data_2KBS
# 
_entry.id   2KBS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2KBS         pdb_00002kbs 10.2210/pdb2kbs/pdb 
RCSB  RCSB100924   ?            ?                   
WWPDB D_1000100924 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2KBQ 'harmonin N terminal domain'                                                  unspecified 
PDB 2KBR 'harmonin N terminal domain in complex with a internal peptide of cadherin23' unspecified 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KBS 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-05 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pan, L.'   1 
'Yan, J.'   2 
'Wu, L.'    3 
'Zhang, M.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Assembling stable hair cell tip link complex via multidentate interactions between harmonin and cadherin 23' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            106 
_citation.page_first                5575 
_citation.page_last                 5580 
_citation.year                      2009 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19297620 
_citation.pdbx_database_id_DOI      10.1073/pnas.0901819106 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pan, L.'   1 ? 
primary 'Yan, J.'   2 ? 
primary 'Wu, L.'    3 ? 
primary 'Zhang, M.' 4 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Harmonin                             9678.154 1 ? ? 'PDZ2 domain, UNP residues 208-299'     ? 
2 polymer man 'octameric peptide from Cadherin-23' 915.039  1 ? ? 'carboxyl tail, UNP residues 3347-3354' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;Usher syndrome type-1C protein, Autoimmune enteropathy-related antigen AIE-75, Antigen NY-CO-38/NY-CO-37, PDZ-73 protein, Renal carcinoma antigen NY-REN-3
;
2 Otocadherin 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;KEKKVFISLVGSRGLGCSISSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTIS
IVAAAGRELFMT
;
;KEKKVFISLVGSRGLGCSISSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTIS
IVAAAGRELFMT
;
A ? 
2 'polypeptide(L)' no no TPLEITEL                                                                                        TPLEITEL 
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LYS n 
1 2  GLU n 
1 3  LYS n 
1 4  LYS n 
1 5  VAL n 
1 6  PHE n 
1 7  ILE n 
1 8  SER n 
1 9  LEU n 
1 10 VAL n 
1 11 GLY n 
1 12 SER n 
1 13 ARG n 
1 14 GLY n 
1 15 LEU n 
1 16 GLY n 
1 17 CYS n 
1 18 SER n 
1 19 ILE n 
1 20 SER n 
1 21 SER n 
1 22 GLY n 
1 23 PRO n 
1 24 ILE n 
1 25 GLN n 
1 26 LYS n 
1 27 PRO n 
1 28 GLY n 
1 29 ILE n 
1 30 PHE n 
1 31 ILE n 
1 32 SER n 
1 33 HIS n 
1 34 VAL n 
1 35 LYS n 
1 36 PRO n 
1 37 GLY n 
1 38 SER n 
1 39 LEU n 
1 40 SER n 
1 41 ALA n 
1 42 GLU n 
1 43 VAL n 
1 44 GLY n 
1 45 LEU n 
1 46 GLU n 
1 47 ILE n 
1 48 GLY n 
1 49 ASP n 
1 50 GLN n 
1 51 ILE n 
1 52 VAL n 
1 53 GLU n 
1 54 VAL n 
1 55 ASN n 
1 56 GLY n 
1 57 VAL n 
1 58 ASP n 
1 59 PHE n 
1 60 SER n 
1 61 ASN n 
1 62 LEU n 
1 63 ASP n 
1 64 HIS n 
1 65 LYS n 
1 66 GLU n 
1 67 ALA n 
1 68 VAL n 
1 69 ASN n 
1 70 VAL n 
1 71 LEU n 
1 72 LYS n 
1 73 SER n 
1 74 SER n 
1 75 ARG n 
1 76 SER n 
1 77 LEU n 
1 78 THR n 
1 79 ILE n 
1 80 SER n 
1 81 ILE n 
1 82 VAL n 
1 83 ALA n 
1 84 ALA n 
1 85 ALA n 
1 86 GLY n 
1 87 ARG n 
1 88 GLU n 
1 89 LEU n 
1 90 PHE n 
1 91 MET n 
1 92 THR n 
2 1  THR n 
2 2  PRO n 
2 3  LEU n 
2 4  GLU n 
2 5  ILE n 
2 6  THR n 
2 7  GLU n 
2 8  LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? HARMONIN   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 
'BL21(DE3)' ? ? ? ? ? ? ? vector pET32a ? ? ? ? ? 
2 1 sample ? ? ? human ? Cadherin23 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 
'BL21(DE3)' ? ? ? ? ? ? ? vector pET32a ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP USH1C_HUMAN Q9Y6N9 1 
;KEKKVFISLVGSRGLGCSISSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTIS
IVAAAGRELFMT
;
208  ? 
2 UNP CAD23_HUMAN Q9H251 2 TPLEITEL                                                                                        3347 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KBS A 1 ? 92 ? Q9Y6N9 208  ? 299  ? 9   100 
2 2 2KBS B 1 ? 8  ? Q9H251 3347 ? 3354 ? 111 118 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC'  
1 2 1 '2D 1H-1H NOESY'  
1 3 1 '3D CBCA(CO)NH'   
1 4 1 '3D HNCACB'       
1 5 1 '3D 1H-15N NOESY' 
1 6 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '100mM potassium phosphate-1, 1mM DTT-2, 1mM EDTA-3, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Varian INOVA 1 'Varian INOVA' 
750 Varian INOVA 2 'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2KBS 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KBS 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      20 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KBS 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Brunger, Adams, Clore, Gros, Nilges and Read' 'data analysis'              CNS ? 1 
'Brunger, Adams, Clore, Gros, Nilges and Read' 'chemical shift calculation' CNS ? 2 
?                                              refinement                   CNS ? 3 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KBS 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KBS 
_struct.title                     'Solution structure of harmonin PDZ2 in complex with the carboxyl tail peptide of cadherin23' 
_struct.pdbx_model_details        'lowest energy, model 20' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KBS 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/CELL ADHESION' 
_struct_keywords.text            
;PROTEIN COMPLEX, Alternative splicing, Coiled coil, Deafness, Hearing, Non-syndromic deafness, Polymorphism, Retinitis pigmentosa, Sensory transduction, Usher syndrome, Vision, Calcium, Cell adhesion, Cell membrane, Disease mutation, Glycoprotein, Membrane, Phosphoprotein, Transmembrane, STRUCTURAL PROTEIN-CELL ADHESION COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 38 ? GLY A 44 ? SER A 46 GLY A 52 1 ? 7  
HELX_P HELX_P2 2 ASP A 63 ? SER A 74 ? ASP A 71 SER A 82 1 ? 12 
HELX_P HELX_P3 3 GLY A 86 ? MET A 91 ? GLY A 94 MET A 99 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 2  ? ILE A 7  ? GLU A 10  ILE A 15  
A 2 LEU A 77 ? VAL A 82 ? LEU A 85  VAL A 90  
A 3 GLN A 50 ? VAL A 54 ? GLN A 58  VAL A 62  
A 4 VAL A 57 ? ASP A 58 ? VAL A 65  ASP A 66  
B 1 GLU A 2  ? ILE A 7  ? GLU A 10  ILE A 15  
B 2 LEU A 77 ? VAL A 82 ? LEU A 85  VAL A 90  
B 3 GLN A 50 ? VAL A 54 ? GLN A 58  VAL A 62  
B 4 ILE A 29 ? VAL A 34 ? ILE A 37  VAL A 42  
B 5 CYS A 17 ? SER A 21 ? CYS A 25  SER A 29  
B 6 ILE B 5  ? GLU B 7  ? ILE B 115 GLU B 117 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 5  ? N VAL A 13 O ILE A 79 ? O ILE A 87  
A 2 3 O SER A 80 ? O SER A 88 N VAL A 52 ? N VAL A 60  
A 3 4 N VAL A 54 ? N VAL A 62 O VAL A 57 ? O VAL A 65  
B 1 2 N VAL A 5  ? N VAL A 13 O ILE A 79 ? O ILE A 87  
B 2 3 O SER A 80 ? O SER A 88 N VAL A 52 ? N VAL A 60  
B 3 4 O ILE A 51 ? O ILE A 59 N ILE A 29 ? N ILE A 37  
B 4 5 O PHE A 30 ? O PHE A 38 N SER A 20 ? N SER A 28  
B 5 6 N ILE A 19 ? N ILE A 27 O THR B 6  ? O THR B 116 
# 
_atom_sites.entry_id                    2KBS 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . LYS A 1 1  ? -4.705  -4.699  -13.587 1.00 0.00 ? 9   LYS A N    1  
ATOM 2     C CA   . LYS A 1 1  ? -4.543  -3.418  -14.323 1.00 0.00 ? 9   LYS A CA   1  
ATOM 3     C C    . LYS A 1 1  ? -3.504  -2.525  -13.653 1.00 0.00 ? 9   LYS A C    1  
ATOM 4     O O    . LYS A 1 1  ? -3.778  -1.894  -12.632 1.00 0.00 ? 9   LYS A O    1  
ATOM 5     C CB   . LYS A 1 1  ? -5.898  -2.709  -14.370 1.00 0.00 ? 9   LYS A CB   1  
ATOM 6     C CG   . LYS A 1 1  ? -6.155  -1.977  -15.676 1.00 0.00 ? 9   LYS A CG   1  
ATOM 7     C CD   . LYS A 1 1  ? -7.363  -1.058  -15.573 1.00 0.00 ? 9   LYS A CD   1  
ATOM 8     C CE   . LYS A 1 1  ? -7.138  0.249   -16.317 1.00 0.00 ? 9   LYS A CE   1  
ATOM 9     N NZ   . LYS A 1 1  ? -7.250  1.429   -15.414 1.00 0.00 ? 9   LYS A NZ   1  
ATOM 10    H H1   . LYS A 1 1  ? -5.380  -5.286  -14.116 1.00 0.00 ? 9   LYS A H1   1  
ATOM 11    H H2   . LYS A 1 1  ? -5.065  -4.475  -12.637 1.00 0.00 ? 9   LYS A H2   1  
ATOM 12    H H3   . LYS A 1 1  ? -3.773  -5.156  -13.537 1.00 0.00 ? 9   LYS A H3   1  
ATOM 13    H HA   . LYS A 1 1  ? -4.222  -3.639  -15.330 1.00 0.00 ? 9   LYS A HA   1  
ATOM 14    H HB2  . LYS A 1 1  ? -6.679  -3.441  -14.234 1.00 0.00 ? 9   LYS A HB2  1  
ATOM 15    H HB3  . LYS A 1 1  ? -5.943  -1.990  -13.565 1.00 0.00 ? 9   LYS A HB3  1  
ATOM 16    H HG2  . LYS A 1 1  ? -5.286  -1.385  -15.924 1.00 0.00 ? 9   LYS A HG2  1  
ATOM 17    H HG3  . LYS A 1 1  ? -6.333  -2.703  -16.457 1.00 0.00 ? 9   LYS A HG3  1  
ATOM 18    H HD2  . LYS A 1 1  ? -8.220  -1.558  -15.997 1.00 0.00 ? 9   LYS A HD2  1  
ATOM 19    H HD3  . LYS A 1 1  ? -7.549  -0.842  -14.531 1.00 0.00 ? 9   LYS A HD3  1  
ATOM 20    H HE2  . LYS A 1 1  ? -6.150  0.236   -16.755 1.00 0.00 ? 9   LYS A HE2  1  
ATOM 21    H HE3  . LYS A 1 1  ? -7.877  0.334   -17.100 1.00 0.00 ? 9   LYS A HE3  1  
ATOM 22    H HZ1  . LYS A 1 1  ? -6.626  1.309   -14.590 1.00 0.00 ? 9   LYS A HZ1  1  
ATOM 23    H HZ2  . LYS A 1 1  ? -8.230  1.532   -15.082 1.00 0.00 ? 9   LYS A HZ2  1  
ATOM 24    H HZ3  . LYS A 1 1  ? -6.973  2.294   -15.921 1.00 0.00 ? 9   LYS A HZ3  1  
ATOM 25    N N    . GLU A 1 2  ? -2.310  -2.478  -14.235 1.00 0.00 ? 10  GLU A N    1  
ATOM 26    C CA   . GLU A 1 2  ? -1.228  -1.661  -13.696 1.00 0.00 ? 10  GLU A CA   1  
ATOM 27    C C    . GLU A 1 2  ? -1.600  -0.182  -13.720 1.00 0.00 ? 10  GLU A C    1  
ATOM 28    O O    . GLU A 1 2  ? -1.777  0.406   -14.786 1.00 0.00 ? 10  GLU A O    1  
ATOM 29    C CB   . GLU A 1 2  ? 0.058   -1.891  -14.494 1.00 0.00 ? 10  GLU A CB   1  
ATOM 30    C CG   . GLU A 1 2  ? 1.028   -2.850  -13.823 1.00 0.00 ? 10  GLU A CG   1  
ATOM 31    C CD   . GLU A 1 2  ? 2.256   -3.120  -14.670 1.00 0.00 ? 10  GLU A CD   1  
ATOM 32    O OE1  . GLU A 1 2  ? 2.093   -3.467  -15.860 1.00 0.00 ? 10  GLU A OE1  1  
ATOM 33    O OE2  . GLU A 1 2  ? 3.381   -2.986  -14.144 1.00 0.00 ? 10  GLU A OE2  1  
ATOM 34    H H    . GLU A 1 2  ? -2.152  -3.003  -15.047 1.00 0.00 ? 10  GLU A H    1  
ATOM 35    H HA   . GLU A 1 2  ? -1.064  -1.963  -12.672 1.00 0.00 ? 10  GLU A HA   1  
ATOM 36    H HB2  . GLU A 1 2  ? -0.202  -2.294  -15.461 1.00 0.00 ? 10  GLU A HB2  1  
ATOM 37    H HB3  . GLU A 1 2  ? 0.557   -0.944  -14.631 1.00 0.00 ? 10  GLU A HB3  1  
ATOM 38    H HG2  . GLU A 1 2  ? 1.345   -2.421  -12.884 1.00 0.00 ? 10  GLU A HG2  1  
ATOM 39    H HG3  . GLU A 1 2  ? 0.521   -3.785  -13.640 1.00 0.00 ? 10  GLU A HG3  1  
ATOM 40    N N    . LYS A 1 3  ? -1.717  0.415   -12.537 1.00 0.00 ? 11  LYS A N    1  
ATOM 41    C CA   . LYS A 1 3  ? -2.068  1.827   -12.428 1.00 0.00 ? 11  LYS A CA   1  
ATOM 42    C C    . LYS A 1 3  ? -0.848  2.668   -12.052 1.00 0.00 ? 11  LYS A C    1  
ATOM 43    O O    . LYS A 1 3  ? 0.046   2.206   -11.342 1.00 0.00 ? 11  LYS A O    1  
ATOM 44    C CB   . LYS A 1 3  ? -3.183  2.021   -11.397 1.00 0.00 ? 11  LYS A CB   1  
ATOM 45    C CG   . LYS A 1 3  ? -3.564  3.478   -11.175 1.00 0.00 ? 11  LYS A CG   1  
ATOM 46    C CD   . LYS A 1 3  ? -4.963  3.606   -10.593 1.00 0.00 ? 11  LYS A CD   1  
ATOM 47    C CE   . LYS A 1 3  ? -5.028  3.077   -9.169  1.00 0.00 ? 11  LYS A CE   1  
ATOM 48    N NZ   . LYS A 1 3  ? -5.994  1.952   -9.038  1.00 0.00 ? 11  LYS A NZ   1  
ATOM 49    H H    . LYS A 1 3  ? -1.564  -0.106  -11.719 1.00 0.00 ? 11  LYS A H    1  
ATOM 50    H HA   . LYS A 1 3  ? -2.425  2.152   -13.394 1.00 0.00 ? 11  LYS A HA   1  
ATOM 51    H HB2  . LYS A 1 3  ? -4.062  1.492   -11.732 1.00 0.00 ? 11  LYS A HB2  1  
ATOM 52    H HB3  . LYS A 1 3  ? -2.865  1.608   -10.452 1.00 0.00 ? 11  LYS A HB3  1  
ATOM 53    H HG2  . LYS A 1 3  ? -2.858  3.924   -10.490 1.00 0.00 ? 11  LYS A HG2  1  
ATOM 54    H HG3  . LYS A 1 3  ? -3.528  3.997   -12.121 1.00 0.00 ? 11  LYS A HG3  1  
ATOM 55    H HD2  . LYS A 1 3  ? -5.246  4.648   -10.592 1.00 0.00 ? 11  LYS A HD2  1  
ATOM 56    H HD3  . LYS A 1 3  ? -5.651  3.044   -11.208 1.00 0.00 ? 11  LYS A HD3  1  
ATOM 57    H HE2  . LYS A 1 3  ? -4.046  2.730   -8.879  1.00 0.00 ? 11  LYS A HE2  1  
ATOM 58    H HE3  . LYS A 1 3  ? -5.333  3.880   -8.514  1.00 0.00 ? 11  LYS A HE3  1  
ATOM 59    H HZ1  . LYS A 1 3  ? -6.915  2.308   -8.711  1.00 0.00 ? 11  LYS A HZ1  1  
ATOM 60    H HZ2  . LYS A 1 3  ? -5.641  1.255   -8.352  1.00 0.00 ? 11  LYS A HZ2  1  
ATOM 61    H HZ3  . LYS A 1 3  ? -6.122  1.482   -9.958  1.00 0.00 ? 11  LYS A HZ3  1  
ATOM 62    N N    . LYS A 1 4  ? -0.815  3.904   -12.538 1.00 0.00 ? 12  LYS A N    1  
ATOM 63    C CA   . LYS A 1 4  ? 0.297   4.807   -12.257 1.00 0.00 ? 12  LYS A CA   1  
ATOM 64    C C    . LYS A 1 4  ? -0.133  5.930   -11.318 1.00 0.00 ? 12  LYS A C    1  
ATOM 65    O O    . LYS A 1 4  ? -1.219  6.493   -11.463 1.00 0.00 ? 12  LYS A O    1  
ATOM 66    C CB   . LYS A 1 4  ? 0.843   5.396   -13.559 1.00 0.00 ? 12  LYS A CB   1  
ATOM 67    C CG   . LYS A 1 4  ? 2.275   5.892   -13.449 1.00 0.00 ? 12  LYS A CG   1  
ATOM 68    C CD   . LYS A 1 4  ? 3.263   4.737   -13.414 1.00 0.00 ? 12  LYS A CD   1  
ATOM 69    C CE   . LYS A 1 4  ? 4.628   5.187   -12.923 1.00 0.00 ? 12  LYS A CE   1  
ATOM 70    N NZ   . LYS A 1 4  ? 5.546   5.512   -14.050 1.00 0.00 ? 12  LYS A NZ   1  
ATOM 71    H H    . LYS A 1 4  ? -1.554  4.217   -13.101 1.00 0.00 ? 12  LYS A H    1  
ATOM 72    H HA   . LYS A 1 4  ? 1.075   4.233   -11.779 1.00 0.00 ? 12  LYS A HA   1  
ATOM 73    H HB2  . LYS A 1 4  ? 0.805   4.639   -14.328 1.00 0.00 ? 12  LYS A HB2  1  
ATOM 74    H HB3  . LYS A 1 4  ? 0.219   6.227   -13.854 1.00 0.00 ? 12  LYS A HB3  1  
ATOM 75    H HG2  . LYS A 1 4  ? 2.497   6.516   -14.301 1.00 0.00 ? 12  LYS A HG2  1  
ATOM 76    H HG3  . LYS A 1 4  ? 2.377   6.468   -12.541 1.00 0.00 ? 12  LYS A HG3  1  
ATOM 77    H HD2  . LYS A 1 4  ? 2.886   3.973   -12.750 1.00 0.00 ? 12  LYS A HD2  1  
ATOM 78    H HD3  . LYS A 1 4  ? 3.363   4.332   -14.412 1.00 0.00 ? 12  LYS A HD3  1  
ATOM 79    H HE2  . LYS A 1 4  ? 4.503   6.066   -12.309 1.00 0.00 ? 12  LYS A HE2  1  
ATOM 80    H HE3  . LYS A 1 4  ? 5.064   4.395   -12.332 1.00 0.00 ? 12  LYS A HE3  1  
ATOM 81    H HZ1  . LYS A 1 4  ? 6.167   4.702   -14.250 1.00 0.00 ? 12  LYS A HZ1  1  
ATOM 82    H HZ2  . LYS A 1 4  ? 6.134   6.334   -13.806 1.00 0.00 ? 12  LYS A HZ2  1  
ATOM 83    H HZ3  . LYS A 1 4  ? 4.997   5.734   -14.906 1.00 0.00 ? 12  LYS A HZ3  1  
ATOM 84    N N    . VAL A 1 5  ? 0.727   6.253   -10.358 1.00 0.00 ? 13  VAL A N    1  
ATOM 85    C CA   . VAL A 1 5  ? 0.440   7.311   -9.398  1.00 0.00 ? 13  VAL A CA   1  
ATOM 86    C C    . VAL A 1 5  ? 1.701   8.097   -9.055  1.00 0.00 ? 13  VAL A C    1  
ATOM 87    O O    . VAL A 1 5  ? 2.731   7.517   -8.705  1.00 0.00 ? 13  VAL A O    1  
ATOM 88    C CB   . VAL A 1 5  ? -0.170  6.742   -8.102  1.00 0.00 ? 13  VAL A CB   1  
ATOM 89    C CG1  . VAL A 1 5  ? -0.572  7.865   -7.159  1.00 0.00 ? 13  VAL A CG1  1  
ATOM 90    C CG2  . VAL A 1 5  ? -1.360  5.850   -8.421  1.00 0.00 ? 13  VAL A CG2  1  
ATOM 91    H H    . VAL A 1 5  ? 1.578   5.769   -10.296 1.00 0.00 ? 13  VAL A H    1  
ATOM 92    H HA   . VAL A 1 5  ? -0.279  7.981   -9.845  1.00 0.00 ? 13  VAL A HA   1  
ATOM 93    H HB   . VAL A 1 5  ? 0.580   6.140   -7.608  1.00 0.00 ? 13  VAL A HB   1  
ATOM 94    H HG11 . VAL A 1 5  ? -0.650  8.790   -7.712  1.00 0.00 ? 13  VAL A HG11 1  
ATOM 95    H HG12 . VAL A 1 5  ? 0.173   7.970   -6.385  1.00 0.00 ? 13  VAL A HG12 1  
ATOM 96    H HG13 . VAL A 1 5  ? -1.528  7.634   -6.710  1.00 0.00 ? 13  VAL A HG13 1  
ATOM 97    H HG21 . VAL A 1 5  ? -1.070  5.109   -9.150  1.00 0.00 ? 13  VAL A HG21 1  
ATOM 98    H HG22 . VAL A 1 5  ? -2.163  6.452   -8.819  1.00 0.00 ? 13  VAL A HG22 1  
ATOM 99    H HG23 . VAL A 1 5  ? -1.693  5.357   -7.519  1.00 0.00 ? 13  VAL A HG23 1  
ATOM 100   N N    . PHE A 1 6  ? 1.615   9.419   -9.158  1.00 0.00 ? 14  PHE A N    1  
ATOM 101   C CA   . PHE A 1 6  ? 2.750   10.285  -8.861  1.00 0.00 ? 14  PHE A CA   1  
ATOM 102   C C    . PHE A 1 6  ? 2.466   11.156  -7.641  1.00 0.00 ? 14  PHE A C    1  
ATOM 103   O O    . PHE A 1 6  ? 1.559   11.989  -7.660  1.00 0.00 ? 14  PHE A O    1  
ATOM 104   C CB   . PHE A 1 6  ? 3.076   11.172  -10.066 1.00 0.00 ? 14  PHE A CB   1  
ATOM 105   C CG   . PHE A 1 6  ? 2.979   10.457  -11.384 1.00 0.00 ? 14  PHE A CG   1  
ATOM 106   C CD1  . PHE A 1 6  ? 1.754   10.303  -12.015 1.00 0.00 ? 14  PHE A CD1  1  
ATOM 107   C CD2  . PHE A 1 6  ? 4.112   9.942   -11.994 1.00 0.00 ? 14  PHE A CD2  1  
ATOM 108   C CE1  . PHE A 1 6  ? 1.661   9.646   -13.227 1.00 0.00 ? 14  PHE A CE1  1  
ATOM 109   C CE2  . PHE A 1 6  ? 4.025   9.285   -13.206 1.00 0.00 ? 14  PHE A CE2  1  
ATOM 110   C CZ   . PHE A 1 6  ? 2.798   9.137   -13.824 1.00 0.00 ? 14  PHE A CZ   1  
ATOM 111   H H    . PHE A 1 6  ? 0.768   9.821   -9.442  1.00 0.00 ? 14  PHE A H    1  
ATOM 112   H HA   . PHE A 1 6  ? 3.602   9.656   -8.648  1.00 0.00 ? 14  PHE A HA   1  
ATOM 113   H HB2  . PHE A 1 6  ? 2.386   12.002  -10.089 1.00 0.00 ? 14  PHE A HB2  1  
ATOM 114   H HB3  . PHE A 1 6  ? 4.083   11.548  -9.964  1.00 0.00 ? 14  PHE A HB3  1  
ATOM 115   H HD1  . PHE A 1 6  ? 0.864   10.700  -11.550 1.00 0.00 ? 14  PHE A HD1  1  
ATOM 116   H HD2  . PHE A 1 6  ? 5.071   10.057  -11.511 1.00 0.00 ? 14  PHE A HD2  1  
ATOM 117   H HE1  . PHE A 1 6  ? 0.701   9.532   -13.709 1.00 0.00 ? 14  PHE A HE1  1  
ATOM 118   H HE2  . PHE A 1 6  ? 4.915   8.887   -13.671 1.00 0.00 ? 14  PHE A HE2  1  
ATOM 119   H HZ   . PHE A 1 6  ? 2.729   8.624   -14.772 1.00 0.00 ? 14  PHE A HZ   1  
ATOM 120   N N    . ILE A 1 7  ? 3.248   10.963  -6.584  1.00 0.00 ? 15  ILE A N    1  
ATOM 121   C CA   . ILE A 1 7  ? 3.079   11.738  -5.359  1.00 0.00 ? 15  ILE A CA   1  
ATOM 122   C C    . ILE A 1 7  ? 4.164   12.801  -5.233  1.00 0.00 ? 15  ILE A C    1  
ATOM 123   O O    . ILE A 1 7  ? 5.355   12.494  -5.279  1.00 0.00 ? 15  ILE A O    1  
ATOM 124   C CB   . ILE A 1 7  ? 3.112   10.834  -4.111  1.00 0.00 ? 15  ILE A CB   1  
ATOM 125   C CG1  . ILE A 1 7  ? 2.115   9.683   -4.260  1.00 0.00 ? 15  ILE A CG1  1  
ATOM 126   C CG2  . ILE A 1 7  ? 2.807   11.644  -2.859  1.00 0.00 ? 15  ILE A CG2  1  
ATOM 127   C CD1  . ILE A 1 7  ? 0.689   10.143  -4.475  1.00 0.00 ? 15  ILE A CD1  1  
ATOM 128   H H    . ILE A 1 7  ? 3.958   10.287  -6.628  1.00 0.00 ? 15  ILE A H    1  
ATOM 129   H HA   . ILE A 1 7  ? 2.115   12.224  -5.404  1.00 0.00 ? 15  ILE A HA   1  
ATOM 130   H HB   . ILE A 1 7  ? 4.107   10.428  -4.013  1.00 0.00 ? 15  ILE A HB   1  
ATOM 131   H HG12 . ILE A 1 7  ? 2.399   9.076   -5.107  1.00 0.00 ? 15  ILE A HG12 1  
ATOM 132   H HG13 . ILE A 1 7  ? 2.137   9.078   -3.365  1.00 0.00 ? 15  ILE A HG13 1  
ATOM 133   H HG21 . ILE A 1 7  ? 2.936   11.022  -1.986  1.00 0.00 ? 15  ILE A HG21 1  
ATOM 134   H HG22 . ILE A 1 7  ? 1.787   11.999  -2.900  1.00 0.00 ? 15  ILE A HG22 1  
ATOM 135   H HG23 . ILE A 1 7  ? 3.480   12.487  -2.803  1.00 0.00 ? 15  ILE A HG23 1  
ATOM 136   H HD11 . ILE A 1 7  ? 0.041   9.647   -3.769  1.00 0.00 ? 15  ILE A HD11 1  
ATOM 137   H HD12 . ILE A 1 7  ? 0.381   9.899   -5.481  1.00 0.00 ? 15  ILE A HD12 1  
ATOM 138   H HD13 . ILE A 1 7  ? 0.630   11.211  -4.330  1.00 0.00 ? 15  ILE A HD13 1  
ATOM 139   N N    . SER A 1 8  ? 3.745   14.052  -5.078  1.00 0.00 ? 16  SER A N    1  
ATOM 140   C CA   . SER A 1 8  ? 4.682   15.161  -4.947  1.00 0.00 ? 16  SER A CA   1  
ATOM 141   C C    . SER A 1 8  ? 4.222   16.138  -3.869  1.00 0.00 ? 16  SER A C    1  
ATOM 142   O O    . SER A 1 8  ? 3.100   16.641  -3.911  1.00 0.00 ? 16  SER A O    1  
ATOM 143   C CB   . SER A 1 8  ? 4.831   15.892  -6.283  1.00 0.00 ? 16  SER A CB   1  
ATOM 144   O OG   . SER A 1 8  ? 5.402   15.044  -7.266  1.00 0.00 ? 16  SER A OG   1  
ATOM 145   H H    . SER A 1 8  ? 2.782   14.235  -5.051  1.00 0.00 ? 16  SER A H    1  
ATOM 146   H HA   . SER A 1 8  ? 5.640   14.754  -4.661  1.00 0.00 ? 16  SER A HA   1  
ATOM 147   H HB2  . SER A 1 8  ? 3.859   16.214  -6.625  1.00 0.00 ? 16  SER A HB2  1  
ATOM 148   H HB3  . SER A 1 8  ? 5.472   16.751  -6.151  1.00 0.00 ? 16  SER A HB3  1  
ATOM 149   H HG   . SER A 1 8  ? 5.168   15.366  -8.140  1.00 0.00 ? 16  SER A HG   1  
ATOM 150   N N    . LEU A 1 9  ? 5.097   16.399  -2.904  1.00 0.00 ? 17  LEU A N    1  
ATOM 151   C CA   . LEU A 1 9  ? 4.780   17.315  -1.813  1.00 0.00 ? 17  LEU A CA   1  
ATOM 152   C C    . LEU A 1 9  ? 4.889   18.766  -2.270  1.00 0.00 ? 17  LEU A C    1  
ATOM 153   O O    . LEU A 1 9  ? 5.873   19.448  -1.983  1.00 0.00 ? 17  LEU A O    1  
ATOM 154   C CB   . LEU A 1 9  ? 5.715   17.071  -0.627  1.00 0.00 ? 17  LEU A CB   1  
ATOM 155   C CG   . LEU A 1 9  ? 5.090   17.309  0.748   1.00 0.00 ? 17  LEU A CG   1  
ATOM 156   C CD1  . LEU A 1 9  ? 5.689   16.364  1.778   1.00 0.00 ? 17  LEU A CD1  1  
ATOM 157   C CD2  . LEU A 1 9  ? 5.281   18.756  1.175   1.00 0.00 ? 17  LEU A CD2  1  
ATOM 158   H H    . LEU A 1 9  ? 5.976   15.967  -2.923  1.00 0.00 ? 17  LEU A H    1  
ATOM 159   H HA   . LEU A 1 9  ? 3.764   17.123  -1.505  1.00 0.00 ? 17  LEU A HA   1  
ATOM 160   H HB2  . LEU A 1 9  ? 6.058   16.047  -0.672  1.00 0.00 ? 17  LEU A HB2  1  
ATOM 161   H HB3  . LEU A 1 9  ? 6.569   17.725  -0.727  1.00 0.00 ? 17  LEU A HB3  1  
ATOM 162   H HG   . LEU A 1 9  ? 4.029   17.112  0.694   1.00 0.00 ? 17  LEU A HG   1  
ATOM 163   H HD11 . LEU A 1 9  ? 6.607   16.785  2.162   1.00 0.00 ? 17  LEU A HD11 1  
ATOM 164   H HD12 . LEU A 1 9  ? 5.897   15.410  1.314   1.00 0.00 ? 17  LEU A HD12 1  
ATOM 165   H HD13 . LEU A 1 9  ? 4.990   16.224  2.589   1.00 0.00 ? 17  LEU A HD13 1  
ATOM 166   H HD21 . LEU A 1 9  ? 6.187   18.844  1.756   1.00 0.00 ? 17  LEU A HD21 1  
ATOM 167   H HD22 . LEU A 1 9  ? 4.439   19.069  1.775   1.00 0.00 ? 17  LEU A HD22 1  
ATOM 168   H HD23 . LEU A 1 9  ? 5.350   19.384  0.300   1.00 0.00 ? 17  LEU A HD23 1  
ATOM 169   N N    . VAL A 1 10 ? 3.870   19.233  -2.985  1.00 0.00 ? 18  VAL A N    1  
ATOM 170   C CA   . VAL A 1 10 ? 3.851   20.603  -3.481  1.00 0.00 ? 18  VAL A CA   1  
ATOM 171   C C    . VAL A 1 10 ? 3.696   21.599  -2.336  1.00 0.00 ? 18  VAL A C    1  
ATOM 172   O O    . VAL A 1 10 ? 4.192   22.723  -2.407  1.00 0.00 ? 18  VAL A O    1  
ATOM 173   C CB   . VAL A 1 10 ? 2.708   20.821  -4.491  1.00 0.00 ? 18  VAL A CB   1  
ATOM 174   C CG1  . VAL A 1 10 ? 3.012   20.116  -5.803  1.00 0.00 ? 18  VAL A CG1  1  
ATOM 175   C CG2  . VAL A 1 10 ? 1.387   20.340  -3.911  1.00 0.00 ? 18  VAL A CG2  1  
ATOM 176   H H    . VAL A 1 10 ? 3.113   18.643  -3.183  1.00 0.00 ? 18  VAL A H    1  
ATOM 177   H HA   . VAL A 1 10 ? 4.789   20.791  -3.984  1.00 0.00 ? 18  VAL A HA   1  
ATOM 178   H HB   . VAL A 1 10 ? 2.626   21.880  -4.688  1.00 0.00 ? 18  VAL A HB   1  
ATOM 179   H HG11 . VAL A 1 10 ? 2.093   19.745  -6.235  1.00 0.00 ? 18  VAL A HG11 1  
ATOM 180   H HG12 . VAL A 1 10 ? 3.683   19.289  -5.621  1.00 0.00 ? 18  VAL A HG12 1  
ATOM 181   H HG13 . VAL A 1 10 ? 3.476   20.811  -6.486  1.00 0.00 ? 18  VAL A HG13 1  
ATOM 182   H HG21 . VAL A 1 10 ? 0.578   20.916  -4.333  1.00 0.00 ? 18  VAL A HG21 1  
ATOM 183   H HG22 . VAL A 1 10 ? 1.396   20.466  -2.839  1.00 0.00 ? 18  VAL A HG22 1  
ATOM 184   H HG23 . VAL A 1 10 ? 1.248   19.295  -4.149  1.00 0.00 ? 18  VAL A HG23 1  
ATOM 185   N N    . GLY A 1 11 ? 3.005   21.177  -1.282  1.00 0.00 ? 19  GLY A N    1  
ATOM 186   C CA   . GLY A 1 11 ? 2.798   22.043  -0.137  1.00 0.00 ? 19  GLY A CA   1  
ATOM 187   C C    . GLY A 1 11 ? 3.657   21.654  1.050   1.00 0.00 ? 19  GLY A C    1  
ATOM 188   O O    . GLY A 1 11 ? 4.885   21.633  0.953   1.00 0.00 ? 19  GLY A O    1  
ATOM 189   H H    . GLY A 1 11 ? 2.633   20.270  -1.283  1.00 0.00 ? 19  GLY A H    1  
ATOM 190   H HA2  . GLY A 1 11 ? 3.032   23.058  -0.419  1.00 0.00 ? 19  GLY A HA2  1  
ATOM 191   H HA3  . GLY A 1 11 ? 1.758   21.992  0.154   1.00 0.00 ? 19  GLY A HA3  1  
ATOM 192   N N    . SER A 1 12 ? 3.014   21.345  2.170   1.00 0.00 ? 20  SER A N    1  
ATOM 193   C CA   . SER A 1 12 ? 3.729   20.957  3.380   1.00 0.00 ? 20  SER A CA   1  
ATOM 194   C C    . SER A 1 12 ? 2.964   19.880  4.144   1.00 0.00 ? 20  SER A C    1  
ATOM 195   O O    . SER A 1 12 ? 2.848   19.937  5.369   1.00 0.00 ? 20  SER A O    1  
ATOM 196   C CB   . SER A 1 12 ? 3.955   22.175  4.277   1.00 0.00 ? 20  SER A CB   1  
ATOM 197   O OG   . SER A 1 12 ? 2.881   23.092  4.170   1.00 0.00 ? 20  SER A OG   1  
ATOM 198   H H    . SER A 1 12 ? 2.034   21.381  2.184   1.00 0.00 ? 20  SER A H    1  
ATOM 199   H HA   . SER A 1 12 ? 4.688   20.556  3.082   1.00 0.00 ? 20  SER A HA   1  
ATOM 200   H HB2  . SER A 1 12 ? 4.036   21.854  5.304   1.00 0.00 ? 20  SER A HB2  1  
ATOM 201   H HB3  . SER A 1 12 ? 4.868   22.672  3.983   1.00 0.00 ? 20  SER A HB3  1  
ATOM 202   H HG   . SER A 1 12 ? 2.050   22.630  4.299   1.00 0.00 ? 20  SER A HG   1  
ATOM 203   N N    . ARG A 1 13 ? 2.441   18.901  3.413   1.00 0.00 ? 21  ARG A N    1  
ATOM 204   C CA   . ARG A 1 13 ? 1.686   17.811  4.023   1.00 0.00 ? 21  ARG A CA   1  
ATOM 205   C C    . ARG A 1 13 ? 2.012   16.480  3.355   1.00 0.00 ? 21  ARG A C    1  
ATOM 206   O O    . ARG A 1 13 ? 2.360   16.436  2.174   1.00 0.00 ? 21  ARG A O    1  
ATOM 207   C CB   . ARG A 1 13 ? 0.183   18.089  3.930   1.00 0.00 ? 21  ARG A CB   1  
ATOM 208   C CG   . ARG A 1 13 ? -0.348  18.104  2.505   1.00 0.00 ? 21  ARG A CG   1  
ATOM 209   C CD   . ARG A 1 13 ? -0.273  19.493  1.896   1.00 0.00 ? 21  ARG A CD   1  
ATOM 210   N NE   . ARG A 1 13 ? -1.255  20.404  2.482   1.00 0.00 ? 21  ARG A NE   1  
ATOM 211   C CZ   . ARG A 1 13 ? -1.652  21.536  1.908   1.00 0.00 ? 21  ARG A CZ   1  
ATOM 212   N NH1  . ARG A 1 13 ? -1.156  21.904  0.733   1.00 0.00 ? 21  ARG A NH1  1  
ATOM 213   N NH2  . ARG A 1 13 ? -2.549  22.305  2.511   1.00 0.00 ? 21  ARG A NH2  1  
ATOM 214   H H    . ARG A 1 13 ? 2.566   18.911  2.441   1.00 0.00 ? 21  ARG A H    1  
ATOM 215   H HA   . ARG A 1 13 ? 1.967   17.757  5.063   1.00 0.00 ? 21  ARG A HA   1  
ATOM 216   H HB2  . ARG A 1 13 ? -0.348  17.326  4.480   1.00 0.00 ? 21  ARG A HB2  1  
ATOM 217   H HB3  . ARG A 1 13 ? -0.022  19.051  4.377   1.00 0.00 ? 21  ARG A HB3  1  
ATOM 218   H HG2  . ARG A 1 13 ? 0.240   17.426  1.904   1.00 0.00 ? 21  ARG A HG2  1  
ATOM 219   H HG3  . ARG A 1 13 ? -1.379  17.779  2.512   1.00 0.00 ? 21  ARG A HG3  1  
ATOM 220   H HD2  . ARG A 1 13 ? 0.717   19.893  2.063   1.00 0.00 ? 21  ARG A HD2  1  
ATOM 221   H HD3  . ARG A 1 13 ? -0.455  19.418  0.834   1.00 0.00 ? 21  ARG A HD3  1  
ATOM 222   H HE   . ARG A 1 13 ? -1.639  20.156  3.349   1.00 0.00 ? 21  ARG A HE   1  
ATOM 223   H HH11 . ARG A 1 13 ? -0.480  21.329  0.273   1.00 0.00 ? 21  ARG A HH11 1  
ATOM 224   H HH12 . ARG A 1 13 ? -1.459  22.756  0.306   1.00 0.00 ? 21  ARG A HH12 1  
ATOM 225   H HH21 . ARG A 1 13 ? -2.927  22.033  3.396   1.00 0.00 ? 21  ARG A HH21 1  
ATOM 226   H HH22 . ARG A 1 13 ? -2.847  23.157  2.080   1.00 0.00 ? 21  ARG A HH22 1  
ATOM 227   N N    . GLY A 1 14 ? 1.898   15.396  4.116   1.00 0.00 ? 22  GLY A N    1  
ATOM 228   C CA   . GLY A 1 14 ? 2.185   14.079  3.579   1.00 0.00 ? 22  GLY A CA   1  
ATOM 229   C C    . GLY A 1 14 ? 1.278   13.717  2.418   1.00 0.00 ? 22  GLY A C    1  
ATOM 230   O O    . GLY A 1 14 ? 0.568   14.573  1.888   1.00 0.00 ? 22  GLY A O    1  
ATOM 231   H H    . GLY A 1 14 ? 1.617   15.492  5.050   1.00 0.00 ? 22  GLY A H    1  
ATOM 232   H HA2  . GLY A 1 14 ? 3.210   14.053  3.242   1.00 0.00 ? 22  GLY A HA2  1  
ATOM 233   H HA3  . GLY A 1 14 ? 2.056   13.347  4.363   1.00 0.00 ? 22  GLY A HA3  1  
ATOM 234   N N    . LEU A 1 15 ? 1.299   12.449  2.022   1.00 0.00 ? 23  LEU A N    1  
ATOM 235   C CA   . LEU A 1 15 ? 0.471   11.983  0.917   1.00 0.00 ? 23  LEU A CA   1  
ATOM 236   C C    . LEU A 1 15 ? -0.975  11.796  1.369   1.00 0.00 ? 23  LEU A C    1  
ATOM 237   O O    . LEU A 1 15 ? -1.908  12.150  0.650   1.00 0.00 ? 23  LEU A O    1  
ATOM 238   C CB   . LEU A 1 15 ? 1.060   10.688  0.325   1.00 0.00 ? 23  LEU A CB   1  
ATOM 239   C CG   . LEU A 1 15 ? 0.247   9.395   0.517   1.00 0.00 ? 23  LEU A CG   1  
ATOM 240   C CD1  . LEU A 1 15 ? -0.170  8.823   -0.829  1.00 0.00 ? 23  LEU A CD1  1  
ATOM 241   C CD2  . LEU A 1 15 ? 1.057   8.372   1.302   1.00 0.00 ? 23  LEU A CD2  1  
ATOM 242   H H    . LEU A 1 15 ? 1.885   11.812  2.483   1.00 0.00 ? 23  LEU A H    1  
ATOM 243   H HA   . LEU A 1 15 ? 0.492   12.749  0.155   1.00 0.00 ? 23  LEU A HA   1  
ATOM 244   H HB2  . LEU A 1 15 ? 1.199   10.839  -0.734  1.00 0.00 ? 23  LEU A HB2  1  
ATOM 245   H HB3  . LEU A 1 15 ? 2.030   10.538  0.770   1.00 0.00 ? 23  LEU A HB3  1  
ATOM 246   H HG   . LEU A 1 15 ? -0.647  9.611   1.075   1.00 0.00 ? 23  LEU A HG   1  
ATOM 247   H HD11 . LEU A 1 15 ? 0.707   8.509   -1.375  1.00 0.00 ? 23  LEU A HD11 1  
ATOM 248   H HD12 . LEU A 1 15 ? -0.695  9.579   -1.394  1.00 0.00 ? 23  LEU A HD12 1  
ATOM 249   H HD13 . LEU A 1 15 ? -0.819  7.975   -0.673  1.00 0.00 ? 23  LEU A HD13 1  
ATOM 250   H HD21 . LEU A 1 15 ? 1.904   8.858   1.766   1.00 0.00 ? 23  LEU A HD21 1  
ATOM 251   H HD22 . LEU A 1 15 ? 1.408   7.600   0.635   1.00 0.00 ? 23  LEU A HD22 1  
ATOM 252   H HD23 . LEU A 1 15 ? 0.435   7.931   2.066   1.00 0.00 ? 23  LEU A HD23 1  
ATOM 253   N N    . GLY A 1 16 ? -1.154  11.250  2.567   1.00 0.00 ? 24  GLY A N    1  
ATOM 254   C CA   . GLY A 1 16 ? -2.492  11.044  3.092   1.00 0.00 ? 24  GLY A CA   1  
ATOM 255   C C    . GLY A 1 16 ? -2.960  9.603   2.995   1.00 0.00 ? 24  GLY A C    1  
ATOM 256   O O    . GLY A 1 16 ? -4.162  9.338   3.035   1.00 0.00 ? 24  GLY A O    1  
ATOM 257   H H    . GLY A 1 16 ? -0.374  10.995  3.103   1.00 0.00 ? 24  GLY A H    1  
ATOM 258   H HA2  . GLY A 1 16 ? -2.512  11.350  4.126   1.00 0.00 ? 24  GLY A HA2  1  
ATOM 259   H HA3  . GLY A 1 16 ? -3.177  11.664  2.538   1.00 0.00 ? 24  GLY A HA3  1  
ATOM 260   N N    . CYS A 1 17 ? -2.024  8.667   2.862   1.00 0.00 ? 25  CYS A N    1  
ATOM 261   C CA   . CYS A 1 17 ? -2.382  7.255   2.757   1.00 0.00 ? 25  CYS A CA   1  
ATOM 262   C C    . CYS A 1 17 ? -1.533  6.390   3.685   1.00 0.00 ? 25  CYS A C    1  
ATOM 263   O O    . CYS A 1 17 ? -0.437  6.778   4.088   1.00 0.00 ? 25  CYS A O    1  
ATOM 264   C CB   . CYS A 1 17 ? -2.248  6.778   1.299   1.00 0.00 ? 25  CYS A CB   1  
ATOM 265   S SG   . CYS A 1 17 ? -0.749  5.830   0.925   1.00 0.00 ? 25  CYS A SG   1  
ATOM 266   H H    . CYS A 1 17 ? -1.079  8.930   2.833   1.00 0.00 ? 25  CYS A H    1  
ATOM 267   H HA   . CYS A 1 17 ? -3.417  7.160   3.055   1.00 0.00 ? 25  CYS A HA   1  
ATOM 268   H HB2  . CYS A 1 17 ? -3.090  6.149   1.059   1.00 0.00 ? 25  CYS A HB2  1  
ATOM 269   H HB3  . CYS A 1 17 ? -2.258  7.638   0.650   1.00 0.00 ? 25  CYS A HB3  1  
ATOM 270   H HG   . CYS A 1 17 ? -0.135  5.944   1.655   1.00 0.00 ? 25  CYS A HG   1  
ATOM 271   N N    . SER A 1 18 ? -2.047  5.207   3.999   1.00 0.00 ? 26  SER A N    1  
ATOM 272   C CA   . SER A 1 18 ? -1.343  4.265   4.859   1.00 0.00 ? 26  SER A CA   1  
ATOM 273   C C    . SER A 1 18 ? -0.979  3.018   4.063   1.00 0.00 ? 26  SER A C    1  
ATOM 274   O O    . SER A 1 18 ? -1.377  2.878   2.907   1.00 0.00 ? 26  SER A O    1  
ATOM 275   C CB   . SER A 1 18 ? -2.210  3.888   6.061   1.00 0.00 ? 26  SER A CB   1  
ATOM 276   O OG   . SER A 1 18 ? -2.186  4.905   7.049   1.00 0.00 ? 26  SER A OG   1  
ATOM 277   H H    . SER A 1 18 ? -2.923  4.954   3.635   1.00 0.00 ? 26  SER A H    1  
ATOM 278   H HA   . SER A 1 18 ? -0.437  4.739   5.206   1.00 0.00 ? 26  SER A HA   1  
ATOM 279   H HB2  . SER A 1 18 ? -3.229  3.744   5.736   1.00 0.00 ? 26  SER A HB2  1  
ATOM 280   H HB3  . SER A 1 18 ? -1.838  2.972   6.498   1.00 0.00 ? 26  SER A HB3  1  
ATOM 281   H HG   . SER A 1 18 ? -3.047  4.964   7.468   1.00 0.00 ? 26  SER A HG   1  
ATOM 282   N N    . ILE A 1 19 ? -0.220  2.116   4.671   1.00 0.00 ? 27  ILE A N    1  
ATOM 283   C CA   . ILE A 1 19 ? 0.181   0.893   3.987   1.00 0.00 ? 27  ILE A CA   1  
ATOM 284   C C    . ILE A 1 19 ? 0.218   -0.298  4.937   1.00 0.00 ? 27  ILE A C    1  
ATOM 285   O O    . ILE A 1 19 ? 0.555   -0.163  6.113   1.00 0.00 ? 27  ILE A O    1  
ATOM 286   C CB   . ILE A 1 19 ? 1.555   1.039   3.306   1.00 0.00 ? 27  ILE A CB   1  
ATOM 287   C CG1  . ILE A 1 19 ? 2.520   1.817   4.201   1.00 0.00 ? 27  ILE A CG1  1  
ATOM 288   C CG2  . ILE A 1 19 ? 1.405   1.726   1.957   1.00 0.00 ? 27  ILE A CG2  1  
ATOM 289   C CD1  . ILE A 1 19 ? 3.917   1.914   3.632   1.00 0.00 ? 27  ILE A CD1  1  
ATOM 290   H H    . ILE A 1 19 ? 0.077   2.274   5.591   1.00 0.00 ? 27  ILE A H    1  
ATOM 291   H HA   . ILE A 1 19 ? -0.553  0.694   3.218   1.00 0.00 ? 27  ILE A HA   1  
ATOM 292   H HB   . ILE A 1 19 ? 1.952   0.050   3.134   1.00 0.00 ? 27  ILE A HB   1  
ATOM 293   H HG12 . ILE A 1 19 ? 2.147   2.821   4.335   1.00 0.00 ? 27  ILE A HG12 1  
ATOM 294   H HG13 . ILE A 1 19 ? 2.584   1.329   5.162   1.00 0.00 ? 27  ILE A HG13 1  
ATOM 295   H HG21 . ILE A 1 19 ? 1.592   2.784   2.069   1.00 0.00 ? 27  ILE A HG21 1  
ATOM 296   H HG22 . ILE A 1 19 ? 0.404   1.575   1.585   1.00 0.00 ? 27  ILE A HG22 1  
ATOM 297   H HG23 . ILE A 1 19 ? 2.115   1.307   1.259   1.00 0.00 ? 27  ILE A HG23 1  
ATOM 298   H HD11 . ILE A 1 19 ? 3.861   2.067   2.564   1.00 0.00 ? 27  ILE A HD11 1  
ATOM 299   H HD12 . ILE A 1 19 ? 4.453   0.998   3.836   1.00 0.00 ? 27  ILE A HD12 1  
ATOM 300   H HD13 . ILE A 1 19 ? 4.435   2.744   4.088   1.00 0.00 ? 27  ILE A HD13 1  
ATOM 301   N N    . SER A 1 20 ? -0.134  -1.463  4.409   1.00 0.00 ? 28  SER A N    1  
ATOM 302   C CA   . SER A 1 20 ? -0.150  -2.693  5.187   1.00 0.00 ? 28  SER A CA   1  
ATOM 303   C C    . SER A 1 20 ? 0.624   -3.791  4.467   1.00 0.00 ? 28  SER A C    1  
ATOM 304   O O    . SER A 1 20 ? 0.880   -3.695  3.267   1.00 0.00 ? 28  SER A O    1  
ATOM 305   C CB   . SER A 1 20 ? -1.589  -3.147  5.438   1.00 0.00 ? 28  SER A CB   1  
ATOM 306   O OG   . SER A 1 20 ? -1.621  -4.362  6.167   1.00 0.00 ? 28  SER A OG   1  
ATOM 307   H H    . SER A 1 20 ? -0.392  -1.497  3.463   1.00 0.00 ? 28  SER A H    1  
ATOM 308   H HA   . SER A 1 20 ? 0.327   -2.494  6.135   1.00 0.00 ? 28  SER A HA   1  
ATOM 309   H HB2  . SER A 1 20 ? -2.111  -2.388  6.004   1.00 0.00 ? 28  SER A HB2  1  
ATOM 310   H HB3  . SER A 1 20 ? -2.088  -3.295  4.492   1.00 0.00 ? 28  SER A HB3  1  
ATOM 311   H HG   . SER A 1 20 ? -1.815  -5.087  5.571   1.00 0.00 ? 28  SER A HG   1  
ATOM 312   N N    . SER A 1 21 ? 0.996   -4.832  5.200   1.00 0.00 ? 29  SER A N    1  
ATOM 313   C CA   . SER A 1 21 ? 1.742   -5.940  4.620   1.00 0.00 ? 29  SER A CA   1  
ATOM 314   C C    . SER A 1 21 ? 0.832   -7.147  4.418   1.00 0.00 ? 29  SER A C    1  
ATOM 315   O O    . SER A 1 21 ? -0.068  -7.399  5.220   1.00 0.00 ? 29  SER A O    1  
ATOM 316   C CB   . SER A 1 21 ? 2.924   -6.315  5.516   1.00 0.00 ? 29  SER A CB   1  
ATOM 317   O OG   . SER A 1 21 ? 4.128   -5.741  5.040   1.00 0.00 ? 29  SER A OG   1  
ATOM 318   H H    . SER A 1 21 ? 0.766   -4.855  6.152   1.00 0.00 ? 29  SER A H    1  
ATOM 319   H HA   . SER A 1 21 ? 2.116   -5.622  3.657   1.00 0.00 ? 29  SER A HA   1  
ATOM 320   H HB2  . SER A 1 21 ? 2.740   -5.957  6.518   1.00 0.00 ? 29  SER A HB2  1  
ATOM 321   H HB3  . SER A 1 21 ? 3.034   -7.390  5.533   1.00 0.00 ? 29  SER A HB3  1  
ATOM 322   H HG   . SER A 1 21 ? 4.846   -6.371  5.142   1.00 0.00 ? 29  SER A HG   1  
ATOM 323   N N    . GLY A 1 22 ? 1.062   -7.878  3.334   1.00 0.00 ? 30  GLY A N    1  
ATOM 324   C CA   . GLY A 1 22 ? 0.243   -9.037  3.035   1.00 0.00 ? 30  GLY A CA   1  
ATOM 325   C C    . GLY A 1 22 ? 0.765   -10.314 3.669   1.00 0.00 ? 30  GLY A C    1  
ATOM 326   O O    . GLY A 1 22 ? 1.832   -10.319 4.280   1.00 0.00 ? 30  GLY A O    1  
ATOM 327   H H    . GLY A 1 22 ? 1.785   -7.622  2.726   1.00 0.00 ? 30  GLY A H    1  
ATOM 328   H HA2  . GLY A 1 22 ? -0.758  -8.857  3.396   1.00 0.00 ? 30  GLY A HA2  1  
ATOM 329   H HA3  . GLY A 1 22 ? 0.208   -9.170  1.964   1.00 0.00 ? 30  GLY A HA3  1  
ATOM 330   N N    . PRO A 1 23 ? 0.017   -11.422 3.531   1.00 0.00 ? 31  PRO A N    1  
ATOM 331   C CA   . PRO A 1 23 ? 0.406   -12.720 4.094   1.00 0.00 ? 31  PRO A CA   1  
ATOM 332   C C    . PRO A 1 23 ? 1.612   -13.323 3.379   1.00 0.00 ? 31  PRO A C    1  
ATOM 333   O O    . PRO A 1 23 ? 2.365   -12.616 2.709   1.00 0.00 ? 31  PRO A O    1  
ATOM 334   C CB   . PRO A 1 23 ? -0.839  -13.586 3.877   1.00 0.00 ? 31  PRO A CB   1  
ATOM 335   C CG   . PRO A 1 23 ? -1.529  -12.970 2.711   1.00 0.00 ? 31  PRO A CG   1  
ATOM 336   C CD   . PRO A 1 23 ? -1.268  -11.493 2.813   1.00 0.00 ? 31  PRO A CD   1  
ATOM 337   H HA   . PRO A 1 23 ? 0.617   -12.644 5.150   1.00 0.00 ? 31  PRO A HA   1  
ATOM 338   H HB2  . PRO A 1 23 ? -0.546  -14.602 3.669   1.00 0.00 ? 31  PRO A HB2  1  
ATOM 339   H HB3  . PRO A 1 23 ? -1.460  -13.557 4.760   1.00 0.00 ? 31  PRO A HB3  1  
ATOM 340   H HG2  . PRO A 1 23 ? -1.118  -13.360 1.791   1.00 0.00 ? 31  PRO A HG2  1  
ATOM 341   H HG3  . PRO A 1 23 ? -2.589  -13.168 2.763   1.00 0.00 ? 31  PRO A HG3  1  
ATOM 342   H HD2  . PRO A 1 23 ? -1.183  -11.055 1.830   1.00 0.00 ? 31  PRO A HD2  1  
ATOM 343   H HD3  . PRO A 1 23 ? -2.051  -11.009 3.377   1.00 0.00 ? 31  PRO A HD3  1  
ATOM 344   N N    . ILE A 1 24 ? 1.791   -14.631 3.530   1.00 0.00 ? 32  ILE A N    1  
ATOM 345   C CA   . ILE A 1 24 ? 2.905   -15.329 2.903   1.00 0.00 ? 32  ILE A CA   1  
ATOM 346   C C    . ILE A 1 24 ? 2.564   -15.748 1.476   1.00 0.00 ? 32  ILE A C    1  
ATOM 347   O O    . ILE A 1 24 ? 3.449   -15.886 0.632   1.00 0.00 ? 32  ILE A O    1  
ATOM 348   C CB   . ILE A 1 24 ? 3.310   -16.579 3.709   1.00 0.00 ? 32  ILE A CB   1  
ATOM 349   C CG1  . ILE A 1 24 ? 3.478   -16.229 5.191   1.00 0.00 ? 32  ILE A CG1  1  
ATOM 350   C CG2  . ILE A 1 24 ? 4.592   -17.177 3.150   1.00 0.00 ? 32  ILE A CG2  1  
ATOM 351   C CD1  . ILE A 1 24 ? 2.745   -17.170 6.121   1.00 0.00 ? 32  ILE A CD1  1  
ATOM 352   H H    . ILE A 1 24 ? 1.157   -15.138 4.078   1.00 0.00 ? 32  ILE A H    1  
ATOM 353   H HA   . ILE A 1 24 ? 3.749   -14.655 2.877   1.00 0.00 ? 32  ILE A HA   1  
ATOM 354   H HB   . ILE A 1 24 ? 2.526   -17.315 3.607   1.00 0.00 ? 32  ILE A HB   1  
ATOM 355   H HG12 . ILE A 1 24 ? 4.528   -16.263 5.446   1.00 0.00 ? 32  ILE A HG12 1  
ATOM 356   H HG13 . ILE A 1 24 ? 3.102   -15.231 5.364   1.00 0.00 ? 32  ILE A HG13 1  
ATOM 357   H HG21 . ILE A 1 24 ? 5.157   -16.410 2.641   1.00 0.00 ? 32  ILE A HG21 1  
ATOM 358   H HG22 . ILE A 1 24 ? 4.348   -17.967 2.456   1.00 0.00 ? 32  ILE A HG22 1  
ATOM 359   H HG23 . ILE A 1 24 ? 5.184   -17.580 3.960   1.00 0.00 ? 32  ILE A HG23 1  
ATOM 360   H HD11 . ILE A 1 24 ? 2.738   -18.164 5.696   1.00 0.00 ? 32  ILE A HD11 1  
ATOM 361   H HD12 . ILE A 1 24 ? 1.729   -16.828 6.252   1.00 0.00 ? 32  ILE A HD12 1  
ATOM 362   H HD13 . ILE A 1 24 ? 3.243   -17.191 7.078   1.00 0.00 ? 32  ILE A HD13 1  
ATOM 363   N N    . GLN A 1 25 ? 1.277   -15.949 1.213   1.00 0.00 ? 33  GLN A N    1  
ATOM 364   C CA   . GLN A 1 25 ? 0.823   -16.350 -0.113  1.00 0.00 ? 33  GLN A CA   1  
ATOM 365   C C    . GLN A 1 25 ? 1.065   -15.239 -1.129  1.00 0.00 ? 33  GLN A C    1  
ATOM 366   O O    . GLN A 1 25 ? 1.332   -15.504 -2.301  1.00 0.00 ? 33  GLN A O    1  
ATOM 367   C CB   . GLN A 1 25 ? -0.662  -16.713 -0.079  1.00 0.00 ? 33  GLN A CB   1  
ATOM 368   C CG   . GLN A 1 25 ? -0.937  -18.103 0.471   1.00 0.00 ? 33  GLN A CG   1  
ATOM 369   C CD   . GLN A 1 25 ? -2.177  -18.151 1.341   1.00 0.00 ? 33  GLN A CD   1  
ATOM 370   O OE1  . GLN A 1 25 ? -3.298  -18.015 0.854   1.00 0.00 ? 33  GLN A OE1  1  
ATOM 371   N NE2  . GLN A 1 25 ? -1.981  -18.344 2.641   1.00 0.00 ? 33  GLN A NE2  1  
ATOM 372   H H    . GLN A 1 25 ? 0.617   -15.824 1.926   1.00 0.00 ? 33  GLN A H    1  
ATOM 373   H HA   . GLN A 1 25 ? 1.390   -17.221 -0.408  1.00 0.00 ? 33  GLN A HA   1  
ATOM 374   H HB2  . GLN A 1 25 ? -1.183  -15.996 0.539   1.00 0.00 ? 33  GLN A HB2  1  
ATOM 375   H HB3  . GLN A 1 25 ? -1.057  -16.664 -1.084  1.00 0.00 ? 33  GLN A HB3  1  
ATOM 376   H HG2  . GLN A 1 25 ? -1.071  -18.785 -0.355  1.00 0.00 ? 33  GLN A HG2  1  
ATOM 377   H HG3  . GLN A 1 25 ? -0.087  -18.418 1.061   1.00 0.00 ? 33  GLN A HG3  1  
ATOM 378   H HE21 . GLN A 1 25 ? -1.060  -18.442 2.961   1.00 0.00 ? 33  GLN A HE21 1  
ATOM 379   H HE22 . GLN A 1 25 ? -2.766  -18.376 3.228   1.00 0.00 ? 33  GLN A HE22 1  
ATOM 380   N N    . LYS A 1 26 ? 0.971   -13.995 -0.671  1.00 0.00 ? 34  LYS A N    1  
ATOM 381   C CA   . LYS A 1 26 ? 1.180   -12.842 -1.538  1.00 0.00 ? 34  LYS A CA   1  
ATOM 382   C C    . LYS A 1 26 ? 1.716   -11.654 -0.743  1.00 0.00 ? 34  LYS A C    1  
ATOM 383   O O    . LYS A 1 26 ? 1.009   -10.668 -0.531  1.00 0.00 ? 34  LYS A O    1  
ATOM 384   C CB   . LYS A 1 26 ? -0.127  -12.460 -2.236  1.00 0.00 ? 34  LYS A CB   1  
ATOM 385   C CG   . LYS A 1 26 ? -0.807  -13.625 -2.935  1.00 0.00 ? 34  LYS A CG   1  
ATOM 386   C CD   . LYS A 1 26 ? -1.863  -13.147 -3.918  1.00 0.00 ? 34  LYS A CD   1  
ATOM 387   C CE   . LYS A 1 26 ? -3.091  -14.041 -3.897  1.00 0.00 ? 34  LYS A CE   1  
ATOM 388   N NZ   . LYS A 1 26 ? -3.797  -13.984 -2.586  1.00 0.00 ? 34  LYS A NZ   1  
ATOM 389   H H    . LYS A 1 26 ? 0.755   -13.849 0.273   1.00 0.00 ? 34  LYS A H    1  
ATOM 390   H HA   . LYS A 1 26 ? 1.909   -13.117 -2.285  1.00 0.00 ? 34  LYS A HA   1  
ATOM 391   H HB2  . LYS A 1 26 ? -0.811  -12.060 -1.502  1.00 0.00 ? 34  LYS A HB2  1  
ATOM 392   H HB3  . LYS A 1 26 ? 0.081   -11.698 -2.974  1.00 0.00 ? 34  LYS A HB3  1  
ATOM 393   H HG2  . LYS A 1 26 ? -0.063  -14.195 -3.472  1.00 0.00 ? 34  LYS A HG2  1  
ATOM 394   H HG3  . LYS A 1 26 ? -1.278  -14.253 -2.192  1.00 0.00 ? 34  LYS A HG3  1  
ATOM 395   H HD2  . LYS A 1 26 ? -2.158  -12.142 -3.654  1.00 0.00 ? 34  LYS A HD2  1  
ATOM 396   H HD3  . LYS A 1 26 ? -1.442  -13.152 -4.914  1.00 0.00 ? 34  LYS A HD3  1  
ATOM 397   H HE2  . LYS A 1 26 ? -3.769  -13.719 -4.674  1.00 0.00 ? 34  LYS A HE2  1  
ATOM 398   H HE3  . LYS A 1 26 ? -2.783  -15.059 -4.086  1.00 0.00 ? 34  LYS A HE3  1  
ATOM 399   H HZ1  . LYS A 1 26 ? -3.864  -12.998 -2.259  1.00 0.00 ? 34  LYS A HZ1  1  
ATOM 400   H HZ2  . LYS A 1 26 ? -3.277  -14.538 -1.877  1.00 0.00 ? 34  LYS A HZ2  1  
ATOM 401   H HZ3  . LYS A 1 26 ? -4.757  -14.374 -2.680  1.00 0.00 ? 34  LYS A HZ3  1  
ATOM 402   N N    . PRO A 1 27 ? 2.978   -11.733 -0.288  1.00 0.00 ? 35  PRO A N    1  
ATOM 403   C CA   . PRO A 1 27 ? 3.607   -10.660 0.488   1.00 0.00 ? 35  PRO A CA   1  
ATOM 404   C C    . PRO A 1 27 ? 3.941   -9.445  -0.369  1.00 0.00 ? 35  PRO A C    1  
ATOM 405   O O    . PRO A 1 27 ? 4.434   -9.579  -1.490  1.00 0.00 ? 35  PRO A O    1  
ATOM 406   C CB   . PRO A 1 27 ? 4.886   -11.310 1.016   1.00 0.00 ? 35  PRO A CB   1  
ATOM 407   C CG   . PRO A 1 27 ? 5.212   -12.366 0.017   1.00 0.00 ? 35  PRO A CG   1  
ATOM 408   C CD   . PRO A 1 27 ? 3.892   -12.874 -0.495  1.00 0.00 ? 35  PRO A CD   1  
ATOM 409   H HA   . PRO A 1 27 ? 2.986   -10.354 1.317   1.00 0.00 ? 35  PRO A HA   1  
ATOM 410   H HB2  . PRO A 1 27 ? 5.670   -10.569 1.080   1.00 0.00 ? 35  PRO A HB2  1  
ATOM 411   H HB3  . PRO A 1 27 ? 4.702   -11.734 1.991   1.00 0.00 ? 35  PRO A HB3  1  
ATOM 412   H HG2  . PRO A 1 27 ? 5.788   -11.941 -0.791  1.00 0.00 ? 35  PRO A HG2  1  
ATOM 413   H HG3  . PRO A 1 27 ? 5.761   -13.164 0.493   1.00 0.00 ? 35  PRO A HG3  1  
ATOM 414   H HD2  . PRO A 1 27 ? 3.964   -13.124 -1.542  1.00 0.00 ? 35  PRO A HD2  1  
ATOM 415   H HD3  . PRO A 1 27 ? 3.571   -13.731 0.077   1.00 0.00 ? 35  PRO A HD3  1  
ATOM 416   N N    . GLY A 1 28 ? 3.673   -8.257  0.164   1.00 0.00 ? 36  GLY A N    1  
ATOM 417   C CA   . GLY A 1 28 ? 3.953   -7.035  -0.567  1.00 0.00 ? 36  GLY A CA   1  
ATOM 418   C C    . GLY A 1 28 ? 3.444   -5.802  0.153   1.00 0.00 ? 36  GLY A C    1  
ATOM 419   O O    . GLY A 1 28 ? 2.941   -5.891  1.272   1.00 0.00 ? 36  GLY A O    1  
ATOM 420   H H    . GLY A 1 28 ? 3.282   -8.210  1.062   1.00 0.00 ? 36  GLY A H    1  
ATOM 421   H HA2  . GLY A 1 28 ? 5.020   -6.946  -0.700  1.00 0.00 ? 36  GLY A HA2  1  
ATOM 422   H HA3  . GLY A 1 28 ? 3.482   -7.093  -1.537  1.00 0.00 ? 36  GLY A HA3  1  
ATOM 423   N N    . ILE A 1 29 ? 3.576   -4.648  -0.493  1.00 0.00 ? 37  ILE A N    1  
ATOM 424   C CA   . ILE A 1 29 ? 3.126   -3.391  0.092   1.00 0.00 ? 37  ILE A CA   1  
ATOM 425   C C    . ILE A 1 29 ? 1.700   -3.067  -0.337  1.00 0.00 ? 37  ILE A C    1  
ATOM 426   O O    . ILE A 1 29 ? 1.427   -2.866  -1.520  1.00 0.00 ? 37  ILE A O    1  
ATOM 427   C CB   . ILE A 1 29 ? 4.050   -2.223  -0.301  1.00 0.00 ? 37  ILE A CB   1  
ATOM 428   C CG1  . ILE A 1 29 ? 5.515   -2.621  -0.116  1.00 0.00 ? 37  ILE A CG1  1  
ATOM 429   C CG2  . ILE A 1 29 ? 3.723   -0.988  0.526   1.00 0.00 ? 37  ILE A CG2  1  
ATOM 430   C CD1  . ILE A 1 29 ? 5.875   -2.954  1.316   1.00 0.00 ? 37  ILE A CD1  1  
ATOM 431   H H    . ILE A 1 29 ? 3.986   -4.641  -1.383  1.00 0.00 ? 37  ILE A H    1  
ATOM 432   H HA   . ILE A 1 29 ? 3.153   -3.496  1.168   1.00 0.00 ? 37  ILE A HA   1  
ATOM 433   H HB   . ILE A 1 29 ? 3.875   -1.989  -1.340  1.00 0.00 ? 37  ILE A HB   1  
ATOM 434   H HG12 . ILE A 1 29 ? 5.724   -3.491  -0.721  1.00 0.00 ? 37  ILE A HG12 1  
ATOM 435   H HG13 . ILE A 1 29 ? 6.146   -1.806  -0.438  1.00 0.00 ? 37  ILE A HG13 1  
ATOM 436   H HG21 . ILE A 1 29 ? 2.809   -0.542  0.160   1.00 0.00 ? 37  ILE A HG21 1  
ATOM 437   H HG22 . ILE A 1 29 ? 4.529   -0.274  0.442   1.00 0.00 ? 37  ILE A HG22 1  
ATOM 438   H HG23 . ILE A 1 29 ? 3.596   -1.270  1.561   1.00 0.00 ? 37  ILE A HG23 1  
ATOM 439   H HD11 . ILE A 1 29 ? 5.675   -2.100  1.947   1.00 0.00 ? 37  ILE A HD11 1  
ATOM 440   H HD12 . ILE A 1 29 ? 6.923   -3.206  1.374   1.00 0.00 ? 37  ILE A HD12 1  
ATOM 441   H HD13 . ILE A 1 29 ? 5.284   -3.794  1.650   1.00 0.00 ? 37  ILE A HD13 1  
ATOM 442   N N    . PHE A 1 30 ? 0.794   -3.022  0.634   1.00 0.00 ? 38  PHE A N    1  
ATOM 443   C CA   . PHE A 1 30 ? -0.609  -2.728  0.361   1.00 0.00 ? 38  PHE A CA   1  
ATOM 444   C C    . PHE A 1 30 ? -0.965  -1.310  0.789   1.00 0.00 ? 38  PHE A C    1  
ATOM 445   O O    . PHE A 1 30 ? -0.177  -0.632  1.449   1.00 0.00 ? 38  PHE A O    1  
ATOM 446   C CB   . PHE A 1 30 ? -1.510  -3.734  1.079   1.00 0.00 ? 38  PHE A CB   1  
ATOM 447   C CG   . PHE A 1 30 ? -1.239  -5.164  0.699   1.00 0.00 ? 38  PHE A CG   1  
ATOM 448   C CD1  . PHE A 1 30 ? -0.013  -5.747  0.973   1.00 0.00 ? 38  PHE A CD1  1  
ATOM 449   C CD2  . PHE A 1 30 ? -2.212  -5.923  0.068   1.00 0.00 ? 38  PHE A CD2  1  
ATOM 450   C CE1  . PHE A 1 30 ? 0.238   -7.062  0.625   1.00 0.00 ? 38  PHE A CE1  1  
ATOM 451   C CE2  . PHE A 1 30 ? -1.967  -7.238  -0.282  1.00 0.00 ? 38  PHE A CE2  1  
ATOM 452   C CZ   . PHE A 1 30 ? -0.740  -7.806  -0.003  1.00 0.00 ? 38  PHE A CZ   1  
ATOM 453   H H    . PHE A 1 30 ? 1.073   -3.194  1.556   1.00 0.00 ? 38  PHE A H    1  
ATOM 454   H HA   . PHE A 1 30 ? -0.763  -2.816  -0.704  1.00 0.00 ? 38  PHE A HA   1  
ATOM 455   H HB2  . PHE A 1 30 ? -1.364  -3.641  2.145   1.00 0.00 ? 38  PHE A HB2  1  
ATOM 456   H HB3  . PHE A 1 30 ? -2.541  -3.515  0.842   1.00 0.00 ? 38  PHE A HB3  1  
ATOM 457   H HD1  . PHE A 1 30 ? 0.752   -5.168  1.467   1.00 0.00 ? 38  PHE A HD1  1  
ATOM 458   H HD2  . PHE A 1 30 ? -3.173  -5.477  -0.150  1.00 0.00 ? 38  PHE A HD2  1  
ATOM 459   H HE1  . PHE A 1 30 ? 1.198   -7.504  0.843   1.00 0.00 ? 38  PHE A HE1  1  
ATOM 460   H HE2  . PHE A 1 30 ? -2.734  -7.818  -0.774  1.00 0.00 ? 38  PHE A HE2  1  
ATOM 461   H HZ   . PHE A 1 30 ? -0.545  -8.833  -0.277  1.00 0.00 ? 38  PHE A HZ   1  
ATOM 462   N N    . ILE A 1 31 ? -2.158  -0.869  0.408   1.00 0.00 ? 39  ILE A N    1  
ATOM 463   C CA   . ILE A 1 31 ? -2.626  0.467   0.748   1.00 0.00 ? 39  ILE A CA   1  
ATOM 464   C C    . ILE A 1 31 ? -3.720  0.410   1.811   1.00 0.00 ? 39  ILE A C    1  
ATOM 465   O O    . ILE A 1 31 ? -4.651  -0.389  1.719   1.00 0.00 ? 39  ILE A O    1  
ATOM 466   C CB   . ILE A 1 31 ? -3.162  1.204   -0.500  1.00 0.00 ? 39  ILE A CB   1  
ATOM 467   C CG1  . ILE A 1 31 ? -2.023  1.466   -1.489  1.00 0.00 ? 39  ILE A CG1  1  
ATOM 468   C CG2  . ILE A 1 31 ? -3.842  2.511   -0.109  1.00 0.00 ? 39  ILE A CG2  1  
ATOM 469   C CD1  . ILE A 1 31 ? -1.068  2.553   -1.044  1.00 0.00 ? 39  ILE A CD1  1  
ATOM 470   H H    . ILE A 1 31 ? -2.739  -1.459  -0.118  1.00 0.00 ? 39  ILE A H    1  
ATOM 471   H HA   . ILE A 1 31 ? -1.786  1.026   1.139   1.00 0.00 ? 39  ILE A HA   1  
ATOM 472   H HB   . ILE A 1 31 ? -3.898  0.573   -0.972  1.00 0.00 ? 39  ILE A HB   1  
ATOM 473   H HG12 . ILE A 1 31 ? -1.452  0.558   -1.619  1.00 0.00 ? 39  ILE A HG12 1  
ATOM 474   H HG13 . ILE A 1 31 ? -2.442  1.761   -2.441  1.00 0.00 ? 39  ILE A HG13 1  
ATOM 475   H HG21 . ILE A 1 31 ? -4.824  2.300   0.289   1.00 0.00 ? 39  ILE A HG21 1  
ATOM 476   H HG22 . ILE A 1 31 ? -3.933  3.142   -0.979  1.00 0.00 ? 39  ILE A HG22 1  
ATOM 477   H HG23 . ILE A 1 31 ? -3.250  3.014   0.641   1.00 0.00 ? 39  ILE A HG23 1  
ATOM 478   H HD11 . ILE A 1 31 ? -1.376  2.931   -0.080  1.00 0.00 ? 39  ILE A HD11 1  
ATOM 479   H HD12 . ILE A 1 31 ? -1.077  3.358   -1.765  1.00 0.00 ? 39  ILE A HD12 1  
ATOM 480   H HD13 . ILE A 1 31 ? -0.069  2.148   -0.969  1.00 0.00 ? 39  ILE A HD13 1  
ATOM 481   N N    . SER A 1 32 ? -3.597  1.269   2.816   1.00 0.00 ? 40  SER A N    1  
ATOM 482   C CA   . SER A 1 32 ? -4.569  1.332   3.900   1.00 0.00 ? 40  SER A CA   1  
ATOM 483   C C    . SER A 1 32 ? -5.442  2.575   3.761   1.00 0.00 ? 40  SER A C    1  
ATOM 484   O O    . SER A 1 32 ? -5.407  3.259   2.737   1.00 0.00 ? 40  SER A O    1  
ATOM 485   C CB   . SER A 1 32 ? -3.854  1.334   5.253   1.00 0.00 ? 40  SER A CB   1  
ATOM 486   O OG   . SER A 1 32 ? -3.972  0.073   5.893   1.00 0.00 ? 40  SER A OG   1  
ATOM 487   H H    . SER A 1 32 ? -2.834  1.881   2.827   1.00 0.00 ? 40  SER A H    1  
ATOM 488   H HA   . SER A 1 32 ? -5.196  0.457   3.832   1.00 0.00 ? 40  SER A HA   1  
ATOM 489   H HB2  . SER A 1 32 ? -2.808  1.550   5.105   1.00 0.00 ? 40  SER A HB2  1  
ATOM 490   H HB3  . SER A 1 32 ? -4.292  2.089   5.890   1.00 0.00 ? 40  SER A HB3  1  
ATOM 491   H HG   . SER A 1 32 ? -4.878  -0.239  5.822   1.00 0.00 ? 40  SER A HG   1  
ATOM 492   N N    . HIS A 1 33 ? -6.224  2.864   4.795   1.00 0.00 ? 41  HIS A N    1  
ATOM 493   C CA   . HIS A 1 33 ? -7.107  4.025   4.787   1.00 0.00 ? 41  HIS A CA   1  
ATOM 494   C C    . HIS A 1 33 ? -6.342  5.292   4.413   1.00 0.00 ? 41  HIS A C    1  
ATOM 495   O O    . HIS A 1 33 ? -5.149  5.416   4.695   1.00 0.00 ? 41  HIS A O    1  
ATOM 496   C CB   . HIS A 1 33 ? -7.766  4.201   6.157   1.00 0.00 ? 41  HIS A CB   1  
ATOM 497   C CG   . HIS A 1 33 ? -9.204  4.613   6.079   1.00 0.00 ? 41  HIS A CG   1  
ATOM 498   N ND1  . HIS A 1 33 ? -10.243 3.713   5.986   1.00 0.00 ? 41  HIS A ND1  1  
ATOM 499   C CD2  . HIS A 1 33 ? -9.774  5.843   6.081   1.00 0.00 ? 41  HIS A CD2  1  
ATOM 500   C CE1  . HIS A 1 33 ? -11.389 4.368   5.932   1.00 0.00 ? 41  HIS A CE1  1  
ATOM 501   N NE2  . HIS A 1 33 ? -11.132 5.662   5.988   1.00 0.00 ? 41  HIS A NE2  1  
ATOM 502   H H    . HIS A 1 33 ? -6.208  2.283   5.582   1.00 0.00 ? 41  HIS A H    1  
ATOM 503   H HA   . HIS A 1 33 ? -7.876  3.853   4.049   1.00 0.00 ? 41  HIS A HA   1  
ATOM 504   H HB2  . HIS A 1 33 ? -7.720  3.265   6.693   1.00 0.00 ? 41  HIS A HB2  1  
ATOM 505   H HB3  . HIS A 1 33 ? -7.232  4.956   6.714   1.00 0.00 ? 41  HIS A HB3  1  
ATOM 506   H HD1  . HIS A 1 33 ? -10.154 2.737   5.963   1.00 0.00 ? 41  HIS A HD1  1  
ATOM 507   H HD2  . HIS A 1 33 ? -9.255  6.790   6.144   1.00 0.00 ? 41  HIS A HD2  1  
ATOM 508   H HE1  . HIS A 1 33 ? -12.368 3.921   5.855   1.00 0.00 ? 41  HIS A HE1  1  
ATOM 509   H HE2  . HIS A 1 33 ? -11.793 6.374   5.864   1.00 0.00 ? 41  HIS A HE2  1  
ATOM 510   N N    . VAL A 1 34 ? -7.034  6.227   3.771   1.00 0.00 ? 42  VAL A N    1  
ATOM 511   C CA   . VAL A 1 34 ? -6.418  7.482   3.355   1.00 0.00 ? 42  VAL A CA   1  
ATOM 512   C C    . VAL A 1 34 ? -7.262  8.678   3.791   1.00 0.00 ? 42  VAL A C    1  
ATOM 513   O O    . VAL A 1 34 ? -8.470  8.555   3.993   1.00 0.00 ? 42  VAL A O    1  
ATOM 514   C CB   . VAL A 1 34 ? -6.206  7.521   1.827   1.00 0.00 ? 42  VAL A CB   1  
ATOM 515   C CG1  . VAL A 1 34 ? -5.508  6.253   1.358   1.00 0.00 ? 42  VAL A CG1  1  
ATOM 516   C CG2  . VAL A 1 34 ? -7.527  7.703   1.094   1.00 0.00 ? 42  VAL A CG2  1  
ATOM 517   H H    . VAL A 1 34 ? -7.980  6.070   3.571   1.00 0.00 ? 42  VAL A H    1  
ATOM 518   H HA   . VAL A 1 34 ? -5.450  7.548   3.833   1.00 0.00 ? 42  VAL A HA   1  
ATOM 519   H HB   . VAL A 1 34 ? -5.569  8.361   1.593   1.00 0.00 ? 42  VAL A HB   1  
ATOM 520   H HG11 . VAL A 1 34 ? -5.026  6.440   0.410   1.00 0.00 ? 42  VAL A HG11 1  
ATOM 521   H HG12 . VAL A 1 34 ? -6.235  5.464   1.244   1.00 0.00 ? 42  VAL A HG12 1  
ATOM 522   H HG13 . VAL A 1 34 ? -4.767  5.960   2.087   1.00 0.00 ? 42  VAL A HG13 1  
ATOM 523   H HG21 . VAL A 1 34 ? -7.437  7.319   0.090   1.00 0.00 ? 42  VAL A HG21 1  
ATOM 524   H HG22 . VAL A 1 34 ? -7.775  8.753   1.059   1.00 0.00 ? 42  VAL A HG22 1  
ATOM 525   H HG23 . VAL A 1 34 ? -8.305  7.167   1.618   1.00 0.00 ? 42  VAL A HG23 1  
ATOM 526   N N    . LYS A 1 35 ? -6.618  9.832   3.937   1.00 0.00 ? 43  LYS A N    1  
ATOM 527   C CA   . LYS A 1 35 ? -7.312  11.045  4.352   1.00 0.00 ? 43  LYS A CA   1  
ATOM 528   C C    . LYS A 1 35 ? -7.708  11.895  3.145   1.00 0.00 ? 43  LYS A C    1  
ATOM 529   O O    . LYS A 1 35 ? -7.003  11.920  2.136   1.00 0.00 ? 43  LYS A O    1  
ATOM 530   C CB   . LYS A 1 35 ? -6.428  11.863  5.296   1.00 0.00 ? 43  LYS A CB   1  
ATOM 531   C CG   . LYS A 1 35 ? -5.964  11.087  6.518   1.00 0.00 ? 43  LYS A CG   1  
ATOM 532   C CD   . LYS A 1 35 ? -4.875  11.835  7.271   1.00 0.00 ? 43  LYS A CD   1  
ATOM 533   C CE   . LYS A 1 35 ? -3.538  11.737  6.555   1.00 0.00 ? 43  LYS A CE   1  
ATOM 534   N NZ   . LYS A 1 35 ? -2.456  12.439  7.302   1.00 0.00 ? 43  LYS A NZ   1  
ATOM 535   H H    . LYS A 1 35 ? -5.653  9.866   3.764   1.00 0.00 ? 43  LYS A H    1  
ATOM 536   H HA   . LYS A 1 35 ? -8.206  10.749  4.878   1.00 0.00 ? 43  LYS A HA   1  
ATOM 537   H HB2  . LYS A 1 35 ? -5.555  12.196  4.755   1.00 0.00 ? 43  LYS A HB2  1  
ATOM 538   H HB3  . LYS A 1 35 ? -6.984  12.725  5.633   1.00 0.00 ? 43  LYS A HB3  1  
ATOM 539   H HG2  . LYS A 1 35 ? -6.805  10.937  7.179   1.00 0.00 ? 43  LYS A HG2  1  
ATOM 540   H HG3  . LYS A 1 35 ? -5.578  10.130  6.200   1.00 0.00 ? 43  LYS A HG3  1  
ATOM 541   H HD2  . LYS A 1 35 ? -5.154  12.874  7.350   1.00 0.00 ? 43  LYS A HD2  1  
ATOM 542   H HD3  . LYS A 1 35 ? -4.778  11.409  8.259   1.00 0.00 ? 43  LYS A HD3  1  
ATOM 543   H HE2  . LYS A 1 35 ? -3.273  10.695  6.453   1.00 0.00 ? 43  LYS A HE2  1  
ATOM 544   H HE3  . LYS A 1 35 ? -3.634  12.182  5.577   1.00 0.00 ? 43  LYS A HE3  1  
ATOM 545   H HZ1  . LYS A 1 35 ? -2.333  13.403  6.932   1.00 0.00 ? 43  LYS A HZ1  1  
ATOM 546   H HZ2  . LYS A 1 35 ? -1.559  11.923  7.201   1.00 0.00 ? 43  LYS A HZ2  1  
ATOM 547   H HZ3  . LYS A 1 35 ? -2.698  12.495  8.312   1.00 0.00 ? 43  LYS A HZ3  1  
ATOM 548   N N    . PRO A 1 36 ? -8.847  12.605  3.236   1.00 0.00 ? 44  PRO A N    1  
ATOM 549   C CA   . PRO A 1 36 ? -9.335  13.458  2.151   1.00 0.00 ? 44  PRO A CA   1  
ATOM 550   C C    . PRO A 1 36 ? -8.582  14.781  2.070   1.00 0.00 ? 44  PRO A C    1  
ATOM 551   O O    . PRO A 1 36 ? -8.188  15.346  3.090   1.00 0.00 ? 44  PRO A O    1  
ATOM 552   C CB   . PRO A 1 36 ? -10.795 13.695  2.530   1.00 0.00 ? 44  PRO A CB   1  
ATOM 553   C CG   . PRO A 1 36 ? -10.807 13.630  4.019   1.00 0.00 ? 44  PRO A CG   1  
ATOM 554   C CD   . PRO A 1 36 ? -9.749  12.631  4.405   1.00 0.00 ? 44  PRO A CD   1  
ATOM 555   H HA   . PRO A 1 36 ? -9.284  12.954  1.196   1.00 0.00 ? 44  PRO A HA   1  
ATOM 556   H HB2  . PRO A 1 36 ? -11.109 14.665  2.173   1.00 0.00 ? 44  PRO A HB2  1  
ATOM 557   H HB3  . PRO A 1 36 ? -11.415 12.925  2.097   1.00 0.00 ? 44  PRO A HB3  1  
ATOM 558   H HG2  . PRO A 1 36 ? -10.573 14.602  4.429   1.00 0.00 ? 44  PRO A HG2  1  
ATOM 559   H HG3  . PRO A 1 36 ? -11.776 13.301  4.363   1.00 0.00 ? 44  PRO A HG3  1  
ATOM 560   H HD2  . PRO A 1 36 ? -9.222  12.963  5.289   1.00 0.00 ? 44  PRO A HD2  1  
ATOM 561   H HD3  . PRO A 1 36 ? -10.191 11.660  4.572   1.00 0.00 ? 44  PRO A HD3  1  
ATOM 562   N N    . GLY A 1 37 ? -8.382  15.271  0.850   1.00 0.00 ? 45  GLY A N    1  
ATOM 563   C CA   . GLY A 1 37 ? -7.674  16.524  0.661   1.00 0.00 ? 45  GLY A CA   1  
ATOM 564   C C    . GLY A 1 37 ? -6.189  16.323  0.422   1.00 0.00 ? 45  GLY A C    1  
ATOM 565   O O    . GLY A 1 37 ? -5.530  17.173  -0.176  1.00 0.00 ? 45  GLY A O    1  
ATOM 566   H H    . GLY A 1 37 ? -8.717  14.776  0.072   1.00 0.00 ? 45  GLY A H    1  
ATOM 567   H HA2  . GLY A 1 37 ? -8.097  17.038  -0.190  1.00 0.00 ? 45  GLY A HA2  1  
ATOM 568   H HA3  . GLY A 1 37 ? -7.807  17.136  1.540   1.00 0.00 ? 45  GLY A HA3  1  
ATOM 569   N N    . SER A 1 38 ? -5.664  15.196  0.893   1.00 0.00 ? 46  SER A N    1  
ATOM 570   C CA   . SER A 1 38 ? -4.249  14.883  0.730   1.00 0.00 ? 46  SER A CA   1  
ATOM 571   C C    . SER A 1 38 ? -3.942  14.479  -0.710  1.00 0.00 ? 46  SER A C    1  
ATOM 572   O O    . SER A 1 38 ? -4.830  14.461  -1.562  1.00 0.00 ? 46  SER A O    1  
ATOM 573   C CB   . SER A 1 38 ? -3.852  13.756  1.681   1.00 0.00 ? 46  SER A CB   1  
ATOM 574   O OG   . SER A 1 38 ? -4.547  13.859  2.912   1.00 0.00 ? 46  SER A OG   1  
ATOM 575   H H    . SER A 1 38 ? -6.241  14.559  1.360   1.00 0.00 ? 46  SER A H    1  
ATOM 576   H HA   . SER A 1 38 ? -3.681  15.764  0.978   1.00 0.00 ? 46  SER A HA   1  
ATOM 577   H HB2  . SER A 1 38 ? -4.087  12.807  1.227   1.00 0.00 ? 46  SER A HB2  1  
ATOM 578   H HB3  . SER A 1 38 ? -2.790  13.811  1.873   1.00 0.00 ? 46  SER A HB3  1  
ATOM 579   H HG   . SER A 1 38 ? -3.975  13.569  3.627   1.00 0.00 ? 46  SER A HG   1  
ATOM 580   N N    . LEU A 1 39 ? -2.681  14.152  -0.972  1.00 0.00 ? 47  LEU A N    1  
ATOM 581   C CA   . LEU A 1 39 ? -2.260  13.746  -2.308  1.00 0.00 ? 47  LEU A CA   1  
ATOM 582   C C    . LEU A 1 39 ? -2.819  12.371  -2.656  1.00 0.00 ? 47  LEU A C    1  
ATOM 583   O O    . LEU A 1 39 ? -3.174  12.106  -3.805  1.00 0.00 ? 47  LEU A O    1  
ATOM 584   C CB   . LEU A 1 39 ? -0.732  13.725  -2.401  1.00 0.00 ? 47  LEU A CB   1  
ATOM 585   C CG   . LEU A 1 39 ? -0.059  15.094  -2.286  1.00 0.00 ? 47  LEU A CG   1  
ATOM 586   C CD1  . LEU A 1 39 ? 1.378   14.940  -1.812  1.00 0.00 ? 47  LEU A CD1  1  
ATOM 587   C CD2  . LEU A 1 39 ? -0.109  15.822  -3.620  1.00 0.00 ? 47  LEU A CD2  1  
ATOM 588   H H    . LEU A 1 39 ? -2.019  14.184  -0.250  1.00 0.00 ? 47  LEU A H    1  
ATOM 589   H HA   . LEU A 1 39 ? -2.645  14.469  -3.012  1.00 0.00 ? 47  LEU A HA   1  
ATOM 590   H HB2  . LEU A 1 39 ? -0.354  13.092  -1.611  1.00 0.00 ? 47  LEU A HB2  1  
ATOM 591   H HB3  . LEU A 1 39 ? -0.456  13.293  -3.350  1.00 0.00 ? 47  LEU A HB3  1  
ATOM 592   H HG   . LEU A 1 39 ? -0.589  15.689  -1.557  1.00 0.00 ? 47  LEU A HG   1  
ATOM 593   H HD11 . LEU A 1 39 ? 2.041   14.944  -2.665  1.00 0.00 ? 47  LEU A HD11 1  
ATOM 594   H HD12 . LEU A 1 39 ? 1.484   14.008  -1.279  1.00 0.00 ? 47  LEU A HD12 1  
ATOM 595   H HD13 . LEU A 1 39 ? 1.629   15.761  -1.157  1.00 0.00 ? 47  LEU A HD13 1  
ATOM 596   H HD21 . LEU A 1 39 ? -0.253  16.878  -3.447  1.00 0.00 ? 47  LEU A HD21 1  
ATOM 597   H HD22 . LEU A 1 39 ? -0.927  15.438  -4.210  1.00 0.00 ? 47  LEU A HD22 1  
ATOM 598   H HD23 . LEU A 1 39 ? 0.820   15.668  -4.149  1.00 0.00 ? 47  LEU A HD23 1  
ATOM 599   N N    . SER A 1 40 ? -2.895  11.501  -1.654  1.00 0.00 ? 48  SER A N    1  
ATOM 600   C CA   . SER A 1 40 ? -3.411  10.148  -1.843  1.00 0.00 ? 48  SER A CA   1  
ATOM 601   C C    . SER A 1 40 ? -4.783  10.174  -2.509  1.00 0.00 ? 48  SER A C    1  
ATOM 602   O O    . SER A 1 40 ? -5.014  9.494   -3.508  1.00 0.00 ? 48  SER A O    1  
ATOM 603   C CB   . SER A 1 40 ? -3.502  9.432   -0.496  1.00 0.00 ? 48  SER A CB   1  
ATOM 604   O OG   . SER A 1 40 ? -3.985  8.109   -0.651  1.00 0.00 ? 48  SER A OG   1  
ATOM 605   H H    . SER A 1 40 ? -2.594  11.774  -0.762  1.00 0.00 ? 48  SER A H    1  
ATOM 606   H HA   . SER A 1 40 ? -2.723  9.614   -2.481  1.00 0.00 ? 48  SER A HA   1  
ATOM 607   H HB2  . SER A 1 40 ? -2.523  9.393   -0.045  1.00 0.00 ? 48  SER A HB2  1  
ATOM 608   H HB3  . SER A 1 40 ? -4.176  9.973   0.151   1.00 0.00 ? 48  SER A HB3  1  
ATOM 609   H HG   . SER A 1 40 ? -4.944  8.118   -0.667  1.00 0.00 ? 48  SER A HG   1  
ATOM 610   N N    . ALA A 1 41 ? -5.689  10.967  -1.950  1.00 0.00 ? 49  ALA A N    1  
ATOM 611   C CA   . ALA A 1 41 ? -7.036  11.085  -2.489  1.00 0.00 ? 49  ALA A CA   1  
ATOM 612   C C    . ALA A 1 41 ? -7.018  11.769  -3.849  1.00 0.00 ? 49  ALA A C    1  
ATOM 613   O O    . ALA A 1 41 ? -7.829  11.463  -4.723  1.00 0.00 ? 49  ALA A O    1  
ATOM 614   C CB   . ALA A 1 41 ? -7.918  11.860  -1.527  1.00 0.00 ? 49  ALA A CB   1  
ATOM 615   H H    . ALA A 1 41 ? -5.444  11.486  -1.155  1.00 0.00 ? 49  ALA A H    1  
ATOM 616   H HA   . ALA A 1 41 ? -7.444  10.091  -2.598  1.00 0.00 ? 49  ALA A HA   1  
ATOM 617   H HB1  . ALA A 1 41 ? -8.921  11.459  -1.555  1.00 0.00 ? 49  ALA A HB1  1  
ATOM 618   H HB2  . ALA A 1 41 ? -7.936  12.901  -1.816  1.00 0.00 ? 49  ALA A HB2  1  
ATOM 619   H HB3  . ALA A 1 41 ? -7.523  11.771  -0.526  1.00 0.00 ? 49  ALA A HB3  1  
ATOM 620   N N    . GLU A 1 42 ? -6.090  12.702  -4.014  1.00 0.00 ? 50  GLU A N    1  
ATOM 621   C CA   . GLU A 1 42 ? -5.960  13.443  -5.260  1.00 0.00 ? 50  GLU A CA   1  
ATOM 622   C C    . GLU A 1 42 ? -5.530  12.527  -6.403  1.00 0.00 ? 50  GLU A C    1  
ATOM 623   O O    . GLU A 1 42 ? -5.887  12.755  -7.559  1.00 0.00 ? 50  GLU A O    1  
ATOM 624   C CB   . GLU A 1 42 ? -4.952  14.578  -5.090  1.00 0.00 ? 50  GLU A CB   1  
ATOM 625   C CG   . GLU A 1 42 ? -5.575  15.879  -4.609  1.00 0.00 ? 50  GLU A CG   1  
ATOM 626   C CD   . GLU A 1 42 ? -5.597  16.949  -5.684  1.00 0.00 ? 50  GLU A CD   1  
ATOM 627   O OE1  . GLU A 1 42 ? -4.610  17.044  -6.445  1.00 0.00 ? 50  GLU A OE1  1  
ATOM 628   O OE2  . GLU A 1 42 ? -6.598  17.689  -5.765  1.00 0.00 ? 50  GLU A OE2  1  
ATOM 629   H H    . GLU A 1 42 ? -5.477  12.900  -3.276  1.00 0.00 ? 50  GLU A H    1  
ATOM 630   H HA   . GLU A 1 42 ? -6.925  13.865  -5.497  1.00 0.00 ? 50  GLU A HA   1  
ATOM 631   H HB2  . GLU A 1 42 ? -4.203  14.275  -4.372  1.00 0.00 ? 50  GLU A HB2  1  
ATOM 632   H HB3  . GLU A 1 42 ? -4.475  14.761  -6.038  1.00 0.00 ? 50  GLU A HB3  1  
ATOM 633   H HG2  . GLU A 1 42 ? -6.591  15.683  -4.298  1.00 0.00 ? 50  GLU A HG2  1  
ATOM 634   H HG3  . GLU A 1 42 ? -5.006  16.247  -3.768  1.00 0.00 ? 50  GLU A HG3  1  
ATOM 635   N N    . VAL A 1 43 ? -4.759  11.494  -6.075  1.00 0.00 ? 51  VAL A N    1  
ATOM 636   C CA   . VAL A 1 43 ? -4.286  10.548  -7.081  1.00 0.00 ? 51  VAL A CA   1  
ATOM 637   C C    . VAL A 1 43 ? -5.280  9.408   -7.284  1.00 0.00 ? 51  VAL A C    1  
ATOM 638   O O    . VAL A 1 43 ? -5.263  8.736   -8.314  1.00 0.00 ? 51  VAL A O    1  
ATOM 639   C CB   . VAL A 1 43 ? -2.917  9.953   -6.693  1.00 0.00 ? 51  VAL A CB   1  
ATOM 640   C CG1  . VAL A 1 43 ? -1.840  11.028  -6.696  1.00 0.00 ? 51  VAL A CG1  1  
ATOM 641   C CG2  . VAL A 1 43 ? -2.997  9.270   -5.336  1.00 0.00 ? 51  VAL A CG2  1  
ATOM 642   H H    . VAL A 1 43 ? -4.506  11.363  -5.138  1.00 0.00 ? 51  VAL A H    1  
ATOM 643   H HA   . VAL A 1 43 ? -4.170  11.083  -8.012  1.00 0.00 ? 51  VAL A HA   1  
ATOM 644   H HB   . VAL A 1 43 ? -2.652  9.209   -7.430  1.00 0.00 ? 51  VAL A HB   1  
ATOM 645   H HG11 . VAL A 1 43 ? -1.270  10.970  -5.779  1.00 0.00 ? 51  VAL A HG11 1  
ATOM 646   H HG12 . VAL A 1 43 ? -2.301  12.002  -6.773  1.00 0.00 ? 51  VAL A HG12 1  
ATOM 647   H HG13 . VAL A 1 43 ? -1.182  10.875  -7.539  1.00 0.00 ? 51  VAL A HG13 1  
ATOM 648   H HG21 . VAL A 1 43 ? -3.121  10.015  -4.564  1.00 0.00 ? 51  VAL A HG21 1  
ATOM 649   H HG22 . VAL A 1 43 ? -2.088  8.715   -5.158  1.00 0.00 ? 51  VAL A HG22 1  
ATOM 650   H HG23 . VAL A 1 43 ? -3.838  8.593   -5.322  1.00 0.00 ? 51  VAL A HG23 1  
ATOM 651   N N    . GLY A 1 44 ? -6.142  9.192   -6.294  1.00 0.00 ? 52  GLY A N    1  
ATOM 652   C CA   . GLY A 1 44 ? -7.125  8.128   -6.387  1.00 0.00 ? 52  GLY A CA   1  
ATOM 653   C C    . GLY A 1 44 ? -6.703  6.894   -5.616  1.00 0.00 ? 52  GLY A C    1  
ATOM 654   O O    . GLY A 1 44 ? -6.912  5.767   -6.067  1.00 0.00 ? 52  GLY A O    1  
ATOM 655   H H    . GLY A 1 44 ? -6.108  9.755   -5.494  1.00 0.00 ? 52  GLY A H    1  
ATOM 656   H HA2  . GLY A 1 44 ? -8.066  8.484   -5.994  1.00 0.00 ? 52  GLY A HA2  1  
ATOM 657   H HA3  . GLY A 1 44 ? -7.257  7.863   -7.427  1.00 0.00 ? 52  GLY A HA3  1  
ATOM 658   N N    . LEU A 1 45 ? -6.103  7.110   -4.452  1.00 0.00 ? 53  LEU A N    1  
ATOM 659   C CA   . LEU A 1 45 ? -5.641  6.014   -3.610  1.00 0.00 ? 53  LEU A CA   1  
ATOM 660   C C    . LEU A 1 45 ? -6.727  5.579   -2.630  1.00 0.00 ? 53  LEU A C    1  
ATOM 661   O O    . LEU A 1 45 ? -7.655  6.334   -2.341  1.00 0.00 ? 53  LEU A O    1  
ATOM 662   C CB   . LEU A 1 45 ? -4.386  6.435   -2.845  1.00 0.00 ? 53  LEU A CB   1  
ATOM 663   C CG   . LEU A 1 45 ? -3.063  6.120   -3.544  1.00 0.00 ? 53  LEU A CG   1  
ATOM 664   C CD1  . LEU A 1 45 ? -1.935  6.948   -2.950  1.00 0.00 ? 53  LEU A CD1  1  
ATOM 665   C CD2  . LEU A 1 45 ? -2.747  4.637   -3.442  1.00 0.00 ? 53  LEU A CD2  1  
ATOM 666   H H    . LEU A 1 45 ? -5.963  8.033   -4.150  1.00 0.00 ? 53  LEU A H    1  
ATOM 667   H HA   . LEU A 1 45 ? -5.398  5.182   -4.253  1.00 0.00 ? 53  LEU A HA   1  
ATOM 668   H HB2  . LEU A 1 45 ? -4.436  7.501   -2.678  1.00 0.00 ? 53  LEU A HB2  1  
ATOM 669   H HB3  . LEU A 1 45 ? -4.388  5.936   -1.886  1.00 0.00 ? 53  LEU A HB3  1  
ATOM 670   H HG   . LEU A 1 45 ? -3.148  6.376   -4.591  1.00 0.00 ? 53  LEU A HG   1  
ATOM 671   H HD11 . LEU A 1 45 ? -1.995  7.960   -3.322  1.00 0.00 ? 53  LEU A HD11 1  
ATOM 672   H HD12 . LEU A 1 45 ? -0.985  6.517   -3.230  1.00 0.00 ? 53  LEU A HD12 1  
ATOM 673   H HD13 . LEU A 1 45 ? -2.023  6.956   -1.874  1.00 0.00 ? 53  LEU A HD13 1  
ATOM 674   H HD21 . LEU A 1 45 ? -1.738  4.459   -3.784  1.00 0.00 ? 53  LEU A HD21 1  
ATOM 675   H HD22 . LEU A 1 45 ? -3.438  4.078   -4.057  1.00 0.00 ? 53  LEU A HD22 1  
ATOM 676   H HD23 . LEU A 1 45 ? -2.842  4.319   -2.415  1.00 0.00 ? 53  LEU A HD23 1  
ATOM 677   N N    . GLU A 1 46 ? -6.600  4.357   -2.123  1.00 0.00 ? 54  GLU A N    1  
ATOM 678   C CA   . GLU A 1 46 ? -7.566  3.815   -1.173  1.00 0.00 ? 54  GLU A CA   1  
ATOM 679   C C    . GLU A 1 46 ? -7.186  2.396   -0.766  1.00 0.00 ? 54  GLU A C    1  
ATOM 680   O O    . GLU A 1 46 ? -6.277  1.797   -1.342  1.00 0.00 ? 54  GLU A O    1  
ATOM 681   C CB   . GLU A 1 46 ? -8.973  3.826   -1.775  1.00 0.00 ? 54  GLU A CB   1  
ATOM 682   C CG   . GLU A 1 46 ? -9.068  3.106   -3.111  1.00 0.00 ? 54  GLU A CG   1  
ATOM 683   C CD   . GLU A 1 46 ? -10.475 3.104   -3.674  1.00 0.00 ? 54  GLU A CD   1  
ATOM 684   O OE1  . GLU A 1 46 ? -11.336 2.388   -3.122  1.00 0.00 ? 54  GLU A OE1  1  
ATOM 685   O OE2  . GLU A 1 46 ? -10.716 3.822   -4.669  1.00 0.00 ? 54  GLU A OE2  1  
ATOM 686   H H    . GLU A 1 46 ? -5.837  3.805   -2.392  1.00 0.00 ? 54  GLU A H    1  
ATOM 687   H HA   . GLU A 1 46 ? -7.555  4.445   -0.293  1.00 0.00 ? 54  GLU A HA   1  
ATOM 688   H HB2  . GLU A 1 46 ? -9.652  3.349   -1.084  1.00 0.00 ? 54  GLU A HB2  1  
ATOM 689   H HB3  . GLU A 1 46 ? -9.282  4.851   -1.921  1.00 0.00 ? 54  GLU A HB3  1  
ATOM 690   H HG2  . GLU A 1 46 ? -8.414  3.596   -3.817  1.00 0.00 ? 54  GLU A HG2  1  
ATOM 691   H HG3  . GLU A 1 46 ? -8.748  2.084   -2.977  1.00 0.00 ? 54  GLU A HG3  1  
ATOM 692   N N    . ILE A 1 47 ? -7.885  1.859   0.230   1.00 0.00 ? 55  ILE A N    1  
ATOM 693   C CA   . ILE A 1 47 ? -7.617  0.509   0.709   1.00 0.00 ? 55  ILE A CA   1  
ATOM 694   C C    . ILE A 1 47 ? -7.816  -0.518  -0.400  1.00 0.00 ? 55  ILE A C    1  
ATOM 695   O O    . ILE A 1 47 ? -8.662  -0.342  -1.277  1.00 0.00 ? 55  ILE A O    1  
ATOM 696   C CB   . ILE A 1 47 ? -8.522  0.143   1.902   1.00 0.00 ? 55  ILE A CB   1  
ATOM 697   C CG1  . ILE A 1 47 ? -8.470  1.240   2.968   1.00 0.00 ? 55  ILE A CG1  1  
ATOM 698   C CG2  . ILE A 1 47 ? -8.105  -1.199  2.491   1.00 0.00 ? 55  ILE A CG2  1  
ATOM 699   C CD1  . ILE A 1 47 ? -9.827  1.820   3.304   1.00 0.00 ? 55  ILE A CD1  1  
ATOM 700   H H    . ILE A 1 47 ? -8.598  2.384   0.652   1.00 0.00 ? 55  ILE A H    1  
ATOM 701   H HA   . ILE A 1 47 ? -6.589  0.471   1.040   1.00 0.00 ? 55  ILE A HA   1  
ATOM 702   H HB   . ILE A 1 47 ? -9.534  0.050   1.541   1.00 0.00 ? 55  ILE A HB   1  
ATOM 703   H HG12 . ILE A 1 47 ? -8.051  0.835   3.877   1.00 0.00 ? 55  ILE A HG12 1  
ATOM 704   H HG13 . ILE A 1 47 ? -7.842  2.047   2.618   1.00 0.00 ? 55  ILE A HG13 1  
ATOM 705   H HG21 . ILE A 1 47 ? -7.125  -1.109  2.935   1.00 0.00 ? 55  ILE A HG21 1  
ATOM 706   H HG22 . ILE A 1 47 ? -8.079  -1.943  1.708   1.00 0.00 ? 55  ILE A HG22 1  
ATOM 707   H HG23 . ILE A 1 47 ? -8.817  -1.497  3.246   1.00 0.00 ? 55  ILE A HG23 1  
ATOM 708   H HD11 . ILE A 1 47 ? -9.741  2.890   3.427   1.00 0.00 ? 55  ILE A HD11 1  
ATOM 709   H HD12 . ILE A 1 47 ? -10.189 1.381   4.221   1.00 0.00 ? 55  ILE A HD12 1  
ATOM 710   H HD13 . ILE A 1 47 ? -10.518 1.605   2.504   1.00 0.00 ? 55  ILE A HD13 1  
ATOM 711   N N    . GLY A 1 48 ? -7.032  -1.589  -0.355  1.00 0.00 ? 56  GLY A N    1  
ATOM 712   C CA   . GLY A 1 48 ? -7.138  -2.628  -1.362  1.00 0.00 ? 56  GLY A CA   1  
ATOM 713   C C    . GLY A 1 48 ? -6.015  -2.569  -2.378  1.00 0.00 ? 56  GLY A C    1  
ATOM 714   O O    . GLY A 1 48 ? -5.467  -3.599  -2.768  1.00 0.00 ? 56  GLY A O    1  
ATOM 715   H H    . GLY A 1 48 ? -6.376  -1.675  0.368   1.00 0.00 ? 56  GLY A H    1  
ATOM 716   H HA2  . GLY A 1 48 ? -7.117  -3.592  -0.873  1.00 0.00 ? 56  GLY A HA2  1  
ATOM 717   H HA3  . GLY A 1 48 ? -8.082  -2.519  -1.877  1.00 0.00 ? 56  GLY A HA3  1  
ATOM 718   N N    . ASP A 1 49 ? -5.672  -1.361  -2.809  1.00 0.00 ? 57  ASP A N    1  
ATOM 719   C CA   . ASP A 1 49 ? -4.606  -1.171  -3.787  1.00 0.00 ? 57  ASP A CA   1  
ATOM 720   C C    . ASP A 1 49 ? -3.306  -1.817  -3.313  1.00 0.00 ? 57  ASP A C    1  
ATOM 721   O O    . ASP A 1 49 ? -3.194  -2.228  -2.158  1.00 0.00 ? 57  ASP A O    1  
ATOM 722   C CB   . ASP A 1 49 ? -4.387  0.320   -4.042  1.00 0.00 ? 57  ASP A CB   1  
ATOM 723   C CG   . ASP A 1 49 ? -5.517  0.943   -4.838  1.00 0.00 ? 57  ASP A CG   1  
ATOM 724   O OD1  . ASP A 1 49 ? -5.909  0.358   -5.871  1.00 0.00 ? 57  ASP A OD1  1  
ATOM 725   O OD2  . ASP A 1 49 ? -6.013  2.015   -4.430  1.00 0.00 ? 57  ASP A OD2  1  
ATOM 726   H H    . ASP A 1 49 ? -6.146  -0.577  -2.461  1.00 0.00 ? 57  ASP A H    1  
ATOM 727   H HA   . ASP A 1 49 ? -4.914  -1.644  -4.709  1.00 0.00 ? 57  ASP A HA   1  
ATOM 728   H HB2  . ASP A 1 49 ? -4.313  0.835   -3.096  1.00 0.00 ? 57  ASP A HB2  1  
ATOM 729   H HB3  . ASP A 1 49 ? -3.468  0.453   -4.591  1.00 0.00 ? 57  ASP A HB3  1  
ATOM 730   N N    . GLN A 1 50 ? -2.330  -1.905  -4.211  1.00 0.00 ? 58  GLN A N    1  
ATOM 731   C CA   . GLN A 1 50 ? -1.041  -2.503  -3.881  1.00 0.00 ? 58  GLN A CA   1  
ATOM 732   C C    . GLN A 1 50 ? 0.079   -1.890  -4.717  1.00 0.00 ? 58  GLN A C    1  
ATOM 733   O O    . GLN A 1 50 ? 0.128   -2.071  -5.935  1.00 0.00 ? 58  GLN A O    1  
ATOM 734   C CB   . GLN A 1 50 ? -1.089  -4.018  -4.101  1.00 0.00 ? 58  GLN A CB   1  
ATOM 735   C CG   . GLN A 1 50 ? -0.559  -4.820  -2.925  1.00 0.00 ? 58  GLN A CG   1  
ATOM 736   C CD   . GLN A 1 50 ? 0.679   -5.623  -3.274  1.00 0.00 ? 58  GLN A CD   1  
ATOM 737   O OE1  . GLN A 1 50 ? 1.789   -5.288  -2.860  1.00 0.00 ? 58  GLN A OE1  1  
ATOM 738   N NE2  . GLN A 1 50 ? 0.494   -6.693  -4.040  1.00 0.00 ? 58  GLN A NE2  1  
ATOM 739   H H    . GLN A 1 50 ? -2.480  -1.561  -5.116  1.00 0.00 ? 58  GLN A H    1  
ATOM 740   H HA   . GLN A 1 50 ? -0.843  -2.308  -2.838  1.00 0.00 ? 58  GLN A HA   1  
ATOM 741   H HB2  . GLN A 1 50 ? -2.114  -4.311  -4.276  1.00 0.00 ? 58  GLN A HB2  1  
ATOM 742   H HB3  . GLN A 1 50 ? -0.500  -4.265  -4.973  1.00 0.00 ? 58  GLN A HB3  1  
ATOM 743   H HG2  . GLN A 1 50 ? -0.312  -4.140  -2.122  1.00 0.00 ? 58  GLN A HG2  1  
ATOM 744   H HG3  . GLN A 1 50 ? -1.329  -5.501  -2.591  1.00 0.00 ? 58  GLN A HG3  1  
ATOM 745   H HE21 . GLN A 1 50 ? -0.418  -6.900  -4.332  1.00 0.00 ? 58  GLN A HE21 1  
ATOM 746   H HE22 . GLN A 1 50 ? 1.276   -7.230  -4.281  1.00 0.00 ? 58  GLN A HE22 1  
ATOM 747   N N    . ILE A 1 51 ? 0.977   -1.167  -4.057  1.00 0.00 ? 59  ILE A N    1  
ATOM 748   C CA   . ILE A 1 51 ? 2.096   -0.529  -4.738  1.00 0.00 ? 59  ILE A CA   1  
ATOM 749   C C    . ILE A 1 51 ? 3.092   -1.569  -5.243  1.00 0.00 ? 59  ILE A C    1  
ATOM 750   O O    . ILE A 1 51 ? 3.623   -2.363  -4.466  1.00 0.00 ? 59  ILE A O    1  
ATOM 751   C CB   . ILE A 1 51 ? 2.829   0.459   -3.808  1.00 0.00 ? 59  ILE A CB   1  
ATOM 752   C CG1  . ILE A 1 51 ? 1.831   1.424   -3.164  1.00 0.00 ? 59  ILE A CG1  1  
ATOM 753   C CG2  . ILE A 1 51 ? 3.892   1.229   -4.580  1.00 0.00 ? 59  ILE A CG2  1  
ATOM 754   C CD1  . ILE A 1 51 ? 2.443   2.294   -2.087  1.00 0.00 ? 59  ILE A CD1  1  
ATOM 755   H H    . ILE A 1 51 ? 0.886   -1.062  -3.088  1.00 0.00 ? 59  ILE A H    1  
ATOM 756   H HA   . ILE A 1 51 ? 1.706   0.023   -5.582  1.00 0.00 ? 59  ILE A HA   1  
ATOM 757   H HB   . ILE A 1 51 ? 3.322   -0.107  -3.035  1.00 0.00 ? 59  ILE A HB   1  
ATOM 758   H HG12 . ILE A 1 51 ? 1.426   2.074   -3.925  1.00 0.00 ? 59  ILE A HG12 1  
ATOM 759   H HG13 . ILE A 1 51 ? 1.028   0.856   -2.717  1.00 0.00 ? 59  ILE A HG13 1  
ATOM 760   H HG21 . ILE A 1 51 ? 3.433   1.745   -5.410  1.00 0.00 ? 59  ILE A HG21 1  
ATOM 761   H HG22 . ILE A 1 51 ? 4.636   0.540   -4.951  1.00 0.00 ? 59  ILE A HG22 1  
ATOM 762   H HG23 . ILE A 1 51 ? 4.362   1.947   -3.924  1.00 0.00 ? 59  ILE A HG23 1  
ATOM 763   H HD11 . ILE A 1 51 ? 3.174   2.954   -2.528  1.00 0.00 ? 59  ILE A HD11 1  
ATOM 764   H HD12 . ILE A 1 51 ? 2.920   1.668   -1.347  1.00 0.00 ? 59  ILE A HD12 1  
ATOM 765   H HD13 . ILE A 1 51 ? 1.668   2.880   -1.616  1.00 0.00 ? 59  ILE A HD13 1  
ATOM 766   N N    . VAL A 1 52 ? 3.334   -1.563  -6.550  1.00 0.00 ? 60  VAL A N    1  
ATOM 767   C CA   . VAL A 1 52 ? 4.260   -2.512  -7.159  1.00 0.00 ? 60  VAL A CA   1  
ATOM 768   C C    . VAL A 1 52 ? 5.520   -1.822  -7.675  1.00 0.00 ? 60  VAL A C    1  
ATOM 769   O O    . VAL A 1 52 ? 6.338   -2.442  -8.355  1.00 0.00 ? 60  VAL A O    1  
ATOM 770   C CB   . VAL A 1 52 ? 3.593   -3.272  -8.320  1.00 0.00 ? 60  VAL A CB   1  
ATOM 771   C CG1  . VAL A 1 52 ? 2.450   -4.135  -7.809  1.00 0.00 ? 60  VAL A CG1  1  
ATOM 772   C CG2  . VAL A 1 52 ? 3.103   -2.301  -9.385  1.00 0.00 ? 60  VAL A CG2  1  
ATOM 773   H H    . VAL A 1 52 ? 2.876   -0.909  -7.119  1.00 0.00 ? 60  VAL A H    1  
ATOM 774   H HA   . VAL A 1 52 ? 4.540   -3.231  -6.404  1.00 0.00 ? 60  VAL A HA   1  
ATOM 775   H HB   . VAL A 1 52 ? 4.332   -3.921  -8.769  1.00 0.00 ? 60  VAL A HB   1  
ATOM 776   H HG11 . VAL A 1 52 ? 2.292   -4.962  -8.486  1.00 0.00 ? 60  VAL A HG11 1  
ATOM 777   H HG12 . VAL A 1 52 ? 1.550   -3.542  -7.749  1.00 0.00 ? 60  VAL A HG12 1  
ATOM 778   H HG13 . VAL A 1 52 ? 2.696   -4.514  -6.828  1.00 0.00 ? 60  VAL A HG13 1  
ATOM 779   H HG21 . VAL A 1 52 ? 3.920   -1.666  -9.695  1.00 0.00 ? 60  VAL A HG21 1  
ATOM 780   H HG22 . VAL A 1 52 ? 2.309   -1.692  -8.977  1.00 0.00 ? 60  VAL A HG22 1  
ATOM 781   H HG23 . VAL A 1 52 ? 2.733   -2.853  -10.234 1.00 0.00 ? 60  VAL A HG23 1  
ATOM 782   N N    . GLU A 1 53 ? 5.679   -0.541  -7.353  1.00 0.00 ? 61  GLU A N    1  
ATOM 783   C CA   . GLU A 1 53 ? 6.849   0.214   -7.792  1.00 0.00 ? 61  GLU A CA   1  
ATOM 784   C C    . GLU A 1 53 ? 6.891   1.593   -7.143  1.00 0.00 ? 61  GLU A C    1  
ATOM 785   O O    . GLU A 1 53 ? 5.854   2.197   -6.871  1.00 0.00 ? 61  GLU A O    1  
ATOM 786   C CB   . GLU A 1 53 ? 6.850   0.355   -9.315  1.00 0.00 ? 61  GLU A CB   1  
ATOM 787   C CG   . GLU A 1 53 ? 8.243   0.403   -9.920  1.00 0.00 ? 61  GLU A CG   1  
ATOM 788   C CD   . GLU A 1 53 ? 8.485   1.660   -10.734 1.00 0.00 ? 61  GLU A CD   1  
ATOM 789   O OE1  . GLU A 1 53 ? 7.967   2.728   -10.345 1.00 0.00 ? 61  GLU A OE1  1  
ATOM 790   O OE2  . GLU A 1 53 ? 9.192   1.575   -11.761 1.00 0.00 ? 61  GLU A OE2  1  
ATOM 791   H H    . GLU A 1 53 ? 4.999   -0.093  -6.809  1.00 0.00 ? 61  GLU A H    1  
ATOM 792   H HA   . GLU A 1 53 ? 7.727   -0.338  -7.492  1.00 0.00 ? 61  GLU A HA   1  
ATOM 793   H HB2  . GLU A 1 53 ? 6.322   -0.485  -9.744  1.00 0.00 ? 61  GLU A HB2  1  
ATOM 794   H HB3  . GLU A 1 53 ? 6.333   1.265   -9.579  1.00 0.00 ? 61  GLU A HB3  1  
ATOM 795   H HG2  . GLU A 1 53 ? 8.970   0.366   -9.123  1.00 0.00 ? 61  GLU A HG2  1  
ATOM 796   H HG3  . GLU A 1 53 ? 8.372   -0.455  -10.563 1.00 0.00 ? 61  GLU A HG3  1  
ATOM 797   N N    . VAL A 1 54 ? 8.102   2.086   -6.903  1.00 0.00 ? 62  VAL A N    1  
ATOM 798   C CA   . VAL A 1 54 ? 8.290   3.395   -6.291  1.00 0.00 ? 62  VAL A CA   1  
ATOM 799   C C    . VAL A 1 54 ? 9.633   3.997   -6.697  1.00 0.00 ? 62  VAL A C    1  
ATOM 800   O O    . VAL A 1 54 ? 10.675  3.642   -6.148  1.00 0.00 ? 62  VAL A O    1  
ATOM 801   C CB   . VAL A 1 54 ? 8.218   3.317   -4.752  1.00 0.00 ? 62  VAL A CB   1  
ATOM 802   C CG1  . VAL A 1 54 ? 8.342   4.703   -4.134  1.00 0.00 ? 62  VAL A CG1  1  
ATOM 803   C CG2  . VAL A 1 54 ? 6.925   2.644   -4.313  1.00 0.00 ? 62  VAL A CG2  1  
ATOM 804   H H    . VAL A 1 54 ? 8.890   1.556   -7.147  1.00 0.00 ? 62  VAL A H    1  
ATOM 805   H HA   . VAL A 1 54 ? 7.498   4.043   -6.637  1.00 0.00 ? 62  VAL A HA   1  
ATOM 806   H HB   . VAL A 1 54 ? 9.046   2.718   -4.403  1.00 0.00 ? 62  VAL A HB   1  
ATOM 807   H HG11 . VAL A 1 54 ? 8.635   5.413   -4.894  1.00 0.00 ? 62  VAL A HG11 1  
ATOM 808   H HG12 . VAL A 1 54 ? 9.089   4.683   -3.354  1.00 0.00 ? 62  VAL A HG12 1  
ATOM 809   H HG13 . VAL A 1 54 ? 7.392   4.998   -3.714  1.00 0.00 ? 62  VAL A HG13 1  
ATOM 810   H HG21 . VAL A 1 54 ? 6.794   2.775   -3.250  1.00 0.00 ? 62  VAL A HG21 1  
ATOM 811   H HG22 . VAL A 1 54 ? 6.971   1.591   -4.545  1.00 0.00 ? 62  VAL A HG22 1  
ATOM 812   H HG23 . VAL A 1 54 ? 6.092   3.091   -4.836  1.00 0.00 ? 62  VAL A HG23 1  
ATOM 813   N N    . ASN A 1 55 ? 9.597   4.910   -7.663  1.00 0.00 ? 63  ASN A N    1  
ATOM 814   C CA   . ASN A 1 55 ? 10.811  5.563   -8.144  1.00 0.00 ? 63  ASN A CA   1  
ATOM 815   C C    . ASN A 1 55 ? 11.757  4.551   -8.782  1.00 0.00 ? 63  ASN A C    1  
ATOM 816   O O    . ASN A 1 55 ? 12.977  4.718   -8.744  1.00 0.00 ? 63  ASN A O    1  
ATOM 817   C CB   . ASN A 1 55 ? 11.517  6.287   -6.996  1.00 0.00 ? 63  ASN A CB   1  
ATOM 818   C CG   . ASN A 1 55 ? 12.142  7.595   -7.437  1.00 0.00 ? 63  ASN A CG   1  
ATOM 819   O OD1  . ASN A 1 55 ? 12.618  7.721   -8.564  1.00 0.00 ? 63  ASN A OD1  1  
ATOM 820   N ND2  . ASN A 1 55 ? 12.143  8.580   -6.545  1.00 0.00 ? 63  ASN A ND2  1  
ATOM 821   H H    . ASN A 1 55 ? 8.735   5.152   -8.061  1.00 0.00 ? 63  ASN A H    1  
ATOM 822   H HA   . ASN A 1 55 ? 10.522  6.287   -8.891  1.00 0.00 ? 63  ASN A HA   1  
ATOM 823   H HB2  . ASN A 1 55 ? 10.800  6.497   -6.216  1.00 0.00 ? 63  ASN A HB2  1  
ATOM 824   H HB3  . ASN A 1 55 ? 12.296  5.650   -6.603  1.00 0.00 ? 63  ASN A HB3  1  
ATOM 825   H HD21 . ASN A 1 55 ? 11.746  8.409   -5.665  1.00 0.00 ? 63  ASN A HD21 1  
ATOM 826   H HD22 . ASN A 1 55 ? 12.541  9.438   -6.804  1.00 0.00 ? 63  ASN A HD22 1  
ATOM 827   N N    . GLY A 1 56 ? 11.189  3.500   -9.366  1.00 0.00 ? 64  GLY A N    1  
ATOM 828   C CA   . GLY A 1 56 ? 12.001  2.479   -10.004 1.00 0.00 ? 64  GLY A CA   1  
ATOM 829   C C    . GLY A 1 56 ? 12.128  1.228   -9.157  1.00 0.00 ? 64  GLY A C    1  
ATOM 830   O O    . GLY A 1 56 ? 12.281  0.126   -9.685  1.00 0.00 ? 64  GLY A O    1  
ATOM 831   H H    . GLY A 1 56 ? 10.213  3.419   -9.366  1.00 0.00 ? 64  GLY A H    1  
ATOM 832   H HA2  . GLY A 1 56 ? 11.550  2.216   -10.950 1.00 0.00 ? 64  GLY A HA2  1  
ATOM 833   H HA3  . GLY A 1 56 ? 12.987  2.879   -10.186 1.00 0.00 ? 64  GLY A HA3  1  
ATOM 834   N N    . VAL A 1 57 ? 12.068  1.398   -7.841  1.00 0.00 ? 65  VAL A N    1  
ATOM 835   C CA   . VAL A 1 57 ? 12.178  0.275   -6.920  1.00 0.00 ? 65  VAL A CA   1  
ATOM 836   C C    . VAL A 1 57 ? 10.948  -0.624  -6.999  1.00 0.00 ? 65  VAL A C    1  
ATOM 837   O O    . VAL A 1 57 ? 9.831   -0.190  -6.721  1.00 0.00 ? 65  VAL A O    1  
ATOM 838   C CB   . VAL A 1 57 ? 12.355  0.754   -5.467  1.00 0.00 ? 65  VAL A CB   1  
ATOM 839   C CG1  . VAL A 1 57 ? 12.666  -0.417  -4.550  1.00 0.00 ? 65  VAL A CG1  1  
ATOM 840   C CG2  . VAL A 1 57 ? 13.445  1.811   -5.383  1.00 0.00 ? 65  VAL A CG2  1  
ATOM 841   H H    . VAL A 1 57 ? 11.945  2.301   -7.481  1.00 0.00 ? 65  VAL A H    1  
ATOM 842   H HA   . VAL A 1 57 ? 13.050  -0.299  -7.196  1.00 0.00 ? 65  VAL A HA   1  
ATOM 843   H HB   . VAL A 1 57 ? 11.426  1.200   -5.140  1.00 0.00 ? 65  VAL A HB   1  
ATOM 844   H HG11 . VAL A 1 57 ? 13.336  -0.094  -3.766  1.00 0.00 ? 65  VAL A HG11 1  
ATOM 845   H HG12 . VAL A 1 57 ? 13.135  -1.207  -5.120  1.00 0.00 ? 65  VAL A HG12 1  
ATOM 846   H HG13 . VAL A 1 57 ? 11.751  -0.785  -4.111  1.00 0.00 ? 65  VAL A HG13 1  
ATOM 847   H HG21 . VAL A 1 57 ? 13.115  2.710   -5.882  1.00 0.00 ? 65  VAL A HG21 1  
ATOM 848   H HG22 . VAL A 1 57 ? 14.342  1.443   -5.860  1.00 0.00 ? 65  VAL A HG22 1  
ATOM 849   H HG23 . VAL A 1 57 ? 13.655  2.032   -4.347  1.00 0.00 ? 65  VAL A HG23 1  
ATOM 850   N N    . ASP A 1 58 ? 11.163  -1.878  -7.381  1.00 0.00 ? 66  ASP A N    1  
ATOM 851   C CA   . ASP A 1 58 ? 10.071  -2.840  -7.498  1.00 0.00 ? 66  ASP A CA   1  
ATOM 852   C C    . ASP A 1 58 ? 9.506   -3.190  -6.126  1.00 0.00 ? 66  ASP A C    1  
ATOM 853   O O    . ASP A 1 58 ? 10.233  -3.643  -5.241  1.00 0.00 ? 66  ASP A O    1  
ATOM 854   C CB   . ASP A 1 58 ? 10.554  -4.109  -8.202  1.00 0.00 ? 66  ASP A CB   1  
ATOM 855   C CG   . ASP A 1 58 ? 10.971  -3.852  -9.638  1.00 0.00 ? 66  ASP A CG   1  
ATOM 856   O OD1  . ASP A 1 58 ? 11.451  -2.736  -9.926  1.00 0.00 ? 66  ASP A OD1  1  
ATOM 857   O OD2  . ASP A 1 58 ? 10.816  -4.768  -10.473 1.00 0.00 ? 66  ASP A OD2  1  
ATOM 858   H H    . ASP A 1 58 ? 12.076  -2.165  -7.590  1.00 0.00 ? 66  ASP A H    1  
ATOM 859   H HA   . ASP A 1 58 ? 9.292   -2.385  -8.090  1.00 0.00 ? 66  ASP A HA   1  
ATOM 860   H HB2  . ASP A 1 58 ? 11.402  -4.509  -7.667  1.00 0.00 ? 66  ASP A HB2  1  
ATOM 861   H HB3  . ASP A 1 58 ? 9.757   -4.838  -8.203  1.00 0.00 ? 66  ASP A HB3  1  
ATOM 862   N N    . PHE A 1 59 ? 8.206   -2.979  -5.955  1.00 0.00 ? 67  PHE A N    1  
ATOM 863   C CA   . PHE A 1 59 ? 7.545   -3.275  -4.690  1.00 0.00 ? 67  PHE A CA   1  
ATOM 864   C C    . PHE A 1 59 ? 6.833   -4.625  -4.742  1.00 0.00 ? 67  PHE A C    1  
ATOM 865   O O    . PHE A 1 59 ? 5.937   -4.893  -3.942  1.00 0.00 ? 67  PHE A O    1  
ATOM 866   C CB   . PHE A 1 59 ? 6.543   -2.170  -4.345  1.00 0.00 ? 67  PHE A CB   1  
ATOM 867   C CG   . PHE A 1 59 ? 7.144   -1.031  -3.572  1.00 0.00 ? 67  PHE A CG   1  
ATOM 868   C CD1  . PHE A 1 59 ? 8.392   -0.531  -3.906  1.00 0.00 ? 67  PHE A CD1  1  
ATOM 869   C CD2  . PHE A 1 59 ? 6.459   -0.460  -2.511  1.00 0.00 ? 67  PHE A CD2  1  
ATOM 870   C CE1  . PHE A 1 59 ? 8.946   0.518   -3.197  1.00 0.00 ? 67  PHE A CE1  1  
ATOM 871   C CE2  . PHE A 1 59 ? 7.009   0.589   -1.797  1.00 0.00 ? 67  PHE A CE2  1  
ATOM 872   C CZ   . PHE A 1 59 ? 8.255   1.078   -2.141  1.00 0.00 ? 67  PHE A CZ   1  
ATOM 873   H H    . PHE A 1 59 ? 7.678   -2.616  -6.697  1.00 0.00 ? 67  PHE A H    1  
ATOM 874   H HA   . PHE A 1 59 ? 8.302   -3.311  -3.920  1.00 0.00 ? 67  PHE A HA   1  
ATOM 875   H HB2  . PHE A 1 59 ? 6.131   -1.769  -5.260  1.00 0.00 ? 67  PHE A HB2  1  
ATOM 876   H HB3  . PHE A 1 59 ? 5.744   -2.591  -3.752  1.00 0.00 ? 67  PHE A HB3  1  
ATOM 877   H HD1  . PHE A 1 59 ? 8.934   -0.968  -4.732  1.00 0.00 ? 67  PHE A HD1  1  
ATOM 878   H HD2  . PHE A 1 59 ? 5.485   -0.840  -2.241  1.00 0.00 ? 67  PHE A HD2  1  
ATOM 879   H HE1  . PHE A 1 59 ? 9.922   0.897   -3.467  1.00 0.00 ? 67  PHE A HE1  1  
ATOM 880   H HE2  . PHE A 1 59 ? 6.465   1.026   -0.973  1.00 0.00 ? 67  PHE A HE2  1  
ATOM 881   H HZ   . PHE A 1 59 ? 8.686   1.897   -1.585  1.00 0.00 ? 67  PHE A HZ   1  
ATOM 882   N N    . SER A 1 60 ? 7.235   -5.470  -5.687  1.00 0.00 ? 68  SER A N    1  
ATOM 883   C CA   . SER A 1 60 ? 6.633   -6.791  -5.834  1.00 0.00 ? 68  SER A CA   1  
ATOM 884   C C    . SER A 1 60 ? 6.840   -7.619  -4.570  1.00 0.00 ? 68  SER A C    1  
ATOM 885   O O    . SER A 1 60 ? 5.935   -8.322  -4.120  1.00 0.00 ? 68  SER A O    1  
ATOM 886   C CB   . SER A 1 60 ? 7.232   -7.518  -7.039  1.00 0.00 ? 68  SER A CB   1  
ATOM 887   O OG   . SER A 1 60 ? 6.241   -8.249  -7.739  1.00 0.00 ? 68  SER A OG   1  
ATOM 888   H H    . SER A 1 60 ? 7.954   -5.204  -6.296  1.00 0.00 ? 68  SER A H    1  
ATOM 889   H HA   . SER A 1 60 ? 5.575   -6.657  -5.995  1.00 0.00 ? 68  SER A HA   1  
ATOM 890   H HB2  . SER A 1 60 ? 7.671   -6.796  -7.711  1.00 0.00 ? 68  SER A HB2  1  
ATOM 891   H HB3  . SER A 1 60 ? 7.997   -8.204  -6.701  1.00 0.00 ? 68  SER A HB3  1  
ATOM 892   H HG   . SER A 1 60 ? 6.374   -9.189  -7.595  1.00 0.00 ? 68  SER A HG   1  
ATOM 893   N N    . ASN A 1 61 ? 8.037   -7.525  -4.001  1.00 0.00 ? 69  ASN A N    1  
ATOM 894   C CA   . ASN A 1 61 ? 8.367   -8.258  -2.786  1.00 0.00 ? 69  ASN A CA   1  
ATOM 895   C C    . ASN A 1 61 ? 9.180   -7.385  -1.834  1.00 0.00 ? 69  ASN A C    1  
ATOM 896   O O    . ASN A 1 61 ? 9.982   -7.887  -1.047  1.00 0.00 ? 69  ASN A O    1  
ATOM 897   C CB   . ASN A 1 61 ? 9.148   -9.529  -3.127  1.00 0.00 ? 69  ASN A CB   1  
ATOM 898   C CG   . ASN A 1 61 ? 10.297  -9.263  -4.082  1.00 0.00 ? 69  ASN A CG   1  
ATOM 899   O OD1  . ASN A 1 61 ? 10.085  -8.960  -5.255  1.00 0.00 ? 69  ASN A OD1  1  
ATOM 900   N ND2  . ASN A 1 61 ? 11.521  -9.378  -3.581  1.00 0.00 ? 69  ASN A ND2  1  
ATOM 901   H H    . ASN A 1 61 ? 8.713   -6.944  -4.407  1.00 0.00 ? 69  ASN A H    1  
ATOM 902   H HA   . ASN A 1 61 ? 7.442   -8.532  -2.302  1.00 0.00 ? 69  ASN A HA   1  
ATOM 903   H HB2  . ASN A 1 61 ? 9.551   -9.952  -2.218  1.00 0.00 ? 69  ASN A HB2  1  
ATOM 904   H HB3  . ASN A 1 61 ? 8.479   -10.242 -3.586  1.00 0.00 ? 69  ASN A HB3  1  
ATOM 905   H HD21 . ASN A 1 61 ? 11.614  -9.624  -2.637  1.00 0.00 ? 69  ASN A HD21 1  
ATOM 906   H HD22 . ASN A 1 61 ? 12.282  -9.213  -4.176  1.00 0.00 ? 69  ASN A HD22 1  
ATOM 907   N N    . LEU A 1 62 ? 8.967   -6.075  -1.914  1.00 0.00 ? 70  LEU A N    1  
ATOM 908   C CA   . LEU A 1 62 ? 9.679   -5.130  -1.061  1.00 0.00 ? 70  LEU A CA   1  
ATOM 909   C C    . LEU A 1 62 ? 9.192   -5.227  0.381   1.00 0.00 ? 70  LEU A C    1  
ATOM 910   O O    . LEU A 1 62 ? 7.999   -5.398  0.634   1.00 0.00 ? 70  LEU A O    1  
ATOM 911   C CB   . LEU A 1 62 ? 9.495   -3.702  -1.581  1.00 0.00 ? 70  LEU A CB   1  
ATOM 912   C CG   . LEU A 1 62 ? 10.190  -2.616  -0.754  1.00 0.00 ? 70  LEU A CG   1  
ATOM 913   C CD1  . LEU A 1 62 ? 11.343  -2.004  -1.533  1.00 0.00 ? 70  LEU A CD1  1  
ATOM 914   C CD2  . LEU A 1 62 ? 9.196   -1.541  -0.336  1.00 0.00 ? 70  LEU A CD2  1  
ATOM 915   H H    . LEU A 1 62 ? 8.316   -5.734  -2.562  1.00 0.00 ? 70  LEU A H    1  
ATOM 916   H HA   . LEU A 1 62 ? 10.728  -5.382  -1.091  1.00 0.00 ? 70  LEU A HA   1  
ATOM 917   H HB2  . LEU A 1 62 ? 9.876   -3.660  -2.592  1.00 0.00 ? 70  LEU A HB2  1  
ATOM 918   H HB3  . LEU A 1 62 ? 8.437   -3.486  -1.604  1.00 0.00 ? 70  LEU A HB3  1  
ATOM 919   H HG   . LEU A 1 62 ? 10.595  -3.064  0.142   1.00 0.00 ? 70  LEU A HG   1  
ATOM 920   H HD11 . LEU A 1 62 ? 12.127  -1.713  -0.848  1.00 0.00 ? 70  LEU A HD11 1  
ATOM 921   H HD12 . LEU A 1 62 ? 10.995  -1.135  -2.071  1.00 0.00 ? 70  LEU A HD12 1  
ATOM 922   H HD13 . LEU A 1 62 ? 11.730  -2.728  -2.234  1.00 0.00 ? 70  LEU A HD13 1  
ATOM 923   H HD21 . LEU A 1 62 ? 8.903   -1.702  0.690   1.00 0.00 ? 70  LEU A HD21 1  
ATOM 924   H HD22 . LEU A 1 62 ? 8.324   -1.591  -0.972  1.00 0.00 ? 70  LEU A HD22 1  
ATOM 925   H HD23 . LEU A 1 62 ? 9.656   -0.569  -0.430  1.00 0.00 ? 70  LEU A HD23 1  
ATOM 926   N N    . ASP A 1 63 ? 10.124  -5.120  1.323   1.00 0.00 ? 71  ASP A N    1  
ATOM 927   C CA   . ASP A 1 63 ? 9.789   -5.197  2.741   1.00 0.00 ? 71  ASP A CA   1  
ATOM 928   C C    . ASP A 1 63 ? 8.903   -4.027  3.157   1.00 0.00 ? 71  ASP A C    1  
ATOM 929   O O    . ASP A 1 63 ? 8.925   -2.965  2.536   1.00 0.00 ? 71  ASP A O    1  
ATOM 930   C CB   . ASP A 1 63 ? 11.064  -5.211  3.586   1.00 0.00 ? 71  ASP A CB   1  
ATOM 931   C CG   . ASP A 1 63 ? 10.948  -6.126  4.791   1.00 0.00 ? 71  ASP A CG   1  
ATOM 932   O OD1  . ASP A 1 63 ? 10.724  -7.338  4.596   1.00 0.00 ? 71  ASP A OD1  1  
ATOM 933   O OD2  . ASP A 1 63 ? 11.082  -5.629  5.928   1.00 0.00 ? 71  ASP A OD2  1  
ATOM 934   H H    . ASP A 1 63 ? 11.058  -4.985  1.060   1.00 0.00 ? 71  ASP A H    1  
ATOM 935   H HA   . ASP A 1 63 ? 9.250   -6.117  2.903   1.00 0.00 ? 71  ASP A HA   1  
ATOM 936   H HB2  . ASP A 1 63 ? 11.888  -5.552  2.977   1.00 0.00 ? 71  ASP A HB2  1  
ATOM 937   H HB3  . ASP A 1 63 ? 11.269  -4.211  3.935   1.00 0.00 ? 71  ASP A HB3  1  
ATOM 938   N N    . HIS A 1 64 ? 8.122   -4.231  4.215   1.00 0.00 ? 72  HIS A N    1  
ATOM 939   C CA   . HIS A 1 64 ? 7.228   -3.195  4.718   1.00 0.00 ? 72  HIS A CA   1  
ATOM 940   C C    . HIS A 1 64 ? 8.005   -1.938  5.094   1.00 0.00 ? 72  HIS A C    1  
ATOM 941   O O    . HIS A 1 64 ? 7.704   -0.842  4.616   1.00 0.00 ? 72  HIS A O    1  
ATOM 942   C CB   . HIS A 1 64 ? 6.453   -3.712  5.933   1.00 0.00 ? 72  HIS A CB   1  
ATOM 943   C CG   . HIS A 1 64 ? 5.258   -2.879  6.281   1.00 0.00 ? 72  HIS A CG   1  
ATOM 944   N ND1  . HIS A 1 64 ? 5.052   -1.611  5.780   1.00 0.00 ? 72  HIS A ND1  1  
ATOM 945   C CD2  . HIS A 1 64 ? 4.202   -3.140  7.085   1.00 0.00 ? 72  HIS A CD2  1  
ATOM 946   C CE1  . HIS A 1 64 ? 3.921   -1.128  6.264   1.00 0.00 ? 72  HIS A CE1  1  
ATOM 947   N NE2  . HIS A 1 64 ? 3.386   -2.036  7.058   1.00 0.00 ? 72  HIS A NE2  1  
ATOM 948   H H    . HIS A 1 64 ? 8.151   -5.099  4.668   1.00 0.00 ? 72  HIS A H    1  
ATOM 949   H HA   . HIS A 1 64 ? 6.528   -2.951  3.932   1.00 0.00 ? 72  HIS A HA   1  
ATOM 950   H HB2  . HIS A 1 64 ? 6.110   -4.716  5.731   1.00 0.00 ? 72  HIS A HB2  1  
ATOM 951   H HB3  . HIS A 1 64 ? 7.110   -3.727  6.788   1.00 0.00 ? 72  HIS A HB3  1  
ATOM 952   H HD1  . HIS A 1 64 ? 5.645   -1.135  5.162   1.00 0.00 ? 72  HIS A HD1  1  
ATOM 953   H HD2  . HIS A 1 64 ? 4.032   -4.050  7.645   1.00 0.00 ? 72  HIS A HD2  1  
ATOM 954   H HE1  . HIS A 1 64 ? 3.506   -0.156  6.046   1.00 0.00 ? 72  HIS A HE1  1  
ATOM 955   H HE2  . HIS A 1 64 ? 2.497   -1.977  7.464   1.00 0.00 ? 72  HIS A HE2  1  
ATOM 956   N N    . LYS A 1 65 ? 9.006   -2.102  5.952   1.00 0.00 ? 73  LYS A N    1  
ATOM 957   C CA   . LYS A 1 65 ? 9.829   -0.981  6.393   1.00 0.00 ? 73  LYS A CA   1  
ATOM 958   C C    . LYS A 1 65 ? 10.473  -0.276  5.203   1.00 0.00 ? 73  LYS A C    1  
ATOM 959   O O    . LYS A 1 65 ? 10.559  0.950   5.168   1.00 0.00 ? 73  LYS A O    1  
ATOM 960   C CB   . LYS A 1 65 ? 10.910  -1.464  7.362   1.00 0.00 ? 73  LYS A CB   1  
ATOM 961   C CG   . LYS A 1 65 ? 10.454  -1.501  8.813   1.00 0.00 ? 73  LYS A CG   1  
ATOM 962   C CD   . LYS A 1 65 ? 11.603  -1.838  9.751   1.00 0.00 ? 73  LYS A CD   1  
ATOM 963   C CE   . LYS A 1 65 ? 11.711  -0.830  10.884  1.00 0.00 ? 73  LYS A CE   1  
ATOM 964   N NZ   . LYS A 1 65 ? 11.890  0.559   10.377  1.00 0.00 ? 73  LYS A NZ   1  
ATOM 965   H H    . LYS A 1 65 ? 9.198   -3.000  6.297   1.00 0.00 ? 73  LYS A H    1  
ATOM 966   H HA   . LYS A 1 65 ? 9.187   -0.282  6.905   1.00 0.00 ? 73  LYS A HA   1  
ATOM 967   H HB2  . LYS A 1 65 ? 11.212  -2.461  7.077   1.00 0.00 ? 73  LYS A HB2  1  
ATOM 968   H HB3  . LYS A 1 65 ? 11.762  -0.805  7.291   1.00 0.00 ? 73  LYS A HB3  1  
ATOM 969   H HG2  . LYS A 1 65 ? 10.057  -0.533  9.078   1.00 0.00 ? 73  LYS A HG2  1  
ATOM 970   H HG3  . LYS A 1 65 ? 9.683   -2.251  8.917   1.00 0.00 ? 73  LYS A HG3  1  
ATOM 971   H HD2  . LYS A 1 65 ? 11.435  -2.817  10.171  1.00 0.00 ? 73  LYS A HD2  1  
ATOM 972   H HD3  . LYS A 1 65 ? 12.526  -1.837  9.191   1.00 0.00 ? 73  LYS A HD3  1  
ATOM 973   H HE2  . LYS A 1 65 ? 10.810  -0.874  11.476  1.00 0.00 ? 73  LYS A HE2  1  
ATOM 974   H HE3  . LYS A 1 65 ? 12.559  -1.091  11.501  1.00 0.00 ? 73  LYS A HE3  1  
ATOM 975   H HZ1  . LYS A 1 65 ? 12.516  0.559   9.547   1.00 0.00 ? 73  LYS A HZ1  1  
ATOM 976   H HZ2  . LYS A 1 65 ? 12.312  1.157   11.115  1.00 0.00 ? 73  LYS A HZ2  1  
ATOM 977   H HZ3  . LYS A 1 65 ? 10.970  0.961   10.105  1.00 0.00 ? 73  LYS A HZ3  1  
ATOM 978   N N    . GLU A 1 66 ? 10.923  -1.061  4.229   1.00 0.00 ? 74  GLU A N    1  
ATOM 979   C CA   . GLU A 1 66 ? 11.556  -0.511  3.037   1.00 0.00 ? 74  GLU A CA   1  
ATOM 980   C C    . GLU A 1 66 ? 10.604  0.423   2.297   1.00 0.00 ? 74  GLU A C    1  
ATOM 981   O O    . GLU A 1 66 ? 11.006  1.479   1.809   1.00 0.00 ? 74  GLU A O    1  
ATOM 982   C CB   . GLU A 1 66 ? 12.011  -1.641  2.109   1.00 0.00 ? 74  GLU A CB   1  
ATOM 983   C CG   . GLU A 1 66 ? 13.498  -1.940  2.197   1.00 0.00 ? 74  GLU A CG   1  
ATOM 984   C CD   . GLU A 1 66 ? 14.327  -1.049  1.293   1.00 0.00 ? 74  GLU A CD   1  
ATOM 985   O OE1  . GLU A 1 66 ? 13.797  -0.598  0.256   1.00 0.00 ? 74  GLU A OE1  1  
ATOM 986   O OE2  . GLU A 1 66 ? 15.506  -0.802  1.622   1.00 0.00 ? 74  GLU A OE2  1  
ATOM 987   H H    . GLU A 1 66 ? 10.824  -2.032  4.313   1.00 0.00 ? 74  GLU A H    1  
ATOM 988   H HA   . GLU A 1 66 ? 12.421  0.053   3.350   1.00 0.00 ? 74  GLU A HA   1  
ATOM 989   H HB2  . GLU A 1 66 ? 11.468  -2.541  2.363   1.00 0.00 ? 74  GLU A HB2  1  
ATOM 990   H HB3  . GLU A 1 66 ? 11.781  -1.371  1.088   1.00 0.00 ? 74  GLU A HB3  1  
ATOM 991   H HG2  . GLU A 1 66 ? 13.822  -1.793  3.217   1.00 0.00 ? 74  GLU A HG2  1  
ATOM 992   H HG3  . GLU A 1 66 ? 13.662  -2.969  1.912   1.00 0.00 ? 74  GLU A HG3  1  
ATOM 993   N N    . ALA A 1 67 ? 9.337   0.025   2.219   1.00 0.00 ? 75  ALA A N    1  
ATOM 994   C CA   . ALA A 1 67 ? 8.324   0.826   1.543   1.00 0.00 ? 75  ALA A CA   1  
ATOM 995   C C    . ALA A 1 67 ? 8.134   2.168   2.240   1.00 0.00 ? 75  ALA A C    1  
ATOM 996   O O    . ALA A 1 67 ? 8.104   3.217   1.598   1.00 0.00 ? 75  ALA A O    1  
ATOM 997   C CB   . ALA A 1 67 ? 7.007   0.071   1.483   1.00 0.00 ? 75  ALA A CB   1  
ATOM 998   H H    . ALA A 1 67 ? 9.076   -0.826  2.628   1.00 0.00 ? 75  ALA A H    1  
ATOM 999   H HA   . ALA A 1 67 ? 8.658   1.002   0.530   1.00 0.00 ? 75  ALA A HA   1  
ATOM 1000  H HB1  . ALA A 1 67 ? 6.266   0.676   0.982   1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1001  H HB2  . ALA A 1 67 ? 6.671   -0.148  2.486   1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1002  H HB3  . ALA A 1 67 ? 7.146   -0.852  0.941   1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1003  N N    . VAL A 1 68 ? 8.006   2.126   3.561   1.00 0.00 ? 76  VAL A N    1  
ATOM 1004  C CA   . VAL A 1 68 ? 7.818   3.339   4.344   1.00 0.00 ? 76  VAL A CA   1  
ATOM 1005  C C    . VAL A 1 68 ? 9.079   4.198   4.337   1.00 0.00 ? 76  VAL A C    1  
ATOM 1006  O O    . VAL A 1 68 ? 9.004   5.425   4.321   1.00 0.00 ? 76  VAL A O    1  
ATOM 1007  C CB   . VAL A 1 68 ? 7.438   3.016   5.802   1.00 0.00 ? 76  VAL A CB   1  
ATOM 1008  C CG1  . VAL A 1 68 ? 7.130   4.291   6.571   1.00 0.00 ? 76  VAL A CG1  1  
ATOM 1009  C CG2  . VAL A 1 68 ? 6.256   2.060   5.846   1.00 0.00 ? 76  VAL A CG2  1  
ATOM 1010  H H    . VAL A 1 68 ? 8.038   1.260   4.019   1.00 0.00 ? 76  VAL A H    1  
ATOM 1011  H HA   . VAL A 1 68 ? 7.009   3.901   3.899   1.00 0.00 ? 76  VAL A HA   1  
ATOM 1012  H HB   . VAL A 1 68 ? 8.282   2.533   6.274   1.00 0.00 ? 76  VAL A HB   1  
ATOM 1013  H HG11 . VAL A 1 68 ? 7.908   5.017   6.390   1.00 0.00 ? 76  VAL A HG11 1  
ATOM 1014  H HG12 . VAL A 1 68 ? 7.081   4.071   7.628   1.00 0.00 ? 76  VAL A HG12 1  
ATOM 1015  H HG13 . VAL A 1 68 ? 6.181   4.690   6.242   1.00 0.00 ? 76  VAL A HG13 1  
ATOM 1016  H HG21 . VAL A 1 68 ? 6.219   1.488   4.930   1.00 0.00 ? 76  VAL A HG21 1  
ATOM 1017  H HG22 . VAL A 1 68 ? 5.341   2.623   5.954   1.00 0.00 ? 76  VAL A HG22 1  
ATOM 1018  H HG23 . VAL A 1 68 ? 6.366   1.390   6.685   1.00 0.00 ? 76  VAL A HG23 1  
ATOM 1019  N N    . ASN A 1 69 ? 10.237  3.545   4.351   1.00 0.00 ? 77  ASN A N    1  
ATOM 1020  C CA   . ASN A 1 69 ? 11.514  4.252   4.352   1.00 0.00 ? 77  ASN A CA   1  
ATOM 1021  C C    . ASN A 1 69 ? 11.687  5.083   3.083   1.00 0.00 ? 77  ASN A C    1  
ATOM 1022  O O    . ASN A 1 69 ? 11.858  6.300   3.148   1.00 0.00 ? 77  ASN A O    1  
ATOM 1023  C CB   . ASN A 1 69 ? 12.670  3.260   4.488   1.00 0.00 ? 77  ASN A CB   1  
ATOM 1024  C CG   . ASN A 1 69 ? 13.754  3.759   5.424   1.00 0.00 ? 77  ASN A CG   1  
ATOM 1025  O OD1  . ASN A 1 69 ? 14.803  4.227   4.983   1.00 0.00 ? 77  ASN A OD1  1  
ATOM 1026  N ND2  . ASN A 1 69 ? 13.505  3.660   6.724   1.00 0.00 ? 77  ASN A ND2  1  
ATOM 1027  H H    . ASN A 1 69 ? 10.234  2.566   4.366   1.00 0.00 ? 77  ASN A H    1  
ATOM 1028  H HA   . ASN A 1 69 ? 11.522  4.917   5.201   1.00 0.00 ? 77  ASN A HA   1  
ATOM 1029  H HB2  . ASN A 1 69 ? 12.292  2.325   4.872   1.00 0.00 ? 77  ASN A HB2  1  
ATOM 1030  H HB3  . ASN A 1 69 ? 13.109  3.092   3.514   1.00 0.00 ? 77  ASN A HB3  1  
ATOM 1031  H HD21 . ASN A 1 69 ? 12.647  3.275   7.003   1.00 0.00 ? 77  ASN A HD21 1  
ATOM 1032  H HD22 . ASN A 1 69 ? 14.188  3.974   7.351   1.00 0.00 ? 77  ASN A HD22 1  
ATOM 1033  N N    . VAL A 1 70 ? 11.646  4.421   1.933   1.00 0.00 ? 78  VAL A N    1  
ATOM 1034  C CA   . VAL A 1 70 ? 11.803  5.106   0.655   1.00 0.00 ? 78  VAL A CA   1  
ATOM 1035  C C    . VAL A 1 70 ? 10.751  6.198   0.481   1.00 0.00 ? 78  VAL A C    1  
ATOM 1036  O O    . VAL A 1 70 ? 11.050  7.287   -0.008  1.00 0.00 ? 78  VAL A O    1  
ATOM 1037  C CB   . VAL A 1 70 ? 11.718  4.122   -0.527  1.00 0.00 ? 78  VAL A CB   1  
ATOM 1038  C CG1  . VAL A 1 70 ? 12.859  3.119   -0.464  1.00 0.00 ? 78  VAL A CG1  1  
ATOM 1039  C CG2  . VAL A 1 70 ? 10.377  3.408   -0.541  1.00 0.00 ? 78  VAL A CG2  1  
ATOM 1040  H H    . VAL A 1 70 ? 11.509  3.450   1.941   1.00 0.00 ? 78  VAL A H    1  
ATOM 1041  H HA   . VAL A 1 70 ? 12.782  5.562   0.644   1.00 0.00 ? 78  VAL A HA   1  
ATOM 1042  H HB   . VAL A 1 70 ? 11.813  4.683   -1.446  1.00 0.00 ? 78  VAL A HB   1  
ATOM 1043  H HG11 . VAL A 1 70 ? 12.738  2.386   -1.249  1.00 0.00 ? 78  VAL A HG11 1  
ATOM 1044  H HG12 . VAL A 1 70 ? 12.849  2.624   0.496   1.00 0.00 ? 78  VAL A HG12 1  
ATOM 1045  H HG13 . VAL A 1 70 ? 13.799  3.635   -0.595  1.00 0.00 ? 78  VAL A HG13 1  
ATOM 1046  H HG21 . VAL A 1 70 ? 9.684   3.955   -1.163  1.00 0.00 ? 78  VAL A HG21 1  
ATOM 1047  H HG22 . VAL A 1 70 ? 9.989   3.350   0.464   1.00 0.00 ? 78  VAL A HG22 1  
ATOM 1048  H HG23 . VAL A 1 70 ? 10.504  2.410   -0.936  1.00 0.00 ? 78  VAL A HG23 1  
ATOM 1049  N N    . LEU A 1 71 ? 9.522   5.902   0.894   1.00 0.00 ? 79  LEU A N    1  
ATOM 1050  C CA   . LEU A 1 71 ? 8.431   6.864   0.790   1.00 0.00 ? 79  LEU A CA   1  
ATOM 1051  C C    . LEU A 1 71 ? 8.667   8.051   1.721   1.00 0.00 ? 79  LEU A C    1  
ATOM 1052  O O    . LEU A 1 71 ? 8.271   9.177   1.419   1.00 0.00 ? 79  LEU A O    1  
ATOM 1053  C CB   . LEU A 1 71 ? 7.096   6.193   1.123   1.00 0.00 ? 79  LEU A CB   1  
ATOM 1054  C CG   . LEU A 1 71 ? 6.317   5.657   -0.083  1.00 0.00 ? 79  LEU A CG   1  
ATOM 1055  C CD1  . LEU A 1 71 ? 5.778   6.802   -0.923  1.00 0.00 ? 79  LEU A CD1  1  
ATOM 1056  C CD2  . LEU A 1 71 ? 7.199   4.745   -0.923  1.00 0.00 ? 79  LEU A CD2  1  
ATOM 1057  H H    . LEU A 1 71 ? 9.346   5.019   1.282   1.00 0.00 ? 79  LEU A H    1  
ATOM 1058  H HA   . LEU A 1 71 ? 8.401   7.221   -0.228  1.00 0.00 ? 79  LEU A HA   1  
ATOM 1059  H HB2  . LEU A 1 71 ? 7.289   5.369   1.795   1.00 0.00 ? 79  LEU A HB2  1  
ATOM 1060  H HB3  . LEU A 1 71 ? 6.472   6.911   1.633   1.00 0.00 ? 79  LEU A HB3  1  
ATOM 1061  H HG   . LEU A 1 71 ? 5.477   5.077   0.270   1.00 0.00 ? 79  LEU A HG   1  
ATOM 1062  H HD11 . LEU A 1 71 ? 5.797   6.523   -1.967  1.00 0.00 ? 79  LEU A HD11 1  
ATOM 1063  H HD12 . LEU A 1 71 ? 6.391   7.679   -0.774  1.00 0.00 ? 79  LEU A HD12 1  
ATOM 1064  H HD13 . LEU A 1 71 ? 4.762   7.019   -0.628  1.00 0.00 ? 79  LEU A HD13 1  
ATOM 1065  H HD21 . LEU A 1 71 ? 6.602   3.944   -1.332  1.00 0.00 ? 79  LEU A HD21 1  
ATOM 1066  H HD22 . LEU A 1 71 ? 7.982   4.334   -0.306  1.00 0.00 ? 79  LEU A HD22 1  
ATOM 1067  H HD23 . LEU A 1 71 ? 7.638   5.314   -1.730  1.00 0.00 ? 79  LEU A HD23 1  
ATOM 1068  N N    . LYS A 1 72 ? 9.318   7.789   2.851   1.00 0.00 ? 80  LYS A N    1  
ATOM 1069  C CA   . LYS A 1 72 ? 9.613   8.835   3.825   1.00 0.00 ? 80  LYS A CA   1  
ATOM 1070  C C    . LYS A 1 72 ? 10.830  9.648   3.397   1.00 0.00 ? 80  LYS A C    1  
ATOM 1071  O O    . LYS A 1 72 ? 10.901  10.853  3.635   1.00 0.00 ? 80  LYS A O    1  
ATOM 1072  C CB   . LYS A 1 72 ? 9.857   8.220   5.207   1.00 0.00 ? 80  LYS A CB   1  
ATOM 1073  C CG   . LYS A 1 72 ? 8.671   8.342   6.150   1.00 0.00 ? 80  LYS A CG   1  
ATOM 1074  C CD   . LYS A 1 72 ? 7.398   7.790   5.527   1.00 0.00 ? 80  LYS A CD   1  
ATOM 1075  C CE   . LYS A 1 72 ? 6.199   7.991   6.440   1.00 0.00 ? 80  LYS A CE   1  
ATOM 1076  N NZ   . LYS A 1 72 ? 5.298   9.069   5.946   1.00 0.00 ? 80  LYS A NZ   1  
ATOM 1077  H H    . LYS A 1 72 ? 9.611   6.871   3.033   1.00 0.00 ? 80  LYS A H    1  
ATOM 1078  H HA   . LYS A 1 72 ? 8.756   9.490   3.878   1.00 0.00 ? 80  LYS A HA   1  
ATOM 1079  H HB2  . LYS A 1 72 ? 10.088  7.173   5.087   1.00 0.00 ? 80  LYS A HB2  1  
ATOM 1080  H HB3  . LYS A 1 72 ? 10.703  8.714   5.663   1.00 0.00 ? 80  LYS A HB3  1  
ATOM 1081  H HG2  . LYS A 1 72 ? 8.885   7.790   7.054   1.00 0.00 ? 80  LYS A HG2  1  
ATOM 1082  H HG3  . LYS A 1 72 ? 8.521   9.383   6.392   1.00 0.00 ? 80  LYS A HG3  1  
ATOM 1083  H HD2  . LYS A 1 72 ? 7.216   8.300   4.592   1.00 0.00 ? 80  LYS A HD2  1  
ATOM 1084  H HD3  . LYS A 1 72 ? 7.527   6.735   5.344   1.00 0.00 ? 80  LYS A HD3  1  
ATOM 1085  H HE2  . LYS A 1 72 ? 5.643   7.066   6.491   1.00 0.00 ? 80  LYS A HE2  1  
ATOM 1086  H HE3  . LYS A 1 72 ? 6.552   8.252   7.427   1.00 0.00 ? 80  LYS A HE3  1  
ATOM 1087  H HZ1  . LYS A 1 72 ? 4.605   9.319   6.681   1.00 0.00 ? 80  LYS A HZ1  1  
ATOM 1088  H HZ2  . LYS A 1 72 ? 4.788   8.748   5.099   1.00 0.00 ? 80  LYS A HZ2  1  
ATOM 1089  H HZ3  . LYS A 1 72 ? 5.853   9.915   5.704   1.00 0.00 ? 80  LYS A HZ3  1  
ATOM 1090  N N    . SER A 1 73 ? 11.788  8.977   2.766   1.00 0.00 ? 81  SER A N    1  
ATOM 1091  C CA   . SER A 1 73 ? 13.007  9.630   2.307   1.00 0.00 ? 81  SER A CA   1  
ATOM 1092  C C    . SER A 1 73 ? 12.696  10.706  1.270   1.00 0.00 ? 81  SER A C    1  
ATOM 1093  O O    . SER A 1 73 ? 13.030  11.876  1.457   1.00 0.00 ? 81  SER A O    1  
ATOM 1094  C CB   . SER A 1 73 ? 13.971  8.601   1.716   1.00 0.00 ? 81  SER A CB   1  
ATOM 1095  O OG   . SER A 1 73 ? 15.314  8.912   2.043   1.00 0.00 ? 81  SER A OG   1  
ATOM 1096  H H    . SER A 1 73 ? 11.674  8.015   2.608   1.00 0.00 ? 81  SER A H    1  
ATOM 1097  H HA   . SER A 1 73 ? 13.474  10.097  3.160   1.00 0.00 ? 81  SER A HA   1  
ATOM 1098  H HB2  . SER A 1 73 ? 13.736  7.623   2.110   1.00 0.00 ? 81  SER A HB2  1  
ATOM 1099  H HB3  . SER A 1 73 ? 13.868  8.590   0.640   1.00 0.00 ? 81  SER A HB3  1  
ATOM 1100  H HG   . SER A 1 73 ? 15.637  8.290   2.698   1.00 0.00 ? 81  SER A HG   1  
ATOM 1101  N N    . SER A 1 74 ? 12.057  10.303  0.177   1.00 0.00 ? 82  SER A N    1  
ATOM 1102  C CA   . SER A 1 74 ? 11.706  11.237  -0.889  1.00 0.00 ? 82  SER A CA   1  
ATOM 1103  C C    . SER A 1 74 ? 10.258  11.696  -0.759  1.00 0.00 ? 82  SER A C    1  
ATOM 1104  O O    . SER A 1 74 ? 9.331   10.887  -0.817  1.00 0.00 ? 82  SER A O    1  
ATOM 1105  C CB   . SER A 1 74 ? 11.928  10.589  -2.256  1.00 0.00 ? 82  SER A CB   1  
ATOM 1106  O OG   . SER A 1 74 ? 13.220  10.890  -2.759  1.00 0.00 ? 82  SER A OG   1  
ATOM 1107  H H    . SER A 1 74 ? 11.816  9.357   0.082   1.00 0.00 ? 82  SER A H    1  
ATOM 1108  H HA   . SER A 1 74 ? 12.352  12.098  -0.799  1.00 0.00 ? 82  SER A HA   1  
ATOM 1109  H HB2  . SER A 1 74 ? 11.833  9.517   -2.165  1.00 0.00 ? 82  SER A HB2  1  
ATOM 1110  H HB3  . SER A 1 74 ? 11.190  10.959  -2.952  1.00 0.00 ? 82  SER A HB3  1  
ATOM 1111  H HG   . SER A 1 74 ? 13.520  10.173  -3.321  1.00 0.00 ? 82  SER A HG   1  
ATOM 1112  N N    . ARG A 1 75 ? 10.068  13.001  -0.588  1.00 0.00 ? 83  ARG A N    1  
ATOM 1113  C CA   . ARG A 1 75 ? 8.732   13.569  -0.456  1.00 0.00 ? 83  ARG A CA   1  
ATOM 1114  C C    . ARG A 1 75 ? 7.958   13.436  -1.763  1.00 0.00 ? 83  ARG A C    1  
ATOM 1115  O O    . ARG A 1 75 ? 6.764   13.140  -1.761  1.00 0.00 ? 83  ARG A O    1  
ATOM 1116  C CB   . ARG A 1 75 ? 8.820   15.040  -0.045  1.00 0.00 ? 83  ARG A CB   1  
ATOM 1117  C CG   . ARG A 1 75 ? 9.596   15.902  -1.026  1.00 0.00 ? 83  ARG A CG   1  
ATOM 1118  C CD   . ARG A 1 75 ? 9.692   17.343  -0.549  1.00 0.00 ? 83  ARG A CD   1  
ATOM 1119  N NE   . ARG A 1 75 ? 10.470  17.460  0.682   1.00 0.00 ? 83  ARG A NE   1  
ATOM 1120  C CZ   . ARG A 1 75 ? 10.417  18.513  1.496   1.00 0.00 ? 83  ARG A CZ   1  
ATOM 1121  N NH1  . ARG A 1 75 ? 9.626   19.540  1.211   1.00 0.00 ? 83  ARG A NH1  1  
ATOM 1122  N NH2  . ARG A 1 75 ? 11.157  18.539  2.595   1.00 0.00 ? 83  ARG A NH2  1  
ATOM 1123  H H    . ARG A 1 75 ? 10.847  13.597  -0.553  1.00 0.00 ? 83  ARG A H    1  
ATOM 1124  H HA   . ARG A 1 75 ? 8.214   13.019  0.315   1.00 0.00 ? 83  ARG A HA   1  
ATOM 1125  H HB2  . ARG A 1 75 ? 7.819   15.439  0.037   1.00 0.00 ? 83  ARG A HB2  1  
ATOM 1126  H HB3  . ARG A 1 75 ? 9.304   15.105  0.918   1.00 0.00 ? 83  ARG A HB3  1  
ATOM 1127  H HG2  . ARG A 1 75 ? 10.594  15.501  -1.131  1.00 0.00 ? 83  ARG A HG2  1  
ATOM 1128  H HG3  . ARG A 1 75 ? 9.096   15.881  -1.983  1.00 0.00 ? 83  ARG A HG3  1  
ATOM 1129  H HD2  . ARG A 1 75 ? 10.165  17.932  -1.320  1.00 0.00 ? 83  ARG A HD2  1  
ATOM 1130  H HD3  . ARG A 1 75 ? 8.695   17.715  -0.370  1.00 0.00 ? 83  ARG A HD3  1  
ATOM 1131  H HE   . ARG A 1 75 ? 11.063  16.716  0.916   1.00 0.00 ? 83  ARG A HE   1  
ATOM 1132  H HH11 . ARG A 1 75 ? 9.064   19.528  0.384   1.00 0.00 ? 83  ARG A HH11 1  
ATOM 1133  H HH12 . ARG A 1 75 ? 9.590   20.328  1.828   1.00 0.00 ? 83  ARG A HH12 1  
ATOM 1134  H HH21 . ARG A 1 75 ? 11.755  17.767  2.813   1.00 0.00 ? 83  ARG A HH21 1  
ATOM 1135  H HH22 . ARG A 1 75 ? 11.118  19.329  3.206   1.00 0.00 ? 83  ARG A HH22 1  
ATOM 1136  N N    . SER A 1 76 ? 8.650   13.651  -2.877  1.00 0.00 ? 84  SER A N    1  
ATOM 1137  C CA   . SER A 1 76 ? 8.033   13.550  -4.195  1.00 0.00 ? 84  SER A CA   1  
ATOM 1138  C C    . SER A 1 76 ? 8.617   12.373  -4.971  1.00 0.00 ? 84  SER A C    1  
ATOM 1139  O O    . SER A 1 76 ? 9.761   12.424  -5.423  1.00 0.00 ? 84  SER A O    1  
ATOM 1140  C CB   . SER A 1 76 ? 8.237   14.847  -4.979  1.00 0.00 ? 84  SER A CB   1  
ATOM 1141  O OG   . SER A 1 76 ? 9.501   15.421  -4.697  1.00 0.00 ? 84  SER A OG   1  
ATOM 1142  H H    . SER A 1 76 ? 9.601   13.880  -2.812  1.00 0.00 ? 84  SER A H    1  
ATOM 1143  H HA   . SER A 1 76 ? 6.975   13.385  -4.053  1.00 0.00 ? 84  SER A HA   1  
ATOM 1144  H HB2  . SER A 1 76 ? 8.179   14.639  -6.037  1.00 0.00 ? 84  SER A HB2  1  
ATOM 1145  H HB3  . SER A 1 76 ? 7.466   15.554  -4.708  1.00 0.00 ? 84  SER A HB3  1  
ATOM 1146  H HG   . SER A 1 76 ? 10.181  14.746  -4.757  1.00 0.00 ? 84  SER A HG   1  
ATOM 1147  N N    . LEU A 1 77 ? 7.829   11.313  -5.114  1.00 0.00 ? 85  LEU A N    1  
ATOM 1148  C CA   . LEU A 1 77 ? 8.276   10.122  -5.831  1.00 0.00 ? 85  LEU A CA   1  
ATOM 1149  C C    . LEU A 1 77 ? 7.132   9.482   -6.609  1.00 0.00 ? 85  LEU A C    1  
ATOM 1150  O O    . LEU A 1 77 ? 5.980   9.502   -6.173  1.00 0.00 ? 85  LEU A O    1  
ATOM 1151  C CB   . LEU A 1 77 ? 8.878   9.097   -4.856  1.00 0.00 ? 85  LEU A CB   1  
ATOM 1152  C CG   . LEU A 1 77 ? 8.733   9.434   -3.369  1.00 0.00 ? 85  LEU A CG   1  
ATOM 1153  C CD1  . LEU A 1 77 ? 7.264   9.472   -2.973  1.00 0.00 ? 85  LEU A CD1  1  
ATOM 1154  C CD2  . LEU A 1 77 ? 9.492   8.426   -2.518  1.00 0.00 ? 85  LEU A CD2  1  
ATOM 1155  H H    . LEU A 1 77 ? 6.929   11.328  -4.727  1.00 0.00 ? 85  LEU A H    1  
ATOM 1156  H HA   . LEU A 1 77 ? 9.041   10.427  -6.529  1.00 0.00 ? 85  LEU A HA   1  
ATOM 1157  H HB2  . LEU A 1 77 ? 8.404   8.142   -5.034  1.00 0.00 ? 85  LEU A HB2  1  
ATOM 1158  H HB3  . LEU A 1 77 ? 9.932   9.001   -5.076  1.00 0.00 ? 85  LEU A HB3  1  
ATOM 1159  H HG   . LEU A 1 77 ? 9.153   10.412  -3.186  1.00 0.00 ? 85  LEU A HG   1  
ATOM 1160  H HD11 . LEU A 1 77 ? 7.087   10.322  -2.329  1.00 0.00 ? 85  LEU A HD11 1  
ATOM 1161  H HD12 . LEU A 1 77 ? 7.009   8.565   -2.445  1.00 0.00 ? 85  LEU A HD12 1  
ATOM 1162  H HD13 . LEU A 1 77 ? 6.653   9.558   -3.858  1.00 0.00 ? 85  LEU A HD13 1  
ATOM 1163  H HD21 . LEU A 1 77 ? 8.800   7.694   -2.125  1.00 0.00 ? 85  LEU A HD21 1  
ATOM 1164  H HD22 . LEU A 1 77 ? 9.978   8.938   -1.701  1.00 0.00 ? 85  LEU A HD22 1  
ATOM 1165  H HD23 . LEU A 1 77 ? 10.235  7.930   -3.125  1.00 0.00 ? 85  LEU A HD23 1  
ATOM 1166  N N    . THR A 1 78 ? 7.462   8.902   -7.760  1.00 0.00 ? 86  THR A N    1  
ATOM 1167  C CA   . THR A 1 78 ? 6.468   8.241   -8.596  1.00 0.00 ? 86  THR A CA   1  
ATOM 1168  C C    . THR A 1 78 ? 6.265   6.804   -8.130  1.00 0.00 ? 86  THR A C    1  
ATOM 1169  O O    . THR A 1 78 ? 7.214   6.025   -8.063  1.00 0.00 ? 86  THR A O    1  
ATOM 1170  C CB   . THR A 1 78 ? 6.905   8.261   -10.062 1.00 0.00 ? 86  THR A CB   1  
ATOM 1171  O OG1  . THR A 1 78 ? 7.214   9.578   -10.477 1.00 0.00 ? 86  THR A OG1  1  
ATOM 1172  C CG2  . THR A 1 78 ? 5.853   7.716   -11.006 1.00 0.00 ? 86  THR A CG2  1  
ATOM 1173  H H    . THR A 1 78 ? 8.398   8.914   -8.048  1.00 0.00 ? 86  THR A H    1  
ATOM 1174  H HA   . THR A 1 78 ? 5.537   8.778   -8.496  1.00 0.00 ? 86  THR A HA   1  
ATOM 1175  H HB   . THR A 1 78 ? 7.793   7.653   -10.171 1.00 0.00 ? 86  THR A HB   1  
ATOM 1176  H HG1  . THR A 1 78 ? 6.537   10.181  -10.163 1.00 0.00 ? 86  THR A HG1  1  
ATOM 1177  H HG21 . THR A 1 78 ? 6.015   6.658   -11.153 1.00 0.00 ? 86  THR A HG21 1  
ATOM 1178  H HG22 . THR A 1 78 ? 5.925   8.225   -11.956 1.00 0.00 ? 86  THR A HG22 1  
ATOM 1179  H HG23 . THR A 1 78 ? 4.873   7.875   -10.583 1.00 0.00 ? 86  THR A HG23 1  
ATOM 1180  N N    . ILE A 1 79 ? 5.025   6.463   -7.800  1.00 0.00 ? 87  ILE A N    1  
ATOM 1181  C CA   . ILE A 1 79 ? 4.708   5.120   -7.326  1.00 0.00 ? 87  ILE A CA   1  
ATOM 1182  C C    . ILE A 1 79 ? 3.728   4.414   -8.258  1.00 0.00 ? 87  ILE A C    1  
ATOM 1183  O O    . ILE A 1 79 ? 2.656   4.938   -8.561  1.00 0.00 ? 87  ILE A O    1  
ATOM 1184  C CB   . ILE A 1 79 ? 4.114   5.156   -5.905  1.00 0.00 ? 87  ILE A CB   1  
ATOM 1185  C CG1  . ILE A 1 79 ? 3.013   6.217   -5.814  1.00 0.00 ? 87  ILE A CG1  1  
ATOM 1186  C CG2  . ILE A 1 79 ? 5.209   5.429   -4.884  1.00 0.00 ? 87  ILE A CG2  1  
ATOM 1187  C CD1  . ILE A 1 79 ? 2.454   6.398   -4.420  1.00 0.00 ? 87  ILE A CD1  1  
ATOM 1188  H H    . ILE A 1 79 ? 4.310   7.129   -7.865  1.00 0.00 ? 87  ILE A H    1  
ATOM 1189  H HA   . ILE A 1 79 ? 5.626   4.554   -7.292  1.00 0.00 ? 87  ILE A HA   1  
ATOM 1190  H HB   . ILE A 1 79 ? 3.689   4.187   -5.690  1.00 0.00 ? 87  ILE A HB   1  
ATOM 1191  H HG12 . ILE A 1 79 ? 3.412   7.169   -6.134  1.00 0.00 ? 87  ILE A HG12 1  
ATOM 1192  H HG13 . ILE A 1 79 ? 2.199   5.937   -6.465  1.00 0.00 ? 87  ILE A HG13 1  
ATOM 1193  H HG21 . ILE A 1 79 ? 5.250   6.486   -4.673  1.00 0.00 ? 87  ILE A HG21 1  
ATOM 1194  H HG22 . ILE A 1 79 ? 6.159   5.104   -5.280  1.00 0.00 ? 87  ILE A HG22 1  
ATOM 1195  H HG23 . ILE A 1 79 ? 4.995   4.889   -3.973  1.00 0.00 ? 87  ILE A HG23 1  
ATOM 1196  H HD11 . ILE A 1 79 ? 1.968   5.486   -4.105  1.00 0.00 ? 87  ILE A HD11 1  
ATOM 1197  H HD12 . ILE A 1 79 ? 1.736   7.205   -4.422  1.00 0.00 ? 87  ILE A HD12 1  
ATOM 1198  H HD13 . ILE A 1 79 ? 3.257   6.633   -3.737  1.00 0.00 ? 87  ILE A HD13 1  
ATOM 1199  N N    . SER A 1 80 ? 4.102   3.219   -8.701  1.00 0.00 ? 88  SER A N    1  
ATOM 1200  C CA   . SER A 1 80 ? 3.258   2.432   -9.590  1.00 0.00 ? 88  SER A CA   1  
ATOM 1201  C C    . SER A 1 80 ? 2.426   1.435   -8.791  1.00 0.00 ? 88  SER A C    1  
ATOM 1202  O O    . SER A 1 80 ? 2.960   0.494   -8.204  1.00 0.00 ? 88  SER A O    1  
ATOM 1203  C CB   . SER A 1 80 ? 4.110   1.694   -10.625 1.00 0.00 ? 88  SER A CB   1  
ATOM 1204  O OG   . SER A 1 80 ? 5.194   2.496   -11.059 1.00 0.00 ? 88  SER A OG   1  
ATOM 1205  H H    . SER A 1 80 ? 4.967   2.854   -8.417  1.00 0.00 ? 88  SER A H    1  
ATOM 1206  H HA   . SER A 1 80 ? 2.591   3.111   -10.101 1.00 0.00 ? 88  SER A HA   1  
ATOM 1207  H HB2  . SER A 1 80 ? 4.501   0.789   -10.185 1.00 0.00 ? 88  SER A HB2  1  
ATOM 1208  H HB3  . SER A 1 80 ? 3.498   1.444   -11.479 1.00 0.00 ? 88  SER A HB3  1  
ATOM 1209  H HG   . SER A 1 80 ? 5.705   2.015   -11.714 1.00 0.00 ? 88  SER A HG   1  
ATOM 1210  N N    . ILE A 1 81 ? 1.116   1.651   -8.770  1.00 0.00 ? 89  ILE A N    1  
ATOM 1211  C CA   . ILE A 1 81 ? 0.210   0.776   -8.037  1.00 0.00 ? 89  ILE A CA   1  
ATOM 1212  C C    . ILE A 1 81 ? -0.698  0.006   -8.990  1.00 0.00 ? 89  ILE A C    1  
ATOM 1213  O O    . ILE A 1 81 ? -1.038  0.492   -10.066 1.00 0.00 ? 89  ILE A O    1  
ATOM 1214  C CB   . ILE A 1 81 ? -0.654  1.582   -7.043  1.00 0.00 ? 89  ILE A CB   1  
ATOM 1215  C CG1  . ILE A 1 81 ? -1.618  0.660   -6.286  1.00 0.00 ? 89  ILE A CG1  1  
ATOM 1216  C CG2  . ILE A 1 81 ? -1.409  2.688   -7.768  1.00 0.00 ? 89  ILE A CG2  1  
ATOM 1217  C CD1  . ILE A 1 81 ? -2.937  0.420   -6.996  1.00 0.00 ? 89  ILE A CD1  1  
ATOM 1218  H H    . ILE A 1 81 ? 0.750   2.420   -9.255  1.00 0.00 ? 89  ILE A H    1  
ATOM 1219  H HA   . ILE A 1 81 ? 0.806   0.071   -7.475  1.00 0.00 ? 89  ILE A HA   1  
ATOM 1220  H HB   . ILE A 1 81 ? 0.012   2.049   -6.330  1.00 0.00 ? 89  ILE A HB   1  
ATOM 1221  H HG12 . ILE A 1 81 ? -1.147  -0.298  -6.143  1.00 0.00 ? 89  ILE A HG12 1  
ATOM 1222  H HG13 . ILE A 1 81 ? -1.834  1.096   -5.322  1.00 0.00 ? 89  ILE A HG13 1  
ATOM 1223  H HG21 . ILE A 1 81 ? -0.722  3.480   -8.030  1.00 0.00 ? 89  ILE A HG21 1  
ATOM 1224  H HG22 . ILE A 1 81 ? -2.182  3.079   -7.122  1.00 0.00 ? 89  ILE A HG22 1  
ATOM 1225  H HG23 . ILE A 1 81 ? -1.857  2.289   -8.666  1.00 0.00 ? 89  ILE A HG23 1  
ATOM 1226  H HD11 . ILE A 1 81 ? -3.206  -0.623  -6.914  1.00 0.00 ? 89  ILE A HD11 1  
ATOM 1227  H HD12 . ILE A 1 81 ? -2.842  0.687   -8.038  1.00 0.00 ? 89  ILE A HD12 1  
ATOM 1228  H HD13 . ILE A 1 81 ? -3.705  1.026   -6.539  1.00 0.00 ? 89  ILE A HD13 1  
ATOM 1229  N N    . VAL A 1 82 ? -1.089  -1.198  -8.589  1.00 0.00 ? 90  VAL A N    1  
ATOM 1230  C CA   . VAL A 1 82 ? -1.957  -2.029  -9.411  1.00 0.00 ? 90  VAL A CA   1  
ATOM 1231  C C    . VAL A 1 82 ? -3.235  -2.389  -8.660  1.00 0.00 ? 90  VAL A C    1  
ATOM 1232  O O    . VAL A 1 82 ? -3.197  -3.081  -7.642  1.00 0.00 ? 90  VAL A O    1  
ATOM 1233  C CB   . VAL A 1 82 ? -1.245  -3.321  -9.853  1.00 0.00 ? 90  VAL A CB   1  
ATOM 1234  C CG1  . VAL A 1 82 ? -2.111  -4.104  -10.828 1.00 0.00 ? 90  VAL A CG1  1  
ATOM 1235  C CG2  . VAL A 1 82 ? 0.111   -3.001  -10.466 1.00 0.00 ? 90  VAL A CG2  1  
ATOM 1236  H H    . VAL A 1 82 ? -0.786  -1.534  -7.719  1.00 0.00 ? 90  VAL A H    1  
ATOM 1237  H HA   . VAL A 1 82 ? -2.219  -1.466  -10.295 1.00 0.00 ? 90  VAL A HA   1  
ATOM 1238  H HB   . VAL A 1 82 ? -1.084  -3.932  -8.979  1.00 0.00 ? 90  VAL A HB   1  
ATOM 1239  H HG11 . VAL A 1 82 ? -2.160  -3.577  -11.770 1.00 0.00 ? 90  VAL A HG11 1  
ATOM 1240  H HG12 . VAL A 1 82 ? -3.105  -4.210  -10.424 1.00 0.00 ? 90  VAL A HG12 1  
ATOM 1241  H HG13 . VAL A 1 82 ? -1.680  -5.082  -10.985 1.00 0.00 ? 90  VAL A HG13 1  
ATOM 1242  H HG21 . VAL A 1 82 ? 0.369   -1.973  -10.254 1.00 0.00 ? 90  VAL A HG21 1  
ATOM 1243  H HG22 . VAL A 1 82 ? 0.066   -3.145  -11.537 1.00 0.00 ? 90  VAL A HG22 1  
ATOM 1244  H HG23 . VAL A 1 82 ? 0.859   -3.656  -10.046 1.00 0.00 ? 90  VAL A HG23 1  
ATOM 1245  N N    . ALA A 1 83 ? -4.364  -1.910  -9.168  1.00 0.00 ? 91  ALA A N    1  
ATOM 1246  C CA   . ALA A 1 83 ? -5.657  -2.168  -8.546  1.00 0.00 ? 91  ALA A CA   1  
ATOM 1247  C C    . ALA A 1 83 ? -5.923  -3.665  -8.407  1.00 0.00 ? 91  ALA A C    1  
ATOM 1248  O O    . ALA A 1 83 ? -5.651  -4.442  -9.323  1.00 0.00 ? 91  ALA A O    1  
ATOM 1249  C CB   . ALA A 1 83 ? -6.769  -1.511  -9.350  1.00 0.00 ? 91  ALA A CB   1  
ATOM 1250  H H    . ALA A 1 83 ? -4.328  -1.361  -9.978  1.00 0.00 ? 91  ALA A H    1  
ATOM 1251  H HA   . ALA A 1 83 ? -5.648  -1.722  -7.563  1.00 0.00 ? 91  ALA A HA   1  
ATOM 1252  H HB1  . ALA A 1 83 ? -7.670  -2.100  -9.268  1.00 0.00 ? 91  ALA A HB1  1  
ATOM 1253  H HB2  . ALA A 1 83 ? -6.473  -1.446  -10.387 1.00 0.00 ? 91  ALA A HB2  1  
ATOM 1254  H HB3  . ALA A 1 83 ? -6.952  -0.519  -8.965  1.00 0.00 ? 91  ALA A HB3  1  
ATOM 1255  N N    . ALA A 1 84 ? -6.462  -4.058  -7.251  1.00 0.00 ? 92  ALA A N    1  
ATOM 1256  C CA   . ALA A 1 84 ? -6.783  -5.458  -6.969  1.00 0.00 ? 92  ALA A CA   1  
ATOM 1257  C C    . ALA A 1 84 ? -5.566  -6.241  -6.475  1.00 0.00 ? 92  ALA A C    1  
ATOM 1258  O O    . ALA A 1 84 ? -5.711  -7.316  -5.891  1.00 0.00 ? 92  ALA A O    1  
ATOM 1259  C CB   . ALA A 1 84 ? -7.384  -6.134  -8.193  1.00 0.00 ? 92  ALA A CB   1  
ATOM 1260  H H    . ALA A 1 84 ? -6.655  -3.383  -6.568  1.00 0.00 ? 92  ALA A H    1  
ATOM 1261  H HA   . ALA A 1 84 ? -7.531  -5.467  -6.189  1.00 0.00 ? 92  ALA A HA   1  
ATOM 1262  H HB1  . ALA A 1 84 ? -8.009  -6.956  -7.880  1.00 0.00 ? 92  ALA A HB1  1  
ATOM 1263  H HB2  . ALA A 1 84 ? -6.593  -6.504  -8.826  1.00 0.00 ? 92  ALA A HB2  1  
ATOM 1264  H HB3  . ALA A 1 84 ? -7.980  -5.418  -8.742  1.00 0.00 ? 92  ALA A HB3  1  
ATOM 1265  N N    . ALA A 1 85 ? -4.369  -5.707  -6.701  1.00 0.00 ? 93  ALA A N    1  
ATOM 1266  C CA   . ALA A 1 85 ? -3.145  -6.370  -6.263  1.00 0.00 ? 93  ALA A CA   1  
ATOM 1267  C C    . ALA A 1 85 ? -3.160  -6.605  -4.754  1.00 0.00 ? 93  ALA A C    1  
ATOM 1268  O O    . ALA A 1 85 ? -2.453  -7.474  -4.244  1.00 0.00 ? 93  ALA A O    1  
ATOM 1269  C CB   . ALA A 1 85 ? -1.930  -5.545  -6.662  1.00 0.00 ? 93  ALA A CB   1  
ATOM 1270  H H    . ALA A 1 85 ? -4.305  -4.847  -7.165  1.00 0.00 ? 93  ALA A H    1  
ATOM 1271  H HA   . ALA A 1 85 ? -3.086  -7.324  -6.767  1.00 0.00 ? 93  ALA A HA   1  
ATOM 1272  H HB1  . ALA A 1 85 ? -1.812  -5.575  -7.735  1.00 0.00 ? 93  ALA A HB1  1  
ATOM 1273  H HB2  . ALA A 1 85 ? -1.048  -5.955  -6.191  1.00 0.00 ? 93  ALA A HB2  1  
ATOM 1274  H HB3  . ALA A 1 85 ? -2.068  -4.524  -6.342  1.00 0.00 ? 93  ALA A HB3  1  
ATOM 1275  N N    . GLY A 1 86 ? -3.968  -5.821  -4.050  1.00 0.00 ? 94  GLY A N    1  
ATOM 1276  C CA   . GLY A 1 86 ? -4.069  -5.946  -2.607  1.00 0.00 ? 94  GLY A CA   1  
ATOM 1277  C C    . GLY A 1 86 ? -5.459  -6.350  -2.154  1.00 0.00 ? 94  GLY A C    1  
ATOM 1278  O O    . GLY A 1 86 ? -5.616  -7.011  -1.128  1.00 0.00 ? 94  GLY A O    1  
ATOM 1279  H H    . GLY A 1 86 ? -4.504  -5.143  -4.514  1.00 0.00 ? 94  GLY A H    1  
ATOM 1280  H HA2  . GLY A 1 86 ? -3.363  -6.691  -2.274  1.00 0.00 ? 94  GLY A HA2  1  
ATOM 1281  H HA3  . GLY A 1 86 ? -3.814  -5.001  -2.153  1.00 0.00 ? 94  GLY A HA3  1  
ATOM 1282  N N    . ARG A 1 87 ? -6.470  -5.938  -2.915  1.00 0.00 ? 95  ARG A N    1  
ATOM 1283  C CA   . ARG A 1 87 ? -7.857  -6.247  -2.579  1.00 0.00 ? 95  ARG A CA   1  
ATOM 1284  C C    . ARG A 1 87 ? -8.064  -7.750  -2.440  1.00 0.00 ? 95  ARG A C    1  
ATOM 1285  O O    . ARG A 1 87 ? -8.850  -8.201  -1.607  1.00 0.00 ? 95  ARG A O    1  
ATOM 1286  C CB   . ARG A 1 87 ? -8.796  -5.694  -3.653  1.00 0.00 ? 95  ARG A CB   1  
ATOM 1287  C CG   . ARG A 1 87 ? -8.704  -4.187  -3.827  1.00 0.00 ? 95  ARG A CG   1  
ATOM 1288  C CD   . ARG A 1 87 ? -9.386  -3.730  -5.107  1.00 0.00 ? 95  ARG A CD   1  
ATOM 1289  N NE   . ARG A 1 87 ? -10.826 -3.559  -4.929  1.00 0.00 ? 95  ARG A NE   1  
ATOM 1290  C CZ   . ARG A 1 87 ? -11.656 -3.206  -5.907  1.00 0.00 ? 95  ARG A CZ   1  
ATOM 1291  N NH1  . ARG A 1 87 ? -11.194 -2.984  -7.131  1.00 0.00 ? 95  ARG A NH1  1  
ATOM 1292  N NH2  . ARG A 1 87 ? -12.953 -3.074  -5.660  1.00 0.00 ? 95  ARG A NH2  1  
ATOM 1293  H H    . ARG A 1 87 ? -6.280  -5.406  -3.715  1.00 0.00 ? 95  ARG A H    1  
ATOM 1294  H HA   . ARG A 1 87 ? -8.084  -5.773  -1.636  1.00 0.00 ? 95  ARG A HA   1  
ATOM 1295  H HB2  . ARG A 1 87 ? -8.556  -6.159  -4.598  1.00 0.00 ? 95  ARG A HB2  1  
ATOM 1296  H HB3  . ARG A 1 87 ? -9.813  -5.943  -3.390  1.00 0.00 ? 95  ARG A HB3  1  
ATOM 1297  H HG2  . ARG A 1 87 ? -9.182  -3.708  -2.987  1.00 0.00 ? 95  ARG A HG2  1  
ATOM 1298  H HG3  . ARG A 1 87 ? -7.662  -3.902  -3.863  1.00 0.00 ? 95  ARG A HG3  1  
ATOM 1299  H HD2  . ARG A 1 87 ? -8.958  -2.787  -5.411  1.00 0.00 ? 95  ARG A HD2  1  
ATOM 1300  H HD3  . ARG A 1 87 ? -9.213  -4.468  -5.876  1.00 0.00 ? 95  ARG A HD3  1  
ATOM 1301  H HE   . ARG A 1 87 ? -11.194 -3.717  -4.034  1.00 0.00 ? 95  ARG A HE   1  
ATOM 1302  H HH11 . ARG A 1 87 ? -10.219 -3.082  -7.325  1.00 0.00 ? 95  ARG A HH11 1  
ATOM 1303  H HH12 . ARG A 1 87 ? -11.824 -2.719  -7.863  1.00 0.00 ? 95  ARG A HH12 1  
ATOM 1304  H HH21 . ARG A 1 87 ? -13.307 -3.241  -4.739  1.00 0.00 ? 95  ARG A HH21 1  
ATOM 1305  H HH22 . ARG A 1 87 ? -13.578 -2.810  -6.396  1.00 0.00 ? 95  ARG A HH22 1  
ATOM 1306  N N    . GLU A 1 88 ? -7.349  -8.524  -3.249  1.00 0.00 ? 96  GLU A N    1  
ATOM 1307  C CA   . GLU A 1 88 ? -7.455  -9.977  -3.196  1.00 0.00 ? 96  GLU A CA   1  
ATOM 1308  C C    . GLU A 1 88 ? -7.141  -10.478 -1.789  1.00 0.00 ? 96  GLU A C    1  
ATOM 1309  O O    . GLU A 1 88 ? -7.820  -11.362 -1.265  1.00 0.00 ? 96  GLU A O    1  
ATOM 1310  C CB   . GLU A 1 88 ? -6.503  -10.618 -4.207  1.00 0.00 ? 96  GLU A CB   1  
ATOM 1311  C CG   . GLU A 1 88 ? -6.867  -12.050 -4.564  1.00 0.00 ? 96  GLU A CG   1  
ATOM 1312  C CD   . GLU A 1 88 ? -7.519  -12.164 -5.929  1.00 0.00 ? 96  GLU A CD   1  
ATOM 1313  O OE1  . GLU A 1 88 ? -8.177  -11.191 -6.354  1.00 0.00 ? 96  GLU A OE1  1  
ATOM 1314  O OE2  . GLU A 1 88 ? -7.372  -13.224 -6.570  1.00 0.00 ? 96  GLU A OE2  1  
ATOM 1315  H H    . GLU A 1 88 ? -6.731  -8.111  -3.888  1.00 0.00 ? 96  GLU A H    1  
ATOM 1316  H HA   . GLU A 1 88 ? -8.470  -10.247 -3.445  1.00 0.00 ? 96  GLU A HA   1  
ATOM 1317  H HB2  . GLU A 1 88 ? -6.511  -10.031 -5.114  1.00 0.00 ? 96  GLU A HB2  1  
ATOM 1318  H HB3  . GLU A 1 88 ? -5.504  -10.617 -3.795  1.00 0.00 ? 96  GLU A HB3  1  
ATOM 1319  H HG2  . GLU A 1 88 ? -5.969  -12.649 -4.560  1.00 0.00 ? 96  GLU A HG2  1  
ATOM 1320  H HG3  . GLU A 1 88 ? -7.553  -12.429 -3.821  1.00 0.00 ? 96  GLU A HG3  1  
ATOM 1321  N N    . LEU A 1 89 ? -6.111  -9.896  -1.182  1.00 0.00 ? 97  LEU A N    1  
ATOM 1322  C CA   . LEU A 1 89 ? -5.702  -10.266 0.169   1.00 0.00 ? 97  LEU A CA   1  
ATOM 1323  C C    . LEU A 1 89 ? -6.716  -9.776  1.197   1.00 0.00 ? 97  LEU A C    1  
ATOM 1324  O O    . LEU A 1 89 ? -7.144  -10.530 2.073   1.00 0.00 ? 97  LEU A O    1  
ATOM 1325  C CB   . LEU A 1 89 ? -4.322  -9.685  0.483   1.00 0.00 ? 97  LEU A CB   1  
ATOM 1326  C CG   . LEU A 1 89 ? -3.149  -10.386 -0.205  1.00 0.00 ? 97  LEU A CG   1  
ATOM 1327  C CD1  . LEU A 1 89 ? -2.972  -11.792 0.344   1.00 0.00 ? 97  LEU A CD1  1  
ATOM 1328  C CD2  . LEU A 1 89 ? -3.357  -10.421 -1.711  1.00 0.00 ? 97  LEU A CD2  1  
ATOM 1329  H H    . LEU A 1 89 ? -5.617  -9.194  -1.653  1.00 0.00 ? 97  LEU A H    1  
ATOM 1330  H HA   . LEU A 1 89 ? -5.649  -11.344 0.216   1.00 0.00 ? 97  LEU A HA   1  
ATOM 1331  H HB2  . LEU A 1 89 ? -4.318  -8.646  0.185   1.00 0.00 ? 97  LEU A HB2  1  
ATOM 1332  H HB3  . LEU A 1 89 ? -4.168  -9.737  1.549   1.00 0.00 ? 97  LEU A HB3  1  
ATOM 1333  H HG   . LEU A 1 89 ? -2.243  -9.832  -0.005  1.00 0.00 ? 97  LEU A HG   1  
ATOM 1334  H HD11 . LEU A 1 89 ? -3.296  -11.821 1.374   1.00 0.00 ? 97  LEU A HD11 1  
ATOM 1335  H HD12 . LEU A 1 89 ? -1.931  -12.074 0.286   1.00 0.00 ? 97  LEU A HD12 1  
ATOM 1336  H HD13 . LEU A 1 89 ? -3.565  -12.484 -0.239  1.00 0.00 ? 97  LEU A HD13 1  
ATOM 1337  H HD21 . LEU A 1 89 ? -2.476  -10.826 -2.186  1.00 0.00 ? 97  LEU A HD21 1  
ATOM 1338  H HD22 . LEU A 1 89 ? -3.534  -9.420  -2.073  1.00 0.00 ? 97  LEU A HD22 1  
ATOM 1339  H HD23 . LEU A 1 89 ? -4.209  -11.044 -1.942  1.00 0.00 ? 97  LEU A HD23 1  
ATOM 1340  N N    . PHE A 1 90 ? -7.095  -8.503  1.088   1.00 0.00 ? 98  PHE A N    1  
ATOM 1341  C CA   . PHE A 1 90 ? -8.055  -7.900  2.009   1.00 0.00 ? 98  PHE A CA   1  
ATOM 1342  C C    . PHE A 1 90 ? -9.308  -8.763  2.145   1.00 0.00 ? 98  PHE A C    1  
ATOM 1343  O O    . PHE A 1 90 ? -9.912  -8.834  3.215   1.00 0.00 ? 98  PHE A O    1  
ATOM 1344  C CB   . PHE A 1 90 ? -8.434  -6.496  1.534   1.00 0.00 ? 98  PHE A CB   1  
ATOM 1345  C CG   . PHE A 1 90 ? -7.736  -5.402  2.291   1.00 0.00 ? 98  PHE A CG   1  
ATOM 1346  C CD1  . PHE A 1 90 ? -6.488  -4.951  1.891   1.00 0.00 ? 98  PHE A CD1  1  
ATOM 1347  C CD2  . PHE A 1 90 ? -8.328  -4.825  3.403   1.00 0.00 ? 98  PHE A CD2  1  
ATOM 1348  C CE1  . PHE A 1 90 ? -5.843  -3.947  2.588   1.00 0.00 ? 98  PHE A CE1  1  
ATOM 1349  C CE2  . PHE A 1 90 ? -7.689  -3.820  4.103   1.00 0.00 ? 98  PHE A CE2  1  
ATOM 1350  C CZ   . PHE A 1 90 ? -6.444  -3.380  3.694   1.00 0.00 ? 98  PHE A CZ   1  
ATOM 1351  H H    . PHE A 1 90 ? -6.715  -7.955  0.371   1.00 0.00 ? 98  PHE A H    1  
ATOM 1352  H HA   . PHE A 1 90 ? -7.581  -7.823  2.976   1.00 0.00 ? 98  PHE A HA   1  
ATOM 1353  H HB2  . PHE A 1 90 ? -8.175  -6.393  0.490   1.00 0.00 ? 98  PHE A HB2  1  
ATOM 1354  H HB3  . PHE A 1 90 ? -9.498  -6.356  1.652   1.00 0.00 ? 98  PHE A HB3  1  
ATOM 1355  H HD1  . PHE A 1 90 ? -6.018  -5.393  1.025   1.00 0.00 ? 98  PHE A HD1  1  
ATOM 1356  H HD2  . PHE A 1 90 ? -9.301  -5.167  3.724   1.00 0.00 ? 98  PHE A HD2  1  
ATOM 1357  H HE1  . PHE A 1 90 ? -4.871  -3.606  2.267   1.00 0.00 ? 98  PHE A HE1  1  
ATOM 1358  H HE2  . PHE A 1 90 ? -8.160  -3.378  4.969   1.00 0.00 ? 98  PHE A HE2  1  
ATOM 1359  H HZ   . PHE A 1 90 ? -5.942  -2.596  4.241   1.00 0.00 ? 98  PHE A HZ   1  
ATOM 1360  N N    . MET A 1 91 ? -9.690  -9.420  1.055   1.00 0.00 ? 99  MET A N    1  
ATOM 1361  C CA   . MET A 1 91 ? -10.869 -10.279 1.056   1.00 0.00 ? 99  MET A CA   1  
ATOM 1362  C C    . MET A 1 91 ? -10.628 -11.526 1.902   1.00 0.00 ? 99  MET A C    1  
ATOM 1363  O O    . MET A 1 91 ? -10.471 -12.627 1.374   1.00 0.00 ? 99  MET A O    1  
ATOM 1364  C CB   . MET A 1 91 ? -11.236 -10.679 -0.374  1.00 0.00 ? 99  MET A CB   1  
ATOM 1365  C CG   . MET A 1 91 ? -11.718 -9.516  -1.226  1.00 0.00 ? 99  MET A CG   1  
ATOM 1366  S SD   . MET A 1 91 ? -13.387 -8.983  -0.794  1.00 0.00 ? 99  MET A SD   1  
ATOM 1367  C CE   . MET A 1 91 ? -13.067 -7.328  -0.190  1.00 0.00 ? 99  MET A CE   1  
ATOM 1368  H H    . MET A 1 91 ? -9.168  -9.327  0.231   1.00 0.00 ? 99  MET A H    1  
ATOM 1369  H HA   . MET A 1 91 ? -11.687 -9.720  1.486   1.00 0.00 ? 99  MET A HA   1  
ATOM 1370  H HB2  . MET A 1 91 ? -10.366 -11.109 -0.850  1.00 0.00 ? 99  MET A HB2  1  
ATOM 1371  H HB3  . MET A 1 91 ? -12.020 -11.420 -0.339  1.00 0.00 ? 99  MET A HB3  1  
ATOM 1372  H HG2  . MET A 1 91 ? -11.044 -8.683  -1.088  1.00 0.00 ? 99  MET A HG2  1  
ATOM 1373  H HG3  . MET A 1 91 ? -11.708 -9.817  -2.262  1.00 0.00 ? 99  MET A HG3  1  
ATOM 1374  H HE1  . MET A 1 91 ? -12.201 -6.923  -0.691  1.00 0.00 ? 99  MET A HE1  1  
ATOM 1375  H HE2  . MET A 1 91 ? -12.884 -7.362  0.875   1.00 0.00 ? 99  MET A HE2  1  
ATOM 1376  H HE3  . MET A 1 91 ? -13.924 -6.701  -0.388  1.00 0.00 ? 99  MET A HE3  1  
ATOM 1377  N N    . THR A 1 92 ? -10.601 -11.343 3.218   1.00 0.00 ? 100 THR A N    1  
ATOM 1378  C CA   . THR A 1 92 ? -10.375 -12.452 4.140   1.00 0.00 ? 100 THR A CA   1  
ATOM 1379  C C    . THR A 1 92 ? -11.694 -13.004 4.684   1.00 0.00 ? 100 THR A C    1  
ATOM 1380  O O    . THR A 1 92 ? -11.699 -13.967 5.449   1.00 0.00 ? 100 THR A O    1  
ATOM 1381  C CB   . THR A 1 92 ? -9.485  -12.001 5.300   1.00 0.00 ? 100 THR A CB   1  
ATOM 1382  O OG1  . THR A 1 92 ? -8.266  -11.464 4.817   1.00 0.00 ? 100 THR A OG1  1  
ATOM 1383  C CG2  . THR A 1 92 ? -9.146  -13.119 6.262   1.00 0.00 ? 100 THR A CG2  1  
ATOM 1384  H H    . THR A 1 92 ? -10.731 -10.441 3.578   1.00 0.00 ? 100 THR A H    1  
ATOM 1385  H HA   . THR A 1 92 ? -9.871  -13.235 3.597   1.00 0.00 ? 100 THR A HA   1  
ATOM 1386  H HB   . THR A 1 92 ? -9.999  -11.231 5.856   1.00 0.00 ? 100 THR A HB   1  
ATOM 1387  H HG1  . THR A 1 92 ? -8.450  -10.715 4.247   1.00 0.00 ? 100 THR A HG1  1  
ATOM 1388  H HG21 . THR A 1 92 ? -9.919  -13.196 7.011   1.00 0.00 ? 100 THR A HG21 1  
ATOM 1389  H HG22 . THR A 1 92 ? -8.201  -12.907 6.739   1.00 0.00 ? 100 THR A HG22 1  
ATOM 1390  H HG23 . THR A 1 92 ? -9.076  -14.052 5.721   1.00 0.00 ? 100 THR A HG23 1  
