data_2KE7
# 
_entry.id   2KE7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KE7         
RCSB  RCSB101010   
WWPDB D_1000101010 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KE7 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-27 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Donaldson, L.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'NMR structure of the first SAM domain from AIDA1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
_citation_author.citation_id   primary 
_citation_author.name          'Donaldson, L.' 
_citation_author.ordinal       1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Ankyrin repeat and sterile alpha motif domain-containing protein 1B' 
_entity.formula_weight             11502.014 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'first SAM domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSDITSLYKKAGSEMNGPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAI
QLLPKMRPIGHDGYHPTSVAEWL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSDITSLYKKAGSEMNGPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAI
QLLPKMRPIGHDGYHPTSVAEWL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ASP n 
1 4   ILE n 
1 5   THR n 
1 6   SER n 
1 7   LEU n 
1 8   TYR n 
1 9   LYS n 
1 10  LYS n 
1 11  ALA n 
1 12  GLY n 
1 13  SER n 
1 14  GLU n 
1 15  MET n 
1 16  ASN n 
1 17  GLY n 
1 18  PRO n 
1 19  ARG n 
1 20  CYS n 
1 21  PRO n 
1 22  VAL n 
1 23  GLN n 
1 24  THR n 
1 25  VAL n 
1 26  GLY n 
1 27  GLN n 
1 28  TRP n 
1 29  LEU n 
1 30  GLU n 
1 31  SER n 
1 32  ILE n 
1 33  GLY n 
1 34  LEU n 
1 35  PRO n 
1 36  GLN n 
1 37  TYR n 
1 38  GLU n 
1 39  ASN n 
1 40  HIS n 
1 41  LEU n 
1 42  MET n 
1 43  ALA n 
1 44  ASN n 
1 45  GLY n 
1 46  PHE n 
1 47  ASP n 
1 48  ASN n 
1 49  VAL n 
1 50  GLN n 
1 51  PHE n 
1 52  MET n 
1 53  GLY n 
1 54  SER n 
1 55  ASN n 
1 56  VAL n 
1 57  MET n 
1 58  GLU n 
1 59  ASP n 
1 60  GLN n 
1 61  ASP n 
1 62  LEU n 
1 63  LEU n 
1 64  GLU n 
1 65  ILE n 
1 66  GLY n 
1 67  ILE n 
1 68  LEU n 
1 69  ASN n 
1 70  SER n 
1 71  GLY n 
1 72  HIS n 
1 73  ARG n 
1 74  GLN n 
1 75  ARG n 
1 76  ILE n 
1 77  LEU n 
1 78  GLN n 
1 79  ALA n 
1 80  ILE n 
1 81  GLN n 
1 82  LEU n 
1 83  LEU n 
1 84  PRO n 
1 85  LYS n 
1 86  MET n 
1 87  ARG n 
1 88  PRO n 
1 89  ILE n 
1 90  GLY n 
1 91  HIS n 
1 92  ASP n 
1 93  GLY n 
1 94  TYR n 
1 95  HIS n 
1 96  PRO n 
1 97  THR n 
1 98  SER n 
1 99  VAL n 
1 100 ALA n 
1 101 GLU n 
1 102 TRP n 
1 103 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ANKS1B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               K12 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               'BL21(DE3)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pDEST586 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
;This vector is from the NIH structural genomics consortium. It contains a His6 tag, Maltose Binding Protein tag and a TEV protease cleavage site
;
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ANS1B_HUMAN 
_struct_ref.pdbx_db_accession          Q7Z6G8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PRCPVQTVGQWLESIGLPQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPT
SVAEWL
;
_struct_ref.pdbx_align_begin           809 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KE7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 18 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 103 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q7Z6G8 
_struct_ref_seq.db_align_beg                  809 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  894 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       809 
_struct_ref_seq.pdbx_auth_seq_align_end       894 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KE7 GLY A 1  ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 792 1  
1 2KE7 SER A 2  ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 793 2  
1 2KE7 ASP A 3  ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 794 3  
1 2KE7 ILE A 4  ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 795 4  
1 2KE7 THR A 5  ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 796 5  
1 2KE7 SER A 6  ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 797 6  
1 2KE7 LEU A 7  ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 798 7  
1 2KE7 TYR A 8  ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 799 8  
1 2KE7 LYS A 9  ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 800 9  
1 2KE7 LYS A 10 ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 801 10 
1 2KE7 ALA A 11 ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 802 11 
1 2KE7 GLY A 12 ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 803 12 
1 2KE7 SER A 13 ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 804 13 
1 2KE7 GLU A 14 ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 805 14 
1 2KE7 MET A 15 ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 806 15 
1 2KE7 ASN A 16 ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 807 16 
1 2KE7 GLY A 17 ? UNP Q7Z6G8 ? ? 'EXPRESSION TAG' 808 17 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC'  
1 2 1 '2D 1H-13C HSQC'  
1 3 1 '3D CBCA(CO)NH'   
1 4 1 '3D C(CO)NH'      
1 5 1 '3D HNCO'         
1 6 1 '3D HNCACB'       
1 7 1 '3D H(CCO)NH'     
1 8 1 '3D 1H-15N NOESY' 
1 9 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.15 
_pdbx_nmr_exptl_sample_conditions.pH                  7.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
;0.8 mM [U-98% 13C; U-98% 15N] AIDA1 SAM1-1, 10 % D2O-2, 90 % H2O-3, 150 mM sodium chloride-4, 20 mM sodium phosphate-5, 0.05 % sodium azide-6, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             NMRS 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian NMRS' 
# 
_pdbx_nmr_refine.entry_id           2KE7 
_pdbx_nmr_refine.method             'torsion angle dynamics, simulated annealing' 
_pdbx_nmr_refine.details            
;5000 steps using CYANA standard torsion angle dynamics, water-refinement using XPLOR-NIH and cartesian dynamics. Specifics: 2000 hot steps at 500 K, 500 cool steps to 100 K final in 100 K increments
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2KE7 
_pdbx_nmr_details.text       
'This structure was determined using NOE restraints and dihedral angle restraints predicted from chemical shifts' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            25 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KE7 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   0.5 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.5 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KE7 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Schwieters, C.D. et al.' refinement           X-PLOR_NIH 2.21 1 
'Johnson, B. et al.'      'peak picking'       NMRView    5    2 
'Guntert, P. et al.'      'structure solution' CYANA      2.1  3 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KE7 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KE7 
_struct.title                     'NMR structure of the first SAM domain from AIDA1' 
_struct.pdbx_descriptor           'Ankyrin repeat and sterile alpha motif domain-containing protein 1B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KE7 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;SAM domain, Alternative splicing, ANK repeat, Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus, Phosphoprotein, Postsynaptic cell membrane, Synapse, PROTEIN BINDING
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 26 ? ILE A 32 ? GLY A 817 ILE A 823 1 ? 7  
HELX_P HELX_P2 2 TYR A 37 ? ASN A 44 ? TYR A 828 ASN A 835 1 ? 8  
HELX_P HELX_P3 3 ASN A 48 ? SER A 54 ? ASN A 839 SER A 845 1 ? 7  
HELX_P HELX_P4 4 GLU A 58 ? GLY A 66 ? GLU A 849 GLY A 857 1 ? 9  
HELX_P HELX_P5 5 ASN A 69 ? LEU A 83 ? ASN A 860 LEU A 874 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2KE7 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . GLN A 1 23 ? -9.798  -10.315 1.863   1.00 0.00 ? 814 GLN A N    1  
ATOM 2    C CA   . GLN A 1 23 ? -10.884 -9.484  1.283   1.00 0.00 ? 814 GLN A CA   1  
ATOM 3    C C    . GLN A 1 23 ? -10.276 -8.477  0.317   1.00 0.00 ? 814 GLN A C    1  
ATOM 4    O O    . GLN A 1 23 ? -9.105  -8.589  -0.059  1.00 0.00 ? 814 GLN A O    1  
ATOM 5    C CB   . GLN A 1 23 ? -11.627 -8.749  2.407   1.00 0.00 ? 814 GLN A CB   1  
ATOM 6    C CG   . GLN A 1 23 ? -10.637 -7.903  3.216   1.00 0.00 ? 814 GLN A CG   1  
ATOM 7    C CD   . GLN A 1 23 ? -10.227 -8.658  4.461   1.00 0.00 ? 814 GLN A CD   1  
ATOM 8    O OE1  . GLN A 1 23 ? -9.600  -9.717  4.362   1.00 0.00 ? 814 GLN A OE1  1  
ATOM 9    N NE2  . GLN A 1 23 ? -10.548 -8.192  5.627   1.00 0.00 ? 814 GLN A NE2  1  
ATOM 10   H HA   . GLN A 1 23 ? -11.574 -10.117 0.747   1.00 0.00 ? 814 GLN A HA   1  
ATOM 11   H HB2  . GLN A 1 23 ? -12.389 -8.111  1.981   1.00 0.00 ? 814 GLN A HB2  1  
ATOM 12   H HB3  . GLN A 1 23 ? -12.095 -9.472  3.059   1.00 0.00 ? 814 GLN A HB3  1  
ATOM 13   H HG2  . GLN A 1 23 ? -9.760  -7.690  2.622   1.00 0.00 ? 814 GLN A HG2  1  
ATOM 14   H HG3  . GLN A 1 23 ? -11.103 -6.974  3.500   1.00 0.00 ? 814 GLN A HG3  1  
ATOM 15   H HE21 . GLN A 1 23 ? -11.054 -7.355  5.697   1.00 0.00 ? 814 GLN A HE21 1  
ATOM 16   H HE22 . GLN A 1 23 ? -10.292 -8.674  6.440   1.00 0.00 ? 814 GLN A HE22 1  
ATOM 17   N N    . THR A 1 24 ? -11.061 -7.480  -0.049  1.00 0.00 ? 815 THR A N    1  
