1.00 0.00 ? 97  PRO A HB2  4  
ATOM   10992 H  HB3  . PRO A 1 97  ? -5.135  4.660   -3.397  1.00 0.00 ? 97  PRO A HB3  4  
ATOM   10993 H  HG2  . PRO A 1 97  ? -5.102  7.596   -3.922  1.00 0.00 ? 97  PRO A HG2  4  
ATOM   10994 H  HG3  . PRO A 1 97  ? -5.263  6.719   -2.381  1.00 0.00 ? 97  PRO A HG3  4  
ATOM   10995 H  HD2  . PRO A 1 97  ? -2.917  7.798   -3.338  1.00 0.00 ? 97  PRO A HD2  4  
ATOM   10996 H  HD3  . PRO A 1 97  ? -2.985  6.494   -2.134  1.00 0.00 ? 97  PRO A HD3  4  
ATOM   10997 N  N    . CYS A 1 98  ? -5.172  6.291   -6.783  1.00 0.00 ? 98  CYS A N    4  
ATOM   10998 C  CA   . CYS A 1 98  ? -5.326  7.022   -8.039  1.00 0.00 ? 98  CYS A CA   4  
ATOM   10999 C  C    . CYS A 1 98  ? -6.677  7.716   -8.161  1.00 0.00 ? 98  CYS A C    4  
ATOM   11000 O  O    . CYS A 1 98  ? -7.631  7.393   -7.462  1.00 0.00 ? 98  CYS A O    4  
ATOM   11001 C  CB   . CYS A 1 98  ? -5.162  6.072   -9.220  1.00 0.00 ? 98  CYS A CB   4  
ATOM   11002 S  SG   . CYS A 1 98  ? -3.697  5.048   -8.972  1.00 0.00 ? 98  CYS A SG   4  
ATOM   11003 H  H    . CYS A 1 98  ? -5.960  5.958   -6.311  1.00 0.00 ? 98  CYS A H    4  
ATOM   11004 H  HA   . CYS A 1 98  ? -4.551  7.768   -8.089  1.00 0.00 ? 98  CYS A HA   4  
ATOM   11005 H  HB2  . CYS A 1 98  ? -6.032  5.441   -9.297  1.00 0.00 ? 98  CYS A HB2  4  
ATOM   11006 H  HB3  . CYS A 1 98  ? -5.051  6.644   -10.130 1.00 0.00 ? 98  CYS A HB3  4  
ATOM   11007 N  N    . PHE A 1 99  ? -6.728  8.669   -9.086  1.00 0.00 ? 99  PHE A N    4  
ATOM   11008 C  CA   . PHE A 1 99  ? -7.938  9.437   -9.356  1.00 0.00 ? 99  PHE A CA   4  
ATOM   11009 C  C    . PHE A 1 99  ? -9.194  8.590   -9.200  1.00 0.00 ? 99  PHE A C    4  
ATOM   11010 O  O    . PHE A 1 99  ? -10.085 8.924   -8.425  1.00 0.00 ? 99  PHE A O    4  
ATOM   11011 C  CB   . PHE A 1 99  ? -7.880  9.979   -10.782 1.00 0.00 ? 99  PHE A CB   4  
ATOM   11012 C  CG   . PHE A 1 99  ? -7.742  8.833   -11.754 1.00 0.00 ? 99  PHE A CG   4  
ATOM   11013 C  CD1  . PHE A 1 99  ? -6.510  8.185   -11.902 1.00 0.00 ? 99  PHE A CD1  4  
ATOM   11014 C  CD2  . PHE A 1 99  ? -8.843  8.422   -12.513 1.00 0.00 ? 99  PHE A CD2  4  
ATOM   11015 C  CE1  . PHE A 1 99  ? -6.380  7.125   -12.806 1.00 0.00 ? 99  PHE A CE1  4  
ATOM   11016 C  CE2  . PHE A 1 99  ? -8.714  7.362   -13.418 1.00 0.00 ? 99  PHE A CE2  4  
ATOM   11017 C  CZ   . PHE A 1 99  ? -7.482  6.713   -13.564 1.00 0.00 ? 99  PHE A CZ   4  
ATOM   11018 H  H    . PHE A 1 99  ? -5.922  8.859   -9.611  1.00 0.00 ? 99  PHE A H    4  