ATOM 1391  N N    . THR B 2 1  ? -4.424  -13.155 12.584  1.00 0.00 ? 111 THR B N    1  
ATOM 1392  C CA   . THR B 2 1  ? -4.363  -11.818 13.162  1.00 0.00 ? 111 THR B CA   1  
ATOM 1393  C C    . THR B 2 1  ? -4.158  -10.764 12.077  1.00 0.00 ? 111 THR B C    1  
ATOM 1394  O O    . THR B 2 1  ? -3.533  -11.030 11.050  1.00 0.00 ? 111 THR B O    1  
ATOM 1395  C CB   . THR B 2 1  ? -3.231  -11.734 14.189  1.00 0.00 ? 111 THR B CB   1  
ATOM 1396  O OG1  . THR B 2 1  ? -2.002  -12.141 13.615  1.00 0.00 ? 111 THR B OG1  1  
ATOM 1397  C CG2  . THR B 2 1  ? -3.473  -12.587 15.415  1.00 0.00 ? 111 THR B CG2  1  
ATOM 1398  H H1   . THR B 2 1  ? -3.591  -13.620 12.367  1.00 0.00 ? 111 THR B H1   1  
ATOM 1399  H HA   . THR B 2 1  ? -5.303  -11.629 13.658  1.00 0.00 ? 111 THR B HA   1  
ATOM 1400  H HB   . THR B 2 1  ? -3.132  -10.709 14.514  1.00 0.00 ? 111 THR B HB   1  
ATOM 1401  H HG1  . THR B 2 1  ? -2.018  -13.089 13.461  1.00 0.00 ? 111 THR B HG1  1  
ATOM 1402  H HG21 . THR B 2 1  ? -2.985  -13.543 15.290  1.00 0.00 ? 111 THR B HG21 1  
ATOM 1403  H HG22 . THR B 2 1  ? -4.534  -12.739 15.546  1.00 0.00 ? 111 THR B HG22 1  
ATOM 1404  H HG23 . THR B 2 1  ? -3.070  -12.088 16.284  1.00 0.00 ? 111 THR B HG23 1  
ATOM 1405  N N    . PRO B 2 2  ? -4.684  -9.545  12.290  1.00 0.00 ? 112 PRO B N    1  
ATOM 1406  C CA   . PRO B 2 2  ? -4.556  -8.449  11.325  1.00 0.00 ? 112 PRO B CA   1  
ATOM 1407  C C    . PRO B 2 2  ? -3.103  -8.177  10.948  1.00 0.00 ? 112 PRO B C    1  
ATOM 1408  O O    . PRO B 2 2  ? -2.191  -8.408  11.743  1.00 0.00 ? 112 PRO B O    1  
ATOM 1409  C CB   . PRO B 2 2  ? -5.147  -7.246  12.063  1.00 0.00 ? 112 PRO B CB   1  
ATOM 1410  C CG   . PRO B 2 2  ? -6.067  -7.836  13.077  1.00 0.00 ? 112 PRO B CG   1  
ATOM 1411  C CD   . PRO B 2 2  ? -5.444  -9.141  13.487  1.00 0.00 ? 112 PRO B CD   1  
ATOM 1412  H HA   . PRO B 2 2  ? -5.128  -8.642  10.429  1.00 0.00 ? 112 PRO B HA   1  
ATOM 1413  H HB2  . PRO B 2 2  ? -4.354  -6.681  12.531  1.00 0.00 ? 112 PRO B HB2  1  
ATOM 1414  H HB3  . PRO B 2 2  ? -5.682  -6.619  11.367  1.00 0.00 ? 112 PRO B HB3  1  
ATOM 1415  H HG2  . PRO B 2 2  ? -6.149  -7.176  13.927  1.00 0.00 ? 112 PRO B HG2  1  
ATOM 1416  H HG3  . PRO B 2 2  ? -7.037  -8.007  12.637  1.00 0.00 ? 112 PRO B HG3  1  
ATOM 1417  H HD2  . PRO B 2 2  ? -4.786  -8.996  14.332  1.00 0.00 ? 112 PRO B HD2  1  
ATOM 1418  H HD3  . PRO B 2 2  ? -6.207  -9.867  13.723  1.00 0.00 ? 112 PRO B HD3  1  
ATOM 1419  N N    . LEU B 2 3  ? -2.894  -7.683  9.732   1.00 0.00 ? 113 LEU B N    1  
ATOM 1420  C CA   . LEU B 2 3  ? -1.553  -7.377  9.251   1.00 0.00 ? 113 LEU B CA   1  
ATOM 1421  C C    . LEU B 2 3  ? -1.104  -6.001  9.730   1.00 0.00 ? 113 LEU B C    1  
ATOM 1422  O O    . LEU B 2 3  ? -1.928  -5.127  10.001  1.00 0.00 ? 113 LEU B O    1  
ATOM 1423  C CB   . LEU B 2 3  ? -1.510  -7.439  7.723   1.00 0.00 ? 113 LEU B CB   1  
ATOM 1424  C CG   . LEU B 2 3  ? -1.983  -8.760  7.114   1.00 0.00 ? 113 LEU B CG   1  
ATOM 1425  C CD1  . LEU B 2 3  ? -2.668  -8.514  5.777   1.00 0.00 ? 113 LEU B CD1  1  
ATOM 1426  C CD2  . LEU B 2 3  ? -0.813  -9.718  6.947   1.00 0.00 ? 113 LEU B CD2  1  
ATOM 1427  H H    . LEU B 2 3  ? -3.662  -7.519  9.144   1.00 0.00 ? 113 LEU B H    1  
ATOM 1428  H HA   . LEU B 2 3  ? -0.880  -8.121  9.652   1.00 0.00 ? 113 LEU B HA   1  
ATOM 1429  H HB2  . LEU B 2 3  ? -2.129  -6.643  7.334   1.00 0.00 ? 113 LEU B HB2  1  
ATOM 1430  H HB3  . LEU B 2 3  ? -0.492  -7.267  7.406   1.00 0.00 ? 113 LEU B HB3  1  
ATOM 1431  H HG   . LEU B 2 3  ? -2.701  -9.217  7.778   1.00 0.00 ? 113 LEU B HG   1  
ATOM 1432  H HD11 . LEU B 2 3  ? -3.504  -9.192  5.673   1.00 0.00 ? 113 LEU B HD11 1  
ATOM 1433  H HD12 . LEU B 2 3  ? -1.964  -8.684  4.976   1.00 0.00 ? 113 LEU B HD12 1  
ATOM 1434  H HD13 . LEU B 2 3  ? -3.023  -7.496  5.737   1.00 0.00 ? 113 LEU B HD13 1  
ATOM 1435  H HD21 . LEU B 2 3  ? -0.967  -10.323 6.066   1.00 0.00 ? 113 LEU B HD21 1  
ATOM 1436  H HD22 . LEU B 2 3  ? -0.746  -10.357 7.815   1.00 0.00 ? 113 LEU B HD22 1  
ATOM 1437  H HD23 . LEU B 2 3  ? 0.101   -9.155  6.844   1.00 0.00 ? 113 LEU B HD23 1  
ATOM 1438  N N    . GLU B 2 4  ? 0.208   -5.812  9.831   1.00 0.00 ? 114 GLU B N    1  
ATOM 1439  C CA   . GLU B 2 4  ? 0.765   -4.540  10.277  1.00 0.00 ? 114 GLU B CA   1  
ATOM 1440  C C    . GLU B 2 4  ? 0.384   -3.414  9.322   1.00 0.00 ? 114 GLU B C    1  
ATOM 1441  O O    . GLU B 2 4  ? 0.217   -3.634  8.123   1.00 0.00 ? 114 GLU B O    1  
ATOM 1442  C CB   . GLU B 2 4  ? 2.288   -4.637  10.389  1.00 0.00 ? 114 GLU B CB   1  
ATOM 1443  C CG   . GLU B 2 4  ? 2.761   -5.759  11.301  1.00 0.00 ? 114 GLU B CG   1  
ATOM 1444  C CD   . GLU B 2 4  ? 3.713   -5.276  12.376  1.00 0.00 ? 114 GLU B CD   1  
ATOM 1445  O OE1  . GLU B 2 4  ? 4.928   -5.198  12.102  1.00 0.00 ? 114 GLU B OE1  1  
ATOM 1446  O OE2  . GLU B 2 4  ? 3.243   -4.974  13.494  1.00 0.00 ? 114 GLU B OE2  1  
ATOM 1447  H H    . GLU B 2 4  ? 0.815   -6.546  9.601   1.00 0.00 ? 114 GLU B H    1  
ATOM 1448  H HA   . GLU B 2 4  ? 0.355   -4.323  11.252  1.00 0.00 ? 114 GLU B HA   1  
ATOM 1449  H HB2  . GLU B 2 4  ? 2.698   -4.806  9.404   1.00 0.00 ? 114 GLU B HB2  1  
ATOM 1450  H HB3  . GLU B 2 4  ? 2.669   -3.704  10.773  1.00 0.00 ? 114 GLU B HB3  1  
ATOM 1451  H HG2  . GLU B 2 4  ? 1.900   -6.206  11.778  1.00 0.00 ? 114 GLU B HG2  1  
ATOM 1452  H HG3  . GLU B 2 4  ? 3.265   -6.503  10.702  1.00 0.00 ? 114 GLU B HG3  1  
ATOM 1453  N N    . ILE B 2 5  ? 0.250   -2.208  9.862   1.00 0.00 ? 115 ILE B N    1  
ATOM 1454  C CA   . ILE B 2 5  ? -0.109  -1.047  9.058   1.00 0.00 ? 115 ILE B CA   1  
ATOM 1455  C C    . ILE B 2 5  ? 0.746   0.162   9.424   1.00 0.00 ? 115 ILE B C    1  
ATOM 1456  O O    . ILE B 2 5  ? 1.214   0.283   10.556  1.00 0.00 ? 115 ILE B O    1  
ATOM 1457  C CB   . ILE B 2 5  ? -1.596  -0.681  9.231   1.00 0.00 ? 115 ILE B CB   1  
ATOM 1458  C CG1  . ILE B 2 5  ? -2.471  -1.923  9.058   1.00 0.00 ? 115 ILE B CG1  1  
ATOM 1459  C CG2  . ILE B 2 5  ? -1.995  0.398   8.235   1.00 0.00 ? 115 ILE B CG2  1  
ATOM 1460  C CD1  . ILE B 2 5  ? -3.925  -1.692  9.414   1.00 0.00 ? 115 ILE B CD1  1  
ATOM 1461  H H    . ILE B 2 5  ? 0.398   -2.095  10.825  1.00 0.00 ? 115 ILE B H    1  
ATOM 1462  H HA   . ILE B 2 5  ? 0.061   -1.294  8.020   1.00 0.00 ? 115 ILE B HA   1  
ATOM 1463  H HB   . ILE B 2 5  ? -1.733  -0.288  10.226  1.00 0.00 ? 115 ILE B HB   1  
ATOM 1464  H HG12 . ILE B 2 5  ? -2.431  -2.246  8.029   1.00 0.00 ? 115 ILE B HG12 1  
ATOM 1465  H HG13 . ILE B 2 5  ? -2.095  -2.712  9.694   1.00 0.00 ? 115 ILE B HG13 1  
ATOM 1466  H HG21 . ILE B 2 5  ? -3.052  0.319   8.024   1.00 0.00 ? 115 ILE B HG21 1  
ATOM 1467  H HG22 . ILE B 2 5  ? -1.434  0.272   7.321   1.00 0.00 ? 115 ILE B HG22 1  
ATOM 1468  H HG23 . ILE B 2 5  ? -1.784  1.371   8.656   1.00 0.00 ? 115 ILE B HG23 1  
ATOM 1469  H HD11 . ILE B 2 5  ? -4.495  -2.582  9.195   1.00 0.00 ? 115 ILE B HD11 1  
ATOM 1470  H HD12 . ILE B 2 5  ? -4.310  -0.866  8.834   1.00 0.00 ? 115 ILE B HD12 1  
ATOM 1471  H HD13 . ILE B 2 5  ? -4.005  -1.463  10.466  1.00 0.00 ? 115 ILE B HD13 1  
ATOM 1472  N N    . THR B 2 6  ? 0.945   1.054   8.460   1.00 0.00 ? 116 THR B N    1  
ATOM 1473  C CA   . THR B 2 6  ? 1.744   2.254   8.682   1.00 0.00 ? 116 THR B CA   1  
ATOM 1474  C C    . THR B 2 6  ? 1.052   3.484   8.104   1.00 0.00 ? 116 THR B C    1  
ATOM 1475  O O    . THR B 2 6  ? 0.344   3.395   7.102   1.00 0.00 ? 116 THR B O    1  
ATOM 1476  C CB   . THR B 2 6  ? 3.129   2.091   8.055   1.00 0.00 ? 116 THR B CB   1  
ATOM 1477  O OG1  . THR B 2 6  ? 3.736   0.887   8.485   1.00 0.00 ? 116 THR B OG1  1  
ATOM 1478  C CG2  . THR B 2 6  ? 4.073   3.226   8.388   1.00 0.00 ? 116 THR B CG2  1  
ATOM 1479  H H    . THR B 2 6  ? 0.546   0.903   7.578   1.00 0.00 ? 116 THR B H    1  
ATOM 1480  H HA   . THR B 2 6  ? 1.854   2.385   9.747   1.00 0.00 ? 116 THR B HA   1  
ATOM 1481  H HB   . THR B 2 6  ? 3.024   2.053   6.981   1.00 0.00 ? 116 THR B HB   1  
ATOM 1482  H HG1  . THR B 2 6  ? 3.167   0.145   8.270   1.00 0.00 ? 116 THR B HG1  1  
ATOM 1483  H HG21 . THR B 2 6  ? 5.084   2.848   8.445   1.00 0.00 ? 116 THR B HG21 1  
ATOM 1484  H HG22 . THR B 2 6  ? 3.795   3.658   9.338   1.00 0.00 ? 116 THR B HG22 1  
ATOM 1485  H HG23 . THR B 2 6  ? 4.014   3.982   7.618   1.00 0.00 ? 116 THR B HG23 1  
ATOM 1486  N N    . GLU B 2 7  ? 1.262   4.630   8.742   1.00 0.00 ? 117 GLU B N    1  
ATOM 1487  C CA   . GLU B 2 7  ? 0.657   5.877   8.290   1.00 0.00 ? 117 GLU B CA   1  
ATOM 1488  C C    . GLU B 2 7  ? 1.673   6.734   7.540   1.00 0.00 ? 117 GLU B C    1  
ATOM 1489  O O    . GLU B 2 7  ? 2.767   6.999   8.038   1.00 0.00 ? 117 GLU B O    1  
ATOM 1490  C CB   . GLU B 2 7  ? 0.093   6.656   9.484   1.00 0.00 ? 117 GLU B CB   1  
ATOM 1491  C CG   . GLU B 2 7  ? -1.419  6.801   9.454   1.00 0.00 ? 117 GLU B CG   1  
ATOM 1492  C CD   . GLU B 2 7  ? -1.881  8.180   9.878   1.00 0.00 ? 117 GLU B CD   1  
ATOM 1493  O OE1  . GLU B 2 7  ? -1.419  8.663   10.932  1.00 0.00 ? 117 GLU B OE1  1  
ATOM 1494  O OE2  . GLU B 2 7  ? -2.706  8.778   9.155   1.00 0.00 ? 117 GLU B OE2  1  
ATOM 1495  H H    . GLU B 2 7  ? 1.836   4.637   9.537   1.00 0.00 ? 117 GLU B H    1  
ATOM 1496  H HA   . GLU B 2 7  ? -0.151  5.629   7.620   1.00 0.00 ? 117 GLU B HA   1  
ATOM 1497  H HB2  . GLU B 2 7  ? 0.367   6.143   10.394  1.00 0.00 ? 117 GLU B HB2  1  
ATOM 1498  H HB3  . GLU B 2 7  ? 0.528   7.645   9.495   1.00 0.00 ? 117 GLU B HB3  1  
ATOM 1499  H HG2  . GLU B 2 7  ? -1.766  6.615   8.448   1.00 0.00 ? 117 GLU B HG2  1  
ATOM 1500  H HG3  . GLU B 2 7  ? -1.851  6.070   10.123  1.00 0.00 ? 117 GLU B HG3  1  
ATOM 1501  N N    . LEU B 2 8  ? 1.303   7.162   6.337   1.00 0.00 ? 118 LEU B N    1  
ATOM 1502  C CA   . LEU B 2 8  ? 2.180   7.987   5.516   1.00 0.00 ? 118 LEU B CA   1  
ATOM 1503  C C    . LEU B 2 8  ? 1.532   9.334   5.212   1.00 0.00 ? 118 LEU B C    1  
ATOM 1504  O O    . LEU B 2 8  ? 0.414   9.578   5.712   1.00 0.00 ? 118 LEU B O    1  
ATOM 1505  C CB   . LEU B 2 8  ? 2.522   7.266   4.211   1.00 0.00 ? 118 LEU B CB   1  
ATOM 1506  C CG   . LEU B 2 8  ? 2.847   5.779   4.359   1.00 0.00 ? 118 LEU B CG   1  
ATOM 1507  C CD1  . LEU B 2 8  ? 3.008   5.128   2.994   1.00 0.00 ? 118 LEU B CD1  1  
ATOM 1508  C CD2  . LEU B 2 8  ? 4.105   5.590   5.193   1.00 0.00 ? 118 LEU B CD2  1  
ATOM 1509  O OXT  . LEU B 2 8  ? 2.147   10.133  4.474   1.00 0.00 ? 118 LEU B OXT  1  
ATOM 1510  H H    . LEU B 2 8  ? 0.418   6.917   5.994   1.00 0.00 ? 118 LEU B H    1  
ATOM 1511  H HA   . LEU B 2 8  ? 3.091   8.158   6.071   1.00 0.00 ? 118 LEU B HA   1  
ATOM 1512  H HB2  . LEU B 2 8  ? 1.681   7.364   3.539   1.00 0.00 ? 118 LEU B HB2  1  
ATOM 1513  H HB3  . LEU B 2 8  ? 3.376   7.755   3.765   1.00 0.00 ? 118 LEU B HB3  1  
ATOM 1514  H HG   . LEU B 2 8  ? 2.031   5.287   4.869   1.00 0.00 ? 118 LEU B HG   1  
ATOM 1515  H HD11 . LEU B 2 8  ? 2.062   4.711   2.680   1.00 0.00 ? 118 LEU B HD11 1  
ATOM 1516  H HD12 . LEU B 2 8  ? 3.746   4.342   3.054   1.00 0.00 ? 118 LEU B HD12 1  
ATOM 1517  H HD13 . LEU B 2 8  ? 3.330   5.869   2.278   1.00 0.00 ? 118 LEU B HD13 1  
ATOM 1518  H HD21 . LEU B 2 8  ? 4.879   6.251   4.832   1.00 0.00 ? 118 LEU B HD21 1  
ATOM 1519  H HD22 . LEU B 2 8  ? 4.440   4.567   5.113   1.00 0.00 ? 118 LEU B HD22 1  
ATOM 1520  H HD23 . LEU B 2 8  ? 3.890   5.819   6.227   1.00 0.00 ? 118 LEU B HD23 1  
ATOM 1521  N N    . LYS A 1 1  ? -4.542  -3.365  -15.258 1.00 0.00 ? 9   LYS A N    2  
ATOM 1522  C CA   . LYS A 1 1  ? -3.570  -2.929  -16.295 1.00 0.00 ? 9   LYS A CA   2  
ATOM 1523  C C    . LYS A 1 1  ? -2.484  -2.039  -15.698 1.00 0.00 ? 9   LYS A C    2  
ATOM 1524  O O    . LYS A 1 1  ? -1.902  -1.205  -16.392 1.00 0.00 ? 9   LYS A O    2  
ATOM 1525  C CB   . LYS A 1 1  ? -4.330  -2.172  -17.387 1.00 0.00 ? 9   LYS A CB   2  
ATOM 1526  C CG   . LYS A 1 1  ? -5.300  -1.134  -16.845 1.00 0.00 ? 9   LYS A CG   2  
ATOM 1527  C CD   . LYS A 1 1  ? -5.343  0.103   -17.729 1.00 0.00 ? 9   LYS A CD   2  
ATOM 1528  C CE   . LYS A 1 1  ? -6.758  0.641   -17.866 1.00 0.00 ? 9   LYS A CE   2  
ATOM 1529  N NZ   . LYS A 1 1  ? -7.019  1.768   -16.928 1.00 0.00 ? 9   LYS A NZ   2  
ATOM 1530  H H1   . LYS A 1 1  ? -4.087  -4.110  -14.692 1.00 0.00 ? 9   LYS A H1   2  
ATOM 1531  H H2   . LYS A 1 1  ? -5.386  -3.726  -15.747 1.00 0.00 ? 9   LYS A H2   2  
ATOM 1532  H H3   . LYS A 1 1  ? -4.771  -2.539  -14.672 1.00 0.00 ? 9   LYS A H3   2  
ATOM 1533  H HA   . LYS A 1 1  ? -3.110  -3.806  -16.726 1.00 0.00 ? 9   LYS A HA   2  
ATOM 1534  H HB2  . LYS A 1 1  ? -3.617  -1.670  -18.025 1.00 0.00 ? 9   LYS A HB2  2  
ATOM 1535  H HB3  . LYS A 1 1  ? -4.890  -2.881  -17.978 1.00 0.00 ? 9   LYS A HB3  2  
ATOM 1536  H HG2  . LYS A 1 1  ? -6.286  -1.566  -16.800 1.00 0.00 ? 9   LYS A HG2  2  
ATOM 1537  H HG3  . LYS A 1 1  ? -4.984  -0.845  -15.854 1.00 0.00 ? 9   LYS A HG3  2  
ATOM 1538  H HD2  . LYS A 1 1  ? -4.719  0.869   -17.292 1.00 0.00 ? 9   LYS A HD2  2  
ATOM 1539  H HD3  . LYS A 1 1  ? -4.968  -0.154  -18.709 1.00 0.00 ? 9   LYS A HD3  2  
ATOM 1540  H HE2  . LYS A 1 1  ? -6.900  0.987   -18.879 1.00 0.00 ? 9   LYS A HE2  2  
ATOM 1541  H HE3  . LYS A 1 1  ? -7.455  -0.159  -17.659 1.00 0.00 ? 9   LYS A HE3  2  
ATOM 1542  H HZ1  . LYS A 1 1  ? -6.577  2.640   -17.285 1.00 0.00 ? 9   LYS A HZ1  2  
ATOM 1543  H HZ2  . LYS A 1 1  ? -6.623  1.551   -15.990 1.00 0.00 ? 9   LYS A HZ2  2  
ATOM 1544  H HZ3  . LYS A 1 1  ? -8.042  1.923   -16.832 1.00 0.00 ? 9   LYS A HZ3  2  
ATOM 1545  N N    . GLU A 1 2  ? -2.216  -2.222  -14.409 1.00 0.00 ? 10  GLU A N    2  
ATOM 1546  C CA   . GLU A 1 2  ? -1.199  -1.435  -13.720 1.00 0.00 ? 10  GLU A CA   2  
ATOM 1547  C C    . GLU A 1 2  ? -1.556  0.048   -13.735 1.00 0.00 ? 10  GLU A C    2  
ATOM 1548  O O    . GLU A 1 2  ? -1.629  0.669   -14.796 1.00 0.00 ? 10  GLU A O    2  
ATOM 1549  C CB   . GLU A 1 2  ? 0.170   -1.650  -14.369 1.00 0.00 ? 10  GLU A CB   2  
ATOM 1550  C CG   . GLU A 1 2  ? 0.515   -3.114  -14.587 1.00 0.00 ? 10  GLU A CG   2  
ATOM 1551  C CD   . GLU A 1 2  ? 1.491   -3.643  -13.555 1.00 0.00 ? 10  GLU A CD   2  
ATOM 1552  O OE1  . GLU A 1 2  ? 2.302   -2.845  -13.041 1.00 0.00 ? 10  GLU A OE1  2  
ATOM 1553  O OE2  . GLU A 1 2  ? 1.445   -4.856  -13.260 1.00 0.00 ? 10  GLU A OE2  2  
ATOM 1554  H H    . GLU A 1 2  ? -2.712  -2.902  -13.908 1.00 0.00 ? 10  GLU A H    2  
ATOM 1555  H HA   . GLU A 1 2  ? -1.158  -1.772  -12.696 1.00 0.00 ? 10  GLU A HA   2  
ATOM 1556  H HB2  . GLU A 1 2  ? 0.183   -1.153  -15.328 1.00 0.00 ? 10  GLU A HB2  2  
ATOM 1557  H HB3  . GLU A 1 2  ? 0.928   -1.213  -13.737 1.00 0.00 ? 10  GLU A HB3  2  
ATOM 1558  H HG2  . GLU A 1 2  ? -0.392  -3.697  -14.533 1.00 0.00 ? 10  GLU A HG2  2  
ATOM 1559  H HG3  . GLU A 1 2  ? 0.955   -3.225  -15.568 1.00 0.00 ? 10  GLU A HG3  2  
ATOM 1560  N N    . LYS A 1 3  ? -1.779  0.611   -12.552 1.00 0.00 ? 11  LYS A N    2  
ATOM 1561  C CA   . LYS A 1 3  ? -2.130  2.023   -12.433 1.00 0.00 ? 11  LYS A CA   2  
ATOM 1562  C C    . LYS A 1 3  ? -0.912  2.866   -12.062 1.00 0.00 ? 11  LYS A C    2  
ATOM 1563  O O    . LYS A 1 3  ? -0.033  2.421   -11.324 1.00 0.00 ? 11  LYS A O    2  
ATOM 1564  C CB   . LYS A 1 3  ? -3.235  2.210   -11.389 1.00 0.00 ? 11  LYS A CB   2  
ATOM 1565  C CG   . LYS A 1 3  ? -3.660  3.658   -11.204 1.00 0.00 ? 11  LYS A CG   2  
ATOM 1566  C CD   . LYS A 1 3  ? -5.002  3.757   -10.498 1.00 0.00 ? 11  LYS A CD   2  
ATOM 1567  C CE   . LYS A 1 3  ? -4.909  3.289   -9.053  1.00 0.00 ? 11  LYS A CE   2  
ATOM 1568  N NZ   . LYS A 1 3  ? -5.489  1.930   -8.872  1.00 0.00 ? 11  LYS A NZ   2  
ATOM 1569  H H    . LYS A 1 3  ? -1.706  0.064   -11.740 1.00 0.00 ? 11  LYS A H    2  
ATOM 1570  H HA   . LYS A 1 3  ? -2.499  2.351   -13.393 1.00 0.00 ? 11  LYS A HA   2  
ATOM 1571  H HB2  . LYS A 1 3  ? -4.100  1.640   -11.691 1.00 0.00 ? 11  LYS A HB2  2  
ATOM 1572  H HB3  . LYS A 1 3  ? -2.886  1.837   -10.439 1.00 0.00 ? 11  LYS A HB3  2  
ATOM 1573  H HG2  . LYS A 1 3  ? -2.915  4.169   -10.614 1.00 0.00 ? 11  LYS A HG2  2  
ATOM 1574  H HG3  . LYS A 1 3  ? -3.738  4.127   -12.173 1.00 0.00 ? 11  LYS A HG3  2  
ATOM 1575  H HD2  . LYS A 1 3  ? -5.330  4.786   -10.511 1.00 0.00 ? 11  LYS A HD2  2  
ATOM 1576  H HD3  . LYS A 1 3  ? -5.719  3.142   -11.020 1.00 0.00 ? 11  LYS A HD3  2  
ATOM 1577  H HE2  . LYS A 1 3  ? -3.870  3.268   -8.761  1.00 0.00 ? 11  LYS A HE2  2  
ATOM 1578  H HE3  . LYS A 1 3  ? -5.444  3.988   -8.427  1.00 0.00 ? 11  LYS A HE3  2  
ATOM 1579  H HZ1  . LYS A 1 3  ? -4.783  1.205   -9.107  1.00 0.00 ? 11  LYS A HZ1  2  
ATOM 1580  H HZ2  . LYS A 1 3  ? -6.316  1.809   -9.493  1.00 0.00 ? 11  LYS A HZ2  2  
ATOM 1581  H HZ3  . LYS A 1 3  ? -5.790  1.799   -7.885  1.00 0.00 ? 11  LYS A HZ3  2  
ATOM 1582  N N    . LYS A 1 4  ? -0.868  4.089   -12.583 1.00 0.00 ? 12  LYS A N    2  
ATOM 1583  C CA   . LYS A 1 4  ? 0.241   4.997   -12.309 1.00 0.00 ? 12  LYS A CA   2  
ATOM 1584  C C    . LYS A 1 4  ? -0.167  6.058   -11.292 1.00 0.00 ? 12  LYS A C    2  
ATOM 1585  O O    . LYS A 1 4  ? -1.277  6.587   -11.345 1.00 0.00 ? 12  LYS A O    2  
ATOM 1586  C CB   . LYS A 1 4  ? 0.710   5.666   -13.603 1.00 0.00 ? 12  LYS A CB   2  
ATOM 1587  C CG   . LYS A 1 4  ? 1.541   4.755   -14.491 1.00 0.00 ? 12  LYS A CG   2  
ATOM 1588  C CD   . LYS A 1 4  ? 2.912   5.348   -14.777 1.00 0.00 ? 12  LYS A CD   2  
ATOM 1589  C CE   . LYS A 1 4  ? 3.977   4.754   -13.870 1.00 0.00 ? 12  LYS A CE   2  
ATOM 1590  N NZ   . LYS A 1 4  ? 5.351   5.024   -14.376 1.00 0.00 ? 12  LYS A NZ   2  
ATOM 1591  H H    . LYS A 1 4  ? -1.598  4.387   -13.164 1.00 0.00 ? 12  LYS A H    2  
ATOM 1592  H HA   . LYS A 1 4  ? 1.053   4.415   -11.900 1.00 0.00 ? 12  LYS A HA   2  
ATOM 1593  H HB2  . LYS A 1 4  ? -0.156  5.986   -14.162 1.00 0.00 ? 12  LYS A HB2  2  
ATOM 1594  H HB3  . LYS A 1 4  ? 1.306   6.531   -13.351 1.00 0.00 ? 12  LYS A HB3  2  
ATOM 1595  H HG2  . LYS A 1 4  ? 1.670   3.804   -13.997 1.00 0.00 ? 12  LYS A HG2  2  
ATOM 1596  H HG3  . LYS A 1 4  ? 1.021   4.608   -15.427 1.00 0.00 ? 12  LYS A HG3  2  
ATOM 1597  H HD2  . LYS A 1 4  ? 3.174   5.146   -15.805 1.00 0.00 ? 12  LYS A HD2  2  
ATOM 1598  H HD3  . LYS A 1 4  ? 2.871   6.417   -14.617 1.00 0.00 ? 12  LYS A HD3  2  
ATOM 1599  H HE2  . LYS A 1 4  ? 3.874   5.184   -12.886 1.00 0.00 ? 12  LYS A HE2  2  
ATOM 1600  H HE3  . LYS A 1 4  ? 3.827   3.686   -13.814 1.00 0.00 ? 12  LYS A HE3  2  
ATOM 1601  H HZ1  . LYS A 1 4  ? 5.685   4.224   -14.950 1.00 0.00 ? 12  LYS A HZ1  2  
ATOM 1602  H HZ2  . LYS A 1 4  ? 6.005   5.158   -13.578 1.00 0.00 ? 12  LYS A HZ2  2  
ATOM 1603  H HZ3  . LYS A 1 4  ? 5.355   5.883   -14.960 1.00 0.00 ? 12  LYS A HZ3  2  
ATOM 1604  N N    . VAL A 1 5  ? 0.737   6.362   -10.368 1.00 0.00 ? 13  VAL A N    2  
ATOM 1605  C CA   . VAL A 1 5  ? 0.469   7.361   -9.341  1.00 0.00 ? 13  VAL A CA   2  
ATOM 1606  C C    . VAL A 1 5  ? 1.736   8.128   -8.973  1.00 0.00 ? 13  VAL A C    2  
ATOM 1607  O O    . VAL A 1 5  ? 2.833   7.570   -8.969  1.00 0.00 ? 13  VAL A O    2  
ATOM 1608  C CB   . VAL A 1 5  ? -0.114  6.715   -8.069  1.00 0.00 ? 13  VAL A CB   2  
ATOM 1609  C CG1  . VAL A 1 5  ? -0.505  7.778   -7.056  1.00 0.00 ? 13  VAL A CG1  2  
ATOM 1610  C CG2  . VAL A 1 5  ? -1.307  5.837   -8.418  1.00 0.00 ? 13  VAL A CG2  2  
ATOM 1611  H H    . VAL A 1 5  ? 1.605   5.907   -10.376 1.00 0.00 ? 13  VAL A H    2  
ATOM 1612  H HA   . VAL A 1 5  ? -0.259  8.055   -9.732  1.00 0.00 ? 13  VAL A HA   2  
ATOM 1613  H HB   . VAL A 1 5  ? 0.646   6.089   -7.626  1.00 0.00 ? 13  VAL A HB   2  
ATOM 1614  H HG11 . VAL A 1 5  ? -1.461  7.528   -6.622  1.00 0.00 ? 13  VAL A HG11 2  
ATOM 1615  H HG12 . VAL A 1 5  ? -0.572  8.737   -7.548  1.00 0.00 ? 13  VAL A HG12 2  
ATOM 1616  H HG13 . VAL A 1 5  ? 0.243   7.826   -6.277  1.00 0.00 ? 13  VAL A HG13 2  
ATOM 1617  H HG21 . VAL A 1 5  ? -1.697  5.386   -7.518  1.00 0.00 ? 13  VAL A HG21 2  
ATOM 1618  H HG22 . VAL A 1 5  ? -0.997  5.062   -9.103  1.00 0.00 ? 13  VAL A HG22 2  
ATOM 1619  H HG23 . VAL A 1 5  ? -2.074  6.441   -8.880  1.00 0.00 ? 13  VAL A HG23 2  
ATOM 1620  N N    . PHE A 1 6  ? 1.573   9.410   -8.660  1.00 0.00 ? 14  PHE A N    2  
ATOM 1621  C CA   . PHE A 1 6  ? 2.700   10.256  -8.289  1.00 0.00 ? 14  PHE A CA   2  
ATOM 1622  C C    . PHE A 1 6  ? 2.393   11.043  -7.020  1.00 0.00 ? 14  PHE A C    2  
ATOM 1623  O O    . PHE A 1 6  ? 1.421   11.797  -6.965  1.00 0.00 ? 14  PHE A O    2  
ATOM 1624  C CB   . PHE A 1 6  ? 3.041   11.218  -9.429  1.00 0.00 ? 14  PHE A CB   2  
ATOM 1625  C CG   . PHE A 1 6  ? 1.840   11.907  -10.011 1.00 0.00 ? 14  PHE A CG   2  
ATOM 1626  C CD1  . PHE A 1 6  ? 1.022   11.253  -10.919 1.00 0.00 ? 14  PHE A CD1  2  
ATOM 1627  C CD2  . PHE A 1 6  ? 1.529   13.209  -9.652  1.00 0.00 ? 14  PHE A CD2  2  
ATOM 1628  C CE1  . PHE A 1 6  ? -0.083  11.883  -11.456 1.00 0.00 ? 14  PHE A CE1  2  
ATOM 1629  C CE2  . PHE A 1 6  ? 0.425   13.845  -10.187 1.00 0.00 ? 14  PHE A CE2  2  
ATOM 1630  C CZ   . PHE A 1 6  ? -0.382  13.181  -11.089 1.00 0.00 ? 14  PHE A CZ   2  
ATOM 1631  H H    . PHE A 1 6  ? 0.672   9.795   -8.681  1.00 0.00 ? 14  PHE A H    2  
ATOM 1632  H HA   . PHE A 1 6  ? 3.550   9.615   -8.104  1.00 0.00 ? 14  PHE A HA   2  
ATOM 1633  H HB2  . PHE A 1 6  ? 3.713   11.978  -9.060  1.00 0.00 ? 14  PHE A HB2  2  
ATOM 1634  H HB3  . PHE A 1 6  ? 3.527   10.667  -10.221 1.00 0.00 ? 14  PHE A HB3  2  
ATOM 1635  H HD1  . PHE A 1 6  ? 1.255   10.237  -11.206 1.00 0.00 ? 14  PHE A HD1  2  
ATOM 1636  H HD2  . PHE A 1 6  ? 2.160   13.728  -8.946  1.00 0.00 ? 14  PHE A HD2  2  
ATOM 1637  H HE1  . PHE A 1 6  ? -0.713  11.363  -12.164 1.00 0.00 ? 14  PHE A HE1  2  
ATOM 1638  H HE2  . PHE A 1 6  ? 0.195   14.860  -9.898  1.00 0.00 ? 14  PHE A HE2  2  
ATOM 1639  H HZ   . PHE A 1 6  ? -1.245  13.677  -11.510 1.00 0.00 ? 14  PHE A HZ   2  
ATOM 1640  N N    . ILE A 1 7  ? 3.225   10.862  -6.000  1.00 0.00 ? 15  ILE A N    2  
ATOM 1641  C CA   . ILE A 1 7  ? 3.041   11.555  -4.730  1.00 0.00 ? 15  ILE A CA   2  
ATOM 1642  C C    . ILE A 1 7  ? 4.101   12.633  -4.533  1.00 0.00 ? 15  ILE A C    2  
ATOM 1643  O O    . ILE A 1 7  ? 5.297   12.376  -4.681  1.00 0.00 ? 15  ILE A O    2  
ATOM 1644  C CB   . ILE A 1 7  ? 3.090   10.573  -3.542  1.00 0.00 ? 15  ILE A CB   2  
ATOM 1645  C CG1  . ILE A 1 7  ? 2.112   9.419   -3.766  1.00 0.00 ? 15  ILE A CG1  2  
ATOM 1646  C CG2  . ILE A 1 7  ? 2.774   11.296  -2.240  1.00 0.00 ? 15  ILE A CG2  2  
ATOM 1647  C CD1  . ILE A 1 7  ? 0.678   9.870   -3.942  1.00 0.00 ? 15  ILE A CD1  2  
ATOM 1648  H H    . ILE A 1 7  ? 3.981   10.247  -6.103  1.00 0.00 ? 15  ILE A H    2  
ATOM 1649  H HA   . ILE A 1 7  ? 2.067   12.021  -4.744  1.00 0.00 ? 15  ILE A HA   2  
ATOM 1650  H HB   . ILE A 1 7  ? 4.092   10.178  -3.472  1.00 0.00 ? 15  ILE A HB   2  
ATOM 1651  H HG12 . ILE A 1 7  ? 2.400   8.879   -4.655  1.00 0.00 ? 15  ILE A HG12 2  
ATOM 1652  H HG13 . ILE A 1 7  ? 2.149   8.754   -2.916  1.00 0.00 ? 15  ILE A HG13 2  
ATOM 1653  H HG21 . ILE A 1 7  ? 2.438   10.580  -1.505  1.00 0.00 ? 15  ILE A HG21 2  
ATOM 1654  H HG22 . ILE A 1 7  ? 1.998   12.027  -2.413  1.00 0.00 ? 15  ILE A HG22 2  
ATOM 1655  H HG23 . ILE A 1 7  ? 3.662   11.792  -1.880  1.00 0.00 ? 15  ILE A HG23 2  
ATOM 1656  H HD11 . ILE A 1 7  ? 0.071   9.030   -4.241  1.00 0.00 ? 15  ILE A HD11 2  
ATOM 1657  H HD12 . ILE A 1 7  ? 0.634   10.635  -4.704  1.00 0.00 ? 15  ILE A HD12 2  
ATOM 1658  H HD13 . ILE A 1 7  ? 0.309   10.269  -3.009  1.00 0.00 ? 15  ILE A HD13 2  
ATOM 1659  N N    . SER A 1 8  ? 3.656   13.839  -4.197  1.00 0.00 ? 16  SER A N    2  
ATOM 1660  C CA   . SER A 1 8  ? 4.564   14.957  -3.978  1.00 0.00 ? 16  SER A CA   2  
ATOM 1661  C C    . SER A 1 8  ? 4.195   15.715  -2.707  1.00 0.00 ? 16  SER A C    2  
ATOM 1662  O O    . SER A 1 8  ? 3.019   15.850  -2.373  1.00 0.00 ? 16  SER A O    2  
ATOM 1663  C CB   . SER A 1 8  ? 4.536   15.907  -5.177  1.00 0.00 ? 16  SER A CB   2  
ATOM 1664  O OG   . SER A 1 8  ? 5.821   16.447  -5.432  1.00 0.00 ? 16  SER A OG   2  
ATOM 1665  H H    . SER A 1 8  ? 2.691   13.979  -4.093  1.00 0.00 ? 16  SER A H    2  
ATOM 1666  H HA   . SER A 1 8  ? 5.561   14.559  -3.869  1.00 0.00 ? 16  SER A HA   2  
ATOM 1667  H HB2  . SER A 1 8  ? 4.207   15.369  -6.053  1.00 0.00 ? 16  SER A HB2  2  
ATOM 1668  H HB3  . SER A 1 8  ? 3.852   16.719  -4.976  1.00 0.00 ? 16  SER A HB3  2  
ATOM 1669  H HG   . SER A 1 8  ? 6.201   16.773  -4.611  1.00 0.00 ? 16  SER A HG   2  
ATOM 1670  N N    . LEU A 1 9  ? 5.209   16.206  -2.002  1.00 0.00 ? 17  LEU A N    2  
ATOM 1671  C CA   . LEU A 1 9  ? 4.990   16.949  -0.766  1.00 0.00 ? 17  LEU A CA   2  
ATOM 1672  C C    . LEU A 1 9  ? 4.851   18.443  -1.049  1.00 0.00 ? 17  LEU A C    2  
ATOM 1673  O O    . LEU A 1 9  ? 5.539   19.267  -0.446  1.00 0.00 ? 17  LEU A O    2  
ATOM 1674  C CB   . LEU A 1 9  ? 6.143   16.703  0.210   1.00 0.00 ? 17  LEU A CB   2  
ATOM 1675  C CG   . LEU A 1 9  ? 5.733   16.578  1.679   1.00 0.00 ? 17  LEU A CG   2  
ATOM 1676  C CD1  . LEU A 1 9  ? 6.574   15.521  2.380   1.00 0.00 ? 17  LEU A CD1  2  
ATOM 1677  C CD2  . LEU A 1 9  ? 5.865   17.919  2.385   1.00 0.00 ? 17  LEU A CD2  2  
ATOM 1678  H H    . LEU A 1 9  ? 6.125   16.064  -2.319  1.00 0.00 ? 17  LEU A H    2  
ATOM 1679  H HA   . LEU A 1 9  ? 4.073   16.590  -0.323  1.00 0.00 ? 17  LEU A HA   2  
ATOM 1680  H HB2  . LEU A 1 9  ? 6.644   15.791  -0.082  1.00 0.00 ? 17  LEU A HB2  2  
ATOM 1681  H HB3  . LEU A 1 9  ? 6.841   17.521  0.123   1.00 0.00 ? 17  LEU A HB3  2  
ATOM 1682  H HG   . LEU A 1 9  ? 4.698   16.270  1.732   1.00 0.00 ? 17  LEU A HG   2  
ATOM 1683  H HD11 . LEU A 1 9  ? 6.334   14.547  1.979   1.00 0.00 ? 17  LEU A HD11 2  
ATOM 1684  H HD12 . LEU A 1 9  ? 6.362   15.536  3.439   1.00 0.00 ? 17  LEU A HD12 2  
ATOM 1685  H HD13 . LEU A 1 9  ? 7.620   15.729  2.218   1.00 0.00 ? 17  LEU A HD13 2  
ATOM 1686  H HD21 . LEU A 1 9  ? 5.303   18.666  1.843   1.00 0.00 ? 17  LEU A HD21 2  
ATOM 1687  H HD22 . LEU A 1 9  ? 6.905   18.206  2.419   1.00 0.00 ? 17  LEU A HD22 2  
ATOM 1688  H HD23 . LEU A 1 9  ? 5.480   17.837  3.389   1.00 0.00 ? 17  LEU A HD23 2  
ATOM 1689  N N    . VAL A 1 10 ? 3.955   18.785  -1.968  1.00 0.00 ? 18  VAL A N    2  
ATOM 1690  C CA   . VAL A 1 10 ? 3.724   20.177  -2.330  1.00 0.00 ? 18  VAL A CA   2  
ATOM 1691  C C    . VAL A 1 10 ? 2.237   20.516  -2.298  1.00 0.00 ? 18  VAL A C    2  
ATOM 1692  O O    . VAL A 1 10 ? 1.463   20.041  -3.129  1.00 0.00 ? 18  VAL A O    2  
ATOM 1693  C CB   . VAL A 1 10 ? 4.281   20.495  -3.730  1.00 0.00 ? 18  VAL A CB   2  
ATOM 1694  C CG1  . VAL A 1 10 ? 5.797   20.599  -3.692  1.00 0.00 ? 18  VAL A CG1  2  
ATOM 1695  C CG2  . VAL A 1 10 ? 3.837   19.441  -4.734  1.00 0.00 ? 18  VAL A CG2  2  
ATOM 1696  H H    . VAL A 1 10 ? 3.435   18.083  -2.415  1.00 0.00 ? 18  VAL A H    2  
ATOM 1697  H HA   . VAL A 1 10 ? 4.239   20.798  -1.612  1.00 0.00 ? 18  VAL A HA   2  
ATOM 1698  H HB   . VAL A 1 10 ? 3.884   21.449  -4.046  1.00 0.00 ? 18  VAL A HB   2  
ATOM 1699  H HG11 . VAL A 1 10 ? 6.102   21.081  -2.774  1.00 0.00 ? 18  VAL A HG11 2  
ATOM 1700  H HG12 . VAL A 1 10 ? 6.140   21.183  -4.534  1.00 0.00 ? 18  VAL A HG12 2  
ATOM 1701  H HG13 . VAL A 1 10 ? 6.228   19.610  -3.740  1.00 0.00 ? 18  VAL A HG13 2  
ATOM 1702  H HG21 . VAL A 1 10 ? 3.586   19.918  -5.669  1.00 0.00 ? 18  VAL A HG21 2  
ATOM 1703  H HG22 . VAL A 1 10 ? 2.973   18.920  -4.351  1.00 0.00 ? 18  VAL A HG22 2  
ATOM 1704  H HG23 . VAL A 1 10 ? 4.641   18.737  -4.895  1.00 0.00 ? 18  VAL A HG23 2  
ATOM 1705  N N    . GLY A 1 11 ? 1.845   21.341  -1.333  1.00 0.00 ? 19  GLY A N    2  
ATOM 1706  C CA   . GLY A 1 11 ? 0.453   21.729  -1.210  1.00 0.00 ? 19  GLY A CA   2  
ATOM 1707  C C    . GLY A 1 11 ? -0.300  20.877  -0.206  1.00 0.00 ? 19  GLY A C    2  
ATOM 1708  O O    . GLY A 1 11 ? -1.287  21.324  0.379   1.00 0.00 ? 19  GLY A O    2  
ATOM 1709  H H    . GLY A 1 11 ? 2.506   21.688  -0.698  1.00 0.00 ? 19  GLY A H    2  
ATOM 1710  H HA2  . GLY A 1 11 ? 0.404   22.762  -0.898  1.00 0.00 ? 19  GLY A HA2  2  
ATOM 1711  H HA3  . GLY A 1 11 ? -0.023  21.632  -2.174  1.00 0.00 ? 19  GLY A HA3  2  
ATOM 1712  N N    . SER A 1 12 ? 0.167   19.649  -0.007  1.00 0.00 ? 20  SER A N    2  
ATOM 1713  C CA   . SER A 1 12 ? -0.469  18.732  0.933   1.00 0.00 ? 20  SER A CA   2  
ATOM 1714  C C    . SER A 1 12 ? 0.528   18.266  1.992   1.00 0.00 ? 20  SER A C    2  
ATOM 1715  O O    . SER A 1 12 ? 1.657   18.752  2.051   1.00 0.00 ? 20  SER A O    2  
ATOM 1716  C CB   . SER A 1 12 ? -1.045  17.528  0.187   1.00 0.00 ? 20  SER A CB   2  
ATOM 1717  O OG   . SER A 1 12 ? -2.088  17.923  -0.688  1.00 0.00 ? 20  SER A OG   2  
ATOM 1718  H H    . SER A 1 12 ? 0.958   19.351  -0.503  1.00 0.00 ? 20  SER A H    2  
ATOM 1719  H HA   . SER A 1 12 ? -1.273  19.262  1.421   1.00 0.00 ? 20  SER A HA   2  
ATOM 1720  H HB2  . SER A 1 12 ? -0.264  17.060  -0.394  1.00 0.00 ? 20  SER A HB2  2  
ATOM 1721  H HB3  . SER A 1 12 ? -1.439  16.819  0.900   1.00 0.00 ? 20  SER A HB3  2  
ATOM 1722  H HG   . SER A 1 12 ? -2.517  17.143  -1.048  1.00 0.00 ? 20  SER A HG   2  
ATOM 1723  N N    . ARG A 1 13 ? 0.102   17.326  2.830   1.00 0.00 ? 21  ARG A N    2  
ATOM 1724  C CA   . ARG A 1 13 ? 0.958   16.802  3.888   1.00 0.00 ? 21  ARG A CA   2  
ATOM 1725  C C    . ARG A 1 13 ? 1.392   15.369  3.592   1.00 0.00 ? 21  ARG A C    2  
ATOM 1726  O O    . ARG A 1 13 ? 0.577   14.447  3.603   1.00 0.00 ? 21  ARG A O    2  
ATOM 1727  C CB   . ARG A 1 13 ? 0.232   16.857  5.233   1.00 0.00 ? 21  ARG A CB   2  
ATOM 1728  C CG   . ARG A 1 13 ? -1.171  16.277  5.189   1.00 0.00 ? 21  ARG A CG   2  
ATOM 1729  C CD   . ARG A 1 13 ? -2.206  17.335  4.839   1.00 0.00 ? 21  ARG A CD   2  
ATOM 1730  N NE   . ARG A 1 13 ? -3.223  17.468  5.879   1.00 0.00 ? 21  ARG A NE   2  
ATOM 1731  C CZ   . ARG A 1 13 ? -4.034  18.519  5.994   1.00 0.00 ? 21  ARG A CZ   2  
ATOM 1732  N NH1  . ARG A 1 13 ? -3.948  19.529  5.138   1.00 0.00 ? 21  ARG A NH1  2  
ATOM 1733  N NH2  . ARG A 1 13 ? -4.931  18.559  6.969   1.00 0.00 ? 21  ARG A NH2  2  
ATOM 1734  H H    . ARG A 1 13 ? -0.810  16.978  2.737   1.00 0.00 ? 21  ARG A H    2  
ATOM 1735  H HA   . ARG A 1 13 ? 1.837   17.426  3.941   1.00 0.00 ? 21  ARG A HA   2  
ATOM 1736  H HB2  . ARG A 1 13 ? 0.804   16.304  5.962   1.00 0.00 ? 21  ARG A HB2  2  
ATOM 1737  H HB3  . ARG A 1 13 ? 0.163   17.887  5.548   1.00 0.00 ? 21  ARG A HB3  2  
ATOM 1738  H HG2  . ARG A 1 13 ? -1.205  15.496  4.443   1.00 0.00 ? 21  ARG A HG2  2  
ATOM 1739  H HG3  . ARG A 1 13 ? -1.406  15.862  6.156   1.00 0.00 ? 21  ARG A HG3  2  
ATOM 1740  H HD2  . ARG A 1 13 ? -1.706  18.285  4.715   1.00 0.00 ? 21  ARG A HD2  2  
ATOM 1741  H HD3  . ARG A 1 13 ? -2.686  17.059  3.912   1.00 0.00 ? 21  ARG A HD3  2  
ATOM 1742  H HE   . ARG A 1 13 ? -3.309  16.737  6.525   1.00 0.00 ? 21  ARG A HE   2  
ATOM 1743  H HH11 . ARG A 1 13 ? -3.273  19.506  4.400   1.00 0.00 ? 21  ARG A HH11 2  
ATOM 1744  H HH12 . ARG A 1 13 ? -4.559  20.316  5.230   1.00 0.00 ? 21  ARG A HH12 2  
ATOM 1745  H HH21 . ARG A 1 13 ? -5.000  17.801  7.617   1.00 0.00 ? 21  ARG A HH21 2  
ATOM 1746  H HH22 . ARG A 1 13 ? -5.540  19.349  7.056   1.00 0.00 ? 21  ARG A HH22 2  
ATOM 1747  N N    . GLY A 1 14 ? 2.685   15.191  3.333   1.00 0.00 ? 22  GLY A N    2  
ATOM 1748  C CA   . GLY A 1 14 ? 3.214   13.869  3.043   1.00 0.00 ? 22  GLY A CA   2  
ATOM 1749  C C    . GLY A 1 14 ? 2.455   13.158  1.938   1.00 0.00 ? 22  GLY A C    2  
ATOM 1750  O O    . GLY A 1 14 ? 2.622   13.473  0.760   1.00 0.00 ? 22  GLY A O    2  
ATOM 1751  H H    . GLY A 1 14 ? 3.286   15.964  3.341   1.00 0.00 ? 22  GLY A H    2  
ATOM 1752  H HA2  . GLY A 1 14 ? 4.248   13.966  2.747   1.00 0.00 ? 22  GLY A HA2  2  
ATOM 1753  H HA3  . GLY A 1 14 ? 3.163   13.271  3.940   1.00 0.00 ? 22  GLY A HA3  2  
ATOM 1754  N N    . LEU A 1 15 ? 1.625   12.193  2.322   1.00 0.00 ? 23  LEU A N    2  
ATOM 1755  C CA   . LEU A 1 15 ? 0.841   11.428  1.359   1.00 0.00 ? 23  LEU A CA   2  
ATOM 1756  C C    . LEU A 1 15 ? -0.645  11.492  1.704   1.00 0.00 ? 23  LEU A C    2  
ATOM 1757  O O    . LEU A 1 15 ? -1.443  12.063  0.961   1.00 0.00 ? 23  LEU A O    2  
ATOM 1758  C CB   . LEU A 1 15 ? 1.318   9.974   1.335   1.00 0.00 ? 23  LEU A CB   2  
ATOM 1759  C CG   . LEU A 1 15 ? 0.337   8.966   0.730   1.00 0.00 ? 23  LEU A CG   2  
ATOM 1760  C CD1  . LEU A 1 15 ? 0.135   9.237   -0.751  1.00 0.00 ? 23  LEU A CD1  2  
ATOM 1761  C CD2  . LEU A 1 15 ? 0.833   7.544   0.951   1.00 0.00 ? 23  LEU A CD2  2  
ATOM 1762  H H    . LEU A 1 15 ? 1.540   11.987  3.275   1.00 0.00 ? 23  LEU A H    2  
ATOM 1763  H HA   . LEU A 1 15 ? 0.993   11.866  0.385   1.00 0.00 ? 23  LEU A HA   2  
ATOM 1764  H HB2  . LEU A 1 15 ? 2.238   9.928   0.774   1.00 0.00 ? 23  LEU A HB2  2  
ATOM 1765  H HB3  . LEU A 1 15 ? 1.522   9.672   2.350   1.00 0.00 ? 23  LEU A HB3  2  
ATOM 1766  H HG   . LEU A 1 15 ? -0.619  9.068   1.222   1.00 0.00 ? 23  LEU A HG   2  
ATOM 1767  H HD11 . LEU A 1 15 ? -0.242  10.241  -0.884  1.00 0.00 ? 23  LEU A HD11 2  
ATOM 1768  H HD12 . LEU A 1 15 ? -0.576  8.530   -1.153  1.00 0.00 ? 23  LEU A HD12 2  
ATOM 1769  H HD13 . LEU A 1 15 ? 1.078   9.135   -1.268  1.00 0.00 ? 23  LEU A HD13 2  
ATOM 1770  H HD21 . LEU A 1 15 ? 0.542   6.926   0.116   1.00 0.00 ? 23  LEU A HD21 2  
ATOM 1771  H HD22 . LEU A 1 15 ? 0.398   7.150   1.859   1.00 0.00 ? 23  LEU A HD22 2  
ATOM 1772  H HD23 . LEU A 1 15 ? 1.909   7.548   1.040   1.00 0.00 ? 23  LEU A HD23 2  
ATOM 1773  N N    . GLY A 1 16 ? -1.008  10.892  2.834   1.00 0.00 ? 24  GLY A N    2  
ATOM 1774  C CA   . GLY A 1 16 ? -2.395  10.884  3.256   1.00 0.00 ? 24  GLY A CA   2  
ATOM 1775  C C    . GLY A 1 16 ? -2.995  9.492   3.226   1.00 0.00 ? 24  GLY A C    2  
ATOM 1776  O O    . GLY A 1 16 ? -4.204  9.333   3.053   1.00 0.00 ? 24  GLY A O    2  
ATOM 1777  H H    . GLY A 1 16 ? -0.328  10.451  3.383   1.00 0.00 ? 24  GLY A H    2  
ATOM 1778  H HA2  . GLY A 1 16 ? -2.460  11.273  4.260   1.00 0.00 ? 24  GLY A HA2  2  
ATOM 1779  H HA3  . GLY A 1 16 ? -2.965  11.521  2.597   1.00 0.00 ? 24  GLY A HA3  2  
ATOM 1780  N N    . CYS A 1 17 ? -2.150  8.480   3.389   1.00 0.00 ? 25  CYS A N    2  
ATOM 1781  C CA   . CYS A 1 17 ? -2.603  7.095   3.375   1.00 0.00 ? 25  CYS A CA   2  
ATOM 1782  C C    . CYS A 1 17 ? -1.659  6.205   4.175   1.00 0.00 ? 25  CYS A C    2  
ATOM 1783  O O    . CYS A 1 17 ? -0.484  6.529   4.351   1.00 0.00 ? 25  CYS A O    2  
ATOM 1784  C CB   . CYS A 1 17 ? -2.699  6.586   1.936   1.00 0.00 ? 25  CYS A CB   2  
ATOM 1785  S SG   . CYS A 1 17 ? -3.269  4.878   1.793   1.00 0.00 ? 25  CYS A SG   2  
ATOM 1786  H H    . CYS A 1 17 ? -1.197  8.671   3.519   1.00 0.00 ? 25  CYS A H    2  
ATOM 1787  H HA   . CYS A 1 17 ? -3.582  7.060   3.823   1.00 0.00 ? 25  CYS A HA   2  
ATOM 1788  H HB2  . CYS A 1 17 ? -3.390  7.210   1.390   1.00 0.00 ? 25  CYS A HB2  2  
ATOM 1789  H HB3  . CYS A 1 17 ? -1.724  6.650   1.474   1.00 0.00 ? 25  CYS A HB3  2  
ATOM 1790  H HG   . CYS A 1 17 ? -3.460  4.706   0.867   1.00 0.00 ? 25  CYS A HG   2  
ATOM 1791  N N    . SER A 1 18 ? -2.176  5.076   4.654   1.00 0.00 ? 26  SER A N    2  
ATOM 1792  C CA   . SER A 1 18 ? -1.373  4.136   5.426   1.00 0.00 ? 26  SER A CA   2  
ATOM 1793  C C    . SER A 1 18 ? -1.233  2.824   4.667   1.00 0.00 ? 26  SER A C    2  
ATOM 1794  O O    . SER A 1 18 ? -2.202  2.324   4.105   1.00 0.00 ? 26  SER A O    2  
ATOM 1795  C CB   . SER A 1 18 ? -2.013  3.887   6.793   1.00 0.00 ? 26  SER A CB   2  
ATOM 1796  O OG   . SER A 1 18 ? -1.077  3.332   7.701   1.00 0.00 ? 26  SER A OG   2  
ATOM 1797  H H    . SER A 1 18 ? -3.120  4.866   4.476   1.00 0.00 ? 26  SER A H    2  
ATOM 1798  H HA   . SER A 1 18 ? -0.394  4.567   5.565   1.00 0.00 ? 26  SER A HA   2  
ATOM 1799  H HB2  . SER A 1 18 ? -2.375  4.820   7.194   1.00 0.00 ? 26  SER A HB2  2  
ATOM 1800  H HB3  . SER A 1 18 ? -2.839  3.199   6.681   1.00 0.00 ? 26  SER A HB3  2  
ATOM 1801  H HG   . SER A 1 18 ? -1.516  3.129   8.530   1.00 0.00 ? 26  SER A HG   2  
ATOM 1802  N N    . ILE A 1 19 ? -0.026  2.271   4.640   1.00 0.00 ? 27  ILE A N    2  
ATOM 1803  C CA   . ILE A 1 19 ? 0.213   1.019   3.932   1.00 0.00 ? 27  ILE A CA   2  
ATOM 1804  C C    . ILE A 1 19 ? 0.280   -0.161  4.894   1.00 0.00 ? 27  ILE A C    2  
ATOM 1805  O O    . ILE A 1 19 ? 0.735   -0.029  6.029   1.00 0.00 ? 27  ILE A O    2  
ATOM 1806  C CB   . ILE A 1 19 ? 1.512   1.073   3.106   1.00 0.00 ? 27  ILE A CB   2  
ATOM 1807  C CG1  . ILE A 1 19 ? 2.679   1.554   3.967   1.00 0.00 ? 27  ILE A CG1  2  
ATOM 1808  C CG2  . ILE A 1 19 ? 1.332   1.977   1.896   1.00 0.00 ? 27  ILE A CG2  2  
ATOM 1809  C CD1  . ILE A 1 19 ? 4.006   1.532   3.243   1.00 0.00 ? 27  ILE A CD1  2  
ATOM 1810  H H    . ILE A 1 19 ? 0.716   2.716   5.099   1.00 0.00 ? 27  ILE A H    2  
ATOM 1811  H HA   . ILE A 1 19 ? -0.612  0.864   3.251   1.00 0.00 ? 27  ILE A HA   2  
ATOM 1812  H HB   . ILE A 1 19 ? 1.724   0.076   2.749   1.00 0.00 ? 27  ILE A HB   2  
ATOM 1813  H HG12 . ILE A 1 19 ? 2.491   2.568   4.284   1.00 0.00 ? 27  ILE A HG12 2  
ATOM 1814  H HG13 . ILE A 1 19 ? 2.764   0.919   4.837   1.00 0.00 ? 27  ILE A HG13 2  
ATOM 1815  H HG21 . ILE A 1 19 ? 1.049   1.384   1.040   1.00 0.00 ? 27  ILE A HG21 2  
ATOM 1816  H HG22 . ILE A 1 19 ? 2.260   2.490   1.689   1.00 0.00 ? 27  ILE A HG22 2  
ATOM 1817  H HG23 . ILE A 1 19 ? 0.558   2.703   2.102   1.00 0.00 ? 27  ILE A HG23 2  
ATOM 1818  H HD11 . ILE A 1 19 ? 4.510   2.476   3.389   1.00 0.00 ? 27  ILE A HD11 2  
ATOM 1819  H HD12 . ILE A 1 19 ? 3.836   1.374   2.188   1.00 0.00 ? 27  ILE A HD12 2  
ATOM 1820  H HD13 . ILE A 1 19 ? 4.617   0.732   3.633   1.00 0.00 ? 27  ILE A HD13 2  
ATOM 1821  N N    . SER A 1 20 ? -0.179  -1.316  4.424   1.00 0.00 ? 28  SER A N    2  
ATOM 1822  C CA   . SER A 1 20 ? -0.178  -2.530  5.234   1.00 0.00 ? 28  SER A CA   2  
ATOM 1823  C C    . SER A 1 20 ? 0.470   -3.684  4.476   1.00 0.00 ? 28  SER A C    2  
ATOM 1824  O O    . SER A 1 20 ? 0.606   -3.638  3.254   1.00 0.00 ? 28  SER A O    2  
ATOM 1825  C CB   . SER A 1 20 ? -1.609  -2.904  5.628   1.00 0.00 ? 28  SER A CB   2  
ATOM 1826  O OG   . SER A 1 20 ? -2.482  -2.834  4.514   1.00 0.00 ? 28  SER A OG   2  
ATOM 1827  H H    . SER A 1 20 ? -0.529  -1.354  3.509   1.00 0.00 ? 28  SER A H    2  
ATOM 1828  H HA   . SER A 1 20 ? 0.393   -2.334  6.127   1.00 0.00 ? 28  SER A HA   2  
ATOM 1829  H HB2  . SER A 1 20 ? -1.621  -3.911  6.016   1.00 0.00 ? 28  SER A HB2  2  
ATOM 1830  H HB3  . SER A 1 20 ? -1.959  -2.222  6.390   1.00 0.00 ? 28  SER A HB3  2  
ATOM 1831  H HG   . SER A 1 20 ? -3.147  -3.522  4.586   1.00 0.00 ? 28  SER A HG   2  
ATOM 1832  N N    . SER A 1 21 ? 0.869   -4.717  5.209   1.00 0.00 ? 29  SER A N    2  
ATOM 1833  C CA   . SER A 1 21 ? 1.503   -5.881  4.603   1.00 0.00 ? 29  SER A CA   2  
ATOM 1834  C C    . SER A 1 21 ? 0.537   -7.061  4.556   1.00 0.00 ? 29  SER A C    2  
ATOM 1835  O O    . SER A 1 21 ? -0.280  -7.244  5.458   1.00 0.00 ? 29  SER A O    2  
ATOM 1836  C CB   . SER A 1 21 ? 2.764   -6.264  5.383   1.00 0.00 ? 29  SER A CB   2  
ATOM 1837  O OG   . SER A 1 21 ? 3.889   -6.348  4.525   1.00 0.00 ? 29  SER A OG   2  
ATOM 1838  H H    . SER A 1 21 ? 0.735   -4.697  6.180   1.00 0.00 ? 29  SER A H    2  
ATOM 1839  H HA   . SER A 1 21 ? 1.782   -5.618  3.593   1.00 0.00 ? 29  SER A HA   2  
ATOM 1840  H HB2  . SER A 1 21 ? 2.958   -5.515  6.137   1.00 0.00 ? 29  SER A HB2  2  
ATOM 1841  H HB3  . SER A 1 21 ? 2.616   -7.222  5.857   1.00 0.00 ? 29  SER A HB3  2  
ATOM 1842  H HG   . SER A 1 21 ? 4.083   -5.479  4.167   1.00 0.00 ? 29  SER A HG   2  
ATOM 1843  N N    . GLY A 1 22 ? 0.636   -7.856  3.496   1.00 0.00 ? 30  GLY A N    2  
ATOM 1844  C CA   . GLY A 1 22 ? -0.237  -9.005  3.348   1.00 0.00 ? 30  GLY A CA   2  
ATOM 1845  C C    . GLY A 1 22 ? 0.329   -10.256 3.998   1.00 0.00 ? 30  GLY A C    2  
ATOM 1846  O O    . GLY A 1 22 ? 1.465   -10.250 4.471   1.00 0.00 ? 30  GLY A O    2  
ATOM 1847  H H    . GLY A 1 22 ? 1.305   -7.660  2.808   1.00 0.00 ? 30  GLY A H    2  
ATOM 1848  H HA2  . GLY A 1 22 ? -1.191  -8.780  3.801   1.00 0.00 ? 30  GLY A HA2  2  
ATOM 1849  H HA3  . GLY A 1 22 ? -0.387  -9.197  2.296   1.00 0.00 ? 30  GLY A HA3  2  
ATOM 1850  N N    . PRO A 1 23 ? -0.449  -11.350 4.037   1.00 0.00 ? 31  PRO A N    2  
ATOM 1851  C CA   . PRO A 1 23 ? -0.007  -12.611 4.641   1.00 0.00 ? 31  PRO A CA   2  
ATOM 1852  C C    . PRO A 1 23 ? 1.059   -13.312 3.806   1.00 0.00 ? 31  PRO A C    2  
ATOM 1853  O O    . PRO A 1 23 ? 1.618   -12.730 2.876   1.00 0.00 ? 31  PRO A O    2  
ATOM 1854  C CB   . PRO A 1 23 ? -1.286  -13.449 4.686   1.00 0.00 ? 31  PRO A CB   2  
ATOM 1855  C CG   . PRO A 1 23 ? -2.127  -12.913 3.580   1.00 0.00 ? 31  PRO A CG   2  
ATOM 1856  C CD   . PRO A 1 23 ? -1.820  -11.444 3.498   1.00 0.00 ? 31  PRO A CD   2  
ATOM 1857  H HA   . PRO A 1 23 ? 0.363   -12.459 5.644   1.00 0.00 ? 31  PRO A HA   2  
ATOM 1858  H HB2  . PRO A 1 23 ? -1.042  -14.490 4.530   1.00 0.00 ? 31  PRO A HB2  2  
ATOM 1859  H HB3  . PRO A 1 23 ? -1.769  -13.326 5.643   1.00 0.00 ? 31  PRO A HB3  2  
ATOM 1860  H HG2  . PRO A 1 23 ? -1.870  -13.404 2.653   1.00 0.00 ? 31  PRO A HG2  2  
ATOM 1861  H HG3  . PRO A 1 23 ? -3.173  -13.066 3.809   1.00 0.00 ? 31  PRO A HG3  2  
ATOM 1862  H HD2  . PRO A 1 23 ? -1.854  -11.109 2.471   1.00 0.00 ? 31  PRO A HD2  2  
ATOM 1863  H HD3  . PRO A 1 23 ? -2.512  -10.879 4.105   1.00 0.00 ? 31  PRO A HD3  2  
ATOM 1864  N N    . ILE A 1 24 ? 1.336   -14.566 4.148   1.00 0.00 ? 32  ILE A N    2  
ATOM 1865  C CA   . ILE A 1 24 ? 2.334   -15.353 3.434   1.00 0.00 ? 32  ILE A CA   2  
ATOM 1866  C C    . ILE A 1 24 ? 1.871   -15.673 2.016   1.00 0.00 ? 32  ILE A C    2  
ATOM 1867  O O    . ILE A 1 24 ? 2.686   -15.857 1.113   1.00 0.00 ? 32  ILE A O    2  
ATOM 1868  C CB   . ILE A 1 24 ? 2.639   -16.670 4.175   1.00 0.00 ? 32  ILE A CB   2  
ATOM 1869  C CG1  . ILE A 1 24 ? 3.057   -16.385 5.619   1.00 0.00 ? 32  ILE A CG1  2  
ATOM 1870  C CG2  . ILE A 1 24 ? 3.726   -17.453 3.450   1.00 0.00 ? 32  ILE A CG2  2  
ATOM 1871  C CD1  . ILE A 1 24 ? 2.497   -17.375 6.617   1.00 0.00 ? 32  ILE A CD1  2  
ATOM 1872  H H    . ILE A 1 24 ? 0.857   -14.972 4.899   1.00 0.00 ? 32  ILE A H    2  
ATOM 1873  H HA   . ILE A 1 24 ? 3.245   -14.773 3.384   1.00 0.00 ? 32  ILE A HA   2  
ATOM 1874  H HB   . ILE A 1 24 ? 1.743   -17.270 4.180   1.00 0.00 ? 32  ILE A HB   2  
ATOM 1875  H HG12 . ILE A 1 24 ? 4.134   -16.418 5.688   1.00 0.00 ? 32  ILE A HG12 2  
ATOM 1876  H HG13 . ILE A 1 24 ? 2.713   -15.401 5.899   1.00 0.00 ? 32  ILE A HG13 2  
ATOM 1877  H HG21 . ILE A 1 24 ? 3.856   -18.413 3.927   1.00 0.00 ? 32  ILE A HG21 2  
ATOM 1878  H HG22 . ILE A 1 24 ? 4.654   -16.902 3.488   1.00 0.00 ? 32  ILE A HG22 2  
ATOM 1879  H HG23 . ILE A 1 24 ? 3.435   -17.599 2.420   1.00 0.00 ? 32  ILE A HG23 2  
ATOM 1880  H HD11 . ILE A 1 24 ? 2.826   -17.110 7.610   1.00 0.00 ? 32  ILE A HD11 2  
ATOM 1881  H HD12 . ILE A 1 24 ? 2.848   -18.367 6.374   1.00 0.00 ? 32  ILE A HD12 2  
ATOM 1882  H HD13 . ILE A 1 24 ? 1.418   -17.355 6.578   1.00 0.00 ? 32  ILE A HD13 2  
ATOM 1883  N N    . GLN A 1 25 ? 0.558   -15.745 1.833   1.00 0.00 ? 33  GLN A N    2  
ATOM 1884  C CA   . GLN A 1 25 ? -0.016  -16.049 0.527   1.00 0.00 ? 33  GLN A CA   2  
ATOM 1885  C C    . GLN A 1 25 ? 0.252   -14.925 -0.469  1.00 0.00 ? 33  GLN A C    2  
ATOM 1886  O O    . GLN A 1 25 ? 0.305   -15.155 -1.678  1.00 0.00 ? 33  GLN A O    2  
ATOM 1887  C CB   . GLN A 1 25 ? -1.522  -16.288 0.655   1.00 0.00 ? 33  GLN A CB   2  
ATOM 1888  C CG   . GLN A 1 25 ? -1.887  -17.292 1.737   1.00 0.00 ? 33  GLN A CG   2  
ATOM 1889  C CD   . GLN A 1 25 ? -1.413  -18.695 1.412   1.00 0.00 ? 33  GLN A CD   2  
ATOM 1890  O OE1  . GLN A 1 25 ? -1.697  -19.227 0.338   1.00 0.00 ? 33  GLN A OE1  2  
ATOM 1891  N NE2  . GLN A 1 25 ? -0.686  -19.304 2.342   1.00 0.00 ? 33  GLN A NE2  2  
ATOM 1892  H H    . GLN A 1 25 ? -0.041  -15.592 2.593   1.00 0.00 ? 33  GLN A H    2  
ATOM 1893  H HA   . GLN A 1 25 ? 0.451   -16.952 0.165   1.00 0.00 ? 33  GLN A HA   2  
ATOM 1894  H HB2  . GLN A 1 25 ? -2.005  -15.350 0.887   1.00 0.00 ? 33  GLN A HB2  2  
ATOM 1895  H HB3  . GLN A 1 25 ? -1.898  -16.654 -0.288  1.00 0.00 ? 33  GLN A HB3  2  
ATOM 1896  H HG2  . GLN A 1 25 ? -1.433  -16.983 2.666   1.00 0.00 ? 33  GLN A HG2  2  
ATOM 1897  H HG3  . GLN A 1 25 ? -2.960  -17.308 1.848   1.00 0.00 ? 33  GLN A HG3  2  
ATOM 1898  H HE21 . GLN A 1 25 ? -0.499  -18.818 3.173   1.00 0.00 ? 33  GLN A HE21 2  
ATOM 1899  H HE22 . GLN A 1 25 ? -0.367  -20.211 2.159   1.00 0.00 ? 33  GLN A HE22 2  
ATOM 1900  N N    . LYS A 1 26 ? 0.418   -13.708 0.042   1.00 0.00 ? 34  LYS A N    2  
ATOM 1901  C CA   . LYS A 1 26 ? 0.679   -12.554 -0.811  1.00 0.00 ? 34  LYS A CA   2  
ATOM 1902  C C    . LYS A 1 26 ? 1.428   -11.463 -0.047  1.00 0.00 ? 34  LYS A C    2  
ATOM 1903  O O    . LYS A 1 26 ? 0.839   -10.460 0.356   1.00 0.00 ? 34  LYS A O    2  
ATOM 1904  C CB   . LYS A 1 26 ? -0.634  -11.999 -1.365  1.00 0.00 ? 34  LYS A CB   2  
ATOM 1905  C CG   . LYS A 1 26 ? -0.527  -11.492 -2.794  1.00 0.00 ? 34  LYS A CG   2  
ATOM 1906  C CD   . LYS A 1 26 ? -1.749  -10.681 -3.194  1.00 0.00 ? 34  LYS A CD   2  
ATOM 1907  C CE   . LYS A 1 26 ? -2.226  -11.044 -4.591  1.00 0.00 ? 34  LYS A CE   2  
ATOM 1908  N NZ   . LYS A 1 26 ? -1.745  -10.075 -5.613  1.00 0.00 ? 34  LYS A NZ   2  
ATOM 1909  H H    . LYS A 1 26 ? 0.363   -13.583 1.012   1.00 0.00 ? 34  LYS A H    2  
ATOM 1910  H HA   . LYS A 1 26 ? 1.293   -12.885 -1.635  1.00 0.00 ? 34  LYS A HA   2  
ATOM 1911  H HB2  . LYS A 1 26 ? -1.382  -12.778 -1.339  1.00 0.00 ? 34  LYS A HB2  2  
ATOM 1912  H HB3  . LYS A 1 26 ? -0.959  -11.180 -0.740  1.00 0.00 ? 34  LYS A HB3  2  
ATOM 1913  H HG2  . LYS A 1 26 ? 0.351   -10.867 -2.879  1.00 0.00 ? 34  LYS A HG2  2  
ATOM 1914  H HG3  . LYS A 1 26 ? -0.432  -12.338 -3.459  1.00 0.00 ? 34  LYS A HG3  2  
ATOM 1915  H HD2  . LYS A 1 26 ? -2.545  -10.876 -2.492  1.00 0.00 ? 34  LYS A HD2  2  
ATOM 1916  H HD3  . LYS A 1 26 ? -1.496  -9.631  -3.172  1.00 0.00 ? 34  LYS A HD3  2  
ATOM 1917  H HE2  . LYS A 1 26 ? -1.857  -12.027 -4.840  1.00 0.00 ? 34  LYS A HE2  2  
ATOM 1918  H HE3  . LYS A 1 26 ? -3.306  -11.054 -4.597  1.00 0.00 ? 34  LYS A HE3  2  
ATOM 1919  H HZ1  . LYS A 1 26 ? -2.212  -9.155  -5.481  1.00 0.00 ? 34  LYS A HZ1  2  
ATOM 1920  H HZ2  . LYS A 1 26 ? -1.961  -10.425 -6.568  1.00 0.00 ? 34  LYS A HZ2  2  
ATOM 1921  H HZ3  . LYS A 1 26 ? -0.717  -9.947  -5.527  1.00 0.00 ? 34  LYS A HZ3  2  
ATOM 1922  N N    . PRO A 1 27 ? 2.743   -11.648 0.161   1.00 0.00 ? 35  PRO A N    2  
ATOM 1923  C CA   . PRO A 1 27 ? 3.571   -10.676 0.879   1.00 0.00 ? 35  PRO A CA   2  
ATOM 1924  C C    . PRO A 1 27 ? 3.946   -9.481  0.008   1.00 0.00 ? 35  PRO A C    2  
ATOM 1925  O O    . PRO A 1 27 ? 4.365   -9.644  -1.138  1.00 0.00 ? 35  PRO A O    2  
ATOM 1926  C CB   . PRO A 1 27 ? 4.813   -11.486 1.240   1.00 0.00 ? 35  PRO A CB   2  
ATOM 1927  C CG   . PRO A 1 27 ? 4.933   -12.492 0.147   1.00 0.00 ? 35  PRO A CG   2  
ATOM 1928  C CD   . PRO A 1 27 ? 3.525   -12.818 -0.285  1.00 0.00 ? 35  PRO A CD   2  
ATOM 1929  H HA   . PRO A 1 27 ? 3.087   -10.328 1.779   1.00 0.00 ? 35  PRO A HA   2  
ATOM 1930  H HB2  . PRO A 1 27 ? 5.674   -10.834 1.276   1.00 0.00 ? 35  PRO A HB2  2  
ATOM 1931  H HB3  . PRO A 1 27 ? 4.672   -11.961 2.198   1.00 0.00 ? 35  PRO A HB3  2  
ATOM 1932  H HG2  . PRO A 1 27 ? 5.489   -12.072 -0.678  1.00 0.00 ? 35  PRO A HG2  2  
ATOM 1933  H HG3  . PRO A 1 27 ? 5.425   -13.379 0.518   1.00 0.00 ? 35  PRO A HG3  2  
ATOM 1934  H HD2  . PRO A 1 27 ? 3.476   -12.926 -1.357  1.00 0.00 ? 35  PRO A HD2  2  
ATOM 1935  H HD3  . PRO A 1 27 ? 3.182   -13.717 0.203   1.00 0.00 ? 35  PRO A HD3  2  
ATOM 1936  N N    . GLY A 1 28 ? 3.793   -8.280  0.556   1.00 0.00 ? 36  GLY A N    2  
ATOM 1937  C CA   . GLY A 1 28 ? 4.122   -7.077  -0.188  1.00 0.00 ? 36  GLY A CA   2  
ATOM 1938  C C    . GLY A 1 28 ? 3.534   -5.827  0.437   1.00 0.00 ? 36  GLY A C    2  
ATOM 1939  O O    . GLY A 1 28 ? 2.861   -5.896  1.465   1.00 0.00 ? 36  GLY A O    2  
ATOM 1940  H H    . GLY A 1 28 ? 3.454   -8.209  1.474   1.00 0.00 ? 36  GLY A H    2  
ATOM 1941  H HA2  . GLY A 1 28 ? 5.195   -6.976  -0.229  1.00 0.00 ? 36  GLY A HA2  2  
ATOM 1942  H HA3  . GLY A 1 28 ? 3.742   -7.176  -1.195  1.00 0.00 ? 36  GLY A HA3  2  
ATOM 1943  N N    . ILE A 1 29 ? 3.789   -4.681  -0.186  1.00 0.00 ? 37  ILE A N    2  
ATOM 1944  C CA   . ILE A 1 29 ? 3.282   -3.408  0.314   1.00 0.00 ? 37  ILE A CA   2  
ATOM 1945  C C    . ILE A 1 29 ? 1.900   -3.107  -0.254  1.00 0.00 ? 37  ILE A C    2  
ATOM 1946  O O    . ILE A 1 29 ? 1.742   -2.910  -1.460  1.00 0.00 ? 37  ILE A O    2  
ATOM 1947  C CB   . ILE A 1 29 ? 4.231   -2.246  -0.033  1.00 0.00 ? 37  ILE A CB   2  
ATOM 1948  C CG1  . ILE A 1 29 ? 5.681   -2.633  0.262   1.00 0.00 ? 37  ILE A CG1  2  
ATOM 1949  C CG2  . ILE A 1 29 ? 3.843   -0.995  0.743   1.00 0.00 ? 37  ILE A CG2  2  
ATOM 1950  C CD1  . ILE A 1 29 ? 5.917   -3.042  1.700   1.00 0.00 ? 37  ILE A CD1  2  
ATOM 1951  H H    . ILE A 1 29 ? 4.332   -4.690  -1.002  1.00 0.00 ? 37  ILE A H    2  
ATOM 1952  H HA   . ILE A 1 29 ? 3.209   -3.478  1.390   1.00 0.00 ? 37  ILE A HA   2  
ATOM 1953  H HB   . ILE A 1 29 ? 4.130   -2.030  -1.086  1.00 0.00 ? 37  ILE A HB   2  
ATOM 1954  H HG12 . ILE A 1 29 ? 5.961   -3.462  -0.367  1.00 0.00 ? 37  ILE A HG12 2  
ATOM 1955  H HG13 . ILE A 1 29 ? 6.322   -1.789  0.047   1.00 0.00 ? 37  ILE A HG13 2  
ATOM 1956  H HG21 . ILE A 1 29 ? 3.989   -0.125  0.120   1.00 0.00 ? 37  ILE A HG21 2  
ATOM 1957  H HG22 . ILE A 1 29 ? 4.459   -0.913  1.625   1.00 0.00 ? 37  ILE A HG22 2  
ATOM 1958  H HG23 . ILE A 1 29 ? 2.804   -1.060  1.033   1.00 0.00 ? 37  ILE A HG23 2  
ATOM 1959  H HD11 . ILE A 1 29 ? 5.940   -2.162  2.326   1.00 0.00 ? 37  ILE A HD11 2  
ATOM 1960  H HD12 . ILE A 1 29 ? 6.860   -3.562  1.777   1.00 0.00 ? 37  ILE A HD12 2  
ATOM 1961  H HD13 . ILE A 1 29 ? 5.118   -3.692  2.024   1.00 0.00 ? 37  ILE A HD13 2  
ATOM 1962  N N    . PHE A 1 30 ? 0.899   -3.076  0.620   1.00 0.00 ? 38  PHE A N    2  
ATOM 1963  C CA   . PHE A 1 30 ? -0.472  -2.802  0.204   1.00 0.00 ? 38  PHE A CA   2  
ATOM 1964  C C    . PHE A 1 30 ? -0.925  -1.426  0.675   1.00 0.00 ? 38  PHE A C    2  
ATOM 1965  O O    . PHE A 1 30 ? -0.213  -0.745  1.414   1.00 0.00 ? 38  PHE A O    2  
ATOM 1966  C CB   . PHE A 1 30 ? -1.414  -3.879  0.747   1.00 0.00 ? 38  PHE A CB   2  
ATOM 1967  C CG   . PHE A 1 30 ? -1.050  -5.267  0.304   1.00 0.00 ? 38  PHE A CG   2  
ATOM 1968  C CD1  . PHE A 1 30 ? 0.067   -5.902  0.821   1.00 0.00 ? 38  PHE A CD1  2  
ATOM 1969  C CD2  . PHE A 1 30 ? -1.823  -5.933  -0.631  1.00 0.00 ? 38  PHE A CD2  2  
ATOM 1970  C CE1  . PHE A 1 30 ? 0.406   -7.177  0.413   1.00 0.00 ? 38  PHE A CE1  2  
ATOM 1971  C CE2  . PHE A 1 30 ? -1.490  -7.208  -1.044  1.00 0.00 ? 38  PHE A CE2  2  
ATOM 1972  C CZ   . PHE A 1 30 ? -0.374  -7.832  -0.521  1.00 0.00 ? 38  PHE A CZ   2  
ATOM 1973  H H    . PHE A 1 30 ? 1.086   -3.243  1.567   1.00 0.00 ? 38  PHE A H    2  
ATOM 1974  H HA   . PHE A 1 30 ? -0.502  -2.823  -0.875  1.00 0.00 ? 38  PHE A HA   2  
ATOM 1975  H HB2  . PHE A 1 30 ? -1.390  -3.856  1.826   1.00 0.00 ? 38  PHE A HB2  2  
ATOM 1976  H HB3  . PHE A 1 30 ? -2.417  -3.672  0.408   1.00 0.00 ? 38  PHE A HB3  2  
ATOM 1977  H HD1  . PHE A 1 30 ? 0.677   -5.391  1.550   1.00 0.00 ? 38  PHE A HD1  2  
ATOM 1978  H HD2  . PHE A 1 30 ? -2.696  -5.446  -1.041  1.00 0.00 ? 38  PHE A HD2  2  
ATOM 1979  H HE1  . PHE A 1 30 ? 1.279   -7.664  0.823   1.00 0.00 ? 38  PHE A HE1  2  
ATOM 1980  H HE2  . PHE A 1 30 ? -2.101  -7.719  -1.774  1.00 0.00 ? 38  PHE A HE2  2  
ATOM 1981  H HZ   . PHE A 1 30 ? -0.111  -8.830  -0.841  1.00 0.00 ? 38  PHE A HZ   2  
ATOM 1982  N N    . ILE A 1 31 ? -2.112  -1.022  0.236   1.00 0.00 ? 39  ILE A N    2  
ATOM 1983  C CA   . ILE A 1 31 ? -2.661  0.276   0.604   1.00 0.00 ? 39  ILE A CA   2  
ATOM 1984  C C    . ILE A 1 31 ? -3.816  0.129   1.591   1.00 0.00 ? 39  ILE A C    2  
ATOM 1985  O O    . ILE A 1 31 ? -4.729  -0.672  1.388   1.00 0.00 ? 39  ILE A O    2  
ATOM 1986  C CB   . ILE A 1 31 ? -3.141  1.050   -0.645  1.00 0.00 ? 39  ILE A CB   2  
ATOM 1987  C CG1  . ILE A 1 31 ? -1.938  1.567   -1.438  1.00 0.00 ? 39  ILE A CG1  2  
ATOM 1988  C CG2  . ILE A 1 31 ? -4.058  2.202   -0.256  1.00 0.00 ? 39  ILE A CG2  2  
ATOM 1989  C CD1  . ILE A 1 31 ? -1.201  2.699   -0.751  1.00 0.00 ? 39  ILE A CD1  2  
ATOM 1990  H H    . ILE A 1 31 ? -2.627  -1.608  -0.355  1.00 0.00 ? 39  ILE A H    2  
ATOM 1991  H HA   . ILE A 1 31 ? -1.872  0.850   1.073   1.00 0.00 ? 39  ILE A HA   2  
ATOM 1992  H HB   . ILE A 1 31 ? -3.704  0.370   -1.266  1.00 0.00 ? 39  ILE A HB   2  
ATOM 1993  H HG12 . ILE A 1 31 ? -1.238  0.758   -1.584  1.00 0.00 ? 39  ILE A HG12 2  
ATOM 1994  H HG13 . ILE A 1 31 ? -2.275  1.925   -2.399  1.00 0.00 ? 39  ILE A HG13 2  
ATOM 1995  H HG21 . ILE A 1 31 ? -5.086  1.888   -0.343  1.00 0.00 ? 39  ILE A HG21 2  
ATOM 1996  H HG22 . ILE A 1 31 ? -3.881  3.042   -0.912  1.00 0.00 ? 39  ILE A HG22 2  
ATOM 1997  H HG23 . ILE A 1 31 ? -3.855  2.492   0.764   1.00 0.00 ? 39  ILE A HG23 2  
ATOM 1998  H HD11 . ILE A 1 31 ? -0.188  2.391   -0.535  1.00 0.00 ? 39  ILE A HD11 2  
ATOM 1999  H HD12 . ILE A 1 31 ? -1.706  2.949   0.171   1.00 0.00 ? 39  ILE A HD12 2  
ATOM 2000  H HD13 . ILE A 1 31 ? -1.185  3.562   -1.398  1.00 0.00 ? 39  ILE A HD13 2  
ATOM 2001  N N    . SER A 1 32 ? -3.764  0.916   2.656   1.00 0.00 ? 40  SER A N    2  
ATOM 2002  C CA   . SER A 1 32 ? -4.793  0.903   3.686   1.00 0.00 ? 40  SER A CA   2  
ATOM 2003  C C    . SER A 1 32 ? -5.668  2.149   3.584   1.00 0.00 ? 40  SER A C    2  
ATOM 2004  O O    . SER A 1 32 ? -5.596  2.890   2.604   1.00 0.00 ? 40  SER A O    2  
ATOM 2005  C CB   . SER A 1 32 ? -4.164  0.815   5.079   1.00 0.00 ? 40  SER A CB   2  
ATOM 2006  O OG   . SER A 1 32 ? -4.943  0.001   5.940   1.00 0.00 ? 40  SER A OG   2  
ATOM 2007  H H    . SER A 1 32 ? -3.009  1.534   2.748   1.00 0.00 ? 40  SER A H    2  
ATOM 2008  H HA   . SER A 1 32 ? -5.410  0.033   3.524   1.00 0.00 ? 40  SER A HA   2  
ATOM 2009  H HB2  . SER A 1 32 ? -3.176  0.387   4.998   1.00 0.00 ? 40  SER A HB2  2  
ATOM 2010  H HB3  . SER A 1 32 ? -4.094  1.805   5.505   1.00 0.00 ? 40  SER A HB3  2  
ATOM 2011  H HG   . SER A 1 32 ? -4.613  0.078   6.838   1.00 0.00 ? 40  SER A HG   2  
ATOM 2012  N N    . HIS A 1 33 ? -6.496  2.370   4.599   1.00 0.00 ? 41  HIS A N    2  
ATOM 2013  C CA   . HIS A 1 33 ? -7.394  3.523   4.629   1.00 0.00 ? 41  HIS A CA   2  
ATOM 2014  C C    . HIS A 1 33 ? -6.666  4.803   4.230   1.00 0.00 ? 41  HIS A C    2  
ATOM 2015  O O    . HIS A 1 33 ? -5.513  5.019   4.607   1.00 0.00 ? 41  HIS A O    2  
ATOM 2016  C CB   . HIS A 1 33 ? -8.003  3.685   6.022   1.00 0.00 ? 41  HIS A CB   2  
ATOM 2017  C CG   . HIS A 1 33 ? -9.168  4.624   6.059   1.00 0.00 ? 41  HIS A CG   2  
ATOM 2018  N ND1  . HIS A 1 33 ? -9.064  5.967   5.759   1.00 0.00 ? 41  HIS A ND1  2  
ATOM 2019  C CD2  . HIS A 1 33 ? -10.472 4.410   6.362   1.00 0.00 ? 41  HIS A CD2  2  
ATOM 2020  C CE1  . HIS A 1 33 ? -10.250 6.536   5.877   1.00 0.00 ? 41  HIS A CE1  2  
ATOM 2021  N NE2  . HIS A 1 33 ? -11.121 5.614   6.242   1.00 0.00 ? 41  HIS A NE2  2  
ATOM 2022  H H    . HIS A 1 33 ? -6.504  1.743   5.350   1.00 0.00 ? 41  HIS A H    2  
ATOM 2023  H HA   . HIS A 1 33 ? -8.188  3.341   3.920   1.00 0.00 ? 41  HIS A HA   2  
ATOM 2024  H HB2  . HIS A 1 33 ? -8.342  2.722   6.375   1.00 0.00 ? 41  HIS A HB2  2  
ATOM 2025  H HB3  . HIS A 1 33 ? -7.248  4.065   6.695   1.00 0.00 ? 41  HIS A HB3  2  
ATOM 2026  H HD1  . HIS A 1 33 ? -8.243  6.432   5.499   1.00 0.00 ? 41  HIS A HD1  2  
ATOM 2027  H HD2  . HIS A 1 33 ? -10.915 3.466   6.646   1.00 0.00 ? 41  HIS A HD2  2  
ATOM 2028  H HE1  . HIS A 1 33 ? -10.470 7.579   5.704   1.00 0.00 ? 41  HIS A HE1  2  
ATOM 2029  H HE2  . HIS A 1 33 ? -12.047 5.787   6.508   1.00 0.00 ? 41  HIS A HE2  2  
ATOM 2030  N N    . VAL A 1 34 ? -7.346  5.646   3.462   1.00 0.00 ? 42  VAL A N    2  
ATOM 2031  C CA   . VAL A 1 34 ? -6.767  6.904   3.008   1.00 0.00 ? 42  VAL A CA   2  
ATOM 2032  C C    . VAL A 1 34 ? -7.411  8.093   3.714   1.00 0.00 ? 42  VAL A C    2  
ATOM 2033  O O    . VAL A 1 34 ? -8.532  7.998   4.213   1.00 0.00 ? 42  VAL A O    2  
ATOM 2034  C CB   . VAL A 1 34 ? -6.922  7.074   1.484   1.00 0.00 ? 42  VAL A CB   2  
ATOM 2035  C CG1  . VAL A 1 34 ? -6.170  8.306   1.004   1.00 0.00 ? 42  VAL A CG1  2  
ATOM 2036  C CG2  . VAL A 1 34 ? -6.439  5.828   0.756   1.00 0.00 ? 42  VAL A CG2  2  
ATOM 2037  H H    . VAL A 1 34 ? -8.261  5.418   3.193   1.00 0.00 ? 42  VAL A H    2  
ATOM 2038  H HA   . VAL A 1 34 ? -5.713  6.888   3.241   1.00 0.00 ? 42  VAL A HA   2  
ATOM 2039  H HB   . VAL A 1 34 ? -7.970  7.210   1.263   1.00 0.00 ? 42  VAL A HB   2  
ATOM 2040  H HG11 . VAL A 1 34 ? -6.631  9.192   1.414   1.00 0.00 ? 42  VAL A HG11 2  
ATOM 2041  H HG12 . VAL A 1 34 ? -6.204  8.348   -0.074  1.00 0.00 ? 42  VAL A HG12 2  
ATOM 2042  H HG13 . VAL A 1 34 ? -5.143  8.248   1.331   1.00 0.00 ? 42  VAL A HG13 2  
ATOM 2043  H HG21 . VAL A 1 34 ? -5.387  5.927   0.532   1.00 0.00 ? 42  VAL A HG21 2  
ATOM 2044  H HG22 . VAL A 1 34 ? -6.991  5.712   -0.165  1.00 0.00 ? 42  VAL A HG22 2  
ATOM 2045  H HG23 . VAL A 1 34 ? -6.594  4.962   1.380   1.00 0.00 ? 42  VAL A HG23 2  
ATOM 2046  N N    . LYS A 1 35 ? -6.695  9.211   3.751   1.00 0.00 ? 43  LYS A N    2  
ATOM 2047  C CA   . LYS A 1 35 ? -7.193  10.420  4.397   1.00 0.00 ? 43  LYS A CA   2  
ATOM 2048  C C    . LYS A 1 35 ? -7.562  11.482  3.360   1.00 0.00 ? 43  LYS A C    2  
ATOM 2049  O O    . LYS A 1 35 ? -6.718  11.903  2.569   1.00 0.00 ? 43  LYS A O    2  
ATOM 2050  C CB   . LYS A 1 35 ? -6.141  10.979  5.358   1.00 0.00 ? 43  LYS A CB   2  
ATOM 2051  C CG   . LYS A 1 35 ? -6.130  10.295  6.715   1.00 0.00 ? 43  LYS A CG   2  
ATOM 2052  C CD   . LYS A 1 35 ? -5.888  11.291  7.838   1.00 0.00 ? 43  LYS A CD   2  
ATOM 2053  C CE   . LYS A 1 35 ? -6.222  10.693  9.196   1.00 0.00 ? 43  LYS A CE   2  
ATOM 2054  N NZ   . LYS A 1 35 ? -6.959  11.655  10.061  1.00 0.00 ? 43  LYS A NZ   2  
ATOM 2055  H H    . LYS A 1 35 ? -5.807  9.223   3.335   1.00 0.00 ? 43  LYS A H    2  
ATOM 2056  H HA   . LYS A 1 35 ? -8.074  10.154  4.960   1.00 0.00 ? 43  LYS A HA   2  
ATOM 2057  H HB2  . LYS A 1 35 ? -5.165  10.861  4.911   1.00 0.00 ? 43  LYS A HB2  2  
ATOM 2058  H HB3  . LYS A 1 35 ? -6.334  12.031  5.509   1.00 0.00 ? 43  LYS A HB3  2  
ATOM 2059  H HG2  . LYS A 1 35 ? -7.083  9.814   6.873   1.00 0.00 ? 43  LYS A HG2  2  
ATOM 2060  H HG3  . LYS A 1 35 ? -5.344  9.553   6.726   1.00 0.00 ? 43  LYS A HG3  2  
ATOM 2061  H HD2  . LYS A 1 35 ? -4.849  11.581  7.831   1.00 0.00 ? 43  LYS A HD2  2  
ATOM 2062  H HD3  . LYS A 1 35 ? -6.508  12.160  7.674   1.00 0.00 ? 43  LYS A HD3  2  
ATOM 2063  H HE2  . LYS A 1 35 ? -6.833  9.815   9.049   1.00 0.00 ? 43  LYS A HE2  2  
ATOM 2064  H HE3  . LYS A 1 35 ? -5.302  10.412  9.687   1.00 0.00 ? 43  LYS A HE3  2  
ATOM 2065  H HZ1  . LYS A 1 35 ? -6.642  11.564  11.047  1.00 0.00 ? 43  LYS A HZ1  2  
ATOM 2066  H HZ2  . LYS A 1 35 ? -7.981  11.463  10.018  1.00 0.00 ? 43  LYS A HZ2  2  
ATOM 2067  H HZ3  . LYS A 1 35 ? -6.787  12.629  9.740   1.00 0.00 ? 43  LYS A HZ3  2  
ATOM 2068  N N    . PRO A 1 36 ? -8.830  11.936  3.350   1.00 0.00 ? 44  PRO A N    2  
ATOM 2069  C CA   . PRO A 1 36 ? -9.292  12.956  2.403   1.00 0.00 ? 44  PRO A CA   2  
ATOM 2070  C C    . PRO A 1 36 ? -8.448  14.225  2.468   1.00 0.00 ? 44  PRO A C    2  
ATOM 2071  O O    . PRO A 1 36 ? -7.888  14.556  3.512   1.00 0.00 ? 44  PRO A O    2  
ATOM 2072  C CB   . PRO A 1 36 ? -10.727 13.244  2.854   1.00 0.00 ? 44  PRO A CB   2  
ATOM 2073  C CG   . PRO A 1 36 ? -11.148 12.024  3.596   1.00 0.00 ? 44  PRO A CG   2  
ATOM 2074  C CD   . PRO A 1 36 ? -9.906  11.497  4.257   1.00 0.00 ? 44  PRO A CD   2  
ATOM 2075  H HA   . PRO A 1 36 ? -9.298  12.581  1.390   1.00 0.00 ? 44  PRO A HA   2  
ATOM 2076  H HB2  . PRO A 1 36 ? -10.737 14.118  3.490   1.00 0.00 ? 44  PRO A HB2  2  
ATOM 2077  H HB3  . PRO A 1 36 ? -11.352 13.414  1.990   1.00 0.00 ? 44  PRO A HB3  2  
ATOM 2078  H HG2  . PRO A 1 36 ? -11.888 12.283  4.340   1.00 0.00 ? 44  PRO A HG2  2  
ATOM 2079  H HG3  . PRO A 1 36 ? -11.545 11.293  2.907   1.00 0.00 ? 44  PRO A HG3  2  
ATOM 2080  H HD2  . PRO A 1 36 ? -9.786  11.931  5.239   1.00 0.00 ? 44  PRO A HD2  2  
ATOM 2081  H HD3  . PRO A 1 36 ? -9.941  10.419  4.320   1.00 0.00 ? 44  PRO A HD3  2  
ATOM 2082  N N    . GLY A 1 37 ? -8.361  14.932  1.345   1.00 0.00 ? 45  GLY A N    2  
ATOM 2083  C CA   . GLY A 1 37 ? -7.580  16.155  1.299   1.00 0.00 ? 45  GLY A CA   2  
ATOM 2084  C C    . GLY A 1 37 ? -6.095  15.898  1.452   1.00 0.00 ? 45  GLY A C    2  
ATOM 2085  O O    . GLY A 1 37 ? -5.440  16.486  2.315   1.00 0.00 ? 45  GLY A O    2  
ATOM 2086  H H    . GLY A 1 37 ? -8.826  14.619  0.541   1.00 0.00 ? 45  GLY A H    2  
ATOM 2087  H HA2  . GLY A 1 37 ? -7.754  16.645  0.353   1.00 0.00 ? 45  GLY A HA2  2  
ATOM 2088  H HA3  . GLY A 1 37 ? -7.907  16.807  2.097   1.00 0.00 ? 45  GLY A HA3  2  
ATOM 2089  N N    . SER A 1 38 ? -5.563  15.015  0.615   1.00 0.00 ? 46  SER A N    2  
ATOM 2090  C CA   . SER A 1 38 ? -4.145  14.675  0.658   1.00 0.00 ? 46  SER A CA   2  
ATOM 2091  C C    . SER A 1 38 ? -3.650  14.247  -0.719  1.00 0.00 ? 46  SER A C    2  
ATOM 2092  O O    . SER A 1 38 ? -4.355  14.399  -1.717  1.00 0.00 ? 46  SER A O    2  
ATOM 2093  C CB   . SER A 1 38 ? -3.902  13.556  1.670   1.00 0.00 ? 46  SER A CB   2  
ATOM 2094  O OG   . SER A 1 38 ? -2.668  13.737  2.345   1.00 0.00 ? 46  SER A OG   2  
ATOM 2095  H H    . SER A 1 38 ? -6.137  14.580  -0.049  1.00 0.00 ? 46  SER A H    2  
ATOM 2096  H HA   . SER A 1 38 ? -3.600  15.552  0.967   1.00 0.00 ? 46  SER A HA   2  
ATOM 2097  H HB2  . SER A 1 38 ? -4.699  13.555  2.400   1.00 0.00 ? 46  SER A HB2  2  
ATOM 2098  H HB3  . SER A 1 38 ? -3.883  12.607  1.157   1.00 0.00 ? 46  SER A HB3  2  
ATOM 2099  H HG   . SER A 1 38 ? -2.805  13.650  3.290   1.00 0.00 ? 46  SER A HG   2  
ATOM 2100  N N    . LEU A 1 39 ? -2.438  13.704  -0.768  1.00 0.00 ? 47  LEU A N    2  
ATOM 2101  C CA   . LEU A 1 39 ? -1.860  13.250  -2.025  1.00 0.00 ? 47  LEU A CA   2  
ATOM 2102  C C    . LEU A 1 39 ? -2.487  11.929  -2.451  1.00 0.00 ? 47  LEU A C    2  
ATOM 2103  O O    . LEU A 1 39 ? -2.874  11.757  -3.607  1.00 0.00 ? 47  LEU A O    2  
ATOM 2104  C CB   . LEU A 1 39 ? -0.342  13.090  -1.897  1.00 0.00 ? 47  LEU A CB   2  
ATOM 2105  C CG   . LEU A 1 39 ? 0.427   14.366  -1.542  1.00 0.00 ? 47  LEU A CG   2  
ATOM 2106  C CD1  . LEU A 1 39 ? -0.065  15.544  -2.370  1.00 0.00 ? 47  LEU A CD1  2  
ATOM 2107  C CD2  . LEU A 1 39 ? 0.305   14.667  -0.057  1.00 0.00 ? 47  LEU A CD2  2  
ATOM 2108  H H    . LEU A 1 39 ? -1.926  13.603  0.060   1.00 0.00 ? 47  LEU A H    2  
ATOM 2109  H HA   . LEU A 1 39 ? -2.073  13.996  -2.778  1.00 0.00 ? 47  LEU A HA   2  
ATOM 2110  H HB2  . LEU A 1 39 ? -0.145  12.352  -1.133  1.00 0.00 ? 47  LEU A HB2  2  
ATOM 2111  H HB3  . LEU A 1 39 ? 0.038   12.717  -2.836  1.00 0.00 ? 47  LEU A HB3  2  
ATOM 2112  H HG   . LEU A 1 39 ? 1.474   14.218  -1.767  1.00 0.00 ? 47  LEU A HG   2  
ATOM 2113  H HD11 . LEU A 1 39 ? -1.028  15.865  -2.000  1.00 0.00 ? 47  LEU A HD11 2  
ATOM 2114  H HD12 . LEU A 1 39 ? -0.159  15.245  -3.403  1.00 0.00 ? 47  LEU A HD12 2  
ATOM 2115  H HD13 . LEU A 1 39 ? 0.640   16.358  -2.293  1.00 0.00 ? 47  LEU A HD13 2  
ATOM 2116  H HD21 . LEU A 1 39 ? -0.664  15.097  0.143   1.00 0.00 ? 47  LEU A HD21 2  
ATOM 2117  H HD22 . LEU A 1 39 ? 1.077   15.364  0.234   1.00 0.00 ? 47  LEU A HD22 2  
ATOM 2118  H HD23 . LEU A 1 39 ? 0.416   13.751  0.505   1.00 0.00 ? 47  LEU A HD23 2  
ATOM 2119  N N    . SER A 1 40 ? -2.589  10.999  -1.506  1.00 0.00 ? 48  SER A N    2  
ATOM 2120  C CA   . SER A 1 40 ? -3.174  9.690   -1.781  1.00 0.00 ? 48  SER A CA   2  
ATOM 2121  C C    . SER A 1 40 ? -4.587  9.833   -2.342  1.00 0.00 ? 48  SER A C    2  
ATOM 2122  O O    . SER A 1 40 ? -4.969  9.132   -3.278  1.00 0.00 ? 48  SER A O    2  
ATOM 2123  C CB   . SER A 1 40 ? -3.200  8.844   -0.506  1.00 0.00 ? 48  SER A CB   2  
ATOM 2124  O OG   . SER A 1 40 ? -3.600  7.514   -0.781  1.00 0.00 ? 48  SER A OG   2  
ATOM 2125  H H    . SER A 1 40 ? -2.263  11.197  -0.600  1.00 0.00 ? 48  SER A H    2  
ATOM 2126  H HA   . SER A 1 40 ? -2.556  9.199   -2.516  1.00 0.00 ? 48  SER A HA   2  
ATOM 2127  H HB2  . SER A 1 40 ? -2.214  8.825   -0.069  1.00 0.00 ? 48  SER A HB2  2  
ATOM 2128  H HB3  . SER A 1 40 ? -3.895  9.278   0.196   1.00 0.00 ? 48  SER A HB3  2  
ATOM 2129  H HG   . SER A 1 40 ? -4.551  7.438   -0.679  1.00 0.00 ? 48  SER A HG   2  
ATOM 2130  N N    . ALA A 1 41 ? -5.359  10.746  -1.763  1.00 0.00 ? 49  ALA A N    2  
ATOM 2131  C CA   . ALA A 1 41 ? -6.728  10.980  -2.207  1.00 0.00 ? 49  ALA A CA   2  
ATOM 2132  C C    . ALA A 1 41 ? -6.754  11.665  -3.568  1.00 0.00 ? 49  ALA A C    2  
ATOM 2133  O O    . ALA A 1 41 ? -7.596  11.361  -4.413  1.00 0.00 ? 49  ALA A O    2  
ATOM 2134  C CB   . ALA A 1 41 ? -7.480  11.814  -1.183  1.00 0.00 ? 49  ALA A CB   2  
ATOM 2135  H H    . ALA A 1 41 ? -5.000  11.276  -1.021  1.00 0.00 ? 49  ALA A H    2  
ATOM 2136  H HA   . ALA A 1 41 ? -7.220  10.021  -2.287  1.00 0.00 ? 49  ALA A HA   2  
ATOM 2137  H HB1  . ALA A 1 41 ? -6.807  12.539  -0.746  1.00 0.00 ? 49  ALA A HB1  2  
ATOM 2138  H HB2  . ALA A 1 41 ? -7.868  11.171  -0.408  1.00 0.00 ? 49  ALA A HB2  2  
ATOM 2139  H HB3  . ALA A 1 41 ? -8.296  12.329  -1.668  1.00 0.00 ? 49  ALA A HB3  2  
ATOM 2140  N N    . GLU A 1 42 ? -5.829  12.596  -3.771  1.00 0.00 ? 50  GLU A N    2  
ATOM 2141  C CA   . GLU A 1 42 ? -5.743  13.332  -5.025  1.00 0.00 ? 50  GLU A CA   2  
ATOM 2142  C C    . GLU A 1 42 ? -5.407  12.401  -6.188  1.00 0.00 ? 50  GLU A C    2  
ATOM 2143  O O    . GLU A 1 42 ? -5.887  12.591  -7.305  1.00 0.00 ? 50  GLU A O    2  
ATOM 2144  C CB   . GLU A 1 42 ? -4.690  14.436  -4.921  1.00 0.00 ? 50  GLU A CB   2  
ATOM 2145  C CG   . GLU A 1 42 ? -5.257  15.781  -4.498  1.00 0.00 ? 50  GLU A CG   2  
ATOM 2146  C CD   . GLU A 1 42 ? -5.939  16.509  -5.640  1.00 0.00 ? 50  GLU A CD   2  
ATOM 2147  O OE1  . GLU A 1 42 ? -5.227  17.126  -6.461  1.00 0.00 ? 50  GLU A OE1  2  
ATOM 2148  O OE2  . GLU A 1 42 ? -7.184  16.466  -5.713  1.00 0.00 ? 50  GLU A OE2  2  
ATOM 2149  H H    . GLU A 1 42 ? -5.187  12.795  -3.057  1.00 0.00 ? 50  GLU A H    2  
ATOM 2150  H HA   . GLU A 1 42 ? -6.706  13.785  -5.210  1.00 0.00 ? 50  GLU A HA   2  
ATOM 2151  H HB2  . GLU A 1 42 ? -3.946  14.139  -4.195  1.00 0.00 ? 50  GLU A HB2  2  
ATOM 2152  H HB3  . GLU A 1 42 ? -4.214  14.556  -5.881  1.00 0.00 ? 50  GLU A HB3  2  
ATOM 2153  H HG2  . GLU A 1 42 ? -5.980  15.622  -3.712  1.00 0.00 ? 50  GLU A HG2  2  
ATOM 2154  H HG3  . GLU A 1 42 ? -4.452  16.397  -4.126  1.00 0.00 ? 50  GLU A HG3  2  
ATOM 2155  N N    . VAL A 1 43 ? -4.581  11.398  -5.918  1.00 0.00 ? 51  VAL A N    2  
ATOM 2156  C CA   . VAL A 1 43 ? -4.181  10.443  -6.945  1.00 0.00 ? 51  VAL A CA   2  
ATOM 2157  C C    . VAL A 1 43 ? -5.282  9.419   -7.208  1.00 0.00 ? 51  VAL A C    2  
ATOM 2158  O O    . VAL A 1 43 ? -5.391  8.882   -8.309  1.00 0.00 ? 51  VAL A O    2  
ATOM 2159  C CB   . VAL A 1 43 ? -2.888  9.703   -6.554  1.00 0.00 ? 51  VAL A CB   2  
ATOM 2160  C CG1  . VAL A 1 43 ? -1.718  10.672  -6.491  1.00 0.00 ? 51  VAL A CG1  2  
ATOM 2161  C CG2  . VAL A 1 43 ? -3.065  8.984   -5.224  1.00 0.00 ? 51  VAL A CG2  2  
ATOM 2162  H H    . VAL A 1 43 ? -4.228  11.298  -5.009  1.00 0.00 ? 51  VAL A H    2  
ATOM 2163  H HA   . VAL A 1 43 ? -3.992  10.994  -7.855  1.00 0.00 ? 51  VAL A HA   2  
ATOM 2164  H HB   . VAL A 1 43 ? -2.676  8.965   -7.312  1.00 0.00 ? 51  VAL A HB   2  
ATOM 2165  H HG11 . VAL A 1 43 ? -2.085  11.667  -6.286  1.00 0.00 ? 51  VAL A HG11 2  
ATOM 2166  H HG12 . VAL A 1 43 ? -1.198  10.668  -7.437  1.00 0.00 ? 51  VAL A HG12 2  
ATOM 2167  H HG13 . VAL A 1 43 ? -1.042  10.369  -5.707  1.00 0.00 ? 51  VAL A HG13 2  
ATOM 2168  H HG21 . VAL A 1 43 ? -3.953  8.370   -5.263  1.00 0.00 ? 51  VAL A HG21 2  
ATOM 2169  H HG22 . VAL A 1 43 ? -3.163  9.711   -4.433  1.00 0.00 ? 51  VAL A HG22 2  
ATOM 2170  H HG23 . VAL A 1 43 ? -2.205  8.360   -5.035  1.00 0.00 ? 51  VAL A HG23 2  
ATOM 2171  N N    . GLY A 1 44 ? -6.098  9.156   -6.192  1.00 0.00 ? 52  GLY A N    2  
ATOM 2172  C CA   . GLY A 1 44 ? -7.178  8.199   -6.340  1.00 0.00 ? 52  GLY A CA   2  
ATOM 2173  C C    . GLY A 1 44 ? -6.891  6.884   -5.641  1.00 0.00 ? 52  GLY A C    2  
ATOM 2174  O O    . GLY A 1 44 ? -7.353  5.829   -6.075  1.00 0.00 ? 52  GLY A O    2  
ATOM 2175  H H    . GLY A 1 44 ? -5.965  9.615   -5.336  1.00 0.00 ? 52  GLY A H    2  
ATOM 2176  H HA2  . GLY A 1 44 ? -8.080  8.624   -5.924  1.00 0.00 ? 52  GLY A HA2  2  
ATOM 2177  H HA3  . GLY A 1 44 ? -7.334  8.008   -7.391  1.00 0.00 ? 52  GLY A HA3  2  
ATOM 2178  N N    . LEU A 1 45 ? -6.125  6.948   -4.557  1.00 0.00 ? 53  LEU A N    2  
ATOM 2179  C CA   . LEU A 1 45 ? -5.775  5.755   -3.797  1.00 0.00 ? 53  LEU A CA   2  
ATOM 2180  C C    . LEU A 1 45 ? -6.955  5.282   -2.952  1.00 0.00 ? 53  LEU A C    2  
ATOM 2181  O O    . LEU A 1 45 ? -7.931  6.010   -2.770  1.00 0.00 ? 53  LEU A O    2  
ATOM 2182  C CB   . LEU A 1 45 ? -4.570  6.037   -2.898  1.00 0.00 ? 53  LEU A CB   2  
ATOM 2183  C CG   . LEU A 1 45 ? -3.207  5.737   -3.526  1.00 0.00 ? 53  LEU A CG   2  
ATOM 2184  C CD1  . LEU A 1 45 ? -2.083  6.247   -2.635  1.00 0.00 ? 53  LEU A CD1  2  
ATOM 2185  C CD2  . LEU A 1 45 ? -3.053  4.246   -3.772  1.00 0.00 ? 53  LEU A CD2  2  
ATOM 2186  H H    . LEU A 1 45 ? -5.787  7.820   -4.261  1.00 0.00 ? 53  LEU A H    2  
ATOM 2187  H HA   . LEU A 1 45 ? -5.516  4.978   -4.499  1.00 0.00 ? 53  LEU A HA   2  
ATOM 2188  H HB2  . LEU A 1 45 ? -4.593  7.080   -2.624  1.00 0.00 ? 53  LEU A HB2  2  
ATOM 2189  H HB3  . LEU A 1 45 ? -4.667  5.443   -2.002  1.00 0.00 ? 53  LEU A HB3  2  
ATOM 2190  H HG   . LEU A 1 45 ? -3.136  6.245   -4.476  1.00 0.00 ? 53  LEU A HG   2  
ATOM 2191  H HD11 . LEU A 1 45 ? -2.057  7.324   -2.673  1.00 0.00 ? 53  LEU A HD11 2  
ATOM 2192  H HD12 . LEU A 1 45 ? -1.142  5.850   -2.983  1.00 0.00 ? 53  LEU A HD12 2  
ATOM 2193  H HD13 . LEU A 1 45 ? -2.258  5.926   -1.619  1.00 0.00 ? 53  LEU A HD13 2  
ATOM 2194  H HD21 . LEU A 1 45 ? -4.030  3.785   -3.813  1.00 0.00 ? 53  LEU A HD21 2  
ATOM 2195  H HD22 . LEU A 1 45 ? -2.481  3.805   -2.970  1.00 0.00 ? 53  LEU A HD22 2  
ATOM 2196  H HD23 . LEU A 1 45 ? -2.541  4.087   -4.710  1.00 0.00 ? 53  LEU A HD23 2  
ATOM 2197  N N    . GLU A 1 46 ? -6.857  4.061   -2.438  1.00 0.00 ? 54  GLU A N    2  
ATOM 2198  C CA   . GLU A 1 46 ? -7.915  3.489   -1.612  1.00 0.00 ? 54  GLU A CA   2  
ATOM 2199  C C    . GLU A 1 46 ? -7.537  2.088   -1.142  1.00 0.00 ? 54  GLU A C    2  
ATOM 2200  O O    . GLU A 1 46 ? -6.731  1.408   -1.777  1.00 0.00 ? 54  GLU A O    2  
ATOM 2201  C CB   . GLU A 1 46 ? -9.233  3.444   -2.391  1.00 0.00 ? 54  GLU A CB   2  
ATOM 2202  C CG   . GLU A 1 46 ? -10.289 4.400   -1.856  1.00 0.00 ? 54  GLU A CG   2  
ATOM 2203  C CD   . GLU A 1 46 ? -11.561 4.384   -2.680  1.00 0.00 ? 54  GLU A CD   2  
ATOM 2204  O OE1  . GLU A 1 46 ? -11.476 4.123   -3.898  1.00 0.00 ? 54  GLU A OE1  2  
ATOM 2205  O OE2  . GLU A 1 46 ? -12.642 4.634   -2.107  1.00 0.00 ? 54  GLU A OE2  2  
ATOM 2206  H H    . GLU A 1 46 ? -6.053  3.530   -2.619  1.00 0.00 ? 54  GLU A H    2  
ATOM 2207  H HA   . GLU A 1 46 ? -8.039  4.125   -0.747  1.00 0.00 ? 54  GLU A HA   2  
ATOM 2208  H HB2  . GLU A 1 46 ? -9.037  3.701   -3.421  1.00 0.00 ? 54  GLU A HB2  2  
ATOM 2209  H HB3  . GLU A 1 46 ? -9.632  2.441   -2.348  1.00 0.00 ? 54  GLU A HB3  2  
ATOM 2210  H HG2  . GLU A 1 46 ? -10.531 4.115   -0.843  1.00 0.00 ? 54  GLU A HG2  2  
ATOM 2211  H HG3  . GLU A 1 46 ? -9.884  5.401   -1.860  1.00 0.00 ? 54  GLU A HG3  2  
ATOM 2212  N N    . ILE A 1 47 ? -8.124  1.659   -0.028  1.00 0.00 ? 55  ILE A N    2  
ATOM 2213  C CA   . ILE A 1 47 ? -7.847  0.337   0.522   1.00 0.00 ? 55  ILE A CA   2  
ATOM 2214  C C    . ILE A 1 47 ? -8.054  -0.748  -0.531  1.00 0.00 ? 55  ILE A C    2  
ATOM 2215  O O    . ILE A 1 47 ? -9.071  -0.768  -1.226  1.00 0.00 ? 55  ILE A O    2  
ATOM 2216  C CB   . ILE A 1 47 ? -8.741  0.033   1.742   1.00 0.00 ? 55  ILE A CB   2  
ATOM 2217  C CG1  . ILE A 1 47 ? -8.620  1.148   2.783   1.00 0.00 ? 55  ILE A CG1  2  
ATOM 2218  C CG2  . ILE A 1 47 ? -8.369  -1.311  2.354   1.00 0.00 ? 55  ILE A CG2  2  
ATOM 2219  C CD1  . ILE A 1 47 ? -9.948  1.567   3.376   1.00 0.00 ? 55  ILE A CD1  2  
ATOM 2220  H H    . ILE A 1 47 ? -8.760  2.246   0.433   1.00 0.00 ? 55  ILE A H    2  
ATOM 2221  H HA   . ILE A 1 47 ? -6.816  0.319   0.843   1.00 0.00 ? 55  ILE A HA   2  
ATOM 2222  H HB   . ILE A 1 47 ? -9.764  -0.025  1.404   1.00 0.00 ? 55  ILE A HB   2  
ATOM 2223  H HG12 . ILE A 1 47 ? -7.988  0.813   3.591   1.00 0.00 ? 55  ILE A HG12 2  
ATOM 2224  H HG13 . ILE A 1 47 ? -8.175  2.017   2.320   1.00 0.00 ? 55  ILE A HG13 2  
ATOM 2225  H HG21 . ILE A 1 47 ? -9.107  -1.587  3.093   1.00 0.00 ? 55  ILE A HG21 2  
ATOM 2226  H HG22 . ILE A 1 47 ? -7.400  -1.238  2.825   1.00 0.00 ? 55  ILE A HG22 2  
ATOM 2227  H HG23 . ILE A 1 47 ? -8.336  -2.064  1.579   1.00 0.00 ? 55  ILE A HG23 2  
ATOM 2228  H HD11 . ILE A 1 47 ? -9.778  2.074   4.314   1.00 0.00 ? 55  ILE A HD11 2  
ATOM 2229  H HD12 . ILE A 1 47 ? -10.558 0.692   3.545   1.00 0.00 ? 55  ILE A HD12 2  
ATOM 2230  H HD13 . ILE A 1 47 ? -10.453 2.233   2.693   1.00 0.00 ? 55  ILE A HD13 2  
ATOM 2231  N N    . GLY A 1 48 ? -7.081  -1.644  -0.648  1.00 0.00 ? 56  GLY A N    2  
ATOM 2232  C CA   . GLY A 1 48 ? -7.173  -2.715  -1.622  1.00 0.00 ? 56  GLY A CA   2  
ATOM 2233  C C    . GLY A 1 48 ? -6.076  -2.638  -2.667  1.00 0.00 ? 56  GLY A C    2  
ATOM 2234  O O    . GLY A 1 48 ? -5.699  -3.648  -3.256  1.00 0.00 ? 56  GLY A O    2  
ATOM 2235  H H    . GLY A 1 48 ? -6.293  -1.576  -0.070  1.00 0.00 ? 56  GLY A H    2  
ATOM 2236  H HA2  . GLY A 1 48 ? -7.100  -3.663  -1.108  1.00 0.00 ? 56  GLY A HA2  2  
ATOM 2237  H HA3  . GLY A 1 48 ? -8.130  -2.657  -2.117  1.00 0.00 ? 56  GLY A HA3  2  
ATOM 2238  N N    . ASP A 1 49 ? -5.562  -1.434  -2.893  1.00 0.00 ? 57  ASP A N    2  
ATOM 2239  C CA   . ASP A 1 49 ? -4.501  -1.230  -3.871  1.00 0.00 ? 57  ASP A CA   2  
ATOM 2240  C C    . ASP A 1 49 ? -3.198  -1.865  -3.392  1.00 0.00 ? 57  ASP A C    2  
ATOM 2241  O O    . ASP A 1 49 ? -3.069  -2.227  -2.223  1.00 0.00 ? 57  ASP A O    2  
ATOM 2242  C CB   . ASP A 1 49 ? -4.296  0.265   -4.121  1.00 0.00 ? 57  ASP A CB   2  
ATOM 2243  C CG   . ASP A 1 49 ? -5.272  0.820   -5.139  1.00 0.00 ? 57  ASP A CG   2  
ATOM 2244  O OD1  . ASP A 1 49 ? -5.825  0.025   -5.927  1.00 0.00 ? 57  ASP A OD1  2  
ATOM 2245  O OD2  . ASP A 1 49 ? -5.484  2.052   -5.149  1.00 0.00 ? 57  ASP A OD2  2  
ATOM 2246  H H    . ASP A 1 49 ? -5.903  -0.666  -2.391  1.00 0.00 ? 57  ASP A H    2  
ATOM 2247  H HA   . ASP A 1 49 ? -4.803  -1.705  -4.795  1.00 0.00 ? 57  ASP A HA   2  
ATOM 2248  H HB2  . ASP A 1 49 ? -4.430  0.799   -3.193  1.00 0.00 ? 57  ASP A HB2  2  
ATOM 2249  H HB3  . ASP A 1 49 ? -3.292  0.428   -4.483  1.00 0.00 ? 57  ASP A HB3  2  
ATOM 2250  N N    . GLN A 1 50 ? -2.235  -1.994  -4.298  1.00 0.00 ? 58  GLN A N    2  
ATOM 2251  C CA   . GLN A 1 50 ? -0.945  -2.587  -3.960  1.00 0.00 ? 58  GLN A CA   2  
ATOM 2252  C C    . GLN A 1 50 ? 0.178   -1.966  -4.786  1.00 0.00 ? 58  GLN A C    2  
ATOM 2253  O O    . GLN A 1 50 ? 0.216   -2.111  -6.007  1.00 0.00 ? 58  GLN A O    2  
ATOM 2254  C CB   . GLN A 1 50 ? -0.982  -4.099  -4.187  1.00 0.00 ? 58  GLN A CB   2  
ATOM 2255  C CG   . GLN A 1 50 ? -0.081  -4.879  -3.243  1.00 0.00 ? 58  GLN A CG   2  
ATOM 2256  C CD   . GLN A 1 50 ? 1.173   -5.391  -3.925  1.00 0.00 ? 58  GLN A CD   2  
ATOM 2257  O OE1  . GLN A 1 50 ? 2.248   -4.805  -3.795  1.00 0.00 ? 58  GLN A OE1  2  
ATOM 2258  N NE2  . GLN A 1 50 ? 1.040   -6.490  -4.657  1.00 0.00 ? 58  GLN A NE2  2  
ATOM 2259  H H    . GLN A 1 50 ? -2.395  -1.687  -5.216  1.00 0.00 ? 58  GLN A H    2  
ATOM 2260  H HA   . GLN A 1 50 ? -0.757  -2.393  -2.915  1.00 0.00 ? 58  GLN A HA   2  
ATOM 2261  H HB2  . GLN A 1 50 ? -1.995  -4.448  -4.052  1.00 0.00 ? 58  GLN A HB2  2  
ATOM 2262  H HB3  . GLN A 1 50 ? -0.671  -4.306  -5.200  1.00 0.00 ? 58  GLN A HB3  2  
ATOM 2263  H HG2  . GLN A 1 50 ? 0.209   -4.232  -2.428  1.00 0.00 ? 58  GLN A HG2  2  
ATOM 2264  H HG3  . GLN A 1 50 ? -0.633  -5.722  -2.854  1.00 0.00 ? 58  GLN A HG3  2  
ATOM 2265  H HE21 . GLN A 1 50 ? 0.154   -6.904  -4.716  1.00 0.00 ? 58  GLN A HE21 2  
ATOM 2266  H HE22 . GLN A 1 50 ? 1.834   -6.844  -5.109  1.00 0.00 ? 58  GLN A HE22 2  
ATOM 2267  N N    . ILE A 1 51 ? 1.092   -1.277  -4.109  1.00 0.00 ? 59  ILE A N    2  
ATOM 2268  C CA   . ILE A 1 51 ? 2.217   -0.637  -4.781  1.00 0.00 ? 59  ILE A CA   2  
ATOM 2269  C C    . ILE A 1 51 ? 3.189   -1.679  -5.321  1.00 0.00 ? 59  ILE A C    2  
ATOM 2270  O O    . ILE A 1 51 ? 3.778   -2.447  -4.561  1.00 0.00 ? 59  ILE A O    2  
ATOM 2271  C CB   . ILE A 1 51 ? 2.972   0.315   -3.832  1.00 0.00 ? 59  ILE A CB   2  
ATOM 2272  C CG1  . ILE A 1 51 ? 1.993   1.280   -3.158  1.00 0.00 ? 59  ILE A CG1  2  
ATOM 2273  C CG2  . ILE A 1 51 ? 4.042   1.084   -4.590  1.00 0.00 ? 59  ILE A CG2  2  
ATOM 2274  C CD1  . ILE A 1 51 ? 2.628   2.126   -2.076  1.00 0.00 ? 59  ILE A CD1  2  
ATOM 2275  H H    . ILE A 1 51 ? 1.009   -1.201  -3.136  1.00 0.00 ? 59  ILE A H    2  
ATOM 2276  H HA   . ILE A 1 51 ? 1.827   -0.058  -5.606  1.00 0.00 ? 59  ILE A HA   2  
ATOM 2277  H HB   . ILE A 1 51 ? 3.459   -0.280  -3.074  1.00 0.00 ? 59  ILE A HB   2  
ATOM 2278  H HG12 . ILE A 1 51 ? 1.585   1.946   -3.902  1.00 0.00 ? 59  ILE A HG12 2  
ATOM 2279  H HG13 . ILE A 1 51 ? 1.190   0.714   -2.709  1.00 0.00 ? 59  ILE A HG13 2  
ATOM 2280  H HG21 . ILE A 1 51 ? 4.872   0.429   -4.807  1.00 0.00 ? 59  ILE A HG21 2  
ATOM 2281  H HG22 . ILE A 1 51 ? 4.386   1.912   -3.987  1.00 0.00 ? 59  ILE A HG22 2  
ATOM 2282  H HG23 . ILE A 1 51 ? 3.629   1.460   -5.514  1.00 0.00 ? 59  ILE A HG23 2  
ATOM 2283  H HD11 . ILE A 1 51 ? 2.617   1.584   -1.142  1.00 0.00 ? 59  ILE A HD11 2  
ATOM 2284  H HD12 . ILE A 1 51 ? 2.075   3.047   -1.967  1.00 0.00 ? 59  ILE A HD12 2  
ATOM 2285  H HD13 . ILE A 1 51 ? 3.650   2.352   -2.350  1.00 0.00 ? 59  ILE A HD13 2  
ATOM 2286  N N    . VAL A 1 52 ? 3.347   -1.704  -6.641  1.00 0.00 ? 60  VAL A N    2  
ATOM 2287  C CA   . VAL A 1 52 ? 4.242   -2.656  -7.287  1.00 0.00 ? 60  VAL A CA   2  
ATOM 2288  C C    . VAL A 1 52 ? 5.594   -2.025  -7.621  1.00 0.00 ? 60  VAL A C    2  
ATOM 2289  O O    . VAL A 1 52 ? 6.560   -2.731  -7.907  1.00 0.00 ? 60  VAL A O    2  
ATOM 2290  C CB   . VAL A 1 52 ? 3.617   -3.223  -8.576  1.00 0.00 ? 60  VAL A CB   2  
ATOM 2291  C CG1  . VAL A 1 52 ? 2.339   -3.986  -8.258  1.00 0.00 ? 60  VAL A CG1  2  
ATOM 2292  C CG2  . VAL A 1 52 ? 3.345   -2.107  -9.575  1.00 0.00 ? 60  VAL A CG2  2  
ATOM 2293  H H    . VAL A 1 52 ? 2.846   -1.068  -7.194  1.00 0.00 ? 60  VAL A H    2  
ATOM 2294  H HA   . VAL A 1 52 ? 4.401   -3.476  -6.602  1.00 0.00 ? 60  VAL A HA   2  
ATOM 2295  H HB   . VAL A 1 52 ? 4.319   -3.912  -9.021  1.00 0.00 ? 60  VAL A HB   2  
ATOM 2296  H HG11 . VAL A 1 52 ? 1.620   -3.315  -7.811  1.00 0.00 ? 60  VAL A HG11 2  
ATOM 2297  H HG12 . VAL A 1 52 ? 2.560   -4.788  -7.569  1.00 0.00 ? 60  VAL A HG12 2  
ATOM 2298  H HG13 . VAL A 1 52 ? 1.929   -4.397  -9.170  1.00 0.00 ? 60  VAL A HG13 2  
ATOM 2299  H HG21 . VAL A 1 52 ? 2.451   -1.575  -9.286  1.00 0.00 ? 60  VAL A HG21 2  
ATOM 2300  H HG22 . VAL A 1 52 ? 3.209   -2.530  -10.559 1.00 0.00 ? 60  VAL A HG22 2  
ATOM 2301  H HG23 . VAL A 1 52 ? 4.182   -1.424  -9.589  1.00 0.00 ? 60  VAL A HG23 2  
ATOM 2302  N N    . GLU A 1 53 ? 5.658   -0.696  -7.586  1.00 0.00 ? 61  GLU A N    2  
ATOM 2303  C CA   . GLU A 1 53 ? 6.898   0.013   -7.887  1.00 0.00 ? 61  GLU A CA   2  
ATOM 2304  C C    . GLU A 1 53 ? 6.890   1.416   -7.286  1.00 0.00 ? 61  GLU A C    2  
ATOM 2305  O O    . GLU A 1 53 ? 5.830   1.998   -7.055  1.00 0.00 ? 61  GLU A O    2  
ATOM 2306  C CB   . GLU A 1 53 ? 7.105   0.097   -9.401  1.00 0.00 ? 61  GLU A CB   2  
ATOM 2307  C CG   . GLU A 1 53 ? 8.568   0.131   -9.815  1.00 0.00 ? 61  GLU A CG   2  
ATOM 2308  C CD   . GLU A 1 53 ? 8.798   0.948   -11.070 1.00 0.00 ? 61  GLU A CD   2  
ATOM 2309  O OE1  . GLU A 1 53 ? 7.964   1.828   -11.369 1.00 0.00 ? 61  GLU A OE1  2  
ATOM 2310  O OE2  . GLU A 1 53 ? 9.815   0.709   -11.755 1.00 0.00 ? 61  GLU A OE2  2  
ATOM 2311  H H    . GLU A 1 53 ? 4.858   -0.182  -7.352  1.00 0.00 ? 61  GLU A H    2  
ATOM 2312  H HA   . GLU A 1 53 ? 7.713   -0.547  -7.453  1.00 0.00 ? 61  GLU A HA   2  
ATOM 2313  H HB2  . GLU A 1 53 ? 6.643   -0.761  -9.864  1.00 0.00 ? 61  GLU A HB2  2  
ATOM 2314  H HB3  . GLU A 1 53 ? 6.629   0.994   -9.769  1.00 0.00 ? 61  GLU A HB3  2  
ATOM 2315  H HG2  . GLU A 1 53 ? 9.147   0.562   -9.013  1.00 0.00 ? 61  GLU A HG2  2  
ATOM 2316  H HG3  . GLU A 1 53 ? 8.902   -0.880  -9.994  1.00 0.00 ? 61  GLU A HG3  2  
ATOM 2317  N N    . VAL A 1 54 ? 8.082   1.952   -7.037  1.00 0.00 ? 62  VAL A N    2  
ATOM 2318  C CA   . VAL A 1 54 ? 8.218   3.286   -6.466  1.00 0.00 ? 62  VAL A CA   2  
ATOM 2319  C C    . VAL A 1 54 ? 9.533   3.932   -6.892  1.00 0.00 ? 62  VAL A C    2  
ATOM 2320  O O    . VAL A 1 54 ? 10.598  3.593   -6.378  1.00 0.00 ? 62  VAL A O    2  
ATOM 2321  C CB   . VAL A 1 54 ? 8.148   3.250   -4.926  1.00 0.00 ? 62  VAL A CB   2  
ATOM 2322  C CG1  . VAL A 1 54 ? 8.219   4.658   -4.348  1.00 0.00 ? 62  VAL A CG1  2  
ATOM 2323  C CG2  . VAL A 1 54 ? 6.885   2.539   -4.468  1.00 0.00 ? 62  VAL A CG2  2  
ATOM 2324  H H    . VAL A 1 54 ? 8.889   1.437   -7.245  1.00 0.00 ? 62  VAL A H    2  
ATOM 2325  H HA   . VAL A 1 54 ? 7.398   3.890   -6.828  1.00 0.00 ? 62  VAL A HA   2  
ATOM 2326  H HB   . VAL A 1 54 ? 9.000   2.694   -4.561  1.00 0.00 ? 62  VAL A HB   2  
ATOM 2327  H HG11 . VAL A 1 54 ? 8.237   5.379   -5.153  1.00 0.00 ? 62  VAL A HG11 2  
ATOM 2328  H HG12 . VAL A 1 54 ? 9.116   4.760   -3.755  1.00 0.00 ? 62  VAL A HG12 2  
ATOM 2329  H HG13 . VAL A 1 54 ? 7.355   4.837   -3.725  1.00 0.00 ? 62  VAL A HG13 2  
ATOM 2330  H HG21 . VAL A 1 54 ? 6.739   2.707   -3.411  1.00 0.00 ? 62  VAL A HG21 2  
ATOM 2331  H HG22 . VAL A 1 54 ? 6.980   1.480   -4.654  1.00 0.00 ? 62  VAL A HG22 2  
ATOM 2332  H HG23 . VAL A 1 54 ? 6.035   2.925   -5.013  1.00 0.00 ? 62  VAL A HG23 2  
ATOM 2333  N N    . ASN A 1 55 ? 9.450   4.864   -7.836  1.00 0.00 ? 63  ASN A N    2  
ATOM 2334  C CA   . ASN A 1 55 ? 10.632  5.558   -8.333  1.00 0.00 ? 63  ASN A CA   2  
ATOM 2335  C C    . ASN A 1 55 ? 11.626  4.572   -8.942  1.00 0.00 ? 63  ASN A C    2  
ATOM 2336  O O    . ASN A 1 55 ? 12.837  4.788   -8.895  1.00 0.00 ? 63  ASN A O    2  
ATOM 2337  C CB   . ASN A 1 55 ? 11.300  6.342   -7.204  1.00 0.00 ? 63  ASN A CB   2  
ATOM 2338  C CG   . ASN A 1 55 ? 11.920  7.639   -7.685  1.00 0.00 ? 63  ASN A CG   2  
ATOM 2339  O OD1  . ASN A 1 55 ? 12.999  7.643   -8.280  1.00 0.00 ? 63  ASN A OD1  2  
ATOM 2340  N ND2  . ASN A 1 55 ? 11.239  8.750   -7.431  1.00 0.00 ? 63  ASN A ND2  2  
ATOM 2341  H H    . ASN A 1 55 ? 8.571   5.091   -8.209  1.00 0.00 ? 63  ASN A H    2  
ATOM 2342  H HA   . ASN A 1 55 ? 10.314  6.249   -9.099  1.00 0.00 ? 63  ASN A HA   2  
ATOM 2343  H HB2  . ASN A 1 55 ? 10.562  6.576   -6.450  1.00 0.00 ? 63  ASN A HB2  2  
ATOM 2344  H HB3  . ASN A 1 55 ? 12.078  5.734   -6.762  1.00 0.00 ? 63  ASN A HB3  2  
ATOM 2345  H HD21 . ASN A 1 55 ? 10.388  8.672   -6.952  1.00 0.00 ? 63  ASN A HD21 2  
ATOM 2346  H HD22 . ASN A 1 55 ? 11.616  9.604   -7.731  1.00 0.00 ? 63  ASN A HD22 2  
ATOM 2347  N N    . GLY A 1 56 ? 11.104  3.490   -9.512  1.00 0.00 ? 64  GLY A N    2  
ATOM 2348  C CA   . GLY A 1 56 ? 11.958  2.488   -10.122 1.00 0.00 ? 64  GLY A CA   2  
ATOM 2349  C C    . GLY A 1 56 ? 12.238  1.323   -9.195  1.00 0.00 ? 64  GLY A C    2  
ATOM 2350  O O    . GLY A 1 56 ? 12.469  0.202   -9.648  1.00 0.00 ? 64  GLY A O    2  
ATOM 2351  H H    . GLY A 1 56 ? 10.132  3.373   -9.519  1.00 0.00 ? 64  GLY A H    2  
ATOM 2352  H HA2  . GLY A 1 56 ? 11.479  2.117   -11.015 1.00 0.00 ? 64  GLY A HA2  2  
ATOM 2353  H HA3  . GLY A 1 56 ? 12.896  2.950   -10.394 1.00 0.00 ? 64  GLY A HA3  2  
ATOM 2354  N N    . VAL A 1 57 ? 12.217  1.586   -7.892  1.00 0.00 ? 65  VAL A N    2  
ATOM 2355  C CA   . VAL A 1 57 ? 12.470  0.550   -6.898  1.00 0.00 ? 65  VAL A CA   2  
ATOM 2356  C C    . VAL A 1 57 ? 11.407  -0.543  -6.960  1.00 0.00 ? 65  VAL A C    2  
ATOM 2357  O O    . VAL A 1 57 ? 10.210  -0.262  -6.892  1.00 0.00 ? 65  VAL A O    2  
ATOM 2358  C CB   . VAL A 1 57 ? 12.505  1.134   -5.474  1.00 0.00 ? 65  VAL A CB   2  
ATOM 2359  C CG1  . VAL A 1 57 ? 12.967  0.082   -4.476  1.00 0.00 ? 65  VAL A CG1  2  
ATOM 2360  C CG2  . VAL A 1 57 ? 13.404  2.359   -5.421  1.00 0.00 ? 65  VAL A CG2  2  
ATOM 2361  H H    . VAL A 1 57 ? 12.026  2.499   -7.591  1.00 0.00 ? 65  VAL A H    2  
ATOM 2362  H HA   . VAL A 1 57 ? 13.435  0.112   -7.110  1.00 0.00 ? 65  VAL A HA   2  
ATOM 2363  H HB   . VAL A 1 57 ? 11.504  1.436   -5.204  1.00 0.00 ? 65  VAL A HB   2  
ATOM 2364  H HG11 . VAL A 1 57 ? 12.181  -0.642  -4.327  1.00 0.00 ? 65  VAL A HG11 2  
ATOM 2365  H HG12 . VAL A 1 57 ? 13.202  0.558   -3.534  1.00 0.00 ? 65  VAL A HG12 2  
ATOM 2366  H HG13 . VAL A 1 57 ? 13.847  -0.414  -4.857  1.00 0.00 ? 65  VAL A HG13 2  
ATOM 2367  H HG21 . VAL A 1 57 ? 14.346  2.136   -5.899  1.00 0.00 ? 65  VAL A HG21 2  
ATOM 2368  H HG22 . VAL A 1 57 ? 13.579  2.636   -4.392  1.00 0.00 ? 65  VAL A HG22 2  
ATOM 2369  H HG23 . VAL A 1 57 ? 12.924  3.180   -5.937  1.00 0.00 ? 65  VAL A HG23 2  
ATOM 2370  N N    . ASP A 1 58 ? 11.853  -1.787  -7.093  1.00 0.00 ? 66  ASP A N    2  
ATOM 2371  C CA   . ASP A 1 58 ? 10.939  -2.922  -7.165  1.00 0.00 ? 66  ASP A CA   2  
ATOM 2372  C C    . ASP A 1 58 ? 10.180  -3.094  -5.852  1.00 0.00 ? 66  ASP A C    2  
ATOM 2373  O O    . ASP A 1 58 ? 10.766  -3.429  -4.823  1.00 0.00 ? 66  ASP A O    2  
ATOM 2374  C CB   . ASP A 1 58 ? 11.709  -4.203  -7.496  1.00 0.00 ? 66  ASP A CB   2  
ATOM 2375  C CG   . ASP A 1 58 ? 11.182  -4.890  -8.741  1.00 0.00 ? 66  ASP A CG   2  
ATOM 2376  O OD1  . ASP A 1 58 ? 11.216  -4.266  -9.822  1.00 0.00 ? 66  ASP A OD1  2  
ATOM 2377  O OD2  . ASP A 1 58 ? 10.733  -6.051  -8.634  1.00 0.00 ? 66  ASP A OD2  2  
ATOM 2378  H H    . ASP A 1 58 ? 12.818  -1.948  -7.141  1.00 0.00 ? 66  ASP A H    2  
ATOM 2379  H HA   . ASP A 1 58 ? 10.229  -2.725  -7.955  1.00 0.00 ? 66  ASP A HA   2  
ATOM 2380  H HB2  . ASP A 1 58 ? 12.749  -3.959  -7.657  1.00 0.00 ? 66  ASP A HB2  2  
ATOM 2381  H HB3  . ASP A 1 58 ? 11.630  -4.890  -6.666  1.00 0.00 ? 66  ASP A HB3  2  
ATOM 2382  N N    . PHE A 1 59 ? 8.871   -2.864  -5.897  1.00 0.00 ? 67  PHE A N    2  
ATOM 2383  C CA   . PHE A 1 59 ? 8.031   -2.993  -4.713  1.00 0.00 ? 67  PHE A CA   2  
ATOM 2384  C C    . PHE A 1 59 ? 7.310   -4.341  -4.688  1.00 0.00 ? 67  PHE A C    2  
ATOM 2385  O O    . PHE A 1 59 ? 6.398   -4.550  -3.888  1.00 0.00 ? 67  PHE A O    2  
ATOM 2386  C CB   . PHE A 1 59 ? 7.011   -1.853  -4.659  1.00 0.00 ? 67  PHE A CB   2  
ATOM 2387  C CG   . PHE A 1 59 ? 7.365   -0.774  -3.677  1.00 0.00 ? 67  PHE A CG   2  
ATOM 2388  C CD1  . PHE A 1 59 ? 8.651   -0.257  -3.628  1.00 0.00 ? 67  PHE A CD1  2  
ATOM 2389  C CD2  . PHE A 1 59 ? 6.412   -0.273  -2.805  1.00 0.00 ? 67  PHE A CD2  2  
ATOM 2390  C CE1  . PHE A 1 59 ? 8.978   0.738   -2.728  1.00 0.00 ? 67  PHE A CE1  2  
ATOM 2391  C CE2  . PHE A 1 59 ? 6.733   0.721   -1.902  1.00 0.00 ? 67  PHE A CE2  2  
ATOM 2392  C CZ   . PHE A 1 59 ? 8.019   1.227   -1.863  1.00 0.00 ? 67  PHE A CZ   2  
ATOM 2393  H H    . PHE A 1 59 ? 8.461   -2.600  -6.747  1.00 0.00 ? 67  PHE A H    2  
ATOM 2394  H HA   . PHE A 1 59 ? 8.672   -2.928  -3.845  1.00 0.00 ? 67  PHE A HA   2  
ATOM 2395  H HB2  . PHE A 1 59 ? 6.939   -1.401  -5.637  1.00 0.00 ? 67  PHE A HB2  2  
ATOM 2396  H HB3  . PHE A 1 59 ? 6.047   -2.253  -4.381  1.00 0.00 ? 67  PHE A HB3  2  
ATOM 2397  H HD1  . PHE A 1 59 ? 9.401   -0.639  -4.305  1.00 0.00 ? 67  PHE A HD1  2  
ATOM 2398  H HD2  . PHE A 1 59 ? 5.408   -0.669  -2.835  1.00 0.00 ? 67  PHE A HD2  2  
ATOM 2399  H HE1  . PHE A 1 59 ? 9.983   1.131   -2.699  1.00 0.00 ? 67  PHE A HE1  2  
ATOM 2400  H HE2  . PHE A 1 59 ? 5.982   1.102   -1.227  1.00 0.00 ? 67  PHE A HE2  2  
ATOM 2401  H HZ   . PHE A 1 59 ? 8.272   2.006   -1.157  1.00 0.00 ? 67  PHE A HZ   2  
ATOM 2402  N N    . SER A 1 60 ? 7.721   -5.253  -5.567  1.00 0.00 ? 68  SER A N    2  
ATOM 2403  C CA   . SER A 1 60 ? 7.109   -6.574  -5.635  1.00 0.00 ? 68  SER A CA   2  
ATOM 2404  C C    . SER A 1 60 ? 7.516   -7.419  -4.434  1.00 0.00 ? 68  SER A C    2  
ATOM 2405  O O    . SER A 1 60 ? 6.685   -8.091  -3.823  1.00 0.00 ? 68  SER A O    2  
ATOM 2406  C CB   . SER A 1 60 ? 7.511   -7.280  -6.932  1.00 0.00 ? 68  SER A CB   2  
ATOM 2407  O OG   . SER A 1 60 ? 7.068   -6.555  -8.066  1.00 0.00 ? 68  SER A OG   2  
ATOM 2408  H H    . SER A 1 60 ? 8.452   -5.034  -6.180  1.00 0.00 ? 68  SER A H    2  
ATOM 2409  H HA   . SER A 1 60 ? 6.037   -6.444  -5.623  1.00 0.00 ? 68  SER A HA   2  
ATOM 2410  H HB2  . SER A 1 60 ? 8.586   -7.367  -6.973  1.00 0.00 ? 68  SER A HB2  2  
ATOM 2411  H HB3  . SER A 1 60 ? 7.070   -8.266  -6.955  1.00 0.00 ? 68  SER A HB3  2  
ATOM 2412  H HG   . SER A 1 60 ? 7.253   -5.622  -7.941  1.00 0.00 ? 68  SER A HG   2  
ATOM 2413  N N    . ASN A 1 61 ? 8.802   -7.379  -4.098  1.00 0.00 ? 69  ASN A N    2  
ATOM 2414  C CA   . ASN A 1 61 ? 9.322   -8.136  -2.967  1.00 0.00 ? 69  ASN A CA   2  
ATOM 2415  C C    . ASN A 1 61 ? 10.019  -7.213  -1.972  1.00 0.00 ? 69  ASN A C    2  
ATOM 2416  O O    . ASN A 1 61 ? 10.962  -7.615  -1.292  1.00 0.00 ? 69  ASN A O    2  
ATOM 2417  C CB   . ASN A 1 61 ? 10.296  -9.212  -3.451  1.00 0.00 ? 69  ASN A CB   2  
ATOM 2418  C CG   . ASN A 1 61 ? 10.306  -10.431 -2.549  1.00 0.00 ? 69  ASN A CG   2  
ATOM 2419  O OD1  . ASN A 1 61 ? 10.022  -10.335 -1.355  1.00 0.00 ? 69  ASN A OD1  2  
ATOM 2420  N ND2  . ASN A 1 61 ? 10.634  -11.585 -3.117  1.00 0.00 ? 69  ASN A ND2  2  
ATOM 2421  H H    . ASN A 1 61 ? 9.414   -6.822  -4.623  1.00 0.00 ? 69  ASN A H    2  
ATOM 2422  H HA   . ASN A 1 61 ? 8.488   -8.612  -2.474  1.00 0.00 ? 69  ASN A HA   2  
ATOM 2423  H HB2  . ASN A 1 61 ? 10.009  -9.526  -4.444  1.00 0.00 ? 69  ASN A HB2  2  
ATOM 2424  H HB3  . ASN A 1 61 ? 11.294  -8.800  -3.481  1.00 0.00 ? 69  ASN A HB3  2  
ATOM 2425  H HD21 . ASN A 1 61 ? 10.850  -11.586 -4.074  1.00 0.00 ? 69  ASN A HD21 2  
ATOM 2426  H HD22 . ASN A 1 61 ? 10.649  -12.389 -2.557  1.00 0.00 ? 69  ASN A HD22 2  
ATOM 2427  N N    . LEU A 1 62 ? 9.548   -5.972  -1.896  1.00 0.00 ? 70  LEU A N    2  
ATOM 2428  C CA   . LEU A 1 62 ? 10.124  -4.989  -0.985  1.00 0.00 ? 70  LEU A CA   2  
ATOM 2429  C C    . LEU A 1 62 ? 9.568   -5.161  0.423   1.00 0.00 ? 70  LEU A C    2  
ATOM 2430  O O    . LEU A 1 62 ? 8.413   -5.543  0.604   1.00 0.00 ? 70  LEU A O    2  
ATOM 2431  C CB   . LEU A 1 62 ? 9.844   -3.572  -1.488  1.00 0.00 ? 70  LEU A CB   2  
ATOM 2432  C CG   . LEU A 1 62 ? 10.478  -2.452  -0.656  1.00 0.00 ? 70  LEU A CG   2  
ATOM 2433  C CD1  . LEU A 1 62 ? 11.629  -1.808  -1.413  1.00 0.00 ? 70  LEU A CD1  2  
ATOM 2434  C CD2  . LEU A 1 62 ? 9.437   -1.408  -0.281  1.00 0.00 ? 70  LEU A CD2  2  
ATOM 2435  H H    . LEU A 1 62 ? 8.794   -5.711  -2.465  1.00 0.00 ? 70  LEU A H    2  
ATOM 2436  H HA   . LEU A 1 62 ? 11.192  -5.148  -0.959  1.00 0.00 ? 70  LEU A HA   2  
ATOM 2437  H HB2  . LEU A 1 62 ? 10.210  -3.493  -2.502  1.00 0.00 ? 70  LEU A HB2  2  
ATOM 2438  H HB3  . LEU A 1 62 ? 8.774   -3.423  -1.497  1.00 0.00 ? 70  LEU A HB3  2  
ATOM 2439  H HG   . LEU A 1 62 ? 10.875  -2.872  0.257   1.00 0.00 ? 70  LEU A HG   2  
ATOM 2440  H HD11 . LEU A 1 62 ? 12.439  -2.516  -1.508  1.00 0.00 ? 70  LEU A HD11 2  
ATOM 2441  H HD12 . LEU A 1 62 ? 11.973  -0.938  -0.872  1.00 0.00 ? 70  LEU A HD12 2  
ATOM 2442  H HD13 . LEU A 1 62 ? 11.293  -1.511  -2.396  1.00 0.00 ? 70  LEU A HD13 2  
ATOM 2443  H HD21 . LEU A 1 62 ? 8.821   -1.188  -1.141  1.00 0.00 ? 70  LEU A HD21 2  
ATOM 2444  H HD22 . LEU A 1 62 ? 9.932   -0.507  0.048   1.00 0.00 ? 70  LEU A HD22 2  
ATOM 2445  H HD23 . LEU A 1 62 ? 8.816   -1.789  0.518   1.00 0.00 ? 70  LEU A HD23 2  
ATOM 2446  N N    . ASP A 1 63 ? 10.400  -4.875  1.421   1.00 0.00 ? 71  ASP A N    2  
ATOM 2447  C CA   . ASP A 1 63 ? 9.990   -4.998  2.816   1.00 0.00 ? 71  ASP A CA   2  
ATOM 2448  C C    . ASP A 1 63 ? 9.038   -3.871  3.203   1.00 0.00 ? 71  ASP A C    2  
ATOM 2449  O O    . ASP A 1 63 ? 8.886   -2.894  2.471   1.00 0.00 ? 71  ASP A O    2  
ATOM 2450  C CB   . ASP A 1 63 ? 11.217  -4.990  3.731   1.00 0.00 ? 71  ASP A CB   2  
ATOM 2451  C CG   . ASP A 1 63 ? 11.222  -6.155  4.701   1.00 0.00 ? 71  ASP A CG   2  
ATOM 2452  O OD1  . ASP A 1 63 ? 10.141  -6.730  4.944   1.00 0.00 ? 71  ASP A OD1  2  
ATOM 2453  O OD2  . ASP A 1 63 ? 12.308  -6.491  5.217   1.00 0.00 ? 71  ASP A OD2  2  
ATOM 2454  H H    . ASP A 1 63 ? 11.309  -4.575  1.215   1.00 0.00 ? 71  ASP A H    2  
ATOM 2455  H HA   . ASP A 1 63 ? 9.475   -5.941  2.928   1.00 0.00 ? 71  ASP A HA   2  
ATOM 2456  H HB2  . ASP A 1 63 ? 12.109  -5.044  3.126   1.00 0.00 ? 71  ASP A HB2  2  
ATOM 2457  H HB3  . ASP A 1 63 ? 11.229  -4.071  4.300   1.00 0.00 ? 71  ASP A HB3  2  
ATOM 2458  N N    . HIS A 1 64 ? 8.399   -4.015  4.360   1.00 0.00 ? 72  HIS A N    2  
ATOM 2459  C CA   . HIS A 1 64 ? 7.462   -3.009  4.847   1.00 0.00 ? 72  HIS A CA   2  
ATOM 2460  C C    . HIS A 1 64 ? 8.184   -1.706  5.176   1.00 0.00 ? 72  HIS A C    2  
ATOM 2461  O O    . HIS A 1 64 ? 7.832   -0.643  4.665   1.00 0.00 ? 72  HIS A O    2  
ATOM 2462  C CB   . HIS A 1 64 ? 6.726   -3.527  6.084   1.00 0.00 ? 72  HIS A CB   2  
ATOM 2463  C CG   . HIS A 1 64 ? 5.542   -2.695  6.468   1.00 0.00 ? 72  HIS A CG   2  
ATOM 2464  N ND1  . HIS A 1 64 ? 4.243   -3.048  6.163   1.00 0.00 ? 72  HIS A ND1  2  
ATOM 2465  C CD2  . HIS A 1 64 ? 5.464   -1.519  7.135   1.00 0.00 ? 72  HIS A CD2  2  
ATOM 2466  C CE1  . HIS A 1 64 ? 3.420   -2.125  6.628   1.00 0.00 ? 72  HIS A CE1  2  
ATOM 2467  N NE2  . HIS A 1 64 ? 4.134   -1.187  7.222   1.00 0.00 ? 72  HIS A NE2  2  
ATOM 2468  H H    . HIS A 1 64 ? 8.562   -4.817  4.901   1.00 0.00 ? 72  HIS A H    2  
ATOM 2469  H HA   . HIS A 1 64 ? 6.743   -2.821  4.064   1.00 0.00 ? 72  HIS A HA   2  
ATOM 2470  H HB2  . HIS A 1 64 ? 6.379   -4.531  5.894   1.00 0.00 ? 72  HIS A HB2  2  
ATOM 2471  H HB3  . HIS A 1 64 ? 7.409   -3.540  6.920   1.00 0.00 ? 72  HIS A HB3  2  
ATOM 2472  H HD1  . HIS A 1 64 ? 3.968   -3.853  5.680   1.00 0.00 ? 72  HIS A HD1  2  
ATOM 2473  H HD2  . HIS A 1 64 ? 6.295   -0.950  7.526   1.00 0.00 ? 72  HIS A HD2  2  
ATOM 2474  H HE1  . HIS A 1 64 ? 2.343   -2.138  6.538   1.00 0.00 ? 72  HIS A HE1  2  
ATOM 2475  H HE2  . HIS A 1 64 ? 3.767   -0.442  7.738   1.00 0.00 ? 72  HIS A HE2  2  
ATOM 2476  N N    . LYS A 1 65 ? 9.197   -1.798  6.033   1.00 0.00 ? 73  LYS A N    2  
ATOM 2477  C CA   . LYS A 1 65 ? 9.969   -0.625  6.430   1.00 0.00 ? 73  LYS A CA   2  
ATOM 2478  C C    . LYS A 1 65 ? 10.603  0.043   5.214   1.00 0.00 ? 73  LYS A C    2  
ATOM 2479  O O    . LYS A 1 65 ? 10.654  1.270   5.123   1.00 0.00 ? 73  LYS A O    2  
ATOM 2480  C CB   . LYS A 1 65 ? 11.053  -1.019  7.439   1.00 0.00 ? 73  LYS A CB   2  
ATOM 2481  C CG   . LYS A 1 65 ? 10.817  -0.461  8.832   1.00 0.00 ? 73  LYS A CG   2  
ATOM 2482  C CD   . LYS A 1 65 ? 10.729  1.056   8.818   1.00 0.00 ? 73  LYS A CD   2  
ATOM 2483  C CE   . LYS A 1 65 ? 11.346  1.661   10.068  1.00 0.00 ? 73  LYS A CE   2  
ATOM 2484  N NZ   . LYS A 1 65 ? 10.368  1.739   11.189  1.00 0.00 ? 73  LYS A NZ   2  
ATOM 2485  H H    . LYS A 1 65 ? 9.430   -2.673  6.407   1.00 0.00 ? 73  LYS A H    2  
ATOM 2486  H HA   . LYS A 1 65 ? 9.293   0.074   6.898   1.00 0.00 ? 73  LYS A HA   2  
ATOM 2487  H HB2  . LYS A 1 65 ? 11.089  -2.096  7.507   1.00 0.00 ? 73  LYS A HB2  2  
ATOM 2488  H HB3  . LYS A 1 65 ? 12.007  -0.657  7.087   1.00 0.00 ? 73  LYS A HB3  2  
ATOM 2489  H HG2  . LYS A 1 65 ? 9.890   -0.862  9.218   1.00 0.00 ? 73  LYS A HG2  2  
ATOM 2490  H HG3  . LYS A 1 65 ? 11.633  -0.760  9.472   1.00 0.00 ? 73  LYS A HG3  2  
ATOM 2491  H HD2  . LYS A 1 65 ? 11.255  1.428   7.952   1.00 0.00 ? 73  LYS A HD2  2  
ATOM 2492  H HD3  . LYS A 1 65 ? 9.690   1.346   8.764   1.00 0.00 ? 73  LYS A HD3  2  
ATOM 2493  H HE2  . LYS A 1 65 ? 12.182  1.050   10.373  1.00 0.00 ? 73  LYS A HE2  2  
ATOM 2494  H HE3  . LYS A 1 65 ? 11.695  2.657   9.836   1.00 0.00 ? 73  LYS A HE3  2  
ATOM 2495  H HZ1  . LYS A 1 65 ? 10.478  0.916   11.815  1.00 0.00 ? 73  LYS A HZ1  2  
ATOM 2496  H HZ2  . LYS A 1 65 ? 9.399   1.752   10.818  1.00 0.00 ? 73  LYS A HZ2  2  
ATOM 2497  H HZ3  . LYS A 1 65 ? 10.528  2.606   11.742  1.00 0.00 ? 73  LYS A HZ3  2  
ATOM 2498  N N    . GLU A 1 66 ? 11.081  -0.772  4.279   1.00 0.00 ? 74  GLU A N    2  
ATOM 2499  C CA   . GLU A 1 66 ? 11.708  -0.259  3.068   1.00 0.00 ? 74  GLU A CA   2  
ATOM 2500  C C    . GLU A 1 66 ? 10.725  0.592   2.269   1.00 0.00 ? 74  GLU A C    2  
ATOM 2501  O O    . GLU A 1 66 ? 11.100  1.611   1.690   1.00 0.00 ? 74  GLU A O    2  
ATOM 2502  C CB   . GLU A 1 66 ? 12.219  -1.413  2.204   1.00 0.00 ? 74  GLU A CB   2  
ATOM 2503  C CG   . GLU A 1 66 ? 13.652  -1.817  2.513   1.00 0.00 ? 74  GLU A CG   2  
ATOM 2504  C CD   . GLU A 1 66 ? 14.278  -2.638  1.404   1.00 0.00 ? 74  GLU A CD   2  
ATOM 2505  O OE1  . GLU A 1 66 ? 13.842  -2.498  0.241   1.00 0.00 ? 74  GLU A OE1  2  
ATOM 2506  O OE2  . GLU A 1 66 ? 15.204  -3.423  1.697   1.00 0.00 ? 74  GLU A OE2  2  
ATOM 2507  H H    . GLU A 1 66 ? 11.009  -1.741  4.406   1.00 0.00 ? 74  GLU A H    2  
ATOM 2508  H HA   . GLU A 1 66 ? 12.545  0.357   3.362   1.00 0.00 ? 74  GLU A HA   2  
ATOM 2509  H HB2  . GLU A 1 66 ? 11.585  -2.273  2.359   1.00 0.00 ? 74  GLU A HB2  2  
ATOM 2510  H HB3  . GLU A 1 66 ? 12.166  -1.122  1.165   1.00 0.00 ? 74  GLU A HB3  2  
ATOM 2511  H HG2  . GLU A 1 66 ? 14.241  -0.923  2.653   1.00 0.00 ? 74  GLU A HG2  2  
ATOM 2512  H HG3  . GLU A 1 66 ? 13.660  -2.399  3.422   1.00 0.00 ? 74  GLU A HG3  2  
ATOM 2513  N N    . ALA A 1 67 ? 9.467   0.168   2.248   1.00 0.00 ? 75  ALA A N    2  
ATOM 2514  C CA   . ALA A 1 67 ? 8.428   0.891   1.524   1.00 0.00 ? 75  ALA A CA   2  
ATOM 2515  C C    . ALA A 1 67 ? 8.173   2.255   2.154   1.00 0.00 ? 75  ALA A C    2  
ATOM 2516  O O    . ALA A 1 67 ? 8.085   3.267   1.458   1.00 0.00 ? 75  ALA A O    2  
ATOM 2517  C CB   . ALA A 1 67 ? 7.145   0.076   1.489   1.00 0.00 ? 75  ALA A CB   2  
ATOM 2518  H H    . ALA A 1 67 ? 9.231   -0.651  2.732   1.00 0.00 ? 75  ALA A H    2  
ATOM 2519  H HA   . ALA A 1 67 ? 8.767   1.031   0.508   1.00 0.00 ? 75  ALA A HA   2  
ATOM 2520  H HB1  . ALA A 1 67 ? 6.654   0.217   0.538   1.00 0.00 ? 75  ALA A HB1  2  
ATOM 2521  H HB2  . ALA A 1 67 ? 6.490   0.402   2.283   1.00 0.00 ? 75  ALA A HB2  2  
ATOM 2522  H HB3  . ALA A 1 67 ? 7.379   -0.970  1.624   1.00 0.00 ? 75  ALA A HB3  2  
ATOM 2523  N N    . VAL A 1 68 ? 8.056   2.276   3.478   1.00 0.00 ? 76  VAL A N    2  
ATOM 2524  C CA   . VAL A 1 68 ? 7.810   3.515   4.203   1.00 0.00 ? 76  VAL A CA   2  
ATOM 2525  C C    . VAL A 1 68 ? 9.025   4.436   4.142   1.00 0.00 ? 76  VAL A C    2  
ATOM 2526  O O    . VAL A 1 68 ? 8.890   5.644   3.951   1.00 0.00 ? 76  VAL A O    2  
ATOM 2527  C CB   . VAL A 1 68 ? 7.458   3.245   5.677   1.00 0.00 ? 76  VAL A CB   2  
ATOM 2528  C CG1  . VAL A 1 68 ? 7.041   4.531   6.374   1.00 0.00 ? 76  VAL A CG1  2  
ATOM 2529  C CG2  . VAL A 1 68 ? 6.362   2.195   5.779   1.00 0.00 ? 76  VAL A CG2  2  
ATOM 2530  H H    . VAL A 1 68 ? 8.135   1.436   3.978   1.00 0.00 ? 76  VAL A H    2  
ATOM 2531  H HA   . VAL A 1 68 ? 6.972   4.012   3.739   1.00 0.00 ? 76  VAL A HA   2  
ATOM 2532  H HB   . VAL A 1 68 ? 8.339   2.862   6.172   1.00 0.00 ? 76  VAL A HB   2  
ATOM 2533  H HG11 . VAL A 1 68 ? 6.786   4.316   7.401   1.00 0.00 ? 76  VAL A HG11 2  
ATOM 2534  H HG12 . VAL A 1 68 ? 6.183   4.951   5.870   1.00 0.00 ? 76  VAL A HG12 2  
ATOM 2535  H HG13 . VAL A 1 68 ? 7.857   5.237   6.345   1.00 0.00 ? 76  VAL A HG13 2  
ATOM 2536  H HG21 . VAL A 1 68 ? 6.033   2.116   6.804   1.00 0.00 ? 76  VAL A HG21 2  
ATOM 2537  H HG22 . VAL A 1 68 ? 6.745   1.240   5.448   1.00 0.00 ? 76  VAL A HG22 2  
ATOM 2538  H HG23 . VAL A 1 68 ? 5.529   2.483   5.155   1.00 0.00 ? 76  VAL A HG23 2  
ATOM 2539  N N    . ASN A 1 69 ? 10.210  3.857   4.308   1.00 0.00 ? 77  ASN A N    2  
ATOM 2540  C CA   . ASN A 1 69 ? 11.450  4.627   4.275   1.00 0.00 ? 77  ASN A CA   2  
ATOM 2541  C C    . ASN A 1 69 ? 11.576  5.412   2.974   1.00 0.00 ? 77  ASN A C    2  
ATOM 2542  O O    . ASN A 1 69 ? 11.738  6.632   2.987   1.00 0.00 ? 77  ASN A O    2  
ATOM 2543  C CB   . ASN A 1 69 ? 12.654  3.698   4.448   1.00 0.00 ? 77  ASN A CB   2  
ATOM 2544  C CG   . ASN A 1 69 ? 13.537  4.106   5.613   1.00 0.00 ? 77  ASN A CG   2  
ATOM 2545  O OD1  . ASN A 1 69 ? 13.925  3.275   6.433   1.00 0.00 ? 77  ASN A OD1  2  
ATOM 2546  N ND2  . ASN A 1 69 ? 13.857  5.392   5.690   1.00 0.00 ? 77  ASN A ND2  2  
ATOM 2547  H H    . ASN A 1 69 ? 10.252  2.890   4.458   1.00 0.00 ? 77  ASN A H    2  
ATOM 2548  H HA   . ASN A 1 69 ? 11.425  5.325   5.099   1.00 0.00 ? 77  ASN A HA   2  
ATOM 2549  H HB2  . ASN A 1 69 ? 12.303  2.693   4.624   1.00 0.00 ? 77  ASN A HB2  2  
ATOM 2550  H HB3  . ASN A 1 69 ? 13.249  3.715   3.547   1.00 0.00 ? 77  ASN A HB3  2  
ATOM 2551  H HD21 . ASN A 1 69 ? 13.513  5.998   5.001   1.00 0.00 ? 77  ASN A HD21 2  
ATOM 2552  H HD22 . ASN A 1 69 ? 14.428  5.683   6.432   1.00 0.00 ? 77  ASN A HD22 2  
ATOM 2553  N N    . VAL A 1 70 ? 11.505  4.706   1.850   1.00 0.00 ? 78  VAL A N    2  
ATOM 2554  C CA   . VAL A 1 70 ? 11.615  5.342   0.543   1.00 0.00 ? 78  VAL A CA   2  
ATOM 2555  C C    . VAL A 1 70 ? 10.530  6.397   0.351   1.00 0.00 ? 78  VAL A C    2  
ATOM 2556  O O    . VAL A 1 70 ? 10.799  7.495   -0.135  1.00 0.00 ? 78  VAL A O    2  
ATOM 2557  C CB   . VAL A 1 70 ? 11.525  4.308   -0.595  1.00 0.00 ? 78  VAL A CB   2  
ATOM 2558  C CG1  . VAL A 1 70 ? 12.687  3.328   -0.514  1.00 0.00 ? 78  VAL A CG1  2  
ATOM 2559  C CG2  . VAL A 1 70 ? 10.196  3.571   -0.546  1.00 0.00 ? 78  VAL A CG2  2  
ATOM 2560  H H    . VAL A 1 70 ? 11.379  3.736   1.901   1.00 0.00 ? 78  VAL A H    2  
ATOM 2561  H HA   . VAL A 1 70 ? 12.582  5.821   0.488   1.00 0.00 ? 78  VAL A HA   2  
ATOM 2562  H HB   . VAL A 1 70 ? 11.590  4.832   -1.537  1.00 0.00 ? 78  VAL A HB   2  
ATOM 2563  H HG11 . VAL A 1 70 ? 13.533  3.812   -0.048  1.00 0.00 ? 78  VAL A HG11 2  
ATOM 2564  H HG12 . VAL A 1 70 ? 12.957  3.008   -1.510  1.00 0.00 ? 78  VAL A HG12 2  
ATOM 2565  H HG13 . VAL A 1 70 ? 12.394  2.471   0.074   1.00 0.00 ? 78  VAL A HG13 2  
ATOM 2566  H HG21 . VAL A 1 70 ? 10.057  3.143   0.434   1.00 0.00 ? 78  VAL A HG21 2  
ATOM 2567  H HG22 . VAL A 1 70 ? 10.193  2.784   -1.286  1.00 0.00 ? 78  VAL A HG22 2  
ATOM 2568  H HG23 . VAL A 1 70 ? 9.394   4.264   -0.754  1.00 0.00 ? 78  VAL A HG23 2  
ATOM 2569  N N    . LEU A 1 71 ? 9.305   6.058   0.739   1.00 0.00 ? 79  LEU A N    2  
ATOM 2570  C CA   . LEU A 1 71 ? 8.182   6.979   0.613   1.00 0.00 ? 79  LEU A CA   2  
ATOM 2571  C C    . LEU A 1 71 ? 8.370   8.189   1.525   1.00 0.00 ? 79  LEU A C    2  
ATOM 2572  O O    . LEU A 1 71 ? 7.926   9.293   1.209   1.00 0.00 ? 79  LEU A O    2  
ATOM 2573  C CB   . LEU A 1 71 ? 6.869   6.267   0.950   1.00 0.00 ? 79  LEU A CB   2  
ATOM 2574  C CG   . LEU A 1 71 ? 6.101   5.715   -0.254  1.00 0.00 ? 79  LEU A CG   2  
ATOM 2575  C CD1  . LEU A 1 71 ? 5.527   6.850   -1.091  1.00 0.00 ? 79  LEU A CD1  2  
ATOM 2576  C CD2  . LEU A 1 71 ? 7.001   4.827   -1.098  1.00 0.00 ? 79  LEU A CD2  2  
ATOM 2577  H H    . LEU A 1 71 ? 9.154   5.168   1.122   1.00 0.00 ? 79  LEU A H    2  
ATOM 2578  H HA   . LEU A 1 71 ? 8.145   7.319   -0.412  1.00 0.00 ? 79  LEU A HA   2  
ATOM 2579  H HB2  . LEU A 1 71 ? 7.092   5.446   1.616   1.00 0.00 ? 79  LEU A HB2  2  
ATOM 2580  H HB3  . LEU A 1 71 ? 6.228   6.964   1.468   1.00 0.00 ? 79  LEU A HB3  2  
ATOM 2581  H HG   . LEU A 1 71 ? 5.275   5.115   0.101   1.00 0.00 ? 79  LEU A HG   2  
ATOM 2582  H HD11 . LEU A 1 71 ? 5.755   7.796   -0.623  1.00 0.00 ? 79  LEU A HD11 2  
ATOM 2583  H HD12 . LEU A 1 71 ? 4.457   6.735   -1.168  1.00 0.00 ? 79  LEU A HD12 2  
ATOM 2584  H HD13 . LEU A 1 71 ? 5.964   6.825   -2.080  1.00 0.00 ? 79  LEU A HD13 2  
ATOM 2585  H HD21 . LEU A 1 71 ? 7.874   5.385   -1.405  1.00 0.00 ? 79  LEU A HD21 2  
ATOM 2586  H HD22 . LEU A 1 71 ? 6.461   4.494   -1.973  1.00 0.00 ? 79  LEU A HD22 2  
ATOM 2587  H HD23 . LEU A 1 71 ? 7.310   3.970   -0.518  1.00 0.00 ? 79  LEU A HD23 2  
ATOM 2588  N N    . LYS A 1 72 ? 9.032   7.971   2.657   1.00 0.00 ? 80  LYS A N    2  
ATOM 2589  C CA   . LYS A 1 72 ? 9.282   9.040   3.618   1.00 0.00 ? 80  LYS A CA   2  
ATOM 2590  C C    . LYS A 1 72 ? 10.505  9.862   3.217   1.00 0.00 ? 80  LYS A C    2  
ATOM 2591  O O    . LYS A 1 72 ? 10.586  11.055  3.510   1.00 0.00 ? 80  LYS A O    2  
ATOM 2592  C CB   . LYS A 1 72 ? 9.486   8.456   5.019   1.00 0.00 ? 80  LYS A CB   2  
ATOM 2593  C CG   . LYS A 1 72 ? 8.239   8.503   5.889   1.00 0.00 ? 80  LYS A CG   2  
ATOM 2594  C CD   . LYS A 1 72 ? 7.042   7.878   5.190   1.00 0.00 ? 80  LYS A CD   2  
ATOM 2595  C CE   . LYS A 1 72 ? 5.826   7.836   6.100   1.00 0.00 ? 80  LYS A CE   2  
ATOM 2596  N NZ   . LYS A 1 72 ? 5.625   9.123   6.822   1.00 0.00 ? 80  LYS A NZ   2  
ATOM 2597  H H    . LYS A 1 72 ? 9.362   7.068   2.851   1.00 0.00 ? 80  LYS A H    2  
ATOM 2598  H HA   . LYS A 1 72 ? 8.417   9.685   3.629   1.00 0.00 ? 80  LYS A HA   2  
ATOM 2599  H HB2  . LYS A 1 72 ? 9.793   7.425   4.925   1.00 0.00 ? 80  LYS A HB2  2  
ATOM 2600  H HB3  . LYS A 1 72 ? 10.267  9.010   5.518   1.00 0.00 ? 80  LYS A HB3  2  
ATOM 2601  H HG2  . LYS A 1 72 ? 8.430   7.964   6.804   1.00 0.00 ? 80  LYS A HG2  2  
ATOM 2602  H HG3  . LYS A 1 72 ? 8.013   9.533   6.119   1.00 0.00 ? 80  LYS A HG3  2  
ATOM 2603  H HD2  . LYS A 1 72 ? 6.803   8.463   4.315   1.00 0.00 ? 80  LYS A HD2  2  
ATOM 2604  H HD3  . LYS A 1 72 ? 7.296   6.872   4.896   1.00 0.00 ? 80  LYS A HD3  2  
ATOM 2605  H HE2  . LYS A 1 72 ? 4.951   7.630   5.501   1.00 0.00 ? 80  LYS A HE2  2  
ATOM 2606  H HE3  . LYS A 1 72 ? 5.960   7.045   6.824   1.00 0.00 ? 80  LYS A HE3  2  
ATOM 2607  H HZ1  . LYS A 1 72 ? 4.627   9.226   7.098   1.00 0.00 ? 80  LYS A HZ1  2  
ATOM 2608  H HZ2  . LYS A 1 72 ? 5.887   9.921   6.210   1.00 0.00 ? 80  LYS A HZ2  2  
ATOM 2609  H HZ3  . LYS A 1 72 ? 6.215   9.148   7.677   1.00 0.00 ? 80  LYS A HZ3  2  
ATOM 2610  N N    . SER A 1 73 ? 11.453  9.214   2.550   1.00 0.00 ? 81  SER A N    2  
ATOM 2611  C CA   . SER A 1 73 ? 12.675  9.882   2.113   1.00 0.00 ? 81  SER A CA   2  
ATOM 2612  C C    . SER A 1 73 ? 12.386  10.881  0.996   1.00 0.00 ? 81  SER A C    2  
ATOM 2613  O O    . SER A 1 73 ? 12.522  12.090  1.182   1.00 0.00 ? 81  SER A O    2  
ATOM 2614  C CB   . SER A 1 73 ? 13.701  8.853   1.637   1.00 0.00 ? 81  SER A CB   2  
ATOM 2615  O OG   . SER A 1 73 ? 14.870  9.486   1.149   1.00 0.00 ? 81  SER A OG   2  
ATOM 2616  H H    . SER A 1 73 ? 11.332  8.264   2.349   1.00 0.00 ? 81  SER A H    2  
ATOM 2617  H HA   . SER A 1 73 ? 13.080  10.416  2.958   1.00 0.00 ? 81  SER A HA   2  
ATOM 2618  H HB2  . SER A 1 73 ? 13.971  8.211   2.461   1.00 0.00 ? 81  SER A HB2  2  
ATOM 2619  H HB3  . SER A 1 73 ? 13.271  8.258   0.845   1.00 0.00 ? 81  SER A HB3  2  
ATOM 2620  H HG   . SER A 1 73 ? 15.054  9.178   0.259   1.00 0.00 ? 81  SER A HG   2  
ATOM 2621  N N    . SER A 1 74 ? 11.993  10.368  -0.164  1.00 0.00 ? 82  SER A N    2  
ATOM 2622  C CA   . SER A 1 74 ? 11.693  11.216  -1.313  1.00 0.00 ? 82  SER A CA   2  
ATOM 2623  C C    . SER A 1 74 ? 10.325  11.876  -1.164  1.00 0.00 ? 82  SER A C    2  
ATOM 2624  O O    . SER A 1 74 ? 9.350   11.232  -0.776  1.00 0.00 ? 82  SER A O    2  
ATOM 2625  C CB   . SER A 1 74 ? 11.742  10.397  -2.604  1.00 0.00 ? 82  SER A CB   2  
ATOM 2626  O OG   . SER A 1 74 ? 12.798  10.832  -3.444  1.00 0.00 ? 82  SER A OG   2  
ATOM 2627  H H    . SER A 1 74 ? 11.907  9.395   -0.253  1.00 0.00 ? 82  SER A H    2  
ATOM 2628  H HA   . SER A 1 74 ? 12.447  11.987  -1.359  1.00 0.00 ? 82  SER A HA   2  
ATOM 2629  H HB2  . SER A 1 74 ? 11.900  9.356   -2.362  1.00 0.00 ? 82  SER A HB2  2  
ATOM 2630  H HB3  . SER A 1 74 ? 10.808  10.504  -3.136  1.00 0.00 ? 82  SER A HB3  2  
ATOM 2631  H HG   . SER A 1 74 ? 12.795  10.319  -4.255  1.00 0.00 ? 82  SER A HG   2  
ATOM 2632  N N    . ARG A 1 75 ? 10.261  13.165  -1.482  1.00 0.00 ? 83  ARG A N    2  
ATOM 2633  C CA   . ARG A 1 75 ? 9.013   13.916  -1.389  1.00 0.00 ? 83  ARG A CA   2  
ATOM 2634  C C    . ARG A 1 75 ? 8.176   13.726  -2.651  1.00 0.00 ? 83  ARG A C    2  
ATOM 2635  O O    . ARG A 1 75 ? 6.995   13.388  -2.578  1.00 0.00 ? 83  ARG A O    2  
ATOM 2636  C CB   . ARG A 1 75 ? 9.301   15.402  -1.172  1.00 0.00 ? 83  ARG A CB   2  
ATOM 2637  C CG   . ARG A 1 75 ? 9.345   15.806  0.293   1.00 0.00 ? 83  ARG A CG   2  
ATOM 2638  C CD   . ARG A 1 75 ? 10.720  16.320  0.693   1.00 0.00 ? 83  ARG A CD   2  
ATOM 2639  N NE   . ARG A 1 75 ? 10.884  17.740  0.392   1.00 0.00 ? 83  ARG A NE   2  
ATOM 2640  C CZ   . ARG A 1 75 ? 10.195  18.709  0.992   1.00 0.00 ? 83  ARG A CZ   2  
ATOM 2641  N NH1  . ARG A 1 75 ? 9.297   18.416  1.924   1.00 0.00 ? 83  ARG A NH1  2  
ATOM 2642  N NH2  . ARG A 1 75 ? 10.407  19.976  0.658   1.00 0.00 ? 83  ARG A NH2  2  
ATOM 2643  H H    . ARG A 1 75 ? 11.071  13.623  -1.789  1.00 0.00 ? 83  ARG A H    2  
ATOM 2644  H HA   . ARG A 1 75 ? 8.460   13.537  -0.543  1.00 0.00 ? 83  ARG A HA   2  
ATOM 2645  H HB2  . ARG A 1 75 ? 10.255  15.641  -1.620  1.00 0.00 ? 83  ARG A HB2  2  
ATOM 2646  H HB3  . ARG A 1 75 ? 8.530   15.982  -1.659  1.00 0.00 ? 83  ARG A HB3  2  
ATOM 2647  H HG2  . ARG A 1 75 ? 8.618   16.587  0.463   1.00 0.00 ? 83  ARG A HG2  2  
ATOM 2648  H HG3  . ARG A 1 75 ? 9.102   14.948  0.901   1.00 0.00 ? 83  ARG A HG3  2  
ATOM 2649  H HD2  . ARG A 1 75 ? 10.852  16.169  1.754   1.00 0.00 ? 83  ARG A HD2  2  
ATOM 2650  H HD3  . ARG A 1 75 ? 11.469  15.758  0.155   1.00 0.00 ? 83  ARG A HD3  2  
ATOM 2651  H HE   . ARG A 1 75 ? 11.539  17.984  -0.293  1.00 0.00 ? 83  ARG A HE   2  
ATOM 2652  H HH11 . ARG A 1 75 ? 9.134   17.463  2.180   1.00 0.00 ? 83  ARG A HH11 2  
ATOM 2653  H HH12 . ARG A 1 75 ? 8.785   19.148  2.370   1.00 0.00 ? 83  ARG A HH12 2  
ATOM 2654  H HH21 . ARG A 1 75 ? 11.083  20.201  -0.043  1.00 0.00 ? 83  ARG A HH21 2  
ATOM 2655  H HH22 . ARG A 1 75 ? 9.890   20.703  1.108   1.00 0.00 ? 83  ARG A HH22 2  
ATOM 2656  N N    . SER A 1 76 ? 8.799   13.944  -3.803  1.00 0.00 ? 84  SER A N    2  
ATOM 2657  C CA   . SER A 1 76 ? 8.117   13.794  -5.083  1.00 0.00 ? 84  SER A CA   2  
ATOM 2658  C C    . SER A 1 76 ? 8.574   12.523  -5.792  1.00 0.00 ? 84  SER A C    2  
ATOM 2659  O O    . SER A 1 76 ? 9.455   12.564  -6.651  1.00 0.00 ? 84  SER A O    2  
ATOM 2660  C CB   . SER A 1 76 ? 8.381   15.011  -5.972  1.00 0.00 ? 84  SER A CB   2  
ATOM 2661  O OG   . SER A 1 76 ? 9.734   15.056  -6.386  1.00 0.00 ? 84  SER A OG   2  
ATOM 2662  H H    . SER A 1 76 ? 9.743   14.208  -3.793  1.00 0.00 ? 84  SER A H    2  
ATOM 2663  H HA   . SER A 1 76 ? 7.057   13.723  -4.889  1.00 0.00 ? 84  SER A HA   2  
ATOM 2664  H HB2  . SER A 1 76 ? 7.751   14.959  -6.847  1.00 0.00 ? 84  SER A HB2  2  
ATOM 2665  H HB3  . SER A 1 76 ? 8.154   15.912  -5.419  1.00 0.00 ? 84  SER A HB3  2  
ATOM 2666  H HG   . SER A 1 76 ? 9.775   15.091  -7.345  1.00 0.00 ? 84  SER A HG   2  
ATOM 2667  N N    . LEU A 1 77 ? 7.974   11.396  -5.423  1.00 0.00 ? 85  LEU A N    2  
ATOM 2668  C CA   . LEU A 1 77 ? 8.327   10.112  -6.022  1.00 0.00 ? 85  LEU A CA   2  
ATOM 2669  C C    . LEU A 1 77 ? 7.149   9.520   -6.791  1.00 0.00 ? 85  LEU A C    2  
ATOM 2670  O O    . LEU A 1 77 ? 6.004   9.586   -6.343  1.00 0.00 ? 85  LEU A O    2  
ATOM 2671  C CB   . LEU A 1 77 ? 8.793   9.121   -4.945  1.00 0.00 ? 85  LEU A CB   2  
ATOM 2672  C CG   . LEU A 1 77 ? 8.497   9.529   -3.499  1.00 0.00 ? 85  LEU A CG   2  
ATOM 2673  C CD1  . LEU A 1 77 ? 7.002   9.470   -3.220  1.00 0.00 ? 85  LEU A CD1  2  
ATOM 2674  C CD2  . LEU A 1 77 ? 9.256   8.636   -2.529  1.00 0.00 ? 85  LEU A CD2  2  
ATOM 2675  H H    . LEU A 1 77 ? 7.282   11.426  -4.730  1.00 0.00 ? 85  LEU A H    2  
ATOM 2676  H HA   . LEU A 1 77 ? 9.139   10.283  -6.713  1.00 0.00 ? 85  LEU A HA   2  
ATOM 2677  H HB2  . LEU A 1 77 ? 8.314   8.170   -5.130  1.00 0.00 ? 85  LEU A HB2  2  
ATOM 2678  H HB3  . LEU A 1 77 ? 9.860   8.991   -5.045  1.00 0.00 ? 85  LEU A HB3  2  
ATOM 2679  H HG   . LEU A 1 77 ? 8.824   10.547  -3.344  1.00 0.00 ? 85  LEU A HG   2  
ATOM 2680  H HD11 . LEU A 1 77 ? 6.461   9.533   -4.153  1.00 0.00 ? 85  LEU A HD11 2  
ATOM 2681  H HD12 . LEU A 1 77 ? 6.722   10.297  -2.584  1.00 0.00 ? 85  LEU A HD12 2  
ATOM 2682  H HD13 . LEU A 1 77 ? 6.765   8.539   -2.726  1.00 0.00 ? 85  LEU A HD13 2  
ATOM 2683  H HD21 . LEU A 1 77 ? 8.707   7.717   -2.380  1.00 0.00 ? 85  LEU A HD21 2  
ATOM 2684  H HD22 . LEU A 1 77 ? 9.368   9.144   -1.583  1.00 0.00 ? 85  LEU A HD22 2  
ATOM 2685  H HD23 . LEU A 1 77 ? 10.231  8.411   -2.936  1.00 0.00 ? 85  LEU A HD23 2  
ATOM 2686  N N    . THR A 1 78 ? 7.441   8.933   -7.946  1.00 0.00 ? 86  THR A N    2  
ATOM 2687  C CA   . THR A 1 78 ? 6.412   8.317   -8.774  1.00 0.00 ? 86  THR A CA   2  
ATOM 2688  C C    . THR A 1 78 ? 6.244   6.849   -8.401  1.00 0.00 ? 86  THR A C    2  
ATOM 2689  O O    . THR A 1 78 ? 7.174   6.054   -8.542  1.00 0.00 ? 86  THR A O    2  
ATOM 2690  C CB   . THR A 1 78 ? 6.769   8.445   -10.254 1.00 0.00 ? 86  THR A CB   2  
ATOM 2691  O OG1  . THR A 1 78 ? 7.180   9.767   -10.560 1.00 0.00 ? 86  THR A OG1  2  
ATOM 2692  C CG2  . THR A 1 78 ? 5.623   8.097   -11.179 1.00 0.00 ? 86  THR A CG2  2  
ATOM 2693  H H    . THR A 1 78 ? 8.374   8.906   -8.245  1.00 0.00 ? 86  THR A H    2  
ATOM 2694  H HA   . THR A 1 78 ? 5.483   8.833   -8.588  1.00 0.00 ? 86  THR A HA   2  
ATOM 2695  H HB   . THR A 1 78 ? 7.588   7.775   -10.477 1.00 0.00 ? 86  THR A HB   2  
ATOM 2696  H HG1  . THR A 1 78 ? 7.896   10.022  -9.973  1.00 0.00 ? 86  THR A HG1  2  
ATOM 2697  H HG21 . THR A 1 78 ? 4.697   8.107   -10.624 1.00 0.00 ? 86  THR A HG21 2  
ATOM 2698  H HG22 . THR A 1 78 ? 5.782   7.113   -11.596 1.00 0.00 ? 86  THR A HG22 2  
ATOM 2699  H HG23 . THR A 1 78 ? 5.571   8.822   -11.978 1.00 0.00 ? 86  THR A HG23 2  
ATOM 2700  N N    . ILE A 1 79 ? 5.061   6.496   -7.914  1.00 0.00 ? 87  ILE A N    2  
ATOM 2701  C CA   . ILE A 1 79 ? 4.783   5.124   -7.512  1.00 0.00 ? 87  ILE A CA   2  
ATOM 2702  C C    . ILE A 1 79 ? 3.766   4.462   -8.433  1.00 0.00 ? 87  ILE A C    2  
ATOM 2703  O O    . ILE A 1 79 ? 2.691   5.006   -8.685  1.00 0.00 ? 87  ILE A O    2  
ATOM 2704  C CB   . ILE A 1 79 ? 4.265   5.060   -6.060  1.00 0.00 ? 87  ILE A CB   2  
ATOM 2705  C CG1  . ILE A 1 79 ? 3.033   5.955   -5.896  1.00 0.00 ? 87  ILE A CG1  2  
ATOM 2706  C CG2  . ILE A 1 79 ? 5.362   5.471   -5.087  1.00 0.00 ? 87  ILE A CG2  2  
ATOM 2707  C CD1  . ILE A 1 79 ? 2.505   6.005   -4.478  1.00 0.00 ? 87  ILE A CD1  2  
ATOM 2708  H H    . ILE A 1 79 ? 4.362   7.176   -7.818  1.00 0.00 ? 87  ILE A H    2  
ATOM 2709  H HA   . ILE A 1 79 ? 5.710   4.570   -7.561  1.00 0.00 ? 87  ILE A HA   2  
ATOM 2710  H HB   . ILE A 1 79 ? 3.992   4.039   -5.845  1.00 0.00 ? 87  ILE A HB   2  
ATOM 2711  H HG12 . ILE A 1 79 ? 3.284   6.962   -6.190  1.00 0.00 ? 87  ILE A HG12 2  
ATOM 2712  H HG13 . ILE A 1 79 ? 2.241   5.586   -6.533  1.00 0.00 ? 87  ILE A HG13 2  
ATOM 2713  H HG21 . ILE A 1 79 ? 5.099   6.410   -4.623  1.00 0.00 ? 87  ILE A HG21 2  
ATOM 2714  H HG22 . ILE A 1 79 ? 6.294   5.583   -5.620  1.00 0.00 ? 87  ILE A HG22 2  
ATOM 2715  H HG23 . ILE A 1 79 ? 5.471   4.712   -4.327  1.00 0.00 ? 87  ILE A HG23 2  
ATOM 2716  H HD11 . ILE A 1 79 ? 2.998   5.249   -3.885  1.00 0.00 ? 87  ILE A HD11 2  
ATOM 2717  H HD12 . ILE A 1 79 ? 1.441   5.822   -4.485  1.00 0.00 ? 87  ILE A HD12 2  
ATOM 2718  H HD13 . ILE A 1 79 ? 2.701   6.980   -4.056  1.00 0.00 ? 87  ILE A HD13 2  
ATOM 2719  N N    . SER A 1 80 ? 4.112   3.276   -8.925  1.00 0.00 ? 88  SER A N    2  
ATOM 2720  C CA   . SER A 1 80 ? 3.232   2.528   -9.813  1.00 0.00 ? 88  SER A CA   2  
ATOM 2721  C C    . SER A 1 80 ? 2.444   1.486   -9.028  1.00 0.00 ? 88  SER A C    2  
ATOM 2722  O O    . SER A 1 80 ? 3.002   0.488   -8.569  1.00 0.00 ? 88  SER A O    2  
ATOM 2723  C CB   . SER A 1 80 ? 4.040   1.850   -10.920 1.00 0.00 ? 88  SER A CB   2  
ATOM 2724  O OG   . SER A 1 80 ? 5.289   2.493   -11.108 1.00 0.00 ? 88  SER A OG   2  
ATOM 2725  H H    . SER A 1 80 ? 4.980   2.892   -8.682  1.00 0.00 ? 88  SER A H    2  
ATOM 2726  H HA   . SER A 1 80 ? 2.538   3.225   -10.259 1.00 0.00 ? 88  SER A HA   2  
ATOM 2727  H HB2  . SER A 1 80 ? 4.219   0.819   -10.654 1.00 0.00 ? 88  SER A HB2  2  
ATOM 2728  H HB3  . SER A 1 80 ? 3.486   1.891   -11.846 1.00 0.00 ? 88  SER A HB3  2  
ATOM 2729  H HG   . SER A 1 80 ? 5.144   3.379   -11.449 1.00 0.00 ? 88  SER A HG   2  
ATOM 2730  N N    . ILE A 1 81 ? 1.147   1.724   -8.873  1.00 0.00 ? 89  ILE A N    2  
ATOM 2731  C CA   . ILE A 1 81 ? 0.283   0.808   -8.139  1.00 0.00 ? 89  ILE A CA   2  
ATOM 2732  C C    . ILE A 1 81 ? -0.675  0.089   -9.081  1.00 0.00 ? 89  ILE A C    2  
ATOM 2733  O O    . ILE A 1 81 ? -1.108  0.650   -10.083 1.00 0.00 ? 89  ILE A O    2  
ATOM 2734  C CB   . ILE A 1 81 ? -0.525  1.557   -7.058  1.00 0.00 ? 89  ILE A CB   2  
ATOM 2735  C CG1  . ILE A 1 81 ? -1.486  0.601   -6.335  1.00 0.00 ? 89  ILE A CG1  2  
ATOM 2736  C CG2  . ILE A 1 81 ? -1.274  2.731   -7.674  1.00 0.00 ? 89  ILE A CG2  2  
ATOM 2737  C CD1  . ILE A 1 81 ? -2.885  0.559   -6.919  1.00 0.00 ? 89  ILE A CD1  2  
ATOM 2738  H H    . ILE A 1 81 ? 0.761   2.538   -9.261  1.00 0.00 ? 89  ILE A H    2  
ATOM 2739  H HA   . ILE A 1 81 ? 0.910   0.077   -7.649  1.00 0.00 ? 89  ILE A HA   2  
ATOM 2740  H HB   . ILE A 1 81 ? 0.175   1.957   -6.338  1.00 0.00 ? 89  ILE A HB   2  
ATOM 2741  H HG12 . ILE A 1 81 ? -1.085  -0.399  -6.378  1.00 0.00 ? 89  ILE A HG12 2  
ATOM 2742  H HG13 . ILE A 1 81 ? -1.569  0.903   -5.300  1.00 0.00 ? 89  ILE A HG13 2  
ATOM 2743  H HG21 . ILE A 1 81 ? -1.771  2.406   -8.576  1.00 0.00 ? 89  ILE A HG21 2  
ATOM 2744  H HG22 . ILE A 1 81 ? -0.575  3.518   -7.912  1.00 0.00 ? 89  ILE A HG22 2  
ATOM 2745  H HG23 . ILE A 1 81 ? -2.008  3.100   -6.973  1.00 0.00 ? 89  ILE A HG23 2  
ATOM 2746  H HD11 . ILE A 1 81 ? -3.408  1.470   -6.665  1.00 0.00 ? 89  ILE A HD11 2  
ATOM 2747  H HD12 . ILE A 1 81 ? -3.419  -0.286  -6.513  1.00 0.00 ? 89  ILE A HD12 2  
ATOM 2748  H HD13 . ILE A 1 81 ? -2.825  0.465   -7.993  1.00 0.00 ? 89  ILE A HD13 2  
ATOM 2749  N N    . VAL A 1 82 ? -1.003  -1.154  -8.751  1.00 0.00 ? 90  VAL A N    2  
ATOM 2750  C CA   . VAL A 1 82 ? -1.915  -1.942  -9.571  1.00 0.00 ? 90  VAL A CA   2  
ATOM 2751  C C    . VAL A 1 82 ? -3.177  -2.298  -8.795  1.00 0.00 ? 90  VAL A C    2  
ATOM 2752  O O    . VAL A 1 82 ? -3.133  -3.061  -7.831  1.00 0.00 ? 90  VAL A O    2  
ATOM 2753  C CB   . VAL A 1 82 ? -1.247  -3.233  -10.074 1.00 0.00 ? 90  VAL A CB   2  
ATOM 2754  C CG1  . VAL A 1 82 ? -2.095  -3.890  -11.153 1.00 0.00 ? 90  VAL A CG1  2  
ATOM 2755  C CG2  . VAL A 1 82 ? 0.156   -2.946  -10.589 1.00 0.00 ? 90  VAL A CG2  2  
ATOM 2756  H H    . VAL A 1 82 ? -0.628  -1.549  -7.937  1.00 0.00 ? 90  VAL A H    2  
ATOM 2757  H HA   . VAL A 1 82 ? -2.190  -1.347  -10.430 1.00 0.00 ? 90  VAL A HA   2  
ATOM 2758  H HB   . VAL A 1 82 ? -1.168  -3.919  -9.245  1.00 0.00 ? 90  VAL A HB   2  
ATOM 2759  H HG11 . VAL A 1 82 ? -1.701  -3.635  -12.126 1.00 0.00 ? 90  VAL A HG11 2  
ATOM 2760  H HG12 . VAL A 1 82 ? -3.112  -3.539  -11.075 1.00 0.00 ? 90  VAL A HG12 2  
ATOM 2761  H HG13 . VAL A 1 82 ? -2.072  -4.962  -11.026 1.00 0.00 ? 90  VAL A HG13 2  
ATOM 2762  H HG21 . VAL A 1 82 ? 0.809   -2.739  -9.756  1.00 0.00 ? 90  VAL A HG21 2  
ATOM 2763  H HG22 . VAL A 1 82 ? 0.128   -2.089  -11.247 1.00 0.00 ? 90  VAL A HG22 2  
ATOM 2764  H HG23 . VAL A 1 82 ? 0.524   -3.805  -11.132 1.00 0.00 ? 90  VAL A HG23 2  
ATOM 2765  N N    . ALA A 1 83 ? -4.300  -1.732  -9.221  1.00 0.00 ? 91  ALA A N    2  
ATOM 2766  C CA   . ALA A 1 83 ? -5.582  -1.976  -8.571  1.00 0.00 ? 91  ALA A CA   2  
ATOM 2767  C C    . ALA A 1 83 ? -5.910  -3.464  -8.532  1.00 0.00 ? 91  ALA A C    2  
ATOM 2768  O O    . ALA A 1 83 ? -5.607  -4.202  -9.470  1.00 0.00 ? 91  ALA A O    2  
ATOM 2769  C CB   . ALA A 1 83 ? -6.687  -1.211  -9.282  1.00 0.00 ? 91  ALA A CB   2  
ATOM 2770  H H    . ALA A 1 83 ? -4.264  -1.130  -9.993  1.00 0.00 ? 91  ALA A H    2  
ATOM 2771  H HA   . ALA A 1 83 ? -5.516  -1.605  -7.558  1.00 0.00 ? 91  ALA A HA   2  
ATOM 2772  H HB1  . ALA A 1 83 ? -7.602  -1.285  -8.712  1.00 0.00 ? 91  ALA A HB1  2  
ATOM 2773  H HB2  . ALA A 1 83 ? -6.840  -1.632  -10.266 1.00 0.00 ? 91  ALA A HB2  2  
ATOM 2774  H HB3  . ALA A 1 83 ? -6.404  -0.173  -9.375  1.00 0.00 ? 91  ALA A HB3  2  
ATOM 2775  N N    . ALA A 1 84 ? -6.532  -3.895  -7.434  1.00 0.00 ? 92  ALA A N    2  
ATOM 2776  C CA   . ALA A 1 84 ? -6.915  -5.296  -7.248  1.00 0.00 ? 92  ALA A CA   2  
ATOM 2777  C C    . ALA A 1 84 ? -5.749  -6.139  -6.733  1.00 0.00 ? 92  ALA A C    2  
ATOM 2778  O O    . ALA A 1 84 ? -5.956  -7.222  -6.182  1.00 0.00 ? 92  ALA A O    2  
ATOM 2779  C CB   . ALA A 1 84 ? -7.465  -5.882  -8.539  1.00 0.00 ? 92  ALA A CB   2  
ATOM 2780  H H    . ALA A 1 84 ? -6.742  -3.251  -6.725  1.00 0.00 ? 92  ALA A H    2  
ATOM 2781  H HA   . ALA A 1 84 ? -7.705  -5.322  -6.511  1.00 0.00 ? 92  ALA A HA   2  
ATOM 2782  H HB1  . ALA A 1 84 ? -7.789  -5.082  -9.187  1.00 0.00 ? 92  ALA A HB1  2  
ATOM 2783  H HB2  . ALA A 1 84 ? -8.302  -6.525  -8.314  1.00 0.00 ? 92  ALA A HB2  2  
ATOM 2784  H HB3  . ALA A 1 84 ? -6.693  -6.455  -9.032  1.00 0.00 ? 92  ALA A HB3  2  
ATOM 2785  N N    . ALA A 1 85 ? -4.526  -5.644  -6.905  1.00 0.00 ? 93  ALA A N    2  
ATOM 2786  C CA   . ALA A 1 85 ? -3.342  -6.358  -6.448  1.00 0.00 ? 93  ALA A CA   2  
ATOM 2787  C C    . ALA A 1 85 ? -3.402  -6.613  -4.942  1.00 0.00 ? 93  ALA A C    2  
ATOM 2788  O O    . ALA A 1 85 ? -2.721  -7.498  -4.423  1.00 0.00 ? 93  ALA A O    2  
ATOM 2789  C CB   . ALA A 1 85 ? -2.091  -5.571  -6.807  1.00 0.00 ? 93  ALA A CB   2  
ATOM 2790  H H    . ALA A 1 85 ? -4.415  -4.777  -7.343  1.00 0.00 ? 93  ALA A H    2  
ATOM 2791  H HA   . ALA A 1 85 ? -3.304  -7.307  -6.963  1.00 0.00 ? 93  ALA A HA   2  
ATOM 2792  H HB1  . ALA A 1 85 ? -2.192  -4.556  -6.453  1.00 0.00 ? 93  ALA A HB1  2  
ATOM 2793  H HB2  . ALA A 1 85 ? -1.965  -5.567  -7.881  1.00 0.00 ? 93  ALA A HB2  2  
ATOM 2794  H HB3  . ALA A 1 85 ? -1.231  -6.031  -6.345  1.00 0.00 ? 93  ALA A HB3  2  
ATOM 2795  N N    . GLY A 1 86 ? -4.222  -5.826  -4.249  1.00 0.00 ? 94  GLY A N    2  
ATOM 2796  C CA   . GLY A 1 86 ? -4.364  -5.968  -2.812  1.00 0.00 ? 94  GLY A CA   2  
ATOM 2797  C C    . GLY A 1 86 ? -5.763  -6.390  -2.405  1.00 0.00 ? 94  GLY A C    2  
ATOM 2798  O O    . GLY A 1 86 ? -5.949  -7.064  -1.392  1.00 0.00 ? 94  GLY A O    2  
ATOM 2799  H H    . GLY A 1 86 ? -4.733  -5.137  -4.719  1.00 0.00 ? 94  GLY A H    2  
ATOM 2800  H HA2  . GLY A 1 86 ? -3.660  -6.710  -2.462  1.00 0.00 ? 94  GLY A HA2  2  
ATOM 2801  H HA3  . GLY A 1 86 ? -4.135  -5.022  -2.343  1.00 0.00 ? 94  GLY A HA3  2  
ATOM 2802  N N    . ARG A 1 87 ? -6.752  -5.974  -3.192  1.00 0.00 ? 95  ARG A N    2  
ATOM 2803  C CA   . ARG A 1 87 ? -8.149  -6.289  -2.910  1.00 0.00 ? 95  ARG A CA   2  
ATOM 2804  C C    . ARG A 1 87 ? -8.370  -7.795  -2.806  1.00 0.00 ? 95  ARG A C    2  
ATOM 2805  O O    . ARG A 1 87 ? -9.196  -8.252  -2.018  1.00 0.00 ? 95  ARG A O    2  
ATOM 2806  C CB   . ARG A 1 87 ? -9.052  -5.714  -4.004  1.00 0.00 ? 95  ARG A CB   2  
ATOM 2807  C CG   . ARG A 1 87 ? -9.048  -4.195  -4.061  1.00 0.00 ? 95  ARG A CG   2  
ATOM 2808  C CD   . ARG A 1 87 ? -9.992  -3.675  -5.134  1.00 0.00 ? 95  ARG A CD   2  
ATOM 2809  N NE   . ARG A 1 87 ? -10.506 -2.347  -4.815  1.00 0.00 ? 95  ARG A NE   2  
ATOM 2810  C CZ   . ARG A 1 87 ? -11.533 -1.779  -5.440  1.00 0.00 ? 95  ARG A CZ   2  
ATOM 2811  N NH1  . ARG A 1 87 ? -12.161 -2.420  -6.420  1.00 0.00 ? 95  ARG A NH1  2  
ATOM 2812  N NH2  . ARG A 1 87 ? -11.937 -0.567  -5.086  1.00 0.00 ? 95  ARG A NH2  2  
ATOM 2813  H H    . ARG A 1 87 ? -6.536  -5.431  -3.977  1.00 0.00 ? 95  ARG A H    2  
ATOM 2814  H HA   . ARG A 1 87 ? -8.408  -5.833  -1.968  1.00 0.00 ? 95  ARG A HA   2  
ATOM 2815  H HB2  . ARG A 1 87 ? -8.721  -6.088  -4.962  1.00 0.00 ? 95  ARG A HB2  2  
ATOM 2816  H HB3  . ARG A 1 87 ? -10.065 -6.044  -3.830  1.00 0.00 ? 95  ARG A HB3  2  
ATOM 2817  H HG2  . ARG A 1 87 ? -9.363  -3.809  -3.104  1.00 0.00 ? 95  ARG A HG2  2  
ATOM 2818  H HG3  . ARG A 1 87 ? -8.046  -3.855  -4.278  1.00 0.00 ? 95  ARG A HG3  2  
ATOM 2819  H HD2  . ARG A 1 87 ? -9.457  -3.629  -6.072  1.00 0.00 ? 95  ARG A HD2  2  
ATOM 2820  H HD3  . ARG A 1 87 ? -10.822 -4.361  -5.228  1.00 0.00 ? 95  ARG A HD3  2  
ATOM 2821  H HE   . ARG A 1 87 ? -10.061 -1.850  -4.095  1.00 0.00 ? 95  ARG A HE   2  
ATOM 2822  H HH11 . ARG A 1 87 ? -11.860 -3.335  -6.692  1.00 0.00 ? 95  ARG A HH11 2  
ATOM 2823  H HH12 . ARG A 1 87 ? -12.933 -1.989  -6.886  1.00 0.00 ? 95  ARG A HH12 2  
ATOM 2824  H HH21 . ARG A 1 87 ? -11.470 -0.080  -4.350  1.00 0.00 ? 95  ARG A HH21 2  
ATOM 2825  H HH22 . ARG A 1 87 ? -12.710 -0.140  -5.556  1.00 0.00 ? 95  ARG A HH22 2  
ATOM 2826  N N    . GLU A 1 88 ? -7.631  -8.564  -3.598  1.00 0.00 ? 96  GLU A N    2  
ATOM 2827  C CA   . GLU A 1 88 ? -7.759  -10.019 -3.580  1.00 0.00 ? 96  GLU A CA   2  
ATOM 2828  C C    . GLU A 1 88 ? -7.728  -10.552 -2.151  1.00 0.00 ? 96  GLU A C    2  
ATOM 2829  O O    . GLU A 1 88 ? -8.591  -11.333 -1.749  1.00 0.00 ? 96  GLU A O    2  
ATOM 2830  C CB   . GLU A 1 88 ? -6.643  -10.661 -4.405  1.00 0.00 ? 96  GLU A CB   2  
ATOM 2831  C CG   . GLU A 1 88 ? -6.896  -12.122 -4.738  1.00 0.00 ? 96  GLU A CG   2  
ATOM 2832  C CD   . GLU A 1 88 ? -6.302  -13.068 -3.711  1.00 0.00 ? 96  GLU A CD   2  
ATOM 2833  O OE1  . GLU A 1 88 ? -5.085  -12.963 -3.444  1.00 0.00 ? 96  GLU A OE1  2  
ATOM 2834  O OE2  . GLU A 1 88 ? -7.051  -13.911 -3.176  1.00 0.00 ? 96  GLU A OE2  2  
ATOM 2835  H H    . GLU A 1 88 ? -6.987  -8.146  -4.207  1.00 0.00 ? 96  GLU A H    2  
ATOM 2836  H HA   . GLU A 1 88 ? -8.711  -10.270 -4.023  1.00 0.00 ? 96  GLU A HA   2  
ATOM 2837  H HB2  . GLU A 1 88 ? -6.534  -10.118 -5.331  1.00 0.00 ? 96  GLU A HB2  2  
ATOM 2838  H HB3  . GLU A 1 88 ? -5.718  -10.597 -3.849  1.00 0.00 ? 96  GLU A HB3  2  
ATOM 2839  H HG2  . GLU A 1 88 ? -7.962  -12.288 -4.781  1.00 0.00 ? 96  GLU A HG2  2  
ATOM 2840  H HG3  . GLU A 1 88 ? -6.459  -12.341 -5.701  1.00 0.00 ? 96  GLU A HG3  2  
ATOM 2841  N N    . LEU A 1 89 ? -6.732  -10.119 -1.386  1.00 0.00 ? 97  LEU A N    2  
ATOM 2842  C CA   . LEU A 1 89 ? -6.592  -10.544 0.003   1.00 0.00 ? 97  LEU A CA   2  
ATOM 2843  C C    . LEU A 1 89 ? -7.676  -9.917  0.872   1.00 0.00 ? 97  LEU A C    2  
ATOM 2844  O O    . LEU A 1 89 ? -8.270  -10.583 1.721   1.00 0.00 ? 97  LEU A O    2  
ATOM 2845  C CB   . LEU A 1 89 ? -5.211  -10.166 0.540   1.00 0.00 ? 97  LEU A CB   2  
ATOM 2846  C CG   . LEU A 1 89 ? -4.039  -10.522 -0.376  1.00 0.00 ? 97  LEU A CG   2  
ATOM 2847  C CD1  . LEU A 1 89 ? -2.821  -9.681  -0.033  1.00 0.00 ? 97  LEU A CD1  2  
ATOM 2848  C CD2  . LEU A 1 89 ? -3.713  -12.005 -0.268  1.00 0.00 ? 97  LEU A CD2  2  
ATOM 2849  H H    . LEU A 1 89 ? -6.079  -9.492  -1.762  1.00 0.00 ? 97  LEU A H    2  
ATOM 2850  H HA   . LEU A 1 89 ? -6.699  -11.619 0.032   1.00 0.00 ? 97  LEU A HA   2  
ATOM 2851  H HB2  . LEU A 1 89 ? -5.195  -9.099  0.712   1.00 0.00 ? 97  LEU A HB2  2  
ATOM 2852  H HB3  . LEU A 1 89 ? -5.066  -10.667 1.484   1.00 0.00 ? 97  LEU A HB3  2  
ATOM 2853  H HG   . LEU A 1 89 ? -4.312  -10.313 -1.399  1.00 0.00 ? 97  LEU A HG   2  
ATOM 2854  H HD11 . LEU A 1 89 ? -3.138  -8.694  0.267   1.00 0.00 ? 97  LEU A HD11 2  
ATOM 2855  H HD12 . LEU A 1 89 ? -2.181  -9.605  -0.900  1.00 0.00 ? 97  LEU A HD12 2  
ATOM 2856  H HD13 . LEU A 1 89 ? -2.276  -10.146 0.775   1.00 0.00 ? 97  LEU A HD13 2  
ATOM 2857  H HD21 . LEU A 1 89 ? -2.964  -12.154 0.495   1.00 0.00 ? 97  LEU A HD21 2  
ATOM 2858  H HD22 . LEU A 1 89 ? -3.336  -12.359 -1.217  1.00 0.00 ? 97  LEU A HD22 2  
ATOM 2859  H HD23 . LEU A 1 89 ? -4.607  -12.551 -0.010  1.00 0.00 ? 97  LEU A HD23 2  
ATOM 2860  N N    . PHE A 1 90 ? -7.928  -8.630  0.656   1.00 0.00 ? 98  PHE A N    2  
ATOM 2861  C CA   . PHE A 1 90 ? -8.938  -7.904  1.419   1.00 0.00 ? 98  PHE A CA   2  
ATOM 2862  C C    . PHE A 1 90 ? -10.312 -8.547  1.263   1.00 0.00 ? 98  PHE A C    2  