ATOM 18   C CA   . THR A 1 24 ? -10.612 -6.435  -0.944  1.00 0.00 ? 815 THR A CA   1  
ATOM 19   C C    . THR A 1 24 ? -9.753  -5.429  -0.181  1.00 0.00 ? 815 THR A C    1  
ATOM 20   O O    . THR A 1 24 ? -9.712  -5.450  1.053   1.00 0.00 ? 815 THR A O    1  
ATOM 21   C CB   . THR A 1 24 ? -11.825 -5.740  -1.583  1.00 0.00 ? 815 THR A CB   1  
ATOM 22   O OG1  . THR A 1 24 ? -13.016 -6.169  -0.918  1.00 0.00 ? 815 THR A OG1  1  
ATOM 23   C CG2  . THR A 1 24 ? -11.914 -6.117  -3.065  1.00 0.00 ? 815 THR A CG2  1  
ATOM 24   H H    . THR A 1 24 ? -11.973 -7.431  0.308   1.00 0.00 ? 815 THR A H    1  
ATOM 25   H HA   . THR A 1 24 ? -10.015 -6.882  -1.724  1.00 0.00 ? 815 THR A HA   1  
ATOM 26   H HB   . THR A 1 24 ? -11.722 -4.668  -1.497  1.00 0.00 ? 815 THR A HB   1  
ATOM 27   H HG21 . THR A 1 24 ? -10.959 -5.952  -3.540  1.00 0.00 ? 815 THR A HG21 1  
ATOM 28   H HG22 . THR A 1 24 ? -12.663 -5.506  -3.549  1.00 0.00 ? 815 THR A HG22 1  
ATOM 29   H HG23 . THR A 1 24 ? -12.187 -7.157  -3.160  1.00 0.00 ? 815 THR A HG23 1  
ATOM 30   N N    . VAL A 1 25 ? -9.030  -4.590  -0.908  1.00 0.00 ? 816 VAL A N    1  
ATOM 31   C CA   . VAL A 1 25 ? -8.141  -3.624  -0.275  1.00 0.00 ? 816 VAL A CA   1  
ATOM 32   C C    . VAL A 1 25 ? -8.940  -2.660  0.600   1.00 0.00 ? 816 VAL A C    1  
ATOM 33   O O    . VAL A 1 25 ? -9.803  -1.927  0.110   1.00 0.00 ? 816 VAL A O    1  
ATOM 34   C CB   . VAL A 1 25 ? -7.363  -2.838  -1.342  1.00 0.00 ? 816 VAL A CB   1  
ATOM 35   C CG1  . VAL A 1 25 ? -6.090  -2.248  -0.731  1.00 0.00 ? 816 VAL A CG1  1  
ATOM 36   C CG2  . VAL A 1 25 ? -6.983  -3.772  -2.500  1.00 0.00 ? 816 VAL A CG2  1  
ATOM 37   H H    . VAL A 1 25 ? -9.072  -4.637  -1.887  1.00 0.00 ? 816 VAL A H    1  
ATOM 38   H HA   . VAL A 1 25 ? -7.435  -4.158  0.345   1.00 0.00 ? 816 VAL A HA   1  
ATOM 39   H HB   . VAL A 1 25 ? -7.985  -2.035  -1.709  1.00 0.00 ? 816 VAL A HB   1  
ATOM 40   H HG11 . VAL A 1 25 ? -6.031  -2.500  0.318   1.00 0.00 ? 816 VAL A HG11 1  
ATOM 41   H HG12 . VAL A 1 25 ? -6.101  -1.174  -0.844  1.00 0.00 ? 816 VAL A HG12 1  
ATOM 42   H HG13 . VAL A 1 25 ? -5.231  -2.653  -1.246  1.00 0.00 ? 816 VAL A HG13 1  
ATOM 43   H HG21 . VAL A 1 25 ? -6.943  -4.793  -2.151  1.00 0.00 ? 816 VAL A HG21 1  
ATOM 44   H HG22 . VAL A 1 25 ? -6.015  -3.489  -2.887  1.00 0.00 ? 816 VAL A HG22 1  
ATOM 45   H HG23 . VAL A 1 25 ? -7.717  -3.687  -3.285  1.00 0.00 ? 816 VAL A HG23 1  
ATOM 46   N N    . GLY A 1 26 ? -8.658  -2.687  1.891   1.00 0.00 ? 817 GLY A N    1  
ATOM 47   C CA   . GLY A 1 26 ? -9.350  -1.839  2.854   1.00 0.00 ? 817 GLY A CA   1  
ATOM 48   C C    . GLY A 1 26 ? -8.915  -2.182  4.268   1.00 0.00 ? 817 GLY A C    1  
ATOM 49   O O    . GLY A 1 26 ? -8.109  -1.466  4.872   1.00 0.00 ? 817 GLY A O    1  
ATOM 50   H H    . GLY A 1 26 ? -7.972  -3.308  2.212   1.00 0.00 ? 817 GLY A H    1  
ATOM 51   H HA2  . GLY A 1 26 ? -9.122  -0.803  2.649   1.00 0.00 ? 817 GLY A HA2  1  
ATOM 52   H HA3  . GLY A 1 26 ? -10.415 -1.994  2.769   1.00 0.00 ? 817 GLY A HA3  1  
ATOM 53   N N    . GLN A 1 27 ? -9.418  -3.302  4.781   1.00 0.00 ? 818 GLN A N    1  
ATOM 54   C CA   . GLN A 1 27 ? -9.066  -3.751  6.123   1.00 0.00 ? 818 GLN A CA   1  
ATOM 55   C C    . GLN A 1 27 ? -7.559  -3.769  6.281   1.00 0.00 ? 818 GLN A C    1  
ATOM 56   O O    . GLN A 1 27 ? -7.035  -3.443  7.333   1.00 0.00 ? 818 GLN A O    1  
ATOM 57   C CB   . GLN A 1 27 ? -9.626  -5.157  6.379   1.00 0.00 ? 818 GLN A CB   1  
ATOM 58   C CG   . GLN A 1 27 ? -10.960 -5.067  7.133   1.00 0.00 ? 818 GLN A CG   1  
ATOM 59   C CD   . GLN A 1 27 ? -10.928 -5.981  8.351   1.00 0.00 ? 818 GLN A CD   1  
ATOM 60   O OE1  . GLN A 1 27 ? -10.479 -7.127  8.258   1.00 0.00 ? 818 GLN A OE1  1  
ATOM 61   N NE2  . GLN A 1 27 ? -11.370 -5.550  9.492   1.00 0.00 ? 818 GLN A NE2  1  
ATOM 62   H H    . GLN A 1 27 ? -10.041 -3.836  4.244   1.00 0.00 ? 818 GLN A H    1  
ATOM 63   H HA   . GLN A 1 27 ? -9.485  -3.068  6.843   1.00 0.00 ? 818 GLN A HA   1  
ATOM 64   H HB2  . GLN A 1 27 ? -9.779  -5.661  5.437   1.00 0.00 ? 818 GLN A HB2  1  
ATOM 65   H HB3  . GLN A 1 27 ? -8.920  -5.717  6.973   1.00 0.00 ? 818 GLN A HB3  1  
ATOM 66   H HG2  . GLN A 1 27 ? -11.133 -4.049  7.448   1.00 0.00 ? 818 GLN A HG2  1  
ATOM 67   H HG3  . GLN A 1 27 ? -11.762 -5.375  6.478   1.00 0.00 ? 818 GLN A HG3  1  
ATOM 68   H HE21 . GLN A 1 27 ? -11.722 -4.637  9.570   1.00 0.00 ? 818 GLN A HE21 1  
ATOM 69   H HE22 . GLN A 1 27 ? -11.351 -6.135  10.277  1.00 0.00 ? 818 GLN A HE22 1  
ATOM 70   N N    . TRP A 1 28 ? -6.874  -4.119  5.217   1.00 0.00 ? 819 TRP A N    1  
ATOM 71   C CA   . TRP A 1 28 ? -5.421  -4.140  5.214   1.00 0.00 ? 819 TRP A CA   1  
ATOM 72   C C    . TRP A 1 28 ? -4.888  -2.770  5.627   1.00 0.00 ? 819 TRP A C    1  
ATOM 73   O O    . TRP A 1 28 ? -4.081  -2.652  6.558   1.00 0.00 ? 819 TRP A O    1  
ATOM 74   C CB   . TRP A 1 28 ? -4.931  -4.505  3.807   1.00 0.00 ? 819 TRP A CB   1  
ATOM 75   C CG   . TRP A 1 28 ? -3.438  -4.518  3.748   1.00 0.00 ? 819 TRP A CG   1  
ATOM 76   C CD1  . TRP A 1 28 ? -2.629  -5.267  4.532   1.00 0.00 ? 819 TRP A CD1  1  
ATOM 77   C CD2  . TRP A 1 28 ? -2.569  -3.770  2.857   1.00 0.00 ? 819 TRP A CD2  1  
ATOM 78   N NE1  . TRP A 1 28 ? -1.316  -5.022  4.172   1.00 0.00 ? 819 TRP A NE1  1  
ATOM 79   C CE2  . TRP A 1 28 ? -1.232  -4.106  3.145   1.00 0.00 ? 819 TRP A CE2  1  
ATOM 80   C CE3  . TRP A 1 28 ? -2.811  -2.839  1.831   1.00 0.00 ? 819 TRP A CE3  1  
ATOM 81   C CZ2  . TRP A 1 28 ? -0.175  -3.543  2.445   1.00 0.00 ? 819 TRP A CZ2  1  
ATOM 82   C CZ3  . TRP A 1 28 ? -1.740  -2.268  1.123   1.00 0.00 ? 819 TRP A CZ3  1  
ATOM 83   C CH2  . TRP A 1 28 ? -0.423  -2.625  1.435   1.00 0.00 ? 819 TRP A CH2  1  
ATOM 84   H H    . TRP A 1 28 ? -7.357  -4.346  4.398   1.00 0.00 ? 819 TRP A H    1  
ATOM 85   H HA   . TRP A 1 28 ? -5.076  -4.887  5.914   1.00 0.00 ? 819 TRP A HA   1  
ATOM 86   H HB2  . TRP A 1 28 ? -5.299  -5.485  3.545   1.00 0.00 ? 819 TRP A HB2  1  
ATOM 87   H HB3  . TRP A 1 28 ? -5.312  -3.784  3.100   1.00 0.00 ? 819 TRP A HB3  1  
ATOM 88   H HD1  . TRP A 1 28 ? -2.955  -5.943  5.308   1.00 0.00 ? 819 TRP A HD1  1  
ATOM 89   N N    . LEU A 1 29 ? -5.390  -1.736  4.965   1.00 0.00 ? 820 LEU A N    1  
ATOM 90   C CA   . LEU A 1 29 ? -5.006  -0.365  5.273   1.00 0.00 ? 820 LEU A CA   1  
ATOM 91   C C    . LEU A 1 29 ? -5.495  0.016   6.662   1.00 0.00 ? 820 LEU A C    1  
ATOM 92   O O    . LEU A 1 29 ? -4.772  0.646   7.443   1.00 0.00 ? 820 LEU A O    1  
ATOM 93   C CB   . LEU A 1 29 ? -5.590  0.594   4.232   1.00 0.00 ? 820 LEU A CB   1  
ATOM 94   C CG   . LEU A 1 29 ? -5.199  0.123   2.822   1.00 0.00 ? 820 LEU A CG   1  
ATOM 95   C CD1  . LEU A 1 29 ? -6.020  0.880   1.779   1.00 0.00 ? 820 LEU A CD1  1  
ATOM 96   C CD2  . LEU A 1 29 ? -3.708  0.390   2.588   1.00 0.00 ? 820 LEU A CD2  1  
ATOM 97   H H    . LEU A 1 29 ? -6.064  -1.898  4.273   1.00 0.00 ? 820 LEU A H    1  
ATOM 98   H HA   . LEU A 1 29 ? -3.929  -0.289  5.249   1.00 0.00 ? 820 LEU A HA   1  
ATOM 99   H HB2  . LEU A 1 29 ? -6.667  0.608   4.328   1.00 0.00 ? 820 LEU A HB2  1  
ATOM 100  H HB3  . LEU A 1 29 ? -5.203  1.589   4.402   1.00 0.00 ? 820 LEU A HB3  1  
ATOM 101  H HG   . LEU A 1 29 ? -5.397  -0.934  2.727   1.00 0.00 ? 820 LEU A HG   1  
ATOM 102  H HD11 . LEU A 1 29 ? -6.942  0.348   1.595   1.00 0.00 ? 820 LEU A HD11 1  
ATOM 103  H HD12 . LEU A 1 29 ? -5.457  0.953   0.860   1.00 0.00 ? 820 LEU A HD12 1  
ATOM 104  H HD13 . LEU A 1 29 ? -6.243  1.872   2.143   1.00 0.00 ? 820 LEU A HD13 1  
ATOM 105  H HD21 . LEU A 1 29 ? -3.123  -0.348  3.118   1.00 0.00 ? 820 LEU A HD21 1  
ATOM 106  H HD22 . LEU A 1 29 ? -3.455  1.375   2.949   1.00 0.00 ? 820 LEU A HD22 1  
ATOM 107  H HD23 . LEU A 1 29 ? -3.492  0.327   1.532   1.00 0.00 ? 820 LEU A HD23 1  
ATOM 108  N N    . GLU A 1 30 ? -6.713  -0.390  6.978   1.00 0.00 ? 821 GLU A N    1  
ATOM 109  C CA   . GLU A 1 30 ? -7.270  -0.116  8.289   1.00 0.00 ? 821 GLU A CA   1  
ATOM 110  C C    . GLU A 1 30 ? -6.470  -0.852  9.352   1.00 0.00 ? 821 GLU A C    1  
ATOM 111  O O    . GLU A 1 30 ? -6.191  -0.309  10.415  1.00 0.00 ? 821 GLU A O    1  
ATOM 112  C CB   . GLU A 1 30 ? -8.736  -0.539  8.346   1.00 0.00 ? 821 GLU A CB   1  
ATOM 113  C CG   . GLU A 1 30 ? -9.536  0.252   7.304   1.00 0.00 ? 821 GLU A CG   1  
ATOM 114  C CD   . GLU A 1 30 ? -10.980 -0.191  7.317   1.00 0.00 ? 821 GLU A CD   1  
ATOM 115  O OE1  . GLU A 1 30 ? -11.214 -1.373  7.234   1.00 0.00 ? 821 GLU A OE1  1  
ATOM 116  O OE2  . GLU A 1 30 ? -11.840 0.659   7.419   1.00 0.00 ? 821 GLU A OE2  1  
ATOM 117  H H    . GLU A 1 30 ? -7.238  -0.900  6.321   1.00 0.00 ? 821 GLU A H    1  
ATOM 118  H HA   . GLU A 1 30 ? -7.205  0.945   8.479   1.00 0.00 ? 821 GLU A HA   1  
ATOM 119  N N    . SER A 1 31 ? -6.068  -2.076  9.040   1.00 0.00 ? 822 SER A N    1  
ATOM 120  C CA   . SER A 1 31 ? -5.263  -2.869  9.959   1.00 0.00 ? 822 SER A CA   1  
ATOM 121  C C    . SER A 1 31 ? -4.020  -2.096  10.352  1.00 0.00 ? 822 SER A C    1  
ATOM 122  O O    . SER A 1 31 ? -3.743  -1.908  11.538  1.00 0.00 ? 822 SER A O    1  
ATOM 123  C CB   . SER A 1 31 ? -4.871  -4.200  9.313   1.00 0.00 ? 822 SER A CB   1  
ATOM 124  O OG   . SER A 1 31 ? -6.054  -4.916  8.954   1.00 0.00 ? 822 SER A OG   1  
ATOM 125  H H    . SER A 1 31 ? -6.303  -2.444  8.163   1.00 0.00 ? 822 SER A H    1  