ATOM   11019 H  HA   . PHE A 1 99  ? -7.988  10.268  -8.671  1.00 0.00 ? 99  PHE A HA   4  
ATOM   11020 H  HB2  . PHE A 1 99  ? -8.782  10.531  -10.998 1.00 0.00 ? 99  PHE A HB2  4  
ATOM   11021 H  HB3  . PHE A 1 99  ? -7.028  10.628  -10.881 1.00 0.00 ? 99  PHE A HB3  4  
ATOM   11022 H  HD1  . PHE A 1 99  ? -5.660  8.503   -11.317 1.00 0.00 ? 99  PHE A HD1  4  
ATOM   11023 H  HD2  . PHE A 1 99  ? -9.793  8.922   -12.399 1.00 0.00 ? 99  PHE A HD2  4  
ATOM   11024 H  HE1  . PHE A 1 99  ? -5.430  6.625   -12.918 1.00 0.00 ? 99  PHE A HE1  4  
ATOM   11025 H  HE2  . PHE A 1 99  ? -9.565  7.046   -14.003 1.00 0.00 ? 99  PHE A HE2  4  
ATOM   11026 H  HZ   . PHE A 1 99  ? -7.382  5.896   -14.263 1.00 0.00 ? 99  PHE A HZ   4  
ATOM   11027 N  N    . SER A 1 100 ? -9.272  7.507   -9.961  1.00 0.00 ? 100 SER A N    4  
ATOM   11028 C  CA   . SER A 1 100 ? -10.447 6.639   -9.908  1.00 0.00 ? 100 SER A CA   4  
ATOM   11029 C  C    . SER A 1 100 ? -10.237 5.481   -8.939  1.00 0.00 ? 100 SER A C    4  
ATOM   11030 O  O    . SER A 1 100 ? -10.950 5.356   -7.944  1.00 0.00 ? 100 SER A O    4  
ATOM   11031 C  CB   . SER A 1 100 ? -10.756 6.081   -11.296 1.00 0.00 ? 100 SER A CB   4  
ATOM   11032 O  OG   . SER A 1 100 ? -12.017 5.425   -11.267 1.00 0.00 ? 100 SER A OG   4  
ATOM   11033 H  H    . SER A 1 100 ? -8.539  7.298   -10.576 1.00 0.00 ? 100 SER A H    4  
ATOM   11034 H  HA   . SER A 1 100 ? -11.293 7.226   -9.575  1.00 0.00 ? 100 SER A HA   4  
ATOM   11035 H  HB2  . SER A 1 100 ? -10.792 6.884   -12.011 1.00 0.00 ? 100 SER A HB2  4  
ATOM   11036 H  HB3  . SER A 1 100 ? -9.982  5.380   -11.583 1.00 0.00 ? 100 SER A HB3  4  
ATOM   11037 H  HG   . SER A 1 100 ? -11.872 4.515   -10.998 1.00 0.00 ? 100 SER A HG   4  
ATOM   11038 N  N    . CYS A 1 101 ? -9.265  4.627   -9.241  1.00 0.00 ? 101 CYS A N    4  
ATOM   11039 C  CA   . CYS A 1 101 ? -8.987  3.477   -8.389  1.00 0.00 ? 101 CYS A CA   4  
ATOM   11040 C  C    . CYS A 1 101 ? -9.168  3.849   -6.923  1.00 0.00 ? 101 CYS A C    4  
ATOM   11041 O  O    . CYS A 1 101 ? -9.465  2.994   -6.083  1.00 0.00 ? 101 CYS A O    4  
ATOM   11042 C  CB   . CYS A 1 101 ? -7.554  2.960   -8.649  1.00 0.00 ? 101 CYS A CB   4  
ATOM   11043 S  SG   . CYS A 1 101 ? -6.477  3.233   -7.212  1.00 0.00 ? 101 CYS A SG   4  
ATOM   11044 H  H    . CYS A 1 101 ? -8.734  4.768   -10.054 1.00 0.00 ? 101 CYS A H    4  
ATOM   11045 H  HA   . CYS A 1 101 ? -9.691  2.694   -8.631  1.00 0.00 ? 101 CYS A HA   4  