ATOM 2863  O O    . PHE A 1 90 ? -10.874 -9.075  2.223   1.00 0.00 ? 98  PHE A O    2  
ATOM 2864  C CB   . PHE A 1 90 ? -8.990  -6.442  0.972   1.00 0.00 ? 98  PHE A CB   2  
ATOM 2865  C CG   . PHE A 1 90 ? -8.148  -5.528  1.815   1.00 0.00 ? 98  PHE A CG   2  
ATOM 2866  C CD1  . PHE A 1 90 ? -8.507  -5.242  3.122   1.00 0.00 ? 98  PHE A CD1  2  
ATOM 2867  C CD2  . PHE A 1 90 ? -6.997  -4.953  1.300   1.00 0.00 ? 98  PHE A CD2  2  
ATOM 2868  C CE1  . PHE A 1 90 ? -7.735  -4.401  3.900   1.00 0.00 ? 98  PHE A CE1  2  
ATOM 2869  C CE2  . PHE A 1 90 ? -6.220  -4.110  2.074   1.00 0.00 ? 98  PHE A CE2  2  
ATOM 2870  C CZ   . PHE A 1 90 ? -6.591  -3.834  3.376   1.00 0.00 ? 98  PHE A CZ   2  
ATOM 2871  H H    . PHE A 1 90 ? -7.419  -8.154  -0.033  1.00 0.00 ? 98  PHE A H    2  
ATOM 2872  H HA   . PHE A 1 90 ? -8.654  -7.939  2.461   1.00 0.00 ? 98  PHE A HA   2  
ATOM 2873  H HB2  . PHE A 1 90 ? -8.638  -6.372  -0.047  1.00 0.00 ? 98  PHE A HB2  2  
ATOM 2874  H HB3  . PHE A 1 90 ? -10.011 -6.094  1.019   1.00 0.00 ? 98  PHE A HB3  2  
ATOM 2875  H HD1  . PHE A 1 90 ? -9.403  -5.685  3.533   1.00 0.00 ? 98  PHE A HD1  2  
ATOM 2876  H HD2  . PHE A 1 90 ? -6.708  -5.166  0.282   1.00 0.00 ? 98  PHE A HD2  2  
ATOM 2877  H HE1  . PHE A 1 90 ? -8.026  -4.187  4.918   1.00 0.00 ? 98  PHE A HE1  2  
ATOM 2878  H HE2  . PHE A 1 90 ? -5.326  -3.669  1.661   1.00 0.00 ? 98  PHE A HE2  2  
ATOM 2879  H HZ   . PHE A 1 90 ? -5.985  -3.176  3.981   1.00 0.00 ? 98  PHE A HZ   2  
ATOM 2880  N N    . MET A 1 91 ? -10.851 -8.495  0.049   1.00 0.00 ? 99  MET A N    2  
ATOM 2881  C CA   . MET A 1 91 ? -12.162 -9.069  -0.231  1.00 0.00 ? 99  MET A CA   2  
ATOM 2882  C C    . MET A 1 91 ? -12.173 -10.567 0.053   1.00 0.00 ? 99  MET A C    2  
ATOM 2883  O O    . MET A 1 91 ? -11.194 -11.267 -0.204  1.00 0.00 ? 99  MET A O    2  
ATOM 2884  C CB   . MET A 1 91 ? -12.557 -8.812  -1.686  1.00 0.00 ? 99  MET A CB   2  
ATOM 2885  C CG   . MET A 1 91 ? -11.595 -9.421  -2.695  1.00 0.00 ? 99  MET A CG   2  
ATOM 2886  S SD   . MET A 1 91 ? -12.431 -10.422 -3.941  1.00 0.00 ? 99  MET A SD   2  
ATOM 2887  C CE   . MET A 1 91 ? -13.082 -11.748 -2.929  1.00 0.00 ? 99  MET A CE   2  
ATOM 2888  H H    . MET A 1 91 ? -10.355 -8.059  -0.676  1.00 0.00 ? 99  MET A H    2  
ATOM 2889  H HA   . MET A 1 91 ? -12.879 -8.588  0.415   1.00 0.00 ? 99  MET A HA   2  
ATOM 2890  H HB2  . MET A 1 91 ? -13.539 -9.227  -1.859  1.00 0.00 ? 99  MET A HB2  2  
ATOM 2891  H HB3  . MET A 1 91 ? -12.592 -7.746  -1.854  1.00 0.00 ? 99  MET A HB3  2  
ATOM 2892  H HG2  . MET A 1 91 ? -11.065 -8.623  -3.192  1.00 0.00 ? 99  MET A HG2  2  
ATOM 2893  H HG3  . MET A 1 91 ? -10.888 -10.045 -2.166  1.00 0.00 ? 99  MET A HG3  2  
ATOM 2894  H HE1  . MET A 1 91 ? -12.395 -11.955 -2.121  1.00 0.00 ? 99  MET A HE1  2  
ATOM 2895  H HE2  . MET A 1 91 ? -13.206 -12.635 -3.533  1.00 0.00 ? 99  MET A HE2  2  
ATOM 2896  H HE3  . MET A 1 91 ? -14.038 -11.454 -2.522  1.00 0.00 ? 99  MET A HE3  2  
ATOM 2897  N N    . THR A 1 92 ? -13.291 -11.053 0.585   1.00 0.00 ? 100 THR A N    2  
ATOM 2898  C CA   . THR A 1 92 ? -13.435 -12.468 0.904   1.00 0.00 ? 100 THR A CA   2  
ATOM 2899  C C    . THR A 1 92 ? -14.581 -13.089 0.112   1.00 0.00 ? 100 THR A C    2  
ATOM 2900  O O    . THR A 1 92 ? -15.551 -12.413 -0.227  1.00 0.00 ? 100 THR A O    2  
ATOM 2901  C CB   . THR A 1 92 ? -13.678 -12.651 2.404   1.00 0.00 ? 100 THR A CB   2  
ATOM 2902  O OG1  . THR A 1 92 ? -12.928 -11.710 3.151   1.00 0.00 ? 100 THR A OG1  2  
ATOM 2903  C CG2  . THR A 1 92 ? -13.314 -14.032 2.906   1.00 0.00 ? 100 THR A CG2  2  
ATOM 2904  H H    . THR A 1 92 ? -14.038 -10.444 0.766   1.00 0.00 ? 100 THR A H    2  
ATOM 2905  H HA   . THR A 1 92 ? -12.515 -12.965 0.635   1.00 0.00 ? 100 THR A HA   2  
ATOM 2906  H HB   . THR A 1 92 ? -14.727 -12.490 2.611   1.00 0.00 ? 100 THR A HB   2  
ATOM 2907  H HG1  . THR A 1 92 ? -13.457 -10.923 3.300   1.00 0.00 ? 100 THR A HG1  2  
ATOM 2908  H HG21 . THR A 1 92 ? -13.651 -14.144 3.926   1.00 0.00 ? 100 THR A HG21 2  
ATOM 2909  H HG22 . THR A 1 92 ? -12.242 -14.159 2.866   1.00 0.00 ? 100 THR A HG22 2  
ATOM 2910  H HG23 . THR A 1 92 ? -13.789 -14.777 2.285   1.00 0.00 ? 100 THR A HG23 2  
ATOM 2911  N N    . THR B 2 1  ? -2.692  -13.265 13.717  1.00 0.00 ? 111 THR B N    2  
ATOM 2912  C CA   . THR B 2 1  ? -2.455  -11.954 14.309  1.00 0.00 ? 111 THR B CA   2  
ATOM 2913  C C    . THR B 2 1  ? -2.571  -10.854 13.257  1.00 0.00 ? 111 THR B C    2  
ATOM 2914  O O    . THR B 2 1  ? -2.414  -11.107 12.063  1.00 0.00 ? 111 THR B O    2  
ATOM 2915  C CB   . THR B 2 1  ? -1.072  -11.906 14.962  1.00 0.00 ? 111 THR B CB   2  
ATOM 2916  O OG1  . THR B 2 1  ? -0.074  -12.359 14.062  1.00 0.00 ? 111 THR B OG1  2  
ATOM 2917  C CG2  . THR B 2 1  ? -0.975  -12.744 16.219  1.00 0.00 ? 111 THR B CG2  2  
ATOM 2918  H H1   . THR B 2 1  ? -1.956  -13.912 13.680  1.00 0.00 ? 111 THR B H1   2  
ATOM 2919  H HA   . THR B 2 1  ? -3.207  -11.791 15.067  1.00 0.00 ? 111 THR B HA   2  
ATOM 2920  H HB   . THR B 2 1  ? -0.847  -10.884 15.229  1.00 0.00 ? 111 THR B HB   2  
ATOM 2921  H HG1  . THR B 2 1  ? -0.121  -13.314 13.982  1.00 0.00 ? 111 THR B HG1  2  
ATOM 2922  H HG21 . THR B 2 1  ? -1.954  -12.842 16.663  1.00 0.00 ? 111 THR B HG21 2  
ATOM 2923  H HG22 . THR B 2 1  ? -0.307  -12.265 16.921  1.00 0.00 ? 111 THR B HG22 2  
ATOM 2924  H HG23 . THR B 2 1  ? -0.592  -13.724 15.971  1.00 0.00 ? 111 THR B HG23 2  
ATOM 2925  N N    . PRO B 2 2  ? -2.848  -9.610  13.689  1.00 0.00 ? 112 PRO B N    2  
ATOM 2926  C CA   . PRO B 2 2  ? -2.983  -8.468  12.778  1.00 0.00 ? 112 PRO B CA   2  
ATOM 2927  C C    . PRO B 2 2  ? -1.716  -8.223  11.966  1.00 0.00 ? 112 PRO B C    2  
ATOM 2928  O O    . PRO B 2 2  ? -0.631  -8.667  12.342  1.00 0.00 ? 112 PRO B O    2  
ATOM 2929  C CB   . PRO B 2 2  ? -3.259  -7.281  13.712  1.00 0.00 ? 112 PRO B CB   2  
ATOM 2930  C CG   . PRO B 2 2  ? -2.816  -7.736  15.061  1.00 0.00 ? 112 PRO B CG   2  
ATOM 2931  C CD   . PRO B 2 2  ? -3.049  -9.218  15.093  1.00 0.00 ? 112 PRO B CD   2  
ATOM 2932  H HA   . PRO B 2 2  ? -3.818  -8.600  12.104  1.00 0.00 ? 112 PRO B HA   2  
ATOM 2933  H HB2  . PRO B 2 2  ? -2.695  -6.422  13.381  1.00 0.00 ? 112 PRO B HB2  2  
ATOM 2934  H HB3  . PRO B 2 2  ? -4.313  -7.050  13.702  1.00 0.00 ? 112 PRO B HB3  2  
ATOM 2935  H HG2  . PRO B 2 2  ? -1.767  -7.516  15.197  1.00 0.00 ? 112 PRO B HG2  2  
ATOM 2936  H HG3  . PRO B 2 2  ? -3.404  -7.248  15.826  1.00 0.00 ? 112 PRO B HG3  2  
ATOM 2937  H HD2  . PRO B 2 2  ? -2.330  -9.701  15.738  1.00 0.00 ? 112 PRO B HD2  2  
ATOM 2938  H HD3  . PRO B 2 2  ? -4.056  -9.436  15.415  1.00 0.00 ? 112 PRO B HD3  2  
ATOM 2939  N N    . LEU B 2 3  ? -1.862  -7.517  10.850  1.00 0.00 ? 113 LEU B N    2  
ATOM 2940  C CA   . LEU B 2 3  ? -0.730  -7.214  9.982   1.00 0.00 ? 113 LEU B CA   2  
ATOM 2941  C C    . LEU B 2 3  ? -0.110  -5.867  10.343  1.00 0.00 ? 113 LEU B C    2  
ATOM 2942  O O    . LEU B 2 3  ? -0.702  -5.077  11.079  1.00 0.00 ? 113 LEU B O    2  
ATOM 2943  C CB   . LEU B 2 3  ? -1.171  -7.209  8.517   1.00 0.00 ? 113 LEU B CB   2  
ATOM 2944  C CG   . LEU B 2 3  ? -2.085  -8.365  8.111   1.00 0.00 ? 113 LEU B CG   2  
ATOM 2945  C CD1  . LEU B 2 3  ? -3.174  -7.882  7.164   1.00 0.00 ? 113 LEU B CD1  2  
ATOM 2946  C CD2  . LEU B 2 3  ? -1.277  -9.482  7.468   1.00 0.00 ? 113 LEU B CD2  2  
ATOM 2947  H H    . LEU B 2 3  ? -2.753  -7.192  10.603  1.00 0.00 ? 113 LEU B H    2  
ATOM 2948  H HA   . LEU B 2 3  ? 0.011   -7.986  10.123  1.00 0.00 ? 113 LEU B HA   2  
ATOM 2949  H HB2  . LEU B 2 3  ? -1.690  -6.280  8.325   1.00 0.00 ? 113 LEU B HB2  2  
ATOM 2950  H HB3  . LEU B 2 3  ? -0.287  -7.243  7.896   1.00 0.00 ? 113 LEU B HB3  2  
ATOM 2951  H HG   . LEU B 2 3  ? -2.564  -8.764  8.994   1.00 0.00 ? 113 LEU B HG   2  
ATOM 2952  H HD11 . LEU B 2 3  ? -3.737  -8.728  6.799   1.00 0.00 ? 113 LEU B HD11 2  
ATOM 2953  H HD12 . LEU B 2 3  ? -2.723  -7.363  6.332   1.00 0.00 ? 113 LEU B HD12 2  
ATOM 2954  H HD13 . LEU B 2 3  ? -3.836  -7.210  7.691   1.00 0.00 ? 113 LEU B HD13 2  
ATOM 2955  H HD21 . LEU B 2 3  ? -1.681  -10.439 7.769   1.00 0.00 ? 113 LEU B HD21 2  
ATOM 2956  H HD22 . LEU B 2 3  ? -0.247  -9.412  7.786   1.00 0.00 ? 113 LEU B HD22 2  
ATOM 2957  H HD23 . LEU B 2 3  ? -1.329  -9.392  6.393   1.00 0.00 ? 113 LEU B HD23 2  
ATOM 2958  N N    . GLU B 2 4  ? 1.083   -5.610  9.816   1.00 0.00 ? 114 GLU B N    2  
ATOM 2959  C CA   . GLU B 2 4  ? 1.782   -4.358  10.079  1.00 0.00 ? 114 GLU B CA   2  
ATOM 2960  C C    . GLU B 2 4  ? 1.213   -3.231  9.226   1.00 0.00 ? 114 GLU B C    2  
ATOM 2961  O O    . GLU B 2 4  ? 0.916   -3.422  8.045   1.00 0.00 ? 114 GLU B O    2  
ATOM 2962  C CB   . GLU B 2 4  ? 3.279   -4.518  9.806   1.00 0.00 ? 114 GLU B CB   2  
ATOM 2963  C CG   . GLU B 2 4  ? 3.903   -5.709  10.513  1.00 0.00 ? 114 GLU B CG   2  
ATOM 2964  C CD   . GLU B 2 4  ? 5.285   -6.042  9.985   1.00 0.00 ? 114 GLU B CD   2  
ATOM 2965  O OE1  . GLU B 2 4  ? 6.238   -5.306  10.311  1.00 0.00 ? 114 GLU B OE1  2  
ATOM 2966  O OE2  . GLU B 2 4  ? 5.412   -7.041  9.245   1.00 0.00 ? 114 GLU B OE2  2  
ATOM 2967  H H    . GLU B 2 4  ? 1.502   -6.279  9.235   1.00 0.00 ? 114 GLU B H    2  
ATOM 2968  H HA   . GLU B 2 4  ? 1.640   -4.112  11.121  1.00 0.00 ? 114 GLU B HA   2  
ATOM 2969  H HB2  . GLU B 2 4  ? 3.427   -4.640  8.743   1.00 0.00 ? 114 GLU B HB2  2  
ATOM 2970  H HB3  . GLU B 2 4  ? 3.789   -3.625  10.132  1.00 0.00 ? 114 GLU B HB3  2  
ATOM 2971  H HG2  . GLU B 2 4  ? 3.982   -5.486  11.566  1.00 0.00 ? 114 GLU B HG2  2  
ATOM 2972  H HG3  . GLU B 2 4  ? 3.263   -6.569  10.376  1.00 0.00 ? 114 GLU B HG3  2  
ATOM 2973  N N    . ILE B 2 5  ? 1.062   -2.055  9.826   1.00 0.00 ? 115 ILE B N    2  
ATOM 2974  C CA   . ILE B 2 5  ? 0.525   -0.899  9.118   1.00 0.00 ? 115 ILE B CA   2  
ATOM 2975  C C    . ILE B 2 5  ? 1.304   0.367   9.459   1.00 0.00 ? 115 ILE B C    2  
ATOM 2976  O O    . ILE B 2 5  ? 1.621   0.619   10.622  1.00 0.00 ? 115 ILE B O    2  
ATOM 2977  C CB   . ILE B 2 5  ? -0.963  -0.677  9.448   1.00 0.00 ? 115 ILE B CB   2  
ATOM 2978  C CG1  . ILE B 2 5  ? -1.732  -1.996  9.355   1.00 0.00 ? 115 ILE B CG1  2  
ATOM 2979  C CG2  . ILE B 2 5  ? -1.563  0.361   8.511   1.00 0.00 ? 115 ILE B CG2  2  
ATOM 2980  C CD1  . ILE B 2 5  ? -3.207  -1.861  9.668   1.00 0.00 ? 115 ILE B CD1  2  
ATOM 2981  H H    . ILE B 2 5  ? 1.314   -1.965  10.769  1.00 0.00 ? 115 ILE B H    2  
ATOM 2982  H HA   . ILE B 2 5  ? 0.614   -1.089  8.057   1.00 0.00 ? 115 ILE B HA   2  
ATOM 2983  H HB   . ILE B 2 5  ? -1.032  -0.298  10.456  1.00 0.00 ? 115 ILE B HB   2  
ATOM 2984  H HG12 . ILE B 2 5  ? -1.643  -2.388  8.352   1.00 0.00 ? 115 ILE B HG12 2  
ATOM 2985  H HG13 . ILE B 2 5  ? -1.308  -2.702  10.052  1.00 0.00 ? 115 ILE B HG13 2  
ATOM 2986  H HG21 . ILE B 2 5  ? -1.682  -0.069  7.527   1.00 0.00 ? 115 ILE B HG21 2  
ATOM 2987  H HG22 . ILE B 2 5  ? -0.907  1.216   8.452   1.00 0.00 ? 115 ILE B HG22 2  
ATOM 2988  H HG23 . ILE B 2 5  ? -2.526  0.670   8.888   1.00 0.00 ? 115 ILE B HG23 2  
ATOM 2989  H HD11 . ILE B 2 5  ? -3.339  -1.159  10.478  1.00 0.00 ? 115 ILE B HD11 2  
ATOM 2990  H HD12 . ILE B 2 5  ? -3.603  -2.823  9.956   1.00 0.00 ? 115 ILE B HD12 2  
ATOM 2991  H HD13 . ILE B 2 5  ? -3.729  -1.503  8.793   1.00 0.00 ? 115 ILE B HD13 2  
ATOM 2992  N N    . THR B 2 6  ? 1.606   1.161   8.438   1.00 0.00 ? 116 THR B N    2  
ATOM 2993  C CA   . THR B 2 6  ? 2.345   2.405   8.628   1.00 0.00 ? 116 THR B CA   2  
ATOM 2994  C C    . THR B 2 6  ? 1.640   3.566   7.934   1.00 0.00 ? 116 THR B C    2  
ATOM 2995  O O    . THR B 2 6  ? 1.234   3.456   6.777   1.00 0.00 ? 116 THR B O    2  
ATOM 2996  C CB   . THR B 2 6  ? 3.770   2.265   8.091   1.00 0.00 ? 116 THR B CB   2  
ATOM 2997  O OG1  . THR B 2 6  ? 4.410   1.135   8.659   1.00 0.00 ? 116 THR B OG1  2  
ATOM 2998  C CG2  . THR B 2 6  ? 4.636   3.473   8.368   1.00 0.00 ? 116 THR B CG2  2  
ATOM 2999  H H    . THR B 2 6  ? 1.324   0.908   7.535   1.00 0.00 ? 116 THR B H    2  
ATOM 3000  H HA   . THR B 2 6  ? 2.388   2.607   9.688   1.00 0.00 ? 116 THR B HA   2  
ATOM 3001  H HB   . THR B 2 6  ? 3.727   2.127   7.019   1.00 0.00 ? 116 THR B HB   2  
ATOM 3002  H HG1  . THR B 2 6  ? 5.175   0.900   8.127   1.00 0.00 ? 116 THR B HG1  2  
ATOM 3003  H HG21 . THR B 2 6  ? 4.224   4.028   9.197   1.00 0.00 ? 116 THR B HG21 2  
ATOM 3004  H HG22 . THR B 2 6  ? 4.668   4.103   7.491   1.00 0.00 ? 116 THR B HG22 2  
ATOM 3005  H HG23 . THR B 2 6  ? 5.638   3.149   8.615   1.00 0.00 ? 116 THR B HG23 2  
ATOM 3006  N N    . GLU B 2 7  ? 1.494   4.677   8.649   1.00 0.00 ? 117 GLU B N    2  
ATOM 3007  C CA   . GLU B 2 7  ? 0.834   5.858   8.101   1.00 0.00 ? 117 GLU B CA   2  
ATOM 3008  C C    . GLU B 2 7  ? 1.834   6.754   7.377   1.00 0.00 ? 117 GLU B C    2  
ATOM 3009  O O    . GLU B 2 7  ? 2.980   6.892   7.803   1.00 0.00 ? 117 GLU B O    2  
ATOM 3010  C CB   . GLU B 2 7  ? 0.141   6.642   9.215   1.00 0.00 ? 117 GLU B CB   2  
ATOM 3011  C CG   . GLU B 2 7  ? -1.186  6.041   9.648   1.00 0.00 ? 117 GLU B CG   2  
ATOM 3012  C CD   . GLU B 2 7  ? -2.378  6.810   9.110   1.00 0.00 ? 117 GLU B CD   2  
ATOM 3013  O OE1  . GLU B 2 7  ? -2.368  7.158   7.911   1.00 0.00 ? 117 GLU B OE1  2  
ATOM 3014  O OE2  . GLU B 2 7  ? -3.321  7.066   9.890   1.00 0.00 ? 117 GLU B OE2  2  
ATOM 3015  H H    . GLU B 2 7  ? 1.837   4.703   9.567   1.00 0.00 ? 117 GLU B H    2  
ATOM 3016  H HA   . GLU B 2 7  ? 0.091   5.522   7.393   1.00 0.00 ? 117 GLU B HA   2  
ATOM 3017  H HB2  . GLU B 2 7  ? 0.793   6.677   10.075  1.00 0.00 ? 117 GLU B HB2  2  
ATOM 3018  H HB3  . GLU B 2 7  ? -0.040  7.651   8.872   1.00 0.00 ? 117 GLU B HB3  2  
ATOM 3019  H HG2  . GLU B 2 7  ? -1.242  5.026   9.287   1.00 0.00 ? 117 GLU B HG2  2  
ATOM 3020  H HG3  . GLU B 2 7  ? -1.233  6.041   10.727  1.00 0.00 ? 117 GLU B HG3  2  
ATOM 3021  N N    . LEU B 2 8  ? 1.389   7.362   6.282   1.00 0.00 ? 118 LEU B N    2  
ATOM 3022  C CA   . LEU B 2 8  ? 2.242   8.248   5.498   1.00 0.00 ? 118 LEU B CA   2  
ATOM 3023  C C    . LEU B 2 8  ? 1.597   9.619   5.332   1.00 0.00 ? 118 LEU B C    2  
ATOM 3024  O O    . LEU B 2 8  ? 2.343   10.614  5.210   1.00 0.00 ? 118 LEU B O    2  
ATOM 3025  C CB   . LEU B 2 8  ? 2.526   7.635   4.126   1.00 0.00 ? 118 LEU B CB   2  
ATOM 3026  C CG   . LEU B 2 8  ? 3.165   6.244   4.158   1.00 0.00 ? 118 LEU B CG   2  
ATOM 3027  C CD1  . LEU B 2 8  ? 2.114   5.168   3.934   1.00 0.00 ? 118 LEU B CD1  2  
ATOM 3028  C CD2  . LEU B 2 8  ? 4.268   6.137   3.115   1.00 0.00 ? 118 LEU B CD2  2  
ATOM 3029  O OXT  . LEU B 2 8  ? 0.349   9.688   5.322   1.00 0.00 ? 118 LEU B OXT  2  
ATOM 3030  H H    . LEU B 2 8  ? 0.464   7.213   5.995   1.00 0.00 ? 118 LEU B H    2  
ATOM 3031  H HA   . LEU B 2 8  ? 3.175   8.365   6.030   1.00 0.00 ? 118 LEU B HA   2  
ATOM 3032  H HB2  . LEU B 2 8  ? 1.593   7.569   3.586   1.00 0.00 ? 118 LEU B HB2  2  
ATOM 3033  H HB3  . LEU B 2 8  ? 3.188   8.298   3.589   1.00 0.00 ? 118 LEU B HB3  2  
ATOM 3034  H HG   . LEU B 2 8  ? 3.607   6.080   5.130   1.00 0.00 ? 118 LEU B HG   2  
ATOM 3035  H HD11 . LEU B 2 8  ? 1.755   4.811   4.888   1.00 0.00 ? 118 LEU B HD11 2  
ATOM 3036  H HD12 . LEU B 2 8  ? 2.550   4.347   3.383   1.00 0.00 ? 118 LEU B HD12 2  
ATOM 3037  H HD13 . LEU B 2 8  ? 1.290   5.582   3.371   1.00 0.00 ? 118 LEU B HD13 2  
ATOM 3038  H HD21 . LEU B 2 8  ? 4.958   6.960   3.235   1.00 0.00 ? 118 LEU B HD21 2  
ATOM 3039  H HD22 . LEU B 2 8  ? 3.834   6.173   2.127   1.00 0.00 ? 118 LEU B HD22 2  
ATOM 3040  H HD23 . LEU B 2 8  ? 4.796   5.205   3.243   1.00 0.00 ? 118 LEU B HD23 2  
ATOM 3041  N N    . LYS A 1 1  ? -3.471  -3.736  -16.482 1.00 0.00 ? 9   LYS A N    3  
ATOM 3042  C CA   . LYS A 1 1  ? -3.293  -2.364  -17.026 1.00 0.00 ? 9   LYS A CA   3  
ATOM 3043  C C    . LYS A 1 1  ? -2.319  -1.558  -16.174 1.00 0.00 ? 9   LYS A C    3  
ATOM 3044  O O    . LYS A 1 1  ? -1.589  -0.707  -16.682 1.00 0.00 ? 9   LYS A O    3  
ATOM 3045  C CB   . LYS A 1 1  ? -4.656  -1.673  -17.066 1.00 0.00 ? 9   LYS A CB   3  
ATOM 3046  C CG   . LYS A 1 1  ? -4.829  -0.735  -18.248 1.00 0.00 ? 9   LYS A CG   3  
ATOM 3047  C CD   . LYS A 1 1  ? -6.297  -0.525  -18.583 1.00 0.00 ? 9   LYS A CD   3  
ATOM 3048  C CE   . LYS A 1 1  ? -6.930  0.522   -17.682 1.00 0.00 ? 9   LYS A CE   3  
ATOM 3049  N NZ   . LYS A 1 1  ? -8.329  0.168   -17.316 1.00 0.00 ? 9   LYS A NZ   3  
ATOM 3050  H H1   . LYS A 1 1  ? -3.882  -4.323  -17.235 1.00 0.00 ? 9   LYS A H1   3  
ATOM 3051  H H2   . LYS A 1 1  ? -4.112  -3.670  -15.664 1.00 0.00 ? 9   LYS A H2   3  
ATOM 3052  H H3   . LYS A 1 1  ? -2.536  -4.089  -16.200 1.00 0.00 ? 9   LYS A H3   3  
ATOM 3053  H HA   . LYS A 1 1  ? -2.903  -2.440  -18.030 1.00 0.00 ? 9   LYS A HA   3  
ATOM 3054  H HB2  . LYS A 1 1  ? -5.428  -2.428  -17.118 1.00 0.00 ? 9   LYS A HB2  3  
ATOM 3055  H HB3  . LYS A 1 1  ? -4.785  -1.102  -16.157 1.00 0.00 ? 9   LYS A HB3  3  
ATOM 3056  H HG2  . LYS A 1 1  ? -4.386  0.220   -18.005 1.00 0.00 ? 9   LYS A HG2  3  
ATOM 3057  H HG3  . LYS A 1 1  ? -4.329  -1.156  -19.107 1.00 0.00 ? 9   LYS A HG3  3  
ATOM 3058  H HD2  . LYS A 1 1  ? -6.380  -0.198  -19.609 1.00 0.00 ? 9   LYS A HD2  3  
ATOM 3059  H HD3  . LYS A 1 1  ? -6.822  -1.460  -18.457 1.00 0.00 ? 9   LYS A HD3  3  
ATOM 3060  H HE2  . LYS A 1 1  ? -6.343  0.606   -16.780 1.00 0.00 ? 9   LYS A HE2  3  
ATOM 3061  H HE3  . LYS A 1 1  ? -6.931  1.470   -18.199 1.00 0.00 ? 9   LYS A HE3  3  
ATOM 3062  H HZ1  . LYS A 1 1  ? -8.828  1.007   -16.953 1.00 0.00 ? 9   LYS A HZ1  3  
ATOM 3063  H HZ2  . LYS A 1 1  ? -8.331  -0.567  -16.580 1.00 0.00 ? 9   LYS A HZ2  3  
ATOM 3064  H HZ3  . LYS A 1 1  ? -8.837  -0.192  -18.149 1.00 0.00 ? 9   LYS A HZ3  3  
ATOM 3065  N N    . GLU A 1 2  ? -2.315  -1.831  -14.872 1.00 0.00 ? 10  GLU A N    3  
ATOM 3066  C CA   . GLU A 1 2  ? -1.431  -1.131  -13.946 1.00 0.00 ? 10  GLU A CA   3  
ATOM 3067  C C    . GLU A 1 2  ? -1.761  0.357   -13.893 1.00 0.00 ? 10  GLU A C    3  
ATOM 3068  O O    . GLU A 1 2  ? -1.775  1.035   -14.920 1.00 0.00 ? 10  GLU A O    3  
ATOM 3069  C CB   . GLU A 1 2  ? 0.031   -1.330  -14.352 1.00 0.00 ? 10  GLU A CB   3  
ATOM 3070  C CG   . GLU A 1 2  ? 0.962   -1.565  -13.174 1.00 0.00 ? 10  GLU A CG   3  
ATOM 3071  C CD   . GLU A 1 2  ? 2.404   -1.757  -13.601 1.00 0.00 ? 10  GLU A CD   3  
ATOM 3072  O OE1  . GLU A 1 2  ? 2.747   -2.872  -14.047 1.00 0.00 ? 10  GLU A OE1  3  
ATOM 3073  O OE2  . GLU A 1 2  ? 3.189   -0.793  -13.489 1.00 0.00 ? 10  GLU A OE2  3  
ATOM 3074  H H    . GLU A 1 2  ? -2.921  -2.519  -14.528 1.00 0.00 ? 10  GLU A H    3  
ATOM 3075  H HA   . GLU A 1 2  ? -1.582  -1.556  -12.964 1.00 0.00 ? 10  GLU A HA   3  
ATOM 3076  H HB2  . GLU A 1 2  ? 0.096   -2.184  -15.011 1.00 0.00 ? 10  GLU A HB2  3  
ATOM 3077  H HB3  . GLU A 1 2  ? 0.368   -0.452  -14.881 1.00 0.00 ? 10  GLU A HB3  3  
ATOM 3078  H HG2  . GLU A 1 2  ? 0.908   -0.712  -12.514 1.00 0.00 ? 10  GLU A HG2  3  
ATOM 3079  H HG3  . GLU A 1 2  ? 0.637   -2.449  -12.646 1.00 0.00 ? 10  GLU A HG3  3  
ATOM 3080  N N    . LYS A 1 3  ? -2.026  0.855   -12.693 1.00 0.00 ? 11  LYS A N    3  
ATOM 3081  C CA   . LYS A 1 3  ? -2.355  2.263   -12.502 1.00 0.00 ? 11  LYS A CA   3  
ATOM 3082  C C    . LYS A 1 3  ? -1.127  3.053   -12.058 1.00 0.00 ? 11  LYS A C    3  
ATOM 3083  O O    . LYS A 1 3  ? -0.376  2.613   -11.188 1.00 0.00 ? 11  LYS A O    3  
ATOM 3084  C CB   . LYS A 1 3  ? -3.475  2.410   -11.468 1.00 0.00 ? 11  LYS A CB   3  
ATOM 3085  C CG   . LYS A 1 3  ? -3.862  3.852   -11.188 1.00 0.00 ? 11  LYS A CG   3  
ATOM 3086  C CD   . LYS A 1 3  ? -5.286  3.954   -10.663 1.00 0.00 ? 11  LYS A CD   3  
ATOM 3087  C CE   . LYS A 1 3  ? -5.379  3.488   -9.219  1.00 0.00 ? 11  LYS A CE   3  
ATOM 3088  N NZ   . LYS A 1 3  ? -6.779  3.531   -8.712  1.00 0.00 ? 11  LYS A NZ   3  
ATOM 3089  H H    . LYS A 1 3  ? -1.998  0.262   -11.912 1.00 0.00 ? 11  LYS A H    3  
ATOM 3090  H HA   . LYS A 1 3  ? -2.698  2.654   -13.449 1.00 0.00 ? 11  LYS A HA   3  
ATOM 3091  H HB2  . LYS A 1 3  ? -4.349  1.888   -11.827 1.00 0.00 ? 11  LYS A HB2  3  
ATOM 3092  H HB3  . LYS A 1 3  ? -3.153  1.960   -10.540 1.00 0.00 ? 11  LYS A HB3  3  
ATOM 3093  H HG2  . LYS A 1 3  ? -3.187  4.261   -10.451 1.00 0.00 ? 11  LYS A HG2  3  
ATOM 3094  H HG3  . LYS A 1 3  ? -3.785  4.421   -12.105 1.00 0.00 ? 11  LYS A HG3  3  
ATOM 3095  H HD2  . LYS A 1 3  ? -5.607  4.983   -10.720 1.00 0.00 ? 11  LYS A HD2  3  
ATOM 3096  H HD3  . LYS A 1 3  ? -5.929  3.339   -11.274 1.00 0.00 ? 11  LYS A HD3  3  
ATOM 3097  H HE2  . LYS A 1 3  ? -5.015  2.473   -9.158  1.00 0.00 ? 11  LYS A HE2  3  
ATOM 3098  H HE3  . LYS A 1 3  ? -4.763  4.128   -8.607  1.00 0.00 ? 11  LYS A HE3  3  
ATOM 3099  H HZ1  . LYS A 1 3  ? -6.943  4.418   -8.192  1.00 0.00 ? 11  LYS A HZ1  3  
ATOM 3100  H HZ2  . LYS A 1 3  ? -6.952  2.730   -8.072  1.00 0.00 ? 11  LYS A HZ2  3  
ATOM 3101  H HZ3  . LYS A 1 3  ? -7.448  3.477   -9.506  1.00 0.00 ? 11  LYS A HZ3  3  
ATOM 3102  N N    . LYS A 1 4  ? -0.931  4.221   -12.662 1.00 0.00 ? 12  LYS A N    3  
ATOM 3103  C CA   . LYS A 1 4  ? 0.205   5.071   -12.329 1.00 0.00 ? 12  LYS A CA   3  
ATOM 3104  C C    . LYS A 1 4  ? -0.181  6.109   -11.279 1.00 0.00 ? 12  LYS A C    3  
ATOM 3105  O O    . LYS A 1 4  ? -1.277  6.667   -11.317 1.00 0.00 ? 12  LYS A O    3  
ATOM 3106  C CB   . LYS A 1 4  ? 0.730   5.770   -13.584 1.00 0.00 ? 12  LYS A CB   3  
ATOM 3107  C CG   . LYS A 1 4  ? 2.077   6.446   -13.385 1.00 0.00 ? 12  LYS A CG   3  
ATOM 3108  C CD   . LYS A 1 4  ? 2.717   6.816   -14.714 1.00 0.00 ? 12  LYS A CD   3  
ATOM 3109  C CE   . LYS A 1 4  ? 3.764   5.797   -15.130 1.00 0.00 ? 12  LYS A CE   3  
ATOM 3110  N NZ   . LYS A 1 4  ? 3.149   4.561   -15.686 1.00 0.00 ? 12  LYS A NZ   3  
ATOM 3111  H H    . LYS A 1 4  ? -1.565  4.516   -13.349 1.00 0.00 ? 12  LYS A H    3  
ATOM 3112  H HA   . LYS A 1 4  ? 0.984   4.442   -11.926 1.00 0.00 ? 12  LYS A HA   3  
ATOM 3113  H HB2  . LYS A 1 4  ? 0.831   5.041   -14.374 1.00 0.00 ? 12  LYS A HB2  3  
ATOM 3114  H HB3  . LYS A 1 4  ? 0.016   6.521   -13.889 1.00 0.00 ? 12  LYS A HB3  3  
ATOM 3115  H HG2  . LYS A 1 4  ? 1.935   7.345   -12.804 1.00 0.00 ? 12  LYS A HG2  3  
ATOM 3116  H HG3  . LYS A 1 4  ? 2.732   5.771   -12.855 1.00 0.00 ? 12  LYS A HG3  3  
ATOM 3117  H HD2  . LYS A 1 4  ? 1.949   6.858   -15.473 1.00 0.00 ? 12  LYS A HD2  3  
ATOM 3118  H HD3  . LYS A 1 4  ? 3.185   7.784   -14.620 1.00 0.00 ? 12  LYS A HD3  3  
ATOM 3119  H HE2  . LYS A 1 4  ? 4.402   6.240   -15.881 1.00 0.00 ? 12  LYS A HE2  3  
ATOM 3120  H HE3  . LYS A 1 4  ? 4.357   5.535   -14.266 1.00 0.00 ? 12  LYS A HE3  3  
ATOM 3121  H HZ1  . LYS A 1 4  ? 3.735   4.186   -16.461 1.00 0.00 ? 12  LYS A HZ1  3  
ATOM 3122  H HZ2  . LYS A 1 4  ? 2.200   4.769   -16.055 1.00 0.00 ? 12  LYS A HZ2  3  
ATOM 3123  H HZ3  . LYS A 1 4  ? 3.068   3.837   -14.945 1.00 0.00 ? 12  LYS A HZ3  3  
ATOM 3124  N N    . VAL A 1 5  ? 0.727   6.360   -10.341 1.00 0.00 ? 13  VAL A N    3  
ATOM 3125  C CA   . VAL A 1 5  ? 0.482   7.330   -9.281  1.00 0.00 ? 13  VAL A CA   3  
ATOM 3126  C C    . VAL A 1 5  ? 1.766   8.058   -8.894  1.00 0.00 ? 13  VAL A C    3  
ATOM 3127  O O    . VAL A 1 5  ? 2.829   7.447   -8.782  1.00 0.00 ? 13  VAL A O    3  
ATOM 3128  C CB   . VAL A 1 5  ? -0.111  6.655   -8.029  1.00 0.00 ? 13  VAL A CB   3  
ATOM 3129  C CG1  . VAL A 1 5  ? -0.449  7.691   -6.966  1.00 0.00 ? 13  VAL A CG1  3  
ATOM 3130  C CG2  . VAL A 1 5  ? -1.339  5.836   -8.398  1.00 0.00 ? 13  VAL A CG2  3  
ATOM 3131  H H    . VAL A 1 5  ? 1.583   5.883   -10.364 1.00 0.00 ? 13  VAL A H    3  
ATOM 3132  H HA   . VAL A 1 5  ? -0.233  8.052   -9.649  1.00 0.00 ? 13  VAL A HA   3  
ATOM 3133  H HB   . VAL A 1 5  ? 0.632   5.985   -7.621  1.00 0.00 ? 13  VAL A HB   3  
ATOM 3134  H HG11 . VAL A 1 5  ? 0.252   7.610   -6.149  1.00 0.00 ? 13  VAL A HG11 3  
ATOM 3135  H HG12 . VAL A 1 5  ? -1.450  7.520   -6.598  1.00 0.00 ? 13  VAL A HG12 3  
ATOM 3136  H HG13 . VAL A 1 5  ? -0.388  8.681   -7.395  1.00 0.00 ? 13  VAL A HG13 3  
ATOM 3137  H HG21 . VAL A 1 5  ? -2.010  6.441   -8.990  1.00 0.00 ? 13  VAL A HG21 3  
ATOM 3138  H HG22 . VAL A 1 5  ? -1.843  5.518   -7.496  1.00 0.00 ? 13  VAL A HG22 3  
ATOM 3139  H HG23 . VAL A 1 5  ? -1.038  4.970   -8.967  1.00 0.00 ? 13  VAL A HG23 3  
ATOM 3140  N N    . PHE A 1 6  ? 1.659   9.367   -8.691  1.00 0.00 ? 14  PHE A N    3  
ATOM 3141  C CA   . PHE A 1 6  ? 2.809   10.180  -8.314  1.00 0.00 ? 14  PHE A CA   3  
ATOM 3142  C C    . PHE A 1 6  ? 2.530   10.949  -7.026  1.00 0.00 ? 14  PHE A C    3  
ATOM 3143  O O    . PHE A 1 6  ? 1.644   11.803  -6.982  1.00 0.00 ? 14  PHE A O    3  
ATOM 3144  C CB   . PHE A 1 6  ? 3.163   11.156  -9.437  1.00 0.00 ? 14  PHE A CB   3  
ATOM 3145  C CG   . PHE A 1 6  ? 1.981   11.916  -9.967  1.00 0.00 ? 14  PHE A CG   3  
ATOM 3146  C CD1  . PHE A 1 6  ? 1.046   11.294  -10.780 1.00 0.00 ? 14  PHE A CD1  3  
ATOM 3147  C CD2  . PHE A 1 6  ? 1.804   13.254  -9.653  1.00 0.00 ? 14  PHE A CD2  3  
ATOM 3148  C CE1  . PHE A 1 6  ? -0.043  11.991  -11.268 1.00 0.00 ? 14  PHE A CE1  3  
ATOM 3149  C CE2  . PHE A 1 6  ? 0.718   13.957  -10.139 1.00 0.00 ? 14  PHE A CE2  3  
ATOM 3150  C CZ   . PHE A 1 6  ? -0.207  13.325  -10.947 1.00 0.00 ? 14  PHE A CZ   3  
ATOM 3151  H H    . PHE A 1 6  ? 0.784   9.797   -8.795  1.00 0.00 ? 14  PHE A H    3  
ATOM 3152  H HA   . PHE A 1 6  ? 3.644   9.516   -8.148  1.00 0.00 ? 14  PHE A HA   3  
ATOM 3153  H HB2  . PHE A 1 6  ? 3.880   11.872  -9.070  1.00 0.00 ? 14  PHE A HB2  3  
ATOM 3154  H HB3  . PHE A 1 6  ? 3.600   10.604  -10.258 1.00 0.00 ? 14  PHE A HB3  3  
ATOM 3155  H HD1  . PHE A 1 6  ? 1.173   10.251  -11.030 1.00 0.00 ? 14  PHE A HD1  3  
ATOM 3156  H HD2  . PHE A 1 6  ? 2.526   13.750  -9.021  1.00 0.00 ? 14  PHE A HD2  3  
ATOM 3157  H HE1  . PHE A 1 6  ? -0.764  11.493  -11.900 1.00 0.00 ? 14  PHE A HE1  3  
ATOM 3158  H HE2  . PHE A 1 6  ? 0.591   15.000  -9.887  1.00 0.00 ? 14  PHE A HE2  3  
ATOM 3159  H HZ   . PHE A 1 6  ? -1.057  13.871  -11.328 1.00 0.00 ? 14  PHE A HZ   3  
ATOM 3160  N N    . ILE A 1 7  ? 3.289   10.640  -5.981  1.00 0.00 ? 15  ILE A N    3  
ATOM 3161  C CA   . ILE A 1 7  ? 3.122   11.302  -4.693  1.00 0.00 ? 15  ILE A CA   3  
ATOM 3162  C C    . ILE A 1 7  ? 4.184   12.375  -4.482  1.00 0.00 ? 15  ILE A C    3  
ATOM 3163  O O    . ILE A 1 7  ? 5.380   12.116  -4.612  1.00 0.00 ? 15  ILE A O    3  
ATOM 3164  C CB   . ILE A 1 7  ? 3.184   10.292  -3.531  1.00 0.00 ? 15  ILE A CB   3  
ATOM 3165  C CG1  . ILE A 1 7  ? 2.189   9.153   -3.760  1.00 0.00 ? 15  ILE A CG1  3  
ATOM 3166  C CG2  . ILE A 1 7  ? 2.902   10.987  -2.205  1.00 0.00 ? 15  ILE A CG2  3  
ATOM 3167  C CD1  . ILE A 1 7  ? 0.762   9.626   -3.943  1.00 0.00 ? 15  ILE A CD1  3  
ATOM 3168  H H    . ILE A 1 7  ? 3.979   9.950   -6.078  1.00 0.00 ? 15  ILE A H    3  
ATOM 3169  H HA   . ILE A 1 7  ? 2.147   11.769  -4.684  1.00 0.00 ? 15  ILE A HA   3  
ATOM 3170  H HB   . ILE A 1 7  ? 4.184   9.885   -3.489  1.00 0.00 ? 15  ILE A HB   3  
ATOM 3171  H HG12 . ILE A 1 7  ? 2.473   8.608   -4.647  1.00 0.00 ? 15  ILE A HG12 3  
ATOM 3172  H HG13 . ILE A 1 7  ? 2.212   8.487   -2.910  1.00 0.00 ? 15  ILE A HG13 3  
ATOM 3173  H HG21 . ILE A 1 7  ? 3.508   11.879  -2.130  1.00 0.00 ? 15  ILE A HG21 3  
ATOM 3174  H HG22 . ILE A 1 7  ? 3.143   10.321  -1.390  1.00 0.00 ? 15  ILE A HG22 3  
ATOM 3175  H HG23 . ILE A 1 7  ? 1.857   11.255  -2.153  1.00 0.00 ? 15  ILE A HG23 3  
ATOM 3176  H HD11 . ILE A 1 7  ? 0.436   9.401   -4.948  1.00 0.00 ? 15  ILE A HD11 3  
ATOM 3177  H HD12 . ILE A 1 7  ? 0.712   10.692  -3.777  1.00 0.00 ? 15  ILE A HD12 3  
ATOM 3178  H HD13 . ILE A 1 7  ? 0.122   9.121   -3.235  1.00 0.00 ? 15  ILE A HD13 3  
ATOM 3179  N N    . SER A 1 8  ? 3.735   13.582  -4.152  1.00 0.00 ? 16  SER A N    3  
ATOM 3180  C CA   . SER A 1 8  ? 4.641   14.699  -3.917  1.00 0.00 ? 16  SER A CA   3  
ATOM 3181  C C    . SER A 1 8  ? 4.223   15.477  -2.674  1.00 0.00 ? 16  SER A C    3  
ATOM 3182  O O    . SER A 1 8  ? 3.053   15.826  -2.515  1.00 0.00 ? 16  SER A O    3  
ATOM 3183  C CB   . SER A 1 8  ? 4.664   15.629  -5.132  1.00 0.00 ? 16  SER A CB   3  
ATOM 3184  O OG   . SER A 1 8  ? 3.435   15.578  -5.837  1.00 0.00 ? 16  SER A OG   3  
ATOM 3185  H H    . SER A 1 8  ? 2.769   13.723  -4.061  1.00 0.00 ? 16  SER A H    3  
ATOM 3186  H HA   . SER A 1 8  ? 5.632   14.299  -3.761  1.00 0.00 ? 16  SER A HA   3  
ATOM 3187  H HB2  . SER A 1 8  ? 4.833   16.644  -4.803  1.00 0.00 ? 16  SER A HB2  3  
ATOM 3188  H HB3  . SER A 1 8  ? 5.460   15.330  -5.797  1.00 0.00 ? 16  SER A HB3  3  
ATOM 3189  H HG   . SER A 1 8  ? 3.456   14.850  -6.463  1.00 0.00 ? 16  SER A HG   3  
ATOM 3190  N N    . LEU A 1 9  ? 5.182   15.743  -1.793  1.00 0.00 ? 17  LEU A N    3  
ATOM 3191  C CA   . LEU A 1 9  ? 4.907   16.477  -0.562  1.00 0.00 ? 17  LEU A CA   3  
ATOM 3192  C C    . LEU A 1 9  ? 4.236   17.815  -0.863  1.00 0.00 ? 17  LEU A C    3  
ATOM 3193  O O    . LEU A 1 9  ? 3.051   17.999  -0.585  1.00 0.00 ? 17  LEU A O    3  
ATOM 3194  C CB   . LEU A 1 9  ? 6.201   16.702  0.224   1.00 0.00 ? 17  LEU A CB   3  
ATOM 3195  C CG   . LEU A 1 9  ? 6.163   16.230  1.678   1.00 0.00 ? 17  LEU A CG   3  
ATOM 3196  C CD1  . LEU A 1 9  ? 6.207   14.712  1.746   1.00 0.00 ? 17  LEU A CD1  3  
ATOM 3197  C CD2  . LEU A 1 9  ? 7.316   16.835  2.464   1.00 0.00 ? 17  LEU A CD2  3  
ATOM 3198  H H    . LEU A 1 9  ? 6.096   15.436  -1.974  1.00 0.00 ? 17  LEU A H    3  
ATOM 3199  H HA   . LEU A 1 9  ? 4.236   15.879  0.034   1.00 0.00 ? 17  LEU A HA   3  
ATOM 3200  H HB2  . LEU A 1 9  ? 7.000   16.179  -0.283  1.00 0.00 ? 17  LEU A HB2  3  
ATOM 3201  H HB3  . LEU A 1 9  ? 6.425   17.759  0.219   1.00 0.00 ? 17  LEU A HB3  3  
ATOM 3202  H HG   . LEU A 1 9  ? 5.239   16.557  2.131   1.00 0.00 ? 17  LEU A HG   3  
ATOM 3203  H HD11 . LEU A 1 9  ? 5.499   14.297  1.045   1.00 0.00 ? 17  LEU A HD11 3  
ATOM 3204  H HD12 . LEU A 1 9  ? 5.956   14.389  2.747   1.00 0.00 ? 17  LEU A HD12 3  
ATOM 3205  H HD13 . LEU A 1 9  ? 7.201   14.368  1.497   1.00 0.00 ? 17  LEU A HD13 3  
ATOM 3206  H HD21 . LEU A 1 9  ? 7.141   16.697  3.522   1.00 0.00 ? 17  LEU A HD21 3  
ATOM 3207  H HD22 . LEU A 1 9  ? 7.386   17.890  2.246   1.00 0.00 ? 17  LEU A HD22 3  
ATOM 3208  H HD23 . LEU A 1 9  ? 8.237   16.347  2.185   1.00 0.00 ? 17  LEU A HD23 3  
ATOM 3209  N N    . VAL A 1 10 ? 5.003   18.741  -1.435  1.00 0.00 ? 18  VAL A N    3  
ATOM 3210  C CA   . VAL A 1 10 ? 4.496   20.070  -1.784  1.00 0.00 ? 18  VAL A CA   3  
ATOM 3211  C C    . VAL A 1 10 ? 3.582   20.634  -0.697  1.00 0.00 ? 18  VAL A C    3  
ATOM 3212  O O    . VAL A 1 10 ? 2.368   20.431  -0.725  1.00 0.00 ? 18  VAL A O    3  
ATOM 3213  C CB   . VAL A 1 10 ? 3.734   20.055  -3.125  1.00 0.00 ? 18  VAL A CB   3  
ATOM 3214  C CG1  . VAL A 1 10 ? 4.708   19.993  -4.291  1.00 0.00 ? 18  VAL A CG1  3  
ATOM 3215  C CG2  . VAL A 1 10 ? 2.754   18.890  -3.183  1.00 0.00 ? 18  VAL A CG2  3  
ATOM 3216  H H    . VAL A 1 10 ? 5.939   18.526  -1.631  1.00 0.00 ? 18  VAL A H    3  
ATOM 3217  H HA   . VAL A 1 10 ? 5.347   20.726  -1.892  1.00 0.00 ? 18  VAL A HA   3  
ATOM 3218  H HB   . VAL A 1 10 ? 3.172   20.973  -3.206  1.00 0.00 ? 18  VAL A HB   3  
ATOM 3219  H HG11 . VAL A 1 10 ? 4.961   20.995  -4.602  1.00 0.00 ? 18  VAL A HG11 3  
ATOM 3220  H HG12 . VAL A 1 10 ? 4.251   19.465  -5.115  1.00 0.00 ? 18  VAL A HG12 3  
ATOM 3221  H HG13 . VAL A 1 10 ? 5.604   19.474  -3.985  1.00 0.00 ? 18  VAL A HG13 3  
ATOM 3222  H HG21 . VAL A 1 10 ? 3.298   17.959  -3.137  1.00 0.00 ? 18  VAL A HG21 3  
ATOM 3223  H HG22 . VAL A 1 10 ? 2.197   18.935  -4.108  1.00 0.00 ? 18  VAL A HG22 3  
ATOM 3224  H HG23 . VAL A 1 10 ? 2.070   18.952  -2.349  1.00 0.00 ? 18  VAL A HG23 3  
ATOM 3225  N N    . GLY A 1 11 ? 4.175   21.343  0.258   1.00 0.00 ? 19  GLY A N    3  
ATOM 3226  C CA   . GLY A 1 11 ? 3.399   21.927  1.338   1.00 0.00 ? 19  GLY A CA   3  
ATOM 3227  C C    . GLY A 1 11 ? 3.541   21.160  2.638   1.00 0.00 ? 19  GLY A C    3  
ATOM 3228  O O    . GLY A 1 11 ? 2.645   21.188  3.482   1.00 0.00 ? 19  GLY A O    3  
ATOM 3229  H H    . GLY A 1 11 ? 5.145   21.474  0.228   1.00 0.00 ? 19  GLY A H    3  
ATOM 3230  H HA2  . GLY A 1 11 ? 3.730   22.943  1.495   1.00 0.00 ? 19  GLY A HA2  3  
ATOM 3231  H HA3  . GLY A 1 11 ? 2.358   21.940  1.052   1.00 0.00 ? 19  GLY A HA3  3  
ATOM 3232  N N    . SER A 1 12 ? 4.667   20.474  2.801   1.00 0.00 ? 20  SER A N    3  
ATOM 3233  C CA   . SER A 1 12 ? 4.922   19.696  4.009   1.00 0.00 ? 20  SER A CA   3  
ATOM 3234  C C    . SER A 1 12 ? 3.813   18.677  4.254   1.00 0.00 ? 20  SER A C    3  
ATOM 3235  O O    . SER A 1 12 ? 3.574   18.267  5.390   1.00 0.00 ? 20  SER A O    3  
ATOM 3236  C CB   . SER A 1 12 ? 5.053   20.625  5.218   1.00 0.00 ? 20  SER A CB   3  
ATOM 3237  O OG   . SER A 1 12 ? 6.023   21.631  4.985   1.00 0.00 ? 20  SER A OG   3  
ATOM 3238  H H    . SER A 1 12 ? 5.343   20.492  2.093   1.00 0.00 ? 20  SER A H    3  
ATOM 3239  H HA   . SER A 1 12 ? 5.854   19.169  3.872   1.00 0.00 ? 20  SER A HA   3  
ATOM 3240  H HB2  . SER A 1 12 ? 4.102   21.097  5.413   1.00 0.00 ? 20  SER A HB2  3  
ATOM 3241  H HB3  . SER A 1 12 ? 5.352   20.048  6.081   1.00 0.00 ? 20  SER A HB3  3  
ATOM 3242  H HG   . SER A 1 12 ? 6.827   21.230  4.649   1.00 0.00 ? 20  SER A HG   3  
ATOM 3243  N N    . ARG A 1 13 ? 3.138   18.271  3.183   1.00 0.00 ? 21  ARG A N    3  
ATOM 3244  C CA   . ARG A 1 13 ? 2.056   17.298  3.285   1.00 0.00 ? 21  ARG A CA   3  
ATOM 3245  C C    . ARG A 1 13 ? 2.522   15.921  2.826   1.00 0.00 ? 21  ARG A C    3  
ATOM 3246  O O    . ARG A 1 13 ? 2.759   15.700  1.639   1.00 0.00 ? 21  ARG A O    3  
ATOM 3247  C CB   . ARG A 1 13 ? 0.857   17.749  2.449   1.00 0.00 ? 21  ARG A CB   3  
ATOM 3248  C CG   . ARG A 1 13 ? -0.469  17.183  2.933   1.00 0.00 ? 21  ARG A CG   3  
ATOM 3249  C CD   . ARG A 1 13 ? -1.601  18.181  2.753   1.00 0.00 ? 21  ARG A CD   3  
ATOM 3250  N NE   . ARG A 1 13 ? -2.545  18.147  3.867   1.00 0.00 ? 21  ARG A NE   3  
ATOM 3251  C CZ   . ARG A 1 13 ? -3.637  18.905  3.937   1.00 0.00 ? 21  ARG A CZ   3  
ATOM 3252  N NH1  . ARG A 1 13 ? -3.926  19.756  2.962   1.00 0.00 ? 21  ARG A NH1  3  
ATOM 3253  N NH2  . ARG A 1 13 ? -4.441  18.811  4.988   1.00 0.00 ? 21  ARG A NH2  3  
ATOM 3254  H H    . ARG A 1 13 ? 3.374   18.631  2.302   1.00 0.00 ? 21  ARG A H    3  
ATOM 3255  H HA   . ARG A 1 13 ? 1.760   17.239  4.321   1.00 0.00 ? 21  ARG A HA   3  
ATOM 3256  H HB2  . ARG A 1 13 ? 0.795   18.827  2.481   1.00 0.00 ? 21  ARG A HB2  3  
ATOM 3257  H HB3  . ARG A 1 13 ? 1.006   17.436  1.428   1.00 0.00 ? 21  ARG A HB3  3  
ATOM 3258  H HG2  . ARG A 1 13 ? -0.697  16.291  2.369   1.00 0.00 ? 21  ARG A HG2  3  
ATOM 3259  H HG3  . ARG A 1 13 ? -0.383  16.935  3.981   1.00 0.00 ? 21  ARG A HG3  3  
ATOM 3260  H HD2  . ARG A 1 13 ? -1.181  19.173  2.680   1.00 0.00 ? 21  ARG A HD2  3  
ATOM 3261  H HD3  . ARG A 1 13 ? -2.129  17.947  1.840   1.00 0.00 ? 21  ARG A HD3  3  
ATOM 3262  H HE   . ARG A 1 13 ? -2.355  17.527  4.602   1.00 0.00 ? 21  ARG A HE   3  
ATOM 3263  H HH11 . ARG A 1 13 ? -3.324  19.833  2.169   1.00 0.00 ? 21  ARG A HH11 3  
ATOM 3264  H HH12 . ARG A 1 13 ? -4.748  20.323  3.021   1.00 0.00 ? 21  ARG A HH12 3  
ATOM 3265  H HH21 . ARG A 1 13 ? -4.227  18.171  5.726   1.00 0.00 ? 21  ARG A HH21 3  
ATOM 3266  H HH22 . ARG A 1 13 ? -5.262  19.380  5.041   1.00 0.00 ? 21  ARG A HH22 3  
ATOM 3267  N N    . GLY A 1 14 ? 2.658   14.999  3.776   1.00 0.00 ? 22  GLY A N    3  
ATOM 3268  C CA   . GLY A 1 14 ? 3.100   13.653  3.452   1.00 0.00 ? 22  GLY A CA   3  
ATOM 3269  C C    . GLY A 1 14 ? 2.351   13.049  2.279   1.00 0.00 ? 22  GLY A C    3  
ATOM 3270  O O    . GLY A 1 14 ? 2.701   13.283  1.122   1.00 0.00 ? 22  GLY A O    3  
ATOM 3271  H H    . GLY A 1 14 ? 2.456   15.236  4.705   1.00 0.00 ? 22  GLY A H    3  
ATOM 3272  H HA2  . GLY A 1 14 ? 4.153   13.681  3.214   1.00 0.00 ? 22  GLY A HA2  3  
ATOM 3273  H HA3  . GLY A 1 14 ? 2.957   13.023  4.318   1.00 0.00 ? 22  GLY A HA3  3  
ATOM 3274  N N    . LEU A 1 15 ? 1.321   12.264  2.577   1.00 0.00 ? 23  LEU A N    3  
ATOM 3275  C CA   . LEU A 1 15 ? 0.523   11.622  1.541   1.00 0.00 ? 23  LEU A CA   3  
ATOM 3276  C C    . LEU A 1 15 ? -0.956  11.634  1.919   1.00 0.00 ? 23  LEU A C    3  
ATOM 3277  O O    . LEU A 1 15 ? -1.794  12.138  1.172   1.00 0.00 ? 23  LEU A O    3  
ATOM 3278  C CB   . LEU A 1 15 ? 1.007   10.182  1.330   1.00 0.00 ? 23  LEU A CB   3  
ATOM 3279  C CG   . LEU A 1 15 ? 0.007   9.243   0.652   1.00 0.00 ? 23  LEU A CG   3  
ATOM 3280  C CD1  . LEU A 1 15 ? -0.210  9.648   -0.797  1.00 0.00 ? 23  LEU A CD1  3  
ATOM 3281  C CD2  . LEU A 1 15 ? 0.487   7.802   0.740   1.00 0.00 ? 23  LEU A CD2  3  
ATOM 3282  H H    . LEU A 1 15 ? 1.091   12.111  3.517   1.00 0.00 ? 23  LEU A H    3  
ATOM 3283  H HA   . LEU A 1 15 ? 0.656   12.177  0.625   1.00 0.00 ? 23  LEU A HA   3  
ATOM 3284  H HB2  . LEU A 1 15 ? 1.904   10.212  0.729   1.00 0.00 ? 23  LEU A HB2  3  
ATOM 3285  H HB3  . LEU A 1 15 ? 1.253   9.768   2.293   1.00 0.00 ? 23  LEU A HB3  3  
ATOM 3286  H HG   . LEU A 1 15 ? -0.943  9.311   1.163   1.00 0.00 ? 23  LEU A HG   3  
ATOM 3287  H HD11 . LEU A 1 15 ? -0.849  8.926   -1.281  1.00 0.00 ? 23  LEU A HD11 3  
ATOM 3288  H HD12 . LEU A 1 15 ? 0.743   9.684   -1.305  1.00 0.00 ? 23  LEU A HD12 3  
ATOM 3289  H HD13 . LEU A 1 15 ? -0.674  10.622  -0.832  1.00 0.00 ? 23  LEU A HD13 3  
ATOM 3290  H HD21 . LEU A 1 15 ? 1.510   7.742   0.400   1.00 0.00 ? 23  LEU A HD21 3  
ATOM 3291  H HD22 . LEU A 1 15 ? -0.136  7.176   0.118   1.00 0.00 ? 23  LEU A HD22 3  
ATOM 3292  H HD23 . LEU A 1 15 ? 0.427   7.465   1.765   1.00 0.00 ? 23  LEU A HD23 3  
ATOM 3293  N N    . GLY A 1 16 ? -1.264  11.066  3.080   1.00 0.00 ? 24  GLY A N    3  
ATOM 3294  C CA   . GLY A 1 16 ? -2.640  11.013  3.537   1.00 0.00 ? 24  GLY A CA   3  
ATOM 3295  C C    . GLY A 1 16 ? -3.227  9.618   3.433   1.00 0.00 ? 24  GLY A C    3  
ATOM 3296  O O    . GLY A 1 16 ? -4.444  9.456   3.348   1.00 0.00 ? 24  GLY A O    3  
ATOM 3297  H H    . GLY A 1 16 ? -0.553  10.676  3.629   1.00 0.00 ? 24  GLY A H    3  
ATOM 3298  H HA2  . GLY A 1 16 ? -2.679  11.335  4.567   1.00 0.00 ? 24  GLY A HA2  3  
ATOM 3299  H HA3  . GLY A 1 16 ? -3.233  11.685  2.938   1.00 0.00 ? 24  GLY A HA3  3  
ATOM 3300  N N    . CYS A 1 17 ? -2.360  8.611   3.437   1.00 0.00 ? 25  CYS A N    3  
ATOM 3301  C CA   . CYS A 1 17 ? -2.800  7.224   3.338   1.00 0.00 ? 25  CYS A CA   3  
ATOM 3302  C C    . CYS A 1 17 ? -1.907  6.307   4.165   1.00 0.00 ? 25  CYS A C    3  
ATOM 3303  O O    . CYS A 1 17 ? -0.810  6.691   4.572   1.00 0.00 ? 25  CYS A O    3  
ATOM 3304  C CB   . CYS A 1 17 ? -2.796  6.770   1.878   1.00 0.00 ? 25  CYS A CB   3  
ATOM 3305  S SG   . CYS A 1 17 ? -3.982  5.453   1.513   1.00 0.00 ? 25  CYS A SG   3  
ATOM 3306  H H    . CYS A 1 17 ? -1.401  8.802   3.506   1.00 0.00 ? 25  CYS A H    3  
ATOM 3307  H HA   . CYS A 1 17 ? -3.806  7.168   3.719   1.00 0.00 ? 25  CYS A HA   3  
ATOM 3308  H HB2  . CYS A 1 17 ? -3.038  7.610   1.248   1.00 0.00 ? 25  CYS A HB2  3  
ATOM 3309  H HB3  . CYS A 1 17 ? -1.813  6.405   1.626   1.00 0.00 ? 25  CYS A HB3  3  
ATOM 3310  H HG   . CYS A 1 17 ? -3.783  4.708   2.084   1.00 0.00 ? 25  CYS A HG   3  
ATOM 3311  N N    . SER A 1 18 ? -2.381  5.089   4.406   1.00 0.00 ? 26  SER A N    3  
ATOM 3312  C CA   . SER A 1 18 ? -1.626  4.112   5.178   1.00 0.00 ? 26  SER A CA   3  
ATOM 3313  C C    . SER A 1 18 ? -1.241  2.924   4.302   1.00 0.00 ? 26  SER A C    3  
ATOM 3314  O O    . SER A 1 18 ? -1.661  2.835   3.150   1.00 0.00 ? 26  SER A O    3  
ATOM 3315  C CB   . SER A 1 18 ? -2.445  3.631   6.379   1.00 0.00 ? 26  SER A CB   3  
ATOM 3316  O OG   . SER A 1 18 ? -2.247  4.472   7.501   1.00 0.00 ? 26  SER A OG   3  
ATOM 3317  H H    . SER A 1 18 ? -3.263  4.842   4.053   1.00 0.00 ? 26  SER A H    3  
ATOM 3318  H HA   . SER A 1 18 ? -0.727  4.590   5.534   1.00 0.00 ? 26  SER A HA   3  
ATOM 3319  H HB2  . SER A 1 18 ? -3.494  3.637   6.121   1.00 0.00 ? 26  SER A HB2  3  
ATOM 3320  H HB3  . SER A 1 18 ? -2.144  2.627   6.638   1.00 0.00 ? 26  SER A HB3  3  
ATOM 3321  H HG   . SER A 1 18 ? -2.978  5.091   7.571   1.00 0.00 ? 26  SER A HG   3  
ATOM 3322  N N    . ILE A 1 19 ? -0.439  2.018   4.848   1.00 0.00 ? 27  ILE A N    3  
ATOM 3323  C CA   . ILE A 1 19 ? -0.009  0.842   4.103   1.00 0.00 ? 27  ILE A CA   3  
ATOM 3324  C C    . ILE A 1 19 ? 0.068   -0.387  5.001   1.00 0.00 ? 27  ILE A C    3  
ATOM 3325  O O    . ILE A 1 19 ? 0.404   -0.288  6.181   1.00 0.00 ? 27  ILE A O    3  
ATOM 3326  C CB   . ILE A 1 19 ? 1.360   1.064   3.432   1.00 0.00 ? 27  ILE A CB   3  
ATOM 3327  C CG1  . ILE A 1 19 ? 2.362   1.640   4.431   1.00 0.00 ? 27  ILE A CG1  3  
ATOM 3328  C CG2  . ILE A 1 19 ? 1.219   1.985   2.230   1.00 0.00 ? 27  ILE A CG2  3  
ATOM 3329  C CD1  . ILE A 1 19 ? 3.758   1.778   3.865   1.00 0.00 ? 27  ILE A CD1  3  
ATOM 3330  H H    . ILE A 1 19 ? -0.132  2.142   5.772   1.00 0.00 ? 27  ILE A H    3  
ATOM 3331  H HA   . ILE A 1 19 ? -0.738  0.660   3.328   1.00 0.00 ? 27  ILE A HA   3  
ATOM 3332  H HB   . ILE A 1 19 ? 1.722   0.109   3.081   1.00 0.00 ? 27  ILE A HB   3  
ATOM 3333  H HG12 . ILE A 1 19 ? 2.031   2.620   4.740   1.00 0.00 ? 27  ILE A HG12 3  
ATOM 3334  H HG13 . ILE A 1 19 ? 2.415   0.993   5.294   1.00 0.00 ? 27  ILE A HG13 3  
ATOM 3335  H HG21 . ILE A 1 19 ? 2.182   2.409   1.986   1.00 0.00 ? 27  ILE A HG21 3  
ATOM 3336  H HG22 . ILE A 1 19 ? 0.525   2.779   2.462   1.00 0.00 ? 27  ILE A HG22 3  
ATOM 3337  H HG23 . ILE A 1 19 ? 0.852   1.421   1.385   1.00 0.00 ? 27  ILE A HG23 3  
ATOM 3338  H HD11 . ILE A 1 19 ? 4.446   1.193   4.457   1.00 0.00 ? 27  ILE A HD11 3  
ATOM 3339  H HD12 . ILE A 1 19 ? 4.054   2.816   3.886   1.00 0.00 ? 27  ILE A HD12 3  
ATOM 3340  H HD13 . ILE A 1 19 ? 3.768   1.422   2.844   1.00 0.00 ? 27  ILE A HD13 3  
ATOM 3341  N N    . SER A 1 20 ? -0.250  -1.544  4.430   1.00 0.00 ? 28  SER A N    3  
ATOM 3342  C CA   . SER A 1 20 ? -0.226  -2.802  5.171   1.00 0.00 ? 28  SER A CA   3  
ATOM 3343  C C    . SER A 1 20 ? 0.596   -3.851  4.430   1.00 0.00 ? 28  SER A C    3  
ATOM 3344  O O    . SER A 1 20 ? 0.856   -3.717  3.235   1.00 0.00 ? 28  SER A O    3  
ATOM 3345  C CB   . SER A 1 20 ? -1.651  -3.315  5.394   1.00 0.00 ? 28  SER A CB   3  
ATOM 3346  O OG   . SER A 1 20 ? -2.593  -2.260  5.310   1.00 0.00 ? 28  SER A OG   3  
ATOM 3347  H H    . SER A 1 20 ? -0.513  -1.553  3.485   1.00 0.00 ? 28  SER A H    3  
ATOM 3348  H HA   . SER A 1 20 ? 0.234   -2.612  6.130   1.00 0.00 ? 28  SER A HA   3  
ATOM 3349  H HB2  . SER A 1 20 ? -1.887  -4.053  4.641   1.00 0.00 ? 28  SER A HB2  3  
ATOM 3350  H HB3  . SER A 1 20 ? -1.718  -3.766  6.374   1.00 0.00 ? 28  SER A HB3  3  
ATOM 3351  H HG   . SER A 1 20 ? -3.418  -2.535  5.716   1.00 0.00 ? 28  SER A HG   3  
ATOM 3352  N N    . SER A 1 21 ? 1.005   -4.893  5.146   1.00 0.00 ? 29  SER A N    3  
ATOM 3353  C CA   . SER A 1 21 ? 1.801   -5.964  4.554   1.00 0.00 ? 29  SER A CA   3  
ATOM 3354  C C    . SER A 1 21 ? 0.950   -7.211  4.333   1.00 0.00 ? 29  SER A C    3  
ATOM 3355  O O    . SER A 1 21 ? 0.088   -7.541  5.148   1.00 0.00 ? 29  SER A O    3  
ATOM 3356  C CB   . SER A 1 21 ? 2.996   -6.296  5.451   1.00 0.00 ? 29  SER A CB   3  
ATOM 3357  O OG   . SER A 1 21 ? 4.214   -5.902  4.843   1.00 0.00 ? 29  SER A OG   3  
ATOM 3358  H H    . SER A 1 21 ? 0.768   -4.945  6.097   1.00 0.00 ? 29  SER A H    3  
ATOM 3359  H HA   . SER A 1 21 ? 2.164   -5.617  3.599   1.00 0.00 ? 29  SER A HA   3  
ATOM 3360  H HB2  . SER A 1 21 ? 2.893   -5.772  6.391   1.00 0.00 ? 29  SER A HB2  3  
ATOM 3361  H HB3  . SER A 1 21 ? 3.026   -7.360  5.633   1.00 0.00 ? 29  SER A HB3  3  
ATOM 3362  H HG   . SER A 1 21 ? 4.925   -6.465  5.157   1.00 0.00 ? 29  SER A HG   3  
ATOM 3363  N N    . GLY A 1 22 ? 1.191   -7.897  3.219   1.00 0.00 ? 30  GLY A N    3  
ATOM 3364  C CA   . GLY A 1 22 ? 0.433   -9.094  2.906   1.00 0.00 ? 30  GLY A CA   3  
ATOM 3365  C C    . GLY A 1 22 ? 1.104   -10.363 3.396   1.00 0.00 ? 30  GLY A C    3  
ATOM 3366  O O    . GLY A 1 22 ? 2.237   -10.325 3.875   1.00 0.00 ? 30  GLY A O    3  
ATOM 3367  H H    . GLY A 1 22 ? 1.885   -7.583  2.604   1.00 0.00 ? 30  GLY A H    3  
ATOM 3368  H HA2  . GLY A 1 22 ? -0.542  -9.018  3.363   1.00 0.00 ? 30  GLY A HA2  3  
ATOM 3369  H HA3  . GLY A 1 22 ? 0.309   -9.157  1.834   1.00 0.00 ? 30  GLY A HA3  3  
ATOM 3370  N N    . PRO A 1 23 ? 0.418   -11.516 3.287   1.00 0.00 ? 31  PRO A N    3  
ATOM 3371  C CA   . PRO A 1 23 ? 0.961   -12.806 3.728   1.00 0.00 ? 31  PRO A CA   3  
ATOM 3372  C C    . PRO A 1 23 ? 2.139   -13.268 2.873   1.00 0.00 ? 31  PRO A C    3  
ATOM 3373  O O    . PRO A 1 23 ? 2.708   -12.489 2.109   1.00 0.00 ? 31  PRO A O    3  
ATOM 3374  C CB   . PRO A 1 23 ? -0.224  -13.765 3.568   1.00 0.00 ? 31  PRO A CB   3  
ATOM 3375  C CG   . PRO A 1 23 ? -1.092  -13.131 2.539   1.00 0.00 ? 31  PRO A CG   3  
ATOM 3376  C CD   . PRO A 1 23 ? -0.940  -11.648 2.730   1.00 0.00 ? 31  PRO A CD   3  
ATOM 3377  H HA   . PRO A 1 23 ? 1.263   -12.774 4.763   1.00 0.00 ? 31  PRO A HA   3  
ATOM 3378  H HB2  . PRO A 1 23 ? 0.133   -14.732 3.244   1.00 0.00 ? 31  PRO A HB2  3  
ATOM 3379  H HB3  . PRO A 1 23 ? -0.740  -13.864 4.512   1.00 0.00 ? 31  PRO A HB3  3  
ATOM 3380  H HG2  . PRO A 1 23 ? -0.760  -13.417 1.551   1.00 0.00 ? 31  PRO A HG2  3  
ATOM 3381  H HG3  . PRO A 1 23 ? -2.118  -13.425 2.692   1.00 0.00 ? 31  PRO A HG3  3  
ATOM 3382  H HD2  . PRO A 1 23 ? -1.021  -11.134 1.784   1.00 0.00 ? 31  PRO A HD2  3  
ATOM 3383  H HD3  . PRO A 1 23 ? -1.679  -11.281 3.427   1.00 0.00 ? 31  PRO A HD3  3  
ATOM 3384  N N    . ILE A 1 24 ? 2.496   -14.540 3.011   1.00 0.00 ? 32  ILE A N    3  
ATOM 3385  C CA   . ILE A 1 24 ? 3.606   -15.113 2.256   1.00 0.00 ? 32  ILE A CA   3  
ATOM 3386  C C    . ILE A 1 24 ? 3.173   -15.502 0.844   1.00 0.00 ? 32  ILE A C    3  
ATOM 3387  O O    . ILE A 1 24 ? 3.994   -15.558 -0.072  1.00 0.00 ? 32  ILE A O    3  
ATOM 3388  C CB   . ILE A 1 24 ? 4.183   -16.352 2.966   1.00 0.00 ? 32  ILE A CB   3  
ATOM 3389  C CG1  . ILE A 1 24 ? 4.517   -16.027 4.424   1.00 0.00 ? 32  ILE A CG1  3  
ATOM 3390  C CG2  . ILE A 1 24 ? 5.420   -16.857 2.235   1.00 0.00 ? 32  ILE A CG2  3  
ATOM 3391  C CD1  . ILE A 1 24 ? 4.121   -17.119 5.392   1.00 0.00 ? 32  ILE A CD1  3  
ATOM 3392  H H    . ILE A 1 24 ? 2.003   -15.110 3.636   1.00 0.00 ? 32  ILE A H    3  
ATOM 3393  H HA   . ILE A 1 24 ? 4.384   -14.365 2.189   1.00 0.00 ? 32  ILE A HA   3  
ATOM 3394  H HB   . ILE A 1 24 ? 3.439   -17.133 2.940   1.00 0.00 ? 32  ILE A HB   3  
ATOM 3395  H HG12 . ILE A 1 24 ? 5.581   -15.869 4.517   1.00 0.00 ? 32  ILE A HG12 3  
ATOM 3396  H HG13 . ILE A 1 24 ? 3.997   -15.123 4.711   1.00 0.00 ? 32  ILE A HG13 3  
ATOM 3397  H HG21 . ILE A 1 24 ? 6.027   -17.439 2.912   1.00 0.00 ? 32  ILE A HG21 3  
ATOM 3398  H HG22 . ILE A 1 24 ? 5.992   -16.015 1.872   1.00 0.00 ? 32  ILE A HG22 3  
ATOM 3399  H HG23 . ILE A 1 24 ? 5.118   -17.473 1.401   1.00 0.00 ? 32  ILE A HG23 3  
ATOM 3400  H HD11 . ILE A 1 24 ? 3.850   -16.679 6.340   1.00 0.00 ? 32  ILE A HD11 3  
ATOM 3401  H HD12 . ILE A 1 24 ? 4.954   -17.793 5.533   1.00 0.00 ? 32  ILE A HD12 3  
ATOM 3402  H HD13 . ILE A 1 24 ? 3.279   -17.666 4.994   1.00 0.00 ? 32  ILE A HD13 3  
ATOM 3403  N N    . GLN A 1 25 ? 1.884   -15.774 0.677   1.00 0.00 ? 33  GLN A N    3  
ATOM 3404  C CA   . GLN A 1 25 ? 1.348   -16.160 -0.624  1.00 0.00 ? 33  GLN A CA   3  
ATOM 3405  C C    . GLN A 1 25 ? 1.190   -14.946 -1.542  1.00 0.00 ? 33  GLN A C    3  
ATOM 3406  O O    . GLN A 1 25 ? 0.846   -15.089 -2.716  1.00 0.00 ? 33  GLN A O    3  
ATOM 3407  C CB   . GLN A 1 25 ? 0.002   -16.863 -0.454  1.00 0.00 ? 33  GLN A CB   3  
ATOM 3408  C CG   . GLN A 1 25 ? 0.117   -18.253 0.151   1.00 0.00 ? 33  GLN A CG   3  
ATOM 3409  C CD   . GLN A 1 25 ? 0.173   -18.228 1.667   1.00 0.00 ? 33  GLN A CD   3  
ATOM 3410  O OE1  . GLN A 1 25 ? 1.223   -18.459 2.265   1.00 0.00 ? 33  GLN A OE1  3  
ATOM 3411  N NE2  . GLN A 1 25 ? -0.964  -17.947 2.295   1.00 0.00 ? 33  GLN A NE2  3  
ATOM 3412  H H    . GLN A 1 25 ? 1.277   -15.715 1.444   1.00 0.00 ? 33  GLN A H    3  
ATOM 3413  H HA   . GLN A 1 25 ? 2.046   -16.847 -1.077  1.00 0.00 ? 33  GLN A HA   3  
ATOM 3414  H HB2  . GLN A 1 25 ? -0.626  -16.265 0.190   1.00 0.00 ? 33  GLN A HB2  3  
ATOM 3415  H HB3  . GLN A 1 25 ? -0.470  -16.953 -1.421  1.00 0.00 ? 33  GLN A HB3  3  
ATOM 3416  H HG2  . GLN A 1 25 ? -0.740  -18.837 -0.152  1.00 0.00 ? 33  GLN A HG2  3  
ATOM 3417  H HG3  . GLN A 1 25 ? 1.018   -18.719 -0.219  1.00 0.00 ? 33  GLN A HG3  3  
ATOM 3418  H HE21 . GLN A 1 25 ? -1.761  -17.775 1.754   1.00 0.00 ? 33  GLN A HE21 3  
ATOM 3419  H HE22 . GLN A 1 25 ? -0.956  -17.923 3.275   1.00 0.00 ? 33  GLN A HE22 3  
ATOM 3420  N N    . LYS A 1 26 ? 1.442   -13.755 -1.005  1.00 0.00 ? 34  LYS A N    3  
ATOM 3421  C CA   . LYS A 1 26 ? 1.325   -12.528 -1.782  1.00 0.00 ? 34  LYS A CA   3  
ATOM 3422  C C    . LYS A 1 26 ? 1.879   -11.337 -1.001  1.00 0.00 ? 34  LYS A C    3  
ATOM 3423  O O    . LYS A 1 26 ? 1.164   -10.372 -0.730  1.00 0.00 ? 34  LYS A O    3  
ATOM 3424  C CB   . LYS A 1 26 ? -0.138  -12.276 -2.158  1.00 0.00 ? 34  LYS A CB   3  
ATOM 3425  C CG   . LYS A 1 26 ? -0.318  -11.695 -3.551  1.00 0.00 ? 34  LYS A CG   3  
ATOM 3426  C CD   . LYS A 1 26 ? -1.791  -11.542 -3.901  1.00 0.00 ? 34  LYS A CD   3  
ATOM 3427  C CE   . LYS A 1 26 ? -1.976  -11.076 -5.337  1.00 0.00 ? 34  LYS A CE   3  
ATOM 3428  N NZ   . LYS A 1 26 ? -3.094  -11.791 -6.013  1.00 0.00 ? 34  LYS A NZ   3  
ATOM 3429  H H    . LYS A 1 26 ? 1.711   -13.700 -0.066  1.00 0.00 ? 34  LYS A H    3  
ATOM 3430  H HA   . LYS A 1 26 ? 1.904   -12.651 -2.686  1.00 0.00 ? 34  LYS A HA   3  
ATOM 3431  H HB2  . LYS A 1 26 ? -0.675  -13.212 -2.108  1.00 0.00 ? 34  LYS A HB2  3  
ATOM 3432  H HB3  . LYS A 1 26 ? -0.566  -11.588 -1.446  1.00 0.00 ? 34  LYS A HB3  3  
ATOM 3433  H HG2  . LYS A 1 26 ? 0.153   -10.725 -3.589  1.00 0.00 ? 34  LYS A HG2  3  
ATOM 3434  H HG3  . LYS A 1 26 ? 0.147   -12.353 -4.268  1.00 0.00 ? 34  LYS A HG3  3  
ATOM 3435  H HD2  . LYS A 1 26 ? -2.280  -12.496 -3.778  1.00 0.00 ? 34  LYS A HD2  3  
ATOM 3436  H HD3  . LYS A 1 26 ? -2.236  -10.818 -3.235  1.00 0.00 ? 34  LYS A HD3  3  
ATOM 3437  H HE2  . LYS A 1 26 ? -2.189  -10.017 -5.333  1.00 0.00 ? 34  LYS A HE2  3  
ATOM 3438  H HE3  . LYS A 1 26 ? -1.062  -11.255 -5.882  1.00 0.00 ? 34  LYS A HE3  3  
ATOM 3439  H HZ1  . LYS A 1 26 ? -3.253  -12.714 -5.560  1.00 0.00 ? 34  LYS A HZ1  3  
ATOM 3440  H HZ2  . LYS A 1 26 ? -2.866  -11.944 -7.015  1.00 0.00 ? 34  LYS A HZ2  3  
ATOM 3441  H HZ3  . LYS A 1 26 ? -3.968  -11.230 -5.949  1.00 0.00 ? 34  LYS A HZ3  3  
ATOM 3442  N N    . PRO A 1 27 ? 3.169   -11.393 -0.624  1.00 0.00 ? 35  PRO A N    3  
ATOM 3443  C CA   . PRO A 1 27 ? 3.819   -10.317 0.133   1.00 0.00 ? 35  PRO A CA   3  
ATOM 3444  C C    . PRO A 1 27 ? 4.004   -9.053  -0.700  1.00 0.00 ? 35  PRO A C    3  
ATOM 3445  O O    . PRO A 1 27 ? 4.261   -9.121  -1.901  1.00 0.00 ? 35  PRO A O    3  
ATOM 3446  C CB   . PRO A 1 27 ? 5.176   -10.914 0.507   1.00 0.00 ? 35  PRO A CB   3  
ATOM 3447  C CG   . PRO A 1 27 ? 5.437   -11.946 -0.536  1.00 0.00 ? 35  PRO A CG   3  
ATOM 3448  C CD   . PRO A 1 27 ? 4.092   -12.508 -0.903  1.00 0.00 ? 35  PRO A CD   3  
ATOM 3449  H HA   . PRO A 1 27 ? 3.268   -10.077 1.030   1.00 0.00 ? 35  PRO A HA   3  
ATOM 3450  H HB2  . PRO A 1 27 ? 5.929   -10.140 0.495   1.00 0.00 ? 35  PRO A HB2  3  
ATOM 3451  H HB3  . PRO A 1 27 ? 5.121   -11.354 1.491   1.00 0.00 ? 35  PRO A HB3  3  
ATOM 3452  H HG2  . PRO A 1 27 ? 5.901   -11.487 -1.396  1.00 0.00 ? 35  PRO A HG2  3  
ATOM 3453  H HG3  . PRO A 1 27 ? 6.071   -12.722 -0.134  1.00 0.00 ? 35  PRO A HG3  3  
ATOM 3454  H HD2  . PRO A 1 27 ? 4.068   -12.775 -1.949  1.00 0.00 ? 35  PRO A HD2  3  
ATOM 3455  H HD3  . PRO A 1 27 ? 3.859   -13.363 -0.289  1.00 0.00 ? 35  PRO A HD3  3  
ATOM 3456  N N    . GLY A 1 28 ? 3.872   -7.901  -0.050  1.00 0.00 ? 36  GLY A N    3  
ATOM 3457  C CA   . GLY A 1 28 ? 4.028   -6.636  -0.744  1.00 0.00 ? 36  GLY A CA   3  
ATOM 3458  C C    . GLY A 1 28 ? 3.451   -5.475  0.041   1.00 0.00 ? 36  GLY A C    3  
ATOM 3459  O O    . GLY A 1 28 ? 2.842   -5.673  1.092   1.00 0.00 ? 36  GLY A O    3  
ATOM 3460  H H    . GLY A 1 28 ? 3.666   -7.908  0.908   1.00 0.00 ? 36  GLY A H    3  
ATOM 3461  H HA2  . GLY A 1 28 ? 5.080   -6.456  -0.912  1.00 0.00 ? 36  GLY A HA2  3  
ATOM 3462  H HA3  . GLY A 1 28 ? 3.526   -6.695  -1.698  1.00 0.00 ? 36  GLY A HA3  3  
ATOM 3463  N N    . ILE A 1 29 ? 3.642   -4.264  -0.468  1.00 0.00 ? 37  ILE A N    3  
ATOM 3464  C CA   . ILE A 1 29 ? 3.133   -3.070  0.196   1.00 0.00 ? 37  ILE A CA   3  
ATOM 3465  C C    . ILE A 1 29 ? 1.722   -2.745  -0.277  1.00 0.00 ? 37  ILE A C    3  
ATOM 3466  O O    . ILE A 1 29 ? 1.507   -2.407  -1.441  1.00 0.00 ? 37  ILE A O    3  
ATOM 3467  C CB   . ILE A 1 29 ? 4.044   -1.851  -0.048  1.00 0.00 ? 37  ILE A CB   3  
ATOM 3468  C CG1  . ILE A 1 29 ? 5.516   -2.255  0.070   1.00 0.00 ? 37  ILE A CG1  3  
ATOM 3469  C CG2  . ILE A 1 29 ? 3.715   -0.740  0.936   1.00 0.00 ? 37  ILE A CG2  3  
ATOM 3470  C CD1  . ILE A 1 29 ? 5.862   -2.894  1.398   1.00 0.00 ? 37  ILE A CD1  3  
ATOM 3471  H H    . ILE A 1 29 ? 4.135   -4.170  -1.310  1.00 0.00 ? 37  ILE A H    3  
ATOM 3472  H HA   . ILE A 1 29 ? 3.109   -3.267  1.259   1.00 0.00 ? 37  ILE A HA   3  
ATOM 3473  H HB   . ILE A 1 29 ? 3.857   -1.485  -1.046  1.00 0.00 ? 37  ILE A HB   3  
ATOM 3474  H HG12 . ILE A 1 29 ? 5.753   -2.962  -0.710  1.00 0.00 ? 37  ILE A HG12 3  
ATOM 3475  H HG13 . ILE A 1 29 ? 6.134   -1.376  -0.048  1.00 0.00 ? 37  ILE A HG13 3  
ATOM 3476  H HG21 . ILE A 1 29 ? 2.700   -0.857  1.285   1.00 0.00 ? 37  ILE A HG21 3  
ATOM 3477  H HG22 . ILE A 1 29 ? 3.821   0.218   0.447   1.00 0.00 ? 37  ILE A HG22 3  
ATOM 3478  H HG23 . ILE A 1 29 ? 4.393   -0.791  1.776   1.00 0.00 ? 37  ILE A HG23 3  
ATOM 3479  H HD11 . ILE A 1 29 ? 5.811   -2.151  2.180   1.00 0.00 ? 37  ILE A HD11 3  
ATOM 3480  H HD12 . ILE A 1 29 ? 6.863   -3.300  1.353   1.00 0.00 ? 37  ILE A HD12 3  
ATOM 3481  H HD13 . ILE A 1 29 ? 5.161   -3.687  1.608   1.00 0.00 ? 37  ILE A HD13 3  
ATOM 3482  N N    . PHE A 1 30 ? 0.762   -2.855  0.635   1.00 0.00 ? 38  PHE A N    3  
ATOM 3483  C CA   . PHE A 1 30 ? -0.632  -2.578  0.317   1.00 0.00 ? 38  PHE A CA   3  
ATOM 3484  C C    . PHE A 1 30 ? -1.047  -1.206  0.829   1.00 0.00 ? 38  PHE A C    3  
ATOM 3485  O O    . PHE A 1 30 ? -0.291  -0.543  1.539   1.00 0.00 ? 38  PHE A O    3  
ATOM 3486  C CB   . PHE A 1 30 ? -1.535  -3.660  0.915   1.00 0.00 ? 38  PHE A CB   3  
ATOM 3487  C CG   . PHE A 1 30 ? -1.167  -5.051  0.478   1.00 0.00 ? 38  PHE A CG   3  
ATOM 3488  C CD1  . PHE A 1 30 ? 0.049   -5.607  0.842   1.00 0.00 ? 38  PHE A CD1  3  
ATOM 3489  C CD2  . PHE A 1 30 ? -2.038  -5.800  -0.296  1.00 0.00 ? 38  PHE A CD2  3  
ATOM 3490  C CE1  . PHE A 1 30 ? 0.391   -6.883  0.439   1.00 0.00 ? 38  PHE A CE1  3  
ATOM 3491  C CE2  . PHE A 1 30 ? -1.701  -7.078  -0.701  1.00 0.00 ? 38  PHE A CE2  3  
ATOM 3492  C CZ   . PHE A 1 30 ? -0.485  -7.620  -0.332  1.00 0.00 ? 38  PHE A CZ   3  
ATOM 3493  H H    . PHE A 1 30 ? 0.998   -3.131  1.545   1.00 0.00 ? 38  PHE A H    3  
ATOM 3494  H HA   . PHE A 1 30 ? -0.736  -2.591  -0.758  1.00 0.00 ? 38  PHE A HA   3  
ATOM 3495  H HB2  . PHE A 1 30 ? -1.467  -3.620  1.991   1.00 0.00 ? 38  PHE A HB2  3  
ATOM 3496  H HB3  . PHE A 1 30 ? -2.555  -3.474  0.615   1.00 0.00 ? 38  PHE A HB3  3  
ATOM 3497  H HD1  . PHE A 1 30 ? 0.735   -5.034  1.447   1.00 0.00 ? 38  PHE A HD1  3  
ATOM 3498  H HD2  . PHE A 1 30 ? -2.988  -5.376  -0.586  1.00 0.00 ? 38  PHE A HD2  3  
ATOM 3499  H HE1  . PHE A 1 30 ? 1.342   -7.305  0.728   1.00 0.00 ? 38  PHE A HE1  3  
ATOM 3500  H HE2  . PHE A 1 30 ? -2.387  -7.652  -1.303  1.00 0.00 ? 38  PHE A HE2  3  
ATOM 3501  H HZ   . PHE A 1 30 ? -0.221  -8.617  -0.648  1.00 0.00 ? 38  PHE A HZ   3  
ATOM 3502  N N    . ILE A 1 31 ? -2.253  -0.783  0.461   1.00 0.00 ? 39  ILE A N    3  
ATOM 3503  C CA   . ILE A 1 31 ? -2.767  0.514   0.876   1.00 0.00 ? 39  ILE A CA   3  
ATOM 3504  C C    . ILE A 1 31 ? -3.892  0.362   1.898   1.00 0.00 ? 39  ILE A C    3  
ATOM 3505  O O    . ILE A 1 31 ? -4.781  -0.476  1.744   1.00 0.00 ? 39  ILE A O    3  
ATOM 3506  C CB   . ILE A 1 31 ? -3.276  1.325   -0.336  1.00 0.00 ? 39  ILE A CB   3  
ATOM 3507  C CG1  . ILE A 1 31 ? -2.103  1.729   -1.231  1.00 0.00 ? 39  ILE A CG1  3  
ATOM 3508  C CG2  . ILE A 1 31 ? -4.049  2.555   0.119   1.00 0.00 ? 39  ILE A CG2  3  
ATOM 3509  C CD1  . ILE A 1 31 ? -1.196  2.769   -0.608  1.00 0.00 ? 39  ILE A CD1  3  
ATOM 3510  H H    . ILE A 1 31 ? -2.805  -1.357  -0.109  1.00 0.00 ? 39  ILE A H    3  
ATOM 3511  H HA   . ILE A 1 31 ? -1.954  1.064   1.333   1.00 0.00 ? 39  ILE A HA   3  
ATOM 3512  H HB   . ILE A 1 31 ? -3.950  0.697   -0.901  1.00 0.00 ? 39  ILE A HB   3  
ATOM 3513  H HG12 . ILE A 1 31 ? -1.506  0.856   -1.448  1.00 0.00 ? 39  ILE A HG12 3  
ATOM 3514  H HG13 . ILE A 1 31 ? -2.488  2.134   -2.155  1.00 0.00 ? 39  ILE A HG13 3  
ATOM 3515  H HG21 . ILE A 1 31 ? -3.843  3.379   -0.550  1.00 0.00 ? 39  ILE A HG21 3  
ATOM 3516  H HG22 . ILE A 1 31 ? -3.745  2.822   1.120   1.00 0.00 ? 39  ILE A HG22 3  
ATOM 3517  H HG23 . ILE A 1 31 ? -5.108  2.340   0.109   1.00 0.00 ? 39  ILE A HG23 3  
ATOM 3518  H HD11 . ILE A 1 31 ? -1.310  2.749   0.467   1.00 0.00 ? 39  ILE A HD11 3  
ATOM 3519  H HD12 . ILE A 1 31 ? -1.462  3.747   -0.979  1.00 0.00 ? 39  ILE A HD12 3  
ATOM 3520  H HD13 . ILE A 1 31 ? -0.171  2.551   -0.865  1.00 0.00 ? 39  ILE A HD13 3  
ATOM 3521  N N    . SER A 1 32 ? -3.842  1.188   2.937   1.00 0.00 ? 40  SER A N    3  
ATOM 3522  C CA   . SER A 1 32 ? -4.848  1.171   3.990   1.00 0.00 ? 40  SER A CA   3  
ATOM 3523  C C    . SER A 1 32 ? -5.770  2.379   3.863   1.00 0.00 ? 40  SER A C    3  
ATOM 3524  O O    . SER A 1 32 ? -5.735  3.094   2.862   1.00 0.00 ? 40  SER A O    3  
ATOM 3525  C CB   . SER A 1 32 ? -4.177  1.160   5.366   1.00 0.00 ? 40  SER A CB   3  
ATOM 3526  O OG   . SER A 1 32 ? -4.408  -0.068  6.036   1.00 0.00 ? 40  SER A OG   3  
ATOM 3527  H H    . SER A 1 32 ? -3.110  1.833   2.992   1.00 0.00 ? 40  SER A H    3  
ATOM 3528  H HA   . SER A 1 32 ? -5.434  0.271   3.875   1.00 0.00 ? 40  SER A HA   3  
ATOM 3529  H HB2  . SER A 1 32 ? -3.113  1.294   5.246   1.00 0.00 ? 40  SER A HB2  3  
ATOM 3530  H HB3  . SER A 1 32 ? -4.577  1.964   5.967   1.00 0.00 ? 40  SER A HB3  3  
ATOM 3531  H HG   . SER A 1 32 ? -5.271  -0.047  6.455   1.00 0.00 ? 40  SER A HG   3  
ATOM 3532  N N    . HIS A 1 33 ? -6.592  2.602   4.885   1.00 0.00 ? 41  HIS A N    3  
ATOM 3533  C CA   . HIS A 1 33 ? -7.526  3.727   4.890   1.00 0.00 ? 41  HIS A CA   3  
ATOM 3534  C C    . HIS A 1 33 ? -6.846  5.012   4.421   1.00 0.00 ? 41  HIS A C    3  
ATOM 3535  O O    . HIS A 1 33 ? -5.661  5.228   4.677   1.00 0.00 ? 41  HIS A O    3  
ATOM 3536  C CB   . HIS A 1 33 ? -8.106  3.929   6.290   1.00 0.00 ? 41  HIS A CB   3  
ATOM 3537  C CG   . HIS A 1 33 ? -9.052  2.846   6.706   1.00 0.00 ? 41  HIS A CG   3  
ATOM 3538  N ND1  . HIS A 1 33 ? -8.803  1.992   7.761   1.00 0.00 ? 41  HIS A ND1  3  
ATOM 3539  C CD2  . HIS A 1 33 ? -10.256 2.478   6.204   1.00 0.00 ? 41  HIS A CD2  3  
ATOM 3540  C CE1  . HIS A 1 33 ? -9.812  1.148   7.889   1.00 0.00 ? 41  HIS A CE1  3  
ATOM 3541  N NE2  . HIS A 1 33 ? -10.705 1.422   6.957   1.00 0.00 ? 41  HIS A NE2  3  
ATOM 3542  H H    . HIS A 1 33 ? -6.571  1.998   5.654   1.00 0.00 ? 41  HIS A H    3  
ATOM 3543  H HA   . HIS A 1 33 ? -8.330  3.492   4.209   1.00 0.00 ? 41  HIS A HA   3  
ATOM 3544  H HB2  . HIS A 1 33 ? -7.298  3.955   7.006   1.00 0.00 ? 41  HIS A HB2  3  
ATOM 3545  H HB3  . HIS A 1 33 ? -8.639  4.867   6.321   1.00 0.00 ? 41  HIS A HB3  3  
ATOM 3546  H HD1  . HIS A 1 33 ? -8.007  2.004   8.332   1.00 0.00 ? 41  HIS A HD1  3  
ATOM 3547  H HD2  . HIS A 1 33 ? -10.766 2.932   5.367   1.00 0.00 ? 41  HIS A HD2  3  
ATOM 3548  H HE1  . HIS A 1 33 ? -9.891  0.367   8.630   1.00 0.00 ? 41  HIS A HE1  3  
ATOM 3549  H HE2  . HIS A 1 33 ? -11.518 0.902   6.781   1.00 0.00 ? 41  HIS A HE2  3  
ATOM 3550  N N    . VAL A 1 34 ? -7.602  5.857   3.728   1.00 0.00 ? 42  VAL A N    3  
ATOM 3551  C CA   . VAL A 1 34 ? -7.071  7.118   3.220   1.00 0.00 ? 42  VAL A CA   3  
ATOM 3552  C C    . VAL A 1 34 ? -7.733  8.308   3.907   1.00 0.00 ? 42  VAL A C    3  
ATOM 3553  O O    . VAL A 1 34 ? -8.883  8.226   4.341   1.00 0.00 ? 42  VAL A O    3  
ATOM 3554  C CB   . VAL A 1 34 ? -7.271  7.245   1.695   1.00 0.00 ? 42  VAL A CB   3  
ATOM 3555  C CG1  . VAL A 1 34 ? -6.274  8.233   1.110   1.00 0.00 ? 42  VAL A CG1  3  
ATOM 3556  C CG2  . VAL A 1 34 ? -7.145  5.887   1.017   1.00 0.00 ? 42  VAL A CG2  3  
ATOM 3557  H H    . VAL A 1 34 ? -8.538  5.628   3.553   1.00 0.00 ? 42  VAL A H    3  
ATOM 3558  H HA   . VAL A 1 34 ? -6.011  7.140   3.426   1.00 0.00 ? 42  VAL A HA   3  
ATOM 3559  H HB   . VAL A 1 34 ? -8.266  7.624   1.513   1.00 0.00 ? 42  VAL A HB   3  
ATOM 3560  H HG11 . VAL A 1 34 ? -6.525  8.432   0.079   1.00 0.00 ? 42  VAL A HG11 3  
ATOM 3561  H HG12 . VAL A 1 34 ? -5.278  7.817   1.163   1.00 0.00 ? 42  VAL A HG12 3  
ATOM 3562  H HG13 . VAL A 1 34 ? -6.308  9.155   1.671   1.00 0.00 ? 42  VAL A HG13 3  
ATOM 3563  H HG21 . VAL A 1 34 ? -6.634  5.201   1.676   1.00 0.00 ? 42  VAL A HG21 3  
ATOM 3564  H HG22 . VAL A 1 34 ? -6.582  5.991   0.101   1.00 0.00 ? 42  VAL A HG22 3  
ATOM 3565  H HG23 . VAL A 1 34 ? -8.129  5.504   0.793   1.00 0.00 ? 42  VAL A HG23 3  
ATOM 3566  N N    . LYS A 1 35 ? -7.000  9.413   4.004   1.00 0.00 ? 43  LYS A N    3  
ATOM 3567  C CA   . LYS A 1 35 ? -7.516  10.618  4.640   1.00 0.00 ? 43  LYS A CA   3  
ATOM 3568  C C    . LYS A 1 35 ? -7.869  11.677  3.595   1.00 0.00 ? 43  LYS A C    3  
ATOM 3569  O O    . LYS A 1 35 ? -7.024  12.066  2.789   1.00 0.00 ? 43  LYS A O    3  
ATOM 3570  C CB   . LYS A 1 35 ? -6.487  11.185  5.621   1.00 0.00 ? 43  LYS A CB   3  
ATOM 3571  C CG   . LYS A 1 35 ? -5.843  10.131  6.507   1.00 0.00 ? 43  LYS A CG   3  
ATOM 3572  C CD   . LYS A 1 35 ? -4.532  10.624  7.095   1.00 0.00 ? 43  LYS A CD   3  
ATOM 3573  C CE   . LYS A 1 35 ? -4.137  9.825   8.326   1.00 0.00 ? 43  LYS A CE   3  
ATOM 3574  N NZ   . LYS A 1 35 ? -4.963  10.185  9.511   1.00 0.00 ? 43  LYS A NZ   3  
ATOM 3575  H H    . LYS A 1 35 ? -6.090  9.416   3.640   1.00 0.00 ? 43  LYS A H    3  
ATOM 3576  H HA   . LYS A 1 35 ? -8.408  10.350  5.183   1.00 0.00 ? 43  LYS A HA   3  
ATOM 3577  H HB2  . LYS A 1 35 ? -5.707  11.678  5.061   1.00 0.00 ? 43  LYS A HB2  3  
ATOM 3578  H HB3  . LYS A 1 35 ? -6.974  11.909  6.256   1.00 0.00 ? 43  LYS A HB3  3  
ATOM 3579  H HG2  . LYS A 1 35 ? -6.520  9.890   7.313   1.00 0.00 ? 43  LYS A HG2  3  
ATOM 3580  H HG3  . LYS A 1 35 ? -5.653  9.246   5.917   1.00 0.00 ? 43  LYS A HG3  3  
ATOM 3581  H HD2  . LYS A 1 35 ? -3.756  10.528  6.352   1.00 0.00 ? 43  LYS A HD2  3  
ATOM 3582  H HD3  . LYS A 1 35 ? -4.642  11.664  7.372   1.00 0.00 ? 43  LYS A HD3  3  
ATOM 3583  H HE2  . LYS A 1 35 ? -4.268  8.774   8.115   1.00 0.00 ? 43  LYS A HE2  3  
ATOM 3584  H HE3  . LYS A 1 35 ? -3.099  10.021  8.550   1.00 0.00 ? 43  LYS A HE3  3  
ATOM 3585  H HZ1  . LYS A 1 35 ? -4.468  10.892  10.091  1.00 0.00 ? 43  LYS A HZ1  3  
ATOM 3586  H HZ2  . LYS A 1 35 ? -5.144  9.343   10.093  1.00 0.00 ? 43  LYS A HZ2  3  
ATOM 3587  H HZ3  . LYS A 1 35 ? -5.876  10.581  9.205   1.00 0.00 ? 43  LYS A HZ3  3  
ATOM 3588  N N    . PRO A 1 36 ? -9.125  12.164  3.593   1.00 0.00 ? 44  PRO A N    3  
ATOM 3589  C CA   . PRO A 1 36 ? -9.570  13.184  2.638   1.00 0.00 ? 44  PRO A CA   3  
ATOM 3590  C C    . PRO A 1 36 ? -8.679  14.422  2.662   1.00 0.00 ? 44  PRO A C    3  
ATOM 3591  O O    . PRO A 1 36 ? -7.963  14.663  3.634   1.00 0.00 ? 44  PRO A O    3  
ATOM 3592  C CB   . PRO A 1 36 ? -10.983 13.532  3.113   1.00 0.00 ? 44  PRO A CB   3  
ATOM 3593  C CG   . PRO A 1 36 ? -11.436 12.334  3.873   1.00 0.00 ? 44  PRO A CG   3  
ATOM 3594  C CD   . PRO A 1 36 ? -10.203 11.764  4.516   1.00 0.00 ? 44  PRO A CD   3  
ATOM 3595  H HA   . PRO A 1 36 ? -9.612  12.792  1.632   1.00 0.00 ? 44  PRO A HA   3  
ATOM 3596  H HB2  . PRO A 1 36 ? -10.948 14.411  3.743   1.00 0.00 ? 44  PRO A HB2  3  
ATOM 3597  H HB3  . PRO A 1 36 ? -11.617 13.722  2.260   1.00 0.00 ? 44  PRO A HB3  3  
ATOM 3598  H HG2  . PRO A 1 36 ? -12.152 12.627  4.627   1.00 0.00 ? 44  PRO A HG2  3  
ATOM 3599  H HG3  . PRO A 1 36 ? -11.874 11.614  3.198   1.00 0.00 ? 44  PRO A HG3  3  
ATOM 3600  H HD2  . PRO A 1 36 ? -10.054 12.196  5.495   1.00 0.00 ? 44  PRO A HD2  3  
ATOM 3601  H HD3  . PRO A 1 36 ? -10.275 10.688  4.582   1.00 0.00 ? 44  PRO A HD3  3  
ATOM 3602  N N    . GLY A 1 37 ? -8.727  15.203  1.589   1.00 0.00 ? 45  GLY A N    3  
ATOM 3603  C CA   . GLY A 1 37 ? -7.919  16.405  1.509   1.00 0.00 ? 45  GLY A CA   3  
ATOM 3604  C C    . GLY A 1 37 ? -6.437  16.119  1.656   1.00 0.00 ? 45  GLY A C    3  
ATOM 3605  O O    . GLY A 1 37 ? -5.750  16.753  2.456   1.00 0.00 ? 45  GLY A O    3  
ATOM 3606  H H    . GLY A 1 37 ? -9.316  14.961  0.843   1.00 0.00 ? 45  GLY A H    3  
ATOM 3607  H HA2  . GLY A 1 37 ? -8.089  16.880  0.554   1.00 0.00 ? 45  GLY A HA2  3  
ATOM 3608  H HA3  . GLY A 1 37 ? -8.222  17.083  2.293   1.00 0.00 ? 45  GLY A HA3  3  
ATOM 3609  N N    . SER A 1 38 ? -5.944  15.158  0.882   1.00 0.00 ? 46  SER A N    3  
ATOM 3610  C CA   . SER A 1 38 ? -4.536  14.783  0.928   1.00 0.00 ? 46  SER A CA   3  
ATOM 3611  C C    . SER A 1 38 ? -4.007  14.482  -0.470  1.00 0.00 ? 46  SER A C    3  
ATOM 3612  O O    . SER A 1 38 ? -4.707  14.678  -1.463  1.00 0.00 ? 46  SER A O    3  
ATOM 3613  C CB   . SER A 1 38 ? -4.342  13.565  1.833   1.00 0.00 ? 46  SER A CB   3  
ATOM 3614  O OG   . SER A 1 38 ? -5.134  13.667  3.003   1.00 0.00 ? 46  SER A OG   3  
ATOM 3615  H H    . SER A 1 38 ? -6.544  14.686  0.265   1.00 0.00 ? 46  SER A H    3  
ATOM 3616  H HA   . SER A 1 38 ? -3.983  15.614  1.339   1.00 0.00 ? 46  SER A HA   3  
ATOM 3617  H HB2  . SER A 1 38 ? -4.628  12.673  1.296   1.00 0.00 ? 46  SER A HB2  3  
ATOM 3618  H HB3  . SER A 1 38 ? -3.304  13.495  2.120   1.00 0.00 ? 46  SER A HB3  3  
ATOM 3619  H HG   . SER A 1 38 ? -4.730  13.158  3.709   1.00 0.00 ? 46  SER A HG   3  
ATOM 3620  N N    . LEU A 1 39 ? -2.770  14.002  -0.541  1.00 0.00 ? 47  LEU A N    3  
ATOM 3621  C CA   . LEU A 1 39 ? -2.153  13.674  -1.821  1.00 0.00 ? 47  LEU A CA   3  
ATOM 3622  C C    . LEU A 1 39 ? -2.666  12.337  -2.343  1.00 0.00 ? 47  LEU A C    3  
ATOM 3623  O O    . LEU A 1 39 ? -2.955  12.194  -3.531  1.00 0.00 ? 47  LEU A O    3  
ATOM 3624  C CB   . LEU A 1 39 ? -0.631  13.634  -1.686  1.00 0.00 ? 47  LEU A CB   3  
ATOM 3625  C CG   . LEU A 1 39 ? 0.033   14.997  -1.479  1.00 0.00 ? 47  LEU A CG   3  
ATOM 3626  C CD1  . LEU A 1 39 ? 1.298   14.853  -0.651  1.00 0.00 ? 47  LEU A CD1  3  
ATOM 3627  C CD2  . LEU A 1 39 ? 0.339   15.647  -2.820  1.00 0.00 ? 47  LEU A CD2  3  
ATOM 3628  H H    . LEU A 1 39 ? -2.260  13.866  0.284   1.00 0.00 ? 47  LEU A H    3  
ATOM 3629  H HA   . LEU A 1 39 ? -2.423  14.447  -2.525  1.00 0.00 ? 47  LEU A HA   3  
ATOM 3630  H HB2  . LEU A 1 39 ? -0.381  13.001  -0.846  1.00 0.00 ? 47  LEU A HB2  3  
ATOM 3631  H HB3  . LEU A 1 39 ? -0.222  13.193  -2.583  1.00 0.00 ? 47  LEU A HB3  3  
ATOM 3632  H HG   . LEU A 1 39 ? -0.646  15.642  -0.941  1.00 0.00 ? 47  LEU A HG   3  
ATOM 3633  H HD11 . LEU A 1 39 ? 1.931   14.095  -1.088  1.00 0.00 ? 47  LEU A HD11 3  
ATOM 3634  H HD12 . LEU A 1 39 ? 1.038   14.568  0.358   1.00 0.00 ? 47  LEU A HD12 3  
ATOM 3635  H HD13 . LEU A 1 39 ? 1.825   15.796  -0.634  1.00 0.00 ? 47  LEU A HD13 3  
ATOM 3636  H HD21 . LEU A 1 39 ? 1.052   15.040  -3.360  1.00 0.00 ? 47  LEU A HD21 3  
ATOM 3637  H HD22 . LEU A 1 39 ? 0.756   16.632  -2.655  1.00 0.00 ? 47  LEU A HD22 3  
ATOM 3638  H HD23 . LEU A 1 39 ? -0.569  15.733  -3.395  1.00 0.00 ? 47  LEU A HD23 3  
ATOM 3639  N N    . SER A 1 40 ? -2.782  11.358  -1.449  1.00 0.00 ? 48  SER A N    3  
ATOM 3640  C CA   . SER A 1 40 ? -3.267  10.033  -1.826  1.00 0.00 ? 48  SER A CA   3  
ATOM 3641  C C    . SER A 1 40 ? -4.601  10.139  -2.560  1.00 0.00 ? 48  SER A C    3  
ATOM 3642  O O    . SER A 1 40 ? -4.841  9.436   -3.540  1.00 0.00 ? 48  SER A O    3  
ATOM 3643  C CB   . SER A 1 40 ? -3.426  9.153   -0.585  1.00 0.00 ? 48  SER A CB   3  
ATOM 3644  O OG   . SER A 1 40 ? -3.476  9.938   0.595   1.00 0.00 ? 48  SER A OG   3  
ATOM 3645  H H    . SER A 1 40 ? -2.537  11.531  -0.513  1.00 0.00 ? 48  SER A H    3  
ATOM 3646  H HA   . SER A 1 40 ? -2.539  9.587   -2.485  1.00 0.00 ? 48  SER A HA   3  
ATOM 3647  H HB2  . SER A 1 40 ? -4.342  8.586   -0.663  1.00 0.00 ? 48  SER A HB2  3  
ATOM 3648  H HB3  . SER A 1 40 ? -2.589  8.475   -0.516  1.00 0.00 ? 48  SER A HB3  3  
ATOM 3649  H HG   . SER A 1 40 ? -4.239  9.682   1.118   1.00 0.00 ? 48  SER A HG   3  
ATOM 3650  N N    . ALA A 1 41 ? -5.458  11.034  -2.082  1.00 0.00 ? 49  ALA A N    3  
ATOM 3651  C CA   . ALA A 1 41 ? -6.762  11.245  -2.693  1.00 0.00 ? 49  ALA A CA   3  
ATOM 3652  C C    . ALA A 1 41 ? -6.619  11.968  -4.025  1.00 0.00 ? 49  ALA A C    3  
ATOM 3653  O O    . ALA A 1 41 ? -7.343  11.686  -4.981  1.00 0.00 ? 49  ALA A O    3  
ATOM 3654  C CB   . ALA A 1 41 ? -7.659  12.040  -1.758  1.00 0.00 ? 49  ALA A CB   3  
ATOM 3655  H H    . ALA A 1 41 ? -5.205  11.570  -1.300  1.00 0.00 ? 49  ALA A H    3  
ATOM 3656  H HA   . ALA A 1 41 ? -7.217  10.280  -2.861  1.00 0.00 ? 49  ALA A HA   3  
ATOM 3657  H HB1  . ALA A 1 41 ? -7.616  13.087  -2.021  1.00 0.00 ? 49  ALA A HB1  3  
ATOM 3658  H HB2  . ALA A 1 41 ? -7.322  11.910  -0.740  1.00 0.00 ? 49  ALA A HB2  3  
ATOM 3659  H HB3  . ALA A 1 41 ? -8.676  11.688  -1.849  1.00 0.00 ? 49  ALA A HB3  3  
ATOM 3660  N N    . GLU A 1 42 ? -5.677  12.903  -4.077  1.00 0.00 ? 50  GLU A N    3  
ATOM 3661  C CA   . GLU A 1 42 ? -5.428  13.673  -5.288  1.00 0.00 ? 50  GLU A CA   3  
ATOM 3662  C C    . GLU A 1 42 ? -5.032  12.756  -6.442  1.00 0.00 ? 50  GLU A C    3  
ATOM 3663  O O    . GLU A 1 42 ? -5.415  12.985  -7.589  1.00 0.00 ? 50  GLU A O    3  
ATOM 3664  C CB   . GLU A 1 42 ? -4.326  14.706  -5.037  1.00 0.00 ? 50  GLU A CB   3  
ATOM 3665  C CG   . GLU A 1 42 ? -4.852  16.110  -4.792  1.00 0.00 ? 50  GLU A CG   3  
ATOM 3666  C CD   . GLU A 1 42 ? -4.685  17.014  -5.998  1.00 0.00 ? 50  GLU A CD   3  
ATOM 3667  O OE1  . GLU A 1 42 ? -5.159  16.640  -7.090  1.00 0.00 ? 50  GLU A OE1  3  
ATOM 3668  O OE2  . GLU A 1 42 ? -4.078  18.095  -5.848  1.00 0.00 ? 50  GLU A OE2  3  
ATOM 3669  H H    . GLU A 1 42 ? -5.135  13.078  -3.280  1.00 0.00 ? 50  GLU A H    3  
ATOM 3670  H HA   . GLU A 1 42 ? -6.340  14.188  -5.548  1.00 0.00 ? 50  GLU A HA   3  
ATOM 3671  H HB2  . GLU A 1 42 ? -3.755  14.401  -4.171  1.00 0.00 ? 50  GLU A HB2  3  
ATOM 3672  H HB3  . GLU A 1 42 ? -3.673  14.733  -5.894  1.00 0.00 ? 50  GLU A HB3  3  
ATOM 3673  H HG2  . GLU A 1 42 ? -5.903  16.050  -4.550  1.00 0.00 ? 50  GLU A HG2  3  
ATOM 3674  H HG3  . GLU A 1 42 ? -4.316  16.540  -3.960  1.00 0.00 ? 50  GLU A HG3  3  
ATOM 3675  N N    . VAL A 1 43 ? -4.267  11.716  -6.126  1.00 0.00 ? 51  VAL A N    3  
ATOM 3676  C CA   . VAL A 1 43 ? -3.821  10.763  -7.135  1.00 0.00 ? 51  VAL A CA   3  
ATOM 3677  C C    . VAL A 1 43 ? -4.892  9.713   -7.409  1.00 0.00 ? 51  VAL A C    3  
ATOM 3678  O O    . VAL A 1 43 ? -4.992  9.189   -8.519  1.00 0.00 ? 51  VAL A O    3  
ATOM 3679  C CB   . VAL A 1 43 ? -2.523  10.055  -6.704  1.00 0.00 ? 51  VAL A CB   3  
ATOM 3680  C CG1  . VAL A 1 43 ? -1.377  11.050  -6.606  1.00 0.00 ? 51  VAL A CG1  3  
ATOM 3681  C CG2  . VAL A 1 43 ? -2.721  9.328   -5.382  1.00 0.00 ? 51  VAL A CG2  3  
ATOM 3682  H H    . VAL A 1 43 ? -3.997  11.588  -5.194  1.00 0.00 ? 51  VAL A H    3  
ATOM 3683  H HA   . VAL A 1 43 ? -3.624  11.309  -8.047  1.00 0.00 ? 51  VAL A HA   3  
ATOM 3684  H HB   . VAL A 1 43 ? -2.269  9.322   -7.456  1.00 0.00 ? 51  VAL A HB   3  
ATOM 3685  H HG11 . VAL A 1 43 ? -1.612  11.799  -5.863  1.00 0.00 ? 51  VAL A HG11 3  
ATOM 3686  H HG12 . VAL A 1 43 ? -1.233  11.528  -7.565  1.00 0.00 ? 51  VAL A HG12 3  
ATOM 3687  H HG13 . VAL A 1 43 ? -0.473  10.533  -6.322  1.00 0.00 ? 51  VAL A HG13 3  
ATOM 3688  H HG21 . VAL A 1 43 ? -2.941  10.047  -4.605  1.00 0.00 ? 51  VAL A HG21 3  
ATOM 3689  H HG22 . VAL A 1 43 ? -1.820  8.790   -5.127  1.00 0.00 ? 51  VAL A HG22 3  
ATOM 3690  H HG23 . VAL A 1 43 ? -3.543  8.633   -5.471  1.00 0.00 ? 51  VAL A HG23 3  
ATOM 3691  N N    . GLY A 1 44 ? -5.690  9.409   -6.391  1.00 0.00 ? 52  GLY A N    3  
ATOM 3692  C CA   . GLY A 1 44 ? -6.742  8.422   -6.543  1.00 0.00 ? 52  GLY A CA   3  
ATOM 3693  C C    . GLY A 1 44 ? -6.409  7.109   -5.861  1.00 0.00 ? 52  GLY A C    3  
ATOM 3694  O O    . GLY A 1 44 ? -6.480  6.047   -6.478  1.00 0.00 ? 52  GLY A O    3  
ATOM 3695  H H    . GLY A 1 44 ? -5.563  9.858   -5.530  1.00 0.00 ? 52  GLY A H    3  
ATOM 3696  H HA2  . GLY A 1 44 ? -7.653  8.815   -6.117  1.00 0.00 ? 52  GLY A HA2  3  
ATOM 3697  H HA3  . GLY A 1 44 ? -6.899  8.238   -7.596  1.00 0.00 ? 52  GLY A HA3  3  
ATOM 3698  N N    . LEU A 1 45 ? -6.046  7.184   -4.585  1.00 0.00 ? 53  LEU A N    3  
ATOM 3699  C CA   . LEU A 1 45 ? -5.701  5.993   -3.819  1.00 0.00 ? 53  LEU A CA   3  
ATOM 3700  C C    . LEU A 1 45 ? -6.889  5.516   -2.988  1.00 0.00 ? 53  LEU A C    3  
ATOM 3701  O O    . LEU A 1 45 ? -7.860  6.249   -2.796  1.00 0.00 ? 53  LEU A O    3  
ATOM 3702  C CB   . LEU A 1 45 ? -4.507  6.276   -2.905  1.00 0.00 ? 53  LEU A CB   3  
ATOM 3703  C CG   . LEU A 1 45 ? -3.136  6.058   -3.546  1.00 0.00 ? 53  LEU A CG   3  
ATOM 3704  C CD1  . LEU A 1 45 ? -2.037  6.630   -2.663  1.00 0.00 ? 53  LEU A CD1  3  
ATOM 3705  C CD2  . LEU A 1 45 ? -2.897  4.577   -3.803  1.00 0.00 ? 53  LEU A CD2  3  
ATOM 3706  H H    . LEU A 1 45 ? -6.010  8.060   -4.149  1.00 0.00 ? 53  LEU A H    3  
ATOM 3707  H HA   . LEU A 1 45 ? -5.431  5.214   -4.517  1.00 0.00 ? 53  LEU A HA   3  
ATOM 3708  H HB2  . LEU A 1 45 ? -4.569  7.303   -2.577  1.00 0.00 ? 53  LEU A HB2  3  
ATOM 3709  H HB3  . LEU A 1 45 ? -4.581  5.634   -2.042  1.00 0.00 ? 53  LEU A HB3  3  
ATOM 3710  H HG   . LEU A 1 45 ? -3.103  6.572   -4.496  1.00 0.00 ? 53  LEU A HG   3  
ATOM 3711  H HD11 . LEU A 1 45 ? -1.871  5.972   -1.824  1.00 0.00 ? 53  LEU A HD11 3  
ATOM 3712  H HD12 . LEU A 1 45 ? -2.335  7.605   -2.305  1.00 0.00 ? 53  LEU A HD12 3  
ATOM 3713  H HD13 . LEU A 1 45 ? -1.125  6.719   -3.236  1.00 0.00 ? 53  LEU A HD13 3  
ATOM 3714  H HD21 . LEU A 1 45 ? -1.848  4.354   -3.683  1.00 0.00 ? 53  LEU A HD21 3  
ATOM 3715  H HD22 . LEU A 1 45 ? -3.205  4.333   -4.809  1.00 0.00 ? 53  LEU A HD22 3  
ATOM 3716  H HD23 . LEU A 1 45 ? -3.473  3.993   -3.100  1.00 0.00 ? 53  LEU A HD23 3  
ATOM 3717  N N    . GLU A 1 46 ? -6.804  4.284   -2.497  1.00 0.00 ? 54  GLU A N    3  
ATOM 3718  C CA   . GLU A 1 46 ? -7.871  3.708   -1.685  1.00 0.00 ? 54  GLU A CA   3  
ATOM 3719  C C    . GLU A 1 46 ? -7.477  2.327   -1.175  1.00 0.00 ? 54  GLU A C    3  
ATOM 3720  O O    . GLU A 1 46 ? -6.552  1.702   -1.695  1.00 0.00 ? 54  GLU A O    3  
ATOM 3721  C CB   . GLU A 1 46 ? -9.166  3.618   -2.498  1.00 0.00 ? 54  GLU A CB   3  
ATOM 3722  C CG   . GLU A 1 46 ? -10.338 4.345   -1.858  1.00 0.00 ? 54  GLU A CG   3  
ATOM 3723  C CD   . GLU A 1 46 ? -11.338 3.396   -1.226  1.00 0.00 ? 54  GLU A CD   3  
ATOM 3724  O OE1  . GLU A 1 46 ? -10.938 2.275   -0.852  1.00 0.00 ? 54  GLU A OE1  3  
ATOM 3725  O OE2  . GLU A 1 46 ? -12.522 3.776   -1.106  1.00 0.00 ? 54  GLU A OE2  3  
ATOM 3726  H H    . GLU A 1 46 ? -6.005  3.750   -2.685  1.00 0.00 ? 54  GLU A H    3  
ATOM 3727  H HA   . GLU A 1 46 ? -8.032  4.360   -0.840  1.00 0.00 ? 54  GLU A HA   3  
ATOM 3728  H HB2  . GLU A 1 46 ? -8.995  4.048   -3.474  1.00 0.00 ? 54  GLU A HB2  3  
ATOM 3729  H HB3  . GLU A 1 46 ? -9.436  2.579   -2.615  1.00 0.00 ? 54  GLU A HB3  3  
ATOM 3730  H HG2  . GLU A 1 46 ? -9.960  5.007   -1.092  1.00 0.00 ? 54  GLU A HG2  3  
ATOM 3731  H HG3  . GLU A 1 46 ? -10.842 4.926   -2.616  1.00 0.00 ? 54  GLU A HG3  3  
ATOM 3732  N N    . ILE A 1 47 ? -8.182  1.854   -0.151  1.00 0.00 ? 55  ILE A N    3  
ATOM 3733  C CA   . ILE A 1 47 ? -7.902  0.545   0.427   1.00 0.00 ? 55  ILE A CA   3  
ATOM 3734  C C    . ILE A 1 47 ? -8.019  -0.552  -0.625  1.00 0.00 ? 55  ILE A C    3  
ATOM 3735  O O    . ILE A 1 47 ? -8.904  -0.516  -1.480  1.00 0.00 ? 55  ILE A O    3  
ATOM 3736  C CB   . ILE A 1 47 ? -8.859  0.227   1.595   1.00 0.00 ? 55  ILE A CB   3  
ATOM 3737  C CG1  . ILE A 1 47 ? -8.876  1.382   2.600   1.00 0.00 ? 55  ILE A CG1  3  
ATOM 3738  C CG2  . ILE A 1 47 ? -8.454  -1.072  2.280   1.00 0.00 ? 55  ILE A CG2  3  
ATOM 3739  C CD1  . ILE A 1 47 ? -10.264 1.739   3.087   1.00 0.00 ? 55  ILE A CD1  3  
ATOM 3740  H H    . ILE A 1 47 ? -8.907  2.397   0.221   1.00 0.00 ? 55  ILE A H    3  
ATOM 3741  H HA   . ILE A 1 47 ? -6.892  0.559   0.809   1.00 0.00 ? 55  ILE A HA   3  
ATOM 3742  H HB   . ILE A 1 47 ? -9.852  0.097   1.191   1.00 0.00 ? 55  ILE A HB   3  
ATOM 3743  H HG12 . ILE A 1 47 ? -8.284  1.111   3.462   1.00 0.00 ? 55  ILE A HG12 3  
ATOM 3744  H HG13 . ILE A 1 47 ? -8.448  2.260   2.139   1.00 0.00 ? 55  ILE A HG13 3  
ATOM 3745  H HG21 . ILE A 1 47 ? -8.095  -0.860  3.276   1.00 0.00 ? 55  ILE A HG21 3  
ATOM 3746  H HG22 . ILE A 1 47 ? -7.670  -1.551  1.710   1.00 0.00 ? 55  ILE A HG22 3  
ATOM 3747  H HG23 . ILE A 1 47 ? -9.308  -1.730  2.337   1.00 0.00 ? 55  ILE A HG23 3  
ATOM 3748  H HD11 . ILE A 1 47 ? -10.454 1.242   4.026   1.00 0.00 ? 55  ILE A HD11 3  
ATOM 3749  H HD12 . ILE A 1 47 ? -10.992 1.423   2.357   1.00 0.00 ? 55  ILE A HD12 3  
ATOM 3750  H HD13 . ILE A 1 47 ? -10.332 2.809   3.226   1.00 0.00 ? 55  ILE A HD13 3  
ATOM 3751  N N    . GLY A 1 48 ? -7.117  -1.526  -0.558  1.00 0.00 ? 56  GLY A N    3  
ATOM 3752  C CA   . GLY A 1 48 ? -7.131  -2.618  -1.514  1.00 0.00 ? 56  GLY A CA   3  
ATOM 3753  C C    . GLY A 1 48 ? -5.981  -2.536  -2.495  1.00 0.00 ? 56  GLY A C    3  
ATOM 3754  O O    . GLY A 1 48 ? -5.410  -3.555  -2.881  1.00 0.00 ? 56  GLY A O    3  
ATOM 3755  H H    . GLY A 1 48 ? -6.433  -1.500  0.143   1.00 0.00 ? 56  GLY A H    3  
ATOM 3756  H HA2  . GLY A 1 48 ? -7.068  -3.552  -0.976  1.00 0.00 ? 56  GLY A HA2  3  
ATOM 3757  H HA3  . GLY A 1 48 ? -8.062  -2.590  -2.062  1.00 0.00 ? 56  GLY A HA3  3  
ATOM 3758  N N    . ASP A 1 49 ? -5.635  -1.319  -2.897  1.00 0.00 ? 57  ASP A N    3  
ATOM 3759  C CA   . ASP A 1 49 ? -4.542  -1.104  -3.836  1.00 0.00 ? 57  ASP A CA   3  
ATOM 3760  C C    . ASP A 1 49 ? -3.234  -1.654  -3.274  1.00 0.00 ? 57  ASP A C    3  
ATOM 3761  O O    . ASP A 1 49 ? -3.077  -1.787  -2.061  1.00 0.00 ? 57  ASP A O    3  
ATOM 3762  C CB   . ASP A 1 49 ? -4.392  0.387   -4.143  1.00 0.00 ? 57  ASP A CB   3  
ATOM 3763  C CG   . ASP A 1 49 ? -5.440  0.886   -5.118  1.00 0.00 ? 57  ASP A CG   3  
ATOM 3764  O OD1  . ASP A 1 49 ? -6.463  0.191   -5.300  1.00 0.00 ? 57  ASP A OD1  3  
ATOM 3765  O OD2  . ASP A 1 49 ? -5.240  1.974   -5.701  1.00 0.00 ? 57  ASP A OD2  3  
ATOM 3766  H H    . ASP A 1 49 ? -6.127  -0.543  -2.550  1.00 0.00 ? 57  ASP A H    3  
ATOM 3767  H HA   . ASP A 1 49 ? -4.780  -1.630  -4.750  1.00 0.00 ? 57  ASP A HA   3  
ATOM 3768  H HB2  . ASP A 1 49 ? -4.489  0.948   -3.224  1.00 0.00 ? 57  ASP A HB2  3  
ATOM 3769  H HB3  . ASP A 1 49 ? -3.416  0.565   -4.567  1.00 0.00 ? 57  ASP A HB3  3  
ATOM 3770  N N    . GLN A 1 50 ? -2.300  -1.973  -4.163  1.00 0.00 ? 58  GLN A N    3  
ATOM 3771  C CA   . GLN A 1 50 ? -1.009  -2.510  -3.749  1.00 0.00 ? 58  GLN A CA   3  
ATOM 3772  C C    . GLN A 1 50 ? 0.122   -1.933  -4.593  1.00 0.00 ? 58  GLN A C    3  
ATOM 3773  O O    . GLN A 1 50 ? 0.158   -2.116  -5.810  1.00 0.00 ? 58  GLN A O    3  
ATOM 3774  C CB   . GLN A 1 50 ? -1.010  -4.037  -3.857  1.00 0.00 ? 58  GLN A CB   3  
ATOM 3775  C CG   . GLN A 1 50 ? 0.249   -4.688  -3.306  1.00 0.00 ? 58  GLN A CG   3  
ATOM 3776  C CD   . GLN A 1 50 ? 0.852   -5.699  -4.261  1.00 0.00 ? 58  GLN A CD   3  
ATOM 3777  O OE1  . GLN A 1 50 ? 0.261   -6.744  -4.532  1.00 0.00 ? 58  GLN A OE1  3  
ATOM 3778  N NE2  . GLN A 1 50 ? 2.035   -5.390  -4.780  1.00 0.00 ? 58  GLN A NE2  3  
ATOM 3779  H H    . GLN A 1 50 ? -2.482  -1.847  -5.117  1.00 0.00 ? 58  GLN A H    3  
ATOM 3780  H HA   . GLN A 1 50 ? -0.850  -2.233  -2.718  1.00 0.00 ? 58  GLN A HA   3  
ATOM 3781  H HB2  . GLN A 1 50 ? -1.858  -4.424  -3.313  1.00 0.00 ? 58  GLN A HB2  3  
ATOM 3782  H HB3  . GLN A 1 50 ? -1.105  -4.311  -4.898  1.00 0.00 ? 58  GLN A HB3  3  
ATOM 3783  H HG2  . GLN A 1 50 ? 0.981   -3.919  -3.112  1.00 0.00 ? 58  GLN A HG2  3  
ATOM 3784  H HG3  . GLN A 1 50 ? 0.003   -5.190  -2.381  1.00 0.00 ? 58  GLN A HG3  3  
ATOM 3785  H HE21 . GLN A 1 50 ? 2.447   -4.542  -4.520  1.00 0.00 ? 58  GLN A HE21 3  
ATOM 3786  H HE22 . GLN A 1 50 ? 2.448   -6.027  -5.401  1.00 0.00 ? 58  GLN A HE22 3  
ATOM 3787  N N    . ILE A 1 51 ? 1.049   -1.242  -3.939  1.00 0.00 ? 59  ILE A N    3  
ATOM 3788  C CA   . ILE A 1 51 ? 2.184   -0.645  -4.633  1.00 0.00 ? 59  ILE A CA   3  
ATOM 3789  C C    . ILE A 1 51 ? 3.133   -1.725  -5.137  1.00 0.00 ? 59  ILE A C    3  
ATOM 3790  O O    . ILE A 1 51 ? 3.706   -2.479  -4.350  1.00 0.00 ? 59  ILE A O    3  
ATOM 3791  C CB   . ILE A 1 51 ? 2.962   0.322   -3.716  1.00 0.00 ? 59  ILE A CB   3  
ATOM 3792  C CG1  . ILE A 1 51 ? 2.007   1.330   -3.073  1.00 0.00 ? 59  ILE A CG1  3  
ATOM 3793  C CG2  . ILE A 1 51 ? 4.049   1.042   -4.501  1.00 0.00 ? 59  ILE A CG2  3  
ATOM 3794  C CD1  . ILE A 1 51 ? 2.512   1.889   -1.761  1.00 0.00 ? 59  ILE A CD1  3  
ATOM 3795  H H    . ILE A 1 51 ? 0.972   -1.134  -2.968  1.00 0.00 ? 59  ILE A H    3  
ATOM 3796  H HA   . ILE A 1 51 ? 1.806   -0.086  -5.475  1.00 0.00 ? 59  ILE A HA   3  
ATOM 3797  H HB   . ILE A 1 51 ? 3.437   -0.258  -2.938  1.00 0.00 ? 59  ILE A HB   3  
ATOM 3798  H HG12 . ILE A 1 51 ? 1.861   2.159   -3.750  1.00 0.00 ? 59  ILE A HG12 3  
ATOM 3799  H HG13 . ILE A 1 51 ? 1.057   0.851   -2.886  1.00 0.00 ? 59  ILE A HG13 3  
ATOM 3800  H HG21 . ILE A 1 51 ? 4.402   1.890   -3.932  1.00 0.00 ? 59  ILE A HG21 3  
ATOM 3801  H HG22 . ILE A 1 51 ? 3.647   1.381   -5.444  1.00 0.00 ? 59  ILE A HG22 3  
ATOM 3802  H HG23 . ILE A 1 51 ? 4.869   0.363   -4.684  1.00 0.00 ? 59  ILE A HG23 3  
ATOM 3803  H HD11 . ILE A 1 51 ? 3.479   2.347   -1.912  1.00 0.00 ? 59  ILE A HD11 3  
ATOM 3804  H HD12 . ILE A 1 51 ? 2.603   1.090   -1.039  1.00 0.00 ? 59  ILE A HD12 3  
ATOM 3805  H HD13 . ILE A 1 51 ? 1.817   2.629   -1.393  1.00 0.00 ? 59  ILE A HD13 3  
ATOM 3806  N N    . VAL A 1 52 ? 3.287   -1.802  -6.455  1.00 0.00 ? 60  VAL A N    3  
ATOM 3807  C CA   . VAL A 1 52 ? 4.158   -2.797  -7.063  1.00 0.00 ? 60  VAL A CA   3  
ATOM 3808  C C    . VAL A 1 52 ? 5.506   -2.199  -7.464  1.00 0.00 ? 60  VAL A C    3  
ATOM 3809  O O    . VAL A 1 52 ? 6.466   -2.926  -7.717  1.00 0.00 ? 60  VAL A O    3  
ATOM 3810  C CB   . VAL A 1 52 ? 3.497   -3.437  -8.301  1.00 0.00 ? 60  VAL A CB   3  
ATOM 3811  C CG1  . VAL A 1 52 ? 2.169   -4.078  -7.922  1.00 0.00 ? 60  VAL A CG1  3  
ATOM 3812  C CG2  . VAL A 1 52 ? 3.303   -2.404  -9.406  1.00 0.00 ? 60  VAL A CG2  3  
ATOM 3813  H H    . VAL A 1 52 ? 2.799   -1.177  -7.031  1.00 0.00 ? 60  VAL A H    3  
ATOM 3814  H HA   . VAL A 1 52 ? 4.330   -3.576  -6.334  1.00 0.00 ? 60  VAL A HA   3  
ATOM 3815  H HB   . VAL A 1 52 ? 4.150   -4.212  -8.673  1.00 0.00 ? 60  VAL A HB   3  
ATOM 3816  H HG11 . VAL A 1 52 ? 1.410   -3.313  -7.836  1.00 0.00 ? 60  VAL A HG11 3  
ATOM 3817  H HG12 . VAL A 1 52 ? 2.271   -4.590  -6.977  1.00 0.00 ? 60  VAL A HG12 3  
ATOM 3818  H HG13 . VAL A 1 52 ? 1.879   -4.786  -8.686  1.00 0.00 ? 60  VAL A HG13 3  
ATOM 3819  H HG21 . VAL A 1 52 ? 3.884   -2.691  -10.270 1.00 0.00 ? 60  VAL A HG21 3  
ATOM 3820  H HG22 . VAL A 1 52 ? 3.631   -1.437  -9.056  1.00 0.00 ? 60  VAL A HG22 3  
ATOM 3821  H HG23 . VAL A 1 52 ? 2.258   -2.355  -9.676  1.00 0.00 ? 60  VAL A HG23 3  
ATOM 3822  N N    . GLU A 1 53 ? 5.574   -0.870  -7.521  1.00 0.00 ? 61  GLU A N    3  
ATOM 3823  C CA   . GLU A 1 53 ? 6.809   -0.187  -7.892  1.00 0.00 ? 61  GLU A CA   3  
ATOM 3824  C C    . GLU A 1 53 ? 6.842   1.230   -7.328  1.00 0.00 ? 61  GLU A C    3  
ATOM 3825  O O    . GLU A 1 53 ? 5.806   1.876   -7.180  1.00 0.00 ? 61  GLU A O    3  
ATOM 3826  C CB   . GLU A 1 53 ? 6.954   -0.144  -9.415  1.00 0.00 ? 61  GLU A CB   3  
ATOM 3827  C CG   . GLU A 1 53 ? 8.397   -0.064  -9.886  1.00 0.00 ? 61  GLU A CG   3  
ATOM 3828  C CD   . GLU A 1 53 ? 8.527   -0.188  -11.391 1.00 0.00 ? 61  GLU A CD   3  
ATOM 3829  O OE1  . GLU A 1 53 ? 7.521   0.043   -12.095 1.00 0.00 ? 61  GLU A OE1  3  
ATOM 3830  O OE2  . GLU A 1 53 ? 9.634   -0.517  -11.867 1.00 0.00 ? 61  GLU A OE2  3  
ATOM 3831  H H    . GLU A 1 53 ? 4.779   -0.338  -7.312  1.00 0.00 ? 61  GLU A H    3  
ATOM 3832  H HA   . GLU A 1 53 ? 7.634   -0.747  -7.478  1.00 0.00 ? 61  GLU A HA   3  
ATOM 3833  H HB2  . GLU A 1 53 ? 6.512   -1.037  -9.833  1.00 0.00 ? 61  GLU A HB2  3  
ATOM 3834  H HB3  . GLU A 1 53 ? 6.426   0.719   -9.791  1.00 0.00 ? 61  GLU A HB3  3  
ATOM 3835  H HG2  . GLU A 1 53 ? 8.809   0.888   -9.583  1.00 0.00 ? 61  GLU A HG2  3  
ATOM 3836  H HG3  . GLU A 1 53 ? 8.958   -0.862  -9.423  1.00 0.00 ? 61  GLU A HG3  3  
ATOM 3837  N N    . VAL A 1 54 ? 8.043   1.707   -7.012  1.00 0.00 ? 62  VAL A N    3  
ATOM 3838  C CA   . VAL A 1 54 ? 8.215   3.047   -6.464  1.00 0.00 ? 62  VAL A CA   3  
ATOM 3839  C C    . VAL A 1 54 ? 9.543   3.654   -6.906  1.00 0.00 ? 62  VAL A C    3  
ATOM 3840  O O    . VAL A 1 54 ? 10.604  3.282   -6.407  1.00 0.00 ? 62  VAL A O    3  
ATOM 3841  C CB   . VAL A 1 54 ? 8.157   3.039   -4.924  1.00 0.00 ? 62  VAL A CB   3  
ATOM 3842  C CG1  . VAL A 1 54 ? 8.229   4.459   -4.373  1.00 0.00 ? 62  VAL A CG1  3  
ATOM 3843  C CG2  . VAL A 1 54 ? 6.897   2.334   -4.441  1.00 0.00 ? 62  VAL A CG2  3  
ATOM 3844  H H    . VAL A 1 54 ? 8.832   1.144   -7.153  1.00 0.00 ? 62  VAL A H    3  
ATOM 3845  H HA   . VAL A 1 54 ? 7.408   3.664   -6.831  1.00 0.00 ? 62  VAL A HA   3  
ATOM 3846  H HB   . VAL A 1 54 ? 9.013   2.492   -4.555  1.00 0.00 ? 62  VAL A HB   3  
ATOM 3847  H HG11 . VAL A 1 54 ? 9.129   4.571   -3.788  1.00 0.00 ? 62  VAL A HG11 3  
ATOM 3848  H HG12 . VAL A 1 54 ? 7.368   4.649   -3.749  1.00 0.00 ? 62  VAL A HG12 3  
ATOM 3849  H HG13 . VAL A 1 54 ? 8.241   5.163   -5.192  1.00 0.00 ? 62  VAL A HG13 3  
ATOM 3850  H HG21 . VAL A 1 54 ? 6.066   2.609   -5.075  1.00 0.00 ? 62  VAL A HG21 3  
ATOM 3851  H HG22 . VAL A 1 54 ? 6.687   2.630   -3.424  1.00 0.00 ? 62  VAL A HG22 3  
ATOM 3852  H HG23 . VAL A 1 54 ? 7.045   1.266   -4.482  1.00 0.00 ? 62  VAL A HG23 3  
ATOM 3853  N N    . ASN A 1 55 ? 9.475   4.594   -7.847  1.00 0.00 ? 63  ASN A N    3  
ATOM 3854  C CA   . ASN A 1 55 ? 10.672  5.255   -8.356  1.00 0.00 ? 63  ASN A CA   3  
ATOM 3855  C C    . ASN A 1 55 ? 11.676  4.238   -8.891  1.00 0.00 ? 63  ASN A C    3  
ATOM 3856  O O    . ASN A 1 55 ? 12.887  4.445   -8.808  1.00 0.00 ? 63  ASN A O    3  
ATOM 3857  C CB   . ASN A 1 55 ? 11.320  6.098   -7.257  1.00 0.00 ? 63  ASN A CB   3  
ATOM 3858  C CG   . ASN A 1 55 ? 11.959  7.361   -7.799  1.00 0.00 ? 63  ASN A CG   3  
ATOM 3859  O OD1  . ASN A 1 55 ? 12.500  7.373   -8.904  1.00 0.00 ? 63  ASN A OD1  3  
ATOM 3860  N ND2  . ASN A 1 55 ? 11.899  8.436   -7.020  1.00 0.00 ? 63  ASN A ND2  3  
ATOM 3861  H H    . ASN A 1 55 ? 8.599   4.848   -8.204  1.00 0.00 ? 63  ASN A H    3  
ATOM 3862  H HA   . ASN A 1 55 ? 10.371  5.905   -9.164  1.00 0.00 ? 63  ASN A HA   3  
ATOM 3863  H HB2  . ASN A 1 55 ? 10.567  6.379   -6.534  1.00 0.00 ? 63  ASN A HB2  3  
ATOM 3864  H HB3  . ASN A 1 55 ? 12.083  5.512   -6.765  1.00 0.00 ? 63  ASN A HB3  3  
ATOM 3865  H HD21 . ASN A 1 55 ? 11.452  8.354   -6.151  1.00 0.00 ? 63  ASN A HD21 3  
ATOM 3866  H HD22 . ASN A 1 55 ? 12.305  9.267   -7.346  1.00 0.00 ? 63  ASN A HD22 3  
ATOM 3867  N N    . GLY A 1 56 ? 11.166  3.141   -9.440  1.00 0.00 ? 64  GLY A N    3  
ATOM 3868  C CA   . GLY A 1 56 ? 12.031  2.110   -9.980  1.00 0.00 ? 64  GLY A CA   3  
ATOM 3869  C C    . GLY A 1 56 ? 12.445  1.089   -8.937  1.00 0.00 ? 64  GLY A C    3  
ATOM 3870  O O    . GLY A 1 56 ? 13.470  0.424   -9.083  1.00 0.00 ? 64  GLY A O    3  
ATOM 3871  H H    . GLY A 1 56 ? 10.192  3.031   -9.477  1.00 0.00 ? 64  GLY A H    3  
ATOM 3872  H HA2  . GLY A 1 56 ? 11.512  1.602   -10.778 1.00 0.00 ? 64  GLY A HA2  3  
ATOM 3873  H HA3  . GLY A 1 56 ? 12.919  2.577   -10.381 1.00 0.00 ? 64  GLY A HA3  3  
ATOM 3874  N N    . VAL A 1 57 ? 11.645  0.963   -7.881  1.00 0.00 ? 65  VAL A N    3  
ATOM 3875  C CA   . VAL A 1 57 ? 11.934  0.015   -6.814  1.00 0.00 ? 65  VAL A CA   3  
ATOM 3876  C C    . VAL A 1 57 ? 10.906  -1.111  -6.788  1.00 0.00 ? 65  VAL A C    3  
ATOM 3877  O O    . VAL A 1 57 ? 9.710   -0.869  -6.620  1.00 0.00 ? 65  VAL A O    3  
ATOM 3878  C CB   . VAL A 1 57 ? 11.959  0.705   -5.437  1.00 0.00 ? 65  VAL A CB   3  
ATOM 3879  C CG1  . VAL A 1 57 ? 12.433  -0.259  -4.361  1.00 0.00 ? 65  VAL A CG1  3  
ATOM 3880  C CG2  . VAL A 1 57 ? 12.840  1.946   -5.478  1.00 0.00 ? 65  VAL A CG2  3  
ATOM 3881  H H    . VAL A 1 57 ? 10.841  1.519   -7.822  1.00 0.00 ? 65  VAL A H    3  
ATOM 3882  H HA   . VAL A 1 57 ? 12.911  -0.409  -6.999  1.00 0.00 ? 65  VAL A HA   3  
ATOM 3883  H HB   . VAL A 1 57 ? 10.952  1.014   -5.192  1.00 0.00 ? 65  VAL A HB   3  
ATOM 3884  H HG11 . VAL A 1 57 ? 11.862  -0.103  -3.458  1.00 0.00 ? 65  VAL A HG11 3  
ATOM 3885  H HG12 . VAL A 1 57 ? 13.481  -0.085  -4.159  1.00 0.00 ? 65  VAL A HG12 3  
ATOM 3886  H HG13 . VAL A 1 57 ? 12.298  -1.275  -4.702  1.00 0.00 ? 65  VAL A HG13 3  
ATOM 3887  H HG21 . VAL A 1 57 ? 12.692  2.462   -6.414  1.00 0.00 ? 65  VAL A HG21 3  
ATOM 3888  H HG22 . VAL A 1 57 ? 13.876  1.655   -5.387  1.00 0.00 ? 65  VAL A HG22 3  
ATOM 3889  H HG23 . VAL A 1 57 ? 12.576  2.601   -4.660  1.00 0.00 ? 65  VAL A HG23 3  
ATOM 3890  N N    . ASP A 1 58 ? 11.377  -2.341  -6.958  1.00 0.00 ? 66  ASP A N    3  
ATOM 3891  C CA   . ASP A 1 58 ? 10.498  -3.505  -6.957  1.00 0.00 ? 66  ASP A CA   3  
ATOM 3892  C C    . ASP A 1 58 ? 9.855   -3.697  -5.587  1.00 0.00 ? 66  ASP A C    3  
ATOM 3893  O O    . ASP A 1 58 ? 10.530  -4.026  -4.613  1.00 0.00 ? 66  ASP A O    3  
ATOM 3894  C CB   . ASP A 1 58 ? 11.277  -4.761  -7.348  1.00 0.00 ? 66  ASP A CB   3  
ATOM 3895  C CG   . ASP A 1 58 ? 11.719  -4.739  -8.797  1.00 0.00 ? 66  ASP A CG   3  
ATOM 3896  O OD1  . ASP A 1 58 ? 10.876  -5.001  -9.679  1.00 0.00 ? 66  ASP A OD1  3  
ATOM 3897  O OD2  . ASP A 1 58 ? 12.909  -4.458  -9.051  1.00 0.00 ? 66  ASP A OD2  3  
ATOM 3898  H H    . ASP A 1 58 ? 12.340  -2.471  -7.089  1.00 0.00 ? 66  ASP A H    3  
ATOM 3899  H HA   . ASP A 1 58 ? 9.721   -3.332  -7.684  1.00 0.00 ? 66  ASP A HA   3  
ATOM 3900  H HB2  . ASP A 1 58 ? 12.155  -4.841  -6.724  1.00 0.00 ? 66  ASP A HB2  3  
ATOM 3901  H HB3  . ASP A 1 58 ? 10.650  -5.628  -7.194  1.00 0.00 ? 66  ASP A HB3  3  
ATOM 3902  N N    . PHE A 1 59 ? 8.543   -3.489  -5.521  1.00 0.00 ? 67  PHE A N    3  
ATOM 3903  C CA   . PHE A 1 59 ? 7.807   -3.641  -4.270  1.00 0.00 ? 67  PHE A CA   3  
ATOM 3904  C C    . PHE A 1 59 ? 7.176   -5.029  -4.168  1.00 0.00 ? 67  PHE A C    3  
ATOM 3905  O O    . PHE A 1 59 ? 6.242   -5.236  -3.393  1.00 0.00 ? 67  PHE A O    3  
ATOM 3906  C CB   . PHE A 1 59 ? 6.726   -2.566  -4.160  1.00 0.00 ? 67  PHE A CB   3  
ATOM 3907  C CG   . PHE A 1 59 ? 7.166   -1.343  -3.406  1.00 0.00 ? 67  PHE A CG   3  
ATOM 3908  C CD1  . PHE A 1 59 ? 8.433   -0.814  -3.593  1.00 0.00 ? 67  PHE A CD1  3  
ATOM 3909  C CD2  . PHE A 1 59 ? 6.310   -0.722  -2.509  1.00 0.00 ? 67  PHE A CD2  3  
ATOM 3910  C CE1  . PHE A 1 59 ? 8.838   0.311   -2.900  1.00 0.00 ? 67  PHE A CE1  3  
ATOM 3911  C CE2  . PHE A 1 59 ? 6.710   0.403   -1.813  1.00 0.00 ? 67  PHE A CE2  3  
ATOM 3912  C CZ   . PHE A 1 59 ? 7.976   0.920   -2.008  1.00 0.00 ? 67  PHE A CZ   3  
ATOM 3913  H H    . PHE A 1 59 ? 8.058   -3.228  -6.332  1.00 0.00 ? 67  PHE A H    3  
ATOM 3914  H HA   . PHE A 1 59 ? 8.508   -3.518  -3.458  1.00 0.00 ? 67  PHE A HA   3  
ATOM 3915  H HB2  . PHE A 1 59 ? 6.433   -2.255  -5.153  1.00 0.00 ? 67  PHE A HB2  3  
ATOM 3916  H HB3  . PHE A 1 59 ? 5.867   -2.980  -3.652  1.00 0.00 ? 67  PHE A HB3  3  
ATOM 3917  H HD1  . PHE A 1 59 ? 9.107   -1.289  -4.289  1.00 0.00 ? 67  PHE A HD1  3  
ATOM 3918  H HD2  . PHE A 1 59 ? 5.320   -1.126  -2.354  1.00 0.00 ? 67  PHE A HD2  3  
ATOM 3919  H HE1  . PHE A 1 59 ? 9.829   0.713   -3.053  1.00 0.00 ? 67  PHE A HE1  3  
ATOM 3920  H HE2  . PHE A 1 59 ? 6.034   0.877   -1.117  1.00 0.00 ? 67  PHE A HE2  3  
ATOM 3921  H HZ   . PHE A 1 59 ? 8.291   1.799   -1.465  1.00 0.00 ? 67  PHE A HZ   3  
ATOM 3922  N N    . SER A 1 60 ? 7.691   -5.975  -4.948  1.00 0.00 ? 68  SER A N    3  
ATOM 3923  C CA   . SER A 1 60 ? 7.175   -7.338  -4.935  1.00 0.00 ? 68  SER A CA   3  
ATOM 3924  C C    . SER A 1 60 ? 7.672   -8.088  -3.704  1.00 0.00 ? 68  SER A C    3  
ATOM 3925  O O    . SER A 1 60 ? 6.922   -8.830  -3.070  1.00 0.00 ? 68  SER A O    3  
ATOM 3926  C CB   . SER A 1 60 ? 7.595   -8.079  -6.205  1.00 0.00 ? 68  SER A CB   3  
ATOM 3927  O OG   . SER A 1 60 ? 6.544   -8.898  -6.692  1.00 0.00 ? 68  SER A OG   3  
ATOM 3928  H H    . SER A 1 60 ? 8.437   -5.752  -5.544  1.00 0.00 ? 68  SER A H    3  
ATOM 3929  H HA   . SER A 1 60 ? 6.097   -7.285  -4.899  1.00 0.00 ? 68  SER A HA   3  
ATOM 3930  H HB2  . SER A 1 60 ? 7.857   -7.361  -6.968  1.00 0.00 ? 68  SER A HB2  3  
ATOM 3931  H HB3  . SER A 1 60 ? 8.451   -8.704  -5.990  1.00 0.00 ? 68  SER A HB3  3  
ATOM 3932  H HG   . SER A 1 60 ? 6.142   -9.371  -5.960  1.00 0.00 ? 68  SER A HG   3  
ATOM 3933  N N    . ASN A 1 61 ? 8.942   -7.883  -3.371  1.00 0.00 ? 69  ASN A N    3  
ATOM 3934  C CA   . ASN A 1 61 ? 9.545   -8.533  -2.213  1.00 0.00 ? 69  ASN A CA   3  
ATOM 3935  C C    . ASN A 1 61 ? 10.126  -7.498  -1.256  1.00 0.00 ? 69  ASN A C    3  
ATOM 3936  O O    . ASN A 1 61 ? 11.081  -7.775  -0.530  1.00 0.00 ? 69  ASN A O    3  
ATOM 3937  C CB   . ASN A 1 61 ? 10.639  -9.506  -2.658  1.00 0.00 ? 69  ASN A CB   3  
ATOM 3938  C CG   . ASN A 1 61 ? 11.647  -8.857  -3.587  1.00 0.00 ? 69  ASN A CG   3  
ATOM 3939  O OD1  . ASN A 1 61 ? 12.718  -8.430  -3.159  1.00 0.00 ? 69  ASN A OD1  3  
ATOM 3940  N ND2  . ASN A 1 61 ? 11.308  -8.783  -4.869  1.00 0.00 ? 69  ASN A ND2  3  
ATOM 3941  H H    . ASN A 1 61 ? 9.487   -7.277  -3.914  1.00 0.00 ? 69  ASN A H    3  
ATOM 3942  H HA   . ASN A 1 61 ? 8.771   -9.085  -1.701  1.00 0.00 ? 69  ASN A HA   3  
ATOM 3943  H HB2  . ASN A 1 61 ? 11.163  -9.871  -1.787  1.00 0.00 ? 69  ASN A HB2  3  
ATOM 3944  H HB3  . ASN A 1 61 ? 10.183  -10.338 -3.174  1.00 0.00 ? 69  ASN A HB3  3  
ATOM 3945  H HD21 . ASN A 1 61 ? 10.438  -9.145  -5.140  1.00 0.00 ? 69  ASN A HD21 3  
ATOM 3946  H HD22 . ASN A 1 61 ? 11.941  -8.369  -5.492  1.00 0.00 ? 69  ASN A HD22 3  
ATOM 3947  N N    . LEU A 1 62 ? 9.544   -6.301  -1.262  1.00 0.00 ? 70  LEU A N    3  
ATOM 3948  C CA   . LEU A 1 62 ? 10.005  -5.221  -0.396  1.00 0.00 ? 70  LEU A CA   3  
ATOM 3949  C C    . LEU A 1 62 ? 9.397   -5.345  0.997   1.00 0.00 ? 70  LEU A C    3  
ATOM 3950  O O    . LEU A 1 62 ? 8.280   -5.836  1.156   1.00 0.00 ? 70  LEU A O    3  
ATOM 3951  C CB   . LEU A 1 62 ? 9.643   -3.866  -1.005  1.00 0.00 ? 70  LEU A CB   3  
ATOM 3952  C CG   . LEU A 1 62 ? 10.304  -2.657  -0.337  1.00 0.00 ? 70  LEU A CG   3  
ATOM 3953  C CD1  . LEU A 1 62 ? 11.399  -2.087  -1.225  1.00 0.00 ? 70  LEU A CD1  3  
ATOM 3954  C CD2  . LEU A 1 62 ? 9.269   -1.589  -0.015  1.00 0.00 ? 70  LEU A CD2  3  
ATOM 3955  H H    . LEU A 1 62 ? 8.789   -6.140  -1.864  1.00 0.00 ? 70  LEU A H    3  
ATOM 3956  H HA   . LEU A 1 62 ? 11.079  -5.296  -0.317  1.00 0.00 ? 70  LEU A HA   3  
ATOM 3957  H HB2  . LEU A 1 62 ? 9.926   -3.876  -2.048  1.00 0.00 ? 70  LEU A HB2  3  
ATOM 3958  H HB3  . LEU A 1 62 ? 8.572   -3.743  -0.943  1.00 0.00 ? 70  LEU A HB3  3  
ATOM 3959  H HG   . LEU A 1 62 ? 10.759  -2.972  0.591   1.00 0.00 ? 70  LEU A HG   3  
ATOM 3960  H HD11 . LEU A 1 62 ? 11.456  -1.017  -1.085  1.00 0.00 ? 70  LEU A HD11 3  
ATOM 3961  H HD12 . LEU A 1 62 ? 11.175  -2.303  -2.258  1.00 0.00 ? 70  LEU A HD12 3  
ATOM 3962  H HD13 . LEU A 1 62 ? 12.347  -2.533  -0.960  1.00 0.00 ? 70  LEU A HD13 3  
ATOM 3963  H HD21 . LEU A 1 62 ? 8.926   -1.715  1.002   1.00 0.00 ? 70  LEU A HD21 3  
ATOM 3964  H HD22 . LEU A 1 62 ? 8.432   -1.684  -0.692  1.00 0.00 ? 70  LEU A HD22 3  
ATOM 3965  H HD23 . LEU A 1 62 ? 9.713   -0.610  -0.126  1.00 0.00 ? 70  LEU A HD23 3  
ATOM 3966  N N    . ASP A 1 63 ? 10.141  -4.897  2.001   1.00 0.00 ? 71  ASP A N    3  
ATOM 3967  C CA   . ASP A 1 63 ? 9.676   -4.956  3.383   1.00 0.00 ? 71  ASP A CA   3  
ATOM 3968  C C    . ASP A 1 63 ? 8.843   -3.727  3.729   1.00 0.00 ? 71  ASP A C    3  
ATOM 3969  O O    . ASP A 1 63 ? 8.868   -2.724  3.014   1.00 0.00 ? 71  ASP A O    3  
ATOM 3970  C CB   . ASP A 1 63 ? 10.865  -5.067  4.339   1.00 0.00 ? 71  ASP A CB   3  
ATOM 3971  C CG   . ASP A 1 63 ? 10.529  -5.853  5.589   1.00 0.00 ? 71  ASP A CG   3  
ATOM 3972  O OD1  . ASP A 1 63 ? 9.552   -6.631  5.558   1.00 0.00 ? 71  ASP A OD1  3  
ATOM 3973  O OD2  . ASP A 1 63 ? 11.245  -5.695  6.601   1.00 0.00 ? 71  ASP A OD2  3  
ATOM 3974  H H    . ASP A 1 63 ? 11.024  -4.516  1.811   1.00 0.00 ? 71  ASP A H    3  
ATOM 3975  H HA   . ASP A 1 63 ? 9.059   -5.835  3.485   1.00 0.00 ? 71  ASP A HA   3  
ATOM 3976  H HB2  . ASP A 1 63 ? 11.680  -5.562  3.833   1.00 0.00 ? 71  ASP A HB2  3  
ATOM 3977  H HB3  . ASP A 1 63 ? 11.177  -4.075  4.631   1.00 0.00 ? 71  ASP A HB3  3  
ATOM 3978  N N    . HIS A 1 64 ? 8.104   -3.810  4.830   1.00 0.00 ? 72  HIS A N    3  
ATOM 3979  C CA   . HIS A 1 64 ? 7.264   -2.705  5.275   1.00 0.00 ? 72  HIS A CA   3  
ATOM 3980  C C    . HIS A 1 64 ? 8.099   -1.454  5.531   1.00 0.00 ? 72  HIS A C    3  
ATOM 3981  O O    . HIS A 1 64 ? 7.764   -0.365  5.064   1.00 0.00 ? 72  HIS A O    3  
ATOM 3982  C CB   . HIS A 1 64 ? 6.504   -3.094  6.544   1.00 0.00 ? 72  HIS A CB   3  
ATOM 3983  C CG   . HIS A 1 64 ? 5.098   -2.582  6.584   1.00 0.00 ? 72  HIS A CG   3  
ATOM 3984  N ND1  . HIS A 1 64 ? 4.098   -3.185  7.318   1.00 0.00 ? 72  HIS A ND1  3  
ATOM 3985  C CD2  . HIS A 1 64 ? 4.525   -1.514  5.978   1.00 0.00 ? 72  HIS A CD2  3  
ATOM 3986  C CE1  . HIS A 1 64 ? 2.971   -2.513  7.160   1.00 0.00 ? 72  HIS A CE1  3  
ATOM 3987  N NE2  . HIS A 1 64 ? 3.205   -1.495  6.352   1.00 0.00 ? 72  HIS A NE2  3  
ATOM 3988  H H    . HIS A 1 64 ? 8.126   -4.636  5.358   1.00 0.00 ? 72  HIS A H    3  
ATOM 3989  H HA   . HIS A 1 64 ? 6.552   -2.493  4.491   1.00 0.00 ? 72  HIS A HA   3  
ATOM 3990  H HB2  . HIS A 1 64 ? 6.465   -4.171  6.615   1.00 0.00 ? 72  HIS A HB2  3  
ATOM 3991  H HB3  . HIS A 1 64 ? 7.027   -2.700  7.403   1.00 0.00 ? 72  HIS A HB3  3  
ATOM 3992  H HD1  . HIS A 1 64 ? 4.198   -3.988  7.871   1.00 0.00 ? 72  HIS A HD1  3  
ATOM 3993  H HD2  . HIS A 1 64 ? 5.017   -0.811  5.321   1.00 0.00 ? 72  HIS A HD2  3  
ATOM 3994  H HE1  . HIS A 1 64 ? 2.022   -2.753  7.614   1.00 0.00 ? 72  HIS A HE1  3  
ATOM 3995  H HE2  . HIS A 1 64 ? 2.558   -0.794  6.126   1.00 0.00 ? 72  HIS A HE2  3  
ATOM 3996  N N    . LYS A 1 65 ? 9.185   -1.618  6.278   1.00 0.00 ? 73  LYS A N    3  
ATOM 3997  C CA   . LYS A 1 65 ? 10.070  -0.502  6.597   1.00 0.00 ? 73  LYS A CA   3  
ATOM 3998  C C    . LYS A 1 65 ? 10.658  0.110   5.328   1.00 0.00 ? 73  LYS A C    3  
ATOM 3999  O O    . LYS A 1 65 ? 10.749  1.330   5.203   1.00 0.00 ? 73  LYS A O    3  
ATOM 4000  C CB   . LYS A 1 65 ? 11.197  -0.965  7.522   1.00 0.00 ? 73  LYS A CB   3  
ATOM 4001  C CG   . LYS A 1 65 ? 10.814  -0.970  8.994   1.00 0.00 ? 73  LYS A CG   3  
ATOM 4002  C CD   . LYS A 1 65 ? 9.929   -2.160  9.336   1.00 0.00 ? 73  LYS A CD   3  
ATOM 4003  C CE   . LYS A 1 65 ? 10.383  -2.842  10.617  1.00 0.00 ? 73  LYS A CE   3  
ATOM 4004  N NZ   . LYS A 1 65 ? 9.484   -3.968  10.994  1.00 0.00 ? 73  LYS A NZ   3  
ATOM 4005  H H    . LYS A 1 65 ? 9.400   -2.511  6.622   1.00 0.00 ? 73  LYS A H    3  
ATOM 4006  H HA   . LYS A 1 65 ? 9.484   0.248   7.106   1.00 0.00 ? 73  LYS A HA   3  
ATOM 4007  H HB2  . LYS A 1 65 ? 11.485  -1.969  7.244   1.00 0.00 ? 73  LYS A HB2  3  
ATOM 4008  H HB3  . LYS A 1 65 ? 12.044  -0.308  7.396   1.00 0.00 ? 73  LYS A HB3  3  
ATOM 4009  H HG2  . LYS A 1 65 ? 11.713  -1.020  9.590   1.00 0.00 ? 73  LYS A HG2  3  
ATOM 4010  H HG3  . LYS A 1 65 ? 10.280  -0.059  9.219   1.00 0.00 ? 73  LYS A HG3  3  
ATOM 4011  H HD2  . LYS A 1 65 ? 8.913   -1.814  9.466   1.00 0.00 ? 73  LYS A HD2  3  
ATOM 4012  H HD3  . LYS A 1 65 ? 9.968   -2.872  8.524   1.00 0.00 ? 73  LYS A HD3  3  
ATOM 4013  H HE2  . LYS A 1 65 ? 11.381  -3.225  10.471  1.00 0.00 ? 73  LYS A HE2  3  
ATOM 4014  H HE3  . LYS A 1 65 ? 10.389  -2.114  11.415  1.00 0.00 ? 73  LYS A HE3  3  
ATOM 4015  H HZ1  . LYS A 1 65 ? 8.515   -3.778  10.665  1.00 0.00 ? 73  LYS A HZ1  3  
ATOM 4016  H HZ2  . LYS A 1 65 ? 9.470   -4.084  12.028  1.00 0.00 ? 73  LYS A HZ2  3  
ATOM 4017  H HZ3  . LYS A 1 65 ? 9.819   -4.853  10.563  1.00 0.00 ? 73  LYS A HZ3  3  
ATOM 4018  N N    . GLU A 1 66 ? 11.055  -0.746  4.392   1.00 0.00 ? 74  GLU A N    3  
ATOM 4019  C CA   . GLU A 1 66 ? 11.634  -0.289  3.134   1.00 0.00 ? 74  GLU A CA   3  
ATOM 4020  C C    . GLU A 1 66 ? 10.658  0.609   2.380   1.00 0.00 ? 74  GLU A C    3  
ATOM 4021  O O    . GLU A 1 66 ? 11.036  1.668   1.878   1.00 0.00 ? 74  GLU A O    3  
ATOM 4022  C CB   . GLU A 1 66 ? 12.026  -1.485  2.263   1.00 0.00 ? 74  GLU A CB   3  
ATOM 4023  C CG   . GLU A 1 66 ? 13.515  -1.791  2.285   1.00 0.00 ? 74  GLU A CG   3  
ATOM 4024  C CD   . GLU A 1 66 ? 13.804  -3.278  2.314   1.00 0.00 ? 74  GLU A CD   3  
ATOM 4025  O OE1  . GLU A 1 66 ? 13.780  -3.866  3.416   1.00 0.00 ? 74  GLU A OE1  3  
ATOM 4026  O OE2  . GLU A 1 66 ? 14.055  -3.856  1.235   1.00 0.00 ? 74  GLU A OE2  3  
ATOM 4027  H H    . GLU A 1 66 ? 10.956  -1.709  4.551   1.00 0.00 ? 74  GLU A H    3  
ATOM 4028  H HA   . GLU A 1 66 ? 12.522  0.281   3.368   1.00 0.00 ? 74  GLU A HA   3  
ATOM 4029  H HB2  . GLU A 1 66 ? 11.498  -2.359  2.615   1.00 0.00 ? 74  GLU A HB2  3  
ATOM 4030  H HB3  . GLU A 1 66 ? 11.736  -1.286  1.243   1.00 0.00 ? 74  GLU A HB3  3  
ATOM 4031  H HG2  . GLU A 1 66 ? 13.969  -1.369  1.400   1.00 0.00 ? 74  GLU A HG2  3  
ATOM 4032  H HG3  . GLU A 1 66 ? 13.950  -1.336  3.163   1.00 0.00 ? 74  GLU A HG3  3  
ATOM 4033  N N    . ALA A 1 67 ? 9.405   0.179   2.305   1.00 0.00 ? 75  ALA A N    3  
ATOM 4034  C CA   . ALA A 1 67 ? 8.374   0.943   1.611   1.00 0.00 ? 75  ALA A CA   3  
ATOM 4035  C C    . ALA A 1 67 ? 8.213   2.332   2.219   1.00 0.00 ? 75  ALA A C    3  
ATOM 4036  O O    . ALA A 1 67 ? 8.175   3.333   1.504   1.00 0.00 ? 75  ALA A O    3  
ATOM 4037  C CB   . ALA A 1 67 ? 7.050   0.195   1.649   1.00 0.00 ? 75  ALA A CB   3  
ATOM 4038  H H    . ALA A 1 67 ? 9.165   -0.673  2.725   1.00 0.00 ? 75  ALA A H    3  
ATOM 4039  H HA   . ALA A 1 67 ? 8.673   1.044   0.578   1.00 0.00 ? 75  ALA A HA   3  
ATOM 4040  H HB1  . ALA A 1 67 ? 6.467   0.448   0.777   1.00 0.00 ? 75  ALA A HB1  3  
ATOM 4041  H HB2  . ALA A 1 67 ? 6.508   0.468   2.540   1.00 0.00 ? 75  ALA A HB2  3  
ATOM 4042  H HB3  . ALA A 1 67 ? 7.241   -0.868  1.656   1.00 0.00 ? 75  ALA A HB3  3  
ATOM 4043  N N    . VAL A 1 68 ? 8.119   2.383   3.542   1.00 0.00 ? 76  VAL A N    3  
ATOM 4044  C CA   . VAL A 1 68 ? 7.962   3.650   4.246   1.00 0.00 ? 76  VAL A CA   3  
ATOM 4045  C C    . VAL A 1 68 ? 9.215   4.511   4.110   1.00 0.00 ? 76  VAL A C    3  
ATOM 4046  O O    . VAL A 1 68 ? 9.129   5.716   3.875   1.00 0.00 ? 76  VAL A O    3  
ATOM 4047  C CB   . VAL A 1 68 ? 7.664   3.429   5.741   1.00 0.00 ? 76  VAL A CB   3  
ATOM 4048  C CG1  . VAL A 1 68 ? 7.349   4.750   6.427   1.00 0.00 ? 76  VAL A CG1  3  
ATOM 4049  C CG2  . VAL A 1 68 ? 6.519   2.443   5.916   1.00 0.00 ? 76  VAL A CG2  3  
ATOM 4050  H H    . VAL A 1 68 ? 8.156   1.551   4.060   1.00 0.00 ? 76  VAL A H    3  
ATOM 4051  H HA   . VAL A 1 68 ? 7.126   4.175   3.806   1.00 0.00 ? 76  VAL A HA   3  
ATOM 4052  H HB   . VAL A 1 68 ? 8.546   3.011   6.205   1.00 0.00 ? 76  VAL A HB   3  
ATOM 4053  H HG11 . VAL A 1 68 ? 8.266   5.205   6.769   1.00 0.00 ? 76  VAL A HG11 3  
ATOM 4054  H HG12 . VAL A 1 68 ? 6.699   4.572   7.269   1.00 0.00 ? 76  VAL A HG12 3  
ATOM 4055  H HG13 . VAL A 1 68 ? 6.859   5.411   5.726   1.00 0.00 ? 76  VAL A HG13 3  
ATOM 4056  H HG21 . VAL A 1 68 ? 5.924   2.731   6.771   1.00 0.00 ? 76  VAL A HG21 3  
ATOM 4057  H HG22 . VAL A 1 68 ? 6.919   1.451   6.073   1.00 0.00 ? 76  VAL A HG22 3  
ATOM 4058  H HG23 . VAL A 1 68 ? 5.902   2.445   5.030   1.00 0.00 ? 76  VAL A HG23 3  
ATOM 4059  N N    . ASN A 1 69 ? 10.378  3.883   4.261   1.00 0.00 ? 77  ASN A N    3  
ATOM 4060  C CA   . ASN A 1 69 ? 11.650  4.591   4.159   1.00 0.00 ? 77  ASN A CA   3  
ATOM 4061  C C    . ASN A 1 69 ? 11.772  5.317   2.823   1.00 0.00 ? 77  ASN A C    3  
ATOM 4062  O O    . ASN A 1 69 ? 11.953  6.534   2.783   1.00 0.00 ? 77  ASN A O    3  
ATOM 4063  C CB   . ASN A 1 69 ? 12.815  3.615   4.330   1.00 0.00 ? 77  ASN A CB   3  
ATOM 4064  C CG   . ASN A 1 69 ? 13.959  4.211   5.125   1.00 0.00 ? 77  ASN A CG   3  
ATOM 4065  O OD1  . ASN A 1 69 ? 14.119  3.929   6.312   1.00 0.00 ? 77  ASN A OD1  3  
ATOM 4066  N ND2  . ASN A 1 69 ? 14.760  5.045   4.473   1.00 0.00 ? 77  ASN A ND2  3  
ATOM 4067  H H    . ASN A 1 69 ? 10.380  2.922   4.448   1.00 0.00 ? 77  ASN A H    3  
ATOM 4068  H HA   . ASN A 1 69 ? 11.686  5.320   4.953   1.00 0.00 ? 77  ASN A HA   3  
ATOM 4069  H HB2  . ASN A 1 69 ? 12.465  2.733   4.846   1.00 0.00 ? 77  ASN A HB2  3  
ATOM 4070  H HB3  . ASN A 1 69 ? 13.185  3.331   3.355   1.00 0.00 ? 77  ASN A HB3  3  
ATOM 4071  H HD21 . ASN A 1 69 ? 14.572  5.224   3.527   1.00 0.00 ? 77  ASN A HD21 3  
ATOM 4072  H HD22 . ASN A 1 69 ? 15.509  5.446   4.962   1.00 0.00 ? 77  ASN A HD22 3  
ATOM 4073  N N    . VAL A 1 70 ? 11.676  4.566   1.730   1.00 0.00 ? 78  VAL A N    3  
ATOM 4074  C CA   . VAL A 1 70 ? 11.782  5.144   0.396   1.00 0.00 ? 78  VAL A CA   3  
ATOM 4075  C C    . VAL A 1 70 ? 10.737  6.236   0.186   1.00 0.00 ? 78  VAL A C    3  
ATOM 4076  O O    . VAL A 1 70 ? 11.040  7.307   -0.338  1.00 0.00 ? 78  VAL A O    3  
ATOM 4077  C CB   . VAL A 1 70 ? 11.619  4.071   -0.697  1.00 0.00 ? 78  VAL A CB   3  
ATOM 4078  C CG1  . VAL A 1 70 ? 12.727  3.037   -0.595  1.00 0.00 ? 78  VAL A CG1  3  
ATOM 4079  C CG2  . VAL A 1 70 ? 10.253  3.408   -0.601  1.00 0.00 ? 78  VAL A CG2  3  
ATOM 4080  H H    . VAL A 1 70 ? 11.536  3.601   1.825   1.00 0.00 ? 78  VAL A H    3  
ATOM 4081  H HA   . VAL A 1 70 ? 12.765  5.581   0.300   1.00 0.00 ? 78  VAL A HA   3  
ATOM 4082  H HB   . VAL A 1 70 ? 11.695  4.553   -1.661  1.00 0.00 ? 78  VAL A HB   3  
ATOM 4083  H HG11 . VAL A 1 70 ? 13.611  3.496   -0.175  1.00 0.00 ? 78  VAL A HG11 3  
ATOM 4084  H HG12 . VAL A 1 70 ? 12.954  2.653   -1.578  1.00 0.00 ? 78  VAL A HG12 3  
ATOM 4085  H HG13 . VAL A 1 70 ? 12.406  2.225   0.043   1.00 0.00 ? 78  VAL A HG13 3  
ATOM 4086  H HG21 . VAL A 1 70 ? 10.208  2.574   -1.286  1.00 0.00 ? 78  VAL A HG21 3  
ATOM 4087  H HG22 . VAL A 1 70 ? 9.487   4.125   -0.859  1.00 0.00 ? 78  VAL A HG22 3  
ATOM 4088  H HG23 . VAL A 1 70 ? 10.092  3.057   0.406   1.00 0.00 ? 78  VAL A HG23 3  
ATOM 4089  N N    . LEU A 1 71 ? 9.506   5.958   0.603   1.00 0.00 ? 79  LEU A N    3  
ATOM 4090  C CA   . LEU A 1 71 ? 8.417   6.918   0.466   1.00 0.00 ? 79  LEU A CA   3  
ATOM 4091  C C    . LEU A 1 71 ? 8.684   8.160   1.311   1.00 0.00 ? 79  LEU A C    3  
ATOM 4092  O O    . LEU A 1 71 ? 8.278   9.266   0.955   1.00 0.00 ? 79  LEU A O    3  
ATOM 4093  C CB   . LEU A 1 71 ? 7.089   6.277   0.879   1.00 0.00 ? 79  LEU A CB   3  
ATOM 4094  C CG   . LEU A 1 71 ? 6.255   5.712   -0.273  1.00 0.00 ? 79  LEU A CG   3  
ATOM 4095  C CD1  . LEU A 1 71 ? 5.700   6.838   -1.132  1.00 0.00 ? 79  LEU A CD1  3  
ATOM 4096  C CD2  . LEU A 1 71 ? 7.087   4.758   -1.116  1.00 0.00 ? 79  LEU A CD2  3  
ATOM 4097  H H    . LEU A 1 71 ? 9.327   5.087   1.018   1.00 0.00 ? 79  LEU A H    3  
ATOM 4098  H HA   . LEU A 1 71 ? 8.361   7.206   -0.572  1.00 0.00 ? 79  LEU A HA   3  
ATOM 4099  H HB2  . LEU A 1 71 ? 7.302   5.475   1.569   1.00 0.00 ? 79  LEU A HB2  3  
ATOM 4100  H HB3  . LEU A 1 71 ? 6.498   7.022   1.389   1.00 0.00 ? 79  LEU A HB3  3  
ATOM 4101  H HG   . LEU A 1 71 ? 5.421   5.160   0.134   1.00 0.00 ? 79  LEU A HG   3  
ATOM 4102  H HD11 . LEU A 1 71 ? 5.652   7.745   -0.550  1.00 0.00 ? 79  LEU A HD11 3  
ATOM 4103  H HD12 . LEU A 1 71 ? 4.709   6.574   -1.473  1.00 0.00 ? 79  LEU A HD12 3  
ATOM 4104  H HD13 . LEU A 1 71 ? 6.345   6.991   -1.986  1.00 0.00 ? 79  LEU A HD13 3  
ATOM 4105  H HD21 . LEU A 1 71 ? 7.387   3.912   -0.513  1.00 0.00 ? 79  LEU A HD21 3  
ATOM 4106  H HD22 . LEU A 1 71 ? 7.967   5.270   -1.478  1.00 0.00 ? 79  LEU A HD22 3  
ATOM 4107  H HD23 . LEU A 1 71 ? 6.500   4.413   -1.954  1.00 0.00 ? 79  LEU A HD23 3  
ATOM 4108  N N    . LYS A 1 72 ? 9.372   7.969   2.433   1.00 0.00 ? 80  LYS A N    3  
ATOM 4109  C CA   . LYS A 1 72 ? 9.696   9.070   3.333   1.00 0.00 ? 80  LYS A CA   3  
ATOM 4110  C C    . LYS A 1 72 ? 10.939  9.817   2.854   1.00 0.00 ? 80  LYS A C    3  
ATOM 4111  O O    . LYS A 1 72 ? 11.080  11.017  3.083   1.00 0.00 ? 80  LYS A O    3  
ATOM 4112  C CB   . LYS A 1 72 ? 9.919   8.545   4.753   1.00 0.00 ? 80  LYS A CB   3  
ATOM 4113  C CG   . LYS A 1 72 ? 8.710   8.707   5.662   1.00 0.00 ? 80  LYS A CG   3  
ATOM 4114  C CD   . LYS A 1 72 ? 7.462   8.093   5.050   1.00 0.00 ? 80  LYS A CD   3  
ATOM 4115  C CE   . LYS A 1 72 ? 6.263   8.229   5.974   1.00 0.00 ? 80  LYS A CE   3  
ATOM 4116  N NZ   . LYS A 1 72 ? 6.016   9.646   6.359   1.00 0.00 ? 80  LYS A NZ   3  
ATOM 4117  H H    . LYS A 1 72 ? 9.669   7.064   2.662   1.00 0.00 ? 80  LYS A H    3  
ATOM 4118  H HA   . LYS A 1 72 ? 8.859   9.753   3.337   1.00 0.00 ? 80  LYS A HA   3  
ATOM 4119  H HB2  . LYS A 1 72 ? 10.165  7.495   4.702   1.00 0.00 ? 80  LYS A HB2  3  
ATOM 4120  H HB3  . LYS A 1 72 ? 10.747  9.078   5.196   1.00 0.00 ? 80  LYS A HB3  3  
ATOM 4121  H HG2  . LYS A 1 72 ? 8.913   8.220   6.604   1.00 0.00 ? 80  LYS A HG2  3  
ATOM 4122  H HG3  . LYS A 1 72 ? 8.538   9.760   5.829   1.00 0.00 ? 80  LYS A HG3  3  
ATOM 4123  H HD2  . LYS A 1 72 ? 7.244   8.594   4.119   1.00 0.00 ? 80  LYS A HD2  3  
ATOM 4124  H HD3  . LYS A 1 72 ? 7.644   7.044   4.862   1.00 0.00 ? 80  LYS A HD3  3  
ATOM 4125  H HE2  . LYS A 1 72 ? 5.390   7.845   5.468   1.00 0.00 ? 80  LYS A HE2  3  
ATOM 4126  H HE3  . LYS A 1 72 ? 6.446   7.649   6.868   1.00 0.00 ? 80  LYS A HE3  3  
ATOM 4127  H HZ1  . LYS A 1 72 ? 5.833   10.220  5.511   1.00 0.00 ? 80  LYS A HZ1  3  
ATOM 4128  H HZ2  . LYS A 1 72 ? 6.845   10.032  6.854   1.00 0.00 ? 80  LYS A HZ2  3  
ATOM 4129  H HZ3  . LYS A 1 72 ? 5.190   9.706   6.991   1.00 0.00 ? 80  LYS A HZ3  3  
ATOM 4130  N N    . SER A 1 73 ? 11.836  9.096   2.191   1.00 0.00 ? 81  SER A N    3  
ATOM 4131  C CA   . SER A 1 73 ? 13.069  9.688   1.682   1.00 0.00 ? 81  SER A CA   3  
ATOM 4132  C C    . SER A 1 73 ? 12.778  10.698  0.578   1.00 0.00 ? 81  SER A C    3  
ATOM 4133  O O    . SER A 1 73 ? 13.046  11.890  0.727   1.00 0.00 ? 81  SER A O    3  
ATOM 4134  C CB   . SER A 1 73 ? 14.003  8.595   1.156   1.00 0.00 ? 81  SER A CB   3  
ATOM 4135  O OG   . SER A 1 73 ? 15.353  9.026   1.174   1.00 0.00 ? 81  SER A OG   3  
ATOM 4136  H H    . SER A 1 73 ? 11.668  8.142   2.040   1.00 0.00 ? 81  SER A H    3  
ATOM 4137  H HA   . SER A 1 73 ? 13.554  10.198  2.501   1.00 0.00 ? 81  SER A HA   3  
ATOM 4138  H HB2  . SER A 1 73 ? 13.910  7.717   1.776   1.00 0.00 ? 81  SER A HB2  3  
ATOM 4139  H HB3  . SER A 1 73 ? 13.730  8.350   0.140   1.00 0.00 ? 81  SER A HB3  3  
ATOM 4140  H HG   . SER A 1 73 ? 15.666  9.060   2.081   1.00 0.00 ? 81  SER A HG   3  
ATOM 4141  N N    . SER A 1 74 ? 12.229  10.214  -0.532  1.00 0.00 ? 82  SER A N    3  
ATOM 4142  C CA   . SER A 1 74 ? 11.904  11.077  -1.661  1.00 0.00 ? 82  SER A CA   3  
ATOM 4143  C C    . SER A 1 74 ? 10.507  11.671  -1.509  1.00 0.00 ? 82  SER A C    3  
ATOM 4144  O O    . SER A 1 74 ? 9.547   10.957  -1.221  1.00 0.00 ? 82  SER A O    3  
ATOM 4145  C CB   . SER A 1 74 ? 12.002  10.294  -2.972  1.00 0.00 ? 82  SER A CB   3  
ATOM 4146  O OG   . SER A 1 74 ? 13.211  10.585  -3.650  1.00 0.00 ? 82  SER A OG   3  
ATOM 4147  H H    . SER A 1 74 ? 12.039  9.254   -0.591  1.00 0.00 ? 82  SER A H    3  
ATOM 4148  H HA   . SER A 1 74 ? 12.624  11.882  -1.678  1.00 0.00 ? 82  SER A HA   3  
ATOM 4149  H HB2  . SER A 1 74 ? 11.970  9.236   -2.759  1.00 0.00 ? 82  SER A HB2  3  
ATOM 4150  H HB3  . SER A 1 74 ? 11.172  10.558  -3.611  1.00 0.00 ? 82  SER A HB3  3  
ATOM 4151  H HG   . SER A 1 74 ? 13.397  9.891   -4.288  1.00 0.00 ? 82  SER A HG   3  
ATOM 4152  N N    . ARG A 1 75 ? 10.403  12.981  -1.706  1.00 0.00 ? 83  ARG A N    3  
ATOM 4153  C CA   . ARG A 1 75 ? 9.124   13.672  -1.593  1.00 0.00 ? 83  ARG A CA   3  
ATOM 4154  C C    . ARG A 1 75 ? 8.273   13.442  -2.837  1.00 0.00 ? 83  ARG A C    3  
ATOM 4155  O O    . ARG A 1 75 ? 7.137   12.975  -2.749  1.00 0.00 ? 83  ARG A O    3  
ATOM 4156  C CB   . ARG A 1 75 ? 9.347   15.170  -1.383  1.00 0.00 ? 83  ARG A CB   3  
ATOM 4157  C CG   . ARG A 1 75 ? 9.815   15.525  0.020   1.00 0.00 ? 83  ARG A CG   3  
ATOM 4158  C CD   . ARG A 1 75 ? 11.274  15.952  0.033   1.00 0.00 ? 83  ARG A CD   3  
ATOM 4159  N NE   . ARG A 1 75 ? 11.417  17.402  0.140   1.00 0.00 ? 83  ARG A NE   3  
ATOM 4160  C CZ   . ARG A 1 75 ? 12.529  18.064  -0.178  1.00 0.00 ? 83  ARG A CZ   3  
ATOM 4161  N NH1  . ARG A 1 75 ? 13.595  17.409  -0.624  1.00 0.00 ? 83  ARG A NH1  3  
ATOM 4162  N NH2  . ARG A 1 75 ? 12.572  19.383  -0.051  1.00 0.00 ? 83  ARG A NH2  3  
ATOM 4163  H H    . ARG A 1 75 ? 11.205  13.496  -1.934  1.00 0.00 ? 83  ARG A H    3  
ATOM 4164  H HA   . ARG A 1 75 ? 8.603   13.270  -0.736  1.00 0.00 ? 83  ARG A HA   3  
ATOM 4165  H HB2  . ARG A 1 75 ? 10.092  15.513  -2.086  1.00 0.00 ? 83  ARG A HB2  3  
ATOM 4166  H HB3  . ARG A 1 75 ? 8.421   15.692  -1.572  1.00 0.00 ? 83  ARG A HB3  3  
ATOM 4167  H HG2  . ARG A 1 75 ? 9.209   16.335  0.397   1.00 0.00 ? 83  ARG A HG2  3  
ATOM 4168  H HG3  . ARG A 1 75 ? 9.697   14.659  0.656   1.00 0.00 ? 83  ARG A HG3  3  
ATOM 4169  H HD2  . ARG A 1 75 ? 11.764  15.490  0.877   1.00 0.00 ? 83  ARG A HD2  3  
ATOM 4170  H HD3  . ARG A 1 75 ? 11.742  15.620  -0.882  1.00 0.00 ? 83  ARG A HD3  3  
ATOM 4171  H HE   . ARG A 1 75 ? 10.646  17.911  0.466   1.00 0.00 ? 83  ARG A HE   3  
ATOM 4172  H HH11 . ARG A 1 75 ? 13.566  16.416  -0.722  1.00 0.00 ? 83  ARG A HH11 3  
ATOM 4173  H HH12 . ARG A 1 75 ? 14.426  17.913  -0.860  1.00 0.00 ? 83  ARG A HH12 3  
ATOM 4174  H HH21 . ARG A 1 75 ? 11.772  19.881  0.283   1.00 0.00 ? 83  ARG A HH21 3  
ATOM 4175  H HH22 . ARG A 1 75 ? 13.407  19.880  -0.290  1.00 0.00 ? 83  ARG A HH22 3  
ATOM 4176  N N    . SER A 1 76 ? 8.832   13.775  -3.997  1.00 0.00 ? 84  SER A N    3  
ATOM 4177  C CA   . SER A 1 76 ? 8.129   13.601  -5.263  1.00 0.00 ? 84  SER A CA   3  
ATOM 4178  C C    . SER A 1 76 ? 8.596   12.334  -5.967  1.00 0.00 ? 84  SER A C    3  
ATOM 4179  O O    . SER A 1 76 ? 9.461   12.378  -6.841  1.00 0.00 ? 84  SER A O    3  
ATOM 4180  C CB   . SER A 1 76 ? 8.356   14.815  -6.166  1.00 0.00 ? 84  SER A CB   3  
ATOM 4181  O OG   . SER A 1 76 ? 7.777   15.983  -5.608  1.00 0.00 ? 84  SER A OG   3  
ATOM 4182  H H    . SER A 1 76 ? 9.741   14.140  -4.001  1.00 0.00 ? 84  SER A H    3  
ATOM 4183  H HA   . SER A 1 76 ? 7.074   13.514  -5.048  1.00 0.00 ? 84  SER A HA   3  
ATOM 4184  H HB2  . SER A 1 76 ? 9.416   14.978  -6.287  1.00 0.00 ? 84  SER A HB2  3  
ATOM 4185  H HB3  . SER A 1 76 ? 7.907   14.633  -7.131  1.00 0.00 ? 84  SER A HB3  3  
ATOM 4186  H HG   . SER A 1 76 ? 8.068   16.081  -4.698  1.00 0.00 ? 84  SER A HG   3  
ATOM 4187  N N    . LEU A 1 77 ? 8.022   11.201  -5.574  1.00 0.00 ? 85  LEU A N    3  
ATOM 4188  C CA   . LEU A 1 77 ? 8.386   9.916   -6.160  1.00 0.00 ? 85  LEU A CA   3  
ATOM 4189  C C    . LEU A 1 77 ? 7.221   9.320   -6.946  1.00 0.00 ? 85  LEU A C    3  
ATOM 4190  O O    . LEU A 1 77 ? 6.065   9.422   -6.535  1.00 0.00 ? 85  LEU A O    3  
ATOM 4191  C CB   . LEU A 1 77 ? 8.829   8.936   -5.069  1.00 0.00 ? 85  LEU A CB   3  
ATOM 4192  C CG   . LEU A 1 77 ? 8.276   9.219   -3.669  1.00 0.00 ? 85  LEU A CG   3  
ATOM 4193  C CD1  . LEU A 1 77 ? 6.797   8.873   -3.599  1.00 0.00 ? 85  LEU A CD1  3  
ATOM 4194  C CD2  . LEU A 1 77 ? 9.058   8.442   -2.621  1.00 0.00 ? 85  LEU A CD2  3  
ATOM 4195  H H    . LEU A 1 77 ? 7.343   11.228  -4.869  1.00 0.00 ? 85  LEU A H    3  
ATOM 4196  H HA   . LEU A 1 77 ? 9.210   10.082  -6.837  1.00 0.00 ? 85  LEU A HA   3  
ATOM 4197  H HB2  . LEU A 1 77 ? 8.517   7.942   -5.359  1.00 0.00 ? 85  LEU A HB2  3  
ATOM 4198  H HB3  . LEU A 1 77 ? 9.907   8.954   -5.015  1.00 0.00 ? 85  LEU A HB3  3  
ATOM 4199  H HG   . LEU A 1 77 ? 8.381   10.273  -3.454  1.00 0.00 ? 85  LEU A HG   3  
ATOM 4200  H HD11 . LEU A 1 77 ? 6.243   9.523   -4.259  1.00 0.00 ? 85  LEU A HD11 3  
ATOM 4201  H HD12 . LEU A 1 77 ? 6.444   9.004   -2.586  1.00 0.00 ? 85  LEU A HD12 3  
ATOM 4202  H HD13 . LEU A 1 77 ? 6.653   7.846   -3.899  1.00 0.00 ? 85  LEU A HD13 3  
ATOM 4203  H HD21 . LEU A 1 77 ? 8.864   8.860   -1.645  1.00 0.00 ? 85  LEU A HD21 3  
ATOM 4204  H HD22 . LEU A 1 77 ? 10.114  8.509   -2.837  1.00 0.00 ? 85  LEU A HD22 3  
ATOM 4205  H HD23 . LEU A 1 77 ? 8.752   7.407   -2.638  1.00 0.00 ? 85  LEU A HD23 3  
ATOM 4206  N N    . THR A 1 78 ? 7.538   8.691   -8.072  1.00 0.00 ? 86  THR A N    3  
ATOM 4207  C CA   . THR A 1 78 ? 6.523   8.067   -8.912  1.00 0.00 ? 86  THR A CA   3  
ATOM 4208  C C    . THR A 1 78 ? 6.303   6.619   -8.489  1.00 0.00 ? 86  THR A C    3  
ATOM 4209  O O    . THR A 1 78 ? 7.215   5.796   -8.565  1.00 0.00 ? 86  THR A O    3  
ATOM 4210  C CB   . THR A 1 78 ? 6.937   8.125   -10.382 1.00 0.00 ? 86  THR A CB   3  
ATOM 4211  O OG1  . THR A 1 78 ? 7.252   9.453   -10.762 1.00 0.00 ? 86  THR A OG1  3  
ATOM 4212  C CG2  . THR A 1 78 ? 5.867   7.620   -11.325 1.00 0.00 ? 86  THR A CG2  3  
ATOM 4213  H H    . THR A 1 78 ? 8.479   8.636   -8.340  1.00 0.00 ? 86  THR A H    3  
ATOM 4214  H HA   . THR A 1 78 ? 5.602   8.614   -8.780  1.00 0.00 ? 86  THR A HA   3  
ATOM 4215  H HB   . THR A 1 78 ? 7.817   7.515   -10.522 1.00 0.00 ? 86  THR A HB   3  
ATOM 4216  H HG1  . THR A 1 78 ? 7.812   9.854   -10.093 1.00 0.00 ? 86  THR A HG1  3  
ATOM 4217  H HG21 . THR A 1 78 ? 5.603   6.607   -11.059 1.00 0.00 ? 86  THR A HG21 3  
ATOM 4218  H HG22 . THR A 1 78 ? 6.240   7.641   -12.338 1.00 0.00 ? 86  THR A HG22 3  
ATOM 4219  H HG23 . THR A 1 78 ? 4.994   8.250   -11.251 1.00 0.00 ? 86  THR A HG23 3  
ATOM 4220  N N    . ILE A 1 79 ? 5.093   6.316   -8.034  1.00 0.00 ? 87  ILE A N    3  
ATOM 4221  C CA   . ILE A 1 79 ? 4.762   4.968   -7.589  1.00 0.00 ? 87  ILE A CA   3  
ATOM 4222  C C    . ILE A 1 79 ? 3.705   4.328   -8.481  1.00 0.00 ? 87  ILE A C    3  
ATOM 4223  O O    . ILE A 1 79 ? 2.635   4.893   -8.700  1.00 0.00 ? 87  ILE A O    3  
ATOM 4224  C CB   . ILE A 1 79 ? 4.257   4.968   -6.133  1.00 0.00 ? 87  ILE A CB   3  
ATOM 4225  C CG1  . ILE A 1 79 ? 3.150   6.009   -5.956  1.00 0.00 ? 87  ILE A CG1  3  
ATOM 4226  C CG2  . ILE A 1 79 ? 5.408   5.237   -5.172  1.00 0.00 ? 87  ILE A CG2  3  
ATOM 4227  C CD1  . ILE A 1 79 ? 2.629   6.105   -4.538  1.00 0.00 ? 87  ILE A CD1  3  
ATOM 4228  H H    . ILE A 1 79 ? 4.408   7.017   -7.990  1.00 0.00 ? 87  ILE A H    3  
ATOM 4229  H HA   . ILE A 1 79 ? 5.663   4.374   -7.634  1.00 0.00 ? 87  ILE A HA   3  
ATOM 4230  H HB   . ILE A 1 79 ? 3.860   3.988   -5.914  1.00 0.00 ? 87  ILE A HB   3  
ATOM 4231  H HG12 . ILE A 1 79 ? 3.530   6.982   -6.233  1.00 0.00 ? 87  ILE A HG12 3  
ATOM 4232  H HG13 . ILE A 1 79 ? 2.319   5.755   -6.598  1.00 0.00 ? 87  ILE A HG13 3  
ATOM 4233  H HG21 . ILE A 1 79 ? 5.223   6.155   -4.634  1.00 0.00 ? 87  ILE A HG21 3  
ATOM 4234  H HG22 . ILE A 1 79 ? 6.329   5.325   -5.728  1.00 0.00 ? 87  ILE A HG22 3  
ATOM 4235  H HG23 . ILE A 1 79 ? 5.489   4.420   -4.471  1.00 0.00 ? 87  ILE A HG23 3  
ATOM 4236  H HD11 . ILE A 1 79 ? 1.590   6.400   -4.555  1.00 0.00 ? 87  ILE A HD11 3  
ATOM 4237  H HD12 . ILE A 1 79 ? 3.203   6.839   -3.992  1.00 0.00 ? 87  ILE A HD12 3  
ATOM 4238  H HD13 . ILE A 1 79 ? 2.723   5.144   -4.055  1.00 0.00 ? 87  ILE A HD13 3  
ATOM 4239  N N    . SER A 1 80 ? 4.014   3.138   -8.988  1.00 0.00 ? 88  SER A N    3  
ATOM 4240  C CA   . SER A 1 80 ? 3.092   2.408   -9.849  1.00 0.00 ? 88  SER A CA   3  
ATOM 4241  C C    . SER A 1 80 ? 2.292   1.398   -9.033  1.00 0.00 ? 88  SER A C    3  
ATOM 4242  O O    . SER A 1 80 ? 2.865   0.540   -8.360  1.00 0.00 ? 88  SER A O    3  
ATOM 4243  C CB   . SER A 1 80 ? 3.856   1.693   -10.964 1.00 0.00 ? 88  SER A CB   3  
ATOM 4244  O OG   . SER A 1 80 ? 3.048   1.536   -12.117 1.00 0.00 ? 88  SER A OG   3  
ATOM 4245  H H    . SER A 1 80 ? 4.882   2.737   -8.770  1.00 0.00 ? 88  SER A H    3  
ATOM 4246  H HA   . SER A 1 80 ? 2.411   3.122   -10.287 1.00 0.00 ? 88  SER A HA   3  
ATOM 4247  H HB2  . SER A 1 80 ? 4.729   2.271   -11.226 1.00 0.00 ? 88  SER A HB2  3  
ATOM 4248  H HB3  . SER A 1 80 ? 4.164   0.716   -10.617 1.00 0.00 ? 88  SER A HB3  3  
ATOM 4249  H HG   . SER A 1 80 ? 3.175   0.656   -12.479 1.00 0.00 ? 88  SER A HG   3  
ATOM 4250  N N    . ILE A 1 81 ? 0.970   1.511   -9.086  1.00 0.00 ? 89  ILE A N    3  
ATOM 4251  C CA   . ILE A 1 81 ? 0.101   0.612   -8.342  1.00 0.00 ? 89  ILE A CA   3  
ATOM 4252  C C    . ILE A 1 81 ? -0.942  -0.031  -9.249  1.00 0.00 ? 89  ILE A C    3  
ATOM 4253  O O    . ILE A 1 81 ? -1.427  0.588   -10.196 1.00 0.00 ? 89  ILE A O    3  
ATOM 4254  C CB   . ILE A 1 81 ? -0.613  1.355   -7.192  1.00 0.00 ? 89  ILE A CB   3  
ATOM 4255  C CG1  . ILE A 1 81 ? -1.604  0.425   -6.472  1.00 0.00 ? 89  ILE A CG1  3  
ATOM 4256  C CG2  . ILE A 1 81 ? -1.309  2.604   -7.719  1.00 0.00 ? 89  ILE A CG2  3  
ATOM 4257  C CD1  . ILE A 1 81 ? -3.022  0.484   -7.009  1.00 0.00 ? 89  ILE A CD1  3  
ATOM 4258  H H    . ILE A 1 81 ? 0.573   2.220   -9.633  1.00 0.00 ? 89  ILE A H    3  
ATOM 4259  H HA   . ILE A 1 81 ? 0.714   -0.166  -7.912  1.00 0.00 ? 89  ILE A HA   3  
ATOM 4260  H HB   . ILE A 1 81 ? 0.141   1.673   -6.486  1.00 0.00 ? 89  ILE A HB   3  
ATOM 4261  H HG12 . ILE A 1 81 ? -1.260  -0.593  -6.567  1.00 0.00 ? 89  ILE A HG12 3  
ATOM 4262  H HG13 . ILE A 1 81 ? -1.636  0.691   -5.425  1.00 0.00 ? 89  ILE A HG13 3  
ATOM 4263  H HG21 . ILE A 1 81 ? -1.682  2.414   -8.714  1.00 0.00 ? 89  ILE A HG21 3  
ATOM 4264  H HG22 . ILE A 1 81 ? -0.605  3.422   -7.749  1.00 0.00 ? 89  ILE A HG22 3  
ATOM 4265  H HG23 . ILE A 1 81 ? -2.131  2.859   -7.067  1.00 0.00 ? 89  ILE A HG23 3  
ATOM 4266  H HD11 . ILE A 1 81 ? -3.645  -0.199  -6.454  1.00 0.00 ? 89  ILE A HD11 3  
ATOM 4267  H HD12 . ILE A 1 81 ? -3.024  0.206   -8.053  1.00 0.00 ? 89  ILE A HD12 3  
ATOM 4268  H HD13 . ILE A 1 81 ? -3.405  1.488   -6.904  1.00 0.00 ? 89  ILE A HD13 3  
ATOM 4269  N N    . VAL A 1 82 ? -1.289  -1.276  -8.942  1.00 0.00 ? 90  VAL A N    3  
ATOM 4270  C CA   . VAL A 1 82 ? -2.285  -2.010  -9.712  1.00 0.00 ? 90  VAL A CA   3  
ATOM 4271  C C    . VAL A 1 82 ? -3.547  -2.220  -8.881  1.00 0.00 ? 90  VAL A C    3  
ATOM 4272  O O    . VAL A 1 82 ? -3.489  -2.731  -7.763  1.00 0.00 ? 90  VAL A O    3  
ATOM 4273  C CB   . VAL A 1 82 ? -1.741  -3.376  -10.198 1.00 0.00 ? 90  VAL A CB   3  
ATOM 4274  C CG1  . VAL A 1 82 ? -0.861  -4.019  -9.138  1.00 0.00 ? 90  VAL A CG1  3  
ATOM 4275  C CG2  . VAL A 1 82 ? -2.875  -4.312  -10.600 1.00 0.00 ? 90  VAL A CG2  3  
ATOM 4276  H H    . VAL A 1 82 ? -0.872  -1.709  -8.169  1.00 0.00 ? 90  VAL A H    3  
ATOM 4277  H HA   . VAL A 1 82 ? -2.536  -1.416  -10.580 1.00 0.00 ? 90  VAL A HA   3  
ATOM 4278  H HB   . VAL A 1 82 ? -1.131  -3.200  -11.070 1.00 0.00 ? 90  VAL A HB   3  
ATOM 4279  H HG11 . VAL A 1 82 ? 0.172   -3.779  -9.338  1.00 0.00 ? 90  VAL A HG11 3  
ATOM 4280  H HG12 . VAL A 1 82 ? -0.993  -5.090  -9.162  1.00 0.00 ? 90  VAL A HG12 3  
ATOM 4281  H HG13 . VAL A 1 82 ? -1.136  -3.645  -8.165  1.00 0.00 ? 90  VAL A HG13 3  
ATOM 4282  H HG21 . VAL A 1 82 ? -2.509  -5.036  -11.314 1.00 0.00 ? 90  VAL A HG21 3  
ATOM 4283  H HG22 . VAL A 1 82 ? -3.674  -3.739  -11.046 1.00 0.00 ? 90  VAL A HG22 3  
ATOM 4284  H HG23 . VAL A 1 82 ? -3.245  -4.826  -9.725  1.00 0.00 ? 90  VAL A HG23 3  
ATOM 4285  N N    . ALA A 1 83 ? -4.683  -1.812  -9.432  1.00 0.00 ? 91  ALA A N    3  
ATOM 4286  C CA   . ALA A 1 83 ? -5.959  -1.944  -8.742  1.00 0.00 ? 91  ALA A CA   3  
ATOM 4287  C C    . ALA A 1 83 ? -6.344  -3.407  -8.553  1.00 0.00 ? 91  ALA A C    3  
ATOM 4288  O O    . ALA A 1 83 ? -6.294  -4.199  -9.494  1.00 0.00 ? 91  ALA A O    3  
ATOM 4289  C CB   . ALA A 1 83 ? -7.047  -1.205  -9.504  1.00 0.00 ? 91  ALA A CB   3  
ATOM 4290  H H    . ALA A 1 83 ? -4.663  -1.405  -10.324 1.00 0.00 ? 91  ALA A H    3  
ATOM 4291  H HA   . ALA A 1 83 ? -5.858  -1.482  -7.770  1.00 0.00 ? 91  ALA A HA   3  
ATOM 4292  H HB1  . ALA A 1 83 ? -6.806  -1.197  -10.556 1.00 0.00 ? 91  ALA A HB1  3  
ATOM 4293  H HB2  . ALA A 1 83 ? -7.114  -0.190  -9.142  1.00 0.00 ? 91  ALA A HB2  3  
ATOM 4294  H HB3  . ALA A 1 83 ? -7.993  -1.705  -9.355  1.00 0.00 ? 91  ALA A HB3  3  
ATOM 4295  N N    . ALA A 1 84 ? -6.744  -3.748  -7.327  1.00 0.00 ? 92  ALA A N    3  
ATOM 4296  C CA   . ALA A 1 84 ? -7.164  -5.108  -6.980  1.00 0.00 ? 92  ALA A CA   3  
ATOM 4297  C C    . ALA A 1 84 ? -5.988  -6.008  -6.601  1.00 0.00 ? 92  ALA A C    3  
ATOM 4298  O O    . ALA A 1 84 ? -6.181  -7.036  -5.952  1.00 0.00 ? 92  ALA A O    3  
ATOM 4299  C CB   . ALA A 1 84 ? -7.967  -5.737  -8.111  1.00 0.00 ? 92  ALA A CB   3  
ATOM 4300  H H    . ALA A 1 84 ? -6.766  -3.059  -6.632  1.00 0.00 ? 92  ALA A H    3  
ATOM 4301  H HA   . ALA A 1 84 ? -7.817  -5.029  -6.124  1.00 0.00 ? 92  ALA A HA   3  
ATOM 4302  H HB1  . ALA A 1 84 ? -8.540  -6.567  -7.724  1.00 0.00 ? 92  ALA A HB1  3  
ATOM 4303  H HB2  . ALA A 1 84 ? -7.294  -6.090  -8.876  1.00 0.00 ? 92  ALA A HB2  3  
ATOM 4304  H HB3  . ALA A 1 84 ? -8.637  -5.001  -8.530  1.00 0.00 ? 92  ALA A HB3  3  
ATOM 4305  N N    . ALA A 1 85 ? -4.773  -5.631  -6.995  1.00 0.00 ? 93  ALA A N    3  
ATOM 4306  C CA   . ALA A 1 85 ? -3.595  -6.430  -6.672  1.00 0.00 ? 93  ALA A CA   3  
ATOM 4307  C C    . ALA A 1 85 ? -3.508  -6.699  -5.171  1.00 0.00 ? 93  ALA A C    3  
ATOM 4308  O O    . ALA A 1 85 ? -2.890  -7.672  -4.737  1.00 0.00 ? 93  ALA A O    3  
ATOM 4309  C CB   . ALA A 1 85 ? -2.337  -5.729  -7.160  1.00 0.00 ? 93  ALA A CB   3  
ATOM 4310  H H    . ALA A 1 85 ? -4.663  -4.802  -7.508  1.00 0.00 ? 93  ALA A H    3  
ATOM 4311  H HA   . ALA A 1 85 ? -3.678  -7.372  -7.193  1.00 0.00 ? 93  ALA A HA   3  
ATOM 4312  H HB1  . ALA A 1 85 ? -2.604  -4.776  -7.588  1.00 0.00 ? 93  ALA A HB1  3  
ATOM 4313  H HB2  . ALA A 1 85 ? -1.854  -6.338  -7.910  1.00 0.00 ? 93  ALA A HB2  3  
ATOM 4314  H HB3  . ALA A 1 85 ? -1.663  -5.576  -6.332  1.00 0.00 ? 93  ALA A HB3  3  
ATOM 4315  N N    . GLY A 1 86 ? -4.132  -5.827  -4.384  1.00 0.00 ? 94  GLY A N    3  
ATOM 4316  C CA   . GLY A 1 86 ? -4.122  -5.973  -2.942  1.00 0.00 ? 94  GLY A CA   3  
ATOM 4317  C C    . GLY A 1 86 ? -5.489  -6.324  -2.385  1.00 0.00 ? 94  GLY A C    3  
ATOM 4318  O O    . GLY A 1 86 ? -5.596  -6.990  -1.356  1.00 0.00 ? 94  GLY A O    3  
ATOM 4319  H H    . GLY A 1 86 ? -4.605  -5.072  -4.791  1.00 0.00 ? 94  GLY A H    3  
ATOM 4320  H HA2  . GLY A 1 86 ? -3.428  -6.754  -2.677  1.00 0.00 ? 94  GLY A HA2  3  
ATOM 4321  H HA3  . GLY A 1 86 ? -3.790  -5.046  -2.499  1.00 0.00 ? 94  GLY A HA3  3  
ATOM 4322  N N    . ARG A 1 87 ? -6.535  -5.852  -3.057  1.00 0.00 ? 95  ARG A N    3  
ATOM 4323  C CA   . ARG A 1 87 ? -7.906  -6.095  -2.620  1.00 0.00 ? 95  ARG A CA   3  
ATOM 4324  C C    . ARG A 1 87 ? -8.189  -7.590  -2.488  1.00 0.00 ? 95  ARG A C    3  
ATOM 4325  O O    . ARG A 1 87 ? -8.937  -8.011  -1.606  1.00 0.00 ? 95  ARG A O    3  
ATOM 4326  C CB   . ARG A 1 87 ? -8.896  -5.445  -3.598  1.00 0.00 ? 95  ARG A CB   3  
ATOM 4327  C CG   . ARG A 1 87 ? -9.361  -6.360  -4.725  1.00 0.00 ? 95  ARG A CG   3  
ATOM 4328  C CD   . ARG A 1 87 ? -10.342 -5.651  -5.648  1.00 0.00 ? 95  ARG A CD   3  
ATOM 4329  N NE   . ARG A 1 87 ? -11.686 -6.218  -5.559  1.00 0.00 ? 95  ARG A NE   3  
ATOM 4330  C CZ   . ARG A 1 87 ? -12.083 -7.297  -6.232  1.00 0.00 ? 95  ARG A CZ   3  
ATOM 4331  N NH1  . ARG A 1 87 ? -11.241 -7.935  -7.036  1.00 0.00 ? 95  ARG A NH1  3  
ATOM 4332  N NH2  . ARG A 1 87 ? -13.325 -7.740  -6.097  1.00 0.00 ? 95  ARG A NH2  3  
ATOM 4333  H H    . ARG A 1 87 ? -6.381  -5.315  -3.861  1.00 0.00 ? 95  ARG A H    3  
ATOM 4334  H HA   . ARG A 1 87 ? -8.026  -5.635  -1.650  1.00 0.00 ? 95  ARG A HA   3  