ATOM 126  H HA   . SER A 1 31 ? -5.845  -3.070  10.847  1.00 0.00 ? 822 SER A HA   1  
ATOM 127  H HB2  . SER A 1 31 ? -4.286  -4.015  8.427   1.00 0.00 ? 822 SER A HB2  1  
ATOM 128  H HB3  . SER A 1 31 ? -4.279  -4.774  10.012  1.00 0.00 ? 822 SER A HB3  1  
ATOM 129  H HG   . SER A 1 31 ? -6.666  -4.281  8.538   1.00 0.00 ? 822 SER A HG   1  
ATOM 130  N N    . ILE A 1 32 ? -3.304  -1.592  9.355   1.00 0.00 ? 823 ILE A N    1  
ATOM 131  C CA   . ILE A 1 32 ? -2.128  -0.780  9.621   1.00 0.00 ? 823 ILE A CA   1  
ATOM 132  C C    . ILE A 1 32 ? -2.552  0.614   10.079  1.00 0.00 ? 823 ILE A C    1  
ATOM 133  O O    . ILE A 1 32 ? -1.714  1.477   10.344  1.00 0.00 ? 823 ILE A O    1  
ATOM 134  C CB   . ILE A 1 32 ? -1.232  -0.690  8.375   1.00 0.00 ? 823 ILE A CB   1  
ATOM 135  C CG1  . ILE A 1 32 ? -2.028  -0.100  7.204   1.00 0.00 ? 823 ILE A CG1  1  
ATOM 136  C CG2  . ILE A 1 32 ? -0.738  -2.090  7.997   1.00 0.00 ? 823 ILE A CG2  1  
ATOM 137  C CD1  . ILE A 1 32 ? -1.169  -0.112  5.938   1.00 0.00 ? 823 ILE A CD1  1  
ATOM 138  H H    . ILE A 1 32 ? -3.595  -1.736  8.427   1.00 0.00 ? 823 ILE A H    1  
ATOM 139  H HA   . ILE A 1 32 ? -1.564  -1.242  10.420  1.00 0.00 ? 823 ILE A HA   1  
ATOM 140  H HB   . ILE A 1 32 ? -0.383  -0.058  8.597   1.00 0.00 ? 823 ILE A HB   1  
ATOM 141  H HG12 . ILE A 1 32 ? -2.913  -0.694  7.039   1.00 0.00 ? 823 ILE A HG12 1  
ATOM 142  H HG21 . ILE A 1 32 ? 0.304   -2.037  7.720   1.00 0.00 ? 823 ILE A HG21 1  
ATOM 143  H HG22 . ILE A 1 32 ? -1.313  -2.465  7.163   1.00 0.00 ? 823 ILE A HG22 1  
ATOM 144  H HG23 . ILE A 1 32 ? -0.851  -2.757  8.839   1.00 0.00 ? 823 ILE A HG23 1  
ATOM 145  H HD11 . ILE A 1 32 ? -0.135  0.060   6.197   1.00 0.00 ? 823 ILE A HD11 1  
ATOM 146  H HD12 . ILE A 1 32 ? -1.507  0.663   5.267   1.00 0.00 ? 823 ILE A HD12 1  
ATOM 147  H HD13 . ILE A 1 32 ? -1.263  -1.073  5.453   1.00 0.00 ? 823 ILE A HD13 1  
ATOM 148  N N    . GLY A 1 33 ? -3.860  0.817   10.183  1.00 0.00 ? 824 GLY A N    1  
ATOM 149  C CA   . GLY A 1 33 ? -4.411  2.088   10.627  1.00 0.00 ? 824 GLY A CA   1  
ATOM 150  C C    . GLY A 1 33 ? -4.034  3.215   9.686   1.00 0.00 ? 824 GLY A C    1  
ATOM 151  O O    . GLY A 1 33 ? -3.675  4.305   10.132  1.00 0.00 ? 824 GLY A O    1  
ATOM 152  H H    . GLY A 1 33 ? -4.476  0.086   9.968   1.00 0.00 ? 824 GLY A H    1  
ATOM 153  H HA2  . GLY A 1 33 ? -5.487  2.009   10.676  1.00 0.00 ? 824 GLY A HA2  1  
ATOM 154  H HA3  . GLY A 1 33 ? -4.030  2.311   11.613  1.00 0.00 ? 824 GLY A HA3  1  
ATOM 155  N N    . LEU A 1 34 ? -4.128  2.963   8.383   1.00 0.00 ? 825 LEU A N    1  
ATOM 156  C CA   . LEU A 1 34 ? -3.799  3.987   7.391   1.00 0.00 ? 825 LEU A CA   1  
ATOM 157  C C    . LEU A 1 34 ? -4.906  4.127   6.344   1.00 0.00 ? 825 LEU A C    1  
ATOM 158  O O    . LEU A 1 34 ? -4.674  3.912   5.150   1.00 0.00 ? 825 LEU A O    1  
ATOM 159  C CB   . LEU A 1 34 ? -2.471  3.653   6.703   1.00 0.00 ? 825 LEU A CB   1  
ATOM 160  C CG   . LEU A 1 34 ? -1.324  3.748   7.716   1.00 0.00 ? 825 LEU A CG   1  
ATOM 161  C CD1  . LEU A 1 34 ? -0.025  3.284   7.060   1.00 0.00 ? 825 LEU A CD1  1  
ATOM 162  C CD2  . LEU A 1 34 ? -1.164  5.199   8.183   1.00 0.00 ? 825 LEU A CD2  1  
ATOM 163  H H    . LEU A 1 34 ? -4.429  2.077   8.079   1.00 0.00 ? 825 LEU A H    1  
ATOM 164  H HA   . LEU A 1 34 ? -3.691  4.936   7.895   1.00 0.00 ? 825 LEU A HA   1  
ATOM 165  H HB2  . LEU A 1 34 ? -2.522  2.655   6.294   1.00 0.00 ? 825 LEU A HB2  1  
ATOM 166  H HB3  . LEU A 1 34 ? -2.302  4.358   5.904   1.00 0.00 ? 825 LEU A HB3  1  
ATOM 167  H HG   . LEU A 1 34 ? -1.541  3.113   8.563   1.00 0.00 ? 825 LEU A HG   1  
ATOM 168  H HD11 . LEU A 1 34 ? 0.810   3.609   7.661   1.00 0.00 ? 825 LEU A HD11 1  
ATOM 169  H HD12 . LEU A 1 34 ? 0.056   3.712   6.072   1.00 0.00 ? 825 LEU A HD12 1  
ATOM 170  H HD13 . LEU A 1 34 ? -0.019  2.208   6.990   1.00 0.00 ? 825 LEU A HD13 1  
ATOM 171  H HD21 . LEU A 1 34 ? -1.347  5.870   7.358   1.00 0.00 ? 825 LEU A HD21 1  
ATOM 172  H HD22 . LEU A 1 34 ? -0.160  5.350   8.549   1.00 0.00 ? 825 LEU A HD22 1  
ATOM 173  H HD23 . LEU A 1 34 ? -1.868  5.405   8.977   1.00 0.00 ? 825 LEU A HD23 1  
ATOM 174  N N    . PRO A 1 35 ? -6.089  4.516   6.758   1.00 0.00 ? 826 PRO A N    1  
ATOM 175  C CA   . PRO A 1 35 ? -7.236  4.725   5.823   1.00 0.00 ? 826 PRO A CA   1  
ATOM 176  C C    . PRO A 1 35 ? -6.920  5.802   4.785   1.00 0.00 ? 826 PRO A C    1  
ATOM 177  O O    . PRO A 1 35 ? -5.931  6.525   4.919   1.00 0.00 ? 826 PRO A O    1  
ATOM 178  C CB   . PRO A 1 35 ? -8.385  5.183   6.734   1.00 0.00 ? 826 PRO A CB   1  
ATOM 179  C CG   . PRO A 1 35 ? -7.988  4.777   8.119   1.00 0.00 ? 826 PRO A CG   1  
ATOM 180  C CD   . PRO A 1 35 ? -6.463  4.793   8.154   1.00 0.00 ? 826 PRO A CD   1  
ATOM 181  H HA   . PRO A 1 35 ? -7.514  3.799   5.345   1.00 0.00 ? 826 PRO A HA   1  
ATOM 182  H HB2  . PRO A 1 35 ? -8.506  6.255   6.675   1.00 0.00 ? 826 PRO A HB2  1  
ATOM 183  H HB3  . PRO A 1 35 ? -9.300  4.685   6.457   1.00 0.00 ? 826 PRO A HB3  1  
ATOM 184  H HG2  . PRO A 1 35 ? -8.391  5.477   8.837   1.00 0.00 ? 826 PRO A HG2  1  
ATOM 185  H HG3  . PRO A 1 35 ? -8.340  3.779   8.333   1.00 0.00 ? 826 PRO A HG3  1  
ATOM 186  H HD2  . PRO A 1 35 ? -6.100  5.762   8.473   1.00 0.00 ? 826 PRO A HD2  1  
ATOM 187  H HD3  . PRO A 1 35 ? -6.097  4.014   8.800   1.00 0.00 ? 826 PRO A HD3  1  
ATOM 188  N N    . GLN A 1 36 ? -7.766  5.905   3.765   1.00 0.00 ? 827 GLN A N    1  
ATOM 189  C CA   . GLN A 1 36 ? -7.595  6.896   2.690   1.00 0.00 ? 827 GLN A CA   1  
ATOM 190  C C    . GLN A 1 36 ? -6.556  6.439   1.681   1.00 0.00 ? 827 GLN A C    1  
ATOM 191  O O    . GLN A 1 36 ? -6.247  7.155   0.722   1.00 0.00 ? 827 GLN A O    1  
ATOM 192  C CB   . GLN A 1 36 ? -7.213  8.280   3.249   1.00 0.00 ? 827 GLN A CB   1  
ATOM 193  C CG   . GLN A 1 36 ? -8.210  8.698   4.337   1.00 0.00 ? 827 GLN A CG   1  
ATOM 194  C CD   . GLN A 1 36 ? -7.764  10.004  4.978   1.00 0.00 ? 827 GLN A CD   1  
ATOM 195  O OE1  . GLN A 1 36 ? -7.106  10.826  4.329   1.00 0.00 ? 827 GLN A OE1  1  
ATOM 196  N NE2  . GLN A 1 36 ? -8.073  10.252  6.212   1.00 0.00 ? 827 GLN A NE2  1  
ATOM 197  H H    . GLN A 1 36 ? -8.534  5.294   3.719   1.00 0.00 ? 827 GLN A H    1  
ATOM 198  H HA   . GLN A 1 36 ? -8.536  6.991   2.169   1.00 0.00 ? 827 GLN A HA   1  
ATOM 199  H HB2  . GLN A 1 36 ? -6.214  8.252   3.656   1.00 0.00 ? 827 GLN A HB2  1  
ATOM 200  H HB3  . GLN A 1 36 ? -7.246  9.002   2.447   1.00 0.00 ? 827 GLN A HB3  1  
ATOM 201  H HG2  . GLN A 1 36 ? -9.185  8.831   3.894   1.00 0.00 ? 827 GLN A HG2  1  
ATOM 202  H HG3  . GLN A 1 36 ? -8.266  7.929   5.094   1.00 0.00 ? 827 GLN A HG3  1  
ATOM 203  H HE21 . GLN A 1 36 ? -8.593  9.597   6.727   1.00 0.00 ? 827 GLN A HE21 1  
ATOM 204  H HE22 . GLN A 1 36 ? -7.791  11.090  6.633   1.00 0.00 ? 827 GLN A HE22 1  
ATOM 205  N N    . TYR A 1 37 ? -6.033  5.239   1.872   1.00 0.00 ? 828 TYR A N    1  
ATOM 206  C CA   . TYR A 1 37 ? -5.053  4.702   0.943   1.00 0.00 ? 828 TYR A CA   1  
ATOM 207  C C    . TYR A 1 37 ? -5.698  3.657   0.050   1.00 0.00 ? 828 TYR A C    1  
ATOM 208  O O    . TYR A 1 37 ? -5.081  3.175   -0.902  1.00 0.00 ? 828 TYR A O    1  
ATOM 209  C CB   . TYR A 1 37 ? -3.864  4.086   1.697   1.00 0.00 ? 828 TYR A CB   1  
ATOM 210  C CG   . TYR A 1 37 ? -2.936  5.169   2.248   1.00 0.00 ? 828 TYR A CG   1  
ATOM 211  C CD1  . TYR A 1 37 ? -2.853  6.440   1.640   1.00 0.00 ? 828 TYR A CD1  1  
ATOM 212  C CD2  . TYR A 1 37 ? -2.146  4.888   3.369   1.00 0.00 ? 828 TYR A CD2  1  
ATOM 213  C CE1  . TYR A 1 37 ? -1.987  7.408   2.159   1.00 0.00 ? 828 TYR A CE1  1  
ATOM 214  C CE2  . TYR A 1 37 ? -1.283  5.860   3.884   1.00 0.00 ? 828 TYR A CE2  1  
ATOM 215  C CZ   . TYR A 1 37 ? -1.204  7.120   3.280   1.00 0.00 ? 828 TYR A CZ   1  
ATOM 216  O OH   . TYR A 1 37 ? -0.352  8.074   3.790   1.00 0.00 ? 828 TYR A OH   1  
ATOM 217  H H    . TYR A 1 37 ? -6.327  4.699   2.635   1.00 0.00 ? 828 TYR A H    1  
ATOM 218  H HA   . TYR A 1 37 ? -4.696  5.497   0.315   1.00 0.00 ? 828 TYR A HA   1  
ATOM 219  H HB2  . TYR A 1 37 ? -4.236  3.487   2.516   1.00 0.00 ? 828 TYR A HB2  1  
ATOM 220  H HB3  . TYR A 1 37 ? -3.310  3.451   1.020   1.00 0.00 ? 828 TYR A HB3  1  
ATOM 221  H HH   . TYR A 1 37 ? -0.645  8.940   3.469   1.00 0.00 ? 828 TYR A HH   1  
ATOM 222  N N    . GLU A 1 38 ? -6.963  3.364   0.310   1.00 0.00 ? 829 GLU A N    1  
ATOM 223  C CA   . GLU A 1 38 ? -7.698  2.429   -0.518  1.00 0.00 ? 829 GLU A CA   1  
ATOM 224  C C    . GLU A 1 38 ? -7.961  3.055   -1.878  1.00 0.00 ? 829 GLU A C    1  
ATOM 225  O O    . GLU A 1 38 ? -7.529  2.531   -2.910  1.00 0.00 ? 829 GLU A O    1  
ATOM 226  C CB   . GLU A 1 38 ? -9.020  1.991   0.170   1.00 0.00 ? 829 GLU A CB   1  
ATOM 227  C CG   . GLU A 1 38 ? -10.005 3.172   0.313   1.00 0.00 ? 829 GLU A CG   1  
ATOM 228  C CD   . GLU A 1 38 ? -9.346  4.341   1.020   1.00 0.00 ? 829 GLU A CD   1  
ATOM 229  O OE1  . GLU A 1 38 ? -9.107  4.235   2.202   1.00 0.00 ? 829 GLU A OE1  1  
ATOM 230  O OE2  . GLU A 1 38 ? -9.081  5.321   0.366   1.00 0.00 ? 829 GLU A OE2  1  
ATOM 231  H H    . GLU A 1 38 ? -7.419  3.821   1.047   1.00 0.00 ? 829 GLU A H    1  
ATOM 232  H HA   . GLU A 1 38 ? -7.082  1.553   -0.668  1.00 0.00 ? 829 GLU A HA   1  