ATOM   11046 H  HB2  . CYS A 1 101 ? -7.588  1.904   -8.859  1.00 0.00 ? 101 CYS A HB2  4  
ATOM   11047 H  HB3  . CYS A 1 101 ? -7.143  3.476   -9.501  1.00 0.00 ? 101 CYS A HB3  4  
ATOM   11048 N  N    . ALA A 1 102 ? -9.008  5.130   -6.618  1.00 0.00 ? 102 ALA A N    4  
ATOM   11049 C  CA   . ALA A 1 102 ? -9.170  5.573   -5.248  1.00 0.00 ? 102 ALA A CA   4  
ATOM   11050 C  C    . ALA A 1 102 ? -10.639 5.523   -4.897  1.00 0.00 ? 102 ALA A C    4  
ATOM   11051 O  O    . ALA A 1 102 ? -11.031 4.957   -3.881  1.00 0.00 ? 102 ALA A O    4  
ATOM   11052 C  CB   . ALA A 1 102 ? -8.631  6.995   -5.061  1.00 0.00 ? 102 ALA A CB   4  
ATOM   11053 H  H    . ALA A 1 102 ? -8.797  5.779   -7.325  1.00 0.00 ? 102 ALA A H    4  
ATOM   11054 H  HA   . ALA A 1 102 ? -8.632  4.894   -4.607  1.00 0.00 ? 102 ALA A HA   4  
ATOM   11055 H  HB1  . ALA A 1 102 ? -7.567  7.005   -5.221  1.00 0.00 ? 102 ALA A HB1  4  
ATOM   11056 H  HB2  . ALA A 1 102 ? -8.842  7.336   -4.062  1.00 0.00 ? 102 ALA A HB2  4  
ATOM   11057 H  HB3  . ALA A 1 102 ? -9.104  7.651   -5.766  1.00 0.00 ? 102 ALA A HB3  4  
ATOM   11058 N  N    . GLN A 1 103 ? -11.452 6.093   -5.773  1.00 0.00 ? 103 GLN A N    4  
ATOM   11059 C  CA   . GLN A 1 103 ? -12.883 6.078   -5.573  1.00 0.00 ? 103 GLN A CA   4  
ATOM   11060 C  C    . GLN A 1 103 ? -13.321 4.662   -5.283  1.00 0.00 ? 103 GLN A C    4  
ATOM   11061 O  O    . GLN A 1 103 ? -13.867 4.382   -4.220  1.00 0.00 ? 103 GLN A O    4  
ATOM   11062 C  CB   . GLN A 1 103 ? -13.579 6.573   -6.829  1.00 0.00 ? 103 GLN A CB   4  
ATOM   11063 C  CG   . GLN A 1 103 ? -13.537 8.090   -6.842  1.00 0.00 ? 103 GLN A CG   4  
ATOM   11064 C  CD   . GLN A 1 103 ? -14.344 8.631   -8.018  1.00 0.00 ? 103 GLN A CD   4  
ATOM   11065 O  OE1  . GLN A 1 103 ? -14.483 7.957   -9.039  1.00 0.00 ? 103 GLN A OE1  4  
ATOM   11066 N  NE2  . GLN A 1 103 ? -14.886 9.816   -7.935  1.00 0.00 ? 103 GLN A NE2  4  
ATOM   11067 H  H    . GLN A 1 103 ? -11.082 6.507   -6.580  1.00 0.00 ? 103 GLN A H    4  
ATOM   11068 H  HA   . GLN A 1 103 ? -13.136 6.715   -4.741  1.00 0.00 ? 103 GLN A HA   4  
ATOM   11069 H  HB2  . GLN A 1 103 ? -13.054 6.191   -7.697  1.00 0.00 ? 103 GLN A HB2  4  
ATOM   11070 H  HB3  . GLN A 1 103 ? -14.605 6.236   -6.838  1.00 0.00 ? 103 GLN A HB3  4  
ATOM   11071 H  HG2  . GLN A 1 103 ? -13.944 8.474   -5.913  1.00 0.00 ? 103 GLN A HG2  4  
ATOM   11072 H  HG3  . GLN A 1 103 ? -12.513 8.394   -6.939  1.00 0.00 ? 103 GLN A HG3  4  