ATOM 4335  H HB2  . ARG A 1 87 ? -9.766  -5.123  -3.049  1.00 0.00 ? 95  ARG A HB2  3  
ATOM 4336  H HB3  . ARG A 1 87 ? -8.423  -4.580  -4.042  1.00 0.00 ? 95  ARG A HB3  3  
ATOM 4337  H HG2  . ARG A 1 87 ? -8.504  -6.675  -5.300  1.00 0.00 ? 95  ARG A HG2  3  
ATOM 4338  H HG3  . ARG A 1 87 ? -9.847  -7.224  -4.296  1.00 0.00 ? 95  ARG A HG3  3  
ATOM 4339  H HD2  . ARG A 1 87 ? -10.384 -4.606  -5.375  1.00 0.00 ? 95  ARG A HD2  3  
ATOM 4340  H HD3  . ARG A 1 87 ? -9.989  -5.741  -6.664  1.00 0.00 ? 95  ARG A HD3  3  
ATOM 4341  H HE   . ARG A 1 87 ? -12.328 -5.769  -4.971  1.00 0.00 ? 95  ARG A HE   3  
ATOM 4342  H HH11 . ARG A 1 87 ? -10.303 -7.609  -7.142  1.00 0.00 ? 95  ARG A HH11 3  
ATOM 4343  H HH12 . ARG A 1 87 ? -11.548 -8.746  -7.538  1.00 0.00 ? 95  ARG A HH12 3  
ATOM 4344  H HH21 . ARG A 1 87 ? -13.963 -7.264  -5.491  1.00 0.00 ? 95  ARG A HH21 3  
ATOM 4345  H HH22 . ARG A 1 87 ? -13.624 -8.551  -6.602  1.00 0.00 ? 95  ARG A HH22 3  
ATOM 4346  N N    . GLU A 1 88 ? -7.585  -8.389  -3.361  1.00 0.00 ? 96  GLU A N    3  
ATOM 4347  C CA   . GLU A 1 88 ? -7.777  -9.835  -3.327  1.00 0.00 ? 96  GLU A CA   3  
ATOM 4348  C C    . GLU A 1 88 ? -7.567  -10.376 -1.915  1.00 0.00 ? 96  GLU A C    3  
ATOM 4349  O O    . GLU A 1 88 ? -8.400  -11.115 -1.391  1.00 0.00 ? 96  GLU A O    3  
ATOM 4350  C CB   . GLU A 1 88 ? -6.814  -10.523 -4.299  1.00 0.00 ? 96  GLU A CB   3  
ATOM 4351  C CG   . GLU A 1 88 ? -7.331  -11.846 -4.837  1.00 0.00 ? 96  GLU A CG   3  
ATOM 4352  C CD   . GLU A 1 88 ? -8.452  -11.668 -5.842  1.00 0.00 ? 96  GLU A CD   3  
ATOM 4353  O OE1  . GLU A 1 88 ? -9.164  -10.645 -5.764  1.00 0.00 ? 96  GLU A OE1  3  
ATOM 4354  O OE2  . GLU A 1 88 ? -8.618  -12.552 -6.709  1.00 0.00 ? 96  GLU A OE2  3  
ATOM 4355  H H    . GLU A 1 88 ? -6.996  -7.999  -4.040  1.00 0.00 ? 96  GLU A H    3  
ATOM 4356  H HA   . GLU A 1 88 ? -8.792  -10.043 -3.633  1.00 0.00 ? 96  GLU A HA   3  
ATOM 4357  H HB2  . GLU A 1 88 ? -6.635  -9.863  -5.135  1.00 0.00 ? 96  GLU A HB2  3  
ATOM 4358  H HB3  . GLU A 1 88 ? -5.879  -10.705 -3.790  1.00 0.00 ? 96  GLU A HB3  3  
ATOM 4359  H HG2  . GLU A 1 88 ? -6.516  -12.367 -5.319  1.00 0.00 ? 96  GLU A HG2  3  
ATOM 4360  H HG3  . GLU A 1 88 ? -7.698  -12.438 -4.011  1.00 0.00 ? 96  GLU A HG3  3  
ATOM 4361  N N    . LEU A 1 89 ? -6.450  -9.994  -1.306  1.00 0.00 ? 97  LEU A N    3  
ATOM 4362  C CA   . LEU A 1 89 ? -6.129  -10.428 0.050   1.00 0.00 ? 97  LEU A CA   3  
ATOM 4363  C C    . LEU A 1 89 ? -7.034  -9.746  1.071   1.00 0.00 ? 97  LEU A C    3  
ATOM 4364  O O    . LEU A 1 89 ? -7.491  -10.371 2.029   1.00 0.00 ? 97  LEU A O    3  
ATOM 4365  C CB   . LEU A 1 89 ? -4.665  -10.130 0.369   1.00 0.00 ? 97  LEU A CB   3  
ATOM 4366  C CG   . LEU A 1 89 ? -3.669  -10.525 -0.723  1.00 0.00 ? 97  LEU A CG   3  
ATOM 4367  C CD1  . LEU A 1 89 ? -2.280  -9.997  -0.397  1.00 0.00 ? 97  LEU A CD1  3  
ATOM 4368  C CD2  . LEU A 1 89 ? -3.640  -12.035 -0.897  1.00 0.00 ? 97  LEU A CD2  3  
ATOM 4369  H H    . LEU A 1 89 ? -5.829  -9.400  -1.776  1.00 0.00 ? 97  LEU A H    3  
ATOM 4370  H HA   . LEU A 1 89 ? -6.290  -11.496 0.103   1.00 0.00 ? 97  LEU A HA   3  
ATOM 4371  H HB2  . LEU A 1 89 ? -4.567  -9.070  0.552   1.00 0.00 ? 97  LEU A HB2  3  
ATOM 4372  H HB3  . LEU A 1 89 ? -4.400  -10.660 1.274   1.00 0.00 ? 97  LEU A HB3  3  
ATOM 4373  H HG   . LEU A 1 89 ? -3.980  -10.084 -1.660  1.00 0.00 ? 97  LEU A HG   3  
ATOM 4374  H HD11 . LEU A 1 89 ? -1.837  -9.581  -1.288  1.00 0.00 ? 97  LEU A HD11 3  
ATOM 4375  H HD12 . LEU A 1 89 ? -1.666  -10.804 -0.032  1.00 0.00 ? 97  LEU A HD12 3  
ATOM 4376  H HD13 . LEU A 1 89 ? -2.355  -9.229  0.360   1.00 0.00 ? 97  LEU A HD13 3  
ATOM 4377  H HD21 . LEU A 1 89 ? -4.379  -12.327 -1.629  1.00 0.00 ? 97  LEU A HD21 3  
ATOM 4378  H HD22 . LEU A 1 89 ? -3.863  -12.511 0.047   1.00 0.00 ? 97  LEU A HD22 3  
ATOM 4379  H HD23 . LEU A 1 89 ? -2.662  -12.340 -1.232  1.00 0.00 ? 97  LEU A HD23 3  
ATOM 4380  N N    . PHE A 1 90 ? -7.283  -8.455  0.863   1.00 0.00 ? 98  PHE A N    3  
ATOM 4381  C CA   . PHE A 1 90 ? -8.125  -7.677  1.766   1.00 0.00 ? 98  PHE A CA   3  
ATOM 4382  C C    . PHE A 1 90 ? -9.499  -8.324  1.935   1.00 0.00 ? 98  PHE A C    3  
ATOM 4383  O O    . PHE A 1 90 ? -9.963  -8.528  3.056   1.00 0.00 ? 98  PHE A O    3  
ATOM 4384  C CB   . PHE A 1 90 ? -8.278  -6.246  1.247   1.00 0.00 ? 98  PHE A CB   3  
ATOM 4385  C CG   . PHE A 1 90 ? -7.627  -5.217  2.127   1.00 0.00 ? 98  PHE A CG   3  
ATOM 4386  C CD1  . PHE A 1 90 ? -6.263  -4.984  2.051   1.00 0.00 ? 98  PHE A CD1  3  
ATOM 4387  C CD2  . PHE A 1 90 ? -8.379  -4.483  3.031   1.00 0.00 ? 98  PHE A CD2  3  
ATOM 4388  C CE1  . PHE A 1 90 ? -5.662  -4.039  2.859   1.00 0.00 ? 98  PHE A CE1  3  
ATOM 4389  C CE2  . PHE A 1 90 ? -7.783  -3.537  3.842   1.00 0.00 ? 98  PHE A CE2  3  
ATOM 4390  C CZ   . PHE A 1 90 ? -6.423  -3.313  3.756   1.00 0.00 ? 98  PHE A CZ   3  
ATOM 4391  H H    . PHE A 1 90 ? -6.884  -8.012  0.083   1.00 0.00 ? 98  PHE A H    3  
ATOM 4392  H HA   . PHE A 1 90 ? -7.637  -7.648  2.728   1.00 0.00 ? 98  PHE A HA   3  
ATOM 4393  H HB2  . PHE A 1 90 ? -7.829  -6.175  0.267   1.00 0.00 ? 98  PHE A HB2  3  
ATOM 4394  H HB3  . PHE A 1 90 ? -9.328  -6.004  1.174   1.00 0.00 ? 98  PHE A HB3  3  
ATOM 4395  H HD1  . PHE A 1 90 ? -5.667  -5.550  1.350   1.00 0.00 ? 98  PHE A HD1  3  
ATOM 4396  H HD2  . PHE A 1 90 ? -9.443  -4.656  3.099   1.00 0.00 ? 98  PHE A HD2  3  
ATOM 4397  H HE1  . PHE A 1 90 ? -4.597  -3.867  2.790   1.00 0.00 ? 98  PHE A HE1  3  
ATOM 4398  H HE2  . PHE A 1 90 ? -8.380  -2.971  4.541   1.00 0.00 ? 98  PHE A HE2  3  
ATOM 4399  H HZ   . PHE A 1 90 ? -5.954  -2.574  4.389   1.00 0.00 ? 98  PHE A HZ   3  
ATOM 4400  N N    . MET A 1 91 ? -10.144 -8.641  0.817   1.00 0.00 ? 99  MET A N    3  
ATOM 4401  C CA   . MET A 1 91 ? -11.464 -9.263  0.847   1.00 0.00 ? 99  MET A CA   3  
ATOM 4402  C C    . MET A 1 91 ? -11.442 -10.552 1.664   1.00 0.00 ? 99  MET A C    3  
ATOM 4403  O O    . MET A 1 91 ? -10.403 -11.200 1.787   1.00 0.00 ? 99  MET A O    3  
ATOM 4404  C CB   . MET A 1 91 ? -11.950 -9.552  -0.574  1.00 0.00 ? 99  MET A CB   3  
ATOM 4405  C CG   . MET A 1 91 ? -11.070 -10.534 -1.330  1.00 0.00 ? 99  MET A CG   3  
ATOM 4406  S SD   . MET A 1 91 ? -11.982 -11.470 -2.571  1.00 0.00 ? 99  MET A SD   3  
ATOM 4407  C CE   . MET A 1 91 ? -12.613 -12.822 -1.581  1.00 0.00 ? 99  MET A CE   3  
ATOM 4408  H H    . MET A 1 91 ? -9.724  -8.453  -0.049  1.00 0.00 ? 99  MET A H    3  
ATOM 4409  H HA   . MET A 1 91 ? -12.146 -8.567  1.315   1.00 0.00 ? 99  MET A HA   3  
ATOM 4410  H HB2  . MET A 1 91 ? -12.948 -9.960  -0.525  1.00 0.00 ? 99  MET A HB2  3  
ATOM 4411  H HB3  . MET A 1 91 ? -11.976 -8.626  -1.129  1.00 0.00 ? 99  MET A HB3  3  
ATOM 4412  H HG2  . MET A 1 91 ? -10.282 -9.985  -1.822  1.00 0.00 ? 99  MET A HG2  3  
ATOM 4413  H HG3  . MET A 1 91 ? -10.637 -11.227 -0.623  1.00 0.00 ? 99  MET A HG3  3  
ATOM 4414  H HE1  . MET A 1 91 ? -11.936 -13.661 -1.643  1.00 0.00 ? 99  MET A HE1  3  
ATOM 4415  H HE2  . MET A 1 91 ? -13.586 -13.115 -1.950  1.00 0.00 ? 99  MET A HE2  3  
ATOM 4416  H HE3  . MET A 1 91 ? -12.700 -12.504 -0.553  1.00 0.00 ? 99  MET A HE3  3  
ATOM 4417  N N    . THR A 1 92 ? -12.593 -10.913 2.222   1.00 0.00 ? 100 THR A N    3  
ATOM 4418  C CA   . THR A 1 92 ? -12.709 -12.125 3.031   1.00 0.00 ? 100 THR A CA   3  
ATOM 4419  C C    . THR A 1 92 ? -14.103 -12.250 3.638   1.00 0.00 ? 100 THR A C    3  
ATOM 4420  O O    . THR A 1 92 ? -14.600 -13.357 3.840   1.00 0.00 ? 100 THR A O    3  
ATOM 4421  C CB   . THR A 1 92 ? -11.659 -12.125 4.145   1.00 0.00 ? 100 THR A CB   3  
ATOM 4422  O OG1  . THR A 1 92 ? -11.923 -13.153 5.083   1.00 0.00 ? 100 THR A OG1  3  
ATOM 4423  C CG2  . THR A 1 92 ? -11.593 -10.817 4.905   1.00 0.00 ? 100 THR A CG2  3  
ATOM 4424  H H    . THR A 1 92 ? -13.385 -10.352 2.085   1.00 0.00 ? 100 THR A H    3  
ATOM 4425  H HA   . THR A 1 92 ? -12.533 -12.971 2.384   1.00 0.00 ? 100 THR A HA   3  
ATOM 4426  H HB   . THR A 1 92 ? -10.686 -12.305 3.710   1.00 0.00 ? 100 THR A HB   3  
ATOM 4427  H HG1  . THR A 1 92 ? -11.765 -14.007 4.674   1.00 0.00 ? 100 THR A HG1  3  
ATOM 4428  H HG21 . THR A 1 92 ? -10.671 -10.307 4.666   1.00 0.00 ? 100 THR A HG21 3  
ATOM 4429  H HG22 . THR A 1 92 ? -11.630 -11.016 5.966   1.00 0.00 ? 100 THR A HG22 3  
ATOM 4430  H HG23 . THR A 1 92 ? -12.431 -10.196 4.626   1.00 0.00 ? 100 THR A HG23 3  
ATOM 4431  N N    . THR B 2 1  ? -3.916  -11.176 15.784  1.00 0.00 ? 111 THR B N    3  
ATOM 4432  C CA   . THR B 2 1  ? -4.345  -9.895  15.234  1.00 0.00 ? 111 THR B CA   3  
ATOM 4433  C C    . THR B 2 1  ? -3.963  -9.779  13.761  1.00 0.00 ? 111 THR B C    3  
ATOM 4434  O O    . THR B 2 1  ? -3.093  -10.503 13.278  1.00 0.00 ? 111 THR B O    3  
ATOM 4435  C CB   . THR B 2 1  ? -3.725  -8.742  16.027  1.00 0.00 ? 111 THR B CB   3  
ATOM 4436  O OG1  . THR B 2 1  ? -2.492  -9.137  16.601  1.00 0.00 ? 111 THR B OG1  3  
ATOM 4437  C CG2  . THR B 2 1  ? -4.613  -8.240  17.145  1.00 0.00 ? 111 THR B CG2  3  
ATOM 4438  H H1   . THR B 2 1  ? -2.992  -11.278 16.092  1.00 0.00 ? 111 THR B H1   3  
ATOM 4439  H HA   . THR B 2 1  ? -5.421  -9.840  15.319  1.00 0.00 ? 111 THR B HA   3  
ATOM 4440  H HB   . THR B 2 1  ? -3.538  -7.917  15.355  1.00 0.00 ? 111 THR B HB   3  
ATOM 4441  H HG1  . THR B 2 1  ? -2.117  -8.401  17.091  1.00 0.00 ? 111 THR B HG1  3  
ATOM 4442  H HG21 . THR B 2 1  ? -4.321  -8.706  18.074  1.00 0.00 ? 111 THR B HG21 3  
ATOM 4443  H HG22 . THR B 2 1  ? -5.642  -8.484  16.925  1.00 0.00 ? 111 THR B HG22 3  
ATOM 4444  H HG23 . THR B 2 1  ? -4.508  -7.167  17.232  1.00 0.00 ? 111 THR B HG23 3  
ATOM 4445  N N    . PRO B 2 2  ? -4.611  -8.859  13.027  1.00 0.00 ? 112 PRO B N    3  
ATOM 4446  C CA   . PRO B 2 2  ? -4.336  -8.648  11.602  1.00 0.00 ? 112 PRO B CA   3  
ATOM 4447  C C    . PRO B 2 2  ? -2.929  -8.113  11.358  1.00 0.00 ? 112 PRO B C    3  
ATOM 4448  O O    . PRO B 2 2  ? -2.158  -7.912  12.298  1.00 0.00 ? 112 PRO B O    3  
ATOM 4449  C CB   . PRO B 2 2  ? -5.383  -7.613  11.179  1.00 0.00 ? 112 PRO B CB   3  
ATOM 4450  C CG   . PRO B 2 2  ? -5.769  -6.922  12.441  1.00 0.00 ? 112 PRO B CG   3  
ATOM 4451  C CD   . PRO B 2 2  ? -5.660  -7.953  13.526  1.00 0.00 ? 112 PRO B CD   3  
ATOM 4452  H HA   . PRO B 2 2  ? -4.475  -9.557  11.035  1.00 0.00 ? 112 PRO B HA   3  
ATOM 4453  H HB2  . PRO B 2 2  ? -4.948  -6.926  10.469  1.00 0.00 ? 112 PRO B HB2  3  
ATOM 4454  H HB3  . PRO B 2 2  ? -6.228  -8.114  10.731  1.00 0.00 ? 112 PRO B HB3  3  
ATOM 4455  H HG2  . PRO B 2 2  ? -5.090  -6.103  12.633  1.00 0.00 ? 112 PRO B HG2  3  
ATOM 4456  H HG3  . PRO B 2 2  ? -6.783  -6.561  12.368  1.00 0.00 ? 112 PRO B HG3  3  
ATOM 4457  H HD2  . PRO B 2 2  ? -5.363  -7.493  14.458  1.00 0.00 ? 112 PRO B HD2  3  
ATOM 4458  H HD3  . PRO B 2 2  ? -6.597  -8.477  13.644  1.00 0.00 ? 112 PRO B HD3  3  
ATOM 4459  N N    . LEU B 2 3  ? -2.600  -7.883  10.092  1.00 0.00 ? 113 LEU B N    3  
ATOM 4460  C CA   . LEU B 2 3  ? -1.285  -7.372  9.724   1.00 0.00 ? 113 LEU B CA   3  
ATOM 4461  C C    . LEU B 2 3  ? -1.098  -5.943  10.224  1.00 0.00 ? 113 LEU B C    3  
ATOM 4462  O O    . LEU B 2 3  ? -2.068  -5.246  10.519  1.00 0.00 ? 113 LEU B O    3  
ATOM 4463  C CB   . LEU B 2 3  ? -1.103  -7.420  8.205   1.00 0.00 ? 113 LEU B CB   3  
ATOM 4464  C CG   . LEU B 2 3  ? -1.514  -8.738  7.545   1.00 0.00 ? 113 LEU B CG   3  
ATOM 4465  C CD1  . LEU B 2 3  ? -2.263  -8.477  6.246   1.00 0.00 ? 113 LEU B CD1  3  
ATOM 4466  C CD2  . LEU B 2 3  ? -0.292  -9.611  7.293   1.00 0.00 ? 113 LEU B CD2  3  
ATOM 4467  H H    . LEU B 2 3  ? -3.257  -8.064  9.387   1.00 0.00 ? 113 LEU B H    3  
ATOM 4468  H HA   . LEU B 2 3  ? -0.542  -8.003  10.186  1.00 0.00 ? 113 LEU B HA   3  
ATOM 4469  H HB2  . LEU B 2 3  ? -1.688  -6.622  7.770   1.00 0.00 ? 113 LEU B HB2  3  
ATOM 4470  H HB3  . LEU B 2 3  ? -0.062  -7.241  7.983   1.00 0.00 ? 113 LEU B HB3  3  
ATOM 4471  H HG   . LEU B 2 3  ? -2.177  -9.273  8.209   1.00 0.00 ? 113 LEU B HG   3  
ATOM 4472  H HD11 . LEU B 2 3  ? -1.967  -9.205  5.507   1.00 0.00 ? 113 LEU B HD11 3  
ATOM 4473  H HD12 . LEU B 2 3  ? -2.027  -7.485  5.889   1.00 0.00 ? 113 LEU B HD12 3  
ATOM 4474  H HD13 . LEU B 2 3  ? -3.325  -8.554  6.422   1.00 0.00 ? 113 LEU B HD13 3  
ATOM 4475  H HD21 . LEU B 2 3  ? 0.511   -9.002  6.904   1.00 0.00 ? 113 LEU B HD21 3  
ATOM 4476  H HD22 . LEU B 2 3  ? -0.542  -10.380 6.578   1.00 0.00 ? 113 LEU B HD22 3  
ATOM 4477  H HD23 . LEU B 2 3  ? 0.020   -10.068 8.220   1.00 0.00 ? 113 LEU B HD23 3  
ATOM 4478  N N    . GLU B 2 4  ? 0.156   -5.513  10.315  1.00 0.00 ? 114 GLU B N    3  
ATOM 4479  C CA   . GLU B 2 4  ? 0.471   -4.166  10.777  1.00 0.00 ? 114 GLU B CA   3  
ATOM 4480  C C    . GLU B 2 4  ? 0.101   -3.130  9.722   1.00 0.00 ? 114 GLU B C    3  
ATOM 4481  O O    . GLU B 2 4  ? -0.115  -3.466  8.557   1.00 0.00 ? 114 GLU B O    3  
ATOM 4482  C CB   . GLU B 2 4  ? 1.958   -4.056  11.118  1.00 0.00 ? 114 GLU B CB   3  
ATOM 4483  C CG   . GLU B 2 4  ? 2.440   -5.124  12.087  1.00 0.00 ? 114 GLU B CG   3  
ATOM 4484  C CD   . GLU B 2 4  ? 3.815   -4.820  12.652  1.00 0.00 ? 114 GLU B CD   3  
ATOM 4485  O OE1  . GLU B 2 4  ? 4.769   -4.695  11.856  1.00 0.00 ? 114 GLU B OE1  3  
ATOM 4486  O OE2  . GLU B 2 4  ? 3.937   -4.709  13.890  1.00 0.00 ? 114 GLU B OE2  3  
ATOM 4487  H H    . GLU B 2 4  ? 0.888   -6.115  10.064  1.00 0.00 ? 114 GLU B H    3  
ATOM 4488  H HA   . GLU B 2 4  ? -0.109  -3.978  11.668  1.00 0.00 ? 114 GLU B HA   3  
ATOM 4489  H HB2  . GLU B 2 4  ? 2.532   -4.142  10.208  1.00 0.00 ? 114 GLU B HB2  3  
ATOM 4490  H HB3  . GLU B 2 4  ? 2.143   -3.089  11.562  1.00 0.00 ? 114 GLU B HB3  3  
ATOM 4491  H HG2  . GLU B 2 4  ? 1.740   -5.193  12.905  1.00 0.00 ? 114 GLU B HG2  3  
ATOM 4492  H HG3  . GLU B 2 4  ? 2.481   -6.070  11.569  1.00 0.00 ? 114 GLU B HG3  3  
ATOM 4493  N N    . ILE B 2 5  ? 0.029   -1.870  10.135  1.00 0.00 ? 115 ILE B N    3  
ATOM 4494  C CA   . ILE B 2 5  ? -0.316  -0.786  9.225   1.00 0.00 ? 115 ILE B CA   3  
ATOM 4495  C C    . ILE B 2 5  ? 0.448   0.488   9.570   1.00 0.00 ? 115 ILE B C    3  
ATOM 4496  O O    . ILE B 2 5  ? 0.536   0.877   10.735  1.00 0.00 ? 115 ILE B O    3  
ATOM 4497  C CB   . ILE B 2 5  ? -1.827  -0.489  9.253   1.00 0.00 ? 115 ILE B CB   3  
ATOM 4498  C CG1  . ILE B 2 5  ? -2.627  -1.783  9.106   1.00 0.00 ? 115 ILE B CG1  3  
ATOM 4499  C CG2  . ILE B 2 5  ? -2.194  0.496   8.153   1.00 0.00 ? 115 ILE B CG2  3  
ATOM 4500  C CD1  . ILE B 2 5  ? -4.124  -1.579  9.172   1.00 0.00 ? 115 ILE B CD1  3  
ATOM 4501  H H    . ILE B 2 5  ? 0.213   -1.665  11.076  1.00 0.00 ? 115 ILE B H    3  
ATOM 4502  H HA   . ILE B 2 5  ? -0.049  -1.094  8.224   1.00 0.00 ? 115 ILE B HA   3  
ATOM 4503  H HB   . ILE B 2 5  ? -2.064  -0.033  10.202  1.00 0.00 ? 115 ILE B HB   3  
ATOM 4504  H HG12 . ILE B 2 5  ? -2.396  -2.235  8.153   1.00 0.00 ? 115 ILE B HG12 3  
ATOM 4505  H HG13 . ILE B 2 5  ? -2.348  -2.462  9.899   1.00 0.00 ? 115 ILE B HG13 3  
ATOM 4506  H HG21 . ILE B 2 5  ? -3.091  1.029   8.431   1.00 0.00 ? 115 ILE B HG21 3  
ATOM 4507  H HG22 . ILE B 2 5  ? -2.366  -0.042  7.232   1.00 0.00 ? 115 ILE B HG22 3  
ATOM 4508  H HG23 . ILE B 2 5  ? -1.386  1.199   8.013   1.00 0.00 ? 115 ILE B HG23 3  
ATOM 4509  H HD11 . ILE B 2 5  ? -4.536  -2.186  9.965   1.00 0.00 ? 115 ILE B HD11 3  
ATOM 4510  H HD12 . ILE B 2 5  ? -4.568  -1.866  8.231   1.00 0.00 ? 115 ILE B HD12 3  
ATOM 4511  H HD13 . ILE B 2 5  ? -4.337  -0.539  9.369   1.00 0.00 ? 115 ILE B HD13 3  
ATOM 4512  N N    . THR B 2 6  ? 1.000   1.134   8.547   1.00 0.00 ? 116 THR B N    3  
ATOM 4513  C CA   . THR B 2 6  ? 1.759   2.366   8.740   1.00 0.00 ? 116 THR B CA   3  
ATOM 4514  C C    . THR B 2 6  ? 1.019   3.558   8.141   1.00 0.00 ? 116 THR B C    3  
ATOM 4515  O O    . THR B 2 6  ? 0.354   3.434   7.113   1.00 0.00 ? 116 THR B O    3  
ATOM 4516  C CB   . THR B 2 6  ? 3.144   2.239   8.104   1.00 0.00 ? 116 THR B CB   3  
ATOM 4517  O OG1  . THR B 2 6  ? 3.809   1.081   8.576   1.00 0.00 ? 116 THR B OG1  3  
ATOM 4518  C CG2  . THR B 2 6  ? 4.040   3.428   8.381   1.00 0.00 ? 116 THR B CG2  3  
ATOM 4519  H H    . THR B 2 6  ? 0.896   0.773   7.641   1.00 0.00 ? 116 THR B H    3  
ATOM 4520  H HA   . THR B 2 6  ? 1.872   2.524   9.801   1.00 0.00 ? 116 THR B HA   3  
ATOM 4521  H HB   . THR B 2 6  ? 3.032   2.152   7.033   1.00 0.00 ? 116 THR B HB   3  
ATOM 4522  H HG1  . THR B 2 6  ? 3.597   0.336   8.009   1.00 0.00 ? 116 THR B HG1  3  
ATOM 4523  H HG21 . THR B 2 6  ? 4.062   4.070   7.512   1.00 0.00 ? 116 THR B HG21 3  
ATOM 4524  H HG22 . THR B 2 6  ? 5.038   3.082   8.600   1.00 0.00 ? 116 THR B HG22 3  
ATOM 4525  H HG23 . THR B 2 6  ? 3.655   3.980   9.225   1.00 0.00 ? 116 THR B HG23 3  
ATOM 4526  N N    . GLU B 2 7  ? 1.141   4.711   8.790   1.00 0.00 ? 117 GLU B N    3  
ATOM 4527  C CA   . GLU B 2 7  ? 0.483   5.924   8.321   1.00 0.00 ? 117 GLU B CA   3  
ATOM 4528  C C    . GLU B 2 7  ? 1.450   6.794   7.525   1.00 0.00 ? 117 GLU B C    3  
ATOM 4529  O O    . GLU B 2 7  ? 2.399   7.352   8.076   1.00 0.00 ? 117 GLU B O    3  
ATOM 4530  C CB   . GLU B 2 7  ? -0.075  6.717   9.504   1.00 0.00 ? 117 GLU B CB   3  
ATOM 4531  C CG   . GLU B 2 7  ? -1.368  6.143   10.063  1.00 0.00 ? 117 GLU B CG   3  
ATOM 4532  C CD   . GLU B 2 7  ? -1.344  6.012   11.574  1.00 0.00 ? 117 GLU B CD   3  
ATOM 4533  O OE1  . GLU B 2 7  ? -0.719  6.868   12.235  1.00 0.00 ? 117 GLU B OE1  3  
ATOM 4534  O OE2  . GLU B 2 7  ? -1.950  5.053   12.095  1.00 0.00 ? 117 GLU B OE2  3  
ATOM 4535  H H    . GLU B 2 7  ? 1.685   4.745   9.605   1.00 0.00 ? 117 GLU B H    3  
ATOM 4536  H HA   . GLU B 2 7  ? -0.332  5.632   7.678   1.00 0.00 ? 117 GLU B HA   3  
ATOM 4537  H HB2  . GLU B 2 7  ? 0.660   6.729   10.296  1.00 0.00 ? 117 GLU B HB2  3  
ATOM 4538  H HB3  . GLU B 2 7  ? -0.266  7.731   9.186   1.00 0.00 ? 117 GLU B HB3  3  
ATOM 4539  H HG2  . GLU B 2 7  ? -2.184  6.795   9.788   1.00 0.00 ? 117 GLU B HG2  3  
ATOM 4540  H HG3  . GLU B 2 7  ? -1.528  5.166   9.633   1.00 0.00 ? 117 GLU B HG3  3  
ATOM 4541  N N    . LEU B 2 8  ? 1.203   6.905   6.223   1.00 0.00 ? 118 LEU B N    3  
ATOM 4542  C CA   . LEU B 2 8  ? 2.051   7.706   5.348   1.00 0.00 ? 118 LEU B CA   3  
ATOM 4543  C C    . LEU B 2 8  ? 1.483   9.112   5.180   1.00 0.00 ? 118 LEU B C    3  
ATOM 4544  O O    . LEU B 2 8  ? 0.548   9.278   4.369   1.00 0.00 ? 118 LEU B O    3  
ATOM 4545  C CB   . LEU B 2 8  ? 2.192   7.032   3.982   1.00 0.00 ? 118 LEU B CB   3  
ATOM 4546  C CG   . LEU B 2 8  ? 2.979   5.720   3.986   1.00 0.00 ? 118 LEU B CG   3  
ATOM 4547  C CD1  . LEU B 2 8  ? 2.405   4.751   2.964   1.00 0.00 ? 118 LEU B CD1  3  
ATOM 4548  C CD2  . LEU B 2 8  ? 4.451   5.982   3.707   1.00 0.00 ? 118 LEU B CD2  3  
ATOM 4549  O OXT  . LEU B 2 8  ? 1.979   10.035  5.859   1.00 0.00 ? 118 LEU B OXT  3  
ATOM 4550  H H    . LEU B 2 8  ? 0.432   6.435   5.842   1.00 0.00 ? 118 LEU B H    3  
ATOM 4551  H HA   . LEU B 2 8  ? 3.027   7.778   5.807   1.00 0.00 ? 118 LEU B HA   3  
ATOM 4552  H HB2  . LEU B 2 8  ? 1.202   6.835   3.598   1.00 0.00 ? 118 LEU B HB2  3  
ATOM 4553  H HB3  . LEU B 2 8  ? 2.688   7.721   3.314   1.00 0.00 ? 118 LEU B HB3  3  
ATOM 4554  H HG   . LEU B 2 8  ? 2.900   5.263   4.962   1.00 0.00 ? 118 LEU B HG   3  
ATOM 4555  H HD11 . LEU B 2 8  ? 3.196   4.121   2.583   1.00 0.00 ? 118 LEU B HD11 3  
ATOM 4556  H HD12 . LEU B 2 8  ? 1.962   5.306   2.151   1.00 0.00 ? 118 LEU B HD12 3  
ATOM 4557  H HD13 . LEU B 2 8  ? 1.651   4.136   3.434   1.00 0.00 ? 118 LEU B HD13 3  
ATOM 4558  H HD21 . LEU B 2 8  ? 4.984   6.076   4.641   1.00 0.00 ? 118 LEU B HD21 3  
ATOM 4559  H HD22 . LEU B 2 8  ? 4.554   6.897   3.142   1.00 0.00 ? 118 LEU B HD22 3  
ATOM 4560  H HD23 . LEU B 2 8  ? 4.862   5.161   3.138   1.00 0.00 ? 118 LEU B HD23 3  
ATOM 4561  N N    . LYS A 1 1  ? -4.319  -2.411  -16.589 1.00 0.00 ? 9   LYS A N    4  
ATOM 4562  C CA   . LYS A 1 1  ? -4.421  -3.047  -15.250 1.00 0.00 ? 9   LYS A CA   4  
ATOM 4563  C C    . LYS A 1 1  ? -3.615  -2.274  -14.209 1.00 0.00 ? 9   LYS A C    4  
ATOM 4564  O O    . LYS A 1 1  ? -4.110  -1.978  -13.121 1.00 0.00 ? 9   LYS A O    4  
ATOM 4565  C CB   . LYS A 1 1  ? -3.912  -4.487  -15.354 1.00 0.00 ? 9   LYS A CB   4  
ATOM 4566  C CG   . LYS A 1 1  ? -4.924  -5.526  -14.902 1.00 0.00 ? 9   LYS A CG   4  
ATOM 4567  C CD   . LYS A 1 1  ? -4.440  -6.938  -15.190 1.00 0.00 ? 9   LYS A CD   4  
ATOM 4568  C CE   . LYS A 1 1  ? -5.255  -7.973  -14.430 1.00 0.00 ? 9   LYS A CE   4  
ATOM 4569  N NZ   . LYS A 1 1  ? -4.952  -7.957  -12.973 1.00 0.00 ? 9   LYS A NZ   4  
ATOM 4570  H H1   . LYS A 1 1  ? -3.388  -2.653  -16.985 1.00 0.00 ? 9   LYS A H1   4  
ATOM 4571  H H2   . LYS A 1 1  ? -4.418  -1.383  -16.460 1.00 0.00 ? 9   LYS A H2   4  
ATOM 4572  H H3   . LYS A 1 1  ? -5.086  -2.791  -17.180 1.00 0.00 ? 9   LYS A H3   4  
ATOM 4573  H HA   . LYS A 1 1  ? -5.460  -3.059  -14.954 1.00 0.00 ? 9   LYS A HA   4  
ATOM 4574  H HB2  . LYS A 1 1  ? -3.654  -4.692  -16.383 1.00 0.00 ? 9   LYS A HB2  4  
ATOM 4575  H HB3  . LYS A 1 1  ? -3.025  -4.590  -14.745 1.00 0.00 ? 9   LYS A HB3  4  
ATOM 4576  H HG2  . LYS A 1 1  ? -5.083  -5.421  -13.839 1.00 0.00 ? 9   LYS A HG2  4  
ATOM 4577  H HG3  . LYS A 1 1  ? -5.854  -5.360  -15.425 1.00 0.00 ? 9   LYS A HG3  4  
ATOM 4578  H HD2  . LYS A 1 1  ? -4.530  -7.130  -16.249 1.00 0.00 ? 9   LYS A HD2  4  
ATOM 4579  H HD3  . LYS A 1 1  ? -3.405  -7.021  -14.894 1.00 0.00 ? 9   LYS A HD3  4  
ATOM 4580  H HE2  . LYS A 1 1  ? -6.305  -7.762  -14.574 1.00 0.00 ? 9   LYS A HE2  4  
ATOM 4581  H HE3  . LYS A 1 1  ? -5.028  -8.952  -14.827 1.00 0.00 ? 9   LYS A HE3  4  
ATOM 4582  H HZ1  . LYS A 1 1  ? -5.336  -8.811  -12.520 1.00 0.00 ? 9   LYS A HZ1  4  
ATOM 4583  H HZ2  . LYS A 1 1  ? -5.381  -7.120  -12.528 1.00 0.00 ? 9   LYS A HZ2  4  
ATOM 4584  H HZ3  . LYS A 1 1  ? -3.925  -7.929  -12.821 1.00 0.00 ? 9   LYS A HZ3  4  
ATOM 4585  N N    . GLU A 1 2  ? -2.374  -1.950  -14.553 1.00 0.00 ? 10  GLU A N    4  
ATOM 4586  C CA   . GLU A 1 2  ? -1.500  -1.212  -13.647 1.00 0.00 ? 10  GLU A CA   4  
ATOM 4587  C C    . GLU A 1 2  ? -1.929  0.246   -13.546 1.00 0.00 ? 10  GLU A C    4  
ATOM 4588  O O    . GLU A 1 2  ? -2.155  0.912   -14.557 1.00 0.00 ? 10  GLU A O    4  
ATOM 4589  C CB   . GLU A 1 2  ? -0.048  -1.296  -14.123 1.00 0.00 ? 10  GLU A CB   4  
ATOM 4590  C CG   . GLU A 1 2  ? 0.436   -2.720  -14.350 1.00 0.00 ? 10  GLU A CG   4  
ATOM 4591  C CD   . GLU A 1 2  ? 1.849   -2.941  -13.850 1.00 0.00 ? 10  GLU A CD   4  
ATOM 4592  O OE1  . GLU A 1 2  ? 2.743   -2.153  -14.226 1.00 0.00 ? 10  GLU A OE1  4  
ATOM 4593  O OE2  . GLU A 1 2  ? 2.063   -3.904  -13.082 1.00 0.00 ? 10  GLU A OE2  4  
ATOM 4594  H H    . GLU A 1 2  ? -2.035  -2.214  -15.434 1.00 0.00 ? 10  GLU A H    4  
ATOM 4595  H HA   . GLU A 1 2  ? -1.575  -1.666  -12.671 1.00 0.00 ? 10  GLU A HA   4  
ATOM 4596  H HB2  . GLU A 1 2  ? 0.046   -0.755  -15.053 1.00 0.00 ? 10  GLU A HB2  4  
ATOM 4597  H HB3  . GLU A 1 2  ? 0.588   -0.836  -13.383 1.00 0.00 ? 10  GLU A HB3  4  
ATOM 4598  H HG2  . GLU A 1 2  ? -0.224  -3.398  -13.830 1.00 0.00 ? 10  GLU A HG2  4  
ATOM 4599  H HG3  . GLU A 1 2  ? 0.406   -2.932  -15.409 1.00 0.00 ? 10  GLU A HG3  4  
ATOM 4600  N N    . LYS A 1 3  ? -2.041  0.740   -12.316 1.00 0.00 ? 11  LYS A N    4  
ATOM 4601  C CA   . LYS A 1 3  ? -2.446  2.123   -12.079 1.00 0.00 ? 11  LYS A CA   4  
ATOM 4602  C C    . LYS A 1 3  ? -1.234  2.989   -11.736 1.00 0.00 ? 11  LYS A C    4  
ATOM 4603  O O    . LYS A 1 3  ? -0.571  2.777   -10.723 1.00 0.00 ? 11  LYS A O    4  
ATOM 4604  C CB   . LYS A 1 3  ? -3.479  2.185   -10.950 1.00 0.00 ? 11  LYS A CB   4  
ATOM 4605  C CG   . LYS A 1 3  ? -3.897  3.600   -10.573 1.00 0.00 ? 11  LYS A CG   4  
ATOM 4606  C CD   . LYS A 1 3  ? -3.790  3.833   -9.073  1.00 0.00 ? 11  LYS A CD   4  
ATOM 4607  C CE   . LYS A 1 3  ? -4.966  3.231   -8.317  1.00 0.00 ? 11  LYS A CE   4  
ATOM 4608  N NZ   . LYS A 1 3  ? -5.394  1.924   -8.889  1.00 0.00 ? 11  LYS A NZ   4  
ATOM 4609  H H    . LYS A 1 3  ? -1.848  0.159   -11.549 1.00 0.00 ? 11  LYS A H    4  
ATOM 4610  H HA   . LYS A 1 3  ? -2.893  2.496   -12.987 1.00 0.00 ? 11  LYS A HA   4  
ATOM 4611  H HB2  . LYS A 1 3  ? -4.361  1.645   -11.258 1.00 0.00 ? 11  LYS A HB2  4  
ATOM 4612  H HB3  . LYS A 1 3  ? -3.068  1.709   -10.074 1.00 0.00 ? 11  LYS A HB3  4  
ATOM 4613  H HG2  . LYS A 1 3  ? -3.254  4.302   -11.081 1.00 0.00 ? 11  LYS A HG2  4  
ATOM 4614  H HG3  . LYS A 1 3  ? -4.920  3.758   -10.880 1.00 0.00 ? 11  LYS A HG3  4  
ATOM 4615  H HD2  . LYS A 1 3  ? -2.880  3.381   -8.714  1.00 0.00 ? 11  LYS A HD2  4  
ATOM 4616  H HD3  . LYS A 1 3  ? -3.761  4.896   -8.887  1.00 0.00 ? 11  LYS A HD3  4  
ATOM 4617  H HE2  . LYS A 1 3  ? -4.675  3.082   -7.288  1.00 0.00 ? 11  LYS A HE2  4  
ATOM 4618  H HE3  . LYS A 1 3  ? -5.794  3.922   -8.360  1.00 0.00 ? 11  LYS A HE3  4  
ATOM 4619  H HZ1  . LYS A 1 3  ? -4.597  1.255   -8.889  1.00 0.00 ? 11  LYS A HZ1  4  
ATOM 4620  H HZ2  . LYS A 1 3  ? -5.725  2.051   -9.867  1.00 0.00 ? 11  LYS A HZ2  4  
ATOM 4621  H HZ3  . LYS A 1 3  ? -6.169  1.523   -8.323  1.00 0.00 ? 11  LYS A HZ3  4  
ATOM 4622  N N    . LYS A 1 4  ? -0.952  3.969   -12.589 1.00 0.00 ? 12  LYS A N    4  
ATOM 4623  C CA   . LYS A 1 4  ? 0.178   4.864   -12.373 1.00 0.00 ? 12  LYS A CA   4  
ATOM 4624  C C    . LYS A 1 4  ? -0.221  6.032   -11.478 1.00 0.00 ? 12  LYS A C    4  
ATOM 4625  O O    . LYS A 1 4  ? -1.252  6.668   -11.693 1.00 0.00 ? 12  LYS A O    4  
ATOM 4626  C CB   . LYS A 1 4  ? 0.707   5.385   -13.711 1.00 0.00 ? 12  LYS A CB   4  
ATOM 4627  C CG   . LYS A 1 4  ? 1.939   4.646   -14.208 1.00 0.00 ? 12  LYS A CG   4  
ATOM 4628  C CD   . LYS A 1 4  ? 3.177   5.027   -13.413 1.00 0.00 ? 12  LYS A CD   4  
ATOM 4629  C CE   . LYS A 1 4  ? 3.869   6.242   -14.008 1.00 0.00 ? 12  LYS A CE   4  
ATOM 4630  N NZ   . LYS A 1 4  ? 5.002   5.859   -14.895 1.00 0.00 ? 12  LYS A NZ   4  
ATOM 4631  H H    . LYS A 1 4  ? -1.517  4.092   -13.381 1.00 0.00 ? 12  LYS A H    4  
ATOM 4632  H HA   . LYS A 1 4  ? 0.959   4.300   -11.883 1.00 0.00 ? 12  LYS A HA   4  
ATOM 4633  H HB2  . LYS A 1 4  ? -0.070  5.284   -14.454 1.00 0.00 ? 12  LYS A HB2  4  
ATOM 4634  H HB3  . LYS A 1 4  ? 0.959   6.430   -13.606 1.00 0.00 ? 12  LYS A HB3  4  
ATOM 4635  H HG2  . LYS A 1 4  ? 1.774   3.583   -14.111 1.00 0.00 ? 12  LYS A HG2  4  
ATOM 4636  H HG3  . LYS A 1 4  ? 2.100   4.894   -15.247 1.00 0.00 ? 12  LYS A HG3  4  
ATOM 4637  H HD2  . LYS A 1 4  ? 2.885   5.253   -12.398 1.00 0.00 ? 12  LYS A HD2  4  
ATOM 4638  H HD3  . LYS A 1 4  ? 3.864   4.194   -13.416 1.00 0.00 ? 12  LYS A HD3  4  
ATOM 4639  H HE2  . LYS A 1 4  ? 3.150   6.808   -14.582 1.00 0.00 ? 12  LYS A HE2  4  
ATOM 4640  H HE3  . LYS A 1 4  ? 4.247   6.857   -13.202 1.00 0.00 ? 12  LYS A HE3  4  
ATOM 4641  H HZ1  . LYS A 1 4  ? 4.640   5.492   -15.799 1.00 0.00 ? 12  LYS A HZ1  4  
ATOM 4642  H HZ2  . LYS A 1 4  ? 5.578   5.121   -14.442 1.00 0.00 ? 12  LYS A HZ2  4  
ATOM 4643  H HZ3  . LYS A 1 4  ? 5.604   6.685   -15.085 1.00 0.00 ? 12  LYS A HZ3  4  
ATOM 4644  N N    . VAL A 1 5  ? 0.599   6.304   -10.468 1.00 0.00 ? 13  VAL A N    4  
ATOM 4645  C CA   . VAL A 1 5  ? 0.326   7.392   -9.537  1.00 0.00 ? 13  VAL A CA   4  
ATOM 4646  C C    . VAL A 1 5  ? 1.606   8.132   -9.159  1.00 0.00 ? 13  VAL A C    4  
ATOM 4647  O O    . VAL A 1 5  ? 2.688   7.546   -9.118  1.00 0.00 ? 13  VAL A O    4  
ATOM 4648  C CB   . VAL A 1 5  ? -0.350  6.869   -8.256  1.00 0.00 ? 13  VAL A CB   4  
ATOM 4649  C CG1  . VAL A 1 5  ? -0.740  8.023   -7.344  1.00 0.00 ? 13  VAL A CG1  4  
ATOM 4650  C CG2  . VAL A 1 5  ? -1.566  6.025   -8.604  1.00 0.00 ? 13  VAL A CG2  4  
ATOM 4651  H H    . VAL A 1 5  ? 1.404   5.759   -10.344 1.00 0.00 ? 13  VAL A H    4  
ATOM 4652  H HA   . VAL A 1 5  ? -0.348  8.082   -10.020 1.00 0.00 ? 13  VAL A HA   4  
ATOM 4653  H HB   . VAL A 1 5  ? 0.356   6.246   -7.727  1.00 0.00 ? 13  VAL A HB   4  
ATOM 4654  H HG11 . VAL A 1 5  ? -1.654  7.776   -6.825  1.00 0.00 ? 13  VAL A HG11 4  
ATOM 4655  H HG12 . VAL A 1 5  ? -0.891  8.914   -7.936  1.00 0.00 ? 13  VAL A HG12 4  
ATOM 4656  H HG13 . VAL A 1 5  ? 0.046   8.196   -6.626  1.00 0.00 ? 13  VAL A HG13 4  
ATOM 4657  H HG21 . VAL A 1 5  ? -2.062  5.716   -7.694  1.00 0.00 ? 13  VAL A HG21 4  
ATOM 4658  H HG22 . VAL A 1 5  ? -1.251  5.152   -9.156  1.00 0.00 ? 13  VAL A HG22 4  
ATOM 4659  H HG23 . VAL A 1 5  ? -2.247  6.606   -9.207  1.00 0.00 ? 13  VAL A HG23 4  
ATOM 4660  N N    . PHE A 1 6  ? 1.472   9.425   -8.882  1.00 0.00 ? 14  PHE A N    4  
ATOM 4661  C CA   . PHE A 1 6  ? 2.612   10.251  -8.503  1.00 0.00 ? 14  PHE A CA   4  
ATOM 4662  C C    . PHE A 1 6  ? 2.323   11.009  -7.212  1.00 0.00 ? 14  PHE A C    4  
ATOM 4663  O O    . PHE A 1 6  ? 1.269   11.630  -7.068  1.00 0.00 ? 14  PHE A O    4  
ATOM 4664  C CB   . PHE A 1 6  ? 2.948   11.239  -9.623  1.00 0.00 ? 14  PHE A CB   4  
ATOM 4665  C CG   . PHE A 1 6  ? 3.397   10.577  -10.895 1.00 0.00 ? 14  PHE A CG   4  
ATOM 4666  C CD1  . PHE A 1 6  ? 2.539   9.744   -11.597 1.00 0.00 ? 14  PHE A CD1  4  
ATOM 4667  C CD2  . PHE A 1 6  ? 4.674   10.789  -11.388 1.00 0.00 ? 14  PHE A CD2  4  
ATOM 4668  C CE1  . PHE A 1 6  ? 2.949   9.136   -12.768 1.00 0.00 ? 14  PHE A CE1  4  
ATOM 4669  C CE2  . PHE A 1 6  ? 5.089   10.182  -12.558 1.00 0.00 ? 14  PHE A CE2  4  
ATOM 4670  C CZ   . PHE A 1 6  ? 4.225   9.355   -13.249 1.00 0.00 ? 14  PHE A CZ   4  
ATOM 4671  H H    . PHE A 1 6  ? 0.583   9.834   -8.931  1.00 0.00 ? 14  PHE A H    4  
ATOM 4672  H HA   . PHE A 1 6  ? 3.457   9.598   -8.343  1.00 0.00 ? 14  PHE A HA   4  
ATOM 4673  H HB2  . PHE A 1 6  ? 2.073   11.829  -9.848  1.00 0.00 ? 14  PHE A HB2  4  
ATOM 4674  H HB3  . PHE A 1 6  ? 3.742   11.891  -9.290  1.00 0.00 ? 14  PHE A HB3  4  
ATOM 4675  H HD1  . PHE A 1 6  ? 1.542   9.572   -11.223 1.00 0.00 ? 14  PHE A HD1  4  
ATOM 4676  H HD2  . PHE A 1 6  ? 5.350   11.435  -10.848 1.00 0.00 ? 14  PHE A HD2  4  
ATOM 4677  H HE1  . PHE A 1 6  ? 2.273   8.489   -13.307 1.00 0.00 ? 14  PHE A HE1  4  
ATOM 4678  H HE2  . PHE A 1 6  ? 6.087   10.356  -12.933 1.00 0.00 ? 14  PHE A HE2  4  
ATOM 4679  H HZ   . PHE A 1 6  ? 4.548   8.879   -14.164 1.00 0.00 ? 14  PHE A HZ   4  
ATOM 4680  N N    . ILE A 1 7  ? 3.262   10.955  -6.274  1.00 0.00 ? 15  ILE A N    4  
ATOM 4681  C CA   . ILE A 1 7  ? 3.102   11.638  -4.994  1.00 0.00 ? 15  ILE A CA   4  
ATOM 4682  C C    . ILE A 1 7  ? 4.233   12.634  -4.756  1.00 0.00 ? 15  ILE A C    4  
ATOM 4683  O O    . ILE A 1 7  ? 5.410   12.304  -4.913  1.00 0.00 ? 15  ILE A O    4  
ATOM 4684  C CB   . ILE A 1 7  ? 3.057   10.635  -3.825  1.00 0.00 ? 15  ILE A CB   4  
ATOM 4685  C CG1  . ILE A 1 7  ? 2.025   9.541   -4.102  1.00 0.00 ? 15  ILE A CG1  4  
ATOM 4686  C CG2  . ILE A 1 7  ? 2.738   11.352  -2.521  1.00 0.00 ? 15  ILE A CG2  4  
ATOM 4687  C CD1  . ILE A 1 7  ? 0.620   10.069  -4.297  1.00 0.00 ? 15  ILE A CD1  4  
ATOM 4688  H H    . ILE A 1 7  ? 4.082   10.445  -6.444  1.00 0.00 ? 15  ILE A H    4  
ATOM 4689  H HA   . ILE A 1 7  ? 2.165   12.174  -5.019  1.00 0.00 ? 15  ILE A HA   4  
ATOM 4690  H HB   . ILE A 1 7  ? 4.033   10.184  -3.729  1.00 0.00 ? 15  ILE A HB   4  
ATOM 4691  H HG12 . ILE A 1 7  ? 2.305   9.010   -4.999  1.00 0.00 ? 15  ILE A HG12 4  
ATOM 4692  H HG13 . ILE A 1 7  ? 2.009   8.851   -3.271  1.00 0.00 ? 15  ILE A HG13 4  
ATOM 4693  H HG21 . ILE A 1 7  ? 2.670   10.631  -1.722  1.00 0.00 ? 15  ILE A HG21 4  
ATOM 4694  H HG22 . ILE A 1 7  ? 1.797   11.873  -2.618  1.00 0.00 ? 15  ILE A HG22 4  
ATOM 4695  H HG23 . ILE A 1 7  ? 3.521   12.064  -2.301  1.00 0.00 ? 15  ILE A HG23 4  
ATOM 4696  H HD11 . ILE A 1 7  ? -0.030  9.262   -4.600  1.00 0.00 ? 15  ILE A HD11 4  
ATOM 4697  H HD12 . ILE A 1 7  ? 0.625   10.835  -5.060  1.00 0.00 ? 15  ILE A HD12 4  
ATOM 4698  H HD13 . ILE A 1 7  ? 0.262   10.490  -3.369  1.00 0.00 ? 15  ILE A HD13 4  
ATOM 4699  N N    . SER A 1 8  ? 3.867   13.854  -4.374  1.00 0.00 ? 16  SER A N    4  
ATOM 4700  C CA   . SER A 1 8  ? 4.848   14.900  -4.112  1.00 0.00 ? 16  SER A CA   4  
ATOM 4701  C C    . SER A 1 8  ? 4.488   15.679  -2.849  1.00 0.00 ? 16  SER A C    4  
ATOM 4702  O O    . SER A 1 8  ? 3.327   15.713  -2.440  1.00 0.00 ? 16  SER A O    4  
ATOM 4703  C CB   . SER A 1 8  ? 4.939   15.854  -5.305  1.00 0.00 ? 16  SER A CB   4  
ATOM 4704  O OG   . SER A 1 8  ? 4.605   15.192  -6.513  1.00 0.00 ? 16  SER A OG   4  
ATOM 4705  H H    . SER A 1 8  ? 2.914   14.054  -4.265  1.00 0.00 ? 16  SER A H    4  
ATOM 4706  H HA   . SER A 1 8  ? 5.807   14.427  -3.966  1.00 0.00 ? 16  SER A HA   4  
ATOM 4707  H HB2  . SER A 1 8  ? 4.255   16.676  -5.159  1.00 0.00 ? 16  SER A HB2  4  
ATOM 4708  H HB3  . SER A 1 8  ? 5.947   16.233  -5.383  1.00 0.00 ? 16  SER A HB3  4  
ATOM 4709  H HG   . SER A 1 8  ? 4.312   15.838  -7.160  1.00 0.00 ? 16  SER A HG   4  
ATOM 4710  N N    . LEU A 1 9  ? 5.490   16.304  -2.239  1.00 0.00 ? 17  LEU A N    4  
ATOM 4711  C CA   . LEU A 1 9  ? 5.278   17.082  -1.024  1.00 0.00 ? 17  LEU A CA   4  
ATOM 4712  C C    . LEU A 1 9  ? 5.063   18.557  -1.355  1.00 0.00 ? 17  LEU A C    4  
ATOM 4713  O O    . LEU A 1 9  ? 5.660   19.437  -0.734  1.00 0.00 ? 17  LEU A O    4  
ATOM 4714  C CB   . LEU A 1 9  ? 6.474   16.925  -0.080  1.00 0.00 ? 17  LEU A CB   4  
ATOM 4715  C CG   . LEU A 1 9  ? 6.119   16.849  1.408   1.00 0.00 ? 17  LEU A CG   4  
ATOM 4716  C CD1  . LEU A 1 9  ? 6.440   15.470  1.968   1.00 0.00 ? 17  LEU A CD1  4  
ATOM 4717  C CD2  . LEU A 1 9  ? 6.857   17.926  2.191   1.00 0.00 ? 17  LEU A CD2  4  
ATOM 4718  H H    . LEU A 1 9  ? 6.392   16.239  -2.615  1.00 0.00 ? 17  LEU A H    4  
ATOM 4719  H HA   . LEU A 1 9  ? 4.394   16.703  -0.537  1.00 0.00 ? 17  LEU A HA   4  
ATOM 4720  H HB2  . LEU A 1 9  ? 7.001   16.022  -0.352  1.00 0.00 ? 17  LEU A HB2  4  
ATOM 4721  H HB3  . LEU A 1 9  ? 7.136   17.764  -0.228  1.00 0.00 ? 17  LEU A HB3  4  
ATOM 4722  H HG   . LEU A 1 9  ? 5.058   17.017  1.527   1.00 0.00 ? 17  LEU A HG   4  
ATOM 4723  H HD11 . LEU A 1 9  ? 6.248   14.723  1.212   1.00 0.00 ? 17  LEU A HD11 4  
ATOM 4724  H HD12 . LEU A 1 9  ? 5.819   15.278  2.829   1.00 0.00 ? 17  LEU A HD12 4  
ATOM 4725  H HD13 . LEU A 1 9  ? 7.480   15.433  2.256   1.00 0.00 ? 17  LEU A HD13 4  
ATOM 4726  H HD21 . LEU A 1 9  ? 7.134   18.730  1.524   1.00 0.00 ? 17  LEU A HD21 4  
ATOM 4727  H HD22 . LEU A 1 9  ? 7.747   17.502  2.634   1.00 0.00 ? 17  LEU A HD22 4  
ATOM 4728  H HD23 . LEU A 1 9  ? 6.213   18.308  2.970   1.00 0.00 ? 17  LEU A HD23 4  
ATOM 4729  N N    . VAL A 1 10 ? 4.208   18.818  -2.338  1.00 0.00 ? 18  VAL A N    4  
ATOM 4730  C CA   . VAL A 1 10 ? 3.914   20.186  -2.752  1.00 0.00 ? 18  VAL A CA   4  
ATOM 4731  C C    . VAL A 1 10 ? 2.770   20.773  -1.933  1.00 0.00 ? 18  VAL A C    4  
ATOM 4732  O O    . VAL A 1 10 ? 1.625   20.811  -2.384  1.00 0.00 ? 18  VAL A O    4  
ATOM 4733  C CB   . VAL A 1 10 ? 3.550   20.255  -4.248  1.00 0.00 ? 18  VAL A CB   4  
ATOM 4734  C CG1  . VAL A 1 10 ? 3.396   21.700  -4.697  1.00 0.00 ? 18  VAL A CG1  4  
ATOM 4735  C CG2  . VAL A 1 10 ? 4.599   19.539  -5.088  1.00 0.00 ? 18  VAL A CG2  4  
ATOM 4736  H H    . VAL A 1 10 ? 3.765   18.075  -2.796  1.00 0.00 ? 18  VAL A H    4  
ATOM 4737  H HA   . VAL A 1 10 ? 4.801   20.781  -2.591  1.00 0.00 ? 18  VAL A HA   4  
ATOM 4738  H HB   . VAL A 1 10 ? 2.604   19.754  -4.391  1.00 0.00 ? 18  VAL A HB   4  
ATOM 4739  H HG11 . VAL A 1 10 ? 4.298   22.023  -5.194  1.00 0.00 ? 18  VAL A HG11 4  
ATOM 4740  H HG12 . VAL A 1 10 ? 3.214   22.327  -3.836  1.00 0.00 ? 18  VAL A HG12 4  
ATOM 4741  H HG13 . VAL A 1 10 ? 2.562   21.777  -5.380  1.00 0.00 ? 18  VAL A HG13 4  
ATOM 4742  H HG21 . VAL A 1 10 ? 5.257   20.268  -5.538  1.00 0.00 ? 18  VAL A HG21 4  
ATOM 4743  H HG22 . VAL A 1 10 ? 4.111   18.968  -5.863  1.00 0.00 ? 18  VAL A HG22 4  
ATOM 4744  H HG23 . VAL A 1 10 ? 5.174   18.876  -4.459  1.00 0.00 ? 18  VAL A HG23 4  
ATOM 4745  N N    . GLY A 1 11 ? 3.086   21.232  -0.727  1.00 0.00 ? 19  GLY A N    4  
ATOM 4746  C CA   . GLY A 1 11 ? 2.076   21.812  0.138   1.00 0.00 ? 19  GLY A CA   4  
ATOM 4747  C C    . GLY A 1 11 ? 2.427   21.689  1.606   1.00 0.00 ? 19  GLY A C    4  
ATOM 4748  O O    . GLY A 1 11 ? 3.354   22.342  2.087   1.00 0.00 ? 19  GLY A O    4  
ATOM 4749  H H    . GLY A 1 11 ? 4.016   21.176  -0.421  1.00 0.00 ? 19  GLY A H    4  
ATOM 4750  H HA2  . GLY A 1 11 ? 1.966   22.859  -0.109  1.00 0.00 ? 19  GLY A HA2  4  
ATOM 4751  H HA3  . GLY A 1 11 ? 1.136   21.311  -0.041  1.00 0.00 ? 19  GLY A HA3  4  
ATOM 4752  N N    . SER A 1 12 ? 1.684   20.851  2.323   1.00 0.00 ? 20  SER A N    4  
ATOM 4753  C CA   . SER A 1 12 ? 1.922   20.645  3.748   1.00 0.00 ? 20  SER A CA   4  
ATOM 4754  C C    . SER A 1 12 ? 1.539   19.228  4.165   1.00 0.00 ? 20  SER A C    4  
ATOM 4755  O O    . SER A 1 12 ? 1.121   18.998  5.298   1.00 0.00 ? 20  SER A O    4  
ATOM 4756  C CB   . SER A 1 12 ? 1.128   21.661  4.569   1.00 0.00 ? 20  SER A CB   4  
ATOM 4757  O OG   . SER A 1 12 ? 1.506   21.622  5.934   1.00 0.00 ? 20  SER A OG   4  
ATOM 4758  H H    . SER A 1 12 ? 0.959   20.359  1.882   1.00 0.00 ? 20  SER A H    4  
ATOM 4759  H HA   . SER A 1 12 ? 2.975   20.789  3.932   1.00 0.00 ? 20  SER A HA   4  
ATOM 4760  H HB2  . SER A 1 12 ? 1.314   22.655  4.186   1.00 0.00 ? 20  SER A HB2  4  
ATOM 4761  H HB3  . SER A 1 12 ? 0.074   21.438  4.494   1.00 0.00 ? 20  SER A HB3  4  
ATOM 4762  H HG   . SER A 1 12 ? 1.323   20.750  6.293   1.00 0.00 ? 20  SER A HG   4  
ATOM 4763  N N    . ARG A 1 13 ? 1.686   18.284  3.240   1.00 0.00 ? 21  ARG A N    4  
ATOM 4764  C CA   . ARG A 1 13 ? 1.356   16.890  3.513   1.00 0.00 ? 21  ARG A CA   4  
ATOM 4765  C C    . ARG A 1 13 ? 2.227   15.953  2.685   1.00 0.00 ? 21  ARG A C    4  
ATOM 4766  O O    . ARG A 1 13 ? 2.582   16.262  1.548   1.00 0.00 ? 21  ARG A O    4  
ATOM 4767  C CB   . ARG A 1 13 ? -0.121  16.624  3.217   1.00 0.00 ? 21  ARG A CB   4  
ATOM 4768  C CG   . ARG A 1 13 ? -0.600  17.241  1.913   1.00 0.00 ? 21  ARG A CG   4  
ATOM 4769  C CD   . ARG A 1 13 ? -1.510  18.435  2.155   1.00 0.00 ? 21  ARG A CD   4  
ATOM 4770  N NE   . ARG A 1 13 ? -2.855  18.026  2.555   1.00 0.00 ? 21  ARG A NE   4  
ATOM 4771  C CZ   . ARG A 1 13 ? -3.290  18.009  3.815   1.00 0.00 ? 21  ARG A CZ   4  
ATOM 4772  N NH1  . ARG A 1 13 ? -2.493  18.375  4.813   1.00 0.00 ? 21  ARG A NH1  4  
ATOM 4773  N NH2  . ARG A 1 13 ? -4.530  17.622  4.079   1.00 0.00 ? 21  ARG A NH2  4  
ATOM 4774  H H    . ARG A 1 13 ? 2.024   18.530  2.354   1.00 0.00 ? 21  ARG A H    4  
ATOM 4775  H HA   . ARG A 1 13 ? 1.543   16.705  4.561   1.00 0.00 ? 21  ARG A HA   4  
ATOM 4776  H HB2  . ARG A 1 13 ? -0.278  15.557  3.164   1.00 0.00 ? 21  ARG A HB2  4  
ATOM 4777  H HB3  . ARG A 1 13 ? -0.717  17.027  4.022   1.00 0.00 ? 21  ARG A HB3  4  
ATOM 4778  H HG2  . ARG A 1 13 ? 0.259   17.568  1.344   1.00 0.00 ? 21  ARG A HG2  4  
ATOM 4779  H HG3  . ARG A 1 13 ? -1.142  16.495  1.350   1.00 0.00 ? 21  ARG A HG3  4  
ATOM 4780  H HD2  . ARG A 1 13 ? -1.080  19.048  2.934   1.00 0.00 ? 21  ARG A HD2  4  
ATOM 4781  H HD3  . ARG A 1 13 ? -1.575  19.011  1.244   1.00 0.00 ? 21  ARG A HD3  4  
ATOM 4782  H HE   . ARG A 1 13 ? -3.470  17.749  1.844   1.00 0.00 ? 21  ARG A HE   4  
ATOM 4783  H HH11 . ARG A 1 13 ? -1.557  18.669  4.627   1.00 0.00 ? 21  ARG A HH11 4  
ATOM 4784  H HH12 . ARG A 1 13 ? -2.832  18.358  5.754   1.00 0.00 ? 21  ARG A HH12 4  
ATOM 4785  H HH21 . ARG A 1 13 ? -5.136  17.343  3.334   1.00 0.00 ? 21  ARG A HH21 4  
ATOM 4786  H HH22 . ARG A 1 13 ? -4.859  17.607  5.023   1.00 0.00 ? 21  ARG A HH22 4  
ATOM 4787  N N    . GLY A 1 14 ? 2.565   14.805  3.262   1.00 0.00 ? 22  GLY A N    4  
ATOM 4788  C CA   . GLY A 1 14 ? 3.390   13.840  2.560   1.00 0.00 ? 22  GLY A CA   4  
ATOM 4789  C C    . GLY A 1 14 ? 2.622   13.094  1.488   1.00 0.00 ? 22  GLY A C    4  
ATOM 4790  O O    . GLY A 1 14 ? 3.020   13.084  0.324   1.00 0.00 ? 22  GLY A O    4  
ATOM 4791  H H    . GLY A 1 14 ? 2.251   14.612  4.170   1.00 0.00 ? 22  GLY A H    4  
ATOM 4792  H HA2  . GLY A 1 14 ? 4.219   14.356  2.100   1.00 0.00 ? 22  GLY A HA2  4  
ATOM 4793  H HA3  . GLY A 1 14 ? 3.775   13.126  3.273   1.00 0.00 ? 22  GLY A HA3  4  
ATOM 4794  N N    . LEU A 1 15 ? 1.518   12.466  1.881   1.00 0.00 ? 23  LEU A N    4  
ATOM 4795  C CA   . LEU A 1 15 ? 0.694   11.713  0.949   1.00 0.00 ? 23  LEU A CA   4  
ATOM 4796  C C    . LEU A 1 15 ? -0.775  11.769  1.362   1.00 0.00 ? 23  LEU A C    4  
ATOM 4797  O O    . LEU A 1 15 ? -1.613  12.311  0.642   1.00 0.00 ? 23  LEU A O    4  
ATOM 4798  C CB   . LEU A 1 15 ? 1.176   10.259  0.884   1.00 0.00 ? 23  LEU A CB   4  
ATOM 4799  C CG   . LEU A 1 15 ? 0.154   9.248   0.364   1.00 0.00 ? 23  LEU A CG   4  
ATOM 4800  C CD1  . LEU A 1 15 ? -0.151  9.501   -1.103  1.00 0.00 ? 23  LEU A CD1  4  
ATOM 4801  C CD2  . LEU A 1 15 ? 0.657   7.828   0.570   1.00 0.00 ? 23  LEU A CD2  4  
ATOM 4802  H H    . LEU A 1 15 ? 1.254   12.508  2.824   1.00 0.00 ? 23  LEU A H    4  
ATOM 4803  H HA   . LEU A 1 15 ? 0.801   12.163  -0.026  1.00 0.00 ? 23  LEU A HA   4  
ATOM 4804  H HB2  . LEU A 1 15 ? 2.046   10.219  0.244   1.00 0.00 ? 23  LEU A HB2  4  
ATOM 4805  H HB3  . LEU A 1 15 ? 1.469   9.959   1.877   1.00 0.00 ? 23  LEU A HB3  4  
ATOM 4806  H HG   . LEU A 1 15 ? -0.765  9.362   0.921   1.00 0.00 ? 23  LEU A HG   4  
ATOM 4807  H HD11 . LEU A 1 15 ? 0.774   9.620   -1.648  1.00 0.00 ? 23  LEU A HD11 4  
ATOM 4808  H HD12 . LEU A 1 15 ? -0.743  10.400  -1.198  1.00 0.00 ? 23  LEU A HD12 4  
ATOM 4809  H HD13 . LEU A 1 15 ? -0.701  8.663   -1.506  1.00 0.00 ? 23  LEU A HD13 4  
ATOM 4810  H HD21 . LEU A 1 15 ? 0.283   7.446   1.509   1.00 0.00 ? 23  LEU A HD21 4  
ATOM 4811  H HD22 . LEU A 1 15 ? 1.737   7.829   0.588   1.00 0.00 ? 23  LEU A HD22 4  
ATOM 4812  H HD23 . LEU A 1 15 ? 0.310   7.201   -0.238  1.00 0.00 ? 23  LEU A HD23 4  
ATOM 4813  N N    . GLY A 1 16 ? -1.079  11.196  2.522   1.00 0.00 ? 24  GLY A N    4  
ATOM 4814  C CA   . GLY A 1 16 ? -2.445  11.183  3.010   1.00 0.00 ? 24  GLY A CA   4  
ATOM 4815  C C    . GLY A 1 16 ? -3.061  9.799   2.942   1.00 0.00 ? 24  GLY A C    4  
ATOM 4816  O O    . GLY A 1 16 ? -4.249  9.653   2.650   1.00 0.00 ? 24  GLY A O    4  
ATOM 4817  H H    . GLY A 1 16 ? -0.368  10.774  3.050   1.00 0.00 ? 24  GLY A H    4  
ATOM 4818  H HA2  . GLY A 1 16 ? -2.457  11.522  4.035   1.00 0.00 ? 24  GLY A HA2  4  
ATOM 4819  H HA3  . GLY A 1 16 ? -3.036  11.857  2.410   1.00 0.00 ? 24  GLY A HA3  4  
ATOM 4820  N N    . CYS A 1 17 ? -2.247  8.782   3.203   1.00 0.00 ? 25  CYS A N    4  
ATOM 4821  C CA   . CYS A 1 17 ? -2.706  7.398   3.161   1.00 0.00 ? 25  CYS A CA   4  
ATOM 4822  C C    . CYS A 1 17 ? -1.758  6.496   3.950   1.00 0.00 ? 25  CYS A C    4  
ATOM 4823  O O    . CYS A 1 17 ? -0.612  6.863   4.210   1.00 0.00 ? 25  CYS A O    4  
ATOM 4824  C CB   . CYS A 1 17 ? -2.819  6.941   1.699   1.00 0.00 ? 25  CYS A CB   4  
ATOM 4825  S SG   . CYS A 1 17 ? -2.772  5.148   1.438   1.00 0.00 ? 25  CYS A SG   4  
ATOM 4826  H H    . CYS A 1 17 ? -1.309  8.966   3.421   1.00 0.00 ? 25  CYS A H    4  
ATOM 4827  H HA   . CYS A 1 17 ? -3.683  7.359   3.617   1.00 0.00 ? 25  CYS A HA   4  
ATOM 4828  H HB2  . CYS A 1 17 ? -3.754  7.296   1.299   1.00 0.00 ? 25  CYS A HB2  4  
ATOM 4829  H HB3  . CYS A 1 17 ? -2.011  7.376   1.133   1.00 0.00 ? 25  CYS A HB3  4  
ATOM 4830  H HG   . CYS A 1 17 ? -3.236  4.955   0.621   1.00 0.00 ? 25  CYS A HG   4  
ATOM 4831  N N    . SER A 1 18 ? -2.241  5.316   4.330   1.00 0.00 ? 26  SER A N    4  
ATOM 4832  C CA   . SER A 1 18 ? -1.432  4.369   5.088   1.00 0.00 ? 26  SER A CA   4  
ATOM 4833  C C    . SER A 1 18 ? -1.166  3.113   4.264   1.00 0.00 ? 26  SER A C    4  
ATOM 4834  O O    . SER A 1 18 ? -1.707  2.955   3.170   1.00 0.00 ? 26  SER A O    4  
ATOM 4835  C CB   . SER A 1 18 ? -2.134  3.999   6.395   1.00 0.00 ? 26  SER A CB   4  
ATOM 4836  O OG   . SER A 1 18 ? -1.908  4.978   7.394   1.00 0.00 ? 26  SER A OG   4  
ATOM 4837  H H    . SER A 1 18 ? -3.165  5.076   4.097   1.00 0.00 ? 26  SER A H    4  
ATOM 4838  H HA   . SER A 1 18 ? -0.489  4.844   5.316   1.00 0.00 ? 26  SER A HA   4  
ATOM 4839  H HB2  . SER A 1 18 ? -3.196  3.919   6.220   1.00 0.00 ? 26  SER A HB2  4  
ATOM 4840  H HB3  . SER A 1 18 ? -1.756  3.049   6.747   1.00 0.00 ? 26  SER A HB3  4  
ATOM 4841  H HG   . SER A 1 18 ? -1.711  4.546   8.228   1.00 0.00 ? 26  SER A HG   4  
ATOM 4842  N N    . ILE A 1 19 ? -0.326  2.226   4.790   1.00 0.00 ? 27  ILE A N    4  
ATOM 4843  C CA   . ILE A 1 19 ? 0.008   0.991   4.092   1.00 0.00 ? 27  ILE A CA   4  
ATOM 4844  C C    . ILE A 1 19 ? -0.025  -0.207  5.036   1.00 0.00 ? 27  ILE A C    4  
ATOM 4845  O O    . ILE A 1 19 ? 0.173   -0.068  6.242   1.00 0.00 ? 27  ILE A O    4  
ATOM 4846  C CB   . ILE A 1 19 ? 1.396   1.072   3.429   1.00 0.00 ? 27  ILE A CB   4  
ATOM 4847  C CG1  . ILE A 1 19 ? 2.424   1.637   4.410   1.00 0.00 ? 27  ILE A CG1  4  
ATOM 4848  C CG2  . ILE A 1 19 ? 1.331   1.924   2.170   1.00 0.00 ? 27  ILE A CG2  4  
ATOM 4849  C CD1  . ILE A 1 19 ? 3.819   1.732   3.833   1.00 0.00 ? 27  ILE A CD1  4  
ATOM 4850  H H    . ILE A 1 19 ? 0.079   2.409   5.663   1.00 0.00 ? 27  ILE A H    4  
ATOM 4851  H HA   . ILE A 1 19 ? -0.728  0.841   3.315   1.00 0.00 ? 27  ILE A HA   4  
ATOM 4852  H HB   . ILE A 1 19 ? 1.693   0.074   3.143   1.00 0.00 ? 27  ILE A HB   4  
ATOM 4853  H HG12 . ILE A 1 19 ? 2.121   2.630   4.709   1.00 0.00 ? 27  ILE A HG12 4  
ATOM 4854  H HG13 . ILE A 1 19 ? 2.468   1.001   5.283   1.00 0.00 ? 27  ILE A HG13 4  
ATOM 4855  H HG21 . ILE A 1 19 ? 0.672   2.763   2.336   1.00 0.00 ? 27  ILE A HG21 4  
ATOM 4856  H HG22 . ILE A 1 19 ? 0.958   1.329   1.350   1.00 0.00 ? 27  ILE A HG22 4  
ATOM 4857  H HG23 . ILE A 1 19 ? 2.321   2.288   1.930   1.00 0.00 ? 27  ILE A HG23 4  
ATOM 4858  H HD11 . ILE A 1 19 ? 4.437   0.957   4.259   1.00 0.00 ? 27  ILE A HD11 4  
ATOM 4859  H HD12 . ILE A 1 19 ? 4.240   2.698   4.067   1.00 0.00 ? 27  ILE A HD12 4  
ATOM 4860  H HD13 . ILE A 1 19 ? 3.774   1.608   2.761   1.00 0.00 ? 27  ILE A HD13 4  
ATOM 4861  N N    . SER A 1 20 ? -0.281  -1.382  4.471   1.00 0.00 ? 28  SER A N    4  
ATOM 4862  C CA   . SER A 1 20 ? -0.350  -2.616  5.245   1.00 0.00 ? 28  SER A CA   4  
ATOM 4863  C C    . SER A 1 20 ? 0.489   -3.709  4.589   1.00 0.00 ? 28  SER A C    4  
ATOM 4864  O O    . SER A 1 20 ? 0.848   -3.604  3.418   1.00 0.00 ? 28  SER A O    4  
ATOM 4865  C CB   . SER A 1 20 ? -1.801  -3.079  5.383   1.00 0.00 ? 28  SER A CB   4  
ATOM 4866  O OG   . SER A 1 20 ? -2.439  -3.147  4.120   1.00 0.00 ? 28  SER A OG   4  
ATOM 4867  H H    . SER A 1 20 ? -0.431  -1.420  3.503   1.00 0.00 ? 28  SER A H    4  
ATOM 4868  H HA   . SER A 1 20 ? 0.050   -2.414  6.228   1.00 0.00 ? 28  SER A HA   4  
ATOM 4869  H HB2  . SER A 1 20 ? -1.821  -4.061  5.835   1.00 0.00 ? 28  SER A HB2  4  
ATOM 4870  H HB3  . SER A 1 20 ? -2.341  -2.384  6.009   1.00 0.00 ? 28  SER A HB3  4  
ATOM 4871  H HG   . SER A 1 20 ? -2.698  -4.054  3.941   1.00 0.00 ? 28  SER A HG   4  
ATOM 4872  N N    . SER A 1 21 ? 0.805   -4.752  5.349   1.00 0.00 ? 29  SER A N    4  
ATOM 4873  C CA   . SER A 1 21 ? 1.605   -5.853  4.826   1.00 0.00 ? 29  SER A CA   4  
ATOM 4874  C C    . SER A 1 21 ? 0.732   -7.072  4.545   1.00 0.00 ? 29  SER A C    4  
ATOM 4875  O O    . SER A 1 21 ? -0.186  -7.379  5.306   1.00 0.00 ? 29  SER A O    4  
ATOM 4876  C CB   . SER A 1 21 ? 2.715   -6.220  5.814   1.00 0.00 ? 29  SER A CB   4  
ATOM 4877  O OG   . SER A 1 21 ? 2.194   -6.409  7.118   1.00 0.00 ? 29  SER A OG   4  
ATOM 4878  H H    . SER A 1 21 ? 0.496   -4.781  6.278   1.00 0.00 ? 29  SER A H    4  
ATOM 4879  H HA   . SER A 1 21 ? 2.055   -5.525  3.900   1.00 0.00 ? 29  SER A HA   4  
ATOM 4880  H HB2  . SER A 1 21 ? 3.191   -7.134  5.495   1.00 0.00 ? 29  SER A HB2  4  
ATOM 4881  H HB3  . SER A 1 21 ? 3.446   -5.425  5.843   1.00 0.00 ? 29  SER A HB3  4  
ATOM 4882  H HG   . SER A 1 21 ? 2.766   -7.005  7.608   1.00 0.00 ? 29  SER A HG   4  
ATOM 4883  N N    . GLY A 1 22 ? 1.022   -7.758  3.445   1.00 0.00 ? 30  GLY A N    4  
ATOM 4884  C CA   . GLY A 1 22 ? 0.251   -8.931  3.073   1.00 0.00 ? 30  GLY A CA   4  
ATOM 4885  C C    . GLY A 1 22 ? 0.797   -10.208 3.682   1.00 0.00 ? 30  GLY A C    4  
ATOM 4886  O O    . GLY A 1 22 ? 1.840   -10.190 4.337   1.00 0.00 ? 30  GLY A O    4  
ATOM 4887  H H    . GLY A 1 22 ? 1.762   -7.462  2.875   1.00 0.00 ? 30  GLY A H    4  
ATOM 4888  H HA2  . GLY A 1 22 ? -0.769  -8.798  3.401   1.00 0.00 ? 30  GLY A HA2  4  
ATOM 4889  H HA3  . GLY A 1 22 ? 0.262   -9.028  1.997   1.00 0.00 ? 30  GLY A HA3  4  
ATOM 4890  N N    . PRO A 1 23 ? 0.106   -11.344 3.484   1.00 0.00 ? 31  PRO A N    4  
ATOM 4891  C CA   . PRO A 1 23 ? 0.537   -12.636 4.025   1.00 0.00 ? 31  PRO A CA   4  
ATOM 4892  C C    . PRO A 1 23 ? 1.772   -13.183 3.320   1.00 0.00 ? 31  PRO A C    4  
ATOM 4893  O O    . PRO A 1 23 ? 2.436   -12.470 2.566   1.00 0.00 ? 31  PRO A O    4  
ATOM 4894  C CB   . PRO A 1 23 ? -0.668  -13.545 3.772   1.00 0.00 ? 31  PRO A CB   4  
ATOM 4895  C CG   . PRO A 1 23 ? -1.357  -12.940 2.599   1.00 0.00 ? 31  PRO A CG   4  
ATOM 4896  C CD   . PRO A 1 23 ? -1.150  -11.455 2.717   1.00 0.00 ? 31  PRO A CD   4  
ATOM 4897  H HA   . PRO A 1 23 ? 0.726   -12.575 5.087   1.00 0.00 ? 31  PRO A HA   4  
ATOM 4898  H HB2  . PRO A 1 23 ? -0.326  -14.548 3.555   1.00 0.00 ? 31  PRO A HB2  4  
ATOM 4899  H HB3  . PRO A 1 23 ? -1.306  -13.556 4.642   1.00 0.00 ? 31  PRO A HB3  4  
ATOM 4900  H HG2  . PRO A 1 23 ? -0.917  -13.307 1.684   1.00 0.00 ? 31  PRO A HG2  4  
ATOM 4901  H HG3  . PRO A 1 23 ? -2.411  -13.174 2.630   1.00 0.00 ? 31  PRO A HG3  4  
ATOM 4902  H HD2  . PRO A 1 23 ? -1.045  -11.009 1.739   1.00 0.00 ? 31  PRO A HD2  4  
ATOM 4903  H HD3  . PRO A 1 23 ? -1.969  -11.001 3.255   1.00 0.00 ? 31  PRO A HD3  4  
ATOM 4904  N N    . ILE A 1 24 ? 2.074   -14.451 3.572   1.00 0.00 ? 32  ILE A N    4  
ATOM 4905  C CA   . ILE A 1 24 ? 3.228   -15.103 2.964   1.00 0.00 ? 32  ILE A CA   4  
ATOM 4906  C C    . ILE A 1 24 ? 2.939   -15.506 1.520   1.00 0.00 ? 32  ILE A C    4  
ATOM 4907  O O    . ILE A 1 24 ? 3.859   -15.705 0.727   1.00 0.00 ? 32  ILE A O    4  
ATOM 4908  C CB   . ILE A 1 24 ? 3.644   -16.354 3.763   1.00 0.00 ? 32  ILE A CB   4  
ATOM 4909  C CG1  . ILE A 1 24 ? 3.899   -15.990 5.227   1.00 0.00 ? 32  ILE A CG1  4  
ATOM 4910  C CG2  . ILE A 1 24 ? 4.880   -16.994 3.147   1.00 0.00 ? 32  ILE A CG2  4  
ATOM 4911  C CD1  . ILE A 1 24 ? 3.470   -17.067 6.200   1.00 0.00 ? 32  ILE A CD1  4  
ATOM 4912  H H    . ILE A 1 24 ? 1.504   -14.964 4.182   1.00 0.00 ? 32  ILE A H    4  
ATOM 4913  H HA   . ILE A 1 24 ? 4.051   -14.402 2.976   1.00 0.00 ? 32  ILE A HA   4  
ATOM 4914  H HB   . ILE A 1 24 ? 2.837   -17.070 3.713   1.00 0.00 ? 32  ILE A HB   4  
ATOM 4915  H HG12 . ILE A 1 24 ? 4.955   -15.815 5.369   1.00 0.00 ? 32  ILE A HG12 4  
ATOM 4916  H HG13 . ILE A 1 24 ? 3.354   -15.088 5.466   1.00 0.00 ? 32  ILE A HG13 4  
ATOM 4917  H HG21 . ILE A 1 24 ? 5.663   -16.255 3.064   1.00 0.00 ? 32  ILE A HG21 4  
ATOM 4918  H HG22 . ILE A 1 24 ? 4.637   -17.375 2.167   1.00 0.00 ? 32  ILE A HG22 4  
ATOM 4919  H HG23 . ILE A 1 24 ? 5.215   -17.805 3.777   1.00 0.00 ? 32  ILE A HG23 4  
ATOM 4920  H HD11 . ILE A 1 24 ? 2.393   -17.072 6.279   1.00 0.00 ? 32  ILE A HD11 4  
ATOM 4921  H HD12 . ILE A 1 24 ? 3.902   -16.865 7.170   1.00 0.00 ? 32  ILE A HD12 4  
ATOM 4922  H HD13 . ILE A 1 24 ? 3.811   -18.027 5.846   1.00 0.00 ? 32  ILE A HD13 4  
ATOM 4923  N N    . GLN A 1 25 ? 1.659   -15.630 1.186   1.00 0.00 ? 33  GLN A N    4  
ATOM 4924  C CA   . GLN A 1 25 ? 1.254   -16.015 -0.160  1.00 0.00 ? 33  GLN A CA   4  
ATOM 4925  C C    . GLN A 1 25 ? 1.494   -14.881 -1.151  1.00 0.00 ? 33  GLN A C    4  
ATOM 4926  O O    . GLN A 1 25 ? 1.757   -15.119 -2.330  1.00 0.00 ? 33  GLN A O    4  
ATOM 4927  C CB   . GLN A 1 25 ? -0.222  -16.418 -0.172  1.00 0.00 ? 33  GLN A CB   4  
ATOM 4928  C CG   . GLN A 1 25 ? -0.592  -17.395 0.931   1.00 0.00 ? 33  GLN A CG   4  
ATOM 4929  C CD   . GLN A 1 25 ? -0.090  -18.800 0.659   1.00 0.00 ? 33  GLN A CD   4  
ATOM 4930  O OE1  . GLN A 1 25 ? -0.392  -19.390 -0.377  1.00 0.00 ? 33  GLN A OE1  4  
ATOM 4931  N NE2  . GLN A 1 25 ? 0.683   -19.340 1.594   1.00 0.00 ? 33  GLN A NE2  4  
ATOM 4932  H H    . GLN A 1 25 ? 0.970   -15.462 1.862   1.00 0.00 ? 33  GLN A H    4  
ATOM 4933  H HA   . GLN A 1 25 ? 1.850   -16.865 -0.454  1.00 0.00 ? 33  GLN A HA   4  
ATOM 4934  H HB2  . GLN A 1 25 ? -0.827  -15.530 -0.056  1.00 0.00 ? 33  GLN A HB2  4  
ATOM 4935  H HB3  . GLN A 1 25 ? -0.451  -16.877 -1.123  1.00 0.00 ? 33  GLN A HB3  4  
ATOM 4936  H HG2  . GLN A 1 25 ? -0.163  -17.050 1.860   1.00 0.00 ? 33  GLN A HG2  4  
ATOM 4937  H HG3  . GLN A 1 25 ? -1.668  -17.426 1.023   1.00 0.00 ? 33  GLN A HG3  4  
ATOM 4938  H HE21 . GLN A 1 25 ? 0.881   -18.810 2.394   1.00 0.00 ? 33  GLN A HE21 4  
ATOM 4939  H HE22 . GLN A 1 25 ? 1.023   -20.246 1.445   1.00 0.00 ? 33  GLN A HE22 4  
ATOM 4940  N N    . LYS A 1 26 ? 1.402   -13.645 -0.666  1.00 0.00 ? 34  LYS A N    4  
ATOM 4941  C CA   . LYS A 1 26 ? 1.611   -12.478 -1.515  1.00 0.00 ? 34  LYS A CA   4  
ATOM 4942  C C    . LYS A 1 26 ? 2.234   -11.330 -0.720  1.00 0.00 ? 34  LYS A C    4  
ATOM 4943  O O    . LYS A 1 26 ? 1.616   -10.280 -0.542  1.00 0.00 ? 34  LYS A O    4  
ATOM 4944  C CB   . LYS A 1 26 ? 0.286   -12.029 -2.136  1.00 0.00 ? 34  LYS A CB   4  
ATOM 4945  C CG   . LYS A 1 26 ? 0.041   -12.601 -3.522  1.00 0.00 ? 34  LYS A CG   4  
ATOM 4946  C CD   . LYS A 1 26 ? -1.040  -11.827 -4.261  1.00 0.00 ? 34  LYS A CD   4  
ATOM 4947  C CE   . LYS A 1 26 ? -1.803  -12.719 -5.225  1.00 0.00 ? 34  LYS A CE   4  
ATOM 4948  N NZ   . LYS A 1 26 ? -1.216  -12.691 -6.593  1.00 0.00 ? 34  LYS A NZ   4  
ATOM 4949  H H    . LYS A 1 26 ? 1.189   -13.518 0.282   1.00 0.00 ? 34  LYS A H    4  
ATOM 4950  H HA   . LYS A 1 26 ? 2.290   -12.762 -2.304  1.00 0.00 ? 34  LYS A HA   4  
ATOM 4951  H HB2  . LYS A 1 26 ? -0.524  -12.343 -1.493  1.00 0.00 ? 34  LYS A HB2  4  
ATOM 4952  H HB3  . LYS A 1 26 ? 0.281   -10.953 -2.208  1.00 0.00 ? 34  LYS A HB3  4  
ATOM 4953  H HG2  . LYS A 1 26 ? 0.958   -12.550 -4.091  1.00 0.00 ? 34  LYS A HG2  4  
ATOM 4954  H HG3  . LYS A 1 26 ? -0.267  -13.631 -3.428  1.00 0.00 ? 34  LYS A HG3  4  
ATOM 4955  H HD2  . LYS A 1 26 ? -1.732  -11.417 -3.540  1.00 0.00 ? 34  LYS A HD2  4  
ATOM 4956  H HD3  . LYS A 1 26 ? -0.578  -11.024 -4.816  1.00 0.00 ? 34  LYS A HD3  4  
ATOM 4957  H HE2  . LYS A 1 26 ? -1.779  -13.733 -4.854  1.00 0.00 ? 34  LYS A HE2  4  
ATOM 4958  H HE3  . LYS A 1 26 ? -2.828  -12.380 -5.274  1.00 0.00 ? 34  LYS A HE3  4  
ATOM 4959  H HZ1  . LYS A 1 26 ? -1.967  -12.779 -7.306  1.00 0.00 ? 34  LYS A HZ1  4  
ATOM 4960  H HZ2  . LYS A 1 26 ? -0.548  -13.479 -6.712  1.00 0.00 ? 34  LYS A HZ2  4  
ATOM 4961  H HZ3  . LYS A 1 26 ? -0.709  -11.796 -6.746  1.00 0.00 ? 34  LYS A HZ3  4  
ATOM 4962  N N    . PRO A 1 27 ? 3.473   -11.514 -0.232  1.00 0.00 ? 35  PRO A N    4  
ATOM 4963  C CA   . PRO A 1 27 ? 4.178   -10.488 0.543   1.00 0.00 ? 35  PRO A CA   4  
ATOM 4964  C C    . PRO A 1 27 ? 4.473   -9.244  -0.290  1.00 0.00 ? 35  PRO A C    4  
ATOM 4965  O O    . PRO A 1 27 ? 5.246   -9.296  -1.247  1.00 0.00 ? 35  PRO A O    4  
ATOM 4966  C CB   . PRO A 1 27 ? 5.489   -11.171 0.961   1.00 0.00 ? 35  PRO A CB   4  
ATOM 4967  C CG   . PRO A 1 27 ? 5.265   -12.629 0.737   1.00 0.00 ? 35  PRO A CG   4  
ATOM 4968  C CD   . PRO A 1 27 ? 4.285   -12.729 -0.395  1.00 0.00 ? 35  PRO A CD   4  
ATOM 4969  H HA   . PRO A 1 27 ? 3.620   -10.205 1.423   1.00 0.00 ? 35  PRO A HA   4  
ATOM 4970  H HB2  . PRO A 1 27 ? 6.299   -10.800 0.350   1.00 0.00 ? 35  PRO A HB2  4  
ATOM 4971  H HB3  . PRO A 1 27 ? 5.690   -10.959 2.000   1.00 0.00 ? 35  PRO A HB3  4  
ATOM 4972  H HG2  . PRO A 1 27 ? 6.196   -13.108 0.470   1.00 0.00 ? 35  PRO A HG2  4  
ATOM 4973  H HG3  . PRO A 1 27 ? 4.853   -13.078 1.629   1.00 0.00 ? 35  PRO A HG3  4  
ATOM 4974  H HD2  . PRO A 1 27 ? 4.803   -12.726 -1.344  1.00 0.00 ? 35  PRO A HD2  4  
ATOM 4975  H HD3  . PRO A 1 27 ? 3.678   -13.616 -0.294  1.00 0.00 ? 35  PRO A HD3  4  
ATOM 4976  N N    . GLY A 1 28 ? 3.853   -8.128  0.079   1.00 0.00 ? 36  GLY A N    4  
ATOM 4977  C CA   . GLY A 1 28 ? 4.066   -6.891  -0.647  1.00 0.00 ? 36  GLY A CA   4  
ATOM 4978  C C    . GLY A 1 28 ? 3.632   -5.674  0.142   1.00 0.00 ? 36  GLY A C    4  
ATOM 4979  O O    . GLY A 1 28 ? 3.557   -5.719  1.371   1.00 0.00 ? 36  GLY A O    4  
ATOM 4980  H H    . GLY A 1 28 ? 3.249   -8.144  0.849   1.00 0.00 ? 36  GLY A H    4  
ATOM 4981  H HA2  . GLY A 1 28 ? 5.116   -6.799  -0.881  1.00 0.00 ? 36  GLY A HA2  4  
ATOM 4982  H HA3  . GLY A 1 28 ? 3.505   -6.927  -1.569  1.00 0.00 ? 36  GLY A HA3  4  
ATOM 4983  N N    . ILE A 1 29 ? 3.348   -4.584  -0.561  1.00 0.00 ? 37  ILE A N    4  
ATOM 4984  C CA   . ILE A 1 29 ? 2.920   -3.351  0.086   1.00 0.00 ? 37  ILE A CA   4  
ATOM 4985  C C    . ILE A 1 29 ? 1.463   -3.043  -0.233  1.00 0.00 ? 37  ILE A C    4  
ATOM 4986  O O    . ILE A 1 29 ? 1.096   -2.842  -1.391  1.00 0.00 ? 37  ILE A O    4  
ATOM 4987  C CB   . ILE A 1 29 ? 3.793   -2.155  -0.341  1.00 0.00 ? 37  ILE A CB   4  
ATOM 4988  C CG1  . ILE A 1 29 ? 5.273   -2.538  -0.297  1.00 0.00 ? 37  ILE A CG1  4  
ATOM 4989  C CG2  . ILE A 1 29 ? 3.524   -0.958  0.560   1.00 0.00 ? 37  ILE A CG2  4  
ATOM 4990  C CD1  . ILE A 1 29 ? 5.758   -2.911  1.085   1.00 0.00 ? 37  ILE A CD1  4  
ATOM 4991  H H    . ILE A 1 29 ? 3.428   -4.610  -1.537  1.00 0.00 ? 37  ILE A H    4  
ATOM 4992  H HA   . ILE A 1 29 ? 3.023   -3.481  1.153   1.00 0.00 ? 37  ILE A HA   4  
ATOM 4993  H HB   . ILE A 1 29 ? 3.526   -1.883  -1.350  1.00 0.00 ? 37  ILE A HB   4  
ATOM 4994  H HG12 . ILE A 1 29 ? 5.439   -3.385  -0.946  1.00 0.00 ? 37  ILE A HG12 4  
ATOM 4995  H HG13 . ILE A 1 29 ? 5.864   -1.702  -0.644  1.00 0.00 ? 37  ILE A HG13 4  
ATOM 4996  H HG21 . ILE A 1 29 ? 4.323   -0.240  0.451   1.00 0.00 ? 37  ILE A HG21 4  
ATOM 4997  H HG22 . ILE A 1 29 ? 3.473   -1.286  1.587   1.00 0.00 ? 37  ILE A HG22 4  
ATOM 4998  H HG23 . ILE A 1 29 ? 2.587   -0.501  0.280   1.00 0.00 ? 37  ILE A HG23 4  
ATOM 4999  H HD11 . ILE A 1 29 ? 5.571   -2.093  1.767   1.00 0.00 ? 37  ILE A HD11 4  
ATOM 5000  H HD12 . ILE A 1 29 ? 6.818   -3.116  1.053   1.00 0.00 ? 37  ILE A HD12 4  
ATOM 5001  H HD13 . ILE A 1 29 ? 5.233   -3.790  1.427   1.00 0.00 ? 37  ILE A HD13 4  
ATOM 5002  N N    . PHE A 1 30 ? 0.635   -3.010  0.804   1.00 0.00 ? 38  PHE A N    4  
ATOM 5003  C CA   . PHE A 1 30 ? -0.786  -2.730  0.643   1.00 0.00 ? 38  PHE A CA   4  
ATOM 5004  C C    . PHE A 1 30 ? -1.099  -1.280  0.993   1.00 0.00 ? 38  PHE A C    4  
ATOM 5005  O O    . PHE A 1 30 ? -0.243  -0.551  1.493   1.00 0.00 ? 38  PHE A O    4  
ATOM 5006  C CB   . PHE A 1 30 ? -1.615  -3.660  1.532   1.00 0.00 ? 38  PHE A CB   4  
ATOM 5007  C CG   . PHE A 1 30 ? -2.114  -4.887  0.826   1.00 0.00 ? 38  PHE A CG   4  
ATOM 5008  C CD1  . PHE A 1 30 ? -1.315  -5.553  -0.088  1.00 0.00 ? 38  PHE A CD1  4  
ATOM 5009  C CD2  . PHE A 1 30 ? -3.386  -5.371  1.080   1.00 0.00 ? 38  PHE A CD2  4  
ATOM 5010  C CE1  . PHE A 1 30 ? -1.777  -6.683  -0.736  1.00 0.00 ? 38  PHE A CE1  4  
ATOM 5011  C CE2  . PHE A 1 30 ? -3.853  -6.500  0.435   1.00 0.00 ? 38  PHE A CE2  4  
ATOM 5012  C CZ   . PHE A 1 30 ? -3.048  -7.155  -0.473  1.00 0.00 ? 38  PHE A CZ   4  
ATOM 5013  H H    . PHE A 1 30 ? 0.989   -3.180  1.700   1.00 0.00 ? 38  PHE A H    4  
ATOM 5014  H HA   . PHE A 1 30 ? -1.046  -2.905  -0.390  1.00 0.00 ? 38  PHE A HA   4  
ATOM 5015  H HB2  . PHE A 1 30 ? -1.010  -3.982  2.365   1.00 0.00 ? 38  PHE A HB2  4  
ATOM 5016  H HB3  . PHE A 1 30 ? -2.472  -3.120  1.903   1.00 0.00 ? 38  PHE A HB3  4  
ATOM 5017  H HD1  . PHE A 1 30 ? -0.322  -5.184  -0.294  1.00 0.00 ? 38  PHE A HD1  4  
ATOM 5018  H HD2  . PHE A 1 30 ? -4.016  -4.858  1.791   1.00 0.00 ? 38  PHE A HD2  4  
ATOM 5019  H HE1  . PHE A 1 30 ? -1.146  -7.195  -1.446  1.00 0.00 ? 38  PHE A HE1  4  
ATOM 5020  H HE2  . PHE A 1 30 ? -4.847  -6.867  0.644   1.00 0.00 ? 38  PHE A HE2  4  
ATOM 5021  H HZ   . PHE A 1 30 ? -3.412  -8.035  -0.980  1.00 0.00 ? 38  PHE A HZ   4  
ATOM 5022  N N    . ILE A 1 31 ? -2.335  -0.875  0.729   1.00 0.00 ? 39  ILE A N    4  
ATOM 5023  C CA   . ILE A 1 31 ? -2.775  0.483   1.016   1.00 0.00 ? 39  ILE A CA   4  
ATOM 5024  C C    . ILE A 1 31 ? -3.924  0.473   2.022   1.00 0.00 ? 39  ILE A C    4  
ATOM 5025  O O    . ILE A 1 31 ? -4.969  -0.129  1.781   1.00 0.00 ? 39  ILE A O    4  
ATOM 5026  C CB   . ILE A 1 31 ? -3.214  1.216   -0.272  1.00 0.00 ? 39  ILE A CB   4  
ATOM 5027  C CG1  . ILE A 1 31 ? -1.989  1.582   -1.114  1.00 0.00 ? 39  ILE A CG1  4  
ATOM 5028  C CG2  . ILE A 1 31 ? -4.030  2.463   0.052   1.00 0.00 ? 39  ILE A CG2  4  
ATOM 5029  C CD1  . ILE A 1 31 ? -1.152  2.693   -0.515  1.00 0.00 ? 39  ILE A CD1  4  
ATOM 5030  H H    . ILE A 1 31 ? -2.971  -1.508  0.334   1.00 0.00 ? 39  ILE A H    4  
ATOM 5031  H HA   . ILE A 1 31 ? -1.941  1.020   1.445   1.00 0.00 ? 39  ILE A HA   4  
ATOM 5032  H HB   . ILE A 1 31 ? -3.842  0.546   -0.842  1.00 0.00 ? 39  ILE A HB   4  
ATOM 5033  H HG12 . ILE A 1 31 ? -1.357  0.711   -1.217  1.00 0.00 ? 39  ILE A HG12 4  
ATOM 5034  H HG13 . ILE A 1 31 ? -2.314  1.902   -2.092  1.00 0.00 ? 39  ILE A HG13 4  
ATOM 5035  H HG21 . ILE A 1 31 ? -5.081  2.249   -0.080  1.00 0.00 ? 39  ILE A HG21 4  
ATOM 5036  H HG22 . ILE A 1 31 ? -3.740  3.266   -0.608  1.00 0.00 ? 39  ILE A HG22 4  
ATOM 5037  H HG23 . ILE A 1 31 ? -3.850  2.755   1.075   1.00 0.00 ? 39  ILE A HG23 4  
ATOM 5038  H HD11 . ILE A 1 31 ? -0.202  2.745   -1.025  1.00 0.00 ? 39  ILE A HD11 4  
ATOM 5039  H HD12 . ILE A 1 31 ? -0.986  2.492   0.534   1.00 0.00 ? 39  ILE A HD12 4  
ATOM 5040  H HD13 . ILE A 1 31 ? -1.672  3.632   -0.622  1.00 0.00 ? 39  ILE A HD13 4  
ATOM 5041  N N    . SER A 1 32 ? -3.718  1.149   3.145   1.00 0.00 ? 40  SER A N    4  
ATOM 5042  C CA   . SER A 1 32 ? -4.730  1.229   4.190   1.00 0.00 ? 40  SER A CA   4  
ATOM 5043  C C    . SER A 1 32 ? -5.617  2.450   3.985   1.00 0.00 ? 40  SER A C    4  
ATOM 5044  O O    . SER A 1 32 ? -5.562  3.104   2.943   1.00 0.00 ? 40  SER A O    4  
ATOM 5045  C CB   . SER A 1 32 ? -4.070  1.282   5.569   1.00 0.00 ? 40  SER A CB   4  
ATOM 5046  O OG   . SER A 1 32 ? -4.623  0.307   6.437   1.00 0.00 ? 40  SER A OG   4  
ATOM 5047  H H    . SER A 1 32 ? -2.864  1.607   3.274   1.00 0.00 ? 40  SER A H    4  
ATOM 5048  H HA   . SER A 1 32 ? -5.342  0.341   4.126   1.00 0.00 ? 40  SER A HA   4  
ATOM 5049  H HB2  . SER A 1 32 ? -3.012  1.095   5.467   1.00 0.00 ? 40  SER A HB2  4  
ATOM 5050  H HB3  . SER A 1 32 ? -4.223  2.259   6.003   1.00 0.00 ? 40  SER A HB3  4  
ATOM 5051  H HG   . SER A 1 32 ? -4.705  -0.529  5.969   1.00 0.00 ? 40  SER A HG   4  
ATOM 5052  N N    . HIS A 1 33 ? -6.436  2.754   4.985   1.00 0.00 ? 41  HIS A N    4  
ATOM 5053  C CA   . HIS A 1 33 ? -7.338  3.899   4.916   1.00 0.00 ? 41  HIS A CA   4  
ATOM 5054  C C    . HIS A 1 33 ? -6.571  5.177   4.597   1.00 0.00 ? 41  HIS A C    4  
ATOM 5055  O O    . HIS A 1 33 ? -5.452  5.376   5.074   1.00 0.00 ? 41  HIS A O    4  
ATOM 5056  C CB   . HIS A 1 33 ? -8.091  4.058   6.239   1.00 0.00 ? 41  HIS A CB   4  
ATOM 5057  C CG   . HIS A 1 33 ? -9.413  4.744   6.095   1.00 0.00 ? 41  HIS A CG   4  
ATOM 5058  N ND1  . HIS A 1 33 ? -10.224 4.593   4.989   1.00 0.00 ? 41  HIS A ND1  4  
ATOM 5059  C CD2  . HIS A 1 33 ? -10.068 5.590   6.924   1.00 0.00 ? 41  HIS A CD2  4  
ATOM 5060  C CE1  . HIS A 1 33 ? -11.318 5.316   5.145   1.00 0.00 ? 41  HIS A CE1  4  
ATOM 5061  N NE2  . HIS A 1 33 ? -11.248 5.930   6.311   1.00 0.00 ? 41  HIS A NE2  4  
ATOM 5062  H H    . HIS A 1 33 ? -6.432  2.198   5.789   1.00 0.00 ? 41  HIS A H    4  
ATOM 5063  H HA   . HIS A 1 33 ? -8.051  3.713   4.126   1.00 0.00 ? 41  HIS A HA   4  
ATOM 5064  H HB2  . HIS A 1 33 ? -8.268  3.082   6.664   1.00 0.00 ? 41  HIS A HB2  4  
ATOM 5065  H HB3  . HIS A 1 33 ? -7.487  4.638   6.921   1.00 0.00 ? 41  HIS A HB3  4  
ATOM 5066  H HD1  . HIS A 1 33 ? -10.025 4.037   4.205   1.00 0.00 ? 41  HIS A HD1  4  
ATOM 5067  H HD2  . HIS A 1 33 ? -9.725  5.933   7.891   1.00 0.00 ? 41  HIS A HD2  4  
ATOM 5068  H HE1  . HIS A 1 33 ? -12.131 5.391   4.438   1.00 0.00 ? 41  HIS A HE1  4  
ATOM 5069  H HE2  . HIS A 1 33 ? -11.971 6.454   6.717   1.00 0.00 ? 41  HIS A HE2  4  
ATOM 5070  N N    . VAL A 1 34 ? -7.173  6.038   3.785   1.00 0.00 ? 42  VAL A N    4  
ATOM 5071  C CA   . VAL A 1 34 ? -6.537  7.292   3.401   1.00 0.00 ? 42  VAL A CA   4  
ATOM 5072  C C    . VAL A 1 34 ? -7.378  8.491   3.841   1.00 0.00 ? 42  VAL A C    4  
ATOM 5073  O O    . VAL A 1 34 ? -8.596  8.387   3.985   1.00 0.00 ? 42  VAL A O    4  
ATOM 5074  C CB   . VAL A 1 34 ? -6.279  7.354   1.877   1.00 0.00 ? 42  VAL A CB   4  
ATOM 5075  C CG1  . VAL A 1 34 ? -5.830  5.999   1.354   1.00 0.00 ? 42  VAL A CG1  4  
ATOM 5076  C CG2  . VAL A 1 34 ? -7.512  7.829   1.123   1.00 0.00 ? 42  VAL A CG2  4  
ATOM 5077  H H    . VAL A 1 34 ? -8.062  5.824   3.432   1.00 0.00 ? 42  VAL A H    4  
ATOM 5078  H HA   . VAL A 1 34 ? -5.583  7.342   3.906   1.00 0.00 ? 42  VAL A HA   4  
ATOM 5079  H HB   . VAL A 1 34 ? -5.483  8.063   1.698   1.00 0.00 ? 42  VAL A HB   4  
ATOM 5080  H HG11 . VAL A 1 34 ? -6.690  5.437   1.020   1.00 0.00 ? 42  VAL A HG11 4  
ATOM 5081  H HG12 . VAL A 1 34 ? -5.330  5.455   2.143   1.00 0.00 ? 42  VAL A HG12 4  
ATOM 5082  H HG13 . VAL A 1 34 ? -5.148  6.137   0.528   1.00 0.00 ? 42  VAL A HG13 4  
ATOM 5083  H HG21 . VAL A 1 34 ? -7.381  7.643   0.068   1.00 0.00 ? 42  VAL A HG21 4  
ATOM 5084  H HG22 . VAL A 1 34 ? -7.647  8.888   1.288   1.00 0.00 ? 42  VAL A HG22 4  
ATOM 5085  H HG23 . VAL A 1 34 ? -8.380  7.294   1.480   1.00 0.00 ? 42  VAL A HG23 4  
ATOM 5086  N N    . LYS A 1 35 ? -6.719  9.624   4.056   1.00 0.00 ? 43  LYS A N    4  
ATOM 5087  C CA   . LYS A 1 35 ? -7.403  10.838  4.485   1.00 0.00 ? 43  LYS A CA   4  
ATOM 5088  C C    . LYS A 1 35 ? -7.732  11.736  3.294   1.00 0.00 ? 43  LYS A C    4  
ATOM 5089  O O    . LYS A 1 35 ? -6.986  11.780  2.316   1.00 0.00 ? 43  LYS A O    4  
ATOM 5090  C CB   . LYS A 1 35 ? -6.545  11.606  5.493   1.00 0.00 ? 43  LYS A CB   4  
ATOM 5091  C CG   . LYS A 1 35 ? -5.846  10.714  6.508   1.00 0.00 ? 43  LYS A CG   4  
ATOM 5092  C CD   . LYS A 1 35 ? -4.334  10.775  6.360   1.00 0.00 ? 43  LYS A CD   4  
ATOM 5093  C CE   . LYS A 1 35 ? -3.637  9.894   7.386   1.00 0.00 ? 43  LYS A CE   4  
ATOM 5094  N NZ   . LYS A 1 35 ? -3.913  10.340  8.780   1.00 0.00 ? 43  LYS A NZ   4  
ATOM 5095  H H    . LYS A 1 35 ? -5.746  9.643   3.929   1.00 0.00 ? 43  LYS A H    4  
ATOM 5096  H HA   . LYS A 1 35 ? -8.326  10.544  4.964   1.00 0.00 ? 43  LYS A HA   4  
ATOM 5097  H HB2  . LYS A 1 35 ? -5.792  12.163  4.955   1.00 0.00 ? 43  LYS A HB2  4  
ATOM 5098  H HB3  . LYS A 1 35 ? -7.176  12.300  6.030   1.00 0.00 ? 43  LYS A HB3  4  
ATOM 5099  H HG2  . LYS A 1 35 ? -6.114  11.040  7.502   1.00 0.00 ? 43  LYS A HG2  4  
ATOM 5100  H HG3  . LYS A 1 35 ? -6.174  9.694   6.361   1.00 0.00 ? 43  LYS A HG3  4  
ATOM 5101  H HD2  . LYS A 1 35 ? -4.065  10.438  5.370   1.00 0.00 ? 43  LYS A HD2  4  
ATOM 5102  H HD3  . LYS A 1 35 ? -4.010  11.795  6.496   1.00 0.00 ? 43  LYS A HD3  4  
ATOM 5103  H HE2  . LYS A 1 35 ? -3.987  8.879   7.268   1.00 0.00 ? 43  LYS A HE2  4  
ATOM 5104  H HE3  . LYS A 1 35 ? -2.573  9.931   7.209   1.00 0.00 ? 43  LYS A HE3  4  
ATOM 5105  H HZ1  . LYS A 1 35 ? -4.691  9.783   9.186   1.00 0.00 ? 43  LYS A HZ1  4  
ATOM 5106  H HZ2  . LYS A 1 35 ? -4.182  11.346  8.787   1.00 0.00 ? 43  LYS A HZ2  4  
ATOM 5107  H HZ3  . LYS A 1 35 ? -3.065  10.216  9.369   1.00 0.00 ? 43  LYS A HZ3  4  
ATOM 5108  N N    . PRO A 1 36 ? -8.857  12.467  3.363   1.00 0.00 ? 44  PRO A N    4  
ATOM 5109  C CA   . PRO A 1 36 ? -9.283  13.368  2.288   1.00 0.00 ? 44  PRO A CA   4  
ATOM 5110  C C    . PRO A 1 36 ? -8.465  14.655  2.252   1.00 0.00 ? 44  PRO A C    4  
ATOM 5111  O O    . PRO A 1 36 ? -7.654  14.912  3.143   1.00 0.00 ? 44  PRO A O    4  
ATOM 5112  C CB   . PRO A 1 36 ? -10.738 13.670  2.644   1.00 0.00 ? 44  PRO A CB   4  
ATOM 5113  C CG   . PRO A 1 36 ? -10.792 13.549  4.127   1.00 0.00 ? 44  PRO A CG   4  
ATOM 5114  C CD   . PRO A 1 36 ? -9.805  12.474  4.496   1.00 0.00 ? 44  PRO A CD   4  
ATOM 5115  H HA   . PRO A 1 36 ? -9.236  12.884  1.323   1.00 0.00 ? 44  PRO A HA   4  
ATOM 5116  H HB2  . PRO A 1 36 ? -10.991 14.669  2.318   1.00 0.00 ? 44  PRO A HB2  4  
ATOM 5117  H HB3  . PRO A 1 36 ? -11.386 12.951  2.165   1.00 0.00 ? 44  PRO A HB3  4  
ATOM 5118  H HG2  . PRO A 1 36 ? -10.512 14.487  4.583   1.00 0.00 ? 44  PRO A HG2  4  
ATOM 5119  H HG3  . PRO A 1 36 ? -11.787 13.264  4.436   1.00 0.00 ? 44  PRO A HG3  4  
ATOM 5120  H HD2  . PRO A 1 36 ? -9.301  12.725  5.417   1.00 0.00 ? 44  PRO A HD2  4  
ATOM 5121  H HD3  . PRO A 1 36 ? -10.303 11.519  4.585   1.00 0.00 ? 44  PRO A HD3  4  
ATOM 5122  N N    . GLY A 1 37 ? -8.685  15.461  1.217   1.00 0.00 ? 45  GLY A N    4  
ATOM 5123  C CA   . GLY A 1 37 ? -7.960  16.714  1.084   1.00 0.00 ? 45  GLY A CA   4  
ATOM 5124  C C    . GLY A 1 37 ? -6.456  16.524  1.122   1.00 0.00 ? 45  GLY A C    4  
ATOM 5125  O O    . GLY A 1 37 ? -5.714  17.446  1.464   1.00 0.00 ? 45  GLY A O    4  
ATOM 5126  H H    . GLY A 1 37 ? -9.343  15.204  0.539   1.00 0.00 ? 45  GLY A H    4  
ATOM 5127  H HA2  . GLY A 1 37 ? -8.229  17.173  0.145   1.00 0.00 ? 45  GLY A HA2  4  
ATOM 5128  H HA3  . GLY A 1 37 ? -8.248  17.371  1.891   1.00 0.00 ? 45  GLY A HA3  4  
ATOM 5129  N N    . SER A 1 38 ? -6.002  15.325  0.769   1.00 0.00 ? 46  SER A N    4  
ATOM 5130  C CA   . SER A 1 38 ? -4.578  15.015  0.764   1.00 0.00 ? 46  SER A CA   4  
ATOM 5131  C C    . SER A 1 38 ? -4.112  14.634  -0.637  1.00 0.00 ? 46  SER A C    4  
ATOM 5132  O O    . SER A 1 38 ? -4.861  14.762  -1.606  1.00 0.00 ? 46  SER A O    4  
ATOM 5133  C CB   . SER A 1 38 ? -4.281  13.877  1.740   1.00 0.00 ? 46  SER A CB   4  
ATOM 5134  O OG   . SER A 1 38 ? -4.790  12.645  1.259   1.00 0.00 ? 46  SER A OG   4  
ATOM 5135  H H    . SER A 1 38 ? -6.642  14.630  0.507   1.00 0.00 ? 46  SER A H    4  
ATOM 5136  H HA   . SER A 1 38 ? -4.044  15.899  1.081   1.00 0.00 ? 46  SER A HA   4  
ATOM 5137  H HB2  . SER A 1 38 ? -3.212  13.783  1.866   1.00 0.00 ? 46  SER A HB2  4  
ATOM 5138  H HB3  . SER A 1 38 ? -4.737  14.094  2.693   1.00 0.00 ? 46  SER A HB3  4  
ATOM 5139  H HG   . SER A 1 38 ? -4.983  12.067  2.000   1.00 0.00 ? 46  SER A HG   4  
ATOM 5140  N N    . LEU A 1 39 ? -2.873  14.167  -0.738  1.00 0.00 ? 47  LEU A N    4  
ATOM 5141  C CA   . LEU A 1 39 ? -2.312  13.768  -2.022  1.00 0.00 ? 47  LEU A CA   4  
ATOM 5142  C C    . LEU A 1 39 ? -2.830  12.395  -2.438  1.00 0.00 ? 47  LEU A C    4  
ATOM 5143  O O    . LEU A 1 39 ? -3.202  12.186  -3.592  1.00 0.00 ? 47  LEU A O    4  
ATOM 5144  C CB   . LEU A 1 39 ? -0.787  13.758  -1.954  1.00 0.00 ? 47  LEU A CB   4  
ATOM 5145  C CG   . LEU A 1 39 ? -0.143  15.131  -1.759  1.00 0.00 ? 47  LEU A CG   4  
ATOM 5146  C CD1  . LEU A 1 39 ? 1.056   15.032  -0.830  1.00 0.00 ? 47  LEU A CD1  4  
ATOM 5147  C CD2  . LEU A 1 39 ? 0.265   15.723  -3.099  1.00 0.00 ? 47  LEU A CD2  4  
ATOM 5148  H H    . LEU A 1 39 ? -2.324  14.087  0.069   1.00 0.00 ? 47  LEU A H    4  
ATOM 5149  H HA   . LEU A 1 39 ? -2.625  14.493  -2.759  1.00 0.00 ? 47  LEU A HA   4  
ATOM 5150  H HB2  . LEU A 1 39 ? -0.489  13.121  -1.134  1.00 0.00 ? 47  LEU A HB2  4  
ATOM 5151  H HB3  . LEU A 1 39 ? -0.407  13.333  -2.872  1.00 0.00 ? 47  LEU A HB3  4  
ATOM 5152  H HG   . LEU A 1 39 ? -0.861  15.796  -1.303  1.00 0.00 ? 47  LEU A HG   4  
ATOM 5153  H HD11 . LEU A 1 39 ? 1.636   14.156  -1.083  1.00 0.00 ? 47  LEU A HD11 4  
ATOM 5154  H HD12 . LEU A 1 39 ? 0.714   14.956  0.191   1.00 0.00 ? 47  LEU A HD12 4  
ATOM 5155  H HD13 . LEU A 1 39 ? 1.670   15.914  -0.940  1.00 0.00 ? 47  LEU A HD13 4  
ATOM 5156  H HD21 . LEU A 1 39 ? -0.605  15.816  -3.732  1.00 0.00 ? 47  LEU A HD21 4  
ATOM 5157  H HD22 . LEU A 1 39 ? 0.989   15.077  -3.574  1.00 0.00 ? 47  LEU A HD22 4  
ATOM 5158  H HD23 . LEU A 1 39 ? 0.703   16.698  -2.944  1.00 0.00 ? 47  LEU A HD23 4  
ATOM 5159  N N    . SER A 1 40 ? -2.857  11.462  -1.488  1.00 0.00 ? 48  SER A N    4  
ATOM 5160  C CA   . SER A 1 40 ? -3.337  10.110  -1.760  1.00 0.00 ? 48  SER A CA   4  
ATOM 5161  C C    . SER A 1 40 ? -4.725  10.152  -2.393  1.00 0.00 ? 48  SER A C    4  
ATOM 5162  O O    . SER A 1 40 ? -4.989  9.469   -3.384  1.00 0.00 ? 48  SER A O    4  
ATOM 5163  C CB   . SER A 1 40 ? -3.373  9.289   -0.468  1.00 0.00 ? 48  SER A CB   4  
ATOM 5164  O OG   . SER A 1 40 ? -4.369  8.282   -0.527  1.00 0.00 ? 48  SER A OG   4  
ATOM 5165  H H    . SER A 1 40 ? -2.548  11.687  -0.584  1.00 0.00 ? 48  SER A H    4  
ATOM 5166  H HA   . SER A 1 40 ? -2.651  9.646   -2.454  1.00 0.00 ? 48  SER A HA   4  
ATOM 5167  H HB2  . SER A 1 40 ? -2.414  8.819   -0.316  1.00 0.00 ? 48  SER A HB2  4  
ATOM 5168  H HB3  . SER A 1 40 ? -3.589  9.943   0.363   1.00 0.00 ? 48  SER A HB3  4  
ATOM 5169  H HG   . SER A 1 40 ? -5.204  8.637   -0.214  1.00 0.00 ? 48  SER A HG   4  
ATOM 5170  N N    . ALA A 1 41 ? -5.604  10.963  -1.818  1.00 0.00 ? 49  ALA A N    4  
ATOM 5171  C CA   . ALA A 1 41 ? -6.961  11.103  -2.329  1.00 0.00 ? 49  ALA A CA   4  
ATOM 5172  C C    . ALA A 1 41 ? -6.956  11.826  -3.668  1.00 0.00 ? 49  ALA A C    4  
ATOM 5173  O O    . ALA A 1 41 ? -7.744  11.516  -4.561  1.00 0.00 ? 49  ALA A O    4  
ATOM 5174  C CB   . ALA A 1 41 ? -7.822  11.859  -1.332  1.00 0.00 ? 49  ALA A CB   4  
ATOM 5175  H H    . ALA A 1 41 ? -5.333  11.485  -1.034  1.00 0.00 ? 49  ALA A H    4  
ATOM 5176  H HA   . ALA A 1 41 ? -7.377  10.115  -2.460  1.00 0.00 ? 49  ALA A HA   4  
ATOM 5177  H HB1  . ALA A 1 41 ? -8.290  11.160  -0.656  1.00 0.00 ? 49  ALA A HB1  4  
ATOM 5178  H HB2  . ALA A 1 41 ? -8.584  12.413  -1.861  1.00 0.00 ? 49  ALA A HB2  4  
ATOM 5179  H HB3  . ALA A 1 41 ? -7.204  12.544  -0.770  1.00 0.00 ? 49  ALA A HB3  4  
ATOM 5180  N N    . GLU A 1 42 ? -6.055  12.792  -3.794  1.00 0.00 ? 50  GLU A N    4  
ATOM 5181  C CA   . GLU A 1 42 ? -5.930  13.573  -5.016  1.00 0.00 ? 50  GLU A CA   4  
ATOM 5182  C C    . GLU A 1 42 ? -5.599  12.675  -6.205  1.00 0.00 ? 50  GLU A C    4  
ATOM 5183  O O    . GLU A 1 42 ? -6.096  12.885  -7.312  1.00 0.00 ? 50  GLU A O    4  
ATOM 5184  C CB   . GLU A 1 42 ? -4.849  14.642  -4.845  1.00 0.00 ? 50  GLU A CB   4  
ATOM 5185  C CG   . GLU A 1 42 ? -5.397  16.004  -4.459  1.00 0.00 ? 50  GLU A CG   4  
ATOM 5186  C CD   . GLU A 1 42 ? -5.955  16.766  -5.644  1.00 0.00 ? 50  GLU A CD   4  
ATOM 5187  O OE1  . GLU A 1 42 ? -5.214  16.953  -6.633  1.00 0.00 ? 50  GLU A OE1  4  
ATOM 5188  O OE2  . GLU A 1 42 ? -7.134  17.177  -5.586  1.00 0.00 ? 50  GLU A OE2  4  
ATOM 5189  H H    . GLU A 1 42 ? -5.458  12.987  -3.042  1.00 0.00 ? 50  GLU A H    4  
ATOM 5190  H HA   . GLU A 1 42 ? -6.877  14.057  -5.198  1.00 0.00 ? 50  GLU A HA   4  
ATOM 5191  H HB2  . GLU A 1 42 ? -4.160  14.323  -4.076  1.00 0.00 ? 50  GLU A HB2  4  
ATOM 5192  H HB3  . GLU A 1 42 ? -4.312  14.744  -5.774  1.00 0.00 ? 50  GLU A HB3  4  
ATOM 5193  H HG2  . GLU A 1 42 ? -6.186  15.870  -3.735  1.00 0.00 ? 50  GLU A HG2  4  
ATOM 5194  H HG3  . GLU A 1 42 ? -4.601  16.588  -4.018  1.00 0.00 ? 50  GLU A HG3  4  
ATOM 5195  N N    . VAL A 1 43 ? -4.755  11.674  -5.970  1.00 0.00 ? 51  VAL A N    4  
ATOM 5196  C CA   . VAL A 1 43 ? -4.360  10.746  -7.023  1.00 0.00 ? 51  VAL A CA   4  
ATOM 5197  C C    . VAL A 1 43 ? -5.427  9.679   -7.248  1.00 0.00 ? 51  VAL A C    4  
ATOM 5198  O O    . VAL A 1 43 ? -5.581  9.167   -8.358  1.00 0.00 ? 51  VAL A O    4  
ATOM 5199  C CB   . VAL A 1 43 ? -3.024  10.052  -6.693  1.00 0.00 ? 51  VAL A CB   4  
ATOM 5200  C CG1  . VAL A 1 43 ? -1.879  11.053  -6.710  1.00 0.00 ? 51  VAL A CG1  4  
ATOM 5201  C CG2  . VAL A 1 43 ? -3.104  9.346   -5.349  1.00 0.00 ? 51  VAL A CG2  4  
ATOM 5202  H H    . VAL A 1 43 ? -4.392  11.558  -5.068  1.00 0.00 ? 51  VAL A H    4  
ATOM 5203  H HA   . VAL A 1 43 ? -4.232  11.311  -7.936  1.00 0.00 ? 51  VAL A HA   4  
ATOM 5204  H HB   . VAL A 1 43 ? -2.834  9.310   -7.455  1.00 0.00 ? 51  VAL A HB   4  
ATOM 5205  H HG11 . VAL A 1 43 ? -1.533  11.188  -7.723  1.00 0.00 ? 51  VAL A HG11 4  
ATOM 5206  H HG12 . VAL A 1 43 ? -1.069  10.682  -6.099  1.00 0.00 ? 51  VAL A HG12 4  
ATOM 5207  H HG13 . VAL A 1 43 ? -2.222  11.998  -6.317  1.00 0.00 ? 51  VAL A HG13 4  
ATOM 5208  H HG21 . VAL A 1 43 ? -3.190  10.078  -4.562  1.00 0.00 ? 51  VAL A HG21 4  
ATOM 5209  H HG22 . VAL A 1 43 ? -2.209  8.758   -5.198  1.00 0.00 ? 51  VAL A HG22 4  
ATOM 5210  H HG23 . VAL A 1 43 ? -3.967  8.696   -5.334  1.00 0.00 ? 51  VAL A HG23 4  
ATOM 5211  N N    . GLY A 1 44 ? -6.160  9.348   -6.191  1.00 0.00 ? 52  GLY A N    4  
ATOM 5212  C CA   . GLY A 1 44 ? -7.201  8.343   -6.295  1.00 0.00 ? 52  GLY A CA   4  
ATOM 5213  C C    . GLY A 1 44 ? -6.841  7.062   -5.569  1.00 0.00 ? 52  GLY A C    4  
ATOM 5214  O O    . GLY A 1 44 ? -7.170  5.967   -6.024  1.00 0.00 ? 52  GLY A O    4  
ATOM 5215  H H    . GLY A 1 44 ? -5.991  9.789   -5.331  1.00 0.00 ? 52  GLY A H    4  
ATOM 5216  H HA2  . GLY A 1 44 ? -8.113  8.740   -5.873  1.00 0.00 ? 52  GLY A HA2  4  
ATOM 5217  H HA3  . GLY A 1 44 ? -7.367  8.118   -7.339  1.00 0.00 ? 52  GLY A HA3  4  
ATOM 5218  N N    . LEU A 1 45 ? -6.159  7.201   -4.436  1.00 0.00 ? 53  LEU A N    4  
ATOM 5219  C CA   . LEU A 1 45 ? -5.749  6.049   -3.642  1.00 0.00 ? 53  LEU A CA   4  
ATOM 5220  C C    . LEU A 1 45 ? -6.865  5.608   -2.701  1.00 0.00 ? 53  LEU A C    4  
ATOM 5221  O O    . LEU A 1 45 ? -7.787  6.370   -2.414  1.00 0.00 ? 53  LEU A O    4  
ATOM 5222  C CB   . LEU A 1 45 ? -4.492  6.384   -2.836  1.00 0.00 ? 53  LEU A CB   4  
ATOM 5223  C CG   . LEU A 1 45 ? -3.170  6.114   -3.555  1.00 0.00 ? 53  LEU A CG   4  
ATOM 5224  C CD1  . LEU A 1 45 ? -2.009  6.714   -2.774  1.00 0.00 ? 53  LEU A CD1  4  
ATOM 5225  C CD2  . LEU A 1 45 ? -2.966  4.620   -3.751  1.00 0.00 ? 53  LEU A CD2  4  
ATOM 5226  H H    . LEU A 1 45 ? -5.926  8.102   -4.126  1.00 0.00 ? 53  LEU A H    4  
ATOM 5227  H HA   . LEU A 1 45 ? -5.525  5.241   -4.321  1.00 0.00 ? 53  LEU A HA   4  
ATOM 5228  H HB2  . LEU A 1 45 ? -4.529  7.430   -2.575  1.00 0.00 ? 53  LEU A HB2  4  
ATOM 5229  H HB3  . LEU A 1 45 ? -4.508  5.801   -1.927  1.00 0.00 ? 53  LEU A HB3  4  
ATOM 5230  H HG   . LEU A 1 45 ? -3.194  6.581   -4.528  1.00 0.00 ? 53  LEU A HG   4  
ATOM 5231  H HD11 . LEU A 1 45 ? -2.364  7.550   -2.189  1.00 0.00 ? 53  LEU A HD11 4  
ATOM 5232  H HD12 . LEU A 1 45 ? -1.250  7.053   -3.463  1.00 0.00 ? 53  LEU A HD12 4  
ATOM 5233  H HD13 . LEU A 1 45 ? -1.592  5.966   -2.117  1.00 0.00 ? 53  LEU A HD13 4  
ATOM 5234  H HD21 . LEU A 1 45 ? -3.457  4.082   -2.954  1.00 0.00 ? 53  LEU A HD21 4  
ATOM 5235  H HD22 . LEU A 1 45 ? -1.910  4.396   -3.740  1.00 0.00 ? 53  LEU A HD22 4  
ATOM 5236  H HD23 . LEU A 1 45 ? -3.388  4.321   -4.699  1.00 0.00 ? 53  LEU A HD23 4  
ATOM 5237  N N    . GLU A 1 46 ? -6.771  4.371   -2.224  1.00 0.00 ? 54  GLU A N    4  
ATOM 5238  C CA   . GLU A 1 46 ? -7.769  3.820   -1.311  1.00 0.00 ? 54  GLU A CA   4  
ATOM 5239  C C    . GLU A 1 46 ? -7.440  2.372   -0.964  1.00 0.00 ? 54  GLU A C    4  
ATOM 5240  O O    . GLU A 1 46 ? -6.606  1.743   -1.613  1.00 0.00 ? 54  GLU A O    4  
ATOM 5241  C CB   . GLU A 1 46 ? -9.167  3.907   -1.931  1.00 0.00 ? 54  GLU A CB   4  
ATOM 5242  C CG   . GLU A 1 46 ? -10.167 4.661   -1.070  1.00 0.00 ? 54  GLU A CG   4  
ATOM 5243  C CD   . GLU A 1 46 ? -11.525 3.988   -1.029  1.00 0.00 ? 54  GLU A CD   4  
ATOM 5244  O OE1  . GLU A 1 46 ? -11.596 2.824   -0.581  1.00 0.00 ? 54  GLU A OE1  4  
ATOM 5245  O OE2  . GLU A 1 46 ? -12.516 4.624   -1.444  1.00 0.00 ? 54  GLU A OE2  4  
ATOM 5246  H H    . GLU A 1 46 ? -6.010  3.813   -2.490  1.00 0.00 ? 54  GLU A H    4  
ATOM 5247  H HA   . GLU A 1 46 ? -7.747  4.410   -0.406  1.00 0.00 ? 54  GLU A HA   4  
ATOM 5248  H HB2  . GLU A 1 46 ? -9.094  4.408   -2.885  1.00 0.00 ? 54  GLU A HB2  4  
ATOM 5249  H HB3  . GLU A 1 46 ? -9.543  2.906   -2.088  1.00 0.00 ? 54  GLU A HB3  4  
ATOM 5250  H HG2  . GLU A 1 46 ? -9.782  4.724   -0.064  1.00 0.00 ? 54  GLU A HG2  4  
ATOM 5251  H HG3  . GLU A 1 46 ? -10.288 5.658   -1.471  1.00 0.00 ? 54  GLU A HG3  4  
ATOM 5252  N N    . ILE A 1 47 ? -8.099  1.848   0.065   1.00 0.00 ? 55  ILE A N    4  
ATOM 5253  C CA   . ILE A 1 47 ? -7.872  0.474   0.497   1.00 0.00 ? 55  ILE A CA   4  
ATOM 5254  C C    . ILE A 1 47 ? -8.140  -0.511  -0.638  1.00 0.00 ? 55  ILE A C    4  
ATOM 5255  O O    . ILE A 1 47 ? -9.036  -0.300  -1.457  1.00 0.00 ? 55  ILE A O    4  
ATOM 5256  C CB   . ILE A 1 47 ? -8.756  0.104   1.703   1.00 0.00 ? 55  ILE A CB   4  
ATOM 5257  C CG1  . ILE A 1 47 ? -8.736  1.226   2.747   1.00 0.00 ? 55  ILE A CG1  4  
ATOM 5258  C CG2  . ILE A 1 47 ? -8.292  -1.210  2.316   1.00 0.00 ? 55  ILE A CG2  4  
ATOM 5259  C CD1  . ILE A 1 47 ? -10.101 1.819   3.022   1.00 0.00 ? 55  ILE A CD1  4  
ATOM 5260  H H    . ILE A 1 47 ? -8.752  2.399   0.545   1.00 0.00 ? 55  ILE A H    4  
ATOM 5261  H HA   . ILE A 1 47 ? -6.838  0.387   0.795   1.00 0.00 ? 55  ILE A HA   4  
ATOM 5262  H HB   . ILE A 1 47 ? -9.768  -0.031  1.350   1.00 0.00 ? 55  ILE A HB   4  
ATOM 5263  H HG12 . ILE A 1 47 ? -8.352  0.836   3.678   1.00 0.00 ? 55  ILE A HG12 4  
ATOM 5264  H HG13 . ILE A 1 47 ? -8.092  2.020   2.402   1.00 0.00 ? 55  ILE A HG13 4  
ATOM 5265  H HG21 . ILE A 1 47 ? -8.908  -1.447  3.170   1.00 0.00 ? 55  ILE A HG21 4  
ATOM 5266  H HG22 . ILE A 1 47 ? -7.263  -1.116  2.630   1.00 0.00 ? 55  ILE A HG22 4  
ATOM 5267  H HG23 . ILE A 1 47 ? -8.373  -1.999  1.583   1.00 0.00 ? 55  ILE A HG23 4  
ATOM 5268  H HD11 . ILE A 1 47 ? -10.196 2.030   4.077   1.00 0.00 ? 55  ILE A HD11 4  
ATOM 5269  H HD12 . ILE A 1 47 ? -10.866 1.114   2.728   1.00 0.00 ? 55  ILE A HD12 4  
ATOM 5270  H HD13 . ILE A 1 47 ? -10.217 2.732   2.459   1.00 0.00 ? 55  ILE A HD13 4  
ATOM 5271  N N    . GLY A 1 48 ? -7.358  -1.584  -0.682  1.00 0.00 ? 56  GLY A N    4  
ATOM 5272  C CA   . GLY A 1 48 ? -7.527  -2.581  -1.722  1.00 0.00 ? 56  GLY A CA   4  
ATOM 5273  C C    . GLY A 1 48 ? -6.433  -2.520  -2.774  1.00 0.00 ? 56  GLY A C    4  
ATOM 5274  O O    . GLY A 1 48 ? -6.292  -3.437  -3.585  1.00 0.00 ? 56  GLY A O    4  
ATOM 5275  H H    . GLY A 1 48 ? -6.659  -1.698  -0.004  1.00 0.00 ? 56  GLY A H    4  
ATOM 5276  H HA2  . GLY A 1 48 ? -7.520  -3.562  -1.270  1.00 0.00 ? 56  GLY A HA2  4  
ATOM 5277  H HA3  . GLY A 1 48 ? -8.480  -2.424  -2.203  1.00 0.00 ? 56  GLY A HA3  4  
ATOM 5278  N N    . ASP A 1 49 ? -5.662  -1.438  -2.765  1.00 0.00 ? 57  ASP A N    4  
ATOM 5279  C CA   . ASP A 1 49 ? -4.580  -1.257  -3.725  1.00 0.00 ? 57  ASP A CA   4  
ATOM 5280  C C    . ASP A 1 49 ? -3.295  -1.917  -3.234  1.00 0.00 ? 57  ASP A C    4  
ATOM 5281  O O    . ASP A 1 49 ? -3.154  -2.220  -2.049  1.00 0.00 ? 57  ASP A O    4  
ATOM 5282  C CB   . ASP A 1 49 ? -4.342  0.235   -3.968  1.00 0.00 ? 57  ASP A CB   4  
ATOM 5283  C CG   . ASP A 1 49 ? -5.464  0.878   -4.759  1.00 0.00 ? 57  ASP A CG   4  
ATOM 5284  O OD1  . ASP A 1 49 ? -5.840  0.326   -5.813  1.00 0.00 ? 57  ASP A OD1  4  
ATOM 5285  O OD2  . ASP A 1 49 ? -5.967  1.935   -4.323  1.00 0.00 ? 57  ASP A OD2  4  
ATOM 5286  H H    . ASP A 1 49 ? -5.825  -0.740  -2.098  1.00 0.00 ? 57  ASP A H    4  
ATOM 5287  H HA   . ASP A 1 49 ? -4.877  -1.721  -4.656  1.00 0.00 ? 57  ASP A HA   4  
ATOM 5288  H HB2  . ASP A 1 49 ? -4.261  0.738   -3.017  1.00 0.00 ? 57  ASP A HB2  4  
ATOM 5289  H HB3  . ASP A 1 49 ? -3.422  0.360   -4.515  1.00 0.00 ? 57  ASP A HB3  4  
ATOM 5290  N N    . GLN A 1 50 ? -2.361  -2.138  -4.154  1.00 0.00 ? 58  GLN A N    4  
ATOM 5291  C CA   . GLN A 1 50 ? -1.086  -2.764  -3.818  1.00 0.00 ? 58  GLN A CA   4  
ATOM 5292  C C    . GLN A 1 50 ? 0.052   -2.141  -4.622  1.00 0.00 ? 58  GLN A C    4  
ATOM 5293  O O    . GLN A 1 50 ? 0.096   -2.261  -5.846  1.00 0.00 ? 58  GLN A O    4  
ATOM 5294  C CB   . GLN A 1 50 ? -1.149  -4.269  -4.083  1.00 0.00 ? 58  GLN A CB   4  
ATOM 5295  C CG   . GLN A 1 50 ? 0.077   -5.026  -3.599  1.00 0.00 ? 58  GLN A CG   4  
ATOM 5296  C CD   . GLN A 1 50 ? 1.062   -5.315  -4.715  1.00 0.00 ? 58  GLN A CD   4  
ATOM 5297  O OE1  . GLN A 1 50 ? 1.812   -4.435  -5.140  1.00 0.00 ? 58  GLN A OE1  4  
ATOM 5298  N NE2  . GLN A 1 50 ? 1.066   -6.552  -5.197  1.00 0.00 ? 58  GLN A NE2  4  
ATOM 5299  H H    . GLN A 1 50 ? -2.534  -1.875  -5.082  1.00 0.00 ? 58  GLN A H    4  
ATOM 5300  H HA   . GLN A 1 50 ? -0.901  -2.599  -2.766  1.00 0.00 ? 58  GLN A HA   4  
ATOM 5301  H HB2  . GLN A 1 50 ? -2.016  -4.675  -3.582  1.00 0.00 ? 58  GLN A HB2  4  
ATOM 5302  H HB3  . GLN A 1 50 ? -1.251  -4.432  -5.146  1.00 0.00 ? 58  GLN A HB3  4  
ATOM 5303  H HG2  . GLN A 1 50 ? 0.575   -4.435  -2.846  1.00 0.00 ? 58  GLN A HG2  4  
ATOM 5304  H HG3  . GLN A 1 50 ? -0.241  -5.964  -3.169  1.00 0.00 ? 58  GLN A HG3  4  
ATOM 5305  H HE21 . GLN A 1 50 ? 0.443   -7.202  -4.810  1.00 0.00 ? 58  GLN A HE21 4  
ATOM 5306  H HE22 . GLN A 1 50 ? 1.694   -6.766  -5.919  1.00 0.00 ? 58  GLN A HE22 4  
ATOM 5307  N N    . ILE A 1 51 ? 0.972   -1.478  -3.927  1.00 0.00 ? 59  ILE A N    4  
ATOM 5308  C CA   . ILE A 1 51 ? 2.106   -0.837  -4.583  1.00 0.00 ? 59  ILE A CA   4  
ATOM 5309  C C    . ILE A 1 51 ? 3.066   -1.879  -5.149  1.00 0.00 ? 59  ILE A C    4  
ATOM 5310  O O    . ILE A 1 51 ? 3.645   -2.673  -4.407  1.00 0.00 ? 59  ILE A O    4  
ATOM 5311  C CB   . ILE A 1 51 ? 2.874   0.079   -3.611  1.00 0.00 ? 59  ILE A CB   4  
ATOM 5312  C CG1  . ILE A 1 51 ? 1.909   1.020   -2.887  1.00 0.00 ? 59  ILE A CG1  4  
ATOM 5313  C CG2  . ILE A 1 51 ? 3.935   0.875   -4.357  1.00 0.00 ? 59  ILE A CG2  4  
ATOM 5314  C CD1  . ILE A 1 51 ? 2.590   1.944   -1.902  1.00 0.00 ? 59  ILE A CD1  4  
ATOM 5315  H H    . ILE A 1 51 ? 0.885   -1.418  -2.953  1.00 0.00 ? 59  ILE A H    4  
ATOM 5316  H HA   . ILE A 1 51 ? 1.727   -0.233  -5.393  1.00 0.00 ? 59  ILE A HA   4  
ATOM 5317  H HB   . ILE A 1 51 ? 3.374   -0.542  -2.883  1.00 0.00 ? 59  ILE A HB   4  
ATOM 5318  H HG12 . ILE A 1 51 ? 1.398   1.630   -3.616  1.00 0.00 ? 59  ILE A HG12 4  
ATOM 5319  H HG13 . ILE A 1 51 ? 1.183   0.432   -2.345  1.00 0.00 ? 59  ILE A HG13 4  
ATOM 5320  H HG21 . ILE A 1 51 ? 4.350   1.627   -3.701  1.00 0.00 ? 59  ILE A HG21 4  
ATOM 5321  H HG22 . ILE A 1 51 ? 3.488   1.355   -5.215  1.00 0.00 ? 59  ILE A HG22 4  
ATOM 5322  H HG23 . ILE A 1 51 ? 4.721   0.211   -4.685  1.00 0.00 ? 59  ILE A HG23 4  
ATOM 5323  H HD11 . ILE A 1 51 ? 2.014   1.986   -0.991  1.00 0.00 ? 59  ILE A HD11 4  
ATOM 5324  H HD12 . ILE A 1 51 ? 2.662   2.934   -2.328  1.00 0.00 ? 59  ILE A HD12 4  
ATOM 5325  H HD13 . ILE A 1 51 ? 3.582   1.572   -1.686  1.00 0.00 ? 59  ILE A HD13 4  
ATOM 5326  N N    . VAL A 1 52 ? 3.223   -1.874  -6.469  1.00 0.00 ? 60  VAL A N    4  
ATOM 5327  C CA   . VAL A 1 52 ? 4.104   -2.823  -7.138  1.00 0.00 ? 60  VAL A CA   4  
ATOM 5328  C C    . VAL A 1 52 ? 5.386   -2.153  -7.636  1.00 0.00 ? 60  VAL A C    4  
ATOM 5329  O O    . VAL A 1 52 ? 6.189   -2.779  -8.328  1.00 0.00 ? 60  VAL A O    4  
ATOM 5330  C CB   . VAL A 1 52 ? 3.393   -3.501  -8.326  1.00 0.00 ? 60  VAL A CB   4  
ATOM 5331  C CG1  . VAL A 1 52 ? 2.150   -4.237  -7.853  1.00 0.00 ? 60  VAL A CG1  4  
ATOM 5332  C CG2  . VAL A 1 52 ? 3.037   -2.478  -9.394  1.00 0.00 ? 60  VAL A CG2  4  
ATOM 5333  H H    . VAL A 1 52 ? 2.729   -1.220  -7.006  1.00 0.00 ? 60  VAL A H    4  
ATOM 5334  H HA   . VAL A 1 52 ? 4.368   -3.588  -6.423  1.00 0.00 ? 60  VAL A HA   4  
ATOM 5335  H HB   . VAL A 1 52 ? 4.069   -4.223  -8.760  1.00 0.00 ? 60  VAL A HB   4  
ATOM 5336  H HG11 . VAL A 1 52 ? 2.441   -5.103  -7.275  1.00 0.00 ? 60  VAL A HG11 4  
ATOM 5337  H HG12 . VAL A 1 52 ? 1.571   -4.555  -8.708  1.00 0.00 ? 60  VAL A HG12 4  
ATOM 5338  H HG13 . VAL A 1 52 ? 1.552   -3.580  -7.239  1.00 0.00 ? 60  VAL A HG13 4  
ATOM 5339  H HG21 . VAL A 1 52 ? 2.708   -2.989  -10.288 1.00 0.00 ? 60  VAL A HG21 4  
ATOM 5340  H HG22 . VAL A 1 52 ? 3.904   -1.877  -9.623  1.00 0.00 ? 60  VAL A HG22 4  
ATOM 5341  H HG23 . VAL A 1 52 ? 2.243   -1.840  -9.033  1.00 0.00 ? 60  VAL A HG23 4  
ATOM 5342  N N    . GLU A 1 53 ? 5.578   -0.883  -7.285  1.00 0.00 ? 61  GLU A N    4  
ATOM 5343  C CA   . GLU A 1 53 ? 6.766   -0.148  -7.704  1.00 0.00 ? 61  GLU A CA   4  
ATOM 5344  C C    . GLU A 1 53 ? 6.779   1.259   -7.114  1.00 0.00 ? 61  GLU A C    4  
ATOM 5345  O O    . GLU A 1 53 ? 5.728   1.853   -6.876  1.00 0.00 ? 61  GLU A O    4  
ATOM 5346  C CB   . GLU A 1 53 ? 6.832   -0.073  -9.230  1.00 0.00 ? 61  GLU A CB   4  
ATOM 5347  C CG   . GLU A 1 53 ? 8.246   0.062   -9.773  1.00 0.00 ? 61  GLU A CG   4  
ATOM 5348  C CD   . GLU A 1 53 ? 8.402   -0.547  -11.153 1.00 0.00 ? 61  GLU A CD   4  
ATOM 5349  O OE1  . GLU A 1 53 ? 7.525   -0.310  -12.009 1.00 0.00 ? 61  GLU A OE1  4  
ATOM 5350  O OE2  . GLU A 1 53 ? 9.402   -1.262  -11.375 1.00 0.00 ? 61  GLU A OE2  4  
ATOM 5351  H H    . GLU A 1 53 ? 4.907   -0.431  -6.731  1.00 0.00 ? 61  GLU A H    4  
ATOM 5352  H HA   . GLU A 1 53 ? 7.632   -0.685  -7.342  1.00 0.00 ? 61  GLU A HA   4  
ATOM 5353  H HB2  . GLU A 1 53 ? 6.395   -0.971  -9.643  1.00 0.00 ? 61  GLU A HB2  4  
ATOM 5354  H HB3  . GLU A 1 53 ? 6.260   0.780   -9.562  1.00 0.00 ? 61  GLU A HB3  4  
ATOM 5355  H HG2  . GLU A 1 53 ? 8.497   1.111   -9.829  1.00 0.00 ? 61  GLU A HG2  4  
ATOM 5356  H HG3  . GLU A 1 53 ? 8.926   -0.434  -9.096  1.00 0.00 ? 61  GLU A HG3  4  
ATOM 5357  N N    . VAL A 1 54 ? 7.979   1.784   -6.881  1.00 0.00 ? 62  VAL A N    4  
ATOM 5358  C CA   . VAL A 1 54 ? 8.134   3.122   -6.322  1.00 0.00 ? 62  VAL A CA   4  
ATOM 5359  C C    . VAL A 1 54 ? 9.471   3.736   -6.731  1.00 0.00 ? 62  VAL A C    4  
ATOM 5360  O O    . VAL A 1 54 ? 10.531  3.269   -6.317  1.00 0.00 ? 62  VAL A O    4  
ATOM 5361  C CB   . VAL A 1 54 ? 8.038   3.102   -4.783  1.00 0.00 ? 62  VAL A CB   4  
ATOM 5362  C CG1  . VAL A 1 54 ? 8.157   4.512   -4.214  1.00 0.00 ? 62  VAL A CG1  4  
ATOM 5363  C CG2  . VAL A 1 54 ? 6.737   2.449   -4.339  1.00 0.00 ? 62  VAL A CG2  4  
ATOM 5364  H H    . VAL A 1 54 ? 8.779   1.260   -7.094  1.00 0.00 ? 62  VAL A H    4  
ATOM 5365  H HA   . VAL A 1 54 ? 7.334   3.739   -6.705  1.00 0.00 ? 62  VAL A HA   4  
ATOM 5366  H HB   . VAL A 1 54 ? 8.859   2.515   -4.399  1.00 0.00 ? 62  VAL A HB   4  
ATOM 5367  H HG11 . VAL A 1 54 ? 8.352   5.210   -5.016  1.00 0.00 ? 62  VAL A HG11 4  
ATOM 5368  H HG12 . VAL A 1 54 ? 8.969   4.546   -3.503  1.00 0.00 ? 62  VAL A HG12 4  
ATOM 5369  H HG13 . VAL A 1 54 ? 7.234   4.782   -3.721  1.00 0.00 ? 62  VAL A HG13 4  
ATOM 5370  H HG21 . VAL A 1 54 ? 6.588   2.625   -3.284  1.00 0.00 ? 62  VAL A HG21 4  
ATOM 5371  H HG22 . VAL A 1 54 ? 6.788   1.386   -4.523  1.00 0.00 ? 62  VAL A HG22 4  
ATOM 5372  H HG23 . VAL A 1 54 ? 5.914   2.873   -4.894  1.00 0.00 ? 62  VAL A HG23 4  
ATOM 5373  N N    . ASN A 1 55 ? 9.409   4.785   -7.546  1.00 0.00 ? 63  ASN A N    4  
ATOM 5374  C CA   . ASN A 1 55 ? 10.612  5.466   -8.010  1.00 0.00 ? 63  ASN A CA   4  
ATOM 5375  C C    . ASN A 1 55 ? 11.552  4.497   -8.721  1.00 0.00 ? 63  ASN A C    4  
ATOM 5376  O O    . ASN A 1 55 ? 12.770  4.678   -8.710  1.00 0.00 ? 63  ASN A O    4  
ATOM 5377  C CB   . ASN A 1 55 ? 11.336  6.126   -6.834  1.00 0.00 ? 63  ASN A CB   4  
ATOM 5378  C CG   . ASN A 1 55 ? 12.090  7.374   -7.248  1.00 0.00 ? 63  ASN A CG   4  
ATOM 5379  O OD1  . ASN A 1 55 ? 12.636  7.449   -8.348  1.00 0.00 ? 63  ASN A OD1  4  
ATOM 5380  N ND2  . ASN A 1 55 ? 12.126  8.364   -6.363  1.00 0.00 ? 63  ASN A ND2  4  
ATOM 5381  H H    . ASN A 1 55 ? 8.533   5.110   -7.840  1.00 0.00 ? 63  ASN A H    4  
ATOM 5382  H HA   . ASN A 1 55 ? 10.309  6.231   -8.708  1.00 0.00 ? 63  ASN A HA   4  
ATOM 5383  H HB2  . ASN A 1 55 ? 10.611  6.399   -6.083  1.00 0.00 ? 63  ASN A HB2  4  
ATOM 5384  H HB3  . ASN A 1 55 ? 12.039  5.424   -6.413  1.00 0.00 ? 63  ASN A HB3  4  
ATOM 5385  H HD21 . ASN A 1 55 ? 11.669  8.234   -5.504  1.00 0.00 ? 63  ASN A HD21 4  
ATOM 5386  H HD22 . ASN A 1 55 ? 12.607  9.183   -6.604  1.00 0.00 ? 63  ASN A HD22 4  
ATOM 5387  N N    . GLY A 1 56 ? 10.980  3.468   -9.338  1.00 0.00 ? 64  GLY A N    4  
ATOM 5388  C CA   . GLY A 1 56 ? 11.782  2.487   -10.045 1.00 0.00 ? 64  GLY A CA   4  
ATOM 5389  C C    . GLY A 1 56 ? 12.110  1.279   -9.188  1.00 0.00 ? 64  GLY A C    4  
ATOM 5390  O O    . GLY A 1 56 ? 12.341  0.187   -9.707  1.00 0.00 ? 64  GLY A O    4  
ATOM 5391  H H    . GLY A 1 56 ? 10.005  3.375   -9.313  1.00 0.00 ? 64  GLY A H    4  
ATOM 5392  H HA2  . GLY A 1 56 ? 11.242  2.159   -10.919 1.00 0.00 ? 64  GLY A HA2  4  
ATOM 5393  H HA3  . GLY A 1 56 ? 12.705  2.952   -10.358 1.00 0.00 ? 64  GLY A HA3  4  
ATOM 5394  N N    . VAL A 1 57 ? 12.132  1.475   -7.873  1.00 0.00 ? 65  VAL A N    4  
ATOM 5395  C CA   . VAL A 1 57 ? 12.434  0.393   -6.945  1.00 0.00 ? 65  VAL A CA   4  
ATOM 5396  C C    . VAL A 1 57 ? 11.379  -0.705  -7.021  1.00 0.00 ? 65  VAL A C    4  
ATOM 5397  O O    . VAL A 1 57 ? 10.187  -0.448  -6.859  1.00 0.00 ? 65  VAL A O    4  
ATOM 5398  C CB   . VAL A 1 57 ? 12.523  0.907   -5.495  1.00 0.00 ? 65  VAL A CB   4  
ATOM 5399  C CG1  . VAL A 1 57 ? 13.035  -0.185  -4.569  1.00 0.00 ? 65  VAL A CG1  4  
ATOM 5400  C CG2  . VAL A 1 57 ? 13.411  2.140   -5.420  1.00 0.00 ? 65  VAL A CG2  4  
ATOM 5401  H H    . VAL A 1 57 ? 11.940  2.368   -7.520  1.00 0.00 ? 65  VAL A H    4  
ATOM 5402  H HA   . VAL A 1 57 ? 13.393  -0.022  -7.217  1.00 0.00 ? 65  VAL A HA   4  
ATOM 5403  H HB   . VAL A 1 57 ? 11.530  1.184   -5.173  1.00 0.00 ? 65  VAL A HB   4  
ATOM 5404  H HG11 . VAL A 1 57 ? 14.093  -0.332  -4.737  1.00 0.00 ? 65  VAL A HG11 4  
ATOM 5405  H HG12 . VAL A 1 57 ? 12.508  -1.106  -4.772  1.00 0.00 ? 65  VAL A HG12 4  
ATOM 5406  H HG13 . VAL A 1 57 ? 12.870  0.106   -3.543  1.00 0.00 ? 65  VAL A HG13 4  
ATOM 5407  H HG21 . VAL A 1 57 ? 13.948  2.139   -4.482  1.00 0.00 ? 65  VAL A HG21 4  
ATOM 5408  H HG22 . VAL A 1 57 ? 12.800  3.029   -5.484  1.00 0.00 ? 65  VAL A HG22 4  
ATOM 5409  H HG23 . VAL A 1 57 ? 14.115  2.127   -6.238  1.00 0.00 ? 65  VAL A HG23 4  
ATOM 5410  N N    . ASP A 1 58 ? 11.828  -1.932  -7.267  1.00 0.00 ? 66  ASP A N    4  
ATOM 5411  C CA   . ASP A 1 58 ? 10.922  -3.071  -7.365  1.00 0.00 ? 66  ASP A CA   4  
ATOM 5412  C C    . ASP A 1 58 ? 10.246  -3.343  -6.026  1.00 0.00 ? 66  ASP A C    4  
ATOM 5413  O O    . ASP A 1 58 ? 10.903  -3.704  -5.049  1.00 0.00 ? 66  ASP A O    4  
ATOM 5414  C CB   . ASP A 1 58 ? 11.683  -4.316  -7.827  1.00 0.00 ? 66  ASP A CB   4  
ATOM 5415  C CG   . ASP A 1 58 ? 12.065  -4.250  -9.293  1.00 0.00 ? 66  ASP A CG   4  
ATOM 5416  O OD1  . ASP A 1 58 ? 11.154  -4.163  -10.142 1.00 0.00 ? 66  ASP A OD1  4  
ATOM 5417  O OD2  . ASP A 1 58 ? 13.278  -4.284  -9.591  1.00 0.00 ? 66  ASP A OD2  4  
ATOM 5418  H H    . ASP A 1 58 ? 12.789  -2.075  -7.387  1.00 0.00 ? 66  ASP A H    4  
ATOM 5419  H HA   . ASP A 1 58 ? 10.164  -2.831  -8.095  1.00 0.00 ? 66  ASP A HA   4  
ATOM 5420  H HB2  . ASP A 1 58 ? 12.585  -4.416  -7.243  1.00 0.00 ? 66  ASP A HB2  4  
ATOM 5421  H HB3  . ASP A 1 58 ? 11.062  -5.186  -7.675  1.00 0.00 ? 66  ASP A HB3  4  
ATOM 5422  N N    . PHE A 1 59 ? 8.929   -3.167  -5.986  1.00 0.00 ? 67  PHE A N    4  
ATOM 5423  C CA   . PHE A 1 59 ? 8.165   -3.395  -4.764  1.00 0.00 ? 67  PHE A CA   4  
ATOM 5424  C C    . PHE A 1 59 ? 7.565   -4.799  -4.745  1.00 0.00 ? 67  PHE A C    4  
ATOM 5425  O O    . PHE A 1 59 ? 6.590   -5.055  -4.038  1.00 0.00 ? 67  PHE A O    4  
ATOM 5426  C CB   . PHE A 1 59 ? 7.056   -2.348  -4.632  1.00 0.00 ? 67  PHE A CB   4  
ATOM 5427  C CG   . PHE A 1 59 ? 7.421   -1.194  -3.744  1.00 0.00 ? 67  PHE A CG   4  
ATOM 5428  C CD1  . PHE A 1 59 ? 8.676   -0.610  -3.823  1.00 0.00 ? 67  PHE A CD1  4  
ATOM 5429  C CD2  . PHE A 1 59 ? 6.508   -0.690  -2.830  1.00 0.00 ? 67  PHE A CD2  4  
ATOM 5430  C CE1  . PHE A 1 59 ? 9.014   0.452   -3.007  1.00 0.00 ? 67  PHE A CE1  4  
ATOM 5431  C CE2  . PHE A 1 59 ? 6.842   0.372   -2.011  1.00 0.00 ? 67  PHE A CE2  4  
ATOM 5432  C CZ   . PHE A 1 59 ? 8.097   0.944   -2.100  1.00 0.00 ? 67  PHE A CZ   4  
ATOM 5433  H H    . PHE A 1 59 ? 8.461   -2.879  -6.796  1.00 0.00 ? 67  PHE A H    4  
ATOM 5434  H HA   . PHE A 1 59 ? 8.841   -3.295  -3.928  1.00 0.00 ? 67  PHE A HA   4  
ATOM 5435  H HB2  . PHE A 1 59 ? 6.824   -1.954  -5.611  1.00 0.00 ? 67  PHE A HB2  4  
ATOM 5436  H HB3  . PHE A 1 59 ? 6.174   -2.819  -4.222  1.00 0.00 ? 67  PHE A HB3  4  
ATOM 5437  H HD1  . PHE A 1 59 ? 9.394   -0.994  -4.533  1.00 0.00 ? 67  PHE A HD1  4  
ATOM 5438  H HD2  . PHE A 1 59 ? 5.528   -1.137  -2.759  1.00 0.00 ? 67  PHE A HD2  4  
ATOM 5439  H HE1  . PHE A 1 59 ? 9.995   0.897   -3.078  1.00 0.00 ? 67  PHE A HE1  4  
ATOM 5440  H HE2  . PHE A 1 59 ? 6.122   0.755   -1.302  1.00 0.00 ? 67  PHE A HE2  4  
ATOM 5441  H HZ   . PHE A 1 59 ? 8.358   1.775   -1.461  1.00 0.00 ? 67  PHE A HZ   4  
ATOM 5442  N N    . SER A 1 60 ? 8.155   -5.706  -5.517  1.00 0.00 ? 68  SER A N    4  
ATOM 5443  C CA   . SER A 1 60 ? 7.677   -7.082  -5.580  1.00 0.00 ? 68  SER A CA   4  
ATOM 5444  C C    . SER A 1 60 ? 8.126   -7.864  -4.350  1.00 0.00 ? 68  SER A C    4  
ATOM 5445  O O    . SER A 1 60 ? 7.310   -8.463  -3.650  1.00 0.00 ? 68  SER A O    4  
ATOM 5446  C CB   . SER A 1 60 ? 8.189   -7.766  -6.850  1.00 0.00 ? 68  SER A CB   4  
ATOM 5447  O OG   . SER A 1 60 ? 7.235   -7.680  -7.895  1.00 0.00 ? 68  SER A OG   4  
ATOM 5448  H H    . SER A 1 60 ? 8.931   -5.447  -6.056  1.00 0.00 ? 68  SER A H    4  
ATOM 5449  H HA   . SER A 1 60 ? 6.598   -7.058  -5.604  1.00 0.00 ? 68  SER A HA   4  
ATOM 5450  H HB2  . SER A 1 60 ? 9.102   -7.285  -7.172  1.00 0.00 ? 68  SER A HB2  4  
ATOM 5451  H HB3  . SER A 1 60 ? 8.385   -8.807  -6.641  1.00 0.00 ? 68  SER A HB3  4  
ATOM 5452  H HG   . SER A 1 60 ? 7.520   -8.225  -8.633  1.00 0.00 ? 68  SER A HG   4  
ATOM 5453  N N    . ASN A 1 61 ? 9.429   -7.848  -4.091  1.00 0.00 ? 69  ASN A N    4  
ATOM 5454  C CA   . ASN A 1 61 ? 9.989   -8.549  -2.944  1.00 0.00 ? 69  ASN A CA   4  
ATOM 5455  C C    . ASN A 1 61 ? 10.520  -7.558  -1.913  1.00 0.00 ? 69  ASN A C    4  
ATOM 5456  O O    . ASN A 1 61 ? 11.450  -7.861  -1.166  1.00 0.00 ? 69  ASN A O    4  
ATOM 5457  C CB   . ASN A 1 61 ? 11.112  -9.488  -3.391  1.00 0.00 ? 69  ASN A CB   4  
ATOM 5458  C CG   . ASN A 1 61 ? 11.382  -10.587 -2.383  1.00 0.00 ? 69  ASN A CG   4  
ATOM 5459  O OD1  . ASN A 1 61 ? 10.780  -11.660 -2.441  1.00 0.00 ? 69  ASN A OD1  4  
ATOM 5460  N ND2  . ASN A 1 61 ? 12.292  -10.325 -1.453  1.00 0.00 ? 69  ASN A ND2  4  
ATOM 5461  H H    . ASN A 1 61 ? 10.028  -7.349  -4.686  1.00 0.00 ? 69  ASN A H    4  
ATOM 5462  H HA   . ASN A 1 61 ? 9.201   -9.134  -2.494  1.00 0.00 ? 69  ASN A HA   4  
ATOM 5463  H HB2  . ASN A 1 61 ? 10.837  -9.946  -4.330  1.00 0.00 ? 69  ASN A HB2  4  
ATOM 5464  H HB3  . ASN A 1 61 ? 12.018  -8.916  -3.525  1.00 0.00 ? 69  ASN A HB3  4  
ATOM 5465  H HD21 . ASN A 1 61 ? 12.731  -9.449  -1.467  1.00 0.00 ? 69  ASN A HD21 4  
ATOM 5466  H HD22 . ASN A 1 61 ? 12.486  -11.019 -0.787  1.00 0.00 ? 69  ASN A HD22 4  
ATOM 5467  N N    . LEU A 1 62 ? 9.920   -6.372  -1.880  1.00 0.00 ? 70  LEU A N    4  
ATOM 5468  C CA   . LEU A 1 62 ? 10.328  -5.332  -0.943  1.00 0.00 ? 70  LEU A CA   4  
ATOM 5469  C C    . LEU A 1 62 ? 9.675   -5.541  0.420   1.00 0.00 ? 70  LEU A C    4  
ATOM 5470  O O    . LEU A 1 62 ? 8.552   -6.038  0.511   1.00 0.00 ? 70  LEU A O    4  
ATOM 5471  C CB   . LEU A 1 62 ? 9.962   -3.953  -1.491  1.00 0.00 ? 70  LEU A CB   4  
ATOM 5472  C CG   . LEU A 1 62 ? 10.484  -2.769  -0.670  1.00 0.00 ? 70  LEU A CG   4  
ATOM 5473  C CD1  . LEU A 1 62 ? 11.642  -2.089  -1.388  1.00 0.00 ? 70  LEU A CD1  4  
ATOM 5474  C CD2  . LEU A 1 62 ? 9.367   -1.773  -0.397  1.00 0.00 ? 70  LEU A CD2  4  
ATOM 5475  H H    . LEU A 1 62 ? 9.184   -6.191  -2.500  1.00 0.00 ? 70  LEU A H    4  
ATOM 5476  H HA   . LEU A 1 62 ? 11.400  -5.393  -0.827  1.00 0.00 ? 70  LEU A HA   4  
ATOM 5477  H HB2  . LEU A 1 62 ? 10.355  -3.872  -2.494  1.00 0.00 ? 70  LEU A HB2  4  
ATOM 5478  H HB3  . LEU A 1 62 ? 8.885   -3.883  -1.540  1.00 0.00 ? 70  LEU A HB3  4  
ATOM 5479  H HG   . LEU A 1 62 ? 10.849  -3.131  0.279   1.00 0.00 ? 70  LEU A HG   4  
ATOM 5480  H HD11 . LEU A 1 62 ? 11.797  -1.107  -0.968  1.00 0.00 ? 70  LEU A HD11 4  
ATOM 5481  H HD12 . LEU A 1 62 ? 11.411  -1.998  -2.438  1.00 0.00 ? 70  LEU A HD12 4  
ATOM 5482  H HD13 . LEU A 1 62 ? 12.537  -2.679  -1.265  1.00 0.00 ? 70  LEU A HD13 4  
ATOM 5483  H HD21 . LEU A 1 62 ? 9.783   -0.781  -0.298  1.00 0.00 ? 70  LEU A HD21 4  
ATOM 5484  H HD22 . LEU A 1 62 ? 8.858   -2.043  0.516   1.00 0.00 ? 70  LEU A HD22 4  
ATOM 5485  H HD23 . LEU A 1 62 ? 8.662   -1.786  -1.218  1.00 0.00 ? 70  LEU A HD23 4  
ATOM 5486  N N    . ASP A 1 63 ? 10.384  -5.158  1.476   1.00 0.00 ? 71  ASP A N    4  
ATOM 5487  C CA   . ASP A 1 63 ? 9.872   -5.303  2.833   1.00 0.00 ? 71  ASP A CA   4  
ATOM 5488  C C    . ASP A 1 63 ? 8.969   -4.129  3.202   1.00 0.00 ? 71  ASP A C    4  
ATOM 5489  O O    . ASP A 1 63 ? 8.991   -3.087  2.547   1.00 0.00 ? 71  ASP A O    4  
ATOM 5490  C CB   . ASP A 1 63 ? 11.031  -5.406  3.829   1.00 0.00 ? 71  ASP A CB   4  
ATOM 5491  C CG   . ASP A 1 63 ? 10.843  -6.542  4.817   1.00 0.00 ? 71  ASP A CG   4  
ATOM 5492  O OD1  . ASP A 1 63 ? 10.421  -7.637  4.388   1.00 0.00 ? 71  ASP A OD1  4  
ATOM 5493  O OD2  . ASP A 1 63 ? 11.118  -6.336  6.017   1.00 0.00 ? 71  ASP A OD2  4  
ATOM 5494  H H    . ASP A 1 63 ? 11.273  -4.767  1.339   1.00 0.00 ? 71  ASP A H    4  
ATOM 5495  H HA   . ASP A 1 63 ? 9.294   -6.213  2.873   1.00 0.00 ? 71  ASP A HA   4  
ATOM 5496  H HB2  . ASP A 1 63 ? 11.949  -5.577  3.285   1.00 0.00 ? 71  ASP A HB2  4  
ATOM 5497  H HB3  . ASP A 1 63 ? 11.109  -4.481  4.382   1.00 0.00 ? 71  ASP A HB3  4  
ATOM 5498  N N    . HIS A 1 64 ? 8.176   -4.307  4.253   1.00 0.00 ? 72  HIS A N    4  
ATOM 5499  C CA   . HIS A 1 64 ? 7.264   -3.264  4.708   1.00 0.00 ? 72  HIS A CA   4  
ATOM 5500  C C    . HIS A 1 64 ? 8.027   -1.996  5.082   1.00 0.00 ? 72  HIS A C    4  
ATOM 5501  O O    . HIS A 1 64 ? 7.687   -0.901  4.634   1.00 0.00 ? 72  HIS A O    4  
ATOM 5502  C CB   . HIS A 1 64 ? 6.452   -3.756  5.908   1.00 0.00 ? 72  HIS A CB   4  
ATOM 5503  C CG   . HIS A 1 64 ? 5.306   -2.863  6.264   1.00 0.00 ? 72  HIS A CG   4  
ATOM 5504  N ND1  . HIS A 1 64 ? 4.381   -3.178  7.238   1.00 0.00 ? 72  HIS A ND1  4  
ATOM 5505  C CD2  . HIS A 1 64 ? 4.935   -1.657  5.771   1.00 0.00 ? 72  HIS A CD2  4  
ATOM 5506  C CE1  . HIS A 1 64 ? 3.490   -2.205  7.327   1.00 0.00 ? 72  HIS A CE1  4  
ATOM 5507  N NE2  . HIS A 1 64 ? 3.804   -1.271  6.449   1.00 0.00 ? 72  HIS A NE2  4  
ATOM 5508  H H    . HIS A 1 64 ? 8.203   -5.161  4.733   1.00 0.00 ? 72  HIS A H    4  
ATOM 5509  H HA   . HIS A 1 64 ? 6.589   -3.037  3.899   1.00 0.00 ? 72  HIS A HA   4  
ATOM 5510  H HB2  . HIS A 1 64 ? 6.054   -4.735  5.687   1.00 0.00 ? 72  HIS A HB2  4  
ATOM 5511  H HB3  . HIS A 1 64 ? 7.101   -3.824  6.769   1.00 0.00 ? 72  HIS A HB3  4  
ATOM 5512  H HD1  . HIS A 1 64 ? 4.377   -3.993  7.781   1.00 0.00 ? 72  HIS A HD1  4  
ATOM 5513  H HD2  . HIS A 1 64 ? 5.435   -1.103  4.990   1.00 0.00 ? 72  HIS A HD2  4  
ATOM 5514  H HE1  . HIS A 1 64 ? 2.649   -2.178  8.005   1.00 0.00 ? 72  HIS A HE1  4  
ATOM 5515  H HE2  . HIS A 1 64 ? 3.368   -0.398  6.374   1.00 0.00 ? 72  HIS A HE2  4  
ATOM 5516  N N    . LYS A 1 65 ? 9.058   -2.153  5.905   1.00 0.00 ? 73  LYS A N    4  
ATOM 5517  C CA   . LYS A 1 65 ? 9.869   -1.022  6.339   1.00 0.00 ? 73  LYS A CA   4  
ATOM 5518  C C    . LYS A 1 65 ? 10.505  -0.319  5.145   1.00 0.00 ? 73  LYS A C    4  
ATOM 5519  O O    . LYS A 1 65 ? 10.621  0.907   5.121   1.00 0.00 ? 73  LYS A O    4  
ATOM 5520  C CB   . LYS A 1 65 ? 10.954  -1.485  7.311   1.00 0.00 ? 73  LYS A CB   4  
ATOM 5521  C CG   . LYS A 1 65 ? 10.492  -1.531  8.759   1.00 0.00 ? 73  LYS A CG   4  
ATOM 5522  C CD   . LYS A 1 65 ? 11.354  -2.466  9.591   1.00 0.00 ? 73  LYS A CD   4  
ATOM 5523  C CE   . LYS A 1 65 ? 11.281  -2.121  11.070  1.00 0.00 ? 73  LYS A CE   4  
ATOM 5524  N NZ   . LYS A 1 65 ? 11.969  -0.836  11.375  1.00 0.00 ? 73  LYS A NZ   4  
ATOM 5525  H H    . LYS A 1 65 ? 9.279   -3.052  6.229   1.00 0.00 ? 73  LYS A H    4  
ATOM 5526  H HA   . LYS A 1 65 ? 9.218   -0.324  6.845   1.00 0.00 ? 73  LYS A HA   4  
ATOM 5527  H HB2  . LYS A 1 65 ? 11.275  -2.477  7.029   1.00 0.00 ? 73  LYS A HB2  4  
ATOM 5528  H HB3  . LYS A 1 65 ? 11.794  -0.811  7.245   1.00 0.00 ? 73  LYS A HB3  4  
ATOM 5529  H HG2  . LYS A 1 65 ? 10.550  -0.537  9.176   1.00 0.00 ? 73  LYS A HG2  4  
ATOM 5530  H HG3  . LYS A 1 65 ? 9.469   -1.876  8.788   1.00 0.00 ? 73  LYS A HG3  4  
ATOM 5531  H HD2  . LYS A 1 65 ? 11.008  -3.479  9.451   1.00 0.00 ? 73  LYS A HD2  4  
ATOM 5532  H HD3  . LYS A 1 65 ? 12.380  -2.384  9.261   1.00 0.00 ? 73  LYS A HD3  4  
ATOM 5533  H HE2  . LYS A 1 65 ? 10.244  -2.040  11.356  1.00 0.00 ? 73  LYS A HE2  4  
ATOM 5534  H HE3  . LYS A 1 65 ? 11.750  -2.914  11.634  1.00 0.00 ? 73  LYS A HE3  4  
ATOM 5535  H HZ1  . LYS A 1 65 ? 12.009  -0.241  10.522  1.00 0.00 ? 73  LYS A HZ1  4  
ATOM 5536  H HZ2  . LYS A 1 65 ? 12.938  -1.018  11.703  1.00 0.00 ? 73  LYS A HZ2  4  
ATOM 5537  H HZ3  . LYS A 1 65 ? 11.453  -0.322  12.118  1.00 0.00 ? 73  LYS A HZ3  4  
ATOM 5538  N N    . GLU A 1 66 ? 10.916  -1.103  4.153   1.00 0.00 ? 74  GLU A N    4  
ATOM 5539  C CA   . GLU A 1 66 ? 11.539  -0.555  2.954   1.00 0.00 ? 74  GLU A CA   4  
ATOM 5540  C C    . GLU A 1 66 ? 10.574  0.369   2.218   1.00 0.00 ? 74  GLU A C    4  
ATOM 5541  O O    . GLU A 1 66 ? 10.955  1.446   1.763   1.00 0.00 ? 74  GLU A O    4  
ATOM 5542  C CB   . GLU A 1 66 ? 11.992  -1.685  2.026   1.00 0.00 ? 74  GLU A CB   4  
ATOM 5543  C CG   . GLU A 1 66 ? 13.470  -2.025  2.157   1.00 0.00 ? 74  GLU A CG   4  
ATOM 5544  C CD   . GLU A 1 66 ? 14.238  -1.793  0.870   1.00 0.00 ? 74  GLU A CD   4  
ATOM 5545  O OE1  . GLU A 1 66 ? 14.230  -0.648  0.371   1.00 0.00 ? 74  GLU A OE1  4  
ATOM 5546  O OE2  . GLU A 1 66 ? 14.849  -2.756  0.362   1.00 0.00 ? 74  GLU A OE2  4  
ATOM 5547  H H    . GLU A 1 66 ? 10.797  -2.073  4.228   1.00 0.00 ? 74  GLU A H    4  
ATOM 5548  H HA   . GLU A 1 66 ? 12.403  0.016   3.260   1.00 0.00 ? 74  GLU A HA   4  
ATOM 5549  H HB2  . GLU A 1 66 ? 11.420  -2.572  2.253   1.00 0.00 ? 74  GLU A HB2  4  
ATOM 5550  H HB3  . GLU A 1 66 ? 11.800  -1.396  1.004   1.00 0.00 ? 74  GLU A HB3  4  
ATOM 5551  H HG2  . GLU A 1 66 ? 13.900  -1.408  2.931   1.00 0.00 ? 74  GLU A HG2  4  
ATOM 5552  H HG3  . GLU A 1 66 ? 13.563  -3.065  2.433   1.00 0.00 ? 74  GLU A HG3  4  
ATOM 5553  N N    . ALA A 1 67 ? 9.321   -0.061  2.109   1.00 0.00 ? 75  ALA A N    4  
ATOM 5554  C CA   . ALA A 1 67 ? 8.298   0.726   1.432   1.00 0.00 ? 75  ALA A CA   4  
ATOM 5555  C C    . ALA A 1 67 ? 8.081   2.063   2.130   1.00 0.00 ? 75  ALA A C    4  
ATOM 5556  O O    . ALA A 1 67 ? 8.017   3.109   1.485   1.00 0.00 ? 75  ALA A O    4  
ATOM 5557  C CB   . ALA A 1 67 ? 6.993   -0.053  1.367   1.00 0.00 ? 75  ALA A CB   4  
ATOM 5558  H H    . ALA A 1 67 ? 9.079   -0.929  2.495   1.00 0.00 ? 75  ALA A H    4  
ATOM 5559  H HA   . ALA A 1 67 ? 8.631   0.908   0.420   1.00 0.00 ? 75  ALA A HA   4  
ATOM 5560  H HB1  . ALA A 1 67 ? 6.195   0.608   1.061   1.00 0.00 ? 75  ALA A HB1  4  
ATOM 5561  H HB2  . ALA A 1 67 ? 6.769   -0.460  2.342   1.00 0.00 ? 75  ALA A HB2  4  
ATOM 5562  H HB3  . ALA A 1 67 ? 7.088   -0.856  0.654   1.00 0.00 ? 75  ALA A HB3  4  
ATOM 5563  N N    . VAL A 1 68 ? 7.969   2.021   3.453   1.00 0.00 ? 76  VAL A N    4  
ATOM 5564  C CA   . VAL A 1 68 ? 7.759   3.232   4.238   1.00 0.00 ? 76  VAL A CA   4  
ATOM 5565  C C    . VAL A 1 68 ? 8.991   4.131   4.201   1.00 0.00 ? 76  VAL A C    4  
ATOM 5566  O O    . VAL A 1 68 ? 8.877   5.346   4.042   1.00 0.00 ? 76  VAL A O    4  
ATOM 5567  C CB   . VAL A 1 68 ? 7.419   2.898   5.704   1.00 0.00 ? 76  VAL A CB   4  
ATOM 5568  C CG1  . VAL A 1 68 ? 7.088   4.163   6.481   1.00 0.00 ? 76  VAL A CG1  4  
ATOM 5569  C CG2  . VAL A 1 68 ? 6.267   1.907   5.770   1.00 0.00 ? 76  VAL A CG2  4  
ATOM 5570  H H    . VAL A 1 68 ? 8.027   1.158   3.912   1.00 0.00 ? 76  VAL A H    4  
ATOM 5571  H HA   . VAL A 1 68 ? 6.923   3.765   3.809   1.00 0.00 ? 76  VAL A HA   4  
ATOM 5572  H HB   . VAL A 1 68 ? 8.286   2.440   6.157   1.00 0.00 ? 76  VAL A HB   4  
ATOM 5573  H HG11 . VAL A 1 68 ? 7.111   3.951   7.539   1.00 0.00 ? 76  VAL A HG11 4  
ATOM 5574  H HG12 . VAL A 1 68 ? 6.101   4.508   6.204   1.00 0.00 ? 76  VAL A HG12 4  
ATOM 5575  H HG13 . VAL A 1 68 ? 7.813   4.928   6.251   1.00 0.00 ? 76  VAL A HG13 4  
ATOM 5576  H HG21 . VAL A 1 68 ? 6.339   1.331   6.681   1.00 0.00 ? 76  VAL A HG21 4  
ATOM 5577  H HG22 . VAL A 1 68 ? 6.313   1.243   4.920   1.00 0.00 ? 76  VAL A HG22 4  
ATOM 5578  H HG23 . VAL A 1 68 ? 5.330   2.444   5.758   1.00 0.00 ? 76  VAL A HG23 4  
ATOM 5579  N N    . ASN A 1 69 ? 10.165  3.529   4.351   1.00 0.00 ? 77  ASN A N    4  
ATOM 5580  C CA   . ASN A 1 69 ? 11.420  4.276   4.338   1.00 0.00 ? 77  ASN A CA   4  
ATOM 5581  C C    . ASN A 1 69 ? 11.559  5.101   3.062   1.00 0.00 ? 77  ASN A C    4  
ATOM 5582  O O    . ASN A 1 69 ? 11.724  6.319   3.114   1.00 0.00 ? 77  ASN A O    4  
ATOM 5583  C CB   . ASN A 1 69 ? 12.608  3.322   4.474   1.00 0.00 ? 77  ASN A CB   4  
ATOM 5584  C CG   . ASN A 1 69 ? 13.731  3.912   5.306   1.00 0.00 ? 77  ASN A CG   4  
ATOM 5585  O OD1  . ASN A 1 69 ? 13.627  4.010   6.529   1.00 0.00 ? 77  ASN A OD1  4  
ATOM 5586  N ND2  . ASN A 1 69 ? 14.813  4.307   4.645   1.00 0.00 ? 77  ASN A ND2  4  
ATOM 5587  H H    . ASN A 1 69 ? 10.191  2.556   4.474   1.00 0.00 ? 77  ASN A H    4  
ATOM 5588  H HA   . ASN A 1 69 ? 11.411  4.947   5.182   1.00 0.00 ? 77  ASN A HA   4  
ATOM 5589  H HB2  . ASN A 1 69 ? 12.279  2.409   4.944   1.00 0.00 ? 77  ASN A HB2  4  
ATOM 5590  H HB3  . ASN A 1 69 ? 12.994  3.095   3.490   1.00 0.00 ? 77  ASN A HB3  4  
ATOM 5591  H HD21 . ASN A 1 69 ? 14.826  4.199   3.671   1.00 0.00 ? 77  ASN A HD21 4  
ATOM 5592  H HD22 . ASN A 1 69 ? 15.554  4.692   5.157   1.00 0.00 ? 77  ASN A HD22 4  
ATOM 5593  N N    . VAL A 1 70 ? 11.495  4.429   1.916   1.00 0.00 ? 78  VAL A N    4  
ATOM 5594  C CA   . VAL A 1 70 ? 11.616  5.103   0.629   1.00 0.00 ? 78  VAL A CA   4  
ATOM 5595  C C    . VAL A 1 70 ? 10.548  6.180   0.466   1.00 0.00 ? 78  VAL A C    4  
ATOM 5596  O O    . VAL A 1 70 ? 10.840  7.297   0.037   1.00 0.00 ? 78  VAL A O    4  
ATOM 5597  C CB   . VAL A 1 70 ? 11.511  4.104   -0.540  1.00 0.00 ? 78  VAL A CB   4  
ATOM 5598  C CG1  . VAL A 1 70 ? 12.655  3.105   -0.487  1.00 0.00 ? 78  VAL A CG1  4  
ATOM 5599  C CG2  . VAL A 1 70 ? 10.169  3.390   -0.515  1.00 0.00 ? 78  VAL A CG2  4  
ATOM 5600  H H    . VAL A 1 70 ? 11.364  3.458   1.938   1.00 0.00 ? 78  VAL A H    4  
ATOM 5601  H HA   . VAL A 1 70 ? 12.590  5.569   0.588   1.00 0.00 ? 78  VAL A HA   4  
ATOM 5602  H HB   . VAL A 1 70 ? 11.587  4.655   -1.465  1.00 0.00 ? 78  VAL A HB   4  
ATOM 5603  H HG11 . VAL A 1 70 ? 12.987  2.884   -1.490  1.00 0.00 ? 78  VAL A HG11 4  
ATOM 5604  H HG12 . VAL A 1 70 ? 12.316  2.196   -0.013  1.00 0.00 ? 78  VAL A HG12 4  
ATOM 5605  H HG13 . VAL A 1 70 ? 13.474  3.522   0.081   1.00 0.00 ? 78  VAL A HG13 4  
ATOM 5606  H HG21 . VAL A 1 70 ? 10.174  2.589   -1.241  1.00 0.00 ? 78  VAL A HG21 4  
ATOM 5607  H HG22 . VAL A 1 70 ? 9.385   4.091   -0.761  1.00 0.00 ? 78  VAL A HG22 4  
ATOM 5608  H HG23 . VAL A 1 70 ? 9.995   2.984   0.468   1.00 0.00 ? 78  VAL A HG23 4  
ATOM 5609  N N    . LEU A 1 71 ? 9.310   5.841   0.814   1.00 0.00 ? 79  LEU A N    4  
ATOM 5610  C CA   . LEU A 1 71 ? 8.201   6.782   0.710   1.00 0.00 ? 79  LEU A CA   4  
ATOM 5611  C C    . LEU A 1 71 ? 8.412   7.968   1.647   1.00 0.00 ? 79  LEU A C    4  
ATOM 5612  O O    . LEU A 1 71 ? 7.956   9.079   1.371   1.00 0.00 ? 79  LEU A O    4  
ATOM 5613  C CB   . LEU A 1 71 ? 6.879   6.084   1.036   1.00 0.00 ? 79  LEU A CB   4  
ATOM 5614  C CG   . LEU A 1 71 ? 6.105   5.554   -0.176  1.00 0.00 ? 79  LEU A CG   4  
ATOM 5615  C CD1  . LEU A 1 71 ? 5.513   6.703   -0.977  1.00 0.00 ? 79  LEU A CD1  4  
ATOM 5616  C CD2  . LEU A 1 71 ? 7.005   4.699   -1.055  1.00 0.00 ? 79  LEU A CD2  4  
ATOM 5617  H H    . LEU A 1 71 ? 9.140   4.937   1.153   1.00 0.00 ? 79  LEU A H    4  
ATOM 5618  H HA   . LEU A 1 71 ? 8.168   7.143   -0.307  1.00 0.00 ? 79  LEU A HA   4  
ATOM 5619  H HB2  . LEU A 1 71 ? 7.087   5.253   1.693   1.00 0.00 ? 79  LEU A HB2  4  
ATOM 5620  H HB3  . LEU A 1 71 ? 6.245   6.784   1.559   1.00 0.00 ? 79  LEU A HB3  4  
ATOM 5621  H HG   . LEU A 1 71 ? 5.288   4.936   0.170   1.00 0.00 ? 79  LEU A HG   4  
ATOM 5622  H HD11 . LEU A 1 71 ? 5.410   6.406   -2.011  1.00 0.00 ? 79  LEU A HD11 4  
ATOM 5623  H HD12 . LEU A 1 71 ? 6.166   7.562   -0.912  1.00 0.00 ? 79  LEU A HD12 4  
ATOM 5624  H HD13 . LEU A 1 71 ? 4.543   6.959   -0.578  1.00 0.00 ? 79  LEU A HD13 4  
ATOM 5625  H HD21 . LEU A 1 71 ? 7.329   3.832   -0.502  1.00 0.00 ? 79  LEU A HD21 4  
ATOM 5626  H HD22 . LEU A 1 71 ? 7.866   5.277   -1.357  1.00 0.00 ? 79  LEU A HD22 4  
ATOM 5627  H HD23 . LEU A 1 71 ? 6.457   4.384   -1.931  1.00 0.00 ? 79  LEU A HD23 4  
ATOM 5628  N N    . LYS A 1 72 ? 9.105   7.725   2.756   1.00 0.00 ? 80  LYS A N    4  
ATOM 5629  C CA   . LYS A 1 72 ? 9.377   8.772   3.736   1.00 0.00 ? 80  LYS A CA   4  
ATOM 5630  C C    . LYS A 1 72 ? 10.584  9.607   3.321   1.00 0.00 ? 80  LYS A C    4  
ATOM 5631  O O    . LYS A 1 72 ? 10.634  10.812  3.570   1.00 0.00 ? 80  LYS A O    4  
ATOM 5632  C CB   . LYS A 1 72 ? 9.623   8.152   5.115   1.00 0.00 ? 80  LYS A CB   4  
ATOM 5633  C CG   . LYS A 1 72 ? 8.445   8.289   6.066   1.00 0.00 ? 80  LYS A CG   4  
ATOM 5634  C CD   . LYS A 1 72 ? 7.196   7.626   5.509   1.00 0.00 ? 80  LYS A CD   4  
ATOM 5635  C CE   . LYS A 1 72 ? 6.099   7.538   6.557   1.00 0.00 ? 80  LYS A CE   4  
ATOM 5636  N NZ   . LYS A 1 72 ? 5.934   8.820   7.297   1.00 0.00 ? 80  LYS A NZ   4  
ATOM 5637  H H    . LYS A 1 72 ? 9.442   6.820   2.920   1.00 0.00 ? 80  LYS A H    4  
ATOM 5638  H HA   . LYS A 1 72 ? 8.509   9.412   3.788   1.00 0.00 ? 80  LYS A HA   4  
ATOM 5639  H HB2  . LYS A 1 72 ? 9.838   7.102   4.991   1.00 0.00 ? 80  LYS A HB2  4  
ATOM 5640  H HB3  . LYS A 1 72 ? 10.479  8.633   5.566   1.00 0.00 ? 80  LYS A HB3  4  
ATOM 5641  H HG2  . LYS A 1 72 ? 8.700   7.820   7.006   1.00 0.00 ? 80  LYS A HG2  4  
ATOM 5642  H HG3  . LYS A 1 72 ? 8.247   9.337   6.227   1.00 0.00 ? 80  LYS A HG3  4  
ATOM 5643  H HD2  . LYS A 1 72 ? 6.836   8.205   4.672   1.00 0.00 ? 80  LYS A HD2  4  
ATOM 5644  H HD3  . LYS A 1 72 ? 7.447   6.628   5.178   1.00 0.00 ? 80  LYS A HD3  4  
ATOM 5645  H HE2  . LYS A 1 72 ? 5.169   7.295   6.067   1.00 0.00 ? 80  LYS A HE2  4  
ATOM 5646  H HE3  . LYS A 1 72 ? 6.351   6.758   7.259   1.00 0.00 ? 80  LYS A HE3  4  
ATOM 5647  H HZ1  . LYS A 1 72 ? 4.946   8.930   7.605   1.00 0.00 ? 80  LYS A HZ1  4  
ATOM 5648  H HZ2  . LYS A 1 72 ? 6.184   9.621   6.684   1.00 0.00 ? 80  LYS A HZ2  4  
ATOM 5649  H HZ3  . LYS A 1 72 ? 6.551   8.832   8.133   1.00 0.00 ? 80  LYS A HZ3  4  
ATOM 5650  N N    . SER A 1 73 ? 11.559  8.959   2.692   1.00 0.00 ? 81  SER A N    4  
ATOM 5651  C CA   . SER A 1 73 ? 12.770  9.637   2.248   1.00 0.00 ? 81  SER A CA   4  
ATOM 5652  C C    . SER A 1 73 ? 12.476  10.616  1.116   1.00 0.00 ? 81  SER A C    4  
ATOM 5653  O O    . SER A 1 73 ? 12.564  11.830  1.294   1.00 0.00 ? 81  SER A O    4  
ATOM 5654  C CB   . SER A 1 73 ? 13.814  8.614   1.793   1.00 0.00 ? 81  SER A CB   4  
ATOM 5655  O OG   . SER A 1 73 ? 15.113  8.984   2.218   1.00 0.00 ? 81  SER A OG   4  
ATOM 5656  H H    . SER A 1 73 ? 11.461  7.997   2.527   1.00 0.00 ? 81  SER A H    4  
ATOM 5657  H HA   . SER A 1 73 ? 13.167  10.188  3.089   1.00 0.00 ? 81  SER A HA   4  
ATOM 5658  H HB2  . SER A 1 73 ? 13.573  7.647   2.211   1.00 0.00 ? 81  SER A HB2  4  
ATOM 5659  H HB3  . SER A 1 73 ? 13.805  8.551   0.714   1.00 0.00 ? 81  SER A HB3  4  
ATOM 5660  H HG   . SER A 1 73 ? 15.722  8.920   1.479   1.00 0.00 ? 81  SER A HG   4  
ATOM 5661  N N    . SER A 1 74 ? 12.136  10.080  -0.051  1.00 0.00 ? 82  SER A N    4  
ATOM 5662  C CA   . SER A 1 74 ? 11.838  10.905  -1.216  1.00 0.00 ? 82  SER A CA   4  
ATOM 5663  C C    . SER A 1 74 ? 10.458  11.547  -1.102  1.00 0.00 ? 82  SER A C    4  
ATOM 5664  O O    . SER A 1 74 ? 9.471   10.872  -0.806  1.00 0.00 ? 82  SER A O    4  
ATOM 5665  C CB   . SER A 1 74 ? 11.919  10.068  -2.494  1.00 0.00 ? 82  SER A CB   4  
ATOM 5666  O OG   . SER A 1 74 ? 12.794  8.967   -2.327  1.00 0.00 ? 82  SER A OG   4  
ATOM 5667  H H    . SER A 1 74 ? 12.088  9.103   -0.133  1.00 0.00 ? 82  SER A H    4  
ATOM 5668  H HA   . SER A 1 74 ? 12.580  11.689  -1.263  1.00 0.00 ? 82  SER A HA   4  
ATOM 5669  H HB2  . SER A 1 74 ? 10.936  9.697   -2.740  1.00 0.00 ? 82  SER A HB2  4  
ATOM 5670  H HB3  . SER A 1 74 ? 12.284  10.685  -3.302  1.00 0.00 ? 82  SER A HB3  4  
ATOM 5671  H HG   . SER A 1 74 ? 12.820  8.453   -3.138  1.00 0.00 ? 82  SER A HG   4  
ATOM 5672  N N    . ARG A 1 75 ? 10.396  12.851  -1.344  1.00 0.00 ? 83  ARG A N    4  
ATOM 5673  C CA   . ARG A 1 75 ? 9.139   13.586  -1.276  1.00 0.00 ? 83  ARG A CA   4  
ATOM 5674  C C    . ARG A 1 75 ? 8.357   13.430  -2.575  1.00 0.00 ? 83  ARG A C    4  
ATOM 5675  O O    . ARG A 1 75 ? 7.175   13.084  -2.565  1.00 0.00 ? 83  ARG A O    4  
ATOM 5676  C CB   . ARG A 1 75 ? 9.401   15.067  -0.998  1.00 0.00 ? 83  ARG A CB   4  
ATOM 5677  C CG   . ARG A 1 75 ? 9.469   15.406  0.482   1.00 0.00 ? 83  ARG A CG   4  
ATOM 5678  C CD   . ARG A 1 75 ? 10.899  15.372  0.997   1.00 0.00 ? 83  ARG A CD   4  
ATOM 5679  N NE   . ARG A 1 75 ? 10.955  15.204  2.447   1.00 0.00 ? 83  ARG A NE   4  
ATOM 5680  C CZ   . ARG A 1 75 ? 10.757  16.193  3.316   1.00 0.00 ? 83  ARG A CZ   4  
ATOM 5681  N NH1  . ARG A 1 75 ? 10.495  17.421  2.886   1.00 0.00 ? 83  ARG A NH1  4  
ATOM 5682  N NH2  . ARG A 1 75 ? 10.822  15.952  4.618   1.00 0.00 ? 83  ARG A NH2  4  
ATOM 5683  H H    . ARG A 1 75 ? 11.218  13.333  -1.580  1.00 0.00 ? 83  ARG A H    4  
ATOM 5684  H HA   . ARG A 1 75 ? 8.557   13.173  -0.466  1.00 0.00 ? 83  ARG A HA   4  
ATOM 5685  H HB2  . ARG A 1 75 ? 10.341  15.346  -1.452  1.00 0.00 ? 83  ARG A HB2  4  
ATOM 5686  H HB3  . ARG A 1 75 ? 8.611   15.651  -1.444  1.00 0.00 ? 83  ARG A HB3  4  
ATOM 5687  H HG2  . ARG A 1 75 ? 9.067   16.397  0.633   1.00 0.00 ? 83  ARG A HG2  4  
ATOM 5688  H HG3  . ARG A 1 75 ? 8.880   14.689  1.033   1.00 0.00 ? 83  ARG A HG3  4  
ATOM 5689  H HD2  . ARG A 1 75 ? 11.417  14.548  0.529   1.00 0.00 ? 83  ARG A HD2  4  
ATOM 5690  H HD3  . ARG A 1 75 ? 11.386  16.299  0.732   1.00 0.00 ? 83  ARG A HD3  4  
ATOM 5691  H HE   . ARG A 1 75 ? 11.150  14.307  2.791   1.00 0.00 ? 83  ARG A HE   4  
ATOM 5692  H HH11 . ARG A 1 75 ? 10.446  17.610  1.905   1.00 0.00 ? 83  ARG A HH11 4  
ATOM 5693  H HH12 . ARG A 1 75 ? 10.347  18.160  3.545   1.00 0.00 ? 83  ARG A HH12 4  
ATOM 5694  H HH21 . ARG A 1 75 ? 11.019  15.029  4.948   1.00 0.00 ? 83  ARG A HH21 4  
ATOM 5695  H HH22 . ARG A 1 75 ? 10.674  16.695  5.272   1.00 0.00 ? 83  ARG A HH22 4  
ATOM 5696  N N    . SER A 1 76 ? 9.028   13.681  -3.696  1.00 0.00 ? 84  SER A N    4  
ATOM 5697  C CA   . SER A 1 76 ? 8.404   13.562  -5.008  1.00 0.00 ? 84  SER A CA   4  
ATOM 5698  C C    . SER A 1 76 ? 8.830   12.266  -5.686  1.00 0.00 ? 84  SER A C    4  
ATOM 5699  O O    . SER A 1 76 ? 9.804   12.240  -6.440  1.00 0.00 ? 84  SER A O    4  
ATOM 5700  C CB   . SER A 1 76 ? 8.775   14.759  -5.885  1.00 0.00 ? 84  SER A CB   4  
ATOM 5701  O OG   . SER A 1 76 ? 8.632   15.977  -5.175  1.00 0.00 ? 84  SER A OG   4  
ATOM 5702  H H    . SER A 1 76 ? 9.970   13.947  -3.638  1.00 0.00 ? 84  SER A H    4  
ATOM 5703  H HA   . SER A 1 76 ? 7.333   13.546  -4.867  1.00 0.00 ? 84  SER A HA   4  
ATOM 5704  H HB2  . SER A 1 76 ? 9.801   14.663  -6.207  1.00 0.00 ? 84  SER A HB2  4  
ATOM 5705  H HB3  . SER A 1 76 ? 8.128   14.783  -6.750  1.00 0.00 ? 84  SER A HB3  4  
ATOM 5706  H HG   . SER A 1 76 ? 7.804   15.969  -4.689  1.00 0.00 ? 84  SER A HG   4  
ATOM 5707  N N    . LEU A 1 77 ? 8.104   11.190  -5.405  1.00 0.00 ? 85  LEU A N    4  
ATOM 5708  C CA   . LEU A 1 77 ? 8.414   9.885   -5.980  1.00 0.00 ? 85  LEU A CA   4  
ATOM 5709  C C    . LEU A 1 77 ? 7.234   9.336   -6.776  1.00 0.00 ? 85  LEU A C    4  
ATOM 5710  O O    . LEU A 1 77 ? 6.077   9.509   -6.393  1.00 0.00 ? 85  LEU A O    4  
ATOM 5711  C CB   . LEU A 1 77 ? 8.797   8.892   -4.875  1.00 0.00 ? 85  LEU A CB   4  
ATOM 5712  C CG   . LEU A 1 77 ? 8.317   9.256   -3.468  1.00 0.00 ? 85  LEU A CG   4  
ATOM 5713  C CD1  . LEU A 1 77 ? 6.796   9.250   -3.402  1.00 0.00 ? 85  LEU A CD1  4  
ATOM 5714  C CD2  . LEU A 1 77 ? 8.902   8.298   -2.441  1.00 0.00 ? 85  LEU A CD2  4  
ATOM 5715  H H    . LEU A 1 77 ? 7.345   11.273  -4.790  1.00 0.00 ? 85  LEU A H    4  
ATOM 5716  H HA   . LEU A 1 77 ? 9.255   10.009  -6.646  1.00 0.00 ? 85  LEU A HA   4  
ATOM 5717  H HB2  . LEU A 1 77 ? 8.386   7.925   -5.132  1.00 0.00 ? 85  LEU A HB2  4  
ATOM 5718  H HB3  . LEU A 1 77 ? 9.874   8.810   -4.854  1.00 0.00 ? 85  LEU A HB3  4  
ATOM 5719  H HG   . LEU A 1 77 ? 8.655   10.254  -3.227  1.00 0.00 ? 85  LEU A HG   4  
ATOM 5720  H HD11 . LEU A 1 77 ? 6.399   8.774   -4.287  1.00 0.00 ? 85  LEU A HD11 4  
ATOM 5721  H HD12 . LEU A 1 77 ? 6.434   10.265  -3.346  1.00 0.00 ? 85  LEU A HD12 4  
ATOM 5722  H HD13 . LEU A 1 77 ? 6.476   8.705   -2.526  1.00 0.00 ? 85  LEU A HD13 4  
ATOM 5723  H HD21 . LEU A 1 77 ? 9.889   7.991   -2.757  1.00 0.00 ? 85  LEU A HD21 4  
ATOM 5724  H HD22 . LEU A 1 77 ? 8.266   7.430   -2.355  1.00 0.00 ? 85  LEU A HD22 4  
ATOM 5725  H HD23 . LEU A 1 77 ? 8.967   8.792   -1.484  1.00 0.00 ? 85  LEU A HD23 4  
ATOM 5726  N N    . THR A 1 78 ? 7.540   8.662   -7.881  1.00 0.00 ? 86  THR A N    4  
ATOM 5727  C CA   . THR A 1 78 ? 6.511   8.070   -8.726  1.00 0.00 ? 86  THR A CA   4  
ATOM 5728  C C    . THR A 1 78 ? 6.254   6.628   -8.304  1.00 0.00 ? 86  THR A C    4  
ATOM 5729  O O    . THR A 1 78 ? 7.146   5.784   -8.377  1.00 0.00 ? 86  THR A O    4  
ATOM 5730  C CB   . THR A 1 78 ? 6.932   8.120   -10.195 1.00 0.00 ? 86  THR A CB   4  
ATOM 5731  O OG1  . THR A 1 78 ? 7.216   9.450   -10.590 1.00 0.00 ? 86  THR A OG1  4  
ATOM 5732  C CG2  . THR A 1 78 ? 5.881   7.576   -11.138 1.00 0.00 ? 86  THR A CG2  4  
ATOM 5733  H H    . THR A 1 78 ? 8.483   8.549   -8.126  1.00 0.00 ? 86  THR A H    4  
ATOM 5734  H HA   . THR A 1 78 ? 5.604   8.641   -8.596  1.00 0.00 ? 86  THR A HA   4  
ATOM 5735  H HB   . THR A 1 78 ? 7.828   7.530   -10.323 1.00 0.00 ? 86  THR A HB   4  
ATOM 5736  H HG1  . THR A 1 78 ? 7.525   9.456   -11.499 1.00 0.00 ? 86  THR A HG1  4  
ATOM 5737  H HG21 . THR A 1 78 ? 5.646   6.558   -10.865 1.00 0.00 ? 86  THR A HG21 4  
ATOM 5738  H HG22 . THR A 1 78 ? 6.257   7.600   -12.149 1.00 0.00 ? 86  THR A HG22 4  
ATOM 5739  H HG23 . THR A 1 78 ? 4.989   8.181   -11.070 1.00 0.00 ? 86  THR A HG23 4  
ATOM 5740  N N    . ILE A 1 79 ? 5.037   6.355   -7.851  1.00 0.00 ? 87  ILE A N    4  
ATOM 5741  C CA   . ILE A 1 79 ? 4.674   5.017   -7.402  1.00 0.00 ? 87  ILE A CA   4  
ATOM 5742  C C    . ILE A 1 79 ? 3.708   4.344   -8.371  1.00 0.00 ? 87  ILE A C    4  
ATOM 5743  O O    . ILE A 1 79 ? 2.697   4.927   -8.764  1.00 0.00 ? 87  ILE A O    4  
ATOM 5744  C CB   . ILE A 1 79 ? 4.043   5.049   -5.996  1.00 0.00 ? 87  ILE A CB   4  
ATOM 5745  C CG1  . ILE A 1 79 ? 2.962   6.130   -5.920  1.00 0.00 ? 87  ILE A CG1  4  
ATOM 5746  C CG2  . ILE A 1 79 ? 5.117   5.283   -4.942  1.00 0.00 ? 87  ILE A CG2  4  
ATOM 5747  C CD1  . ILE A 1 79 ? 2.388   6.321   -4.532  1.00 0.00 ? 87  ILE A CD1  4  
ATOM 5748  H H    . ILE A 1 79 ? 4.372   7.073   -7.809  1.00 0.00 ? 87  ILE A H    4  
ATOM 5749  H HA   . ILE A 1 79 ? 5.579   4.428   -7.352  1.00 0.00 ? 87  ILE A HA   4  
ATOM 5750  H HB   . ILE A 1 79 ? 3.593   4.085   -5.807  1.00 0.00 ? 87  ILE A HB   4  
ATOM 5751  H HG12 . ILE A 1 79 ? 3.382   7.074   -6.232  1.00 0.00 ? 87  ILE A HG12 4  
ATOM 5752  H HG13 . ILE A 1 79 ? 2.151   5.866   -6.581  1.00 0.00 ? 87  ILE A HG13 4  
ATOM 5753  H HG21 . ILE A 1 79 ? 4.976   6.255   -4.494  1.00 0.00 ? 87  ILE A HG21 4  
ATOM 5754  H HG22 . ILE A 1 79 ? 6.092   5.237   -5.402  1.00 0.00 ? 87  ILE A HG22 4  
ATOM 5755  H HG23 . ILE A 1 79 ? 5.044   4.521   -4.180  1.00 0.00 ? 87  ILE A HG23 4  
ATOM 5756  H HD11 . ILE A 1 79 ? 2.043   5.371   -4.152  1.00 0.00 ? 87  ILE A HD11 4  
ATOM 5757  H HD12 . ILE A 1 79 ? 1.559   7.013   -4.577  1.00 0.00 ? 87  ILE A HD12 4  
ATOM 5758  H HD13 . ILE A 1 79 ? 3.150   6.716   -3.878  1.00 0.00 ? 87  ILE A HD13 4  
ATOM 5759  N N    . SER A 1 80 ? 4.029   3.111   -8.751  1.00 0.00 ? 88  SER A N    4  
ATOM 5760  C CA   . SER A 1 80 ? 3.191   2.349   -9.670  1.00 0.00 ? 88  SER A CA   4  
ATOM 5761  C C    . SER A 1 80 ? 2.415   1.268   -8.925  1.00 0.00 ? 88  SER A C    4  
ATOM 5762  O O    . SER A 1 80 ? 2.968   0.232   -8.556  1.00 0.00 ? 88  SER A O    4  
ATOM 5763  C CB   . SER A 1 80 ? 4.047   1.715   -10.769 1.00 0.00 ? 88  SER A CB   4  
ATOM 5764  O OG   . SER A 1 80 ? 5.152   2.540   -11.095 1.00 0.00 ? 88  SER A OG   4  
ATOM 5765  H H    . SER A 1 80 ? 4.846   2.700   -8.401  1.00 0.00 ? 88  SER A H    4  
ATOM 5766  H HA   . SER A 1 80 ? 2.488   3.034   -10.122 1.00 0.00 ? 88  SER A HA   4  
ATOM 5767  H HB2  . SER A 1 80 ? 4.416   0.760   -10.429 1.00 0.00 ? 88  SER A HB2  4  
ATOM 5768  H HB3  . SER A 1 80 ? 3.445   1.574   -11.654 1.00 0.00 ? 88  SER A HB3  4  
ATOM 5769  H HG   . SER A 1 80 ? 4.857   3.451   -11.184 1.00 0.00 ? 88  SER A HG   4  
ATOM 5770  N N    . ILE A 1 81 ? 1.130   1.521   -8.706  1.00 0.00 ? 89  ILE A N    4  
ATOM 5771  C CA   . ILE A 1 81 ? 0.268   0.578   -8.003  1.00 0.00 ? 89  ILE A CA   4  
ATOM 5772  C C    . ILE A 1 81 ? -0.755  -0.033  -8.954  1.00 0.00 ? 89  ILE A C    4  
ATOM 5773  O O    . ILE A 1 81 ? -1.201  0.614   -9.898  1.00 0.00 ? 89  ILE A O    4  
ATOM 5774  C CB   . ILE A 1 81 ? -0.462  1.265   -6.825  1.00 0.00 ? 89  ILE A CB   4  
ATOM 5775  C CG1  . ILE A 1 81 ? -1.563  0.357   -6.253  1.00 0.00 ? 89  ILE A CG1  4  
ATOM 5776  C CG2  . ILE A 1 81 ? -1.028  2.609   -7.260  1.00 0.00 ? 89  ILE A CG2  4  
ATOM 5777  C CD1  . ILE A 1 81 ? -2.908  0.501   -6.939  1.00 0.00 ? 89  ILE A CD1  4  
ATOM 5778  H H    . ILE A 1 81 ? 0.751   2.367   -9.023  1.00 0.00 ? 89  ILE A H    4  
ATOM 5779  H HA   . ILE A 1 81 ? 0.889   -0.212  -7.603  1.00 0.00 ? 89  ILE A HA   4  
ATOM 5780  H HB   . ILE A 1 81 ? 0.267   1.453   -6.050  1.00 0.00 ? 89  ILE A HB   4  
ATOM 5781  H HG12 . ILE A 1 81 ? -1.256  -0.670  -6.352  1.00 0.00 ? 89  ILE A HG12 4  
ATOM 5782  H HG13 . ILE A 1 81 ? -1.697  0.588   -5.207  1.00 0.00 ? 89  ILE A HG13 4  
ATOM 5783  H HG21 . ILE A 1 81 ? -1.986  2.767   -6.788  1.00 0.00 ? 89  ILE A HG21 4  
ATOM 5784  H HG22 . ILE A 1 81 ? -1.148  2.617   -8.333  1.00 0.00 ? 89  ILE A HG22 4  
ATOM 5785  H HG23 . ILE A 1 81 ? -0.349  3.396   -6.969  1.00 0.00 ? 89  ILE A HG23 4  
ATOM 5786  H HD11 . ILE A 1 81 ? -2.771  0.942   -7.916  1.00 0.00 ? 89  ILE A HD11 4  
ATOM 5787  H HD12 . ILE A 1 81 ? -3.549  1.136   -6.346  1.00 0.00 ? 89  ILE A HD12 4  
ATOM 5788  H HD13 . ILE A 1 81 ? -3.364  -0.473  -7.044  1.00 0.00 ? 89  ILE A HD13 4  
ATOM 5789  N N    . VAL A 1 82 ? -1.123  -1.283  -8.700  1.00 0.00 ? 90  VAL A N    4  
ATOM 5790  C CA   . VAL A 1 82 ? -2.096  -1.973  -9.536  1.00 0.00 ? 90  VAL A CA   4  
ATOM 5791  C C    . VAL A 1 82 ? -3.369  -2.275  -8.755  1.00 0.00 ? 90  VAL A C    4  
ATOM 5792  O O    . VAL A 1 82 ? -3.375  -3.112  -7.852  1.00 0.00 ? 90  VAL A O    4  
ATOM 5793  C CB   . VAL A 1 82 ? -1.521  -3.287  -10.099 1.00 0.00 ? 90  VAL A CB   4  
ATOM 5794  C CG1  . VAL A 1 82 ? -2.503  -3.932  -11.065 1.00 0.00 ? 90  VAL A CG1  4  
ATOM 5795  C CG2  . VAL A 1 82 ? -0.182  -3.038  -10.776 1.00 0.00 ? 90  VAL A CG2  4  
ATOM 5796  H H    . VAL A 1 82 ? -0.734  -1.750  -7.932  1.00 0.00 ? 90  VAL A H    4  
ATOM 5797  H HA   . VAL A 1 82 ? -2.341  -1.328  -10.367 1.00 0.00 ? 90  VAL A HA   4  
ATOM 5798  H HB   . VAL A 1 82 ? -1.363  -3.964  -9.276  1.00 0.00 ? 90  VAL A HB   4  
ATOM 5799  H HG11 . VAL A 1 82 ? -2.054  -4.812  -11.499 1.00 0.00 ? 90  VAL A HG11 4  
ATOM 5800  H HG12 . VAL A 1 82 ? -2.753  -3.230  -11.847 1.00 0.00 ? 90  VAL A HG12 4  
ATOM 5801  H HG13 . VAL A 1 82 ? -3.401  -4.211  -10.533 1.00 0.00 ? 90  VAL A HG13 4  
ATOM 5802  H HG21 . VAL A 1 82 ? 0.232   -2.104  -10.425 1.00 0.00 ? 90  VAL A HG21 4  
ATOM 5803  H HG22 . VAL A 1 82 ? -0.323  -2.989  -11.846 1.00 0.00 ? 90  VAL A HG22 4  
ATOM 5804  H HG23 . VAL A 1 82 ? 0.496   -3.844  -10.539 1.00 0.00 ? 90  VAL A HG23 4  
ATOM 5805  N N    . ALA A 1 83 ? -4.446  -1.578  -9.105  1.00 0.00 ? 91  ALA A N    4  
ATOM 5806  C CA   . ALA A 1 83 ? -5.728  -1.760  -8.436  1.00 0.00 ? 91  ALA A CA   4  