ATOM 233  N N    . ASN A 1 39 ? -8.581  4.228   -1.867  1.00 0.00 ? 830 ASN A N    1  
ATOM 234  C CA   . ASN A 1 39 ? -8.819  4.969   -3.091  1.00 0.00 ? 830 ASN A CA   1  
ATOM 235  C C    . ASN A 1 39 ? -7.507  5.169   -3.808  1.00 0.00 ? 830 ASN A C    1  
ATOM 236  O O    . ASN A 1 39 ? -7.418  5.017   -5.023  1.00 0.00 ? 830 ASN A O    1  
ATOM 237  C CB   . ASN A 1 39 ? -9.444  6.331   -2.785  1.00 0.00 ? 830 ASN A CB   1  
ATOM 238  C CG   . ASN A 1 39 ? -10.882 6.163   -2.321  1.00 0.00 ? 830 ASN A CG   1  
ATOM 239  O OD1  . ASN A 1 39 ? -11.817 6.378   -3.097  1.00 0.00 ? 830 ASN A OD1  1  
ATOM 240  N ND2  . ASN A 1 39 ? -11.123 5.796   -1.103  1.00 0.00 ? 830 ASN A ND2  1  
ATOM 241  H H    . ASN A 1 39 ? -8.831  4.630   -1.002  1.00 0.00 ? 830 ASN A H    1  
ATOM 242  H HA   . ASN A 1 39 ? -9.491  4.406   -3.724  1.00 0.00 ? 830 ASN A HA   1  
ATOM 243  H HB2  . ASN A 1 39 ? -8.872  6.824   -2.013  1.00 0.00 ? 830 ASN A HB2  1  
ATOM 244  H HB3  . ASN A 1 39 ? -9.427  6.937   -3.679  1.00 0.00 ? 830 ASN A HB3  1  
ATOM 245  H HD21 . ASN A 1 39 ? -10.374 5.632   -0.483  1.00 0.00 ? 830 ASN A HD21 1  
ATOM 246  H HD22 . ASN A 1 39 ? -12.046 5.684   -0.796  1.00 0.00 ? 830 ASN A HD22 1  
ATOM 247  N N    . HIS A 1 40 ? -6.476  5.482   -3.033  1.00 0.00 ? 831 HIS A N    1  
ATOM 248  C CA   . HIS A 1 40 ? -5.145  5.675   -3.579  1.00 0.00 ? 831 HIS A CA   1  
ATOM 249  C C    . HIS A 1 40 ? -4.721  4.442   -4.358  1.00 0.00 ? 831 HIS A C    1  
ATOM 250  O O    . HIS A 1 40 ? -4.363  4.531   -5.537  1.00 0.00 ? 831 HIS A O    1  
ATOM 251  C CB   . HIS A 1 40 ? -4.143  5.954   -2.453  1.00 0.00 ? 831 HIS A CB   1  
ATOM 252  C CG   . HIS A 1 40 ? -4.144  7.427   -2.128  1.00 0.00 ? 831 HIS A CG   1  
ATOM 253  N ND1  . HIS A 1 40 ? -4.922  7.973   -1.110  1.00 0.00 ? 831 HIS A ND1  1  
ATOM 254  C CD2  . HIS A 1 40 ? -3.465  8.480   -2.683  1.00 0.00 ? 831 HIS A CD2  1  
ATOM 255  C CE1  . HIS A 1 40 ? -4.686  9.300   -1.092  1.00 0.00 ? 831 HIS A CE1  1  
ATOM 256  N NE2  . HIS A 1 40 ? -3.804  9.659   -2.031  1.00 0.00 ? 831 HIS A NE2  1  
ATOM 257  H H    . HIS A 1 40 ? -6.619  5.566   -2.067  1.00 0.00 ? 831 HIS A H    1  
ATOM 258  H HA   . HIS A 1 40 ? -5.164  6.522   -4.250  1.00 0.00 ? 831 HIS A HA   1  
ATOM 259  H HB2  . HIS A 1 40 ? -4.414  5.386   -1.579  1.00 0.00 ? 831 HIS A HB2  1  
ATOM 260  H HB3  . HIS A 1 40 ? -3.153  5.662   -2.774  1.00 0.00 ? 831 HIS A HB3  1  
ATOM 261  N N    . LEU A 1 41 ? -4.784  3.283   -3.709  1.00 0.00 ? 832 LEU A N    1  
ATOM 262  C CA   . LEU A 1 41 ? -4.436  2.039   -4.365  1.00 0.00 ? 832 LEU A CA   1  
ATOM 263  C C    . LEU A 1 41 ? -5.277  1.871   -5.621  1.00 0.00 ? 832 LEU A C    1  
ATOM 264  O O    . LEU A 1 41 ? -4.746  1.658   -6.716  1.00 0.00 ? 832 LEU A O    1  
ATOM 265  C CB   . LEU A 1 41 ? -4.659  0.855   -3.415  1.00 0.00 ? 832 LEU A CB   1  
ATOM 266  C CG   . LEU A 1 41 ? -3.311  0.400   -2.825  1.00 0.00 ? 832 LEU A CG   1  
ATOM 267  C CD1  . LEU A 1 41 ? -2.959  1.266   -1.613  1.00 0.00 ? 832 LEU A CD1  1  
ATOM 268  C CD2  . LEU A 1 41 ? -3.408  -1.063  -2.383  1.00 0.00 ? 832 LEU A CD2  1  
ATOM 269  H H    . LEU A 1 41 ? -5.094  3.260   -2.777  1.00 0.00 ? 832 LEU A H    1  
ATOM 270  H HA   . LEU A 1 41 ? -3.396  2.071   -4.648  1.00 0.00 ? 832 LEU A HA   1  
ATOM 271  H HB2  . LEU A 1 41 ? -5.327  1.154   -2.619  1.00 0.00 ? 832 LEU A HB2  1  
ATOM 272  H HB3  . LEU A 1 41 ? -5.104  0.041   -3.964  1.00 0.00 ? 832 LEU A HB3  1  
ATOM 273  H HG   . LEU A 1 41 ? -2.535  0.502   -3.570  1.00 0.00 ? 832 LEU A HG   1  
ATOM 274  H HD11 . LEU A 1 41 ? -1.946  1.056   -1.304  1.00 0.00 ? 832 LEU A HD11 1  
ATOM 275  H HD12 . LEU A 1 41 ? -3.635  1.042   -0.801  1.00 0.00 ? 832 LEU A HD12 1  
ATOM 276  H HD13 . LEU A 1 41 ? -3.046  2.310   -1.873  1.00 0.00 ? 832 LEU A HD13 1  
ATOM 277  H HD21 . LEU A 1 41 ? -4.052  -1.607  -3.057  1.00 0.00 ? 832 LEU A HD21 1  
ATOM 278  H HD22 . LEU A 1 41 ? -3.810  -1.110  -1.382  1.00 0.00 ? 832 LEU A HD22 1  
ATOM 279  H HD23 . LEU A 1 41 ? -2.423  -1.505  -2.392  1.00 0.00 ? 832 LEU A HD23 1  
ATOM 280  N N    . MET A 1 42 ? -6.585  2.022   -5.466  1.00 0.00 ? 833 MET A N    1  
ATOM 281  C CA   . MET A 1 42 ? -7.498  1.928   -6.598  1.00 0.00 ? 833 MET A CA   1  
ATOM 282  C C    . MET A 1 42 ? -7.086  2.912   -7.686  1.00 0.00 ? 833 MET A C    1  
ATOM 283  O O    . MET A 1 42 ? -6.984  2.551   -8.859  1.00 0.00 ? 833 MET A O    1  
ATOM 284  C CB   . MET A 1 42 ? -8.932  2.224   -6.152  1.00 0.00 ? 833 MET A CB   1  
ATOM 285  C CG   . MET A 1 42 ? -9.366  1.210   -5.091  1.00 0.00 ? 833 MET A CG   1  
ATOM 286  S SD   . MET A 1 42 ? -9.299  -0.458  -5.787  1.00 0.00 ? 833 MET A SD   1  
ATOM 287  C CE   . MET A 1 42 ? -8.158  -1.168  -4.577  1.00 0.00 ? 833 MET A CE   1  
ATOM 288  H H    . MET A 1 42 ? -6.942  2.227   -4.573  1.00 0.00 ? 833 MET A H    1  
ATOM 289  H HA   . MET A 1 42 ? -7.458  0.926   -6.998  1.00 0.00 ? 833 MET A HA   1  
ATOM 290  H HB2  . MET A 1 42 ? -8.984  3.221   -5.741  1.00 0.00 ? 833 MET A HB2  1  
ATOM 291  H HB3  . MET A 1 42 ? -9.593  2.153   -7.003  1.00 0.00 ? 833 MET A HB3  1  
ATOM 292  H HG2  . MET A 1 42 ? -8.712  1.272   -4.237  1.00 0.00 ? 833 MET A HG2  1  
ATOM 293  H HG3  . MET A 1 42 ? -10.377 1.430   -4.781  1.00 0.00 ? 833 MET A HG3  1  
ATOM 294  H HE1  . MET A 1 42 ? -7.839  -2.143  -4.918  1.00 0.00 ? 833 MET A HE1  1  
ATOM 295  H HE2  . MET A 1 42 ? -8.655  -1.271  -3.626  1.00 0.00 ? 833 MET A HE2  1  
ATOM 296  H HE3  . MET A 1 42 ? -7.303  -0.518  -4.465  1.00 0.00 ? 833 MET A HE3  1  
ATOM 297  N N    . ALA A 1 43 ? -6.835  4.152   -7.287  1.00 0.00 ? 834 ALA A N    1  
ATOM 298  C CA   . ALA A 1 43 ? -6.420  5.189   -8.225  1.00 0.00 ? 834 ALA A CA   1  
ATOM 299  C C    . ALA A 1 43 ? -5.184  4.744   -8.988  1.00 0.00 ? 834 ALA A C    1  
ATOM 300  O O    . ALA A 1 43 ? -5.020  5.058   -10.166 1.00 0.00 ? 834 ALA A O    1  
ATOM 301  C CB   . ALA A 1 43 ? -6.128  6.494   -7.484  1.00 0.00 ? 834 ALA A CB   1  
ATOM 302  H H    . ALA A 1 43 ? -6.922  4.372   -6.335  1.00 0.00 ? 834 ALA A H    1  
ATOM 303  H HA   . ALA A 1 43 ? -7.220  5.361   -8.929  1.00 0.00 ? 834 ALA A HA   1  
ATOM 304  H HB1  . ALA A 1 43 ? -5.523  7.137   -8.108  1.00 0.00 ? 834 ALA A HB1  1  
ATOM 305  H HB2  . ALA A 1 43 ? -5.598  6.282   -6.569  1.00 0.00 ? 834 ALA A HB2  1  
ATOM 306  H HB3  . ALA A 1 43 ? -7.058  6.992   -7.252  1.00 0.00 ? 834 ALA A HB3  1  
ATOM 307  N N    . ASN A 1 44 ? -4.327  3.998   -8.312  1.00 0.00 ? 835 ASN A N    1  
ATOM 308  C CA   . ASN A 1 44 ? -3.109  3.480   -8.929  1.00 0.00 ? 835 ASN A CA   1  
ATOM 309  C C    . ASN A 1 44 ? -3.388  2.137   -9.593  1.00 0.00 ? 835 ASN A C    1  
ATOM 310  O O    . ASN A 1 44 ? -2.467  1.440   -10.026 1.00 0.00 ? 835 ASN A O    1  
ATOM 311  C CB   . ASN A 1 44 ? -1.999  3.323   -7.883  1.00 0.00 ? 835 ASN A CB   1  
ATOM 312  C CG   . ASN A 1 44 ? -0.623  3.345   -8.556  1.00 0.00 ? 835 ASN A CG   1  
ATOM 313  O OD1  . ASN A 1 44 ? 0.294   4.002   -8.071  1.00 0.00 ? 835 ASN A OD1  1  
ATOM 314  N ND2  . ASN A 1 44 ? -0.425  2.668   -9.645  1.00 0.00 ? 835 ASN A ND2  1  
ATOM 315  H H    . ASN A 1 44 ? -4.526  3.772   -7.378  1.00 0.00 ? 835 ASN A H    1  
ATOM 316  H HA   . ASN A 1 44 ? -2.779  4.179   -9.683  1.00 0.00 ? 835 ASN A HA   1  
ATOM 317  H HB2  . ASN A 1 44 ? -2.063  4.134   -7.172  1.00 0.00 ? 835 ASN A HB2  1  
ATOM 318  H HB3  . ASN A 1 44 ? -2.129  2.385   -7.366  1.00 0.00 ? 835 ASN A HB3  1  
ATOM 319  H HD21 . ASN A 1 44 ? -1.158  2.143   -10.037 1.00 0.00 ? 835 ASN A HD21 1  
ATOM 320  H HD22 . ASN A 1 44 ? 0.454   2.678   -10.079 1.00 0.00 ? 835 ASN A HD22 1  
ATOM 321  N N    . GLY A 1 45 ? -4.655  1.753   -9.619  1.00 0.00 ? 836 GLY A N    1  
ATOM 322  C CA   . GLY A 1 45 ? -5.047  0.475   -10.192 1.00 0.00 ? 836 GLY A CA   1  
ATOM 323  C C    . GLY A 1 45 ? -4.476  -0.667  -9.378  1.00 0.00 ? 836 GLY A C    1  
ATOM 324  O O    . GLY A 1 45 ? -4.311  -1.781  -9.879  1.00 0.00 ? 836 GLY A O    1  
ATOM 325  H H    . GLY A 1 45 ? -5.343  2.328   -9.222  1.00 0.00 ? 836 GLY A H    1  
ATOM 326  H HA2  . GLY A 1 45 ? -6.125  0.405   -10.200 1.00 0.00 ? 836 GLY A HA2  1  
ATOM 327  H HA3  . GLY A 1 45 ? -4.675  0.407   -11.203 1.00 0.00 ? 836 GLY A HA3  1  
ATOM 328  N N    . PHE A 1 46 ? -4.185  -0.392  -8.114  1.00 0.00 ? 837 PHE A N    1  
ATOM 329  C CA   . PHE A 1 46 ? -3.643  -1.400  -7.225  1.00 0.00 ? 837 PHE A CA   1  
ATOM 330  C C    . PHE A 1 46 ? -4.767  -2.146  -6.538  1.00 0.00 ? 837 PHE A C    1  
ATOM 331  O O    . PHE A 1 46 ? -5.655  -1.531  -5.946  1.00 0.00 ? 837 PHE A O    1  
ATOM 332  C CB   . PHE A 1 46 ? -2.735  -0.758  -6.167  1.00 0.00 ? 837 PHE A CB   1  
ATOM 333  C CG   . PHE A 1 46 ? -1.285  -0.882  -6.580  1.00 0.00 ? 837 PHE A CG   1  
ATOM 334  C CD1  . PHE A 1 46 ? -0.759  -2.131  -6.933  1.00 0.00 ? 837 PHE A CD1  1  
ATOM 335  C CD2  . PHE A 1 46 ? -0.466  0.253   -6.607  1.00 0.00 ? 837 PHE A CD2  1  
ATOM 336  C CE1  . PHE A 1 46 ? 0.581   -2.242  -7.311  1.00 0.00 ? 837 PHE A CE1  1  
ATOM 337  C CE2  . PHE A 1 46 ? 0.873   0.139   -6.984  1.00 0.00 ? 837 PHE A CE2  1  
ATOM 338  C CZ   . PHE A 1 46 ? 1.397   -1.108  -7.337  1.00 0.00 ? 837 PHE A CZ   1  
ATOM 339  H H    . PHE A 1 46 ? -4.358  0.509   -7.764  1.00 0.00 ? 837 PHE A H    1  
ATOM 340  H HA   . PHE A 1 46 ? -3.062  -2.100  -7.805  1.00 0.00 ? 837 PHE A HA   1  