ATOM   11073 H  HE21 . GLN A 1 103 ? -14.773 10.350  -7.122  1.00 0.00 ? 103 GLN A HE21 4  
ATOM   11074 H  HE22 . GLN A 1 103 ? -15.405 10.170  -8.686  1.00 0.00 ? 103 GLN A HE22 4  
ATOM   11075 N  N    . GLU A 1 104 ? -13.045 3.769   -6.237  1.00 0.00 ? 104 GLU A N    4  
ATOM   11076 C  CA   . GLU A 1 104 ? -13.393 2.355   -6.077  1.00 0.00 ? 104 GLU A CA   4  
ATOM   11077 C  C    . GLU A 1 104 ? -13.249 1.982   -4.611  1.00 0.00 ? 104 GLU A C    4  
ATOM   11078 O  O    . GLU A 1 104 ? -14.225 1.659   -3.929  1.00 0.00 ? 104 GLU A O    4  
ATOM   11079 C  CB   . GLU A 1 104 ? -12.463 1.484   -6.933  1.00 0.00 ? 104 GLU A CB   4  
ATOM   11080 C  CG   . GLU A 1 104 ? -13.095 1.245   -8.307  1.00 0.00 ? 104 GLU A CG   4  
ATOM   11081 C  CD   . GLU A 1 104 ? -14.050 0.058   -8.241  1.00 0.00 ? 104 GLU A CD   4  
ATOM   11082 O  OE1  . GLU A 1 104 ? -13.719 -0.906  -7.570  1.00 0.00 ? 104 GLU A OE1  4  
ATOM   11083 O  OE2  . GLU A 1 104 ? -15.099 0.131   -8.860  1.00 0.00 ? 104 GLU A OE2  4  
ATOM   11084 H  H    . GLU A 1 104 ? -12.581 4.071   -7.051  1.00 0.00 ? 104 GLU A H    4  
ATOM   11085 H  HA   . GLU A 1 104 ? -14.415 2.197   -6.387  1.00 0.00 ? 104 GLU A HA   4  
ATOM   11086 H  HB2  . GLU A 1 104 ? -11.515 1.987   -7.057  1.00 0.00 ? 104 GLU A HB2  4  
ATOM   11087 H  HB3  . GLU A 1 104 ? -12.303 0.533   -6.445  1.00 0.00 ? 104 GLU A HB3  4  
ATOM   11088 H  HG2  . GLU A 1 104 ? -13.640 2.129   -8.609  1.00 0.00 ? 104 GLU A HG2  4  
ATOM   11089 H  HG3  . GLU A 1 104 ? -12.317 1.038   -9.029  1.00 0.00 ? 104 GLU A HG3  4  
ATOM   11090 N  N    . MET A 1 105 ? -12.024 2.080   -4.126  1.00 0.00 ? 105 MET A N    4  
ATOM   11091 C  CA   . MET A 1 105 ? -11.751 1.806   -2.739  1.00 0.00 ? 105 MET A CA   4  
ATOM   11092 C  C    . MET A 1 105 ? -12.651 2.692   -1.866  1.00 0.00 ? 105 MET A C    4  
ATOM   11093 O  O    . MET A 1 105 ? -13.557 2.178   -1.214  1.00 0.00 ? 105 MET A O    4  
ATOM   11094 C  CB   . MET A 1 105 ? -10.249 2.031   -2.505  1.00 0.00 ? 105 MET A CB   4  
ATOM   11095 C  CG   . MET A 1 105 ? -9.669  1.037   -1.488  1.00 0.00 ? 105 MET A CG   4  
ATOM   11096 S  SD   . MET A 1 105 ? -9.790  1.727   0.177   1.00 0.00 ? 105 MET A SD   4  
ATOM   11097 C  CE   . MET A 1 105 ? -8.638  3.095   -0.075  1.00 0.00 ? 105 MET A CE   4  
ATOM   11098 H  H    . MET A 1 105 ? -11.288 2.369   -4.709  1.00 0.00 ? 105 MET A H    4  
ATOM   11099 H  HA   . MET A 1 105 ? -11.992 0.792   -2.533  1.00 0.00 ? 105 MET A HA   4  