ATOM 5807  C C    . ALA A 1 83 ? -6.171  -3.220  -8.476  1.00 0.00 ? 91  ALA A C    4  
ATOM 5808  O O    . ALA A 1 83 ? -6.025  -3.895  -9.496  1.00 0.00 ? 91  ALA A O    4  
ATOM 5809  C CB   . ALA A 1 83 ? -6.782  -0.867  -9.073  1.00 0.00 ? 91  ALA A CB   4  
ATOM 5810  H H    . ALA A 1 83 ? -4.375  -0.923  -9.829  1.00 0.00 ? 91  ALA A H    4  
ATOM 5811  H HA   . ALA A 1 83 ? -5.611  -1.459  -7.405  1.00 0.00 ? 91  ALA A HA   4  
ATOM 5812  H HB1  . ALA A 1 83 ? -7.315  -0.332  -8.301  1.00 0.00 ? 91  ALA A HB1  4  
ATOM 5813  H HB2  . ALA A 1 83 ? -7.477  -1.471  -9.637  1.00 0.00 ? 91  ALA A HB2  4  
ATOM 5814  H HB3  . ALA A 1 83 ? -6.303  -0.160  -9.733  1.00 0.00 ? 91  ALA A HB3  4  
ATOM 5815  N N    . ALA A 1 84 ? -6.708  -3.698  -7.352  1.00 0.00 ? 92  ALA A N    4  
ATOM 5816  C CA   . ALA A 1 84 ? -7.181  -5.080  -7.229  1.00 0.00 ? 92  ALA A CA   4  
ATOM 5817  C C    . ALA A 1 84 ? -6.053  -6.032  -6.840  1.00 0.00 ? 92  ALA A C    4  
ATOM 5818  O O    . ALA A 1 84 ? -6.301  -7.108  -6.296  1.00 0.00 ? 92  ALA A O    4  
ATOM 5819  C CB   . ALA A 1 84 ? -7.851  -5.545  -8.515  1.00 0.00 ? 92  ALA A CB   4  
ATOM 5820  H H    . ALA A 1 84 ? -6.789  -3.102  -6.579  1.00 0.00 ? 92  ALA A H    4  
ATOM 5821  H HA   . ALA A 1 84 ? -7.926  -5.098  -6.447  1.00 0.00 ? 92  ALA A HA   4  
ATOM 5822  H HB1  . ALA A 1 84 ? -8.133  -4.687  -9.105  1.00 0.00 ? 92  ALA A HB1  4  
ATOM 5823  H HB2  . ALA A 1 84 ? -8.730  -6.123  -8.275  1.00 0.00 ? 92  ALA A HB2  4  
ATOM 5824  H HB3  . ALA A 1 84 ? -7.160  -6.156  -9.079  1.00 0.00 ? 92  ALA A HB3  4  
ATOM 5825  N N    . ALA A 1 85 ? -4.812  -5.636  -7.113  1.00 0.00 ? 93  ALA A N    4  
ATOM 5826  C CA   . ALA A 1 85 ? -3.657  -6.462  -6.778  1.00 0.00 ? 93  ALA A CA   4  
ATOM 5827  C C    . ALA A 1 85 ? -3.585  -6.719  -5.275  1.00 0.00 ? 93  ALA A C    4  
ATOM 5828  O O    . ALA A 1 85 ? -2.922  -7.653  -4.824  1.00 0.00 ? 93  ALA A O    4  
ATOM 5829  C CB   . ALA A 1 85 ? -2.379  -5.794  -7.263  1.00 0.00 ? 93  ALA A CB   4  
ATOM 5830  H H    . ALA A 1 85 ? -4.666  -4.769  -7.542  1.00 0.00 ? 93  ALA A H    4  
ATOM 5831  H HA   . ALA A 1 85 ? -3.760  -7.406  -7.292  1.00 0.00 ? 93  ALA A HA   4  
ATOM 5832  H HB1  . ALA A 1 85 ? -1.526  -6.385  -6.964  1.00 0.00 ? 93  ALA A HB1  4  
ATOM 5833  H HB2  . ALA A 1 85 ? -2.303  -4.806  -6.828  1.00 0.00 ? 93  ALA A HB2  4  
ATOM 5834  H HB3  . ALA A 1 85 ? -2.401  -5.711  -8.339  1.00 0.00 ? 93  ALA A HB3  4  
ATOM 5835  N N    . GLY A 1 86 ? -4.268  -5.876  -4.505  1.00 0.00 ? 94  GLY A N    4  
ATOM 5836  C CA   . GLY A 1 86 ? -4.270  -6.011  -3.062  1.00 0.00 ? 94  GLY A CA   4  
ATOM 5837  C C    . GLY A 1 86 ? -5.618  -6.449  -2.517  1.00 0.00 ? 94  GLY A C    4  
ATOM 5838  O O    . GLY A 1 86 ? -5.693  -7.103  -1.478  1.00 0.00 ? 94  GLY A O    4  
ATOM 5839  H H    . GLY A 1 86 ? -4.770  -5.148  -4.922  1.00 0.00 ? 94  GLY A H    4  
ATOM 5840  H HA2  . GLY A 1 86 ? -3.529  -6.744  -2.783  1.00 0.00 ? 94  GLY A HA2  4  
ATOM 5841  H HA3  . GLY A 1 86 ? -4.007  -5.063  -2.621  1.00 0.00 ? 94  GLY A HA3  4  
ATOM 5842  N N    . ARG A 1 87 ? -6.683  -6.064  -3.210  1.00 0.00 ? 95  ARG A N    4  
ATOM 5843  C CA   . ARG A 1 87 ? -8.040  -6.394  -2.784  1.00 0.00 ? 95  ARG A CA   4  
ATOM 5844  C C    . ARG A 1 87 ? -8.220  -7.899  -2.608  1.00 0.00 ? 95  ARG A C    4  
ATOM 5845  O O    . ARG A 1 87 ? -8.957  -8.342  -1.728  1.00 0.00 ? 95  ARG A O    4  
ATOM 5846  C CB   . ARG A 1 87 ? -9.053  -5.873  -3.805  1.00 0.00 ? 95  ARG A CB   4  
ATOM 5847  C CG   . ARG A 1 87 ? -9.280  -4.372  -3.730  1.00 0.00 ? 95  ARG A CG   4  
ATOM 5848  C CD   . ARG A 1 87 ? -10.548 -3.964  -4.460  1.00 0.00 ? 95  ARG A CD   4  
ATOM 5849  N NE   . ARG A 1 87 ? -11.719 -4.000  -3.586  1.00 0.00 ? 95  ARG A NE   4  
ATOM 5850  C CZ   . ARG A 1 87 ? -12.038 -3.032  -2.730  1.00 0.00 ? 95  ARG A CZ   4  
ATOM 5851  N NH1  . ARG A 1 87 ? -11.279 -1.947  -2.632  1.00 0.00 ? 95  ARG A NH1  4  
ATOM 5852  N NH2  . ARG A 1 87 ? -13.118 -3.147  -1.971  1.00 0.00 ? 95  ARG A NH2  4  
ATOM 5853  H H    . ARG A 1 87 ? -6.556  -5.530  -4.022  1.00 0.00 ? 95  ARG A H    4  
ATOM 5854  H HA   . ARG A 1 87 ? -8.218  -5.909  -1.836  1.00 0.00 ? 95  ARG A HA   4  
ATOM 5855  H HB2  . ARG A 1 87 ? -8.701  -6.112  -4.797  1.00 0.00 ? 95  ARG A HB2  4  
ATOM 5856  H HB3  . ARG A 1 87 ? -10.000 -6.367  -3.641  1.00 0.00 ? 95  ARG A HB3  4  
ATOM 5857  H HG2  . ARG A 1 87 ? -9.363  -4.084  -2.694  1.00 0.00 ? 95  ARG A HG2  4  
ATOM 5858  H HG3  . ARG A 1 87 ? -8.438  -3.868  -4.180  1.00 0.00 ? 95  ARG A HG3  4  
ATOM 5859  H HD2  . ARG A 1 87 ? -10.425 -2.961  -4.837  1.00 0.00 ? 95  ARG A HD2  4  
ATOM 5860  H HD3  . ARG A 1 87 ? -10.707 -4.641  -5.286  1.00 0.00 ? 95  ARG A HD3  4  
ATOM 5861  H HE   . ARG A 1 87 ? -12.298 -4.790  -3.637  1.00 0.00 ? 95  ARG A HE   4  
ATOM 5862  H HH11 . ARG A 1 87 ? -10.463 -1.853  -3.201  1.00 0.00 ? 95  ARG A HH11 4  
ATOM 5863  H HH12 . ARG A 1 87 ? -11.525 -1.223  -1.987  1.00 0.00 ? 95  ARG A HH12 4  
ATOM 5864  H HH21 . ARG A 1 87 ? -13.693 -3.962  -2.040  1.00 0.00 ? 95  ARG A HH21 4  
ATOM 5865  H HH22 . ARG A 1 87 ? -13.357 -2.420  -1.328  1.00 0.00 ? 95  ARG A HH22 4  
ATOM 5866  N N    . GLU A 1 88 ? -7.548  -8.683  -3.444  1.00 0.00 ? 96  GLU A N    4  
ATOM 5867  C CA   . GLU A 1 88 ? -7.648  -10.138 -3.362  1.00 0.00 ? 96  GLU A CA   4  
ATOM 5868  C C    . GLU A 1 88 ? -7.344  -10.626 -1.946  1.00 0.00 ? 96  GLU A C    4  
ATOM 5869  O O    . GLU A 1 88 ? -8.109  -11.398 -1.369  1.00 0.00 ? 96  GLU A O    4  
ATOM 5870  C CB   . GLU A 1 88 ? -6.690  -10.792 -4.358  1.00 0.00 ? 96  GLU A CB   4  
ATOM 5871  C CG   . GLU A 1 88 ? -7.160  -12.150 -4.852  1.00 0.00 ? 96  GLU A CG   4  
ATOM 5872  C CD   . GLU A 1 88 ? -6.943  -13.251 -3.832  1.00 0.00 ? 96  GLU A CD   4  
ATOM 5873  O OE1  . GLU A 1 88 ? -5.794  -13.414 -3.371  1.00 0.00 ? 96  GLU A OE1  4  
ATOM 5874  O OE2  . GLU A 1 88 ? -7.922  -13.949 -3.494  1.00 0.00 ? 96  GLU A OE2  4  
ATOM 5875  H H    . GLU A 1 88 ? -6.974  -8.279  -4.128  1.00 0.00 ? 96  GLU A H    4  
ATOM 5876  H HA   . GLU A 1 88 ? -8.661  -10.415 -3.616  1.00 0.00 ? 96  GLU A HA   4  
ATOM 5877  H HB2  . GLU A 1 88 ? -6.575  -10.143 -5.213  1.00 0.00 ? 96  GLU A HB2  4  
ATOM 5878  H HB3  . GLU A 1 88 ? -5.727  -10.920 -3.884  1.00 0.00 ? 96  GLU A HB3  4  
ATOM 5879  H HG2  . GLU A 1 88 ? -8.215  -12.093 -5.077  1.00 0.00 ? 96  GLU A HG2  4  
ATOM 5880  H HG3  . GLU A 1 88 ? -6.616  -12.402 -5.752  1.00 0.00 ? 96  GLU A HG3  4  
ATOM 5881  N N    . LEU A 1 89 ? -6.227  -10.163 -1.393  1.00 0.00 ? 97  LEU A N    4  
ATOM 5882  C CA   . LEU A 1 89 ? -5.827  -10.546 -0.043  1.00 0.00 ? 97  LEU A CA   4  
ATOM 5883  C C    . LEU A 1 89 ? -6.730  -9.895  1.001   1.00 0.00 ? 97  LEU A C    4  
ATOM 5884  O O    . LEU A 1 89 ? -7.243  -10.562 1.899   1.00 0.00 ? 97  LEU A O    4  
ATOM 5885  C CB   . LEU A 1 89 ? -4.370  -10.157 0.215   1.00 0.00 ? 97  LEU A CB   4  
ATOM 5886  C CG   . LEU A 1 89 ? -3.403  -10.483 -0.925  1.00 0.00 ? 97  LEU A CG   4  
ATOM 5887  C CD1  . LEU A 1 89 ? -1.999  -10.002 -0.591  1.00 0.00 ? 97  LEU A CD1  4  
ATOM 5888  C CD2  . LEU A 1 89 ? -3.405  -11.977 -1.209  1.00 0.00 ? 97  LEU A CD2  4  
ATOM 5889  H H    . LEU A 1 89 ? -5.662  -9.546  -1.901  1.00 0.00 ? 97  LEU A H    4  
ATOM 5890  H HA   . LEU A 1 89 ? -5.922  -11.619 0.038   1.00 0.00 ? 97  LEU A HA   4  
ATOM 5891  H HB2  . LEU A 1 89 ? -4.333  -9.093  0.399   1.00 0.00 ? 97  LEU A HB2  4  
ATOM 5892  H HB3  . LEU A 1 89 ? -4.032  -10.671 1.101   1.00 0.00 ? 97  LEU A HB3  4  
ATOM 5893  H HG   . LEU A 1 89 ? -3.726  -9.971  -1.820  1.00 0.00 ? 97  LEU A HG   4  
ATOM 5894  H HD11 . LEU A 1 89 ? -1.377  -10.849 -0.340  1.00 0.00 ? 97  LEU A HD11 4  
ATOM 5895  H HD12 . LEU A 1 89 ? -2.039  -9.325  0.250   1.00 0.00 ? 97  LEU A HD12 4  
ATOM 5896  H HD13 . LEU A 1 89 ? -1.582  -9.490  -1.445  1.00 0.00 ? 97  LEU A HD13 4  
ATOM 5897  H HD21 . LEU A 1 89 ? -3.470  -12.519 -0.278  1.00 0.00 ? 97  LEU A HD21 4  
ATOM 5898  H HD22 . LEU A 1 89 ? -2.495  -12.246 -1.721  1.00 0.00 ? 97  LEU A HD22 4  
ATOM 5899  H HD23 . LEU A 1 89 ? -4.254  -12.222 -1.829  1.00 0.00 ? 97  LEU A HD23 4  
ATOM 5900  N N    . PHE A 1 90 ? -6.911  -8.581  0.877   1.00 0.00 ? 98  PHE A N    4  
ATOM 5901  C CA   . PHE A 1 90 ? -7.745  -7.824  1.809   1.00 0.00 ? 98  PHE A CA   4  
ATOM 5902  C C    . PHE A 1 90 ? -9.085  -8.519  2.048   1.00 0.00 ? 98  PHE A C    4  
ATOM 5903  O O    . PHE A 1 90 ? -9.463  -8.782  3.189   1.00 0.00 ? 98  PHE A O    4  
ATOM 5904  C CB   . PHE A 1 90 ? -7.978  -6.408  1.276   1.00 0.00 ? 98  PHE A CB   4  
ATOM 5905  C CG   . PHE A 1 90 ? -7.470  -5.332  2.194   1.00 0.00 ? 98  PHE A CG   4  
ATOM 5906  C CD1  . PHE A 1 90 ? -7.888  -5.276  3.513   1.00 0.00 ? 98  PHE A CD1  4  
ATOM 5907  C CD2  . PHE A 1 90 ? -6.576  -4.378  1.736   1.00 0.00 ? 98  PHE A CD2  4  
ATOM 5908  C CE1  . PHE A 1 90 ? -7.423  -4.287  4.360   1.00 0.00 ? 98  PHE A CE1  4  
ATOM 5909  C CE2  . PHE A 1 90 ? -6.107  -3.387  2.577   1.00 0.00 ? 98  PHE A CE2  4  
ATOM 5910  C CZ   . PHE A 1 90 ? -6.532  -3.342  3.891   1.00 0.00 ? 98  PHE A CZ   4  
ATOM 5911  H H    . PHE A 1 90 ? -6.470  -8.108  0.141   1.00 0.00 ? 98  PHE A H    4  
ATOM 5912  H HA   . PHE A 1 90 ? -7.216  -7.759  2.748   1.00 0.00 ? 98  PHE A HA   4  
ATOM 5913  H HB2  . PHE A 1 90 ? -7.472  -6.301  0.328   1.00 0.00 ? 98  PHE A HB2  4  
ATOM 5914  H HB3  . PHE A 1 90 ? -9.037  -6.253  1.133   1.00 0.00 ? 98  PHE A HB3  4  
ATOM 5915  H HD1  . PHE A 1 90 ? -8.585  -6.016  3.881   1.00 0.00 ? 98  PHE A HD1  4  
ATOM 5916  H HD2  . PHE A 1 90 ? -6.245  -4.413  0.708   1.00 0.00 ? 98  PHE A HD2  4  
ATOM 5917  H HE1  . PHE A 1 90 ? -7.757  -4.254  5.387   1.00 0.00 ? 98  PHE A HE1  4  
ATOM 5918  H HE2  . PHE A 1 90 ? -5.411  -2.649  2.209   1.00 0.00 ? 98  PHE A HE2  4  
ATOM 5919  H HZ   . PHE A 1 90 ? -6.167  -2.568  4.551   1.00 0.00 ? 98  PHE A HZ   4  
ATOM 5920  N N    . MET A 1 91 ? -9.796  -8.811  0.964   1.00 0.00 ? 99  MET A N    4  
ATOM 5921  C CA   . MET A 1 91 ? -11.093 -9.473  1.059   1.00 0.00 ? 99  MET A CA   4  
ATOM 5922  C C    . MET A 1 91 ? -10.929 -10.944 1.425   1.00 0.00 ? 99  MET A C    4  
ATOM 5923  O O    . MET A 1 91 ? -10.300 -11.709 0.694   1.00 0.00 ? 99  MET A O    4  
ATOM 5924  C CB   . MET A 1 91 ? -11.851 -9.345  -0.263  1.00 0.00 ? 99  MET A CB   4  
ATOM 5925  C CG   . MET A 1 91 ? -11.896 -7.925  -0.803  1.00 0.00 ? 99  MET A CG   4  
ATOM 5926  S SD   . MET A 1 91 ? -13.030 -6.868  0.120   1.00 0.00 ? 99  MET A SD   4  
ATOM 5927  C CE   . MET A 1 91 ? -11.960 -6.299  1.439   1.00 0.00 ? 99  MET A CE   4  
ATOM 5928  H H    . MET A 1 91 ? -9.443  -8.576  0.082   1.00 0.00 ? 99  MET A H    4  
ATOM 5929  H HA   . MET A 1 91 ? -11.658 -8.982  1.838   1.00 0.00 ? 99  MET A HA   4  
ATOM 5930  H HB2  . MET A 1 91 ? -11.373 -9.972  -1.001  1.00 0.00 ? 99  MET A HB2  4  
ATOM 5931  H HB3  . MET A 1 91 ? -12.866 -9.683  -0.117  1.00 0.00 ? 99  MET A HB3  4  
ATOM 5932  H HG2  . MET A 1 91 ? -10.905 -7.499  -0.743  1.00 0.00 ? 99  MET A HG2  4  
ATOM 5933  H HG3  . MET A 1 91 ? -12.212 -7.954  -1.834  1.00 0.00 ? 99  MET A HG3  4  
ATOM 5934  H HE1  . MET A 1 91 ? -11.163 -7.011  1.588   1.00 0.00 ? 99  MET A HE1  4  
ATOM 5935  H HE2  . MET A 1 91 ? -12.533 -6.202  2.350   1.00 0.00 ? 99  MET A HE2  4  
ATOM 5936  H HE3  . MET A 1 91 ? -11.542 -5.340  1.174   1.00 0.00 ? 99  MET A HE3  4  
ATOM 5937  N N    . THR A 1 92 ? -11.496 -11.333 2.562   1.00 0.00 ? 100 THR A N    4  
ATOM 5938  C CA   . THR A 1 92 ? -11.413 -12.714 3.025   1.00 0.00 ? 100 THR A CA   4  
ATOM 5939  C C    . THR A 1 92 ? -12.434 -12.983 4.124   1.00 0.00 ? 100 THR A C    4  
ATOM 5940  O O    . THR A 1 92 ? -13.171 -13.968 4.073   1.00 0.00 ? 100 THR A O    4  
ATOM 5941  C CB   . THR A 1 92 ? -10.003 -13.018 3.535   1.00 0.00 ? 100 THR A CB   4  
ATOM 5942  O OG1  . THR A 1 92 ? -9.954  -14.298 4.139   1.00 0.00 ? 100 THR A OG1  4  
ATOM 5943  C CG2  . THR A 1 92 ? -9.504  -12.012 4.550   1.00 0.00 ? 100 THR A CG2  4  
ATOM 5944  H H    . THR A 1 92 ? -11.984 -10.676 3.102   1.00 0.00 ? 100 THR A H    4  
ATOM 5945  H HA   . THR A 1 92 ? -11.629 -13.357 2.184   1.00 0.00 ? 100 THR A HA   4  
ATOM 5946  H HB   . THR A 1 92 ? -9.319  -13.011 2.699   1.00 0.00 ? 100 THR A HB   4  
ATOM 5947  H HG1  . THR A 1 92 ? -10.466 -14.288 4.951   1.00 0.00 ? 100 THR A HG1  4  
ATOM 5948  H HG21 . THR A 1 92 ? -10.062 -12.119 5.468   1.00 0.00 ? 100 THR A HG21 4  
ATOM 5949  H HG22 . THR A 1 92 ? -9.637  -11.013 4.161   1.00 0.00 ? 100 THR A HG22 4  
ATOM 5950  H HG23 . THR A 1 92 ? -8.455  -12.187 4.743   1.00 0.00 ? 100 THR A HG23 4  
ATOM 5951  N N    . THR B 2 1  ? -6.619  -9.580  15.682  1.00 0.00 ? 111 THR B N    4  
ATOM 5952  C CA   . THR B 2 1  ? -6.035  -8.338  15.192  1.00 0.00 ? 111 THR B CA   4  
ATOM 5953  C C    . THR B 2 1  ? -5.682  -8.448  13.710  1.00 0.00 ? 111 THR B C    4  
ATOM 5954  O O    . THR B 2 1  ? -5.265  -9.507  13.241  1.00 0.00 ? 111 THR B O    4  
ATOM 5955  C CB   . THR B 2 1  ? -4.787  -7.983  15.999  1.00 0.00 ? 111 THR B CB   4  
ATOM 5956  O OG1  . THR B 2 1  ? -3.852  -9.047  15.970  1.00 0.00 ? 111 THR B OG1  4  
ATOM 5957  C CG2  . THR B 2 1  ? -5.080  -7.670  17.451  1.00 0.00 ? 111 THR B CG2  4  
ATOM 5958  H H1   . THR B 2 1  ? -6.029  -10.280 16.034  1.00 0.00 ? 111 THR B H1   4  
ATOM 5959  H HA   . THR B 2 1  ? -6.770  -7.555  15.319  1.00 0.00 ? 111 THR B HA   4  
ATOM 5960  H HB   . THR B 2 1  ? -4.321  -7.112  15.561  1.00 0.00 ? 111 THR B HB   4  
ATOM 5961  H HG1  . THR B 2 1  ? -2.985  -8.721  16.227  1.00 0.00 ? 111 THR B HG1  4  
ATOM 5962  H HG21 . THR B 2 1  ? -4.708  -8.471  18.074  1.00 0.00 ? 111 THR B HG21 4  
ATOM 5963  H HG22 . THR B 2 1  ? -6.147  -7.573  17.589  1.00 0.00 ? 111 THR B HG22 4  
ATOM 5964  H HG23 . THR B 2 1  ? -4.594  -6.745  17.725  1.00 0.00 ? 111 THR B HG23 4  
ATOM 5965  N N    . PRO B 2 2  ? -5.846  -7.350  12.949  1.00 0.00 ? 112 PRO B N    4  
ATOM 5966  C CA   . PRO B 2 2  ? -5.543  -7.331  11.516  1.00 0.00 ? 112 PRO B CA   4  
ATOM 5967  C C    . PRO B 2 2  ? -4.043  -7.286  11.242  1.00 0.00 ? 112 PRO B C    4  
ATOM 5968  O O    . PRO B 2 2  ? -3.230  -7.486  12.144  1.00 0.00 ? 112 PRO B O    4  
ATOM 5969  C CB   . PRO B 2 2  ? -6.215  -6.046  11.036  1.00 0.00 ? 112 PRO B CB   4  
ATOM 5970  C CG   . PRO B 2 2  ? -6.200  -5.148  12.224  1.00 0.00 ? 112 PRO B CG   4  
ATOM 5971  C CD   . PRO B 2 2  ? -6.341  -6.044  13.426  1.00 0.00 ? 112 PRO B CD   4  
ATOM 5972  H HA   . PRO B 2 2  ? -5.976  -8.180  11.009  1.00 0.00 ? 112 PRO B HA   4  
ATOM 5973  H HB2  . PRO B 2 2  ? -5.651  -5.626  10.215  1.00 0.00 ? 112 PRO B HB2  4  
ATOM 5974  H HB3  . PRO B 2 2  ? -7.224  -6.261  10.715  1.00 0.00 ? 112 PRO B HB3  4  
ATOM 5975  H HG2  . PRO B 2 2  ? -5.264  -4.610  12.265  1.00 0.00 ? 112 PRO B HG2  4  
ATOM 5976  H HG3  . PRO B 2 2  ? -7.029  -4.458  12.172  1.00 0.00 ? 112 PRO B HG3  4  
ATOM 5977  H HD2  . PRO B 2 2  ? -5.734  -5.677  14.241  1.00 0.00 ? 112 PRO B HD2  4  
ATOM 5978  H HD3  . PRO B 2 2  ? -7.376  -6.111  13.727  1.00 0.00 ? 112 PRO B HD3  4  
ATOM 5979  N N    . LEU B 2 3  ? -3.684  -7.018  9.991   1.00 0.00 ? 113 LEU B N    4  
ATOM 5980  C CA   . LEU B 2 3  ? -2.282  -6.944  9.597   1.00 0.00 ? 113 LEU B CA   4  
ATOM 5981  C C    . LEU B 2 3  ? -1.665  -5.621  10.035  1.00 0.00 ? 113 LEU B C    4  
ATOM 5982  O O    . LEU B 2 3  ? -2.367  -4.712  10.476  1.00 0.00 ? 113 LEU B O    4  
ATOM 5983  C CB   . LEU B 2 3  ? -2.148  -7.105  8.081   1.00 0.00 ? 113 LEU B CB   4  
ATOM 5984  C CG   . LEU B 2 3  ? -2.918  -8.284  7.484   1.00 0.00 ? 113 LEU B CG   4  
ATOM 5985  C CD1  . LEU B 2 3  ? -3.531  -7.901  6.146   1.00 0.00 ? 113 LEU B CD1  4  
ATOM 5986  C CD2  . LEU B 2 3  ? -2.008  -9.491  7.328   1.00 0.00 ? 113 LEU B CD2  4  
ATOM 5987  H H    . LEU B 2 3  ? -4.378  -6.867  9.316   1.00 0.00 ? 113 LEU B H    4  
ATOM 5988  H HA   . LEU B 2 3  ? -1.757  -7.751  10.083  1.00 0.00 ? 113 LEU B HA   4  
ATOM 5989  H HB2  . LEU B 2 3  ? -2.497  -6.196  7.612   1.00 0.00 ? 113 LEU B HB2  4  
ATOM 5990  H HB3  . LEU B 2 3  ? -1.102  -7.233  7.845   1.00 0.00 ? 113 LEU B HB3  4  
ATOM 5991  H HG   . LEU B 2 3  ? -3.723  -8.555  8.154   1.00 0.00 ? 113 LEU B HG   4  
ATOM 5992  H HD11 . LEU B 2 3  ? -4.169  -7.039  6.276   1.00 0.00 ? 113 LEU B HD11 4  
ATOM 5993  H HD12 . LEU B 2 3  ? -4.114  -8.727  5.766   1.00 0.00 ? 113 LEU B HD12 4  
ATOM 5994  H HD13 . LEU B 2 3  ? -2.745  -7.663  5.445   1.00 0.00 ? 113 LEU B HD13 4  
ATOM 5995  H HD21 . LEU B 2 3  ? -1.133  -9.212  6.759   1.00 0.00 ? 113 LEU B HD21 4  
ATOM 5996  H HD22 . LEU B 2 3  ? -2.536  -10.278 6.811   1.00 0.00 ? 113 LEU B HD22 4  
ATOM 5997  H HD23 . LEU B 2 3  ? -1.705  -9.843  8.303   1.00 0.00 ? 113 LEU B HD23 4  
ATOM 5998  N N    . GLU B 2 4  ? -0.344  -5.518  9.911   1.00 0.00 ? 114 GLU B N    4  
ATOM 5999  C CA   . GLU B 2 4  ? 0.367   -4.305  10.294  1.00 0.00 ? 114 GLU B CA   4  
ATOM 6000  C C    . GLU B 2 4  ? -0.063  -3.127  9.426   1.00 0.00 ? 114 GLU B C    4  
ATOM 6001  O O    . GLU B 2 4  ? -0.438  -3.303  8.267   1.00 0.00 ? 114 GLU B O    4  
ATOM 6002  C CB   . GLU B 2 4  ? 1.878   -4.515  10.177  1.00 0.00 ? 114 GLU B CB   4  
ATOM 6003  C CG   . GLU B 2 4  ? 2.470   -5.321  11.321  1.00 0.00 ? 114 GLU B CG   4  
ATOM 6004  C CD   . GLU B 2 4  ? 3.765   -4.729  11.843  1.00 0.00 ? 114 GLU B CD   4  
ATOM 6005  O OE1  . GLU B 2 4  ? 4.655   -4.428  11.020  1.00 0.00 ? 114 GLU B OE1  4  
ATOM 6006  O OE2  . GLU B 2 4  ? 3.887   -4.566  13.076  1.00 0.00 ? 114 GLU B OE2  4  
ATOM 6007  H H    . GLU B 2 4  ? 0.162   -6.276  9.553   1.00 0.00 ? 114 GLU B H    4  
ATOM 6008  H HA   . GLU B 2 4  ? 0.121   -4.087  11.323  1.00 0.00 ? 114 GLU B HA   4  
ATOM 6009  H HB2  . GLU B 2 4  ? 2.087   -5.033  9.253   1.00 0.00 ? 114 GLU B HB2  4  
ATOM 6010  H HB3  . GLU B 2 4  ? 2.363   -3.550  10.156  1.00 0.00 ? 114 GLU B HB3  4  
ATOM 6011  H HG2  . GLU B 2 4  ? 1.755   -5.355  12.129  1.00 0.00 ? 114 GLU B HG2  4  
ATOM 6012  H HG3  . GLU B 2 4  ? 2.665   -6.326  10.973  1.00 0.00 ? 114 GLU B HG3  4  
ATOM 6013  N N    . ILE B 2 5  ? -0.007  -1.926  9.994   1.00 0.00 ? 115 ILE B N    4  
ATOM 6014  C CA   . ILE B 2 5  ? -0.391  -0.721  9.267   1.00 0.00 ? 115 ILE B CA   4  
ATOM 6015  C C    . ILE B 2 5  ? 0.560   0.432   9.570   1.00 0.00 ? 115 ILE B C    4  
ATOM 6016  O O    . ILE B 2 5  ? 0.972   0.629   10.713  1.00 0.00 ? 115 ILE B O    4  
ATOM 6017  C CB   . ILE B 2 5  ? -1.829  -0.291  9.616   1.00 0.00 ? 115 ILE B CB   4  
ATOM 6018  C CG1  . ILE B 2 5  ? -2.782  -1.483  9.502   1.00 0.00 ? 115 ILE B CG1  4  
ATOM 6019  C CG2  . ILE B 2 5  ? -2.279  0.841   8.703   1.00 0.00 ? 115 ILE B CG2  4  
ATOM 6020  C CD1  . ILE B 2 5  ? -4.219  -1.141  9.831   1.00 0.00 ? 115 ILE B CD1  4  
ATOM 6021  H H    . ILE B 2 5  ? 0.301   -1.849  10.921  1.00 0.00 ? 115 ILE B H    4  
ATOM 6022  H HA   . ILE B 2 5  ? -0.349  -0.941  8.211   1.00 0.00 ? 115 ILE B HA   4  
ATOM 6023  H HB   . ILE B 2 5  ? -1.838  0.073   10.632  1.00 0.00 ? 115 ILE B HB   4  
ATOM 6024  H HG12 . ILE B 2 5  ? -2.755  -1.863  8.493   1.00 0.00 ? 115 ILE B HG12 4  
ATOM 6025  H HG13 . ILE B 2 5  ? -2.460  -2.258  10.183  1.00 0.00 ? 115 ILE B HG13 4  
ATOM 6026  H HG21 . ILE B 2 5  ? -2.618  0.432   7.763   1.00 0.00 ? 115 ILE B HG21 4  
ATOM 6027  H HG22 . ILE B 2 5  ? -1.451  1.511   8.526   1.00 0.00 ? 115 ILE B HG22 4  
ATOM 6028  H HG23 . ILE B 2 5  ? -3.087  1.382   9.173   1.00 0.00 ? 115 ILE B HG23 4  
ATOM 6029  H HD11 . ILE B 2 5  ? -4.536  -0.303  9.231   1.00 0.00 ? 115 ILE B HD11 4  
ATOM 6030  H HD12 . ILE B 2 5  ? -4.298  -0.885  10.877  1.00 0.00 ? 115 ILE B HD12 4  
ATOM 6031  H HD13 . ILE B 2 5  ? -4.848  -1.994  9.621   1.00 0.00 ? 115 ILE B HD13 4  
ATOM 6032  N N    . THR B 2 6  ? 0.904   1.194   8.536   1.00 0.00 ? 116 THR B N    4  
ATOM 6033  C CA   . THR B 2 6  ? 1.807   2.331   8.689   1.00 0.00 ? 116 THR B CA   4  
ATOM 6034  C C    . THR B 2 6  ? 1.215   3.583   8.051   1.00 0.00 ? 116 THR B C    4  
ATOM 6035  O O    . THR B 2 6  ? 0.468   3.500   7.075   1.00 0.00 ? 116 THR B O    4  
ATOM 6036  C CB   . THR B 2 6  ? 3.167   2.017   8.060   1.00 0.00 ? 116 THR B CB   4  
ATOM 6037  O OG1  . THR B 2 6  ? 3.729   0.851   8.637   1.00 0.00 ? 116 THR B OG1  4  
ATOM 6038  C CG2  . THR B 2 6  ? 4.171   3.137   8.215   1.00 0.00 ? 116 THR B CG2  4  
ATOM 6039  H H    . THR B 2 6  ? 0.542   0.988   7.649   1.00 0.00 ? 116 THR B H    4  
ATOM 6040  H HA   . THR B 2 6  ? 1.941   2.508   9.746   1.00 0.00 ? 116 THR B HA   4  
ATOM 6041  H HB   . THR B 2 6  ? 3.029   1.838   7.004   1.00 0.00 ? 116 THR B HB   4  
ATOM 6042  H HG1  . THR B 2 6  ? 4.302   0.422   7.997   1.00 0.00 ? 116 THR B HG1  4  
ATOM 6043  H HG21 . THR B 2 6  ? 4.167   3.749   7.326   1.00 0.00 ? 116 THR B HG21 4  
ATOM 6044  H HG22 . THR B 2 6  ? 5.157   2.720   8.359   1.00 0.00 ? 116 THR B HG22 4  
ATOM 6045  H HG23 . THR B 2 6  ? 3.908   3.741   9.070   1.00 0.00 ? 116 THR B HG23 4  
ATOM 6046  N N    . GLU B 2 7  ? 1.551   4.742   8.608   1.00 0.00 ? 117 GLU B N    4  
ATOM 6047  C CA   . GLU B 2 7  ? 1.050   6.012   8.093   1.00 0.00 ? 117 GLU B CA   4  
ATOM 6048  C C    . GLU B 2 7  ? 2.060   6.656   7.149   1.00 0.00 ? 117 GLU B C    4  
ATOM 6049  O O    . GLU B 2 7  ? 3.270   6.561   7.358   1.00 0.00 ? 117 GLU B O    4  
ATOM 6050  C CB   . GLU B 2 7  ? 0.734   6.965   9.247   1.00 0.00 ? 117 GLU B CB   4  
ATOM 6051  C CG   . GLU B 2 7  ? -0.260  6.400   10.249  1.00 0.00 ? 117 GLU B CG   4  
ATOM 6052  C CD   . GLU B 2 7  ? 0.110   6.724   11.683  1.00 0.00 ? 117 GLU B CD   4  
ATOM 6053  O OE1  . GLU B 2 7  ? 1.313   6.670   12.013  1.00 0.00 ? 117 GLU B OE1  4  
ATOM 6054  O OE2  . GLU B 2 7  ? -0.804  7.032   12.477  1.00 0.00 ? 117 GLU B OE2  4  
ATOM 6055  H H    . GLU B 2 7  ? 2.149   4.744   9.385   1.00 0.00 ? 117 GLU B H    4  
ATOM 6056  H HA   . GLU B 2 7  ? 0.142   5.811   7.546   1.00 0.00 ? 117 GLU B HA   4  
ATOM 6057  H HB2  . GLU B 2 7  ? 1.650   7.194   9.772   1.00 0.00 ? 117 GLU B HB2  4  
ATOM 6058  H HB3  . GLU B 2 7  ? 0.324   7.878   8.843   1.00 0.00 ? 117 GLU B HB3  4  
ATOM 6059  H HG2  . GLU B 2 7  ? -1.235  6.814   10.043  1.00 0.00 ? 117 GLU B HG2  4  
ATOM 6060  H HG3  . GLU B 2 7  ? -0.295  5.326   10.135  1.00 0.00 ? 117 GLU B HG3  4  
ATOM 6061  N N    . LEU B 2 8  ? 1.554   7.312   6.109   1.00 0.00 ? 118 LEU B N    4  
ATOM 6062  C CA   . LEU B 2 8  ? 2.409   7.974   5.131   1.00 0.00 ? 118 LEU B CA   4  
ATOM 6063  C C    . LEU B 2 8  ? 1.903   9.381   4.829   1.00 0.00 ? 118 LEU B C    4  
ATOM 6064  O O    . LEU B 2 8  ? 2.731   10.241  4.462   1.00 0.00 ? 118 LEU B O    4  
ATOM 6065  C CB   . LEU B 2 8  ? 2.474   7.155   3.840   1.00 0.00 ? 118 LEU B CB   4  
ATOM 6066  C CG   . LEU B 2 8  ? 3.034   5.741   3.999   1.00 0.00 ? 118 LEU B CG   4  
ATOM 6067  C CD1  . LEU B 2 8  ? 2.551   4.847   2.868   1.00 0.00 ? 118 LEU B CD1  4  
ATOM 6068  C CD2  . LEU B 2 8  ? 4.557   5.772   4.046   1.00 0.00 ? 118 LEU B CD2  4  
ATOM 6069  O OXT  . LEU B 2 8  ? 0.682   9.611   4.961   1.00 0.00 ? 118 LEU B OXT  4  
ATOM 6070  H H    . LEU B 2 8  ? 0.581   7.351   5.997   1.00 0.00 ? 118 LEU B H    4  
ATOM 6071  H HA   . LEU B 2 8  ? 3.401   8.045   5.552   1.00 0.00 ? 118 LEU B HA   4  
ATOM 6072  H HB2  . LEU B 2 8  ? 1.476   7.082   3.436   1.00 0.00 ? 118 LEU B HB2  4  
ATOM 6073  H HB3  . LEU B 2 8  ? 3.094   7.686   3.132   1.00 0.00 ? 118 LEU B HB3  4  
ATOM 6074  H HG   . LEU B 2 8  ? 2.680   5.322   4.930   1.00 0.00 ? 118 LEU B HG   4  
ATOM 6075  H HD11 . LEU B 2 8  ? 2.601   3.814   3.179   1.00 0.00 ? 118 LEU B HD11 4  
ATOM 6076  H HD12 . LEU B 2 8  ? 3.178   4.992   2.001   1.00 0.00 ? 118 LEU B HD12 4  
ATOM 6077  H HD13 . LEU B 2 8  ? 1.530   5.099   2.621   1.00 0.00 ? 118 LEU B HD13 4  
ATOM 6078  H HD21 . LEU B 2 8  ? 4.908   6.737   3.711   1.00 0.00 ? 118 LEU B HD21 4  
ATOM 6079  H HD22 . LEU B 2 8  ? 4.953   5.002   3.401   1.00 0.00 ? 118 LEU B HD22 4  
ATOM 6080  H HD23 . LEU B 2 8  ? 4.889   5.600   5.059   1.00 0.00 ? 118 LEU B HD23 4  
ATOM 6081  N N    . LYS A 1 1  ? -5.522  -2.829  -15.487 1.00 0.00 ? 9   LYS A N    5  
ATOM 6082  C CA   . LYS A 1 1  ? -5.355  -3.122  -14.037 1.00 0.00 ? 9   LYS A CA   5  
ATOM 6083  C C    . LYS A 1 1  ? -4.231  -2.287  -13.429 1.00 0.00 ? 9   LYS A C    5  
ATOM 6084  O O    . LYS A 1 1  ? -4.431  -1.596  -12.432 1.00 0.00 ? 9   LYS A O    5  
ATOM 6085  C CB   . LYS A 1 1  ? -5.059  -4.616  -13.866 1.00 0.00 ? 9   LYS A CB   5  
ATOM 6086  C CG   . LYS A 1 1  ? -4.009  -5.151  -14.829 1.00 0.00 ? 9   LYS A CG   5  
ATOM 6087  C CD   . LYS A 1 1  ? -4.228  -6.625  -15.127 1.00 0.00 ? 9   LYS A CD   5  
ATOM 6088  C CE   . LYS A 1 1  ? -3.319  -7.506  -14.284 1.00 0.00 ? 9   LYS A CE   5  
ATOM 6089  N NZ   . LYS A 1 1  ? -1.907  -7.455  -14.751 1.00 0.00 ? 9   LYS A NZ   5  
ATOM 6090  H H1   . LYS A 1 1  ? -6.000  -3.644  -15.922 1.00 0.00 ? 9   LYS A H1   5  
ATOM 6091  H H2   . LYS A 1 1  ? -4.576  -2.686  -15.892 1.00 0.00 ? 9   LYS A H2   5  
ATOM 6092  H H3   . LYS A 1 1  ? -6.101  -1.969  -15.569 1.00 0.00 ? 9   LYS A H3   5  
ATOM 6093  H HA   . LYS A 1 1  ? -6.278  -2.886  -13.533 1.00 0.00 ? 9   LYS A HA   5  
ATOM 6094  H HB2  . LYS A 1 1  ? -4.711  -4.788  -12.858 1.00 0.00 ? 9   LYS A HB2  5  
ATOM 6095  H HB3  . LYS A 1 1  ? -5.973  -5.170  -14.020 1.00 0.00 ? 9   LYS A HB3  5  
ATOM 6096  H HG2  . LYS A 1 1  ? -4.063  -4.596  -15.752 1.00 0.00 ? 9   LYS A HG2  5  
ATOM 6097  H HG3  . LYS A 1 1  ? -3.031  -5.024  -14.386 1.00 0.00 ? 9   LYS A HG3  5  
ATOM 6098  H HD2  . LYS A 1 1  ? -5.256  -6.877  -14.914 1.00 0.00 ? 9   LYS A HD2  5  
ATOM 6099  H HD3  . LYS A 1 1  ? -4.021  -6.805  -16.172 1.00 0.00 ? 9   LYS A HD3  5  
ATOM 6100  H HE2  . LYS A 1 1  ? -3.363  -7.168  -13.260 1.00 0.00 ? 9   LYS A HE2  5  
ATOM 6101  H HE3  . LYS A 1 1  ? -3.674  -8.524  -14.342 1.00 0.00 ? 9   LYS A HE3  5  
ATOM 6102  H HZ1  . LYS A 1 1  ? -1.854  -7.722  -15.756 1.00 0.00 ? 9   LYS A HZ1  5  
ATOM 6103  H HZ2  . LYS A 1 1  ? -1.324  -8.113  -14.199 1.00 0.00 ? 9   LYS A HZ2  5  
ATOM 6104  H HZ3  . LYS A 1 1  ? -1.527  -6.494  -14.639 1.00 0.00 ? 9   LYS A HZ3  5  
ATOM 6105  N N    . GLU A 1 2  ? -3.049  -2.354  -14.035 1.00 0.00 ? 10  GLU A N    5  
ATOM 6106  C CA   . GLU A 1 2  ? -1.899  -1.601  -13.550 1.00 0.00 ? 10  GLU A CA   5  
ATOM 6107  C C    . GLU A 1 2  ? -2.171  -0.101  -13.600 1.00 0.00 ? 10  GLU A C    5  
ATOM 6108  O O    . GLU A 1 2  ? -2.530  0.439   -14.646 1.00 0.00 ? 10  GLU A O    5  
ATOM 6109  C CB   . GLU A 1 2  ? -0.657  -1.933  -14.381 1.00 0.00 ? 10  GLU A CB   5  
ATOM 6110  C CG   . GLU A 1 2  ? -0.146  -3.349  -14.170 1.00 0.00 ? 10  GLU A CG   5  
ATOM 6111  C CD   . GLU A 1 2  ? 0.048   -4.101  -15.473 1.00 0.00 ? 10  GLU A CD   5  
ATOM 6112  O OE1  . GLU A 1 2  ? 0.540   -3.487  -16.443 1.00 0.00 ? 10  GLU A OE1  5  
ATOM 6113  O OE2  . GLU A 1 2  ? -0.292  -5.302  -15.522 1.00 0.00 ? 10  GLU A OE2  5  
ATOM 6114  H H    . GLU A 1 2  ? -2.948  -2.922  -14.828 1.00 0.00 ? 10  GLU A H    5  
ATOM 6115  H HA   . GLU A 1 2  ? -1.723  -1.889  -12.524 1.00 0.00 ? 10  GLU A HA   5  
ATOM 6116  H HB2  . GLU A 1 2  ? -0.897  -1.811  -15.427 1.00 0.00 ? 10  GLU A HB2  5  
ATOM 6117  H HB3  . GLU A 1 2  ? 0.132   -1.245  -14.117 1.00 0.00 ? 10  GLU A HB3  5  
ATOM 6118  H HG2  . GLU A 1 2  ? 0.802   -3.303  -13.655 1.00 0.00 ? 10  GLU A HG2  5  
ATOM 6119  H HG3  . GLU A 1 2  ? -0.858  -3.889  -13.561 1.00 0.00 ? 10  GLU A HG3  5  
ATOM 6120  N N    . LYS A 1 3  ? -2.001  0.566   -12.463 1.00 0.00 ? 11  LYS A N    5  
ATOM 6121  C CA   . LYS A 1 3  ? -2.232  2.005   -12.380 1.00 0.00 ? 11  LYS A CA   5  
ATOM 6122  C C    . LYS A 1 3  ? -0.955  2.745   -11.990 1.00 0.00 ? 11  LYS A C    5  
ATOM 6123  O O    . LYS A 1 3  ? -0.036  2.162   -11.416 1.00 0.00 ? 11  LYS A O    5  
ATOM 6124  C CB   . LYS A 1 3  ? -3.347  2.310   -11.374 1.00 0.00 ? 11  LYS A CB   5  
ATOM 6125  C CG   . LYS A 1 3  ? -3.605  3.796   -11.176 1.00 0.00 ? 11  LYS A CG   5  
ATOM 6126  C CD   . LYS A 1 3  ? -4.967  4.046   -10.551 1.00 0.00 ? 11  LYS A CD   5  
ATOM 6127  C CE   . LYS A 1 3  ? -4.930  3.858   -9.043  1.00 0.00 ? 11  LYS A CE   5  
ATOM 6128  N NZ   . LYS A 1 3  ? -6.016  4.618   -8.362  1.00 0.00 ? 11  LYS A NZ   5  
ATOM 6129  H H    . LYS A 1 3  ? -1.714  0.079   -11.660 1.00 0.00 ? 11  LYS A H    5  
ATOM 6130  H HA   . LYS A 1 3  ? -2.542  2.345   -13.357 1.00 0.00 ? 11  LYS A HA   5  
ATOM 6131  H HB2  . LYS A 1 3  ? -4.262  1.852   -11.720 1.00 0.00 ? 11  LYS A HB2  5  
ATOM 6132  H HB3  . LYS A 1 3  ? -3.081  1.883   -10.419 1.00 0.00 ? 11  LYS A HB3  5  
ATOM 6133  H HG2  . LYS A 1 3  ? -2.843  4.200   -10.526 1.00 0.00 ? 11  LYS A HG2  5  
ATOM 6134  H HG3  . LYS A 1 3  ? -3.562  4.291   -12.136 1.00 0.00 ? 11  LYS A HG3  5  
ATOM 6135  H HD2  . LYS A 1 3  ? -5.274  5.057   -10.770 1.00 0.00 ? 11  LYS A HD2  5  
ATOM 6136  H HD3  . LYS A 1 3  ? -5.679  3.351   -10.974 1.00 0.00 ? 11  LYS A HD3  5  
ATOM 6137  H HE2  . LYS A 1 3  ? -5.046  2.807   -8.821  1.00 0.00 ? 11  LYS A HE2  5  
ATOM 6138  H HE3  . LYS A 1 3  ? -3.976  4.203   -8.673  1.00 0.00 ? 11  LYS A HE3  5  
ATOM 6139  H HZ1  . LYS A 1 3  ? -5.655  5.535   -8.030  1.00 0.00 ? 11  LYS A HZ1  5  
ATOM 6140  H HZ2  . LYS A 1 3  ? -6.372  4.080   -7.547  1.00 0.00 ? 11  LYS A HZ2  5  
ATOM 6141  H HZ3  . LYS A 1 3  ? -6.802  4.785   -9.022  1.00 0.00 ? 11  LYS A HZ3  5  
ATOM 6142  N N    . LYS A 1 4  ? -0.908  4.034   -12.307 1.00 0.00 ? 12  LYS A N    5  
ATOM 6143  C CA   . LYS A 1 4  ? 0.251   4.860   -11.989 1.00 0.00 ? 12  LYS A CA   5  
ATOM 6144  C C    . LYS A 1 4  ? -0.148  6.031   -11.099 1.00 0.00 ? 12  LYS A C    5  
ATOM 6145  O O    . LYS A 1 4  ? -1.213  6.622   -11.278 1.00 0.00 ? 12  LYS A O    5  
ATOM 6146  C CB   . LYS A 1 4  ? 0.903   5.376   -13.274 1.00 0.00 ? 12  LYS A CB   5  
ATOM 6147  C CG   . LYS A 1 4  ? 2.106   4.560   -13.717 1.00 0.00 ? 12  LYS A CG   5  
ATOM 6148  C CD   . LYS A 1 4  ? 3.167   5.440   -14.361 1.00 0.00 ? 12  LYS A CD   5  
ATOM 6149  C CE   . LYS A 1 4  ? 4.567   4.911   -14.093 1.00 0.00 ? 12  LYS A CE   5  
ATOM 6150  N NZ   . LYS A 1 4  ? 5.616   5.871   -14.531 1.00 0.00 ? 12  LYS A NZ   5  
ATOM 6151  H H    . LYS A 1 4  ? -1.674  4.443   -12.764 1.00 0.00 ? 12  LYS A H    5  
ATOM 6152  H HA   . LYS A 1 4  ? 0.961   4.244   -11.457 1.00 0.00 ? 12  LYS A HA   5  
ATOM 6153  H HB2  . LYS A 1 4  ? 0.171   5.356   -14.068 1.00 0.00 ? 12  LYS A HB2  5  
ATOM 6154  H HB3  . LYS A 1 4  ? 1.224   6.396   -13.118 1.00 0.00 ? 12  LYS A HB3  5  
ATOM 6155  H HG2  . LYS A 1 4  ? 2.534   4.071   -12.854 1.00 0.00 ? 12  LYS A HG2  5  
ATOM 6156  H HG3  . LYS A 1 4  ? 1.784   3.818   -14.431 1.00 0.00 ? 12  LYS A HG3  5  
ATOM 6157  H HD2  . LYS A 1 4  ? 3.001   5.464   -15.427 1.00 0.00 ? 12  LYS A HD2  5  
ATOM 6158  H HD3  . LYS A 1 4  ? 3.086   6.438   -13.959 1.00 0.00 ? 12  LYS A HD3  5  
ATOM 6159  H HE2  . LYS A 1 4  ? 4.674   4.733   -13.032 1.00 0.00 ? 12  LYS A HE2  5  
ATOM 6160  H HE3  . LYS A 1 4  ? 4.696   3.980   -14.627 1.00 0.00 ? 12  LYS A HE3  5  
ATOM 6161  H HZ1  . LYS A 1 4  ? 5.334   6.844   -14.290 1.00 0.00 ? 12  LYS A HZ1  5  
ATOM 6162  H HZ2  . LYS A 1 4  ? 5.753   5.806   -15.559 1.00 0.00 ? 12  LYS A HZ2  5  
ATOM 6163  H HZ3  . LYS A 1 4  ? 6.518   5.655   -14.057 1.00 0.00 ? 12  LYS A HZ3  5  
ATOM 6164  N N    . VAL A 1 5  ? 0.709   6.360   -10.138 1.00 0.00 ? 13  VAL A N    5  
ATOM 6165  C CA   . VAL A 1 5  ? 0.438   7.459   -9.222  1.00 0.00 ? 13  VAL A CA   5  
ATOM 6166  C C    . VAL A 1 5  ? 1.705   8.249   -8.913  1.00 0.00 ? 13  VAL A C    5  
ATOM 6167  O O    . VAL A 1 5  ? 2.808   7.704   -8.916  1.00 0.00 ? 13  VAL A O    5  
ATOM 6168  C CB   . VAL A 1 5  ? -0.172  6.954   -7.902  1.00 0.00 ? 13  VAL A CB   5  
ATOM 6169  C CG1  . VAL A 1 5  ? -0.627  8.120   -7.041  1.00 0.00 ? 13  VAL A CG1  5  
ATOM 6170  C CG2  . VAL A 1 5  ? -1.327  6.003   -8.177  1.00 0.00 ? 13  VAL A CG2  5  
ATOM 6171  H H    . VAL A 1 5  ? 1.541   5.851   -10.043 1.00 0.00 ? 13  VAL A H    5  
ATOM 6172  H HA   . VAL A 1 5  ? -0.277  8.118   -9.693  1.00 0.00 ? 13  VAL A HA   5  
ATOM 6173  H HB   . VAL A 1 5  ? 0.590   6.411   -7.361  1.00 0.00 ? 13  VAL A HB   5  
ATOM 6174  H HG11 . VAL A 1 5  ? 0.154   8.376   -6.340  1.00 0.00 ? 13  VAL A HG11 5  
ATOM 6175  H HG12 . VAL A 1 5  ? -1.519  7.840   -6.500  1.00 0.00 ? 13  VAL A HG12 5  
ATOM 6176  H HG13 . VAL A 1 5  ? -0.840  8.971   -7.670  1.00 0.00 ? 13  VAL A HG13 5  
ATOM 6177  H HG21 . VAL A 1 5  ? -0.992  5.208   -8.827  1.00 0.00 ? 13  VAL A HG21 5  
ATOM 6178  H HG22 . VAL A 1 5  ? -2.131  6.542   -8.654  1.00 0.00 ? 13  VAL A HG22 5  
ATOM 6179  H HG23 . VAL A 1 5  ? -1.677  5.582   -7.245  1.00 0.00 ? 13  VAL A HG23 5  
ATOM 6180  N N    . PHE A 1 6  ? 1.535   9.539   -8.641  1.00 0.00 ? 14  PHE A N    5  
ATOM 6181  C CA   . PHE A 1 6  ? 2.659   10.412  -8.324  1.00 0.00 ? 14  PHE A CA   5  
ATOM 6182  C C    . PHE A 1 6  ? 2.404   11.169  -7.024  1.00 0.00 ? 14  PHE A C    5  
ATOM 6183  O O    . PHE A 1 6  ? 1.431   11.914  -6.911  1.00 0.00 ? 14  PHE A O    5  
ATOM 6184  C CB   . PHE A 1 6  ? 2.899   11.404  -9.465  1.00 0.00 ? 14  PHE A CB   5  
ATOM 6185  C CG   . PHE A 1 6  ? 4.290   11.971  -9.492  1.00 0.00 ? 14  PHE A CG   5  
ATOM 6186  C CD1  . PHE A 1 6  ? 4.785   12.680  -8.409  1.00 0.00 ? 14  PHE A CD1  5  
ATOM 6187  C CD2  . PHE A 1 6  ? 5.101   11.797  -10.602 1.00 0.00 ? 14  PHE A CD2  5  
ATOM 6188  C CE1  . PHE A 1 6  ? 6.064   13.203  -8.433  1.00 0.00 ? 14  PHE A CE1  5  
ATOM 6189  C CE2  . PHE A 1 6  ? 6.381   12.319  -10.630 1.00 0.00 ? 14  PHE A CE2  5  
ATOM 6190  C CZ   . PHE A 1 6  ? 6.863   13.023  -9.544  1.00 0.00 ? 14  PHE A CZ   5  
ATOM 6191  H H    . PHE A 1 6  ? 0.629   9.914   -8.651  1.00 0.00 ? 14  PHE A H    5  
ATOM 6192  H HA   . PHE A 1 6  ? 3.538   9.794   -8.204  1.00 0.00 ? 14  PHE A HA   5  
ATOM 6193  H HB2  . PHE A 1 6  ? 2.727   10.905  -10.408 1.00 0.00 ? 14  PHE A HB2  5  
ATOM 6194  H HB3  . PHE A 1 6  ? 2.206   12.226  -9.369  1.00 0.00 ? 14  PHE A HB3  5  
ATOM 6195  H HD1  . PHE A 1 6  ? 4.162   12.822  -7.539  1.00 0.00 ? 14  PHE A HD1  5  
ATOM 6196  H HD2  . PHE A 1 6  ? 4.725   11.248  -11.452 1.00 0.00 ? 14  PHE A HD2  5  
ATOM 6197  H HE1  . PHE A 1 6  ? 6.438   13.754  -7.582  1.00 0.00 ? 14  PHE A HE1  5  
ATOM 6198  H HE2  . PHE A 1 6  ? 7.003   12.176  -11.502 1.00 0.00 ? 14  PHE A HE2  5  
ATOM 6199  H HZ   . PHE A 1 6  ? 7.863   13.431  -9.565  1.00 0.00 ? 14  PHE A HZ   5  
ATOM 6200  N N    . ILE A 1 7  ? 3.281   10.973  -6.045  1.00 0.00 ? 15  ILE A N    5  
ATOM 6201  C CA   . ILE A 1 7  ? 3.143   11.637  -4.755  1.00 0.00 ? 15  ILE A CA   5  
ATOM 6202  C C    . ILE A 1 7  ? 4.229   12.690  -4.561  1.00 0.00 ? 15  ILE A C    5  
ATOM 6203  O O    . ILE A 1 7  ? 5.410   12.363  -4.441  1.00 0.00 ? 15  ILE A O    5  
ATOM 6204  C CB   . ILE A 1 7  ? 3.204   10.628  -3.593  1.00 0.00 ? 15  ILE A CB   5  
ATOM 6205  C CG1  . ILE A 1 7  ? 2.174   9.516   -3.800  1.00 0.00 ? 15  ILE A CG1  5  
ATOM 6206  C CG2  . ILE A 1 7  ? 2.970   11.332  -2.262  1.00 0.00 ? 15  ILE A CG2  5  
ATOM 6207  C CD1  . ILE A 1 7  ? 0.743   10.006  -3.768  1.00 0.00 ? 15  ILE A CD1  5  
ATOM 6208  H H    . ILE A 1 7  ? 4.039   10.365  -6.193  1.00 0.00 ? 15  ILE A H    5  
ATOM 6209  H HA   . ILE A 1 7  ? 2.178   12.123  -4.733  1.00 0.00 ? 15  ILE A HA   5  
ATOM 6210  H HB   . ILE A 1 7  ? 4.193   10.194  -3.572  1.00 0.00 ? 15  ILE A HB   5  
ATOM 6211  H HG12 . ILE A 1 7  ? 2.344   9.050   -4.759  1.00 0.00 ? 15  ILE A HG12 5  
ATOM 6212  H HG13 . ILE A 1 7  ? 2.290   8.777   -3.020  1.00 0.00 ? 15  ILE A HG13 5  
ATOM 6213  H HG21 . ILE A 1 7  ? 2.725   10.602  -1.507  1.00 0.00 ? 15  ILE A HG21 5  
ATOM 6214  H HG22 . ILE A 1 7  ? 2.154   12.033  -2.365  1.00 0.00 ? 15  ILE A HG22 5  
ATOM 6215  H HG23 . ILE A 1 7  ? 3.865   11.863  -1.974  1.00 0.00 ? 15  ILE A HG23 5  
ATOM 6216  H HD11 . ILE A 1 7  ? 0.078   9.168   -3.617  1.00 0.00 ? 15  ILE A HD11 5  
ATOM 6217  H HD12 . ILE A 1 7  ? 0.507   10.488  -4.706  1.00 0.00 ? 15  ILE A HD12 5  
ATOM 6218  H HD13 . ILE A 1 7  ? 0.621   10.714  -2.960  1.00 0.00 ? 15  ILE A HD13 5  
ATOM 6219  N N    . SER A 1 8  ? 3.820   13.954  -4.532  1.00 0.00 ? 16  SER A N    5  
ATOM 6220  C CA   . SER A 1 8  ? 4.756   15.058  -4.352  1.00 0.00 ? 16  SER A CA   5  
ATOM 6221  C C    . SER A 1 8  ? 4.228   16.060  -3.330  1.00 0.00 ? 16  SER A C    5  
ATOM 6222  O O    . SER A 1 8  ? 3.041   16.387  -3.323  1.00 0.00 ? 16  SER A O    5  
ATOM 6223  C CB   . SER A 1 8  ? 5.013   15.760  -5.687  1.00 0.00 ? 16  SER A CB   5  
ATOM 6224  O OG   . SER A 1 8  ? 4.692   14.914  -6.779  1.00 0.00 ? 16  SER A OG   5  
ATOM 6225  H H    . SER A 1 8  ? 2.865   14.151  -4.632  1.00 0.00 ? 16  SER A H    5  
ATOM 6226  H HA   . SER A 1 8  ? 5.685   14.648  -3.987  1.00 0.00 ? 16  SER A HA   5  
ATOM 6227  H HB2  . SER A 1 8  ? 4.405   16.650  -5.747  1.00 0.00 ? 16  SER A HB2  5  
ATOM 6228  H HB3  . SER A 1 8  ? 6.057   16.032  -5.753  1.00 0.00 ? 16  SER A HB3  5  
ATOM 6229  H HG   . SER A 1 8  ? 4.364   15.444  -7.508  1.00 0.00 ? 16  SER A HG   5  
ATOM 6230  N N    . LEU A 1 9  ? 5.117   16.544  -2.470  1.00 0.00 ? 17  LEU A N    5  
ATOM 6231  C CA   . LEU A 1 9  ? 4.741   17.509  -1.442  1.00 0.00 ? 17  LEU A CA   5  
ATOM 6232  C C    . LEU A 1 9  ? 4.493   18.883  -2.055  1.00 0.00 ? 17  LEU A C    5  
ATOM 6233  O O    . LEU A 1 9  ? 5.373   19.457  -2.695  1.00 0.00 ? 17  LEU A O    5  
ATOM 6234  C CB   . LEU A 1 9  ? 5.833   17.598  -0.373  1.00 0.00 ? 17  LEU A CB   5  
ATOM 6235  C CG   . LEU A 1 9  ? 5.483   16.944  0.966   1.00 0.00 ? 17  LEU A CG   5  
ATOM 6236  C CD1  . LEU A 1 9  ? 5.493   15.429  0.838   1.00 0.00 ? 17  LEU A CD1  5  
ATOM 6237  C CD2  . LEU A 1 9  ? 6.451   17.397  2.048   1.00 0.00 ? 17  LEU A CD2  5  
ATOM 6238  H H    . LEU A 1 9  ? 6.049   16.243  -2.525  1.00 0.00 ? 17  LEU A H    5  
ATOM 6239  H HA   . LEU A 1 9  ? 3.828   17.161  -0.984  1.00 0.00 ? 17  LEU A HA   5  
ATOM 6240  H HB2  . LEU A 1 9  ? 6.724   17.125  -0.758  1.00 0.00 ? 17  LEU A HB2  5  
ATOM 6241  H HB3  . LEU A 1 9  ? 6.048   18.641  -0.191  1.00 0.00 ? 17  LEU A HB3  5  
ATOM 6242  H HG   . LEU A 1 9  ? 4.487   17.247  1.256   1.00 0.00 ? 17  LEU A HG   5  
ATOM 6243  H HD11 . LEU A 1 9  ? 5.815   14.991  1.771   1.00 0.00 ? 17  LEU A HD11 5  
ATOM 6244  H HD12 . LEU A 1 9  ? 6.173   15.139  0.050   1.00 0.00 ? 17  LEU A HD12 5  
ATOM 6245  H HD13 . LEU A 1 9  ? 4.499   15.081  0.601   1.00 0.00 ? 17  LEU A HD13 5  
ATOM 6246  H HD21 . LEU A 1 9  ? 6.236   16.868  2.966   1.00 0.00 ? 17  LEU A HD21 5  
ATOM 6247  H HD22 . LEU A 1 9  ? 6.340   18.459  2.209   1.00 0.00 ? 17  LEU A HD22 5  
ATOM 6248  H HD23 . LEU A 1 9  ? 7.462   17.181  1.739   1.00 0.00 ? 17  LEU A HD23 5  
ATOM 6249  N N    . VAL A 1 10 ? 3.288   19.408  -1.852  1.00 0.00 ? 18  VAL A N    5  
ATOM 6250  C CA   . VAL A 1 10 ? 2.924   20.715  -2.383  1.00 0.00 ? 18  VAL A CA   5  
ATOM 6251  C C    . VAL A 1 10 ? 3.260   21.823  -1.392  1.00 0.00 ? 18  VAL A C    5  
ATOM 6252  O O    . VAL A 1 10 ? 3.802   22.863  -1.768  1.00 0.00 ? 18  VAL A O    5  
ATOM 6253  C CB   . VAL A 1 10 ? 1.423   20.785  -2.723  1.00 0.00 ? 18  VAL A CB   5  
ATOM 6254  C CG1  . VAL A 1 10 ? 1.100   22.079  -3.456  1.00 0.00 ? 18  VAL A CG1  5  
ATOM 6255  C CG2  . VAL A 1 10 ? 1.006   19.578  -3.551  1.00 0.00 ? 18  VAL A CG2  5  
ATOM 6256  H H    . VAL A 1 10 ? 2.627   18.901  -1.333  1.00 0.00 ? 18  VAL A H    5  
ATOM 6257  H HA   . VAL A 1 10 ? 3.486   20.875  -3.291  1.00 0.00 ? 18  VAL A HA   5  
ATOM 6258  H HB   . VAL A 1 10 ? 0.864   20.771  -1.799  1.00 0.00 ? 18  VAL A HB   5  
ATOM 6259  H HG11 . VAL A 1 10 ? 1.984   22.436  -3.962  1.00 0.00 ? 18  VAL A HG11 5  
ATOM 6260  H HG12 . VAL A 1 10 ? 0.767   22.820  -2.745  1.00 0.00 ? 18  VAL A HG12 5  
ATOM 6261  H HG13 . VAL A 1 10 ? 0.319   21.896  -4.179  1.00 0.00 ? 18  VAL A HG13 5  
ATOM 6262  H HG21 . VAL A 1 10 ? 0.243   19.870  -4.255  1.00 0.00 ? 18  VAL A HG21 5  
ATOM 6263  H HG22 . VAL A 1 10 ? 0.619   18.810  -2.897  1.00 0.00 ? 18  VAL A HG22 5  
ATOM 6264  H HG23 . VAL A 1 10 ? 1.863   19.195  -4.086  1.00 0.00 ? 18  VAL A HG23 5  
ATOM 6265  N N    . GLY A 1 11 ? 2.934   21.596  -0.123  1.00 0.00 ? 19  GLY A N    5  
ATOM 6266  C CA   . GLY A 1 11 ? 3.210   22.584  0.902   1.00 0.00 ? 19  GLY A CA   5  
ATOM 6267  C C    . GLY A 1 11 ? 3.693   21.958  2.195   1.00 0.00 ? 19  GLY A C    5  
ATOM 6268  O O    . GLY A 1 11 ? 4.871   22.060  2.541   1.00 0.00 ? 19  GLY A O    5  
ATOM 6269  H H    . GLY A 1 11 ? 2.505   20.748  0.117   1.00 0.00 ? 19  GLY A H    5  
ATOM 6270  H HA2  . GLY A 1 11 ? 3.968   23.262  0.538   1.00 0.00 ? 19  GLY A HA2  5  
ATOM 6271  H HA3  . GLY A 1 11 ? 2.307   23.141  1.099   1.00 0.00 ? 19  GLY A HA3  5  
ATOM 6272  N N    . SER A 1 12 ? 2.781   21.309  2.913   1.00 0.00 ? 20  SER A N    5  
ATOM 6273  C CA   . SER A 1 12 ? 3.119   20.664  4.176   1.00 0.00 ? 20  SER A CA   5  
ATOM 6274  C C    . SER A 1 12 ? 2.308   19.386  4.367   1.00 0.00 ? 20  SER A C    5  
ATOM 6275  O O    . SER A 1 12 ? 1.975   19.014  5.492   1.00 0.00 ? 20  SER A O    5  
ATOM 6276  C CB   . SER A 1 12 ? 2.870   21.620  5.344   1.00 0.00 ? 20  SER A CB   5  
ATOM 6277  O OG   . SER A 1 12 ? 3.985   22.471  5.552   1.00 0.00 ? 20  SER A OG   5  
ATOM 6278  H H    . SER A 1 12 ? 1.859   21.262  2.583   1.00 0.00 ? 20  SER A H    5  
ATOM 6279  H HA   . SER A 1 12 ? 4.168   20.409  4.147   1.00 0.00 ? 20  SER A HA   5  
ATOM 6280  H HB2  . SER A 1 12 ? 2.004   22.227  5.131   1.00 0.00 ? 20  SER A HB2  5  
ATOM 6281  H HB3  . SER A 1 12 ? 2.698   21.047  6.243   1.00 0.00 ? 20  SER A HB3  5  
ATOM 6282  H HG   . SER A 1 12 ? 4.758   21.942  5.765   1.00 0.00 ? 20  SER A HG   5  
ATOM 6283  N N    . ARG A 1 13 ? 1.994   18.719  3.261   1.00 0.00 ? 21  ARG A N    5  
ATOM 6284  C CA   . ARG A 1 13 ? 1.222   17.483  3.306   1.00 0.00 ? 21  ARG A CA   5  
ATOM 6285  C C    . ARG A 1 13 ? 2.016   16.324  2.715   1.00 0.00 ? 21  ARG A C    5  
ATOM 6286  O O    . ARG A 1 13 ? 2.445   16.376  1.562   1.00 0.00 ? 21  ARG A O    5  
ATOM 6287  C CB   . ARG A 1 13 ? -0.097  17.652  2.550   1.00 0.00 ? 21  ARG A CB   5  
ATOM 6288  C CG   . ARG A 1 13 ? -1.082  16.519  2.783   1.00 0.00 ? 21  ARG A CG   5  
ATOM 6289  C CD   . ARG A 1 13 ? -1.567  16.491  4.224   1.00 0.00 ? 21  ARG A CD   5  
ATOM 6290  N NE   . ARG A 1 13 ? -2.166  17.762  4.625   1.00 0.00 ? 21  ARG A NE   5  
ATOM 6291  C CZ   . ARG A 1 13 ? -3.407  18.129  4.310   1.00 0.00 ? 21  ARG A CZ   5  
ATOM 6292  N NH1  . ARG A 1 13 ? -4.182  17.326  3.591   1.00 0.00 ? 21  ARG A NH1  5  
ATOM 6293  N NH2  . ARG A 1 13 ? -3.873  19.303  4.714   1.00 0.00 ? 21  ARG A NH2  5  
ATOM 6294  H H    . ARG A 1 13 ? 2.289   19.067  2.393   1.00 0.00 ? 21  ARG A H    5  
ATOM 6295  H HA   . ARG A 1 13 ? 1.007   17.264  4.342   1.00 0.00 ? 21  ARG A HA   5  
ATOM 6296  H HB2  . ARG A 1 13 ? -0.563  18.575  2.864   1.00 0.00 ? 21  ARG A HB2  5  
ATOM 6297  H HB3  . ARG A 1 13 ? 0.113   17.707  1.492   1.00 0.00 ? 21  ARG A HB3  5  
ATOM 6298  H HG2  . ARG A 1 13 ? -1.932  16.653  2.130   1.00 0.00 ? 21  ARG A HG2  5  
ATOM 6299  H HG3  . ARG A 1 13 ? -0.595  15.580  2.557   1.00 0.00 ? 21  ARG A HG3  5  
ATOM 6300  H HD2  . ARG A 1 13 ? -2.305  15.709  4.327   1.00 0.00 ? 21  ARG A HD2  5  
ATOM 6301  H HD3  . ARG A 1 13 ? -0.728  16.280  4.869   1.00 0.00 ? 21  ARG A HD3  5  
ATOM 6302  H HE   . ARG A 1 13 ? -1.616  18.373  5.156   1.00 0.00 ? 21  ARG A HE   5  
ATOM 6303  H HH11 . ARG A 1 13 ? -3.838  16.440  3.283   1.00 0.00 ? 21  ARG A HH11 5  
ATOM 6304  H HH12 . ARG A 1 13 ? -5.113  17.608  3.359   1.00 0.00 ? 21  ARG A HH12 5  
ATOM 6305  H HH21 . ARG A 1 13 ? -3.293  19.912  5.256   1.00 0.00 ? 21  ARG A HH21 5  
ATOM 6306  H HH22 . ARG A 1 13 ? -4.804  19.579  4.478   1.00 0.00 ? 21  ARG A HH22 5  
ATOM 6307  N N    . GLY A 1 14 ? 2.207   15.278  3.511   1.00 0.00 ? 22  GLY A N    5  
ATOM 6308  C CA   . GLY A 1 14 ? 2.950   14.120  3.049   1.00 0.00 ? 22  GLY A CA   5  
ATOM 6309  C C    . GLY A 1 14 ? 2.232   13.376  1.940   1.00 0.00 ? 22  GLY A C    5  
ATOM 6310  O O    . GLY A 1 14 ? 2.468   13.631  0.759   1.00 0.00 ? 22  GLY A O    5  
ATOM 6311  H H    . GLY A 1 14 ? 1.842   15.291  4.420   1.00 0.00 ? 22  GLY A H    5  
ATOM 6312  H HA2  . GLY A 1 14 ? 3.912   14.445  2.684   1.00 0.00 ? 22  GLY A HA2  5  
ATOM 6313  H HA3  . GLY A 1 14 ? 3.100   13.447  3.880   1.00 0.00 ? 22  GLY A HA3  5  
ATOM 6314  N N    . LEU A 1 15 ? 1.359   12.450  2.319   1.00 0.00 ? 23  LEU A N    5  
ATOM 6315  C CA   . LEU A 1 15 ? 0.608   11.664  1.351   1.00 0.00 ? 23  LEU A CA   5  
ATOM 6316  C C    . LEU A 1 15 ? -0.871  11.612  1.727   1.00 0.00 ? 23  LEU A C    5  
ATOM 6317  O O    . LEU A 1 15 ? -1.736  11.982  0.934   1.00 0.00 ? 23  LEU A O    5  
ATOM 6318  C CB   . LEU A 1 15 ? 1.188   10.248  1.268   1.00 0.00 ? 23  LEU A CB   5  
ATOM 6319  C CG   . LEU A 1 15 ? 0.271   9.197   0.642   1.00 0.00 ? 23  LEU A CG   5  
ATOM 6320  C CD1  . LEU A 1 15 ? 0.051   9.492   -0.834  1.00 0.00 ? 23  LEU A CD1  5  
ATOM 6321  C CD2  . LEU A 1 15 ? 0.851   7.804   0.830   1.00 0.00 ? 23  LEU A CD2  5  
ATOM 6322  H H    . LEU A 1 15 ? 1.216   12.288  3.274   1.00 0.00 ? 23  LEU A H    5  
ATOM 6323  H HA   . LEU A 1 15 ? 0.707   12.142  0.387   1.00 0.00 ? 23  LEU A HA   5  
ATOM 6324  H HB2  . LEU A 1 15 ? 2.099   10.291  0.688   1.00 0.00 ? 23  LEU A HB2  5  
ATOM 6325  H HB3  . LEU A 1 15 ? 1.433   9.927   2.267   1.00 0.00 ? 23  LEU A HB3  5  
ATOM 6326  H HG   . LEU A 1 15 ? -0.688  9.232   1.136   1.00 0.00 ? 23  LEU A HG   5  
ATOM 6327  H HD11 . LEU A 1 15 ? -0.360  10.484  -0.946  1.00 0.00 ? 23  LEU A HD11 5  
ATOM 6328  H HD12 . LEU A 1 15 ? -0.637  8.768   -1.247  1.00 0.00 ? 23  LEU A HD12 5  
ATOM 6329  H HD13 . LEU A 1 15 ? 0.994   9.432   -1.358  1.00 0.00 ? 23  LEU A HD13 5  
ATOM 6330  H HD21 . LEU A 1 15 ? 0.645   7.462   1.833   1.00 0.00 ? 23  LEU A HD21 5  
ATOM 6331  H HD22 . LEU A 1 15 ? 1.919   7.835   0.673   1.00 0.00 ? 23  LEU A HD22 5  
ATOM 6332  H HD23 . LEU A 1 15 ? 0.401   7.128   0.119   1.00 0.00 ? 23  LEU A HD23 5  
ATOM 6333  N N    . GLY A 1 16 ? -1.153  11.148  2.939   1.00 0.00 ? 24  GLY A N    5  
ATOM 6334  C CA   . GLY A 1 16 ? -2.526  11.053  3.396   1.00 0.00 ? 24  GLY A CA   5  
ATOM 6335  C C    . GLY A 1 16 ? -3.078  9.645   3.283   1.00 0.00 ? 24  GLY A C    5  
ATOM 6336  O O    . GLY A 1 16 ? -4.282  9.455   3.117   1.00 0.00 ? 24  GLY A O    5  
ATOM 6337  H H    . GLY A 1 16 ? -0.422  10.864  3.528   1.00 0.00 ? 24  GLY A H    5  
ATOM 6338  H HA2  . GLY A 1 16 ? -2.577  11.371  4.426   1.00 0.00 ? 24  GLY A HA2  5  
ATOM 6339  H HA3  . GLY A 1 16 ? -3.136  11.711  2.799   1.00 0.00 ? 24  GLY A HA3  5  
ATOM 6340  N N    . CYS A 1 17 ? -2.193  8.659   3.364   1.00 0.00 ? 25  CYS A N    5  
ATOM 6341  C CA   . CYS A 1 17 ? -2.598  7.262   3.260   1.00 0.00 ? 25  CYS A CA   5  
ATOM 6342  C C    . CYS A 1 17 ? -1.606  6.355   3.983   1.00 0.00 ? 25  CYS A C    5  
ATOM 6343  O O    . CYS A 1 17 ? -0.458  6.737   4.220   1.00 0.00 ? 25  CYS A O    5  
ATOM 6344  C CB   . CYS A 1 17 ? -2.715  6.864   1.785   1.00 0.00 ? 25  CYS A CB   5  
ATOM 6345  S SG   . CYS A 1 17 ? -3.047  5.108   1.498   1.00 0.00 ? 25  CYS A SG   5  
ATOM 6346  H H    . CYS A 1 17 ? -1.246  8.874   3.489   1.00 0.00 ? 25  CYS A H    5  
ATOM 6347  H HA   . CYS A 1 17 ? -3.565  7.162   3.727   1.00 0.00 ? 25  CYS A HA   5  
ATOM 6348  H HB2  . CYS A 1 17 ? -3.521  7.424   1.338   1.00 0.00 ? 25  CYS A HB2  5  
ATOM 6349  H HB3  . CYS A 1 17 ? -1.792  7.110   1.283   1.00 0.00 ? 25  CYS A HB3  5  
ATOM 6350  H HG   . CYS A 1 17 ? -3.610  5.038   0.723   1.00 0.00 ? 25  CYS A HG   5  
ATOM 6351  N N    . SER A 1 18 ? -2.055  5.155   4.330   1.00 0.00 ? 26  SER A N    5  
ATOM 6352  C CA   . SER A 1 18 ? -1.212  4.191   5.025   1.00 0.00 ? 26  SER A CA   5  
ATOM 6353  C C    . SER A 1 18 ? -0.955  2.974   4.144   1.00 0.00 ? 26  SER A C    5  
ATOM 6354  O O    . SER A 1 18 ? -1.524  2.853   3.061   1.00 0.00 ? 26  SER A O    5  
ATOM 6355  C CB   . SER A 1 18 ? -1.872  3.757   6.334   1.00 0.00 ? 26  SER A CB   5  
ATOM 6356  O OG   . SER A 1 18 ? -1.795  4.781   7.310   1.00 0.00 ? 26  SER A OG   5  
ATOM 6357  H H    . SER A 1 18 ? -2.980  4.909   4.115   1.00 0.00 ? 26  SER A H    5  
ATOM 6358  H HA   . SER A 1 18 ? -0.268  4.670   5.245   1.00 0.00 ? 26  SER A HA   5  
ATOM 6359  H HB2  . SER A 1 18 ? -2.912  3.530   6.152   1.00 0.00 ? 26  SER A HB2  5  
ATOM 6360  H HB3  . SER A 1 18 ? -1.373  2.877   6.712   1.00 0.00 ? 26  SER A HB3  5  
ATOM 6361  H HG   . SER A 1 18 ? -2.608  4.803   7.818   1.00 0.00 ? 26  SER A HG   5  
ATOM 6362  N N    . ILE A 1 19 ? -0.094  2.077   4.608   1.00 0.00 ? 27  ILE A N    5  
ATOM 6363  C CA   . ILE A 1 19 ? 0.229   0.874   3.852   1.00 0.00 ? 27  ILE A CA   5  
ATOM 6364  C C    . ILE A 1 19 ? 0.249   -0.355  4.753   1.00 0.00 ? 27  ILE A C    5  
ATOM 6365  O O    . ILE A 1 19 ? 0.754   -0.308  5.874   1.00 0.00 ? 27  ILE A O    5  
ATOM 6366  C CB   . ILE A 1 19 ? 1.591   1.001   3.142   1.00 0.00 ? 27  ILE A CB   5  
ATOM 6367  C CG1  . ILE A 1 19 ? 2.679   1.391   4.142   1.00 0.00 ? 27  ILE A CG1  5  
ATOM 6368  C CG2  . ILE A 1 19 ? 1.506   2.021   2.016   1.00 0.00 ? 27  ILE A CG2  5  
ATOM 6369  C CD1  . ILE A 1 19 ? 4.044   1.544   3.510   1.00 0.00 ? 27  ILE A CD1  5  
ATOM 6370  H H    . ILE A 1 19 ? 0.334   2.226   5.478   1.00 0.00 ? 27  ILE A H    5  
ATOM 6371  H HA   . ILE A 1 19 ? -0.533  0.741   3.098   1.00 0.00 ? 27  ILE A HA   5  
ATOM 6372  H HB   . ILE A 1 19 ? 1.835   0.043   2.709   1.00 0.00 ? 27  ILE A HB   5  
ATOM 6373  H HG12 . ILE A 1 19 ? 2.419   2.333   4.600   1.00 0.00 ? 27  ILE A HG12 5  
ATOM 6374  H HG13 . ILE A 1 19 ? 2.748   0.630   4.905   1.00 0.00 ? 27  ILE A HG13 5  
ATOM 6375  H HG21 . ILE A 1 19 ? 2.499   2.235   1.649   1.00 0.00 ? 27  ILE A HG21 5  
ATOM 6376  H HG22 . ILE A 1 19 ? 1.055   2.929   2.386   1.00 0.00 ? 27  ILE A HG22 5  
ATOM 6377  H HG23 . ILE A 1 19 ? 0.905   1.622   1.213   1.00 0.00 ? 27  ILE A HG23 5  
ATOM 6378  H HD11 . ILE A 1 19 ? 4.019   1.165   2.499   1.00 0.00 ? 27  ILE A HD11 5  
ATOM 6379  H HD12 . ILE A 1 19 ? 4.771   0.989   4.084   1.00 0.00 ? 27  ILE A HD12 5  
ATOM 6380  H HD13 . ILE A 1 19 ? 4.320   2.589   3.495   1.00 0.00 ? 27  ILE A HD13 5  
ATOM 6381  N N    . SER A 1 20 ? -0.306  -1.453  4.253   1.00 0.00 ? 28  SER A N    5  
ATOM 6382  C CA   . SER A 1 20 ? -0.358  -2.699  5.010   1.00 0.00 ? 28  SER A CA   5  
ATOM 6383  C C    . SER A 1 20 ? 0.454   -3.788  4.318   1.00 0.00 ? 28  SER A C    5  
ATOM 6384  O O    . SER A 1 20 ? 0.762   -3.687  3.131   1.00 0.00 ? 28  SER A O    5  
ATOM 6385  C CB   . SER A 1 20 ? -1.808  -3.158  5.179   1.00 0.00 ? 28  SER A CB   5  
ATOM 6386  O OG   . SER A 1 20 ? -2.451  -3.292  3.924   1.00 0.00 ? 28  SER A OG   5  
ATOM 6387  H H    . SER A 1 20 ? -0.693  -1.425  3.353   1.00 0.00 ? 28  SER A H    5  
ATOM 6388  H HA   . SER A 1 20 ? 0.067   -2.513  5.984   1.00 0.00 ? 28  SER A HA   5  
ATOM 6389  H HB2  . SER A 1 20 ? -1.824  -4.113  5.682   1.00 0.00 ? 28  SER A HB2  5  
ATOM 6390  H HB3  . SER A 1 20 ? -2.346  -2.431  5.769   1.00 0.00 ? 28  SER A HB3  5  
ATOM 6391  H HG   . SER A 1 20 ? -2.341  -4.191  3.602   1.00 0.00 ? 28  SER A HG   5  
ATOM 6392  N N    . SER A 1 21 ? 0.798   -4.830  5.067   1.00 0.00 ? 29  SER A N    5  
ATOM 6393  C CA   . SER A 1 21 ? 1.574   -5.937  4.522   1.00 0.00 ? 29  SER A CA   5  
ATOM 6394  C C    . SER A 1 21 ? 0.687   -7.158  4.296   1.00 0.00 ? 29  SER A C    5  
ATOM 6395  O O    . SER A 1 21 ? -0.244  -7.412  5.060   1.00 0.00 ? 29  SER A O    5  
ATOM 6396  C CB   . SER A 1 21 ? 2.727   -6.293  5.463   1.00 0.00 ? 29  SER A CB   5  
ATOM 6397  O OG   . SER A 1 21 ? 3.225   -7.593  5.195   1.00 0.00 ? 29  SER A OG   5  
ATOM 6398  H H    . SER A 1 21 ? 0.523   -4.856  6.007   1.00 0.00 ? 29  SER A H    5  
ATOM 6399  H HA   . SER A 1 21 ? 1.980   -5.621  3.573   1.00 0.00 ? 29  SER A HA   5  
ATOM 6400  H HB2  . SER A 1 21 ? 3.528   -5.582  5.332   1.00 0.00 ? 29  SER A HB2  5  
ATOM 6401  H HB3  . SER A 1 21 ? 2.378   -6.258  6.485   1.00 0.00 ? 29  SER A HB3  5  
ATOM 6402  H HG   . SER A 1 21 ? 4.134   -7.532  4.897   1.00 0.00 ? 29  SER A HG   5  
ATOM 6403  N N    . GLY A 1 22 ? 0.981   -7.906  3.237   1.00 0.00 ? 30  GLY A N    5  
ATOM 6404  C CA   . GLY A 1 22 ? 0.197   -9.087  2.924   1.00 0.00 ? 30  GLY A CA   5  
ATOM 6405  C C    . GLY A 1 22 ? 0.758   -10.347 3.556   1.00 0.00 ? 30  GLY A C    5  
ATOM 6406  O O    . GLY A 1 22 ? 1.853   -10.326 4.119   1.00 0.00 ? 30  GLY A O    5  
ATOM 6407  H H    . GLY A 1 22 ? 1.732   -7.652  2.663   1.00 0.00 ? 30  GLY A H    5  
ATOM 6408  H HA2  . GLY A 1 22 ? -0.811  -8.940  3.280   1.00 0.00 ? 30  GLY A HA2  5  
ATOM 6409  H HA3  . GLY A 1 22 ? 0.173   -9.216  1.852   1.00 0.00 ? 30  GLY A HA3  5  
ATOM 6410  N N    . PRO A 1 23 ? 0.025   -11.469 3.473   1.00 0.00 ? 31  PRO A N    5  
ATOM 6411  C CA   . PRO A 1 23 ? 0.464   -12.745 4.046   1.00 0.00 ? 31  PRO A CA   5  
ATOM 6412  C C    . PRO A 1 23 ? 1.620   -13.364 3.268   1.00 0.00 ? 31  PRO A C    5  
ATOM 6413  O O    . PRO A 1 23 ? 2.249   -12.705 2.439   1.00 0.00 ? 31  PRO A O    5  
ATOM 6414  C CB   . PRO A 1 23 ? -0.783  -13.626 3.944   1.00 0.00 ? 31  PRO A CB   5  
ATOM 6415  C CG   . PRO A 1 23 ? -1.552  -13.063 2.802   1.00 0.00 ? 31  PRO A CG   5  
ATOM 6416  C CD   . PRO A 1 23 ? -1.292  -11.580 2.818   1.00 0.00 ? 31  PRO A CD   5  
ATOM 6417  H HA   . PRO A 1 23 ? 0.748   -12.636 5.083   1.00 0.00 ? 31  PRO A HA   5  
ATOM 6418  H HB2  . PRO A 1 23 ? -0.491  -14.650 3.758   1.00 0.00 ? 31  PRO A HB2  5  
ATOM 6419  H HB3  . PRO A 1 23 ? -1.344  -13.568 4.865   1.00 0.00 ? 31  PRO A HB3  5  
ATOM 6420  H HG2  . PRO A 1 23 ? -1.204  -13.494 1.874   1.00 0.00 ? 31  PRO A HG2  5  
ATOM 6421  H HG3  . PRO A 1 23 ? -2.606  -13.259 2.936   1.00 0.00 ? 31  PRO A HG3  5  
ATOM 6422  H HD2  . PRO A 1 23 ? -1.257  -11.194 1.811   1.00 0.00 ? 31  PRO A HD2  5  
ATOM 6423  H HD3  . PRO A 1 23 ? -2.053  -11.071 3.393   1.00 0.00 ? 31  PRO A HD3  5  
ATOM 6424  N N    . ILE A 1 24 ? 1.894   -14.635 3.541   1.00 0.00 ? 32  ILE A N    5  
ATOM 6425  C CA   . ILE A 1 24 ? 2.973   -15.351 2.870   1.00 0.00 ? 32  ILE A CA   5  
ATOM 6426  C C    . ILE A 1 24 ? 2.564   -15.771 1.462   1.00 0.00 ? 32  ILE A C    5  
ATOM 6427  O O    . ILE A 1 24 ? 3.413   -15.959 0.590   1.00 0.00 ? 32  ILE A O    5  
ATOM 6428  C CB   . ILE A 1 24 ? 3.390   -16.602 3.670   1.00 0.00 ? 32  ILE A CB   5  
ATOM 6429  C CG1  . ILE A 1 24 ? 3.793   -16.213 5.094   1.00 0.00 ? 32  ILE A CG1  5  
ATOM 6430  C CG2  . ILE A 1 24 ? 4.532   -17.329 2.970   1.00 0.00 ? 32  ILE A CG2  5  
ATOM 6431  C CD1  . ILE A 1 24 ? 3.561   -17.310 6.109   1.00 0.00 ? 32  ILE A CD1  5  
ATOM 6432  H H    . ILE A 1 24 ? 1.355   -15.104 4.211   1.00 0.00 ? 32  ILE A H    5  
ATOM 6433  H HA   . ILE A 1 24 ? 3.824   -14.688 2.807   1.00 0.00 ? 32  ILE A HA   5  
ATOM 6434  H HB   . ILE A 1 24 ? 2.546   -17.271 3.714   1.00 0.00 ? 32  ILE A HB   5  
ATOM 6435  H HG12 . ILE A 1 24 ? 4.845   -15.966 5.108   1.00 0.00 ? 32  ILE A HG12 5  
ATOM 6436  H HG13 . ILE A 1 24 ? 3.221   -15.350 5.399   1.00 0.00 ? 32  ILE A HG13 5  
ATOM 6437  H HG21 . ILE A 1 24 ? 5.230   -17.698 3.707   1.00 0.00 ? 32  ILE A HG21 5  
ATOM 6438  H HG22 . ILE A 1 24 ? 5.038   -16.646 2.305   1.00 0.00 ? 32  ILE A HG22 5  
ATOM 6439  H HG23 . ILE A 1 24 ? 4.136   -18.156 2.402   1.00 0.00 ? 32  ILE A HG23 5  
ATOM 6440  H HD11 . ILE A 1 24 ? 2.531   -17.630 6.063   1.00 0.00 ? 32  ILE A HD11 5  
ATOM 6441  H HD12 . ILE A 1 24 ? 3.781   -16.937 7.098   1.00 0.00 ? 32  ILE A HD12 5  
ATOM 6442  H HD13 . ILE A 1 24 ? 4.207   -18.147 5.889   1.00 0.00 ? 32  ILE A HD13 5  
ATOM 6443  N N    . GLN A 1 25 ? 1.263   -15.921 1.247   1.00 0.00 ? 33  GLN A N    5  
ATOM 6444  C CA   . GLN A 1 25 ? 0.746   -16.326 -0.054  1.00 0.00 ? 33  GLN A CA   5  
ATOM 6445  C C    . GLN A 1 25 ? 0.956   -15.231 -1.097  1.00 0.00 ? 33  GLN A C    5  
ATOM 6446  O O    . GLN A 1 25 ? 1.083   -15.514 -2.288  1.00 0.00 ? 33  GLN A O    5  
ATOM 6447  C CB   . GLN A 1 25 ? -0.741  -16.667 0.052   1.00 0.00 ? 33  GLN A CB   5  
ATOM 6448  C CG   . GLN A 1 25 ? -1.059  -17.640 1.177   1.00 0.00 ? 33  GLN A CG   5  
ATOM 6449  C CD   . GLN A 1 25 ? -0.498  -19.026 0.925   1.00 0.00 ? 33  GLN A CD   5  
ATOM 6450  O OE1  . GLN A 1 25 ? -0.745  -19.629 -0.118  1.00 0.00 ? 33  GLN A OE1  5  
ATOM 6451  N NE2  . GLN A 1 25 ? 0.264   -19.539 1.886   1.00 0.00 ? 33  GLN A NE2  5  
ATOM 6452  H H    . GLN A 1 25 ? 0.634   -15.761 1.981   1.00 0.00 ? 33  GLN A H    5  
ATOM 6453  H HA   . GLN A 1 25 ? 1.285   -17.207 -0.364  1.00 0.00 ? 33  GLN A HA   5  
ATOM 6454  H HB2  . GLN A 1 25 ? -1.297  -15.758 0.223   1.00 0.00 ? 33  GLN A HB2  5  
ATOM 6455  H HB3  . GLN A 1 25 ? -1.066  -17.110 -0.879  1.00 0.00 ? 33  GLN A HB3  5  
ATOM 6456  H HG2  . GLN A 1 25 ? -0.636  -17.259 2.095   1.00 0.00 ? 33  GLN A HG2  5  
ATOM 6457  H HG3  . GLN A 1 25 ? -2.131  -17.716 1.278   1.00 0.00 ? 33  GLN A HG3  5  
ATOM 6458  H HE21 . GLN A 1 25 ? 0.416   -19.000 2.691   1.00 0.00 ? 33  GLN A HE21 5  
ATOM 6459  H HE22 . GLN A 1 25 ? 0.639   -20.433 1.750   1.00 0.00 ? 33  GLN A HE22 5  
ATOM 6460  N N    . LYS A 1 26 ? 0.993   -13.981 -0.644  1.00 0.00 ? 34  LYS A N    5  
ATOM 6461  C CA   . LYS A 1 26 ? 1.190   -12.851 -1.544  1.00 0.00 ? 34  LYS A CA   5  
ATOM 6462  C C    . LYS A 1 26 ? 1.744   -11.639 -0.797  1.00 0.00 ? 34  LYS A C    5  
ATOM 6463  O O    . LYS A 1 26 ? 1.077   -10.612 -0.682  1.00 0.00 ? 34  LYS A O    5  
ATOM 6464  C CB   . LYS A 1 26 ? -0.129  -12.487 -2.232  1.00 0.00 ? 34  LYS A CB   5  
ATOM 6465  C CG   . LYS A 1 26 ? 0.039   -12.058 -3.681  1.00 0.00 ? 34  LYS A CG   5  
ATOM 6466  C CD   . LYS A 1 26 ? -1.223  -12.314 -4.486  1.00 0.00 ? 34  LYS A CD   5  
ATOM 6467  C CE   . LYS A 1 26 ? -1.277  -11.438 -5.728  1.00 0.00 ? 34  LYS A CE   5  
ATOM 6468  N NZ   . LYS A 1 26 ? -0.360  -11.930 -6.794  1.00 0.00 ? 34  LYS A NZ   5  
ATOM 6469  H H    . LYS A 1 26 ? 0.887   -13.816 0.316   1.00 0.00 ? 34  LYS A H    5  
ATOM 6470  H HA   . LYS A 1 26 ? 1.906   -13.151 -2.297  1.00 0.00 ? 34  LYS A HA   5  
ATOM 6471  H HB2  . LYS A 1 26 ? -0.782  -13.345 -2.207  1.00 0.00 ? 34  LYS A HB2  5  
ATOM 6472  H HB3  . LYS A 1 26 ? -0.592  -11.677 -1.690  1.00 0.00 ? 34  LYS A HB3  5  
ATOM 6473  H HG2  . LYS A 1 26 ? 0.266   -11.003 -3.709  1.00 0.00 ? 34  LYS A HG2  5  
ATOM 6474  H HG3  . LYS A 1 26 ? 0.854   -12.615 -4.118  1.00 0.00 ? 34  LYS A HG3  5  
ATOM 6475  H HD2  . LYS A 1 26 ? -1.243  -13.350 -4.788  1.00 0.00 ? 34  LYS A HD2  5  
ATOM 6476  H HD3  . LYS A 1 26 ? -2.082  -12.099 -3.869  1.00 0.00 ? 34  LYS A HD3  5  
ATOM 6477  H HE2  . LYS A 1 26 ? -2.288  -11.438 -6.108  1.00 0.00 ? 34  LYS A HE2  5  
ATOM 6478  H HE3  . LYS A 1 26 ? -0.993  -10.432 -5.457  1.00 0.00 ? 34  LYS A HE3  5  
ATOM 6479  H HZ1  . LYS A 1 26 ? -0.881  -12.528 -7.467  1.00 0.00 ? 34  LYS A HZ1  5  
ATOM 6480  H HZ2  . LYS A 1 26 ? 0.409   -12.490 -6.374  1.00 0.00 ? 34  LYS A HZ2  5  
ATOM 6481  H HZ3  . LYS A 1 26 ? 0.053   -11.126 -7.308  1.00 0.00 ? 34  LYS A HZ3  5  
ATOM 6482  N N    . PRO A 1 27 ? 2.980   -11.743 -0.277  1.00 0.00 ? 35  PRO A N    5  
ATOM 6483  C CA   . PRO A 1 27 ? 3.622   -10.650 0.460   1.00 0.00 ? 35  PRO A CA   5  
ATOM 6484  C C    . PRO A 1 27 ? 3.881   -9.436  -0.426  1.00 0.00 ? 35  PRO A C    5  
ATOM 6485  O O    . PRO A 1 27 ? 4.189   -9.574  -1.610  1.00 0.00 ? 35  PRO A O    5  
ATOM 6486  C CB   . PRO A 1 27 ? 4.952   -11.253 0.934   1.00 0.00 ? 35  PRO A CB   5  
ATOM 6487  C CG   . PRO A 1 27 ? 4.794   -12.730 0.783   1.00 0.00 ? 35  PRO A CG   5  
ATOM 6488  C CD   . PRO A 1 27 ? 3.848   -12.927 -0.365  1.00 0.00 ? 35  PRO A CD   5  
ATOM 6489  H HA   . PRO A 1 27 ? 3.033   -10.350 1.314   1.00 0.00 ? 35  PRO A HA   5  
ATOM 6490  H HB2  . PRO A 1 27 ? 5.758   -10.880 0.321   1.00 0.00 ? 35  PRO A HB2  5  
ATOM 6491  H HB3  . PRO A 1 27 ? 5.123   -10.982 1.965   1.00 0.00 ? 35  PRO A HB3  5  
ATOM 6492  H HG2  . PRO A 1 27 ? 5.750   -13.181 0.563   1.00 0.00 ? 35  PRO A HG2  5  
ATOM 6493  H HG3  . PRO A 1 27 ? 4.379   -13.150 1.687   1.00 0.00 ? 35  PRO A HG3  5  
ATOM 6494  H HD2  . PRO A 1 27 ? 4.386   -12.944 -1.302  1.00 0.00 ? 35  PRO A HD2  5  
ATOM 6495  H HD3  . PRO A 1 27 ? 3.278   -13.834 -0.236  1.00 0.00 ? 35  PRO A HD3  5  
ATOM 6496  N N    . GLY A 1 28 ? 3.754   -8.247  0.153   1.00 0.00 ? 36  GLY A N    5  
ATOM 6497  C CA   . GLY A 1 28 ? 3.981   -7.030  -0.604  1.00 0.00 ? 36  GLY A CA   5  
ATOM 6498  C C    . GLY A 1 28 ? 3.417   -5.803  0.085   1.00 0.00 ? 36  GLY A C    5  
ATOM 6499  O O    . GLY A 1 28 ? 2.664   -5.916  1.052   1.00 0.00 ? 36  GLY A O    5  
ATOM 6500  H H    . GLY A 1 28 ? 3.508   -8.194  1.101   1.00 0.00 ? 36  GLY A H    5  
ATOM 6501  H HA2  . GLY A 1 28 ? 5.045   -6.896  -0.737  1.00 0.00 ? 36  GLY A HA2  5  
ATOM 6502  H HA3  . GLY A 1 28 ? 3.517   -7.131  -1.574  1.00 0.00 ? 36  GLY A HA3  5  
ATOM 6503  N N    . ILE A 1 29 ? 3.781   -4.627  -0.417  1.00 0.00 ? 37  ILE A N    5  
ATOM 6504  C CA   . ILE A 1 29 ? 3.306   -3.374  0.154   1.00 0.00 ? 37  ILE A CA   5  
ATOM 6505  C C    . ILE A 1 29 ? 1.923   -3.019  -0.379  1.00 0.00 ? 37  ILE A C    5  
ATOM 6506  O O    . ILE A 1 29 ? 1.753   -2.760  -1.570  1.00 0.00 ? 37  ILE A O    5  
ATOM 6507  C CB   . ILE A 1 29 ? 4.277   -2.217  -0.148  1.00 0.00 ? 37  ILE A CB   5  
ATOM 6508  C CG1  . ILE A 1 29 ? 5.714   -2.633  0.169   1.00 0.00 ? 37  ILE A CG1  5  
ATOM 6509  C CG2  . ILE A 1 29 ? 3.890   -0.979  0.647   1.00 0.00 ? 37  ILE A CG2  5  
ATOM 6510  C CD1  . ILE A 1 29 ? 5.902   -3.136  1.584   1.00 0.00 ? 37  ILE A CD1  5  
ATOM 6511  H H    . ILE A 1 29 ? 4.382   -4.604  -1.189  1.00 0.00 ? 37  ILE A H    5  
ATOM 6512  H HA   . ILE A 1 29 ? 3.247   -3.496  1.226   1.00 0.00 ? 37  ILE A HA   5  
ATOM 6513  H HB   . ILE A 1 29 ? 4.201   -1.978  -1.198  1.00 0.00 ? 37  ILE A HB   5  
ATOM 6514  H HG12 . ILE A 1 29 ? 6.009   -3.423  -0.505  1.00 0.00 ? 37  ILE A HG12 5  
ATOM 6515  H HG13 . ILE A 1 29 ? 6.367   -1.784  0.027   1.00 0.00 ? 37  ILE A HG13 5  
ATOM 6516  H HG21 . ILE A 1 29 ? 2.833   -0.791  0.529   1.00 0.00 ? 37  ILE A HG21 5  
ATOM 6517  H HG22 . ILE A 1 29 ? 4.448   -0.128  0.285   1.00 0.00 ? 37  ILE A HG22 5  
ATOM 6518  H HG23 . ILE A 1 29 ? 4.113   -1.139  1.692   1.00 0.00 ? 37  ILE A HG23 5  
ATOM 6519  H HD11 . ILE A 1 29 ? 5.765   -2.321  2.277   1.00 0.00 ? 37  ILE A HD11 5  
ATOM 6520  H HD12 . ILE A 1 29 ? 6.898   -3.539  1.693   1.00 0.00 ? 37  ILE A HD12 5  
ATOM 6521  H HD13 . ILE A 1 29 ? 5.177   -3.909  1.790   1.00 0.00 ? 37  ILE A HD13 5  
ATOM 6522  N N    . PHE A 1 30 ? 0.936   -3.016  0.511   1.00 0.00 ? 38  PHE A N    5  
ATOM 6523  C CA   . PHE A 1 30 ? -0.434  -2.700  0.130   1.00 0.00 ? 38  PHE A CA   5  
ATOM 6524  C C    . PHE A 1 30 ? -0.852  -1.333  0.659   1.00 0.00 ? 38  PHE A C    5  
ATOM 6525  O O    . PHE A 1 30 ? -0.092  -0.669  1.364   1.00 0.00 ? 38  PHE A O    5  
ATOM 6526  C CB   . PHE A 1 30 ? -1.383  -3.785  0.639   1.00 0.00 ? 38  PHE A CB   5  
ATOM 6527  C CG   . PHE A 1 30 ? -1.023  -5.153  0.140   1.00 0.00 ? 38  PHE A CG   5  
ATOM 6528  C CD1  . PHE A 1 30 ? -0.064  -5.912  0.791   1.00 0.00 ? 38  PHE A CD1  5  
ATOM 6529  C CD2  . PHE A 1 30 ? -1.634  -5.678  -0.987  1.00 0.00 ? 38  PHE A CD2  5  
ATOM 6530  C CE1  . PHE A 1 30 ? 0.276   -7.169  0.329   1.00 0.00 ? 38  PHE A CE1  5  
ATOM 6531  C CE2  . PHE A 1 30 ? -1.296  -6.934  -1.455  1.00 0.00 ? 38  PHE A CE2  5  
ATOM 6532  C CZ   . PHE A 1 30 ? -0.340  -7.680  -0.795  1.00 0.00 ? 38  PHE A CZ   5  
ATOM 6533  H H    . PHE A 1 30 ? 1.135   -3.235  1.444   1.00 0.00 ? 38  PHE A H    5  
ATOM 6534  H HA   . PHE A 1 30 ? -0.479  -2.676  -0.946  1.00 0.00 ? 38  PHE A HA   5  
ATOM 6535  H HB2  . PHE A 1 30 ? -1.356  -3.804  1.718   1.00 0.00 ? 38  PHE A HB2  5  
ATOM 6536  H HB3  . PHE A 1 30 ? -2.387  -3.561  0.311   1.00 0.00 ? 38  PHE A HB3  5  
ATOM 6537  H HD1  . PHE A 1 30 ? 0.419   -5.513  1.671   1.00 0.00 ? 38  PHE A HD1  5  
ATOM 6538  H HD2  . PHE A 1 30 ? -2.382  -5.096  -1.503  1.00 0.00 ? 38  PHE A HD2  5  
ATOM 6539  H HE1  . PHE A 1 30 ? 1.025   -7.751  0.846   1.00 0.00 ? 38  PHE A HE1  5  
ATOM 6540  H HE2  . PHE A 1 30 ? -1.781  -7.331  -2.335  1.00 0.00 ? 38  PHE A HE2  5  
ATOM 6541  H HZ   . PHE A 1 30 ? -0.075  -8.661  -1.159  1.00 0.00 ? 38  PHE A HZ   5  
ATOM 6542  N N    . ILE A 1 31 ? -2.060  -0.914  0.299   1.00 0.00 ? 39  ILE A N    5  
ATOM 6543  C CA   . ILE A 1 31 ? -2.575  0.382   0.720   1.00 0.00 ? 39  ILE A CA   5  
ATOM 6544  C C    . ILE A 1 31 ? -3.668  0.237   1.776   1.00 0.00 ? 39  ILE A C    5  
ATOM 6545  O O    . ILE A 1 31 ? -4.542  -0.623  1.675   1.00 0.00 ? 39  ILE A O    5  
ATOM 6546  C CB   . ILE A 1 31 ? -3.128  1.170   -0.491  1.00 0.00 ? 39  ILE A CB   5  
ATOM 6547  C CG1  . ILE A 1 31 ? -1.977  1.661   -1.370  1.00 0.00 ? 39  ILE A CG1  5  
ATOM 6548  C CG2  . ILE A 1 31 ? -3.990  2.341   -0.038  1.00 0.00 ? 39  ILE A CG2  5  
ATOM 6549  C CD1  . ILE A 1 31 ? -1.141  2.744   -0.723  1.00 0.00 ? 39  ILE A CD1  5  
ATOM 6550  H H    . ILE A 1 31 ? -2.612  -1.486  -0.273  1.00 0.00 ? 39  ILE A H    5  
ATOM 6551  H HA   . ILE A 1 31 ? -1.753  0.943   1.140   1.00 0.00 ? 39  ILE A HA   5  
ATOM 6552  H HB   . ILE A 1 31 ? -3.749  0.503   -1.069  1.00 0.00 ? 39  ILE A HB   5  
ATOM 6553  H HG12 . ILE A 1 31 ? -1.324  0.831   -1.597  1.00 0.00 ? 39  ILE A HG12 5  
ATOM 6554  H HG13 . ILE A 1 31 ? -2.379  2.058   -2.291  1.00 0.00 ? 39  ILE A HG13 5  
ATOM 6555  H HG21 . ILE A 1 31 ? -3.751  2.589   0.985   1.00 0.00 ? 39  ILE A HG21 5  
ATOM 6556  H HG22 . ILE A 1 31 ? -5.033  2.067   -0.109  1.00 0.00 ? 39  ILE A HG22 5  
ATOM 6557  H HG23 . ILE A 1 31 ? -3.799  3.196   -0.670  1.00 0.00 ? 39  ILE A HG23 5  
ATOM 6558  H HD11 . ILE A 1 31 ? -0.710  2.367   0.193   1.00 0.00 ? 39  ILE A HD11 5  
ATOM 6559  H HD12 . ILE A 1 31 ? -1.767  3.597   -0.501  1.00 0.00 ? 39  ILE A HD12 5  
ATOM 6560  H HD13 . ILE A 1 31 ? -0.352  3.042   -1.395  1.00 0.00 ? 39  ILE A HD13 5  
ATOM 6561  N N    . SER A 1 32 ? -3.605  1.100   2.783   1.00 0.00 ? 40  SER A N    5  
ATOM 6562  C CA   . SER A 1 32 ? -4.580  1.103   3.866   1.00 0.00 ? 40  SER A CA   5  
ATOM 6563  C C    . SER A 1 32 ? -5.525  2.293   3.726   1.00 0.00 ? 40  SER A C    5  
ATOM 6564  O O    . SER A 1 32 ? -5.533  2.973   2.701   1.00 0.00 ? 40  SER A O    5  
ATOM 6565  C CB   . SER A 1 32 ? -3.868  1.150   5.222   1.00 0.00 ? 40  SER A CB   5  
ATOM 6566  O OG   . SER A 1 32 ? -4.184  0.009   6.001   1.00 0.00 ? 40  SER A OG   5  
ATOM 6567  H H    . SER A 1 32 ? -2.886  1.762   2.793   1.00 0.00 ? 40  SER A H    5  
ATOM 6568  H HA   . SER A 1 32 ? -5.152  0.191   3.800   1.00 0.00 ? 40  SER A HA   5  
ATOM 6569  H HB2  . SER A 1 32 ? -2.800  1.177   5.063   1.00 0.00 ? 40  SER A HB2  5  
ATOM 6570  H HB3  . SER A 1 32 ? -4.176  2.035   5.758   1.00 0.00 ? 40  SER A HB3  5  
ATOM 6571  H HG   . SER A 1 32 ? -4.071  -0.783  5.472   1.00 0.00 ? 40  SER A HG   5  
ATOM 6572  N N    . HIS A 1 33 ? -6.323  2.538   4.763   1.00 0.00 ? 41  HIS A N    5  
ATOM 6573  C CA   . HIS A 1 33 ? -7.274  3.648   4.756   1.00 0.00 ? 41  HIS A CA   5  
ATOM 6574  C C    . HIS A 1 33 ? -6.622  4.936   4.254   1.00 0.00 ? 41  HIS A C    5  
ATOM 6575  O O    . HIS A 1 33 ? -5.421  5.141   4.424   1.00 0.00 ? 41  HIS A O    5  
ATOM 6576  C CB   . HIS A 1 33 ? -7.842  3.867   6.161   1.00 0.00 ? 41  HIS A CB   5  
ATOM 6577  C CG   . HIS A 1 33 ? -9.282  4.275   6.168   1.00 0.00 ? 41  HIS A CG   5  
ATOM 6578  N ND1  . HIS A 1 33 ? -10.276 3.521   6.757   1.00 0.00 ? 41  HIS A ND1  5  
ATOM 6579  C CD2  . HIS A 1 33 ? -9.896  5.366   5.653   1.00 0.00 ? 41  HIS A CD2  5  
ATOM 6580  C CE1  . HIS A 1 33 ? -11.437 4.130   6.603   1.00 0.00 ? 41  HIS A CE1  5  
ATOM 6581  N NE2  . HIS A 1 33 ? -11.234 5.253   5.938   1.00 0.00 ? 41  HIS A NE2  5  
ATOM 6582  H H    . HIS A 1 33 ? -6.268  1.961   5.552   1.00 0.00 ? 41  HIS A H    5  
ATOM 6583  H HA   . HIS A 1 33 ? -8.082  3.385   4.090   1.00 0.00 ? 41  HIS A HA   5  
ATOM 6584  H HB2  . HIS A 1 33 ? -7.755  2.949   6.723   1.00 0.00 ? 41  HIS A HB2  5  
ATOM 6585  H HB3  . HIS A 1 33 ? -7.272  4.641   6.653   1.00 0.00 ? 41  HIS A HB3  5  
ATOM 6586  H HD1  . HIS A 1 33 ? -10.148 2.666   7.218   1.00 0.00 ? 41  HIS A HD1  5  
ATOM 6587  H HD2  . HIS A 1 33 ? -9.420  6.177   5.119   1.00 0.00 ? 41  HIS A HD2  5  
ATOM 6588  H HE1  . HIS A 1 33 ? -12.392 3.773   6.962   1.00 0.00 ? 41  HIS A HE1  5  
ATOM 6589  H HE2  . HIS A 1 33 ? -11.938 5.852   5.612   1.00 0.00 ? 41  HIS A HE2  5  
ATOM 6590  N N    . VAL A 1 34 ? -7.422  5.797   3.634   1.00 0.00 ? 42  VAL A N    5  
ATOM 6591  C CA   . VAL A 1 34 ? -6.926  7.063   3.104   1.00 0.00 ? 42  VAL A CA   5  
ATOM 6592  C C    . VAL A 1 34 ? -7.753  8.236   3.621   1.00 0.00 ? 42  VAL A C    5  
ATOM 6593  O O    . VAL A 1 34 ? -8.905  8.067   4.023   1.00 0.00 ? 42  VAL A O    5  
ATOM 6594  C CB   . VAL A 1 34 ? -6.949  7.072   1.563   1.00 0.00 ? 42  VAL A CB   5  
ATOM 6595  C CG1  . VAL A 1 34 ? -6.290  8.332   1.024   1.00 0.00 ? 42  VAL A CG1  5  
ATOM 6596  C CG2  . VAL A 1 34 ? -6.268  5.827   1.013   1.00 0.00 ? 42  VAL A CG2  5  
ATOM 6597  H H    . VAL A 1 34 ? -8.372  5.575   3.527   1.00 0.00 ? 42  VAL A H    5  
ATOM 6598  H HA   . VAL A 1 34 ? -5.902  7.183   3.431   1.00 0.00 ? 42  VAL A HA   5  
ATOM 6599  H HB   . VAL A 1 34 ? -7.978  7.064   1.239   1.00 0.00 ? 42  VAL A HB   5  
ATOM 6600  H HG11 . VAL A 1 34 ? -6.243  8.281   -0.055  1.00 0.00 ? 42  VAL A HG11 5  
ATOM 6601  H HG12 . VAL A 1 34 ? -5.290  8.416   1.422   1.00 0.00 ? 42  VAL A HG12 5  
ATOM 6602  H HG13 . VAL A 1 34 ? -6.867  9.196   1.317   1.00 0.00 ? 42  VAL A HG13 5  
ATOM 6603  H HG21 . VAL A 1 34 ? -5.626  6.100   0.189   1.00 0.00 ? 42  VAL A HG21 5  
ATOM 6604  H HG22 . VAL A 1 34 ? -7.017  5.129   0.672   1.00 0.00 ? 42  VAL A HG22 5  
ATOM 6605  H HG23 . VAL A 1 34 ? -5.677  5.365   1.791   1.00 0.00 ? 42  VAL A HG23 5  
ATOM 6606  N N    . LYS A 1 35 ? -7.161  9.427   3.604   1.00 0.00 ? 43  LYS A N    5  
ATOM 6607  C CA   . LYS A 1 35 ? -7.846  10.630  4.067   1.00 0.00 ? 43  LYS A CA   5  
ATOM 6608  C C    . LYS A 1 35 ? -7.908  11.683  2.961   1.00 0.00 ? 43  LYS A C    5  
ATOM 6609  O O    . LYS A 1 35 ? -6.957  11.846  2.196   1.00 0.00 ? 43  LYS A O    5  
ATOM 6610  C CB   . LYS A 1 35 ? -7.139  11.206  5.295   1.00 0.00 ? 43  LYS A CB   5  
ATOM 6611  C CG   . LYS A 1 35 ? -5.729  11.698  5.012   1.00 0.00 ? 43  LYS A CG   5  
ATOM 6612  C CD   . LYS A 1 35 ? -5.033  12.155  6.283   1.00 0.00 ? 43  LYS A CD   5  
ATOM 6613  C CE   . LYS A 1 35 ? -3.908  13.131  5.983   1.00 0.00 ? 43  LYS A CE   5  
ATOM 6614  N NZ   . LYS A 1 35 ? -2.737  12.924  6.879   1.00 0.00 ? 43  LYS A NZ   5  
ATOM 6615  H H    . LYS A 1 35 ? -6.242  9.500   3.269   1.00 0.00 ? 43  LYS A H    5  
ATOM 6616  H HA   . LYS A 1 35 ? -8.852  10.351  4.341   1.00 0.00 ? 43  LYS A HA   5  
ATOM 6617  H HB2  . LYS A 1 35 ? -7.717  12.036  5.673   1.00 0.00 ? 43  LYS A HB2  5  
ATOM 6618  H HB3  . LYS A 1 35 ? -7.083  10.442  6.056   1.00 0.00 ? 43  LYS A HB3  5  
ATOM 6619  H HG2  . LYS A 1 35 ? -5.159  10.895  4.571   1.00 0.00 ? 43  LYS A HG2  5  
ATOM 6620  H HG3  . LYS A 1 35 ? -5.779  12.526  4.321   1.00 0.00 ? 43  LYS A HG3  5  
ATOM 6621  H HD2  . LYS A 1 35 ? -5.755  12.640  6.922   1.00 0.00 ? 43  LYS A HD2  5  
ATOM 6622  H HD3  . LYS A 1 35 ? -4.624  11.292  6.788   1.00 0.00 ? 43  LYS A HD3  5  
ATOM 6623  H HE2  . LYS A 1 35 ? -3.593  12.996  4.958   1.00 0.00 ? 43  LYS A HE2  5  
ATOM 6624  H HE3  . LYS A 1 35 ? -4.277  14.139  6.116   1.00 0.00 ? 43  LYS A HE3  5  
ATOM 6625  H HZ1  . LYS A 1 35 ? -2.906  13.379  7.799   1.00 0.00 ? 43  LYS A HZ1  5  
ATOM 6626  H HZ2  . LYS A 1 35 ? -1.882  13.333  6.453   1.00 0.00 ? 43  LYS A HZ2  5  
ATOM 6627  H HZ3  . LYS A 1 35 ? -2.581  11.906  7.032   1.00 0.00 ? 43  LYS A HZ3  5  
ATOM 6628  N N    . PRO A 1 36 ? -9.034  12.412  2.858   1.00 0.00 ? 44  PRO A N    5  
ATOM 6629  C CA   . PRO A 1 36 ? -9.212  13.449  1.835   1.00 0.00 ? 44  PRO A CA   5  
ATOM 6630  C C    . PRO A 1 36 ? -8.397  14.705  2.132   1.00 0.00 ? 44  PRO A C    5  
ATOM 6631  O O    . PRO A 1 36 ? -7.983  14.934  3.267   1.00 0.00 ? 44  PRO A O    5  
ATOM 6632  C CB   . PRO A 1 36 ? -10.709 13.755  1.905   1.00 0.00 ? 44  PRO A CB   5  
ATOM 6633  C CG   . PRO A 1 36 ? -11.091 13.438  3.308   1.00 0.00 ? 44  PRO A CG   5  
ATOM 6634  C CD   . PRO A 1 36 ? -10.221 12.284  3.726   1.00 0.00 ? 44  PRO A CD   5  
ATOM 6635  H HA   . PRO A 1 36 ? -8.961  13.082  0.852   1.00 0.00 ? 44  PRO A HA   5  
ATOM 6636  H HB2  . PRO A 1 36 ? -10.876 14.796  1.672   1.00 0.00 ? 44  PRO A HB2  5  
ATOM 6637  H HB3  . PRO A 1 36 ? -11.238 13.131  1.200   1.00 0.00 ? 44  PRO A HB3  5  
ATOM 6638  H HG2  . PRO A 1 36 ? -10.908 14.294  3.941   1.00 0.00 ? 44  PRO A HG2  5  
ATOM 6639  H HG3  . PRO A 1 36 ? -12.133 13.156  3.349   1.00 0.00 ? 44  PRO A HG3  5  
ATOM 6640  H HD2  . PRO A 1 36 ? -9.948  12.373  4.768   1.00 0.00 ? 44  PRO A HD2  5  
ATOM 6641  H HD3  . PRO A 1 36 ? -10.728 11.345  3.549   1.00 0.00 ? 44  PRO A HD3  5  
ATOM 6642  N N    . GLY A 1 37 ? -8.176  15.515  1.100   1.00 0.00 ? 45  GLY A N    5  
ATOM 6643  C CA   . GLY A 1 37 ? -7.416  16.740  1.269   1.00 0.00 ? 45  GLY A CA   5  
ATOM 6644  C C    . GLY A 1 37 ? -5.916  16.525  1.165   1.00 0.00 ? 45  GLY A C    5  
ATOM 6645  O O    . GLY A 1 37 ? -5.145  17.483  1.185   1.00 0.00 ? 45  GLY A O    5  
ATOM 6646  H H    . GLY A 1 37 ? -8.534  15.281  0.218   1.00 0.00 ? 45  GLY A H    5  
ATOM 6647  H HA2  . GLY A 1 37 ? -7.718  17.444  0.507   1.00 0.00 ? 45  GLY A HA2  5  
ATOM 6648  H HA3  . GLY A 1 37 ? -7.640  17.159  2.239   1.00 0.00 ? 45  GLY A HA3  5  
ATOM 6649  N N    . SER A 1 38 ? -5.500  15.266  1.053   1.00 0.00 ? 46  SER A N    5  
ATOM 6650  C CA   . SER A 1 38 ? -4.084  14.936  0.949   1.00 0.00 ? 46  SER A CA   5  
ATOM 6651  C C    . SER A 1 38 ? -3.710  14.577  -0.486  1.00 0.00 ? 46  SER A C    5  
ATOM 6652  O O    . SER A 1 38 ? -4.477  14.823  -1.418  1.00 0.00 ? 46  SER A O    5  
ATOM 6653  C CB   . SER A 1 38 ? -3.746  13.776  1.881   1.00 0.00 ? 46  SER A CB   5  
ATOM 6654  O OG   . SER A 1 38 ? -4.465  13.874  3.098   1.00 0.00 ? 46  SER A OG   5  
ATOM 6655  H H    . SER A 1 38 ? -6.159  14.542  1.043   1.00 0.00 ? 46  SER A H    5  
ATOM 6656  H HA   . SER A 1 38 ? -3.516  15.803  1.251   1.00 0.00 ? 46  SER A HA   5  
ATOM 6657  H HB2  . SER A 1 38 ? -4.002  12.843  1.400   1.00 0.00 ? 46  SER A HB2  5  
ATOM 6658  H HB3  . SER A 1 38 ? -2.689  13.789  2.100   1.00 0.00 ? 46  SER A HB3  5  
ATOM 6659  H HG   . SER A 1 38 ? -4.013  14.478  3.690   1.00 0.00 ? 46  SER A HG   5  
ATOM 6660  N N    . LEU A 1 39 ? -2.528  13.993  -0.659  1.00 0.00 ? 47  LEU A N    5  
ATOM 6661  C CA   . LEU A 1 39 ? -2.055  13.599  -1.981  1.00 0.00 ? 47  LEU A CA   5  
ATOM 6662  C C    . LEU A 1 39 ? -2.681  12.275  -2.407  1.00 0.00 ? 47  LEU A C    5  
ATOM 6663  O O    . LEU A 1 39 ? -3.106  12.119  -3.551  1.00 0.00 ? 47  LEU A O    5  
ATOM 6664  C CB   . LEU A 1 39 ? -0.528  13.481  -1.992  1.00 0.00 ? 47  LEU A CB   5  
ATOM 6665  C CG   . LEU A 1 39 ? 0.231   14.773  -1.681  1.00 0.00 ? 47  LEU A CG   5  
ATOM 6666  C CD1  . LEU A 1 39 ? -0.305  15.926  -2.516  1.00 0.00 ? 47  LEU A CD1  5  
ATOM 6667  C CD2  . LEU A 1 39 ? 0.140   15.099  -0.197  1.00 0.00 ? 47  LEU A CD2  5  
ATOM 6668  H H    . LEU A 1 39 ? -1.961  13.821  0.123   1.00 0.00 ? 47  LEU A H    5  
ATOM 6669  H HA   . LEU A 1 39 ? -2.353  14.366  -2.680  1.00 0.00 ? 47  LEU A HA   5  
ATOM 6670  H HB2  . LEU A 1 39 ? -0.242  12.736  -1.264  1.00 0.00 ? 47  LEU A HB2  5  
ATOM 6671  H HB3  . LEU A 1 39 ? -0.223  13.138  -2.969  1.00 0.00 ? 47  LEU A HB3  5  
ATOM 6672  H HG   . LEU A 1 39 ? 1.273   14.639  -1.929  1.00 0.00 ? 47  LEU A HG   5  
ATOM 6673  H HD11 . LEU A 1 39 ? -1.341  16.104  -2.265  1.00 0.00 ? 47  LEU A HD11 5  
ATOM 6674  H HD12 . LEU A 1 39 ? -0.226  15.679  -3.565  1.00 0.00 ? 47  LEU A HD12 5  
ATOM 6675  H HD13 . LEU A 1 39 ? 0.272   16.817  -2.312  1.00 0.00 ? 47  LEU A HD13 5  
ATOM 6676  H HD21 . LEU A 1 39 ? -0.847  15.476  0.029   1.00 0.00 ? 47  LEU A HD21 5  
ATOM 6677  H HD22 . LEU A 1 39 ? 0.877   15.848  0.052   1.00 0.00 ? 47  LEU A HD22 5  
ATOM 6678  H HD23 . LEU A 1 39 ? 0.323   14.205  0.379   1.00 0.00 ? 47  LEU A HD23 5  
ATOM 6679  N N    . SER A 1 40 ? -2.732  11.325  -1.478  1.00 0.00 ? 48  SER A N    5  
ATOM 6680  C CA   . SER A 1 40 ? -3.305  10.013  -1.757  1.00 0.00 ? 48  SER A CA   5  
ATOM 6681  C C    . SER A 1 40 ? -4.739  10.139  -2.264  1.00 0.00 ? 48  SER A C    5  
ATOM 6682  O O    . SER A 1 40 ? -5.150  9.429   -3.181  1.00 0.00 ? 48  SER A O    5  
ATOM 6683  C CB   . SER A 1 40 ? -3.272  9.140   -0.500  1.00 0.00 ? 48  SER A CB   5  
ATOM 6684  O OG   . SER A 1 40 ? -3.580  7.794   -0.805  1.00 0.00 ? 48  SER A OG   5  
ATOM 6685  H H    . SER A 1 40 ? -2.373  11.510  -0.584  1.00 0.00 ? 48  SER A H    5  
ATOM 6686  H HA   . SER A 1 40 ? -2.706  9.545   -2.524  1.00 0.00 ? 48  SER A HA   5  
ATOM 6687  H HB2  . SER A 1 40 ? -2.286  9.179   -0.063  1.00 0.00 ? 48  SER A HB2  5  
ATOM 6688  H HB3  . SER A 1 40 ? -3.995  9.510   0.211   1.00 0.00 ? 48  SER A HB3  5  
ATOM 6689  H HG   . SER A 1 40 ? -4.427  7.562   -0.417  1.00 0.00 ? 48  SER A HG   5  
ATOM 6690  N N    . ALA A 1 41 ? -5.496  11.047  -1.660  1.00 0.00 ? 49  ALA A N    5  
ATOM 6691  C CA   . ALA A 1 41 ? -6.883  11.267  -2.050  1.00 0.00 ? 49  ALA A CA   5  
ATOM 6692  C C    . ALA A 1 41 ? -6.973  11.900  -3.434  1.00 0.00 ? 49  ALA A C    5  
ATOM 6693  O O    . ALA A 1 41 ? -7.857  11.567  -4.224  1.00 0.00 ? 49  ALA A O    5  
ATOM 6694  C CB   . ALA A 1 41 ? -7.587  12.142  -1.025  1.00 0.00 ? 49  ALA A CB   5  
ATOM 6695  H H    . ALA A 1 41 ? -5.114  11.584  -0.935  1.00 0.00 ? 49  ALA A H    5  
ATOM 6696  H HA   . ALA A 1 41 ? -7.379  10.308  -2.071  1.00 0.00 ? 49  ALA A HA   5  
ATOM 6697  H HB1  . ALA A 1 41 ? -8.359  12.719  -1.512  1.00 0.00 ? 49  ALA A HB1  5  
ATOM 6698  H HB2  . ALA A 1 41 ? -6.870  12.811  -0.572  1.00 0.00 ? 49  ALA A HB2  5  
ATOM 6699  H HB3  . ALA A 1 41 ? -8.029  11.518  -0.262  1.00 0.00 ? 49  ALA A HB3  5  
ATOM 6700  N N    . GLU A 1 42 ? -6.057  12.818  -3.720  1.00 0.00 ? 50  GLU A N    5  
ATOM 6701  C CA   . GLU A 1 42 ? -6.033  13.503  -5.007  1.00 0.00 ? 50  GLU A CA   5  
ATOM 6702  C C    . GLU A 1 42 ? -5.704  12.534  -6.139  1.00 0.00 ? 50  GLU A C    5  
ATOM 6703  O O    . GLU A 1 42 ? -6.216  12.668  -7.251  1.00 0.00 ? 50  GLU A O    5  
ATOM 6704  C CB   . GLU A 1 42 ? -5.014  14.641  -4.980  1.00 0.00 ? 50  GLU A CB   5  
ATOM 6705  C CG   . GLU A 1 42 ? -5.605  15.980  -4.567  1.00 0.00 ? 50  GLU A CG   5  
ATOM 6706  C CD   . GLU A 1 42 ? -6.644  16.486  -5.549  1.00 0.00 ? 50  GLU A CD   5  
ATOM 6707  O OE1  . GLU A 1 42 ? -6.301  16.664  -6.737  1.00 0.00 ? 50  GLU A OE1  5  
ATOM 6708  O OE2  . GLU A 1 42 ? -7.801  16.702  -5.131  1.00 0.00 ? 50  GLU A OE2  5  
ATOM 6709  H H    . GLU A 1 42 ? -5.380  13.042  -3.047  1.00 0.00 ? 50  GLU A H    5  
ATOM 6710  H HA   . GLU A 1 42 ? -7.016  13.917  -5.178  1.00 0.00 ? 50  GLU A HA   5  
ATOM 6711  H HB2  . GLU A 1 42 ? -4.228  14.390  -4.283  1.00 0.00 ? 50  GLU A HB2  5  
ATOM 6712  H HB3  . GLU A 1 42 ? -4.585  14.750  -5.965  1.00 0.00 ? 50  GLU A HB3  5  
ATOM 6713  H HG2  . GLU A 1 42 ? -6.072  15.870  -3.600  1.00 0.00 ? 50  GLU A HG2  5  
ATOM 6714  H HG3  . GLU A 1 42 ? -4.809  16.706  -4.501  1.00 0.00 ? 50  GLU A HG3  5  
ATOM 6715  N N    . VAL A 1 43 ? -4.846  11.561  -5.851  1.00 0.00 ? 51  VAL A N    5  
ATOM 6716  C CA   . VAL A 1 43 ? -4.449  10.574  -6.849  1.00 0.00 ? 51  VAL A CA   5  
ATOM 6717  C C    . VAL A 1 43 ? -5.518  9.498   -7.027  1.00 0.00 ? 51  VAL A C    5  
ATOM 6718  O O    . VAL A 1 43 ? -5.522  8.776   -8.024  1.00 0.00 ? 51  VAL A O    5  
ATOM 6719  C CB   . VAL A 1 43 ? -3.116  9.898   -6.471  1.00 0.00 ? 51  VAL A CB   5  
ATOM 6720  C CG1  . VAL A 1 43 ? -1.976  10.903  -6.519  1.00 0.00 ? 51  VAL A CG1  5  
ATOM 6721  C CG2  . VAL A 1 43 ? -3.213  9.254   -5.098  1.00 0.00 ? 51  VAL A CG2  5  
ATOM 6722  H H    . VAL A 1 43 ? -4.470  11.505  -4.948  1.00 0.00 ? 51  VAL A H    5  
ATOM 6723  H HA   . VAL A 1 43 ? -4.312  11.089  -7.789  1.00 0.00 ? 51  VAL A HA   5  
ATOM 6724  H HB   . VAL A 1 43 ? -2.912  9.123   -7.197  1.00 0.00 ? 51  VAL A HB   5  
ATOM 6725  H HG11 . VAL A 1 43 ? -1.511  10.875  -7.494  1.00 0.00 ? 51  VAL A HG11 5  
ATOM 6726  H HG12 . VAL A 1 43 ? -1.246  10.656  -5.764  1.00 0.00 ? 51  VAL A HG12 5  
ATOM 6727  H HG13 . VAL A 1 43 ? -2.363  11.895  -6.334  1.00 0.00 ? 51  VAL A HG13 5  
ATOM 6728  H HG21 . VAL A 1 43 ? -3.328  10.022  -4.346  1.00 0.00 ? 51  VAL A HG21 5  
ATOM 6729  H HG22 . VAL A 1 43 ? -2.313  8.691   -4.900  1.00 0.00 ? 51  VAL A HG22 5  
ATOM 6730  H HG23 . VAL A 1 43 ? -4.064  8.592   -5.070  1.00 0.00 ? 51  VAL A HG23 5  
ATOM 6731  N N    . GLY A 1 44 ? -6.424  9.395   -6.058  1.00 0.00 ? 52  GLY A N    5  
ATOM 6732  C CA   . GLY A 1 44 ? -7.480  8.402   -6.135  1.00 0.00 ? 52  GLY A CA   5  
ATOM 6733  C C    . GLY A 1 44 ? -7.080  7.087   -5.497  1.00 0.00 ? 52  GLY A C    5  
ATOM 6734  O O    . GLY A 1 44 ? -7.334  6.016   -6.051  1.00 0.00 ? 52  GLY A O    5  
ATOM 6735  H H    . GLY A 1 44 ? -6.374  9.995   -5.285  1.00 0.00 ? 52  GLY A H    5  
ATOM 6736  H HA2  . GLY A 1 44 ? -8.356  8.783   -5.631  1.00 0.00 ? 52  GLY A HA2  5  
ATOM 6737  H HA3  . GLY A 1 44 ? -7.721  8.228   -7.173  1.00 0.00 ? 52  GLY A HA3  5  
ATOM 6738  N N    . LEU A 1 45 ? -6.449  7.169   -4.332  1.00 0.00 ? 53  LEU A N    5  
ATOM 6739  C CA   . LEU A 1 45 ? -6.007  5.980   -3.614  1.00 0.00 ? 53  LEU A CA   5  
ATOM 6740  C C    . LEU A 1 45 ? -7.099  5.464   -2.682  1.00 0.00 ? 53  LEU A C    5  
ATOM 6741  O O    . LEU A 1 45 ? -7.970  6.219   -2.250  1.00 0.00 ? 53  LEU A O    5  
ATOM 6742  C CB   . LEU A 1 45 ? -4.741  6.291   -2.814  1.00 0.00 ? 53  LEU A CB   5  
ATOM 6743  C CG   . LEU A 1 45 ? -3.427  5.977   -3.531  1.00 0.00 ? 53  LEU A CG   5  
ATOM 6744  C CD1  . LEU A 1 45 ? -2.247  6.560   -2.770  1.00 0.00 ? 53  LEU A CD1  5  
ATOM 6745  C CD2  . LEU A 1 45 ? -3.262  4.476   -3.699  1.00 0.00 ? 53  LEU A CD2  5  
ATOM 6746  H H    . LEU A 1 45 ? -6.275  8.052   -3.944  1.00 0.00 ? 53  LEU A H    5  
ATOM 6747  H HA   . LEU A 1 45 ? -5.781  5.216   -4.342  1.00 0.00 ? 53  LEU A HA   5  
ATOM 6748  H HB2  . LEU A 1 45 ? -4.749  7.342   -2.566  1.00 0.00 ? 53  LEU A HB2  5  
ATOM 6749  H HB3  . LEU A 1 45 ? -4.768  5.721   -1.896  1.00 0.00 ? 53  LEU A HB3  5  
ATOM 6750  H HG   . LEU A 1 45 ? -3.446  6.426   -4.515  1.00 0.00 ? 53  LEU A HG   5  
ATOM 6751  H HD11 . LEU A 1 45 ? -1.326  6.231   -3.227  1.00 0.00 ? 53  LEU A HD11 5  
ATOM 6752  H HD12 . LEU A 1 45 ? -2.281  6.227   -1.744  1.00 0.00 ? 53  LEU A HD12 5  
ATOM 6753  H HD13 . LEU A 1 45 ? -2.298  7.638   -2.798  1.00 0.00 ? 53  LEU A HD13 5  
ATOM 6754  H HD21 . LEU A 1 45 ? -2.658  4.089   -2.892  1.00 0.00 ? 53  LEU A HD21 5  
ATOM 6755  H HD22 . LEU A 1 45 ? -2.779  4.270   -4.641  1.00 0.00 ? 53  LEU A HD22 5  
ATOM 6756  H HD23 . LEU A 1 45 ? -4.233  4.004   -3.680  1.00 0.00 ? 53  LEU A HD23 5  
ATOM 6757  N N    . GLU A 1 46 ? -7.046  4.172   -2.379  1.00 0.00 ? 54  GLU A N    5  
ATOM 6758  C CA   . GLU A 1 46 ? -8.028  3.548   -1.500  1.00 0.00 ? 54  GLU A CA   5  
ATOM 6759  C C    . GLU A 1 46 ? -7.563  2.163   -1.068  1.00 0.00 ? 54  GLU A C    5  
ATOM 6760  O O    . GLU A 1 46 ? -6.694  1.566   -1.704  1.00 0.00 ? 54  GLU A O    5  
ATOM 6761  C CB   . GLU A 1 46 ? -9.385  3.447   -2.203  1.00 0.00 ? 54  GLU A CB   5  
ATOM 6762  C CG   . GLU A 1 46 ? -10.245 4.691   -2.048  1.00 0.00 ? 54  GLU A CG   5  
ATOM 6763  C CD   . GLU A 1 46 ? -10.378 5.474   -3.340  1.00 0.00 ? 54  GLU A CD   5  
ATOM 6764  O OE1  . GLU A 1 46 ? -10.687 4.855   -4.379  1.00 0.00 ? 54  GLU A OE1  5  
ATOM 6765  O OE2  . GLU A 1 46 ? -10.172 6.705   -3.311  1.00 0.00 ? 54  GLU A OE2  5  
ATOM 6766  H H    . GLU A 1 46 ? -6.328  3.623   -2.755  1.00 0.00 ? 54  GLU A H    5  
ATOM 6767  H HA   . GLU A 1 46 ? -8.133  4.170   -0.624  1.00 0.00 ? 54  GLU A HA   5  
ATOM 6768  H HB2  . GLU A 1 46 ? -9.217  3.280   -3.257  1.00 0.00 ? 54  GLU A HB2  5  
ATOM 6769  H HB3  . GLU A 1 46 ? -9.926  2.607   -1.796  1.00 0.00 ? 54  GLU A HB3  5  
ATOM 6770  H HG2  . GLU A 1 46 ? -11.231 4.391   -1.724  1.00 0.00 ? 54  GLU A HG2  5  
ATOM 6771  H HG3  . GLU A 1 46 ? -9.800  5.330   -1.301  1.00 0.00 ? 54  GLU A HG3  5  
ATOM 6772  N N    . ILE A 1 47 ? -8.147  1.652   0.013   1.00 0.00 ? 55  ILE A N    5  
ATOM 6773  C CA   . ILE A 1 47 ? -7.787  0.332   0.519   1.00 0.00 ? 55  ILE A CA   5  
ATOM 6774  C C    . ILE A 1 47 ? -7.955  -0.729  -0.564  1.00 0.00 ? 55  ILE A C    5  
ATOM 6775  O O    . ILE A 1 47 ? -8.810  -0.604  -1.440  1.00 0.00 ? 55  ILE A O    5  
ATOM 6776  C CB   . ILE A 1 47 ? -8.637  -0.056  1.746   1.00 0.00 ? 55  ILE A CB   5  
ATOM 6777  C CG1  . ILE A 1 47 ? -8.580  1.046   2.805   1.00 0.00 ? 55  ILE A CG1  5  
ATOM 6778  C CG2  . ILE A 1 47 ? -8.162  -1.381  2.325   1.00 0.00 ? 55  ILE A CG2  5  
ATOM 6779  C CD1  . ILE A 1 47 ? -9.918  1.336   3.451   1.00 0.00 ? 55  ILE A CD1  5  
ATOM 6780  H H    . ILE A 1 47 ? -8.834  2.173   0.476   1.00 0.00 ? 55  ILE A H    5  
ATOM 6781  H HA   . ILE A 1 47 ? -6.750  0.363   0.821   1.00 0.00 ? 55  ILE A HA   5  
ATOM 6782  H HB   . ILE A 1 47 ? -9.661  -0.180  1.420   1.00 0.00 ? 55  ILE A HB   5  
ATOM 6783  H HG12 . ILE A 1 47 ? -7.894  0.752   3.585   1.00 0.00 ? 55  ILE A HG12 5  
ATOM 6784  H HG13 . ILE A 1 47 ? -8.226  1.959   2.349   1.00 0.00 ? 55  ILE A HG13 5  
ATOM 6785  H HG21 . ILE A 1 47 ? -8.803  -1.664  3.149   1.00 0.00 ? 55  ILE A HG21 5  
ATOM 6786  H HG22 . ILE A 1 47 ? -7.147  -1.277  2.678   1.00 0.00 ? 55  ILE A HG22 5  
ATOM 6787  H HG23 . ILE A 1 47 ? -8.202  -2.144  1.561   1.00 0.00 ? 55  ILE A HG23 5  
ATOM 6788  H HD11 . ILE A 1 47 ? -10.711 0.986   2.807   1.00 0.00 ? 55  ILE A HD11 5  
ATOM 6789  H HD12 . ILE A 1 47 ? -10.021 2.401   3.602   1.00 0.00 ? 55  ILE A HD12 5  
ATOM 6790  H HD13 . ILE A 1 47 ? -9.977  0.829   4.402   1.00 0.00 ? 55  ILE A HD13 5  
ATOM 6791  N N    . GLY A 1 48 ? -7.131  -1.767  -0.502  1.00 0.00 ? 56  GLY A N    5  
ATOM 6792  C CA   . GLY A 1 48 ? -7.203  -2.828  -1.489  1.00 0.00 ? 56  GLY A CA   5  
ATOM 6793  C C    . GLY A 1 48 ? -6.123  -2.705  -2.545  1.00 0.00 ? 56  GLY A C    5  
ATOM 6794  O O    . GLY A 1 48 ? -5.751  -3.689  -3.182  1.00 0.00 ? 56  GLY A O    5  
ATOM 6795  H H    . GLY A 1 48 ? -6.464  -1.812  0.216   1.00 0.00 ? 56  GLY A H    5  
ATOM 6796  H HA2  . GLY A 1 48 ? -7.098  -3.779  -0.990  1.00 0.00 ? 56  GLY A HA2  5  
ATOM 6797  H HA3  . GLY A 1 48 ? -8.168  -2.790  -1.971  1.00 0.00 ? 56  GLY A HA3  5  
ATOM 6798  N N    . ASP A 1 49 ? -5.614  -1.491  -2.728  1.00 0.00 ? 57  ASP A N    5  
ATOM 6799  C CA   . ASP A 1 49 ? -4.567  -1.240  -3.708  1.00 0.00 ? 57  ASP A CA   5  
ATOM 6800  C C    . ASP A 1 49 ? -3.240  -1.828  -3.238  1.00 0.00 ? 57  ASP A C    5  
ATOM 6801  O O    . ASP A 1 49 ? -3.096  -2.203  -2.074  1.00 0.00 ? 57  ASP A O    5  
ATOM 6802  C CB   . ASP A 1 49 ? -4.419  0.263   -3.947  1.00 0.00 ? 57  ASP A CB   5  
ATOM 6803  C CG   . ASP A 1 49 ? -5.590  0.844   -4.716  1.00 0.00 ? 57  ASP A CG   5  
ATOM 6804  O OD1  . ASP A 1 49 ? -5.855  0.369   -5.841  1.00 0.00 ? 57  ASP A OD1  5  
ATOM 6805  O OD2  . ASP A 1 49 ? -6.243  1.772   -4.195  1.00 0.00 ? 57  ASP A OD2  5  
ATOM 6806  H H    . ASP A 1 49 ? -5.949  -0.745  -2.187  1.00 0.00 ? 57  ASP A H    5  
ATOM 6807  H HA   . ASP A 1 49 ? -4.854  -1.718  -4.634  1.00 0.00 ? 57  ASP A HA   5  
ATOM 6808  H HB2  . ASP A 1 49 ? -4.353  0.769   -2.995  1.00 0.00 ? 57  ASP A HB2  5  
ATOM 6809  H HB3  . ASP A 1 49 ? -3.518  0.446   -4.508  1.00 0.00 ? 57  ASP A HB3  5  
ATOM 6810  N N    . GLN A 1 50 ? -2.272  -1.912  -4.145  1.00 0.00 ? 58  GLN A N    5  
ATOM 6811  C CA   . GLN A 1 50 ? -0.963  -2.459  -3.808  1.00 0.00 ? 58  GLN A CA   5  
ATOM 6812  C C    . GLN A 1 50 ? 0.129   -1.876  -4.700  1.00 0.00 ? 58  GLN A C    5  
ATOM 6813  O O    . GLN A 1 50 ? 0.106   -2.044  -5.919  1.00 0.00 ? 58  GLN A O    5  
ATOM 6814  C CB   . GLN A 1 50 ? -0.978  -3.984  -3.930  1.00 0.00 ? 58  GLN A CB   5  
ATOM 6815  C CG   . GLN A 1 50 ? 0.336   -4.640  -3.539  1.00 0.00 ? 58  GLN A CG   5  
ATOM 6816  C CD   . GLN A 1 50 ? 0.755   -5.729  -4.508  1.00 0.00 ? 58  GLN A CD   5  
ATOM 6817  O OE1  . GLN A 1 50 ? 0.044   -6.715  -4.697  1.00 0.00 ? 58  GLN A OE1  5  
ATOM 6818  N NE2  . GLN A 1 50 ? 1.917   -5.554  -5.125  1.00 0.00 ? 58  GLN A NE2  5  
ATOM 6819  H H    . GLN A 1 50 ? -2.441  -1.600  -5.060  1.00 0.00 ? 58  GLN A H    5  
ATOM 6820  H HA   . GLN A 1 50 ? -0.751  -2.193  -2.785  1.00 0.00 ? 58  GLN A HA   5  
ATOM 6821  H HB2  . GLN A 1 50 ? -1.755  -4.377  -3.291  1.00 0.00 ? 58  GLN A HB2  5  
ATOM 6822  H HB3  . GLN A 1 50 ? -1.198  -4.250  -4.953  1.00 0.00 ? 58  GLN A HB3  5  
ATOM 6823  H HG2  . GLN A 1 50 ? 1.107   -3.885  -3.514  1.00 0.00 ? 58  GLN A HG2  5  
ATOM 6824  H HG3  . GLN A 1 50 ? 0.228   -5.074  -2.556  1.00 0.00 ? 58  GLN A HG3  5  
ATOM 6825  H HE21 . GLN A 1 50 ? 2.432   -4.744  -4.926  1.00 0.00 ? 58  GLN A HE21 5  
ATOM 6826  H HE22 . GLN A 1 50 ? 2.214   -6.243  -5.757  1.00 0.00 ? 58  GLN A HE22 5  
ATOM 6827  N N    . ILE A 1 51 ? 1.090   -1.199  -4.078  1.00 0.00 ? 59  ILE A N    5  
ATOM 6828  C CA   . ILE A 1 51 ? 2.197   -0.596  -4.811  1.00 0.00 ? 59  ILE A CA   5  
ATOM 6829  C C    . ILE A 1 51 ? 3.118   -1.671  -5.375  1.00 0.00 ? 59  ILE A C    5  
ATOM 6830  O O    . ILE A 1 51 ? 3.718   -2.443  -4.626  1.00 0.00 ? 59  ILE A O    5  
ATOM 6831  C CB   . ILE A 1 51 ? 3.016   0.350   -3.912  1.00 0.00 ? 59  ILE A CB   5  
ATOM 6832  C CG1  . ILE A 1 51 ? 2.087   1.304   -3.155  1.00 0.00 ? 59  ILE A CG1  5  
ATOM 6833  C CG2  . ILE A 1 51 ? 4.027   1.130   -4.740  1.00 0.00 ? 59  ILE A CG2  5  
ATOM 6834  C CD1  . ILE A 1 51 ? 2.002   1.015   -1.672  1.00 0.00 ? 59  ILE A CD1  5  
ATOM 6835  H H    . ILE A 1 51 ? 1.056   -1.106  -3.105  1.00 0.00 ? 59  ILE A H    5  
ATOM 6836  H HA   . ILE A 1 51 ? 1.786   -0.021  -5.628  1.00 0.00 ? 59  ILE A HA   5  
ATOM 6837  H HB   . ILE A 1 51 ? 3.560   -0.250  -3.199  1.00 0.00 ? 59  ILE A HB   5  
ATOM 6838  H HG12 . ILE A 1 51 ? 2.444   2.317   -3.274  1.00 0.00 ? 59  ILE A HG12 5  
ATOM 6839  H HG13 . ILE A 1 51 ? 1.090   1.229   -3.566  1.00 0.00 ? 59  ILE A HG13 5  
ATOM 6840  H HG21 . ILE A 1 51 ? 4.199   0.617   -5.674  1.00 0.00 ? 59  ILE A HG21 5  
ATOM 6841  H HG22 . ILE A 1 51 ? 4.955   1.205   -4.195  1.00 0.00 ? 59  ILE A HG22 5  
ATOM 6842  H HG23 . ILE A 1 51 ? 3.643   2.120   -4.937  1.00 0.00 ? 59  ILE A HG23 5  
ATOM 6843  H HD11 . ILE A 1 51 ? 0.966   0.995   -1.369  1.00 0.00 ? 59  ILE A HD11 5  
ATOM 6844  H HD12 . ILE A 1 51 ? 2.523   1.787   -1.125  1.00 0.00 ? 59  ILE A HD12 5  
ATOM 6845  H HD13 . ILE A 1 51 ? 2.456   0.057   -1.466  1.00 0.00 ? 59  ILE A HD13 5  
ATOM 6846  N N    . VAL A 1 52 ? 3.220   -1.722  -6.698  1.00 0.00 ? 60  VAL A N    5  
ATOM 6847  C CA   . VAL A 1 52 ? 4.059   -2.713  -7.361  1.00 0.00 ? 60  VAL A CA   5  
ATOM 6848  C C    . VAL A 1 52 ? 5.456   -2.170  -7.656  1.00 0.00 ? 60  VAL A C    5  
ATOM 6849  O O    . VAL A 1 52 ? 6.393   -2.937  -7.871  1.00 0.00 ? 60  VAL A O    5  
ATOM 6850  C CB   . VAL A 1 52 ? 3.420   -3.195  -8.677  1.00 0.00 ? 60  VAL A CB   5  
ATOM 6851  C CG1  . VAL A 1 52 ? 2.094   -3.890  -8.403  1.00 0.00 ? 60  VAL A CG1  5  
ATOM 6852  C CG2  . VAL A 1 52 ? 3.233   -2.032  -9.640  1.00 0.00 ? 60  VAL A CG2  5  
ATOM 6853  H H    . VAL A 1 52 ? 2.711   -1.086  -7.242  1.00 0.00 ? 60  VAL A H    5  
ATOM 6854  H HA   . VAL A 1 52 ? 4.150   -3.563  -6.702  1.00 0.00 ? 60  VAL A HA   5  
ATOM 6855  H HB   . VAL A 1 52 ? 4.085   -3.911  -9.136  1.00 0.00 ? 60  VAL A HB   5  
ATOM 6856  H HG11 . VAL A 1 52 ? 1.297   -3.160  -8.404  1.00 0.00 ? 60  VAL A HG11 5  
ATOM 6857  H HG12 . VAL A 1 52 ? 2.133   -4.377  -7.440  1.00 0.00 ? 60  VAL A HG12 5  
ATOM 6858  H HG13 . VAL A 1 52 ? 1.907   -4.625  -9.171  1.00 0.00 ? 60  VAL A HG13 5  
ATOM 6859  H HG21 . VAL A 1 52 ? 4.169   -1.506  -9.754  1.00 0.00 ? 60  VAL A HG21 5  
ATOM 6860  H HG22 . VAL A 1 52 ? 2.485   -1.357  -9.248  1.00 0.00 ? 60  VAL A HG22 5  
ATOM 6861  H HG23 . VAL A 1 52 ? 2.910   -2.408  -10.601 1.00 0.00 ? 60  VAL A HG23 5  
ATOM 6862  N N    . GLU A 1 53 ? 5.594   -0.846  -7.669  1.00 0.00 ? 61  GLU A N    5  
ATOM 6863  C CA   . GLU A 1 53 ? 6.886   -0.225  -7.944  1.00 0.00 ? 61  GLU A CA   5  
ATOM 6864  C C    . GLU A 1 53 ? 6.932   1.213   -7.437  1.00 0.00 ? 61  GLU A C    5  
ATOM 6865  O O    . GLU A 1 53 ? 5.899   1.860   -7.265  1.00 0.00 ? 61  GLU A O    5  
ATOM 6866  C CB   . GLU A 1 53 ? 7.176   -0.256  -9.446  1.00 0.00 ? 61  GLU A CB   5  
ATOM 6867  C CG   . GLU A 1 53 ? 8.647   -0.071  -9.784  1.00 0.00 ? 61  GLU A CG   5  
ATOM 6868  C CD   . GLU A 1 53 ? 8.948   -0.349  -11.244 1.00 0.00 ? 61  GLU A CD   5  
ATOM 6869  O OE1  . GLU A 1 53 ? 8.147   -1.055  -11.892 1.00 0.00 ? 61  GLU A OE1  5  
ATOM 6870  O OE2  . GLU A 1 53 ? 9.984   0.141   -11.739 1.00 0.00 ? 61  GLU A OE2  5  
ATOM 6871  H H    . GLU A 1 53 ? 4.815   -0.277  -7.495  1.00 0.00 ? 61  GLU A H    5  
ATOM 6872  H HA   . GLU A 1 53 ? 7.642   -0.798  -7.431  1.00 0.00 ? 61  GLU A HA   5  
ATOM 6873  H HB2  . GLU A 1 53 ? 6.854   -1.206  -9.844  1.00 0.00 ? 61  GLU A HB2  5  
ATOM 6874  H HB3  . GLU A 1 53 ? 6.616   0.535   -9.925  1.00 0.00 ? 61  GLU A HB3  5  
ATOM 6875  H HG2  . GLU A 1 53 ? 8.930   0.947   -9.562  1.00 0.00 ? 61  GLU A HG2  5  
ATOM 6876  H HG3  . GLU A 1 53 ? 9.230   -0.747  -9.177  1.00 0.00 ? 61  GLU A HG3  5  
ATOM 6877  N N    . VAL A 1 54 ? 8.145   1.706   -7.204  1.00 0.00 ? 62  VAL A N    5  
ATOM 6878  C CA   . VAL A 1 54 ? 8.349   3.067   -6.722  1.00 0.00 ? 62  VAL A CA   5  
ATOM 6879  C C    . VAL A 1 54 ? 9.684   3.614   -7.216  1.00 0.00 ? 62  VAL A C    5  
ATOM 6880  O O    . VAL A 1 54 ? 10.742  3.081   -6.884  1.00 0.00 ? 62  VAL A O    5  
ATOM 6881  C CB   . VAL A 1 54 ? 8.313   3.127   -5.182  1.00 0.00 ? 62  VAL A CB   5  
ATOM 6882  C CG1  . VAL A 1 54 ? 8.442   4.563   -4.693  1.00 0.00 ? 62  VAL A CG1  5  
ATOM 6883  C CG2  . VAL A 1 54 ? 7.036   2.490   -4.655  1.00 0.00 ? 62  VAL A CG2  5  
ATOM 6884  H H    . VAL A 1 54 ? 8.926   1.137   -7.366  1.00 0.00 ? 62  VAL A H    5  
ATOM 6885  H HA   . VAL A 1 54 ? 7.551   3.684   -7.108  1.00 0.00 ? 62  VAL A HA   5  
ATOM 6886  H HB   . VAL A 1 54 ? 9.153   2.566   -4.799  1.00 0.00 ? 62  VAL A HB   5  
ATOM 6887  H HG11 . VAL A 1 54 ? 8.268   5.243   -5.514  1.00 0.00 ? 62  VAL A HG11 5  
ATOM 6888  H HG12 . VAL A 1 54 ? 9.437   4.721   -4.302  1.00 0.00 ? 62  VAL A HG12 5  
ATOM 6889  H HG13 . VAL A 1 54 ? 7.718   4.748   -3.912  1.00 0.00 ? 62  VAL A HG13 5  
ATOM 6890  H HG21 . VAL A 1 54 ? 6.868   2.809   -3.637  1.00 0.00 ? 62  VAL A HG21 5  
ATOM 6891  H HG22 . VAL A 1 54 ? 7.130   1.415   -4.686  1.00 0.00 ? 62  VAL A HG22 5  
ATOM 6892  H HG23 . VAL A 1 54 ? 6.202   2.797   -5.269  1.00 0.00 ? 62  VAL A HG23 5  
ATOM 6893  N N    . ASN A 1 55 ? 9.630   4.675   -8.021  1.00 0.00 ? 63  ASN A N    5  
ATOM 6894  C CA   . ASN A 1 55 ? 10.839  5.292   -8.575  1.00 0.00 ? 63  ASN A CA   5  
ATOM 6895  C C    . ASN A 1 55 ? 11.802  4.234   -9.112  1.00 0.00 ? 63  ASN A C    5  
ATOM 6896  O O    . ASN A 1 55 ? 12.999  4.261   -8.822  1.00 0.00 ? 63  ASN A O    5  
ATOM 6897  C CB   . ASN A 1 55 ? 11.550  6.172   -7.532  1.00 0.00 ? 63  ASN A CB   5  
ATOM 6898  C CG   . ASN A 1 55 ? 11.124  5.887   -6.106  1.00 0.00 ? 63  ASN A CG   5  
ATOM 6899  O OD1  . ASN A 1 55 ? 11.618  4.955   -5.469  1.00 0.00 ? 63  ASN A OD1  5  
ATOM 6900  N ND2  . ASN A 1 55 ? 10.202  6.693   -5.601  1.00 0.00 ? 63  ASN A ND2  5  
ATOM 6901  H H    . ASN A 1 55 ? 8.756   5.050   -8.254  1.00 0.00 ? 63  ASN A H    5  
ATOM 6902  H HA   . ASN A 1 55 ? 10.530  5.917   -9.400  1.00 0.00 ? 63  ASN A HA   5  
ATOM 6903  H HB2  . ASN A 1 55 ? 12.613  6.015   -7.602  1.00 0.00 ? 63  ASN A HB2  5  
ATOM 6904  H HB3  . ASN A 1 55 ? 11.335  7.207   -7.747  1.00 0.00 ? 63  ASN A HB3  5  
ATOM 6905  H HD21 . ASN A 1 55 ? 9.858   7.409   -6.172  1.00 0.00 ? 63  ASN A HD21 5  
ATOM 6906  H HD22 . ASN A 1 55 ? 9.910   6.545   -4.678  1.00 0.00 ? 63  ASN A HD22 5  
ATOM 6907  N N    . GLY A 1 56 ? 11.270  3.301   -9.894  1.00 0.00 ? 64  GLY A N    5  
ATOM 6908  C CA   . GLY A 1 56 ? 12.094  2.247   -10.456 1.00 0.00 ? 64  GLY A CA   5  
ATOM 6909  C C    . GLY A 1 56 ? 12.613  1.295   -9.396  1.00 0.00 ? 64  GLY A C    5  
ATOM 6910  O O    . GLY A 1 56 ? 13.617  0.614   -9.600  1.00 0.00 ? 64  GLY A O    5  
ATOM 6911  H H    . GLY A 1 56 ? 10.310  3.326   -10.089 1.00 0.00 ? 64  GLY A H    5  
ATOM 6912  H HA2  . GLY A 1 56 ? 11.510  1.688   -11.171 1.00 0.00 ? 64  GLY A HA2  5  
ATOM 6913  H HA3  . GLY A 1 56 ? 12.936  2.694   -10.963 1.00 0.00 ? 64  GLY A HA3  5  
ATOM 6914  N N    . VAL A 1 57 ? 11.924  1.250   -8.260  1.00 0.00 ? 65  VAL A N    5  
ATOM 6915  C CA   . VAL A 1 57 ? 12.314  0.378   -7.162  1.00 0.00 ? 65  VAL A CA   5  
ATOM 6916  C C    . VAL A 1 57 ? 11.325  -0.773  -7.003  1.00 0.00 ? 65  VAL A C    5  
ATOM 6917  O O    . VAL A 1 57 ? 10.117  -0.557  -6.908  1.00 0.00 ? 65  VAL A O    5  
ATOM 6918  C CB   . VAL A 1 57 ? 12.404  1.158   -5.836  1.00 0.00 ? 65  VAL A CB   5  
ATOM 6919  C CG1  . VAL A 1 57 ? 12.993  0.287   -4.740  1.00 0.00 ? 65  VAL A CG1  5  
ATOM 6920  C CG2  . VAL A 1 57 ? 13.224  2.428   -6.016  1.00 0.00 ? 65  VAL A CG2  5  
ATOM 6921  H H    . VAL A 1 57 ? 11.132  1.817   -8.159  1.00 0.00 ? 65  VAL A H    5  
ATOM 6922  H HA   . VAL A 1 57 ? 13.291  -0.026  -7.386  1.00 0.00 ? 65  VAL A HA   5  
ATOM 6923  H HB   . VAL A 1 57 ? 11.403  1.441   -5.540  1.00 0.00 ? 65  VAL A HB   5  
ATOM 6924  H HG11 . VAL A 1 57 ? 12.879  -0.754  -5.007  1.00 0.00 ? 65  VAL A HG11 5  
ATOM 6925  H HG12 . VAL A 1 57 ? 12.477  0.476   -3.812  1.00 0.00 ? 65  VAL A HG12 5  
ATOM 6926  H HG13 . VAL A 1 57 ? 14.042  0.515   -4.623  1.00 0.00 ? 65  VAL A HG13 5  
ATOM 6927  H HG21 . VAL A 1 57 ? 12.975  2.886   -6.963  1.00 0.00 ? 65  VAL A HG21 5  
ATOM 6928  H HG22 . VAL A 1 57 ? 14.275  2.181   -6.001  1.00 0.00 ? 65  VAL A HG22 5  
ATOM 6929  H HG23 . VAL A 1 57 ? 13.003  3.117   -5.214  1.00 0.00 ? 65  VAL A HG23 5  
ATOM 6930  N N    . ASP A 1 58 ? 11.845  -1.995  -6.985  1.00 0.00 ? 66  ASP A N    5  
ATOM 6931  C CA   . ASP A 1 58 ? 11.007  -3.181  -6.846  1.00 0.00 ? 66  ASP A CA   5  
ATOM 6932  C C    . ASP A 1 58 ? 10.317  -3.210  -5.486  1.00 0.00 ? 66  ASP A C    5  
ATOM 6933  O O    . ASP A 1 58 ? 10.970  -3.326  -4.450  1.00 0.00 ? 66  ASP A O    5  
ATOM 6934  C CB   . ASP A 1 58 ? 11.844  -4.448  -7.033  1.00 0.00 ? 66  ASP A CB   5  
ATOM 6935  C CG   . ASP A 1 58 ? 12.187  -4.705  -8.488  1.00 0.00 ? 66  ASP A CG   5  
ATOM 6936  O OD1  . ASP A 1 58 ? 12.959  -3.911  -9.064  1.00 0.00 ? 66  ASP A OD1  5  
ATOM 6937  O OD2  . ASP A 1 58 ? 11.680  -5.699  -9.049  1.00 0.00 ? 66  ASP A OD2  5  
ATOM 6938  H H    . ASP A 1 58 ? 12.815  -2.104  -7.069  1.00 0.00 ? 66  ASP A H    5  
ATOM 6939  H HA   . ASP A 1 58 ? 10.252  -3.144  -7.617  1.00 0.00 ? 66  ASP A HA   5  
ATOM 6940  H HB2  . ASP A 1 58 ? 12.765  -4.349  -6.477  1.00 0.00 ? 66  ASP A HB2  5  
ATOM 6941  H HB3  . ASP A 1 58 ? 11.291  -5.296  -6.655  1.00 0.00 ? 66  ASP A HB3  5  
ATOM 6942  N N    . PHE A 1 59 ? 8.992   -3.106  -5.500  1.00 0.00 ? 67  PHE A N    5  
ATOM 6943  C CA   . PHE A 1 59 ? 8.210   -3.121  -4.270  1.00 0.00 ? 67  PHE A CA   5  
ATOM 6944  C C    . PHE A 1 59 ? 7.612   -4.504  -4.016  1.00 0.00 ? 67  PHE A C    5  
ATOM 6945  O O    . PHE A 1 59 ? 7.262   -4.838  -2.884  1.00 0.00 ? 67  PHE A O    5  
ATOM 6946  C CB   . PHE A 1 59 ? 7.098   -2.071  -4.335  1.00 0.00 ? 67  PHE A CB   5  
ATOM 6947  C CG   . PHE A 1 59 ? 7.360   -0.870  -3.472  1.00 0.00 ? 67  PHE A CG   5  
ATOM 6948  C CD1  . PHE A 1 59 ? 8.598   -0.250  -3.486  1.00 0.00 ? 67  PHE A CD1  5  
ATOM 6949  C CD2  . PHE A 1 59 ? 6.368   -0.365  -2.648  1.00 0.00 ? 67  PHE A CD2  5  
ATOM 6950  C CE1  . PHE A 1 59 ? 8.843   0.855   -2.693  1.00 0.00 ? 67  PHE A CE1  5  
ATOM 6951  C CE2  . PHE A 1 59 ? 6.607   0.740   -1.853  1.00 0.00 ? 67  PHE A CE2  5  
ATOM 6952  C CZ   . PHE A 1 59 ? 7.846   1.352   -1.874  1.00 0.00 ? 67  PHE A CZ   5  
ATOM 6953  H H    . PHE A 1 59 ? 8.529   -3.016  -6.359  1.00 0.00 ? 67  PHE A H    5  
ATOM 6954  H HA   . PHE A 1 59 ? 8.874   -2.876  -3.455  1.00 0.00 ? 67  PHE A HA   5  
ATOM 6955  H HB2  . PHE A 1 59 ? 6.993   -1.732  -5.355  1.00 0.00 ? 67  PHE A HB2  5  
ATOM 6956  H HB3  . PHE A 1 59 ? 6.169   -2.519  -4.012  1.00 0.00 ? 67  PHE A HB3  5  
ATOM 6957  H HD1  . PHE A 1 59 ? 9.378   -0.636  -4.126  1.00 0.00 ? 67  PHE A HD1  5  
ATOM 6958  H HD2  . PHE A 1 59 ? 5.399   -0.840  -2.630  1.00 0.00 ? 67  PHE A HD2  5  
ATOM 6959  H HE1  . PHE A 1 59 ? 9.812   1.329   -2.711  1.00 0.00 ? 67  PHE A HE1  5  
ATOM 6960  H HE2  . PHE A 1 59 ? 5.826   1.125   -1.213  1.00 0.00 ? 67  PHE A HE2  5  
ATOM 6961  H HZ   . PHE A 1 59 ? 8.036   2.214   -1.254  1.00 0.00 ? 67  PHE A HZ   5  
ATOM 6962  N N    . SER A 1 60 ? 7.495   -5.303  -5.074  1.00 0.00 ? 68  SER A N    5  
ATOM 6963  C CA   . SER A 1 60 ? 6.938   -6.648  -4.959  1.00 0.00 ? 68  SER A CA   5  
ATOM 6964  C C    . SER A 1 60 ? 7.658   -7.451  -3.879  1.00 0.00 ? 68  SER A C    5  
ATOM 6965  O O    . SER A 1 60 ? 7.027   -8.108  -3.053  1.00 0.00 ? 68  SER A O    5  
ATOM 6966  C CB   . SER A 1 60 ? 7.033   -7.378  -6.301  1.00 0.00 ? 68  SER A CB   5  
ATOM 6967  O OG   . SER A 1 60 ? 5.914   -7.089  -7.120  1.00 0.00 ? 68  SER A OG   5  
ATOM 6968  H H    . SER A 1 60 ? 7.789   -4.984  -5.951  1.00 0.00 ? 68  SER A H    5  
ATOM 6969  H HA   . SER A 1 60 ? 5.898   -6.554  -4.685  1.00 0.00 ? 68  SER A HA   5  
ATOM 6970  H HB2  . SER A 1 60 ? 7.929   -7.065  -6.815  1.00 0.00 ? 68  SER A HB2  5  
ATOM 6971  H HB3  . SER A 1 60 ? 7.072   -8.444  -6.127  1.00 0.00 ? 68  SER A HB3  5  
ATOM 6972  H HG   . SER A 1 60 ? 6.147   -7.225  -8.042  1.00 0.00 ? 68  SER A HG   5  
ATOM 6973  N N    . ASN A 1 61 ? 8.986   -7.388  -3.891  1.00 0.00 ? 69  ASN A N    5  
ATOM 6974  C CA   . ASN A 1 61 ? 9.793   -8.106  -2.910  1.00 0.00 ? 69  ASN A CA   5  
ATOM 6975  C C    . ASN A 1 61 ? 10.392  -7.141  -1.893  1.00 0.00 ? 69  ASN A C    5  
ATOM 6976  O O    . ASN A 1 61 ? 11.514  -7.331  -1.424  1.00 0.00 ? 69  ASN A O    5  
ATOM 6977  C CB   . ASN A 1 61 ? 10.909  -8.887  -3.609  1.00 0.00 ? 69  ASN A CB   5  
ATOM 6978  C CG   . ASN A 1 61 ? 11.730  -8.017  -4.541  1.00 0.00 ? 69  ASN A CG   5  
ATOM 6979  O OD1  . ASN A 1 61 ? 11.794  -6.798  -4.375  1.00 0.00 ? 69  ASN A OD1  5  
ATOM 6980  N ND2  . ASN A 1 61 ? 12.363  -8.641  -5.527  1.00 0.00 ? 69  ASN A ND2  5  
ATOM 6981  H H    . ASN A 1 61 ? 9.434   -6.846  -4.574  1.00 0.00 ? 69  ASN A H    5  
ATOM 6982  H HA   . ASN A 1 61 ? 9.149   -8.800  -2.395  1.00 0.00 ? 69  ASN A HA   5  
ATOM 6983  H HB2  . ASN A 1 61 ? 11.568  -9.305  -2.863  1.00 0.00 ? 69  ASN A HB2  5  
ATOM 6984  H HB3  . ASN A 1 61 ? 10.471  -9.689  -4.186  1.00 0.00 ? 69  ASN A HB3  5  
ATOM 6985  H HD21 . ASN A 1 61 ? 12.267  -9.614  -5.597  1.00 0.00 ? 69  ASN A HD21 5  
ATOM 6986  H HD22 . ASN A 1 61 ? 12.901  -8.102  -6.144  1.00 0.00 ? 69  ASN A HD22 5  
ATOM 6987  N N    . LEU A 1 62 ? 9.632   -6.104  -1.555  1.00 0.00 ? 70  LEU A N    5  
ATOM 6988  C CA   . LEU A 1 62 ? 10.083  -5.104  -0.595  1.00 0.00 ? 70  LEU A CA   5  
ATOM 6989  C C    . LEU A 1 62 ? 9.372   -5.280  0.744   1.00 0.00 ? 70  LEU A C    5  
ATOM 6990  O O    . LEU A 1 62 ? 8.229   -5.732  0.795   1.00 0.00 ? 70  LEU A O    5  
ATOM 6991  C CB   . LEU A 1 62 ? 9.832   -3.697  -1.138  1.00 0.00 ? 70  LEU A CB   5  
ATOM 6992  C CG   . LEU A 1 62 ? 10.528  -2.569  -0.369  1.00 0.00 ? 70  LEU A CG   5  
ATOM 6993  C CD1  . LEU A 1 62 ? 11.733  -2.058  -1.144  1.00 0.00 ? 70  LEU A CD1  5  
ATOM 6994  C CD2  . LEU A 1 62 ? 9.553   -1.434  -0.089  1.00 0.00 ? 70  LEU A CD2  5  
ATOM 6995  H H    . LEU A 1 62 ? 8.747   -6.007  -1.965  1.00 0.00 ? 70  LEU A H    5  
ATOM 6996  H HA   . LEU A 1 62 ? 11.144  -5.240  -0.446  1.00 0.00 ? 70  LEU A HA   5  
ATOM 6997  H HB2  . LEU A 1 62 ? 10.169  -3.667  -2.163  1.00 0.00 ? 70  LEU A HB2  5  
ATOM 6998  H HB3  . LEU A 1 62 ? 8.769   -3.511  -1.121  1.00 0.00 ? 70  LEU A HB3  5  
ATOM 6999  H HG   . LEU A 1 62 ? 10.878  -2.952  0.577   1.00 0.00 ? 70  LEU A HG   5  
ATOM 7000  H HD11 . LEU A 1 62 ? 12.480  -2.836  -1.201  1.00 0.00 ? 70  LEU A HD11 5  
ATOM 7001  H HD12 . LEU A 1 62 ? 12.147  -1.197  -0.638  1.00 0.00 ? 70  LEU A HD12 5  
ATOM 7002  H HD13 . LEU A 1 62 ? 11.428  -1.778  -2.141  1.00 0.00 ? 70  LEU A HD13 5  
ATOM 7003  H HD21 . LEU A 1 62 ? 10.105  -0.527  0.110   1.00 0.00 ? 70  LEU A HD21 5  
ATOM 7004  H HD22 . LEU A 1 62 ? 8.949   -1.683  0.771   1.00 0.00 ? 70  LEU A HD22 5  
ATOM 7005  H HD23 . LEU A 1 62 ? 8.915   -1.287  -0.947  1.00 0.00 ? 70  LEU A HD23 5  
ATOM 7006  N N    . ASP A 1 63 ? 10.057  -4.920  1.824   1.00 0.00 ? 71  ASP A N    5  
ATOM 7007  C CA   . ASP A 1 63 ? 9.493   -5.040  3.163   1.00 0.00 ? 71  ASP A CA   5  
ATOM 7008  C C    . ASP A 1 63 ? 8.633   -3.826  3.502   1.00 0.00 ? 71  ASP A C    5  
ATOM 7009  O O    . ASP A 1 63 ? 8.686   -2.804  2.819   1.00 0.00 ? 71  ASP A O    5  
ATOM 7010  C CB   . ASP A 1 63 ? 10.609  -5.197  4.198   1.00 0.00 ? 71  ASP A CB   5  
ATOM 7011  C CG   . ASP A 1 63 ? 10.805  -6.640  4.622   1.00 0.00 ? 71  ASP A CG   5  
ATOM 7012  O OD1  . ASP A 1 63 ? 9.858   -7.225  5.188   1.00 0.00 ? 71  ASP A OD1  5  
ATOM 7013  O OD2  . ASP A 1 63 ? 11.905  -7.183  4.387   1.00 0.00 ? 71  ASP A OD2  5  
ATOM 7014  H H    . ASP A 1 63 ? 10.966  -4.568  1.718   1.00 0.00 ? 71  ASP A H    5  
ATOM 7015  H HA   . ASP A 1 63 ? 8.870   -5.921  3.182   1.00 0.00 ? 71  ASP A HA   5  
ATOM 7016  H HB2  . ASP A 1 63 ? 11.535  -4.837  3.776   1.00 0.00 ? 71  ASP A HB2  5  
ATOM 7017  H HB3  . ASP A 1 63 ? 10.368  -4.613  5.074   1.00 0.00 ? 71  ASP A HB3  5  
ATOM 7018  N N    . HIS A 1 64 ? 7.841   -3.945  4.564   1.00 0.00 ? 72  HIS A N    5  
ATOM 7019  C CA   . HIS A 1 64 ? 6.969   -2.858  4.995   1.00 0.00 ? 72  HIS A CA   5  
ATOM 7020  C C    . HIS A 1 64 ? 7.780   -1.615  5.342   1.00 0.00 ? 72  HIS A C    5  
ATOM 7021  O O    . HIS A 1 64 ? 7.527   -0.530  4.819   1.00 0.00 ? 72  HIS A O    5  
ATOM 7022  C CB   . HIS A 1 64 ? 6.137   -3.293  6.204   1.00 0.00 ? 72  HIS A CB   5  
ATOM 7023  C CG   . HIS A 1 64 ? 4.933   -2.437  6.442   1.00 0.00 ? 72  HIS A CG   5  
ATOM 7024  N ND1  . HIS A 1 64 ? 3.666   -2.951  6.622   1.00 0.00 ? 72  HIS A ND1  5  
ATOM 7025  C CD2  . HIS A 1 64 ? 4.806   -1.091  6.531   1.00 0.00 ? 72  HIS A CD2  5  
ATOM 7026  C CE1  . HIS A 1 64 ? 2.812   -1.960  6.811   1.00 0.00 ? 72  HIS A CE1  5  
ATOM 7027  N NE2  . HIS A 1 64 ? 3.480   -0.822  6.761   1.00 0.00 ? 72  HIS A NE2  5  
ATOM 7028  H H    . HIS A 1 64 ? 7.843   -4.786  5.070   1.00 0.00 ? 72  HIS A H    5  
ATOM 7029  H HA   . HIS A 1 64 ? 6.305   -2.624  4.178   1.00 0.00 ? 72  HIS A HA   5  
ATOM 7030  H HB2  . HIS A 1 64 ? 5.797   -4.307  6.052   1.00 0.00 ? 72  HIS A HB2  5  
ATOM 7031  H HB3  . HIS A 1 64 ? 6.755   -3.255  7.090   1.00 0.00 ? 72  HIS A HB3  5  
ATOM 7032  H HD1  . HIS A 1 64 ? 3.427   -3.901  6.613   1.00 0.00 ? 72  HIS A HD1  5  
ATOM 7033  H HD2  . HIS A 1 64 ? 5.601   -0.365  6.438   1.00 0.00 ? 72  HIS A HD2  5  
ATOM 7034  H HE1  . HIS A 1 64 ? 1.751   -2.062  6.980   1.00 0.00 ? 72  HIS A HE1  5  
ATOM 7035  H HE2  . HIS A 1 64 ? 3.078   0.071   6.807   1.00 0.00 ? 72  HIS A HE2  5  
ATOM 7036  N N    . LYS A 1 65 ? 8.759   -1.779  6.227   1.00 0.00 ? 73  LYS A N    5  
ATOM 7037  C CA   . LYS A 1 65 ? 9.609   -0.668  6.642   1.00 0.00 ? 73  LYS A CA   5  
ATOM 7038  C C    . LYS A 1 65 ? 10.314  -0.049  5.440   1.00 0.00 ? 73  LYS A C    5  
ATOM 7039  O O    . LYS A 1 65 ? 10.451  1.171   5.349   1.00 0.00 ? 73  LYS A O    5  
ATOM 7040  C CB   . LYS A 1 65 ? 10.639  -1.142  7.668   1.00 0.00 ? 73  LYS A CB   5  
ATOM 7041  C CG   . LYS A 1 65 ? 11.490  -2.306  7.185   1.00 0.00 ? 73  LYS A CG   5  
ATOM 7042  C CD   . LYS A 1 65 ? 12.402  -2.823  8.285   1.00 0.00 ? 73  LYS A CD   5  
ATOM 7043  C CE   . LYS A 1 65 ? 13.548  -1.862  8.555   1.00 0.00 ? 73  LYS A CE   5  
ATOM 7044  N NZ   . LYS A 1 65 ? 14.459  -1.742  7.383   1.00 0.00 ? 73  LYS A NZ   5  
ATOM 7045  H H    . LYS A 1 65 ? 8.913   -2.668  6.611   1.00 0.00 ? 73  LYS A H    5  
ATOM 7046  H HA   . LYS A 1 65 ? 8.977   0.079   7.098   1.00 0.00 ? 73  LYS A HA   5  
ATOM 7047  H HB2  . LYS A 1 65 ? 11.298  -0.319  7.905   1.00 0.00 ? 73  LYS A HB2  5  
ATOM 7048  H HB3  . LYS A 1 65 ? 10.124  -1.448  8.565   1.00 0.00 ? 73  LYS A HB3  5  
ATOM 7049  H HG2  . LYS A 1 65 ? 10.839  -3.107  6.867   1.00 0.00 ? 73  LYS A HG2  5  
ATOM 7050  H HG3  . LYS A 1 65 ? 12.095  -1.978  6.353   1.00 0.00 ? 73  LYS A HG3  5  
ATOM 7051  H HD2  . LYS A 1 65 ? 11.826  -2.943  9.191   1.00 0.00 ? 73  LYS A HD2  5  
ATOM 7052  H HD3  . LYS A 1 65 ? 12.807  -3.778  7.984   1.00 0.00 ? 73  LYS A HD3  5  
ATOM 7053  H HE2  . LYS A 1 65 ? 13.139  -0.889  8.782   1.00 0.00 ? 73  LYS A HE2  5  
ATOM 7054  H HE3  . LYS A 1 65 ? 14.113  -2.222  9.403   1.00 0.00 ? 73  LYS A HE3  5  
ATOM 7055  H HZ1  . LYS A 1 65 ? 14.686  -2.685  7.010   1.00 0.00 ? 73  LYS A HZ1  5  
ATOM 7056  H HZ2  . LYS A 1 65 ? 15.342  -1.270  7.664   1.00 0.00 ? 73  LYS A HZ2  5  
ATOM 7057  H HZ3  . LYS A 1 65 ? 14.004  -1.183  6.633   1.00 0.00 ? 73  LYS A HZ3  5  
ATOM 7058  N N    . GLU A 1 66 ? 10.756  -0.899  4.518   1.00 0.00 ? 74  GLU A N    5  
ATOM 7059  C CA   . GLU A 1 66 ? 11.443  -0.434  3.319   1.00 0.00 ? 74  GLU A CA   5  
ATOM 7060  C C    . GLU A 1 66 ? 10.531  0.464   2.489   1.00 0.00 ? 74  GLU A C    5  
ATOM 7061  O O    . GLU A 1 66 ? 10.952  1.510   1.996   1.00 0.00 ? 74  GLU A O    5  
ATOM 7062  C CB   . GLU A 1 66 ? 11.910  -1.624  2.479   1.00 0.00 ? 74  GLU A CB   5  
ATOM 7063  C CG   . GLU A 1 66 ? 13.366  -2.000  2.712   1.00 0.00 ? 74  GLU A CG   5  
ATOM 7064  C CD   . GLU A 1 66 ? 14.021  -2.581  1.475   1.00 0.00 ? 74  GLU A CD   5  
ATOM 7065  O OE1  . GLU A 1 66 ? 13.369  -3.386  0.780   1.00 0.00 ? 74  GLU A OE1  5  
ATOM 7066  O OE2  . GLU A 1 66 ? 15.188  -2.229  1.201   1.00 0.00 ? 74  GLU A OE2  5  
ATOM 7067  H H    . GLU A 1 66 ? 10.614  -1.860  4.645   1.00 0.00 ? 74  GLU A H    5  
ATOM 7068  H HA   . GLU A 1 66 ? 12.305  0.138   3.630   1.00 0.00 ? 74  GLU A HA   5  
ATOM 7069  H HB2  . GLU A 1 66 ? 11.298  -2.482  2.718   1.00 0.00 ? 74  GLU A HB2  5  
ATOM 7070  H HB3  . GLU A 1 66 ? 11.787  -1.386  1.433   1.00 0.00 ? 74  GLU A HB3  5  
ATOM 7071  H HG2  . GLU A 1 66 ? 13.910  -1.115  3.008   1.00 0.00 ? 74  GLU A HG2  5  
ATOM 7072  H HG3  . GLU A 1 66 ? 13.413  -2.731  3.505   1.00 0.00 ? 74  GLU A HG3  5  
ATOM 7073  N N    . ALA A 1 67 ? 9.277   0.047   2.342   1.00 0.00 ? 75  ALA A N    5  
ATOM 7074  C CA   . ALA A 1 67 ? 8.300   0.813   1.577   1.00 0.00 ? 75  ALA A CA   5  
ATOM 7075  C C    . ALA A 1 67 ? 8.130   2.210   2.158   1.00 0.00 ? 75  ALA A C    5  
ATOM 7076  O O    . ALA A 1 67 ? 8.112   3.203   1.430   1.00 0.00 ? 75  ALA A O    5  
ATOM 7077  C CB   . ALA A 1 67 ? 6.965   0.086   1.550   1.00 0.00 ? 75  ALA A CB   5  
ATOM 7078  H H    . ALA A 1 67 ? 9.001   -0.794  2.761   1.00 0.00 ? 75  ALA A H    5  
ATOM 7079  H HA   . ALA A 1 67 ? 8.661   0.896   0.562   1.00 0.00 ? 75  ALA A HA   5  
ATOM 7080  H HB1  . ALA A 1 67 ? 6.496   0.229   0.586   1.00 0.00 ? 75  ALA A HB1  5  
ATOM 7081  H HB2  . ALA A 1 67 ? 6.324   0.481   2.324   1.00 0.00 ? 75  ALA A HB2  5  
ATOM 7082  H HB3  . ALA A 1 67 ? 7.126   -0.968  1.718   1.00 0.00 ? 75  ALA A HB3  5  
ATOM 7083  N N    . VAL A 1 68 ? 8.007   2.283   3.478   1.00 0.00 ? 76  VAL A N    5  
ATOM 7084  C CA   . VAL A 1 68 ? 7.843   3.558   4.159   1.00 0.00 ? 76  VAL A CA   5  
ATOM 7085  C C    . VAL A 1 68 ? 9.120   4.387   4.076   1.00 0.00 ? 76  VAL A C    5  
ATOM 7086  O O    . VAL A 1 68 ? 9.072   5.600   3.885   1.00 0.00 ? 76  VAL A O    5  
ATOM 7087  C CB   . VAL A 1 68 ? 7.464   3.363   5.638   1.00 0.00 ? 76  VAL A CB   5  
ATOM 7088  C CG1  . VAL A 1 68 ? 7.172   4.702   6.299   1.00 0.00 ? 76  VAL A CG1  5  
ATOM 7089  C CG2  . VAL A 1 68 ? 6.271   2.427   5.764   1.00 0.00 ? 76  VAL A CG2  5  
ATOM 7090  H H    . VAL A 1 68 ? 8.032   1.458   4.008   1.00 0.00 ? 76  VAL A H    5  
ATOM 7091  H HA   . VAL A 1 68 ? 7.044   4.097   3.670   1.00 0.00 ? 76  VAL A HA   5  
ATOM 7092  H HB   . VAL A 1 68 ? 8.303   2.911   6.147   1.00 0.00 ? 76  VAL A HB   5  
ATOM 7093  H HG11 . VAL A 1 68 ? 6.359   5.189   5.782   1.00 0.00 ? 76  VAL A HG11 5  
ATOM 7094  H HG12 . VAL A 1 68 ? 8.053   5.325   6.255   1.00 0.00 ? 76  VAL A HG12 5  
ATOM 7095  H HG13 . VAL A 1 68 ? 6.897   4.541   7.332   1.00 0.00 ? 76  VAL A HG13 5  
ATOM 7096  H HG21 . VAL A 1 68 ? 6.558   1.433   5.453   1.00 0.00 ? 76  VAL A HG21 5  
ATOM 7097  H HG22 . VAL A 1 68 ? 5.468   2.783   5.137   1.00 0.00 ? 76  VAL A HG22 5  
ATOM 7098  H HG23 . VAL A 1 68 ? 5.940   2.402   6.792   1.00 0.00 ? 76  VAL A HG23 5  
ATOM 7099  N N    . ASN A 1 69 ? 10.261  3.721   4.219   1.00 0.00 ? 77  ASN A N    5  
ATOM 7100  C CA   . ASN A 1 69 ? 11.554  4.395   4.164   1.00 0.00 ? 77  ASN A CA   5  
ATOM 7101  C C    . ASN A 1 69 ? 11.713  5.188   2.869   1.00 0.00 ? 77  ASN A C    5  
ATOM 7102  O O    . ASN A 1 69 ? 11.916  6.401   2.899   1.00 0.00 ? 77  ASN A O    5  
ATOM 7103  C CB   . ASN A 1 69 ? 12.689  3.378   4.295   1.00 0.00 ? 77  ASN A CB   5  
ATOM 7104  C CG   . ASN A 1 69 ? 13.818  3.880   5.173   1.00 0.00 ? 77  ASN A CG   5  
ATOM 7105  O OD1  . ASN A 1 69 ? 14.984  3.855   4.780   1.00 0.00 ? 77  ASN A OD1  5  
ATOM 7106  N ND2  . ASN A 1 69 ? 13.475  4.338   6.371   1.00 0.00 ? 77  ASN A ND2  5  
ATOM 7107  H H    . ASN A 1 69 ? 10.234  2.752   4.368   1.00 0.00 ? 77  ASN A H    5  
ATOM 7108  H HA   . ASN A 1 69 ? 11.603  5.082   4.995   1.00 0.00 ? 77  ASN A HA   5  
ATOM 7109  H HB2  . ASN A 1 69 ? 12.300  2.467   4.728   1.00 0.00 ? 77  ASN A HB2  5  
ATOM 7110  H HB3  . ASN A 1 69 ? 13.088  3.163   3.314   1.00 0.00 ? 77  ASN A HB3  5  
ATOM 7111  H HD21 . ASN A 1 69 ? 12.527  4.326   6.618   1.00 0.00 ? 77  ASN A HD21 5  
ATOM 7112  H HD22 . ASN A 1 69 ? 14.185  4.669   6.960   1.00 0.00 ? 77  ASN A HD22 5  
ATOM 7113  N N    . VAL A 1 70 ? 11.620  4.499   1.737   1.00 0.00 ? 78  VAL A N    5  
ATOM 7114  C CA   . VAL A 1 70 ? 11.756  5.151   0.440   1.00 0.00 ? 78  VAL A CA   5  
ATOM 7115  C C    . VAL A 1 70 ? 10.704  6.241   0.265   1.00 0.00 ? 78  VAL A C    5  
ATOM 7116  O O    . VAL A 1 70 ? 11.009  7.347   -0.184  1.00 0.00 ? 78  VAL A O    5  
ATOM 7117  C CB   . VAL A 1 70 ? 11.637  4.140   -0.717  1.00 0.00 ? 78  VAL A CB   5  
ATOM 7118  C CG1  . VAL A 1 70 ? 12.767  3.125   -0.657  1.00 0.00 ? 78  VAL A CG1  5  
ATOM 7119  C CG2  . VAL A 1 70 ? 10.287  3.443   -0.683  1.00 0.00 ? 78  VAL A CG2  5  
ATOM 7120  H H    . VAL A 1 70 ? 11.459  3.533   1.774   1.00 0.00 ? 78  VAL A H    5  
ATOM 7121  H HA   . VAL A 1 70 ? 12.737  5.603   0.397   1.00 0.00 ? 78  VAL A HA   5  
ATOM 7122  H HB   . VAL A 1 70 ? 11.716  4.680   -1.649  1.00 0.00 ? 78  VAL A HB   5  
ATOM 7123  H HG11 . VAL A 1 70 ? 13.605  3.550   -0.126  1.00 0.00 ? 78  VAL A HG11 5  
ATOM 7124  H HG12 . VAL A 1 70 ? 13.071  2.866   -1.661  1.00 0.00 ? 78  VAL A HG12 5  
ATOM 7125  H HG13 . VAL A 1 70 ? 12.426  2.238   -0.144  1.00 0.00 ? 78  VAL A HG13 5  
ATOM 7126  H HG21 . VAL A 1 70 ? 9.548   4.065   -1.168  1.00 0.00 ? 78  VAL A HG21 5  
ATOM 7127  H HG22 . VAL A 1 70 ? 9.996   3.271   0.342   1.00 0.00 ? 78  VAL A HG22 5  
ATOM 7128  H HG23 . VAL A 1 70 ? 10.357  2.499   -1.201  1.00 0.00 ? 78  VAL A HG23 5  
ATOM 7129  N N    . LEU A 1 71 ? 9.464   5.924   0.629   1.00 0.00 ? 79  LEU A N    5  
ATOM 7130  C CA   . LEU A 1 71 ? 8.369   6.880   0.517   1.00 0.00 ? 79  LEU A CA   5  
ATOM 7131  C C    . LEU A 1 71 ? 8.608   8.084   1.424   1.00 0.00 ? 79  LEU A C    5  
ATOM 7132  O O    . LEU A 1 71 ? 8.199   9.203   1.110   1.00 0.00 ? 79  LEU A O    5  
ATOM 7133  C CB   . LEU A 1 71 ? 7.039   6.208   0.873   1.00 0.00 ? 79  LEU A CB   5  
ATOM 7134  C CG   . LEU A 1 71 ? 6.247   5.661   -0.318  1.00 0.00 ? 79  LEU A CG   5  
ATOM 7135  C CD1  . LEU A 1 71 ? 5.673   6.799   -1.148  1.00 0.00 ? 79  LEU A CD1  5  
ATOM 7136  C CD2  . LEU A 1 71 ? 7.124   4.763   -1.179  1.00 0.00 ? 79  LEU A CD2  5  
ATOM 7137  H H    . LEU A 1 71 ? 9.284   5.028   0.984   1.00 0.00 ? 79  LEU A H    5  
ATOM 7138  H HA   . LEU A 1 71 ? 8.328   7.217   -0.507  1.00 0.00 ? 79  LEU A HA   5  
ATOM 7139  H HB2  . LEU A 1 71 ? 7.243   5.390   1.549   1.00 0.00 ? 79  LEU A HB2  5  
ATOM 7140  H HB3  . LEU A 1 71 ? 6.421   6.930   1.385   1.00 0.00 ? 79  LEU A HB3  5  
ATOM 7141  H HG   . LEU A 1 71 ? 5.422   5.069   0.049   1.00 0.00 ? 79  LEU A HG   5  
ATOM 7142  H HD11 . LEU A 1 71 ? 6.302   6.971   -2.009  1.00 0.00 ? 79  LEU A HD11 5  
ATOM 7143  H HD12 . LEU A 1 71 ? 5.628   7.695   -0.549  1.00 0.00 ? 79  LEU A HD12 5  
ATOM 7144  H HD13 . LEU A 1 71 ? 4.678   6.537   -1.478  1.00 0.00 ? 79  LEU A HD13 5  
ATOM 7145  H HD21 . LEU A 1 71 ? 6.502   4.180   -1.842  1.00 0.00 ? 79  LEU A HD21 5  
ATOM 7146  H HD22 . LEU A 1 71 ? 7.692   4.101   -0.544  1.00 0.00 ? 79  LEU A HD22 5  
ATOM 7147  H HD23 . LEU A 1 71 ? 7.801   5.372   -1.761  1.00 0.00 ? 79  LEU A HD23 5  
ATOM 7148  N N    . LYS A 1 72 ? 9.277   7.846   2.549   1.00 0.00 ? 80  LYS A N    5  
ATOM 7149  C CA   . LYS A 1 72 ? 9.577   8.908   3.504   1.00 0.00 ? 80  LYS A CA   5  
ATOM 7150  C C    . LYS A 1 72 ? 10.823  9.684   3.084   1.00 0.00 ? 80  LYS A C    5  
ATOM 7151  O O    . LYS A 1 72 ? 10.942  10.879  3.350   1.00 0.00 ? 80  LYS A O    5  
ATOM 7152  C CB   . LYS A 1 72 ? 9.782   8.322   4.905   1.00 0.00 ? 80  LYS A CB   5  
ATOM 7153  C CG   . LYS A 1 72 ? 8.544   8.385   5.784   1.00 0.00 ? 80  LYS A CG   5  
ATOM 7154  C CD   . LYS A 1 72 ? 7.327   7.797   5.086   1.00 0.00 ? 80  LYS A CD   5  
ATOM 7155  C CE   . LYS A 1 72 ? 6.072   7.945   5.934   1.00 0.00 ? 80  LYS A CE   5  
ATOM 7156  N NZ   . LYS A 1 72 ? 6.321   7.608   7.363   1.00 0.00 ? 80  LYS A NZ   5  
ATOM 7157  H H    . LYS A 1 72 ? 9.578   6.934   2.741   1.00 0.00 ? 80  LYS A H    5  
ATOM 7158  H HA   . LYS A 1 72 ? 8.735   9.584   3.525   1.00 0.00 ? 80  LYS A HA   5  
ATOM 7159  H HB2  . LYS A 1 72 ? 10.078  7.289   4.810   1.00 0.00 ? 80  LYS A HB2  5  
ATOM 7160  H HB3  . LYS A 1 72 ? 10.573  8.868   5.398   1.00 0.00 ? 80  LYS A HB3  5  
ATOM 7161  H HG2  . LYS A 1 72 ? 8.730   7.827   6.690   1.00 0.00 ? 80  LYS A HG2  5  
ATOM 7162  H HG3  . LYS A 1 72 ? 8.344   9.416   6.031   1.00 0.00 ? 80  LYS A HG3  5  
ATOM 7163  H HD2  . LYS A 1 72 ? 7.178   8.311   4.150   1.00 0.00 ? 80  LYS A HD2  5  
ATOM 7164  H HD3  . LYS A 1 72 ? 7.502   6.749   4.901   1.00 0.00 ? 80  LYS A HD3  5  
ATOM 7165  H HE2  . LYS A 1 72 ? 5.727   8.965   5.870   1.00 0.00 ? 80  LYS A HE2  5  
ATOM 7166  H HE3  . LYS A 1 72 ? 5.311   7.284   5.544   1.00 0.00 ? 80  LYS A HE3  5  
ATOM 7167  H HZ1  . LYS A 1 72 ? 7.098   6.920   7.438   1.00 0.00 ? 80  LYS A HZ1  5  
ATOM 7168  H HZ2  . LYS A 1 72 ? 5.466   7.197   7.787   1.00 0.00 ? 80  LYS A HZ2  5  
ATOM 7169  H HZ3  . LYS A 1 72 ? 6.580   8.466   7.892   1.00 0.00 ? 80  LYS A HZ3  5  
ATOM 7170  N N    . SER A 1 73 ? 11.751  8.991   2.432   1.00 0.00 ? 81  SER A N    5  
ATOM 7171  C CA   . SER A 1 73 ? 12.992  9.607   1.983   1.00 0.00 ? 81  SER A CA   5  
ATOM 7172  C C    . SER A 1 73 ? 12.732  10.679  0.931   1.00 0.00 ? 81  SER A C    5  
ATOM 7173  O O    . SER A 1 73 ? 13.010  11.858  1.151   1.00 0.00 ? 81  SER A O    5  
ATOM 7174  C CB   . SER A 1 73 ? 13.936  8.542   1.418   1.00 0.00 ? 81  SER A CB   5  
ATOM 7175  O OG   . SER A 1 73 ? 15.216  9.088   1.145   1.00 0.00 ? 81  SER A OG   5  
ATOM 7176  H H    . SER A 1 73 ? 11.599  8.040   2.256   1.00 0.00 ? 81  SER A H    5  
ATOM 7177  H HA   . SER A 1 73 ? 13.461  10.068  2.839   1.00 0.00 ? 81  SER A HA   5  
ATOM 7178  H HB2  . SER A 1 73 ? 14.046  7.744   2.138   1.00 0.00 ? 81  SER A HB2  5  
ATOM 7179  H HB3  . SER A 1 73 ? 13.523  8.147   0.502   1.00 0.00 ? 81  SER A HB3  5  
ATOM 7180  H HG   . SER A 1 73 ? 15.153  9.699   0.407   1.00 0.00 ? 81  SER A HG   5  
ATOM 7181  N N    . SER A 1 74 ? 12.200  10.266  -0.215  1.00 0.00 ? 82  SER A N    5  
ATOM 7182  C CA   . SER A 1 74 ? 11.911  11.198  -1.301  1.00 0.00 ? 82  SER A CA   5  
ATOM 7183  C C    . SER A 1 74 ? 10.515  11.795  -1.155  1.00 0.00 ? 82  SER A C    5  
ATOM 7184  O O    . SER A 1 74 ? 9.549   11.085  -0.874  1.00 0.00 ? 82  SER A O    5  
ATOM 7185  C CB   . SER A 1 74 ? 12.043  10.494  -2.654  1.00 0.00 ? 82  SER A CB   5  
ATOM 7186  O OG   . SER A 1 74 ? 12.954  11.177  -3.496  1.00 0.00 ? 82  SER A OG   5  
ATOM 7187  H H    . SER A 1 74 ? 12.003  9.311   -0.337  1.00 0.00 ? 82  SER A H    5  
ATOM 7188  H HA   . SER A 1 74 ? 12.636  11.995  -1.250  1.00 0.00 ? 82  SER A HA   5  
ATOM 7189  H HB2  . SER A 1 74 ? 12.400  9.487   -2.500  1.00 0.00 ? 82  SER A HB2  5  
ATOM 7190  H HB3  . SER A 1 74 ? 11.078  10.462  -3.138  1.00 0.00 ? 82  SER A HB3  5  
ATOM 7191  H HG   . SER A 1 74 ? 13.621  10.561  -3.813  1.00 0.00 ? 82  SER A HG   5  
ATOM 7192  N N    . ARG A 1 75 ? 10.417  13.107  -1.351  1.00 0.00 ? 83  ARG A N    5  
ATOM 7193  C CA   . ARG A 1 75 ? 9.140   13.802  -1.247  1.00 0.00 ? 83  ARG A CA   5  
ATOM 7194  C C    . ARG A 1 75 ? 8.310   13.592  -2.509  1.00 0.00 ? 83  ARG A C    5  
ATOM 7195  O O    . ARG A 1 75 ? 7.151   13.183  -2.443  1.00 0.00 ? 83  ARG A O    5  
ATOM 7196  C CB   . ARG A 1 75 ? 9.364   15.299  -1.013  1.00 0.00 ? 83  ARG A CB   5  
ATOM 7197  C CG   . ARG A 1 75 ? 10.407  15.598  0.052   1.00 0.00 ? 83  ARG A CG   5  
ATOM 7198  C CD   . ARG A 1 75 ? 9.764   15.847  1.408   1.00 0.00 ? 83  ARG A CD   5  
ATOM 7199  N NE   . ARG A 1 75 ? 10.663  15.516  2.511   1.00 0.00 ? 83  ARG A NE   5  
ATOM 7200  C CZ   . ARG A 1 75 ? 11.749  16.220  2.818   1.00 0.00 ? 83  ARG A CZ   5  
ATOM 7201  N NH1  . ARG A 1 75 ? 12.077  17.293  2.110   1.00 0.00 ? 83  ARG A NH1  5  
ATOM 7202  N NH2  . ARG A 1 75 ? 12.511  15.850  3.838   1.00 0.00 ? 83  ARG A NH2  5  
ATOM 7203  H H    . ARG A 1 75 ? 11.221  13.619  -1.575  1.00 0.00 ? 83  ARG A H    5  
ATOM 7204  H HA   . ARG A 1 75 ? 8.604   13.391  -0.405  1.00 0.00 ? 83  ARG A HA   5  
ATOM 7205  H HB2  . ARG A 1 75 ? 9.687   15.751  -1.938  1.00 0.00 ? 83  ARG A HB2  5  
ATOM 7206  H HB3  . ARG A 1 75 ? 8.430   15.748  -0.709  1.00 0.00 ? 83  ARG A HB3  5  
ATOM 7207  H HG2  . ARG A 1 75 ? 11.079  14.759  0.135   1.00 0.00 ? 83  ARG A HG2  5  
ATOM 7208  H HG3  . ARG A 1 75 ? 10.962  16.478  -0.239  1.00 0.00 ? 83  ARG A HG3  5  
ATOM 7209  H HD2  . ARG A 1 75 ? 9.495   16.891  1.478   1.00 0.00 ? 83  ARG A HD2  5  
ATOM 7210  H HD3  . ARG A 1 75 ? 8.874   15.241  1.486   1.00 0.00 ? 83  ARG A HD3  5  
ATOM 7211  H HE   . ARG A 1 75 ? 10.445  14.727  3.050   1.00 0.00 ? 83  ARG A HE   5  
ATOM 7212  H HH11 . ARG A 1 75 ? 11.506  17.579  1.340   1.00 0.00 ? 83  ARG A HH11 5  
ATOM 7213  H HH12 . ARG A 1 75 ? 12.894  17.819  2.347   1.00 0.00 ? 83  ARG A HH12 5  
ATOM 7214  H HH21 . ARG A 1 75 ? 12.270  15.041  4.375   1.00 0.00 ? 83  ARG A HH21 5  
ATOM 7215  H HH22 . ARG A 1 75 ? 13.328  16.378  4.070   1.00 0.00 ? 83  ARG A HH22 5  
ATOM 7216  N N    . SER A 1 76 ? 8.915   13.868  -3.660  1.00 0.00 ? 84  SER A N    5  
ATOM 7217  C CA   . SER A 1 76 ? 8.241   13.703  -4.943  1.00 0.00 ? 84  SER A CA   5  
ATOM 7218  C C    . SER A 1 76 ? 8.707   12.423  -5.627  1.00 0.00 ? 84  SER A C    5  
ATOM 7219  O O    . SER A 1 76 ? 9.627   12.445  -6.444  1.00 0.00 ? 84  SER A O    5  
ATOM 7220  C CB   . SER A 1 76 ? 8.511   14.908  -5.844  1.00 0.00 ? 84  SER A CB   5  
ATOM 7221  O OG   . SER A 1 76 ? 9.899   15.181  -5.930  1.00 0.00 ? 84  SER A OG   5  
ATOM 7222  H H    . SER A 1 76 ? 9.844   14.185  -3.646  1.00 0.00 ? 84  SER A H    5  
ATOM 7223  H HA   . SER A 1 76 ? 7.182   13.632  -4.754  1.00 0.00 ? 84  SER A HA   5  
ATOM 7224  H HB2  . SER A 1 76 ? 8.137   14.702  -6.836  1.00 0.00 ? 84  SER A HB2  5  
ATOM 7225  H HB3  . SER A 1 76 ? 8.009   15.775  -5.442  1.00 0.00 ? 84  SER A HB3  5  
ATOM 7226  H HG   . SER A 1 76 ? 10.031  16.118  -6.091  1.00 0.00 ? 84  SER A HG   5  
ATOM 7227  N N    . LEU A 1 77 ? 8.077   11.306  -5.279  1.00 0.00 ? 85  LEU A N    5  
ATOM 7228  C CA   . LEU A 1 77 ? 8.438   10.015  -5.851  1.00 0.00 ? 85  LEU A CA   5  
ATOM 7229  C C    . LEU A 1 77 ? 7.287   9.421   -6.656  1.00 0.00 ? 85  LEU A C    5  
ATOM 7230  O O    . LEU A 1 77 ? 6.116   9.597   -6.315  1.00 0.00 ? 85  LEU A O    5  
ATOM 7231  C CB   . LEU A 1 77 ? 8.861   9.038   -4.747  1.00 0.00 ? 85  LEU A CB   5  
ATOM 7232  C CG   . LEU A 1 77 ? 8.432   9.422   -3.327  1.00 0.00 ? 85  LEU A CG   5  
ATOM 7233  C CD1  . LEU A 1 77 ? 6.938   9.205   -3.142  1.00 0.00 ? 85  LEU A CD1  5  
ATOM 7234  C CD2  . LEU A 1 77 ? 9.223   8.621   -2.304  1.00 0.00 ? 85  LEU A CD2  5  
ATOM 7235  H H    . LEU A 1 77 ? 7.358   11.349  -4.614  1.00 0.00 ? 85  LEU A H    5  
ATOM 7236  H HA   . LEU A 1 77 ? 9.275   10.173  -6.513  1.00 0.00 ? 85  LEU A HA   5  
ATOM 7237  H HB2  . LEU A 1 77 ? 8.443   8.069   -4.975  1.00 0.00 ? 85  LEU A HB2  5  
ATOM 7238  H HB3  . LEU A 1 77 ? 9.937   8.957   -4.763  1.00 0.00 ? 85  LEU A HB3  5  
ATOM 7239  H HG   . LEU A 1 77 ? 8.641   10.470  -3.166  1.00 0.00 ? 85  LEU A HG   5  
ATOM 7240  H HD11 . LEU A 1 77 ? 6.603   8.427   -3.811  1.00 0.00 ? 85  LEU A HD11 5  
ATOM 7241  H HD12 . LEU A 1 77 ? 6.412   10.123  -3.361  1.00 0.00 ? 85  LEU A HD12 5  
ATOM 7242  H HD13 . LEU A 1 77 ? 6.743   8.912   -2.122  1.00 0.00 ? 85  LEU A HD13 5  
ATOM 7243  H HD21 . LEU A 1 77 ? 8.961   7.576   -2.385  1.00 0.00 ? 85  LEU A HD21 5  
ATOM 7244  H HD22 . LEU A 1 77 ? 8.986   8.974   -1.311  1.00 0.00 ? 85  LEU A HD22 5  
ATOM 7245  H HD23 . LEU A 1 77 ? 10.280  8.743   -2.488  1.00 0.00 ? 85  LEU A HD23 5  
ATOM 7246  N N    . THR A 1 78 ? 7.635   8.705   -7.720  1.00 0.00 ? 86  THR A N    5  
ATOM 7247  C CA   . THR A 1 78 ? 6.644   8.066   -8.575  1.00 0.00 ? 86  THR A CA   5  
ATOM 7248  C C    . THR A 1 78 ? 6.357   6.650   -8.089  1.00 0.00 ? 86  THR A C    5  
ATOM 7249  O O    . THR A 1 78 ? 7.247   5.800   -8.069  1.00 0.00 ? 86  THR A O    5  
ATOM 7250  C CB   . THR A 1 78 ? 7.136   8.031   -10.023 1.00 0.00 ? 86  THR A CB   5  
ATOM 7251  O OG1  . THR A 1 78 ? 7.751   9.258   -10.374 1.00 0.00 ? 86  THR A OG1  5  
ATOM 7252  C CG2  . THR A 1 78 ? 6.033   7.767   -11.025 1.00 0.00 ? 86  THR A CG2  5  
ATOM 7253  H H    . THR A 1 78 ? 8.585   8.597   -7.931  1.00 0.00 ? 86  THR A H    5  
ATOM 7254  H HA   . THR A 1 78 ? 5.733   8.646   -8.525  1.00 0.00 ? 86  THR A HA   5  
ATOM 7255  H HB   . THR A 1 78 ? 7.870   7.245   -10.123 1.00 0.00 ? 86  THR A HB   5  
ATOM 7256  H HG1  . THR A 1 78 ? 7.084   9.948   -10.421 1.00 0.00 ? 86  THR A HG1  5  
ATOM 7257  H HG21 . THR A 1 78 ? 6.405   7.126   -11.810 1.00 0.00 ? 86  THR A HG21 5  
ATOM 7258  H HG22 . THR A 1 78 ? 5.702   8.703   -11.451 1.00 0.00 ? 86  THR A HG22 5  
ATOM 7259  H HG23 . THR A 1 78 ? 5.204   7.284   -10.529 1.00 0.00 ? 86  THR A HG23 5  
ATOM 7260  N N    . ILE A 1 79 ? 5.114   6.403   -7.688  1.00 0.00 ? 87  ILE A N    5  
ATOM 7261  C CA   . ILE A 1 79 ? 4.724   5.090   -7.192  1.00 0.00 ? 87  ILE A CA   5  
ATOM 7262  C C    . ILE A 1 79 ? 3.698   4.428   -8.106  1.00 0.00 ? 87  ILE A C    5  
ATOM 7263  O O    . ILE A 1 79 ? 2.615   4.968   -8.338  1.00 0.00 ? 87  ILE A O    5  
ATOM 7264  C CB   . ILE A 1 79 ? 4.145   5.180   -5.767  1.00 0.00 ? 87  ILE A CB   5  
ATOM 7265  C CG1  . ILE A 1 79 ? 3.032   6.227   -5.708  1.00 0.00 ? 87  ILE A CG1  5  
ATOM 7266  C CG2  . ILE A 1 79 ? 5.244   5.512   -4.769  1.00 0.00 ? 87  ILE A CG2  5  
ATOM 7267  C CD1  . ILE A 1 79 ? 2.465   6.432   -4.320  1.00 0.00 ? 87  ILE A CD1  5  
ATOM 7268  H H    . ILE A 1 79 ? 4.450   7.122   -7.720  1.00 0.00 ? 87  ILE A H    5  
ATOM 7269  H HA   . ILE A 1 79 ? 5.609   4.471   -7.158  1.00 0.00 ? 87  ILE A HA   5  
ATOM 7270  H HB   . ILE A 1 79 ? 3.736   4.216   -5.507  1.00 0.00 ? 87  ILE A HB   5  
ATOM 7271  H HG12 . ILE A 1 79 ? 3.423   7.175   -6.048  1.00 0.00 ? 87  ILE A HG12 5  
ATOM 7272  H HG13 . ILE A 1 79 ? 2.224   5.923   -6.356  1.00 0.00 ? 87  ILE A HG13 5  
ATOM 7273  H HG21 . ILE A 1 79 ? 5.938   4.688   -4.714  1.00 0.00 ? 87  ILE A HG21 5  
ATOM 7274  H HG22 . ILE A 1 79 ? 4.809   5.682   -3.797  1.00 0.00 ? 87  ILE A HG22 5  
ATOM 7275  H HG23 . ILE A 1 79 ? 5.766   6.401   -5.092  1.00 0.00 ? 87  ILE A HG23 5  
ATOM 7276  H HD11 . ILE A 1 79 ? 1.481   6.870   -4.394  1.00 0.00 ? 87  ILE A HD11 5  
ATOM 7277  H HD12 . ILE A 1 79 ? 3.111   7.092   -3.760  1.00 0.00 ? 87  ILE A HD12 5  
ATOM 7278  H HD13 . ILE A 1 79 ? 2.397   5.480   -3.815  1.00 0.00 ? 87  ILE A HD13 5  