ATOM 341  H HB2  . PHE A 1 46 ? -2.992  0.284   -6.056  1.00 0.00 ? 837 PHE A HB2  1  
ATOM 342  H HB3  . PHE A 1 46 ? -2.879  -1.261  -5.220  1.00 0.00 ? 837 PHE A HB3  1  
ATOM 343  H HZ   . PHE A 1 46 ? 2.432   -1.197  -7.629  1.00 0.00 ? 837 PHE A HZ   1  
ATOM 344  N N    . ASP A 1 47 ? -4.719  -3.461  -6.604  1.00 0.00 ? 838 ASP A N    1  
ATOM 345  C CA   . ASP A 1 47 ? -5.724  -4.297  -5.960  1.00 0.00 ? 838 ASP A CA   1  
ATOM 346  C C    . ASP A 1 47 ? -5.085  -5.562  -5.437  1.00 0.00 ? 838 ASP A C    1  
ATOM 347  O O    . ASP A 1 47 ? -3.928  -5.859  -5.755  1.00 0.00 ? 838 ASP A O    1  
ATOM 348  C CB   . ASP A 1 47 ? -6.850  -4.657  -6.937  1.00 0.00 ? 838 ASP A CB   1  
ATOM 349  C CG   . ASP A 1 47 ? -8.188  -4.690  -6.210  1.00 0.00 ? 838 ASP A CG   1  
ATOM 350  O OD1  . ASP A 1 47 ? -8.222  -5.147  -5.084  1.00 0.00 ? 838 ASP A OD1  1  
ATOM 351  O OD2  . ASP A 1 47 ? -9.162  -4.265  -6.792  1.00 0.00 ? 838 ASP A OD2  1  
ATOM 352  H H    . ASP A 1 47 ? -3.977  -3.889  -7.080  1.00 0.00 ? 838 ASP A H    1  
ATOM 353  H HA   . ASP A 1 47 ? -6.147  -3.753  -5.129  1.00 0.00 ? 838 ASP A HA   1  
ATOM 354  N N    . ASN A 1 48 ? -5.832  -6.306  -4.640  1.00 0.00 ? 839 ASN A N    1  
ATOM 355  C CA   . ASN A 1 48 ? -5.331  -7.549  -4.060  1.00 0.00 ? 839 ASN A CA   1  
ATOM 356  C C    . ASN A 1 48 ? -4.053  -7.288  -3.282  1.00 0.00 ? 839 ASN A C    1  
ATOM 357  O O    . ASN A 1 48 ? -2.945  -7.576  -3.758  1.00 0.00 ? 839 ASN A O    1  
ATOM 358  C CB   . ASN A 1 48 ? -5.075  -8.589  -5.150  1.00 0.00 ? 839 ASN A CB   1  
ATOM 359  C CG   . ASN A 1 48 ? -4.964  -9.974  -4.527  1.00 0.00 ? 839 ASN A CG   1  
ATOM 360  O OD1  . ASN A 1 48 ? -3.960  -10.293 -3.884  1.00 0.00 ? 839 ASN A OD1  1  
ATOM 361  N ND2  . ASN A 1 48 ? -5.933  -10.822 -4.674  1.00 0.00 ? 839 ASN A ND2  1  
ATOM 362  H H    . ASN A 1 48 ? -6.744  -6.005  -4.433  1.00 0.00 ? 839 ASN A H    1  
ATOM 363  H HA   . ASN A 1 48 ? -6.075  -7.937  -3.382  1.00 0.00 ? 839 ASN A HA   1  
ATOM 364  H HB2  . ASN A 1 48 ? -5.894  -8.573  -5.853  1.00 0.00 ? 839 ASN A HB2  1  
ATOM 365  H HB3  . ASN A 1 48 ? -4.155  -8.353  -5.665  1.00 0.00 ? 839 ASN A HB3  1  
ATOM 366  H HD21 . ASN A 1 48 ? -6.733  -10.570 -5.184  1.00 0.00 ? 839 ASN A HD21 1  
ATOM 367  H HD22 . ASN A 1 48 ? -5.871  -11.715 -4.275  1.00 0.00 ? 839 ASN A HD22 1  
ATOM 368  N N    . VAL A 1 49 ? -4.205  -6.722  -2.095  1.00 0.00 ? 840 VAL A N    1  
ATOM 369  C CA   . VAL A 1 49 ? -3.062  -6.401  -1.256  1.00 0.00 ? 840 VAL A CA   1  
ATOM 370  C C    . VAL A 1 49 ? -2.087  -7.570  -1.206  1.00 0.00 ? 840 VAL A C    1  
ATOM 371  O O    . VAL A 1 49 ? -0.868  -7.379  -1.242  1.00 0.00 ? 840 VAL A O    1  
ATOM 372  C CB   . VAL A 1 49 ? -3.528  -6.023  0.160   1.00 0.00 ? 840 VAL A CB   1  
ATOM 373  C CG1  . VAL A 1 49 ? -4.430  -4.791  0.085   1.00 0.00 ? 840 VAL A CG1  1  
ATOM 374  C CG2  . VAL A 1 49 ? -4.320  -7.180  0.782   1.00 0.00 ? 840 VAL A CG2  1  
ATOM 375  H H    . VAL A 1 49 ? -5.107  -6.507  -1.778  1.00 0.00 ? 840 VAL A H    1  
ATOM 376  H HA   . VAL A 1 49 ? -2.552  -5.551  -1.687  1.00 0.00 ? 840 VAL A HA   1  
ATOM 377  H HB   . VAL A 1 49 ? -2.666  -5.797  0.771   1.00 0.00 ? 840 VAL A HB   1  
ATOM 378  H HG11 . VAL A 1 49 ? -5.266  -4.992  -0.569  1.00 0.00 ? 840 VAL A HG11 1  
ATOM 379  H HG12 . VAL A 1 49 ? -3.864  -3.956  -0.297  1.00 0.00 ? 840 VAL A HG12 1  
ATOM 380  H HG13 . VAL A 1 49 ? -4.796  -4.557  1.073   1.00 0.00 ? 840 VAL A HG13 1  
ATOM 381  H HG21 . VAL A 1 49 ? -4.615  -6.909  1.786   1.00 0.00 ? 840 VAL A HG21 1  
ATOM 382  H HG22 . VAL A 1 49 ? -3.707  -8.069  0.821   1.00 0.00 ? 840 VAL A HG22 1  
ATOM 383  H HG23 . VAL A 1 49 ? -5.203  -7.373  0.193   1.00 0.00 ? 840 VAL A HG23 1  
ATOM 384  N N    . GLN A 1 50 ? -2.628  -8.778  -1.146  1.00 0.00 ? 841 GLN A N    1  
ATOM 385  C CA   . GLN A 1 50 ? -1.802  -9.969  -1.111  1.00 0.00 ? 841 GLN A CA   1  
ATOM 386  C C    . GLN A 1 50 ? -0.912  -10.024 -2.336  1.00 0.00 ? 841 GLN A C    1  
ATOM 387  O O    . GLN A 1 50 ? 0.315   -10.039 -2.221  1.00 0.00 ? 841 GLN A O    1  
ATOM 388  C CB   . GLN A 1 50 ? -2.674  -11.227 -1.039  1.00 0.00 ? 841 GLN A CB   1  
ATOM 389  C CG   . GLN A 1 50 ? -1.792  -12.476 -1.111  1.00 0.00 ? 841 GLN A CG   1  
ATOM 390  C CD   . GLN A 1 50 ? -0.905  -12.551 0.123   1.00 0.00 ? 841 GLN A CD   1  
ATOM 391  O OE1  . GLN A 1 50 ? -1.404  -12.775 1.230   1.00 0.00 ? 841 GLN A OE1  1  
ATOM 392  N NE2  . GLN A 1 50 ? 0.375   -12.369 0.008   1.00 0.00 ? 841 GLN A NE2  1  
ATOM 393  H H    . GLN A 1 50 ? -3.605  -8.865  -1.141  1.00 0.00 ? 841 GLN A H    1  
ATOM 394  H HA   . GLN A 1 50 ? -1.179  -9.930  -0.230  1.00 0.00 ? 841 GLN A HA   1  
ATOM 395  H HB2  . GLN A 1 50 ? -3.214  -11.226 -0.106  1.00 0.00 ? 841 GLN A HB2  1  
ATOM 396  H HB3  . GLN A 1 50 ? -3.373  -11.234 -1.861  1.00 0.00 ? 841 GLN A HB3  1  
ATOM 397  H HG2  . GLN A 1 50 ? -2.421  -13.353 -1.159  1.00 0.00 ? 841 GLN A HG2  1  
ATOM 398  H HG3  . GLN A 1 50 ? -1.174  -12.437 -1.996  1.00 0.00 ? 841 GLN A HG3  1  
ATOM 399  H HE21 . GLN A 1 50 ? 0.776   -12.181 -0.871  1.00 0.00 ? 841 GLN A HE21 1  
ATOM 400  H HE22 . GLN A 1 50 ? 0.957   -12.425 0.801   1.00 0.00 ? 841 GLN A HE22 1  
ATOM 401  N N    . PHE A 1 51 ? -1.528  -10.031 -3.511  1.00 0.00 ? 842 PHE A N    1  
ATOM 402  C CA   . PHE A 1 51 ? -0.765  -10.058 -4.746  1.00 0.00 ? 842 PHE A CA   1  
ATOM 403  C C    . PHE A 1 51 ? 0.286   -8.976  -4.704  1.00 0.00 ? 842 PHE A C    1  
ATOM 404  O O    . PHE A 1 51 ? 1.461   -9.228  -4.953  1.00 0.00 ? 842 PHE A O    1  
ATOM 405  C CB   . PHE A 1 51 ? -1.680  -9.853  -5.959  1.00 0.00 ? 842 PHE A CB   1  
ATOM 406  C CG   . PHE A 1 51 ? -1.077  -10.532 -7.170  1.00 0.00 ? 842 PHE A CG   1  
ATOM 407  C CD1  . PHE A 1 51 ? -1.229  -11.913 -7.349  1.00 0.00 ? 842 PHE A CD1  1  
ATOM 408  C CD2  . PHE A 1 51 ? -0.369  -9.780  -8.113  1.00 0.00 ? 842 PHE A CD2  1  
ATOM 409  C CE1  . PHE A 1 51 ? -0.674  -12.538 -8.470  1.00 0.00 ? 842 PHE A CE1  1  
ATOM 410  C CE2  . PHE A 1 51 ? 0.185   -10.406 -9.234  1.00 0.00 ? 842 PHE A CE2  1  
ATOM 411  C CZ   . PHE A 1 51 ? 0.032   -11.785 -9.413  1.00 0.00 ? 842 PHE A CZ   1  
ATOM 412  H H    . PHE A 1 51 ? -2.511  -9.995  -3.544  1.00 0.00 ? 842 PHE A H    1  
ATOM 413  H HA   . PHE A 1 51 ? -0.276  -11.018 -4.832  1.00 0.00 ? 842 PHE A HA   1  
ATOM 414  H HB2  . PHE A 1 51 ? -2.651  -10.280 -5.759  1.00 0.00 ? 842 PHE A HB2  1  
ATOM 415  H HB3  . PHE A 1 51 ? -1.785  -8.797  -6.157  1.00 0.00 ? 842 PHE A HB3  1  
ATOM 416  H HZ   . PHE A 1 51 ? 0.460   -12.268 -10.280 1.00 0.00 ? 842 PHE A HZ   1  
ATOM 417  N N    . MET A 1 52 ? -0.135  -7.777  -4.324  1.00 0.00 ? 843 MET A N    1  
ATOM 418  C CA   . MET A 1 52 ? 0.787   -6.663  -4.202  1.00 0.00 ? 843 MET A CA   1  
ATOM 419  C C    . MET A 1 52 ? 1.938   -7.033  -3.281  1.00 0.00 ? 843 MET A C    1  
ATOM 420  O O    . MET A 1 52 ? 3.104   -6.974  -3.673  1.00 0.00 ? 843 MET A O    1  
ATOM 421  C CB   . MET A 1 52 ? 0.065   -5.431  -3.641  1.00 0.00 ? 843 MET A CB   1  
ATOM 422  C CG   . MET A 1 52 ? -0.880  -4.855  -4.697  1.00 0.00 ? 843 MET A CG   1  
ATOM 423  S SD   . MET A 1 52 ? -1.711  -3.389  -4.028  1.00 0.00 ? 843 MET A SD   1  
ATOM 424  C CE   . MET A 1 52 ? -0.231  -2.378  -3.758  1.00 0.00 ? 843 MET A CE   1  
ATOM 425  H H    . MET A 1 52 ? -1.083  -7.651  -4.095  1.00 0.00 ? 843 MET A H    1  
ATOM 426  H HA   . MET A 1 52 ? 1.178   -6.423  -5.178  1.00 0.00 ? 843 MET A HA   1  
ATOM 427  H HB2  . MET A 1 52 ? -0.502  -5.715  -2.766  1.00 0.00 ? 843 MET A HB2  1  
ATOM 428  H HB3  . MET A 1 52 ? 0.794   -4.685  -3.365  1.00 0.00 ? 843 MET A HB3  1  
ATOM 429  H HG2  . MET A 1 52 ? -0.318  -4.583  -5.577  1.00 0.00 ? 843 MET A HG2  1  
ATOM 430  H HG3  . MET A 1 52 ? -1.620  -5.597  -4.958  1.00 0.00 ? 843 MET A HG3  1  
ATOM 431  H HE1  . MET A 1 52 ? -0.488  -1.334  -3.861  1.00 0.00 ? 843 MET A HE1  1  
ATOM 432  H HE2  . MET A 1 52 ? 0.522   -2.628  -4.490  1.00 0.00 ? 843 MET A HE2  1  
ATOM 433  H HE3  . MET A 1 52 ? 0.158   -2.567  -2.768  1.00 0.00 ? 843 MET A HE3  1  
ATOM 434  N N    . GLY A 1 53 ? 1.605   -7.429  -2.063  1.00 0.00 ? 844 GLY A N    1  
ATOM 435  C CA   . GLY A 1 53 ? 2.614   -7.799  -1.078  1.00 0.00 ? 844 GLY A CA   1  
ATOM 436  C C    . GLY A 1 53 ? 3.421   -8.994  -1.531  1.00 0.00 ? 844 GLY A C    1  
ATOM 437  O O    . GLY A 1 53 ? 4.484   -9.280  -0.976  1.00 0.00 ? 844 GLY A O    1  
ATOM 438  H H    . GLY A 1 53 ? 0.654   -7.466  -1.815  1.00 0.00 ? 844 GLY A H    1  
ATOM 439  H HA2  . GLY A 1 53 ? 3.285   -6.966  -0.954  1.00 0.00 ? 844 GLY A HA2  1  
ATOM 440  H HA3  . GLY A 1 53 ? 2.137   -8.026  -0.137  1.00 0.00 ? 844 GLY A HA3  1  
ATOM 441  N N    . SER A 1 54 ? 2.931   -9.678  -2.543  1.00 0.00 ? 845 SER A N    1  
ATOM 442  C CA   . SER A 1 54 ? 3.625   -10.832 -3.081  1.00 0.00 ? 845 SER A CA   1  
ATOM 443  C C    . SER A 1 54 ? 4.198   -10.512 -4.453  1.00 0.00 ? 845 SER A C    1  
ATOM 444  O O    . SER A 1 54 ? 4.765   -11.384 -5.120  1.00 0.00 ? 845 SER A O    1  
ATOM 445  C CB   . SER A 1 54 ? 2.665   -12.018 -3.193  1.00 0.00 ? 845 SER A CB   1  
ATOM 446  O OG   . SER A 1 54 ? 1.688   -11.952 -2.144  1.00 0.00 ? 845 SER A OG   1  
ATOM 447  H H    . SER A 1 54 ? 2.085   -9.395  -2.951  1.00 0.00 ? 845 SER A H    1  