ATOM   11100 H  HB2  . MET A 1 105 ? -9.742  1.889   -3.448  1.00 0.00 ? 105 MET A HB2  4  
ATOM   11101 H  HB3  . MET A 1 105 ? -10.079 3.031   -2.166  1.00 0.00 ? 105 MET A HB3  4  
ATOM   11102 H  HG2  . MET A 1 105 ? -10.200 0.107   -1.532  1.00 0.00 ? 105 MET A HG2  4  
ATOM   11103 H  HG3  . MET A 1 105 ? -8.631  0.859   -1.723  1.00 0.00 ? 105 MET A HG3  4  
ATOM   11104 H  HE1  . MET A 1 105 ? -9.197  4.003   -0.247  1.00 0.00 ? 105 MET A HE1  4  
ATOM   11105 H  HE2  . MET A 1 105 ? -8.011  2.886   -0.931  1.00 0.00 ? 105 MET A HE2  4  
ATOM   11106 H  HE3  . MET A 1 105 ? -8.020  3.215   0.797   1.00 0.00 ? 105 MET A HE3  4  
ATOM   11107 N  N    . ALA A 1 106 ? -12.438 4.010   -1.873  1.00 0.00 ? 106 ALA A N    4  
ATOM   11108 C  CA   . ALA A 1 106 ? -13.282 4.908   -1.071  1.00 0.00 ? 106 ALA A CA   4  
ATOM   11109 C  C    . ALA A 1 106 ? -14.719 4.380   -0.944  1.00 0.00 ? 106 ALA A C    4  
ATOM   11110 O  O    . ALA A 1 106 ? -15.238 4.251   0.148   1.00 0.00 ? 106 ALA A O    4  
ATOM   11111 C  CB   . ALA A 1 106 ? -13.363 6.297   -1.701  1.00 0.00 ? 106 ALA A CB   4  
ATOM   11112 H  H    . ALA A 1 106 ? -11.716 4.386   -2.418  1.00 0.00 ? 106 ALA A H    4  
ATOM   11113 H  HA   . ALA A 1 106 ? -12.837 4.999   -0.080  1.00 0.00 ? 106 ALA A HA   4  
ATOM   11114 H  HB1  . ALA A 1 106 ? -13.599 7.020   -0.934  1.00 0.00 ? 106 ALA A HB1  4  
ATOM   11115 H  HB2  . ALA A 1 106 ? -14.139 6.312   -2.450  1.00 0.00 ? 106 ALA A HB2  4  
ATOM   11116 H  HB3  . ALA A 1 106 ? -12.427 6.543   -2.155  1.00 0.00 ? 106 ALA A HB3  4  
ATOM   11117 N  N    . LYS A 1 107 ? -15.384 4.082   -2.054  1.00 0.00 ? 107 LYS A N    4  
ATOM   11118 C  CA   . LYS A 1 107 ? -16.746 3.584   -1.951  1.00 0.00 ? 107 LYS A CA   4  
ATOM   11119 C  C    . LYS A 1 107 ? -16.794 2.497   -0.912  1.00 0.00 ? 107 LYS A C    4  
ATOM   11120 O  O    . LYS A 1 107 ? -17.330 2.666   0.182   1.00 0.00 ? 107 LYS A O    4  
ATOM   11121 C  CB   . LYS A 1 107 ? -17.178 2.975   -3.267  1.00 0.00 ? 107 LYS A CB   4  
ATOM   11122 C  CG   . LYS A 1 107 ? -17.508 4.084   -4.283  1.00 0.00 ? 107 LYS A CG   4  
ATOM   11123 C  CD   . LYS A 1 107 ? -16.713 3.860   -5.562  1.00 0.00 ? 107 LYS A CD   4  
ATOM   11124 C  CE   . LYS A 1 107 ? -17.256 2.632   -6.281  1.00 0.00 ? 107 LYS A CE   4  
ATOM   11125 N  NZ   . LYS A 1 107 ? -18.602 2.936   -6.843  1.00 0.00 ? 107 LYS A NZ   4  
ATOM   11126 H  H    . LYS A 1 107 ? -14.968 4.192   -2.934  1.00 0.00 ? 107 LYS A H    4  
ATOM   11127 H  HA   . LYS A 1