ATOM 7279  N N    . SER A 1 80 ? 4.044   3.249   -8.614  1.00 0.00 ? 88  SER A N    5  
ATOM 7280  C CA   . SER A 1 80 ? 3.153   2.502   -9.494  1.00 0.00 ? 88  SER A CA   5  
ATOM 7281  C C    . SER A 1 80 ? 2.315   1.514   -8.689  1.00 0.00 ? 88  SER A C    5  
ATOM 7282  O O    . SER A 1 80 ? 2.852   0.644   -8.005  1.00 0.00 ? 88  SER A O    5  
ATOM 7283  C CB   . SER A 1 80 ? 3.958   1.760   -10.561 1.00 0.00 ? 88  SER A CB   5  
ATOM 7284  O OG   . SER A 1 80 ? 3.307   1.812   -11.818 1.00 0.00 ? 88  SER A OG   5  
ATOM 7285  H H    . SER A 1 80 ? 4.917   2.868   -8.385  1.00 0.00 ? 88  SER A H    5  
ATOM 7286  H HA   . SER A 1 80 ? 2.494   3.208   -9.977  1.00 0.00 ? 88  SER A HA   5  
ATOM 7287  H HB2  . SER A 1 80 ? 4.933   2.214   -10.656 1.00 0.00 ? 88  SER A HB2  5  
ATOM 7288  H HB3  . SER A 1 80 ? 4.070   0.725   -10.271 1.00 0.00 ? 88  SER A HB3  5  
ATOM 7289  H HG   . SER A 1 80 ? 2.937   0.950   -12.025 1.00 0.00 ? 88  SER A HG   5  
ATOM 7290  N N    . ILE A 1 81 ? 0.997   1.663   -8.767  1.00 0.00 ? 89  ILE A N    5  
ATOM 7291  C CA   . ILE A 1 81 ? 0.087   0.788   -8.039  1.00 0.00 ? 89  ILE A CA   5  
ATOM 7292  C C    . ILE A 1 81 ? -0.882  0.087   -8.986  1.00 0.00 ? 89  ILE A C    5  
ATOM 7293  O O    . ILE A 1 81 ? -1.324  0.664   -9.976  1.00 0.00 ? 89  ILE A O    5  
ATOM 7294  C CB   . ILE A 1 81 ? -0.712  1.581   -6.982  1.00 0.00 ? 89  ILE A CB   5  
ATOM 7295  C CG1  . ILE A 1 81 ? -1.676  0.659   -6.222  1.00 0.00 ? 89  ILE A CG1  5  
ATOM 7296  C CG2  . ILE A 1 81 ? -1.459  2.736   -7.634  1.00 0.00 ? 89  ILE A CG2  5  
ATOM 7297  C CD1  . ILE A 1 81 ? -3.015  0.461   -6.907  1.00 0.00 ? 89  ILE A CD1  5  
ATOM 7298  H H    . ILE A 1 81 ? 0.628   2.379   -9.325  1.00 0.00 ? 89  ILE A H    5  
ATOM 7299  H HA   . ILE A 1 81 ? 0.678   0.042   -7.528  1.00 0.00 ? 89  ILE A HA   5  
ATOM 7300  H HB   . ILE A 1 81 ? -0.007  2.000   -6.279  1.00 0.00 ? 89  ILE A HB   5  
ATOM 7301  H HG12 . ILE A 1 81 ? -1.219  -0.312  -6.111  1.00 0.00 ? 89  ILE A HG12 5  
ATOM 7302  H HG13 . ILE A 1 81 ? -1.861  1.077   -5.244  1.00 0.00 ? 89  ILE A HG13 5  
ATOM 7303  H HG21 . ILE A 1 81 ? -1.682  2.486   -8.661  1.00 0.00 ? 89  ILE A HG21 5  
ATOM 7304  H HG22 . ILE A 1 81 ? -0.847  3.625   -7.603  1.00 0.00 ? 89  ILE A HG22 5  
ATOM 7305  H HG23 . ILE A 1 81 ? -2.381  2.915   -7.100  1.00 0.00 ? 89  ILE A HG23 5  
ATOM 7306  H HD11 . ILE A 1 81 ? -3.769  1.039   -6.393  1.00 0.00 ? 89  ILE A HD11 5  
ATOM 7307  H HD12 . ILE A 1 81 ? -3.282  -0.585  -6.879  1.00 0.00 ? 89  ILE A HD12 5  
ATOM 7308  H HD13 . ILE A 1 81 ? -2.950  0.789   -7.934  1.00 0.00 ? 89  ILE A HD13 5  
ATOM 7309  N N    . VAL A 1 82 ? -1.212  -1.160  -8.667  1.00 0.00 ? 90  VAL A N    5  
ATOM 7310  C CA   . VAL A 1 82 ? -2.133  -1.939  -9.484  1.00 0.00 ? 90  VAL A CA   5  
ATOM 7311  C C    . VAL A 1 82 ? -3.408  -2.257  -8.707  1.00 0.00 ? 90  VAL A C    5  
ATOM 7312  O O    . VAL A 1 82 ? -3.383  -3.008  -7.733  1.00 0.00 ? 90  VAL A O    5  
ATOM 7313  C CB   . VAL A 1 82 ? -1.489  -3.252  -9.963  1.00 0.00 ? 90  VAL A CB   5  
ATOM 7314  C CG1  . VAL A 1 82 ? -2.422  -3.998  -10.907 1.00 0.00 ? 90  VAL A CG1  5  
ATOM 7315  C CG2  . VAL A 1 82 ? -0.151  -2.981  -10.633 1.00 0.00 ? 90  VAL A CG2  5  
ATOM 7316  H H    . VAL A 1 82 ? -0.830  -1.564  -7.860  1.00 0.00 ? 90  VAL A H    5  
ATOM 7317  H HA   . VAL A 1 82 ? -2.391  -1.349  -10.352 1.00 0.00 ? 90  VAL A HA   5  
ATOM 7318  H HB   . VAL A 1 82 ? -1.314  -3.877  -9.102  1.00 0.00 ? 90  VAL A HB   5  
ATOM 7319  H HG11 . VAL A 1 82 ? -3.244  -4.415  -10.344 1.00 0.00 ? 90  VAL A HG11 5  
ATOM 7320  H HG12 . VAL A 1 82 ? -1.880  -4.792  -11.396 1.00 0.00 ? 90  VAL A HG12 5  
ATOM 7321  H HG13 . VAL A 1 82 ? -2.806  -3.313  -11.648 1.00 0.00 ? 90  VAL A HG13 5  
ATOM 7322  H HG21 . VAL A 1 82 ? 0.225   -2.020  -10.310 1.00 0.00 ? 90  VAL A HG21 5  
ATOM 7323  H HG22 . VAL A 1 82 ? -0.279  -2.975  -11.705 1.00 0.00 ? 90  VAL A HG22 5  
ATOM 7324  H HG23 . VAL A 1 82 ? 0.552   -3.753  -10.357 1.00 0.00 ? 90  VAL A HG23 5  
ATOM 7325  N N    . ALA A 1 83 ? -4.517  -1.672  -9.142  1.00 0.00 ? 91  ALA A N    5  
ATOM 7326  C CA   . ALA A 1 83 ? -5.805  -1.880  -8.488  1.00 0.00 ? 91  ALA A CA   5  
ATOM 7327  C C    . ALA A 1 83 ? -6.168  -3.361  -8.427  1.00 0.00 ? 91  ALA A C    5  
ATOM 7328  O O    . ALA A 1 83 ? -5.952  -4.103  -9.385  1.00 0.00 ? 91  ALA A O    5  
ATOM 7329  C CB   . ALA A 1 83 ? -6.891  -1.099  -9.211  1.00 0.00 ? 91  ALA A CB   5  
ATOM 7330  H H    . ALA A 1 83 ? -4.468  -1.080  -9.920  1.00 0.00 ? 91  ALA A H    5  
ATOM 7331  H HA   . ALA A 1 83 ? -5.731  -1.497  -7.481  1.00 0.00 ? 91  ALA A HA   5  
ATOM 7332  H HB1  . ALA A 1 83 ? -7.815  -1.660  -9.187  1.00 0.00 ? 91  ALA A HB1  5  
ATOM 7333  H HB2  . ALA A 1 83 ? -6.597  -0.936  -10.237 1.00 0.00 ? 91  ALA A HB2  5  
ATOM 7334  H HB3  . ALA A 1 83 ? -7.035  -0.147  -8.723  1.00 0.00 ? 91  ALA A HB3  5  
ATOM 7335  N N    . ALA A 1 84 ? -6.725  -3.779  -7.289  1.00 0.00 ? 92  ALA A N    5  
ATOM 7336  C CA   . ALA A 1 84 ? -7.135  -5.169  -7.078  1.00 0.00 ? 92  ALA A CA   5  
ATOM 7337  C C    . ALA A 1 84 ? -5.968  -6.053  -6.633  1.00 0.00 ? 92  ALA A C    5  
ATOM 7338  O O    . ALA A 1 84 ? -6.180  -7.145  -6.108  1.00 0.00 ? 92  ALA A O    5  
ATOM 7339  C CB   . ALA A 1 84 ? -7.783  -5.740  -8.332  1.00 0.00 ? 92  ALA A CB   5  
ATOM 7340  H H    . ALA A 1 84 ? -6.870  -3.130  -6.568  1.00 0.00 ? 92  ALA A H    5  
ATOM 7341  H HA   . ALA A 1 84 ? -7.880  -5.171  -6.295  1.00 0.00 ? 92  ALA A HA   5  
ATOM 7342  H HB1  . ALA A 1 84 ? -8.468  -6.529  -8.056  1.00 0.00 ? 92  ALA A HB1  5  
ATOM 7343  H HB2  . ALA A 1 84 ? -7.018  -6.137  -8.981  1.00 0.00 ? 92  ALA A HB2  5  
ATOM 7344  H HB3  . ALA A 1 84 ? -8.322  -4.959  -8.845  1.00 0.00 ? 92  ALA A HB3  5  
ATOM 7345  N N    . ALA A 1 85 ? -4.743  -5.579  -6.838  1.00 0.00 ? 93  ALA A N    5  
ATOM 7346  C CA   . ALA A 1 85 ? -3.561  -6.338  -6.448  1.00 0.00 ? 93  ALA A CA   5  
ATOM 7347  C C    . ALA A 1 85 ? -3.554  -6.618  -4.946  1.00 0.00 ? 93  ALA A C    5  
ATOM 7348  O O    . ALA A 1 85 ? -2.855  -7.516  -4.473  1.00 0.00 ? 93  ALA A O    5  
ATOM 7349  C CB   . ALA A 1 85 ? -2.303  -5.587  -6.854  1.00 0.00 ? 93  ALA A CB   5  
ATOM 7350  H H    . ALA A 1 85 ? -4.627  -4.702  -7.255  1.00 0.00 ? 93  ALA A H    5  
ATOM 7351  H HA   . ALA A 1 85 ? -3.577  -7.279  -6.979  1.00 0.00 ? 93  ALA A HA   5  
ATOM 7352  H HB1  . ALA A 1 85 ? -2.207  -5.597  -7.929  1.00 0.00 ? 93  ALA A HB1  5  
ATOM 7353  H HB2  . ALA A 1 85 ? -1.439  -6.062  -6.411  1.00 0.00 ? 93  ALA A HB2  5  
ATOM 7354  H HB3  . ALA A 1 85 ? -2.368  -4.565  -6.510  1.00 0.00 ? 93  ALA A HB3  5  
ATOM 7355  N N    . GLY A 1 86 ? -4.334  -5.840  -4.199  1.00 0.00 ? 94  GLY A N    5  
ATOM 7356  C CA   . GLY A 1 86 ? -4.406  -6.009  -2.760  1.00 0.00 ? 94  GLY A CA   5  
ATOM 7357  C C    . GLY A 1 86 ? -5.778  -6.460  -2.293  1.00 0.00 ? 94  GLY A C    5  
ATOM 7358  O O    . GLY A 1 86 ? -5.900  -7.153  -1.284  1.00 0.00 ? 94  GLY A O    5  
ATOM 7359  H H    . GLY A 1 86 ? -4.863  -5.139  -4.631  1.00 0.00 ? 94  GLY A H    5  
ATOM 7360  H HA2  . GLY A 1 86 ? -3.676  -6.745  -2.458  1.00 0.00 ? 94  GLY A HA2  5  
ATOM 7361  H HA3  . GLY A 1 86 ? -4.170  -5.069  -2.286  1.00 0.00 ? 94  GLY A HA3  5  
ATOM 7362  N N    . ARG A 1 87 ? -6.810  -6.049  -3.021  1.00 0.00 ? 95  ARG A N    5  
ATOM 7363  C CA   . ARG A 1 87 ? -8.186  -6.396  -2.670  1.00 0.00 ? 95  ARG A CA   5  
ATOM 7364  C C    . ARG A 1 87 ? -8.370  -7.906  -2.577  1.00 0.00 ? 95  ARG A C    5  
ATOM 7365  O O    . ARG A 1 87 ? -9.139  -8.393  -1.748  1.00 0.00 ? 95  ARG A O    5  
ATOM 7366  C CB   . ARG A 1 87 ? -9.156  -5.825  -3.707  1.00 0.00 ? 95  ARG A CB   5  
ATOM 7367  C CG   . ARG A 1 87 ? -9.217  -4.307  -3.715  1.00 0.00 ? 95  ARG A CG   5  
ATOM 7368  C CD   . ARG A 1 87 ? -10.200 -3.795  -4.756  1.00 0.00 ? 95  ARG A CD   5  
ATOM 7369  N NE   . ARG A 1 87 ? -11.586 -4.040  -4.366  1.00 0.00 ? 95  ARG A NE   5  
ATOM 7370  C CZ   . ARG A 1 87 ? -12.629 -3.396  -4.888  1.00 0.00 ? 95  ARG A CZ   5  
ATOM 7371  N NH1  . ARG A 1 87 ? -12.446 -2.470  -5.820  1.00 0.00 ? 95  ARG A NH1  5  
ATOM 7372  N NH2  . ARG A 1 87 ? -13.857 -3.682  -4.476  1.00 0.00 ? 95  ARG A NH2  5  
ATOM 7373  H H    . ARG A 1 87 ? -6.647  -5.490  -3.807  1.00 0.00 ? 95  ARG A H    5  
ATOM 7374  H HA   . ARG A 1 87 ? -8.403  -5.957  -1.708  1.00 0.00 ? 95  ARG A HA   5  
ATOM 7375  H HB2  . ARG A 1 87 ? -8.851  -6.156  -4.688  1.00 0.00 ? 95  ARG A HB2  5  
ATOM 7376  H HB3  . ARG A 1 87 ? -10.146 -6.202  -3.500  1.00 0.00 ? 95  ARG A HB3  5  
ATOM 7377  H HG2  . ARG A 1 87 ? -9.531  -3.964  -2.741  1.00 0.00 ? 95  ARG A HG2  5  
ATOM 7378  H HG3  . ARG A 1 87 ? -8.235  -3.917  -3.938  1.00 0.00 ? 95  ARG A HG3  5  
ATOM 7379  H HD2  . ARG A 1 87 ? -10.053 -2.731  -4.878  1.00 0.00 ? 95  ARG A HD2  5  
ATOM 7380  H HD3  . ARG A 1 87 ? -10.004 -4.295  -5.694  1.00 0.00 ? 95  ARG A HD3  5  
ATOM 7381  H HE   . ARG A 1 87 ? -11.749 -4.720  -3.680  1.00 0.00 ? 95  ARG A HE   5  
ATOM 7382  H HH11 . ARG A 1 87 ? -11.523 -2.252  -6.136  1.00 0.00 ? 95  ARG A HH11 5  
ATOM 7383  H HH12 . ARG A 1 87 ? -13.234 -1.990  -6.208  1.00 0.00 ? 95  ARG A HH12 5  
ATOM 7384  H HH21 . ARG A 1 87 ? -14.000 -4.380  -3.774  1.00 0.00 ? 95  ARG A HH21 5  
ATOM 7385  H HH22 . ARG A 1 87 ? -14.639 -3.197  -4.868  1.00 0.00 ? 95  ARG A HH22 5  
ATOM 7386  N N    . GLU A 1 88 ? -7.662  -8.647  -3.424  1.00 0.00 ? 96  GLU A N    5  
ATOM 7387  C CA   . GLU A 1 88 ? -7.759  -10.103 -3.420  1.00 0.00 ? 96  GLU A CA   5  
ATOM 7388  C C    . GLU A 1 88 ? -7.477  -10.659 -2.027  1.00 0.00 ? 96  GLU A C    5  
ATOM 7389  O O    . GLU A 1 88 ? -8.246  -11.462 -1.499  1.00 0.00 ? 96  GLU A O    5  
ATOM 7390  C CB   . GLU A 1 88 ? -6.781  -10.705 -4.432  1.00 0.00 ? 96  GLU A CB   5  
ATOM 7391  C CG   . GLU A 1 88 ? -5.346  -10.239 -4.243  1.00 0.00 ? 96  GLU A CG   5  
ATOM 7392  C CD   . GLU A 1 88 ? -4.518  -10.377 -5.507  1.00 0.00 ? 96  GLU A CD   5  
ATOM 7393  O OE1  . GLU A 1 88 ? -4.844  -11.252 -6.338  1.00 0.00 ? 96  GLU A OE1  5  
ATOM 7394  O OE2  . GLU A 1 88 ? -3.545  -9.612  -5.665  1.00 0.00 ? 96  GLU A OE2  5  
ATOM 7395  H H    . GLU A 1 88 ? -7.064  -8.207  -4.062  1.00 0.00 ? 96  GLU A H    5  
ATOM 7396  H HA   . GLU A 1 88 ? -8.766  -10.369 -3.704  1.00 0.00 ? 96  GLU A HA   5  
ATOM 7397  H HB2  . GLU A 1 88 ? -6.802  -11.780 -4.339  1.00 0.00 ? 96  GLU A HB2  5  
ATOM 7398  H HB3  . GLU A 1 88 ? -7.098  -10.433 -5.427  1.00 0.00 ? 96  GLU A HB3  5  
ATOM 7399  H HG2  . GLU A 1 88 ? -5.354  -9.200  -3.949  1.00 0.00 ? 96  GLU A HG2  5  
ATOM 7400  H HG3  . GLU A 1 88 ? -4.889  -10.831 -3.464  1.00 0.00 ? 96  GLU A HG3  5  
ATOM 7401  N N    . LEU A 1 89 ? -6.373  -10.218 -1.434  1.00 0.00 ? 97  LEU A N    5  
ATOM 7402  C CA   . LEU A 1 89 ? -5.988  -10.662 -0.099  1.00 0.00 ? 97  LEU A CA   5  
ATOM 7403  C C    . LEU A 1 89 ? -6.910  -10.067 0.961   1.00 0.00 ? 97  LEU A C    5  
ATOM 7404  O O    . LEU A 1 89 ? -7.329  -10.755 1.892   1.00 0.00 ? 97  LEU A O    5  
ATOM 7405  C CB   . LEU A 1 89 ? -4.538  -10.274 0.191   1.00 0.00 ? 97  LEU A CB   5  
ATOM 7406  C CG   . LEU A 1 89 ? -3.545  -10.605 -0.925  1.00 0.00 ? 97  LEU A CG   5  
ATOM 7407  C CD1  . LEU A 1 89 ? -2.182  -10.008 -0.620  1.00 0.00 ? 97  LEU A CD1  5  
ATOM 7408  C CD2  . LEU A 1 89 ? -3.441  -12.111 -1.113  1.00 0.00 ? 97  LEU A CD2  5  
ATOM 7409  H H    . LEU A 1 89 ? -5.803  -9.573  -1.903  1.00 0.00 ? 97  LEU A H    5  
ATOM 7410  H HA   . LEU A 1 89 ? -6.076  -11.738 -0.071  1.00 0.00 ? 97  LEU A HA   5  
ATOM 7411  H HB2  . LEU A 1 89 ? -4.501  -9.209  0.373   1.00 0.00 ? 97  LEU A HB2  5  
ATOM 7412  H HB3  . LEU A 1 89 ? -4.222  -10.787 1.087   1.00 0.00 ? 97  LEU A HB3  5  
ATOM 7413  H HG   . LEU A 1 89 ? -3.899  -10.175 -1.851  1.00 0.00 ? 97  LEU A HG   5  
ATOM 7414  H HD11 . LEU A 1 89 ? -2.302  -9.129  -0.005  1.00 0.00 ? 97  LEU A HD11 5  
ATOM 7415  H HD12 . LEU A 1 89 ? -1.694  -9.736  -1.545  1.00 0.00 ? 97  LEU A HD12 5  
ATOM 7416  H HD13 . LEU A 1 89 ? -1.580  -10.734 -0.096  1.00 0.00 ? 97  LEU A HD13 5  
ATOM 7417  H HD21 . LEU A 1 89 ? -3.207  -12.575 -0.167  1.00 0.00 ? 97  LEU A HD21 5  
ATOM 7418  H HD22 . LEU A 1 89 ? -2.660  -12.331 -1.825  1.00 0.00 ? 97  LEU A HD22 5  
ATOM 7419  H HD23 . LEU A 1 89 ? -4.381  -12.494 -1.480  1.00 0.00 ? 97  LEU A HD23 5  
ATOM 7420  N N    . PHE A 1 90 ? -7.219  -8.780  0.814   1.00 0.00 ? 98  PHE A N    5  
ATOM 7421  C CA   . PHE A 1 90 ? -8.088  -8.083  1.758   1.00 0.00 ? 98  PHE A CA   5  
ATOM 7422  C C    . PHE A 1 90 ? -9.377  -8.863  2.003   1.00 0.00 ? 98  PHE A C    5  
ATOM 7423  O O    . PHE A 1 90 ? -9.842  -8.975  3.137   1.00 0.00 ? 98  PHE A O    5  
ATOM 7424  C CB   . PHE A 1 90 ? -8.415  -6.681  1.238   1.00 0.00 ? 98  PHE A CB   5  
ATOM 7425  C CG   . PHE A 1 90 ? -7.586  -5.599  1.870   1.00 0.00 ? 98  PHE A CG   5  
ATOM 7426  C CD1  . PHE A 1 90 ? -7.968  -5.029  3.074   1.00 0.00 ? 98  PHE A CD1  5  
ATOM 7427  C CD2  . PHE A 1 90 ? -6.425  -5.154  1.260   1.00 0.00 ? 98  PHE A CD2  5  
ATOM 7428  C CE1  . PHE A 1 90 ? -7.207  -4.034  3.658   1.00 0.00 ? 98  PHE A CE1  5  
ATOM 7429  C CE2  . PHE A 1 90 ? -5.659  -4.159  1.839   1.00 0.00 ? 98  PHE A CE2  5  
ATOM 7430  C CZ   . PHE A 1 90 ? -6.051  -3.599  3.039   1.00 0.00 ? 98  PHE A CZ   5  
ATOM 7431  H H    . PHE A 1 90 ? -6.850  -8.286  0.052   1.00 0.00 ? 98  PHE A H    5  
ATOM 7432  H HA   . PHE A 1 90 ? -7.555  -7.992  2.693   1.00 0.00 ? 98  PHE A HA   5  
ATOM 7433  H HB2  . PHE A 1 90 ? -8.245  -6.651  0.173   1.00 0.00 ? 98  PHE A HB2  5  
ATOM 7434  H HB3  . PHE A 1 90 ? -9.455  -6.463  1.438   1.00 0.00 ? 98  PHE A HB3  5  
ATOM 7435  H HD1  . PHE A 1 90 ? -8.871  -5.368  3.558   1.00 0.00 ? 98  PHE A HD1  5  
ATOM 7436  H HD2  . PHE A 1 90 ? -6.116  -5.591  0.321   1.00 0.00 ? 98  PHE A HD2  5  
ATOM 7437  H HE1  . PHE A 1 90 ? -7.516  -3.597  4.594   1.00 0.00 ? 98  PHE A HE1  5  
ATOM 7438  H HE2  . PHE A 1 90 ? -4.756  -3.821  1.354   1.00 0.00 ? 98  PHE A HE2  5  
ATOM 7439  H HZ   . PHE A 1 90 ? -5.454  -2.821  3.494   1.00 0.00 ? 98  PHE A HZ   5  
ATOM 7440  N N    . MET A 1 91 ? -9.951  -9.401  0.931   1.00 0.00 ? 99  MET A N    5  
ATOM 7441  C CA   . MET A 1 91 ? -11.185 -10.170 1.030   1.00 0.00 ? 99  MET A CA   5  
ATOM 7442  C C    . MET A 1 91 ? -10.892 -11.628 1.370   1.00 0.00 ? 99  MET A C    5  
ATOM 7443  O O    . MET A 1 91 ? -10.061 -12.270 0.729   1.00 0.00 ? 99  MET A O    5  
ATOM 7444  C CB   . MET A 1 91 ? -11.968 -10.088 -0.281  1.00 0.00 ? 99  MET A CB   5  
ATOM 7445  C CG   . MET A 1 91 ? -11.246 -10.716 -1.462  1.00 0.00 ? 99  MET A CG   5  
ATOM 7446  S SD   . MET A 1 91 ? -12.058 -10.374 -3.035  1.00 0.00 ? 99  MET A SD   5  
ATOM 7447  C CE   . MET A 1 91 ? -13.743 -10.845 -2.653  1.00 0.00 ? 99  MET A CE   5  
ATOM 7448  H H    . MET A 1 91 ? -9.534  -9.277  0.053   1.00 0.00 ? 99  MET A H    5  
ATOM 7449  H HA   . MET A 1 91 ? -11.780 -9.741  1.822   1.00 0.00 ? 99  MET A HA   5  
ATOM 7450  H HB2  . MET A 1 91 ? -12.914 -10.593 -0.154  1.00 0.00 ? 99  MET A HB2  5  
ATOM 7451  H HB3  . MET A 1 91 ? -12.154 -9.049  -0.510  1.00 0.00 ? 99  MET A HB3  5  
ATOM 7452  H HG2  . MET A 1 91 ? -10.241 -10.325 -1.500  1.00 0.00 ? 99  MET A HG2  5  
ATOM 7453  H HG3  . MET A 1 91 ? -11.210 -11.785 -1.317  1.00 0.00 ? 99  MET A HG3  5  
ATOM 7454  H HE1  . MET A 1 91 ? -14.340 -9.958  -2.500  1.00 0.00 ? 99  MET A HE1  5  
ATOM 7455  H HE2  . MET A 1 91 ? -13.755 -11.446 -1.755  1.00 0.00 ? 99  MET A HE2  5  
ATOM 7456  H HE3  . MET A 1 91 ? -14.151 -11.417 -3.473  1.00 0.00 ? 99  MET A HE3  5  
ATOM 7457  N N    . THR A 1 92 ? -11.581 -12.145 2.383   1.00 0.00 ? 100 THR A N    5  
ATOM 7458  C CA   . THR A 1 92 ? -11.394 -13.527 2.808   1.00 0.00 ? 100 THR A CA   5  
ATOM 7459  C C    . THR A 1 92 ? -12.136 -14.486 1.882   1.00 0.00 ? 100 THR A C    5  
ATOM 7460  O O    . THR A 1 92 ? -13.011 -14.077 1.119   1.00 0.00 ? 100 THR A O    5  
ATOM 7461  C CB   . THR A 1 92 ? -11.878 -13.710 4.248   1.00 0.00 ? 100 THR A CB   5  
ATOM 7462  O OG1  . THR A 1 92 ? -11.601 -15.021 4.707   1.00 0.00 ? 100 THR A OG1  5  
ATOM 7463  C CG2  . THR A 1 92 ? -13.361 -13.465 4.417   1.00 0.00 ? 100 THR A CG2  5  
ATOM 7464  H H    . THR A 1 92 ? -12.231 -11.583 2.856   1.00 0.00 ? 100 THR A H    5  
ATOM 7465  H HA   . THR A 1 92 ? -10.338 -13.749 2.762   1.00 0.00 ? 100 THR A HA   5  
ATOM 7466  H HB   . THR A 1 92 ? -11.353 -13.011 4.883   1.00 0.00 ? 100 THR A HB   5  
ATOM 7467  H HG1  . THR A 1 92 ? -12.176 -15.647 4.260   1.00 0.00 ? 100 THR A HG1  5  
ATOM 7468  H HG21 . THR A 1 92 ? -13.908 -14.343 4.105   1.00 0.00 ? 100 THR A HG21 5  
ATOM 7469  H HG22 . THR A 1 92 ? -13.658 -12.621 3.813   1.00 0.00 ? 100 THR A HG22 5  
ATOM 7470  H HG23 . THR A 1 92 ? -13.575 -13.258 5.456   1.00 0.00 ? 100 THR A HG23 5  
ATOM 7471  N N    . THR B 2 1  ? -6.135  -10.732 14.205  1.00 0.00 ? 111 THR B N    5  
ATOM 7472  C CA   . THR B 2 1  ? -5.634  -9.363  14.207  1.00 0.00 ? 111 THR B CA   5  
ATOM 7473  C C    . THR B 2 1  ? -5.270  -8.913  12.795  1.00 0.00 ? 111 THR B C    5  
ATOM 7474  O O    . THR B 2 1  ? -4.817  -9.715  11.978  1.00 0.00 ? 111 THR B O    5  
ATOM 7475  C CB   . THR B 2 1  ? -4.414  -9.246  15.123  1.00 0.00 ? 111 THR B CB   5  
ATOM 7476  O OG1  . THR B 2 1  ? -3.611  -10.409 15.040  1.00 0.00 ? 111 THR B OG1  5  
ATOM 7477  C CG2  . THR B 2 1  ? -4.775  -9.041  16.579  1.00 0.00 ? 111 THR B CG2  5  
ATOM 7478  H H1   . THR B 2 1  ? -5.521  -11.464 13.989  1.00 0.00 ? 111 THR B H1   5  
ATOM 7479  H HA   . THR B 2 1  ? -6.418  -8.724  14.586  1.00 0.00 ? 111 THR B HA   5  
ATOM 7480  H HB   . THR B 2 1  ? -3.820  -8.400  14.807  1.00 0.00 ? 111 THR B HB   5  
ATOM 7481  H HG1  . THR B 2 1  ? -3.109  -10.394 14.221  1.00 0.00 ? 111 THR B HG1  5  
ATOM 7482  H HG21 . THR B 2 1  ? -4.258  -9.771  17.184  1.00 0.00 ? 111 THR B HG21 5  
ATOM 7483  H HG22 . THR B 2 1  ? -5.841  -9.158  16.705  1.00 0.00 ? 111 THR B HG22 5  
ATOM 7484  H HG23 . THR B 2 1  ? -4.483  -8.047  16.886  1.00 0.00 ? 111 THR B HG23 5  
ATOM 7485  N N    . PRO B 2 2  ? -5.462  -7.617  12.487  1.00 0.00 ? 112 PRO B N    5  
ATOM 7486  C CA   . PRO B 2 2  ? -5.150  -7.066  11.165  1.00 0.00 ? 112 PRO B CA   5  
ATOM 7487  C C    . PRO B 2 2  ? -3.648  -6.940  10.928  1.00 0.00 ? 112 PRO B C    5  
ATOM 7488  O O    . PRO B 2 2  ? -2.874  -6.783  11.871  1.00 0.00 ? 112 PRO B O    5  
ATOM 7489  C CB   . PRO B 2 2  ? -5.804  -5.684  11.197  1.00 0.00 ? 112 PRO B CB   5  
ATOM 7490  C CG   . PRO B 2 2  ? -5.816  -5.307  12.638  1.00 0.00 ? 112 PRO B CG   5  
ATOM 7491  C CD   . PRO B 2 2  ? -5.997  -6.590  13.402  1.00 0.00 ? 112 PRO B CD   5  
ATOM 7492  H HA   . PRO B 2 2  ? -5.590  -7.657  10.377  1.00 0.00 ? 112 PRO B HA   5  
ATOM 7493  H HB2  . PRO B 2 2  ? -5.217  -4.992  10.612  1.00 0.00 ? 112 PRO B HB2  5  
ATOM 7494  H HB3  . PRO B 2 2  ? -6.804  -5.746  10.798  1.00 0.00 ? 112 PRO B HB3  5  
ATOM 7495  H HG2  . PRO B 2 2  ? -4.877  -4.842  12.904  1.00 0.00 ? 112 PRO B HG2  5  
ATOM 7496  H HG3  . PRO B 2 2  ? -6.638  -4.635  12.835  1.00 0.00 ? 112 PRO B HG3  5  
ATOM 7497  H HD2  . PRO B 2 2  ? -5.433  -6.564  14.323  1.00 0.00 ? 112 PRO B HD2  5  
ATOM 7498  H HD3  . PRO B 2 2  ? -7.045  -6.764  13.605  1.00 0.00 ? 112 PRO B HD3  5  
ATOM 7499  N N    . LEU B 2 3  ? -3.247  -7.009  9.665   1.00 0.00 ? 113 LEU B N    5  
ATOM 7500  C CA   . LEU B 2 3  ? -1.837  -6.902  9.304   1.00 0.00 ? 113 LEU B CA   5  
ATOM 7501  C C    . LEU B 2 3  ? -1.264  -5.559  9.747   1.00 0.00 ? 113 LEU B C    5  
ATOM 7502  O O    . LEU B 2 3  ? -2.008  -4.632  10.068  1.00 0.00 ? 113 LEU B O    5  
ATOM 7503  C CB   . LEU B 2 3  ? -1.661  -7.071  7.794   1.00 0.00 ? 113 LEU B CB   5  
ATOM 7504  C CG   . LEU B 2 3  ? -2.351  -8.300  7.193   1.00 0.00 ? 113 LEU B CG   5  
ATOM 7505  C CD1  . LEU B 2 3  ? -2.959  -7.964  5.841   1.00 0.00 ? 113 LEU B CD1  5  
ATOM 7506  C CD2  . LEU B 2 3  ? -1.365  -9.452  7.066   1.00 0.00 ? 113 LEU B CD2  5  
ATOM 7507  H H    . LEU B 2 3  ? -3.912  -7.134  8.957   1.00 0.00 ? 113 LEU B H    5  
ATOM 7508  H HA   . LEU B 2 3  ? -1.305  -7.693  9.810   1.00 0.00 ? 113 LEU B HA   5  
ATOM 7509  H HB2  . LEU B 2 3  ? -2.054  -6.189  7.307   1.00 0.00 ? 113 LEU B HB2  5  
ATOM 7510  H HB3  . LEU B 2 3  ? -0.605  -7.138  7.581   1.00 0.00 ? 113 LEU B HB3  5  
ATOM 7511  H HG   . LEU B 2 3  ? -3.149  -8.611  7.850   1.00 0.00 ? 113 LEU B HG   5  
ATOM 7512  H HD11 . LEU B 2 3  ? -2.861  -8.813  5.180   1.00 0.00 ? 113 LEU B HD11 5  
ATOM 7513  H HD12 . LEU B 2 3  ? -2.444  -7.115  5.415   1.00 0.00 ? 113 LEU B HD12 5  
ATOM 7514  H HD13 . LEU B 2 3  ? -4.004  -7.724  5.965   1.00 0.00 ? 113 LEU B HD13 5  
ATOM 7515  H HD21 . LEU B 2 3  ? -1.907  -10.386 7.036   1.00 0.00 ? 113 LEU B HD21 5  
ATOM 7516  H HD22 . LEU B 2 3  ? -0.697  -9.450  7.915   1.00 0.00 ? 113 LEU B HD22 5  
ATOM 7517  H HD23 . LEU B 2 3  ? -0.794  -9.337  6.158   1.00 0.00 ? 113 LEU B HD23 5  
ATOM 7518  N N    . GLU B 2 4  ? 0.060   -5.462  9.762   1.00 0.00 ? 114 GLU B N    5  
ATOM 7519  C CA   . GLU B 2 4  ? 0.732   -4.231  10.166  1.00 0.00 ? 114 GLU B CA   5  
ATOM 7520  C C    . GLU B 2 4  ? 0.305   -3.064  9.281   1.00 0.00 ? 114 GLU B C    5  
ATOM 7521  O O    . GLU B 2 4  ? 0.067   -3.235  8.085   1.00 0.00 ? 114 GLU B O    5  
ATOM 7522  C CB   . GLU B 2 4  ? 2.251   -4.409  10.101  1.00 0.00 ? 114 GLU B CB   5  
ATOM 7523  C CG   . GLU B 2 4  ? 2.899   -4.604  11.463  1.00 0.00 ? 114 GLU B CG   5  
ATOM 7524  C CD   . GLU B 2 4  ? 3.971   -3.571  11.753  1.00 0.00 ? 114 GLU B CD   5  
ATOM 7525  O OE1  . GLU B 2 4  ? 5.102   -3.729  11.244  1.00 0.00 ? 114 GLU B OE1  5  
ATOM 7526  O OE2  . GLU B 2 4  ? 3.680   -2.605  12.488  1.00 0.00 ? 114 GLU B OE2  5  
ATOM 7527  H H    . GLU B 2 4  ? 0.600   -6.235  9.495   1.00 0.00 ? 114 GLU B H    5  
ATOM 7528  H HA   . GLU B 2 4  ? 0.447   -4.018  11.186  1.00 0.00 ? 114 GLU B HA   5  
ATOM 7529  H HB2  . GLU B 2 4  ? 2.475   -5.275  9.494   1.00 0.00 ? 114 GLU B HB2  5  
ATOM 7530  H HB3  . GLU B 2 4  ? 2.687   -3.536  9.640   1.00 0.00 ? 114 GLU B HB3  5  
ATOM 7531  H HG2  . GLU B 2 4  ? 2.136   -4.530  12.224  1.00 0.00 ? 114 GLU B HG2  5  
ATOM 7532  H HG3  . GLU B 2 4  ? 3.347   -5.585  11.498  1.00 0.00 ? 114 GLU B HG3  5  
ATOM 7533  N N    . ILE B 2 5  ? 0.206   -1.879  9.876   1.00 0.00 ? 115 ILE B N    5  
ATOM 7534  C CA   . ILE B 2 5  ? -0.196  -0.687  9.140   1.00 0.00 ? 115 ILE B CA   5  
ATOM 7535  C C    . ILE B 2 5  ? 0.684   0.506   9.501   1.00 0.00 ? 115 ILE B C    5  
ATOM 7536  O O    . ILE B 2 5  ? 1.019   0.712   10.667  1.00 0.00 ? 115 ILE B O    5  
ATOM 7537  C CB   . ILE B 2 5  ? -1.669  -0.327  9.415   1.00 0.00 ? 115 ILE B CB   5  
ATOM 7538  C CG1  . ILE B 2 5  ? -2.559  -1.559  9.242   1.00 0.00 ? 115 ILE B CG1  5  
ATOM 7539  C CG2  . ILE B 2 5  ? -2.121  0.794   8.492   1.00 0.00 ? 115 ILE B CG2  5  
ATOM 7540  C CD1  . ILE B 2 5  ? -3.919  -1.417  9.890   1.00 0.00 ? 115 ILE B CD1  5  
ATOM 7541  H H    . ILE B 2 5  ? 0.407   -1.807  10.832  1.00 0.00 ? 115 ILE B H    5  
ATOM 7542  H HA   . ILE B 2 5  ? -0.088  -0.895  8.085   1.00 0.00 ? 115 ILE B HA   5  
ATOM 7543  H HB   . ILE B 2 5  ? -1.746  0.025   10.433  1.00 0.00 ? 115 ILE B HB   5  
ATOM 7544  H HG12 . ILE B 2 5  ? -2.712  -1.739  8.188   1.00 0.00 ? 115 ILE B HG12 5  
ATOM 7545  H HG13 . ILE B 2 5  ? -2.069  -2.414  9.681   1.00 0.00 ? 115 ILE B HG13 5  
ATOM 7546  H HG21 . ILE B 2 5  ? -1.443  1.631   8.581   1.00 0.00 ? 115 ILE B HG21 5  
ATOM 7547  H HG22 . ILE B 2 5  ? -3.116  1.109   8.770   1.00 0.00 ? 115 ILE B HG22 5  
ATOM 7548  H HG23 . ILE B 2 5  ? -2.126  0.442   7.472   1.00 0.00 ? 115 ILE B HG23 5  
ATOM 7549  H HD11 . ILE B 2 5  ? -3.871  -0.669  10.667  1.00 0.00 ? 115 ILE B HD11 5  
ATOM 7550  H HD12 . ILE B 2 5  ? -4.213  -2.364  10.319  1.00 0.00 ? 115 ILE B HD12 5  
ATOM 7551  H HD13 . ILE B 2 5  ? -4.644  -1.119  9.147   1.00 0.00 ? 115 ILE B HD13 5  
ATOM 7552  N N    . THR B 2 6  ? 1.055   1.287   8.492   1.00 0.00 ? 116 THR B N    5  
ATOM 7553  C CA   . THR B 2 6  ? 1.895   2.460   8.702   1.00 0.00 ? 116 THR B CA   5  
ATOM 7554  C C    . THR B 2 6  ? 1.336   3.670   7.960   1.00 0.00 ? 116 THR B C    5  
ATOM 7555  O O    . THR B 2 6  ? 0.808   3.543   6.857   1.00 0.00 ? 116 THR B O    5  
ATOM 7556  C CB   . THR B 2 6  ? 3.325   2.179   8.236   1.00 0.00 ? 116 THR B CB   5  
ATOM 7557  O OG1  . THR B 2 6  ? 3.836   1.014   8.858   1.00 0.00 ? 116 THR B OG1  5  
ATOM 7558  C CG2  . THR B 2 6  ? 4.284   3.313   8.531   1.00 0.00 ? 116 THR B CG2  5  
ATOM 7559  H H    . THR B 2 6  ? 0.754   1.070   7.584   1.00 0.00 ? 116 THR B H    5  
ATOM 7560  H HA   . THR B 2 6  ? 1.906   2.676   9.759   1.00 0.00 ? 116 THR B HA   5  
ATOM 7561  H HB   . THR B 2 6  ? 3.321   2.020   7.167   1.00 0.00 ? 116 THR B HB   5  
ATOM 7562  H HG1  . THR B 2 6  ? 4.587   0.687   8.360   1.00 0.00 ? 116 THR B HG1  5  
ATOM 7563  H HG21 . THR B 2 6  ? 5.288   2.922   8.618   1.00 0.00 ? 116 THR B HG21 5  
ATOM 7564  H HG22 . THR B 2 6  ? 4.003   3.791   9.457   1.00 0.00 ? 116 THR B HG22 5  
ATOM 7565  H HG23 . THR B 2 6  ? 4.247   4.034   7.727   1.00 0.00 ? 116 THR B HG23 5  
ATOM 7566  N N    . GLU B 2 7  ? 1.455   4.842   8.575   1.00 0.00 ? 117 GLU B N    5  
ATOM 7567  C CA   . GLU B 2 7  ? 0.960   6.075   7.972   1.00 0.00 ? 117 GLU B CA   5  
ATOM 7568  C C    . GLU B 2 7  ? 2.067   6.791   7.205   1.00 0.00 ? 117 GLU B C    5  
ATOM 7569  O O    . GLU B 2 7  ? 3.217   6.825   7.640   1.00 0.00 ? 117 GLU B O    5  
ATOM 7570  C CB   . GLU B 2 7  ? 0.389   7.000   9.048   1.00 0.00 ? 117 GLU B CB   5  
ATOM 7571  C CG   . GLU B 2 7  ? -0.508  6.289   10.048  1.00 0.00 ? 117 GLU B CG   5  
ATOM 7572  C CD   . GLU B 2 7  ? -1.807  7.030   10.299  1.00 0.00 ? 117 GLU B CD   5  
ATOM 7573  O OE1  . GLU B 2 7  ? -1.793  8.278   10.267  1.00 0.00 ? 117 GLU B OE1  5  
ATOM 7574  O OE2  . GLU B 2 7  ? -2.836  6.362   10.530  1.00 0.00 ? 117 GLU B OE2  5  
ATOM 7575  H H    . GLU B 2 7  ? 1.886   4.880   9.454   1.00 0.00 ? 117 GLU B H    5  
ATOM 7576  H HA   . GLU B 2 7  ? 0.174   5.813   7.281   1.00 0.00 ? 117 GLU B HA   5  
ATOM 7577  H HB2  . GLU B 2 7  ? 1.207   7.453   9.589   1.00 0.00 ? 117 GLU B HB2  5  
ATOM 7578  H HB3  . GLU B 2 7  ? -0.188  7.777   8.569   1.00 0.00 ? 117 GLU B HB3  5  
ATOM 7579  H HG2  . GLU B 2 7  ? -0.742  5.305   9.667   1.00 0.00 ? 117 GLU B HG2  5  
ATOM 7580  H HG3  . GLU B 2 7  ? 0.023   6.194   10.984  1.00 0.00 ? 117 GLU B HG3  5  
ATOM 7581  N N    . LEU B 2 8  ? 1.709   7.363   6.059   1.00 0.00 ? 118 LEU B N    5  
ATOM 7582  C CA   . LEU B 2 8  ? 2.671   8.081   5.230   1.00 0.00 ? 118 LEU B CA   5  
ATOM 7583  C C    . LEU B 2 8  ? 2.137   9.457   4.846   1.00 0.00 ? 118 LEU B C    5  
ATOM 7584  O O    . LEU B 2 8  ? 0.912   9.667   4.956   1.00 0.00 ? 118 LEU B O    5  
ATOM 7585  C CB   . LEU B 2 8  ? 2.989   7.276   3.970   1.00 0.00 ? 118 LEU B CB   5  
ATOM 7586  C CG   . LEU B 2 8  ? 3.196   5.773   4.195   1.00 0.00 ? 118 LEU B CG   5  
ATOM 7587  C CD1  . LEU B 2 8  ? 2.096   4.970   3.515   1.00 0.00 ? 118 LEU B CD1  5  
ATOM 7588  C CD2  . LEU B 2 8  ? 4.565   5.340   3.691   1.00 0.00 ? 118 LEU B CD2  5  
ATOM 7589  O OXT  . LEU B 2 8  ? 2.951   10.313  4.439   1.00 0.00 ? 118 LEU B OXT  5  
ATOM 7590  H H    . LEU B 2 8  ? 0.777   7.302   5.766   1.00 0.00 ? 118 LEU B H    5  
ATOM 7591  H HA   . LEU B 2 8  ? 3.576   8.205   5.804   1.00 0.00 ? 118 LEU B HA   5  
ATOM 7592  H HB2  . LEU B 2 8  ? 2.176   7.407   3.269   1.00 0.00 ? 118 LEU B HB2  5  
ATOM 7593  H HB3  . LEU B 2 8  ? 3.889   7.678   3.528   1.00 0.00 ? 118 LEU B HB3  5  
ATOM 7594  H HG   . LEU B 2 8  ? 3.150   5.568   5.254   1.00 0.00 ? 118 LEU B HG   5  
ATOM 7595  H HD11 . LEU B 2 8  ? 2.472   4.553   2.592   1.00 0.00 ? 118 LEU B HD11 5  
ATOM 7596  H HD12 . LEU B 2 8  ? 1.257   5.616   3.302   1.00 0.00 ? 118 LEU B HD12 5  
ATOM 7597  H HD13 . LEU B 2 8  ? 1.778   4.172   4.167   1.00 0.00 ? 118 LEU B HD13 5  
ATOM 7598  H HD21 . LEU B 2 8  ? 4.525   5.195   2.620   1.00 0.00 ? 118 LEU B HD21 5  
ATOM 7599  H HD22 . LEU B 2 8  ? 4.847   4.415   4.169   1.00 0.00 ? 118 LEU B HD22 5  
ATOM 7600  H HD23 . LEU B 2 8  ? 5.292   6.104   3.923   1.00 0.00 ? 118 LEU B HD23 5  
ATOM 7601  N N    . LYS A 1 1  ? -4.291  -5.082  -14.149 1.00 0.00 ? 9   LYS A N    6  
ATOM 7602  C CA   . LYS A 1 1  ? -4.511  -3.642  -14.448 1.00 0.00 ? 9   LYS A CA   6  
ATOM 7603  C C    . LYS A 1 1  ? -3.584  -2.758  -13.622 1.00 0.00 ? 9   LYS A C    6  
ATOM 7604  O O    . LYS A 1 1  ? -3.990  -2.197  -12.604 1.00 0.00 ? 9   LYS A O    6  
ATOM 7605  C CB   . LYS A 1 1  ? -5.971  -3.298  -14.151 1.00 0.00 ? 9   LYS A CB   6  
ATOM 7606  C CG   . LYS A 1 1  ? -6.912  -3.581  -15.312 1.00 0.00 ? 9   LYS A CG   6  
ATOM 7607  C CD   . LYS A 1 1  ? -7.666  -4.887  -15.116 1.00 0.00 ? 9   LYS A CD   6  
ATOM 7608  C CE   . LYS A 1 1  ? -9.113  -4.769  -15.568 1.00 0.00 ? 9   LYS A CE   6  
ATOM 7609  N NZ   . LYS A 1 1  ? -9.860  -3.749  -14.780 1.00 0.00 ? 9   LYS A NZ   6  
ATOM 7610  H H1   . LYS A 1 1  ? -3.403  -5.369  -14.607 1.00 0.00 ? 9   LYS A H1   6  
ATOM 7611  H H2   . LYS A 1 1  ? -5.100  -5.612  -14.531 1.00 0.00 ? 9   LYS A H2   6  
ATOM 7612  H H3   . LYS A 1 1  ? -4.229  -5.185  -13.117 1.00 0.00 ? 9   LYS A H3   6  
ATOM 7613  H HA   . LYS A 1 1  ? -4.312  -3.476  -15.498 1.00 0.00 ? 9   LYS A HA   6  
ATOM 7614  H HB2  . LYS A 1 1  ? -6.299  -3.879  -13.300 1.00 0.00 ? 9   LYS A HB2  6  
ATOM 7615  H HB3  . LYS A 1 1  ? -6.039  -2.249  -13.907 1.00 0.00 ? 9   LYS A HB3  6  
ATOM 7616  H HG2  . LYS A 1 1  ? -7.626  -2.774  -15.388 1.00 0.00 ? 9   LYS A HG2  6  
ATOM 7617  H HG3  . LYS A 1 1  ? -6.335  -3.642  -16.223 1.00 0.00 ? 9   LYS A HG3  6  
ATOM 7618  H HD2  . LYS A 1 1  ? -7.182  -5.662  -15.692 1.00 0.00 ? 9   LYS A HD2  6  
ATOM 7619  H HD3  . LYS A 1 1  ? -7.645  -5.149  -14.068 1.00 0.00 ? 9   LYS A HD3  6  
ATOM 7620  H HE2  . LYS A 1 1  ? -9.128  -4.489  -16.610 1.00 0.00 ? 9   LYS A HE2  6  
ATOM 7621  H HE3  . LYS A 1 1  ? -9.594  -5.729  -15.446 1.00 0.00 ? 9   LYS A HE3  6  
ATOM 7622  H HZ1  . LYS A 1 1  ? -10.841 -4.060  -14.633 1.00 0.00 ? 9   LYS A HZ1  6  
ATOM 7623  H HZ2  . LYS A 1 1  ? -9.868  -2.842  -15.288 1.00 0.00 ? 9   LYS A HZ2  6  
ATOM 7624  H HZ3  . LYS A 1 1  ? -9.407  -3.611  -13.854 1.00 0.00 ? 9   LYS A HZ3  6  
ATOM 7625  N N    . GLU A 1 2  ? -2.337  -2.637  -14.065 1.00 0.00 ? 10  GLU A N    6  
ATOM 7626  C CA   . GLU A 1 2  ? -1.352  -1.819  -13.366 1.00 0.00 ? 10  GLU A CA   6  
ATOM 7627  C C    . GLU A 1 2  ? -1.675  -0.335  -13.517 1.00 0.00 ? 10  GLU A C    6  
ATOM 7628  O O    . GLU A 1 2  ? -1.759  0.181   -14.632 1.00 0.00 ? 10  GLU A O    6  
ATOM 7629  C CB   . GLU A 1 2  ? 0.052   -2.105  -13.902 1.00 0.00 ? 10  GLU A CB   6  
ATOM 7630  C CG   . GLU A 1 2  ? 1.144   -1.315  -13.199 1.00 0.00 ? 10  GLU A CG   6  
ATOM 7631  C CD   . GLU A 1 2  ? 2.328   -1.028  -14.104 1.00 0.00 ? 10  GLU A CD   6  
ATOM 7632  O OE1  . GLU A 1 2  ? 2.135   -0.978  -15.337 1.00 0.00 ? 10  GLU A OE1  6  
ATOM 7633  O OE2  . GLU A 1 2  ? 3.447   -0.852  -13.578 1.00 0.00 ? 10  GLU A OE2  6  
ATOM 7634  H H    . GLU A 1 2  ? -2.072  -3.108  -14.882 1.00 0.00 ? 10  GLU A H    6  
ATOM 7635  H HA   . GLU A 1 2  ? -1.390  -2.078  -12.319 1.00 0.00 ? 10  GLU A HA   6  
ATOM 7636  H HB2  . GLU A 1 2  ? 0.263   -3.157  -13.778 1.00 0.00 ? 10  GLU A HB2  6  
ATOM 7637  H HB3  . GLU A 1 2  ? 0.080   -1.862  -14.953 1.00 0.00 ? 10  GLU A HB3  6  
ATOM 7638  H HG2  . GLU A 1 2  ? 0.733   -0.375  -12.863 1.00 0.00 ? 10  GLU A HG2  6  
ATOM 7639  H HG3  . GLU A 1 2  ? 1.491   -1.881  -12.347 1.00 0.00 ? 10  GLU A HG3  6  
ATOM 7640  N N    . LYS A 1 3  ? -1.860  0.345   -12.390 1.00 0.00 ? 11  LYS A N    6  
ATOM 7641  C CA   . LYS A 1 3  ? -2.177  1.769   -12.400 1.00 0.00 ? 11  LYS A CA   6  
ATOM 7642  C C    . LYS A 1 3  ? -0.970  2.603   -11.972 1.00 0.00 ? 11  LYS A C    6  
ATOM 7643  O O    . LYS A 1 3  ? -0.169  2.179   -11.139 1.00 0.00 ? 11  LYS A O    6  
ATOM 7644  C CB   . LYS A 1 3  ? -3.370  2.053   -11.479 1.00 0.00 ? 11  LYS A CB   6  
ATOM 7645  C CG   . LYS A 1 3  ? -3.651  3.533   -11.272 1.00 0.00 ? 11  LYS A CG   6  
ATOM 7646  C CD   . LYS A 1 3  ? -5.086  3.770   -10.832 1.00 0.00 ? 11  LYS A CD   6  
ATOM 7647  C CE   . LYS A 1 3  ? -5.202  3.831   -9.317  1.00 0.00 ? 11  LYS A CE   6  
ATOM 7648  N NZ   . LYS A 1 3  ? -5.282  5.231   -8.822  1.00 0.00 ? 11  LYS A NZ   6  
ATOM 7649  H H    . LYS A 1 3  ? -1.782  -0.124  -11.531 1.00 0.00 ? 11  LYS A H    6  
ATOM 7650  H HA   . LYS A 1 3  ? -2.444  2.040   -13.411 1.00 0.00 ? 11  LYS A HA   6  
ATOM 7651  H HB2  . LYS A 1 3  ? -4.253  1.598   -11.906 1.00 0.00 ? 11  LYS A HB2  6  
ATOM 7652  H HB3  . LYS A 1 3  ? -3.179  1.607   -10.514 1.00 0.00 ? 11  LYS A HB3  6  
ATOM 7653  H HG2  . LYS A 1 3  ? -2.986  3.913   -10.510 1.00 0.00 ? 11  LYS A HG2  6  
ATOM 7654  H HG3  . LYS A 1 3  ? -3.475  4.057   -12.200 1.00 0.00 ? 11  LYS A HG3  6  
ATOM 7655  H HD2  . LYS A 1 3  ? -5.429  4.706   -11.247 1.00 0.00 ? 11  LYS A HD2  6  
ATOM 7656  H HD3  . LYS A 1 3  ? -5.703  2.964   -11.201 1.00 0.00 ? 11  LYS A HD3  6  
ATOM 7657  H HE2  . LYS A 1 3  ? -6.094  3.300   -9.017  1.00 0.00 ? 11  LYS A HE2  6  
ATOM 7658  H HE3  . LYS A 1 3  ? -4.337  3.352   -8.884  1.00 0.00 ? 11  LYS A HE3  6  
ATOM 7659  H HZ1  . LYS A 1 3  ? -5.791  5.826   -9.507  1.00 0.00 ? 11  LYS A HZ1  6  
ATOM 7660  H HZ2  . LYS A 1 3  ? -4.327  5.620   -8.688  1.00 0.00 ? 11  LYS A HZ2  6  
ATOM 7661  H HZ3  . LYS A 1 3  ? -5.786  5.261   -7.911  1.00 0.00 ? 11  LYS A HZ3  6  
ATOM 7662  N N    . LYS A 1 4  ? -0.852  3.795   -12.549 1.00 0.00 ? 12  LYS A N    6  
ATOM 7663  C CA   . LYS A 1 4  ? 0.251   4.694   -12.228 1.00 0.00 ? 12  LYS A CA   6  
ATOM 7664  C C    . LYS A 1 4  ? -0.183  5.736   -11.203 1.00 0.00 ? 12  LYS A C    6  
ATOM 7665  O O    . LYS A 1 4  ? -1.351  6.124   -11.153 1.00 0.00 ? 12  LYS A O    6  
ATOM 7666  C CB   . LYS A 1 4  ? 0.761   5.383   -13.495 1.00 0.00 ? 12  LYS A CB   6  
ATOM 7667  C CG   . LYS A 1 4  ? 2.000   4.729   -14.086 1.00 0.00 ? 12  LYS A CG   6  
ATOM 7668  C CD   . LYS A 1 4  ? 2.815   5.721   -14.900 1.00 0.00 ? 12  LYS A CD   6  
ATOM 7669  C CE   . LYS A 1 4  ? 4.239   5.233   -15.110 1.00 0.00 ? 12  LYS A CE   6  
ATOM 7670  N NZ   . LYS A 1 4  ? 4.795   5.683   -16.416 1.00 0.00 ? 12  LYS A NZ   6  
ATOM 7671  H H    . LYS A 1 4  ? -1.524  4.078   -13.202 1.00 0.00 ? 12  LYS A H    6  
ATOM 7672  H HA   . LYS A 1 4  ? 1.047   4.101   -11.804 1.00 0.00 ? 12  LYS A HA   6  
ATOM 7673  H HB2  . LYS A 1 4  ? -0.020  5.363   -14.241 1.00 0.00 ? 12  LYS A HB2  6  
ATOM 7674  H HB3  . LYS A 1 4  ? 0.999   6.410   -13.262 1.00 0.00 ? 12  LYS A HB3  6  
ATOM 7675  H HG2  . LYS A 1 4  ? 2.612   4.349   -13.283 1.00 0.00 ? 12  LYS A HG2  6  
ATOM 7676  H HG3  . LYS A 1 4  ? 1.695   3.915   -14.728 1.00 0.00 ? 12  LYS A HG3  6  
ATOM 7677  H HD2  . LYS A 1 4  ? 2.346   5.855   -15.862 1.00 0.00 ? 12  LYS A HD2  6  
ATOM 7678  H HD3  . LYS A 1 4  ? 2.841   6.666   -14.376 1.00 0.00 ? 12  LYS A HD3  6  
ATOM 7679  H HE2  . LYS A 1 4  ? 4.860   5.617   -14.314 1.00 0.00 ? 12  LYS A HE2  6  
ATOM 7680  H HE3  . LYS A 1 4  ? 4.243   4.153   -15.079 1.00 0.00 ? 12  LYS A HE3  6  
ATOM 7681  H HZ1  . LYS A 1 4  ? 4.023   5.888   -17.082 1.00 0.00 ? 12  LYS A HZ1  6  
ATOM 7682  H HZ2  . LYS A 1 4  ? 5.400   4.941   -16.821 1.00 0.00 ? 12  LYS A HZ2  6  
ATOM 7683  H HZ3  . LYS A 1 4  ? 5.364   6.544   -16.285 1.00 0.00 ? 12  LYS A HZ3  6  
ATOM 7684  N N    . VAL A 1 5  ? 0.763   6.185   -10.385 1.00 0.00 ? 13  VAL A N    6  
ATOM 7685  C CA   . VAL A 1 5  ? 0.476   7.181   -9.359  1.00 0.00 ? 13  VAL A CA   6  
ATOM 7686  C C    . VAL A 1 5  ? 1.721   7.998   -9.025  1.00 0.00 ? 13  VAL A C    6  
ATOM 7687  O O    . VAL A 1 5  ? 2.828   7.464   -8.970  1.00 0.00 ? 13  VAL A O    6  
ATOM 7688  C CB   . VAL A 1 5  ? -0.061  6.517   -8.075  1.00 0.00 ? 13  VAL A CB   6  
ATOM 7689  C CG1  . VAL A 1 5  ? -0.370  7.560   -7.010  1.00 0.00 ? 13  VAL A CG1  6  
ATOM 7690  C CG2  . VAL A 1 5  ? -1.295  5.683   -8.387  1.00 0.00 ? 13  VAL A CG2  6  
ATOM 7691  H H    . VAL A 1 5  ? 1.674   5.837   -10.471 1.00 0.00 ? 13  VAL A H    6  
ATOM 7692  H HA   . VAL A 1 5  ? -0.286  7.845   -9.744  1.00 0.00 ? 13  VAL A HA   6  
ATOM 7693  H HB   . VAL A 1 5  ? 0.702   5.858   -7.689  1.00 0.00 ? 13  VAL A HB   6  
ATOM 7694  H HG11 . VAL A 1 5  ? -0.171  8.547   -7.401  1.00 0.00 ? 13  VAL A HG11 6  
ATOM 7695  H HG12 . VAL A 1 5  ? 0.253   7.385   -6.145  1.00 0.00 ? 13  VAL A HG12 6  
ATOM 7696  H HG13 . VAL A 1 5  ? -1.409  7.489   -6.725  1.00 0.00 ? 13  VAL A HG13 6  
ATOM 7697  H HG21 . VAL A 1 5  ? -1.732  5.329   -7.465  1.00 0.00 ? 13  VAL A HG21 6  
ATOM 7698  H HG22 . VAL A 1 5  ? -1.015  4.840   -9.000  1.00 0.00 ? 13  VAL A HG22 6  
ATOM 7699  H HG23 . VAL A 1 5  ? -2.015  6.290   -8.916  1.00 0.00 ? 13  VAL A HG23 6  
ATOM 7700  N N    . PHE A 1 6  ? 1.529   9.295   -8.807  1.00 0.00 ? 14  PHE A N    6  
ATOM 7701  C CA   . PHE A 1 6  ? 2.637   10.187  -8.479  1.00 0.00 ? 14  PHE A CA   6  
ATOM 7702  C C    . PHE A 1 6  ? 2.323   11.010  -7.234  1.00 0.00 ? 14  PHE A C    6  
ATOM 7703  O O    . PHE A 1 6  ? 1.315   11.714  -7.181  1.00 0.00 ? 14  PHE A O    6  
ATOM 7704  C CB   . PHE A 1 6  ? 2.935   11.114  -9.658  1.00 0.00 ? 14  PHE A CB   6  
ATOM 7705  C CG   . PHE A 1 6  ? 1.765   11.965  -10.060 1.00 0.00 ? 14  PHE A CG   6  
ATOM 7706  C CD1  . PHE A 1 6  ? 0.770   11.454  -10.879 1.00 0.00 ? 14  PHE A CD1  6  
ATOM 7707  C CD2  . PHE A 1 6  ? 1.659   13.274  -9.618  1.00 0.00 ? 14  PHE A CD2  6  
ATOM 7708  C CE1  . PHE A 1 6  ? -0.308  12.235  -11.250 1.00 0.00 ? 14  PHE A CE1  6  
ATOM 7709  C CE2  . PHE A 1 6  ? 0.583   14.059  -9.987  1.00 0.00 ? 14  PHE A CE2  6  
ATOM 7710  C CZ   . PHE A 1 6  ? -0.402  13.539  -10.803 1.00 0.00 ? 14  PHE A CZ   6  
ATOM 7711  H H    . PHE A 1 6  ? 0.623   9.661   -8.867  1.00 0.00 ? 14  PHE A H    6  
ATOM 7712  H HA   . PHE A 1 6  ? 3.505   9.577   -8.284  1.00 0.00 ? 14  PHE A HA   6  
ATOM 7713  H HB2  . PHE A 1 6  ? 3.749   11.772  -9.391  1.00 0.00 ? 14  PHE A HB2  6  
ATOM 7714  H HB3  . PHE A 1 6  ? 3.223   10.519  -10.511 1.00 0.00 ? 14  PHE A HB3  6  
ATOM 7715  H HD1  . PHE A 1 6  ? 0.842   10.436  -11.229 1.00 0.00 ? 14  PHE A HD1  6  
ATOM 7716  H HD2  . PHE A 1 6  ? 2.428   13.682  -8.981  1.00 0.00 ? 14  PHE A HD2  6  
ATOM 7717  H HE1  . PHE A 1 6  ? -1.078  11.826  -11.889 1.00 0.00 ? 14  PHE A HE1  6  
ATOM 7718  H HE2  . PHE A 1 6  ? 0.512   15.077  -9.635  1.00 0.00 ? 14  PHE A HE2  6  
ATOM 7719  H HZ   . PHE A 1 6  ? -1.244  14.150  -11.091 1.00 0.00 ? 14  PHE A HZ   6  
ATOM 7720  N N    . ILE A 1 7  ? 3.194   10.916  -6.233  1.00 0.00 ? 15  ILE A N    6  
ATOM 7721  C CA   . ILE A 1 7  ? 3.011   11.653  -4.988  1.00 0.00 ? 15  ILE A CA   6  
ATOM 7722  C C    . ILE A 1 7  ? 4.055   12.752  -4.839  1.00 0.00 ? 15  ILE A C    6  
ATOM 7723  O O    . ILE A 1 7  ? 5.255   12.501  -4.953  1.00 0.00 ? 15  ILE A O    6  
ATOM 7724  C CB   . ILE A 1 7  ? 3.090   10.719  -3.765  1.00 0.00 ? 15  ILE A CB   6  
ATOM 7725  C CG1  . ILE A 1 7  ? 2.196   9.497   -3.972  1.00 0.00 ? 15  ILE A CG1  6  
ATOM 7726  C CG2  . ILE A 1 7  ? 2.693   11.466  -2.500  1.00 0.00 ? 15  ILE A CG2  6  
ATOM 7727  C CD1  . ILE A 1 7  ? 0.720   9.826   -4.025  1.00 0.00 ? 15  ILE A CD1  6  
ATOM 7728  H H    . ILE A 1 7  ? 3.979   10.338  -6.335  1.00 0.00 ? 15  ILE A H    6  
ATOM 7729  H HA   . ILE A 1 7  ? 2.028   12.103  -5.009  1.00 0.00 ? 15  ILE A HA   6  
ATOM 7730  H HB   . ILE A 1 7  ? 4.113   10.392  -3.656  1.00 0.00 ? 15  ILE A HB   6  
ATOM 7731  H HG12 . ILE A 1 7  ? 2.461   9.019   -4.903  1.00 0.00 ? 15  ILE A HG12 6  
ATOM 7732  H HG13 . ILE A 1 7  ? 2.352   8.802   -3.159  1.00 0.00 ? 15  ILE A HG13 6  
ATOM 7733  H HG21 . ILE A 1 7  ? 1.670   11.802  -2.585  1.00 0.00 ? 15  ILE A HG21 6  
ATOM 7734  H HG22 . ILE A 1 7  ? 3.342   12.318  -2.366  1.00 0.00 ? 15  ILE A HG22 6  
ATOM 7735  H HG23 . ILE A 1 7  ? 2.786   10.806  -1.649  1.00 0.00 ? 15  ILE A HG23 6  
ATOM 7736  H HD11 . ILE A 1 7  ? 0.565   10.838  -3.681  1.00 0.00 ? 15  ILE A HD11 6  
ATOM 7737  H HD12 . ILE A 1 7  ? 0.175   9.143   -3.390  1.00 0.00 ? 15  ILE A HD12 6  
ATOM 7738  H HD13 . ILE A 1 7  ? 0.366   9.734   -5.041  1.00 0.00 ? 15  ILE A HD13 6  
ATOM 7739  N N    . SER A 1 8  ? 3.591   13.971  -4.585  1.00 0.00 ? 16  SER A N    6  
ATOM 7740  C CA   . SER A 1 8  ? 4.485   15.111  -4.418  1.00 0.00 ? 16  SER A CA   6  
ATOM 7741  C C    . SER A 1 8  ? 3.984   16.035  -3.313  1.00 0.00 ? 16  SER A C    6  
ATOM 7742  O O    . SER A 1 8  ? 2.849   16.510  -3.351  1.00 0.00 ? 16  SER A O    6  
ATOM 7743  C CB   . SER A 1 8  ? 4.607   15.887  -5.731  1.00 0.00 ? 16  SER A CB   6  
ATOM 7744  O OG   . SER A 1 8  ? 4.939   15.024  -6.803  1.00 0.00 ? 16  SER A OG   6  
ATOM 7745  H H    . SER A 1 8  ? 2.623   14.107  -4.504  1.00 0.00 ? 16  SER A H    6  
ATOM 7746  H HA   . SER A 1 8  ? 5.458   14.733  -4.141  1.00 0.00 ? 16  SER A HA   6  
ATOM 7747  H HB2  . SER A 1 8  ? 3.667   16.368  -5.950  1.00 0.00 ? 16  SER A HB2  6  
ATOM 7748  H HB3  . SER A 1 8  ? 5.381   16.635  -5.634  1.00 0.00 ? 16  SER A HB3  6  
ATOM 7749  H HG   . SER A 1 8  ? 5.889   15.040  -6.946  1.00 0.00 ? 16  SER A HG   6  
ATOM 7750  N N    . LEU A 1 9  ? 4.839   16.288  -2.326  1.00 0.00 ? 17  LEU A N    6  
ATOM 7751  C CA   . LEU A 1 9  ? 4.482   17.155  -1.209  1.00 0.00 ? 17  LEU A CA   6  
ATOM 7752  C C    . LEU A 1 9  ? 4.291   18.594  -1.679  1.00 0.00 ? 17  LEU A C    6  
ATOM 7753  O O    . LEU A 1 9  ? 5.253   19.275  -2.034  1.00 0.00 ? 17  LEU A O    6  
ATOM 7754  C CB   . LEU A 1 9  ? 5.563   17.095  -0.126  1.00 0.00 ? 17  LEU A CB   6  
ATOM 7755  C CG   . LEU A 1 9  ? 5.052   16.762  1.278   1.00 0.00 ? 17  LEU A CG   6  
ATOM 7756  C CD1  . LEU A 1 9  ? 4.855   15.261  1.431   1.00 0.00 ? 17  LEU A CD1  6  
ATOM 7757  C CD2  . LEU A 1 9  ? 6.015   17.286  2.332   1.00 0.00 ? 17  LEU A CD2  6  
ATOM 7758  H H    . LEU A 1 9  ? 5.730   15.881  -2.350  1.00 0.00 ? 17  LEU A H    6  
ATOM 7759  H HA   . LEU A 1 9  ? 3.550   16.798  -0.797  1.00 0.00 ? 17  LEU A HA   6  
ATOM 7760  H HB2  . LEU A 1 9  ? 6.285   16.344  -0.410  1.00 0.00 ? 17  LEU A HB2  6  
ATOM 7761  H HB3  . LEU A 1 9  ? 6.059   18.052  -0.085  1.00 0.00 ? 17  LEU A HB3  6  
ATOM 7762  H HG   . LEU A 1 9  ? 4.096   17.242  1.429   1.00 0.00 ? 17  LEU A HG   6  
ATOM 7763  H HD11 . LEU A 1 9  ? 3.817   15.017  1.256   1.00 0.00 ? 17  LEU A HD11 6  
ATOM 7764  H HD12 . LEU A 1 9  ? 5.131   14.962  2.431   1.00 0.00 ? 17  LEU A HD12 6  
ATOM 7765  H HD13 . LEU A 1 9  ? 5.473   14.743  0.714   1.00 0.00 ? 17  LEU A HD13 6  
ATOM 7766  H HD21 . LEU A 1 9  ? 5.460   17.587  3.209   1.00 0.00 ? 17  LEU A HD21 6  
ATOM 7767  H HD22 . LEU A 1 9  ? 6.555   18.135  1.939   1.00 0.00 ? 17  LEU A HD22 6  
ATOM 7768  H HD23 . LEU A 1 9  ? 6.716   16.508  2.600   1.00 0.00 ? 17  LEU A HD23 6  
ATOM 7769  N N    . VAL A 1 10 ? 3.043   19.050  -1.679  1.00 0.00 ? 18  VAL A N    6  
ATOM 7770  C CA   . VAL A 1 10 ? 2.724   20.408  -2.105  1.00 0.00 ? 18  VAL A CA   6  
ATOM 7771  C C    . VAL A 1 10 ? 2.259   21.259  -0.927  1.00 0.00 ? 18  VAL A C    6  
ATOM 7772  O O    . VAL A 1 10 ? 2.496   22.467  -0.889  1.00 0.00 ? 18  VAL A O    6  
ATOM 7773  C CB   . VAL A 1 10 ? 1.636   20.413  -3.197  1.00 0.00 ? 18  VAL A CB   6  
ATOM 7774  C CG1  . VAL A 1 10 ? 0.336   19.826  -2.667  1.00 0.00 ? 18  VAL A CG1  6  
ATOM 7775  C CG2  . VAL A 1 10 ? 1.417   21.823  -3.726  1.00 0.00 ? 18  VAL A CG2  6  
ATOM 7776  H H    . VAL A 1 10 ? 2.317   18.459  -1.385  1.00 0.00 ? 18  VAL A H    6  
ATOM 7777  H HA   . VAL A 1 10 ? 3.621   20.844  -2.519  1.00 0.00 ? 18  VAL A HA   6  
ATOM 7778  H HB   . VAL A 1 10 ? 1.974   19.796  -4.016  1.00 0.00 ? 18  VAL A HB   6  
ATOM 7779  H HG11 . VAL A 1 10 ? 0.538   19.242  -1.782  1.00 0.00 ? 18  VAL A HG11 6  
ATOM 7780  H HG12 . VAL A 1 10 ? -0.109  19.195  -3.422  1.00 0.00 ? 18  VAL A HG12 6  
ATOM 7781  H HG13 . VAL A 1 10 ? -0.347  20.628  -2.422  1.00 0.00 ? 18  VAL A HG13 6  
ATOM 7782  H HG21 . VAL A 1 10 ? 0.724   22.344  -3.083  1.00 0.00 ? 18  VAL A HG21 6  
ATOM 7783  H HG22 . VAL A 1 10 ? 1.011   21.774  -4.726  1.00 0.00 ? 18  VAL A HG22 6  
ATOM 7784  H HG23 . VAL A 1 10 ? 2.358   22.351  -3.745  1.00 0.00 ? 18  VAL A HG23 6  
ATOM 7785  N N    . GLY A 1 11 ? 1.595   20.623  0.033   1.00 0.00 ? 19  GLY A N    6  
ATOM 7786  C CA   . GLY A 1 11 ? 1.108   21.338  1.197   1.00 0.00 ? 19  GLY A CA   6  
ATOM 7787  C C    . GLY A 1 11 ? 1.952   21.091  2.436   1.00 0.00 ? 19  GLY A C    6  
ATOM 7788  O O    . GLY A 1 11 ? 1.606   21.547  3.527   1.00 0.00 ? 19  GLY A O    6  
ATOM 7789  H H    . GLY A 1 11 ? 1.436   19.659  -0.051  1.00 0.00 ? 19  GLY A H    6  
ATOM 7790  H HA2  . GLY A 1 11 ? 1.110   22.396  0.981   1.00 0.00 ? 19  GLY A HA2  6  
ATOM 7791  H HA3  . GLY A 1 11 ? 0.095   21.025  1.399   1.00 0.00 ? 19  GLY A HA3  6  
ATOM 7792  N N    . SER A 1 12 ? 3.058   20.371  2.272   1.00 0.00 ? 20  SER A N    6  
ATOM 7793  C CA   . SER A 1 12 ? 3.945   20.070  3.391   1.00 0.00 ? 20  SER A CA   6  
ATOM 7794  C C    . SER A 1 12 ? 3.201   19.320  4.492   1.00 0.00 ? 20  SER A C    6  
ATOM 7795  O O    . SER A 1 12 ? 3.517   19.460  5.674   1.00 0.00 ? 20  SER A O    6  
ATOM 7796  C CB   . SER A 1 12 ? 4.546   21.361  3.952   1.00 0.00 ? 20  SER A CB   6  
ATOM 7797  O OG   . SER A 1 12 ? 5.901   21.174  4.324   1.00 0.00 ? 20  SER A OG   6  
ATOM 7798  H H    . SER A 1 12 ? 3.284   20.034  1.381   1.00 0.00 ? 20  SER A H    6  
ATOM 7799  H HA   . SER A 1 12 ? 4.743   19.444  3.022   1.00 0.00 ? 20  SER A HA   6  
ATOM 7800  H HB2  . SER A 1 12 ? 4.497   22.134  3.201   1.00 0.00 ? 20  SER A HB2  6  
ATOM 7801  H HB3  . SER A 1 12 ? 3.985   21.667  4.823   1.00 0.00 ? 20  SER A HB3  6  
ATOM 7802  H HG   . SER A 1 12 ? 5.993   20.341  4.792   1.00 0.00 ? 20  SER A HG   6  
ATOM 7803  N N    . ARG A 1 13 ? 2.212   18.526  4.096   1.00 0.00 ? 21  ARG A N    6  
ATOM 7804  C CA   . ARG A 1 13 ? 1.423   17.755  5.052   1.00 0.00 ? 21  ARG A CA   6  
ATOM 7805  C C    . ARG A 1 13 ? 1.710   16.264  4.920   1.00 0.00 ? 21  ARG A C    6  
ATOM 7806  O O    . ARG A 1 13 ? 1.613   15.516  5.892   1.00 0.00 ? 21  ARG A O    6  
ATOM 7807  C CB   . ARG A 1 13 ? -0.068  18.020  4.842   1.00 0.00 ? 21  ARG A CB   6  
ATOM 7808  C CG   . ARG A 1 13 ? -0.543  17.733  3.425   1.00 0.00 ? 21  ARG A CG   6  
ATOM 7809  C CD   . ARG A 1 13 ? -1.559  16.600  3.391   1.00 0.00 ? 21  ARG A CD   6  
ATOM 7810  N NE   . ARG A 1 13 ? -2.811  16.966  4.052   1.00 0.00 ? 21  ARG A NE   6  
ATOM 7811  C CZ   . ARG A 1 13 ? -3.136  16.603  5.293   1.00 0.00 ? 21  ARG A CZ   6  
ATOM 7812  N NH1  . ARG A 1 13 ? -2.307  15.866  6.023   1.00 0.00 ? 21  ARG A NH1  6  
ATOM 7813  N NH2  . ARG A 1 13 ? -4.299  16.982  5.806   1.00 0.00 ? 21  ARG A NH2  6  
ATOM 7814  H H    . ARG A 1 13 ? 2.008   18.456  3.141   1.00 0.00 ? 21  ARG A H    6  
ATOM 7815  H HA   . ARG A 1 13 ? 1.700   18.076  6.043   1.00 0.00 ? 21  ARG A HA   6  
ATOM 7816  H HB2  . ARG A 1 13 ? -0.631  17.399  5.523   1.00 0.00 ? 21  ARG A HB2  6  
ATOM 7817  H HB3  . ARG A 1 13 ? -0.273  19.058  5.063   1.00 0.00 ? 21  ARG A HB3  6  
ATOM 7818  H HG2  . ARG A 1 13 ? -1.001  18.623  3.023   1.00 0.00 ? 21  ARG A HG2  6  
ATOM 7819  H HG3  . ARG A 1 13 ? 0.308   17.459  2.819   1.00 0.00 ? 21  ARG A HG3  6  
ATOM 7820  H HD2  . ARG A 1 13 ? -1.768  16.355  2.360   1.00 0.00 ? 21  ARG A HD2  6  
ATOM 7821  H HD3  . ARG A 1 13 ? -1.136  15.740  3.884   1.00 0.00 ? 21  ARG A HD3  6  
ATOM 7822  H HE   . ARG A 1 13 ? -3.446  17.510  3.543   1.00 0.00 ? 21  ARG A HE   6  
ATOM 7823  H HH11 . ARG A 1 13 ? -1.429  15.578  5.649   1.00 0.00 ? 21  ARG A HH11 6  
ATOM 7824  H HH12 . ARG A 1 13 ? -2.562  15.602  6.954   1.00 0.00 ? 21  ARG A HH12 6  
ATOM 7825  H HH21 . ARG A 1 13 ? -4.928  17.537  5.264   1.00 0.00 ? 21  ARG A HH21 6  
ATOM 7826  H HH22 . ARG A 1 13 ? -4.546  16.711  6.737   1.00 0.00 ? 21  ARG A HH22 6  
ATOM 7827  N N    . GLY A 1 14 ? 2.064   15.838  3.713   1.00 0.00 ? 22  GLY A N    6  
ATOM 7828  C CA   . GLY A 1 14 ? 2.361   14.436  3.478   1.00 0.00 ? 22  GLY A CA   6  
ATOM 7829  C C    . GLY A 1 14 ? 1.534   13.849  2.351   1.00 0.00 ? 22  GLY A C    6  
ATOM 7830  O O    . GLY A 1 14 ? 1.059   14.573  1.476   1.00 0.00 ? 22  GLY A O    6  
ATOM 7831  H H    . GLY A 1 14 ? 2.127   16.482  2.976   1.00 0.00 ? 22  GLY A H    6  
ATOM 7832  H HA2  . GLY A 1 14 ? 3.408   14.338  3.231   1.00 0.00 ? 22  GLY A HA2  6  
ATOM 7833  H HA3  . GLY A 1 14 ? 2.163   13.881  4.383   1.00 0.00 ? 22  GLY A HA3  6  
ATOM 7834  N N    . LEU A 1 15 ? 1.360   12.531  2.374   1.00 0.00 ? 23  LEU A N    6  
ATOM 7835  C CA   . LEU A 1 15 ? 0.585   11.842  1.352   1.00 0.00 ? 23  LEU A CA   6  
ATOM 7836  C C    . LEU A 1 15 ? -0.889  11.791  1.740   1.00 0.00 ? 23  LEU A C    6  
ATOM 7837  O O    . LEU A 1 15 ? -1.767  12.113  0.937   1.00 0.00 ? 23  LEU A O    6  
ATOM 7838  C CB   . LEU A 1 15 ? 1.132   10.426  1.148   1.00 0.00 ? 23  LEU A CB   6  
ATOM 7839  C CG   . LEU A 1 15 ? 0.183   9.447   0.455   1.00 0.00 ? 23  LEU A CG   6  
ATOM 7840  C CD1  . LEU A 1 15 ? -0.095  9.892   -0.972  1.00 0.00 ? 23  LEU A CD1  6  
ATOM 7841  C CD2  . LEU A 1 15 ? 0.764   8.041   0.474   1.00 0.00 ? 23  LEU A CD2  6  
ATOM 7842  H H    . LEU A 1 15 ? 1.762   12.010  3.099   1.00 0.00 ? 23  LEU A H    6  
ATOM 7843  H HA   . LEU A 1 15 ? 0.686   12.395  0.430   1.00 0.00 ? 23  LEU A HA   6  
ATOM 7844  H HB2  . LEU A 1 15 ? 2.036   10.494  0.563   1.00 0.00 ? 23  LEU A HB2  6  
ATOM 7845  H HB3  . LEU A 1 15 ? 1.380   10.021  2.115   1.00 0.00 ? 23  LEU A HB3  6  
ATOM 7846  H HG   . LEU A 1 15 ? -0.756  9.429   0.988   1.00 0.00 ? 23  LEU A HG   6  
ATOM 7847  H HD11 . LEU A 1 15 ? 0.836   9.963   -1.515  1.00 0.00 ? 23  LEU A HD11 6  
ATOM 7848  H HD12 . LEU A 1 15 ? -0.578  10.857  -0.958  1.00 0.00 ? 23  LEU A HD12 6  
ATOM 7849  H HD13 . LEU A 1 15 ? -0.738  9.173   -1.454  1.00 0.00 ? 23  LEU A HD13 6  
ATOM 7850  H HD21 . LEU A 1 15 ? 1.843   8.097   0.465   1.00 0.00 ? 23  LEU A HD21 6  
ATOM 7851  H HD22 . LEU A 1 15 ? 0.425   7.499   -0.397  1.00 0.00 ? 23  LEU A HD22 6  
ATOM 7852  H HD23 . LEU A 1 15 ? 0.437   7.528   1.365   1.00 0.00 ? 23  LEU A HD23 6  
ATOM 7853  N N    . GLY A 1 16 ? -1.154  11.380  2.975   1.00 0.00 ? 24  GLY A N    6  
ATOM 7854  C CA   . GLY A 1 16 ? -2.522  11.288  3.448   1.00 0.00 ? 24  GLY A CA   6  
ATOM 7855  C C    . GLY A 1 16 ? -3.100  9.899   3.269   1.00 0.00 ? 24  GLY A C    6  
ATOM 7856  O O    . GLY A 1 16 ? -4.303  9.742   3.059   1.00 0.00 ? 24  GLY A O    6  
ATOM 7857  H H    . GLY A 1 16 ? -0.414  11.134  3.568   1.00 0.00 ? 24  GLY A H    6  
ATOM 7858  H HA2  . GLY A 1 16 ? -2.550  11.549  4.494   1.00 0.00 ? 24  GLY A HA2  6  
ATOM 7859  H HA3  . GLY A 1 16 ? -3.127  11.989  2.899   1.00 0.00 ? 24  GLY A HA3  6  
ATOM 7860  N N    . CYS A 1 17 ? -2.241  8.888   3.345   1.00 0.00 ? 25  CYS A N    6  
ATOM 7861  C CA   . CYS A 1 17 ? -2.671  7.505   3.182   1.00 0.00 ? 25  CYS A CA   6  
ATOM 7862  C C    . CYS A 1 17 ? -1.766  6.555   3.962   1.00 0.00 ? 25  CYS A C    6  
ATOM 7863  O O    . CYS A 1 17 ? -0.628  6.892   4.287   1.00 0.00 ? 25  CYS A O    6  
ATOM 7864  C CB   . CYS A 1 17 ? -2.670  7.129   1.697   1.00 0.00 ? 25  CYS A CB   6  
ATOM 7865  S SG   . CYS A 1 17 ? -3.134  5.414   1.358   1.00 0.00 ? 25  CYS A SG   6  
ATOM 7866  H H    . CYS A 1 17 ? -1.294  9.078   3.509   1.00 0.00 ? 25  CYS A H    6  
ATOM 7867  H HA   . CYS A 1 17 ? -3.675  7.422   3.564   1.00 0.00 ? 25  CYS A HA   6  
ATOM 7868  H HB2  . CYS A 1 17 ? -3.370  7.764   1.178   1.00 0.00 ? 25  CYS A HB2  6  
ATOM 7869  H HB3  . CYS A 1 17 ? -1.681  7.289   1.295   1.00 0.00 ? 25  CYS A HB3  6  
ATOM 7870  H HG   . CYS A 1 17 ? -2.350  4.869   1.463   1.00 0.00 ? 25  CYS A HG   6  
ATOM 7871  N N    . SER A 1 18 ? -2.280  5.365   4.258   1.00 0.00 ? 26  SER A N    6  
ATOM 7872  C CA   . SER A 1 18 ? -1.520  4.363   4.992   1.00 0.00 ? 26  SER A CA   6  
ATOM 7873  C C    . SER A 1 18 ? -1.247  3.156   4.104   1.00 0.00 ? 26  SER A C    6  
ATOM 7874  O O    . SER A 1 18 ? -1.739  3.085   2.979   1.00 0.00 ? 26  SER A O    6  
ATOM 7875  C CB   . SER A 1 18 ? -2.285  3.930   6.245   1.00 0.00 ? 26  SER A CB   6  
ATOM 7876  O OG   . SER A 1 18 ? -1.857  4.656   7.383   1.00 0.00 ? 26  SER A OG   6  
ATOM 7877  H H    . SER A 1 18 ? -3.194  5.154   3.971   1.00 0.00 ? 26  SER A H    6  
ATOM 7878  H HA   . SER A 1 18 ? -0.580  4.805   5.285   1.00 0.00 ? 26  SER A HA   6  
ATOM 7879  H HB2  . SER A 1 18 ? -3.340  4.108   6.098   1.00 0.00 ? 26  SER A HB2  6  
ATOM 7880  H HB3  . SER A 1 18 ? -2.119  2.877   6.420   1.00 0.00 ? 26  SER A HB3  6  
ATOM 7881  H HG   . SER A 1 18 ? -1.771  4.059   8.130   1.00 0.00 ? 26  SER A HG   6  
ATOM 7882  N N    . ILE A 1 19 ? -0.455  2.215   4.602   1.00 0.00 ? 27  ILE A N    6  
ATOM 7883  C CA   . ILE A 1 19 ? -0.124  1.022   3.833   1.00 0.00 ? 27  ILE A CA   6  
ATOM 7884  C C    . ILE A 1 19 ? -0.211  -0.234  4.692   1.00 0.00 ? 27  ILE A C    6  
ATOM 7885  O O    . ILE A 1 19 ? -0.455  -0.162  5.896   1.00 0.00 ? 27  ILE A O    6  
ATOM 7886  C CB   . ILE A 1 19 ? 1.283   1.113   3.219   1.00 0.00 ? 27  ILE A CB   6  
ATOM 7887  C CG1  . ILE A 1 19 ? 2.298   1.562   4.271   1.00 0.00 ? 27  ILE A CG1  6  
ATOM 7888  C CG2  . ILE A 1 19 ? 1.283   2.068   2.035   1.00 0.00 ? 27  ILE A CG2  6  
ATOM 7889  C CD1  . ILE A 1 19 ? 3.710   1.656   3.740   1.00 0.00 ? 27  ILE A CD1  6  
ATOM 7890  H H    . ILE A 1 19 ? -0.082  2.327   5.502   1.00 0.00 ? 27  ILE A H    6  
ATOM 7891  H HA   . ILE A 1 19 ? -0.839  0.940   3.028   1.00 0.00 ? 27  ILE A HA   6  
ATOM 7892  H HB   . ILE A 1 19 ? 1.559   0.134   2.859   1.00 0.00 ? 27  ILE A HB   6  
ATOM 7893  H HG12 . ILE A 1 19 ? 2.017   2.535   4.642   1.00 0.00 ? 27  ILE A HG12 6  
ATOM 7894  H HG13 . ILE A 1 19 ? 2.296   0.854   5.087   1.00 0.00 ? 27  ILE A HG13 6  
ATOM 7895  H HG21 . ILE A 1 19 ? 1.440   3.078   2.387   1.00 0.00 ? 27  ILE A HG21 6  
ATOM 7896  H HG22 . ILE A 1 19 ? 0.332   2.009   1.525   1.00 0.00 ? 27  ILE A HG22 6  
ATOM 7897  H HG23 . ILE A 1 19 ? 2.075   1.797   1.353   1.00 0.00 ? 27  ILE A HG23 6  
ATOM 7898  H HD11 . ILE A 1 19 ? 3.683   1.771   2.666   1.00 0.00 ? 27  ILE A HD11 6  
ATOM 7899  H HD12 . ILE A 1 19 ? 4.250   0.756   3.992   1.00 0.00 ? 27  ILE A HD12 6  
ATOM 7900  H HD13 . ILE A 1 19 ? 4.203   2.510   4.181   1.00 0.00 ? 27  ILE A HD13 6  
ATOM 7901  N N    . SER A 1 20 ? -0.011  -1.384  4.058   1.00 0.00 ? 28  SER A N    6  
ATOM 7902  C CA   . SER A 1 20 ? -0.068  -2.665  4.751   1.00 0.00 ? 28  SER A CA   6  
ATOM 7903  C C    . SER A 1 20 ? 0.917   -3.653  4.136   1.00 0.00 ? 28  SER A C    6  
ATOM 7904  O O    . SER A 1 20 ? 1.381   -3.462  3.012   1.00 0.00 ? 28  SER A O    6  
ATOM 7905  C CB   . SER A 1 20 ? -1.488  -3.235  4.696   1.00 0.00 ? 28  SER A CB   6  
ATOM 7906  O OG   . SER A 1 20 ? -1.490  -4.630  4.949   1.00 0.00 ? 28  SER A OG   6  
ATOM 7907  H H    . SER A 1 20 ? 0.175   -1.371  3.096   1.00 0.00 ? 28  SER A H    6  
ATOM 7908  H HA   . SER A 1 20 ? 0.204   -2.497  5.781   1.00 0.00 ? 28  SER A HA   6  
ATOM 7909  H HB2  . SER A 1 20 ? -2.098  -2.746  5.442   1.00 0.00 ? 28  SER A HB2  6  
ATOM 7910  H HB3  . SER A 1 20 ? -1.906  -3.058  3.717   1.00 0.00 ? 28  SER A HB3  6  
ATOM 7911  H HG   . SER A 1 20 ? -2.394  -4.950  4.971   1.00 0.00 ? 28  SER A HG   6  
ATOM 7912  N N    . SER A 1 21 ? 1.233   -4.709  4.877   1.00 0.00 ? 29  SER A N    6  
ATOM 7913  C CA   . SER A 1 21 ? 2.165   -5.723  4.400   1.00 0.00 ? 29  SER A CA   6  
ATOM 7914  C C    . SER A 1 21 ? 1.418   -6.984  3.982   1.00 0.00 ? 29  SER A C    6  
ATOM 7915  O O    . SER A 1 21 ? 0.369   -7.308  4.539   1.00 0.00 ? 29  SER A O    6  
ATOM 7916  C CB   . SER A 1 21 ? 3.190   -6.058  5.485   1.00 0.00 ? 29  SER A CB   6  
ATOM 7917  O OG   . SER A 1 21 ? 2.563   -6.222  6.745   1.00 0.00 ? 29  SER A OG   6  
ATOM 7918  H H    . SER A 1 21 ? 0.832   -4.807  5.766   1.00 0.00 ? 29  SER A H    6  
ATOM 7919  H HA   . SER A 1 21 ? 2.681   -5.322  3.540   1.00 0.00 ? 29  SER A HA   6  
ATOM 7920  H HB2  . SER A 1 21 ? 3.697   -6.975  5.227   1.00 0.00 ? 29  SER A HB2  6  
ATOM 7921  H HB3  . SER A 1 21 ? 3.910   -5.257  5.557   1.00 0.00 ? 29  SER A HB3  6  
ATOM 7922  H HG   . SER A 1 21 ? 2.872   -7.036  7.152   1.00 0.00 ? 29  SER A HG   6  
ATOM 7923  N N    . GLY A 1 22 ? 1.956   -7.682  2.989   1.00 0.00 ? 30  GLY A N    6  
ATOM 7924  C CA   . GLY A 1 22 ? 1.319   -8.891  2.504   1.00 0.00 ? 30  GLY A CA   6  
ATOM 7925  C C    . GLY A 1 22 ? 1.762   -10.134 3.249   1.00 0.00 ? 30  GLY A C    6  
ATOM 7926  O O    . GLY A 1 22 ? 2.860   -10.176 3.802   1.00 0.00 ? 30  GLY A O    6  
ATOM 7927  H H    . GLY A 1 22 ? 2.789   -7.370  2.576   1.00 0.00 ? 30  GLY A H    6  
ATOM 7928  H HA2  . GLY A 1 22 ? 0.250   -8.787  2.611   1.00 0.00 ? 30  GLY A HA2  6  
ATOM 7929  H HA3  . GLY A 1 22 ? 1.553   -9.012  1.456   1.00 0.00 ? 30  GLY A HA3  6  
ATOM 7930  N N    . PRO A 1 23 ? 0.915   -11.178 3.276   1.00 0.00 ? 31  PRO A N    6  
ATOM 7931  C CA   . PRO A 1 23 ? 1.225   -12.436 3.959   1.00 0.00 ? 31  PRO A CA   6  
ATOM 7932  C C    . PRO A 1 23 ? 2.308   -13.230 3.233   1.00 0.00 ? 31  PRO A C    6  
ATOM 7933  O O    . PRO A 1 23 ? 3.072   -12.673 2.443   1.00 0.00 ? 31  PRO A O    6  
ATOM 7934  C CB   . PRO A 1 23 ? -0.108  -13.189 3.937   1.00 0.00 ? 31  PRO A CB   6  
ATOM 7935  C CG   . PRO A 1 23 ? -0.824  -12.652 2.749   1.00 0.00 ? 31  PRO A CG   6  
ATOM 7936  C CD   . PRO A 1 23 ? -0.416  -11.209 2.637   1.00 0.00 ? 31  PRO A CD   6  
ATOM 7937  H HA   . PRO A 1 23 ? 1.531   -12.267 4.981   1.00 0.00 ? 31  PRO A HA   6  
ATOM 7938  H HB2  . PRO A 1 23 ? 0.072   -14.248 3.844   1.00 0.00 ? 31  PRO A HB2  6  
ATOM 7939  H HB3  . PRO A 1 23 ? -0.652  -12.990 4.847   1.00 0.00 ? 31  PRO A HB3  6  
ATOM 7940  H HG2  . PRO A 1 23 ? -0.527  -13.196 1.863   1.00 0.00 ? 31  PRO A HG2  6  
ATOM 7941  H HG3  . PRO A 1 23 ? -1.891  -12.727 2.898   1.00 0.00 ? 31  PRO A HG3  6  
ATOM 7942  H HD2  . PRO A 1 23 ? -0.351  -10.915 1.600   1.00 0.00 ? 31  PRO A HD2  6  
ATOM 7943  H HD3  . PRO A 1 23 ? -1.113  -10.578 3.168   1.00 0.00 ? 31  PRO A HD3  6  
ATOM 7944  N N    . ILE A 1 24 ? 2.371   -14.529 3.504   1.00 0.00 ? 32  ILE A N    6  
ATOM 7945  C CA   . ILE A 1 24 ? 3.363   -15.393 2.875   1.00 0.00 ? 32  ILE A CA   6  
ATOM 7946  C C    . ILE A 1 24 ? 2.931   -15.804 1.471   1.00 0.00 ? 32  ILE A C    6  
ATOM 7947  O O    . ILE A 1 24 ? 3.767   -16.092 0.614   1.00 0.00 ? 32  ILE A O    6  
ATOM 7948  C CB   . ILE A 1 24 ? 3.617   -16.661 3.711   1.00 0.00 ? 32  ILE A CB   6  
ATOM 7949  C CG1  . ILE A 1 24 ? 3.849   -16.298 5.180   1.00 0.00 ? 32  ILE A CG1  6  
ATOM 7950  C CG2  . ILE A 1 24 ? 4.804   -17.433 3.155   1.00 0.00 ? 32  ILE A CG2  6  
ATOM 7951  C CD1  . ILE A 1 24 ? 2.931   -17.029 6.135   1.00 0.00 ? 32  ILE A CD1  6  
ATOM 7952  H H    . ILE A 1 24 ? 1.737   -14.915 4.141   1.00 0.00 ? 32  ILE A H    6  
ATOM 7953  H HA   . ILE A 1 24 ? 4.290   -14.841 2.808   1.00 0.00 ? 32  ILE A HA   6  
ATOM 7954  H HB   . ILE A 1 24 ? 2.743   -17.292 3.638   1.00 0.00 ? 32  ILE A HB   6  
ATOM 7955  H HG12 . ILE A 1 24 ? 4.866   -16.539 5.450   1.00 0.00 ? 32  ILE A HG12 6  
ATOM 7956  H HG13 . ILE A 1 24 ? 3.688   -15.237 5.313   1.00 0.00 ? 32  ILE A HG13 6  
ATOM 7957  H HG21 . ILE A 1 24 ? 5.573   -16.739 2.849   1.00 0.00 ? 32  ILE A HG21 6  
ATOM 7958  H HG22 . ILE A 1 24 ? 4.488   -18.017 2.304   1.00 0.00 ? 32  ILE A HG22 6  
ATOM 7959  H HG23 . ILE A 1 24 ? 5.196   -18.091 3.918   1.00 0.00 ? 32  ILE A HG23 6  
ATOM 7960  H HD11 . ILE A 1 24 ? 1.952   -17.128 5.690   1.00 0.00 ? 32  ILE A HD11 6  
ATOM 7961  H HD12 . ILE A 1 24 ? 2.851   -16.473 7.057   1.00 0.00 ? 32  ILE A HD12 6  
ATOM 7962  H HD13 . ILE A 1 24 ? 3.332   -18.011 6.340   1.00 0.00 ? 32  ILE A HD13 6  
ATOM 7963  N N    . GLN A 1 25 ? 1.622   -15.835 1.242   1.00 0.00 ? 33  GLN A N    6  
ATOM 7964  C CA   . GLN A 1 25 ? 1.083   -16.218 -0.059  1.00 0.00 ? 33  GLN A CA   6  
ATOM 7965  C C    . GLN A 1 25 ? 1.016   -15.024 -1.013  1.00 0.00 ? 33  GLN A C    6  
ATOM 7966  O O    . GLN A 1 25 ? 0.575   -15.162 -2.154  1.00 0.00 ? 33  GLN A O    6  
ATOM 7967  C CB   . GLN A 1 25 ? -0.308  -16.831 0.105   1.00 0.00 ? 33  GLN A CB   6  
ATOM 7968  C CG   . GLN A 1 25 ? -0.285  -18.266 0.607   1.00 0.00 ? 33  GLN A CG   6  
ATOM 7969  C CD   . GLN A 1 25 ? -1.606  -18.691 1.218   1.00 0.00 ? 33  GLN A CD   6  
ATOM 7970  O OE1  . GLN A 1 25 ? -2.354  -19.470 0.628   1.00 0.00 ? 33  GLN A OE1  6  
ATOM 7971  N NE2  . GLN A 1 25 ? -1.899  -18.177 2.408   1.00 0.00 ? 33  GLN A NE2  6  
ATOM 7972  H H    . GLN A 1 25 ? 1.004   -15.600 1.965   1.00 0.00 ? 33  GLN A H    6  
ATOM 7973  H HA   . GLN A 1 25 ? 1.744   -16.960 -0.482  1.00 0.00 ? 33  GLN A HA   6  
ATOM 7974  H HB2  . GLN A 1 25 ? -0.873  -16.235 0.807   1.00 0.00 ? 33  GLN A HB2  6  
ATOM 7975  H HB3  . GLN A 1 25 ? -0.810  -16.817 -0.852  1.00 0.00 ? 33  GLN A HB3  6  
ATOM 7976  H HG2  . GLN A 1 25 ? -0.063  -18.920 -0.221  1.00 0.00 ? 33  GLN A HG2  6  
ATOM 7977  H HG3  . GLN A 1 25 ? 0.488   -18.358 1.356   1.00 0.00 ? 33  GLN A HG3  6  
ATOM 7978  H HE21 . GLN A 1 25 ? -1.256  -17.563 2.819   1.00 0.00 ? 33  GLN A HE21 6  
ATOM 7979  H HE22 . GLN A 1 25 ? -2.748  -18.436 2.825   1.00 0.00 ? 33  GLN A HE22 6  
ATOM 7980  N N    . LYS A 1 26 ? 1.452   -13.855 -0.547  1.00 0.00 ? 34  LYS A N    6  
ATOM 7981  C CA   . LYS A 1 26 ? 1.433   -12.655 -1.374  1.00 0.00 ? 34  LYS A CA   6  
ATOM 7982  C C    . LYS A 1 26 ? 2.074   -11.472 -0.647  1.00 0.00 ? 34  LYS A C    6  
ATOM 7983  O O    . LYS A 1 26 ? 1.403   -10.488 -0.333  1.00 0.00 ? 34  LYS A O    6  
ATOM 7984  C CB   . LYS A 1 26 ? -0.005  -12.307 -1.768  1.00 0.00 ? 34  LYS A CB   6  
ATOM 7985  C CG   . LYS A 1 26 ? -0.119  -11.653 -3.136  1.00 0.00 ? 34  LYS A CG   6  
ATOM 7986  C CD   . LYS A 1 26 ? -1.528  -11.776 -3.695  1.00 0.00 ? 34  LYS A CD   6  
ATOM 7987  C CE   . LYS A 1 26 ? -1.970  -10.493 -4.380  1.00 0.00 ? 34  LYS A CE   6  
ATOM 7988  N NZ   . LYS A 1 26 ? -1.387  -10.363 -5.744  1.00 0.00 ? 34  LYS A NZ   6  
ATOM 7989  H H    . LYS A 1 26 ? 1.794   -13.800 0.369   1.00 0.00 ? 34  LYS A H    6  
ATOM 7990  H HA   . LYS A 1 26 ? 2.000   -12.861 -2.268  1.00 0.00 ? 34  LYS A HA   6  
ATOM 7991  H HB2  . LYS A 1 26 ? -0.591  -13.214 -1.777  1.00 0.00 ? 34  LYS A HB2  6  
ATOM 7992  H HB3  . LYS A 1 26 ? -0.414  -11.629 -1.034  1.00 0.00 ? 34  LYS A HB3  6  
ATOM 7993  H HG2  . LYS A 1 26 ? 0.131   -10.607 -3.046  1.00 0.00 ? 34  LYS A HG2  6  
ATOM 7994  H HG3  . LYS A 1 26 ? 0.571   -12.135 -3.814  1.00 0.00 ? 34  LYS A HG3  6  
ATOM 7995  H HD2  . LYS A 1 26 ? -1.550  -12.582 -4.414  1.00 0.00 ? 34  LYS A HD2  6  
ATOM 7996  H HD3  . LYS A 1 26 ? -2.209  -11.996 -2.885  1.00 0.00 ? 34  LYS A HD3  6  
ATOM 7997  H HE2  . LYS A 1 26 ? -3.046  -10.494 -4.457  1.00 0.00 ? 34  LYS A HE2  6  
ATOM 7998  H HE3  . LYS A 1 26 ? -1.653  -9.653  -3.780  1.00 0.00 ? 34  LYS A HE3  6  
ATOM 7999  H HZ1  . LYS A 1 26 ? -1.272  -9.358  -5.989  1.00 0.00 ? 34  LYS A HZ1  6  
ATOM 8000  H HZ2  . LYS A 1 26 ? -2.013  -10.809 -6.445  1.00 0.00 ? 34  LYS A HZ2  6  
ATOM 8001  H HZ3  . LYS A 1 26 ? -0.457  -10.827 -5.781  1.00 0.00 ? 34  LYS A HZ3  6  
ATOM 8002  N N    . PRO A 1 27 ? 3.388   -11.551 -0.372  1.00 0.00 ? 35  PRO A N    6  
ATOM 8003  C CA   . PRO A 1 27 ? 4.119   -10.484 0.318   1.00 0.00 ? 35  PRO A CA   6  
ATOM 8004  C C    . PRO A 1 27 ? 4.260   -9.238  -0.549  1.00 0.00 ? 35  PRO A C    6  
ATOM 8005  O O    . PRO A 1 27 ? 4.857   -9.285  -1.626  1.00 0.00 ? 35  PRO A O    6  
ATOM 8006  C CB   . PRO A 1 27 ? 5.499   -11.098 0.597   1.00 0.00 ? 35  PRO A CB   6  
ATOM 8007  C CG   . PRO A 1 27 ? 5.355   -12.558 0.317   1.00 0.00 ? 35  PRO A CG   6  
ATOM 8008  C CD   . PRO A 1 27 ? 4.267   -12.680 -0.706  1.00 0.00 ? 35  PRO A CD   6  
ATOM 8009  H HA   . PRO A 1 27 ? 3.642   -10.218 1.250   1.00 0.00 ? 35  PRO A HA   6  
ATOM 8010  H HB2  . PRO A 1 27 ? 6.234   -10.644 -0.054  1.00 0.00 ? 35  PRO A HB2  6  
ATOM 8011  H HB3  . PRO A 1 27 ? 5.770   -10.920 1.628   1.00 0.00 ? 35  PRO A HB3  6  
ATOM 8012  H HG2  . PRO A 1 27 ? 6.283   -12.950 -0.074  1.00 0.00 ? 35  PRO A HG2  6  
ATOM 8013  H HG3  . PRO A 1 27 ? 5.079   -13.079 1.222   1.00 0.00 ? 35  PRO A HG3  6  
ATOM 8014  H HD2  . PRO A 1 27 ? 4.670   -12.575 -1.704  1.00 0.00 ? 35  PRO A HD2  6  
ATOM 8015  H HD3  . PRO A 1 27 ? 3.749   -13.619 -0.600  1.00 0.00 ? 35  PRO A HD3  6  
ATOM 8016  N N    . GLY A 1 28 ? 3.709   -8.124  -0.078  1.00 0.00 ? 36  GLY A N    6  
ATOM 8017  C CA   . GLY A 1 28 ? 3.790   -6.886  -0.830  1.00 0.00 ? 36  GLY A CA   6  
ATOM 8018  C C    . GLY A 1 28 ? 3.336   -5.682  -0.029  1.00 0.00 ? 36  GLY A C    6  
ATOM 8019  O O    . GLY A 1 28 ? 3.032   -5.796  1.158   1.00 0.00 ? 36  GLY A O    6  
ATOM 8020  H H    . GLY A 1 28 ? 3.246   -8.143  0.784   1.00 0.00 ? 36  GLY A H    6  
ATOM 8021  H HA2  . GLY A 1 28 ? 4.814   -6.731  -1.140  1.00 0.00 ? 36  GLY A HA2  6  
ATOM 8022  H HA3  . GLY A 1 28 ? 3.170   -6.972  -1.711  1.00 0.00 ? 36  GLY A HA3  6  
ATOM 8023  N N    . ILE A 1 29 ? 3.292   -4.524  -0.681  1.00 0.00 ? 37  ILE A N    6  
ATOM 8024  C CA   . ILE A 1 29 ? 2.874   -3.291  -0.025  1.00 0.00 ? 37  ILE A CA   6  
ATOM 8025  C C    . ILE A 1 29 ? 1.475   -2.882  -0.474  1.00 0.00 ? 37  ILE A C    6  
ATOM 8026  O O    . ILE A 1 29 ? 1.270   -2.501  -1.627  1.00 0.00 ? 37  ILE A O    6  
ATOM 8027  C CB   . ILE A 1 29 ? 3.853   -2.138  -0.317  1.00 0.00 ? 37  ILE A CB   6  
ATOM 8028  C CG1  . ILE A 1 29 ? 5.300   -2.619  -0.173  1.00 0.00 ? 37  ILE A CG1  6  
ATOM 8029  C CG2  . ILE A 1 29 ? 3.585   -0.962  0.610   1.00 0.00 ? 37  ILE A CG2  6  
ATOM 8030  C CD1  . ILE A 1 29 ? 5.659   -3.035  1.238   1.00 0.00 ? 37  ILE A CD1  6  
ATOM 8031  H H    . ILE A 1 29 ? 3.548   -4.498  -1.627  1.00 0.00 ? 37  ILE A H    6  
ATOM 8032  H HA   . ILE A 1 29 ? 2.862   -3.466  1.041   1.00 0.00 ? 37  ILE A HA   6  
ATOM 8033  H HB   . ILE A 1 29 ? 3.692   -1.807  -1.332  1.00 0.00 ? 37  ILE A HB   6  
ATOM 8034  H HG12 . ILE A 1 29 ? 5.454   -3.470  -0.818  1.00 0.00 ? 37  ILE A HG12 6  
ATOM 8035  H HG13 . ILE A 1 29 ? 5.968   -1.823  -0.466  1.00 0.00 ? 37  ILE A HG13 6  
ATOM 8036  H HG21 . ILE A 1 29 ? 4.311   -0.959  1.408   1.00 0.00 ? 37  ILE A HG21 6  
ATOM 8037  H HG22 . ILE A 1 29 ? 2.592   -1.051  1.027   1.00 0.00 ? 37  ILE A HG22 6  
ATOM 8038  H HG23 . ILE A 1 29 ? 3.659   -0.039  0.051   1.00 0.00 ? 37  ILE A HG23 6  
ATOM 8039  H HD11 . ILE A 1 29 ? 5.488   -4.094  1.356   1.00 0.00 ? 37  ILE A HD11 6  
ATOM 8040  H HD12 . ILE A 1 29 ? 5.046   -2.491  1.941   1.00 0.00 ? 37  ILE A HD12 6  
ATOM 8041  H HD13 . ILE A 1 29 ? 6.701   -2.816  1.423   1.00 0.00 ? 37  ILE A HD13 6  
ATOM 8042  N N    . PHE A 1 30 ? 0.515   -2.966  0.441   1.00 0.00 ? 38  PHE A N    6  
ATOM 8043  C CA   . PHE A 1 30 ? -0.866  -2.607  0.136   1.00 0.00 ? 38  PHE A CA   6  
ATOM 8044  C C    . PHE A 1 30 ? -1.203  -1.220  0.663   1.00 0.00 ? 38  PHE A C    6  
ATOM 8045  O O    . PHE A 1 30 ? -0.393  -0.587  1.342   1.00 0.00 ? 38  PHE A O    6  
ATOM 8046  C CB   . PHE A 1 30 ? -1.829  -3.641  0.726   1.00 0.00 ? 38  PHE A CB   6  
ATOM 8047  C CG   . PHE A 1 30 ? -1.361  -5.063  0.570   1.00 0.00 ? 38  PHE A CG   6  
ATOM 8048  C CD1  . PHE A 1 30 ? -0.571  -5.436  -0.508  1.00 0.00 ? 38  PHE A CD1  6  
ATOM 8049  C CD2  . PHE A 1 30 ? -1.712  -6.024  1.502   1.00 0.00 ? 38  PHE A CD2  6  
ATOM 8050  C CE1  . PHE A 1 30 ? -0.140  -6.740  -0.650  1.00 0.00 ? 38  PHE A CE1  6  
ATOM 8051  C CE2  . PHE A 1 30 ? -1.284  -7.330  1.365   1.00 0.00 ? 38  PHE A CE2  6  
ATOM 8052  C CZ   . PHE A 1 30 ? -0.498  -7.689  0.286   1.00 0.00 ? 38  PHE A CZ   6  
ATOM 8053  H H    . PHE A 1 30 ? 0.740   -3.278  1.343   1.00 0.00 ? 38  PHE A H    6  
ATOM 8054  H HA   . PHE A 1 30 ? -0.976  -2.602  -0.937  1.00 0.00 ? 38  PHE A HA   6  
ATOM 8055  H HB2  . PHE A 1 30 ? -1.949  -3.447  1.781   1.00 0.00 ? 38  PHE A HB2  6  
ATOM 8056  H HB3  . PHE A 1 30 ? -2.786  -3.550  0.236   1.00 0.00 ? 38  PHE A HB3  6  
ATOM 8057  H HD1  . PHE A 1 30 ? -0.290  -4.693  -1.241  1.00 0.00 ? 38  PHE A HD1  6  
ATOM 8058  H HD2  . PHE A 1 30 ? -2.327  -5.747  2.346   1.00 0.00 ? 38  PHE A HD2  6  
ATOM 8059  H HE1  . PHE A 1 30 ? 0.474   -7.017  -1.495  1.00 0.00 ? 38  PHE A HE1  6  
ATOM 8060  H HE2  . PHE A 1 30 ? -1.565  -8.071  2.099   1.00 0.00 ? 38  PHE A HE2  6  
ATOM 8061  H HZ   . PHE A 1 30 ? -0.161  -8.709  0.177   1.00 0.00 ? 38  PHE A HZ   6  
ATOM 8062  N N    . ILE A 1 31 ? -2.401  -0.752  0.339   1.00 0.00 ? 39  ILE A N    6  
ATOM 8063  C CA   . ILE A 1 31 ? -2.850  0.563   0.772   1.00 0.00 ? 39  ILE A CA   6  
ATOM 8064  C C    . ILE A 1 31 ? -3.920  0.450   1.858   1.00 0.00 ? 39  ILE A C    6  
ATOM 8065  O O    . ILE A 1 31 ? -4.820  -0.385  1.780   1.00 0.00 ? 39  ILE A O    6  
ATOM 8066  C CB   . ILE A 1 31 ? -3.404  1.379   -0.417  1.00 0.00 ? 39  ILE A CB   6  
ATOM 8067  C CG1  . ILE A 1 31 ? -2.264  1.794   -1.350  1.00 0.00 ? 39  ILE A CG1  6  
ATOM 8068  C CG2  . ILE A 1 31 ? -4.167  2.606   0.070   1.00 0.00 ? 39  ILE A CG2  6  
ATOM 8069  C CD1  . ILE A 1 31 ? -1.343  2.836   -0.752  1.00 0.00 ? 39  ILE A CD1  6  
ATOM 8070  H H    . ILE A 1 31 ? -2.998  -1.304  -0.207  1.00 0.00 ? 39  ILE A H    6  
ATOM 8071  H HA   . ILE A 1 31 ? -1.997  1.089   1.176   1.00 0.00 ? 39  ILE A HA   6  
ATOM 8072  H HB   . ILE A 1 31 ? -4.095  0.754   -0.964  1.00 0.00 ? 39  ILE A HB   6  
ATOM 8073  H HG12 . ILE A 1 31 ? -1.670  0.924   -1.589  1.00 0.00 ? 39  ILE A HG12 6  
ATOM 8074  H HG13 . ILE A 1 31 ? -2.682  2.200   -2.259  1.00 0.00 ? 39  ILE A HG13 6  
ATOM 8075  H HG21 . ILE A 1 31 ? -5.227  2.400   0.056   1.00 0.00 ? 39  ILE A HG21 6  
ATOM 8076  H HG22 . ILE A 1 31 ? -3.953  3.443   -0.578  1.00 0.00 ? 39  ILE A HG22 6  
ATOM 8077  H HG23 . ILE A 1 31 ? -3.858  2.842   1.078   1.00 0.00 ? 39  ILE A HG23 6  
ATOM 8078  H HD11 . ILE A 1 31 ? -1.287  3.688   -1.413  1.00 0.00 ? 39  ILE A HD11 6  
ATOM 8079  H HD12 . ILE A 1 31 ? -0.358  2.414   -0.623  1.00 0.00 ? 39  ILE A HD12 6  
ATOM 8080  H HD13 . ILE A 1 31 ? -1.730  3.149   0.208   1.00 0.00 ? 39  ILE A HD13 6  
ATOM 8081  N N    . SER A 1 32 ? -3.810  1.308   2.863   1.00 0.00 ? 40  SER A N    6  
ATOM 8082  C CA   . SER A 1 32 ? -4.755  1.332   3.971   1.00 0.00 ? 40  SER A CA   6  
ATOM 8083  C C    . SER A 1 32 ? -5.679  2.541   3.856   1.00 0.00 ? 40  SER A C    6  
ATOM 8084  O O    . SER A 1 32 ? -5.702  3.220   2.829   1.00 0.00 ? 40  SER A O    6  
ATOM 8085  C CB   . SER A 1 32 ? -4.010  1.360   5.307   1.00 0.00 ? 40  SER A CB   6  
ATOM 8086  O OG   . SER A 1 32 ? -4.499  0.359   6.183   1.00 0.00 ? 40  SER A OG   6  
ATOM 8087  H H    . SER A 1 32 ? -3.073  1.950   2.859   1.00 0.00 ? 40  SER A H    6  
ATOM 8088  H HA   . SER A 1 32 ? -5.351  0.433   3.917   1.00 0.00 ? 40  SER A HA   6  
ATOM 8089  H HB2  . SER A 1 32 ? -2.959  1.188   5.135   1.00 0.00 ? 40  SER A HB2  6  
ATOM 8090  H HB3  . SER A 1 32 ? -4.145  2.326   5.773   1.00 0.00 ? 40  SER A HB3  6  
ATOM 8091  H HG   . SER A 1 32 ? -4.673  0.744   7.045   1.00 0.00 ? 40  SER A HG   6  
ATOM 8092  N N    . HIS A 1 33 ? -6.442  2.801   4.914   1.00 0.00 ? 41  HIS A N    6  
ATOM 8093  C CA   . HIS A 1 33 ? -7.374  3.927   4.935   1.00 0.00 ? 41  HIS A CA   6  
ATOM 8094  C C    . HIS A 1 33 ? -6.722  5.197   4.391   1.00 0.00 ? 41  HIS A C    6  
ATOM 8095  O O    . HIS A 1 33 ? -5.569  5.498   4.701   1.00 0.00 ? 41  HIS A O    6  
ATOM 8096  C CB   . HIS A 1 33 ? -7.876  4.171   6.359   1.00 0.00 ? 41  HIS A CB   6  
ATOM 8097  C CG   . HIS A 1 33 ? -6.792  4.554   7.318   1.00 0.00 ? 41  HIS A CG   6  
ATOM 8098  N ND1  . HIS A 1 33 ? -6.739  5.781   7.946   1.00 0.00 ? 41  HIS A ND1  6  
ATOM 8099  C CD2  . HIS A 1 33 ? -5.713  3.863   7.758   1.00 0.00 ? 41  HIS A CD2  6  
ATOM 8100  C CE1  . HIS A 1 33 ? -5.674  5.828   8.727   1.00 0.00 ? 41  HIS A CE1  6  
ATOM 8101  N NE2  . HIS A 1 33 ? -5.036  4.677   8.631   1.00 0.00 ? 41  HIS A NE2  6  
ATOM 8102  H H    . HIS A 1 33 ? -6.377  2.223   5.700   1.00 0.00 ? 41  HIS A H    6  
ATOM 8103  H HA   . HIS A 1 33 ? -8.214  3.672   4.307   1.00 0.00 ? 41  HIS A HA   6  
ATOM 8104  H HB2  . HIS A 1 33 ? -8.603  4.970   6.345   1.00 0.00 ? 41  HIS A HB2  6  
ATOM 8105  H HB3  . HIS A 1 33 ? -8.344  3.270   6.727   1.00 0.00 ? 41  HIS A HB3  6  
ATOM 8106  H HD1  . HIS A 1 33 ? -7.385  6.510   7.833   1.00 0.00 ? 41  HIS A HD1  6  
ATOM 8107  H HD2  . HIS A 1 33 ? -5.436  2.858   7.471   1.00 0.00 ? 41  HIS A HD2  6  
ATOM 8108  H HE1  . HIS A 1 33 ? -5.378  6.667   9.341   1.00 0.00 ? 41  HIS A HE1  6  
ATOM 8109  H HE2  . HIS A 1 33 ? -4.264  4.412   9.173   1.00 0.00 ? 41  HIS A HE2  6  
ATOM 8110  N N    . VAL A 1 34 ? -7.469  5.934   3.576   1.00 0.00 ? 42  VAL A N    6  
ATOM 8111  C CA   . VAL A 1 34 ? -6.967  7.170   2.985   1.00 0.00 ? 42  VAL A CA   6  
ATOM 8112  C C    . VAL A 1 34 ? -7.640  8.389   3.605   1.00 0.00 ? 42  VAL A C    6  
ATOM 8113  O O    . VAL A 1 34 ? -8.733  8.291   4.164   1.00 0.00 ? 42  VAL A O    6  
ATOM 8114  C CB   . VAL A 1 34 ? -7.191  7.196   1.462   1.00 0.00 ? 42  VAL A CB   6  
ATOM 8115  C CG1  . VAL A 1 34 ? -6.466  8.377   0.835   1.00 0.00 ? 42  VAL A CG1  6  
ATOM 8116  C CG2  . VAL A 1 34 ? -6.737  5.887   0.833   1.00 0.00 ? 42  VAL A CG2  6  
ATOM 8117  H H    . VAL A 1 34 ? -8.380  5.640   3.366   1.00 0.00 ? 42  VAL A H    6  
ATOM 8118  H HA   . VAL A 1 34 ? -5.904  7.222   3.173   1.00 0.00 ? 42  VAL A HA   6  
ATOM 8119  H HB   . VAL A 1 34 ? -8.249  7.312   1.276   1.00 0.00 ? 42  VAL A HB   6  
ATOM 8120  H HG11 . VAL A 1 34 ? -6.979  9.292   1.091   1.00 0.00 ? 42  VAL A HG11 6  
ATOM 8121  H HG12 . VAL A 1 34 ? -6.449  8.261   -0.238  1.00 0.00 ? 42  VAL A HG12 6  
ATOM 8122  H HG13 . VAL A 1 34 ? -5.453  8.417   1.208   1.00 0.00 ? 42  VAL A HG13 6  
ATOM 8123  H HG21 . VAL A 1 34 ? -6.596  6.027   -0.228  1.00 0.00 ? 42  VAL A HG21 6  
ATOM 8124  H HG22 . VAL A 1 34 ? -7.487  5.129   0.999   1.00 0.00 ? 42  VAL A HG22 6  
ATOM 8125  H HG23 . VAL A 1 34 ? -5.806  5.576   1.282   1.00 0.00 ? 42  VAL A HG23 6  
ATOM 8126  N N    . LYS A 1 35 ? -6.980  9.538   3.504   1.00 0.00 ? 43  LYS A N    6  
ATOM 8127  C CA   . LYS A 1 35 ? -7.516  10.778  4.056   1.00 0.00 ? 43  LYS A CA   6  
ATOM 8128  C C    . LYS A 1 35 ? -7.992  11.708  2.942   1.00 0.00 ? 43  LYS A C    6  
ATOM 8129  O O    . LYS A 1 35 ? -7.513  11.631  1.811   1.00 0.00 ? 43  LYS A O    6  
ATOM 8130  C CB   . LYS A 1 35 ? -6.456  11.481  4.905   1.00 0.00 ? 43  LYS A CB   6  
ATOM 8131  C CG   . LYS A 1 35 ? -6.236  10.831  6.262   1.00 0.00 ? 43  LYS A CG   6  
ATOM 8132  C CD   . LYS A 1 35 ? -6.082  11.871  7.360   1.00 0.00 ? 43  LYS A CD   6  
ATOM 8133  C CE   . LYS A 1 35 ? -5.710  11.231  8.687   1.00 0.00 ? 43  LYS A CE   6  
ATOM 8134  N NZ   . LYS A 1 35 ? -6.471  11.821  9.822   1.00 0.00 ? 43  LYS A NZ   6  
ATOM 8135  H H    . LYS A 1 35 ? -6.114  9.553   3.048   1.00 0.00 ? 43  LYS A H    6  
ATOM 8136  H HA   . LYS A 1 35 ? -8.358  10.525  4.682   1.00 0.00 ? 43  LYS A HA   6  
ATOM 8137  H HB2  . LYS A 1 35 ? -5.518  11.472  4.370   1.00 0.00 ? 43  LYS A HB2  6  
ATOM 8138  H HB3  . LYS A 1 35 ? -6.760  12.505  5.064   1.00 0.00 ? 43  LYS A HB3  6  
ATOM 8139  H HG2  . LYS A 1 35 ? -7.084  10.204  6.491   1.00 0.00 ? 43  LYS A HG2  6  
ATOM 8140  H HG3  . LYS A 1 35 ? -5.341  10.229  6.221   1.00 0.00 ? 43  LYS A HG3  6  
ATOM 8141  H HD2  . LYS A 1 35 ? -5.305  12.567  7.078   1.00 0.00 ? 43  LYS A HD2  6  
ATOM 8142  H HD3  . LYS A 1 35 ? -7.017  12.400  7.475   1.00 0.00 ? 43  LYS A HD3  6  
ATOM 8143  H HE2  . LYS A 1 35 ? -5.921  10.173  8.635   1.00 0.00 ? 43  LYS A HE2  6  
ATOM 8144  H HE3  . LYS A 1 35 ? -4.653  11.377  8.859   1.00 0.00 ? 43  LYS A HE3  6  
ATOM 8145  H HZ1  . LYS A 1 35 ? -6.590  12.845  9.679   1.00 0.00 ? 43  LYS A HZ1  6  
ATOM 8146  H HZ2  . LYS A 1 35 ? -5.962  11.664  10.715  1.00 0.00 ? 43  LYS A HZ2  6  
ATOM 8147  H HZ3  . LYS A 1 35 ? -7.411  11.381  9.889   1.00 0.00 ? 43  LYS A HZ3  6  
ATOM 8148  N N    . PRO A 1 36 ? -8.947  12.602  3.249   1.00 0.00 ? 44  PRO A N    6  
ATOM 8149  C CA   . PRO A 1 36 ? -9.487  13.547  2.275   1.00 0.00 ? 44  PRO A CA   6  
ATOM 8150  C C    . PRO A 1 36 ? -8.611  14.785  2.119   1.00 0.00 ? 44  PRO A C    6  
ATOM 8151  O O    . PRO A 1 36 ? -7.881  15.160  3.037   1.00 0.00 ? 44  PRO A O    6  
ATOM 8152  C CB   . PRO A 1 36 ? -10.836 13.918  2.883   1.00 0.00 ? 44  PRO A CB   6  
ATOM 8153  C CG   . PRO A 1 36 ? -10.618 13.832  4.355   1.00 0.00 ? 44  PRO A CG   6  
ATOM 8154  C CD   . PRO A 1 36 ? -9.579  12.760  4.575   1.00 0.00 ? 44  PRO A CD   6  
ATOM 8155  H HA   . PRO A 1 36 ? -9.635  13.084  1.311   1.00 0.00 ? 44  PRO A HA   6  
ATOM 8156  H HB2  . PRO A 1 36 ? -11.108 14.919  2.579   1.00 0.00 ? 44  PRO A HB2  6  
ATOM 8157  H HB3  . PRO A 1 36 ? -11.589 13.219  2.555   1.00 0.00 ? 44  PRO A HB3  6  
ATOM 8158  H HG2  . PRO A 1 36 ? -10.259 14.781  4.728   1.00 0.00 ? 44  PRO A HG2  6  
ATOM 8159  H HG3  . PRO A 1 36 ? -11.541 13.565  4.847   1.00 0.00 ? 44  PRO A HG3  6  
ATOM 8160  H HD2  . PRO A 1 36 ? -8.854  13.083  5.308   1.00 0.00 ? 44  PRO A HD2  6  
ATOM 8161  H HD3  . PRO A 1 36 ? -10.049 11.840  4.889   1.00 0.00 ? 44  PRO A HD3  6  
ATOM 8162  N N    . GLY A 1 37 ? -8.687  15.416  0.952   1.00 0.00 ? 45  GLY A N    6  
ATOM 8163  C CA   . GLY A 1 37 ? -7.897  16.607  0.699   1.00 0.00 ? 45  GLY A CA   6  
ATOM 8164  C C    . GLY A 1 37 ? -6.407  16.351  0.807   1.00 0.00 ? 45  GLY A C    6  
ATOM 8165  O O    . GLY A 1 37 ? -5.634  17.260  1.114   1.00 0.00 ? 45  GLY A O    6  
ATOM 8166  H H    . GLY A 1 37 ? -9.288  15.072  0.257   1.00 0.00 ? 45  GLY A H    6  
ATOM 8167  H HA2  . GLY A 1 37 ? -8.118  16.966  -0.295  1.00 0.00 ? 45  GLY A HA2  6  
ATOM 8168  H HA3  . GLY A 1 37 ? -8.174  17.368  1.415   1.00 0.00 ? 45  GLY A HA3  6  
ATOM 8169  N N    . SER A 1 38 ? -6.001  15.110  0.555   1.00 0.00 ? 46  SER A N    6  
ATOM 8170  C CA   . SER A 1 38 ? -4.594  14.737  0.624   1.00 0.00 ? 46  SER A CA   6  
ATOM 8171  C C    . SER A 1 38 ? -4.052  14.405  -0.762  1.00 0.00 ? 46  SER A C    6  
ATOM 8172  O O    . SER A 1 38 ? -4.768  14.510  -1.759  1.00 0.00 ? 46  SER A O    6  
ATOM 8173  C CB   . SER A 1 38 ? -4.405  13.539  1.559   1.00 0.00 ? 46  SER A CB   6  
ATOM 8174  O OG   . SER A 1 38 ? -5.623  13.179  2.184   1.00 0.00 ? 46  SER A OG   6  
ATOM 8175  H H    . SER A 1 38 ? -6.664  14.430  0.316   1.00 0.00 ? 46  SER A H    6  
ATOM 8176  H HA   . SER A 1 38 ? -4.044  15.579  1.021   1.00 0.00 ? 46  SER A HA   6  
ATOM 8177  H HB2  . SER A 1 38 ? -4.044  12.695  0.991   1.00 0.00 ? 46  SER A HB2  6  
ATOM 8178  H HB3  . SER A 1 38 ? -3.685  13.792  2.321   1.00 0.00 ? 46  SER A HB3  6  
ATOM 8179  H HG   . SER A 1 38 ? -5.652  12.227  2.302   1.00 0.00 ? 46  SER A HG   6  
ATOM 8180  N N    . LEU A 1 39 ? -2.787  14.006  -0.820  1.00 0.00 ? 47  LEU A N    6  
ATOM 8181  C CA   . LEU A 1 39 ? -2.157  13.658  -2.087  1.00 0.00 ? 47  LEU A CA   6  
ATOM 8182  C C    . LEU A 1 39 ? -2.678  12.320  -2.600  1.00 0.00 ? 47  LEU A C    6  
ATOM 8183  O O    . LEU A 1 39 ? -3.020  12.187  -3.775  1.00 0.00 ? 47  LEU A O    6  
ATOM 8184  C CB   . LEU A 1 39 ? -0.639  13.604  -1.930  1.00 0.00 ? 47  LEU A CB   6  
ATOM 8185  C CG   . LEU A 1 39 ? 0.058   14.965  -1.944  1.00 0.00 ? 47  LEU A CG   6  
ATOM 8186  C CD1  . LEU A 1 39 ? 1.456   14.854  -1.362  1.00 0.00 ? 47  LEU A CD1  6  
ATOM 8187  C CD2  . LEU A 1 39 ? 0.109   15.521  -3.358  1.00 0.00 ? 47  LEU A CD2  6  
ATOM 8188  H H    . LEU A 1 39 ? -2.267  13.940  0.007   1.00 0.00 ? 47  LEU A H    6  
ATOM 8189  H HA   . LEU A 1 39 ? -2.409  14.426  -2.804  1.00 0.00 ? 47  LEU A HA   6  
ATOM 8190  H HB2  . LEU A 1 39 ? -0.413  13.116  -0.994  1.00 0.00 ? 47  LEU A HB2  6  
ATOM 8191  H HB3  . LEU A 1 39 ? -0.234  13.010  -2.735  1.00 0.00 ? 47  LEU A HB3  6  
ATOM 8192  H HG   . LEU A 1 39 ? -0.504  15.656  -1.331  1.00 0.00 ? 47  LEU A HG   6  
ATOM 8193  H HD11 . LEU A 1 39 ? 2.164   14.685  -2.160  1.00 0.00 ? 47  LEU A HD11 6  
ATOM 8194  H HD12 . LEU A 1 39 ? 1.493   14.026  -0.669  1.00 0.00 ? 47  LEU A HD12 6  
ATOM 8195  H HD13 . LEU A 1 39 ? 1.705   15.768  -0.846  1.00 0.00 ? 47  LEU A HD13 6  
ATOM 8196  H HD21 . LEU A 1 39 ? 0.718   14.879  -3.976  1.00 0.00 ? 47  LEU A HD21 6  
ATOM 8197  H HD22 . LEU A 1 39 ? 0.535   16.514  -3.340  1.00 0.00 ? 47  LEU A HD22 6  
ATOM 8198  H HD23 . LEU A 1 39 ? -0.891  15.568  -3.763  1.00 0.00 ? 47  LEU A HD23 6  
ATOM 8199  N N    . SER A 1 40 ? -2.740  11.331  -1.712  1.00 0.00 ? 48  SER A N    6  
ATOM 8200  C CA   . SER A 1 40 ? -3.226  10.006  -2.082  1.00 0.00 ? 48  SER A CA   6  
ATOM 8201  C C    . SER A 1 40 ? -4.595  10.105  -2.751  1.00 0.00 ? 48  SER A C    6  
ATOM 8202  O O    . SER A 1 40 ? -4.882  9.393   -3.713  1.00 0.00 ? 48  SER A O    6  
ATOM 8203  C CB   . SER A 1 40 ? -3.311  9.106   -0.849  1.00 0.00 ? 48  SER A CB   6  
ATOM 8204  O OG   . SER A 1 40 ? -3.311  9.872   0.343   1.00 0.00 ? 48  SER A OG   6  
ATOM 8205  H H    . SER A 1 40 ? -2.454  11.495  -0.787  1.00 0.00 ? 48  SER A H    6  
ATOM 8206  H HA   . SER A 1 40 ? -2.527  9.577   -2.783  1.00 0.00 ? 48  SER A HA   6  
ATOM 8207  H HB2  . SER A 1 40 ? -4.223  8.527   -0.888  1.00 0.00 ? 48  SER A HB2  6  
ATOM 8208  H HB3  . SER A 1 40 ? -2.463  8.438   -0.834  1.00 0.00 ? 48  SER A HB3  6  
ATOM 8209  H HG   . SER A 1 40 ? -4.203  10.172  0.532   1.00 0.00 ? 48  SER A HG   6  
ATOM 8210  N N    . ALA A 1 41 ? -5.430  11.003  -2.239  1.00 0.00 ? 49  ALA A N    6  
ATOM 8211  C CA   . ALA A 1 41 ? -6.763  11.207  -2.790  1.00 0.00 ? 49  ALA A CA   6  
ATOM 8212  C C    . ALA A 1 41 ? -6.677  11.869  -4.159  1.00 0.00 ? 49  ALA A C    6  
ATOM 8213  O O    . ALA A 1 41 ? -7.423  11.526  -5.077  1.00 0.00 ? 49  ALA A O    6  
ATOM 8214  C CB   . ALA A 1 41 ? -7.599  12.057  -1.846  1.00 0.00 ? 49  ALA A CB   6  
ATOM 8215  H H    . ALA A 1 41 ? -5.141  11.546  -1.477  1.00 0.00 ? 49  ALA A H    6  
ATOM 8216  H HA   . ALA A 1 41 ? -7.238  10.243  -2.893  1.00 0.00 ? 49  ALA A HA   6  
ATOM 8217  H HB1  . ALA A 1 41 ? -7.199  11.982  -0.846  1.00 0.00 ? 49  ALA A HB1  6  
ATOM 8218  H HB2  . ALA A 1 41 ? -8.619  11.706  -1.855  1.00 0.00 ? 49  ALA A HB2  6  
ATOM 8219  H HB3  . ALA A 1 41 ? -7.569  13.088  -2.170  1.00 0.00 ? 49  ALA A HB3  6  
ATOM 8220  N N    . GLU A 1 42 ? -5.758  12.821  -4.285  1.00 0.00 ? 50  GLU A N    6  
ATOM 8221  C CA   . GLU A 1 42 ? -5.563  13.536  -5.540  1.00 0.00 ? 50  GLU A CA   6  
ATOM 8222  C C    . GLU A 1 42 ? -5.186  12.569  -6.659  1.00 0.00 ? 50  GLU A C    6  
ATOM 8223  O O    . GLU A 1 42 ? -5.653  12.703  -7.791  1.00 0.00 ? 50  GLU A O    6  
ATOM 8224  C CB   . GLU A 1 42 ? -4.474  14.598  -5.378  1.00 0.00 ? 50  GLU A CB   6  
ATOM 8225  C CG   . GLU A 1 42 ? -5.008  15.956  -4.955  1.00 0.00 ? 50  GLU A CG   6  
ATOM 8226  C CD   . GLU A 1 42 ? -5.966  16.548  -5.970  1.00 0.00 ? 50  GLU A CD   6  
ATOM 8227  O OE1  . GLU A 1 42 ? -7.158  16.175  -5.951  1.00 0.00 ? 50  GLU A OE1  6  
ATOM 8228  O OE2  . GLU A 1 42 ? -5.524  17.386  -6.785  1.00 0.00 ? 50  GLU A OE2  6  
ATOM 8229  H H    . GLU A 1 42 ? -5.195  13.046  -3.517  1.00 0.00 ? 50  GLU A H    6  
ATOM 8230  H HA   . GLU A 1 42 ? -6.493  14.021  -5.795  1.00 0.00 ? 50  GLU A HA   6  
ATOM 8231  H HB2  . GLU A 1 42 ? -3.767  14.264  -4.630  1.00 0.00 ? 50  GLU A HB2  6  
ATOM 8232  H HB3  . GLU A 1 42 ? -3.960  14.715  -6.318  1.00 0.00 ? 50  GLU A HB3  6  
ATOM 8233  H HG2  . GLU A 1 42 ? -5.528  15.848  -4.014  1.00 0.00 ? 50  GLU A HG2  6  
ATOM 8234  H HG3  . GLU A 1 42 ? -4.176  16.633  -4.829  1.00 0.00 ? 50  GLU A HG3  6  
ATOM 8235  N N    . VAL A 1 43 ? -4.342  11.597  -6.332  1.00 0.00 ? 51  VAL A N    6  
ATOM 8236  C CA   . VAL A 1 43 ? -3.903  10.605  -7.306  1.00 0.00 ? 51  VAL A CA   6  
ATOM 8237  C C    . VAL A 1 43 ? -4.970  9.534   -7.517  1.00 0.00 ? 51  VAL A C    6  
ATOM 8238  O O    . VAL A 1 43 ? -5.051  8.929   -8.586  1.00 0.00 ? 51  VAL A O    6  
ATOM 8239  C CB   . VAL A 1 43 ? -2.590  9.927   -6.870  1.00 0.00 ? 51  VAL A CB   6  
ATOM 8240  C CG1  . VAL A 1 43 ? -1.456  10.940  -6.823  1.00 0.00 ? 51  VAL A CG1  6  
ATOM 8241  C CG2  . VAL A 1 43 ? -2.761  9.246   -5.519  1.00 0.00 ? 51  VAL A CG2  6  
ATOM 8242  H H    . VAL A 1 43 ? -4.007  11.545  -5.412  1.00 0.00 ? 51  VAL A H    6  
ATOM 8243  H HA   . VAL A 1 43 ? -3.727  11.112  -8.244  1.00 0.00 ? 51  VAL A HA   6  
ATOM 8244  H HB   . VAL A 1 43 ? -2.338  9.172   -7.600  1.00 0.00 ? 51  VAL A HB   6  
ATOM 8245  H HG11 . VAL A 1 43 ? -0.560  10.495  -7.229  1.00 0.00 ? 51  VAL A HG11 6  
ATOM 8246  H HG12 . VAL A 1 43 ? -1.279  11.235  -5.799  1.00 0.00 ? 51  VAL A HG12 6  
ATOM 8247  H HG13 . VAL A 1 43 ? -1.724  11.807  -7.407  1.00 0.00 ? 51  VAL A HG13 6  
ATOM 8248  H HG21 . VAL A 1 43 ? -2.995  9.986   -4.769  1.00 0.00 ? 51  VAL A HG21 6  
ATOM 8249  H HG22 . VAL A 1 43 ? -1.845  8.740   -5.253  1.00 0.00 ? 51  VAL A HG22 6  
ATOM 8250  H HG23 . VAL A 1 43 ? -3.565  8.527   -5.578  1.00 0.00 ? 51  VAL A HG23 6  
ATOM 8251  N N    . GLY A 1 44 ? -5.784  9.305   -6.491  1.00 0.00 ? 52  GLY A N    6  
ATOM 8252  C CA   . GLY A 1 44 ? -6.832  8.307   -6.586  1.00 0.00 ? 52  GLY A CA   6  
ATOM 8253  C C    . GLY A 1 44 ? -6.488  7.032   -5.840  1.00 0.00 ? 52  GLY A C    6  
ATOM 8254  O O    . GLY A 1 44 ? -6.616  5.934   -6.381  1.00 0.00 ? 52  GLY A O    6  
ATOM 8255  H H    . GLY A 1 44 ? -5.672  9.817   -5.664  1.00 0.00 ? 52  GLY A H    6  
ATOM 8256  H HA2  . GLY A 1 44 ? -7.742  8.718   -6.175  1.00 0.00 ? 52  GLY A HA2  6  
ATOM 8257  H HA3  . GLY A 1 44 ? -6.994  8.068   -7.626  1.00 0.00 ? 52  GLY A HA3  6  
ATOM 8258  N N    . LEU A 1 45 ? -6.052  7.179   -4.593  1.00 0.00 ? 53  LEU A N    6  
ATOM 8259  C CA   . LEU A 1 45 ? -5.688  6.032   -3.771  1.00 0.00 ? 53  LEU A CA   6  
ATOM 8260  C C    . LEU A 1 45 ? -6.849  5.613   -2.875  1.00 0.00 ? 53  LEU A C    6  
ATOM 8261  O O    . LEU A 1 45 ? -7.709  6.426   -2.536  1.00 0.00 ? 53  LEU A O    6  
ATOM 8262  C CB   . LEU A 1 45 ? -4.461  6.357   -2.918  1.00 0.00 ? 53  LEU A CB   6  
ATOM 8263  C CG   . LEU A 1 45 ? -3.114  6.107   -3.600  1.00 0.00 ? 53  LEU A CG   6  
ATOM 8264  C CD1  . LEU A 1 45 ? -1.982  6.704   -2.779  1.00 0.00 ? 53  LEU A CD1  6  
ATOM 8265  C CD2  . LEU A 1 45 ? -2.893  4.619   -3.813  1.00 0.00 ? 53  LEU A CD2  6  
ATOM 8266  H H    . LEU A 1 45 ? -5.971  8.082   -4.217  1.00 0.00 ? 53  LEU A H    6  
ATOM 8267  H HA   . LEU A 1 45 ? -5.448  5.213   -4.433  1.00 0.00 ? 53  LEU A HA   6  
ATOM 8268  H HB2  . LEU A 1 45 ? -4.512  7.399   -2.636  1.00 0.00 ? 53  LEU A HB2  6  
ATOM 8269  H HB3  . LEU A 1 45 ? -4.501  5.756   -2.022  1.00 0.00 ? 53  LEU A HB3  6  
ATOM 8270  H HG   . LEU A 1 45 ? -3.113  6.588   -4.568  1.00 0.00 ? 53  LEU A HG   6  
ATOM 8271  H HD11 . LEU A 1 45 ? -2.238  6.666   -1.730  1.00 0.00 ? 53  LEU A HD11 6  
ATOM 8272  H HD12 . LEU A 1 45 ? -1.826  7.732   -3.074  1.00 0.00 ? 53  LEU A HD12 6  
ATOM 8273  H HD13 . LEU A 1 45 ? -1.077  6.140   -2.949  1.00 0.00 ? 53  LEU A HD13 6  
ATOM 8274  H HD21 . LEU A 1 45 ? -3.715  4.209   -4.383  1.00 0.00 ? 53  LEU A HD21 6  
ATOM 8275  H HD22 . LEU A 1 45 ? -2.836  4.122   -2.856  1.00 0.00 ? 53  LEU A HD22 6  
ATOM 8276  H HD23 . LEU A 1 45 ? -1.970  4.464   -4.353  1.00 0.00 ? 53  LEU A HD23 6  
ATOM 8277  N N    . GLU A 1 46 ? -6.865  4.341   -2.494  1.00 0.00 ? 54  GLU A N    6  
ATOM 8278  C CA   . GLU A 1 46 ? -7.919  3.812   -1.637  1.00 0.00 ? 54  GLU A CA   6  
ATOM 8279  C C    . GLU A 1 46 ? -7.550  2.428   -1.114  1.00 0.00 ? 54  GLU A C    6  
ATOM 8280  O O    . GLU A 1 46 ? -6.611  1.800   -1.604  1.00 0.00 ? 54  GLU A O    6  
ATOM 8281  C CB   . GLU A 1 46 ? -9.241  3.744   -2.402  1.00 0.00 ? 54  GLU A CB   6  
ATOM 8282  C CG   . GLU A 1 46 ? -10.462 3.995   -1.532  1.00 0.00 ? 54  GLU A CG   6  
ATOM 8283  C CD   . GLU A 1 46 ? -11.737 4.132   -2.342  1.00 0.00 ? 54  GLU A CD   6  
ATOM 8284  O OE1  . GLU A 1 46 ? -11.711 4.833   -3.376  1.00 0.00 ? 54  GLU A OE1  6  
ATOM 8285  O OE2  . GLU A 1 46 ? -12.761 3.540   -1.941  1.00 0.00 ? 54  GLU A OE2  6  
ATOM 8286  H H    . GLU A 1 46 ? -6.151  3.741   -2.797  1.00 0.00 ? 54  GLU A H    6  
ATOM 8287  H HA   . GLU A 1 46 ? -8.034  4.483   -0.798  1.00 0.00 ? 54  GLU A HA   6  
ATOM 8288  H HB2  . GLU A 1 46 ? -9.228  4.484   -3.188  1.00 0.00 ? 54  GLU A HB2  6  
ATOM 8289  H HB3  . GLU A 1 46 ? -9.338  2.763   -2.845  1.00 0.00 ? 54  GLU A HB3  6  
ATOM 8290  H HG2  . GLU A 1 46 ? -10.577 3.169   -0.847  1.00 0.00 ? 54  GLU A HG2  6  
ATOM 8291  H HG3  . GLU A 1 46 ? -10.309 4.906   -0.973  1.00 0.00 ? 54  GLU A HG3  6  
ATOM 8292  N N    . ILE A 1 47 ? -8.293  1.957   -0.119  1.00 0.00 ? 55  ILE A N    6  
ATOM 8293  C CA   . ILE A 1 47 ? -8.039  0.646   0.466   1.00 0.00 ? 55  ILE A CA   6  
ATOM 8294  C C    . ILE A 1 47 ? -8.259  -0.458  -0.563  1.00 0.00 ? 55  ILE A C    6  
ATOM 8295  O O    . ILE A 1 47 ? -9.212  -0.415  -1.342  1.00 0.00 ? 55  ILE A O    6  
ATOM 8296  C CB   . ILE A 1 47 ? -8.942  0.385   1.688   1.00 0.00 ? 55  ILE A CB   6  
ATOM 8297  C CG1  . ILE A 1 47 ? -8.870  1.559   2.665   1.00 0.00 ? 55  ILE A CG1  6  
ATOM 8298  C CG2  . ILE A 1 47 ? -8.539  -0.910  2.377   1.00 0.00 ? 55  ILE A CG2  6  
ATOM 8299  C CD1  . ILE A 1 47 ? -9.726  1.375   3.899   1.00 0.00 ? 55  ILE A CD1  6  
ATOM 8300  H H    . ILE A 1 47 ? -9.029  2.503   0.230   1.00 0.00 ? 55  ILE A H    6  
ATOM 8301  H HA   . ILE A 1 47 ? -7.009  0.621   0.792   1.00 0.00 ? 55  ILE A HA   6  
ATOM 8302  H HB   . ILE A 1 47 ? -9.959  0.276   1.339   1.00 0.00 ? 55  ILE A HB   6  
ATOM 8303  H HG12 . ILE A 1 47 ? -7.848  1.687   2.989   1.00 0.00 ? 55  ILE A HG12 6  
ATOM 8304  H HG13 . ILE A 1 47 ? -9.200  2.458   2.165   1.00 0.00 ? 55  ILE A HG13 6  
ATOM 8305  H HG21 . ILE A 1 47 ? -8.105  -1.584  1.654   1.00 0.00 ? 55  ILE A HG21 6  
ATOM 8306  H HG22 . ILE A 1 47 ? -9.411  -1.370  2.818   1.00 0.00 ? 55  ILE A HG22 6  
ATOM 8307  H HG23 . ILE A 1 47 ? -7.817  -0.696  3.151   1.00 0.00 ? 55  ILE A HG23 6  
ATOM 8308  H HD11 . ILE A 1 47 ? -10.482 0.628   3.704   1.00 0.00 ? 55  ILE A HD11 6  
ATOM 8309  H HD12 . ILE A 1 47 ? -10.201 2.311   4.151   1.00 0.00 ? 55  ILE A HD12 6  
ATOM 8310  H HD13 . ILE A 1 47 ? -9.107  1.052   4.722   1.00 0.00 ? 55  ILE A HD13 6  
ATOM 8311  N N    . GLY A 1 48 ? -7.367  -1.442  -0.565  1.00 0.00 ? 56  GLY A N    6  
ATOM 8312  C CA   . GLY A 1 48 ? -7.477  -2.541  -1.507  1.00 0.00 ? 56  GLY A CA   6  
ATOM 8313  C C    . GLY A 1 48 ? -6.518  -2.400  -2.673  1.00 0.00 ? 56  GLY A C    6  
ATOM 8314  O O    . GLY A 1 48 ? -6.684  -3.050  -3.706  1.00 0.00 ? 56  GLY A O    6  
ATOM 8315  H H    . GLY A 1 48 ? -6.625  -1.421  0.075   1.00 0.00 ? 56  GLY A H    6  
ATOM 8316  H HA2  . GLY A 1 48 ? -7.266  -3.466  -0.991  1.00 0.00 ? 56  GLY A HA2  6  
ATOM 8317  H HA3  . GLY A 1 48 ? -8.487  -2.575  -1.888  1.00 0.00 ? 56  GLY A HA3  6  
ATOM 8318  N N    . ASP A 1 49 ? -5.509  -1.548  -2.510  1.00 0.00 ? 57  ASP A N    6  
ATOM 8319  C CA   . ASP A 1 49 ? -4.519  -1.322  -3.553  1.00 0.00 ? 57  ASP A CA   6  
ATOM 8320  C C    . ASP A 1 49 ? -3.167  -1.898  -3.146  1.00 0.00 ? 57  ASP A C    6  
ATOM 8321  O O    . ASP A 1 49 ? -2.913  -2.129  -1.964  1.00 0.00 ? 57  ASP A O    6  
ATOM 8322  C CB   . ASP A 1 49 ? -4.387  0.175   -3.840  1.00 0.00 ? 57  ASP A CB   6  
ATOM 8323  C CG   . ASP A 1 49 ? -5.428  0.673   -4.823  1.00 0.00 ? 57  ASP A CG   6  
ATOM 8324  O OD1  . ASP A 1 49 ? -6.255  -0.145  -5.280  1.00 0.00 ? 57  ASP A OD1  6  
ATOM 8325  O OD2  . ASP A 1 49 ? -5.419  1.882   -5.136  1.00 0.00 ? 57  ASP A OD2  6  
ATOM 8326  H H    . ASP A 1 49 ? -5.430  -1.060  -1.665  1.00 0.00 ? 57  ASP A H    6  
ATOM 8327  H HA   . ASP A 1 49 ? -4.856  -1.822  -4.449  1.00 0.00 ? 57  ASP A HA   6  
ATOM 8328  H HB2  . ASP A 1 49 ? -4.501  0.723   -2.917  1.00 0.00 ? 57  ASP A HB2  6  
ATOM 8329  H HB3  . ASP A 1 49 ? -3.408  0.371   -4.250  1.00 0.00 ? 57  ASP A HB3  6  
ATOM 8330  N N    . GLN A 1 50 ? -2.304  -2.133  -4.128  1.00 0.00 ? 58  GLN A N    6  
ATOM 8331  C CA   . GLN A 1 50 ? -0.981  -2.687  -3.863  1.00 0.00 ? 58  GLN A CA   6  
ATOM 8332  C C    . GLN A 1 50 ? 0.077   -2.025  -4.736  1.00 0.00 ? 58  GLN A C    6  
ATOM 8333  O O    . GLN A 1 50 ? 0.095   -2.203  -5.953  1.00 0.00 ? 58  GLN A O    6  
ATOM 8334  C CB   . GLN A 1 50 ? -0.984  -4.198  -4.101  1.00 0.00 ? 58  GLN A CB   6  
ATOM 8335  C CG   . GLN A 1 50 ? 0.294   -4.889  -3.654  1.00 0.00 ? 58  GLN A CG   6  
ATOM 8336  C CD   . GLN A 1 50 ? 1.263   -5.117  -4.796  1.00 0.00 ? 58  GLN A CD   6  
ATOM 8337  O OE1  . GLN A 1 50 ? 0.866   -5.497  -5.898  1.00 0.00 ? 58  GLN A OE1  6  
ATOM 8338  N NE2  . GLN A 1 50 ? 2.545   -4.887  -4.538  1.00 0.00 ? 58  GLN A NE2  6  
ATOM 8339  H H    . GLN A 1 50 ? -2.562  -1.932  -5.052  1.00 0.00 ? 58  GLN A H    6  
ATOM 8340  H HA   . GLN A 1 50 ? -0.746  -2.497  -2.828  1.00 0.00 ? 58  GLN A HA   6  
ATOM 8341  H HB2  . GLN A 1 50 ? -1.811  -4.634  -3.561  1.00 0.00 ? 58  GLN A HB2  6  
ATOM 8342  H HB3  . GLN A 1 50 ? -1.116  -4.383  -5.157  1.00 0.00 ? 58  GLN A HB3  6  
ATOM 8343  H HG2  . GLN A 1 50 ? 0.778   -4.275  -2.909  1.00 0.00 ? 58  GLN A HG2  6  
ATOM 8344  H HG3  . GLN A 1 50 ? 0.038   -5.845  -3.220  1.00 0.00 ? 58  GLN A HG3  6  
ATOM 8345  H HE21 . GLN A 1 50 ? 2.791   -4.586  -3.640  1.00 0.00 ? 58  GLN A HE21 6  
ATOM 8346  H HE22 . GLN A 1 50 ? 3.195   -5.026  -5.259  1.00 0.00 ? 58  GLN A HE22 6  
ATOM 8347  N N    . ILE A 1 51 ? 0.966   -1.264  -4.103  1.00 0.00 ? 59  ILE A N    6  
ATOM 8348  C CA   . ILE A 1 51 ? 2.032   -0.579  -4.821  1.00 0.00 ? 59  ILE A CA   6  
ATOM 8349  C C    . ILE A 1 51 ? 3.046   -1.583  -5.357  1.00 0.00 ? 59  ILE A C    6  
ATOM 8350  O O    . ILE A 1 51 ? 3.674   -2.314  -4.590  1.00 0.00 ? 59  ILE A O    6  
ATOM 8351  C CB   . ILE A 1 51 ? 2.756   0.437   -3.918  1.00 0.00 ? 59  ILE A CB   6  
ATOM 8352  C CG1  . ILE A 1 51 ? 1.742   1.348   -3.223  1.00 0.00 ? 59  ILE A CG1  6  
ATOM 8353  C CG2  . ILE A 1 51 ? 3.744   1.262   -4.729  1.00 0.00 ? 59  ILE A CG2  6  
ATOM 8354  C CD1  . ILE A 1 51 ? 2.377   2.371   -2.305  1.00 0.00 ? 59  ILE A CD1  6  
ATOM 8355  H H    . ILE A 1 51 ? 0.903   -1.164  -3.130  1.00 0.00 ? 59  ILE A H    6  
ATOM 8356  H HA   . ILE A 1 51 ? 1.591   -0.047  -5.651  1.00 0.00 ? 59  ILE A HA   6  
ATOM 8357  H HB   . ILE A 1 51 ? 3.311   -0.109  -3.170  1.00 0.00 ? 59  ILE A HB   6  
ATOM 8358  H HG12 . ILE A 1 51 ? 1.174   1.882   -3.970  1.00 0.00 ? 59  ILE A HG12 6  
ATOM 8359  H HG13 . ILE A 1 51 ? 1.071   0.743   -2.630  1.00 0.00 ? 59  ILE A HG13 6  
ATOM 8360  H HG21 . ILE A 1 51 ? 4.580   0.642   -5.018  1.00 0.00 ? 59  ILE A HG21 6  
ATOM 8361  H HG22 . ILE A 1 51 ? 4.099   2.088   -4.132  1.00 0.00 ? 59  ILE A HG22 6  
ATOM 8362  H HG23 . ILE A 1 51 ? 3.255   1.641   -5.615  1.00 0.00 ? 59  ILE A HG23 6  
ATOM 8363  H HD11 . ILE A 1 51 ? 1.901   3.330   -2.451  1.00 0.00 ? 59  ILE A HD11 6  
ATOM 8364  H HD12 . ILE A 1 51 ? 3.430   2.453   -2.531  1.00 0.00 ? 59  ILE A HD12 6  
ATOM 8365  H HD13 . ILE A 1 51 ? 2.251   2.061   -1.278  1.00 0.00 ? 59  ILE A HD13 6  
ATOM 8366  N N    . VAL A 1 52 ? 3.192   -1.625  -6.677  1.00 0.00 ? 60  VAL A N    6  
ATOM 8367  C CA   . VAL A 1 52 ? 4.121   -2.554  -7.311  1.00 0.00 ? 60  VAL A CA   6  
ATOM 8368  C C    . VAL A 1 52 ? 5.367   -1.844  -7.840  1.00 0.00 ? 60  VAL A C    6  
ATOM 8369  O O    . VAL A 1 52 ? 6.131   -2.418  -8.614  1.00 0.00 ? 60  VAL A O    6  
ATOM 8370  C CB   . VAL A 1 52 ? 3.442   -3.314  -8.468  1.00 0.00 ? 60  VAL A CB   6  
ATOM 8371  C CG1  . VAL A 1 52 ? 2.252   -4.113  -7.957  1.00 0.00 ? 60  VAL A CG1  6  
ATOM 8372  C CG2  . VAL A 1 52 ? 3.012   -2.354  -9.568  1.00 0.00 ? 60  VAL A CG2  6  
ATOM 8373  H H    . VAL A 1 52 ? 2.657   -1.026  -7.238  1.00 0.00 ? 60  VAL A H    6  
ATOM 8374  H HA   . VAL A 1 52 ? 4.423   -3.276  -6.567  1.00 0.00 ? 60  VAL A HA   6  
ATOM 8375  H HB   . VAL A 1 52 ? 4.159   -4.008  -8.885  1.00 0.00 ? 60  VAL A HB   6  
ATOM 8376  H HG11 . VAL A 1 52 ? 1.823   -4.680  -8.770  1.00 0.00 ? 60  VAL A HG11 6  
ATOM 8377  H HG12 . VAL A 1 52 ? 1.510   -3.437  -7.559  1.00 0.00 ? 60  VAL A HG12 6  
ATOM 8378  H HG13 . VAL A 1 52 ? 2.579   -4.789  -7.181  1.00 0.00 ? 60  VAL A HG13 6  
ATOM 8379  H HG21 . VAL A 1 52 ? 2.103   -1.852  -9.272  1.00 0.00 ? 60  VAL A HG21 6  
ATOM 8380  H HG22 . VAL A 1 52 ? 2.837   -2.907  -10.480 1.00 0.00 ? 60  VAL A HG22 6  
ATOM 8381  H HG23 . VAL A 1 52 ? 3.791   -1.625  -9.735  1.00 0.00 ? 60  VAL A HG23 6  
ATOM 8382  N N    . GLU A 1 53 ? 5.572   -0.596  -7.420  1.00 0.00 ? 61  GLU A N    6  
ATOM 8383  C CA   . GLU A 1 53 ? 6.734   0.171   -7.860  1.00 0.00 ? 61  GLU A CA   6  
ATOM 8384  C C    . GLU A 1 53 ? 6.782   1.538   -7.185  1.00 0.00 ? 61  GLU A C    6  
ATOM 8385  O O    . GLU A 1 53 ? 5.747   2.146   -6.913  1.00 0.00 ? 61  GLU A O    6  
ATOM 8386  C CB   . GLU A 1 53 ? 6.712   0.344   -9.380  1.00 0.00 ? 61  GLU A CB   6  
ATOM 8387  C CG   . GLU A 1 53 ? 8.080   0.642   -9.975  1.00 0.00 ? 61  GLU A CG   6  
ATOM 8388  C CD   . GLU A 1 53 ? 7.992   1.215   -11.377 1.00 0.00 ? 61  GLU A CD   6  
ATOM 8389  O OE1  . GLU A 1 53 ? 7.254   0.643   -12.207 1.00 0.00 ? 61  GLU A OE1  6  
ATOM 8390  O OE2  . GLU A 1 53 ? 8.663   2.234   -11.644 1.00 0.00 ? 61  GLU A OE2  6  
ATOM 8391  H H    . GLU A 1 53 ? 4.934   -0.185  -6.801  1.00 0.00 ? 61  GLU A H    6  
ATOM 8392  H HA   . GLU A 1 53 ? 7.618   -0.383  -7.585  1.00 0.00 ? 61  GLU A HA   6  
ATOM 8393  H HB2  . GLU A 1 53 ? 6.337   -0.562  -9.830  1.00 0.00 ? 61  GLU A HB2  6  
ATOM 8394  H HB3  . GLU A 1 53 ? 6.051   1.161   -9.628  1.00 0.00 ? 61  GLU A HB3  6  
ATOM 8395  H HG2  . GLU A 1 53 ? 8.585   1.356   -9.343  1.00 0.00 ? 61  GLU A HG2  6  
ATOM 8396  H HG3  . GLU A 1 53 ? 8.650   -0.275  -10.011 1.00 0.00 ? 61  GLU A HG3  6  
ATOM 8397  N N    . VAL A 1 54 ? 7.995   2.018   -6.920  1.00 0.00 ? 62  VAL A N    6  
ATOM 8398  C CA   . VAL A 1 54 ? 8.186   3.314   -6.281  1.00 0.00 ? 62  VAL A CA   6  
ATOM 8399  C C    . VAL A 1 54 ? 9.490   3.963   -6.735  1.00 0.00 ? 62  VAL A C    6  
ATOM 8400  O O    . VAL A 1 54 ? 10.563  3.641   -6.228  1.00 0.00 ? 62  VAL A O    6  
ATOM 8401  C CB   . VAL A 1 54 ? 8.197   3.191   -4.745  1.00 0.00 ? 62  VAL A CB   6  
ATOM 8402  C CG1  . VAL A 1 54 ? 8.268   4.567   -4.099  1.00 0.00 ? 62  VAL A CG1  6  
ATOM 8403  C CG2  . VAL A 1 54 ? 6.975   2.428   -4.261  1.00 0.00 ? 62  VAL A CG2  6  
ATOM 8404  H H    . VAL A 1 54 ? 8.781   1.485   -7.165  1.00 0.00 ? 62  VAL A H    6  
ATOM 8405  H HA   . VAL A 1 54 ? 7.360   3.952   -6.565  1.00 0.00 ? 62  VAL A HA   6  
ATOM 8406  H HB   . VAL A 1 54 ? 9.078   2.637   -4.456  1.00 0.00 ? 62  VAL A HB   6  
ATOM 8407  H HG11 . VAL A 1 54 ? 7.546   5.221   -4.564  1.00 0.00 ? 62  VAL A HG11 6  
ATOM 8408  H HG12 . VAL A 1 54 ? 9.259   4.975   -4.228  1.00 0.00 ? 62  VAL A HG12 6  
ATOM 8409  H HG13 . VAL A 1 54 ? 8.050   4.481   -3.045  1.00 0.00 ? 62  VAL A HG13 6  
ATOM 8410  H HG21 . VAL A 1 54 ? 7.120   1.371   -4.429  1.00 0.00 ? 62  VAL A HG21 6  
ATOM 8411  H HG22 . VAL A 1 54 ? 6.103   2.762   -4.805  1.00 0.00 ? 62  VAL A HG22 6  
ATOM 8412  H HG23 . VAL A 1 54 ? 6.830   2.608   -3.206  1.00 0.00 ? 62  VAL A HG23 6  
ATOM 8413  N N    . ASN A 1 55 ? 9.388   4.878   -7.694  1.00 0.00 ? 63  ASN A N    6  
ATOM 8414  C CA   . ASN A 1 55 ? 10.560  5.572   -8.214  1.00 0.00 ? 63  ASN A CA   6  
ATOM 8415  C C    . ASN A 1 55 ? 11.580  4.583   -8.773  1.00 0.00 ? 63  ASN A C    6  
ATOM 8416  O O    . ASN A 1 55 ? 12.784  4.836   -8.743  1.00 0.00 ? 63  ASN A O    6  
ATOM 8417  C CB   . ASN A 1 55 ? 11.205  6.421   -7.116  1.00 0.00 ? 63  ASN A CB   6  
ATOM 8418  C CG   . ASN A 1 55 ? 11.824  7.694   -7.658  1.00 0.00 ? 63  ASN A CG   6  
ATOM 8419  O OD1  . ASN A 1 55 ? 12.680  7.655   -8.542  1.00 0.00 ? 63  ASN A OD1  6  
ATOM 8420  N ND2  . ASN A 1 55 ? 11.393  8.833   -7.129  1.00 0.00 ? 63  ASN A ND2  6  
ATOM 8421  H H    . ASN A 1 55 ? 8.504   5.092   -8.057  1.00 0.00 ? 63  ASN A H    6  
ATOM 8422  H HA   . ASN A 1 55 ? 10.233  6.222   -9.013  1.00 0.00 ? 63  ASN A HA   6  
ATOM 8423  H HB2  . ASN A 1 55 ? 10.453  6.690   -6.390  1.00 0.00 ? 63  ASN A HB2  6  
ATOM 8424  H HB3  . ASN A 1 55 ? 11.978  5.844   -6.632  1.00 0.00 ? 63  ASN A HB3  6  
ATOM 8425  H HD21 . ASN A 1 55 ? 10.709  8.789   -6.429  1.00 0.00 ? 63  ASN A HD21 6  
ATOM 8426  H HD22 . ASN A 1 55 ? 11.776  9.672   -7.461  1.00 0.00 ? 63  ASN A HD22 6  
ATOM 8427  N N    . GLY A 1 56 ? 11.088  3.458   -9.279  1.00 0.00 ? 64  GLY A N    6  
ATOM 8428  C CA   . GLY A 1 56 ? 11.970  2.448   -9.835  1.00 0.00 ? 64  GLY A CA   6  
ATOM 8429  C C    . GLY A 1 56 ? 12.164  1.270   -8.902  1.00 0.00 ? 64  GLY A C    6  
ATOM 8430  O O    . GLY A 1 56 ? 12.409  0.149   -9.348  1.00 0.00 ? 64  GLY A O    6  
ATOM 8431  H H    . GLY A 1 56 ? 10.119  3.310   -9.275  1.00 0.00 ? 64  GLY A H    6  
ATOM 8432  H HA2  . GLY A 1 56 ? 11.550  2.092   -10.764 1.00 0.00 ? 64  GLY A HA2  6  
ATOM 8433  H HA3  . GLY A 1 56 ? 12.932  2.897   -10.036 1.00 0.00 ? 64  GLY A HA3  6  
ATOM 8434  N N    . VAL A 1 57 ? 12.055  1.524   -7.602  1.00 0.00 ? 65  VAL A N    6  
ATOM 8435  C CA   . VAL A 1 57 ? 12.220  0.478   -6.601  1.00 0.00 ? 65  VAL A CA   6  
ATOM 8436  C C    . VAL A 1 57 ? 11.157  -0.605  -6.758  1.00 0.00 ? 65  VAL A C    6  
ATOM 8437  O O    . VAL A 1 57 ? 9.963   -0.310  -6.827  1.00 0.00 ? 65  VAL A O    6  
ATOM 8438  C CB   . VAL A 1 57 ? 12.148  1.048   -5.172  1.00 0.00 ? 65  VAL A CB   6  
ATOM 8439  C CG1  . VAL A 1 57 ? 12.505  -0.018  -4.149  1.00 0.00 ? 65  VAL A CG1  6  
ATOM 8440  C CG2  . VAL A 1 57 ? 13.061  2.258   -5.036  1.00 0.00 ? 65  VAL A CG2  6  
ATOM 8441  H H    . VAL A 1 57 ? 11.858  2.438   -7.308  1.00 0.00 ? 65  VAL A H    6  
ATOM 8442  H HA   . VAL A 1 57 ? 13.195  0.033   -6.741  1.00 0.00 ? 65  VAL A HA   6  
ATOM 8443  H HB   . VAL A 1 57 ? 11.133  1.368   -4.985  1.00 0.00 ? 65  VAL A HB   6  
ATOM 8444  H HG11 . VAL A 1 57 ? 13.535  0.104   -3.848  1.00 0.00 ? 65  VAL A HG11 6  
ATOM 8445  H HG12 . VAL A 1 57 ? 12.372  -0.996  -4.588  1.00 0.00 ? 65  VAL A HG12 6  
ATOM 8446  H HG13 . VAL A 1 57 ? 11.864  0.081   -3.286  1.00 0.00 ? 65  VAL A HG13 6  
ATOM 8447  H HG21 . VAL A 1 57 ? 13.830  2.214   -5.793  1.00 0.00 ? 65  VAL A HG21 6  
ATOM 8448  H HG22 . VAL A 1 57 ? 13.518  2.256   -4.058  1.00 0.00 ? 65  VAL A HG22 6  
ATOM 8449  H HG23 . VAL A 1 57 ? 12.482  3.162   -5.161  1.00 0.00 ? 65  VAL A HG23 6  
ATOM 8450  N N    . ASP A 1 58 ? 11.596  -1.858  -6.812  1.00 0.00 ? 66  ASP A N    6  
ATOM 8451  C CA   . ASP A 1 58 ? 10.682  -2.983  -6.961  1.00 0.00 ? 66  ASP A CA   6  
ATOM 8452  C C    . ASP A 1 58 ? 9.910   -3.232  -5.668  1.00 0.00 ? 66  ASP A C    6  
ATOM 8453  O O    . ASP A 1 58 ? 10.477  -3.681  -4.673  1.00 0.00 ? 66  ASP A O    6  
ATOM 8454  C CB   . ASP A 1 58 ? 11.450  -4.244  -7.363  1.00 0.00 ? 66  ASP A CB   6  
ATOM 8455  C CG   . ASP A 1 58 ? 11.451  -4.467  -8.862  1.00 0.00 ? 66  ASP A CG   6  
ATOM 8456  O OD1  . ASP A 1 58 ? 11.623  -3.480  -9.608  1.00 0.00 ? 66  ASP A OD1  6  
ATOM 8457  O OD2  . ASP A 1 58 ? 11.282  -5.628  -9.289  1.00 0.00 ? 66  ASP A OD2  6  
ATOM 8458  H H    . ASP A 1 58 ? 12.559  -2.029  -6.752  1.00 0.00 ? 66  ASP A H    6  
ATOM 8459  H HA   . ASP A 1 58 ? 9.979   -2.738  -7.742  1.00 0.00 ? 66  ASP A HA   6  
ATOM 8460  H HB2  . ASP A 1 58 ? 12.474  -4.156  -7.029  1.00 0.00 ? 66  ASP A HB2  6  
ATOM 8461  H HB3  . ASP A 1 58 ? 10.995  -5.103  -6.889  1.00 0.00 ? 66  ASP A HB3  6  
ATOM 8462  N N    . PHE A 1 59 ? 8.615   -2.936  -5.692  1.00 0.00 ? 67  PHE A N    6  
ATOM 8463  C CA   . PHE A 1 59 ? 7.765   -3.128  -4.523  1.00 0.00 ? 67  PHE A CA   6  
ATOM 8464  C C    . PHE A 1 59 ? 7.016   -4.457  -4.591  1.00 0.00 ? 67  PHE A C    6  
ATOM 8465  O O    . PHE A 1 59 ? 6.416   -4.889  -3.606  1.00 0.00 ? 67  PHE A O    6  
ATOM 8466  C CB   . PHE A 1 59 ? 6.768   -1.973  -4.400  1.00 0.00 ? 67  PHE A CB   6  
ATOM 8467  C CG   . PHE A 1 59 ? 7.196   -0.910  -3.428  1.00 0.00 ? 67  PHE A CG   6  
ATOM 8468  C CD1  . PHE A 1 59 ? 8.502   -0.447  -3.420  1.00 0.00 ? 67  PHE A CD1  6  
ATOM 8469  C CD2  . PHE A 1 59 ? 6.292   -0.377  -2.524  1.00 0.00 ? 67  PHE A CD2  6  
ATOM 8470  C CE1  . PHE A 1 59 ? 8.898   0.531   -2.527  1.00 0.00 ? 67  PHE A CE1  6  
ATOM 8471  C CE2  . PHE A 1 59 ? 6.683   0.601   -1.629  1.00 0.00 ? 67  PHE A CE2  6  
ATOM 8472  C CZ   . PHE A 1 59 ? 7.986   1.055   -1.630  1.00 0.00 ? 67  PHE A CZ   6  
ATOM 8473  H H    . PHE A 1 59 ? 8.222   -2.582  -6.517  1.00 0.00 ? 67  PHE A H    6  
ATOM 8474  H HA   . PHE A 1 59 ? 8.402   -3.132  -3.651  1.00 0.00 ? 67  PHE A HA   6  
ATOM 8475  H HB2  . PHE A 1 59 ? 6.644   -1.508  -5.367  1.00 0.00 ? 67  PHE A HB2  6  
ATOM 8476  H HB3  . PHE A 1 59 ? 5.816   -2.363  -4.069  1.00 0.00 ? 67  PHE A HB3  6  
ATOM 8477  H HD1  . PHE A 1 59 ? 9.214   -0.855  -4.120  1.00 0.00 ? 67  PHE A HD1  6  
ATOM 8478  H HD2  . PHE A 1 59 ? 5.272   -0.732  -2.522  1.00 0.00 ? 67  PHE A HD2  6  
ATOM 8479  H HE1  . PHE A 1 59 ? 9.918   0.886   -2.530  1.00 0.00 ? 67  PHE A HE1  6  
ATOM 8480  H HE2  . PHE A 1 59 ? 5.967   1.009   -0.929  1.00 0.00 ? 67  PHE A HE2  6  
ATOM 8481  H HZ   . PHE A 1 59 ? 8.293   1.819   -0.932  1.00 0.00 ? 67  PHE A HZ   6  
ATOM 8482  N N    . SER A 1 60 ? 7.051   -5.104  -5.755  1.00 0.00 ? 68  SER A N    6  
ATOM 8483  C CA   . SER A 1 60 ? 6.372   -6.383  -5.941  1.00 0.00 ? 68  SER A CA   6  
ATOM 8484  C C    . SER A 1 60 ? 6.733   -7.367  -4.830  1.00 0.00 ? 68  SER A C    6  
ATOM 8485  O O    . SER A 1 60 ? 5.947   -8.254  -4.494  1.00 0.00 ? 68  SER A O    6  
ATOM 8486  C CB   . SER A 1 60 ? 6.733   -6.981  -7.302  1.00 0.00 ? 68  SER A CB   6  
ATOM 8487  O OG   . SER A 1 60 ? 6.634   -6.011  -8.329  1.00 0.00 ? 68  SER A OG   6  
ATOM 8488  H H    . SER A 1 60 ? 7.543   -4.713  -6.506  1.00 0.00 ? 68  SER A H    6  
ATOM 8489  H HA   . SER A 1 60 ? 5.307   -6.200  -5.911  1.00 0.00 ? 68  SER A HA   6  
ATOM 8490  H HB2  . SER A 1 60 ? 7.748   -7.352  -7.272  1.00 0.00 ? 68  SER A HB2  6  
ATOM 8491  H HB3  . SER A 1 60 ? 6.060   -7.796  -7.525  1.00 0.00 ? 68  SER A HB3  6  
ATOM 8492  H HG   . SER A 1 60 ? 5.737   -5.669  -8.361  1.00 0.00 ? 68  SER A HG   6  
ATOM 8493  N N    . ASN A 1 61 ? 7.924   -7.203  -4.263  1.00 0.00 ? 69  ASN A N    6  
ATOM 8494  C CA   . ASN A 1 61 ? 8.385   -8.075  -3.190  1.00 0.00 ? 69  ASN A CA   6  
ATOM 8495  C C    . ASN A 1 61 ? 9.217   -7.299  -2.175  1.00 0.00 ? 69  ASN A C    6  
ATOM 8496  O O    . ASN A 1 61 ? 10.134  -7.846  -1.562  1.00 0.00 ? 69  ASN A O    6  
ATOM 8497  C CB   . ASN A 1 61 ? 9.204   -9.232  -3.764  1.00 0.00 ? 69  ASN A CB   6  
ATOM 8498  C CG   . ASN A 1 61 ? 8.360   -10.463 -4.030  1.00 0.00 ? 69  ASN A CG   6  
ATOM 8499  O OD1  . ASN A 1 61 ? 8.038   -10.772 -5.177  1.00 0.00 ? 69  ASN A OD1  6  
ATOM 8500  N ND2  . ASN A 1 61 ? 7.995   -11.171 -2.968  1.00 0.00 ? 69  ASN A ND2  6  
ATOM 8501  H H    . ASN A 1 61 ? 8.505   -6.477  -4.572  1.00 0.00 ? 69  ASN A H    6  
ATOM 8502  H HA   . ASN A 1 61 ? 7.514   -8.476  -2.692  1.00 0.00 ? 69  ASN A HA   6  
ATOM 8503  H HB2  . ASN A 1 61 ? 9.656   -8.920  -4.694  1.00 0.00 ? 69  ASN A HB2  6  
ATOM 8504  H HB3  . ASN A 1 61 ? 9.983   -9.497  -3.063  1.00 0.00 ? 69  ASN A HB3  6  
ATOM 8505  H HD21 . ASN A 1 61 ? 8.289   -10.866 -2.084  1.00 0.00 ? 69  ASN A HD21 6  
ATOM 8506  H HD22 . ASN A 1 61 ? 7.448   -11.972 -3.111  1.00 0.00 ? 69  ASN A HD22 6  
ATOM 8507  N N    . LEU A 1 62 ? 8.892   -6.023  -2.001  1.00 0.00 ? 70  LEU A N    6  
ATOM 8508  C CA   . LEU A 1 62 ? 9.610   -5.172  -1.059  1.00 0.00 ? 70  LEU A CA   6  
ATOM 8509  C C    . LEU A 1 62 ? 9.048   -5.328  0.351   1.00 0.00 ? 70  LEU A C    6  
ATOM 8510  O O    . LEU A 1 62 ? 7.842   -5.500  0.534   1.00 0.00 ? 70  LEU A O    6  
ATOM 8511  C CB   . LEU A 1 62 ? 9.527   -3.707  -1.493  1.00 0.00 ? 70  LEU A CB   6  
ATOM 8512  C CG   . LEU A 1 62 ? 10.277  -2.722  -0.592  1.00 0.00 ? 70  LEU A CG   6  
ATOM 8513  C CD1  . LEU A 1 62 ? 11.528  -2.204  -1.289  1.00 0.00 ? 70  LEU A CD1  6  
ATOM 8514  C CD2  . LEU A 1 62 ? 9.372   -1.566  -0.192  1.00 0.00 ? 70  LEU A CD2  6  
ATOM 8515  H H    . LEU A 1 62 ? 8.150   -5.644  -2.518  1.00 0.00 ? 70  LEU A H    6  
ATOM 8516  H HA   . LEU A 1 62 ? 10.645  -5.480  -1.056  1.00 0.00 ? 70  LEU A HA   6  
ATOM 8517  H HB2  . LEU A 1 62 ? 9.928   -3.630  -2.494  1.00 0.00 ? 70  LEU A HB2  6  
ATOM 8518  H HB3  . LEU A 1 62 ? 8.486   -3.421  -1.518  1.00 0.00 ? 70  LEU A HB3  6  
ATOM 8519  H HG   . LEU A 1 62 ? 10.586  -3.233  0.308   1.00 0.00 ? 70  LEU A HG   6  
ATOM 8520  H HD11 . LEU A 1 62 ? 11.790  -2.869  -2.099  1.00 0.00 ? 70  LEU A HD11 6  
ATOM 8521  H HD12 . LEU A 1 62 ? 12.341  -2.161  -0.580  1.00 0.00 ? 70  LEU A HD12 6  
ATOM 8522  H HD13 . LEU A 1 62 ? 11.338  -1.216  -1.681  1.00 0.00 ? 70  LEU A HD13 6  
ATOM 8523  H HD21 . LEU A 1 62 ? 8.616   -1.420  -0.951  1.00 0.00 ? 70  LEU A HD21 6  
ATOM 8524  H HD22 . LEU A 1 62 ? 9.959   -0.666  -0.092  1.00 0.00 ? 70  LEU A HD22 6  
ATOM 8525  H HD23 . LEU A 1 62 ? 8.895   -1.793  0.750   1.00 0.00 ? 70  LEU A HD23 6  
ATOM 8526  N N    . ASP A 1 63 ? 9.929   -5.267  1.344   1.00 0.00 ? 71  ASP A N    6  
ATOM 8527  C CA   . ASP A 1 63 ? 9.520   -5.401  2.737   1.00 0.00 ? 71  ASP A CA   6  
ATOM 8528  C C    . ASP A 1 63 ? 8.654   -4.220  3.167   1.00 0.00 ? 71  ASP A C    6  
ATOM 8529  O O    . ASP A 1 63 ? 8.635   -3.180  2.510   1.00 0.00 ? 71  ASP A O    6  
ATOM 8530  C CB   . ASP A 1 63 ? 10.752  -5.507  3.643   1.00 0.00 ? 71  ASP A CB   6  
ATOM 8531  C CG   . ASP A 1 63 ? 10.777  -6.799  4.435   1.00 0.00 ? 71  ASP A CG   6  
ATOM 8532  O OD1  . ASP A 1 63 ? 9.745   -7.139  5.050   1.00 0.00 ? 71  ASP A OD1  6  
ATOM 8533  O OD2  . ASP A 1 63 ? 11.831  -7.470  4.441   1.00 0.00 ? 71  ASP A OD2  6  
ATOM 8534  H H    . ASP A 1 63 ? 10.876  -5.129  1.133   1.00 0.00 ? 71  ASP A H    6  
ATOM 8535  H HA   . ASP A 1 63 ? 8.941   -6.307  2.826   1.00 0.00 ? 71  ASP A HA   6  
ATOM 8536  H HB2  . ASP A 1 63 ? 11.642  -5.463  3.034   1.00 0.00 ? 71  ASP A HB2  6  
ATOM 8537  H HB3  . ASP A 1 63 ? 10.754  -4.679  4.337   1.00 0.00 ? 71  ASP A HB3  6  
ATOM 8538  N N    . HIS A 1 64 ? 7.940   -4.391  4.275   1.00 0.00 ? 72  HIS A N    6  
ATOM 8539  C CA   . HIS A 1 64 ? 7.072   -3.339  4.793   1.00 0.00 ? 72  HIS A CA   6  
ATOM 8540  C C    . HIS A 1 64 ? 7.886   -2.114  5.200   1.00 0.00 ? 72  HIS A C    6  
ATOM 8541  O O    . HIS A 1 64 ? 7.626   -1.004  4.737   1.00 0.00 ? 72  HIS A O    6  
ATOM 8542  C CB   . HIS A 1 64 ? 6.271   -3.852  5.991   1.00 0.00 ? 72  HIS A CB   6  
ATOM 8543  C CG   . HIS A 1 64 ? 5.092   -2.995  6.331   1.00 0.00 ? 72  HIS A CG   6  
ATOM 8544  N ND1  . HIS A 1 64 ? 4.344   -3.164  7.477   1.00 0.00 ? 72  HIS A ND1  6  
ATOM 8545  C CD2  . HIS A 1 64 ? 4.532   -1.954  5.670   1.00 0.00 ? 72  HIS A CD2  6  
ATOM 8546  C CE1  . HIS A 1 64 ? 3.375   -2.265  7.507   1.00 0.00 ? 72  HIS A CE1  6  
ATOM 8547  N NE2  . HIS A 1 64 ? 3.467   -1.520  6.421   1.00 0.00 ? 72  HIS A NE2  6  
ATOM 8548  H H    . HIS A 1 64 ? 7.998   -5.242  4.755   1.00 0.00 ? 72  HIS A H    6  
ATOM 8549  H HA   . HIS A 1 64 ? 6.389   -3.057  4.007   1.00 0.00 ? 72  HIS A HA   6  
ATOM 8550  H HB2  . HIS A 1 64 ? 5.907   -4.845  5.773   1.00 0.00 ? 72  HIS A HB2  6  
ATOM 8551  H HB3  . HIS A 1 64 ? 6.916   -3.892  6.857   1.00 0.00 ? 72  HIS A HB3  6  
ATOM 8552  H HD1  . HIS A 1 64 ? 4.499   -3.843  8.168   1.00 0.00 ? 72  HIS A HD1  6  
ATOM 8553  H HD2  . HIS A 1 64 ? 4.861   -1.542  4.727   1.00 0.00 ? 72  HIS A HD2  6  
ATOM 8554  H HE1  . HIS A 1 64 ? 2.635   -2.159  8.286   1.00 0.00 ? 72  HIS A HE1  6  
ATOM 8555  H HE2  . HIS A 1 64 ? 2.822   -0.833  6.151   1.00 0.00 ? 72  HIS A HE2  6  
ATOM 8556  N N    . LYS A 1 65 ? 8.870   -2.325  6.065   1.00 0.00 ? 73  LYS A N    6  
ATOM 8557  C CA   . LYS A 1 65 ? 9.723   -1.238  6.534   1.00 0.00 ? 73  LYS A CA   6  
ATOM 8558  C C    . LYS A 1 65 ? 10.420  -0.551  5.362   1.00 0.00 ? 73  LYS A C    6  
ATOM 8559  O O    . LYS A 1 65 ? 10.533  0.673   5.326   1.00 0.00 ? 73  LYS A O    6  
ATOM 8560  C CB   . LYS A 1 65 ? 10.761  -1.765  7.526   1.00 0.00 ? 73  LYS A CB   6  
ATOM 8561  C CG   . LYS A 1 65 ? 10.360  -1.580  8.980   1.00 0.00 ? 73  LYS A CG   6  
ATOM 8562  C CD   . LYS A 1 65 ? 11.379  -2.198  9.925   1.00 0.00 ? 73  LYS A CD   6  
ATOM 8563  C CE   . LYS A 1 65 ? 11.920  -1.175  10.914  1.00 0.00 ? 73  LYS A CE   6  
ATOM 8564  N NZ   . LYS A 1 65 ? 11.929  -1.700  12.308  1.00 0.00 ? 73  LYS A NZ   6  
ATOM 8565  H H    . LYS A 1 65 ? 9.030   -3.232  6.399   1.00 0.00 ? 73  LYS A H    6  
ATOM 8566  H HA   . LYS A 1 65 ? 9.094   -0.515  7.034   1.00 0.00 ? 73  LYS A HA   6  
ATOM 8567  H HB2  . LYS A 1 65 ? 10.910  -2.820  7.346   1.00 0.00 ? 73  LYS A HB2  6  
ATOM 8568  H HB3  . LYS A 1 65 ? 11.696  -1.247  7.364   1.00 0.00 ? 73  LYS A HB3  6  
ATOM 8569  H HG2  . LYS A 1 65 ? 10.281  -0.523  9.189   1.00 0.00 ? 73  LYS A HG2  6  
ATOM 8570  H HG3  . LYS A 1 65 ? 9.401   -2.053  9.140   1.00 0.00 ? 73  LYS A HG3  6  
ATOM 8571  H HD2  . LYS A 1 65 ? 10.907  -2.998  10.476  1.00 0.00 ? 73  LYS A HD2  6  
ATOM 8572  H HD3  . LYS A 1 65 ? 12.201  -2.594  9.345   1.00 0.00 ? 73  LYS A HD3  6  
ATOM 8573  H HE2  . LYS A 1 65 ? 12.930  -0.918  10.630  1.00 0.00 ? 73  LYS A HE2  6  
ATOM 8574  H HE3  . LYS A 1 65 ? 11.300  -0.291  10.875  1.00 0.00 ? 73  LYS A HE3  6  
ATOM 8575  H HZ1  . LYS A 1 65 ? 11.938  -2.740  12.298  1.00 0.00 ? 73  LYS A HZ1  6  
ATOM 8576  H HZ2  . LYS A 1 65 ? 11.083  -1.376  12.817  1.00 0.00 ? 73  LYS A HZ2  6  
ATOM 8577  H HZ3  . LYS A 1 65 ? 12.774  -1.362  12.811  1.00 0.00 ? 73  LYS A HZ3  6  
ATOM 8578  N N    . GLU A 1 66 ? 10.880  -1.350  4.406   1.00 0.00 ? 74  GLU A N    6  
ATOM 8579  C CA   . GLU A 1 66 ? 11.564  -0.820  3.232   1.00 0.00 ? 74  GLU A CA   6  
ATOM 8580  C C    . GLU A 1 66 ? 10.647  0.117   2.451   1.00 0.00 ? 74  GLU A C    6  
ATOM 8581  O O    . GLU A 1 66 ? 11.099  1.105   1.873   1.00 0.00 ? 74  GLU A O    6  
ATOM 8582  C CB   . GLU A 1 66 ? 12.033  -1.963  2.328   1.00 0.00 ? 74  GLU A CB   6  
ATOM 8583  C CG   . GLU A 1 66 ? 13.484  -2.358  2.553   1.00 0.00 ? 74  GLU A CG   6  
ATOM 8584  C CD   . GLU A 1 66 ? 13.696  -3.073  3.874   1.00 0.00 ? 74  GLU A CD   6  
ATOM 8585  O OE1  . GLU A 1 66 ? 13.255  -4.235  3.995   1.00 0.00 ? 74  GLU A OE1  6  
ATOM 8586  O OE2  . GLU A 1 66 ? 14.303  -2.471  4.784   1.00 0.00 ? 74  GLU A OE2  6  
ATOM 8587  H H    . GLU A 1 66 ? 10.758  -2.319  4.490   1.00 0.00 ? 74  GLU A H    6  
ATOM 8588  H HA   . GLU A 1 66 ? 12.423  -0.264  3.571   1.00 0.00 ? 74  GLU A HA   6  
ATOM 8589  H HB2  . GLU A 1 66 ? 11.415  -2.829  2.512   1.00 0.00 ? 74  GLU A HB2  6  
ATOM 8590  H HB3  . GLU A 1 66 ? 11.921  -1.663  1.297   1.00 0.00 ? 74  GLU A HB3  6  
ATOM 8591  H HG2  . GLU A 1 66 ? 13.793  -3.014  1.753   1.00 0.00 ? 74  GLU A HG2  6  
ATOM 8592  H HG3  . GLU A 1 66 ? 14.093  -1.465  2.542   1.00 0.00 ? 74  GLU A HG3  6  
ATOM 8593  N N    . ALA A 1 67 ? 9.356   -0.198  2.445   1.00 0.00 ? 75  ALA A N    6  
ATOM 8594  C CA   . ALA A 1 67 ? 8.373   0.615   1.740   1.00 0.00 ? 75  ALA A CA   6  
ATOM 8595  C C    . ALA A 1 67 ? 8.189   1.966   2.424   1.00 0.00 ? 75  ALA A C    6  
ATOM 8596  O O    . ALA A 1 67 ? 8.158   3.006   1.767   1.00 0.00 ? 75  ALA A O    6  
ATOM 8597  C CB   . ALA A 1 67 ? 7.045   -0.121  1.651   1.00 0.00 ? 75  ALA A CB   6  
ATOM 8598  H H    . ALA A 1 67 ? 9.057   -0.998  2.927   1.00 0.00 ? 75  ALA A H    6  
ATOM 8599  H HA   . ALA A 1 67 ? 8.736   0.778   0.735   1.00 0.00 ? 75  ALA A HA   6  
ATOM 8600  H HB1  . ALA A 1 67 ? 6.935   -0.544  0.664   1.00 0.00 ? 75  ALA A HB1  6  
ATOM 8601  H HB2  . ALA A 1 67 ? 6.236   0.570   1.837   1.00 0.00 ? 75  ALA A HB2  6  
ATOM 8602  H HB3  . ALA A 1 67 ? 7.020   -0.910  2.387   1.00 0.00 ? 75  ALA A HB3  6  
ATOM 8603  N N    . VAL A 1 68 ? 8.069   1.943   3.746   1.00 0.00 ? 76  VAL A N    6  
ATOM 8604  C CA   . VAL A 1 68 ? 7.890   3.167   4.518   1.00 0.00 ? 76  VAL A CA   6  
ATOM 8605  C C    . VAL A 1 68 ? 9.149   4.025   4.478   1.00 0.00 ? 76  VAL A C    6  
ATOM 8606  O O    . VAL A 1 68 ? 9.073   5.252   4.401   1.00 0.00 ? 76  VAL A O    6  
ATOM 8607  C CB   . VAL A 1 68 ? 7.533   2.860   5.985   1.00 0.00 ? 76  VAL A CB   6  
ATOM 8608  C CG1  . VAL A 1 68 ? 7.249   4.145   6.749   1.00 0.00 ? 76  VAL A CG1  6  
ATOM 8609  C CG2  . VAL A 1 68 ? 6.343   1.914   6.059   1.00 0.00 ? 76  VAL A CG2  6  
ATOM 8610  H H    . VAL A 1 68 ? 8.103   1.082   4.214   1.00 0.00 ? 76  VAL A H    6  
ATOM 8611  H HA   . VAL A 1 68 ? 7.074   3.720   4.078   1.00 0.00 ? 76  VAL A HA   6  
ATOM 8612  H HB   . VAL A 1 68 ? 8.380   2.373   6.446   1.00 0.00 ? 76  VAL A HB   6  
ATOM 8613  H HG11 . VAL A 1 68 ? 7.008   3.907   7.775   1.00 0.00 ? 76  VAL A HG11 6  
ATOM 8614  H HG12 . VAL A 1 68 ? 6.415   4.657   6.294   1.00 0.00 ? 76  VAL A HG12 6  
ATOM 8615  H HG13 . VAL A 1 68 ? 8.121   4.781   6.722   1.00 0.00 ? 76  VAL A HG13 6  
ATOM 8616  H HG21 . VAL A 1 68 ? 6.509   1.073   5.404   1.00 0.00 ? 76  VAL A HG21 6  
ATOM 8617  H HG22 . VAL A 1 68 ? 5.449   2.437   5.754   1.00 0.00 ? 76  VAL A HG22 6  
ATOM 8618  H HG23 . VAL A 1 68 ? 6.226   1.563   7.074   1.00 0.00 ? 76  VAL A HG23 6  
ATOM 8619  N N    . ASN A 1 69 ? 10.306  3.375   4.535   1.00 0.00 ? 77  ASN A N    6  
ATOM 8620  C CA   . ASN A 1 69 ? 11.583  4.080   4.508   1.00 0.00 ? 77  ASN A CA   6  
ATOM 8621  C C    . ASN A 1 69 ? 11.732  4.896   3.228   1.00 0.00 ? 77  ASN A C    6  
ATOM 8622  O O    . ASN A 1 69 ? 11.947  6.108   3.276   1.00 0.00 ? 77  ASN A O    6  
ATOM 8623  C CB   . ASN A 1 69 ? 12.741  3.087   4.634   1.00 0.00 ? 77  ASN A CB   6  
ATOM 8624  C CG   . ASN A 1 69 ? 13.705  3.464   5.741   1.00 0.00 ? 77  ASN A CG   6  
ATOM 8625  O OD1  . ASN A 1 69 ? 14.419  4.462   5.646   1.00 0.00 ? 77  ASN A OD1  6  
ATOM 8626  N ND2  . ASN A 1 69 ? 13.733  2.663   6.800   1.00 0.00 ? 77  ASN A ND2  6  
ATOM 8627  H H    . ASN A 1 69 ? 10.302  2.396   4.596   1.00 0.00 ? 77  ASN A H    6  
ATOM 8628  H HA   . ASN A 1 69 ? 11.605  4.753   5.350   1.00 0.00 ? 77  ASN A HA   6  
ATOM 8629  H HB2  . ASN A 1 69 ? 12.343  2.107   4.849   1.00 0.00 ? 77  ASN A HB2  6  
ATOM 8630  H HB3  . ASN A 1 69 ? 13.285  3.054   3.702   1.00 0.00 ? 77  ASN A HB3  6  
ATOM 8631  H HD21 . ASN A 1 69 ? 13.137  1.884   6.807   1.00 0.00 ? 77  ASN A HD21 6  
ATOM 8632  H HD22 . ASN A 1 69 ? 14.348  2.883   7.531   1.00 0.00 ? 77  ASN A HD22 6  
ATOM 8633  N N    . VAL A 1 70 ? 11.619  4.228   2.087   1.00 0.00 ? 78  VAL A N    6  
ATOM 8634  C CA   . VAL A 1 70 ? 11.744  4.895   0.797   1.00 0.00 ? 78  VAL A CA   6  
ATOM 8635  C C    . VAL A 1 70 ? 10.697  5.994   0.644   1.00 0.00 ? 78  VAL A C    6  
ATOM 8636  O O    . VAL A 1 70 ? 11.010  7.107   0.215   1.00 0.00 ? 78  VAL A O    6  
ATOM 8637  C CB   . VAL A 1 70 ? 11.603  3.898   -0.366  1.00 0.00 ? 78  VAL A CB   6  
ATOM 8638  C CG1  . VAL A 1 70 ? 12.737  2.885   -0.336  1.00 0.00 ? 78  VAL A CG1  6  
ATOM 8639  C CG2  . VAL A 1 70 ? 10.255  3.198   -0.313  1.00 0.00 ? 78  VAL A CG2  6  
ATOM 8640  H H    . VAL A 1 70 ? 11.447  3.263   2.112   1.00 0.00 ? 78  VAL A H    6  
ATOM 8641  H HA   . VAL A 1 70 ? 12.727  5.339   0.746   1.00 0.00 ? 78  VAL A HA   6  
ATOM 8642  H HB   . VAL A 1 70 ? 11.665  4.445   -1.295  1.00 0.00 ? 78  VAL A HB   6  
ATOM 8643  H HG11 . VAL A 1 70 ? 12.791  2.436   0.644   1.00 0.00 ? 78  VAL A HG11 6  
ATOM 8644  H HG12 . VAL A 1 70 ? 13.669  3.383   -0.557  1.00 0.00 ? 78  VAL A HG12 6  
ATOM 8645  H HG13 . VAL A 1 70 ? 12.554  2.118   -1.074  1.00 0.00 ? 78  VAL A HG13 6  
ATOM 8646  H HG21 . VAL A 1 70 ? 10.235  2.399   -1.040  1.00 0.00 ? 78  VAL A HG21 6  
ATOM 8647  H HG22 . VAL A 1 70 ? 9.473   3.907   -0.535  1.00 0.00 ? 78  VAL A HG22 6  
ATOM 8648  H HG23 . VAL A 1 70 ? 10.101  2.788   0.675   1.00 0.00 ? 78  VAL A HG23 6  
ATOM 8649  N N    . LEU A 1 71 ? 9.457   5.681   1.001   1.00 0.00 ? 79  LEU A N    6  
ATOM 8650  C CA   . LEU A 1 71 ? 8.369   6.647   0.907   1.00 0.00 ? 79  LEU A CA   6  
ATOM 8651  C C    . LEU A 1 71 ? 8.633   7.843   1.816   1.00 0.00 ? 79  LEU A C    6  
ATOM 8652  O O    . LEU A 1 71 ? 8.224   8.966   1.517   1.00 0.00 ? 79  LEU A O    6  
ATOM 8653  C CB   . LEU A 1 71 ? 7.036   5.988   1.280   1.00 0.00 ? 79  LEU A CB   6  
ATOM 8654  C CG   . LEU A 1 71 ? 6.221   5.449   0.100   1.00 0.00 ? 79  LEU A CG   6  
ATOM 8655  C CD1  . LEU A 1 71 ? 5.652   6.593   -0.725  1.00 0.00 ? 79  LEU A CD1  6  
ATOM 8656  C CD2  . LEU A 1 71 ? 7.077   4.539   -0.769  1.00 0.00 ? 79  LEU A CD2  6  
ATOM 8657  H H    . LEU A 1 71 ? 9.269   4.781   1.339   1.00 0.00 ? 79  LEU A H    6  
ATOM 8658  H HA   . LEU A 1 71 ? 8.317   6.991   -0.115  1.00 0.00 ? 79  LEU A HA   6  
ATOM 8659  H HB2  . LEU A 1 71 ? 7.242   5.167   1.953   1.00 0.00 ? 79  LEU A HB2  6  
ATOM 8660  H HB3  . LEU A 1 71 ? 6.432   6.715   1.802   1.00 0.00 ? 79  LEU A HB3  6  
ATOM 8661  H HG   . LEU A 1 71 ? 5.394   4.868   0.480   1.00 0.00 ? 79  LEU A HG   6  
ATOM 8662  H HD11 . LEU A 1 71 ? 6.264   6.743   -1.602  1.00 0.00 ? 79  LEU A HD11 6  
ATOM 8663  H HD12 . LEU A 1 71 ? 5.644   7.495   -0.133  1.00 0.00 ? 79  LEU A HD12 6  
ATOM 8664  H HD13 . LEU A 1 71 ? 4.644   6.350   -1.027  1.00 0.00 ? 79  LEU A HD13 6  
ATOM 8665  H HD21 . LEU A 1 71 ? 7.366   3.667   -0.202  1.00 0.00 ? 79  LEU A HD21 6  
ATOM 8666  H HD22 . LEU A 1 71 ? 7.962   5.071   -1.086  1.00 0.00 ? 79  LEU A HD22 6  
ATOM 8667  H HD23 . LEU A 1 71 ? 6.509   4.233   -1.636  1.00 0.00 ? 79  LEU A HD23 6  
ATOM 8668  N N    . LYS A 1 72 ? 9.321   7.594   2.926   1.00 0.00 ? 80  LYS A N    6  
ATOM 8669  C CA   . LYS A 1 72 ? 9.645   8.648   3.883   1.00 0.00 ? 80  LYS A CA   6  
ATOM 8670  C C    . LYS A 1 72 ? 10.886  9.419   3.444   1.00 0.00 ? 80  LYS A C    6  
ATOM 8671  O O    . LYS A 1 72 ? 11.000  10.621  3.685   1.00 0.00 ? 80  LYS A O    6  
ATOM 8672  C CB   . LYS A 1 72 ? 9.870   8.050   5.273   1.00 0.00 ? 80  LYS A CB   6  
ATOM 8673  C CG   . LYS A 1 72 ? 8.634   8.075   6.159   1.00 0.00 ? 80  LYS A CG   6  
ATOM 8674  C CD   . LYS A 1 72 ? 7.447   7.401   5.488   1.00 0.00 ? 80  LYS A CD   6  
ATOM 8675  C CE   . LYS A 1 72 ? 6.133   7.843   6.109   1.00 0.00 ? 80  LYS A CE   6  
ATOM 8676  N NZ   . LYS A 1 72 ? 5.482   8.925   5.321   1.00 0.00 ? 80  LYS A NZ   6  
ATOM 8677  H H    . LYS A 1 72 ? 9.619   6.679   3.107   1.00 0.00 ? 80  LYS A H    6  
ATOM 8678  H HA   . LYS A 1 72 ? 8.807   9.328   3.924   1.00 0.00 ? 80  LYS A HA   6  
ATOM 8679  H HB2  . LYS A 1 72 ? 10.186  7.023   5.163   1.00 0.00 ? 80  LYS A HB2  6  
ATOM 8680  H HB3  . LYS A 1 72 ? 10.652  8.605   5.769   1.00 0.00 ? 80  LYS A HB3  6  
ATOM 8681  H HG2  . LYS A 1 72 ? 8.854   7.558   7.080   1.00 0.00 ? 80  LYS A HG2  6  
ATOM 8682  H HG3  . LYS A 1 72 ? 8.380   9.102   6.373   1.00 0.00 ? 80  LYS A HG3  6  
ATOM 8683  H HD2  . LYS A 1 72 ? 7.443   7.660   4.439   1.00 0.00 ? 80  LYS A HD2  6  
ATOM 8684  H HD3  . LYS A 1 72 ? 7.545   6.332   5.595   1.00 0.00 ? 80  LYS A HD3  6  
ATOM 8685  H HE2  . LYS A 1 72 ? 5.468   6.993   6.155   1.00 0.00 ? 80  LYS A HE2  6  
ATOM 8686  H HE3  . LYS A 1 72 ? 6.326   8.204   7.109   1.00 0.00 ? 80  LYS A HE3  6  
ATOM 8687  H HZ1  . LYS A 1 72 ? 4.790   9.431   5.909   1.00 0.00 ? 80  LYS A HZ1  6  
ATOM 8688  H HZ2  . LYS A 1 72 ? 4.988   8.521   4.498   1.00 0.00 ? 80  LYS A HZ2  6  
ATOM 8689  H HZ3  . LYS A 1 72 ? 6.196   9.602   4.983   1.00 0.00 ? 80  LYS A HZ3  6  
ATOM 8690  N N    . SER A 1 73 ? 11.815  8.718   2.802   1.00 0.00 ? 81  SER A N    6  
ATOM 8691  C CA   . SER A 1 73 ? 13.052  9.334   2.333   1.00 0.00 ? 81  SER A CA   6  
ATOM 8692  C C    . SER A 1 73 ? 12.766  10.431  1.313   1.00 0.00 ? 81  SER A C    6  
ATOM 8693  O O    . SER A 1 73 ? 13.100  11.596  1.532   1.00 0.00 ? 81  SER A O    6  
ATOM 8694  C CB   . SER A 1 73 ? 13.967  8.275   1.714   1.00 0.00 ? 81  SER A CB   6  
ATOM 8695  O OG   . SER A 1 73 ? 15.259  8.801   1.465   1.00 0.00 ? 81  SER A OG   6  
ATOM 8696  H H    . SER A 1 73 ? 11.667  7.764   2.643   1.00 0.00 ? 81  SER A H    6  
ATOM 8697  H HA   . SER A 1 73 ? 13.548  9.771   3.185   1.00 0.00 ? 81  SER A HA   6  
ATOM 8698  H HB2  . SER A 1 73 ? 14.057  7.440   2.393   1.00 0.00 ? 81  SER A HB2  6  
ATOM 8699  H HB3  . SER A 1 73 ? 13.543  7.936   0.781   1.00 0.00 ? 81  SER A HB3  6  
ATOM 8700  H HG   . SER A 1 73 ? 15.841  8.584   2.197   1.00 0.00 ? 81  SER A HG   6  
ATOM 8701  N N    . SER A 1 74 ? 12.151  10.053  0.198   1.00 0.00 ? 82  SER A N    6  
ATOM 8702  C CA   . SER A 1 74 ? 11.827  11.006  -0.856  1.00 0.00 ? 82  SER A CA   6  
ATOM 8703  C C    . SER A 1 74 ? 10.379  11.474  -0.743  1.00 0.00 ? 82  SER A C    6  
ATOM 8704  O O    . SER A 1 74 ? 9.458   10.661  -0.683  1.00 0.00 ? 82  SER A O    6  
ATOM 8705  C CB   . SER A 1 74 ? 12.066  10.380  -2.230  1.00 0.00 ? 82  SER A CB   6  
ATOM 8706  O OG   . SER A 1 74 ? 13.432  10.471  -2.602  1.00 0.00 ? 82  SER A OG   6  
ATOM 8707  H H    . SER A 1 74 ? 11.914  9.109   0.080   1.00 0.00 ? 82  SER A H    6  
ATOM 8708  H HA   . SER A 1 74 ? 12.478  11.860  -0.743  1.00 0.00 ? 82  SER A HA   6  
ATOM 8709  H HB2  . SER A 1 74 ? 11.783  9.337   -2.203  1.00 0.00 ? 82  SER A HB2  6  
ATOM 8710  H HB3  . SER A 1 74 ? 11.469  10.895  -2.969  1.00 0.00 ? 82  SER A HB3  6  
ATOM 8711  H HG   . SER A 1 74 ? 13.577  9.972   -3.409  1.00 0.00 ? 82  SER A HG   6  
ATOM 8712  N N    . ARG A 1 75 ? 10.189  12.789  -0.717  1.00 0.00 ? 83  ARG A N    6  
ATOM 8713  C CA   . ARG A 1 75 ? 8.853   13.363  -0.614  1.00 0.00 ? 83  ARG A CA   6  
ATOM 8714  C C    . ARG A 1 75 ? 8.107   13.231  -1.937  1.00 0.00 ? 83  ARG A C    6  
ATOM 8715  O O    . ARG A 1 75 ? 6.960   12.782  -1.973  1.00 0.00 ? 83  ARG A O    6  
ATOM 8716  C CB   . ARG A 1 75 ? 8.938   14.837  -0.209  1.00 0.00 ? 83  ARG A CB   6  
ATOM 8717  C CG   . ARG A 1 75 ? 8.882   15.060  1.294   1.00 0.00 ? 83  ARG A CG   6  
ATOM 8718  C CD   . ARG A 1 75 ? 9.709   16.264  1.710   1.00 0.00 ? 83  ARG A CD   6  
ATOM 8719  N NE   . ARG A 1 75 ? 9.440   17.429  0.869   1.00 0.00 ? 83  ARG A NE   6  
ATOM 8720  C CZ   . ARG A 1 75 ? 10.222  18.504  0.817   1.00 0.00 ? 83  ARG A CZ   6  
ATOM 8721  N NH1  . ARG A 1 75 ? 11.326  18.568  1.552   1.00 0.00 ? 83  ARG A NH1  6  
ATOM 8722  N NH2  . ARG A 1 75 ? 9.901   19.520  0.028   1.00 0.00 ? 83  ARG A NH2  6  
ATOM 8723  H H    . ARG A 1 75 ? 10.965  13.385  -0.769  1.00 0.00 ? 83  ARG A H    6  
ATOM 8724  H HA   . ARG A 1 75 ? 8.315   12.820  0.147   1.00 0.00 ? 83  ARG A HA   6  
ATOM 8725  H HB2  . ARG A 1 75 ? 9.868   15.246  -0.577  1.00 0.00 ? 83  ARG A HB2  6  
ATOM 8726  H HB3  . ARG A 1 75 ? 8.116   15.371  -0.661  1.00 0.00 ? 83  ARG A HB3  6  
ATOM 8727  H HG2  . ARG A 1 75 ? 7.855   15.222  1.585   1.00 0.00 ? 83  ARG A HG2  6  
ATOM 8728  H HG3  . ARG A 1 75 ? 9.265   14.181  1.792   1.00 0.00 ? 83  ARG A HG3  6  
ATOM 8729  H HD2  . ARG A 1 75 ? 9.474   16.511  2.735   1.00 0.00 ? 83  ARG A HD2  6  
ATOM 8730  H HD3  . ARG A 1 75 ? 10.756  16.011  1.633   1.00 0.00 ? 83  ARG A HD3  6  
ATOM 8731  H HE   . ARG A 1 75 ? 8.632   17.409  0.315   1.00 0.00 ? 83  ARG A HE   6  
ATOM 8732  H HH11 . ARG A 1 75 ? 11.574  17.806  2.150   1.00 0.00 ? 83  ARG A HH11 6  
ATOM 8733  H HH12 . ARG A 1 75 ? 11.909  19.378  1.507   1.00 0.00 ? 83  ARG A HH12 6  
ATOM 8734  H HH21 . ARG A 1 75 ? 9.069   19.477  -0.527  1.00 0.00 ? 83  ARG A HH21 6  
ATOM 8735  H HH22 . ARG A 1 75 ? 10.487  20.328  -0.011  1.00 0.00 ? 83  ARG A HH22 6  
ATOM 8736  N N    . SER A 1 76 ? 8.767   13.620  -3.022  1.00 0.00 ? 84  SER A N    6  
ATOM 8737  C CA   . SER A 1 76 ? 8.169   13.542  -4.349  1.00 0.00 ? 84  SER A CA   6  
ATOM 8738  C C    . SER A 1 76 ? 8.639   12.290  -5.082  1.00 0.00 ? 84  SER A C    6  
ATOM 8739  O O    . SER A 1 76 ? 9.694   12.290  -5.717  1.00 0.00 ? 84  SER A O    6  
ATOM 8740  C CB   . SER A 1 76 ? 8.523   14.785  -5.166  1.00 0.00 ? 84  SER A CB   6  
ATOM 8741  O OG   . SER A 1 76 ? 7.775   14.838  -6.367  1.00 0.00 ? 84  SER A OG   6  
ATOM 8742  H H    . SER A 1 76 ? 9.679   13.966  -2.930  1.00 0.00 ? 84  SER A H    6  
ATOM 8743  H HA   . SER A 1 76 ? 7.097   13.494  -4.228  1.00 0.00 ? 84  SER A HA   6  
ATOM 8744  H HB2  . SER A 1 76 ? 8.308   15.669  -4.584  1.00 0.00 ? 84  SER A HB2  6  
ATOM 8745  H HB3  . SER A 1 76 ? 9.575   14.764  -5.411  1.00 0.00 ? 84  SER A HB3  6  
ATOM 8746  H HG   . SER A 1 76 ? 7.790   13.977  -6.793  1.00 0.00 ? 84  SER A HG   6  
ATOM 8747  N N    . LEU A 1 77 ? 7.853   11.221  -4.986  1.00 0.00 ? 85  LEU A N    6  
ATOM 8748  C CA   . LEU A 1 77 ? 8.195   9.963   -5.639  1.00 0.00 ? 85  LEU A CA   6  
ATOM 8749  C C    . LEU A 1 77 ? 6.990   9.370   -6.362  1.00 0.00 ? 85  LEU A C    6  
ATOM 8750  O O    . LEU A 1 77 ? 5.869   9.407   -5.856  1.00 0.00 ? 85  LEU A O    6  
ATOM 8751  C CB   . LEU A 1 77 ? 8.731   8.955   -4.616  1.00 0.00 ? 85  LEU A CB   6  