ATOM 448  H HA   . SER A 1 54 ? 4.433   -11.104 -2.419  1.00 0.00 ? 845 SER A HA   1  
ATOM 449  H HB2  . SER A 1 54 ? 2.162   -11.988 -4.147  1.00 0.00 ? 845 SER A HB2  1  
ATOM 450  H HB3  . SER A 1 54 ? 3.237   -12.931 -3.126  1.00 0.00 ? 845 SER A HB3  1  
ATOM 451  H HG   . SER A 1 54 ? 1.285   -11.068 -2.176  1.00 0.00 ? 845 SER A HG   1  
ATOM 452  N N    . ASN A 1 55 ? 4.008   -9.273  -4.897  1.00 0.00 ? 846 ASN A N    1  
ATOM 453  C CA   . ASN A 1 55 ? 4.467   -8.872  -6.226  1.00 0.00 ? 846 ASN A CA   1  
ATOM 454  C C    . ASN A 1 55 ? 5.244   -7.563  -6.195  1.00 0.00 ? 846 ASN A C    1  
ATOM 455  O O    . ASN A 1 55 ? 6.362   -7.484  -6.712  1.00 0.00 ? 846 ASN A O    1  
ATOM 456  C CB   . ASN A 1 55 ? 3.271   -8.732  -7.170  1.00 0.00 ? 846 ASN A CB   1  
ATOM 457  C CG   . ASN A 1 55 ? 3.740   -8.274  -8.543  1.00 0.00 ? 846 ASN A CG   1  
ATOM 458  O OD1  . ASN A 1 55 ? 4.462   -9.001  -9.225  1.00 0.00 ? 846 ASN A OD1  1  
ATOM 459  N ND2  . ASN A 1 55 ? 3.374   -7.115  -8.991  1.00 0.00 ? 846 ASN A ND2  1  
ATOM 460  H H    . ASN A 1 55 ? 3.526   -8.628  -4.332  1.00 0.00 ? 846 ASN A H    1  
ATOM 461  H HA   . ASN A 1 55 ? 5.112   -9.644  -6.619  1.00 0.00 ? 846 ASN A HA   1  
ATOM 462  H HB2  . ASN A 1 55 ? 2.771   -9.685  -7.260  1.00 0.00 ? 846 ASN A HB2  1  
ATOM 463  H HB3  . ASN A 1 55 ? 2.581   -8.005  -6.767  1.00 0.00 ? 846 ASN A HB3  1  
ATOM 464  H HD21 . ASN A 1 55 ? 2.797   -6.541  -8.447  1.00 0.00 ? 846 ASN A HD21 1  
ATOM 465  H HD22 . ASN A 1 55 ? 3.674   -6.811  -9.873  1.00 0.00 ? 846 ASN A HD22 1  
ATOM 466  N N    . VAL A 1 56 ? 4.639   -6.527  -5.632  1.00 0.00 ? 847 VAL A N    1  
ATOM 467  C CA   . VAL A 1 56 ? 5.265   -5.211  -5.602  1.00 0.00 ? 847 VAL A CA   1  
ATOM 468  C C    . VAL A 1 56 ? 5.733   -4.840  -4.200  1.00 0.00 ? 847 VAL A C    1  
ATOM 469  O O    . VAL A 1 56 ? 4.928   -4.697  -3.277  1.00 0.00 ? 847 VAL A O    1  
ATOM 470  C CB   . VAL A 1 56 ? 4.287   -4.145  -6.146  1.00 0.00 ? 847 VAL A CB   1  
ATOM 471  C CG1  . VAL A 1 56 ? 2.873   -4.420  -5.635  1.00 0.00 ? 847 VAL A CG1  1  
ATOM 472  C CG2  . VAL A 1 56 ? 4.723   -2.744  -5.694  1.00 0.00 ? 847 VAL A CG2  1  
ATOM 473  H H    . VAL A 1 56 ? 3.740   -6.639  -5.252  1.00 0.00 ? 847 VAL A H    1  
ATOM 474  H HA   . VAL A 1 56 ? 6.127   -5.230  -6.253  1.00 0.00 ? 847 VAL A HA   1  
ATOM 475  H HB   . VAL A 1 56 ? 4.284   -4.191  -7.227  1.00 0.00 ? 847 VAL A HB   1  
ATOM 476  H HG11 . VAL A 1 56 ? 2.282   -3.520  -5.713  1.00 0.00 ? 847 VAL A HG11 1  
ATOM 477  H HG12 . VAL A 1 56 ? 2.915   -4.731  -4.602  1.00 0.00 ? 847 VAL A HG12 1  
ATOM 478  H HG13 . VAL A 1 56 ? 2.423   -5.197  -6.231  1.00 0.00 ? 847 VAL A HG13 1  
ATOM 479  H HG21 . VAL A 1 56 ? 4.693   -2.679  -4.617  1.00 0.00 ? 847 VAL A HG21 1  
ATOM 480  H HG22 . VAL A 1 56 ? 4.047   -2.014  -6.110  1.00 0.00 ? 847 VAL A HG22 1  
ATOM 481  H HG23 . VAL A 1 56 ? 5.725   -2.544  -6.043  1.00 0.00 ? 847 VAL A HG23 1  
ATOM 482  N N    . MET A 1 57 ? 7.030   -4.627  -4.068  1.00 0.00 ? 848 MET A N    1  
ATOM 483  C CA   . MET A 1 57 ? 7.614   -4.196  -2.810  1.00 0.00 ? 848 MET A CA   1  
ATOM 484  C C    . MET A 1 57 ? 8.681   -3.153  -3.093  1.00 0.00 ? 848 MET A C    1  
ATOM 485  O O    . MET A 1 57 ? 9.788   -3.492  -3.524  1.00 0.00 ? 848 MET A O    1  
ATOM 486  C CB   . MET A 1 57 ? 8.233   -5.394  -2.067  1.00 0.00 ? 848 MET A CB   1  
ATOM 487  C CG   . MET A 1 57 ? 7.382   -6.650  -2.299  1.00 0.00 ? 848 MET A CG   1  
ATOM 488  S SD   . MET A 1 57 ? 8.123   -8.051  -1.424  1.00 0.00 ? 848 MET A SD   1  
ATOM 489  C CE   . MET A 1 57 ? 7.206   -9.366  -2.267  1.00 0.00 ? 848 MET A CE   1  
ATOM 490  H H    . MET A 1 57 ? 7.609   -4.711  -4.854  1.00 0.00 ? 848 MET A H    1  
ATOM 491  H HA   . MET A 1 57 ? 6.844   -3.757  -2.193  1.00 0.00 ? 848 MET A HA   1  
ATOM 492  H HB2  . MET A 1 57 ? 9.235   -5.565  -2.430  1.00 0.00 ? 848 MET A HB2  1  
ATOM 493  H HB3  . MET A 1 57 ? 8.269   -5.179  -1.008  1.00 0.00 ? 848 MET A HB3  1  
ATOM 494  H HG2  . MET A 1 57 ? 6.380   -6.484  -1.928  1.00 0.00 ? 848 MET A HG2  1  
ATOM 495  H HG3  . MET A 1 57 ? 7.341   -6.869  -3.356  1.00 0.00 ? 848 MET A HG3  1  
ATOM 496  H HE1  . MET A 1 57 ? 6.324   -8.951  -2.734  1.00 0.00 ? 848 MET A HE1  1  
ATOM 497  H HE2  . MET A 1 57 ? 6.908   -10.114 -1.549  1.00 0.00 ? 848 MET A HE2  1  
ATOM 498  H HE3  . MET A 1 57 ? 7.841   -9.824  -3.013  1.00 0.00 ? 848 MET A HE3  1  
ATOM 499  N N    . GLU A 1 58 ? 8.340   -1.889  -2.887  1.00 0.00 ? 849 GLU A N    1  
ATOM 500  C CA   . GLU A 1 58 ? 9.262   -0.789  -3.162  1.00 0.00 ? 849 GLU A CA   1  
ATOM 501  C C    . GLU A 1 58 ? 8.748   0.502   -2.553  1.00 0.00 ? 849 GLU A C    1  
ATOM 502  O O    . GLU A 1 58 ? 7.542   0.684   -2.392  1.00 0.00 ? 849 GLU A O    1  
ATOM 503  C CB   . GLU A 1 58 ? 9.412   -0.590  -4.677  1.00 0.00 ? 849 GLU A CB   1  
ATOM 504  C CG   . GLU A 1 58 ? 10.621  -1.367  -5.202  1.00 0.00 ? 849 GLU A CG   1  
ATOM 505  C CD   . GLU A 1 58 ? 11.125  -0.723  -6.473  1.00 0.00 ? 849 GLU A CD   1  
ATOM 506  O OE1  . GLU A 1 58 ? 10.607  -1.049  -7.518  1.00 0.00 ? 849 GLU A OE1  1  
ATOM 507  O OE2  . GLU A 1 58 ? 12.011  0.098   -6.386  1.00 0.00 ? 849 GLU A OE2  1  
ATOM 508  H H    . GLU A 1 58 ? 7.436   -1.682  -2.570  1.00 0.00 ? 849 GLU A H    1  
ATOM 509  H HA   . GLU A 1 58 ? 10.228  -1.017  -2.742  1.00 0.00 ? 849 GLU A HA   1  
ATOM 510  N N    . ASP A 1 59 ? 9.663   1.415   -2.270  1.00 0.00 ? 850 ASP A N    1  
ATOM 511  C CA   . ASP A 1 59 ? 9.299   2.719   -1.734  1.00 0.00 ? 850 ASP A CA   1  
ATOM 512  C C    . ASP A 1 59 ? 8.631   3.561   -2.812  1.00 0.00 ? 850 ASP A C    1  
ATOM 513  O O    . ASP A 1 59 ? 7.569   4.151   -2.592  1.00 0.00 ? 850 ASP A O    1  
ATOM 514  C CB   . ASP A 1 59 ? 10.543  3.443   -1.215  1.00 0.00 ? 850 ASP A CB   1  
ATOM 515  C CG   . ASP A 1 59 ? 10.162  4.797   -0.652  1.00 0.00 ? 850 ASP A CG   1  
ATOM 516  O OD1  . ASP A 1 59 ? 9.475   4.830   0.349   1.00 0.00 ? 850 ASP A OD1  1  
ATOM 517  O OD2  . ASP A 1 59 ? 10.565  5.783   -1.225  1.00 0.00 ? 850 ASP A OD2  1  
ATOM 518  H H    . ASP A 1 59 ? 10.604  1.221   -2.465  1.00 0.00 ? 850 ASP A H    1  
ATOM 519  H HA   . ASP A 1 59 ? 8.608   2.583   -0.916  1.00 0.00 ? 850 ASP A HA   1  
ATOM 520  N N    . GLN A 1 60 ? 9.261   3.613   -3.982  1.00 0.00 ? 851 GLN A N    1  
ATOM 521  C CA   . GLN A 1 60 ? 8.732   4.387   -5.098  1.00 0.00 ? 851 GLN A CA   1  
ATOM 522  C C    . GLN A 1 60 ? 7.274   4.049   -5.343  1.00 0.00 ? 851 GLN A C    1  
ATOM 523  O O    . GLN A 1 60 ? 6.466   4.924   -5.638  1.00 0.00 ? 851 GLN A O    1  
ATOM 524  C CB   . GLN A 1 60 ? 9.551   4.133   -6.373  1.00 0.00 ? 851 GLN A CB   1  
ATOM 525  C CG   . GLN A 1 60 ? 9.733   2.622   -6.604  1.00 0.00 ? 851 GLN A CG   1  
ATOM 526  C CD   . GLN A 1 60 ? 9.354   2.263   -8.040  1.00 0.00 ? 851 GLN A CD   1  
ATOM 527  O OE1  . GLN A 1 60 ? 10.019  2.699   -8.987  1.00 0.00 ? 851 GLN A OE1  1  
ATOM 528  N NE2  . GLN A 1 60 ? 8.333   1.500   -8.266  1.00 0.00 ? 851 GLN A NE2  1  
ATOM 529  H H    . GLN A 1 60 ? 10.102  3.125   -4.098  1.00 0.00 ? 851 GLN A H    1  
ATOM 530  H HA   . GLN A 1 60 ? 8.801   5.436   -4.851  1.00 0.00 ? 851 GLN A HA   1  
ATOM 531  H HB2  . GLN A 1 60 ? 9.030   4.566   -7.211  1.00 0.00 ? 851 GLN A HB2  1  
ATOM 532  H HB3  . GLN A 1 60 ? 10.520  4.601   -6.278  1.00 0.00 ? 851 GLN A HB3  1  
ATOM 533  H HG2  . GLN A 1 60 ? 10.765  2.358   -6.432  1.00 0.00 ? 851 GLN A HG2  1  
ATOM 534  H HG3  . GLN A 1 60 ? 9.108   2.069   -5.924  1.00 0.00 ? 851 GLN A HG3  1  
ATOM 535  H HE21 . GLN A 1 60 ? 7.798   1.146   -7.520  1.00 0.00 ? 851 GLN A HE21 1  
ATOM 536  H HE22 . GLN A 1 60 ? 8.091   1.268   -9.186  1.00 0.00 ? 851 GLN A HE22 1  
ATOM 537  N N    . ASP A 1 61 ? 6.940   2.773   -5.212  1.00 0.00 ? 852 ASP A N    1  
ATOM 538  C CA   . ASP A 1 61 ? 5.572   2.332   -5.418  1.00 0.00 ? 852 ASP A CA   1  
ATOM 539  C C    . ASP A 1 61 ? 4.649   3.020   -4.440  1.00 0.00 ? 852 ASP A C    1  
ATOM 540  O O    . ASP A 1 61 ? 3.583   3.499   -4.814  1.00 0.00 ? 852 ASP A O    1  
ATOM 541  C CB   . ASP A 1 61 ? 5.465   0.818   -5.281  1.00 0.00 ? 852 ASP A CB   1  
ATOM 542  C CG   . ASP A 1 61 ? 5.543   0.193   -6.654  1.00 0.00 ? 852 ASP A CG   1  
ATOM 543  O OD1  . ASP A 1 61 ? 6.640   -0.051  -7.109  1.00 0.00 ? 852 ASP A OD1  1  
ATOM 544  O OD2  . ASP A 1 61 ? 4.512   -0.012  -7.247  1.00 0.00 ? 852 ASP A OD2  1  
ATOM 545  H H    . ASP A 1 61 ? 7.624   2.120   -4.961  1.00 0.00 ? 852 ASP A H    1  
ATOM 546  H HA   . ASP A 1 61 ? 5.276   2.610   -6.418  1.00 0.00 ? 852 ASP A HA   1  
ATOM 547  N N    . LEU A 1 62 ? 5.091   3.138   -3.206  1.00 0.00 ? 853 LEU A N    1  
ATOM 548  C CA   . LEU A 1 62 ? 4.315   3.852   -2.213  1.00 0.00 ? 853 LEU A CA   1  
ATOM 549  C C    . LEU A 1 62 ? 4.085   5.266   -2.708  1.00 0.00 ? 853 LEU A C    1  
ATOM 550  O O    . LEU A 1 62 ? 2.969   5.791   -2.654  1.00 0.00 ? 853 LEU A O    1  
ATOM 551  C CB   . LEU A 1 62 ? 5.053   3.879   -0.875  1.00 0.00 ? 853 LEU A CB   1  
ATOM 552  C CG   . LEU A 1 62 ? 5.513   2.463   -0.513  1.00 0.00 ? 853 LEU A CG   1  
ATOM 553  C CD1  . LEU A 1 62 ? 6.413   2.524   0.710   1.00 0.00 ? 853 LEU A CD1  1  
ATOM 554  C CD2  . LEU A 1 62 ? 4.295   1.588   -0.204  1.00 0.00 ? 853 LEU A CD2  1  
ATOM 555  H H    . LEU A 1 62 ? 5.978   2.792   -2.975  1.00 0.00 ? 853 LEU A H    1  
ATOM 556  H HA   . LEU A 1 62 ? 3.361   3.362   -2.086  1.00 0.00 ? 853 LEU A HA   1  
ATOM 557  H HB2  . LEU A 1 62 ? 5.912   4.528   -0.957  1.00 0.00 ? 853 LEU A HB2  1  
ATOM 558  H HB3  . LEU A 1 62 ? 4.394   4.249   -0.106  1.00 0.00 ? 853 LEU A HB3  1  
ATOM 559  H HG   . LEU A 1 62 ? 6.066   2.038   -1.338  1.00 0.00 ? 853 LEU A HG   1  
ATOM 560  H HD11 . LEU A 1 62 ? 6.810   1.542   0.916   1.00 0.00 ? 853 LEU A HD11 1  
ATOM 561  H HD12 . LEU A 1 62 ? 5.833   2.862   1.553   1.00 0.00 ? 853 LEU A HD12 1  
ATOM 562  H HD13 . LEU A 1 62 ? 7.222   3.213   0.526   1.00 0.00 ? 853 LEU A HD13 1  
ATOM 563  H HD21 . LEU A 1 62 ? 3.826   1.283   -1.127  1.00 0.00 ? 853 LEU A HD21 1  
ATOM 564  H HD22 . LEU A 1 62 ? 3.590   2.148   0.393   1.00 0.00 ? 853 LEU A HD22 1  
ATOM 565  H HD23 . LEU A 1 62 ? 4.613   0.713   0.343   1.00 0.00 ? 853 LEU A HD23 1  
ATOM 566  N N    . LEU A 1 63 ? 5.132   5.847   -3.270  1.00 0.00 ? 854 LEU A N    1  
ATOM 567  C CA   . LEU A 1 63 ? 5.031   7.170   -3.854  1.00 0.00 ? 854 LEU A CA   1  
ATOM 568  C C    . LEU A 1 63 ? 4.086   7.124   -5.045  1.00 0.00 ? 854 LEU A C    1  
ATOM 569  O O    . LEU A 1 63 ? 3.249   8.012   -5.224  1.00 0.00 ? 854 LEU A O    1  
ATOM 570  C CB   . LEU A 1 63 ? 6.415   7.675   -4.296  1.00 0.00 ? 854 LEU A CB   1  
ATOM 571  C CG   . LEU A 1 63 ? 6.655   9.100   -3.766  1.00 0.00 ? 854 LEU A CG   1  
ATOM 572  C CD1  . LEU A 1 63 ? 5.586   10.051  -4.315  1.00 0.00 ? 854 LEU A CD1  1  
ATOM 573  C CD2  . LEU A 1 63 ? 6.605   9.102   -2.231  1.00 0.00 ? 854 LEU A CD2  1  
ATOM 574  H H    . LEU A 1 63 ? 5.975   5.348   -3.338  1.00 0.00 ? 854 LEU A H    1  
ATOM 575  H HA   . LEU A 1 63 ? 4.626   7.844   -3.116  1.00 0.00 ? 854 LEU A HA   1  
ATOM 576  H HB2  . LEU A 1 63 ? 7.179   7.014   -3.911  1.00 0.00 ? 854 LEU A HB2  1  
ATOM 577  H HB3  . LEU A 1 63 ? 6.468   7.684   -5.375  1.00 0.00 ? 854 LEU A HB3  1  
ATOM 578  H HG   . LEU A 1 63 ? 7.626   9.438   -4.097  1.00 0.00 ? 854 LEU A HG   1  
ATOM 579  H HD11 . LEU A 1 63 ? 4.628   9.818   -3.873  1.00 0.00 ? 854 LEU A HD11 1  
ATOM 580  H HD12 . LEU A 1 63 ? 5.524   9.947   -5.388  1.00 0.00 ? 854 LEU A HD12 1  
ATOM 581  H HD13 . LEU A 1 63 ? 5.855   11.067  -4.070  1.00 0.00 ? 854 LEU A HD13 1  
ATOM 582  H HD21 . LEU A 1 63 ? 7.055   8.196   -1.852  1.00 0.00 ? 854 LEU A HD21 1  
ATOM 583  H HD22 . LEU A 1 63 ? 5.579   9.162   -1.898  1.00 0.00 ? 854 LEU A HD22 1  
ATOM 584  H HD23 . LEU A 1 63 ? 7.151   9.956   -1.858  1.00 0.00 ? 854 LEU A HD23 1  
ATOM 585  N N    . GLU A 1 64 ? 4.200   6.065   -5.842  1.00 0.00 ? 855 GLU A N    1  
ATOM 586  C CA   . GLU A 1 64 ? 3.329   5.881   -7.000  1.00 0.00 ? 855 GLU A CA   1  
ATOM 587  C C    . GLU A 1 64 ? 1.872   6.012   -6.581  1.00 0.00 ? 855 GLU A C    1  
ATOM 588  O O    . GLU A 1 64 ? 1.107   6.772   -7.181  1.00 0.00 ? 855 GLU A O    1  
ATOM 589  C CB   . GLU A 1 64 ? 3.560   4.504   -7.637  1.00 0.00 ? 855 GLU A CB   1  
ATOM 590  C CG   . GLU A 1 64 ? 4.885   4.492   -8.408  1.00 0.00 ? 855 GLU A CG   1  
ATOM 591  C CD   . GLU A 1 64 ? 4.657   4.950   -9.832  1.00 0.00 ? 855 GLU A CD   1  
ATOM 592  O OE1  . GLU A 1 64 ? 4.010   4.233   -10.565 1.00 0.00 ? 855 GLU A OE1  1  
ATOM 593  O OE2  . GLU A 1 64 ? 5.125   6.014   -10.174 1.00 0.00 ? 855 GLU A OE2  1  
ATOM 594  H H    . GLU A 1 64 ? 4.875   5.383   -5.634  1.00 0.00 ? 855 GLU A H    1  
ATOM 595  H HA   . GLU A 1 64 ? 3.550   6.646   -7.730  1.00 0.00 ? 855 GLU A HA   1  
ATOM 596  N N    . ILE A 1 65 ? 1.494   5.279   -5.538  1.00 0.00 ? 856 ILE A N    1  
ATOM 597  C CA   . ILE A 1 65 ? 0.128   5.341   -5.043  1.00 0.00 ? 856 ILE A CA   1  
ATOM 598  C C    . ILE A 1 65 ? -0.152  6.700   -4.429  1.00 0.00 ? 856 ILE A C    1  
ATOM 599  O O    . ILE A 1 65 ? -1.302  7.046   -4.180  1.00 0.00 ? 856 ILE A O    1  
ATOM 600  C CB   . ILE A 1 65 ? -0.150  4.244   -4.001  1.00 0.00 ? 856 ILE A CB   1  
ATOM 601  C CG1  . ILE A 1 65 ? 0.869   3.102   -4.133  1.00 0.00 ? 856 ILE A CG1  1  
ATOM 602  C CG2  . ILE A 1 65 ? -1.555  3.697   -4.218  1.00 0.00 ? 856 ILE A CG2  1  
ATOM 603  C CD1  . ILE A 1 65 ? 0.303   1.826   -3.498  1.00 0.00 ? 856 ILE A CD1  1  
ATOM 604  H H    . ILE A 1 65 ? 2.146   4.698   -5.091  1.00 0.00 ? 856 ILE A H    1  
ATOM 605  H HA   . ILE A 1 65 ? -0.540  5.201   -5.880  1.00 0.00 ? 856 ILE A HA   1  
ATOM 606  H HB   . ILE A 1 65 ? -0.093  4.679   -3.012  1.00 0.00 ? 856 ILE A HB   1  
ATOM 607  H HG12 . ILE A 1 65 ? 1.084   2.920   -5.176  1.00 0.00 ? 856 ILE A HG12 1  
ATOM 608  H HG21 . ILE A 1 65 ? -2.241  4.520   -4.344  1.00 0.00 ? 856 ILE A HG21 1  
ATOM 609  H HG22 . ILE A 1 65 ? -1.846  3.108   -3.362  1.00 0.00 ? 856 ILE A HG22 1  
ATOM 610  H HG23 . ILE A 1 65 ? -1.563  3.079   -5.104  1.00 0.00 ? 856 ILE A HG23 1  
ATOM 611  H HD11 . ILE A 1 65 ? -0.193  2.074   -2.571  1.00 0.00 ? 856 ILE A HD11 1  
ATOM 612  H HD12 . ILE A 1 65 ? 1.108   1.134   -3.303  1.00 0.00 ? 856 ILE A HD12 1  
ATOM 613  H HD13 . ILE A 1 65 ? -0.406  1.371   -4.173  1.00 0.00 ? 856 ILE A HD13 1  
ATOM 614  N N    . GLY A 1 66 ? 0.902   7.463   -4.189  1.00 0.00 ? 857 GLY A N    1  
ATOM 615  C CA   . GLY A 1 66 ? 0.768   8.789   -3.605  1.00 0.00 ? 857 GLY A CA   1  
ATOM 616  C C    . GLY A 1 66 ? 0.966   8.761   -2.094  1.00 0.00 ? 857 GLY A C    1  
ATOM 617  O O    . GLY A 1 66 ? 0.622   9.720   -1.402  1.00 0.00 ? 857 GLY A O    1  
ATOM 618  H H    . GLY A 1 66 ? 1.798   7.130   -4.414  1.00 0.00 ? 857 GLY A H    1  
ATOM 619  H HA2  . GLY A 1 66 ? 1.506   9.442   -4.048  1.00 0.00 ? 857 GLY A HA2  1  
ATOM 620  H HA3  . GLY A 1 66 ? -0.218  9.173   -3.823  1.00 0.00 ? 857 GLY A HA3  1  
ATOM 621  N N    . ILE A 1 67 ? 1.559   7.687   -1.582  1.00 0.00 ? 858 ILE A N    1  
ATOM 622  C CA   . ILE A 1 67 ? 1.830   7.597   -0.151  1.00 0.00 ? 858 ILE A CA   1  
ATOM 623  C C    . ILE A 1 67 ? 3.009   8.501   0.196   1.00 0.00 ? 858 ILE A C    1  
ATOM 624  O O    . ILE A 1 67 ? 4.162   8.138   -0.026  1.00 0.00 ? 858 ILE A O    1  
ATOM 625  C CB   . ILE A 1 67 ? 2.143   6.144   0.260   1.00 0.00 ? 858 ILE A CB   1  
ATOM 626  C CG1  . ILE A 1 67 ? 1.161   5.173   -0.425  1.00 0.00 ? 858 ILE A CG1  1  
ATOM 627  C CG2  . ILE A 1 67 ? 2.021   5.999   1.783   1.00 0.00 ? 858 ILE A CG2  1  
ATOM 628  C CD1  . ILE A 1 67 ? -0.241  5.343   0.165   1.00 0.00 ? 858 ILE A CD1  1  
ATOM 629  H H    . ILE A 1 67 ? 1.854   6.961   -2.176  1.00 0.00 ? 858 ILE A H    1  
ATOM 630  H HA   . ILE A 1 67 ? 0.959   7.937   0.390   1.00 0.00 ? 858 ILE A HA   1  
ATOM 631  H HB   . ILE A 1 67 ? 3.155   5.908   -0.037  1.00 0.00 ? 858 ILE A HB   1  
ATOM 632  H HG12 . ILE A 1 67 ? 1.132   5.373   -1.484  1.00 0.00 ? 858 ILE A HG12 1  
ATOM 633  H HG21 . ILE A 1 67 ? 2.286   4.993   2.072   1.00 0.00 ? 858 ILE A HG21 1  
ATOM 634  H HG22 . ILE A 1 67 ? 1.004   6.201   2.085   1.00 0.00 ? 858 ILE A HG22 1  
ATOM 635  H HG23 . ILE A 1 67 ? 2.683   6.700   2.270   1.00 0.00 ? 858 ILE A HG23 1  
ATOM 636  H HD11 . ILE A 1 67 ? -0.575  6.358   0.016   1.00 0.00 ? 858 ILE A HD11 1  
ATOM 637  H HD12 . ILE A 1 67 ? -0.217  5.123   1.222   1.00 0.00 ? 858 ILE A HD12 1  
ATOM 638  H HD13 . ILE A 1 67 ? -0.922  4.665   -0.327  1.00 0.00 ? 858 ILE A HD13 1  
ATOM 639  N N    . LEU A 1 68 ? 2.714   9.694   0.687   1.00 0.00 ? 859 LEU A N    1  
ATOM 640  C CA   . LEU A 1 68 ? 3.760   10.661  1.006   1.00 0.00 ? 859 LEU A CA   1  
ATOM 641  C C    . LEU A 1 68 ? 4.459   10.311  2.314   1.00 0.00 ? 859 LEU A C    1  
ATOM 642  O O    . LEU A 1 68 ? 5.616   9.867   2.317   1.00 0.00 ? 859 LEU A O    1  
ATOM 643  C CB   . LEU A 1 68 ? 3.176   12.077  1.092   1.00 0.00 ? 859 LEU A CB   1  
ATOM 644  C CG   . LEU A 1 68 ? 2.225   12.325  -0.090  1.00 0.00 ? 859 LEU A CG   1  
ATOM 645  C CD1  . LEU A 1 68 ? 0.783   12.416  0.414   1.00 0.00 ? 859 LEU A CD1  1  
ATOM 646  C CD2  . LEU A 1 68 ? 2.601   13.635  -0.780  1.00 0.00 ? 859 LEU A CD2  1  
ATOM 647  H H    . LEU A 1 68 ? 1.774   9.947   0.803   1.00 0.00 ? 859 LEU A H    1  
ATOM 648  H HA   . LEU A 1 68 ? 4.494   10.646  0.212   1.00 0.00 ? 859 LEU A HA   1  
ATOM 649  H HB2  . LEU A 1 68 ? 2.640   12.190  2.023   1.00 0.00 ? 859 LEU A HB2  1  
ATOM 650  H HB3  . LEU A 1 68 ? 3.983   12.794  1.058   1.00 0.00 ? 859 LEU A HB3  1  
ATOM 651  H HG   . LEU A 1 68 ? 2.303   11.510  -0.797  1.00 0.00 ? 859 LEU A HG   1  
ATOM 652  H HD11 . LEU A 1 68 ? 0.749   13.001  1.321   1.00 0.00 ? 859 LEU A HD11 1  
ATOM 653  H HD12 . LEU A 1 68 ? 0.405   11.425  0.611   1.00 0.00 ? 859 LEU A HD12 1  
ATOM 654  H HD13 . LEU A 1 68 ? 0.170   12.889  -0.340  1.00 0.00 ? 859 LEU A HD13 1  
ATOM 655  H HD21 . LEU A 1 68 ? 3.464   13.476  -1.409  1.00 0.00 ? 859 LEU A HD21 1  
ATOM 656  H HD22 . LEU A 1 68 ? 2.831   14.386  -0.038  1.00 0.00 ? 859 LEU A HD22 1  
ATOM 657  H HD23 . LEU A 1 68 ? 1.773   13.970  -1.385  1.00 0.00 ? 859 LEU A HD23 1  
ATOM 658  N N    . ASN A 1 69 ? 3.767   10.549  3.427   1.00 0.00 ? 860 ASN A N    1  
ATOM 659  C CA   . ASN A 1 69 ? 4.325   10.299  4.759   1.00 0.00 ? 860 ASN A CA   1  
ATOM 660  C C    . ASN A 1 69 ? 5.166   9.028   4.776   1.00 0.00 ? 860 ASN A C    1  
ATOM 661  O O    . ASN A 1 69 ? 4.641   7.921   4.650   1.00 0.00 ? 860 ASN A O    1  
ATOM 662  C CB   . ASN A 1 69 ? 3.202   10.193  5.798   1.00 0.00 ? 860 ASN A CB   1  
ATOM 663  C CG   . ASN A 1 69 ? 3.795   9.987   7.188   1.00 0.00 ? 860 ASN A CG   1  