ATOM 8752  C CG   . LEU A 1 77 ? 8.255   9.166   -3.176  1.00 0.00 ? 85  LEU A CG   6  
ATOM 8753  C CD1  . LEU A 1 77 ? 6.757   8.929   -3.069  1.00 0.00 ? 85  LEU A CD1  6  
ATOM 8754  C CD2  . LEU A 1 77 ? 9.011   8.247   -2.229  1.00 0.00 ? 85  LEU A CD2  6  
ATOM 8755  H H    . LEU A 1 77 ? 7.026   11.281  -4.464  1.00 0.00 ? 85  LEU A H    6  
ATOM 8756  H HA   . LEU A 1 77 ? 8.969   10.167  -6.365  1.00 0.00 ? 85  LEU A HA   6  
ATOM 8757  H HB2  . LEU A 1 77 ? 8.429   7.966   -4.928  1.00 0.00 ? 85  LEU A HB2  6  
ATOM 8758  H HB3  . LEU A 1 77 ? 9.808   9.003   -4.626  1.00 0.00 ? 85  LEU A HB3  6  
ATOM 8759  H HG   . LEU A 1 77 ? 8.454   10.186  -2.884  1.00 0.00 ? 85  LEU A HG   6  
ATOM 8760  H HD11 . LEU A 1 77 ? 6.229   9.822   -3.364  1.00 0.00 ? 85  LEU A HD11 6  
ATOM 8761  H HD12 . LEU A 1 77 ? 6.504   8.682   -2.048  1.00 0.00 ? 85  LEU A HD12 6  
ATOM 8762  H HD13 . LEU A 1 77 ? 6.473   8.112   -3.717  1.00 0.00 ? 85  LEU A HD13 6  
ATOM 8763  H HD21 . LEU A 1 77 ? 10.066  8.280   -2.457  1.00 0.00 ? 85  LEU A HD21 6  
ATOM 8764  H HD22 . LEU A 1 77 ? 8.651   7.235   -2.343  1.00 0.00 ? 85  LEU A HD22 6  
ATOM 8765  H HD23 . LEU A 1 77 ? 8.853   8.571   -1.210  1.00 0.00 ? 85  LEU A HD23 6  
ATOM 8766  N N    . THR A 1 78 ? 7.235   8.814   -7.543  1.00 0.00 ? 86  THR A N    6  
ATOM 8767  C CA   . THR A 1 78 ? 6.175   8.199   -8.334  1.00 0.00 ? 86  THR A CA   6  
ATOM 8768  C C    . THR A 1 78 ? 6.071   6.714   -8.013  1.00 0.00 ? 86  THR A C    6  
ATOM 8769  O O    . THR A 1 78 ? 7.079   6.010   -7.958  1.00 0.00 ? 86  THR A O    6  
ATOM 8770  C CB   . THR A 1 78 ? 6.443   8.394   -9.828  1.00 0.00 ? 86  THR A CB   6  
ATOM 8771  O OG1  . THR A 1 78 ? 6.798   9.738   -10.103 1.00 0.00 ? 86  THR A OG1  6  
ATOM 8772  C CG2  . THR A 1 78 ? 5.257   8.043   -10.700 1.00 0.00 ? 86  THR A CG2  6  
ATOM 8773  H H    . THR A 1 78 ? 8.152   8.809   -7.889  1.00 0.00 ? 86  THR A H    6  
ATOM 8774  H HA   . THR A 1 78 ? 5.245   8.681   -8.076  1.00 0.00 ? 86  THR A HA   6  
ATOM 8775  H HB   . THR A 1 78 ? 7.268   7.759   -10.119 1.00 0.00 ? 86  THR A HB   6  
ATOM 8776  H HG1  . THR A 1 78 ? 7.411   9.763   -10.840 1.00 0.00 ? 86  THR A HG1  6  
ATOM 8777  H HG21 . THR A 1 78 ? 5.416   8.430   -11.696 1.00 0.00 ? 86  THR A HG21 6  
ATOM 8778  H HG22 . THR A 1 78 ? 4.361   8.478   -10.282 1.00 0.00 ? 86  THR A HG22 6  
ATOM 8779  H HG23 . THR A 1 78 ? 5.149   6.968   -10.744 1.00 0.00 ? 86  THR A HG23 6  
ATOM 8780  N N    . ILE A 1 79 ? 4.849   6.240   -7.792  1.00 0.00 ? 87  ILE A N    6  
ATOM 8781  C CA   . ILE A 1 79 ? 4.631   4.835   -7.467  1.00 0.00 ? 87  ILE A CA   6  
ATOM 8782  C C    . ILE A 1 79 ? 3.634   4.186   -8.420  1.00 0.00 ? 87  ILE A C    6  
ATOM 8783  O O    . ILE A 1 79 ? 2.623   4.786   -8.785  1.00 0.00 ? 87  ILE A O    6  
ATOM 8784  C CB   . ILE A 1 79 ? 4.137   4.660   -6.013  1.00 0.00 ? 87  ILE A CB   6  
ATOM 8785  C CG1  . ILE A 1 79 ? 2.722   5.227   -5.839  1.00 0.00 ? 87  ILE A CG1  6  
ATOM 8786  C CG2  . ILE A 1 79 ? 5.107   5.321   -5.040  1.00 0.00 ? 87  ILE A CG2  6  
ATOM 8787  C CD1  . ILE A 1 79 ? 2.655   6.739   -5.877  1.00 0.00 ? 87  ILE A CD1  6  
ATOM 8788  H H    . ILE A 1 79 ? 4.083   6.846   -7.844  1.00 0.00 ? 87  ILE A H    6  
ATOM 8789  H HA   . ILE A 1 79 ? 5.579   4.325   -7.561  1.00 0.00 ? 87  ILE A HA   6  
ATOM 8790  H HB   . ILE A 1 79 ? 4.119   3.604   -5.793  1.00 0.00 ? 87  ILE A HB   6  
ATOM 8791  H HG12 . ILE A 1 79 ? 2.089   4.850   -6.627  1.00 0.00 ? 87  ILE A HG12 6  
ATOM 8792  H HG13 . ILE A 1 79 ? 2.329   4.903   -4.885  1.00 0.00 ? 87  ILE A HG13 6  
ATOM 8793  H HG21 . ILE A 1 79 ? 5.922   5.771   -5.590  1.00 0.00 ? 87  ILE A HG21 6  
ATOM 8794  H HG22 . ILE A 1 79 ? 5.499   4.579   -4.361  1.00 0.00 ? 87  ILE A HG22 6  
ATOM 8795  H HG23 . ILE A 1 79 ? 4.591   6.085   -4.477  1.00 0.00 ? 87  ILE A HG23 6  
ATOM 8796  H HD11 . ILE A 1 79 ? 2.116   7.052   -6.758  1.00 0.00 ? 87  ILE A HD11 6  
ATOM 8797  H HD12 . ILE A 1 79 ? 3.656   7.143   -5.905  1.00 0.00 ? 87  ILE A HD12 6  
ATOM 8798  H HD13 . ILE A 1 79 ? 2.146   7.098   -4.997  1.00 0.00 ? 87  ILE A HD13 6  
ATOM 8799  N N    . SER A 1 80 ? 3.923   2.948   -8.809  1.00 0.00 ? 88  SER A N    6  
ATOM 8800  C CA   . SER A 1 80 ? 3.050   2.204   -9.709  1.00 0.00 ? 88  SER A CA   6  
ATOM 8801  C C    . SER A 1 80 ? 2.229   1.187   -8.925  1.00 0.00 ? 88  SER A C    6  
ATOM 8802  O O    . SER A 1 80 ? 2.744   0.151   -8.505  1.00 0.00 ? 88  SER A O    6  
ATOM 8803  C CB   . SER A 1 80 ? 3.873   1.496   -10.787 1.00 0.00 ? 88  SER A CB   6  
ATOM 8804  O OG   . SER A 1 80 ? 3.180   1.469   -12.021 1.00 0.00 ? 88  SER A OG   6  
ATOM 8805  H H    . SER A 1 80 ? 4.740   2.521   -8.476  1.00 0.00 ? 88  SER A H    6  
ATOM 8806  H HA   . SER A 1 80 ? 2.379   2.907   -10.180 1.00 0.00 ? 88  SER A HA   6  
ATOM 8807  H HB2  . SER A 1 80 ? 4.808   2.019   -10.924 1.00 0.00 ? 88  SER A HB2  6  
ATOM 8808  H HB3  . SER A 1 80 ? 4.071   0.481   -10.477 1.00 0.00 ? 88  SER A HB3  6  
ATOM 8809  H HG   . SER A 1 80 ? 3.765   1.147   -12.711 1.00 0.00 ? 88  SER A HG   6  
ATOM 8810  N N    . ILE A 1 81 ? 0.954   1.495   -8.721  1.00 0.00 ? 89  ILE A N    6  
ATOM 8811  C CA   . ILE A 1 81 ? 0.065   0.613   -7.976  1.00 0.00 ? 89  ILE A CA   6  
ATOM 8812  C C    . ILE A 1 81 ? -0.929  -0.080  -8.901  1.00 0.00 ? 89  ILE A C    6  
ATOM 8813  O O    . ILE A 1 81 ? -1.414  0.514   -9.862  1.00 0.00 ? 89  ILE A O    6  
ATOM 8814  C CB   . ILE A 1 81 ? -0.702  1.393   -6.888  1.00 0.00 ? 89  ILE A CB   6  
ATOM 8815  C CG1  . ILE A 1 81 ? -1.675  0.469   -6.142  1.00 0.00 ? 89  ILE A CG1  6  
ATOM 8816  C CG2  . ILE A 1 81 ? -1.431  2.579   -7.502  1.00 0.00 ? 89  ILE A CG2  6  
ATOM 8817  C CD1  . ILE A 1 81 ? -3.081  0.459   -6.706  1.00 0.00 ? 89  ILE A CD1  6  
ATOM 8818  H H    . ILE A 1 81 ? 0.603   2.339   -9.074  1.00 0.00 ? 89  ILE A H    6  
ATOM 8819  H HA   . ILE A 1 81 ? 0.672   -0.138  -7.490  1.00 0.00 ? 89  ILE A HA   6  
ATOM 8820  H HB   . ILE A 1 81 ? 0.021   1.778   -6.185  1.00 0.00 ? 89  ILE A HB   6  
ATOM 8821  H HG12 . ILE A 1 81 ? -1.300  -0.541  -6.182  1.00 0.00 ? 89  ILE A HG12 6  
ATOM 8822  H HG13 . ILE A 1 81 ? -1.733  0.783   -5.110  1.00 0.00 ? 89  ILE A HG13 6  
ATOM 8823  H HG21 . ILE A 1 81 ? -0.743  3.400   -7.621  1.00 0.00 ? 89  ILE A HG21 6  
ATOM 8824  H HG22 . ILE A 1 81 ? -2.242  2.877   -6.853  1.00 0.00 ? 89  ILE A HG22 6  
ATOM 8825  H HG23 . ILE A 1 81 ? -1.827  2.298   -8.466  1.00 0.00 ? 89  ILE A HG23 6  
ATOM 8826  H HD11 . ILE A 1 81 ? -3.604  -0.420  -6.359  1.00 0.00 ? 89  ILE A HD11 6  
ATOM 8827  H HD12 . ILE A 1 81 ? -3.037  0.450   -7.785  1.00 0.00 ? 89  ILE A HD12 6  
ATOM 8828  H HD13 . ILE A 1 81 ? -3.607  1.343   -6.376  1.00 0.00 ? 89  ILE A HD13 6  
ATOM 8829  N N    . VAL A 1 82 ? -1.235  -1.336  -8.599  1.00 0.00 ? 90  VAL A N    6  
ATOM 8830  C CA   . VAL A 1 82 ? -2.177  -2.105  -9.399  1.00 0.00 ? 90  VAL A CA   6  
ATOM 8831  C C    . VAL A 1 82 ? -3.464  -2.364  -8.622  1.00 0.00 ? 90  VAL A C    6  
ATOM 8832  O O    . VAL A 1 82 ? -3.429  -2.818  -7.479  1.00 0.00 ? 90  VAL A O    6  
ATOM 8833  C CB   . VAL A 1 82 ? -1.574  -3.450  -9.843  1.00 0.00 ? 90  VAL A CB   6  
ATOM 8834  C CG1  . VAL A 1 82 ? -2.496  -4.150  -10.831 1.00 0.00 ? 90  VAL A CG1  6  
ATOM 8835  C CG2  . VAL A 1 82 ? -0.193  -3.238  -10.445 1.00 0.00 ? 90  VAL A CG2  6  
ATOM 8836  H H    . VAL A 1 82 ? -0.818  -1.754  -7.817  1.00 0.00 ? 90  VAL A H    6  
ATOM 8837  H HA   . VAL A 1 82 ? -2.413  -1.530  -10.283 1.00 0.00 ? 90  VAL A HA   6  
ATOM 8838  H HB   . VAL A 1 82 ? -1.471  -4.079  -8.972  1.00 0.00 ? 90  VAL A HB   6  
ATOM 8839  H HG11 . VAL A 1 82 ? -2.508  -5.210  -10.622 1.00 0.00 ? 90  VAL A HG11 6  
ATOM 8840  H HG12 . VAL A 1 82 ? -2.136  -3.987  -11.836 1.00 0.00 ? 90  VAL A HG12 6  
ATOM 8841  H HG13 . VAL A 1 82 ? -3.494  -3.752  -10.737 1.00 0.00 ? 90  VAL A HG13 6  
ATOM 8842  H HG21 . VAL A 1 82 ? -0.100  -2.218  -10.783 1.00 0.00 ? 90  VAL A HG21 6  
ATOM 8843  H HG22 . VAL A 1 82 ? -0.058  -3.908  -11.282 1.00 0.00 ? 90  VAL A HG22 6  
ATOM 8844  H HG23 . VAL A 1 82 ? 0.560   -3.441  -9.698  1.00 0.00 ? 90  VAL A HG23 6  
ATOM 8845  N N    . ALA A 1 83 ? -4.595  -2.057  -9.245  1.00 0.00 ? 91  ALA A N    6  
ATOM 8846  C CA   . ALA A 1 83 ? -5.895  -2.241  -8.611  1.00 0.00 ? 91  ALA A CA   6  
ATOM 8847  C C    . ALA A 1 83 ? -6.199  -3.715  -8.357  1.00 0.00 ? 91  ALA A C    6  
ATOM 8848  O O    . ALA A 1 83 ? -6.055  -4.552  -9.249  1.00 0.00 ? 91  ALA A O    6  
ATOM 8849  C CB   . ALA A 1 83 ? -6.988  -1.619  -9.464  1.00 0.00 ? 91  ALA A CB   6  
ATOM 8850  H H    . ALA A 1 83 ? -4.556  -1.689  -10.153 1.00 0.00 ? 91  ALA A H    6  
ATOM 8851  H HA   . ALA A 1 83 ? -5.877  -1.722  -7.663  1.00 0.00 ? 91  ALA A HA   6  
ATOM 8852  H HB1  . ALA A 1 83 ? -7.870  -1.460  -8.861  1.00 0.00 ? 91  ALA A HB1  6  
ATOM 8853  H HB2  . ALA A 1 83 ? -7.226  -2.282  -10.283 1.00 0.00 ? 91  ALA A HB2  6  
ATOM 8854  H HB3  . ALA A 1 83 ? -6.644  -0.673  -9.856  1.00 0.00 ? 91  ALA A HB3  6  
ATOM 8855  N N    . ALA A 1 84 ? -6.636  -4.014  -7.134  1.00 0.00 ? 92  ALA A N    6  
ATOM 8856  C CA   . ALA A 1 84 ? -6.990  -5.376  -6.733  1.00 0.00 ? 92  ALA A CA   6  
ATOM 8857  C C    . ALA A 1 84 ? -5.769  -6.205  -6.334  1.00 0.00 ? 92  ALA A C    6  
ATOM 8858  O O    . ALA A 1 84 ? -5.908  -7.233  -5.670  1.00 0.00 ? 92  ALA A O    6  
ATOM 8859  C CB   . ALA A 1 84 ? -7.776  -6.081  -7.828  1.00 0.00 ? 92  ALA A CB   6  
ATOM 8860  H H    . ALA A 1 84 ? -6.735  -3.290  -6.482  1.00 0.00 ? 92  ALA A H    6  
ATOM 8861  H HA   . ALA A 1 84 ? -7.636  -5.293  -5.872  1.00 0.00 ? 92  ALA A HA   6  
ATOM 8862  H HB1  . ALA A 1 84 ? -7.104  -6.395  -8.610  1.00 0.00 ? 92  ALA A HB1  6  
ATOM 8863  H HB2  . ALA A 1 84 ? -8.513  -5.406  -8.235  1.00 0.00 ? 92  ALA A HB2  6  
ATOM 8864  H HB3  . ALA A 1 84 ? -8.274  -6.946  -7.412  1.00 0.00 ? 92  ALA A HB3  6  
ATOM 8865  N N    . ALA A 1 85 ? -4.575  -5.764  -6.723  1.00 0.00 ? 93  ALA A N    6  
ATOM 8866  C CA   . ALA A 1 85 ? -3.355  -6.487  -6.379  1.00 0.00 ? 93  ALA A CA   6  
ATOM 8867  C C    . ALA A 1 85 ? -3.237  -6.662  -4.866  1.00 0.00 ? 93  ALA A C    6  
ATOM 8868  O O    . ALA A 1 85 ? -2.546  -7.559  -4.385  1.00 0.00 ? 93  ALA A O    6  
ATOM 8869  C CB   . ALA A 1 85 ? -2.136  -5.759  -6.927  1.00 0.00 ? 93  ALA A CB   6  
ATOM 8870  H H    . ALA A 1 85 ? -4.509  -4.938  -7.243  1.00 0.00 ? 93  ALA A H    6  
ATOM 8871  H HA   . ALA A 1 85 ? -3.403  -7.462  -6.843  1.00 0.00 ? 93  ALA A HA   6  
ATOM 8872  H HB1  . ALA A 1 85 ? -1.993  -6.026  -7.964  1.00 0.00 ? 93  ALA A HB1  6  
ATOM 8873  H HB2  . ALA A 1 85 ? -1.262  -6.043  -6.359  1.00 0.00 ? 93  ALA A HB2  6  
ATOM 8874  H HB3  . ALA A 1 85 ? -2.287  -4.694  -6.847  1.00 0.00 ? 93  ALA A HB3  6  
ATOM 8875  N N    . GLY A 1 86 ? -3.923  -5.794  -4.127  1.00 0.00 ? 94  GLY A N    6  
ATOM 8876  C CA   . GLY A 1 86 ? -3.897  -5.850  -2.676  1.00 0.00 ? 94  GLY A CA   6  
ATOM 8877  C C    . GLY A 1 86 ? -5.255  -6.181  -2.086  1.00 0.00 ? 94  GLY A C    6  
ATOM 8878  O O    . GLY A 1 86 ? -5.344  -6.780  -1.014  1.00 0.00 ? 94  GLY A O    6  
ATOM 8879  H H    . GLY A 1 86 ? -4.453  -5.102  -4.571  1.00 0.00 ? 94  GLY A H    6  
ATOM 8880  H HA2  . GLY A 1 86 ? -3.191  -6.606  -2.369  1.00 0.00 ? 94  GLY A HA2  6  
ATOM 8881  H HA3  . GLY A 1 86 ? -3.575  -4.896  -2.293  1.00 0.00 ? 94  GLY A HA3  6  
ATOM 8882  N N    . ARG A 1 87 ? -6.316  -5.773  -2.780  1.00 0.00 ? 95  ARG A N    6  
ATOM 8883  C CA   . ARG A 1 87 ? -7.679  -6.012  -2.310  1.00 0.00 ? 95  ARG A CA   6  
ATOM 8884  C C    . ARG A 1 87 ? -7.921  -7.498  -2.061  1.00 0.00 ? 95  ARG A C    6  
ATOM 8885  O O    . ARG A 1 87 ? -8.646  -7.871  -1.140  1.00 0.00 ? 95  ARG A O    6  
ATOM 8886  C CB   . ARG A 1 87 ? -8.689  -5.478  -3.336  1.00 0.00 ? 95  ARG A CB   6  
ATOM 8887  C CG   . ARG A 1 87 ? -9.117  -6.503  -4.379  1.00 0.00 ? 95  ARG A CG   6  
ATOM 8888  C CD   . ARG A 1 87 ? -10.068 -5.899  -5.402  1.00 0.00 ? 95  ARG A CD   6  
ATOM 8889  N NE   . ARG A 1 87 ? -11.465 -6.189  -5.088  1.00 0.00 ? 95  ARG A NE   6  
ATOM 8890  C CZ   . ARG A 1 87 ? -12.223 -5.434  -4.294  1.00 0.00 ? 95  ARG A CZ   6  
ATOM 8891  N NH1  . ARG A 1 87 ? -11.729 -4.337  -3.735  1.00 0.00 ? 95  ARG A NH1  6  
ATOM 8892  N NH2  . ARG A 1 87 ? -13.482 -5.778  -4.060  1.00 0.00 ? 95  ARG A NH2  6  
ATOM 8893  H H    . ARG A 1 87 ? -6.180  -5.290  -3.620  1.00 0.00 ? 95  ARG A H    6  
ATOM 8894  H HA   . ARG A 1 87 ? -7.808  -5.477  -1.381  1.00 0.00 ? 95  ARG A HA   6  
ATOM 8895  H HB2  . ARG A 1 87 ? -9.571  -5.144  -2.814  1.00 0.00 ? 95  ARG A HB2  6  
ATOM 8896  H HB3  . ARG A 1 87 ? -8.249  -4.637  -3.851  1.00 0.00 ? 95  ARG A HB3  6  
ATOM 8897  H HG2  . ARG A 1 87 ? -8.241  -6.870  -4.890  1.00 0.00 ? 95  ARG A HG2  6  
ATOM 8898  H HG3  . ARG A 1 87 ? -9.613  -7.322  -3.881  1.00 0.00 ? 95  ARG A HG3  6  
ATOM 8899  H HD2  . ARG A 1 87 ? -9.925  -4.829  -5.421  1.00 0.00 ? 95  ARG A HD2  6  
ATOM 8900  H HD3  . ARG A 1 87 ? -9.836  -6.308  -6.374  1.00 0.00 ? 95  ARG A HD3  6  
ATOM 8901  H HE   . ARG A 1 87 ? -11.861 -6.991  -5.488  1.00 0.00 ? 95  ARG A HE   6  
ATOM 8902  H HH11 . ARG A 1 87 ? -10.782 -4.070  -3.908  1.00 0.00 ? 95  ARG A HH11 6  
ATOM 8903  H HH12 . ARG A 1 87 ? -12.305 -3.776  -3.141  1.00 0.00 ? 95  ARG A HH12 6  
ATOM 8904  H HH21 . ARG A 1 87 ? -13.860 -6.604  -4.479  1.00 0.00 ? 95  ARG A HH21 6  
ATOM 8905  H HH22 . ARG A 1 87 ? -14.052 -5.213  -3.464  1.00 0.00 ? 95  ARG A HH22 6  
ATOM 8906  N N    . GLU A 1 88 ? -7.304  -8.343  -2.879  1.00 0.00 ? 96  GLU A N    6  
ATOM 8907  C CA   . GLU A 1 88 ? -7.453  -9.785  -2.732  1.00 0.00 ? 96  GLU A CA   6  
ATOM 8908  C C    . GLU A 1 88 ? -7.109  -10.211 -1.307  1.00 0.00 ? 96  GLU A C    6  
ATOM 8909  O O    . GLU A 1 88 ? -7.764  -11.078 -0.730  1.00 0.00 ? 96  GLU A O    6  
ATOM 8910  C CB   . GLU A 1 88 ? -6.557  -10.520 -3.730  1.00 0.00 ? 96  GLU A CB   6  
ATOM 8911  C CG   . GLU A 1 88 ? -7.187  -11.782 -4.295  1.00 0.00 ? 96  GLU A CG   6  
ATOM 8912  C CD   . GLU A 1 88 ? -8.489  -11.509 -5.021  1.00 0.00 ? 96  GLU A CD   6  
ATOM 8913  O OE1  . GLU A 1 88 ? -8.539  -10.538 -5.805  1.00 0.00 ? 96  GLU A OE1  6  
ATOM 8914  O OE2  . GLU A 1 88 ? -9.459  -12.265 -4.804  1.00 0.00 ? 96  GLU A OE2  6  
ATOM 8915  H H    . GLU A 1 88 ? -6.732  -7.991  -3.594  1.00 0.00 ? 96  GLU A H    6  
ATOM 8916  H HA   . GLU A 1 88 ? -8.485  -10.035 -2.932  1.00 0.00 ? 96  GLU A HA   6  
ATOM 8917  H HB2  . GLU A 1 88 ? -6.335  -9.855  -4.551  1.00 0.00 ? 96  GLU A HB2  6  
ATOM 8918  H HB3  . GLU A 1 88 ? -5.636  -10.792 -3.238  1.00 0.00 ? 96  GLU A HB3  6  
ATOM 8919  H HG2  . GLU A 1 88 ? -6.494  -12.235 -4.989  1.00 0.00 ? 96  GLU A HG2  6  
ATOM 8920  H HG3  . GLU A 1 88 ? -7.380  -12.467 -3.482  1.00 0.00 ? 96  GLU A HG3  6  
ATOM 8921  N N    . LEU A 1 89 ? -6.082  -9.582  -0.746  1.00 0.00 ? 97  LEU A N    6  
ATOM 8922  C CA   . LEU A 1 89 ? -5.650  -9.880  0.612   1.00 0.00 ? 97  LEU A CA   6  
ATOM 8923  C C    . LEU A 1 89 ? -6.660  -9.354  1.627   1.00 0.00 ? 97  LEU A C    6  
ATOM 8924  O O    . LEU A 1 89 ? -7.145  -10.097 2.479   1.00 0.00 ? 97  LEU A O    6  
ATOM 8925  C CB   . LEU A 1 89 ? -4.275  -9.260  0.880   1.00 0.00 ? 97  LEU A CB   6  
ATOM 8926  C CG   . LEU A 1 89 ? -3.088  -10.034 0.305   1.00 0.00 ? 97  LEU A CG   6  
ATOM 8927  C CD1  . LEU A 1 89 ? -2.915  -11.361 1.026   1.00 0.00 ? 97  LEU A CD1  6  
ATOM 8928  C CD2  . LEU A 1 89 ? -3.265  -10.254 -1.190  1.00 0.00 ? 97  LEU A CD2  6  
ATOM 8929  H H    . LEU A 1 89 ? -5.606  -8.895  -1.260  1.00 0.00 ? 97  LEU A H    6  
ATOM 8930  H HA   . LEU A 1 89 ? -5.578  -10.952 0.713   1.00 0.00 ? 97  LEU A HA   6  
ATOM 8931  H HB2  . LEU A 1 89 ? -4.266  -8.265  0.462   1.00 0.00 ? 97  LEU A HB2  6  
ATOM 8932  H HB3  . LEU A 1 89 ? -4.142  -9.184  1.949   1.00 0.00 ? 97  LEU A HB3  6  
ATOM 8933  H HG   . LEU A 1 89 ? -2.188  -9.457  0.453   1.00 0.00 ? 97  LEU A HG   6  
ATOM 8934  H HD11 . LEU A 1 89 ? -3.756  -12.001 0.810   1.00 0.00 ? 97  LEU A HD11 6  
ATOM 8935  H HD12 . LEU A 1 89 ? -2.860  -11.186 2.091   1.00 0.00 ? 97  LEU A HD12 6  
ATOM 8936  H HD13 . LEU A 1 89 ? -2.005  -11.835 0.693   1.00 0.00 ? 97  LEU A HD13 6  
ATOM 8937  H HD21 . LEU A 1 89 ? -3.716  -9.379  -1.631  1.00 0.00 ? 97  LEU A HD21 6  
ATOM 8938  H HD22 . LEU A 1 89 ? -3.902  -11.110 -1.354  1.00 0.00 ? 97  LEU A HD22 6  
ATOM 8939  H HD23 . LEU A 1 89 ? -2.301  -10.430 -1.643  1.00 0.00 ? 97  LEU A HD23 6  
ATOM 8940  N N    . PHE A 1 90 ? -6.970  -8.063  1.526   1.00 0.00 ? 98  PHE A N    6  
ATOM 8941  C CA   . PHE A 1 90 ? -7.920  -7.422  2.432   1.00 0.00 ? 98  PHE A CA   6  
ATOM 8942  C C    . PHE A 1 90 ? -9.227  -8.207  2.507   1.00 0.00 ? 98  PHE A C    6  
ATOM 8943  O O    . PHE A 1 90 ? -9.903  -8.208  3.536   1.00 0.00 ? 98  PHE A O    6  
ATOM 8944  C CB   . PHE A 1 90 ? -8.200  -5.990  1.977   1.00 0.00 ? 98  PHE A CB   6  
ATOM 8945  C CG   . PHE A 1 90 ? -7.264  -4.976  2.571   1.00 0.00 ? 98  PHE A CG   6  
ATOM 8946  C CD1  . PHE A 1 90 ? -6.062  -4.677  1.950   1.00 0.00 ? 98  PHE A CD1  6  
ATOM 8947  C CD2  . PHE A 1 90 ? -7.585  -4.328  3.753   1.00 0.00 ? 98  PHE A CD2  6  
ATOM 8948  C CE1  . PHE A 1 90 ? -5.198  -3.746  2.496   1.00 0.00 ? 98  PHE A CE1  6  
ATOM 8949  C CE2  . PHE A 1 90 ? -6.725  -3.396  4.303   1.00 0.00 ? 98  PHE A CE2  6  
ATOM 8950  C CZ   . PHE A 1 90 ? -5.530  -3.105  3.674   1.00 0.00 ? 98  PHE A CZ   6  
ATOM 8951  H H    . PHE A 1 90 ? -6.545  -7.525  0.826   1.00 0.00 ? 98  PHE A H    6  
ATOM 8952  H HA   . PHE A 1 90 ? -7.474  -7.396  3.414   1.00 0.00 ? 98  PHE A HA   6  
ATOM 8953  H HB2  . PHE A 1 90 ? -8.108  -5.936  0.903   1.00 0.00 ? 98  PHE A HB2  6  
ATOM 8954  H HB3  . PHE A 1 90 ? -9.208  -5.719  2.260   1.00 0.00 ? 98  PHE A HB3  6  
ATOM 8955  H HD1  . PHE A 1 90 ? -5.802  -5.176  1.028   1.00 0.00 ? 98  PHE A HD1  6  
ATOM 8956  H HD2  . PHE A 1 90 ? -8.518  -4.555  4.246   1.00 0.00 ? 98  PHE A HD2  6  
ATOM 8957  H HE1  . PHE A 1 90 ? -4.265  -3.520  2.001   1.00 0.00 ? 98  PHE A HE1  6  
ATOM 8958  H HE2  . PHE A 1 90 ? -6.986  -2.898  5.225   1.00 0.00 ? 98  PHE A HE2  6  
ATOM 8959  H HZ   . PHE A 1 90 ? -4.856  -2.378  4.102   1.00 0.00 ? 98  PHE A HZ   6  
ATOM 8960  N N    . MET A 1 91 ? -9.576  -8.873  1.413   1.00 0.00 ? 99  MET A N    6  
ATOM 8961  C CA   . MET A 1 91 ? -10.803 -9.661  1.358   1.00 0.00 ? 99  MET A CA   6  
ATOM 8962  C C    . MET A 1 91 ? -10.785 -10.768 2.407   1.00 0.00 ? 99  MET A C    6  
ATOM 8963  O O    . MET A 1 91 ? -11.745 -10.943 3.155   1.00 0.00 ? 99  MET A O    6  
ATOM 8964  C CB   . MET A 1 91 ? -10.986 -10.264 -0.036  1.00 0.00 ? 99  MET A CB   6  
ATOM 8965  C CG   . MET A 1 91 ? -11.391 -9.248  -1.091  1.00 0.00 ? 99  MET A CG   6  
ATOM 8966  S SD   . MET A 1 91 ? -13.156 -9.294  -1.458  1.00 0.00 ? 99  MET A SD   6  
ATOM 8967  C CE   . MET A 1 91 ? -13.825 -8.480  -0.011  1.00 0.00 ? 99  MET A CE   6  
ATOM 8968  H H    . MET A 1 91 ? -8.998  -8.835  0.624   1.00 0.00 ? 99  MET A H    6  
ATOM 8969  H HA   . MET A 1 91 ? -11.629 -8.998  1.565   1.00 0.00 ? 99  MET A HA   6  
ATOM 8970  H HB2  . MET A 1 91 ? -10.055 -10.720 -0.343  1.00 0.00 ? 99  MET A HB2  6  
ATOM 8971  H HB3  . MET A 1 91 ? -11.751 -11.026 0.013   1.00 0.00 ? 99  MET A HB3  6  
ATOM 8972  H HG2  . MET A 1 91 ? -11.139 -8.260  -0.737  1.00 0.00 ? 99  MET A HG2  6  
ATOM 8973  H HG3  . MET A 1 91 ? -10.843 -9.455  -1.999  1.00 0.00 ? 99  MET A HG3  6  
ATOM 8974  H HE1  . MET A 1 91 ? -14.904 -8.471  -0.068  1.00 0.00 ? 99  MET A HE1  6  
ATOM 8975  H HE2  . MET A 1 91 ? -13.458 -7.464  0.034   1.00 0.00 ? 99  MET A HE2  6  
ATOM 8976  H HE3  . MET A 1 91 ? -13.515 -9.012  0.876   1.00 0.00 ? 99  MET A HE3  6  
ATOM 8977  N N    . THR A 1 92 ? -9.685  -11.513 2.454   1.00 0.00 ? 100 THR A N    6  
ATOM 8978  C CA   . THR A 1 92 ? -9.540  -12.603 3.412   1.00 0.00 ? 100 THR A CA   6  
ATOM 8979  C C    . THR A 1 92 ? -10.608 -13.669 3.189   1.00 0.00 ? 100 THR A C    6  
ATOM 8980  O O    . THR A 1 92 ? -11.690 -13.380 2.679   1.00 0.00 ? 100 THR A O    6  
ATOM 8981  C CB   . THR A 1 92 ? -9.627  -12.070 4.843   1.00 0.00 ? 100 THR A CB   6  
ATOM 8982  O OG1  . THR A 1 92 ? -9.109  -10.754 4.920   1.00 0.00 ? 100 THR A OG1  6  
ATOM 8983  C CG2  . THR A 1 92 ? -8.873  -12.919 5.844   1.00 0.00 ? 100 THR A CG2  6  
ATOM 8984  H H    . THR A 1 92 ? -8.952  -11.324 1.831   1.00 0.00 ? 100 THR A H    6  
ATOM 8985  H HA   . THR A 1 92 ? -8.568  -13.048 3.262   1.00 0.00 ? 100 THR A HA   6  
ATOM 8986  H HB   . THR A 1 92 ? -10.664 -12.046 5.144   1.00 0.00 ? 100 THR A HB   6  
ATOM 8987  H HG1  . THR A 1 92 ? -9.169  -10.440 5.825   1.00 0.00 ? 100 THR A HG1  6  
ATOM 8988  H HG21 . THR A 1 92 ? -7.829  -12.644 5.835   1.00 0.00 ? 100 THR A HG21 6  
ATOM 8989  H HG22 . THR A 1 92 ? -8.973  -13.961 5.579   1.00 0.00 ? 100 THR A HG22 6  
ATOM 8990  H HG23 . THR A 1 92 ? -9.279  -12.758 6.830   1.00 0.00 ? 100 THR A HG23 6  
ATOM 8991  N N    . THR B 2 1  ? -4.747  -12.409 13.007  1.00 0.00 ? 111 THR B N    6  
ATOM 8992  C CA   . THR B 2 1  ? -4.504  -11.002 13.296  1.00 0.00 ? 111 THR B CA   6  
ATOM 8993  C C    . THR B 2 1  ? -4.329  -10.203 12.006  1.00 0.00 ? 111 THR B C    6  
ATOM 8994  O O    . THR B 2 1  ? -3.887  -10.740 10.990  1.00 0.00 ? 111 THR B O    6  
ATOM 8995  C CB   . THR B 2 1  ? -3.263  -10.848 14.179  1.00 0.00 ? 111 THR B CB   6  
ATOM 8996  O OG1  . THR B 2 1  ? -2.375  -11.937 13.988  1.00 0.00 ? 111 THR B OG1  6  
ATOM 8997  C CG2  . THR B 2 1  ? -3.583  -10.770 15.655  1.00 0.00 ? 111 THR B CG2  6  
ATOM 8998  H H1   . THR B 2 1  ? -3.987  -12.997 12.814  1.00 0.00 ? 111 THR B H1   6  
ATOM 8999  H HA   . THR B 2 1  ? -5.363  -10.619 13.828  1.00 0.00 ? 111 THR B HA   6  
ATOM 9000  H HB   . THR B 2 1  ? -2.747  -9.938  13.903  1.00 0.00 ? 111 THR B HB   6  
ATOM 9001  H HG1  . THR B 2 1  ? -2.761  -12.733 14.359  1.00 0.00 ? 111 THR B HG1  6  
ATOM 9002  H HG21 . THR B 2 1  ? -3.524  -9.743  15.982  1.00 0.00 ? 111 THR B HG21 6  
ATOM 9003  H HG22 . THR B 2 1  ? -2.875  -11.368 16.210  1.00 0.00 ? 111 THR B HG22 6  
ATOM 9004  H HG23 . THR B 2 1  ? -4.583  -11.145 15.827  1.00 0.00 ? 111 THR B HG23 6  
ATOM 9005  N N    . PRO B 2 2  ? -4.677  -8.905  12.029  1.00 0.00 ? 112 PRO B N    6  
ATOM 9006  C CA   . PRO B 2 2  ? -4.556  -8.036  10.854  1.00 0.00 ? 112 PRO B CA   6  
ATOM 9007  C C    . PRO B 2 2  ? -3.101  -7.753  10.492  1.00 0.00 ? 112 PRO B C    6  
ATOM 9008  O O    . PRO B 2 2  ? -2.219  -7.799  11.348  1.00 0.00 ? 112 PRO B O    6  
ATOM 9009  C CB   . PRO B 2 2  ? -5.259  -6.748  11.288  1.00 0.00 ? 112 PRO B CB   6  
ATOM 9010  C CG   . PRO B 2 2  ? -5.156  -6.743  12.773  1.00 0.00 ? 112 PRO B CG   6  
ATOM 9011  C CD   . PRO B 2 2  ? -5.215  -8.183  13.198  1.00 0.00 ? 112 PRO B CD   6  
ATOM 9012  H HA   . PRO B 2 2  ? -5.062  -8.455  9.998   1.00 0.00 ? 112 PRO B HA   6  
ATOM 9013  H HB2  . PRO B 2 2  ? -4.756  -5.896  10.853  1.00 0.00 ? 112 PRO B HB2  6  
ATOM 9014  H HB3  . PRO B 2 2  ? -6.288  -6.770  10.964  1.00 0.00 ? 112 PRO B HB3  6  
ATOM 9015  H HG2  . PRO B 2 2  ? -4.218  -6.300  13.075  1.00 0.00 ? 112 PRO B HG2  6  
ATOM 9016  H HG3  . PRO B 2 2  ? -5.983  -6.193  13.197  1.00 0.00 ? 112 PRO B HG3  6  
ATOM 9017  H HD2  . PRO B 2 2  ? -4.595  -8.345  14.068  1.00 0.00 ? 112 PRO B HD2  6  
ATOM 9018  H HD3  . PRO B 2 2  ? -6.233  -8.478  13.398  1.00 0.00 ? 112 PRO B HD3  6  
ATOM 9019  N N    . LEU B 2 3  ? -2.861  -7.460  9.218   1.00 0.00 ? 113 LEU B N    6  
ATOM 9020  C CA   . LEU B 2 3  ? -1.514  -7.170  8.742   1.00 0.00 ? 113 LEU B CA   6  
ATOM 9021  C C    . LEU B 2 3  ? -1.028  -5.826  9.271   1.00 0.00 ? 113 LEU B C    6  
ATOM 9022  O O    . LEU B 2 3  ? -1.825  -4.923  9.526   1.00 0.00 ? 113 LEU B O    6  
ATOM 9023  C CB   . LEU B 2 3  ? -1.480  -7.170  7.213   1.00 0.00 ? 113 LEU B CB   6  
ATOM 9024  C CG   . LEU B 2 3  ? -2.186  -8.355  6.550   1.00 0.00 ? 113 LEU B CG   6  
ATOM 9025  C CD1  . LEU B 2 3  ? -2.873  -7.917  5.266   1.00 0.00 ? 113 LEU B CD1  6  
ATOM 9026  C CD2  . LEU B 2 3  ? -1.195  -9.476  6.270   1.00 0.00 ? 113 LEU B CD2  6  
ATOM 9027  H H    . LEU B 2 3  ? -3.608  -7.440  8.584   1.00 0.00 ? 113 LEU B H    6  
ATOM 9028  H HA   . LEU B 2 3  ? -0.859  -7.946  9.109   1.00 0.00 ? 113 LEU B HA   6  
ATOM 9029  H HB2  . LEU B 2 3  ? -1.944  -6.260  6.863   1.00 0.00 ? 113 LEU B HB2  6  
ATOM 9030  H HB3  . LEU B 2 3  ? -0.448  -7.174  6.897   1.00 0.00 ? 113 LEU B HB3  6  
ATOM 9031  H HG   . LEU B 2 3  ? -2.942  -8.736  7.220   1.00 0.00 ? 113 LEU B HG   6  
ATOM 9032  H HD11 . LEU B 2 3  ? -2.321  -7.103  4.822   1.00 0.00 ? 113 LEU B HD11 6  
ATOM 9033  H HD12 . LEU B 2 3  ? -3.879  -7.591  5.489   1.00 0.00 ? 113 LEU B HD12 6  
ATOM 9034  H HD13 . LEU B 2 3  ? -2.910  -8.747  4.576   1.00 0.00 ? 113 LEU B HD13 6  
ATOM 9035  H HD21 . LEU B 2 3  ? -0.939  -9.969  7.196   1.00 0.00 ? 113 LEU B HD21 6  
ATOM 9036  H HD22 . LEU B 2 3  ? -0.302  -9.064  5.824   1.00 0.00 ? 113 LEU B HD22 6  
ATOM 9037  H HD23 . LEU B 2 3  ? -1.639  -10.190 5.592   1.00 0.00 ? 113 LEU B HD23 6  
ATOM 9038  N N    . GLU B 2 4  ? 0.285   -5.698  9.434   1.00 0.00 ? 114 GLU B N    6  
ATOM 9039  C CA   . GLU B 2 4  ? 0.878   -4.463  9.933   1.00 0.00 ? 114 GLU B CA   6  
ATOM 9040  C C    . GLU B 2 4  ? 0.534   -3.289  9.022   1.00 0.00 ? 114 GLU B C    6  
ATOM 9041  O O    . GLU B 2 4  ? 0.572   -3.409  7.797   1.00 0.00 ? 114 GLU B O    6  
ATOM 9042  C CB   . GLU B 2 4  ? 2.396   -4.608  10.046  1.00 0.00 ? 114 GLU B CB   6  
ATOM 9043  C CG   . GLU B 2 4  ? 2.842   -5.366  11.286  1.00 0.00 ? 114 GLU B CG   6  
ATOM 9044  C CD   . GLU B 2 4  ? 4.261   -5.022  11.699  1.00 0.00 ? 114 GLU B CD   6  
ATOM 9045  O OE1  . GLU B 2 4  ? 5.177   -5.182  10.866  1.00 0.00 ? 114 GLU B OE1  6  
ATOM 9046  O OE2  . GLU B 2 4  ? 4.454   -4.595  12.856  1.00 0.00 ? 114 GLU B OE2  6  
ATOM 9047  H H    . GLU B 2 4  ? 0.869   -6.454  9.214   1.00 0.00 ? 114 GLU B H    6  
ATOM 9048  H HA   . GLU B 2 4  ? 0.470   -4.272  10.914  1.00 0.00 ? 114 GLU B HA   6  
ATOM 9049  H HB2  . GLU B 2 4  ? 2.760   -5.137  9.176   1.00 0.00 ? 114 GLU B HB2  6  
ATOM 9050  H HB3  . GLU B 2 4  ? 2.840   -3.625  10.071  1.00 0.00 ? 114 GLU B HB3  6  
ATOM 9051  H HG2  . GLU B 2 4  ? 2.178   -5.121  12.101  1.00 0.00 ? 114 GLU B HG2  6  
ATOM 9052  H HG3  . GLU B 2 4  ? 2.788   -6.426  11.083  1.00 0.00 ? 114 GLU B HG3  6  
ATOM 9053  N N    . ILE B 2 5  ? 0.196   -2.155  9.626   1.00 0.00 ? 115 ILE B N    6  
ATOM 9054  C CA   . ILE B 2 5  ? -0.157  -0.960  8.867   1.00 0.00 ? 115 ILE B CA   6  
ATOM 9055  C C    . ILE B 2 5  ? 0.776   0.199   9.201   1.00 0.00 ? 115 ILE B C    6  
ATOM 9056  O O    . ILE B 2 5  ? 1.263   0.313   10.328  1.00 0.00 ? 115 ILE B O    6  
ATOM 9057  C CB   . ILE B 2 5  ? -1.612  -0.528  9.138   1.00 0.00 ? 115 ILE B CB   6  
ATOM 9058  C CG1  . ILE B 2 5  ? -2.537  -1.746  9.167   1.00 0.00 ? 115 ILE B CG1  6  
ATOM 9059  C CG2  . ILE B 2 5  ? -2.074  0.470   8.087   1.00 0.00 ? 115 ILE B CG2  6  
ATOM 9060  C CD1  . ILE B 2 5  ? -2.564  -2.515  7.865   1.00 0.00 ? 115 ILE B CD1  6  
ATOM 9061  H H    . ILE B 2 5  ? 0.182   -2.120  10.606  1.00 0.00 ? 115 ILE B H    6  
ATOM 9062  H HA   . ILE B 2 5  ? -0.063  -1.194  7.817   1.00 0.00 ? 115 ILE B HA   6  
ATOM 9063  H HB   . ILE B 2 5  ? -1.644  -0.039  10.101  1.00 0.00 ? 115 ILE B HB   6  
ATOM 9064  H HG12 . ILE B 2 5  ? -2.211  -2.421  9.943   1.00 0.00 ? 115 ILE B HG12 6  
ATOM 9065  H HG13 . ILE B 2 5  ? -3.545  -1.418  9.380   1.00 0.00 ? 115 ILE B HG13 6  
ATOM 9066  H HG21 . ILE B 2 5  ? -2.960  0.979   8.439   1.00 0.00 ? 115 ILE B HG21 6  
ATOM 9067  H HG22 . ILE B 2 5  ? -2.300  -0.053  7.170   1.00 0.00 ? 115 ILE B HG22 6  
ATOM 9068  H HG23 . ILE B 2 5  ? -1.293  1.192   7.907   1.00 0.00 ? 115 ILE B HG23 6  
ATOM 9069  H HD11 . ILE B 2 5  ? -3.010  -3.485  8.028   1.00 0.00 ? 115 ILE B HD11 6  
ATOM 9070  H HD12 . ILE B 2 5  ? -1.555  -2.642  7.501   1.00 0.00 ? 115 ILE B HD12 6  
ATOM 9071  H HD13 . ILE B 2 5  ? -3.144  -1.971  7.135   1.00 0.00 ? 115 ILE B HD13 6  
ATOM 9072  N N    . THR B 2 6  ? 1.021   1.059   8.218   1.00 0.00 ? 116 THR B N    6  
ATOM 9073  C CA   . THR B 2 6  ? 1.896   2.211   8.409   1.00 0.00 ? 116 THR B CA   6  
ATOM 9074  C C    . THR B 2 6  ? 1.267   3.473   7.828   1.00 0.00 ? 116 THR B C    6  
ATOM 9075  O O    . THR B 2 6  ? 0.560   3.420   6.822   1.00 0.00 ? 116 THR B O    6  
ATOM 9076  C CB   . THR B 2 6  ? 3.256   1.959   7.757   1.00 0.00 ? 116 THR B CB   6  
ATOM 9077  O OG1  . THR B 2 6  ? 3.855   0.788   8.281   1.00 0.00 ? 116 THR B OG1  6  
ATOM 9078  C CG2  . THR B 2 6  ? 4.233   3.100   7.949   1.00 0.00 ? 116 THR B CG2  6  
ATOM 9079  H H    . THR B 2 6  ? 0.604   0.915   7.343   1.00 0.00 ? 116 THR B H    6  
ATOM 9080  H HA   . THR B 2 6  ? 2.036   2.349   9.471   1.00 0.00 ? 116 THR B HA   6  
ATOM 9081  H HB   . THR B 2 6  ? 3.115   1.821   6.695   1.00 0.00 ? 116 THR B HB   6  
ATOM 9082  H HG1  . THR B 2 6  ? 3.202   0.085   8.321   1.00 0.00 ? 116 THR B HG1  6  
ATOM 9083  H HG21 . THR B 2 6  ? 5.168   2.713   8.325   1.00 0.00 ? 116 THR B HG21 6  
ATOM 9084  H HG22 . THR B 2 6  ? 3.826   3.808   8.655   1.00 0.00 ? 116 THR B HG22 6  
ATOM 9085  H HG23 . THR B 2 6  ? 4.402   3.592   7.004   1.00 0.00 ? 116 THR B HG23 6  
ATOM 9086  N N    . GLU B 2 7  ? 1.528   4.608   8.469   1.00 0.00 ? 117 GLU B N    6  
ATOM 9087  C CA   . GLU B 2 7  ? 0.988   5.885   8.018   1.00 0.00 ? 117 GLU B CA   6  
ATOM 9088  C C    . GLU B 2 7  ? 1.999   6.628   7.153   1.00 0.00 ? 117 GLU B C    6  
ATOM 9089  O O    . GLU B 2 7  ? 3.150   6.817   7.548   1.00 0.00 ? 117 GLU B O    6  
ATOM 9090  C CB   . GLU B 2 7  ? 0.590   6.746   9.217   1.00 0.00 ? 117 GLU B CB   6  
ATOM 9091  C CG   . GLU B 2 7  ? -0.737  6.346   9.840   1.00 0.00 ? 117 GLU B CG   6  
ATOM 9092  C CD   . GLU B 2 7  ? -0.690  6.326   11.355  1.00 0.00 ? 117 GLU B CD   6  
ATOM 9093  O OE1  . GLU B 2 7  ? -0.355  5.268   11.925  1.00 0.00 ? 117 GLU B OE1  6  
ATOM 9094  O OE2  . GLU B 2 7  ? -0.991  7.371   11.973  1.00 0.00 ? 117 GLU B OE2  6  
ATOM 9095  H H    . GLU B 2 7  ? 2.099   4.585   9.267   1.00 0.00 ? 117 GLU B H    6  
ATOM 9096  H HA   . GLU B 2 7  ? 0.108   5.680   7.426   1.00 0.00 ? 117 GLU B HA   6  
ATOM 9097  H HB2  . GLU B 2 7  ? 1.357   6.666   9.973   1.00 0.00 ? 117 GLU B HB2  6  
ATOM 9098  H HB3  . GLU B 2 7  ? 0.518   7.776   8.897   1.00 0.00 ? 117 GLU B HB3  6  
ATOM 9099  H HG2  . GLU B 2 7  ? -1.494  7.052   9.529   1.00 0.00 ? 117 GLU B HG2  6  
ATOM 9100  H HG3  . GLU B 2 7  ? -1.002  5.359   9.489   1.00 0.00 ? 117 GLU B HG3  6  
ATOM 9101  N N    . LEU B 2 8  ? 1.561   7.050   5.971   1.00 0.00 ? 118 LEU B N    6  
ATOM 9102  C CA   . LEU B 2 8  ? 2.426   7.776   5.048   1.00 0.00 ? 118 LEU B CA   6  
ATOM 9103  C C    . LEU B 2 8  ? 1.884   9.177   4.782   1.00 0.00 ? 118 LEU B C    6  
ATOM 9104  O O    . LEU B 2 8  ? 0.805   9.284   4.163   1.00 0.00 ? 118 LEU B O    6  
ATOM 9105  C CB   . LEU B 2 8  ? 2.559   7.010   3.730   1.00 0.00 ? 118 LEU B CB   6  
ATOM 9106  C CG   . LEU B 2 8  ? 2.950   5.538   3.871   1.00 0.00 ? 118 LEU B CG   6  
ATOM 9107  C CD1  . LEU B 2 8  ? 3.138   4.902   2.503   1.00 0.00 ? 118 LEU B CD1  6  
ATOM 9108  C CD2  . LEU B 2 8  ? 4.218   5.402   4.702   1.00 0.00 ? 118 LEU B CD2  6  
ATOM 9109  O OXT  . LEU B 2 8  ? 2.543   10.154  5.196   1.00 0.00 ? 118 LEU B OXT  6  
ATOM 9110  H H    . LEU B 2 8  ? 0.634   6.869   5.713   1.00 0.00 ? 118 LEU B H    6  
ATOM 9111  H HA   . LEU B 2 8  ? 3.401   7.862   5.503   1.00 0.00 ? 118 LEU B HA   6  
ATOM 9112  H HB2  . LEU B 2 8  ? 1.613   7.061   3.212   1.00 0.00 ? 118 LEU B HB2  6  
ATOM 9113  H HB3  . LEU B 2 8  ? 3.307   7.502   3.126   1.00 0.00 ? 118 LEU B HB3  6  
ATOM 9114  H HG   . LEU B 2 8  ? 2.158   5.009   4.379   1.00 0.00 ? 118 LEU B HG   6  
ATOM 9115  H HD11 . LEU B 2 8  ? 2.266   5.093   1.894   1.00 0.00 ? 118 LEU B HD11 6  
ATOM 9116  H HD12 . LEU B 2 8  ? 3.271   3.837   2.615   1.00 0.00 ? 118 LEU B HD12 6  
ATOM 9117  H HD13 . LEU B 2 8  ? 4.009   5.325   2.025   1.00 0.00 ? 118 LEU B HD13 6  
ATOM 9118  H HD21 . LEU B 2 8  ? 4.921   6.168   4.415   1.00 0.00 ? 118 LEU B HD21 6  
ATOM 9119  H HD22 . LEU B 2 8  ? 4.656   4.429   4.531   1.00 0.00 ? 118 LEU B HD22 6  
ATOM 9120  H HD23 . LEU B 2 8  ? 3.975   5.508   5.749   1.00 0.00 ? 118 LEU B HD23 6  
ATOM 9121  N N    . LYS A 1 1  ? -6.418  -3.149  -13.970 1.00 0.00 ? 9   LYS A N    7  
ATOM 9122  C CA   . LYS A 1 1  ? -5.118  -3.091  -14.687 1.00 0.00 ? 9   LYS A CA   7  
ATOM 9123  C C    . LYS A 1 1  ? -4.093  -2.278  -13.904 1.00 0.00 ? 9   LYS A C    7  
ATOM 9124  O O    . LYS A 1 1  ? -4.431  -1.600  -12.936 1.00 0.00 ? 9   LYS A O    7  
ATOM 9125  C CB   . LYS A 1 1  ? -5.348  -2.470  -16.065 1.00 0.00 ? 9   LYS A CB   7  
ATOM 9126  C CG   . LYS A 1 1  ? -4.374  -2.957  -17.124 1.00 0.00 ? 9   LYS A CG   7  
ATOM 9127  C CD   . LYS A 1 1  ? -5.078  -3.259  -18.437 1.00 0.00 ? 9   LYS A CD   7  
ATOM 9128  C CE   . LYS A 1 1  ? -4.097  -3.313  -19.597 1.00 0.00 ? 9   LYS A CE   7  
ATOM 9129  N NZ   . LYS A 1 1  ? -3.746  -1.954  -20.092 1.00 0.00 ? 9   LYS A NZ   7  
ATOM 9130  H H1   . LYS A 1 1  ? -6.642  -2.188  -13.641 1.00 0.00 ? 9   LYS A H1   7  
ATOM 9131  H H2   . LYS A 1 1  ? -6.311  -3.804  -13.170 1.00 0.00 ? 9   LYS A H2   7  
ATOM 9132  H H3   . LYS A 1 1  ? -7.135  -3.489  -14.640 1.00 0.00 ? 9   LYS A H3   7  
ATOM 9133  H HA   . LYS A 1 1  ? -4.749  -4.099  -14.809 1.00 0.00 ? 9   LYS A HA   7  
ATOM 9134  H HB2  . LYS A 1 1  ? -6.351  -2.706  -16.392 1.00 0.00 ? 9   LYS A HB2  7  
ATOM 9135  H HB3  . LYS A 1 1  ? -5.249  -1.396  -15.983 1.00 0.00 ? 9   LYS A HB3  7  
ATOM 9136  H HG2  . LYS A 1 1  ? -3.629  -2.193  -17.294 1.00 0.00 ? 9   LYS A HG2  7  
ATOM 9137  H HG3  . LYS A 1 1  ? -3.893  -3.858  -16.768 1.00 0.00 ? 9   LYS A HG3  7  
ATOM 9138  H HD2  . LYS A 1 1  ? -5.577  -4.213  -18.356 1.00 0.00 ? 9   LYS A HD2  7  
ATOM 9139  H HD3  . LYS A 1 1  ? -5.807  -2.484  -18.630 1.00 0.00 ? 9   LYS A HD3  7  
ATOM 9140  H HE2  . LYS A 1 1  ? -3.196  -3.808  -19.266 1.00 0.00 ? 9   LYS A HE2  7  
ATOM 9141  H HE3  . LYS A 1 1  ? -4.543  -3.877  -20.402 1.00 0.00 ? 9   LYS A HE3  7  
ATOM 9142  H HZ1  . LYS A 1 1  ? -3.064  -2.023  -20.874 1.00 0.00 ? 9   LYS A HZ1  7  
ATOM 9143  H HZ2  . LYS A 1 1  ? -3.324  -1.391  -19.326 1.00 0.00 ? 9   LYS A HZ2  7  
ATOM 9144  H HZ3  . LYS A 1 1  ? -4.601  -1.467  -20.433 1.00 0.00 ? 9   LYS A HZ3  7  
ATOM 9145  N N    . GLU A 1 2  ? -2.837  -2.351  -14.332 1.00 0.00 ? 10  GLU A N    7  
ATOM 9146  C CA   . GLU A 1 2  ? -1.760  -1.620  -13.673 1.00 0.00 ? 10  GLU A CA   7  
ATOM 9147  C C    . GLU A 1 2  ? -2.022  -0.119  -13.704 1.00 0.00 ? 10  GLU A C    7  
ATOM 9148  O O    . GLU A 1 2  ? -2.214  0.465   -14.771 1.00 0.00 ? 10  GLU A O    7  
ATOM 9149  C CB   . GLU A 1 2  ? -0.419  -1.931  -14.342 1.00 0.00 ? 10  GLU A CB   7  
ATOM 9150  C CG   . GLU A 1 2  ? -0.222  -3.404  -14.663 1.00 0.00 ? 10  GLU A CG   7  
ATOM 9151  C CD   . GLU A 1 2  ? -0.451  -3.716  -16.129 1.00 0.00 ? 10  GLU A CD   7  
ATOM 9152  O OE1  . GLU A 1 2  ? 0.336   -3.232  -16.968 1.00 0.00 ? 10  GLU A OE1  7  
ATOM 9153  O OE2  . GLU A 1 2  ? -1.416  -4.447  -16.437 1.00 0.00 ? 10  GLU A OE2  7  
ATOM 9154  H H    . GLU A 1 2  ? -2.628  -2.908  -15.111 1.00 0.00 ? 10  GLU A H    7  
ATOM 9155  H HA   . GLU A 1 2  ? -1.722  -1.946  -12.644 1.00 0.00 ? 10  GLU A HA   7  
ATOM 9156  H HB2  . GLU A 1 2  ? -0.353  -1.372  -15.264 1.00 0.00 ? 10  GLU A HB2  7  
ATOM 9157  H HB3  . GLU A 1 2  ? 0.379   -1.618  -13.685 1.00 0.00 ? 10  GLU A HB3  7  
ATOM 9158  H HG2  . GLU A 1 2  ? 0.787   -3.684  -14.402 1.00 0.00 ? 10  GLU A HG2  7  
ATOM 9159  H HG3  . GLU A 1 2  ? -0.918  -3.982  -14.073 1.00 0.00 ? 10  GLU A HG3  7  
ATOM 9160  N N    . LYS A 1 3  ? -2.032  0.502   -12.529 1.00 0.00 ? 11  LYS A N    7  
ATOM 9161  C CA   . LYS A 1 3  ? -2.273  1.938   -12.428 1.00 0.00 ? 11  LYS A CA   7  
ATOM 9162  C C    . LYS A 1 3  ? -0.998  2.684   -12.038 1.00 0.00 ? 11  LYS A C    7  
ATOM 9163  O O    . LYS A 1 3  ? -0.066  2.100   -11.484 1.00 0.00 ? 11  LYS A O    7  
ATOM 9164  C CB   . LYS A 1 3  ? -3.381  2.221   -11.406 1.00 0.00 ? 11  LYS A CB   7  
ATOM 9165  C CG   . LYS A 1 3  ? -3.610  3.701   -11.141 1.00 0.00 ? 11  LYS A CG   7  
ATOM 9166  C CD   . LYS A 1 3  ? -4.934  3.943   -10.437 1.00 0.00 ? 11  LYS A CD   7  
ATOM 9167  C CE   . LYS A 1 3  ? -4.943  3.337   -9.041  1.00 0.00 ? 11  LYS A CE   7  
ATOM 9168  N NZ   . LYS A 1 3  ? -6.257  2.718   -8.712  1.00 0.00 ? 11  LYS A NZ   7  
ATOM 9169  H H    . LYS A 1 3  ? -1.873  -0.018  -11.711 1.00 0.00 ? 11  LYS A H    7  
ATOM 9170  H HA   . LYS A 1 3  ? -2.594  2.287   -13.397 1.00 0.00 ? 11  LYS A HA   7  
ATOM 9171  H HB2  . LYS A 1 3  ? -4.305  1.799   -11.772 1.00 0.00 ? 11  LYS A HB2  7  
ATOM 9172  H HB3  . LYS A 1 3  ? -3.124  1.745   -10.472 1.00 0.00 ? 11  LYS A HB3  7  
ATOM 9173  H HG2  . LYS A 1 3  ? -2.809  4.074   -10.518 1.00 0.00 ? 11  LYS A HG2  7  
ATOM 9174  H HG3  . LYS A 1 3  ? -3.612  4.231   -12.082 1.00 0.00 ? 11  LYS A HG3  7  
ATOM 9175  H HD2  . LYS A 1 3  ? -5.100  5.006   -10.356 1.00 0.00 ? 11  LYS A HD2  7  
ATOM 9176  H HD3  . LYS A 1 3  ? -5.727  3.497   -11.018 1.00 0.00 ? 11  LYS A HD3  7  
ATOM 9177  H HE2  . LYS A 1 3  ? -4.175  2.580   -8.988  1.00 0.00 ? 11  LYS A HE2  7  
ATOM 9178  H HE3  . LYS A 1 3  ? -4.729  4.115   -8.323  1.00 0.00 ? 11  LYS A HE3  7  
ATOM 9179  H HZ1  . LYS A 1 3  ? -6.301  1.750   -9.090  1.00 0.00 ? 11  LYS A HZ1  7  
ATOM 9180  H HZ2  . LYS A 1 3  ? -7.029  3.277   -9.128  1.00 0.00 ? 11  LYS A HZ2  7  
ATOM 9181  H HZ3  . LYS A 1 3  ? -6.387  2.683   -7.680  1.00 0.00 ? 11  LYS A HZ3  7  
ATOM 9182  N N    . LYS A 1 4  ? -0.967  3.979   -12.333 1.00 0.00 ? 12  LYS A N    7  
ATOM 9183  C CA   . LYS A 1 4  ? 0.189   4.809   -12.013 1.00 0.00 ? 12  LYS A CA   7  
ATOM 9184  C C    . LYS A 1 4  ? -0.213  5.967   -11.108 1.00 0.00 ? 12  LYS A C    7  
ATOM 9185  O O    . LYS A 1 4  ? -1.279  6.561   -11.280 1.00 0.00 ? 12  LYS A O    7  
ATOM 9186  C CB   . LYS A 1 4  ? 0.830   5.343   -13.296 1.00 0.00 ? 12  LYS A CB   7  
ATOM 9187  C CG   . LYS A 1 4  ? 2.350   5.373   -13.250 1.00 0.00 ? 12  LYS A CG   7  
ATOM 9188  C CD   . LYS A 1 4  ? 2.932   5.993   -14.509 1.00 0.00 ? 12  LYS A CD   7  
ATOM 9189  C CE   . LYS A 1 4  ? 4.386   6.396   -14.312 1.00 0.00 ? 12  LYS A CE   7  
ATOM 9190  N NZ   . LYS A 1 4  ? 4.685   7.718   -14.931 1.00 0.00 ? 12  LYS A NZ   7  
ATOM 9191  H H    . LYS A 1 4  ? -1.740  4.388   -12.774 1.00 0.00 ? 12  LYS A H    7  
ATOM 9192  H HA   . LYS A 1 4  ? 0.906   4.192   -11.493 1.00 0.00 ? 12  LYS A HA   7  
ATOM 9193  H HB2  . LYS A 1 4  ? 0.529   4.717   -14.123 1.00 0.00 ? 12  LYS A HB2  7  
ATOM 9194  H HB3  . LYS A 1 4  ? 0.477   6.350   -13.469 1.00 0.00 ? 12  LYS A HB3  7  
ATOM 9195  H HG2  . LYS A 1 4  ? 2.663   5.954   -12.396 1.00 0.00 ? 12  LYS A HG2  7  
ATOM 9196  H HG3  . LYS A 1 4  ? 2.716   4.361   -13.155 1.00 0.00 ? 12  LYS A HG3  7  
ATOM 9197  H HD2  . LYS A 1 4  ? 2.875   5.275   -15.313 1.00 0.00 ? 12  LYS A HD2  7  
ATOM 9198  H HD3  . LYS A 1 4  ? 2.357   6.871   -14.766 1.00 0.00 ? 12  LYS A HD3  7  
ATOM 9199  H HE2  . LYS A 1 4  ? 4.591   6.450   -13.253 1.00 0.00 ? 12  LYS A HE2  7  
ATOM 9200  H HE3  . LYS A 1 4  ? 5.018   5.645   -14.762 1.00 0.00 ? 12  LYS A HE3  7  
ATOM 9201  H HZ1  . LYS A 1 4  ? 5.354   8.246   -14.336 1.00 0.00 ? 12  LYS A HZ1  7  
ATOM 9202  H HZ2  . LYS A 1 4  ? 3.811   8.273   -15.028 1.00 0.00 ? 12  LYS A HZ2  7  
ATOM 9203  H HZ3  . LYS A 1 4  ? 5.105   7.583   -15.872 1.00 0.00 ? 12  LYS A HZ3  7  
ATOM 9204  N N    . VAL A 1 5  ? 0.640   6.283   -10.140 1.00 0.00 ? 13  VAL A N    7  
ATOM 9205  C CA   . VAL A 1 5  ? 0.365   7.369   -9.207  1.00 0.00 ? 13  VAL A CA   7  
ATOM 9206  C C    . VAL A 1 5  ? 1.647   8.091   -8.806  1.00 0.00 ? 13  VAL A C    7  
ATOM 9207  O O    . VAL A 1 5  ? 2.708   7.479   -8.688  1.00 0.00 ? 13  VAL A O    7  
ATOM 9208  C CB   . VAL A 1 5  ? -0.344  6.851   -7.941  1.00 0.00 ? 13  VAL A CB   7  
ATOM 9209  C CG1  . VAL A 1 5  ? -0.666  7.997   -6.993  1.00 0.00 ? 13  VAL A CG1  7  
ATOM 9210  C CG2  . VAL A 1 5  ? -1.608  6.091   -8.311  1.00 0.00 ? 13  VAL A CG2  7  
ATOM 9211  H H    . VAL A 1 5  ? 1.471   5.773   -10.049 1.00 0.00 ? 13  VAL A H    7  
ATOM 9212  H HA   . VAL A 1 5  ? -0.292  8.071   -9.699  1.00 0.00 ? 13  VAL A HA   7  
ATOM 9213  H HB   . VAL A 1 5  ? 0.323   6.169   -7.432  1.00 0.00 ? 13  VAL A HB   7  
ATOM 9214  H HG11 . VAL A 1 5  ? 0.090   8.050   -6.223  1.00 0.00 ? 13  VAL A HG11 7  
ATOM 9215  H HG12 . VAL A 1 5  ? -1.630  7.828   -6.540  1.00 0.00 ? 13  VAL A HG12 7  
ATOM 9216  H HG13 . VAL A 1 5  ? -0.683  8.925   -7.545  1.00 0.00 ? 13  VAL A HG13 7  
ATOM 9217  H HG21 . VAL A 1 5  ? -2.061  5.689   -7.418  1.00 0.00 ? 13  VAL A HG21 7  
ATOM 9218  H HG22 . VAL A 1 5  ? -1.359  5.283   -8.984  1.00 0.00 ? 13  VAL A HG22 7  
ATOM 9219  H HG23 . VAL A 1 5  ? -2.302  6.763   -8.795  1.00 0.00 ? 13  VAL A HG23 7  
ATOM 9220  N N    . PHE A 1 6  ? 1.539   9.400   -8.595  1.00 0.00 ? 14  PHE A N    7  
ATOM 9221  C CA   . PHE A 1 6  ? 2.685   10.212  -8.204  1.00 0.00 ? 14  PHE A CA   7  
ATOM 9222  C C    . PHE A 1 6  ? 2.403   10.947  -6.898  1.00 0.00 ? 14  PHE A C    7  
ATOM 9223  O O    . PHE A 1 6  ? 1.376   11.611  -6.757  1.00 0.00 ? 14  PHE A O    7  
ATOM 9224  C CB   . PHE A 1 6  ? 3.030   11.219  -9.304  1.00 0.00 ? 14  PHE A CB   7  
ATOM 9225  C CG   . PHE A 1 6  ? 2.819   10.693  -10.697 1.00 0.00 ? 14  PHE A CG   7  
ATOM 9226  C CD1  . PHE A 1 6  ? 3.301   9.447   -11.060 1.00 0.00 ? 14  PHE A CD1  7  
ATOM 9227  C CD2  . PHE A 1 6  ? 2.139   11.447  -11.640 1.00 0.00 ? 14  PHE A CD2  7  
ATOM 9228  C CE1  . PHE A 1 6  ? 3.110   8.961   -12.340 1.00 0.00 ? 14  PHE A CE1  7  
ATOM 9229  C CE2  . PHE A 1 6  ? 1.944   10.966  -12.921 1.00 0.00 ? 14  PHE A CE2  7  
ATOM 9230  C CZ   . PHE A 1 6  ? 2.429   9.722   -13.271 1.00 0.00 ? 14  PHE A CZ   7  
ATOM 9231  H H    . PHE A 1 6  ? 0.665   9.829   -8.703  1.00 0.00 ? 14  PHE A H    7  
ATOM 9232  H HA   . PHE A 1 6  ? 3.525   9.550   -8.057  1.00 0.00 ? 14  PHE A HA   7  
ATOM 9233  H HB2  . PHE A 1 6  ? 2.409   12.096  -9.186  1.00 0.00 ? 14  PHE A HB2  7  
ATOM 9234  H HB3  . PHE A 1 6  ? 4.066   11.505  -9.208  1.00 0.00 ? 14  PHE A HB3  7  
ATOM 9235  H HD1  . PHE A 1 6  ? 3.832   8.851   -10.333 1.00 0.00 ? 14  PHE A HD1  7  
ATOM 9236  H HD2  . PHE A 1 6  ? 1.759   12.421  -11.367 1.00 0.00 ? 14  PHE A HD2  7  
ATOM 9237  H HE1  . PHE A 1 6  ? 3.490   7.987   -12.611 1.00 0.00 ? 14  PHE A HE1  7  
ATOM 9238  H HE2  . PHE A 1 6  ? 1.412   11.562  -13.647 1.00 0.00 ? 14  PHE A HE2  7  
ATOM 9239  H HZ   . PHE A 1 6  ? 2.278   9.344   -14.271 1.00 0.00 ? 14  PHE A HZ   7  
ATOM 9240  N N    . ILE A 1 7  ? 3.321   10.827  -5.944  1.00 0.00 ? 15  ILE A N    7  
ATOM 9241  C CA   . ILE A 1 7  ? 3.166   11.483  -4.652  1.00 0.00 ? 15  ILE A CA   7  
ATOM 9242  C C    . ILE A 1 7  ? 4.309   12.460  -4.389  1.00 0.00 ? 15  ILE A C    7  
ATOM 9243  O O    . ILE A 1 7  ? 5.481   12.091  -4.451  1.00 0.00 ? 15  ILE A O    7  
ATOM 9244  C CB   . ILE A 1 7  ? 3.106   10.457  -3.503  1.00 0.00 ? 15  ILE A CB   7  
ATOM 9245  C CG1  . ILE A 1 7  ? 2.069   9.376   -3.812  1.00 0.00 ? 15  ILE A CG1  7  
ATOM 9246  C CG2  . ILE A 1 7  ? 2.783   11.150  -2.188  1.00 0.00 ? 15  ILE A CG2  7  
ATOM 9247  C CD1  . ILE A 1 7  ? 0.672   9.921   -4.019  1.00 0.00 ? 15  ILE A CD1  7  
ATOM 9248  H H    . ILE A 1 7  ? 4.121   10.286  -6.114  1.00 0.00 ? 15  ILE A H    7  
ATOM 9249  H HA   . ILE A 1 7  ? 2.234   12.031  -4.664  1.00 0.00 ? 15  ILE A HA   7  
ATOM 9250  H HB   . ILE A 1 7  ? 4.079   9.998   -3.410  1.00 0.00 ? 15  ILE A HB   7  
ATOM 9251  H HG12 . ILE A 1 7  ? 2.358   8.854   -4.712  1.00 0.00 ? 15  ILE A HG12 7  
ATOM 9252  H HG13 . ILE A 1 7  ? 2.035   8.675   -2.989  1.00 0.00 ? 15  ILE A HG13 7  
ATOM 9253  H HG21 . ILE A 1 7  ? 3.549   11.879  -1.968  1.00 0.00 ? 15  ILE A HG21 7  
ATOM 9254  H HG22 . ILE A 1 7  ? 2.744   10.417  -1.395  1.00 0.00 ? 15  ILE A HG22 7  
ATOM 9255  H HG23 . ILE A 1 7  ? 1.827   11.646  -2.268  1.00 0.00 ? 15  ILE A HG23 7  
ATOM 9256  H HD11 . ILE A 1 7  ? 0.653   10.968  -3.762  1.00 0.00 ? 15  ILE A HD11 7  
ATOM 9257  H HD12 . ILE A 1 7  ? -0.021  9.382   -3.392  1.00 0.00 ? 15  ILE A HD12 7  
ATOM 9258  H HD13 . ILE A 1 7  ? 0.389   9.799   -5.054  1.00 0.00 ? 15  ILE A HD13 7  
ATOM 9259  N N    . SER A 1 8  ? 3.955   13.707  -4.094  1.00 0.00 ? 16  SER A N    7  
ATOM 9260  C CA   . SER A 1 8  ? 4.949   14.739  -3.820  1.00 0.00 ? 16  SER A CA   7  
ATOM 9261  C C    . SER A 1 8  ? 4.616   15.484  -2.531  1.00 0.00 ? 16  SER A C    7  
ATOM 9262  O O    . SER A 1 8  ? 3.529   16.045  -2.389  1.00 0.00 ? 16  SER A O    7  
ATOM 9263  C CB   . SER A 1 8  ? 5.025   15.726  -4.987  1.00 0.00 ? 16  SER A CB   7  
ATOM 9264  O OG   . SER A 1 8  ? 3.731   16.122  -5.407  1.00 0.00 ? 16  SER A OG   7  
ATOM 9265  H H    . SER A 1 8  ? 3.004   13.938  -4.058  1.00 0.00 ? 16  SER A H    7  
ATOM 9266  H HA   . SER A 1 8  ? 5.906   14.256  -3.706  1.00 0.00 ? 16  SER A HA   7  
ATOM 9267  H HB2  . SER A 1 8  ? 5.574   16.602  -4.679  1.00 0.00 ? 16  SER A HB2  7  
ATOM 9268  H HB3  . SER A 1 8  ? 5.531   15.257  -5.818  1.00 0.00 ? 16  SER A HB3  7  
ATOM 9269  H HG   . SER A 1 8  ? 3.305   16.617  -4.704  1.00 0.00 ? 16  SER A HG   7  
ATOM 9270  N N    . LEU A 1 9  ? 5.558   15.485  -1.593  1.00 0.00 ? 17  LEU A N    7  
ATOM 9271  C CA   . LEU A 1 9  ? 5.364   16.161  -0.316  1.00 0.00 ? 17  LEU A CA   7  
ATOM 9272  C C    . LEU A 1 9  ? 5.108   17.652  -0.520  1.00 0.00 ? 17  LEU A C    7  
ATOM 9273  O O    . LEU A 1 9  ? 4.888   18.105  -1.642  1.00 0.00 ? 17  LEU A O    7  
ATOM 9274  C CB   . LEU A 1 9  ? 6.586   15.954  0.585   1.00 0.00 ? 17  LEU A CB   7  
ATOM 9275  C CG   . LEU A 1 9  ? 6.297   15.258  1.918   1.00 0.00 ? 17  LEU A CG   7  
ATOM 9276  C CD1  . LEU A 1 9  ? 6.663   13.784  1.840   1.00 0.00 ? 17  LEU A CD1  7  
ATOM 9277  C CD2  . LEU A 1 9  ? 7.052   15.937  3.050   1.00 0.00 ? 17  LEU A CD2  7  
ATOM 9278  H H    . LEU A 1 9  ? 6.403   15.020  -1.765  1.00 0.00 ? 17  LEU A H    7  
ATOM 9279  H HA   . LEU A 1 9  ? 4.499   15.723  0.161   1.00 0.00 ? 17  LEU A HA   7  
ATOM 9280  H HB2  . LEU A 1 9  ? 7.309   15.363  0.041   1.00 0.00 ? 17  LEU A HB2  7  
ATOM 9281  H HB3  . LEU A 1 9  ? 7.021   16.920  0.795   1.00 0.00 ? 17  LEU A HB3  7  
ATOM 9282  H HG   . LEU A 1 9  ? 5.240   15.328  2.130   1.00 0.00 ? 17  LEU A HG   7  
ATOM 9283  H HD11 . LEU A 1 9  ? 5.931   13.262  1.242   1.00 0.00 ? 17  LEU A HD11 7  
ATOM 9284  H HD12 . LEU A 1 9  ? 6.681   13.365  2.836   1.00 0.00 ? 17  LEU A HD12 7  
ATOM 9285  H HD13 . LEU A 1 9  ? 7.639   13.679  1.389   1.00 0.00 ? 17  LEU A HD13 7  
ATOM 9286  H HD21 . LEU A 1 9  ? 8.012   15.460  3.182   1.00 0.00 ? 17  LEU A HD21 7  
ATOM 9287  H HD22 . LEU A 1 9  ? 6.482   15.856  3.963   1.00 0.00 ? 17  LEU A HD22 7  
ATOM 9288  H HD23 . LEU A 1 9  ? 7.200   16.981  2.809   1.00 0.00 ? 17  LEU A HD23 7  
ATOM 9289  N N    . VAL A 1 10 ? 5.140   18.408  0.573   1.00 0.00 ? 18  VAL A N    7  
ATOM 9290  C CA   . VAL A 1 10 ? 4.912   19.847  0.515   1.00 0.00 ? 18  VAL A CA   7  
ATOM 9291  C C    . VAL A 1 10 ? 3.491   20.160  0.059   1.00 0.00 ? 18  VAL A C    7  
ATOM 9292  O O    . VAL A 1 10 ? 2.982   19.549  -0.882  1.00 0.00 ? 18  VAL A O    7  
ATOM 9293  C CB   . VAL A 1 10 ? 5.908   20.536  -0.436  1.00 0.00 ? 18  VAL A CB   7  
ATOM 9294  C CG1  . VAL A 1 10 ? 5.789   22.049  -0.328  1.00 0.00 ? 18  VAL A CG1  7  
ATOM 9295  C CG2  . VAL A 1 10 ? 7.330   20.083  -0.140  1.00 0.00 ? 18  VAL A CG2  7  
ATOM 9296  H H    . VAL A 1 10 ? 5.320   17.986  1.440   1.00 0.00 ? 18  VAL A H    7  
ATOM 9297  H HA   . VAL A 1 10 ? 5.058   20.247  1.508   1.00 0.00 ? 18  VAL A HA   7  
ATOM 9298  H HB   . VAL A 1 10 ? 5.666   20.250  -1.449  1.00 0.00 ? 18  VAL A HB   7  
ATOM 9299  H HG11 . VAL A 1 10 ? 5.402   22.311  0.646   1.00 0.00 ? 18  VAL A HG11 7  
ATOM 9300  H HG12 . VAL A 1 10 ? 5.118   22.412  -1.091  1.00 0.00 ? 18  VAL A HG12 7  
ATOM 9301  H HG13 . VAL A 1 10 ? 6.764   22.496  -0.462  1.00 0.00 ? 18  VAL A HG13 7  
ATOM 9302  H HG21 . VAL A 1 10 ? 8.016   20.600  -0.794  1.00 0.00 ? 18  VAL A HG21 7  
ATOM 9303  H HG22 . VAL A 1 10 ? 7.409   19.019  -0.304  1.00 0.00 ? 18  VAL A HG22 7  
ATOM 9304  H HG23 . VAL A 1 10 ? 7.573   20.308  0.889   1.00 0.00 ? 18  VAL A HG23 7  
ATOM 9305  N N    . GLY A 1 11 ? 2.855   21.113  0.731   1.00 0.00 ? 19  GLY A N    7  
ATOM 9306  C CA   . GLY A 1 11 ? 1.498   21.490  0.382   1.00 0.00 ? 19  GLY A CA   7  
ATOM 9307  C C    . GLY A 1 11 ? 0.517   21.232  1.509   1.00 0.00 ? 19  GLY A C    7  
ATOM 9308  O O    . GLY A 1 11 ? -0.390  22.029  1.746   1.00 0.00 ? 19  GLY A O    7  
ATOM 9309  H H    . GLY A 1 11 ? 3.311   21.564  1.472   1.00 0.00 ? 19  GLY A H    7  
ATOM 9310  H HA2  . GLY A 1 11 ? 1.480   22.541  0.137   1.00 0.00 ? 19  GLY A HA2  7  
ATOM 9311  H HA3  . GLY A 1 11 ? 1.190   20.924  -0.485  1.00 0.00 ? 19  GLY A HA3  7  
ATOM 9312  N N    . SER A 1 12 ? 0.701   20.113  2.205   1.00 0.00 ? 20  SER A N    7  
ATOM 9313  C CA   . SER A 1 12 ? -0.174  19.750  3.314   1.00 0.00 ? 20  SER A CA   7  
ATOM 9314  C C    . SER A 1 12 ? 0.527   18.780  4.260   1.00 0.00 ? 20  SER A C    7  
ATOM 9315  O O    . SER A 1 12 ? 0.812   19.117  5.410   1.00 0.00 ? 20  SER A O    7  
ATOM 9316  C CB   . SER A 1 12 ? -1.466  19.123  2.788   1.00 0.00 ? 20  SER A CB   7  
ATOM 9317  O OG   . SER A 1 12 ? -2.573  19.484  3.596   1.00 0.00 ? 20  SER A OG   7  
ATOM 9318  H H    . SER A 1 12 ? 1.444   19.520  1.967   1.00 0.00 ? 20  SER A H    7  
ATOM 9319  H HA   . SER A 1 12 ? -0.414  20.652  3.855   1.00 0.00 ? 20  SER A HA   7  
ATOM 9320  H HB2  . SER A 1 12 ? -1.645  19.465  1.780   1.00 0.00 ? 20  SER A HB2  7  
ATOM 9321  H HB3  . SER A 1 12 ? -1.369  18.048  2.793   1.00 0.00 ? 20  SER A HB3  7  
ATOM 9322  H HG   . SER A 1 12 ? -2.421  19.194  4.498   1.00 0.00 ? 20  SER A HG   7  
ATOM 9323  N N    . ARG A 1 13 ? 0.801   17.577  3.769   1.00 0.00 ? 21  ARG A N    7  
ATOM 9324  C CA   . ARG A 1 13 ? 1.470   16.559  4.569   1.00 0.00 ? 21  ARG A CA   7  
ATOM 9325  C C    . ARG A 1 13 ? 2.125   15.509  3.675   1.00 0.00 ? 21  ARG A C    7  
ATOM 9326  O O    . ARG A 1 13 ? 2.165   15.659  2.453   1.00 0.00 ? 21  ARG A O    7  
ATOM 9327  C CB   . ARG A 1 13 ? 0.472   15.894  5.521   1.00 0.00 ? 21  ARG A CB   7  
ATOM 9328  C CG   . ARG A 1 13 ? -0.731  15.287  4.819   1.00 0.00 ? 21  ARG A CG   7  
ATOM 9329  C CD   . ARG A 1 13 ? -0.459  13.857  4.383   1.00 0.00 ? 21  ARG A CD   7  
ATOM 9330  N NE   . ARG A 1 13 ? 0.094   13.048  5.466   1.00 0.00 ? 21  ARG A NE   7  
ATOM 9331  C CZ   . ARG A 1 13 ? -0.628  12.572  6.478   1.00 0.00 ? 21  ARG A CZ   7  
ATOM 9332  N NH1  . ARG A 1 13 ? -1.930  12.822  6.549   1.00 0.00 ? 21  ARG A NH1  7  
ATOM 9333  N NH2  . ARG A 1 13 ? -0.046  11.844  7.423   1.00 0.00 ? 21  ARG A NH2  7  
ATOM 9334  H H    . ARG A 1 13 ? 0.549   17.370  2.845   1.00 0.00 ? 21  ARG A H    7  
ATOM 9335  H HA   . ARG A 1 13 ? 2.236   17.047  5.151   1.00 0.00 ? 21  ARG A HA   7  
ATOM 9336  H HB2  . ARG A 1 13 ? 0.977   15.112  6.067   1.00 0.00 ? 21  ARG A HB2  7  
ATOM 9337  H HB3  . ARG A 1 13 ? 0.115   16.634  6.222   1.00 0.00 ? 21  ARG A HB3  7  
ATOM 9338  H HG2  . ARG A 1 13 ? -1.571  15.292  5.494   1.00 0.00 ? 21  ARG A HG2  7  
ATOM 9339  H HG3  . ARG A 1 13 ? -0.964  15.882  3.946   1.00 0.00 ? 21  ARG A HG3  7  
ATOM 9340  H HD2  . ARG A 1 13 ? -1.387  13.414  4.053   1.00 0.00 ? 21  ARG A HD2  7  
ATOM 9341  H HD3  . ARG A 1 13 ? 0.243   13.872  3.562   1.00 0.00 ? 21  ARG A HD3  7  
ATOM 9342  H HE   . ARG A 1 13 ? 1.053   12.849  5.439   1.00 0.00 ? 21  ARG A HE   7  
ATOM 9343  H HH11 . ARG A 1 13 ? -2.375  13.368  5.842   1.00 0.00 ? 21  ARG A HH11 7  
ATOM 9344  H HH12 . ARG A 1 13 ? -2.465  12.460  7.313   1.00 0.00 ? 21  ARG A HH12 7  
ATOM 9345  H HH21 . ARG A 1 13 ? 0.935   11.653  7.373   1.00 0.00 ? 21  ARG A HH21 7  
ATOM 9346  H HH22 . ARG A 1 13 ? -0.587  11.486  8.183   1.00 0.00 ? 21  ARG A HH22 7  
ATOM 9347  N N    . GLY A 1 14 ? 2.641   14.449  4.290   1.00 0.00 ? 22  GLY A N    7  
ATOM 9348  C CA   . GLY A 1 14 ? 3.293   13.391  3.538   1.00 0.00 ? 22  GLY A CA   7  
ATOM 9349  C C    . GLY A 1 14 ? 2.480   12.924  2.343   1.00 0.00 ? 22  GLY A C    7  
ATOM 9350  O O    . GLY A 1 14 ? 2.789   13.269  1.203   1.00 0.00 ? 22  GLY A O    7  
ATOM 9351  H H    . GLY A 1 14 ? 2.582   14.386  5.266   1.00 0.00 ? 22  GLY A H    7  
ATOM 9352  H HA2  . GLY A 1 14 ? 4.248   13.751  3.188   1.00 0.00 ? 22  GLY A HA2  7  
ATOM 9353  H HA3  . GLY A 1 14 ? 3.460   12.549  4.195   1.00 0.00 ? 22  GLY A HA3  7  
ATOM 9354  N N    . LEU A 1 15 ? 1.445   12.132  2.604   1.00 0.00 ? 23  LEU A N    7  
ATOM 9355  C CA   . LEU A 1 15 ? 0.594   11.612  1.543   1.00 0.00 ? 23  LEU A CA   7  
ATOM 9356  C C    . LEU A 1 15 ? -0.872  11.604  1.976   1.00 0.00 ? 23  LEU A C    7  
ATOM 9357  O O    . LEU A 1 15 ? -1.758  11.975  1.207   1.00 0.00 ? 23  LEU A O    7  
ATOM 9358  C CB   . LEU A 1 15 ? 1.047   10.199  1.161   1.00 0.00 ? 23  LEU A CB   7  
ATOM 9359  C CG   . LEU A 1 15 ? 0.005   9.339   0.442   1.00 0.00 ? 23  LEU A CG   7  
ATOM 9360  C CD1  . LEU A 1 15 ? -0.257  9.875   -0.957  1.00 0.00 ? 23  LEU A CD1  7  
ATOM 9361  C CD2  . LEU A 1 15 ? 0.465   7.890   0.382   1.00 0.00 ? 23  LEU A CD2  7  
ATOM 9362  H H    . LEU A 1 15 ? 1.253   11.886  3.532   1.00 0.00 ? 23  LEU A H    7  
ATOM 9363  H HA   . LEU A 1 15 ? 0.700   12.260  0.685   1.00 0.00 ? 23  LEU A HA   7  
ATOM 9364  H HB2  . LEU A 1 15 ? 1.914   10.284  0.523   1.00 0.00 ? 23  LEU A HB2  7  
ATOM 9365  H HB3  . LEU A 1 15 ? 1.336   9.688   2.063   1.00 0.00 ? 23  LEU A HB3  7  
ATOM 9366  H HG   . LEU A 1 15 ? -0.921  9.375   0.993   1.00 0.00 ? 23  LEU A HG   7  
ATOM 9367  H HD11 . LEU A 1 15 ? 0.662   9.863   -1.524  1.00 0.00 ? 23  LEU A HD11 7  
ATOM 9368  H HD12 . LEU A 1 15 ? -0.625  10.888  -0.891  1.00 0.00 ? 23  LEU A HD12 7  
ATOM 9369  H HD13 . LEU A 1 15 ? -0.992  9.254   -1.447  1.00 0.00 ? 23  LEU A HD13 7  
ATOM 9370  H HD21 . LEU A 1 15 ? 1.539   7.857   0.262   1.00 0.00 ? 23  LEU A HD21 7  
ATOM 9371  H HD22 . LEU A 1 15 ? -0.006  7.396   -0.454  1.00 0.00 ? 23  LEU A HD22 7  
ATOM 9372  H HD23 . LEU A 1 15 ? 0.190   7.388   1.298   1.00 0.00 ? 23  LEU A HD23 7  
ATOM 9373  N N    . GLY A 1 16 ? -1.119  11.169  3.209   1.00 0.00 ? 24  GLY A N    7  
ATOM 9374  C CA   . GLY A 1 16 ? -2.478  11.113  3.718   1.00 0.00 ? 24  GLY A CA   7  
ATOM 9375  C C    . GLY A 1 16 ? -3.102  9.742   3.549   1.00 0.00 ? 24  GLY A C    7  
ATOM 9376  O O    . GLY A 1 16 ? -4.324  9.599   3.598   1.00 0.00 ? 24  GLY A O    7  
ATOM 9377  H H    . GLY A 1 16 ? -0.373  10.879  3.774   1.00 0.00 ? 24  GLY A H    7  
ATOM 9378  H HA2  . GLY A 1 16 ? -2.467  11.367  4.767   1.00 0.00 ? 24  GLY A HA2  7  
ATOM 9379  H HA3  . GLY A 1 16 ? -3.078  11.836  3.190   1.00 0.00 ? 24  GLY A HA3  7  
ATOM 9380  N N    . CYS A 1 17 ? -2.262  8.733   3.347   1.00 0.00 ? 25  CYS A N    7  
ATOM 9381  C CA   . CYS A 1 17 ? -2.734  7.366   3.168   1.00 0.00 ? 25  CYS A CA   7  
ATOM 9382  C C    . CYS A 1 17 ? -1.830  6.387   3.909   1.00 0.00 ? 25  CYS A C    7  
ATOM 9383  O O    . CYS A 1 17 ? -0.679  6.700   4.212   1.00 0.00 ? 25  CYS A O    7  
ATOM 9384  C CB   . CYS A 1 17 ? -2.781  7.018   1.678   1.00 0.00 ? 25  CYS A CB   7  
ATOM 9385  S SG   . CYS A 1 17 ? -3.335  5.335   1.324   1.00 0.00 ? 25  CYS A SG   7  
ATOM 9386  H H    . CYS A 1 17 ? -1.299  8.910   3.319   1.00 0.00 ? 25  CYS A H    7  
ATOM 9387  H HA   . CYS A 1 17 ? -3.730  7.300   3.576   1.00 0.00 ? 25  CYS A HA   7  
ATOM 9388  H HB2  . CYS A 1 17 ? -3.458  7.696   1.181   1.00 0.00 ? 25  CYS A HB2  7  
ATOM 9389  H HB3  . CYS A 1 17 ? -1.794  7.135   1.260   1.00 0.00 ? 25  CYS A HB3  7  
ATOM 9390  H HG   . CYS A 1 17 ? -2.644  4.731   1.604   1.00 0.00 ? 25  CYS A HG   7  
ATOM 9391  N N    . SER A 1 18 ? -2.355  5.203   4.203   1.00 0.00 ? 26  SER A N    7  
ATOM 9392  C CA   . SER A 1 18 ? -1.588  4.186   4.914   1.00 0.00 ? 26  SER A CA   7  
ATOM 9393  C C    . SER A 1 18 ? -1.341  2.972   4.025   1.00 0.00 ? 26  SER A C    7  
ATOM 9394  O O    . SER A 1 18 ? -1.864  2.889   2.914   1.00 0.00 ? 26  SER A O    7  
ATOM 9395  C CB   . SER A 1 18 ? -2.322  3.764   6.188   1.00 0.00 ? 26  SER A CB   7  
ATOM 9396  O OG   . SER A 1 18 ? -1.483  3.882   7.325   1.00 0.00 ? 26  SER A OG   7  
ATOM 9397  H H    . SER A 1 18 ? -3.280  5.009   3.941   1.00 0.00 ? 26  SER A H    7  
ATOM 9398  H HA   . SER A 1 18 ? -0.635  4.618   5.184   1.00 0.00 ? 26  SER A HA   7  
ATOM 9399  H HB2  . SER A 1 18 ? -3.187  4.395   6.329   1.00 0.00 ? 26  SER A HB2  7  
ATOM 9400  H HB3  . SER A 1 18 ? -2.640  2.735   6.097   1.00 0.00 ? 26  SER A HB3  7  
ATOM 9401  H HG   . SER A 1 18 ? -1.906  4.443   7.978   1.00 0.00 ? 26  SER A HG   7  
ATOM 9402  N N    . ILE A 1 19 ? -0.539  2.036   4.519   1.00 0.00 ? 27  ILE A N    7  
ATOM 9403  C CA   . ILE A 1 19 ? -0.222  0.826   3.769   1.00 0.00 ? 27  ILE A CA   7  
ATOM 9404  C C    . ILE A 1 19 ? -0.112  -0.375  4.700   1.00 0.00 ? 27  ILE A C    7  
ATOM 9405  O O    . ILE A 1 19 ? 0.209   -0.229  5.879   1.00 0.00 ? 27  ILE A O    7  
ATOM 9406  C CB   . ILE A 1 19 ? 1.095   0.979   2.983   1.00 0.00 ? 27  ILE A CB   7  
ATOM 9407  C CG1  . ILE A 1 19 ? 2.191   1.545   3.885   1.00 0.00 ? 27  ILE A CG1  7  
ATOM 9408  C CG2  . ILE A 1 19 ? 0.887   1.869   1.767   1.00 0.00 ? 27  ILE A CG2  7  
ATOM 9409  C CD1  . ILE A 1 19 ? 3.576   1.462   3.280   1.00 0.00 ? 27  ILE A CD1  7  
ATOM 9410  H H    . ILE A 1 19 ? -0.150  2.161   5.409   1.00 0.00 ? 27  ILE A H    7  
ATOM 9411  H HA   . ILE A 1 19 ? -1.021  0.652   3.063   1.00 0.00 ? 27  ILE A HA   7  
ATOM 9412  H HB   . ILE A 1 19 ? 1.395   0.002   2.633   1.00 0.00 ? 27  ILE A HB   7  
ATOM 9413  H HG12 . ILE A 1 19 ? 1.980   2.584   4.088   1.00 0.00 ? 27  ILE A HG12 7  
ATOM 9414  H HG13 . ILE A 1 19 ? 2.201   0.998   4.816   1.00 0.00 ? 27  ILE A HG13 7  
ATOM 9415  H HG21 . ILE A 1 19 ? 0.784   2.896   2.088   1.00 0.00 ? 27  ILE A HG21 7  
ATOM 9416  H HG22 . ILE A 1 19 ? -0.008  1.564   1.246   1.00 0.00 ? 27  ILE A HG22 7  
ATOM 9417  H HG23 . ILE A 1 19 ? 1.737   1.782   1.107   1.00 0.00 ? 27  ILE A HG23 7  
ATOM 9418  H HD11 . ILE A 1 19 ? 3.511   1.035   2.291   1.00 0.00 ? 27  ILE A HD11 7  
ATOM 9419  H HD12 . ILE A 1 19 ? 4.204   0.840   3.902   1.00 0.00 ? 27  ILE A HD12 7  
ATOM 9420  H HD13 . ILE A 1 19 ? 4.002   2.453   3.218   1.00 0.00 ? 27  ILE A HD13 7  
ATOM 9421  N N    . SER A 1 20 ? -0.384  -1.562  4.167   1.00 0.00 ? 28  SER A N    7  
ATOM 9422  C CA   . SER A 1 20 ? -0.319  -2.785  4.961   1.00 0.00 ? 28  SER A CA   7  
ATOM 9423  C C    . SER A 1 20 ? 0.380   -3.904  4.196   1.00 0.00 ? 28  SER A C    7  
ATOM 9424  O O    . SER A 1 20 ? 0.483   -3.864  2.971   1.00 0.00 ? 28  SER A O    7  
ATOM 9425  C CB   . SER A 1 20 ? -1.727  -3.230  5.362   1.00 0.00 ? 28  SER A CB   7  
ATOM 9426  O OG   . SER A 1 20 ? -2.534  -3.456  4.219   1.00 0.00 ? 28  SER A OG   7  
ATOM 9427  H H    . SER A 1 20 ? -0.638  -1.617  3.221   1.00 0.00 ? 28  SER A H    7  
ATOM 9428  H HA   . SER A 1 20 ? 0.247   -2.568  5.854   1.00 0.00 ? 28  SER A HA   7  
ATOM 9429  H HB2  . SER A 1 20 ? -1.664  -4.146  5.931   1.00 0.00 ? 28  SER A HB2  7  
ATOM 9430  H HB3  . SER A 1 20 ? -2.186  -2.462  5.966   1.00 0.00 ? 28  SER A HB3  7  
ATOM 9431  H HG   . SER A 1 20 ? -2.038  -3.959  3.570   1.00 0.00 ? 28  SER A HG   7  
ATOM 9432  N N    . SER A 1 21 ? 0.855   -4.905  4.933   1.00 0.00 ? 29  SER A N    7  
ATOM 9433  C CA   . SER A 1 21 ? 1.539   -6.042  4.332   1.00 0.00 ? 29  SER A CA   7  
ATOM 9434  C C    . SER A 1 21 ? 0.641   -7.274  4.334   1.00 0.00 ? 29  SER A C    7  
ATOM 9435  O O    . SER A 1 21 ? -0.269  -7.388  5.157   1.00 0.00 ? 29  SER A O    7  
ATOM 9436  C CB   . SER A 1 21 ? 2.838   -6.341  5.084   1.00 0.00 ? 29  SER A CB   7  
ATOM 9437  O OG   . SER A 1 21 ? 3.917   -5.585  4.561   1.00 0.00 ? 29  SER A OG   7  
ATOM 9438  H H    . SER A 1 21 ? 0.737   -4.878  5.905   1.00 0.00 ? 29  SER A H    7  
ATOM 9439  H HA   . SER A 1 21 ? 1.777   -5.784  3.309   1.00 0.00 ? 29  SER A HA   7  
ATOM 9440  H HB2  . SER A 1 21 ? 2.713   -6.091  6.127   1.00 0.00 ? 29  SER A HB2  7  
ATOM 9441  H HB3  . SER A 1 21 ? 3.071   -7.391  4.992   1.00 0.00 ? 29  SER A HB3  7  
ATOM 9442  H HG   . SER A 1 21 ? 4.138   -5.907  3.684   1.00 0.00 ? 29  SER A HG   7  
ATOM 9443  N N    . GLY A 1 22 ? 0.895   -8.193  3.409   1.00 0.00 ? 30  GLY A N    7  
ATOM 9444  C CA   . GLY A 1 22 ? 0.092   -9.398  3.325   1.00 0.00 ? 30  GLY A CA   7  
ATOM 9445  C C    . GLY A 1 22 ? 0.809   -10.623 3.860   1.00 0.00 ? 30  GLY A C    7  
ATOM 9446  O O    . GLY A 1 22 ? 1.834   -10.501 4.533   1.00 0.00 ? 30  GLY A O    7  
ATOM 9447  H H    . GLY A 1 22 ? 1.629   -8.048  2.776   1.00 0.00 ? 30  GLY A H    7  
ATOM 9448  H HA2  . GLY A 1 22 ? -0.815  -9.252  3.893   1.00 0.00 ? 30  GLY A HA2  7  
ATOM 9449  H HA3  . GLY A 1 22 ? -0.168  -9.572  2.291   1.00 0.00 ? 30  GLY A HA3  7  
ATOM 9450  N N    . PRO A 1 23 ? 0.287   -11.827 3.575   1.00 0.00 ? 31  PRO A N    7  
ATOM 9451  C CA   . PRO A 1 23 ? 0.889   -13.082 4.038   1.00 0.00 ? 31  PRO A CA   7  
ATOM 9452  C C    . PRO A 1 23 ? 2.203   -13.392 3.327   1.00 0.00 ? 31  PRO A C    7  
ATOM 9453  O O    . PRO A 1 23 ? 2.802   -12.521 2.697   1.00 0.00 ? 31  PRO A O    7  
ATOM 9454  C CB   . PRO A 1 23 ? -0.170  -14.130 3.691   1.00 0.00 ? 31  PRO A CB   7  
ATOM 9455  C CG   . PRO A 1 23 ? -0.921  -13.544 2.547   1.00 0.00 ? 31  PRO A CG   7  
ATOM 9456  C CD   . PRO A 1 23 ? -0.933  -12.060 2.779   1.00 0.00 ? 31  PRO A CD   7  
ATOM 9457  H HA   . PRO A 1 23 ? 1.053   -13.071 5.105   1.00 0.00 ? 31  PRO A HA   7  
ATOM 9458  H HB2  . PRO A 1 23 ? 0.310   -15.056 3.415   1.00 0.00 ? 31  PRO A HB2  7  
ATOM 9459  H HB3  . PRO A 1 23 ? -0.814  -14.291 4.542   1.00 0.00 ? 31  PRO A HB3  7  
ATOM 9460  H HG2  . PRO A 1 23 ? -0.417  -13.775 1.619   1.00 0.00 ? 31  PRO A HG2  7  
ATOM 9461  H HG3  . PRO A 1 23 ? -1.930  -13.930 2.533   1.00 0.00 ? 31  PRO A HG3  7  
ATOM 9462  H HD2  . PRO A 1 23 ? -0.889  -11.530 1.839   1.00 0.00 ? 31  PRO A HD2  7  
ATOM 9463  H HD3  . PRO A 1 23 ? -1.815  -11.772 3.333   1.00 0.00 ? 31  PRO A HD3  7  
ATOM 9464  N N    . ILE A 1 24 ? 2.647   -14.640 3.436   1.00 0.00 ? 32  ILE A N    7  
ATOM 9465  C CA   . ILE A 1 24 ? 3.891   -15.069 2.808   1.00 0.00 ? 32  ILE A CA   7  
ATOM 9466  C C    . ILE A 1 24 ? 3.646   -15.590 1.395   1.00 0.00 ? 32  ILE A C    7  
ATOM 9467  O O    . ILE A 1 24 ? 4.549   -15.588 0.559   1.00 0.00 ? 32  ILE A O    7  
ATOM 9468  C CB   . ILE A 1 24 ? 4.589   -16.169 3.633   1.00 0.00 ? 32  ILE A CB   7  
ATOM 9469  C CG1  . ILE A 1 24 ? 4.656   -15.767 5.109   1.00 0.00 ? 32  ILE A CG1  7  
ATOM 9470  C CG2  . ILE A 1 24 ? 5.981   -16.438 3.085   1.00 0.00 ? 32  ILE A CG2  7  
ATOM 9471  C CD1  . ILE A 1 24 ? 3.693   -16.533 5.988   1.00 0.00 ? 32  ILE A CD1  7  
ATOM 9472  H H    . ILE A 1 24 ? 2.125   -15.288 3.952   1.00 0.00 ? 32  ILE A H    7  
ATOM 9473  H HA   . ILE A 1 24 ? 4.550   -14.215 2.756   1.00 0.00 ? 32  ILE A HA   7  
ATOM 9474  H HB   . ILE A 1 24 ? 4.011   -17.077 3.542   1.00 0.00 ? 32  ILE A HB   7  
ATOM 9475  H HG12 . ILE A 1 24 ? 5.655   -15.945 5.479   1.00 0.00 ? 32  ILE A HG12 7  
ATOM 9476  H HG13 . ILE A 1 24 ? 4.425   -14.716 5.200   1.00 0.00 ? 32  ILE A HG13 7  
ATOM 9477  H HG21 . ILE A 1 24 ? 6.340   -15.562 2.567   1.00 0.00 ? 32  ILE A HG21 7  
ATOM 9478  H HG22 . ILE A 1 24 ? 5.942   -17.271 2.398   1.00 0.00 ? 32  ILE A HG22 7  
ATOM 9479  H HG23 . ILE A 1 24 ? 6.649   -16.675 3.899   1.00 0.00 ? 32  ILE A HG23 7  
ATOM 9480  H HD11 . ILE A 1 24 ? 3.748   -16.153 6.998   1.00 0.00 ? 32  ILE A HD11 7  
ATOM 9481  H HD12 . ILE A 1 24 ? 3.957   -17.581 5.984   1.00 0.00 ? 32  ILE A HD12 7  
ATOM 9482  H HD13 . ILE A 1 24 ? 2.688   -16.414 5.612   1.00 0.00 ? 32  ILE A HD13 7  
ATOM 9483  N N    . GLN A 1 25 ? 2.423   -16.040 1.136   1.00 0.00 ? 33  GLN A N    7  
ATOM 9484  C CA   . GLN A 1 25 ? 2.064   -16.564 -0.176  1.00 0.00 ? 33  GLN A CA   7  
ATOM 9485  C C    . GLN A 1 25 ? 1.931   -15.437 -1.196  1.00 0.00 ? 33  GLN A C    7  
ATOM 9486  O O    . GLN A 1 25 ? 2.165   -15.635 -2.388  1.00 0.00 ? 33  GLN A O    7  
ATOM 9487  C CB   . GLN A 1 25 ? 0.755   -17.351 -0.092  1.00 0.00 ? 33  GLN A CB   7  
ATOM 9488  C CG   . GLN A 1 25 ? 0.903   -18.710 0.571   1.00 0.00 ? 33  GLN A CG   7  
ATOM 9489  C CD   . GLN A 1 25 ? -0.235  -19.023 1.520   1.00 0.00 ? 33  GLN A CD   7  
ATOM 9490  O OE1  . GLN A 1 25 ? -1.401  -19.050 1.123   1.00 0.00 ? 33  GLN A OE1  7  
ATOM 9491  N NE2  . GLN A 1 25 ? 0.096   -19.261 2.783   1.00 0.00 ? 33  GLN A NE2  7  
ATOM 9492  H H    . GLN A 1 25 ? 1.745   -16.020 1.843   1.00 0.00 ? 33  GLN A H    7  
ATOM 9493  H HA   . GLN A 1 25 ? 2.853   -17.228 -0.494  1.00 0.00 ? 33  GLN A HA   7  
ATOM 9494  H HB2  . GLN A 1 25 ? 0.037   -16.774 0.472   1.00 0.00 ? 33  GLN A HB2  7  
ATOM 9495  H HB3  . GLN A 1 25 ? 0.375   -17.502 -1.092  1.00 0.00 ? 33  GLN A HB3  7  
ATOM 9496  H HG2  . GLN A 1 25 ? 0.932   -19.470 -0.195  1.00 0.00 ? 33  GLN A HG2  7  
ATOM 9497  H HG3  . GLN A 1 25 ? 1.830   -18.726 1.127   1.00 0.00 ? 33  GLN A HG3  7  
ATOM 9498  H HE21 . GLN A 1 25 ? 1.044   -19.222 3.028   1.00 0.00 ? 33  GLN A HE21 7  
ATOM 9499  H HE22 . GLN A 1 25 ? -0.621  -19.466 3.420   1.00 0.00 ? 33  GLN A HE22 7  
ATOM 9500  N N    . LYS A 1 26 ? 1.552   -14.256 -0.720  1.00 0.00 ? 34  LYS A N    7  
ATOM 9501  C CA   . LYS A 1 26 ? 1.387   -13.098 -1.591  1.00 0.00 ? 34  LYS A CA   7  
ATOM 9502  C C    . LYS A 1 26 ? 1.751   -11.806 -0.856  1.00 0.00 ? 34  LYS A C    7  
ATOM 9503  O O    . LYS A 1 26 ? 0.906   -10.934 -0.653  1.00 0.00 ? 34  LYS A O    7  
ATOM 9504  C CB   . LYS A 1 26 ? -0.053  -13.030 -2.110  1.00 0.00 ? 34  LYS A CB   7  
ATOM 9505  C CG   . LYS A 1 26 ? -0.152  -13.036 -3.627  1.00 0.00 ? 34  LYS A CG   7  
ATOM 9506  C CD   . LYS A 1 26 ? -1.388  -13.785 -4.100  1.00 0.00 ? 34  LYS A CD   7  
ATOM 9507  C CE   . LYS A 1 26 ? -2.083  -13.052 -5.236  1.00 0.00 ? 34  LYS A CE   7  
ATOM 9508  N NZ   . LYS A 1 26 ? -3.042  -13.932 -5.963  1.00 0.00 ? 34  LYS A NZ   7  
ATOM 9509  H H    . LYS A 1 26 ? 1.379   -14.159 0.240   1.00 0.00 ? 34  LYS A H    7  
ATOM 9510  H HA   . LYS A 1 26 ? 2.056   -13.220 -2.430  1.00 0.00 ? 34  LYS A HA   7  
ATOM 9511  H HB2  . LYS A 1 26 ? -0.599  -13.882 -1.733  1.00 0.00 ? 34  LYS A HB2  7  
ATOM 9512  H HB3  . LYS A 1 26 ? -0.517  -12.126 -1.745  1.00 0.00 ? 34  LYS A HB3  7  
ATOM 9513  H HG2  . LYS A 1 26 ? -0.204  -12.017 -3.979  1.00 0.00 ? 34  LYS A HG2  7  
ATOM 9514  H HG3  . LYS A 1 26 ? 0.726   -13.516 -4.035  1.00 0.00 ? 34  LYS A HG3  7  
ATOM 9515  H HD2  . LYS A 1 26 ? -1.094  -14.765 -4.445  1.00 0.00 ? 34  LYS A HD2  7  
ATOM 9516  H HD3  . LYS A 1 26 ? -2.077  -13.883 -3.273  1.00 0.00 ? 34  LYS A HD3  7  
ATOM 9517  H HE2  . LYS A 1 26 ? -2.621  -12.209 -4.830  1.00 0.00 ? 34  LYS A HE2  7  
ATOM 9518  H HE3  . LYS A 1 26 ? -1.336  -12.699 -5.932  1.00 0.00 ? 34  LYS A HE3  7  
ATOM 9519  H HZ1  . LYS A 1 26 ? -2.660  -14.897 -6.028  1.00 0.00 ? 34  LYS A HZ1  7  
ATOM 9520  H HZ2  . LYS A 1 26 ? -3.204  -13.569 -6.924  1.00 0.00 ? 34  LYS A HZ2  7  
ATOM 9521  H HZ3  . LYS A 1 26 ? -3.950  -13.962 -5.458  1.00 0.00 ? 34  LYS A HZ3  7  
ATOM 9522  N N    . PRO A 1 27 ? 3.023   -11.670 -0.444  1.00 0.00 ? 35  PRO A N    7  
ATOM 9523  C CA   . PRO A 1 27 ? 3.497   -10.481 0.271   1.00 0.00 ? 35  PRO A CA   7  
ATOM 9524  C C    . PRO A 1 27 ? 3.633   -9.270  -0.645  1.00 0.00 ? 35  PRO A C    7  
ATOM 9525  O O    . PRO A 1 27 ? 4.065   -9.391  -1.791  1.00 0.00 ? 35  PRO A O    7  
ATOM 9526  C CB   . PRO A 1 27 ? 4.867   -10.911 0.797   1.00 0.00 ? 35  PRO A CB   7  
ATOM 9527  C CG   . PRO A 1 27 ? 5.333   -11.943 -0.170  1.00 0.00 ? 35  PRO A CG   7  
ATOM 9528  C CD   . PRO A 1 27 ? 4.098   -12.663 -0.642  1.00 0.00 ? 35  PRO A CD   7  
ATOM 9529  H HA   . PRO A 1 27 ? 2.852   -10.235 1.101   1.00 0.00 ? 35  PRO A HA   7  
ATOM 9530  H HB2  . PRO A 1 27 ? 5.531   -10.059 0.818   1.00 0.00 ? 35  PRO A HB2  7  
ATOM 9531  H HB3  . PRO A 1 27 ? 4.764   -11.319 1.791   1.00 0.00 ? 35  PRO A HB3  7  
ATOM 9532  H HG2  . PRO A 1 27 ? 5.831   -11.468 -1.003  1.00 0.00 ? 35  PRO A HG2  7  
ATOM 9533  H HG3  . PRO A 1 27 ? 6.002   -12.633 0.324   1.00 0.00 ? 35  PRO A HG3  7  
ATOM 9534  H HD2  . PRO A 1 27 ? 4.190   -12.927 -1.684  1.00 0.00 ? 35  PRO A HD2  7  
ATOM 9535  H HD3  . PRO A 1 27 ? 3.922   -13.543 -0.041  1.00 0.00 ? 35  PRO A HD3  7  
ATOM 9536  N N    . GLY A 1 28 ? 3.263   -8.102  -0.131  1.00 0.00 ? 36  GLY A N    7  
ATOM 9537  C CA   . GLY A 1 28 ? 3.351   -6.886  -0.917  1.00 0.00 ? 36  GLY A CA   7  
ATOM 9538  C C    . GLY A 1 28 ? 2.829   -5.673  -0.172  1.00 0.00 ? 36  GLY A C    7  
ATOM 9539  O O    . GLY A 1 28 ? 2.148   -5.805  0.846   1.00 0.00 ? 36  GLY A O    7  
ATOM 9540  H H    . GLY A 1 28 ? 2.927   -8.065  0.789   1.00 0.00 ? 36  GLY A H    7  
ATOM 9541  H HA2  . GLY A 1 28 ? 4.384   -6.715  -1.181  1.00 0.00 ? 36  GLY A HA2  7  
ATOM 9542  H HA3  . GLY A 1 28 ? 2.776   -7.013  -1.823  1.00 0.00 ? 36  GLY A HA3  7  
ATOM 9543  N N    . ILE A 1 29 ? 3.149   -4.487  -0.680  1.00 0.00 ? 37  ILE A N    7  
ATOM 9544  C CA   . ILE A 1 29 ? 2.710   -3.244  -0.056  1.00 0.00 ? 37  ILE A CA   7  
ATOM 9545  C C    . ILE A 1 29 ? 1.318   -2.852  -0.538  1.00 0.00 ? 37  ILE A C    7  
ATOM 9546  O O    . ILE A 1 29 ? 1.134   -2.474  -1.694  1.00 0.00 ? 37  ILE A O    7  
ATOM 9547  C CB   . ILE A 1 29 ? 3.688   -2.090  -0.352  1.00 0.00 ? 37  ILE A CB   7  
ATOM 9548  C CG1  . ILE A 1 29 ? 5.135   -2.571  -0.231  1.00 0.00 ? 37  ILE A CG1  7  
ATOM 9549  C CG2  . ILE A 1 29 ? 3.430   -0.924  0.593   1.00 0.00 ? 37  ILE A CG2  7  
ATOM 9550  C CD1  . ILE A 1 29 ? 5.490   -3.083  1.148   1.00 0.00 ? 37  ILE A CD1  7  
ATOM 9551  H H    . ILE A 1 29 ? 3.694   -4.448  -1.493  1.00 0.00 ? 37  ILE A H    7  
ATOM 9552  H HA   . ILE A 1 29 ? 2.680   -3.400  1.013   1.00 0.00 ? 37  ILE A HA   7  
ATOM 9553  H HB   . ILE A 1 29 ? 3.511   -1.749  -1.360  1.00 0.00 ? 37  ILE A HB   7  
ATOM 9554  H HG12 . ILE A 1 29 ? 5.301   -3.372  -0.934  1.00 0.00 ? 37  ILE A HG12 7  
ATOM 9555  H HG13 . ILE A 1 29 ? 5.801   -1.752  -0.464  1.00 0.00 ? 37  ILE A HG13 7  
ATOM 9556  H HG21 . ILE A 1 29 ? 2.426   -0.557  0.445   1.00 0.00 ? 37  ILE A HG21 7  
ATOM 9557  H HG22 . ILE A 1 29 ? 4.137   -0.133  0.388   1.00 0.00 ? 37  ILE A HG22 7  
ATOM 9558  H HG23 . ILE A 1 29 ? 3.548   -1.256  1.615   1.00 0.00 ? 37  ILE A HG23 7  
ATOM 9559  H HD11 . ILE A 1 29 ? 4.867   -3.932  1.387   1.00 0.00 ? 37  ILE A HD11 7  
ATOM 9560  H HD12 . ILE A 1 29 ? 5.326   -2.301  1.875   1.00 0.00 ? 37  ILE A HD12 7  
ATOM 9561  H HD13 . ILE A 1 29 ? 6.528   -3.379  1.167   1.00 0.00 ? 37  ILE A HD13 7  
ATOM 9562  N N    . PHE A 1 30 ? 0.339   -2.946  0.356   1.00 0.00 ? 38  PHE A N    7  
ATOM 9563  C CA   . PHE A 1 30 ? -1.038  -2.603  0.017   1.00 0.00 ? 38  PHE A CA   7  
ATOM 9564  C C    . PHE A 1 30 ? -1.397  -1.215  0.528   1.00 0.00 ? 38  PHE A C    7  
ATOM 9565  O O    . PHE A 1 30 ? -0.626  -0.594  1.261   1.00 0.00 ? 38  PHE A O    7  
ATOM 9566  C CB   . PHE A 1 30 ? -2.009  -3.639  0.593   1.00 0.00 ? 38  PHE A CB   7  
ATOM 9567  C CG   . PHE A 1 30 ? -1.473  -5.044  0.587   1.00 0.00 ? 38  PHE A CG   7  
ATOM 9568  C CD1  . PHE A 1 30 ? -0.629  -5.478  -0.424  1.00 0.00 ? 38  PHE A CD1  7  
ATOM 9569  C CD2  . PHE A 1 30 ? -1.816  -5.931  1.595   1.00 0.00 ? 38  PHE A CD2  7  
ATOM 9570  C CE1  . PHE A 1 30 ? -0.136  -6.767  -0.428  1.00 0.00 ? 38  PHE A CE1  7  
ATOM 9571  C CE2  . PHE A 1 30 ? -1.324  -7.222  1.597   1.00 0.00 ? 38  PHE A CE2  7  
ATOM 9572  C CZ   . PHE A 1 30 ? -0.483  -7.641  0.584   1.00 0.00 ? 38  PHE A CZ   7  
ATOM 9573  H H    . PHE A 1 30 ? 0.546   -3.255  1.262   1.00 0.00 ? 38  PHE A H    7  
ATOM 9574  H HA   . PHE A 1 30 ? -1.123  -2.606  -1.059  1.00 0.00 ? 38  PHE A HA   7  
ATOM 9575  H HB2  . PHE A 1 30 ? -2.237  -3.377  1.615   1.00 0.00 ? 38  PHE A HB2  7  
ATOM 9576  H HB3  . PHE A 1 30 ? -2.920  -3.628  0.012   1.00 0.00 ? 38  PHE A HB3  7  
ATOM 9577  H HD1  . PHE A 1 30 ? -0.356  -4.796  -1.216  1.00 0.00 ? 38  PHE A HD1  7  
ATOM 9578  H HD2  . PHE A 1 30 ? -2.472  -5.604  2.387   1.00 0.00 ? 38  PHE A HD2  7  
ATOM 9579  H HE1  . PHE A 1 30 ? 0.522   -7.093  -1.220  1.00 0.00 ? 38  PHE A HE1  7  
ATOM 9580  H HE2  . PHE A 1 30 ? -1.600  -7.903  2.387   1.00 0.00 ? 38  PHE A HE2  7  
ATOM 9581  H HZ   . PHE A 1 30 ? -0.097  -8.650  0.583   1.00 0.00 ? 38  PHE A HZ   7  
ATOM 9582  N N    . ILE A 1 31 ? -2.569  -0.732  0.134   1.00 0.00 ? 39  ILE A N    7  
ATOM 9583  C CA   . ILE A 1 31 ? -3.030  0.585   0.543   1.00 0.00 ? 39  ILE A CA   7  
ATOM 9584  C C    . ILE A 1 31 ? -4.163  0.485   1.562   1.00 0.00 ? 39  ILE A C    7  
ATOM 9585  O O    . ILE A 1 31 ? -5.080  -0.324  1.417   1.00 0.00 ? 39  ILE A O    7  
ATOM 9586  C CB   . ILE A 1 31 ? -3.500  1.413   -0.674  1.00 0.00 ? 39  ILE A CB   7  
ATOM 9587  C CG1  . ILE A 1 31 ? -2.299  1.815   -1.532  1.00 0.00 ? 39  ILE A CG1  7  
ATOM 9588  C CG2  . ILE A 1 31 ? -4.275  2.648   -0.230  1.00 0.00 ? 39  ILE A CG2  7  
ATOM 9589  C CD1  . ILE A 1 31 ? -1.395  2.834   -0.871  1.00 0.00 ? 39  ILE A CD1  7  
ATOM 9590  H H    . ILE A 1 31 ? -3.135  -1.276  -0.452  1.00 0.00 ? 39  ILE A H    7  
ATOM 9591  H HA   . ILE A 1 31 ? -2.198  1.101   1.000   1.00 0.00 ? 39  ILE A HA   7  
ATOM 9592  H HB   . ILE A 1 31 ? -4.162  0.799   -1.263  1.00 0.00 ? 39  ILE A HB   7  
ATOM 9593  H HG12 . ILE A 1 31 ? -1.707  0.938   -1.746  1.00 0.00 ? 39  ILE A HG12 7  
ATOM 9594  H HG13 . ILE A 1 31 ? -2.654  2.239   -2.461  1.00 0.00 ? 39  ILE A HG13 7  
ATOM 9595  H HG21 . ILE A 1 31 ? -3.970  3.498   -0.823  1.00 0.00 ? 39  ILE A HG21 7  
ATOM 9596  H HG22 . ILE A 1 31 ? -4.072  2.843   0.812   1.00 0.00 ? 39  ILE A HG22 7  
ATOM 9597  H HG23 . ILE A 1 31 ? -5.332  2.477   -0.365  1.00 0.00 ? 39  ILE A HG23 7  
ATOM 9598  H HD11 . ILE A 1 31 ? -0.364  2.587   -1.072  1.00 0.00 ? 39  ILE A HD11 7  
ATOM 9599  H HD12 . ILE A 1 31 ? -1.565  2.826   0.196   1.00 0.00 ? 39  ILE A HD12 7  
ATOM 9600  H HD13 . ILE A 1 31 ? -1.613  3.817   -1.262  1.00 0.00 ? 39  ILE A HD13 7  
ATOM 9601  N N    . SER A 1 32 ? -4.089  1.325   2.586   1.00 0.00 ? 40  SER A N    7  
ATOM 9602  C CA   . SER A 1 32 ? -5.097  1.362   3.634   1.00 0.00 ? 40  SER A CA   7  
ATOM 9603  C C    . SER A 1 32 ? -5.973  2.600   3.478   1.00 0.00 ? 40  SER A C    7  
ATOM 9604  O O    . SER A 1 32 ? -5.906  3.290   2.460   1.00 0.00 ? 40  SER A O    7  
ATOM 9605  C CB   . SER A 1 32 ? -4.434  1.357   5.013   1.00 0.00 ? 40  SER A CB   7  
ATOM 9606  O OG   . SER A 1 32 ? -5.073  0.440   5.884   1.00 0.00 ? 40  SER A OG   7  
ATOM 9607  H H    . SER A 1 32 ? -3.336  1.947   2.632   1.00 0.00 ? 40  SER A H    7  
ATOM 9608  H HA   . SER A 1 32 ? -5.714  0.481   3.534   1.00 0.00 ? 40  SER A HA   7  
ATOM 9609  H HB2  . SER A 1 32 ? -3.398  1.071   4.911   1.00 0.00 ? 40  SER A HB2  7  
ATOM 9610  H HB3  . SER A 1 32 ? -4.493  2.345   5.444   1.00 0.00 ? 40  SER A HB3  7  
ATOM 9611  H HG   . SER A 1 32 ? -6.026  0.530   5.802   1.00 0.00 ? 40  SER A HG   7  
ATOM 9612  N N    . HIS A 1 33 ? -6.793  2.877   4.487   1.00 0.00 ? 41  HIS A N    7  
ATOM 9613  C CA   . HIS A 1 33 ? -7.683  4.036   4.457   1.00 0.00 ? 41  HIS A CA   7  
ATOM 9614  C C    . HIS A 1 33 ? -6.947  5.283   3.964   1.00 0.00 ? 41  HIS A C    7  
ATOM 9615  O O    . HIS A 1 33 ? -5.747  5.440   4.195   1.00 0.00 ? 41  HIS A O    7  
ATOM 9616  C CB   . HIS A 1 33 ? -8.269  4.288   5.848   1.00 0.00 ? 41  HIS A CB   7  
ATOM 9617  C CG   . HIS A 1 33 ? -9.767  4.254   5.880   1.00 0.00 ? 41  HIS A CG   7  
ATOM 9618  N ND1  . HIS A 1 33 ? -10.554 4.896   4.949   1.00 0.00 ? 41  HIS A ND1  7  
ATOM 9619  C CD2  . HIS A 1 33 ? -10.620 3.649   6.739   1.00 0.00 ? 41  HIS A CD2  7  
ATOM 9620  C CE1  . HIS A 1 33 ? -11.828 4.689   5.234   1.00 0.00 ? 41  HIS A CE1  7  
ATOM 9621  N NE2  . HIS A 1 33 ? -11.895 3.935   6.316   1.00 0.00 ? 41  HIS A NE2  7  
ATOM 9622  H H    . HIS A 1 33 ? -6.801  2.290   5.269   1.00 0.00 ? 41  HIS A H    7  
ATOM 9623  H HA   . HIS A 1 33 ? -8.488  3.815   3.771   1.00 0.00 ? 41  HIS A HA   7  
ATOM 9624  H HB2  . HIS A 1 33 ? -7.907  3.532   6.527   1.00 0.00 ? 41  HIS A HB2  7  
ATOM 9625  H HB3  . HIS A 1 33 ? -7.951  5.260   6.197   1.00 0.00 ? 41  HIS A HB3  7  
ATOM 9626  H HD1  . HIS A 1 33 ? -10.230 5.427   4.191   1.00 0.00 ? 41  HIS A HD1  7  
ATOM 9627  H HD2  . HIS A 1 33 ? -10.349 3.054   7.600   1.00 0.00 ? 41  HIS A HD2  7  
ATOM 9628  H HE1  . HIS A 1 33 ? -12.671 5.069   4.677   1.00 0.00 ? 41  HIS A HE1  7  
ATOM 9629  H HE2  . HIS A 1 33 ? -12.718 3.708   6.797   1.00 0.00 ? 41  HIS A HE2  7  
ATOM 9630  N N    . VAL A 1 34 ? -7.675  6.161   3.281   1.00 0.00 ? 42  VAL A N    7  
ATOM 9631  C CA   . VAL A 1 34 ? -7.093  7.391   2.752   1.00 0.00 ? 42  VAL A CA   7  
ATOM 9632  C C    . VAL A 1 34 ? -7.808  8.619   3.303   1.00 0.00 ? 42  VAL A C    7  
ATOM 9633  O O    . VAL A 1 34 ? -8.956  8.539   3.742   1.00 0.00 ? 42  VAL A O    7  
ATOM 9634  C CB   . VAL A 1 34 ? -7.156  7.422   1.212   1.00 0.00 ? 42  VAL A CB   7  
ATOM 9635  C CG1  . VAL A 1 34 ? -6.423  8.638   0.671   1.00 0.00 ? 42  VAL A CG1  7  
ATOM 9636  C CG2  . VAL A 1 34 ? -6.583  6.140   0.626   1.00 0.00 ? 42  VAL A CG2  7  
ATOM 9637  H H    . VAL A 1 34 ? -8.625  5.977   3.126   1.00 0.00 ? 42  VAL A H    7  
ATOM 9638  H HA   . VAL A 1 34 ? -6.055  7.425   3.050   1.00 0.00 ? 42  VAL A HA   7  
ATOM 9639  H HB   . VAL A 1 34 ? -8.194  7.494   0.917   1.00 0.00 ? 42  VAL A HB   7  
ATOM 9640  H HG11 . VAL A 1 34 ? -5.497  8.772   1.211   1.00 0.00 ? 42  VAL A HG11 7  
ATOM 9641  H HG12 . VAL A 1 34 ? -7.042  9.516   0.794   1.00 0.00 ? 42  VAL A HG12 7  
ATOM 9642  H HG13 . VAL A 1 34 ? -6.210  8.492   -0.378  1.00 0.00 ? 42  VAL A HG13 7  
ATOM 9643  H HG21 . VAL A 1 34 ? -7.211  5.802   -0.185  1.00 0.00 ? 42  VAL A HG21 7  
ATOM 9644  H HG22 . VAL A 1 34 ? -6.544  5.380   1.392   1.00 0.00 ? 42  VAL A HG22 7  
ATOM 9645  H HG23 . VAL A 1 34 ? -5.586  6.328   0.254   1.00 0.00 ? 42  VAL A HG23 7  
ATOM 9646  N N    . LYS A 1 35 ? -7.122  9.758   3.275   1.00 0.00 ? 43  LYS A N    7  
ATOM 9647  C CA   . LYS A 1 35 ? -7.691  11.007  3.769   1.00 0.00 ? 43  LYS A CA   7  
ATOM 9648  C C    . LYS A 1 35 ? -8.277  11.828  2.621   1.00 0.00 ? 43  LYS A C    7  
ATOM 9649  O O    . LYS A 1 35 ? -7.878  11.668  1.467   1.00 0.00 ? 43  LYS A O    7  
ATOM 9650  C CB   . LYS A 1 35 ? -6.624  11.821  4.503   1.00 0.00 ? 43  LYS A CB   7  
ATOM 9651  C CG   . LYS A 1 35 ? -6.158  11.185  5.801   1.00 0.00 ? 43  LYS A CG   7  
ATOM 9652  C CD   . LYS A 1 35 ? -5.634  12.226  6.777   1.00 0.00 ? 43  LYS A CD   7  
ATOM 9653  C CE   . LYS A 1 35 ? -6.766  13.026  7.401   1.00 0.00 ? 43  LYS A CE   7  
ATOM 9654  N NZ   . LYS A 1 35 ? -6.958  14.338  6.727   1.00 0.00 ? 43  LYS A NZ   7  
ATOM 9655  H H    . LYS A 1 35 ? -6.213  9.758   2.911   1.00 0.00 ? 43  LYS A H    7  
ATOM 9656  H HA   . LYS A 1 35 ? -8.482  10.760  4.460   1.00 0.00 ? 43  LYS A HA   7  
ATOM 9657  H HB2  . LYS A 1 35 ? -5.766  11.934  3.856   1.00 0.00 ? 43  LYS A HB2  7  
ATOM 9658  H HB3  . LYS A 1 35 ? -7.023  12.798  4.728   1.00 0.00 ? 43  LYS A HB3  7  
ATOM 9659  H HG2  . LYS A 1 35 ? -6.991  10.668  6.257   1.00 0.00 ? 43  LYS A HG2  7  
ATOM 9660  H HG3  . LYS A 1 35 ? -5.370  10.478  5.584   1.00 0.00 ? 43  LYS A HG3  7  
ATOM 9661  H HD2  . LYS A 1 35 ? -5.084  11.727  7.561   1.00 0.00 ? 43  LYS A HD2  7  
ATOM 9662  H HD3  . LYS A 1 35 ? -4.977  12.902  6.248   1.00 0.00 ? 43  LYS A HD3  7  
ATOM 9663  H HE2  . LYS A 1 35 ? -7.678  12.453  7.324   1.00 0.00 ? 43  LYS A HE2  7  
ATOM 9664  H HE3  . LYS A 1 35 ? -6.537  13.196  8.443   1.00 0.00 ? 43  LYS A HE3  7  
ATOM 9665  H HZ1  . LYS A 1 35 ? -7.289  15.047  7.411   1.00 0.00 ? 43  LYS A HZ1  7  
ATOM 9666  H HZ2  . LYS A 1 35 ? -7.662  14.250  5.966   1.00 0.00 ? 43  LYS A HZ2  7  
ATOM 9667  H HZ3  . LYS A 1 35 ? -6.059  14.662  6.314   1.00 0.00 ? 43  LYS A HZ3  7  
ATOM 9668  N N    . PRO A 1 36 ? -9.233  12.722  2.925   1.00 0.00 ? 44  PRO A N    7  
ATOM 9669  C CA   . PRO A 1 36 ? -9.872  13.569  1.911   1.00 0.00 ? 44  PRO A CA   7  
ATOM 9670  C C    . PRO A 1 36 ? -8.885  14.524  1.249   1.00 0.00 ? 44  PRO A C    7  
ATOM 9671  O O    . PRO A 1 36 ? -8.805  14.597  0.024   1.00 0.00 ? 44  PRO A O    7  
ATOM 9672  C CB   . PRO A 1 36 ? -10.928 14.350  2.700   1.00 0.00 ? 44  PRO A CB   7  
ATOM 9673  C CG   . PRO A 1 36 ? -10.469 14.297  4.117   1.00 0.00 ? 44  PRO A CG   7  
ATOM 9674  C CD   . PRO A 1 36 ? -9.768  12.980  4.274   1.00 0.00 ? 44  PRO A CD   7  
ATOM 9675  H HA   . PRO A 1 36 ? -10.354 12.973  1.149   1.00 0.00 ? 44  PRO A HA   7  
ATOM 9676  H HB2  . PRO A 1 36 ? -10.973 15.367  2.336   1.00 0.00 ? 44  PRO A HB2  7  
ATOM 9677  H HB3  . PRO A 1 36 ? -11.892 13.879  2.581   1.00 0.00 ? 44  PRO A HB3  7  
ATOM 9678  H HG2  . PRO A 1 36 ? -9.787  15.112  4.312   1.00 0.00 ? 44  PRO A HG2  7  
ATOM 9679  H HG3  . PRO A 1 36 ? -11.319 14.352  4.780   1.00 0.00 ? 44  PRO A HG3  7  
ATOM 9680  H HD2  . PRO A 1 36 ? -8.970  13.060  4.998   1.00 0.00 ? 44  PRO A HD2  7  
ATOM 9681  H HD3  . PRO A 1 36 ? -10.468 12.211  4.564   1.00 0.00 ? 44  PRO A HD3  7  
ATOM 9682  N N    . GLY A 1 37 ? -8.128  15.248  2.067   1.00 0.00 ? 45  GLY A N    7  
ATOM 9683  C CA   . GLY A 1 37 ? -7.153  16.181  1.537   1.00 0.00 ? 45  GLY A CA   7  
ATOM 9684  C C    . GLY A 1 37 ? -5.847  15.497  1.186   1.00 0.00 ? 45  GLY A C    7  
ATOM 9685  O O    . GLY A 1 37 ? -5.829  14.547  0.404   1.00 0.00 ? 45  GLY A O    7  
ATOM 9686  H H    . GLY A 1 37 ? -8.231  15.146  3.036   1.00 0.00 ? 45  GLY A H    7  
ATOM 9687  H HA2  . GLY A 1 37 ? -7.557  16.645  0.650   1.00 0.00 ? 45  GLY A HA2  7  
ATOM 9688  H HA3  . GLY A 1 37 ? -6.961  16.945  2.276   1.00 0.00 ? 45  GLY A HA3  7  
ATOM 9689  N N    . SER A 1 38 ? -4.754  15.973  1.770   1.00 0.00 ? 46  SER A N    7  
ATOM 9690  C CA   . SER A 1 38 ? -3.439  15.393  1.519   1.00 0.00 ? 46  SER A CA   7  
ATOM 9691  C C    . SER A 1 38 ? -3.194  15.198  0.022   1.00 0.00 ? 46  SER A C    7  
ATOM 9692  O O    . SER A 1 38 ? -3.838  15.840  -0.809  1.00 0.00 ? 46  SER A O    7  
ATOM 9693  C CB   . SER A 1 38 ? -3.315  14.057  2.251   1.00 0.00 ? 46  SER A CB   7  
ATOM 9694  O OG   . SER A 1 38 ? -3.985  13.026  1.546   1.00 0.00 ? 46  SER A OG   7  
ATOM 9695  H H    . SER A 1 38 ? -4.834  16.729  2.390   1.00 0.00 ? 46  SER A H    7  
ATOM 9696  H HA   . SER A 1 38 ? -2.696  16.074  1.908   1.00 0.00 ? 46  SER A HA   7  
ATOM 9697  H HB2  . SER A 1 38 ? -2.272  13.794  2.342   1.00 0.00 ? 46  SER A HB2  7  
ATOM 9698  H HB3  . SER A 1 38 ? -3.751  14.147  3.236   1.00 0.00 ? 46  SER A HB3  7  
ATOM 9699  H HG   . SER A 1 38 ? -4.670  12.650  2.104   1.00 0.00 ? 46  SER A HG   7  
ATOM 9700  N N    . LEU A 1 39 ? -2.260  14.311  -0.318  1.00 0.00 ? 47  LEU A N    7  
ATOM 9701  C CA   . LEU A 1 39 ? -1.938  14.039  -1.714  1.00 0.00 ? 47  LEU A CA   7  
ATOM 9702  C C    . LEU A 1 39 ? -2.565  12.730  -2.182  1.00 0.00 ? 47  LEU A C    7  
ATOM 9703  O O    . LEU A 1 39 ? -2.882  12.573  -3.361  1.00 0.00 ? 47  LEU A O    7  
ATOM 9704  C CB   . LEU A 1 39 ? -0.422  13.987  -1.906  1.00 0.00 ? 47  LEU A CB   7  
ATOM 9705  C CG   . LEU A 1 39 ? 0.327   15.250  -1.471  1.00 0.00 ? 47  LEU A CG   7  
ATOM 9706  C CD1  . LEU A 1 39 ? 1.545   14.886  -0.637  1.00 0.00 ? 47  LEU A CD1  7  
ATOM 9707  C CD2  . LEU A 1 39 ? 0.736   16.073  -2.683  1.00 0.00 ? 47  LEU A CD2  7  
ATOM 9708  H H    . LEU A 1 39 ? -1.778  13.829  0.385   1.00 0.00 ? 47  LEU A H    7  
ATOM 9709  H HA   . LEU A 1 39 ? -2.337  14.847  -2.308  1.00 0.00 ? 47  LEU A HA   7  
ATOM 9710  H HB2  . LEU A 1 39 ? -0.038  13.149  -1.341  1.00 0.00 ? 47  LEU A HB2  7  
ATOM 9711  H HB3  . LEU A 1 39 ? -0.217  13.816  -2.952  1.00 0.00 ? 47  LEU A HB3  7  
ATOM 9712  H HG   . LEU A 1 39 ? -0.327  15.854  -0.859  1.00 0.00 ? 47  LEU A HG   7  
ATOM 9713  H HD11 . LEU A 1 39 ? 2.052   14.044  -1.087  1.00 0.00 ? 47  LEU A HD11 7  
ATOM 9714  H HD12 . LEU A 1 39 ? 1.231   14.625  0.363   1.00 0.00 ? 47  LEU A HD12 7  
ATOM 9715  H HD13 . LEU A 1 39 ? 2.218   15.730  -0.596  1.00 0.00 ? 47  LEU A HD13 7  
ATOM 9716  H HD21 . LEU A 1 39 ? 1.510   15.554  -3.227  1.00 0.00 ? 47  LEU A HD21 7  
ATOM 9717  H HD22 . LEU A 1 39 ? 1.108   17.033  -2.357  1.00 0.00 ? 47  LEU A HD22 7  
ATOM 9718  H HD23 . LEU A 1 39 ? -0.121  16.219  -3.324  1.00 0.00 ? 47  LEU A HD23 7  
ATOM 9719  N N    . SER A 1 40 ? -2.742  11.790  -1.256  1.00 0.00 ? 48  SER A N    7  
ATOM 9720  C CA   . SER A 1 40 ? -3.330  10.494  -1.588  1.00 0.00 ? 48  SER A CA   7  
ATOM 9721  C C    . SER A 1 40 ? -4.663  10.667  -2.313  1.00 0.00 ? 48  SER A C    7  
ATOM 9722  O O    . SER A 1 40 ? -4.870  10.107  -3.389  1.00 0.00 ? 48  SER A O    7  
ATOM 9723  C CB   . SER A 1 40 ? -3.531  9.663   -0.320  1.00 0.00 ? 48  SER A CB   7  
ATOM 9724  O OG   . SER A 1 40 ? -4.012  10.462  0.745   1.00 0.00 ? 48  SER A OG   7  
ATOM 9725  H H    . SER A 1 40 ? -2.465  11.967  -0.331  1.00 0.00 ? 48  SER A H    7  
ATOM 9726  H HA   . SER A 1 40 ? -2.644  9.977   -2.241  1.00 0.00 ? 48  SER A HA   7  
ATOM 9727  H HB2  . SER A 1 40 ? -4.248  8.879   -0.517  1.00 0.00 ? 48  SER A HB2  7  
ATOM 9728  H HB3  . SER A 1 40 ? -2.590  9.222   -0.029  1.00 0.00 ? 48  SER A HB3  7  
ATOM 9729  H HG   . SER A 1 40 ? -3.271  10.878  1.193   1.00 0.00 ? 48  SER A HG   7  
ATOM 9730  N N    . ALA A 1 41 ? -5.560  11.448  -1.721  1.00 0.00 ? 49  ALA A N    7  
ATOM 9731  C CA   . ALA A 1 41 ? -6.864  11.695  -2.322  1.00 0.00 ? 49  ALA A CA   7  
ATOM 9732  C C    . ALA A 1 41 ? -6.715  12.392  -3.666  1.00 0.00 ? 49  ALA A C    7  
ATOM 9733  O O    . ALA A 1 41 ? -7.484  12.148  -4.598  1.00 0.00 ? 49  ALA A O    7  
ATOM 9734  C CB   . ALA A 1 41 ? -7.720  12.538  -1.393  1.00 0.00 ? 49  ALA A CB   7  
ATOM 9735  H H    . ALA A 1 41 ? -5.339  11.872  -0.867  1.00 0.00 ? 49  ALA A H    7  
ATOM 9736  H HA   . ALA A 1 41 ? -7.355  10.744  -2.467  1.00 0.00 ? 49  ALA A HA   7  
ATOM 9737  H HB1  . ALA A 1 41 ? -8.405  13.134  -1.978  1.00 0.00 ? 49  ALA A HB1  7  
ATOM 9738  H HB2  . ALA A 1 41 ? -7.083  13.188  -0.812  1.00 0.00 ? 49  ALA A HB2  7  
ATOM 9739  H HB3  . ALA A 1 41 ? -8.277  11.892  -0.732  1.00 0.00 ? 49  ALA A HB3  7  
ATOM 9740  N N    . GLU A 1 42 ? -5.719  13.264  -3.757  1.00 0.00 ? 50  GLU A N    7  
ATOM 9741  C CA   . GLU A 1 42 ? -5.457  14.008  -4.979  1.00 0.00 ? 50  GLU A CA   7  
ATOM 9742  C C    . GLU A 1 42 ? -5.171  13.064  -6.143  1.00 0.00 ? 50  GLU A C    7  
ATOM 9743  O O    . GLU A 1 42 ? -5.644  13.277  -7.259  1.00 0.00 ? 50  GLU A O    7  
ATOM 9744  C CB   . GLU A 1 42 ? -4.279  14.959  -4.770  1.00 0.00 ? 50  GLU A CB   7  
ATOM 9745  C CG   . GLU A 1 42 ? -4.695  16.384  -4.444  1.00 0.00 ? 50  GLU A CG   7  
ATOM 9746  C CD   . GLU A 1 42 ? -4.980  17.206  -5.688  1.00 0.00 ? 50  GLU A CD   7  
ATOM 9747  O OE1  . GLU A 1 42 ? -4.196  17.110  -6.655  1.00 0.00 ? 50  GLU A OE1  7  
ATOM 9748  O OE2  . GLU A 1 42 ? -5.988  17.944  -5.692  1.00 0.00 ? 50  GLU A OE2  7  
ATOM 9749  H H    . GLU A 1 42 ? -5.145  13.414  -2.976  1.00 0.00 ? 50  GLU A H    7  
ATOM 9750  H HA   . GLU A 1 42 ? -6.339  14.588  -5.210  1.00 0.00 ? 50  GLU A HA   7  
ATOM 9751  H HB2  . GLU A 1 42 ? -3.671  14.589  -3.954  1.00 0.00 ? 50  GLU A HB2  7  
ATOM 9752  H HB3  . GLU A 1 42 ? -3.684  14.976  -5.667  1.00 0.00 ? 50  GLU A HB3  7  
ATOM 9753  H HG2  . GLU A 1 42 ? -5.587  16.355  -3.839  1.00 0.00 ? 50  GLU A HG2  7  
ATOM 9754  H HG3  . GLU A 1 42 ? -3.899  16.861  -3.891  1.00 0.00 ? 50  GLU A HG3  7  
ATOM 9755  N N    . VAL A 1 43 ? -4.396  12.018  -5.873  1.00 0.00 ? 51  VAL A N    7  
ATOM 9756  C CA   . VAL A 1 43 ? -4.049  11.041  -6.899  1.00 0.00 ? 51  VAL A CA   7  
ATOM 9757  C C    . VAL A 1 43 ? -5.169  10.026  -7.092  1.00 0.00 ? 51  VAL A C    7  
ATOM 9758  O O    . VAL A 1 43 ? -5.348  9.483   -8.182  1.00 0.00 ? 51  VAL A O    7  
ATOM 9759  C CB   . VAL A 1 43 ? -2.749  10.292  -6.548  1.00 0.00 ? 51  VAL A CB   7  
ATOM 9760  C CG1  . VAL A 1 43 ? -1.555  11.231  -6.617  1.00 0.00 ? 51  VAL A CG1  7  
ATOM 9761  C CG2  . VAL A 1 43 ? -2.854  9.650   -5.172  1.00 0.00 ? 51  VAL A CG2  7  
ATOM 9762  H H    . VAL A 1 43 ? -4.050  11.902  -4.965  1.00 0.00 ? 51  VAL A H    7  
ATOM 9763  H HA   . VAL A 1 43 ? -3.894  11.571  -7.827  1.00 0.00 ? 51  VAL A HA   7  
ATOM 9764  H HB   . VAL A 1 43 ? -2.604  9.508   -7.277  1.00 0.00 ? 51  VAL A HB   7  
ATOM 9765  H HG11 . VAL A 1 43 ? -0.643  10.659  -6.530  1.00 0.00 ? 51  VAL A HG11 7  
ATOM 9766  H HG12 . VAL A 1 43 ? -1.610  11.945  -5.808  1.00 0.00 ? 51  VAL A HG12 7  
ATOM 9767  H HG13 . VAL A 1 43 ? -1.563  11.756  -7.562  1.00 0.00 ? 51  VAL A HG13 7  
ATOM 9768  H HG21 . VAL A 1 43 ? -2.864  10.421  -4.415  1.00 0.00 ? 51  VAL A HG21 7  
ATOM 9769  H HG22 . VAL A 1 43 ? -2.007  9.001   -5.012  1.00 0.00 ? 51  VAL A HG22 7  
ATOM 9770  H HG23 . VAL A 1 43 ? -3.766  9.076   -5.112  1.00 0.00 ? 51  VAL A HG23 7  
ATOM 9771  N N    . GLY A 1 44 ? -5.920  9.769   -6.025  1.00 0.00 ? 52  GLY A N    7  
ATOM 9772  C CA   . GLY A 1 44 ? -7.015  8.818   -6.100  1.00 0.00 ? 52  GLY A CA   7  
ATOM 9773  C C    . GLY A 1 44 ? -6.642  7.463   -5.533  1.00 0.00 ? 52  GLY A C    7  
ATOM 9774  O O    . GLY A 1 44 ? -6.652  6.461   -6.247  1.00 0.00 ? 52  GLY A O    7  
ATOM 9775  H H    . GLY A 1 44 ? -5.731  10.232  -5.182  1.00 0.00 ? 52  GLY A H    7  
ATOM 9776  H HA2  . GLY A 1 44 ? -7.854  9.210   -5.546  1.00 0.00 ? 52  GLY A HA2  7  
ATOM 9777  H HA3  . GLY A 1 44 ? -7.302  8.698   -7.133  1.00 0.00 ? 52  GLY A HA3  7  
ATOM 9778  N N    . LEU A 1 45 ? -6.311  7.433   -4.246  1.00 0.00 ? 53  LEU A N    7  
ATOM 9779  C CA   . LEU A 1 45 ? -5.931  6.191   -3.584  1.00 0.00 ? 53  LEU A CA   7  
ATOM 9780  C C    . LEU A 1 45 ? -7.101  5.620   -2.786  1.00 0.00 ? 53  LEU A C    7  
ATOM 9781  O O    . LEU A 1 45 ? -8.001  6.351   -2.376  1.00 0.00 ? 53  LEU A O    7  
ATOM 9782  C CB   . LEU A 1 45 ? -4.736  6.424   -2.660  1.00 0.00 ? 53  LEU A CB   7  
ATOM 9783  C CG   . LEU A 1 45 ? -3.367  6.333   -3.337  1.00 0.00 ? 53  LEU A CG   7  
ATOM 9784  C CD1  . LEU A 1 45 ? -2.289  6.927   -2.445  1.00 0.00 ? 53  LEU A CD1  7  
ATOM 9785  C CD2  . LEU A 1 45 ? -3.040  4.887   -3.683  1.00 0.00 ? 53  LEU A CD2  7  
ATOM 9786  H H    . LEU A 1 45 ? -6.321  8.265   -3.730  1.00 0.00 ? 53  LEU A H    7  
ATOM 9787  H HA   . LEU A 1 45 ? -5.652  5.480   -4.347  1.00 0.00 ? 53  LEU A HA   7  
ATOM 9788  H HB2  . LEU A 1 45 ? -4.832  7.407   -2.222  1.00 0.00 ? 53  LEU A HB2  7  
ATOM 9789  H HB3  . LEU A 1 45 ? -4.770  5.691   -1.869  1.00 0.00 ? 53  LEU A HB3  7  
ATOM 9790  H HG   . LEU A 1 45 ? -3.389  6.900   -4.257  1.00 0.00 ? 53  LEU A HG   7  
ATOM 9791  H HD11 . LEU A 1 45 ? -1.328  6.515   -2.718  1.00 0.00 ? 53  LEU A HD11 7  
ATOM 9792  H HD12 . LEU A 1 45 ? -2.503  6.687   -1.413  1.00 0.00 ? 53  LEU A HD12 7  
ATOM 9793  H HD13 . LEU A 1 45 ? -2.269  7.999   -2.569  1.00 0.00 ? 53  LEU A HD13 7  
ATOM 9794  H HD21 . LEU A 1 45 ? -2.863  4.331   -2.774  1.00 0.00 ? 53  LEU A HD21 7  
ATOM 9795  H HD22 . LEU A 1 45 ? -2.156  4.856   -4.302  1.00 0.00 ? 53  LEU A HD22 7  
ATOM 9796  H HD23 . LEU A 1 45 ? -3.869  4.448   -4.218  1.00 0.00 ? 53  LEU A HD23 7  
ATOM 9797  N N    . GLU A 1 46 ? -7.075  4.309   -2.569  1.00 0.00 ? 54  GLU A N    7  
ATOM 9798  C CA   . GLU A 1 46 ? -8.132  3.639   -1.820  1.00 0.00 ? 54  GLU A CA   7  
ATOM 9799  C C    . GLU A 1 46 ? -7.678  2.258   -1.363  1.00 0.00 ? 54  GLU A C    7  
ATOM 9800  O O    . GLU A 1 46 ? -6.739  1.686   -1.918  1.00 0.00 ? 54  GLU A O    7  
ATOM 9801  C CB   . GLU A 1 46 ? -9.394  3.517   -2.675  1.00 0.00 ? 54  GLU A CB   7  
ATOM 9802  C CG   . GLU A 1 46 ? -10.682 3.576   -1.869  1.00 0.00 ? 54  GLU A CG   7  
ATOM 9803  C CD   . GLU A 1 46 ? -11.887 3.924   -2.722  1.00 0.00 ? 54  GLU A CD   7  
ATOM 9804  O OE1  . GLU A 1 46 ? -11.695 4.505   -3.811  1.00 0.00 ? 54  GLU A OE1  7  
ATOM 9805  O OE2  . GLU A 1 46 ? -13.022 3.616   -2.301  1.00 0.00 ? 54  GLU A OE2  7  
ATOM 9806  H H    . GLU A 1 46 ? -6.330  3.781   -2.921  1.00 0.00 ? 54  GLU A H    7  
ATOM 9807  H HA   . GLU A 1 46 ? -8.352  4.238   -0.950  1.00 0.00 ? 54  GLU A HA   7  
ATOM 9808  H HB2  . GLU A 1 46 ? -9.407  4.322   -3.393  1.00 0.00 ? 54  GLU A HB2  7  
ATOM 9809  H HB3  . GLU A 1 46 ? -9.368  2.574   -3.203  1.00 0.00 ? 54  GLU A HB3  7  
ATOM 9810  H HG2  . GLU A 1 46 ? -10.851 2.613   -1.413  1.00 0.00 ? 54  GLU A HG2  7  
ATOM 9811  H HG3  . GLU A 1 46 ? -10.576 4.326   -1.099  1.00 0.00 ? 54  GLU A HG3  7  
ATOM 9812  N N    . ILE A 1 47 ? -8.350  1.723   -0.347  1.00 0.00 ? 55  ILE A N    7  
ATOM 9813  C CA   . ILE A 1 47 ? -8.014  0.408   0.184   1.00 0.00 ? 55  ILE A CA   7  
ATOM 9814  C C    . ILE A 1 47 ? -8.064  -0.657  -0.910  1.00 0.00 ? 55  ILE A C    7  
ATOM 9815  O O    . ILE A 1 47 ? -8.867  -0.568  -1.839  1.00 0.00 ? 55  ILE A O    7  
ATOM 9816  C CB   . ILE A 1 47 ? -8.966  0.001   1.325   1.00 0.00 ? 55  ILE A CB   7  
ATOM 9817  C CG1  . ILE A 1 47 ? -9.051  1.116   2.372   1.00 0.00 ? 55  ILE A CG1  7  
ATOM 9818  C CG2  . ILE A 1 47 ? -8.505  -1.302  1.964   1.00 0.00 ? 55  ILE A CG2  7  
ATOM 9819  C CD1  . ILE A 1 47 ? -10.420 1.755   2.463   1.00 0.00 ? 55  ILE A CD1  7  
ATOM 9820  H H    . ILE A 1 47 ? -9.089  2.227   0.055   1.00 0.00 ? 55  ILE A H    7  
ATOM 9821  H HA   . ILE A 1 47 ? -7.010  0.454   0.580   1.00 0.00 ? 55  ILE A HA   7  
ATOM 9822  H HB   . ILE A 1 47 ? -9.948  -0.162  0.904   1.00 0.00 ? 55  ILE A HB   7  
ATOM 9823  H HG12 . ILE A 1 47 ? -8.811  0.710   3.344   1.00 0.00 ? 55  ILE A HG12 7  
ATOM 9824  H HG13 . ILE A 1 47 ? -8.338  1.889   2.125   1.00 0.00 ? 55  ILE A HG13 7  
ATOM 9825  H HG21 . ILE A 1 47 ? -8.526  -2.091  1.227   1.00 0.00 ? 55  ILE A HG21 7  
ATOM 9826  H HG22 . ILE A 1 47 ? -9.162  -1.556  2.781   1.00 0.00 ? 55  ILE A HG22 7  
ATOM 9827  H HG23 . ILE A 1 47 ? -7.498  -1.184  2.335   1.00 0.00 ? 55  ILE A HG23 7  
ATOM 9828  H HD11 . ILE A 1 47 ? -10.940 1.626   1.526   1.00 0.00 ? 55  ILE A HD11 7  
ATOM 9829  H HD12 . ILE A 1 47 ? -10.311 2.809   2.672   1.00 0.00 ? 55  ILE A HD12 7  
ATOM 9830  H HD13 . ILE A 1 47 ? -10.984 1.287   3.256   1.00 0.00 ? 55  ILE A HD13 7  
ATOM 9831  N N    . GLY A 1 48 ? -7.200  -1.659  -0.792  1.00 0.00 ? 56  GLY A N    7  
ATOM 9832  C CA   . GLY A 1 48 ? -7.160  -2.724  -1.778  1.00 0.00 ? 56  GLY A CA   7  
ATOM 9833  C C    . GLY A 1 48 ? -6.027  -2.550  -2.770  1.00 0.00 ? 56  GLY A C    7  
ATOM 9834  O O    . GLY A 1 48 ? -5.510  -3.528  -3.311  1.00 0.00 ? 56  GLY A O    7  
ATOM 9835  H H    . GLY A 1 48 ? -6.583  -1.675  -0.031  1.00 0.00 ? 56  GLY A H    7  
ATOM 9836  H HA2  . GLY A 1 48 ? -7.038  -3.668  -1.268  1.00 0.00 ? 56  GLY A HA2  7  
ATOM 9837  H HA3  . GLY A 1 48 ? -8.096  -2.737  -2.316  1.00 0.00 ? 56  GLY A HA3  7  
ATOM 9838  N N    . ASP A 1 49 ? -5.640  -1.302  -3.008  1.00 0.00 ? 57  ASP A N    7  
ATOM 9839  C CA   . ASP A 1 49 ? -4.557  -1.001  -3.940  1.00 0.00 ? 57  ASP A CA   7  
ATOM 9840  C C    . ASP A 1 49 ? -3.240  -1.593  -3.450  1.00 0.00 ? 57  ASP A C    7  
ATOM 9841  O O    . ASP A 1 49 ? -2.997  -1.679  -2.247  1.00 0.00 ? 57  ASP A O    7  
ATOM 9842  C CB   . ASP A 1 49 ? -4.421  0.512   -4.119  1.00 0.00 ? 57  ASP A CB   7  
ATOM 9843  C CG   . ASP A 1 49 ? -5.414  1.071   -5.121  1.00 0.00 ? 57  ASP A CG   7  
ATOM 9844  O OD1  . ASP A 1 49 ? -6.305  0.314   -5.562  1.00 0.00 ? 57  ASP A OD1  7  
ATOM 9845  O OD2  . ASP A 1 49 ? -5.301  2.266   -5.465  1.00 0.00 ? 57  ASP A OD2  7  
ATOM 9846  H H    . ASP A 1 49 ? -6.089  -0.564  -2.545  1.00 0.00 ? 57  ASP A H    7  
ATOM 9847  H HA   . ASP A 1 49 ? -4.807  -1.446  -4.892  1.00 0.00 ? 57  ASP A HA   7  
ATOM 9848  H HB2  . ASP A 1 49 ? -4.588  0.998   -3.169  1.00 0.00 ? 57  ASP A HB2  7  
ATOM 9849  H HB3  . ASP A 1 49 ? -3.425  0.739   -4.462  1.00 0.00 ? 57  ASP A HB3  7  
ATOM 9850  N N    . GLN A 1 50 ? -2.392  -2.004  -4.389  1.00 0.00 ? 58  GLN A N    7  
ATOM 9851  C CA   . GLN A 1 50 ? -1.100  -2.592  -4.049  1.00 0.00 ? 58  GLN A CA   7  
ATOM 9852  C C    . GLN A 1 50 ? 0.025   -1.965  -4.867  1.00 0.00 ? 58  GLN A C    7  
ATOM 9853  O O    . GLN A 1 50 ? 0.043   -2.066  -6.094  1.00 0.00 ? 58  GLN A O    7  
ATOM 9854  C CB   . GLN A 1 50 ? -1.129  -4.103  -4.281  1.00 0.00 ? 58  GLN A CB   7  
ATOM 9855  C CG   . GLN A 1 50 ? 0.071   -4.834  -3.700  1.00 0.00 ? 58  GLN A CG   7  
ATOM 9856  C CD   . GLN A 1 50 ? 1.059   -5.273  -4.763  1.00 0.00 ? 58  GLN A CD   7  
ATOM 9857  O OE1  . GLN A 1 50 ? 1.218   -4.613  -5.791  1.00 0.00 ? 58  GLN A OE1  7  
ATOM 9858  N NE2  . GLN A 1 50 ? 1.728   -6.395  -4.522  1.00 0.00 ? 58  GLN A NE2  7  
ATOM 9859  H H    . GLN A 1 50 ? -2.641  -1.911  -5.333  1.00 0.00 ? 58  GLN A H    7  
ATOM 9860  H HA   . GLN A 1 50 ? -0.916  -2.402  -3.002  1.00 0.00 ? 58  GLN A HA   7  
ATOM 9861  H HB2  . GLN A 1 50 ? -2.023  -4.509  -3.830  1.00 0.00 ? 58  GLN A HB2  7  
ATOM 9862  H HB3  . GLN A 1 50 ? -1.156  -4.290  -5.344  1.00 0.00 ? 58  GLN A HB3  7  
ATOM 9863  H HG2  . GLN A 1 50 ? 0.577   -4.176  -3.011  1.00 0.00 ? 58  GLN A HG2  7  
ATOM 9864  H HG3  . GLN A 1 50 ? -0.279  -5.708  -3.170  1.00 0.00 ? 58  GLN A HG3  7  
ATOM 9865  H HE21 . GLN A 1 50 ? 1.549   -6.869  -3.684  1.00 0.00 ? 58  GLN A HE21 7  
ATOM 9866  H HE22 . GLN A 1 50 ? 2.374   -6.702  -5.193  1.00 0.00 ? 58  GLN A HE22 7  
ATOM 9867  N N    . ILE A 1 51 ? 0.963   -1.322  -4.180  1.00 0.00 ? 59  ILE A N    7  
ATOM 9868  C CA   . ILE A 1 51 ? 2.092   -0.682  -4.844  1.00 0.00 ? 59  ILE A CA   7  
ATOM 9869  C C    . ILE A 1 51 ? 3.033   -1.724  -5.437  1.00 0.00 ? 59  ILE A C    7  
ATOM 9870  O O    . ILE A 1 51 ? 3.583   -2.559  -4.719  1.00 0.00 ? 59  ILE A O    7  
ATOM 9871  C CB   . ILE A 1 51 ? 2.884   0.217   -3.872  1.00 0.00 ? 59  ILE A CB   7  
ATOM 9872  C CG1  . ILE A 1 51 ? 1.938   1.167   -3.135  1.00 0.00 ? 59  ILE A CG1  7  
ATOM 9873  C CG2  . ILE A 1 51 ? 3.950   1.002   -4.623  1.00 0.00 ? 59  ILE A CG2  7  
ATOM 9874  C CD1  . ILE A 1 51 ? 2.392   1.502   -1.729  1.00 0.00 ? 59  ILE A CD1  7  
ATOM 9875  H H    . ILE A 1 51 ? 0.896   -1.279  -3.203  1.00 0.00 ? 59  ILE A H    7  
ATOM 9876  H HA   . ILE A 1 51 ? 1.704   -0.063  -5.641  1.00 0.00 ? 59  ILE A HA   7  
ATOM 9877  H HB   . ILE A 1 51 ? 3.378   -0.417  -3.153  1.00 0.00 ? 59  ILE A HB   7  
ATOM 9878  H HG12 . ILE A 1 51 ? 1.864   2.092   -3.687  1.00 0.00 ? 59  ILE A HG12 7  
ATOM 9879  H HG13 . ILE A 1 51 ? 0.960   0.714   -3.069  1.00 0.00 ? 59  ILE A HG13 7  
ATOM 9880  H HG21 . ILE A 1 51 ? 3.477   1.742   -5.250  1.00 0.00 ? 59  ILE A HG21 7  
ATOM 9881  H HG22 . ILE A 1 51 ? 4.528   0.326   -5.236  1.00 0.00 ? 59  ILE A HG22 7  
ATOM 9882  H HG23 . ILE A 1 51 ? 4.600   1.492   -3.915  1.00 0.00 ? 59  ILE A HG23 7  
ATOM 9883  H HD11 . ILE A 1 51 ? 2.734   2.526   -1.696  1.00 0.00 ? 59  ILE A HD11 7  
ATOM 9884  H HD12 . ILE A 1 51 ? 3.200   0.843   -1.446  1.00 0.00 ? 59  ILE A HD12 7  
ATOM 9885  H HD13 . ILE A 1 51 ? 1.568   1.374   -1.045  1.00 0.00 ? 59  ILE A HD13 7  
ATOM 9886  N N    . VAL A 1 52 ? 3.207   -1.675  -6.754  1.00 0.00 ? 60  VAL A N    7  
ATOM 9887  C CA   . VAL A 1 52 ? 4.074   -2.622  -7.446  1.00 0.00 ? 60  VAL A CA   7  
ATOM 9888  C C    . VAL A 1 52 ? 5.445   -2.019  -7.741  1.00 0.00 ? 60  VAL A C    7  
ATOM 9889  O O    . VAL A 1 52 ? 6.416   -2.744  -7.958  1.00 0.00 ? 60  VAL A O    7  
ATOM 9890  C CB   . VAL A 1 52 ? 3.438   -3.102  -8.766  1.00 0.00 ? 60  VAL A CB   7  
ATOM 9891  C CG1  . VAL A 1 52 ? 2.132   -3.834  -8.494  1.00 0.00 ? 60  VAL A CG1  7  
ATOM 9892  C CG2  . VAL A 1 52 ? 3.212   -1.931  -9.711  1.00 0.00 ? 60  VAL A CG2  7  
ATOM 9893  H H    . VAL A 1 52 ? 2.736   -0.991  -7.274  1.00 0.00 ? 60  VAL A H    7  
ATOM 9894  H HA   . VAL A 1 52 ? 4.204   -3.481  -6.804  1.00 0.00 ? 60  VAL A HA   7  
ATOM 9895  H HB   . VAL A 1 52 ? 4.121   -3.793  -9.240  1.00 0.00 ? 60  VAL A HB   7  
ATOM 9896  H HG11 . VAL A 1 52 ? 1.754   -4.251  -9.416  1.00 0.00 ? 60  VAL A HG11 7  
ATOM 9897  H HG12 . VAL A 1 52 ? 1.408   -3.143  -8.090  1.00 0.00 ? 60  VAL A HG12 7  
ATOM 9898  H HG13 . VAL A 1 52 ? 2.305   -4.630  -7.784  1.00 0.00 ? 60  VAL A HG13 7  
ATOM 9899  H HG21 . VAL A 1 52 ? 3.314   -2.269  -10.732 1.00 0.00 ? 60  VAL A HG21 7  
ATOM 9900  H HG22 . VAL A 1 52 ? 3.941   -1.161  -9.512  1.00 0.00 ? 60  VAL A HG22 7  
ATOM 9901  H HG23 . VAL A 1 52 ? 2.218   -1.535  -9.562  1.00 0.00 ? 60  VAL A HG23 7  
ATOM 9902  N N    . GLU A 1 53 ? 5.526   -0.690  -7.750  1.00 0.00 ? 61  GLU A N    7  
ATOM 9903  C CA   . GLU A 1 53 ? 6.785   -0.005  -8.023  1.00 0.00 ? 61  GLU A CA   7  
ATOM 9904  C C    . GLU A 1 53 ? 6.812   1.380   -7.381  1.00 0.00 ? 61  GLU A C    7  
ATOM 9905  O O    . GLU A 1 53 ? 5.766   1.983   -7.138  1.00 0.00 ? 61  GLU A O    7  
ATOM 9906  C CB   . GLU A 1 53 ? 7.004   0.119   -9.532  1.00 0.00 ? 61  GLU A CB   7  
ATOM 9907  C CG   . GLU A 1 53 ? 8.460   0.317   -9.923  1.00 0.00 ? 61  GLU A CG   7  
ATOM 9908  C CD   . GLU A 1 53 ? 8.687   1.595   -10.705 1.00 0.00 ? 61  GLU A CD   7  
ATOM 9909  O OE1  . GLU A 1 53 ? 8.529   2.686   -10.116 1.00 0.00 ? 61  GLU A OE1  7  
ATOM 9910  O OE2  . GLU A 1 53 ? 9.021   1.508   -11.904 1.00 0.00 ? 61  GLU A OE2  7  
ATOM 9911  H H    . GLU A 1 53 ? 4.721   -0.159  -7.573  1.00 0.00 ? 61  GLU A H    7  
ATOM 9912  H HA   . GLU A 1 53 ? 7.582   -0.598  -7.601  1.00 0.00 ? 61  GLU A HA   7  
ATOM 9913  H HB2  . GLU A 1 53 ? 6.645   -0.781  -10.010 1.00 0.00 ? 61  GLU A HB2  7  
ATOM 9914  H HB3  . GLU A 1 53 ? 6.437   0.961   -9.898  1.00 0.00 ? 61  GLU A HB3  7  
ATOM 9915  H HG2  . GLU A 1 53 ? 9.058   0.349   -9.025  1.00 0.00 ? 61  GLU A HG2  7  
ATOM 9916  H HG3  . GLU A 1 53 ? 8.772   -0.520  -10.532 1.00 0.00 ? 61  GLU A HG3  7  
ATOM 9917  N N    . VAL A 1 54 ? 8.016   1.878   -7.110  1.00 0.00 ? 62  VAL A N    7  
ATOM 9918  C CA   . VAL A 1 54 ? 8.184   3.192   -6.499  1.00 0.00 ? 62  VAL A CA   7  
ATOM 9919  C C    . VAL A 1 54 ? 9.507   3.829   -6.918  1.00 0.00 ? 62  VAL A C    7  
ATOM 9920  O O    . VAL A 1 54 ? 10.553  3.555   -6.330  1.00 0.00 ? 62  VAL A O    7  
ATOM 9921  C CB   . VAL A 1 54 ? 8.132   3.109   -4.959  1.00 0.00 ? 62  VAL A CB   7  
ATOM 9922  C CG1  . VAL A 1 54 ? 8.236   4.498   -4.339  1.00 0.00 ? 62  VAL A CG1  7  
ATOM 9923  C CG2  . VAL A 1 54 ? 6.859   2.410   -4.507  1.00 0.00 ? 62  VAL A CG2  7  
ATOM 9924  H H    . VAL A 1 54 ? 8.812   1.348   -7.328  1.00 0.00 ? 62  VAL A H    7  
ATOM 9925  H HA   . VAL A 1 54 ? 7.373   3.820   -6.832  1.00 0.00 ? 62  VAL A HA   7  
ATOM 9926  H HB   . VAL A 1 54 ? 8.977   2.526   -4.621  1.00 0.00 ? 62  VAL A HB   7  
ATOM 9927  H HG11 . VAL A 1 54 ? 7.297   4.758   -3.876  1.00 0.00 ? 62  VAL A HG11 7  
ATOM 9928  H HG12 . VAL A 1 54 ? 8.471   5.218   -5.108  1.00 0.00 ? 62  VAL A HG12 7  
ATOM 9929  H HG13 . VAL A 1 54 ? 9.018   4.500   -3.593  1.00 0.00 ? 62  VAL A HG13 7  
ATOM 9930  H HG21 . VAL A 1 54 ? 6.019   2.795   -5.066  1.00 0.00 ? 62  VAL A HG21 7  
ATOM 9931  H HG22 . VAL A 1 54 ? 6.704   2.592   -3.453  1.00 0.00 ? 62  VAL A HG22 7  
ATOM 9932  H HG23 . VAL A 1 54 ? 6.951   1.348   -4.679  1.00 0.00 ? 62  VAL A HG23 7  
ATOM 9933  N N    . ASN A 1 55 ? 9.450   4.680   -7.938  1.00 0.00 ? 63  ASN A N    7  
ATOM 9934  C CA   . ASN A 1 55 ? 10.643  5.358   -8.436  1.00 0.00 ? 63  ASN A CA   7  
ATOM 9935  C C    . ASN A 1 55 ? 11.709  4.349   -8.858  1.00 0.00 ? 63  ASN A C    7  
ATOM 9936  O O    . ASN A 1 55 ? 12.904  4.573   -8.665  1.00 0.00 ? 63  ASN A O    7  
ATOM 9937  C CB   . ASN A 1 55 ? 11.202  6.300   -7.366  1.00 0.00 ? 63  ASN A CB   7  
ATOM 9938  C CG   . ASN A 1 55 ? 10.970  7.760   -7.704  1.00 0.00 ? 63  ASN A CG   7  
ATOM 9939  O OD1  . ASN A 1 55 ? 10.073  8.094   -8.478  1.00 0.00 ? 63  ASN A OD1  7  
ATOM 9940  N ND2  . ASN A 1 55 ? 11.781  8.639   -7.127  1.00 0.00 ? 63  ASN A ND2  7  
ATOM 9941  H H    . ASN A 1 55 ? 8.587   4.858   -8.365  1.00 0.00 ? 63  ASN A H    7  
ATOM 9942  H HA   . ASN A 1 55 ? 10.355  5.940   -9.299  1.00 0.00 ? 63  ASN A HA   7  
ATOM 9943  H HB2  . ASN A 1 55 ? 10.721  6.089   -6.422  1.00 0.00 ? 63  ASN A HB2  7  
ATOM 9944  H HB3  . ASN A 1 55 ? 12.265  6.138   -7.267  1.00 0.00 ? 63  ASN A HB3  7  
ATOM 9945  H HD21 . ASN A 1 55 ? 12.474  8.300   -6.521  1.00 0.00 ? 63  ASN A HD21 7  
ATOM 9946  H HD22 . ASN A 1 55 ? 11.653  9.589   -7.328  1.00 0.00 ? 63  ASN A HD22 7  
ATOM 9947  N N    . GLY A 1 56 ? 11.267  3.237   -9.435  1.00 0.00 ? 64  GLY A N    7  
ATOM 9948  C CA   . GLY A 1 56 ? 12.193  2.211   -9.875  1.00 0.00 ? 64  GLY A CA   7  
ATOM 9949  C C    . GLY A 1 56 ? 12.348  1.097   -8.859  1.00 0.00 ? 64  GLY A C    7  
ATOM 9950  O O    . GLY A 1 56 ? 12.633  -0.045  -9.218  1.00 0.00 ? 64  GLY A O    7  
ATOM 9951  H H    . GLY A 1 56 ? 10.303  3.112   -9.563  1.00 0.00 ? 64  GLY A H    7  
ATOM 9952  H HA2  . GLY A 1 56 ? 11.833  1.789   -10.802 1.00 0.00 ? 64  GLY A HA2  7  
ATOM 9953  H HA3  . GLY A 1 56 ? 13.158  2.663   -10.047 1.00 0.00 ? 64  GLY A HA3  7  
ATOM 9954  N N    . VAL A 1 57 ? 12.159  1.431   -7.585  1.00 0.00 ? 65  VAL A N    7  
ATOM 9955  C CA   . VAL A 1 57 ? 12.278  0.451   -6.513  1.00 0.00 ? 65  VAL A CA   7  
ATOM 9956  C C    . VAL A 1 57 ? 11.246  -0.661  -6.672  1.00 0.00 ? 65  VAL A C    7  
ATOM 9957  O O    . VAL A 1 57 ? 10.044  -0.424  -6.575  1.00 0.00 ? 65  VAL A O    7  
ATOM 9958  C CB   . VAL A 1 57 ? 12.102  1.107   -5.129  1.00 0.00 ? 65  VAL A CB   7  
ATOM 9959  C CG1  . VAL A 1 57 ? 12.379  0.101   -4.023  1.00 0.00 ? 65  VAL A CG1  7  
ATOM 9960  C CG2  . VAL A 1 57 ? 13.007  2.322   -4.994  1.00 0.00 ? 65  VAL A CG2  7  
ATOM 9961  H H    . VAL A 1 57 ? 11.932  2.358   -7.363  1.00 0.00 ? 65  VAL A H    7  
ATOM 9962  H HA   . VAL A 1 57 ? 13.268  0.021   -6.563  1.00 0.00 ? 65  VAL A HA   7  
ATOM 9963  H HB   . VAL A 1 57 ? 11.078  1.435   -5.039  1.00 0.00 ? 65  VAL A HB   7  
ATOM 9964  H HG11 . VAL A 1 57 ? 11.447  -0.335  -3.691  1.00 0.00 ? 65  VAL A HG11 7  
ATOM 9965  H HG12 . VAL A 1 57 ? 12.856  0.601   -3.193  1.00 0.00 ? 65  VAL A HG12 7  
ATOM 9966  H HG13 . VAL A 1 57 ? 13.026  -0.678  -4.395  1.00 0.00 ? 65  VAL A HG13 7  
ATOM 9967  H HG21 . VAL A 1 57 ? 12.460  3.128   -4.529  1.00 0.00 ? 65  VAL A HG21 7  
ATOM 9968  H HG22 . VAL A 1 57 ? 13.343  2.633   -5.972  1.00 0.00 ? 65  VAL A HG22 7  
ATOM 9969  H HG23 . VAL A 1 57 ? 13.862  2.068   -4.384  1.00 0.00 ? 65  VAL A HG23 7  
ATOM 9970  N N    . ASP A 1 58 ? 11.728  -1.876  -6.920  1.00 0.00 ? 66  ASP A N    7  
ATOM 9971  C CA   . ASP A 1 58 ? 10.846  -3.024  -7.093  1.00 0.00 ? 66  ASP A CA   7  
ATOM 9972  C C    . ASP A 1 58 ? 10.100  -3.336  -5.800  1.00 0.00 ? 66  ASP A C    7  
ATOM 9973  O O    . ASP A 1 58 ? 10.707  -3.704  -4.794  1.00 0.00 ? 66  ASP A O    7  
ATOM 9974  C CB   . ASP A 1 58 ? 11.650  -4.247  -7.540  1.00 0.00 ? 66  ASP A CB   7  
ATOM 9975  C CG   . ASP A 1 58 ? 11.884  -4.270  -9.036  1.00 0.00 ? 66  ASP A CG   7  
ATOM 9976  O OD1  . ASP A 1 58 ? 10.938  -3.957  -9.789  1.00 0.00 ? 66  ASP A OD1  7  
ATOM 9977  O OD2  . ASP A 1 58 ? 13.012  -4.602  -9.457  1.00 0.00 ? 66  ASP A OD2  7  
ATOM 9978  H H    . ASP A 1 58 ? 12.698  -2.001  -6.986  1.00 0.00 ? 66  ASP A H    7  
ATOM 9979  H HA   . ASP A 1 58 ? 10.128  -2.777  -7.860  1.00 0.00 ? 66  ASP A HA   7  
ATOM 9980  H HB2  . ASP A 1 58 ? 12.611  -4.238  -7.044  1.00 0.00 ? 66  ASP A HB2  7  
ATOM 9981  H HB3  . ASP A 1 58 ? 11.114  -5.142  -7.261  1.00 0.00 ? 66  ASP A HB3  7  
ATOM 9982  N N    . PHE A 1 59 ? 8.780   -3.189  -5.835  1.00 0.00 ? 67  PHE A N    7  
ATOM 9983  C CA   . PHE A 1 59 ? 7.950   -3.457  -4.666  1.00 0.00 ? 67  PHE A CA   7  
ATOM 9984  C C    . PHE A 1 59 ? 7.352   -4.860  -4.729  1.00 0.00 ? 67  PHE A C    7  
ATOM 9985  O O    . PHE A 1 59 ? 6.311   -5.128  -4.131  1.00 0.00 ? 67  PHE A O    7  
ATOM 9986  C CB   . PHE A 1 59 ? 6.834   -2.417  -4.559  1.00 0.00 ? 67  PHE A CB   7  
ATOM 9987  C CG   . PHE A 1 59 ? 7.175   -1.258  -3.666  1.00 0.00 ? 67  PHE A CG   7  
ATOM 9988  C CD1  . PHE A 1 59 ? 8.422   -0.655  -3.735  1.00 0.00 ? 67  PHE A CD1  7  
ATOM 9989  C CD2  . PHE A 1 59 ? 6.250   -0.770  -2.756  1.00 0.00 ? 67  PHE A CD2  7  
ATOM 9990  C CE1  . PHE A 1 59 ? 8.738   0.410   -2.915  1.00 0.00 ? 67  PHE A CE1  7  
ATOM 9991  C CE2  . PHE A 1 59 ? 6.561   0.295   -1.933  1.00 0.00 ? 67  PHE A CE2  7  
ATOM 9992  C CZ   . PHE A 1 59 ? 7.807   0.886   -2.011  1.00 0.00 ? 67  PHE A CZ   7  
ATOM 9993  H H    . PHE A 1 59 ? 8.353   -2.894  -6.666  1.00 0.00 ? 67  PHE A H    7  
ATOM 9994  H HA   . PHE A 1 59 ? 8.580   -3.386  -3.791  1.00 0.00 ? 67  PHE A HA   7  
ATOM 9995  H HB2  . PHE A 1 59 ? 6.620   -2.025  -5.542  1.00 0.00 ? 67  PHE A HB2  7  
ATOM 9996  H HB3  . PHE A 1 59 ? 5.946   -2.889  -4.165  1.00 0.00 ? 67  PHE A HB3  7  
ATOM 9997  H HD1  . PHE A 1 59 ? 9.151   -1.027  -4.440  1.00 0.00 ? 67  PHE A HD1  7  
ATOM 9998  H HD2  . PHE A 1 59 ? 5.275   -1.233  -2.693  1.00 0.00 ? 67  PHE A HD2  7  
ATOM 9999  H HE1  . PHE A 1 59 ? 9.713   0.870   -2.977  1.00 0.00 ? 67  PHE A HE1  7  
ATOM 10000 H HE2  . PHE A 1 59 ? 5.831   0.665   -1.228  1.00 0.00 ? 67  PHE A HE2  7  
ATOM 10001 H HZ   . PHE A 1 59 ? 8.053   1.719   -1.370  1.00 0.00 ? 67  PHE A HZ   7  
ATOM 10002 N N    . SER A 1 60 ? 8.020   -5.754  -5.455  1.00 0.00 ? 68  SER A N    7  
ATOM 10003 C CA   . SER A 1 60 ? 7.552   -7.129  -5.590  1.00 0.00 ? 68  SER A CA   7  
ATOM 10004 C C    . SER A 1 60 ? 7.728   -7.889  -4.280  1.00 0.00 ? 68  SER A C    7  
ATOM 10005 O O    . SER A 1 60 ? 6.778   -8.469  -3.756  1.00 0.00 ? 68  SER A O    7  
ATOM 10006 C CB   . SER A 1 60 ? 8.312   -7.839  -6.711  1.00 0.00 ? 68  SER A CB   7  
ATOM 10007 O OG   . SER A 1 60 ? 7.841   -9.164  -6.888  1.00 0.00 ? 68  SER A OG   7  
ATOM 10008 H H    . SER A 1 60 ? 8.845   -5.483  -5.908  1.00 0.00 ? 68  SER A H    7  
ATOM 10009 H HA   . SER A 1 60 ? 6.502   -7.101  -5.840  1.00 0.00 ? 68  SER A HA   7  
ATOM 10010 H HB2  . SER A 1 60 ? 8.177   -7.296  -7.636  1.00 0.00 ? 68  SER A HB2  7  
ATOM 10011 H HB3  . SER A 1 60 ? 9.364   -7.874  -6.465  1.00 0.00 ? 68  SER A HB3  7  
ATOM 10012 H HG   . SER A 1 60 ? 8.045   -9.461  -7.778  1.00 0.00 ? 68  SER A HG   7  
ATOM 10013 N N    . ASN A 1 61 ? 8.949   -7.876  -3.756  1.00 0.00 ? 69  ASN A N    7  
ATOM 10014 C CA   . ASN A 1 61 ? 9.253   -8.559  -2.505  1.00 0.00 ? 69  ASN A CA   7  
ATOM 10015 C C    . ASN A 1 61 ? 9.754   -7.571  -1.457  1.00 0.00 ? 69  ASN A C    7  
ATOM 10016 O O    . ASN A 1 61 ? 10.531  -7.931  -0.572  1.00 0.00 ? 69  ASN A O    7  
ATOM 10017 C CB   . ASN A 1 61 ? 10.297  -9.652  -2.735  1.00 0.00 ? 69  ASN A CB   7  
ATOM 10018 C CG   . ASN A 1 61 ? 9.702   -10.901 -3.352  1.00 0.00 ? 69  ASN A CG   7  
ATOM 10019 O OD1  . ASN A 1 61 ? 9.840   -11.143 -4.551  1.00 0.00 ? 69  ASN A OD1  7  
ATOM 10020 N ND2  . ASN A 1 61 ? 9.034   -11.705 -2.532  1.00 0.00 ? 69  ASN A ND2  7  
ATOM 10021 H H    . ASN A 1 61 ? 9.662   -7.393  -4.221  1.00 0.00 ? 69  ASN A H    7  
ATOM 10022 H HA   . ASN A 1 61 ? 8.341   -9.014  -2.146  1.00 0.00 ? 69  ASN A HA   7  
ATOM 10023 H HB2  . ASN A 1 61 ? 11.062  -9.275  -3.398  1.00 0.00 ? 69  ASN A HB2  7  
ATOM 10024 H HB3  . ASN A 1 61 ? 10.747  -9.917  -1.789  1.00 0.00 ? 69  ASN A HB3  7  
ATOM 10025 H HD21 . ASN A 1 61 ? 8.965   -11.450 -1.589  1.00 0.00 ? 69  ASN A HD21 7  
ATOM 10026 H HD22 . ASN A 1 61 ? 8.639   -12.522 -2.904  1.00 0.00 ? 69  ASN A HD22 7  
ATOM 10027 N N    . LEU A 1 62 ? 9.306   -6.324  -1.565  1.00 0.00 ? 70  LEU A N    7  
ATOM 10028 C CA   . LEU A 1 62 ? 9.710   -5.282  -0.630  1.00 0.00 ? 70  LEU A CA   7  
ATOM 10029 C C    . LEU A 1 62 ? 9.017   -5.462  0.717   1.00 0.00 ? 70  LEU A C    7  
ATOM 10030 O O    . LEU A 1 62 ? 7.897   -5.966  0.788   1.00 0.00 ? 70  LEU A O    7  
ATOM 10031 C CB   . LEU A 1 62 ? 9.385   -3.901  -1.202  1.00 0.00 ? 70  LEU A CB   7  
ATOM 10032 C CG   . LEU A 1 62 ? 10.026  -2.724  -0.461  1.00 0.00 ? 70  LEU A CG   7  
ATOM 10033 C CD1  . LEU A 1 62 ? 11.184  -2.151  -1.264  1.00 0.00 ? 70  LEU A CD1  7  
ATOM 10034 C CD2  . LEU A 1 62 ? 8.991   -1.646  -0.173  1.00 0.00 ? 70  LEU A CD2  7  
ATOM 10035 H H    . LEU A 1 62 ? 8.690   -6.099  -2.292  1.00 0.00 ? 70  LEU A H    7  
ATOM 10036 H HA   . LEU A 1 62 ? 10.777  -5.360  -0.485  1.00 0.00 ? 70  LEU A HA   7  
ATOM 10037 H HB2  . LEU A 1 62 ? 9.715   -3.876  -2.230  1.00 0.00 ? 70  LEU A HB2  7  
ATOM 10038 H HB3  . LEU A 1 62 ? 8.314   -3.770  -1.183  1.00 0.00 ? 70  LEU A HB3  7  
ATOM 10039 H HG   . LEU A 1 62 ? 10.417  -3.072  0.483   1.00 0.00 ? 70  LEU A HG   7  
ATOM 10040 H HD11 . LEU A 1 62 ? 11.972  -1.845  -0.591  1.00 0.00 ? 70  LEU A HD11 7  
ATOM 10041 H HD12 . LEU A 1 62 ? 10.842  -1.297  -1.830  1.00 0.00 ? 70  LEU A HD12 7  
ATOM 10042 H HD13 . LEU A 1 62 ? 11.561  -2.904  -1.941  1.00 0.00 ? 70  LEU A HD13 7  
ATOM 10043 H HD21 . LEU A 1 62 ? 8.201   -1.700  -0.907  1.00 0.00 ? 70  LEU A HD21 7  
ATOM 10044 H HD22 . LEU A 1 62 ? 9.460   -0.674  -0.221  1.00 0.00 ? 70  LEU A HD22 7  
ATOM 10045 H HD23 . LEU A 1 62 ? 8.578   -1.799  0.812   1.00 0.00 ? 70  LEU A HD23 7  
ATOM 10046 N N    . ASP A 1 63 ? 9.692   -5.048  1.784   1.00 0.00 ? 71  ASP A N    7  
ATOM 10047 C CA   . ASP A 1 63 ? 9.142   -5.164  3.129   1.00 0.00 ? 71  ASP A CA   7  
ATOM 10048 C C    . ASP A 1 63 ? 8.235   -3.981  3.452   1.00 0.00 ? 71  ASP A C    7  
ATOM 10049 O O    . ASP A 1 63 ? 8.145   -3.026  2.681   1.00 0.00 ? 71  ASP A O    7  
ATOM 10050 C CB   . ASP A 1 63 ? 10.271  -5.256  4.158   1.00 0.00 ? 71  ASP A CB   7  
ATOM 10051 C CG   . ASP A 1 63 ? 10.562  -6.687  4.568   1.00 0.00 ? 71  ASP A CG   7  
ATOM 10052 O OD1  . ASP A 1 63 ? 10.472  -7.583  3.703   1.00 0.00 ? 71  ASP A OD1  7  
ATOM 10053 O OD2  . ASP A 1 63 ? 10.880  -6.910  5.755   1.00 0.00 ? 71  ASP A OD2  7  
ATOM 10054 H H    . ASP A 1 63 ? 10.581  -4.655  1.664   1.00 0.00 ? 71  ASP A H    7  
ATOM 10055 H HA   . ASP A 1 63 ? 8.556   -6.071  3.169   1.00 0.00 ? 71  ASP A HA   7  
ATOM 10056 H HB2  . ASP A 1 63 ? 11.170  -4.833  3.735   1.00 0.00 ? 71  ASP A HB2  7  
ATOM 10057 H HB3  . ASP A 1 63 ? 9.994   -4.697  5.040   1.00 0.00 ? 71  ASP A HB3  7  
ATOM 10058 N N    . HIS A 1 64 ? 7.565   -4.053  4.597   1.00 0.00 ? 72  HIS A N    7  
ATOM 10059 C CA   . HIS A 1 64 ? 6.664   -2.991  5.027   1.00 0.00 ? 72  HIS A CA   7  
ATOM 10060 C C    . HIS A 1 64 ? 7.439   -1.712  5.334   1.00 0.00 ? 72  HIS A C    7  
ATOM 10061 O O    . HIS A 1 64 ? 7.190   -0.664  4.737   1.00 0.00 ? 72  HIS A O    7  
ATOM 10062 C CB   . HIS A 1 64 ? 5.879   -3.443  6.259   1.00 0.00 ? 72  HIS A CB   7  
ATOM 10063 C CG   . HIS A 1 64 ? 4.942   -2.406  6.793   1.00 0.00 ? 72  HIS A CG   7  
ATOM 10064 N ND1  . HIS A 1 64 ? 4.382   -1.418  6.011   1.00 0.00 ? 72  HIS A ND1  7  
ATOM 10065 C CD2  . HIS A 1 64 ? 4.463   -2.209  8.044   1.00 0.00 ? 72  HIS A CD2  7  
ATOM 10066 C CE1  . HIS A 1 64 ? 3.601   -0.657  6.758   1.00 0.00 ? 72  HIS A CE1  7  
ATOM 10067 N NE2  . HIS A 1 64 ? 3.632   -1.119  7.995   1.00 0.00 ? 72  HIS A NE2  7  
ATOM 10068 H H    . HIS A 1 64 ? 7.679   -4.840  5.169   1.00 0.00 ? 72  HIS A H    7  
ATOM 10069 H HA   . HIS A 1 64 ? 5.973   -2.794  4.221   1.00 0.00 ? 72  HIS A HA   7  
ATOM 10070 H HB2  . HIS A 1 64 ? 5.296   -4.314  6.005   1.00 0.00 ? 72  HIS A HB2  7  
ATOM 10071 H HB3  . HIS A 1 64 ? 6.574   -3.698  7.045   1.00 0.00 ? 72  HIS A HB3  7  
ATOM 10072 H HD1  . HIS A 1 64 ? 4.536   -1.290  5.052   1.00 0.00 ? 72  HIS A HD1  7  
ATOM 10073 H HD2  . HIS A 1 64 ? 4.694   -2.803  8.918   1.00 0.00 ? 72  HIS A HD2  7  
ATOM 10074 H HE1  . HIS A 1 64 ? 3.032   0.195   6.416   1.00 0.00 ? 72  HIS A HE1  7  
ATOM 10075 H HE2  . HIS A 1 64 ? 3.099   -0.775  8.741   1.00 0.00 ? 72  HIS A HE2  7  
ATOM 10076 N N    . LYS A 1 65 ? 8.381   -1.808  6.267   1.00 0.00 ? 73  LYS A N    7  
ATOM 10077 C CA   . LYS A 1 65 ? 9.194   -0.660  6.652   1.00 0.00 ? 73  LYS A CA   7  
ATOM 10078 C C    . LYS A 1 65 ? 9.930   -0.088  5.445   1.00 0.00 ? 73  LYS A C    7  
ATOM 10079 O O    . LYS A 1 65 ? 10.122  1.123   5.340   1.00 0.00 ? 73  LYS A O    7  
ATOM 10080 C CB   . LYS A 1 65 ? 10.196  -1.060  7.738   1.00 0.00 ? 73  LYS A CB   7  
ATOM 10081 C CG   . LYS A 1 65 ? 9.771   -0.643  9.137   1.00 0.00 ? 73  LYS A CG   7  
ATOM 10082 C CD   . LYS A 1 65 ? 10.698  -1.217  10.198  1.00 0.00 ? 73  LYS A CD   7  
ATOM 10083 C CE   . LYS A 1 65 ? 9.928   -1.984  11.260  1.00 0.00 ? 73  LYS A CE   7  
ATOM 10084 N NZ   . LYS A 1 65 ? 10.784  -2.981  11.959  1.00 0.00 ? 73  LYS A NZ   7  
ATOM 10085 H H    . LYS A 1 65 ? 8.533   -2.671  6.706   1.00 0.00 ? 73  LYS A H    7  
ATOM 10086 H HA   . LYS A 1 65 ? 8.531   0.097   7.047   1.00 0.00 ? 73  LYS A HA   7  
ATOM 10087 H HB2  . LYS A 1 65 ? 10.315  -2.133  7.725   1.00 0.00 ? 73  LYS A HB2  7  
ATOM 10088 H HB3  . LYS A 1 65 ? 11.148  -0.598  7.523   1.00 0.00 ? 73  LYS A HB3  7  
ATOM 10089 H HG2  . LYS A 1 65 ? 9.789   0.433   9.203   1.00 0.00 ? 73  LYS A HG2  7  
ATOM 10090 H HG3  . LYS A 1 65 ? 8.767   -1.001  9.319   1.00 0.00 ? 73  LYS A HG3  7  
ATOM 10091 H HD2  . LYS A 1 65 ? 11.401  -1.887  9.725   1.00 0.00 ? 73  LYS A HD2  7  
ATOM 10092 H HD3  . LYS A 1 65 ? 11.234  -0.406  10.669  1.00 0.00 ? 73  LYS A HD3  7  
ATOM 10093 H HE2  . LYS A 1 65 ? 9.543   -1.281  11.985  1.00 0.00 ? 73  LYS A HE2  7  
ATOM 10094 H HE3  . LYS A 1 65 ? 9.104   -2.498  10.788  1.00 0.00 ? 73  LYS A HE3  7  
ATOM 10095 H HZ1  . LYS A 1 65 ? 10.235  -3.839  12.169  1.00 0.00 ? 73  LYS A HZ1  7  
ATOM 10096 H HZ2  . LYS A 1 65 ? 11.139  -2.585  12.852  1.00 0.00 ? 73  LYS A HZ2  7  
ATOM 10097 H HZ3  . LYS A 1 65 ? 11.595  -3.237  11.361  1.00 0.00 ? 73  LYS A HZ3  7  
ATOM 10098 N N    . GLU A 1 66 ? 10.336  -0.966  4.534   1.00 0.00 ? 74  GLU A N    7  
ATOM 10099 C CA   . GLU A 1 66 ? 11.047  -0.546  3.333   1.00 0.00 ? 74  GLU A CA   7  
ATOM 10100 C C    . GLU A 1 66 ? 10.171  0.364   2.477   1.00 0.00 ? 74  GLU A C    7  
ATOM 10101 O O    . GLU A 1 66 ? 10.625  1.396   1.984   1.00 0.00 ? 74  GLU A O    7  
ATOM 10102 C CB   . GLU A 1 66 ? 11.484  -1.767  2.520   1.00 0.00 ? 74  GLU A CB   7  
ATOM 10103 C CG   . GLU A 1 66 ? 12.951  -2.122  2.700   1.00 0.00 ? 74  GLU A CG   7  
ATOM 10104 C CD   . GLU A 1 66 ? 13.855  -1.361  1.749   1.00 0.00 ? 74  GLU A CD   7  
ATOM 10105 O OE1  . GLU A 1 66 ? 14.184  -0.196  2.048   1.00 0.00 ? 74  GLU A OE1  7  
ATOM 10106 O OE2  . GLU A 1 66 ? 14.235  -1.934  0.704   1.00 0.00 ? 74  GLU A OE2  7  
ATOM 10107 H H    . GLU A 1 66 ? 10.152  -1.919  4.672   1.00 0.00 ? 74  GLU A H    7  
ATOM 10108 H HA   . GLU A 1 66 ? 11.923  0.004   3.640   1.00 0.00 ? 74  GLU A HA   7  
ATOM 10109 H HB2  . GLU A 1 66 ? 10.891  -2.617  2.821   1.00 0.00 ? 74  GLU A HB2  7  
ATOM 10110 H HB3  . GLU A 1 66 ? 11.310  -1.571  1.472   1.00 0.00 ? 74  GLU A HB3  7  
ATOM 10111 H HG2  . GLU A 1 66 ? 13.244  -1.890  3.713   1.00 0.00 ? 74  GLU A HG2  7  
ATOM 10112 H HG3  . GLU A 1 66 ? 13.077  -3.181  2.523   1.00 0.00 ? 74  GLU A HG3  7  
ATOM 10113 N N    . ALA A 1 67 ? 8.911   -0.025  2.310   1.00 0.00 ? 75  ALA A N    7  
ATOM 10114 C CA   . ALA A 1 67 ? 7.969   0.754   1.517   1.00 0.00 ? 75  ALA A CA   7  
ATOM 10115 C C    . ALA A 1 67 ? 7.775   2.144   2.113   1.00 0.00 ? 75  ALA A C    7  
ATOM 10116 O O    . ALA A 1 67 ? 7.771   3.144   1.395   1.00 0.00 ? 75  ALA A O    7  
ATOM 10117 C CB   . ALA A 1 67 ? 6.635   0.030   1.420   1.00 0.00 ? 75  ALA A CB   7  
ATOM 10118 H H    . ALA A 1 67 ? 8.607   -0.857  2.729   1.00 0.00 ? 75  ALA A H    7  
ATOM 10119 H HA   . ALA A 1 67 ? 8.372   0.854   0.520   1.00 0.00 ? 75  ALA A HA   7  
ATOM 10120 H HB1  . ALA A 1 67 ? 6.795   -0.969  1.041   1.00 0.00 ? 75  ALA A HB1  7  
ATOM 10121 H HB2  . ALA A 1 67 ? 5.982   0.568   0.750   1.00 0.00 ? 75  ALA A HB2  7  
ATOM 10122 H HB3  . ALA A 1 67 ? 6.184   -0.025  2.399   1.00 0.00 ? 75  ALA A HB3  7  
ATOM 10123 N N    . VAL A 1 68 ? 7.614   2.198   3.431   1.00 0.00 ? 76  VAL A N    7  
ATOM 10124 C CA   . VAL A 1 68 ? 7.421   3.464   4.124   1.00 0.00 ? 76  VAL A CA   7  
ATOM 10125 C C    . VAL A 1 68 ? 8.695   4.302   4.098   1.00 0.00 ? 76  VAL A C    7  
ATOM 10126 O O    . VAL A 1 68 ? 8.650   5.509   3.861   1.00 0.00 ? 76  VAL A O    7  
ATOM 10127 C CB   . VAL A 1 68 ? 6.989   3.245   5.587   1.00 0.00 ? 76  VAL A CB   7  
ATOM 10128 C CG1  . VAL A 1 68 ? 6.667   4.570   6.261   1.00 0.00 ? 76  VAL A CG1  7  
ATOM 10129 C CG2  . VAL A 1 68 ? 5.795   2.305   5.654   1.00 0.00 ? 76  VAL A CG2  7  
ATOM 10130 H H    . VAL A 1 68 ? 7.627   1.364   3.950   1.00 0.00 ? 76  VAL A H    7  
ATOM 10131 H HA   . VAL A 1 68 ? 6.635   4.006   3.616   1.00 0.00 ? 76  VAL A HA   7  
ATOM 10132 H HB   . VAL A 1 68 ? 7.810   2.787   6.120   1.00 0.00 ? 76  VAL A HB   7  
ATOM 10133 H HG11 . VAL A 1 68 ? 6.842   4.485   7.324   1.00 0.00 ? 76  VAL A HG11 7  
ATOM 10134 H HG12 . VAL A 1 68 ? 5.632   4.822   6.086   1.00 0.00 ? 76  VAL A HG12 7  
ATOM 10135 H HG13 . VAL A 1 68 ? 7.299   5.346   5.854   1.00 0.00 ? 76  VAL A HG13 7  
ATOM 10136 H HG21 . VAL A 1 68 ? 4.885   2.869   5.513   1.00 0.00 ? 76  VAL A HG21 7  
ATOM 10137 H HG22 . VAL A 1 68 ? 5.772   1.820   6.619   1.00 0.00 ? 76  VAL A HG22 7  
ATOM 10138 H HG23 . VAL A 1 68 ? 5.880   1.558   4.879   1.00 0.00 ? 76  VAL A HG23 7  
ATOM 10139 N N    . ASN A 1 69 ? 9.830   3.658   4.346   1.00 0.00 ? 77  ASN A N    7  
ATOM 10140 C CA   . ASN A 1 69 ? 11.118  4.347   4.353   1.00 0.00 ? 77  ASN A CA   7  
ATOM 10141 C C    . ASN A 1 69 ? 11.351  5.093   3.045   1.00 0.00 ? 77  ASN A C    7  
ATOM 10142 O O    . ASN A 1 69 ? 11.600  6.299   3.043   1.00 0.00 ? 77  ASN A O    7  
ATOM 10143 C CB   . ASN A 1 69 ? 12.253  3.352   4.596   1.00 0.00 ? 77  ASN A CB   7  
ATOM 10144 C CG   . ASN A 1 69 ? 13.380  3.949   5.414   1.00 0.00 ? 77  ASN A CG   7  
ATOM 10145 O OD1  . ASN A 1 69 ? 13.637  5.152   5.357   1.00 0.00 ? 77  ASN A OD1  7  
ATOM 10146 N ND2  . ASN A 1 69 ? 14.063  3.108   6.182   1.00 0.00 ? 77  ASN A ND2  7  
ATOM 10147 H H    . ASN A 1 69 ? 9.803   2.696   4.529   1.00 0.00 ? 77  ASN A H    7  
ATOM 10148 H HA   . ASN A 1 69 ? 11.102  5.064   5.160   1.00 0.00 ? 77  ASN A HA   7  
ATOM 10149 H HB2  . ASN A 1 69 ? 11.866  2.493   5.124   1.00 0.00 ? 77  ASN A HB2  7  
ATOM 10150 H HB3  . ASN A 1 69 ? 12.653  3.033   3.645   1.00 0.00 ? 77  ASN A HB3  7  
ATOM 10151 H HD21 . ASN A 1 69 ? 13.804  2.162   6.179   1.00 0.00 ? 77  ASN A HD21 7  
ATOM 10152 H HD22 . ASN A 1 69 ? 14.797  3.467   6.723   1.00 0.00 ? 77  ASN A HD22 7  
ATOM 10153 N N    . VAL A 1 70 ? 11.272  4.371   1.933   1.00 0.00 ? 78  VAL A N    7  
ATOM 10154 C CA   . VAL A 1 70 ? 11.478  4.971   0.620   1.00 0.00 ? 78  VAL A CA   7  
ATOM 10155 C C    . VAL A 1 70 ? 10.476  6.092   0.366   1.00 0.00 ? 78  VAL A C    7  
ATOM 10156 O O    . VAL A 1 70 ? 10.842  7.171   -0.105  1.00 0.00 ? 78  VAL A O    7  
ATOM 10157 C CB   . VAL A 1 70 ? 11.362  3.921   -0.500  1.00 0.00 ? 78  VAL A CB   7  
ATOM 10158 C CG1  . VAL A 1 70 ? 12.454  2.873   -0.361  1.00 0.00 ? 78  VAL A CG1  7  
ATOM 10159 C CG2  . VAL A 1 70 ? 9.988   3.271   -0.487  1.00 0.00 ? 78  VAL A CG2  7  
ATOM 10160 H H    . VAL A 1 70 ? 11.072  3.414   1.995   1.00 0.00 ? 78  VAL A H    7  
ATOM 10161 H HA   . VAL A 1 70 ? 12.477  5.383   0.596   1.00 0.00 ? 78  VAL A HA   7  
ATOM 10162 H HB   . VAL A 1 70 ? 11.493  4.420   -1.450  1.00 0.00 ? 78  VAL A HB   7  
ATOM 10163 H HG11 . VAL A 1 70 ? 12.747  2.795   0.677   1.00 0.00 ? 78  VAL A HG11 7  
ATOM 10164 H HG12 . VAL A 1 70 ? 13.309  3.163   -0.954  1.00 0.00 ? 78  VAL A HG12 7  
ATOM 10165 H HG13 . VAL A 1 70 ? 12.085  1.919   -0.703  1.00 0.00 ? 78  VAL A HG13 7  
ATOM 10166 H HG21 . VAL A 1 70 ? 9.240   4.003   -0.752  1.00 0.00 ? 78  VAL A HG21 7  
ATOM 10167 H HG22 . VAL A 1 70 ? 9.782   2.886   0.501   1.00 0.00 ? 78  VAL A HG22 7  
ATOM 10168 H HG23 . VAL A 1 70 ? 9.966   2.460   -1.201  1.00 0.00 ? 78  VAL A HG23 7  
ATOM 10169 N N    . LEU A 1 71 ? 9.212   5.837   0.688   1.00 0.00 ? 79  LEU A N    7  
ATOM 10170 C CA   . LEU A 1 71 ? 8.160   6.829   0.499   1.00 0.00 ? 79  LEU A CA   7  
ATOM 10171 C C    . LEU A 1 71 ? 8.391   8.035   1.405   1.00 0.00 ? 79  LEU A C    7  
ATOM 10172 O O    . LEU A 1 71 ? 8.049   9.164   1.053   1.00 0.00 ? 79  LEU A O    7  
ATOM 10173 C CB   . LEU A 1 71 ? 6.788   6.213   0.789   1.00 0.00 ? 79  LEU A CB   7  
ATOM 10174 C CG   . LEU A 1 71 ? 6.039   5.692   -0.438  1.00 0.00 ? 79  LEU A CG   7  
ATOM 10175 C CD1  . LEU A 1 71 ? 5.584   6.847   -1.316  1.00 0.00 ? 79  LEU A CD1  7  
ATOM 10176 C CD2  . LEU A 1 71 ? 6.913   4.730   -1.229  1.00 0.00 ? 79  LEU A CD2  7  
ATOM 10177 H H    . LEU A 1 71 ? 8.981   4.959   1.064   1.00 0.00 ? 79  LEU A H    7  
ATOM 10178 H HA   . LEU A 1 71 ? 8.190   7.153   -0.530  1.00 0.00 ? 79  LEU A HA   7  
ATOM 10179 H HB2  . LEU A 1 71 ? 6.924   5.392   1.478   1.00 0.00 ? 79  LEU A HB2  7  
ATOM 10180 H HB3  . LEU A 1 71 ? 6.174   6.962   1.266   1.00 0.00 ? 79  LEU A HB3  7  
ATOM 10181 H HG   . LEU A 1 71 ? 5.158   5.154   -0.114  1.00 0.00 ? 79  LEU A HG   7  
ATOM 10182 H HD11 . LEU A 1 71 ? 4.565   7.107   -1.071  1.00 0.00 ? 79  LEU A HD11 7  
ATOM 10183 H HD12 . LEU A 1 71 ? 5.639   6.554   -2.355  1.00 0.00 ? 79  LEU A HD12 7  
ATOM 10184 H HD13 . LEU A 1 71 ? 6.224   7.700   -1.149  1.00 0.00 ? 79  LEU A HD13 7  
ATOM 10185 H HD21 . LEU A 1 71 ? 7.839   5.222   -1.493  1.00 0.00 ? 79  LEU A HD21 7  
ATOM 10186 H HD22 . LEU A 1 71 ? 6.396   4.430   -2.127  1.00 0.00 ? 79  LEU A HD22 7  
ATOM 10187 H HD23 . LEU A 1 71 ? 7.126   3.861   -0.627  1.00 0.00 ? 79  LEU A HD23 7  
ATOM 10188 N N    . LYS A 1 72 ? 8.976   7.787   2.573   1.00 0.00 ? 80  LYS A N    7  
ATOM 10189 C CA   . LYS A 1 72 ? 9.258   8.850   3.530   1.00 0.00 ? 80  LYS A CA   7  
ATOM 10190 C C    . LYS A 1 72 ? 10.558  9.569   3.180   1.00 0.00 ? 80  LYS A C    7  
ATOM 10191 O O    . LYS A 1 72 ? 10.730  10.748  3.489   1.00 0.00 ? 80  LYS A O    7  
ATOM 10192 C CB   . LYS A 1 72 ? 9.347   8.276   4.947   1.00 0.00 ? 80  LYS A CB   7  
ATOM 10193 C CG   . LYS A 1 72 ? 8.070   8.438   5.756   1.00 0.00 ? 80  LYS A CG   7  
ATOM 10194 C CD   . LYS A 1 72 ? 6.866   7.865   5.025   1.00 0.00 ? 80  LYS A CD   7  
ATOM 10195 C CE   . LYS A 1 72 ? 5.677   7.697   5.958   1.00 0.00 ? 80  LYS A CE   7  
ATOM 10196 N NZ   . LYS A 1 72 ? 5.188   9.005   6.477   1.00 0.00 ? 80  LYS A NZ   7  
ATOM 10197 H H    . LYS A 1 72 ? 9.226   6.866   2.794   1.00 0.00 ? 80  LYS A H    7  
ATOM 10198 H HA   . LYS A 1 72 ? 8.444   9.559   3.489   1.00 0.00 ? 80  LYS A HA   7  
ATOM 10199 H HB2  . LYS A 1 72 ? 9.576   7.223   4.884   1.00 0.00 ? 80  LYS A HB2  7  
ATOM 10200 H HB3  . LYS A 1 72 ? 10.147  8.776   5.477   1.00 0.00 ? 80  LYS A HB3  7  
ATOM 10201 H HG2  . LYS A 1 72 ? 8.184   7.922   6.698   1.00 0.00 ? 80  LYS A HG2  7  
ATOM 10202 H HG3  . LYS A 1 72 ? 7.904   9.489   5.938   1.00 0.00 ? 80  LYS A HG3  7  
ATOM 10203 H HD2  . LYS A 1 72 ? 6.590   8.535   4.225   1.00 0.00 ? 80  LYS A HD2  7  
ATOM 10204 H HD3  . LYS A 1 72 ? 7.129   6.901   4.616   1.00 0.00 ? 80  LYS A HD3  7  
ATOM 10205 H HE2  . LYS A 1 72 ? 4.878   7.212   5.419   1.00 0.00 ? 80  LYS A HE2  7  
ATOM 10206 H HE3  . LYS A 1 72 ? 5.975   7.078   6.792   1.00 0.00 ? 80  LYS A HE3  7  
ATOM 10207 H HZ1  . LYS A 1 72 ? 4.400   8.854   7.138   1.00 0.00 ? 80  LYS A HZ1  7  
ATOM 10208 H HZ2  . LYS A 1 72 ? 4.857   9.600   5.690   1.00 0.00 ? 80  LYS A HZ2  7  
ATOM 10209 H HZ3  . LYS A 1 72 ? 5.954   9.502   6.973   1.00 0.00 ? 80  LYS A HZ3  7  
ATOM 10210 N N    . SER A 1 73 ? 11.473  8.848   2.537   1.00 0.00 ? 81  SER A N    7  
ATOM 10211 C CA   . SER A 1 73 ? 12.760  9.413   2.151   1.00 0.00 ? 81  SER A CA   7  
ATOM 10212 C C    . SER A 1 73 ? 12.594  10.472  1.065   1.00 0.00 ? 81  SER A C    7  
ATOM 10213 O O    . SER A 1 73 ? 12.888  11.647  1.279   1.00 0.00 ? 81  SER A O    7  
ATOM 10214 C CB   . SER A 1 73 ? 13.698  8.308   1.663   1.00 0.00 ? 81  SER A CB   7  
ATOM 10215 O OG   . SER A 1 73 ? 15.050  8.731   1.704   1.00 0.00 ? 81  SER A OG   7  
ATOM 10216 H H    . SER A 1 73 ? 11.279  7.912   2.323   1.00 0.00 ? 81  SER A H    7  
ATOM 10217 H HA   . SER A 1 73 ? 13.193  9.879   3.024   1.00 0.00 ? 81  SER A HA   7  
ATOM 10218 H HB2  . SER A 1 73 ? 13.585  7.439   2.293   1.00 0.00 ? 81  SER A HB2  7  
ATOM 10219 H HB3  . SER A 1 73 ? 13.446  8.050   0.644   1.00 0.00 ? 81  SER A HB3  7  
ATOM 10220 H HG   . SER A 1 73 ? 15.304  8.898   2.615   1.00 0.00 ? 81  SER A HG   7  
ATOM 10221 N N    . SER A 1 74 ? 12.125  10.047  -0.106  1.00 0.00 ? 82  SER A N    7  
ATOM 10222 C CA   . SER A 1 74 ? 11.928  10.962  -1.224  1.00 0.00 ? 82  SER A CA   7  
ATOM 10223 C C    . SER A 1 74 ? 10.574  11.657  -1.134  1.00 0.00 ? 82  SER A C    7  
ATOM 10224 O O    . SER A 1 74 ? 9.570   11.041  -0.777  1.00 0.00 ? 82  SER A O    7  
ATOM 10225 C CB   . SER A 1 74 ? 12.043  10.206  -2.551  1.00 0.00 ? 82  SER A CB   7  
ATOM 10226 O OG   . SER A 1 74 ? 13.269  10.498  -3.199  1.00 0.00 ? 82  SER A OG   7  
ATOM 10227 H H    . SER A 1 74 ? 11.911  9.096   -0.219  1.00 0.00 ? 82  SER A H    7  
ATOM 10228 H HA   . SER A 1 74 ? 12.706  11.710  -1.180  1.00 0.00 ? 82  SER A HA   7  
ATOM 10229 H HB2  . SER A 1 74 ? 11.993  9.144   -2.365  1.00 0.00 ? 82  SER A HB2  7  
ATOM 10230 H HB3  . SER A 1 74 ? 11.229  10.495  -3.201  1.00 0.00 ? 82  SER A HB3  7  
ATOM 10231 H HG   . SER A 1 74 ? 13.913  9.819   -2.988  1.00 0.00 ? 82  SER A HG   7  
ATOM 10232 N N    . ARG A 1 75 ? 10.553  12.945  -1.466  1.00 0.00 ? 83  ARG A N    7  
ATOM 10233 C CA   . ARG A 1 75 ? 9.323   13.726  -1.427  1.00 0.00 ? 83  ARG A CA   7  
ATOM 10234 C C    . ARG A 1 75 ? 8.467   13.443  -2.657  1.00 0.00 ? 83  ARG A C    7  
ATOM 10235 O O    . ARG A 1 75 ? 7.328   12.988  -2.541  1.00 0.00 ? 83  ARG A O    7  
ATOM 10236 C CB   . ARG A 1 75 ? 9.645   15.221  -1.346  1.00 0.00 ? 83  ARG A CB   7  
ATOM 10237 C CG   . ARG A 1 75 ? 10.160  15.660  0.015   1.00 0.00 ? 83  ARG A CG   7  
ATOM 10238 C CD   . ARG A 1 75 ? 9.958   17.150  0.235   1.00 0.00 ? 83  ARG A CD   7  
ATOM 10239 N NE   . ARG A 1 75 ? 11.200  17.902  0.071   1.00 0.00 ? 83  ARG A NE   7  
ATOM 10240 C CZ   . ARG A 1 75 ? 11.674  18.308  -1.106  1.00 0.00 ? 83  ARG A CZ   7  
ATOM 10241 N NH1  . ARG A 1 75 ? 11.019  18.032  -2.227  1.00 0.00 ? 83  ARG A NH1  7  
ATOM 10242 N NH2  . ARG A 1 75 ? 12.810  18.992  -1.162  1.00 0.00 ? 83  ARG A NH2  7  
ATOM 10243 H H    . ARG A 1 75 ? 11.387  13.379  -1.745  1.00 0.00 ? 83  ARG A H    7  
ATOM 10244 H HA   . ARG A 1 75 ? 8.774   13.437  -0.544  1.00 0.00 ? 83  ARG A HA   7  
ATOM 10245 H HB2  . ARG A 1 75 ? 10.397  15.455  -2.084  1.00 0.00 ? 83  ARG A HB2  7  
ATOM 10246 H HB3  . ARG A 1 75 ? 8.747   15.781  -1.567  1.00 0.00 ? 83  ARG A HB3  7  
ATOM 10247 H HG2  . ARG A 1 75 ? 9.626   15.119  0.783   1.00 0.00 ? 83  ARG A HG2  7  
ATOM 10248 H HG3  . ARG A 1 75 ? 11.214  15.434  0.079   1.00 0.00 ? 83  ARG A HG3  7  
ATOM 10249 H HD2  . ARG A 1 75 ? 9.232   17.513  -0.478  1.00 0.00 ? 83  ARG A HD2  7  
ATOM 10250 H HD3  . ARG A 1 75 ? 9.585   17.305  1.237   1.00 0.00 ? 83  ARG A HD3  7  
ATOM 10251 H HE   . ARG A 1 75 ? 11.709  18.117  0.881   1.00 0.00 ? 83  ARG A HE   7  
ATOM 10252 H HH11 . ARG A 1 75 ? 10.163  17.516  -2.193  1.00 0.00 ? 83  ARG A HH11 7  
ATOM 10253 H HH12 . ARG A 1 75 ? 11.381  18.340  -3.105  1.00 0.00 ? 83  ARG A HH12 7  
ATOM 10254 H HH21 . ARG A 1 75 ? 13.308  19.201  -0.322  1.00 0.00 ? 83  ARG A HH21 7  
ATOM 10255 H HH22 . ARG A 1 75 ? 13.166  19.297  -2.044  1.00 0.00 ? 83  ARG A HH22 7  
ATOM 10256 N N    . SER A 1 76 ? 9.023   13.711  -3.833  1.00 0.00 ? 84  SER A N    7  
ATOM 10257 C CA   . SER A 1 76 ? 8.313   13.481  -5.087  1.00 0.00 ? 84  SER A CA   7  
ATOM 10258 C C    . SER A 1 76 ? 8.805   12.205  -5.760  1.00 0.00 ? 84  SER A C    7  
ATOM 10259 O O    . SER A 1 76 ? 9.866   12.192  -6.387  1.00 0.00 ? 84  SER A O    7  
ATOM 10260 C CB   . SER A 1 76 ? 8.496   14.673  -6.029  1.00 0.00 ? 84  SER A CB   7  
ATOM 10261 O OG   . SER A 1 76 ? 7.499   14.685  -7.036  1.00 0.00 ? 84  SER A OG   7  
ATOM 10262 H H    . SER A 1 76 ? 9.935   14.069  -3.860  1.00 0.00 ? 84  SER A H    7  
ATOM 10263 H HA   . SER A 1 76 ? 7.263   13.372  -4.858  1.00 0.00 ? 84  SER A HA   7  
ATOM 10264 H HB2  . SER A 1 76 ? 8.430   15.590  -5.463  1.00 0.00 ? 84  SER A HB2  7  
ATOM 10265 H HB3  . SER A 1 76 ? 9.466   14.610  -6.501  1.00 0.00 ? 84  SER A HB3  7  
ATOM 10266 H HG   . SER A 1 76 ? 7.556   13.879  -7.553  1.00 0.00 ? 84  SER A HG   7  
ATOM 10267 N N    . LEU A 1 77 ? 8.034   11.132  -5.625  1.00 0.00 ? 85  LEU A N    7  
ATOM 10268 C CA   . LEU A 1 77 ? 8.398   9.850   -6.219  1.00 0.00 ? 85  LEU A CA   7  
ATOM 10269 C C    . LEU A 1 77 ? 7.221   9.246   -6.980  1.00 0.00 ? 85  LEU A C    7  
ATOM 10270 O O    . LEU A 1 77 ? 6.072   9.346   -6.548  1.00 0.00 ? 85  LEU A O    7  
ATOM 10271 C CB   . LEU A 1 77 ? 8.881   8.870   -5.140  1.00 0.00 ? 85  LEU A CB   7  
ATOM 10272 C CG   . LEU A 1 77 ? 8.763   9.366   -3.696  1.00 0.00 ? 85  LEU A CG   7  
ATOM 10273 C CD1  . LEU A 1 77 ? 7.308   9.384   -3.254  1.00 0.00 ? 85  LEU A CD1  7  
ATOM 10274 C CD2  . LEU A 1 77 ? 9.593   8.492   -2.765  1.00 0.00 ? 85  LEU A CD2  7  
ATOM 10275 H H    . LEU A 1 77 ? 7.201   11.202  -5.111  1.00 0.00 ? 85  LEU A H    7  
ATOM 10276 H HA   . LEU A 1 77 ? 9.204   10.028  -6.915  1.00 0.00 ? 85  LEU A HA   7  
ATOM 10277 H HB2  . LEU A 1 77 ? 8.309   7.957   -5.230  1.00 0.00 ? 85  LEU A HB2  7  
ATOM 10278 H HB3  . LEU A 1 77 ? 9.919   8.643   -5.332  1.00 0.00 ? 85  LEU A HB3  7  
ATOM 10279 H HG   . LEU A 1 77 ? 9.143   10.375  -3.636  1.00 0.00 ? 85  LEU A HG   7  
ATOM 10280 H HD11 . LEU A 1 77 ? 6.924   10.392  -3.320  1.00 0.00 ? 85  LEU A HD11 7  
ATOM 10281 H HD12 . LEU A 1 77 ? 7.235   9.037   -2.234  1.00 0.00 ? 85  LEU A HD12 7  
ATOM 10282 H HD13 . LEU A 1 77 ? 6.727   8.737   -3.895  1.00 0.00 ? 85  LEU A HD13 7  
ATOM 10283 H HD21 . LEU A 1 77 ? 10.498  8.188   -3.271  1.00 0.00 ? 85  LEU A HD21 7  
ATOM 10284 H HD22 . LEU A 1 77 ? 9.023   7.618   -2.490  1.00 0.00 ? 85  LEU A HD22 7  
ATOM 10285 H HD23 . LEU A 1 77 ? 9.847   9.052   -1.877  1.00 0.00 ? 85  LEU A HD23 7  
ATOM 10286 N N    . THR A 1 78 ? 7.521   8.609   -8.107  1.00 0.00 ? 86  THR A N    7  
ATOM 10287 C CA   . THR A 1 78 ? 6.492   7.977   -8.925  1.00 0.00 ? 86  THR A CA   7  
ATOM 10288 C C    . THR A 1 78 ? 6.248   6.549   -8.456  1.00 0.00 ? 86  THR A C    7  
ATOM 10289 O O    . THR A 1 78 ? 7.147   5.707   -8.507  1.00 0.00 ? 86  THR A O    7  
ATOM 10290 C CB   . THR A 1 78 ? 6.904   7.982   -10.398 1.00 0.00 ? 86  THR A CB   7  
ATOM 10291 O OG1  . THR A 1 78 ? 7.338   9.271   -10.793 1.00 0.00 ? 86  THR A OG1  7  
ATOM 10292 C CG2  . THR A 1 78 ? 5.789   7.567   -11.333 1.00 0.00 ? 86  THR A CG2  7  
ATOM 10293 H H    . THR A 1 78 ? 8.456   8.558   -8.394  1.00 0.00 ? 86  THR A H    7  
ATOM 10294 H HA   . THR A 1 78 ? 5.580   8.544   -8.810  1.00 0.00 ? 86  THR A HA   7  
ATOM 10295 H HB   . THR A 1 78 ? 7.723   7.291   -10.535 1.00 0.00 ? 86  THR A HB   7  
ATOM 10296 H HG1  . THR A 1 78 ? 8.225   9.426   -10.462 1.00 0.00 ? 86  THR A HG1  7  
ATOM 10297 H HG21 . THR A 1 78 ? 5.507   8.406   -11.952 1.00 0.00 ? 86  THR A HG21 7  
ATOM 10298 H HG22 . THR A 1 78 ? 4.935   7.245   -10.754 1.00 0.00 ? 86  THR A HG22 7  
ATOM 10299 H HG23 . THR A 1 78 ? 6.126   6.755   -11.959 1.00 0.00 ? 86  THR A HG23 7  
ATOM 10300 N N    . ILE A 1 79 ? 5.036   6.280   -7.989  1.00 0.00 ? 87  ILE A N    7  
ATOM 10301 C CA   . ILE A 1 79 ? 4.686   4.952   -7.500  1.00 0.00 ? 87  ILE A CA   7  
ATOM 10302 C C    . ILE A 1 79 ? 3.677   4.265   -8.409  1.00 0.00 ? 87  ILE A C    7  
ATOM 10303 O O    . ILE A 1 79 ? 2.593   4.791   -8.665  1.00 0.00 ? 87  ILE A O    7  
ATOM 10304 C CB   . ILE A 1 79 ? 4.113   5.014   -6.072  1.00 0.00 ? 87  ILE A CB   7  
ATOM 10305 C CG1  . ILE A 1 79 ? 2.979   6.040   -5.995  1.00 0.00 ? 87  ILE A CG1  7  
ATOM 10306 C CG2  . ILE A 1 79 ? 5.210   5.356   -5.074  1.00 0.00 ? 87  ILE A CG2  7  
ATOM 10307 C CD1  . ILE A 1 79 ? 2.380   6.178   -4.613  1.00 0.00 ? 87  ILE A CD1  7  
ATOM 10308 H H    . ILE A 1 79 ? 4.363   6.992   -7.966  1.00 0.00 ? 87  ILE A H    7  
ATOM 10309 H HA   . ILE A 1 79 ? 5.589   4.360   -7.473  1.00 0.00 ? 87  ILE A HA   7  
ATOM 10310 H HB   . ILE A 1 79 ? 3.725   4.039   -5.821  1.00 0.00 ? 87  ILE A HB   7  
ATOM 10311 H HG12 . ILE A 1 79 ? 3.356   7.006   -6.290  1.00 0.00 ? 87  ILE A HG12 7  
ATOM 10312 H HG13 . ILE A 1 79 ? 2.190   5.745   -6.672  1.00 0.00 ? 87  ILE A HG13 7  
ATOM 10313 H HG21 . ILE A 1 79 ? 6.175   5.208   -5.535  1.00 0.00 ? 87  ILE A HG21 7  
ATOM 10314 H HG22 . ILE A 1 79 ? 5.122   4.716   -4.209  1.00 0.00 ? 87  ILE A HG22 7  
ATOM 10315 H HG23 . ILE A 1 79 ? 5.112   6.388   -4.769  1.00 0.00 ? 87  ILE A HG23 7  
ATOM 10316 H HD11 . ILE A 1 79 ? 1.660   6.983   -4.611  1.00 0.00 ? 87  ILE A HD11 7  
ATOM 10317 H HD12 . ILE A 1 79 ? 3.163   6.393   -3.902  1.00 0.00 ? 87  ILE A HD12 7  
ATOM 10318 H HD13 . ILE A 1 79 ? 1.888   5.255   -4.340  1.00 0.00 ? 87  ILE A HD13 7  
ATOM 10319 N N    . SER A 1 80 ? 4.036   3.076   -8.886  1.00 0.00 ? 88  SER A N    7  
ATOM 10320 C CA   . SER A 1 80 ? 3.160   2.302   -9.756  1.00 0.00 ? 88  SER A CA   7  
ATOM 10321 C C    . SER A 1 80 ? 2.323   1.332   -8.933  1.00 0.00 ? 88  SER A C    7  
ATOM 10322 O O    . SER A 1 80 ? 2.852   0.402   -8.324  1.00 0.00 ? 88  SER A O    7  
ATOM 10323 C CB   . SER A 1 80 ? 3.981   1.536   -10.795 1.00 0.00 ? 88  SER A CB   7  
ATOM 10324 O OG   . SER A 1 80 ? 3.169   1.116   -11.877 1.00 0.00 ? 88  SER A OG   7  
ATOM 10325 H H    . SER A 1 80 ? 4.910   2.708   -8.637  1.00 0.00 ? 88  SER A H    7  
ATOM 10326 H HA   . SER A 1 80 ? 2.500   2.991   -10.263 1.00 0.00 ? 88  SER A HA   7  
ATOM 10327 H HB2  . SER A 1 80 ? 4.763   2.176   -11.176 1.00 0.00 ? 88  SER A HB2  7  
ATOM 10328 H HB3  . SER A 1 80 ? 4.421   0.666   -10.331 1.00 0.00 ? 88  SER A HB3  7  
ATOM 10329 H HG   . SER A 1 80 ? 3.719   0.950   -12.645 1.00 0.00 ? 88  SER A HG   7  
ATOM 10330 N N    . ILE A 1 81 ? 1.015   1.560   -8.906  1.00 0.00 ? 89  ILE A N    7  
ATOM 10331 C CA   . ILE A 1 81 ? 0.109   0.710   -8.146  1.00 0.00 ? 89  ILE A CA   7  
ATOM 10332 C C    . ILE A 1 81 ? -0.906  0.029   -9.057  1.00 0.00 ? 89  ILE A C    7  
ATOM 10333 O O    . ILE A 1 81 ? -1.327  0.594   -10.063 1.00 0.00 ? 89  ILE A O    7  
ATOM 10334 C CB   . ILE A 1 81 ? -0.638  1.524   -7.066  1.00 0.00 ? 89  ILE A CB   7  
ATOM 10335 C CG1  . ILE A 1 81 ? -1.642  0.637   -6.314  1.00 0.00 ? 89  ILE A CG1  7  
ATOM 10336 C CG2  . ILE A 1 81 ? -1.329  2.728   -7.693  1.00 0.00 ? 89  ILE A CG2  7  
ATOM 10337 C CD1  . ILE A 1 81 ? -3.046  0.655   -6.890  1.00 0.00 ? 89  ILE A CD1  7  
ATOM 10338 H H    . ILE A 1 81 ? 0.651   2.321   -9.404  1.00 0.00 ? 89  ILE A H    7  
ATOM 10339 H HA   . ILE A 1 81 ? 0.698   -0.048  -7.650  1.00 0.00 ? 89  ILE A HA   7  
ATOM 10340 H HB   . ILE A 1 81 ? 0.095   1.893   -6.364  1.00 0.00 ? 89  ILE A HB   7  
ATOM 10341 H HG12 . ILE A 1 81 ? -1.295  -0.382  -6.334  1.00 0.00 ? 89  ILE A HG12 7  
ATOM 10342 H HG13 . ILE A 1 81 ? -1.700  0.970   -5.287  1.00 0.00 ? 89  ILE A HG13 7  
ATOM 10343 H HG21 . ILE A 1 81 ? -0.606  3.513   -7.857  1.00 0.00 ? 89  ILE A HG21 7  
ATOM 10344 H HG22 . ILE A 1 81 ? -2.102  3.085   -7.028  1.00 0.00 ? 89  ILE A HG22 7  
ATOM 10345 H HG23 . ILE A 1 81 ? -1.769  2.440   -8.635  1.00 0.00 ? 89  ILE A HG23 7  
ATOM 10346 H HD11 . ILE A 1 81 ? -3.519  1.596   -6.650  1.00 0.00 ? 89  ILE A HD11 7  
ATOM 10347 H HD12 . ILE A 1 81 ? -3.619  -0.155  -6.463  1.00 0.00 ? 89  ILE A HD12 7  
ATOM 10348 H HD13 . ILE A 1 81 ? -2.999  0.539   -7.961  1.00 0.00 ? 89  ILE A HD13 7  
ATOM 10349 N N    . VAL A 1 82 ? -1.302  -1.182  -8.688  1.00 0.00 ? 90  VAL A N    7  
ATOM 10350 C CA   . VAL A 1 82 ? -2.276  -1.936  -9.466  1.00 0.00 ? 90  VAL A CA   7  
ATOM 10351 C C    . VAL A 1 82 ? -3.545  -2.171  -8.652  1.00 0.00 ? 90  VAL A C    7  
ATOM 10352 O O    . VAL A 1 82 ? -3.483  -2.540  -7.480  1.00 0.00 ? 90  VAL A O    7  
ATOM 10353 C CB   . VAL A 1 82 ? -1.710  -3.291  -9.925  1.00 0.00 ? 90  VAL A CB   7  
ATOM 10354 C CG1  . VAL A 1 82 ? -2.620  -3.929  -10.962 1.00 0.00 ? 90  VAL A CG1  7  
ATOM 10355 C CG2  . VAL A 1 82 ? -0.299  -3.125  -10.472 1.00 0.00 ? 90  VAL A CG2  7  
ATOM 10356 H H    . VAL A 1 82 ? -0.935  -1.577  -7.870  1.00 0.00 ? 90  VAL A H    7  
ATOM 10357 H HA   . VAL A 1 82 ? -2.525  -1.356  -10.343 1.00 0.00 ? 90  VAL A HA   7  
ATOM 10358 H HB   . VAL A 1 82 ? -1.664  -3.946  -9.070  1.00 0.00 ? 90  VAL A HB   7  
ATOM 10359 H HG11 . VAL A 1 82 ? -3.392  -4.497  -10.464 1.00 0.00 ? 90  VAL A HG11 7  
ATOM 10360 H HG12 . VAL A 1 82 ? -2.041  -4.585  -11.596 1.00 0.00 ? 90  VAL A HG12 7  
ATOM 10361 H HG13 . VAL A 1 82 ? -3.075  -3.157  -11.565 1.00 0.00 ? 90  VAL A HG13 7  
ATOM 10362 H HG21 . VAL A 1 82 ? 0.322   -2.647  -9.728  1.00 0.00 ? 90  VAL A HG21 7  
ATOM 10363 H HG22 . VAL A 1 82 ? -0.329  -2.514  -11.363 1.00 0.00 ? 90  VAL A HG22 7  
ATOM 10364 H HG23 . VAL A 1 82 ? 0.110   -4.094  -10.713 1.00 0.00 ? 90  VAL A HG23 7  
ATOM 10365 N N    . ALA A 1 83 ? -4.693  -1.939  -9.277  1.00 0.00 ? 91  ALA A N    7  
ATOM 10366 C CA   . ALA A 1 83 ? -5.976  -2.109  -8.607  1.00 0.00 ? 91  ALA A CA   7  
ATOM 10367 C C    . ALA A 1 83 ? -6.302  -3.580  -8.364  1.00 0.00 ? 91  ALA A C    7  
ATOM 10368 O O    . ALA A 1 83 ? -6.241  -4.402  -9.281  1.00 0.00 ? 91  ALA A O    7  
ATOM 10369 C CB   . ALA A 1 83 ? -7.083  -1.453  -9.418  1.00 0.00 ? 91  ALA A CB   7  
ATOM 10370 H H    . ALA A 1 83 ? -4.678  -1.636  -10.209 1.00 0.00 ? 91  ALA A H    7  
ATOM 10371 H HA   . ALA A 1 83 ? -5.919  -1.606  -7.652  1.00 0.00 ? 91  ALA A HA   7  
ATOM 10372 H HB1  . ALA A 1 83 ? -6.704  -0.554  -9.882  1.00 0.00 ? 91  ALA A HB1  7  
ATOM 10373 H HB2  . ALA A 1 83 ? -7.906  -1.203  -8.766  1.00 0.00 ? 91  ALA A HB2  7  
ATOM 10374 H HB3  . ALA A 1 83 ? -7.423  -2.135  -10.182 1.00 0.00 ? 91  ALA A HB3  7  
ATOM 10375 N N    . ALA A 1 84 ? -6.665  -3.897  -7.120  1.00 0.00 ? 92  ALA A N    7  
ATOM 10376 C CA   . ALA A 1 84 ? -7.029  -5.260  -6.724  1.00 0.00 ? 92  ALA A CA   7  
ATOM 10377 C C    . ALA A 1 84 ? -5.811  -6.121  -6.386  1.00 0.00 ? 92  ALA A C    7  
ATOM 10378 O O    . ALA A 1 84 ? -5.945  -7.161  -5.742  1.00 0.00 ? 92  ALA A O    7  
ATOM 10379 C CB   . ALA A 1 84 ? -7.871  -5.933  -7.799  1.00 0.00 ? 92  ALA A CB   7  
ATOM 10380 H H    . ALA A 1 84 ? -6.702  -3.186  -6.446  1.00 0.00 ? 92  ALA A H    7  
ATOM 10381 H HA   . ALA A 1 84 ? -7.639  -5.180  -5.836  1.00 0.00 ? 92  ALA A HA   7  
ATOM 10382 H HB1  . ALA A 1 84 ? -8.461  -6.721  -7.352  1.00 0.00 ? 92  ALA A HB1  7  
ATOM 10383 H HB2  . ALA A 1 84 ? -7.224  -6.351  -8.554  1.00 0.00 ? 92  ALA A HB2  7  
ATOM 10384 H HB3  . ALA A 1 84 ? -8.528  -5.204  -8.249  1.00 0.00 ? 92  ALA A HB3  7  
ATOM 10385 N N    . ALA A 1 85 ? -4.624  -5.695  -6.814  1.00 0.00 ? 93  ALA A N    7  
ATOM 10386 C CA   . ALA A 1 85 ? -3.404  -6.450  -6.536  1.00 0.00 ? 93  ALA A CA   7  
ATOM 10387 C C    . ALA A 1 85 ? -3.237  -6.703  -5.038  1.00 0.00 ? 93  ALA A C    7  
ATOM 10388 O O    . ALA A 1 85 ? -2.529  -7.623  -4.628  1.00 0.00 ? 93  ALA A O    7  
ATOM 10389 C CB   . ALA A 1 85 ? -2.194  -5.710  -7.086  1.00 0.00 ? 93  ALA A CB   7  
ATOM 10390 H H    . ALA A 1 85 ? -4.564  -4.862  -7.322  1.00 0.00 ? 93  ALA A H    7  
ATOM 10391 H HA   . ALA A 1 85 ? -3.477  -7.400  -7.046  1.00 0.00 ? 93  ALA A HA   7  
ATOM 10392 H HB1  . ALA A 1 85 ? -2.038  -5.991  -8.117  1.00 0.00 ? 93  ALA A HB1  7  
ATOM 10393 H HB2  . ALA A 1 85 ? -1.320  -5.967  -6.507  1.00 0.00 ? 93  ALA A HB2  7  
ATOM 10394 H HB3  . ALA A 1 85 ? -2.365  -4.645  -7.027  1.00 0.00 ? 93  ALA A HB3  7  
ATOM 10395 N N    . GLY A 1 86 ? -3.891  -5.875  -4.229  1.00 0.00 ? 94  GLY A N    7  
ATOM 10396 C CA   . GLY A 1 86 ? -3.808  -6.010  -2.786  1.00 0.00 ? 94  GLY A CA   7  
ATOM 10397 C C    . GLY A 1 86 ? -5.137  -6.387  -2.158  1.00 0.00 ? 94  GLY A C    7  
ATOM 10398 O O    . GLY A 1 86 ? -5.178  -7.038  -1.115  1.00 0.00 ? 94  GLY A O    7  
ATOM 10399 H H    . GLY A 1 86 ? -4.434  -5.158  -4.615  1.00 0.00 ? 94  GLY A H    7  
ATOM 10400 H HA2  . GLY A 1 86 ? -3.081  -6.772  -2.548  1.00 0.00 ? 94  GLY A HA2  7  
ATOM 10401 H HA3  . GLY A 1 86 ? -3.479  -5.072  -2.366  1.00 0.00 ? 94  GLY A HA3  7  
ATOM 10402 N N    . ARG A 1 87 ? -6.225  -5.953  -2.786  1.00 0.00 ? 95  ARG A N    7  
ATOM 10403 C CA   . ARG A 1 87 ? -7.569  -6.218  -2.278  1.00 0.00 ? 95  ARG A CA   7  
ATOM 10404 C C    . ARG A 1 87 ? -7.815  -7.714  -2.094  1.00 0.00 ? 95  ARG A C    7  
ATOM 10405 O O    . ARG A 1 87 ? -8.464  -8.128  -1.132  1.00 0.00 ? 95  ARG A O    7  
ATOM 10406 C CB   . ARG A 1 87 ? -8.615  -5.625  -3.231  1.00 0.00 ? 95  ARG A CB   7  
ATOM 10407 C CG   . ARG A 1 87 ? -9.038  -6.560  -4.358  1.00 0.00 ? 95  ARG A CG   7  
ATOM 10408 C CD   . ARG A 1 87 ? -10.071 -5.911  -5.262  1.00 0.00 ? 95  ARG A CD   7  
ATOM 10409 N NE   . ARG A 1 87 ? -11.413 -5.968  -4.686  1.00 0.00 ? 95  ARG A NE   7  
ATOM 10410 C CZ   . ARG A 1 87 ? -12.531 -5.832  -5.395  1.00 0.00 ? 95  ARG A CZ   7  
ATOM 10411 N NH1  . ARG A 1 87 ? -12.476 -5.627  -6.705  1.00 0.00 ? 95  ARG A NH1  7  
ATOM 10412 N NH2  . ARG A 1 87 ? -13.710 -5.901  -4.791  1.00 0.00 ? 95  ARG A NH2  7  
ATOM 10413 H H    . ARG A 1 87 ? -6.121  -5.425  -3.603  1.00 0.00 ? 95  ARG A H    7  
ATOM 10414 H HA   . ARG A 1 87 ? -7.658  -5.732  -1.319  1.00 0.00 ? 95  ARG A HA   7  
ATOM 10415 H HB2  . ARG A 1 87 ? -9.495  -5.366  -2.664  1.00 0.00 ? 95  ARG A HB2  7  
ATOM 10416 H HB3  . ARG A 1 87 ? -8.209  -4.727  -3.674  1.00 0.00 ? 95  ARG A HB3  7  
ATOM 10417 H HG2  . ARG A 1 87 ? -8.169  -6.817  -4.945  1.00 0.00 ? 95  ARG A HG2  7  
ATOM 10418 H HG3  . ARG A 1 87 ? -9.461  -7.455  -3.927  1.00 0.00 ? 95  ARG A HG3  7  
ATOM 10419 H HD2  . ARG A 1 87 ? -9.799  -4.877  -5.415  1.00 0.00 ? 95  ARG A HD2  7  
ATOM 10420 H HD3  . ARG A 1 87 ? -10.074 -6.426  -6.211  1.00 0.00 ? 95  ARG A HD3  7  
ATOM 10421 H HE   . ARG A 1 87 ? -11.484 -6.115  -3.720  1.00 0.00 ? 95  ARG A HE   7  
ATOM 10422 H HH11 . ARG A 1 87 ? -11.591 -5.574  -7.167  1.00 0.00 ? 95  ARG A HH11 7  
ATOM 10423 H HH12 . ARG A 1 87 ? -13.321 -5.526  -7.232  1.00 0.00 ? 95  ARG A HH12 7  
ATOM 10424 H HH21 . ARG A 1 87 ? -13.757 -6.056  -3.804  1.00 0.00 ? 95  ARG A HH21 7  
ATOM 10425 H HH22 . ARG A 1 87 ? -14.551 -5.799  -5.322  1.00 0.00 ? 95  ARG A HH22 7  
ATOM 10426 N N    . GLU A 1 88 ? -7.301  -8.523  -3.015  1.00 0.00 ? 96  GLU A N    7  
ATOM 10427 C CA   . GLU A 1 88 ? -7.479  -9.970  -2.933  1.00 0.00 ? 96  GLU A CA   7  
ATOM 10428 C C    . GLU A 1 88 ? -7.073  -10.487 -1.556  1.00 0.00 ? 96  GLU A C    7  
ATOM 10429 O O    . GLU A 1 88 ? -7.823  -11.218 -0.909  1.00 0.00 ? 96  GLU A O    7  
ATOM 10430 C CB   . GLU A 1 88 ? -6.660  -10.671 -4.019  1.00 0.00 ? 96  GLU A CB   7  
ATOM 10431 C CG   . GLU A 1 88 ? -5.201  -10.246 -4.055  1.00 0.00 ? 96  GLU A CG   7  
ATOM 10432 C CD   . GLU A 1 88 ? -4.612  -10.304 -5.449  1.00 0.00 ? 96  GLU A CD   7  
ATOM 10433 O OE1  . GLU A 1 88 ? -5.111  -11.101 -6.272  1.00 0.00 ? 96  GLU A OE1  7  
ATOM 10434 O OE2  . GLU A 1 88 ? -3.650  -9.554  -5.720  1.00 0.00 ? 96  GLU A OE2  7  
ATOM 10435 H H    . GLU A 1 88 ? -6.794  -8.142  -3.760  1.00 0.00 ? 96  GLU A H    7  
ATOM 10436 H HA   . GLU A 1 88 ? -8.526  -10.184 -3.090  1.00 0.00 ? 96  GLU A HA   7  
ATOM 10437 H HB2  . GLU A 1 88 ? -6.697  -11.737 -3.850  1.00 0.00 ? 96  GLU A HB2  7  
ATOM 10438 H HB3  . GLU A 1 88 ? -7.099  -10.454 -4.982  1.00 0.00 ? 96  GLU A HB3  7  
ATOM 10439 H HG2  . GLU A 1 88 ? -5.125  -9.233  -3.689  1.00 0.00 ? 96  GLU A HG2  7  
ATOM 10440 H HG3  . GLU A 1 88 ? -4.633  -10.901 -3.411  1.00 0.00 ? 96  GLU A HG3  7  
ATOM 10441 N N    . LEU A 1 89 ? -5.886  -10.092 -1.111  1.00 0.00 ? 97  LEU A N    7  
ATOM 10442 C CA   . LEU A 1 89 ? -5.380  -10.503 0.193   1.00 0.00 ? 97  LEU A CA   7  
ATOM 10443 C C    . LEU A 1 89 ? -6.140  -9.806  1.318   1.00 0.00 ? 97  LEU A C    7  
ATOM 10444 O O    . LEU A 1 89 ? -6.380  -10.389 2.375   1.00 0.00 ? 97  LEU A O    7  
ATOM 10445 C CB   . LEU A 1 89 ? -3.887  -10.191 0.302   1.00 0.00 ? 97  LEU A CB   7  
ATOM 10446 C CG   . LEU A 1 89 ? -3.035  -10.709 -0.856  1.00 0.00 ? 97  LEU A CG   7  
ATOM 10447 C CD1  . LEU A 1 89 ? -1.720  -9.950  -0.931  1.00 0.00 ? 97  LEU A CD1  7  
ATOM 10448 C CD2  . LEU A 1 89 ? -2.783  -12.202 -0.705  1.00 0.00 ? 97  LEU A CD2  7  
ATOM 10449 H H    . LEU A 1 89 ? -5.338  -9.503  -1.671  1.00 0.00 ? 97  LEU A H    7  
ATOM 10450 H HA   . LEU A 1 89 ? -5.524  -11.570 0.284   1.00 0.00 ? 97  LEU A HA   7  
ATOM 10451 H HB2  . LEU A 1 89 ? -3.767  -9.120  0.361   1.00 0.00 ? 97  LEU A HB2  7  
ATOM 10452 H HB3  . LEU A 1 89 ? -3.515  -10.629 1.217   1.00 0.00 ? 97  LEU A HB3  7  
ATOM 10453 H HG   . LEU A 1 89 ? -3.564  -10.550 -1.782  1.00 0.00 ? 97  LEU A HG   7  
ATOM 10454 H HD11 . LEU A 1 89 ? -1.125  -10.172 -0.057  1.00 0.00 ? 97  LEU A HD11 7  
ATOM 10455 H HD12 . LEU A 1 89 ? -1.921  -8.890  -0.971  1.00 0.00 ? 97  LEU A HD12 7  
ATOM 10456 H HD13 . LEU A 1 89 ? -1.182  -10.249 -1.818  1.00 0.00 ? 97  LEU A HD13 7  
ATOM 10457 H HD21 . LEU A 1 89 ? -1.825  -12.360 -0.231  1.00 0.00 ? 97  LEU A HD21 7  
ATOM 10458 H HD22 . LEU A 1 89 ? -2.784  -12.667 -1.677  1.00 0.00 ? 97  LEU A HD22 7  
ATOM 10459 H HD23 . LEU A 1 89 ? -3.560  -12.637 -0.095  1.00 0.00 ? 97  LEU A HD23 7  
ATOM 10460 N N    . PHE A 1 90 ? -6.512  -8.551  1.081   1.00 0.00 ? 98  PHE A N    7  
ATOM 10461 C CA   . PHE A 1 90 ? -7.242  -7.763  2.071   1.00 0.00 ? 98  PHE A CA   7  
ATOM 10462 C C    . PHE A 1 90 ? -8.495  -8.492  2.547   1.00 0.00 ? 98  PHE A C    7  
ATOM 10463 O O    . PHE A 1 90 ? -8.820  -8.474  3.735   1.00 0.00 ? 98  PHE A O    7  
ATOM 10464 C CB   . PHE A 1 90 ? -7.619  -6.400  1.485   1.00 0.00 ? 98  PHE A CB   7  
ATOM 10465 C CG   . PHE A 1 90 ? -7.264  -5.245  2.378   1.00 0.00 ? 98  PHE A CG   7  
ATOM 10466 C CD1  . PHE A 1 90 ? -8.124  -4.843  3.388   1.00 0.00 ? 98  PHE A CD1  7  
ATOM 10467 C CD2  . PHE A 1 90 ? -6.071  -4.562  2.207   1.00 0.00 ? 98  PHE A CD2  7  
ATOM 10468 C CE1  . PHE A 1 90 ? -7.800  -3.781  4.211   1.00 0.00 ? 98  PHE A CE1  7  
ATOM 10469 C CE2  . PHE A 1 90 ? -5.741  -3.498  3.028   1.00 0.00 ? 98  PHE A CE2  7  
ATOM 10470 C CZ   . PHE A 1 90 ? -6.608  -3.108  4.030   1.00 0.00 ? 98  PHE A CZ   7  
ATOM 10471 H H    . PHE A 1 90 ? -6.287  -8.142  0.219   1.00 0.00 ? 98  PHE A H    7  
ATOM 10472 H HA   . PHE A 1 90 ? -6.587  -7.610  2.916   1.00 0.00 ? 98  PHE A HA   7  
ATOM 10473 H HB2  . PHE A 1 90 ? -7.104  -6.263  0.547   1.00 0.00 ? 98  PHE A HB2  7  
ATOM 10474 H HB3  . PHE A 1 90 ? -8.686  -6.372  1.312   1.00 0.00 ? 98  PHE A HB3  7  
ATOM 10475 H HD1  . PHE A 1 90 ? -9.056  -5.368  3.530   1.00 0.00 ? 98  PHE A HD1  7  
ATOM 10476 H HD2  . PHE A 1 90 ? -5.394  -4.867  1.424   1.00 0.00 ? 98  PHE A HD2  7  
ATOM 10477 H HE1  . PHE A 1 90 ? -8.478  -3.478  4.994   1.00 0.00 ? 98  PHE A HE1  7  
ATOM 10478 H HE2  . PHE A 1 90 ? -4.808  -2.974  2.884   1.00 0.00 ? 98  PHE A HE2  7  
ATOM 10479 H HZ   . PHE A 1 90 ? -6.351  -2.277  4.672   1.00 0.00 ? 98  PHE A HZ   7  
ATOM 10480 N N    . MET A 1 91 ? -9.196  -9.131  1.616   1.00 0.00 ? 99  MET A N    7  
ATOM 10481 C CA   . MET A 1 91 ? -10.415 -9.863  1.946   1.00 0.00 ? 99  MET A CA   7  
ATOM 10482 C C    . MET A 1 91 ? -10.139 -10.933 2.999   1.00 0.00 ? 99  MET A C    7  
ATOM 10483 O O    . MET A 1 91 ? -9.401  -11.885 2.752   1.00 0.00 ? 99  MET A O    7  
ATOM 10484 C CB   . MET A 1 91 ? -11.003 -10.506 0.689   1.00 0.00 ? 99  MET A CB   7  
ATOM 10485 C CG   . MET A 1 91 ? -11.933 -9.586  -0.085  1.00 0.00 ? 99  MET A CG   7  
ATOM 10486 S SD   . MET A 1 91 ? -13.372 -9.083  0.878   1.00 0.00 ? 99  MET A SD   7  
ATOM 10487 C CE   . MET A 1 91 ? -14.570 -8.800  -0.423  1.00 0.00 ? 99  MET A CE   7  
ATOM 10488 H H    . MET A 1 91 ? -8.887  -9.108  0.686   1.00 0.00 ? 99  MET A H    7  
ATOM 10489 H HA   . MET A 1 91 ? -11.126 -9.157  2.345   1.00 0.00 ? 99  MET A HA   7  
ATOM 10490 H HB2  . MET A 1 91 ? -10.194 -10.798 0.035   1.00 0.00 ? 99  MET A HB2  7  
ATOM 10491 H HB3  . MET A 1 91 ? -11.558 -11.387 0.976   1.00 0.00 ? 99  MET A HB3  7  
ATOM 10492 H HG2  . MET A 1 91 ? -11.386 -8.703  -0.375  1.00 0.00 ? 99  MET A HG2  7  
ATOM 10493 H HG3  . MET A 1 91 ? -12.273 -10.103 -0.971  1.00 0.00 ? 99  MET A HG3  7  
ATOM 10494 H HE1  . MET A 1 91 ? -15.316 -8.098  -0.077  1.00 0.00 ? 99  MET A HE1  7  
ATOM 10495 H HE2  . MET A 1 91 ? -15.046 -9.733  -0.681  1.00 0.00 ? 99  MET A HE2  7  
ATOM 10496 H HE3  . MET A 1 91 ? -14.070 -8.397  -1.289  1.00 0.00 ? 99  MET A HE3  7  
ATOM 10497 N N    . THR A 1 92 ? -10.739 -10.767 4.174   1.00 0.00 ? 100 THR A N    7  
ATOM 10498 C CA   . THR A 1 92 ? -10.558 -11.717 5.267   1.00 0.00 ? 100 THR A CA   7  
ATOM 10499 C C    . THR A 1 92 ? -10.910 -13.135 4.827   1.00 0.00 ? 100 THR A C    7  
ATOM 10500 O O    . THR A 1 92 ? -10.113 -14.059 4.987   1.00 0.00 ? 100 THR A O    7  
ATOM 10501 C CB   . THR A 1 92 ? -11.411 -11.315 6.471   1.00 0.00 ? 100 THR A CB   7  
ATOM 10502 O OG1  . THR A 1 92 ? -11.426 -12.346 7.442   1.00 0.00 ? 100 THR A OG1  7  
ATOM 10503 C CG2  . THR A 1 92 ? -12.848 -10.999 6.115   1.00 0.00 ? 100 THR A CG2  7  
ATOM 10504 H H    . THR A 1 92 ? -11.314 -9.986  4.310   1.00 0.00 ? 100 THR A H    7  
ATOM 10505 H HA   . THR A 1 92 ? -9.516  -11.694 5.553   1.00 0.00 ? 100 THR A HA   7  
ATOM 10506 H HB   . THR A 1 92 ? -10.982 -10.431 6.923   1.00 0.00 ? 100 THR A HB   7  
ATOM 10507 H HG1  . THR A 1 92 ? -11.963 -12.074 8.191   1.00 0.00 ? 100 THR A HG1  7  
ATOM 10508 H HG21 . THR A 1 92 ? -12.921 -10.784 5.060   1.00 0.00 ? 100 THR A HG21 7  
ATOM 10509 H HG22 . THR A 1 92 ? -13.180 -10.141 6.681   1.00 0.00 ? 100 THR A HG22 7  
ATOM 10510 H HG23 . THR A 1 92 ? -13.472 -11.848 6.353   1.00 0.00 ? 100 THR A HG23 7  
ATOM 10511 N N    . THR B 2 1  ? -1.154  -14.643 12.604  1.00 0.00 ? 111 THR B N    7  
ATOM 10512 C CA   . THR B 2 1  ? -0.589  -13.336 12.913  1.00 0.00 ? 111 THR B CA   7  
ATOM 10513 C C    . THR B 2 1  ? -1.261  -12.241 12.089  1.00 0.00 ? 111 THR B C    7  
ATOM 10514 O O    . THR B 2 1  ? -1.632  -12.461 10.936  1.00 0.00 ? 111 THR B O    7  
ATOM 10515 C CB   . THR B 2 1  ? 0.918   -13.334 12.653  1.00 0.00 ? 111 THR B CB   7  
ATOM 10516 O OG1  . THR B 2 1  ? 1.189   -13.535 11.276  1.00 0.00 ? 111 THR B OG1  7  
ATOM 10517 C CG2  . THR B 2 1  ? 1.661   -14.400 13.427  1.00 0.00 ? 111 THR B CG2  7  
ATOM 10518 H H1   . THR B 2 1  ? -0.752  -15.181 11.891  1.00 0.00 ? 111 THR B H1   7  
ATOM 10519 H HA   . THR B 2 1  ? -0.762  -13.139 13.961  1.00 0.00 ? 111 THR B HA   7  
ATOM 10520 H HB   . THR B 2 1  ? 1.322   -12.374 12.942  1.00 0.00 ? 111 THR B HB   7  
ATOM 10521 H HG1  . THR B 2 1  ? 0.848   -14.389 11.005  1.00 0.00 ? 111 THR B HG1  7  
ATOM 10522 H HG21 . THR B 2 1  ? 1.948   -14.009 14.391  1.00 0.00 ? 111 THR B HG21 7  
ATOM 10523 H HG22 . THR B 2 1  ? 2.543   -14.695 12.879  1.00 0.00 ? 111 THR B HG22 7  
ATOM 10524 H HG23 . THR B 2 1  ? 1.018   -15.258 13.565  1.00 0.00 ? 111 THR B HG23 7  
ATOM 10525 N N    . PRO B 2 2  ? -1.427  -11.041 12.671  1.00 0.00 ? 112 PRO B N    7  
ATOM 10526 C CA   . PRO B 2 2  ? -2.057  -9.911  11.987  1.00 0.00 ? 112 PRO B CA   7  
ATOM 10527 C C    . PRO B 2 2  ? -1.091  -9.180  11.062  1.00 0.00 ? 112 PRO B C    7  
ATOM 10528 O O    . PRO B 2 2  ? 0.100   -9.488  11.024  1.00 0.00 ? 112 PRO B O    7  
ATOM 10529 C CB   . PRO B 2 2  ? -2.477  -9.009  13.144  1.00 0.00 ? 112 PRO B CB   7  
ATOM 10530 C CG   . PRO B 2 2  ? -1.449  -9.252  14.197  1.00 0.00 ? 112 PRO B CG   7  
ATOM 10531 C CD   . PRO B 2 2  ? -1.015  -10.689 14.045  1.00 0.00 ? 112 PRO B CD   7  
ATOM 10532 H HA   . PRO B 2 2  ? -2.930  -10.220 11.431  1.00 0.00 ? 112 PRO B HA   7  
ATOM 10533 H HB2  . PRO B 2 2  ? -2.478  -7.979  12.820  1.00 0.00 ? 112 PRO B HB2  7  
ATOM 10534 H HB3  . PRO B 2 2  ? -3.463  -9.288  13.484  1.00 0.00 ? 112 PRO B HB3  7  
ATOM 10535 H HG2  . PRO B 2 2  ? -0.609  -8.591  14.046  1.00 0.00 ? 112 PRO B HG2  7  
ATOM 10536 H HG3  . PRO B 2 2  ? -1.880  -9.092  15.174  1.00 0.00 ? 112 PRO B HG3  7  
ATOM 10537 H HD2  . PRO B 2 2  ? 0.056   -10.772 14.158  1.00 0.00 ? 112 PRO B HD2  7  
ATOM 10538 H HD3  . PRO B 2 2  ? -1.520  -11.312 14.769  1.00 0.00 ? 112 PRO B HD3  7  
ATOM 10539 N N    . LEU B 2 3  ? -1.612  -8.208  10.320  1.00 0.00 ? 113 LEU B N    7  
ATOM 10540 C CA   . LEU B 2 3  ? -0.792  -7.430  9.397   1.00 0.00 ? 113 LEU B CA   7  
ATOM 10541 C C    . LEU B 2 3  ? -0.607  -6.005  9.908   1.00 0.00 ? 113 LEU B C    7  
ATOM 10542 O O    . LEU B 2 3  ? -1.573  -5.334  10.270  1.00 0.00 ? 113 LEU B O    7  
ATOM 10543 C CB   . LEU B 2 3  ? -1.433  -7.409  8.007   1.00 0.00 ? 113 LEU B CB   7  
ATOM 10544 C CG   . LEU B 2 3  ? -1.905  -8.768  7.489   1.00 0.00 ? 113 LEU B CG   7  
ATOM 10545 C CD1  . LEU B 2 3  ? -2.898  -8.588  6.352   1.00 0.00 ? 113 LEU B CD1  7  
ATOM 10546 C CD2  . LEU B 2 3  ? -0.720  -9.608  7.035   1.00 0.00 ? 113 LEU B CD2  7  
ATOM 10547 H H    . LEU B 2 3  ? -2.568  -8.008  10.397  1.00 0.00 ? 113 LEU B H    7  
ATOM 10548 H HA   . LEU B 2 3  ? 0.175   -7.905  9.331   1.00 0.00 ? 113 LEU B HA   7  
ATOM 10549 H HB2  . LEU B 2 3  ? -2.282  -6.741  8.038   1.00 0.00 ? 113 LEU B HB2  7  
ATOM 10550 H HB3  . LEU B 2 3  ? -0.711  -7.013  7.309   1.00 0.00 ? 113 LEU B HB3  7  
ATOM 10551 H HG   . LEU B 2 3  ? -2.405  -9.296  8.288   1.00 0.00 ? 113 LEU B HG   7  
ATOM 10552 H HD11 . LEU B 2 3  ? -3.652  -9.360  6.405   1.00 0.00 ? 113 LEU B HD11 7  
ATOM 10553 H HD12 . LEU B 2 3  ? -2.381  -8.655  5.408   1.00 0.00 ? 113 LEU B HD12 7  
ATOM 10554 H HD13 . LEU B 2 3  ? -3.371  -7.620  6.436   1.00 0.00 ? 113 LEU B HD13 7  
ATOM 10555 H HD21 . LEU B 2 3  ? 0.083   -8.957  6.723   1.00 0.00 ? 113 LEU B HD21 7  
ATOM 10556 H HD22 . LEU B 2 3  ? -1.019  -10.233 6.207   1.00 0.00 ? 113 LEU B HD22 7  
ATOM 10557 H HD23 . LEU B 2 3  ? -0.384  -10.229 7.852   1.00 0.00 ? 113 LEU B HD23 7  
ATOM 10558 N N    . GLU B 2 4  ? 0.641   -5.550  9.936   1.00 0.00 ? 114 GLU B N    7  
ATOM 10559 C CA   . GLU B 2 4  ? 0.954   -4.205  10.404  1.00 0.00 ? 114 GLU B CA   7  
ATOM 10560 C C    . GLU B 2 4  ? 0.503   -3.154  9.394   1.00 0.00 ? 114 GLU B C    7  
ATOM 10561 O O    . GLU B 2 4  ? 0.176   -3.478  8.253   1.00 0.00 ? 114 GLU B O    7  
ATOM 10562 C CB   . GLU B 2 4  ? 2.456   -4.068  10.663  1.00 0.00 ? 114 GLU B CB   7  
ATOM 10563 C CG   . GLU B 2 4  ? 2.950   -4.908  11.831  1.00 0.00 ? 114 GLU B CG   7  
ATOM 10564 C CD   . GLU B 2 4  ? 3.103   -4.101  13.105  1.00 0.00 ? 114 GLU B CD   7  
ATOM 10565 O OE1  . GLU B 2 4  ? 2.486   -3.020  13.202  1.00 0.00 ? 114 GLU B OE1  7  
ATOM 10566 O OE2  . GLU B 2 4  ? 3.842   -4.550  14.007  1.00 0.00 ? 114 GLU B OE2  7  
ATOM 10567 H H    . GLU B 2 4  ? 1.369   -6.133  9.636   1.00 0.00 ? 114 GLU B H    7  
ATOM 10568 H HA   . GLU B 2 4  ? 0.423   -4.046  11.332  1.00 0.00 ? 114 GLU B HA   7  
ATOM 10569 H HB2  . GLU B 2 4  ? 2.991   -4.372  9.777   1.00 0.00 ? 114 GLU B HB2  7  
ATOM 10570 H HB3  . GLU B 2 4  ? 2.681   -3.033  10.872  1.00 0.00 ? 114 GLU B HB3  7  
ATOM 10571 H HG2  . GLU B 2 4  ? 2.243   -5.703  12.010  1.00 0.00 ? 114 GLU B HG2  7  
ATOM 10572 H HG3  . GLU B 2 4  ? 3.909   -5.332  11.572  1.00 0.00 ? 114 GLU B HG3  7  
ATOM 10573 N N    . ILE B 2 5  ? 0.488   -1.897  9.823   1.00 0.00 ? 115 ILE B N    7  
ATOM 10574 C CA   . ILE B 2 5  ? 0.077   -0.799  8.957   1.00 0.00 ? 115 ILE B CA   7  
ATOM 10575 C C    . ILE B 2 5  ? 0.805   0.492   9.318   1.00 0.00 ? 115 ILE B C    7  
ATOM 10576 O O    . ILE B 2 5  ? 0.907   0.851   10.491  1.00 0.00 ? 115 ILE B O    7  
ATOM 10577 C CB   . ILE B 2 5  ? -1.443  -0.555  9.039   1.00 0.00 ? 115 ILE B CB   7  
ATOM 10578 C CG1  . ILE B 2 5  ? -2.203  -1.876  8.893   1.00 0.00 ? 115 ILE B CG1  7  
ATOM 10579 C CG2  . ILE B 2 5  ? -1.880  0.435   7.971   1.00 0.00 ? 115 ILE B CG2  7  
ATOM 10580 C CD1  . ILE B 2 5  ? -3.707  -1.719  8.965   1.00 0.00 ? 115 ILE B CD1  7  
ATOM 10581 H H    . ILE B 2 5  ? 0.759   -1.702  10.745  1.00 0.00 ? 115 ILE B H    7  
ATOM 10582 H HA   . ILE B 2 5  ? 0.322   -1.066  7.939   1.00 0.00 ? 115 ILE B HA   7  
ATOM 10583 H HB   . ILE B 2 5  ? -1.664  -0.126  10.004  1.00 0.00 ? 115 ILE B HB   7  
ATOM 10584 H HG12 . ILE B 2 5  ? -1.962  -2.318  7.939   1.00 0.00 ? 115 ILE B HG12 7  
ATOM 10585 H HG13 . ILE B 2 5  ? -1.899  -2.546  9.683   1.00 0.00 ? 115 ILE B HG13 7  
ATOM 10586 H HG21 . ILE B 2 5  ? -1.033  1.032   7.664   1.00 0.00 ? 115 ILE B HG21 7  
ATOM 10587 H HG22 . ILE B 2 5  ? -2.649  1.081   8.371   1.00 0.00 ? 115 ILE B HG22 7  
ATOM 10588 H HG23 . ILE B 2 5  ? -2.268  -0.102  7.119   1.00 0.00 ? 115 ILE B HG23 7  
ATOM 10589 H HD11 . ILE B 2 5  ? -4.118  -1.730  7.968   1.00 0.00 ? 115 ILE B HD11 7  
ATOM 10590 H HD12 . ILE B 2 5  ? -3.947  -0.781  9.445   1.00 0.00 ? 115 ILE B HD12 7  
ATOM 10591 H HD13 . ILE B 2 5  ? -4.126  -2.533  9.537   1.00 0.00 ? 115 ILE B HD13 7  
ATOM 10592 N N    . THR B 2 6  ? 1.311   1.187   8.302   1.00 0.00 ? 116 THR B N    7  
ATOM 10593 C CA   . THR B 2 6  ? 2.029   2.439   8.515   1.00 0.00 ? 116 THR B CA   7  
ATOM 10594 C C    . THR B 2 6  ? 1.366   3.582   7.754   1.00 0.00 ? 116 THR B C    7  
ATOM 10595 O O    . THR B 2 6  ? 0.854   3.392   6.649   1.00 0.00 ? 116 THR B O    7  
ATOM 10596 C CB   . THR B 2 6  ? 3.488   2.296   8.075   1.00 0.00 ? 116 THR B CB   7  
ATOM 10597 O OG1  . THR B 2 6  ? 4.138   1.279   8.817   1.00 0.00 ? 116 THR B OG1  7  
ATOM 10598 C CG2  . THR B 2 6  ? 4.294   3.567   8.241   1.00 0.00 ? 116 THR B CG2  7  
ATOM 10599 H H    . THR B 2 6  ? 1.197   0.850   7.390   1.00 0.00 ? 116 THR B H    7  
ATOM 10600 H HA   . THR B 2 6  ? 2.002   2.661   9.571   1.00 0.00 ? 116 THR B HA   7  
ATOM 10601 H HB   . THR B 2 6  ? 3.513   2.022   7.030   1.00 0.00 ? 116 THR B HB   7  
ATOM 10602 H HG1  . THR B 2 6  ? 4.851   0.905   8.292   1.00 0.00 ? 116 THR B HG1  7  
ATOM 10603 H HG21 . THR B 2 6  ? 3.910   4.324   7.572   1.00 0.00 ? 116 THR B HG21 7  
ATOM 10604 H HG22 . THR B 2 6  ? 5.329   3.370   8.008   1.00 0.00 ? 116 THR B HG22 7  
ATOM 10605 H HG23 . THR B 2 6  ? 4.212   3.914   9.260   1.00 0.00 ? 116 THR B HG23 7  
ATOM 10606 N N    . GLU B 2 7  ? 1.379   4.769   8.352   1.00 0.00 ? 117 GLU B N    7  
ATOM 10607 C CA   . GLU B 2 7  ? 0.780   5.945   7.731   1.00 0.00 ? 117 GLU B CA   7  
ATOM 10608 C C    . GLU B 2 7  ? 1.792   6.669   6.850   1.00 0.00 ? 117 GLU B C    7  
ATOM 10609 O O    . GLU B 2 7  ? 2.990   6.671   7.134   1.00 0.00 ? 117 GLU B O    7  
ATOM 10610 C CB   . GLU B 2 7  ? 0.249   6.897   8.804   1.00 0.00 ? 117 GLU B CB   7  
ATOM 10611 C CG   . GLU B 2 7  ? -1.199  6.634   9.188   1.00 0.00 ? 117 GLU B CG   7  
ATOM 10612 C CD   . GLU B 2 7  ? -1.712  7.612   10.228  1.00 0.00 ? 117 GLU B CD   7  
ATOM 10613 O OE1  . GLU B 2 7  ? -1.295  7.503   11.401  1.00 0.00 ? 117 GLU B OE1  7  
ATOM 10614 O OE2  . GLU B 2 7  ? -2.529  8.484   9.870   1.00 0.00 ? 117 GLU B OE2  7  
ATOM 10615 H H    . GLU B 2 7  ? 1.802   4.856   9.230   1.00 0.00 ? 117 GLU B H    7  
ATOM 10616 H HA   . GLU B 2 7  ? -0.044  5.613   7.117   1.00 0.00 ? 117 GLU B HA   7  
ATOM 10617 H HB2  . GLU B 2 7  ? 0.857   6.798   9.690   1.00 0.00 ? 117 GLU B HB2  7  
ATOM 10618 H HB3  . GLU B 2 7  ? 0.323   7.910   8.439   1.00 0.00 ? 117 GLU B HB3  7  
ATOM 10619 H HG2  . GLU B 2 7  ? -1.813  6.719   8.304   1.00 0.00 ? 117 GLU B HG2  7  
ATOM 10620 H HG3  . GLU B 2 7  ? -1.276  5.633   9.586   1.00 0.00 ? 117 GLU B HG3  7  
ATOM 10621 N N    . LEU B 2 8  ? 1.302   7.283   5.778   1.00 0.00 ? 118 LEU B N    7  
ATOM 10622 C CA   . LEU B 2 8  ? 2.163   8.013   4.854   1.00 0.00 ? 118 LEU B CA   7  
ATOM 10623 C C    . LEU B 2 8  ? 1.573   9.380   4.524   1.00 0.00 ? 118 LEU B C    7  
ATOM 10624 O O    . LEU B 2 8  ? 0.333   9.519   4.584   1.00 0.00 ? 118 LEU B O    7  
ATOM 10625 C CB   . LEU B 2 8  ? 2.364   7.207   3.570   1.00 0.00 ? 118 LEU B CB   7  
ATOM 10626 C CG   . LEU B 2 8  ? 2.943   5.803   3.769   1.00 0.00 ? 118 LEU B CG   7  
ATOM 10627 C CD1  . LEU B 2 8  ? 2.183   4.787   2.931   1.00 0.00 ? 118 LEU B CD1  7  
ATOM 10628 C CD2  . LEU B 2 8  ? 4.424   5.783   3.421   1.00 0.00 ? 118 LEU B CD2  7  
ATOM 10629 O OXT  . LEU B 2 8  ? 2.357   10.300  4.209   1.00 0.00 ? 118 LEU B OXT  7  
ATOM 10630 H H    . LEU B 2 8  ? 0.338   7.246   5.606   1.00 0.00 ? 118 LEU B H    7  
ATOM 10631 H HA   . LEU B 2 8  ? 3.120   8.153   5.334   1.00 0.00 ? 118 LEU B HA   7  
ATOM 10632 H HB2  . LEU B 2 8  ? 1.408   7.116   3.075   1.00 0.00 ? 118 LEU B HB2  7  
ATOM 10633 H HB3  . LEU B 2 8  ? 3.032   7.759   2.925   1.00 0.00 ? 118 LEU B HB3  7  
ATOM 10634 H HG   . LEU B 2 8  ? 2.838   5.523   4.806   1.00 0.00 ? 118 LEU B HG   7  
ATOM 10635 H HD11 . LEU B 2 8  ? 1.804   5.265   2.040   1.00 0.00 ? 118 LEU B HD11 7  
ATOM 10636 H HD12 . LEU B 2 8  ? 1.359   4.390   3.505   1.00 0.00 ? 118 LEU B HD12 7  
ATOM 10637 H HD13 . LEU B 2 8  ? 2.847   3.981   2.652   1.00 0.00 ? 118 LEU B HD13 7  
ATOM 10638 H HD21 . LEU B 2 8  ? 4.820   6.786   3.468   1.00 0.00 ? 118 LEU B HD21 7  
ATOM 10639 H HD22 . LEU B 2 8  ? 4.555   5.390   2.423   1.00 0.00 ? 118 LEU B HD22 7  
ATOM 10640 H HD23 . LEU B 2 8  ? 4.950   5.155   4.127   1.00 0.00 ? 118 LEU B HD23 7  
ATOM 10641 N N    . LYS A 1 1  ? -5.445  -2.106  -15.682 1.00 0.00 ? 9   LYS A N    8  
ATOM 10642 C CA   . LYS A 1 1  ? -4.918  -2.818  -14.487 1.00 0.00 ? 9   LYS A CA   8  
ATOM 10643 C C    . LYS A 1 1  ? -3.844  -1.991  -13.784 1.00 0.00 ? 9   LYS A C    8  
ATOM 10644 O O    . LYS A 1 1  ? -4.062  -1.475  -12.690 1.00 0.00 ? 9   LYS A O    8  
ATOM 10645 C CB   . LYS A 1 1  ? -4.341  -4.162  -14.936 1.00 0.00 ? 9   LYS A CB   8  
ATOM 10646 C CG   . LYS A 1 1  ? -5.376  -5.095  -15.541 1.00 0.00 ? 9   LYS A CG   8  
ATOM 10647 C CD   . LYS A 1 1  ? -5.034  -6.553  -15.278 1.00 0.00 ? 9   LYS A CD   8  
ATOM 10648 C CE   . LYS A 1 1  ? -5.342  -6.945  -13.842 1.00 0.00 ? 9   LYS A CE   8  
ATOM 10649 N NZ   . LYS A 1 1  ? -4.413  -7.996  -13.343 1.00 0.00 ? 9   LYS A NZ   8  
ATOM 10650 H H1   . LYS A 1 1  ? -6.004  -1.296  -15.346 1.00 0.00 ? 9   LYS A H1   8  
ATOM 10651 H H2   . LYS A 1 1  ? -6.037  -2.778  -16.212 1.00 0.00 ? 9   LYS A H2   8  
ATOM 10652 H H3   . LYS A 1 1  ? -4.632  -1.792  -16.248 1.00 0.00 ? 9   LYS A H3   8  
ATOM 10653 H HA   . LYS A 1 1  ? -5.733  -2.991  -13.801 1.00 0.00 ? 9   LYS A HA   8  
ATOM 10654 H HB2  . LYS A 1 1  ? -3.573  -3.983  -15.674 1.00 0.00 ? 9   LYS A HB2  8  
ATOM 10655 H HB3  . LYS A 1 1  ? -3.900  -4.653  -14.081 1.00 0.00 ? 9   LYS A HB3  8  
ATOM 10656 H HG2  . LYS A 1 1  ? -6.340  -4.877  -15.108 1.00 0.00 ? 9   LYS A HG2  8  
ATOM 10657 H HG3  . LYS A 1 1  ? -5.413  -4.930  -16.608 1.00 0.00 ? 9   LYS A HG3  8  
ATOM 10658 H HD2  . LYS A 1 1  ? -5.615  -7.173  -15.943 1.00 0.00 ? 9   LYS A HD2  8  
ATOM 10659 H HD3  . LYS A 1 1  ? -3.982  -6.705  -15.467 1.00 0.00 ? 9   LYS A HD3  8  
ATOM 10660 H HE2  . LYS A 1 1  ? -5.253  -6.070  -13.215 1.00 0.00 ? 9   LYS A HE2  8  
ATOM 10661 H HE3  . LYS A 1 1  ? -6.354  -7.319  -13.794 1.00 0.00 ? 9   LYS A HE3  8  
ATOM 10662 H HZ1  . LYS A 1 1  ? -4.899  -8.603  -12.652 1.00 0.00 ? 9   LYS A HZ1  8  
ATOM 10663 H HZ2  . LYS A 1 1  ? -3.590  -7.556  -12.883 1.00 0.00 ? 9   LYS A HZ2  8  
ATOM 10664 H HZ3  . LYS A 1 1  ? -4.082  -8.584  -14.132 1.00 0.00 ? 9   LYS A HZ3  8  
ATOM 10665 N N    . GLU A 1 2  ? -2.684  -1.871  -14.423 1.00 0.00 ? 10  GLU A N    8  
ATOM 10666 C CA   . GLU A 1 2  ? -1.578  -1.107  -13.860 1.00 0.00 ? 10  GLU A CA   8  
ATOM 10667 C C    . GLU A 1 2  ? -1.926  0.377   -13.791 1.00 0.00 ? 10  GLU A C    8  
ATOM 10668 O O    . GLU A 1 2  ? -2.111  1.030   -14.818 1.00 0.00 ? 10  GLU A O    8  
ATOM 10669 C CB   . GLU A 1 2  ? -0.312  -1.311  -14.697 1.00 0.00 ? 10  GLU A CB   8  
ATOM 10670 C CG   . GLU A 1 2  ? 0.750   -2.146  -14.000 1.00 0.00 ? 10  GLU A CG   8  
ATOM 10671 C CD   . GLU A 1 2  ? 0.544   -3.635  -14.196 1.00 0.00 ? 10  GLU A CD   8  
ATOM 10672 O OE1  . GLU A 1 2  ? 0.011   -4.026  -15.256 1.00 0.00 ? 10  GLU A OE1  8  
ATOM 10673 O OE2  . GLU A 1 2  ? 0.917   -4.410  -13.291 1.00 0.00 ? 10  GLU A OE2  8  
ATOM 10674 H H    . GLU A 1 2  ? -2.571  -2.306  -15.294 1.00 0.00 ? 10  GLU A H    8  
ATOM 10675 H HA   . GLU A 1 2  ? -1.401  -1.470  -12.859 1.00 0.00 ? 10  GLU A HA   8  
ATOM 10676 H HB2  . GLU A 1 2  ? -0.580  -1.807  -15.618 1.00 0.00 ? 10  GLU A HB2  8  
ATOM 10677 H HB3  . GLU A 1 2  ? 0.114   -0.346  -14.929 1.00 0.00 ? 10  GLU A HB3  8  
ATOM 10678 H HG2  . GLU A 1 2  ? 1.718   -1.877  -14.396 1.00 0.00 ? 10  GLU A HG2  8  
ATOM 10679 H HG3  . GLU A 1 2  ? 0.722   -1.929  -12.941 1.00 0.00 ? 10  GLU A HG3  8  
ATOM 10680 N N    . LYS A 1 3  ? -2.013  0.905   -12.574 1.00 0.00 ? 11  LYS A N    8  
ATOM 10681 C CA   . LYS A 1 3  ? -2.341  2.313   -12.375 1.00 0.00 ? 11  LYS A CA   8  
ATOM 10682 C C    . LYS A 1 3  ? -1.093  3.125   -12.033 1.00 0.00 ? 11  LYS A C    8  
ATOM 10683 O O    . LYS A 1 3  ? -0.195  2.647   -11.339 1.00 0.00 ? 11  LYS A O    8  
ATOM 10684 C CB   . LYS A 1 3  ? -3.390  2.464   -11.268 1.00 0.00 ? 11  LYS A CB   8  
ATOM 10685 C CG   . LYS A 1 3  ? -3.731  3.909   -10.942 1.00 0.00 ? 11  LYS A CG   8  
ATOM 10686 C CD   . LYS A 1 3  ? -4.992  4.006   -10.097 1.00 0.00 ? 11  LYS A CD   8  
ATOM 10687 C CE   . LYS A 1 3  ? -4.709  3.701   -8.635  1.00 0.00 ? 11  LYS A CE   8  
ATOM 10688 N NZ   . LYS A 1 3  ? -5.938  3.792   -7.799  1.00 0.00 ? 11  LYS A NZ   8  
ATOM 10689 H H    . LYS A 1 3  ? -1.855  0.332   -11.791 1.00 0.00 ? 11  LYS A H    8  
ATOM 10690 H HA   . LYS A 1 3  ? -2.754  2.688   -13.300 1.00 0.00 ? 11  LYS A HA   8  
ATOM 10691 H HB2  . LYS A 1 3  ? -4.296  1.965   -11.579 1.00 0.00 ? 11  LYS A HB2  8  
ATOM 10692 H HB3  . LYS A 1 3  ? -3.022  1.991   -10.370 1.00 0.00 ? 11  LYS A HB3  8  
ATOM 10693 H HG2  . LYS A 1 3  ? -2.911  4.349   -10.396 1.00 0.00 ? 11  LYS A HG2  8  
ATOM 10694 H HG3  . LYS A 1 3  ? -3.885  4.450   -11.865 1.00 0.00 ? 11  LYS A HG3  8  
ATOM 10695 H HD2  . LYS A 1 3  ? -5.389  5.007   -10.174 1.00 0.00 ? 11  LYS A HD2  8  
ATOM 10696 H HD3  . LYS A 1 3  ? -5.718  3.299   -10.469 1.00 0.00 ? 11  LYS A HD3  8  
ATOM 10697 H HE2  . LYS A 1 3  ? -4.307  2.701   -8.562  1.00 0.00 ? 11  LYS A HE2  8  
ATOM 10698 H HE3  . LYS A 1 3  ? -3.979  4.408   -8.268  1.00 0.00 ? 11  LYS A HE3  8  
ATOM 10699 H HZ1  . LYS A 1 3  ? -6.056  4.762   -7.444  1.00 0.00 ? 11  LYS A HZ1  8  
ATOM 10700 H HZ2  . LYS A 1 3  ? -5.868  3.144   -6.989  1.00 0.00 ? 11  LYS A HZ2  8  
ATOM 10701 H HZ3  . LYS A 1 3  ? -6.772  3.536   -8.364  1.00 0.00 ? 11  LYS A HZ3  8  
ATOM 10702 N N    . LYS A 1 4  ? -1.041  4.359   -12.528 1.00 0.00 ? 12  LYS A N    8  
ATOM 10703 C CA   . LYS A 1 4  ? 0.096   5.235   -12.275 1.00 0.00 ? 12  LYS A CA   8  
ATOM 10704 C C    . LYS A 1 4  ? -0.263  6.309   -11.253 1.00 0.00 ? 12  LYS A C    8  
ATOM 10705 O O    . LYS A 1 4  ? -1.297  6.968   -11.367 1.00 0.00 ? 12  LYS A O    8  
ATOM 10706 C CB   . LYS A 1 4  ? 0.566   5.887   -13.579 1.00 0.00 ? 12  LYS A CB   8  
ATOM 10707 C CG   . LYS A 1 4  ? 1.911   5.373   -14.064 1.00 0.00 ? 12  LYS A CG   8  
ATOM 10708 C CD   . LYS A 1 4  ? 3.043   6.301   -13.654 1.00 0.00 ? 12  LYS A CD   8  
ATOM 10709 C CE   . LYS A 1 4  ? 4.365   5.555   -13.548 1.00 0.00 ? 12  LYS A CE   8  
ATOM 10710 N NZ   . LYS A 1 4  ? 5.129   5.596   -14.826 1.00 0.00 ? 12  LYS A NZ   8  
ATOM 10711 H H    . LYS A 1 4  ? -1.786  4.686   -13.075 1.00 0.00 ? 12  LYS A H    8  
ATOM 10712 H HA   . LYS A 1 4  ? 0.896   4.631   -11.876 1.00 0.00 ? 12  LYS A HA   8  
ATOM 10713 H HB2  . LYS A 1 4  ? -0.166  5.695   -14.347 1.00 0.00 ? 12  LYS A HB2  8  
ATOM 10714 H HB3  . LYS A 1 4  ? 0.646   6.954   -13.428 1.00 0.00 ? 12  LYS A HB3  8  
ATOM 10715 H HG2  . LYS A 1 4  ? 2.088   4.397   -13.637 1.00 0.00 ? 12  LYS A HG2  8  
ATOM 10716 H HG3  . LYS A 1 4  ? 1.890   5.300   -15.141 1.00 0.00 ? 12  LYS A HG3  8  
ATOM 10717 H HD2  . LYS A 1 4  ? 3.141   7.082   -14.391 1.00 0.00 ? 12  LYS A HD2  8  
ATOM 10718 H HD3  . LYS A 1 4  ? 2.809   6.736   -12.692 1.00 0.00 ? 12  LYS A HD3  8  
ATOM 10719 H HE2  . LYS A 1 4  ? 4.959   6.009   -12.770 1.00 0.00 ? 12  LYS A HE2  8  
ATOM 10720 H HE3  . LYS A 1 4  ? 4.163   4.526   -13.293 1.00 0.00 ? 12  LYS A HE3  8  
ATOM 10721 H HZ1  . LYS A 1 4  ? 4.958   4.728   -15.373 1.00 0.00 ? 12  LYS A HZ1  8  
ATOM 10722 H HZ2  . LYS A 1 4  ? 6.148   5.675   -14.631 1.00 0.00 ? 12  LYS A HZ2  8  
ATOM 10723 H HZ3  . LYS A 1 4  ? 4.832   6.416   -15.395 1.00 0.00 ? 12  LYS A HZ3  8  
ATOM 10724 N N    . VAL A 1 5  ? 0.597   6.477   -10.253 1.00 0.00 ? 13  VAL A N    8  
ATOM 10725 C CA   . VAL A 1 5  ? 0.369   7.470   -9.210  1.00 0.00 ? 13  VAL A CA   8  
ATOM 10726 C C    . VAL A 1 5  ? 1.659   8.208   -8.863  1.00 0.00 ? 13  VAL A C    8  
ATOM 10727 O O    . VAL A 1 5  ? 2.742   7.624   -8.873  1.00 0.00 ? 13  VAL A O    8  
ATOM 10728 C CB   . VAL A 1 5  ? -0.200  6.820   -7.933  1.00 0.00 ? 13  VAL A CB   8  
ATOM 10729 C CG1  . VAL A 1 5  ? -0.523  7.878   -6.889  1.00 0.00 ? 13  VAL A CG1  8  
ATOM 10730 C CG2  . VAL A 1 5  ? -1.432  5.993   -8.262  1.00 0.00 ? 13  VAL A CG2  8  
ATOM 10731 H H    . VAL A 1 5  ? 1.401   5.921   -10.215 1.00 0.00 ? 13  VAL A H    8  
ATOM 10732 H HA   . VAL A 1 5  ? -0.354  8.184   -9.579  1.00 0.00 ? 13  VAL A HA   8  
ATOM 10733 H HB   . VAL A 1 5  ? 0.551   6.161   -7.523  1.00 0.00 ? 13  VAL A HB   8  
ATOM 10734 H HG11 . VAL A 1 5  ? 0.321   8.000   -6.226  1.00 0.00 ? 13  VAL A HG11 8  
ATOM 10735 H HG12 . VAL A 1 5  ? -1.386  7.567   -6.317  1.00 0.00 ? 13  VAL A HG12 8  
ATOM 10736 H HG13 . VAL A 1 5  ? -0.735  8.817   -7.380  1.00 0.00 ? 13  VAL A HG13 8  
ATOM 10737 H HG21 . VAL A 1 5  ? -1.205  5.316   -9.072  1.00 0.00 ? 13  VAL A HG21 8  
ATOM 10738 H HG22 . VAL A 1 5  ? -2.237  6.649   -8.556  1.00 0.00 ? 13  VAL A HG22 8  
ATOM 10739 H HG23 . VAL A 1 5  ? -1.728  5.427   -7.391  1.00 0.00 ? 13  VAL A HG23 8  
ATOM 10740 N N    . PHE A 1 6  ? 1.533   9.495   -8.559  1.00 0.00 ? 14  PHE A N    8  
ATOM 10741 C CA   . PHE A 1 6  ? 2.687   10.315  -8.208  1.00 0.00 ? 14  PHE A CA   8  
ATOM 10742 C C    . PHE A 1 6  ? 2.431   11.085  -6.916  1.00 0.00 ? 14  PHE A C    8  
ATOM 10743 O O    . PHE A 1 6  ? 1.436   11.800  -6.795  1.00 0.00 ? 14  PHE A O    8  
ATOM 10744 C CB   . PHE A 1 6  ? 3.013   11.292  -9.341  1.00 0.00 ? 14  PHE A CB   8  
ATOM 10745 C CG   . PHE A 1 6  ? 2.868   10.698  -10.713 1.00 0.00 ? 14  PHE A CG   8  
ATOM 10746 C CD1  . PHE A 1 6  ? 1.620   10.585  -11.305 1.00 0.00 ? 14  PHE A CD1  8  
ATOM 10747 C CD2  . PHE A 1 6  ? 3.979   10.250  -11.411 1.00 0.00 ? 14  PHE A CD2  8  
ATOM 10748 C CE1  . PHE A 1 6  ? 1.482   10.039  -12.566 1.00 0.00 ? 14  PHE A CE1  8  
ATOM 10749 C CE2  . PHE A 1 6  ? 3.848   9.702   -12.673 1.00 0.00 ? 14  PHE A CE2  8  
ATOM 10750 C CZ   . PHE A 1 6  ? 2.597   9.596   -13.252 1.00 0.00 ? 14  PHE A CZ   8  
ATOM 10751 H H    . PHE A 1 6  ? 0.642   9.905   -8.568  1.00 0.00 ? 14  PHE A H    8  
ATOM 10752 H HA   . PHE A 1 6  ? 3.530   9.655   -8.059  1.00 0.00 ? 14  PHE A HA   8  
ATOM 10753 H HB2  . PHE A 1 6  ? 2.348   12.141  -9.276  1.00 0.00 ? 14  PHE A HB2  8  
ATOM 10754 H HB3  . PHE A 1 6  ? 4.033   11.632  -9.231  1.00 0.00 ? 14  PHE A HB3  8  
ATOM 10755 H HD1  . PHE A 1 6  ? 0.746   10.931  -10.770 1.00 0.00 ? 14  PHE A HD1  8  
ATOM 10756 H HD2  . PHE A 1 6  ? 4.957   10.332  -10.959 1.00 0.00 ? 14  PHE A HD2  8  
ATOM 10757 H HE1  . PHE A 1 6  ? 0.504   9.957   -13.017 1.00 0.00 ? 14  PHE A HE1  8  
ATOM 10758 H HE2  . PHE A 1 6  ? 4.721   9.358   -13.207 1.00 0.00 ? 14  PHE A HE2  8  
ATOM 10759 H HZ   . PHE A 1 6  ? 2.493   9.170   -14.238 1.00 0.00 ? 14  PHE A HZ   8  
ATOM 10760 N N    . ILE A 1 7  ? 3.333   10.933  -5.951  1.00 0.00 ? 15  ILE A N    8  
ATOM 10761 C CA   . ILE A 1 7  ? 3.200   11.613  -4.668  1.00 0.00 ? 15  ILE A CA   8  
ATOM 10762 C C    . ILE A 1 7  ? 4.309   12.641  -4.472  1.00 0.00 ? 15  ILE A C    8  
ATOM 10763 O O    . ILE A 1 7  ? 5.491   12.300  -4.467  1.00 0.00 ? 15  ILE A O    8  
ATOM 10764 C CB   . ILE A 1 7  ? 3.228   10.614  -3.496  1.00 0.00 ? 15  ILE A CB   8  
ATOM 10765 C CG1  . ILE A 1 7  ? 2.234   9.477   -3.745  1.00 0.00 ? 15  ILE A CG1  8  
ATOM 10766 C CG2  . ILE A 1 7  ? 2.914   11.322  -2.187  1.00 0.00 ? 15  ILE A CG2  8  
ATOM 10767 C CD1  . ILE A 1 7  ? 0.809   9.950   -3.929  1.00 0.00 ? 15  ILE A CD1  8  
ATOM 10768 H H    . ILE A 1 7  ? 4.105   10.348  -6.105  1.00 0.00 ? 15  ILE A H    8  
ATOM 10769 H HA   . ILE A 1 7  ? 2.247   12.121  -4.658  1.00 0.00 ? 15  ILE A HA   8  
ATOM 10770 H HB   . ILE A 1 7  ? 4.224   10.203  -3.426  1.00 0.00 ? 15  ILE A HB   8  
ATOM 10771 H HG12 . ILE A 1 7  ? 2.524   8.942   -4.636  1.00 0.00 ? 15  ILE A HG12 8  
ATOM 10772 H HG13 . ILE A 1 7  ? 2.254   8.801   -2.901  1.00 0.00 ? 15  ILE A HG13 8  
ATOM 10773 H HG21 . ILE A 1 7  ? 3.691   12.042  -1.970  1.00 0.00 ? 15  ILE A HG21 8  
ATOM 10774 H HG22 . ILE A 1 7  ? 2.865   10.596  -1.388  1.00 0.00 ? 15  ILE A HG22 8  
ATOM 10775 H HG23 . ILE A 1 7  ? 1.965   11.832  -2.270  1.00 0.00 ? 15  ILE A HG23 8  
ATOM 10776 H HD11 . ILE A 1 7  ? 0.715   10.441  -4.887  1.00 0.00 ? 15  ILE A HD11 8  
ATOM 10777 H HD12 . ILE A 1 7  ? 0.555   10.644  -3.143  1.00 0.00 ? 15  ILE A HD12 8  
ATOM 10778 H HD13 . ILE A 1 7  ? 0.142   9.103   -3.892  1.00 0.00 ? 15  ILE A HD13 8  
ATOM 10779 N N    . SER A 1 8  ? 3.918   13.902  -4.313  1.00 0.00 ? 16  SER A N    8  
ATOM 10780 C CA   . SER A 1 8  ? 4.880   14.981  -4.117  1.00 0.00 ? 16  SER A CA   8  
ATOM 10781 C C    . SER A 1 8  ? 4.373   15.977  -3.078  1.00 0.00 ? 16  SER A C    8  
ATOM 10782 O O    . SER A 1 8  ? 3.207   16.372  -3.099  1.00 0.00 ? 16  SER A O    8  
ATOM 10783 C CB   . SER A 1 8  ? 5.148   15.700  -5.440  1.00 0.00 ? 16  SER A CB   8  
ATOM 10784 O OG   . SER A 1 8  ? 3.960   16.277  -5.958  1.00 0.00 ? 16  SER A OG   8  
ATOM 10785 H H    . SER A 1 8  ? 2.961   14.111  -4.327  1.00 0.00 ? 16  SER A H    8  
ATOM 10786 H HA   . SER A 1 8  ? 5.800   14.545  -3.761  1.00 0.00 ? 16  SER A HA   8  
ATOM 10787 H HB2  . SER A 1 8  ? 5.873   16.485  -5.281  1.00 0.00 ? 16  SER A HB2  8  
ATOM 10788 H HB3  . SER A 1 8  ? 5.535   14.994  -6.160  1.00 0.00 ? 16  SER A HB3  8  
ATOM 10789 H HG   . SER A 1 8  ? 3.275   15.606  -6.008  1.00 0.00 ? 16  SER A HG   8  
ATOM 10790 N N    . LEU A 1 9  ? 5.256   16.378  -2.170  1.00 0.00 ? 17  LEU A N    8  
ATOM 10791 C CA   . LEU A 1 9  ? 4.898   17.327  -1.123  1.00 0.00 ? 17  LEU A CA   8  
ATOM 10792 C C    . LEU A 1 9  ? 4.529   18.681  -1.720  1.00 0.00 ? 17  LEU A C    8  
ATOM 10793 O O    . LEU A 1 9  ? 5.397   19.434  -2.161  1.00 0.00 ? 17  LEU A O    8  
ATOM 10794 C CB   . LEU A 1 9  ? 6.055   17.486  -0.134  1.00 0.00 ? 17  LEU A CB   8  
ATOM 10795 C CG   . LEU A 1 9  ? 5.695   17.226  1.331   1.00 0.00 ? 17  LEU A CG   8  
ATOM 10796 C CD1  . LEU A 1 9  ? 4.681   18.249  1.819   1.00 0.00 ? 17  LEU A CD1  8  
ATOM 10797 C CD2  . LEU A 1 9  ? 5.156   15.814  1.504   1.00 0.00 ? 17  LEU A CD2  8  
ATOM 10798 H H    . LEU A 1 9  ? 6.171   16.027  -2.206  1.00 0.00 ? 17  LEU A H    8  
ATOM 10799 H HA   . LEU A 1 9  ? 4.041   16.932  -0.599  1.00 0.00 ? 17  LEU A HA   8  
ATOM 10800 H HB2  . LEU A 1 9  ? 6.840   16.798  -0.417  1.00 0.00 ? 17  LEU A HB2  8  
ATOM 10801 H HB3  . LEU A 1 9  ? 6.437   18.493  -0.213  1.00 0.00 ? 17  LEU A HB3  8  
ATOM 10802 H HG   . LEU A 1 9  ? 6.584   17.323  1.937   1.00 0.00 ? 17  LEU A HG   8  
ATOM 10803 H HD11 . LEU A 1 9  ? 4.218   17.892  2.728   1.00 0.00 ? 17  LEU A HD11 8  
ATOM 10804 H HD12 . LEU A 1 9  ? 3.923   18.395  1.062   1.00 0.00 ? 17  LEU A HD12 8  
ATOM 10805 H HD13 . LEU A 1 9  ? 5.180   19.187  2.014   1.00 0.00 ? 17  LEU A HD13 8  
ATOM 10806 H HD21 . LEU A 1 9  ? 4.391   15.811  2.265   1.00 0.00 ? 17  LEU A HD21 8  
ATOM 10807 H HD22 . LEU A 1 9  ? 5.961   15.156  1.797   1.00 0.00 ? 17  LEU A HD22 8  
ATOM 10808 H HD23 . LEU A 1 9  ? 4.736   15.473  0.569   1.00 0.00 ? 17  LEU A HD23 8  
ATOM 10809 N N    . VAL A 1 10 ? 3.235   18.985  -1.730  1.00 0.00 ? 18  VAL A N    8  
ATOM 10810 C CA   . VAL A 1 10 ? 2.751   20.248  -2.271  1.00 0.00 ? 18  VAL A CA   8  
ATOM 10811 C C    . VAL A 1 10 ? 2.994   21.394  -1.296  1.00 0.00 ? 18  VAL A C    8  
ATOM 10812 O O    . VAL A 1 10 ? 3.241   22.529  -1.703  1.00 0.00 ? 18  VAL A O    8  
ATOM 10813 C CB   . VAL A 1 10 ? 1.248   20.179  -2.600  1.00 0.00 ? 18  VAL A CB   8  
ATOM 10814 C CG1  . VAL A 1 10 ? 0.986   19.157  -3.696  1.00 0.00 ? 18  VAL A CG1  8  
ATOM 10815 C CG2  . VAL A 1 10 ? 0.440   19.854  -1.352  1.00 0.00 ? 18  VAL A CG2  8  
ATOM 10816 H H    . VAL A 1 10 ? 2.591   18.343  -1.363  1.00 0.00 ? 18  VAL A H    8  
ATOM 10817 H HA   . VAL A 1 10 ? 3.290   20.448  -3.187  1.00 0.00 ? 18  VAL A HA   8  
ATOM 10818 H HB   . VAL A 1 10 ? 0.935   21.148  -2.964  1.00 0.00 ? 18  VAL A HB   8  
ATOM 10819 H HG11 . VAL A 1 10 ? 0.222   19.530  -4.362  1.00 0.00 ? 18  VAL A HG11 8  
ATOM 10820 H HG12 . VAL A 1 10 ? 0.654   18.230  -3.251  1.00 0.00 ? 18  VAL A HG12 8  
ATOM 10821 H HG13 . VAL A 1 10 ? 1.896   18.984  -4.252  1.00 0.00 ? 18  VAL A HG13 8  
ATOM 10822 H HG21 . VAL A 1 10 ? 1.089   19.419  -0.607  1.00 0.00 ? 18  VAL A HG21 8  
ATOM 10823 H HG22 . VAL A 1 10 ? -0.343  19.153  -1.601  1.00 0.00 ? 18  VAL A HG22 8  
ATOM 10824 H HG23 . VAL A 1 10 ? 0.001   20.761  -0.962  1.00 0.00 ? 18  VAL A HG23 8  
ATOM 10825 N N    . GLY A 1 11 ? 2.923   21.089  -0.004  1.00 0.00 ? 19  GLY A N    8  
ATOM 10826 C CA   . GLY A 1 11 ? 3.138   22.104  1.011   1.00 0.00 ? 19  GLY A CA   8  
ATOM 10827 C C    . GLY A 1 11 ? 3.310   21.512  2.396   1.00 0.00 ? 19  GLY A C    8  
ATOM 10828 O O    . GLY A 1 11 ? 4.429   21.217  2.819   1.00 0.00 ? 19  GLY A O    8  
ATOM 10829 H H    . GLY A 1 11 ? 2.724   20.166  0.263   1.00 0.00 ? 19  GLY A H    8  
ATOM 10830 H HA2  . GLY A 1 11 ? 4.025   22.666  0.760   1.00 0.00 ? 19  GLY A HA2  8  
ATOM 10831 H HA3  . GLY A 1 11 ? 2.291   22.773  1.020   1.00 0.00 ? 19  GLY A HA3  8  
ATOM 10832 N N    . SER A 1 12 ? 2.201   21.340  3.106   1.00 0.00 ? 20  SER A N    8  
ATOM 10833 C CA   . SER A 1 12 ? 2.234   20.780  4.453   1.00 0.00 ? 20  SER A CA   8  
ATOM 10834 C C    . SER A 1 12 ? 1.360   19.532  4.546   1.00 0.00 ? 20  SER A C    8  
ATOM 10835 O O    . SER A 1 12 ? 0.669   19.317  5.543   1.00 0.00 ? 20  SER A O    8  
ATOM 10836 C CB   . SER A 1 12 ? 1.764   21.822  5.471   1.00 0.00 ? 20  SER A CB   8  
ATOM 10837 O OG   . SER A 1 12 ? 2.351   23.086  5.215   1.00 0.00 ? 20  SER A OG   8  
ATOM 10838 H H    . SER A 1 12 ? 1.338   21.594  2.716   1.00 0.00 ? 20  SER A H    8  
ATOM 10839 H HA   . SER A 1 12 ? 3.254   20.508  4.675   1.00 0.00 ? 20  SER A HA   8  
ATOM 10840 H HB2  . SER A 1 12 ? 0.692   21.919  5.415   1.00 0.00 ? 20  SER A HB2  8  
ATOM 10841 H HB3  . SER A 1 12 ? 2.046   21.502  6.464   1.00 0.00 ? 20  SER A HB3  8  
ATOM 10842 H HG   . SER A 1 12 ? 2.781   23.407  6.012   1.00 0.00 ? 20  SER A HG   8  
ATOM 10843 N N    . ARG A 1 13 ? 1.397   18.711  3.502   1.00 0.00 ? 21  ARG A N    8  
ATOM 10844 C CA   . ARG A 1 13 ? 0.611   17.484  3.467   1.00 0.00 ? 21  ARG A CA   8  
ATOM 10845 C C    . ARG A 1 13 ? 1.458   16.307  2.995   1.00 0.00 ? 21  ARG A C    8  
ATOM 10846 O O    . ARG A 1 13 ? 1.975   16.309  1.877   1.00 0.00 ? 21  ARG A O    8  
ATOM 10847 C CB   . ARG A 1 13 ? -0.599  17.655  2.547   1.00 0.00 ? 21  ARG A CB   8  
ATOM 10848 C CG   . ARG A 1 13 ? -1.373  18.942  2.791   1.00 0.00 ? 21  ARG A CG   8  
ATOM 10849 C CD   . ARG A 1 13 ? -2.631  19.006  1.941   1.00 0.00 ? 21  ARG A CD   8  
ATOM 10850 N NE   . ARG A 1 13 ? -3.686  19.786  2.582   1.00 0.00 ? 21  ARG A NE   8  
ATOM 10851 C CZ   . ARG A 1 13 ? -4.742  20.275  1.937   1.00 0.00 ? 21  ARG A CZ   8  
ATOM 10852 N NH1  . ARG A 1 13 ? -4.889  20.064  0.634   1.00 0.00 ? 21  ARG A NH1  8  
ATOM 10853 N NH2  . ARG A 1 13 ? -5.655  20.977  2.595   1.00 0.00 ? 21  ARG A NH2  8  
ATOM 10854 H H    . ARG A 1 13 ? 1.967   18.936  2.737   1.00 0.00 ? 21  ARG A H    8  
ATOM 10855 H HA   . ARG A 1 13 ? 0.264   17.284  4.470   1.00 0.00 ? 21  ARG A HA   8  
ATOM 10856 H HB2  . ARG A 1 13 ? -0.262  17.654  1.521   1.00 0.00 ? 21  ARG A HB2  8  
ATOM 10857 H HB3  . ARG A 1 13 ? -1.272  16.823  2.697   1.00 0.00 ? 21  ARG A HB3  8  
ATOM 10858 H HG2  . ARG A 1 13 ? -1.652  18.989  3.834   1.00 0.00 ? 21  ARG A HG2  8  
ATOM 10859 H HG3  . ARG A 1 13 ? -0.739  19.782  2.547   1.00 0.00 ? 21  ARG A HG3  8  
ATOM 10860 H HD2  . ARG A 1 13 ? -2.385  19.461  0.993   1.00 0.00 ? 21  ARG A HD2  8  
ATOM 10861 H HD3  . ARG A 1 13 ? -2.988  18.000  1.775   1.00 0.00 ? 21  ARG A HD3  8  
ATOM 10862 H HE   . ARG A 1 13 ? -3.603  19.956  3.544   1.00 0.00 ? 21  ARG A HE   8  
ATOM 10863 H HH11 . ARG A 1 13 ? -4.204  19.536  0.132   1.00 0.00 ? 21  ARG A HH11 8  
ATOM 10864 H HH12 . ARG A 1 13 ? -5.685  20.434  0.154   1.00 0.00 ? 21  ARG A HH12 8  
ATOM 10865 H HH21 . ARG A 1 13 ? -5.550  21.138  3.576   1.00 0.00 ? 21  ARG A HH21 8  
ATOM 10866 H HH22 . ARG A 1 13 ? -6.448  21.345  2.110   1.00 0.00 ? 21  ARG A HH22 8  
ATOM 10867 N N    . GLY A 1 14 ? 1.598   15.303  3.855   1.00 0.00 ? 22  GLY A N    8  
ATOM 10868 C CA   . GLY A 1 14 ? 2.383   14.134  3.506   1.00 0.00 ? 22  GLY A CA   8  
ATOM 10869 C C    . GLY A 1 14 ? 1.857   13.429  2.272   1.00 0.00 ? 22  GLY A C    8  
ATOM 10870 O O    . GLY A 1 14 ? 2.119   13.855  1.147   1.00 0.00 ? 22  GLY A O    8  
ATOM 10871 H H    . GLY A 1 14 ? 1.163   15.356  4.731   1.00 0.00 ? 22  GLY A H    8  
ATOM 10872 H HA2  . GLY A 1 14 ? 3.403   14.440  3.326   1.00 0.00 ? 22  GLY A HA2  8  
ATOM 10873 H HA3  . GLY A 1 14 ? 2.367   13.443  4.336   1.00 0.00 ? 22  GLY A HA3  8  
ATOM 10874 N N    . LEU A 1 15 ? 1.113   12.349  2.483   1.00 0.00 ? 23  LEU A N    8  
ATOM 10875 C CA   . LEU A 1 15 ? 0.547   11.581  1.383   1.00 0.00 ? 23  LEU A CA   8  
ATOM 10876 C C    . LEU A 1 15 ? -0.975  11.530  1.498   1.00 0.00 ? 23  LEU A C    8  
ATOM 10877 O O    . LEU A 1 15 ? -1.689  11.927  0.578   1.00 0.00 ? 23  LEU A O    8  
ATOM 10878 C CB   . LEU A 1 15 ? 1.140   10.170  1.377   1.00 0.00 ? 23  LEU A CB   8  
ATOM 10879 C CG   . LEU A 1 15 ? 0.374   9.132   0.559   1.00 0.00 ? 23  LEU A CG   8  
ATOM 10880 C CD1  . LEU A 1 15 ? 0.066   9.660   -0.833  1.00 0.00 ? 23  LEU A CD1  8  
ATOM 10881 C CD2  . LEU A 1 15 ? 1.166   7.836   0.475   1.00 0.00 ? 23  LEU A CD2  8  
ATOM 10882 H H    . LEU A 1 15 ? 0.938   12.058  3.401   1.00 0.00 ? 23  LEU A H    8  
ATOM 10883 H HA   . LEU A 1 15 ? 0.812   12.079  0.461   1.00 0.00 ? 23  LEU A HA   8  
ATOM 10884 H HB2  . LEU A 1 15 ? 2.147   10.229  0.991   1.00 0.00 ? 23  LEU A HB2  8  
ATOM 10885 H HB3  . LEU A 1 15 ? 1.186   9.824   2.397   1.00 0.00 ? 23  LEU A HB3  8  
ATOM 10886 H HG   . LEU A 1 15 ? -0.561  8.922   1.050   1.00 0.00 ? 23  LEU A HG   8  
ATOM 10887 H HD11 . LEU A 1 15 ? 0.989   9.863   -1.354  1.00 0.00 ? 23  LEU A HD11 8  
ATOM 10888 H HD12 . LEU A 1 15 ? -0.511  10.570  -0.753  1.00 0.00 ? 23  LEU A HD12 8  
ATOM 10889 H HD13 . LEU A 1 15 ? -0.503  8.922   -1.380  1.00 0.00 ? 23  LEU A HD13 8  
ATOM 10890 H HD21 . LEU A 1 15 ? 0.862   7.176   1.274   1.00 0.00 ? 23  LEU A HD21 8  
ATOM 10891 H HD22 . LEU A 1 15 ? 2.220   8.051   0.569   1.00 0.00 ? 23  LEU A HD22 8  
ATOM 10892 H HD23 . LEU A 1 15 ? 0.979   7.360   -0.477  1.00 0.00 ? 23  LEU A HD23 8  
ATOM 10893 N N    . GLY A 1 16 ? -1.465  11.051  2.638   1.00 0.00 ? 24  GLY A N    8  
ATOM 10894 C CA   . GLY A 1 16 ? -2.899  10.972  2.854   1.00 0.00 ? 24  GLY A CA   8  
ATOM 10895 C C    . GLY A 1 16 ? -3.414  9.548   2.959   1.00 0.00 ? 24  GLY A C    8  
ATOM 10896 O O    . GLY A 1 16 ? -4.604  9.333   3.187   1.00 0.00 ? 24  GLY A O    8  
ATOM 10897 H H    . GLY A 1 16 ? -0.847  10.758  3.342   1.00 0.00 ? 24  GLY A H    8  
ATOM 10898 H HA2  . GLY A 1 16 ? -3.140  11.495  3.767   1.00 0.00 ? 24  GLY A HA2  8  
ATOM 10899 H HA3  . GLY A 1 16 ? -3.399  11.462  2.033   1.00 0.00 ? 24  GLY A HA3  8  
ATOM 10900 N N    . CYS A 1 17 ? -2.526  8.570   2.797   1.00 0.00 ? 25  CYS A N    8  
ATOM 10901 C CA   . CYS A 1 17 ? -2.919  7.167   2.878   1.00 0.00 ? 25  CYS A CA   8  
ATOM 10902 C C    . CYS A 1 17 ? -1.879  6.347   3.632   1.00 0.00 ? 25  CYS A C    8  
ATOM 10903 O O    . CYS A 1 17 ? -0.762  6.805   3.869   1.00 0.00 ? 25  CYS A O    8  
ATOM 10904 C CB   . CYS A 1 17 ? -3.134  6.585   1.479   1.00 0.00 ? 25  CYS A CB   8  
ATOM 10905 S SG   . CYS A 1 17 ? -1.619  6.385   0.512   1.00 0.00 ? 25  CYS A SG   8  
ATOM 10906 H H    . CYS A 1 17 ? -1.590  8.794   2.619   1.00 0.00 ? 25  CYS A H    8  
ATOM 10907 H HA   . CYS A 1 17 ? -3.851  7.121   3.417   1.00 0.00 ? 25  CYS A HA   8  
ATOM 10908 H HB2  . CYS A 1 17 ? -3.592  5.612   1.569   1.00 0.00 ? 25  CYS A HB2  8  
ATOM 10909 H HB3  . CYS A 1 17 ? -3.794  7.235   0.924   1.00 0.00 ? 25  CYS A HB3  8  
ATOM 10910 H HG   . CYS A 1 17 ? -1.186  5.581   0.803   1.00 0.00 ? 25  CYS A HG   8  
ATOM 10911 N N    . SER A 1 18 ? -2.256  5.129   4.009   1.00 0.00 ? 26  SER A N    8  
ATOM 10912 C CA   . SER A 1 18 ? -1.358  4.240   4.738   1.00 0.00 ? 26  SER A CA   8  
ATOM 10913 C C    . SER A 1 18 ? -1.019  3.010   3.901   1.00 0.00 ? 26  SER A C    8  
ATOM 10914 O O    . SER A 1 18 ? -1.566  2.818   2.817   1.00 0.00 ? 26  SER A O    8  
ATOM 10915 C CB   . SER A 1 18 ? -1.995  3.811   6.062   1.00 0.00 ? 26  SER A CB   8  
ATOM 10916 O OG   . SER A 1 18 ? -1.276  2.741   6.651   1.00 0.00 ? 26  SER A OG   8  
ATOM 10917 H H    . SER A 1 18 ? -3.164  4.820   3.794   1.00 0.00 ? 26  SER A H    8  
ATOM 10918 H HA   . SER A 1 18 ? -0.448  4.784   4.945   1.00 0.00 ? 26  SER A HA   8  
ATOM 10919 H HB2  . SER A 1 18 ? -1.996  4.646   6.745   1.00 0.00 ? 26  SER A HB2  8  
ATOM 10920 H HB3  . SER A 1 18 ? -3.011  3.490   5.883   1.00 0.00 ? 26  SER A HB3  8  
ATOM 10921 H HG   . SER A 1 18 ? -1.378  2.774   7.605   1.00 0.00 ? 26  SER A HG   8  
ATOM 10922 N N    . ILE A 1 19 ? -0.109  2.184   4.406   1.00 0.00 ? 27  ILE A N    8  
ATOM 10923 C CA   . ILE A 1 19 ? 0.298   0.975   3.701   1.00 0.00 ? 27  ILE A CA   8  
ATOM 10924 C C    . ILE A 1 19 ? 0.520   -0.177  4.676   1.00 0.00 ? 27  ILE A C    8  
ATOM 10925 O O    . ILE A 1 19 ? 0.858   0.038   5.839   1.00 0.00 ? 27  ILE A O    8  
ATOM 10926 C CB   . ILE A 1 19 ? 1.582   1.199   2.882   1.00 0.00 ? 27  ILE A CB   8  
ATOM 10927 C CG1  . ILE A 1 19 ? 2.680   1.797   3.761   1.00 0.00 ? 27  ILE A CG1  8  
ATOM 10928 C CG2  . ILE A 1 19 ? 1.299   2.104   1.692   1.00 0.00 ? 27  ILE A CG2  8  
ATOM 10929 C CD1  . ILE A 1 19 ? 4.021   1.883   3.069   1.00 0.00 ? 27  ILE A CD1  8  
ATOM 10930 H H    . ILE A 1 19 ? 0.297   2.392   5.274   1.00 0.00 ? 27  ILE A H    8  
ATOM 10931 H HA   . ILE A 1 19 ? -0.497  0.706   3.020   1.00 0.00 ? 27  ILE A HA   8  
ATOM 10932 H HB   . ILE A 1 19 ? 1.912   0.243   2.505   1.00 0.00 ? 27  ILE A HB   8  
ATOM 10933 H HG12 . ILE A 1 19 ? 2.394   2.795   4.057   1.00 0.00 ? 27  ILE A HG12 8  
ATOM 10934 H HG13 . ILE A 1 19 ? 2.799   1.184   4.644   1.00 0.00 ? 27  ILE A HG13 8  
ATOM 10935 H HG21 . ILE A 1 19 ? 0.284   1.951   1.357   1.00 0.00 ? 27  ILE A HG21 8  
ATOM 10936 H HG22 . ILE A 1 19 ? 1.982   1.868   0.890   1.00 0.00 ? 27  ILE A HG22 8  
ATOM 10937 H HG23 . ILE A 1 19 ? 1.430   3.135   1.984   1.00 0.00 ? 27  ILE A HG23 8  
ATOM 10938 H HD11 . ILE A 1 19 ? 3.878   1.825   2.000   1.00 0.00 ? 27  ILE A HD11 8  
ATOM 10939 H HD12 . ILE A 1 19 ? 4.647   1.066   3.394   1.00 0.00 ? 27  ILE A HD12 8  
ATOM 10940 H HD13 . ILE A 1 19 ? 4.494   2.822   3.318   1.00 0.00 ? 27  ILE A HD13 8  
ATOM 10941 N N    . SER A 1 20 ? 0.317   -1.400  4.196   1.00 0.00 ? 28  SER A N    8  
ATOM 10942 C CA   . SER A 1 20 ? 0.486   -2.584  5.032   1.00 0.00 ? 28  SER A CA   8  
ATOM 10943 C C    . SER A 1 20 ? 1.006   -3.767  4.220   1.00 0.00 ? 28  SER A C    8  
ATOM 10944 O O    . SER A 1 20 ? 0.919   -3.776  2.991   1.00 0.00 ? 28  SER A O    8  
ATOM 10945 C CB   . SER A 1 20 ? -0.839  -2.952  5.700   1.00 0.00 ? 28  SER A CB   8  
ATOM 10946 O OG   . SER A 1 20 ? -1.940  -2.475  4.946   1.00 0.00 ? 28  SER A OG   8  
ATOM 10947 H H    . SER A 1 20 ? 0.040   -1.509  3.261   1.00 0.00 ? 28  SER A H    8  
ATOM 10948 H HA   . SER A 1 20 ? 1.209   -2.346  5.798   1.00 0.00 ? 28  SER A HA   8  
ATOM 10949 H HB2  . SER A 1 20 ? -0.914  -4.026  5.784   1.00 0.00 ? 28  SER A HB2  8  
ATOM 10950 H HB3  . SER A 1 20 ? -0.877  -2.512  6.687   1.00 0.00 ? 28  SER A HB3  8  
ATOM 10951 H HG   . SER A 1 20 ? -1.918  -1.515  4.919   1.00 0.00 ? 28  SER A HG   8  
ATOM 10952 N N    . SER A 1 21 ? 1.546   -4.764  4.916   1.00 0.00 ? 29  SER A N    8  
ATOM 10953 C CA   . SER A 1 21 ? 2.080   -5.956  4.264   1.00 0.00 ? 29  SER A CA   8  
ATOM 10954 C C    . SER A 1 21 ? 1.135   -7.139  4.448   1.00 0.00 ? 29  SER A C    8  
ATOM 10955 O O    . SER A 1 21 ? 0.464   -7.255  5.474   1.00 0.00 ? 29  SER A O    8  
ATOM 10956 C CB   . SER A 1 21 ? 3.461   -6.295  4.829   1.00 0.00 ? 29  SER A CB   8  
ATOM 10957 O OG   . SER A 1 21 ? 4.339   -6.731  3.807   1.00 0.00 ? 29  SER A OG   8  
ATOM 10958 H H    . SER A 1 21 ? 1.585   -4.697  5.893   1.00 0.00 ? 29  SER A H    8  
ATOM 10959 H HA   . SER A 1 21 ? 2.174   -5.744  3.210   1.00 0.00 ? 29  SER A HA   8  
ATOM 10960 H HB2  . SER A 1 21 ? 3.882   -5.418  5.298   1.00 0.00 ? 29  SER A HB2  8  
ATOM 10961 H HB3  . SER A 1 21 ? 3.363   -7.083  5.563   1.00 0.00 ? 29  SER A HB3  8  
ATOM 10962 H HG   . SER A 1 21 ? 5.248   -6.610  4.091   1.00 0.00 ? 29  SER A HG   8  
ATOM 10963 N N    . GLY A 1 22 ? 1.080   -8.010  3.446   1.00 0.00 ? 30  GLY A N    8  
ATOM 10964 C CA   . GLY A 1 22 ? 0.203   -9.165  3.514   1.00 0.00 ? 30  GLY A CA   8  
ATOM 10965 C C    . GLY A 1 22 ? 0.899   -10.412 4.028   1.00 0.00 ? 30  GLY A C    8  
ATOM 10966 O O    . GLY A 1 22 ? 2.017   -10.339 4.535   1.00 0.00 ? 30  GLY A O    8  
ATOM 10967 H H    . GLY A 1 22 ? 1.631   -7.863  2.648   1.00 0.00 ? 30  GLY A H    8  
ATOM 10968 H HA2  . GLY A 1 22 ? -0.622  -8.934  4.172   1.00 0.00 ? 30  GLY A HA2  8  
ATOM 10969 H HA3  . GLY A 1 22 ? -0.186  -9.365  2.527   1.00 0.00 ? 30  GLY A HA3  8  
ATOM 10970 N N    . PRO A 1 23 ? 0.248   -11.583 3.908   1.00 0.00 ? 31  PRO A N    8  
ATOM 10971 C CA   . PRO A 1 23 ? 0.809   -12.857 4.370   1.00 0.00 ? 31  PRO A CA   8  
ATOM 10972 C C    . PRO A 1 23 ? 1.928   -13.366 3.465   1.00 0.00 ? 31  PRO A C    8  
ATOM 10973 O O    . PRO A 1 23 ? 2.467   -12.622 2.647   1.00 0.00 ? 31  PRO A O    8  
ATOM 10974 C CB   . PRO A 1 23 ? -0.391  -13.805 4.323   1.00 0.00 ? 31  PRO A CB   8  
ATOM 10975 C CG   . PRO A 1 23 ? -1.271  -13.245 3.259   1.00 0.00 ? 31  PRO A CG   8  
ATOM 10976 C CD   . PRO A 1 23 ? -1.095  -11.752 3.319   1.00 0.00 ? 31  PRO A CD   8  
ATOM 10977 H HA   . PRO A 1 23 ? 1.173   -12.783 5.384   1.00 0.00 ? 31  PRO A HA   8  
ATOM 10978 H HB2  . PRO A 1 23 ? -0.058  -14.802 4.077   1.00 0.00 ? 31  PRO A HB2  8  
ATOM 10979 H HB3  . PRO A 1 23 ? -0.888  -13.810 5.281   1.00 0.00 ? 31  PRO A HB3  8  
ATOM 10980 H HG2  . PRO A 1 23 ? -0.963  -13.621 2.294   1.00 0.00 ? 31  PRO A HG2  8  
ATOM 10981 H HG3  . PRO A 1 23 ? -2.299  -13.510 3.456   1.00 0.00 ? 31  PRO A HG3  8  
ATOM 10982 H HD2  . PRO A 1 23 ? -1.136  -11.327 2.326   1.00 0.00 ? 31  PRO A HD2  8  
ATOM 10983 H HD3  . PRO A 1 23 ? -1.851  -11.309 3.950   1.00 0.00 ? 31  PRO A HD3  8  
ATOM 10984 N N    . ILE A 1 24 ? 2.272   -14.641 3.624   1.00 0.00 ? 32  ILE A N    8  
ATOM 10985 C CA   . ILE A 1 24 ? 3.326   -15.259 2.828   1.00 0.00 ? 32  ILE A CA   8  
ATOM 10986 C C    . ILE A 1 24 ? 2.797   -15.724 1.475   1.00 0.00 ? 32  ILE A C    8  
ATOM 10987 O O    . ILE A 1 24 ? 3.543   -15.801 0.500   1.00 0.00 ? 32  ILE A O    8  
ATOM 10988 C CB   . ILE A 1 24 ? 3.950   -16.460 3.562   1.00 0.00 ? 32  ILE A CB   8  
ATOM 10989 C CG1  . ILE A 1 24 ? 4.354   -16.065 4.983   1.00 0.00 ? 32  ILE A CG1  8  
ATOM 10990 C CG2  . ILE A 1 24 ? 5.152   -16.989 2.792   1.00 0.00 ? 32  ILE A CG2  8  
ATOM 10991 C CD1  . ILE A 1 24 ? 3.314   -16.416 6.026   1.00 0.00 ? 32  ILE A CD1  8  
ATOM 10992 H H    . ILE A 1 24 ? 1.804   -15.179 4.295   1.00 0.00 ? 32  ILE A H    8  
ATOM 10993 H HA   . ILE A 1 24 ? 4.098   -14.521 2.668   1.00 0.00 ? 32  ILE A HA   8  
ATOM 10994 H HB   . ILE A 1 24 ? 3.212   -17.247 3.611   1.00 0.00 ? 32  ILE A HB   8  
ATOM 10995 H HG12 . ILE A 1 24 ? 5.269   -16.571 5.246   1.00 0.00 ? 32  ILE A HG12 8  
ATOM 10996 H HG13 . ILE A 1 24 ? 4.515   -14.997 5.021   1.00 0.00 ? 32  ILE A HG13 8  
ATOM 10997 H HG21 . ILE A 1 24 ? 4.869   -17.170 1.766   1.00 0.00 ? 32  ILE A HG21 8  
ATOM 10998 H HG22 . ILE A 1 24 ? 5.490   -17.912 3.241   1.00 0.00 ? 32  ILE A HG22 8  
ATOM 10999 H HG23 . ILE A 1 24 ? 5.948   -16.259 2.824   1.00 0.00 ? 32  ILE A HG23 8  
ATOM 11000 H HD11 . ILE A 1 24 ? 3.746   -17.086 6.755   1.00 0.00 ? 32  ILE A HD11 8  
ATOM 11001 H HD12 . ILE A 1 24 ? 2.474   -16.896 5.548   1.00 0.00 ? 32  ILE A HD12 8  
ATOM 11002 H HD13 . ILE A 1 24 ? 2.981   -15.514 6.521   1.00 0.00 ? 32  ILE A HD13 8  
ATOM 11003 N N    . GLN A 1 25 ? 1.506   -16.037 1.424   1.00 0.00 ? 33  GLN A N    8  
ATOM 11004 C CA   . GLN A 1 25 ? 0.881   -16.493 0.188   1.00 0.00 ? 33  GLN A CA   8  
ATOM 11005 C C    . GLN A 1 25 ? 0.939   -15.407 -0.882  1.00 0.00 ? 33  GLN A C    8  
ATOM 11006 O O    . GLN A 1 25 ? 0.980   -15.701 -2.077  1.00 0.00 ? 33  GLN A O    8  
ATOM 11007 C CB   . GLN A 1 25 ? -0.571  -16.898 0.446   1.00 0.00 ? 33  GLN A CB   8  
ATOM 11008 C CG   . GLN A 1 25 ? -0.709  -18.145 1.307   1.00 0.00 ? 33  GLN A CG   8  
ATOM 11009 C CD   . GLN A 1 25 ? -1.517  -17.900 2.566   1.00 0.00 ? 33  GLN A CD   8  
ATOM 11010 O OE1  . GLN A 1 25 ? -2.307  -16.958 2.638   1.00 0.00 ? 33  GLN A OE1  8  
ATOM 11011 N NE2  . GLN A 1 25 ? -1.324  -18.751 3.568   1.00 0.00 ? 33  GLN A NE2  8  
ATOM 11012 H H    . GLN A 1 25 ? 0.961   -15.956 2.233   1.00 0.00 ? 33  GLN A H    8  
ATOM 11013 H HA   . GLN A 1 25 ? 1.429   -17.356 -0.162  1.00 0.00 ? 33  GLN A HA   8  
ATOM 11014 H HB2  . GLN A 1 25 ? -1.076  -16.083 0.945   1.00 0.00 ? 33  GLN A HB2  8  
ATOM 11015 H HB3  . GLN A 1 25 ? -1.055  -17.084 -0.500  1.00 0.00 ? 33  GLN A HB3  8  
ATOM 11016 H HG2  . GLN A 1 25 ? -1.197  -18.914 0.729   1.00 0.00 ? 33  GLN A HG2  8  
ATOM 11017 H HG3  . GLN A 1 25 ? 0.277   -18.481 1.590   1.00 0.00 ? 33  GLN A HG3  8  
ATOM 11018 H HE21 . GLN A 1 25 ? -0.679  -19.478 3.440   1.00 0.00 ? 33  GLN A HE21 8  
ATOM 11019 H HE22 . GLN A 1 25 ? -1.835  -18.617 4.394   1.00 0.00 ? 33  GLN A HE22 8  
ATOM 11020 N N    . LYS A 1 26 ? 0.946   -14.153 -0.443  1.00 0.00 ? 34  LYS A N    8  
ATOM 11021 C CA   . LYS A 1 26 ? 1.002   -13.021 -1.359  1.00 0.00 ? 34  LYS A CA   8  
ATOM 11022 C C    . LYS A 1 26 ? 1.628   -11.805 -0.678  1.00 0.00 ? 34  LYS A C    8  
ATOM 11023 O O    . LYS A 1 26 ? 0.929   -10.868 -0.296  1.00 0.00 ? 34  LYS A O    8  
ATOM 11024 C CB   . LYS A 1 26 ? -0.401  -12.676 -1.865  1.00 0.00 ? 34  LYS A CB   8  
ATOM 11025 C CG   . LYS A 1 26 ? -0.442  -12.299 -3.337  1.00 0.00 ? 34  LYS A CG   8  
ATOM 11026 C CD   . LYS A 1 26 ? -1.865  -12.298 -3.873  1.00 0.00 ? 34  LYS A CD   8  
ATOM 11027 C CE   . LYS A 1 26 ? -2.104  -11.131 -4.818  1.00 0.00 ? 34  LYS A CE   8  
ATOM 11028 N NZ   . LYS A 1 26 ? -2.801  -11.558 -6.063  1.00 0.00 ? 34  LYS A NZ   8  
ATOM 11029 H H    . LYS A 1 26 ? 0.913   -13.984 0.522   1.00 0.00 ? 34  LYS A H    8  
ATOM 11030 H HA   . LYS A 1 26 ? 1.617   -13.305 -2.200  1.00 0.00 ? 34  LYS A HA   8  
ATOM 11031 H HB2  . LYS A 1 26 ? -1.045  -13.530 -1.717  1.00 0.00 ? 34  LYS A HB2  8  
ATOM 11032 H HB3  . LYS A 1 26 ? -0.784  -11.845 -1.292  1.00 0.00 ? 34  LYS A HB3  8  
ATOM 11033 H HG2  . LYS A 1 26 ? -0.021  -11.312 -3.457  1.00 0.00 ? 34  LYS A HG2  8  
ATOM 11034 H HG3  . LYS A 1 26 ? 0.144   -13.013 -3.897  1.00 0.00 ? 34  LYS A HG3  8  
ATOM 11035 H HD2  . LYS A 1 26 ? -2.039  -13.220 -4.405  1.00 0.00 ? 34  LYS A HD2  8  
ATOM 11036 H HD3  . LYS A 1 26 ? -2.551  -12.223 -3.042  1.00 0.00 ? 34  LYS A HD3  8  
ATOM 11037 H HE2  . LYS A 1 26 ? -2.710  -10.393 -4.312  1.00 0.00 ? 34  LYS A HE2  8  
ATOM 11038 H HE3  . LYS A 1 26 ? -1.151  -10.694 -5.081  1.00 0.00 ? 34  LYS A HE3  8  
ATOM 11039 H HZ1  . LYS A 1 26 ? -2.250  -12.298 -6.544  1.00 0.00 ? 34  LYS A HZ1  8  
ATOM 11040 H HZ2  . LYS A 1 26 ? -2.911  -10.749 -6.706  1.00 0.00 ? 34  LYS A HZ2  8  
ATOM 11041 H HZ3  . LYS A 1 26 ? -3.743  -11.934 -5.834  1.00 0.00 ? 34  LYS A HZ3  8  
ATOM 11042 N N    . PRO A 1 27 ? 2.962   -11.811 -0.514  1.00 0.00 ? 35  PRO A N    8  
ATOM 11043 C CA   . PRO A 1 27 ? 3.682   -10.705 0.127   1.00 0.00 ? 35  PRO A CA   8  
ATOM 11044 C C    . PRO A 1 27 ? 3.735   -9.462  -0.752  1.00 0.00 ? 35  PRO A C    8  
ATOM 11045 O O    . PRO A 1 27 ? 4.130   -9.528  -1.914  1.00 0.00 ? 35  PRO A O    8  
ATOM 11046 C CB   . PRO A 1 27 ? 5.087   -11.273 0.335   1.00 0.00 ? 35  PRO A CB   8  
ATOM 11047 C CG   . PRO A 1 27 ? 5.240   -12.300 -0.731  1.00 0.00 ? 35  PRO A CG   8  
ATOM 11048 C CD   . PRO A 1 27 ? 3.873   -12.891 -0.938  1.00 0.00 ? 35  PRO A CD   8  
ATOM 11049 H HA   . PRO A 1 27 ? 3.247   -10.452 1.082   1.00 0.00 ? 35  PRO A HA   8  
ATOM 11050 H HB2  . PRO A 1 27 ? 5.816   -10.482 0.233   1.00 0.00 ? 35  PRO A HB2  8  
ATOM 11051 H HB3  . PRO A 1 27 ? 5.158   -11.712 1.320   1.00 0.00 ? 35  PRO A HB3  8  
ATOM 11052 H HG2  . PRO A 1 27 ? 5.590   -11.835 -1.641  1.00 0.00 ? 35  PRO A HG2  8  
ATOM 11053 H HG3  . PRO A 1 27 ? 5.932   -13.063 -0.408  1.00 0.00 ? 35  PRO A HG3  8  
ATOM 11054 H HD2  . PRO A 1 27 ? 3.722   -13.135 -1.979  1.00 0.00 ? 35  PRO A HD2  8  
ATOM 11055 H HD3  . PRO A 1 27 ? 3.742   -13.767 -0.321  1.00 0.00 ? 35  PRO A HD3  8  
ATOM 11056 N N    . GLY A 1 28 ? 3.334   -8.328  -0.187  1.00 0.00 ? 36  GLY A N    8  
ATOM 11057 C CA   . GLY A 1 28 ? 3.344   -7.086  -0.934  1.00 0.00 ? 36  GLY A CA   8  
ATOM 11058 C C    . GLY A 1 28 ? 2.906   -5.902  -0.097  1.00 0.00 ? 36  GLY A C    8  
ATOM 11059 O O    . GLY A 1 28 ? 2.384   -6.070  1.004   1.00 0.00 ? 36  GLY A O    8  
ATOM 11060 H H    . GLY A 1 28 ? 3.028   -8.334  0.744   1.00 0.00 ? 36  GLY A H    8  
ATOM 11061 H HA2  . GLY A 1 28 ? 4.346   -6.904  -1.297  1.00 0.00 ? 36  GLY A HA2  8  
ATOM 11062 H HA3  . GLY A 1 28 ? 2.678   -7.182  -1.778  1.00 0.00 ? 36  GLY A HA3  8  
ATOM 11063 N N    . ILE A 1 29 ? 3.121   -4.699  -0.620  1.00 0.00 ? 37  ILE A N    8  
ATOM 11064 C CA   . ILE A 1 29 ? 2.746   -3.481  0.086   1.00 0.00 ? 37  ILE A CA   8  
ATOM 11065 C C    . ILE A 1 29 ? 1.459   -2.891  -0.485  1.00 0.00 ? 37  ILE A C    8  
ATOM 11066 O O    . ILE A 1 29 ? 1.461   -2.315  -1.571  1.00 0.00 ? 37  ILE A O    8  
ATOM 11067 C CB   . ILE A 1 29 ? 3.859   -2.418  -0.001  1.00 0.00 ? 37  ILE A CB   8  
ATOM 11068 C CG1  . ILE A 1 29 ? 5.226   -3.042  0.295   1.00 0.00 ? 37  ILE A CG1  8  
ATOM 11069 C CG2  . ILE A 1 29 ? 3.571   -1.269  0.956   1.00 0.00 ? 37  ILE A CG2  8  
ATOM 11070 C CD1  . ILE A 1 29 ? 5.429   -3.406  1.752   1.00 0.00 ? 37  ILE A CD1  8  
ATOM 11071 H H    . ILE A 1 29 ? 3.543   -4.632  -1.503  1.00 0.00 ? 37  ILE A H    8  
ATOM 11072 H HA   . ILE A 1 29 ? 2.590   -3.730  1.125   1.00 0.00 ? 37  ILE A HA   8  
ATOM 11073 H HB   . ILE A 1 29 ? 3.865   -2.018  -1.004  1.00 0.00 ? 37  ILE A HB   8  
ATOM 11074 H HG12 . ILE A 1 29 ? 5.335   -3.944  -0.289  1.00 0.00 ? 37  ILE A HG12 8  
ATOM 11075 H HG13 . ILE A 1 29 ? 6.001   -2.343  0.016   1.00 0.00 ? 37  ILE A HG13 8  
ATOM 11076 H HG21 . ILE A 1 29 ? 2.580   -0.884  0.768   1.00 0.00 ? 37  ILE A HG21 8  
ATOM 11077 H HG22 . ILE A 1 29 ? 4.297   -0.484  0.804   1.00 0.00 ? 37  ILE A HG22 8  
ATOM 11078 H HG23 . ILE A 1 29 ? 3.632   -1.625  1.974   1.00 0.00 ? 37  ILE A HG23 8  
ATOM 11079 H HD11 . ILE A 1 29 ? 5.228   -2.543  2.369   1.00 0.00 ? 37  ILE A HD11 8  
ATOM 11080 H HD12 . ILE A 1 29 ? 6.450   -3.726  1.902   1.00 0.00 ? 37  ILE A HD12 8  
ATOM 11081 H HD13 . ILE A 1 29 ? 4.757   -4.207  2.019   1.00 0.00 ? 37  ILE A HD13 8  
ATOM 11082 N N    . PHE A 1 30 ? 0.363   -3.032  0.256   1.00 0.00 ? 38  PHE A N    8  
ATOM 11083 C CA   . PHE A 1 30 ? -0.922  -2.499  -0.186  1.00 0.00 ? 38  PHE A CA   8  
ATOM 11084 C C    . PHE A 1 30 ? -1.227  -1.182  0.510   1.00 0.00 ? 38  PHE A C    8  
ATOM 11085 O O    . PHE A 1 30 ? -0.406  -0.662  1.266   1.00 0.00 ? 38  PHE A O    8  
ATOM 11086 C CB   . PHE A 1 30 ? -2.061  -3.499  0.050   1.00 0.00 ? 38  PHE A CB   8  
ATOM 11087 C CG   . PHE A 1 30 ? -1.845  -4.427  1.210   1.00 0.00 ? 38  PHE A CG   8  
ATOM 11088 C CD1  . PHE A 1 30 ? -2.233  -4.064  2.489   1.00 0.00 ? 38  PHE A CD1  8  
ATOM 11089 C CD2  . PHE A 1 30 ? -1.263  -5.670  1.016   1.00 0.00 ? 38  PHE A CD2  8  
ATOM 11090 C CE1  . PHE A 1 30 ? -2.042  -4.921  3.555   1.00 0.00 ? 38  PHE A CE1  8  
ATOM 11091 C CE2  . PHE A 1 30 ? -1.073  -6.532  2.078   1.00 0.00 ? 38  PHE A CE2  8  
ATOM 11092 C CZ   . PHE A 1 30 ? -1.462  -6.157  3.350   1.00 0.00 ? 38  PHE A CZ   8  
ATOM 11093 H H    . PHE A 1 30 ? 0.422   -3.496  1.118   1.00 0.00 ? 38  PHE A H    8  
ATOM 11094 H HA   . PHE A 1 30 ? -0.846  -2.305  -1.245  1.00 0.00 ? 38  PHE A HA   8  
ATOM 11095 H HB2  . PHE A 1 30 ? -2.973  -2.953  0.233   1.00 0.00 ? 38  PHE A HB2  8  
ATOM 11096 H HB3  . PHE A 1 30 ? -2.186  -4.101  -0.839  1.00 0.00 ? 38  PHE A HB3  8  
ATOM 11097 H HD1  . PHE A 1 30 ? -2.686  -3.097  2.651   1.00 0.00 ? 38  PHE A HD1  8  
ATOM 11098 H HD2  . PHE A 1 30 ? -0.959  -5.963  0.023   1.00 0.00 ? 38  PHE A HD2  8  
ATOM 11099 H HE1  . PHE A 1 30 ? -2.348  -4.627  4.547   1.00 0.00 ? 38  PHE A HE1  8  
ATOM 11100 H HE2  . PHE A 1 30 ? -0.618  -7.498  1.912   1.00 0.00 ? 38  PHE A HE2  8  
ATOM 11101 H HZ   . PHE A 1 30 ? -1.313  -6.831  4.180   1.00 0.00 ? 38  PHE A HZ   8  
ATOM 11102 N N    . ILE A 1 31 ? -2.407  -0.637  0.237   1.00 0.00 ? 39  ILE A N    8  
ATOM 11103 C CA   . ILE A 1 31 ? -2.810  0.631   0.821   1.00 0.00 ? 39  ILE A CA   8  
ATOM 11104 C C    . ILE A 1 31 ? -3.884  0.450   1.890   1.00 0.00 ? 39  ILE A C    8  
ATOM 11105 O O    . ILE A 1 31 ? -4.766  -0.401  1.771   1.00 0.00 ? 39  ILE A O    8  
ATOM 11106 C CB   . ILE A 1 31 ? -3.334  1.595   -0.263  1.00 0.00 ? 39  ILE A CB   8  
ATOM 11107 C CG1  . ILE A 1 31 ? -2.238  1.879   -1.295  1.00 0.00 ? 39  ILE A CG1  8  
ATOM 11108 C CG2  . ILE A 1 31 ? -3.829  2.891   0.361   1.00 0.00 ? 39  ILE A CG2  8  
ATOM 11109 C CD1  . ILE A 1 31 ? -1.125  2.762   -0.771  1.00 0.00 ? 39  ILE A CD1  8  
ATOM 11110 H H    . ILE A 1 31 ? -3.012  -1.092  -0.384  1.00 0.00 ? 39  ILE A H    8  
ATOM 11111 H HA   . ILE A 1 31 ? -1.939  1.080   1.277   1.00 0.00 ? 39  ILE A HA   8  
ATOM 11112 H HB   . ILE A 1 31 ? -4.168  1.123   -0.759  1.00 0.00 ? 39  ILE A HB   8  
ATOM 11113 H HG12 . ILE A 1 31 ? -1.798  0.944   -1.607  1.00 0.00 ? 39  ILE A HG12 8  
ATOM 11114 H HG13 . ILE A 1 31 ? -2.677  2.370   -2.152  1.00 0.00 ? 39  ILE A HG13 8  
ATOM 11115 H HG21 . ILE A 1 31 ? -3.052  3.307   0.986   1.00 0.00 ? 39  ILE A HG21 8  
ATOM 11116 H HG22 . ILE A 1 31 ? -4.705  2.691   0.958   1.00 0.00 ? 39  ILE A HG22 8  
ATOM 11117 H HG23 . ILE A 1 31 ? -4.077  3.595   -0.420  1.00 0.00 ? 39  ILE A HG23 8  
ATOM 11118 H HD11 . ILE A 1 31 ? -1.335  3.035   0.253   1.00 0.00 ? 39  ILE A HD11 8  
ATOM 11119 H HD12 . ILE A 1 31 ? -1.061  3.654   -1.375  1.00 0.00 ? 39  ILE A HD12 8  
ATOM 11120 H HD13 . ILE A 1 31 ? -0.189  2.227   -0.815  1.00 0.00 ? 39  ILE A HD13 8  
ATOM 11121 N N    . SER A 1 32 ? -3.798  1.276   2.925   1.00 0.00 ? 40  SER A N    8  
ATOM 11122 C CA   . SER A 1 32 ? -4.748  1.253   4.026   1.00 0.00 ? 40  SER A CA   8  
ATOM 11123 C C    . SER A 1 32 ? -5.680  2.453   3.931   1.00 0.00 ? 40  SER A C    8  
ATOM 11124 O O    . SER A 1 32 ? -5.703  3.150   2.917   1.00 0.00 ? 40  SER A O    8  
ATOM 11125 C CB   . SER A 1 32 ? -4.010  1.259   5.367   1.00 0.00 ? 40  SER A CB   8  
ATOM 11126 O OG   . SER A 1 32 ? -4.160  0.021   6.039   1.00 0.00 ? 40  SER A OG   8  
ATOM 11127 H H    . SER A 1 32 ? -3.076  1.933   2.942   1.00 0.00 ? 40  SER A H    8  
ATOM 11128 H HA   . SER A 1 32 ? -5.330  0.347   3.947   1.00 0.00 ? 40  SER A HA   8  
ATOM 11129 H HB2  . SER A 1 32 ? -2.957  1.434   5.196   1.00 0.00 ? 40  SER A HB2  8  
ATOM 11130 H HB3  . SER A 1 32 ? -4.406  2.046   5.993   1.00 0.00 ? 40  SER A HB3  8  
ATOM 11131 H HG   . SER A 1 32 ? -3.435  -0.561  5.807   1.00 0.00 ? 40  SER A HG   8  
ATOM 11132 N N    . HIS A 1 33 ? -6.452  2.692   4.989   1.00 0.00 ? 41  HIS A N    8  
ATOM 11133 C CA   . HIS A 1 33 ? -7.389  3.813   5.022   1.00 0.00 ? 41  HIS A CA   8  
ATOM 11134 C C    . HIS A 1 33 ? -6.762  5.075   4.427   1.00 0.00 ? 41  HIS A C    8  
ATOM 11135 O O    . HIS A 1 33 ? -5.547  5.272   4.505   1.00 0.00 ? 41  HIS A O    8  
ATOM 11136 C CB   . HIS A 1 33 ? -7.841  4.084   6.458   1.00 0.00 ? 41  HIS A CB   8  
ATOM 11137 C CG   . HIS A 1 33 ? -9.042  4.972   6.550   1.00 0.00 ? 41  HIS A CG   8  
ATOM 11138 N ND1  . HIS A 1 33 ? -9.983  5.076   5.546   1.00 0.00 ? 41  HIS A ND1  8  
ATOM 11139 C CD2  . HIS A 1 33 ? -9.457  5.802   7.538   1.00 0.00 ? 41  HIS A CD2  8  
ATOM 11140 C CE1  . HIS A 1 33 ? -10.921 5.932   5.911   1.00 0.00 ? 41  HIS A CE1  8  
ATOM 11141 N NE2  . HIS A 1 33 ? -10.626 6.385   7.115   1.00 0.00 ? 41  HIS A NE2  8  
ATOM 11142 H H    . HIS A 1 33 ? -6.388  2.101   5.767   1.00 0.00 ? 41  HIS A H    8  
ATOM 11143 H HA   . HIS A 1 33 ? -8.250  3.542   4.428   1.00 0.00 ? 41  HIS A HA   8  
ATOM 11144 H HB2  . HIS A 1 33 ? -8.086  3.145   6.933   1.00 0.00 ? 41  HIS A HB2  8  
ATOM 11145 H HB3  . HIS A 1 33 ? -7.035  4.556   6.999   1.00 0.00 ? 41  HIS A HB3  8  
ATOM 11146 H HD1  . HIS A 1 33 ? -9.963  4.595   4.692   1.00 0.00 ? 41  HIS A HD1  8  
ATOM 11147 H HD2  . HIS A 1 33 ? -8.959  5.973   8.482   1.00 0.00 ? 41  HIS A HD2  8  
ATOM 11148 H HE1  . HIS A 1 33 ? -11.784 6.210   5.324   1.00 0.00 ? 41  HIS A HE1  8  
ATOM 11149 H HE2  . HIS A 1 33 ? -11.107 7.100   7.583   1.00 0.00 ? 41  HIS A HE2  8  
ATOM 11150 N N    . VAL A 1 34 ? -7.596  5.918   3.829   1.00 0.00 ? 42  VAL A N    8  
ATOM 11151 C CA   . VAL A 1 34 ? -7.126  7.152   3.212   1.00 0.00 ? 42  VAL A CA   8  
ATOM 11152 C C    . VAL A 1 34 ? -7.980  8.342   3.636   1.00 0.00 ? 42  VAL A C    8  
ATOM 11153 O O    . VAL A 1 34 ? -9.146  8.185   3.998   1.00 0.00 ? 42  VAL A O    8  
ATOM 11154 C CB   . VAL A 1 34 ? -7.139  7.048   1.674   1.00 0.00 ? 42  VAL A CB   8  
ATOM 11155 C CG1  . VAL A 1 34 ? -6.439  8.245   1.049   1.00 0.00 ? 42  VAL A CG1  8  
ATOM 11156 C CG2  . VAL A 1 34 ? -6.493  5.748   1.221   1.00 0.00 ? 42  VAL A CG2  8  
ATOM 11157 H H    . VAL A 1 34 ? -8.551  5.700   3.793   1.00 0.00 ? 42  VAL A H    8  
ATOM 11158 H HA   . VAL A 1 34 ? -6.107  7.319   3.533   1.00 0.00 ? 42  VAL A HA   8  
ATOM 11159 H HB   . VAL A 1 34 ? -8.167  7.048   1.343   1.00 0.00 ? 42  VAL A HB   8  
ATOM 11160 H HG11 . VAL A 1 34 ? -5.420  8.289   1.401   1.00 0.00 ? 42  VAL A HG11 8  
ATOM 11161 H HG12 . VAL A 1 34 ? -6.958  9.150   1.326   1.00 0.00 ? 42  VAL A HG12 8  
ATOM 11162 H HG13 . VAL A 1 34 ? -6.444  8.143   -0.026  1.00 0.00 ? 42  VAL A HG13 8  
ATOM 11163 H HG21 . VAL A 1 34 ? -5.574  5.592   1.768   1.00 0.00 ? 42  VAL A HG21 8  
ATOM 11164 H HG22 . VAL A 1 34 ? -6.278  5.801   0.164   1.00 0.00 ? 42  VAL A HG22 8  
ATOM 11165 H HG23 . VAL A 1 34 ? -7.168  4.926   1.410   1.00 0.00 ? 42  VAL A HG23 8  
ATOM 11166 N N    . LYS A 1 35 ? -7.391  9.533   3.586   1.00 0.00 ? 43  LYS A N    8  
ATOM 11167 C CA   . LYS A 1 35 ? -8.098  10.752  3.963   1.00 0.00 ? 43  LYS A CA   8  
ATOM 11168 C C    . LYS A 1 35 ? -8.220  11.699  2.768   1.00 0.00 ? 43  LYS A C    8  
ATOM 11169 O O    . LYS A 1 35 ? -7.315  11.780  1.937   1.00 0.00 ? 43  LYS A O    8  
ATOM 11170 C CB   . LYS A 1 35 ? -7.372  11.455  5.112   1.00 0.00 ? 43  LYS A CB   8  
ATOM 11171 C CG   . LYS A 1 35 ? -6.919  10.509  6.213   1.00 0.00 ? 43  LYS A CG   8  
ATOM 11172 C CD   . LYS A 1 35 ? -5.438  10.178  6.091   1.00 0.00 ? 43  LYS A CD   8  
ATOM 11173 C CE   . LYS A 1 35 ? -4.622  10.861  7.179   1.00 0.00 ? 43  LYS A CE   8  
ATOM 11174 N NZ   . LYS A 1 35 ? -4.342  9.946   8.319   1.00 0.00 ? 43  LYS A NZ   8  
ATOM 11175 H H    . LYS A 1 35 ? -6.460  9.595   3.287   1.00 0.00 ? 43  LYS A H    8  
ATOM 11176 H HA   . LYS A 1 35 ? -9.088  10.474  4.289   1.00 0.00 ? 43  LYS A HA   8  
ATOM 11177 H HB2  . LYS A 1 35 ? -6.503  11.960  4.718   1.00 0.00 ? 43  LYS A HB2  8  
ATOM 11178 H HB3  . LYS A 1 35 ? -8.036  12.186  5.546   1.00 0.00 ? 43  LYS A HB3  8  
ATOM 11179 H HG2  . LYS A 1 35 ? -7.097  10.975  7.170   1.00 0.00 ? 43  LYS A HG2  8  
ATOM 11180 H HG3  . LYS A 1 35 ? -7.489  9.594   6.145   1.00 0.00 ? 43  LYS A HG3  8  
ATOM 11181 H HD2  . LYS A 1 35 ? -5.309  9.109   6.177   1.00 0.00 ? 43  LYS A HD2  8  
ATOM 11182 H HD3  . LYS A 1 35 ? -5.083  10.509  5.126   1.00 0.00 ? 43  LYS A HD3  8  
ATOM 11183 H HE2  . LYS A 1 35 ? -3.685  11.190  6.754   1.00 0.00 ? 43  LYS A HE2  8  
ATOM 11184 H HE3  . LYS A 1 35 ? -5.174  11.717  7.540   1.00 0.00 ? 43  LYS A HE3  8  
ATOM 11185 H HZ1  . LYS A 1 35 ? -3.587  10.340  8.916   1.00 0.00 ? 43  LYS A HZ1  8  
ATOM 11186 H HZ2  . LYS A 1 35 ? -4.041  9.016   7.967   1.00 0.00 ? 43  LYS A HZ2  8  
ATOM 11187 H HZ3  . LYS A 1 35 ? -5.198  9.824   8.897   1.00 0.00 ? 43  LYS A HZ3  8  
ATOM 11188 N N    . PRO A 1 36 ? -9.345  12.428  2.665   1.00 0.00 ? 44  PRO A N    8  
ATOM 11189 C CA   . PRO A 1 36 ? -9.577  13.367  1.564   1.00 0.00 ? 44  PRO A CA   8  
ATOM 11190 C C    . PRO A 1 36 ? -8.718  14.622  1.679   1.00 0.00 ? 44  PRO A C    8  
ATOM 11191 O O    . PRO A 1 36 ? -8.246  14.966  2.762   1.00 0.00 ? 44  PRO A O    8  
ATOM 11192 C CB   . PRO A 1 36 ? -11.058 13.719  1.708   1.00 0.00 ? 44  PRO A CB   8  
ATOM 11193 C CG   . PRO A 1 36 ? -11.352 13.529  3.156   1.00 0.00 ? 44  PRO A CG   8  
ATOM 11194 C CD   . PRO A 1 36 ? -10.477 12.392  3.611   1.00 0.00 ? 44  PRO A CD   8  
ATOM 11195 H HA   . PRO A 1 36 ? -9.407  12.903  0.604   1.00 0.00 ? 44  PRO A HA   8  
ATOM 11196 H HB2  . PRO A 1 36 ? -11.220 14.743  1.402   1.00 0.00 ? 44  PRO A HB2  8  
ATOM 11197 H HB3  . PRO A 1 36 ? -11.651 13.057  1.096   1.00 0.00 ? 44  PRO A HB3  8  
ATOM 11198 H HG2  . PRO A 1 36 ? -11.111 14.428  3.701   1.00 0.00 ? 44  PRO A HG2  8  
ATOM 11199 H HG3  . PRO A 1 36 ? -12.393 13.278  3.290   1.00 0.00 ? 44  PRO A HG3  8  
ATOM 11200 H HD2  . PRO A 1 36 ? -10.139 12.559  4.624   1.00 0.00 ? 44  PRO A HD2  8  
ATOM 11201 H HD3  . PRO A 1 36 ? -11.010 11.455  3.539   1.00 0.00 ? 44  PRO A HD3  8  
ATOM 11202 N N    . GLY A 1 37 ? -8.519  15.302  0.554   1.00 0.00 ? 45  GLY A N    8  
ATOM 11203 C CA   . GLY A 1 37 ? -7.717  16.512  0.550   1.00 0.00 ? 45  GLY A CA   8  
ATOM 11204 C C    . GLY A 1 37 ? -6.243  16.232  0.773   1.00 0.00 ? 45  GLY A C    8  
ATOM 11205 O O    . GLY A 1 37 ? -5.571  16.959  1.504   1.00 0.00 ? 45  GLY A O    8  
ATOM 11206 H H    . GLY A 1 37 ? -8.921  14.981  -0.280  1.00 0.00 ? 45  GLY A H    8  
ATOM 11207 H HA2  . GLY A 1 37 ? -7.838  17.007  -0.402  1.00 0.00 ? 45  GLY A HA2  8  
ATOM 11208 H HA3  . GLY A 1 37 ? -8.069  17.168  1.332   1.00 0.00 ? 45  GLY A HA3  8  
ATOM 11209 N N    . SER A 1 38 ? -5.741  15.178  0.139   1.00 0.00 ? 46  SER A N    8  
ATOM 11210 C CA   . SER A 1 38 ? -4.338  14.804  0.271   1.00 0.00 ? 46  SER A CA   8  
ATOM 11211 C C    . SER A 1 38 ? -3.789  14.282  -1.053  1.00 0.00 ? 46  SER A C    8  
ATOM 11212 O O    . SER A 1 38 ? -4.499  14.243  -2.058  1.00 0.00 ? 46  SER A O    8  
ATOM 11213 C CB   . SER A 1 38 ? -4.171  13.741  1.359   1.00 0.00 ? 46  SER A CB   8  
ATOM 11214 O OG   . SER A 1 38 ? -4.542  14.249  2.629   1.00 0.00 ? 46  SER A OG   8  
ATOM 11215 H H    . SER A 1 38 ? -6.327  14.638  -0.430  1.00 0.00 ? 46  SER A H    8  
ATOM 11216 H HA   . SER A 1 38 ? -3.784  15.686  0.553   1.00 0.00 ? 46  SER A HA   8  
ATOM 11217 H HB2  . SER A 1 38 ? -4.795  12.892  1.128   1.00 0.00 ? 46  SER A HB2  8  
ATOM 11218 H HB3  . SER A 1 38 ? -3.138  13.428  1.398   1.00 0.00 ? 46  SER A HB3  8  
ATOM 11219 H HG   . SER A 1 38 ? -3.837  14.802  2.972   1.00 0.00 ? 46  SER A HG   8  
ATOM 11220 N N    . LEU A 1 39 ? -2.522  13.880  -1.046  1.00 0.00 ? 47  LEU A N    8  
ATOM 11221 C CA   . LEU A 1 39 ? -1.881  13.358  -2.247  1.00 0.00 ? 47  LEU A CA   8  
ATOM 11222 C C    . LEU A 1 39 ? -2.538  12.054  -2.684  1.00 0.00 ? 47  LEU A C    8  
ATOM 11223 O O    . LEU A 1 39 ? -2.918  11.895  -3.844  1.00 0.00 ? 47  LEU A O    8  
ATOM 11224 C CB   . LEU A 1 39 ? -0.387  13.130  -2.000  1.00 0.00 ? 47  LEU A CB   8  
ATOM 11225 C CG   . LEU A 1 39 ? 0.448   14.398  -1.809  1.00 0.00 ? 47  LEU A CG   8  
ATOM 11226 C CD1  . LEU A 1 39 ? 0.141   15.414  -2.899  1.00 0.00 ? 47  LEU A CD1  8  
ATOM 11227 C CD2  . LEU A 1 39 ? 0.199   14.998  -0.432  1.00 0.00 ? 47  LEU A CD2  8  
ATOM 11228 H H    . LEU A 1 39 ? -2.008  13.933  -0.213  1.00 0.00 ? 47  LEU A H    8  
ATOM 11229 H HA   . LEU A 1 39 ? -2.001  14.089  -3.033  1.00 0.00 ? 47  LEU A HA   8  
ATOM 11230 H HB2  . LEU A 1 39 ? -0.281  12.518  -1.117  1.00 0.00 ? 47  LEU A HB2  8  
ATOM 11231 H HB3  . LEU A 1 39 ? 0.015   12.586  -2.842  1.00 0.00 ? 47  LEU A HB3  8  
ATOM 11232 H HG   . LEU A 1 39 ? 1.496   14.144  -1.877  1.00 0.00 ? 47  LEU A HG   8  
ATOM 11233 H HD11 . LEU A 1 39 ? 0.288   14.960  -3.866  1.00 0.00 ? 47  LEU A HD11 8  
ATOM 11234 H HD12 . LEU A 1 39 ? 0.801   16.262  -2.794  1.00 0.00 ? 47  LEU A HD12 8  
ATOM 11235 H HD13 . LEU A 1 39 ? -0.883  15.742  -2.807  1.00 0.00 ? 47  LEU A HD13 8  
ATOM 11236 H HD21 . LEU A 1 39 ? -0.677  15.627  -0.467  1.00 0.00 ? 47  LEU A HD21 8  
ATOM 11237 H HD22 . LEU A 1 39 ? 1.053   15.585  -0.135  1.00 0.00 ? 47  LEU A HD22 8  
ATOM 11238 H HD23 . LEU A 1 39 ? 0.043   14.203  0.282   1.00 0.00 ? 47  LEU A HD23 8  
ATOM 11239 N N    . SER A 1 40 ? -2.670  11.125  -1.743  1.00 0.00 ? 48  SER A N    8  
ATOM 11240 C CA   . SER A 1 40 ? -3.283  9.832   -2.023  1.00 0.00 ? 48  SER A CA   8  
ATOM 11241 C C    . SER A 1 40 ? -4.713  10.002  -2.527  1.00 0.00 ? 48  SER A C    8  
ATOM 11242 O O    . SER A 1 40 ? -5.163  9.270   -3.408  1.00 0.00 ? 48  SER A O    8  
ATOM 11243 C CB   . SER A 1 40 ? -3.276  8.963   -0.766  1.00 0.00 ? 48  SER A CB   8  
ATOM 11244 O OG   . SER A 1 40 ? -3.989  9.586   0.288   1.00 0.00 ? 48  SER A OG   8  
ATOM 11245 H H    . SER A 1 40 ? -2.348  11.314  -0.836  1.00 0.00 ? 48  SER A H    8  
ATOM 11246 H HA   . SER A 1 40 ? -2.697  9.347   -2.790  1.00 0.00 ? 48  SER A HA   8  
ATOM 11247 H HB2  . SER A 1 40 ? -3.739  8.013   -0.983  1.00 0.00 ? 48  SER A HB2  8  
ATOM 11248 H HB3  . SER A 1 40 ? -2.258  8.801   -0.448  1.00 0.00 ? 48  SER A HB3  8  
ATOM 11249 H HG   . SER A 1 40 ? -3.767  10.520  0.317   1.00 0.00 ? 48  SER A HG   8  
ATOM 11250 N N    . ALA A 1 41 ? -5.422  10.975  -1.962  1.00 0.00 ? 49  ALA A N    8  
ATOM 11251 C CA   . ALA A 1 41 ? -6.800  11.240  -2.354  1.00 0.00 ? 49  ALA A CA   8  
ATOM 11252 C C    . ALA A 1 41 ? -6.865  11.881  -3.736  1.00 0.00 ? 49  ALA A C    8  
ATOM 11253 O O    . ALA A 1 41 ? -7.724  11.541  -4.549  1.00 0.00 ? 49  ALA A O    8  
ATOM 11254 C CB   . ALA A 1 41 ? -7.478  12.131  -1.324  1.00 0.00 ? 49  ALA A CB   8  
ATOM 11255 H H    . ALA A 1 41 ? -5.008  11.525  -1.266  1.00 0.00 ? 49  ALA A H    8  
ATOM 11256 H HA   . ALA A 1 41 ? -7.326  10.297  -2.380  1.00 0.00 ? 49  ALA A HA   8  
ATOM 11257 H HB1  . ALA A 1 41 ? -8.548  12.012  -1.394  1.00 0.00 ? 49  ALA A HB1  8  
ATOM 11258 H HB2  . ALA A 1 41 ? -7.216  13.163  -1.513  1.00 0.00 ? 49  ALA A HB2  8  
ATOM 11259 H HB3  . ALA A 1 41 ? -7.148  11.852  -0.335  1.00 0.00 ? 49  ALA A HB3  8  
ATOM 11260 N N    . GLU A 1 42 ? -5.952  12.811  -3.996  1.00 0.00 ? 50  GLU A N    8  
ATOM 11261 C CA   . GLU A 1 42 ? -5.906  13.499  -5.280  1.00 0.00 ? 50  GLU A CA   8  
ATOM 11262 C C    . GLU A 1 42 ? -5.609  12.520  -6.411  1.00 0.00 ? 50  GLU A C    8  
ATOM 11263 O O    . GLU A 1 42 ? -6.272  12.535  -7.449  1.00 0.00 ? 50  GLU A O    8  
ATOM 11264 C CB   . GLU A 1 42 ? -4.848  14.604  -5.253  1.00 0.00 ? 50  GLU A CB   8  
ATOM 11265 C CG   . GLU A 1 42 ? -5.395  15.961  -4.837  1.00 0.00 ? 50  GLU A CG   8  
ATOM 11266 C CD   . GLU A 1 42 ? -6.472  16.467  -5.777  1.00 0.00 ? 50  GLU A CD   8  
ATOM 11267 O OE1  . GLU A 1 42 ? -6.234  16.476  -7.003  1.00 0.00 ? 50  GLU A OE1  8  
ATOM 11268 O OE2  . GLU A 1 42 ? -7.554  16.854  -5.285  1.00 0.00 ? 50  GLU A OE2  8  
ATOM 11269 H H    . GLU A 1 42 ? -5.293  13.039  -3.307  1.00 0.00 ? 50  GLU A H    8  
ATOM 11270 H HA   . GLU A 1 42 ? -6.874  13.945  -5.451  1.00 0.00 ? 50  GLU A HA   8  
ATOM 11271 H HB2  . GLU A 1 42 ? -4.071  14.325  -4.557  1.00 0.00 ? 50  GLU A HB2  8  
ATOM 11272 H HB3  . GLU A 1 42 ? -4.418  14.700  -6.238  1.00 0.00 ? 50  GLU A HB3  8  
ATOM 11273 H HG2  . GLU A 1 42 ? -5.814  15.877  -3.846  1.00 0.00 ? 50  GLU A HG2  8  
ATOM 11274 H HG3  . GLU A 1 42 ? -4.583  16.673  -4.825  1.00 0.00 ? 50  GLU A HG3  8  
ATOM 11275 N N    . VAL A 1 43 ? -4.608  11.671  -6.204  1.00 0.00 ? 51  VAL A N    8  
ATOM 11276 C CA   . VAL A 1 43 ? -4.223  10.686  -7.206  1.00 0.00 ? 51  VAL A CA   8  
ATOM 11277 C C    . VAL A 1 43 ? -5.305  9.624   -7.380  1.00 0.00 ? 51  VAL A C    8  
ATOM 11278 O O    . VAL A 1 43 ? -5.454  9.045   -8.457  1.00 0.00 ? 51  VAL A O    8  
ATOM 11279 C CB   . VAL A 1 43 ? -2.896  9.997   -6.835  1.00 0.00 ? 51  VAL A CB   8  
ATOM 11280 C CG1  . VAL A 1 43 ? -1.765  11.012  -6.786  1.00 0.00 ? 51  VAL A CG1  8  
ATOM 11281 C CG2  . VAL A 1 43 ? -3.023  9.265   -5.508  1.00 0.00 ? 51  VAL A CG2  8  
ATOM 11282 H H    . VAL A 1 43 ? -4.117  11.709  -5.357  1.00 0.00 ? 51  VAL A H    8  
ATOM 11283 H HA   . VAL A 1 43 ? -4.086  11.202  -8.145  1.00 0.00 ? 51  VAL A HA   8  
ATOM 11284 H HB   . VAL A 1 43 ? -2.664  9.272   -7.602  1.00 0.00 ? 51  VAL A HB   8  
ATOM 11285 H HG11 . VAL A 1 43 ? -2.168  11.988  -6.560  1.00 0.00 ? 51  VAL A HG11 8  
ATOM 11286 H HG12 . VAL A 1 43 ? -1.263  11.039  -7.742  1.00 0.00 ? 51  VAL A HG12 8  
ATOM 11287 H HG13 . VAL A 1 43 ? -1.061  10.727  -6.018  1.00 0.00 ? 51  VAL A HG13 8  
ATOM 11288 H HG21 . VAL A 1 43 ? -3.534  9.896   -4.797  1.00 0.00 ? 51  VAL A HG21 8  
ATOM 11289 H HG22 . VAL A 1 43 ? -2.039  9.026   -5.133  1.00 0.00 ? 51  VAL A HG22 8  
ATOM 11290 H HG23 . VAL A 1 43 ? -3.586  8.355   -5.651  1.00 0.00 ? 51  VAL A HG23 8  
ATOM 11291 N N    . GLY A 1 44 ? -6.057  9.372   -6.314  1.00 0.00 ? 52  GLY A N    8  
ATOM 11292 C CA   . GLY A 1 44 ? -7.115  8.379   -6.369  1.00 0.00 ? 52  GLY A CA   8  
ATOM 11293 C C    . GLY A 1 44 ? -6.718  7.074   -5.710  1.00 0.00 ? 52  GLY A C    8  
ATOM 11294 O O    . GLY A 1 44 ? -6.785  6.012   -6.330  1.00 0.00 ? 52  GLY A O    8  
ATOM 11295 H H    . GLY A 1 44 ? -5.893  9.862   -5.481  1.00 0.00 ? 52  GLY A H    8  
ATOM 11296 H HA2  . GLY A 1 44 ? -7.988  8.771   -5.870  1.00 0.00 ? 52  GLY A HA2  8  
ATOM 11297 H HA3  . GLY A 1 44 ? -7.359  8.188   -7.405  1.00 0.00 ? 52  GLY A HA3  8  
ATOM 11298 N N    . LEU A 1 45 ? -6.301  7.151   -4.450  1.00 0.00 ? 53  LEU A N    8  
ATOM 11299 C CA   . LEU A 1 45 ? -5.890  5.967   -3.706  1.00 0.00 ? 53  LEU A CA   8  
ATOM 11300 C C    . LEU A 1 45 ? -6.983  5.520   -2.742  1.00 0.00 ? 53  LEU A C    8  
ATOM 11301 O O    . LEU A 1 45 ? -7.937  6.255   -2.485  1.00 0.00 ? 53  LEU A O    8  
ATOM 11302 C CB   . LEU A 1 45 ? -4.600  6.248   -2.934  1.00 0.00 ? 53  LEU A CB   8  
ATOM 11303 C CG   . LEU A 1 45 ? -3.310  6.082   -3.740  1.00 0.00 ? 53  LEU A CG   8  
ATOM 11304 C CD1  . LEU A 1 45 ? -2.126  6.654   -2.976  1.00 0.00 ? 53  LEU A CD1  8  
ATOM 11305 C CD2  . LEU A 1 45 ? -3.079  4.615   -4.074  1.00 0.00 ? 53  LEU A CD2  8  
ATOM 11306 H H    . LEU A 1 45 ? -6.268  8.027   -4.011  1.00 0.00 ? 53  LEU A H    8  
ATOM 11307 H HA   . LEU A 1 45 ? -5.706  5.176   -4.417  1.00 0.00 ? 53  LEU A HA   8  
ATOM 11308 H HB2  . LEU A 1 45 ? -4.642  7.263   -2.565  1.00 0.00 ? 53  LEU A HB2  8  
ATOM 11309 H HB3  . LEU A 1 45 ? -4.558  5.579   -2.089  1.00 0.00 ? 53  LEU A HB3  8  
ATOM 11310 H HG   . LEU A 1 45 ? -3.403  6.627   -4.668  1.00 0.00 ? 53  LEU A HG   8  
ATOM 11311 H HD11 . LEU A 1 45 ? -1.331  5.923   -2.938  1.00 0.00 ? 53  LEU A HD11 8  
ATOM 11312 H HD12 . LEU A 1 45 ? -2.431  6.902   -1.970  1.00 0.00 ? 53  LEU A HD12 8  
ATOM 11313 H HD13 . LEU A 1 45 ? -1.772  7.544   -3.474  1.00 0.00 ? 53  LEU A HD13 8  
ATOM 11314 H HD21 . LEU A 1 45 ? -3.138  4.028   -3.171  1.00 0.00 ? 53  LEU A HD21 8  
ATOM 11315 H HD22 . LEU A 1 45 ? -2.101  4.498   -4.517  1.00 0.00 ? 53  LEU A HD22 8  
ATOM 11316 H HD23 . LEU A 1 45 ? -3.833  4.282   -4.771  1.00 0.00 ? 53  LEU A HD23 8  
ATOM 11317 N N    . GLU A 1 46 ? -6.836  4.311   -2.211  1.00 0.00 ? 54  GLU A N    8  
ATOM 11318 C CA   . GLU A 1 46 ? -7.807  3.759   -1.271  1.00 0.00 ? 54  GLU A CA   8  
ATOM 11319 C C    . GLU A 1 46 ? -7.400  2.354   -0.839  1.00 0.00 ? 54  GLU A C    8  
ATOM 11320 O O    . GLU A 1 46 ? -6.543  1.728   -1.461  1.00 0.00 ? 54  GLU A O    8  
ATOM 11321 C CB   . GLU A 1 46 ? -9.203  3.733   -1.902  1.00 0.00 ? 54  GLU A CB   8  
ATOM 11322 C CG   . GLU A 1 46 ? -10.179 4.702   -1.259  1.00 0.00 ? 54  GLU A CG   8  
ATOM 11323 C CD   . GLU A 1 46 ? -10.491 4.347   0.182   1.00 0.00 ? 54  GLU A CD   8  
ATOM 11324 O OE1  . GLU A 1 46 ? -9.566  4.399   1.020   1.00 0.00 ? 54  GLU A OE1  8  
ATOM 11325 O OE2  . GLU A 1 46 ? -11.659 4.015   0.473   1.00 0.00 ? 54  GLU A OE2  8  
ATOM 11326 H H    . GLU A 1 46 ? -6.053  3.775   -2.456  1.00 0.00 ? 54  GLU A H    8  
ATOM 11327 H HA   . GLU A 1 46 ? -7.827  4.400   -0.401  1.00 0.00 ? 54  GLU A HA   8  
ATOM 11328 H HB2  . GLU A 1 46 ? -9.117  3.984   -2.948  1.00 0.00 ? 54  GLU A HB2  8  
ATOM 11329 H HB3  . GLU A 1 46 ? -9.608  2.735   -1.812  1.00 0.00 ? 54  GLU A HB3  8  
ATOM 11330 H HG2  . GLU A 1 46 ? -9.752  5.693   -1.283  1.00 0.00 ? 54  GLU A HG2  8  
ATOM 11331 H HG3  . GLU A 1 46 ? -11.101 4.694   -1.824  1.00 0.00 ? 54  GLU A HG3  8  
ATOM 11332 N N    . ILE A 1 47 ? -8.020  1.863   0.230   1.00 0.00 ? 55  ILE A N    8  
ATOM 11333 C CA   . ILE A 1 47 ? -7.718  0.531   0.739   1.00 0.00 ? 55  ILE A CA   8  
ATOM 11334 C C    . ILE A 1 47 ? -7.960  -0.528  -0.332  1.00 0.00 ? 55  ILE A C    8  
ATOM 11335 O O    . ILE A 1 47 ? -8.996  -0.529  -0.996  1.00 0.00 ? 55  ILE A O    8  
ATOM 11336 C CB   . ILE A 1 47 ? -8.568  0.195   1.981   1.00 0.00 ? 55  ILE A CB   8  
ATOM 11337 C CG1  . ILE A 1 47 ? -8.452  1.306   3.026   1.00 0.00 ? 55  ILE A CG1  8  
ATOM 11338 C CG2  . ILE A 1 47 ? -8.141  -1.141  2.573   1.00 0.00 ? 55  ILE A CG2  8  
ATOM 11339 C CD1  . ILE A 1 47 ? -9.771  1.668   3.672   1.00 0.00 ? 55  ILE A CD1  8  
ATOM 11340 H H    . ILE A 1 47 ? -8.695  2.409   0.685   1.00 0.00 ? 55  ILE A H    8  
ATOM 11341 H HA   . ILE A 1 47 ? -6.676  0.511   1.023   1.00 0.00 ? 55  ILE A HA   8  
ATOM 11342 H HB   . ILE A 1 47 ? -9.598  0.108   1.671   1.00 0.00 ? 55  ILE A HB   8  
ATOM 11343 H HG12 . ILE A 1 47 ? -7.778  0.990   3.806   1.00 0.00 ? 55  ILE A HG12 8  
ATOM 11344 H HG13 . ILE A 1 47 ? -8.058  2.195   2.554   1.00 0.00 ? 55  ILE A HG13 8  
ATOM 11345 H HG21 . ILE A 1 47 ? -8.015  -1.864  1.779   1.00 0.00 ? 55  ILE A HG21 8  
ATOM 11346 H HG22 . ILE A 1 47 ? -8.897  -1.490  3.259   1.00 0.00 ? 55  ILE A HG22 8  
ATOM 11347 H HG23 . ILE A 1 47 ? -7.206  -1.021  3.099   1.00 0.00 ? 55  ILE A HG23 8  
ATOM 11348 H HD11 . ILE A 1 47 ? -9.949  2.727   3.558   1.00 0.00 ? 55  ILE A HD11 8  
ATOM 11349 H HD12 . ILE A 1 47 ? -9.738  1.419   4.722   1.00 0.00 ? 55  ILE A HD12 8  
ATOM 11350 H HD13 . ILE A 1 47 ? -10.568 1.116   3.196   1.00 0.00 ? 55  ILE A HD13 8  
ATOM 11351 N N    . GLY A 1 48 ? -6.995  -1.427  -0.493  1.00 0.00 ? 56  GLY A N    8  
ATOM 11352 C CA   . GLY A 1 48 ? -7.118  -2.478  -1.487  1.00 0.00 ? 56  GLY A CA   8  
ATOM 11353 C C    . GLY A 1 48 ? -6.056  -2.380  -2.562  1.00 0.00 ? 56  GLY A C    8  
ATOM 11354 O O    . GLY A 1 48 ? -5.635  -3.394  -3.123  1.00 0.00 ? 56  GLY A O    8  
ATOM 11355 H H    . GLY A 1 48 ? -6.191  -1.376  0.063   1.00 0.00 ? 56  GLY A H    8  
ATOM 11356 H HA2  . GLY A 1 48 ? -7.034  -3.436  -0.995  1.00 0.00 ? 56  GLY A HA2  8  
ATOM 11357 H HA3  . GLY A 1 48 ? -8.091  -2.407  -1.950  1.00 0.00 ? 56  GLY A HA3  8  
ATOM 11358 N N    . ASP A 1 49 ? -5.616  -1.160  -2.848  1.00 0.00 ? 57  ASP A N    8  
ATOM 11359 C CA   . ASP A 1 49 ? -4.592  -0.936  -3.861  1.00 0.00 ? 57  ASP A CA   8  
ATOM 11360 C C    . ASP A 1 49 ? -3.304  -1.668  -3.498  1.00 0.00 ? 57  ASP A C    8  
ATOM 11361 O O    . ASP A 1 49 ? -3.176  -2.205  -2.397  1.00 0.00 ? 57  ASP A O    8  
ATOM 11362 C CB   . ASP A 1 49 ? -4.320  0.562   -4.013  1.00 0.00 ? 57  ASP A CB   8  
ATOM 11363 C CG   . ASP A 1 49 ? -5.523  1.319   -4.536  1.00 0.00 ? 57  ASP A CG   8  
ATOM 11364 O OD1  . ASP A 1 49 ? -6.662  0.924   -4.209  1.00 0.00 ? 57  ASP A OD1  8  
ATOM 11365 O OD2  . ASP A 1 49 ? -5.328  2.308   -5.274  1.00 0.00 ? 57  ASP A OD2  8  
ATOM 11366 H H    . ASP A 1 49 ? -5.988  -0.393  -2.366  1.00 0.00 ? 57  ASP A H    8  
ATOM 11367 H HA   . ASP A 1 49 ? -4.961  -1.323  -4.800  1.00 0.00 ? 57  ASP A HA   8  
ATOM 11368 H HB2  . ASP A 1 49 ? -4.050  0.972   -3.053  1.00 0.00 ? 57  ASP A HB2  8  
ATOM 11369 H HB3  . ASP A 1 49 ? -3.502  0.703   -4.701  1.00 0.00 ? 57  ASP A HB3  8  
ATOM 11370 N N    . GLN A 1 50 ? -2.354  -1.691  -4.426  1.00 0.00 ? 58  GLN A N    8  
ATOM 11371 C CA   . GLN A 1 50 ? -1.081  -2.365  -4.195  1.00 0.00 ? 58  GLN A CA   8  
ATOM 11372 C C    . GLN A 1 50 ? 0.040   -1.730  -5.011  1.00 0.00 ? 58  GLN A C    8  
ATOM 11373 O O    . GLN A 1 50 ? 0.078   -1.855  -6.236  1.00 0.00 ? 58  GLN A O    8  
ATOM 11374 C CB   . GLN A 1 50 ? -1.197  -3.850  -4.540  1.00 0.00 ? 58  GLN A CB   8  
ATOM 11375 C CG   . GLN A 1 50 ? -0.517  -4.764  -3.536  1.00 0.00 ? 58  GLN A CG   8  
ATOM 11376 C CD   . GLN A 1 50 ? 0.926   -5.050  -3.895  1.00 0.00 ? 58  GLN A CD   8  
ATOM 11377 O OE1  . GLN A 1 50 ? 1.312   -4.992  -5.063  1.00 0.00 ? 58  GLN A OE1  8  
ATOM 11378 N NE2  . GLN A 1 50 ? 1.735   -5.364  -2.890  1.00 0.00 ? 58  GLN A NE2  8  
ATOM 11379 H H    . GLN A 1 50 ? -2.512  -1.249  -5.286  1.00 0.00 ? 58  GLN A H    8  
ATOM 11380 H HA   . GLN A 1 50 ? -0.842  -2.268  -3.148  1.00 0.00 ? 58  GLN A HA   8  
ATOM 11381 H HB2  . GLN A 1 50 ? -2.243  -4.115  -4.587  1.00 0.00 ? 58  GLN A HB2  8  
ATOM 11382 H HB3  . GLN A 1 50 ? -0.750  -4.019  -5.508  1.00 0.00 ? 58  GLN A HB3  8  
ATOM 11383 H HG2  . GLN A 1 50 ? -0.544  -4.294  -2.564  1.00 0.00 ? 58  GLN A HG2  8  
ATOM 11384 H HG3  . GLN A 1 50 ? -1.056  -5.700  -3.497  1.00 0.00 ? 58  GLN A HG3  8  
ATOM 11385 H HE21 . GLN A 1 50 ? 1.359   -5.392  -1.985  1.00 0.00 ? 58  GLN A HE21 8  
ATOM 11386 H HE22 . GLN A 1 50 ? 2.675   -5.554  -3.093  1.00 0.00 ? 58  GLN A HE22 8  
ATOM 11387 N N    . ILE A 1 51 ? 0.959   -1.058  -4.325  1.00 0.00 ? 59  ILE A N    8  
ATOM 11388 C CA   . ILE A 1 51 ? 2.085   -0.413  -4.990  1.00 0.00 ? 59  ILE A CA   8  
ATOM 11389 C C    . ILE A 1 51 ? 3.047   -1.457  -5.544  1.00 0.00 ? 59  ILE A C    8  
ATOM 11390 O O    . ILE A 1 51 ? 3.627   -2.240  -4.792  1.00 0.00 ? 59  ILE A O    8  
ATOM 11391 C CB   . ILE A 1 51 ? 2.848   0.519   -4.027  1.00 0.00 ? 59  ILE A CB   8  
ATOM 11392 C CG1  . ILE A 1 51 ? 1.880   1.477   -3.329  1.00 0.00 ? 59  ILE A CG1  8  
ATOM 11393 C CG2  . ILE A 1 51 ? 3.921   1.296   -4.777  1.00 0.00 ? 59  ILE A CG2  8  
ATOM 11394 C CD1  . ILE A 1 51 ? 2.259   1.784   -1.898  1.00 0.00 ? 59  ILE A CD1  8  
ATOM 11395 H H    . ILE A 1 51 ? 0.880   -0.999  -3.350  1.00 0.00 ? 59  ILE A H    8  
ATOM 11396 H HA   . ILE A 1 51 ? 1.699   0.180   -5.806  1.00 0.00 ? 59  ILE A HA   8  
ATOM 11397 H HB   . ILE A 1 51 ? 3.338   -0.092  -3.283  1.00 0.00 ? 59  ILE A HB   8  
ATOM 11398 H HG12 . ILE A 1 51 ? 1.854   2.410   -3.873  1.00 0.00 ? 59  ILE A HG12 8  
ATOM 11399 H HG13 . ILE A 1 51 ? 0.892   1.040   -3.325  1.00 0.00 ? 59  ILE A HG13 8  
ATOM 11400 H HG21 . ILE A 1 51 ? 3.469   1.825   -5.604  1.00 0.00 ? 59  ILE A HG21 8  
ATOM 11401 H HG22 . ILE A 1 51 ? 4.666   0.611   -5.153  1.00 0.00 ? 59  ILE A HG22 8  
ATOM 11402 H HG23 . ILE A 1 51 ? 4.386   2.004   -4.107  1.00 0.00 ? 59  ILE A HG23 8  
ATOM 11403 H HD11 . ILE A 1 51 ? 3.335   1.829   -1.813  1.00 0.00 ? 59  ILE A HD11 8  
ATOM 11404 H HD12 . ILE A 1 51 ? 1.878   1.009   -1.251  1.00 0.00 ? 59  ILE A HD12 8  
ATOM 11405 H HD13 . ILE A 1 51 ? 1.835   2.734   -1.609  1.00 0.00 ? 59  ILE A HD13 8  
ATOM 11406 N N    . VAL A 1 52 ? 3.205   -1.472  -6.863  1.00 0.00 ? 60  VAL A N    8  
ATOM 11407 C CA   . VAL A 1 52 ? 4.089   -2.431  -7.515  1.00 0.00 ? 60  VAL A CA   8  
ATOM 11408 C C    . VAL A 1 52 ? 5.426   -1.803  -7.906  1.00 0.00 ? 60  VAL A C    8  
ATOM 11409 O O    . VAL A 1 52 ? 6.261   -2.454  -8.532  1.00 0.00 ? 60  VAL A O    8  
ATOM 11410 C CB   . VAL A 1 52 ? 3.429   -3.029  -8.772  1.00 0.00 ? 60  VAL A CB   8  
ATOM 11411 C CG1  . VAL A 1 52 ? 2.169   -3.797  -8.403  1.00 0.00 ? 60  VAL A CG1  8  
ATOM 11412 C CG2  . VAL A 1 52 ? 3.117   -1.936  -9.784  1.00 0.00 ? 60  VAL A CG2  8  
ATOM 11413 H H    . VAL A 1 52 ? 2.709   -0.827  -7.412  1.00 0.00 ? 60  VAL A H    8  
ATOM 11414 H HA   . VAL A 1 52 ? 4.273   -3.236  -6.818  1.00 0.00 ? 60  VAL A HA   8  
ATOM 11415 H HB   . VAL A 1 52 ? 4.124   -3.720  -9.226  1.00 0.00 ? 60  VAL A HB   8  
ATOM 11416 H HG11 . VAL A 1 52 ? 2.338   -4.347  -7.489  1.00 0.00 ? 60  VAL A HG11 8  
ATOM 11417 H HG12 . VAL A 1 52 ? 1.921   -4.486  -9.197  1.00 0.00 ? 60  VAL A HG12 8  
ATOM 11418 H HG13 . VAL A 1 52 ? 1.353   -3.103  -8.261  1.00 0.00 ? 60  VAL A HG13 8  
ATOM 11419 H HG21 . VAL A 1 52 ? 2.916   -2.382  -10.747 1.00 0.00 ? 60  VAL A HG21 8  
ATOM 11420 H HG22 . VAL A 1 52 ? 3.962   -1.269  -9.867  1.00 0.00 ? 60  VAL A HG22 8  
ATOM 11421 H HG23 . VAL A 1 52 ? 2.250   -1.380  -9.458  1.00 0.00 ? 60  VAL A HG23 8  
ATOM 11422 N N    . GLU A 1 53 ? 5.629   -0.541  -7.535  1.00 0.00 ? 61  GLU A N    8  
ATOM 11423 C CA   . GLU A 1 53 ? 6.873   0.151   -7.857  1.00 0.00 ? 61  GLU A CA   8  
ATOM 11424 C C    . GLU A 1 53 ? 6.920   1.531   -7.208  1.00 0.00 ? 61  GLU A C    8  
ATOM 11425 O O    . GLU A 1 53 ? 5.889   2.179   -7.028  1.00 0.00 ? 61  GLU A O    8  
ATOM 11426 C CB   . GLU A 1 53 ? 7.031   0.283   -9.372  1.00 0.00 ? 61  GLU A CB   8  
ATOM 11427 C CG   . GLU A 1 53 ? 8.478   0.245   -9.838  1.00 0.00 ? 61  GLU A CG   8  
ATOM 11428 C CD   . GLU A 1 53 ? 8.890   -1.122  -10.350 1.00 0.00 ? 61  GLU A CD   8  
ATOM 11429 O OE1  . GLU A 1 53 ? 8.336   -2.130  -9.862  1.00 0.00 ? 61  GLU A OE1  8  
ATOM 11430 O OE2  . GLU A 1 53 ? 9.767   -1.185  -11.237 1.00 0.00 ? 61  GLU A OE2  8  
ATOM 11431 H H    . GLU A 1 53 ? 4.932   -0.065  -7.038  1.00 0.00 ? 61  GLU A H    8  
ATOM 11432 H HA   . GLU A 1 53 ? 7.689   -0.442  -7.470  1.00 0.00 ? 61  GLU A HA   8  
ATOM 11433 H HB2  . GLU A 1 53 ? 6.500   -0.526  -9.850  1.00 0.00 ? 61  GLU A HB2  8  
ATOM 11434 H HB3  . GLU A 1 53 ? 6.600   1.222   -9.688  1.00 0.00 ? 61  GLU A HB3  8  
ATOM 11435 H HG2  . GLU A 1 53 ? 8.606   0.963   -10.635 1.00 0.00 ? 61  GLU A HG2  8  
ATOM 11436 H HG3  . GLU A 1 53 ? 9.118   0.510   -9.009  1.00 0.00 ? 61  GLU A HG3  8  
ATOM 11437 N N    . VAL A 1 54 ? 8.124   1.973   -6.861  1.00 0.00 ? 62  VAL A N    8  
ATOM 11438 C CA   . VAL A 1 54 ? 8.313   3.275   -6.233  1.00 0.00 ? 62  VAL A CA   8  
ATOM 11439 C C    . VAL A 1 54 ? 9.692   3.842   -6.552  1.00 0.00 ? 62  VAL A C    8  
ATOM 11440 O O    . VAL A 1 54 ? 10.697  3.404   -5.993  1.00 0.00 ? 62  VAL A O    8  
ATOM 11441 C CB   . VAL A 1 54 ? 8.144   3.192   -4.702  1.00 0.00 ? 62  VAL A CB   8  
ATOM 11442 C CG1  . VAL A 1 54 ? 8.234   4.577   -4.075  1.00 0.00 ? 62  VAL A CG1  8  
ATOM 11443 C CG2  . VAL A 1 54 ? 6.826   2.520   -4.347  1.00 0.00 ? 62  VAL A CG2  8  
ATOM 11444 H H    . VAL A 1 54 ? 8.907   1.408   -7.031  1.00 0.00 ? 62  VAL A H    8  
ATOM 11445 H HA   . VAL A 1 54 ? 7.559   3.945   -6.622  1.00 0.00 ? 62  VAL A HA   8  
ATOM 11446 H HB   . VAL A 1 54 ? 8.948   2.590   -4.305  1.00 0.00 ? 62  VAL A HB   8  
ATOM 11447 H HG11 . VAL A 1 54 ? 8.259   5.326   -4.853  1.00 0.00 ? 62  VAL A HG11 8  
ATOM 11448 H HG12 . VAL A 1 54 ? 9.134   4.645   -3.482  1.00 0.00 ? 62  VAL A HG12 8  
ATOM 11449 H HG13 . VAL A 1 54 ? 7.375   4.743   -3.441  1.00 0.00 ? 62  VAL A HG13 8  
ATOM 11450 H HG21 . VAL A 1 54 ? 6.894   1.463   -4.553  1.00 0.00 ? 62  VAL A HG21 8  
ATOM 11451 H HG22 . VAL A 1 54 ? 6.031   2.953   -4.937  1.00 0.00 ? 62  VAL A HG22 8  
ATOM 11452 H HG23 . VAL A 1 54 ? 6.617   2.670   -3.298  1.00 0.00 ? 62  VAL A HG23 8  
ATOM 11453 N N    . ASN A 1 55 ? 9.732   4.817   -7.453  1.00 0.00 ? 63  ASN A N    8  
ATOM 11454 C CA   . ASN A 1 55 ? 10.989  5.443   -7.846  1.00 0.00 ? 63  ASN A CA   8  
ATOM 11455 C C    . ASN A 1 55 ? 11.943  4.416   -8.449  1.00 0.00 ? 63  ASN A C    8  
ATOM 11456 O O    . ASN A 1 55 ? 13.161  4.541   -8.330  1.00 0.00 ? 63  ASN A O    8  
ATOM 11457 C CB   . ASN A 1 55 ? 11.646  6.119   -6.641  1.00 0.00 ? 63  ASN A CB   8  
ATOM 11458 C CG   . ASN A 1 55 ? 12.368  7.398   -7.019  1.00 0.00 ? 63  ASN A CG   8  
ATOM 11459 O OD1  . ASN A 1 55 ? 13.597  7.461   -6.990  1.00 0.00 ? 63  ASN A OD1  8  
ATOM 11460 N ND2  . ASN A 1 55 ? 11.606  8.426   -7.373  1.00 0.00 ? 63  ASN A ND2  8  
ATOM 11461 H H    . ASN A 1 55 ? 8.896   5.124   -7.864  1.00 0.00 ? 63  ASN A H    8  
ATOM 11462 H HA   . ASN A 1 55 ? 10.767  6.192   -8.592  1.00 0.00 ? 63  ASN A HA   8  
ATOM 11463 H HB2  . ASN A 1 55 ? 10.884  6.359   -5.912  1.00 0.00 ? 63  ASN A HB2  8  
ATOM 11464 H HB3  . ASN A 1 55 ? 12.360  5.440   -6.200  1.00 0.00 ? 63  ASN A HB3  8  
ATOM 11465 H HD21 . ASN A 1 55 ? 10.633  8.302   -7.373  1.00 0.00 ? 63  ASN A HD21 8  
ATOM 11466 H HD22 . ASN A 1 55 ? 12.046  9.264   -7.622  1.00 0.00 ? 63  ASN A HD22 8  
ATOM 11467 N N    . GLY A 1 56 ? 11.379  3.400   -9.094  1.00 0.00 ? 64  GLY A N    8  
ATOM 11468 C CA   . GLY A 1 56 ? 12.195  2.367   -9.705  1.00 0.00 ? 64  GLY A CA   8  
ATOM 11469 C C    . GLY A 1 56 ? 12.267  1.111   -8.860  1.00 0.00 ? 64  GLY A C    8  
ATOM 11470 O O    . GLY A 1 56 ? 12.426  0.009   -9.384  1.00 0.00 ? 64  GLY A O    8  
ATOM 11471 H H    . GLY A 1 56 ? 10.403  3.353   -9.156  1.00 0.00 ? 64  GLY A H    8  
ATOM 11472 H HA2  . GLY A 1 56 ? 11.775  2.116   -10.668 1.00 0.00 ? 64  GLY A HA2  8  
ATOM 11473 H HA3  . GLY A 1 56 ? 13.194  2.749   -9.847  1.00 0.00 ? 64  GLY A HA3  8  
ATOM 11474 N N    . VAL A 1 57 ? 12.148  1.278   -7.546  1.00 0.00 ? 65  VAL A N    8  
ATOM 11475 C CA   . VAL A 1 57 ? 12.200  0.147   -6.626  1.00 0.00 ? 65  VAL A CA   8  
ATOM 11476 C C    . VAL A 1 57 ? 11.041  -0.813  -6.870  1.00 0.00 ? 65  VAL A C    8  
ATOM 11477 O O    . VAL A 1 57 ? 9.890   -0.393  -6.997  1.00 0.00 ? 65  VAL A O    8  
ATOM 11478 C CB   . VAL A 1 57 ? 12.164  0.615   -5.158  1.00 0.00 ? 65  VAL A CB   8  
ATOM 11479 C CG1  . VAL A 1 57 ? 12.418  -0.552  -4.219  1.00 0.00 ? 65  VAL A CG1  8  
ATOM 11480 C CG2  . VAL A 1 57 ? 13.178  1.726   -4.926  1.00 0.00 ? 65  VAL A CG2  8  
ATOM 11481 H H    . VAL A 1 57 ? 12.022  2.181   -7.187  1.00 0.00 ? 65  VAL A H    8  
ATOM 11482 H HA   . VAL A 1 57 ? 13.130  -0.377  -6.793  1.00 0.00 ? 65  VAL A HA   8  
ATOM 11483 H HB   . VAL A 1 57 ? 11.178  1.008   -4.951  1.00 0.00 ? 65  VAL A HB   8  
ATOM 11484 H HG11 . VAL A 1 57 ? 12.154  -0.268  -3.211  1.00 0.00 ? 65  VAL A HG11 8  
ATOM 11485 H HG12 . VAL A 1 57 ? 13.462  -0.823  -4.255  1.00 0.00 ? 65  VAL A HG12 8  
ATOM 11486 H HG13 . VAL A 1 57 ? 11.817  -1.397  -4.523  1.00 0.00 ? 65  VAL A HG13 8  
ATOM 11487 H HG21 . VAL A 1 57 ? 13.580  1.643   -3.929  1.00 0.00 ? 65  VAL A HG21 8  
ATOM 11488 H HG22 . VAL A 1 57 ? 12.694  2.684   -5.041  1.00 0.00 ? 65  VAL A HG22 8  
ATOM 11489 H HG23 . VAL A 1 57 ? 13.979  1.637   -5.647  1.00 0.00 ? 65  VAL A HG23 8  
ATOM 11490 N N    . ASP A 1 58 ? 11.351  -2.103  -6.935  1.00 0.00 ? 66  ASP A N    8  
ATOM 11491 C CA   . ASP A 1 58 ? 10.335  -3.122  -7.165  1.00 0.00 ? 66  ASP A CA   8  
ATOM 11492 C C    . ASP A 1 58 ? 9.621   -3.483  -5.865  1.00 0.00 ? 66  ASP A C    8  
ATOM 11493 O O    . ASP A 1 58 ? 10.236  -3.994  -4.930  1.00 0.00 ? 66  ASP A O    8  
ATOM 11494 C CB   . ASP A 1 58 ? 10.970  -4.375  -7.777  1.00 0.00 ? 66  ASP A CB   8  
ATOM 11495 C CG   . ASP A 1 58 ? 10.208  -4.875  -8.989  1.00 0.00 ? 66  ASP A CG   8  
ATOM 11496 O OD1  . ASP A 1 58 ? 8.959   -4.884  -8.944  1.00 0.00 ? 66  ASP A OD1  8  
ATOM 11497 O OD2  . ASP A 1 58 ? 10.861  -5.257  -9.983  1.00 0.00 ? 66  ASP A OD2  8  
ATOM 11498 H H    . ASP A 1 58 ? 12.286  -2.376  -6.827  1.00 0.00 ? 66  ASP A H    8  
ATOM 11499 H HA   . ASP A 1 58 ? 9.611   -2.720  -7.860  1.00 0.00 ? 66  ASP A HA   8  
ATOM 11500 H HB2  . ASP A 1 58 ? 11.980  -4.146  -8.080  1.00 0.00 ? 66  ASP A HB2  8  
ATOM 11501 H HB3  . ASP A 1 58 ? 10.990  -5.162  -7.037  1.00 0.00 ? 66  ASP A HB3  8  
ATOM 11502 N N    . PHE A 1 59 ? 8.321   -3.213  -5.814  1.00 0.00 ? 67  PHE A N    8  
ATOM 11503 C CA   . PHE A 1 59 ? 7.526   -3.510  -4.627  1.00 0.00 ? 67  PHE A CA   8  
ATOM 11504 C C    . PHE A 1 59 ? 6.892   -4.897  -4.718  1.00 0.00 ? 67  PHE A C    8  
ATOM 11505 O O    . PHE A 1 59 ? 5.996   -5.228  -3.941  1.00 0.00 ? 67  PHE A O    8  
ATOM 11506 C CB   . PHE A 1 59 ? 6.439   -2.450  -4.438  1.00 0.00 ? 67  PHE A CB   8  
ATOM 11507 C CG   . PHE A 1 59 ? 6.868   -1.297  -3.575  1.00 0.00 ? 67  PHE A CG   8  
ATOM 11508 C CD1  . PHE A 1 59 ? 8.130   -0.742  -3.712  1.00 0.00 ? 67  PHE A CD1  8  
ATOM 11509 C CD2  . PHE A 1 59 ? 6.007   -0.768  -2.626  1.00 0.00 ? 67  PHE A CD2  8  
ATOM 11510 C CE1  . PHE A 1 59 ? 8.527   0.316   -2.919  1.00 0.00 ? 67  PHE A CE1  8  
ATOM 11511 C CE2  . PHE A 1 59 ? 6.398   0.293   -1.831  1.00 0.00 ? 67  PHE A CE2  8  
ATOM 11512 C CZ   . PHE A 1 59 ? 7.660   0.835   -1.977  1.00 0.00 ? 67  PHE A CZ   8  
ATOM 11513 H H    . PHE A 1 59 ? 7.885   -2.806  -6.591  1.00 0.00 ? 67  PHE A H    8  
ATOM 11514 H HA   . PHE A 1 59 ? 8.188   -3.487  -3.774  1.00 0.00 ? 67  PHE A HA   8  
ATOM 11515 H HB2  . PHE A 1 59 ? 6.157   -2.057  -5.402  1.00 0.00 ? 67  PHE A HB2  8  
ATOM 11516 H HB3  . PHE A 1 59 ? 5.578   -2.909  -3.976  1.00 0.00 ? 67  PHE A HB3  8  
ATOM 11517 H HD1  . PHE A 1 59 ? 8.809   -1.147  -4.448  1.00 0.00 ? 67  PHE A HD1  8  
ATOM 11518 H HD2  . PHE A 1 59 ? 5.020   -1.191  -2.511  1.00 0.00 ? 67  PHE A HD2  8  
ATOM 11519 H HE1  . PHE A 1 59 ? 9.514   0.739   -3.036  1.00 0.00 ? 67  PHE A HE1  8  
ATOM 11520 H HE2  . PHE A 1 59 ? 5.718   0.696   -1.095  1.00 0.00 ? 67  PHE A HE2  8  
ATOM 11521 H HZ   . PHE A 1 59 ? 7.967   1.663   -1.357  1.00 0.00 ? 67  PHE A HZ   8  
ATOM 11522 N N    . SER A 1 60 ? 7.359   -5.707  -5.664  1.00 0.00 ? 68  SER A N    8  
ATOM 11523 C CA   . SER A 1 60 ? 6.832   -7.054  -5.841  1.00 0.00 ? 68  SER A CA   8  
ATOM 11524 C C    . SER A 1 60 ? 7.188   -7.930  -4.644  1.00 0.00 ? 68  SER A C    8  
ATOM 11525 O O    . SER A 1 60 ? 6.419   -8.808  -4.252  1.00 0.00 ? 68  SER A O    8  
ATOM 11526 C CB   . SER A 1 60 ? 7.384   -7.679  -7.125  1.00 0.00 ? 68  SER A CB   8  
ATOM 11527 O OG   . SER A 1 60 ? 6.400   -8.465  -7.773  1.00 0.00 ? 68  SER A OG   8  
ATOM 11528 H H    . SER A 1 60 ? 8.077   -5.395  -6.254  1.00 0.00 ? 68  SER A H    8  
ATOM 11529 H HA   . SER A 1 60 ? 5.758   -6.985  -5.916  1.00 0.00 ? 68  SER A HA   8  
ATOM 11530 H HB2  . SER A 1 60 ? 7.699   -6.894  -7.797  1.00 0.00 ? 68  SER A HB2  8  
ATOM 11531 H HB3  . SER A 1 60 ? 8.228   -8.307  -6.883  1.00 0.00 ? 68  SER A HB3  8  
ATOM 11532 H HG   . SER A 1 60 ? 5.566   -7.990  -7.785  1.00 0.00 ? 68  SER A HG   8  
ATOM 11533 N N    . ASN A 1 61 ? 8.358   -7.679  -4.066  1.00 0.00 ? 69  ASN A N    8  
ATOM 11534 C CA   . ASN A 1 61 ? 8.820   -8.438  -2.909  1.00 0.00 ? 69  ASN A CA   8  
ATOM 11535 C C    . ASN A 1 61 ? 9.518   -7.523  -1.910  1.00 0.00 ? 69  ASN A C    8  
ATOM 11536 O O    . ASN A 1 61 ? 10.453  -7.935  -1.222  1.00 0.00 ? 69  ASN A O    8  
ATOM 11537 C CB   . ASN A 1 61 ? 9.771   -9.552  -3.351  1.00 0.00 ? 69  ASN A CB   8  
ATOM 11538 C CG   . ASN A 1 61 ? 9.088   -10.578 -4.235  1.00 0.00 ? 69  ASN A CG   8  
ATOM 11539 O OD1  . ASN A 1 61 ? 8.338   -11.428 -3.754  1.00 0.00 ? 69  ASN A OD1  8  
ATOM 11540 N ND2  . ASN A 1 61 ? 9.347   -10.503 -5.536  1.00 0.00 ? 69  ASN A ND2  8  
ATOM 11541 H H    . ASN A 1 61 ? 8.924   -6.964  -4.424  1.00 0.00 ? 69  ASN A H    8  
ATOM 11542 H HA   . ASN A 1 61 ? 7.956   -8.879  -2.434  1.00 0.00 ? 69  ASN A HA   8  
ATOM 11543 H HB2  . ASN A 1 61 ? 10.592  -9.119  -3.903  1.00 0.00 ? 69  ASN A HB2  8  
ATOM 11544 H HB3  . ASN A 1 61 ? 10.155  -10.056 -2.476  1.00 0.00 ? 69  ASN A HB3  8  
ATOM 11545 H HD21 . ASN A 1 61 ? 9.954   -9.800  -5.847  1.00 0.00 ? 69  ASN A HD21 8  
ATOM 11546 H HD22 . ASN A 1 61 ? 8.918   -11.154 -6.131  1.00 0.00 ? 69  ASN A HD22 8  
ATOM 11547 N N    . LEU A 1 62 ? 9.058   -6.279  -1.834  1.00 0.00 ? 70  LEU A N    8  
ATOM 11548 C CA   . LEU A 1 62 ? 9.636   -5.302  -0.919  1.00 0.00 ? 70  LEU A CA   8  
ATOM 11549 C C    . LEU A 1 62 ? 9.076   -5.475  0.488   1.00 0.00 ? 70  LEU A C    8  
ATOM 11550 O O    . LEU A 1 62 ? 7.917   -5.850  0.664   1.00 0.00 ? 70  LEU A O    8  
ATOM 11551 C CB   . LEU A 1 62 ? 9.362   -3.881  -1.418  1.00 0.00 ? 70  LEU A CB   8  
ATOM 11552 C CG   . LEU A 1 62 ? 9.997   -2.768  -0.582  1.00 0.00 ? 70  LEU A CG   8  
ATOM 11553 C CD1  . LEU A 1 62 ? 11.148  -2.117  -1.334  1.00 0.00 ? 70  LEU A CD1  8  
ATOM 11554 C CD2  . LEU A 1 62 ? 8.956   -1.727  -0.196  1.00 0.00 ? 70  LEU A CD2  8  
ATOM 11555 H H    . LEU A 1 62 ? 8.310   -6.011  -2.410  1.00 0.00 ? 70  LEU A H    8  
ATOM 11556 H HA   . LEU A 1 62 ? 10.703  -5.464  -0.892  1.00 0.00 ? 70  LEU A HA   8  
ATOM 11557 H HB2  . LEU A 1 62 ? 9.732   -3.801  -2.431  1.00 0.00 ? 70  LEU A HB2  8  
ATOM 11558 H HB3  . LEU A 1 62 ? 8.293   -3.728  -1.431  1.00 0.00 ? 70  LEU A HB3  8  
ATOM 11559 H HG   . LEU A 1 62 ? 10.396  -3.195  0.327   1.00 0.00 ? 70  LEU A HG   8  
ATOM 11560 H HD11 . LEU A 1 62 ? 11.456  -2.760  -2.146  1.00 0.00 ? 70  LEU A HD11 8  
ATOM 11561 H HD12 . LEU A 1 62 ? 11.978  -1.963  -0.662  1.00 0.00 ? 70  LEU A HD12 8  
ATOM 11562 H HD13 . LEU A 1 62 ? 10.826  -1.166  -1.733  1.00 0.00 ? 70  LEU A HD13 8  
ATOM 11563 H HD21 . LEU A 1 62 ? 9.453   -0.828  0.135   1.00 0.00 ? 70  LEU A HD21 8  
ATOM 11564 H HD22 . LEU A 1 62 ? 8.339   -2.113  0.602   1.00 0.00 ? 70  LEU A HD22 8  
ATOM 11565 H HD23 . LEU A 1 62 ? 8.338   -1.501  -1.053  1.00 0.00 ? 70  LEU A HD23 8  
ATOM 11566 N N    . ASP A 1 63 ? 9.907   -5.200  1.487   1.00 0.00 ? 71  ASP A N    8  
ATOM 11567 C CA   . ASP A 1 63 ? 9.496   -5.325  2.881   1.00 0.00 ? 71  ASP A CA   8  
ATOM 11568 C C    . ASP A 1 63 ? 8.615   -4.150  3.296   1.00 0.00 ? 71  ASP A C    8  
ATOM 11569 O O    . ASP A 1 63 ? 8.519   -3.151  2.583   1.00 0.00 ? 71  ASP A O    8  
ATOM 11570 C CB   . ASP A 1 63 ? 10.723  -5.408  3.790   1.00 0.00 ? 71  ASP A CB   8  
ATOM 11571 C CG   . ASP A 1 63 ? 10.620  -6.540  4.795   1.00 0.00 ? 71  ASP A CG   8  
ATOM 11572 O OD1  . ASP A 1 63 ? 9.517   -6.750  5.343   1.00 0.00 ? 71  ASP A OD1  8  
ATOM 11573 O OD2  . ASP A 1 63 ? 11.643  -7.216  5.034   1.00 0.00 ? 71  ASP A OD2  8  
ATOM 11574 H H    . ASP A 1 63 ? 10.819  -4.904  1.284   1.00 0.00 ? 71  ASP A H    8  
ATOM 11575 H HA   . ASP A 1 63 ? 8.925   -6.236  2.976   1.00 0.00 ? 71  ASP A HA   8  
ATOM 11576 H HB2  . ASP A 1 63 ? 11.602  -5.569  3.185   1.00 0.00 ? 71  ASP A HB2  8  
ATOM 11577 H HB3  . ASP A 1 63 ? 10.828  -4.480  4.331   1.00 0.00 ? 71  ASP A HB3  8  
ATOM 11578 N N    . HIS A 1 64 ? 7.975   -4.277  4.454   1.00 0.00 ? 72  HIS A N    8  
ATOM 11579 C CA   . HIS A 1 64 ? 7.102   -3.226  4.965   1.00 0.00 ? 72  HIS A CA   8  
ATOM 11580 C C    . HIS A 1 64 ? 7.898   -1.966  5.290   1.00 0.00 ? 72  HIS A C    8  
ATOM 11581 O O    . HIS A 1 64 ? 7.617   -0.889  4.763   1.00 0.00 ? 72  HIS A O    8  
ATOM 11582 C CB   . HIS A 1 64 ? 6.364   -3.713  6.214   1.00 0.00 ? 72  HIS A CB   8  
ATOM 11583 C CG   . HIS A 1 64 ? 5.407   -2.707  6.773   1.00 0.00 ? 72  HIS A CG   8  
ATOM 11584 N ND1  . HIS A 1 64 ? 5.186   -2.546  8.125   1.00 0.00 ? 72  HIS A ND1  8  
ATOM 11585 C CD2  . HIS A 1 64 ? 4.608   -1.804  6.155   1.00 0.00 ? 72  HIS A CD2  8  
ATOM 11586 C CE1  . HIS A 1 64 ? 4.294   -1.591  8.314   1.00 0.00 ? 72  HIS A CE1  8  
ATOM 11587 N NE2  . HIS A 1 64 ? 3.929   -1.123  7.134   1.00 0.00 ? 72  HIS A NE2  8  
ATOM 11588 H H    . HIS A 1 64 ? 8.093   -5.098  4.977   1.00 0.00 ? 72  HIS A H    8  
ATOM 11589 H HA   . HIS A 1 64 ? 6.380   -2.994  4.198   1.00 0.00 ? 72  HIS A HA   8  
ATOM 11590 H HB2  . HIS A 1 64 ? 5.804   -4.603  5.969   1.00 0.00 ? 72  HIS A HB2  8  
ATOM 11591 H HB3  . HIS A 1 64 ? 7.087   -3.949  6.982   1.00 0.00 ? 72  HIS A HB3  8  
ATOM 11592 H HD1  . HIS A 1 64 ? 5.620   -3.058  8.840   1.00 0.00 ? 72  HIS A HD1  8  
ATOM 11593 H HD2  . HIS A 1 64 ? 4.522   -1.648  5.088   1.00 0.00 ? 72  HIS A HD2  8  
ATOM 11594 H HE1  . HIS A 1 64 ? 3.928   -1.247  9.270   1.00 0.00 ? 72  HIS A HE1  8  
ATOM 11595 H HE2  . HIS A 1 64 ? 3.340   -0.354  6.990   1.00 0.00 ? 72  HIS A HE2  8  
ATOM 11596 N N    . LYS A 1 65 ? 8.892   -2.108  6.162   1.00 0.00 ? 73  LYS A N    8  
ATOM 11597 C CA   . LYS A 1 65 ? 9.729   -0.980  6.558   1.00 0.00 ? 73  LYS A CA   8  
ATOM 11598 C C    . LYS A 1 65 ? 10.378  -0.327  5.341   1.00 0.00 ? 73  LYS A C    8  
ATOM 11599 O O    . LYS A 1 65 ? 10.493  0.897   5.267   1.00 0.00 ? 73  LYS A O    8  
ATOM 11600 C CB   . LYS A 1 65 ? 10.809  -1.440  7.539   1.00 0.00 ? 73  LYS A CB   8  
ATOM 11601 C CG   . LYS A 1 65 ? 10.391  -1.338  8.997   1.00 0.00 ? 73  LYS A CG   8  
ATOM 11602 C CD   . LYS A 1 65 ? 9.764   -2.632  9.488   1.00 0.00 ? 73  LYS A CD   8  
ATOM 11603 C CE   . LYS A 1 65 ? 8.769   -2.379  10.611  1.00 0.00 ? 73  LYS A CE   8  
ATOM 11604 N NZ   . LYS A 1 65 ? 8.511   -3.606  11.413  1.00 0.00 ? 73  LYS A NZ   8  
ATOM 11605 H H    . LYS A 1 65 ? 9.067   -2.991  6.548   1.00 0.00 ? 73  LYS A H    8  
ATOM 11606 H HA   . LYS A 1 65 ? 9.097   -0.255  7.046   1.00 0.00 ? 73  LYS A HA   8  
ATOM 11607 H HB2  . LYS A 1 65 ? 11.053  -2.471  7.329   1.00 0.00 ? 73  LYS A HB2  8  
ATOM 11608 H HB3  . LYS A 1 65 ? 11.692  -0.834  7.397   1.00 0.00 ? 73  LYS A HB3  8  
ATOM 11609 H HG2  . LYS A 1 65 ? 11.261  -1.121  9.597   1.00 0.00 ? 73  LYS A HG2  8  
ATOM 11610 H HG3  . LYS A 1 65 ? 9.672   -0.538  9.099   1.00 0.00 ? 73  LYS A HG3  8  
ATOM 11611 H HD2  . LYS A 1 65 ? 9.251   -3.108  8.667   1.00 0.00 ? 73  LYS A HD2  8  
ATOM 11612 H HD3  . LYS A 1 65 ? 10.545  -3.283  9.854   1.00 0.00 ? 73  LYS A HD3  8  
ATOM 11613 H HE2  . LYS A 1 65 ? 9.165   -1.612  11.259  1.00 0.00 ? 73  LYS A HE2  8  
ATOM 11614 H HE3  . LYS A 1 65 ? 7.838   -2.038  10.178  1.00 0.00 ? 73  LYS A HE3  8  
ATOM 11615 H HZ1  . LYS A 1 65 ? 7.651   -4.082  11.070  1.00 0.00 ? 73  LYS A HZ1  8  
ATOM 11616 H HZ2  . LYS A 1 65 ? 8.381   -3.358  12.413  1.00 0.00 ? 73  LYS A HZ2  8  
ATOM 11617 H HZ3  . LYS A 1 65 ? 9.313   -4.263  11.330  1.00 0.00 ? 73  LYS A HZ3  8  
ATOM 11618 N N    . GLU A 1 66 ? 10.801  -1.151  4.388   1.00 0.00 ? 74  GLU A N    8  
ATOM 11619 C CA   . GLU A 1 66 ? 11.436  -0.652  3.173   1.00 0.00 ? 74  GLU A CA   8  
ATOM 11620 C C    . GLU A 1 66 ? 10.491  0.261   2.400   1.00 0.00 ? 74  GLU A C    8  
ATOM 11621 O O    . GLU A 1 66 ? 10.912  1.270   1.835   1.00 0.00 ? 74  GLU A O    8  
ATOM 11622 C CB   . GLU A 1 66 ? 11.879  -1.821  2.290   1.00 0.00 ? 74  GLU A CB   8  
ATOM 11623 C CG   . GLU A 1 66 ? 13.349  -2.178  2.446   1.00 0.00 ? 74  GLU A CG   8  
ATOM 11624 C CD   . GLU A 1 66 ? 13.559  -3.626  2.847   1.00 0.00 ? 74  GLU A CD   8  
ATOM 11625 O OE1  . GLU A 1 66 ? 13.522  -4.501  1.957   1.00 0.00 ? 74  GLU A OE1  8  
ATOM 11626 O OE2  . GLU A 1 66 ? 13.762  -3.884  4.053   1.00 0.00 ? 74  GLU A OE2  8  
ATOM 11627 H H    . GLU A 1 66 ? 10.681  -2.117  4.503   1.00 0.00 ? 74  GLU A H    8  
ATOM 11628 H HA   . GLU A 1 66 ? 12.307  -0.085  3.466   1.00 0.00 ? 74  GLU A HA   8  
ATOM 11629 H HB2  . GLU A 1 66 ? 11.289  -2.690  2.541   1.00 0.00 ? 74  GLU A HB2  8  
ATOM 11630 H HB3  . GLU A 1 66 ? 11.702  -1.563  1.256   1.00 0.00 ? 74  GLU A HB3  8  
ATOM 11631 H HG2  . GLU A 1 66 ? 13.850  -2.007  1.505   1.00 0.00 ? 74  GLU A HG2  8  
ATOM 11632 H HG3  . GLU A 1 66 ? 13.781  -1.543  3.205   1.00 0.00 ? 74  GLU A HG3  8  
ATOM 11633 N N    . ALA A 1 67 ? 9.212   -0.100  2.380   1.00 0.00 ? 75  ALA A N    8  
ATOM 11634 C CA   . ALA A 1 67 ? 8.207   0.689   1.677   1.00 0.00 ? 75  ALA A CA   8  
ATOM 11635 C C    . ALA A 1 67 ? 8.018   2.050   2.336   1.00 0.00 ? 75  ALA A C    8  
ATOM 11636 O O    . ALA A 1 67 ? 7.971   3.078   1.660   1.00 0.00 ? 75  ALA A O    8  
ATOM 11637 C CB   . ALA A 1 67 ? 6.886   -0.064  1.627   1.00 0.00 ? 75  ALA A CB   8  
ATOM 11638 H H    . ALA A 1 67 ? 8.937   -0.915  2.850   1.00 0.00 ? 75  ALA A H    8  
ATOM 11639 H HA   . ALA A 1 67 ? 8.548   0.835   0.662   1.00 0.00 ? 75  ALA A HA   8  
ATOM 11640 H HB1  . ALA A 1 67 ? 6.417   0.091   0.666   1.00 0.00 ? 75  ALA A HB1  8  
ATOM 11641 H HB2  . ALA A 1 67 ? 6.234   0.301   2.408   1.00 0.00 ? 75  ALA A HB2  8  
ATOM 11642 H HB3  . ALA A 1 67 ? 7.065   -1.118  1.773   1.00 0.00 ? 75  ALA A HB3  8  
ATOM 11643 N N    . VAL A 1 68 ? 7.911   2.050   3.660   1.00 0.00 ? 76  VAL A N    8  
ATOM 11644 C CA   . VAL A 1 68 ? 7.726   3.286   4.408   1.00 0.00 ? 76  VAL A CA   8  
ATOM 11645 C C    . VAL A 1 68 ? 8.979   4.154   4.351   1.00 0.00 ? 76  VAL A C    8  
ATOM 11646 O O    . VAL A 1 68 ? 8.897   5.366   4.153   1.00 0.00 ? 76  VAL A O    8  
ATOM 11647 C CB   . VAL A 1 68 ? 7.381   3.003   5.883   1.00 0.00 ? 76  VAL A CB   8  
ATOM 11648 C CG1  . VAL A 1 68 ? 7.011   4.290   6.602   1.00 0.00 ? 76  VAL A CG1  8  
ATOM 11649 C CG2  . VAL A 1 68 ? 6.254   1.987   5.980   1.00 0.00 ? 76  VAL A CG2  8  
ATOM 11650 H H    . VAL A 1 68 ? 7.956   1.199   4.144   1.00 0.00 ? 76  VAL A H    8  
ATOM 11651 H HA   . VAL A 1 68 ? 6.904   3.826   3.964   1.00 0.00 ? 76  VAL A HA   8  
ATOM 11652 H HB   . VAL A 1 68 ? 8.254   2.587   6.363   1.00 0.00 ? 76  VAL A HB   8  
ATOM 11653 H HG11 . VAL A 1 68 ? 6.817   4.077   7.644   1.00 0.00 ? 76  VAL A HG11 8  
ATOM 11654 H HG12 . VAL A 1 68 ? 6.126   4.714   6.152   1.00 0.00 ? 76  VAL A HG12 8  
ATOM 11655 H HG13 . VAL A 1 68 ? 7.827   4.994   6.524   1.00 0.00 ? 76  VAL A HG13 8  
ATOM 11656 H HG21 . VAL A 1 68 ? 5.684   2.166   6.880   1.00 0.00 ? 76  VAL A HG21 8  
ATOM 11657 H HG22 . VAL A 1 68 ? 6.670   0.989   6.010   1.00 0.00 ? 76  VAL A HG22 8  
ATOM 11658 H HG23 . VAL A 1 68 ? 5.608   2.081   5.120   1.00 0.00 ? 76  VAL A HG23 8  
ATOM 11659 N N    . ASN A 1 69 ? 10.137  3.527   4.527   1.00 0.00 ? 77  ASN A N    8  
ATOM 11660 C CA   . ASN A 1 69 ? 11.410  4.242   4.501   1.00 0.00 ? 77  ASN A CA   8  
ATOM 11661 C C    . ASN A 1 69 ? 11.576  5.026   3.202   1.00 0.00 ? 77  ASN A C    8  
ATOM 11662 O O    . ASN A 1 69 ? 11.774  6.241   3.222   1.00 0.00 ? 77  ASN A O    8  
ATOM 11663 C CB   . ASN A 1 69 ? 12.572  3.261   4.670   1.00 0.00 ? 77  ASN A CB   8  
ATOM 11664 C CG   . ASN A 1 69 ? 13.656  3.801   5.581   1.00 0.00 ? 77  ASN A CG   8  
ATOM 11665 O OD1  . ASN A 1 69 ? 13.729  5.005   5.833   1.00 0.00 ? 77  ASN A OD1  8  
ATOM 11666 N ND2  . ASN A 1 69 ? 14.507  2.912   6.081   1.00 0.00 ? 77  ASN A ND2  8  
ATOM 11667 H H    . ASN A 1 69 ? 10.136  2.560   4.684   1.00 0.00 ? 77  ASN A H    8  
ATOM 11668 H HA   . ASN A 1 69 ? 11.415  4.936   5.326   1.00 0.00 ? 77  ASN A HA   8  
ATOM 11669 H HB2  . ASN A 1 69 ? 12.198  2.340   5.094   1.00 0.00 ? 77  ASN A HB2  8  
ATOM 11670 H HB3  . ASN A 1 69 ? 13.008  3.057   3.703   1.00 0.00 ? 77  ASN A HB3  8  
ATOM 11671 H HD21 . ASN A 1 69 ? 14.388  1.972   5.838   1.00 0.00 ? 77  ASN A HD21 8  
ATOM 11672 H HD22 . ASN A 1 69 ? 15.218  3.235   6.674   1.00 0.00 ? 77  ASN A HD22 8  
ATOM 11673 N N    . VAL A 1 70 ? 11.501  4.326   2.074   1.00 0.00 ? 78  VAL A N    8  
ATOM 11674 C CA   . VAL A 1 70 ? 11.649  4.960   0.771   1.00 0.00 ? 78  VAL A CA   8  
ATOM 11675 C C    . VAL A 1 70 ? 10.619  6.070   0.575   1.00 0.00 ? 78  VAL A C    8  
ATOM 11676 O O    . VAL A 1 70 ? 10.950  7.164   0.117   1.00 0.00 ? 78  VAL A O    8  
ATOM 11677 C CB   . VAL A 1 70 ? 11.515  3.936   -0.371  1.00 0.00 ? 78  VAL A CB   8  
ATOM 11678 C CG1  . VAL A 1 70 ? 12.617  2.892   -0.280  1.00 0.00 ? 78  VAL A CG1  8  
ATOM 11679 C CG2  . VAL A 1 70 ? 10.145  3.277   -0.345  1.00 0.00 ? 78  VAL A CG2  8  
ATOM 11680 H H    . VAL A 1 70 ? 11.345  3.359   2.122   1.00 0.00 ? 78  VAL A H    8  
ATOM 11681 H HA   . VAL A 1 70 ? 12.638  5.392   0.723   1.00 0.00 ? 78  VAL A HA   8  
ATOM 11682 H HB   . VAL A 1 70 ? 11.622  4.458   -1.312  1.00 0.00 ? 78  VAL A HB   8  
ATOM 11683 H HG11 . VAL A 1 70 ? 12.563  2.237   -1.136  1.00 0.00 ? 78  VAL A HG11 8  
ATOM 11684 H HG12 . VAL A 1 70 ? 12.490  2.314   0.624   1.00 0.00 ? 78  VAL A HG12 8  
ATOM 11685 H HG13 . VAL A 1 70 ? 13.578  3.383   -0.262  1.00 0.00 ? 78  VAL A HG13 8  
ATOM 11686 H HG21 . VAL A 1 70 ? 9.947   2.897   0.647   1.00 0.00 ? 78  VAL A HG21 8  
ATOM 11687 H HG22 . VAL A 1 70 ? 10.123  2.462   -1.054  1.00 0.00 ? 78  VAL A HG22 8  
ATOM 11688 H HG23 . VAL A 1 70 ? 9.391   4.005   -0.608  1.00 0.00 ? 78  VAL A HG23 8  
ATOM 11689 N N    . LEU A 1 71 ? 9.369   5.781   0.924   1.00 0.00 ? 79  LEU A N    8  
ATOM 11690 C CA   . LEU A 1 71 ? 8.293   6.755   0.786   1.00 0.00 ? 79  LEU A CA   8  
ATOM 11691 C C    . LEU A 1 71 ? 8.516   7.946   1.716   1.00 0.00 ? 79  LEU A C    8  
ATOM 11692 O O    . LEU A 1 71 ? 8.109   9.067   1.412   1.00 0.00 ? 79  LEU A O    8  
ATOM 11693 C CB   . LEU A 1 71 ? 6.942   6.102   1.085   1.00 0.00 ? 79  LEU A CB   8  
ATOM 11694 C CG   . LEU A 1 71 ? 6.171   5.618   -0.146  1.00 0.00 ? 79  LEU A CG   8  
ATOM 11695 C CD1  . LEU A 1 71 ? 5.709   6.799   -0.987