ATOM 664  O OD1  . ASN A 1 69 ? 4.053   8.853   7.592   1.00 0.00 ? 860 ASN A OD1  1  
ATOM 665  N ND2  . ASN A 1 69 ? 4.028   11.015  7.948   1.00 0.00 ? 860 ASN A ND2  1  
ATOM 666  H H    . ASN A 1 69 ? 2.865   10.925  3.352   1.00 0.00 ? 860 ASN A H    1  
ATOM 667  H HA   . ASN A 1 69 ? 4.957   11.132  5.026   1.00 0.00 ? 860 ASN A HA   1  
ATOM 668  H HB2  . ASN A 1 69 ? 2.616   11.100  5.789   1.00 0.00 ? 860 ASN A HB2  1  
ATOM 669  H HB3  . ASN A 1 69 ? 2.566   9.355   5.556   1.00 0.00 ? 860 ASN A HB3  1  
ATOM 670  H HD21 . ASN A 1 69 ? 3.822   11.919  7.628   1.00 0.00 ? 860 ASN A HD21 1  
ATOM 671  H HD22 . ASN A 1 69 ? 4.411   10.891  8.842   1.00 0.00 ? 860 ASN A HD22 1  
ATOM 672  N N    . SER A 1 70 ? 6.470   9.193   4.926   1.00 0.00 ? 861 SER A N    1  
ATOM 673  C CA   . SER A 1 70 ? 7.375   8.057   4.956   1.00 0.00 ? 861 SER A CA   1  
ATOM 674  C C    . SER A 1 70 ? 6.951   7.060   6.023   1.00 0.00 ? 861 SER A C    1  
ATOM 675  O O    . SER A 1 70 ? 6.977   5.847   5.792   1.00 0.00 ? 861 SER A O    1  
ATOM 676  C CB   . SER A 1 70 ? 8.807   8.529   5.181   1.00 0.00 ? 861 SER A CB   1  
ATOM 677  O OG   . SER A 1 70 ? 9.149   9.469   4.151   1.00 0.00 ? 861 SER A OG   1  
ATOM 678  H H    . SER A 1 70 ? 6.833   10.098  5.019   1.00 0.00 ? 861 SER A H    1  
ATOM 679  H HA   . SER A 1 70 ? 7.322   7.554   4.007   1.00 0.00 ? 861 SER A HA   1  
ATOM 680  H HB2  . SER A 1 70 ? 8.888   9.006   6.145   1.00 0.00 ? 861 SER A HB2  1  
ATOM 681  H HB3  . SER A 1 70 ? 9.472   7.676   5.152   1.00 0.00 ? 861 SER A HB3  1  
ATOM 682  H HG   . SER A 1 70 ? 9.271   10.330  4.570   1.00 0.00 ? 861 SER A HG   1  
ATOM 683  N N    . GLY A 1 71 ? 6.484   7.566   7.156   1.00 0.00 ? 862 GLY A N    1  
ATOM 684  C CA   . GLY A 1 71 ? 5.979   6.695   8.201   1.00 0.00 ? 862 GLY A CA   1  
ATOM 685  C C    . GLY A 1 71 ? 4.911   5.795   7.617   1.00 0.00 ? 862 GLY A C    1  
ATOM 686  O O    . GLY A 1 71 ? 4.951   4.572   7.773   1.00 0.00 ? 862 GLY A O    1  
ATOM 687  H H    . GLY A 1 71 ? 6.427   8.538   7.269   1.00 0.00 ? 862 GLY A H    1  
ATOM 688  H HA2  . GLY A 1 71 ? 6.790   6.095   8.587   1.00 0.00 ? 862 GLY A HA2  1  
ATOM 689  H HA3  . GLY A 1 71 ? 5.552   7.286   8.995   1.00 0.00 ? 862 GLY A HA3  1  
ATOM 690  N N    . HIS A 1 72 ? 3.992   6.404   6.874   1.00 0.00 ? 863 HIS A N    1  
ATOM 691  C CA   . HIS A 1 72 ? 2.952   5.655   6.194   1.00 0.00 ? 863 HIS A CA   1  
ATOM 692  C C    . HIS A 1 72 ? 3.582   4.725   5.181   1.00 0.00 ? 863 HIS A C    1  
ATOM 693  O O    . HIS A 1 72 ? 3.289   3.533   5.156   1.00 0.00 ? 863 HIS A O    1  
ATOM 694  C CB   . HIS A 1 72 ? 1.981   6.601   5.485   1.00 0.00 ? 863 HIS A CB   1  
ATOM 695  C CG   . HIS A 1 72 ? 1.138   7.321   6.497   1.00 0.00 ? 863 HIS A CG   1  
ATOM 696  N ND1  . HIS A 1 72 ? -0.008  8.006   6.140   1.00 0.00 ? 863 HIS A ND1  1  
ATOM 697  C CD2  . HIS A 1 72 ? 1.258   7.469   7.857   1.00 0.00 ? 863 HIS A CD2  1  
ATOM 698  C CE1  . HIS A 1 72 ? -0.532  8.531   7.264   1.00 0.00 ? 863 HIS A CE1  1  
ATOM 699  N NE2  . HIS A 1 72 ? 0.203   8.233   8.338   1.00 0.00 ? 863 HIS A NE2  1  
ATOM 700  H H    . HIS A 1 72 ? 4.049   7.377   6.746   1.00 0.00 ? 863 HIS A H    1  
ATOM 701  H HA   . HIS A 1 72 ? 2.406   5.069   6.918   1.00 0.00 ? 863 HIS A HA   1  
ATOM 702  H HB2  . HIS A 1 72 ? 2.534   7.318   4.899   1.00 0.00 ? 863 HIS A HB2  1  
ATOM 703  H HB3  . HIS A 1 72 ? 1.342   6.029   4.830   1.00 0.00 ? 863 HIS A HB3  1  
ATOM 704  N N    . ARG A 1 73 ? 4.481   5.269   4.366   1.00 0.00 ? 864 ARG A N    1  
ATOM 705  C CA   . ARG A 1 73 ? 5.182   4.462   3.378   1.00 0.00 ? 864 ARG A CA   1  
ATOM 706  C C    . ARG A 1 73 ? 5.806   3.250   4.059   1.00 0.00 ? 864 ARG A C    1  
ATOM 707  O O    . ARG A 1 73 ? 5.568   2.107   3.662   1.00 0.00 ? 864 ARG A O    1  
ATOM 708  C CB   . ARG A 1 73 ? 6.269   5.294   2.667   1.00 0.00 ? 864 ARG A CB   1  
ATOM 709  C CG   . ARG A 1 73 ? 5.610   6.466   1.918   1.00 0.00 ? 864 ARG A CG   1  
ATOM 710  C CD   . ARG A 1 73 ? 6.482   6.911   0.726   1.00 0.00 ? 864 ARG A CD   1  
ATOM 711  N NE   . ARG A 1 73 ? 7.894   6.614   0.965   1.00 0.00 ? 864 ARG A NE   1  
ATOM 712  C CZ   . ARG A 1 73 ? 8.658   7.390   1.725   1.00 0.00 ? 864 ARG A CZ   1  
ATOM 713  N NH1  . ARG A 1 73 ? 8.158   8.468   2.270   1.00 0.00 ? 864 ARG A NH1  1  
ATOM 714  N NH2  . ARG A 1 73 ? 9.905   7.075   1.912   1.00 0.00 ? 864 ARG A NH2  1  
ATOM 715  H H    . ARG A 1 73 ? 4.690   6.226   4.454   1.00 0.00 ? 864 ARG A H    1  
ATOM 716  H HA   . ARG A 1 73 ? 4.468   4.116   2.644   1.00 0.00 ? 864 ARG A HA   1  
ATOM 717  N N    . GLN A 1 74 ? 6.563   3.504   5.118   1.00 0.00 ? 865 GLN A N    1  
ATOM 718  C CA   . GLN A 1 74 ? 7.179   2.430   5.880   1.00 0.00 ? 865 GLN A CA   1  
ATOM 719  C C    . GLN A 1 74 ? 6.113   1.466   6.374   1.00 0.00 ? 865 GLN A C    1  
ATOM 720  O O    . GLN A 1 74 ? 6.243   0.248   6.222   1.00 0.00 ? 865 GLN A O    1  
ATOM 721  C CB   . GLN A 1 74 ? 7.953   3.001   7.071   1.00 0.00 ? 865 GLN A CB   1  
ATOM 722  C CG   . GLN A 1 74 ? 9.234   3.682   6.578   1.00 0.00 ? 865 GLN A CG   1  
ATOM 723  C CD   . GLN A 1 74 ? 10.236  3.780   7.715   1.00 0.00 ? 865 GLN A CD   1  
ATOM 724  O OE1  . GLN A 1 74 ? 10.668  4.879   8.074   1.00 0.00 ? 865 GLN A OE1  1  
ATOM 725  N NE2  . GLN A 1 74 ? 10.632  2.701   8.312   1.00 0.00 ? 865 GLN A NE2  1  
ATOM 726  H H    . GLN A 1 74 ? 6.685   4.435   5.411   1.00 0.00 ? 865 GLN A H    1  
ATOM 727  H HA   . GLN A 1 74 ? 7.864   1.894   5.242   1.00 0.00 ? 865 GLN A HA   1  
ATOM 728  H HB2  . GLN A 1 74 ? 7.336   3.722   7.590   1.00 0.00 ? 865 GLN A HB2  1  
ATOM 729  H HB3  . GLN A 1 74 ? 8.211   2.200   7.747   1.00 0.00 ? 865 GLN A HB3  1  
ATOM 730  H HG2  . GLN A 1 74 ? 9.664   3.103   5.772   1.00 0.00 ? 865 GLN A HG2  1  
ATOM 731  H HG3  . GLN A 1 74 ? 9.001   4.675   6.219   1.00 0.00 ? 865 GLN A HG3  1  
ATOM 732  H HE21 . GLN A 1 74 ? 10.284  1.829   8.028   1.00 0.00 ? 865 GLN A HE21 1  
ATOM 733  H HE22 . GLN A 1 74 ? 11.279  2.754   9.045   1.00 0.00 ? 865 GLN A HE22 1  
ATOM 734  N N    . ARG A 1 75 ? 5.047   2.015   6.946   1.00 0.00 ? 866 ARG A N    1  
ATOM 735  C CA   . ARG A 1 75 ? 3.954   1.195   7.441   1.00 0.00 ? 866 ARG A CA   1  
ATOM 736  C C    . ARG A 1 75 ? 3.378   0.359   6.312   1.00 0.00 ? 866 ARG A C    1  
ATOM 737  O O    . ARG A 1 75 ? 3.218   -0.847  6.450   1.00 0.00 ? 866 ARG A O    1  
ATOM 738  C CB   . ARG A 1 75 ? 2.859   2.071   8.057   1.00 0.00 ? 866 ARG A CB   1  
ATOM 739  C CG   . ARG A 1 75 ? 3.280   2.498   9.467   1.00 0.00 ? 866 ARG A CG   1  
ATOM 740  C CD   . ARG A 1 75 ? 2.411   3.668   9.939   1.00 0.00 ? 866 ARG A CD   1  
ATOM 741  N NE   . ARG A 1 75 ? 1.052   3.217   10.236  1.00 0.00 ? 866 ARG A NE   1  
ATOM 742  C CZ   . ARG A 1 75 ? 0.172   4.022   10.834  1.00 0.00 ? 866 ARG A CZ   1  
ATOM 743  N NH1  . ARG A 1 75 ? 0.514   5.241   11.146  1.00 0.00 ? 866 ARG A NH1  1  
ATOM 744  N NH2  . ARG A 1 75 ? -1.023  3.595   11.101  1.00 0.00 ? 866 ARG A NH2  1  
ATOM 745  H H    . ARG A 1 75 ? 4.994   2.993   7.025   1.00 0.00 ? 866 ARG A H    1  
ATOM 746  H HA   . ARG A 1 75 ? 4.337   0.530   8.201   1.00 0.00 ? 866 ARG A HA   1  
ATOM 747  N N    . ILE A 1 76 ? 3.105   0.996   5.183   1.00 0.00 ? 867 ILE A N    1  
ATOM 748  C CA   . ILE A 1 76 ? 2.589   0.283   4.026   1.00 0.00 ? 867 ILE A CA   1  
ATOM 749  C C    . ILE A 1 76 ? 3.586   -0.789  3.600   1.00 0.00 ? 867 ILE A C    1  
ATOM 750  O O    . ILE A 1 76 ? 3.214   -1.942  3.361   1.00 0.00 ? 867 ILE A O    1  
ATOM 751  C CB   . ILE A 1 76 ? 2.318   1.257   2.867   1.00 0.00 ? 867 ILE A CB   1  
ATOM 752  C CG1  . ILE A 1 76 ? 1.245   2.279   3.293   1.00 0.00 ? 867 ILE A CG1  1  
ATOM 753  C CG2  . ILE A 1 76 ? 1.825   0.480   1.636   1.00 0.00 ? 867 ILE A CG2  1  
ATOM 754  C CD1  . ILE A 1 76 ? -0.154  1.684   3.091   1.00 0.00 ? 867 ILE A CD1  1  
ATOM 755  H H    . ILE A 1 76 ? 3.281   1.961   5.119   1.00 0.00 ? 867 ILE A H    1  
ATOM 756  H HA   . ILE A 1 76 ? 1.663   -0.198  4.303   1.00 0.00 ? 867 ILE A HA   1  
ATOM 757  H HB   . ILE A 1 76 ? 3.235   1.774   2.618   1.00 0.00 ? 867 ILE A HB   1  
ATOM 758  H HG12 . ILE A 1 76 ? 1.377   2.530   4.335   1.00 0.00 ? 867 ILE A HG12 1  
ATOM 759  H HG21 . ILE A 1 76 ? 1.459   1.177   0.896   1.00 0.00 ? 867 ILE A HG21 1  
ATOM 760  H HG22 . ILE A 1 76 ? 1.026   -0.185  1.928   1.00 0.00 ? 867 ILE A HG22 1  
ATOM 761  H HG23 . ILE A 1 76 ? 2.637   -0.095  1.219   1.00 0.00 ? 867 ILE A HG23 1  
ATOM 762  H HD11 . ILE A 1 76 ? -0.463  1.831   2.067   1.00 0.00 ? 867 ILE A HD11 1  
ATOM 763  H HD12 . ILE A 1 76 ? -0.852  2.176   3.752   1.00 0.00 ? 867 ILE A HD12 1  
ATOM 764  H HD13 . ILE A 1 76 ? -0.136  0.627   3.312   1.00 0.00 ? 867 ILE A HD13 1  
ATOM 765  N N    . LEU A 1 77 ? 4.861   -0.419  3.558   1.00 0.00 ? 868 LEU A N    1  
ATOM 766  C CA   . LEU A 1 77 ? 5.904   -1.372  3.218   1.00 0.00 ? 868 LEU A CA   1  
ATOM 767  C C    . LEU A 1 77 ? 5.836   -2.548  4.177   1.00 0.00 ? 868 LEU A C    1  
ATOM 768  O O    . LEU A 1 77 ? 5.819   -3.706  3.766   1.00 0.00 ? 868 LEU A O    1  
ATOM 769  C CB   . LEU A 1 77 ? 7.287   -0.706  3.291   1.00 0.00 ? 868 LEU A CB   1  
ATOM 770  C CG   . LEU A 1 77 ? 8.291   -1.490  2.430   1.00 0.00 ? 868 LEU A CG   1  
ATOM 771  C CD1  . LEU A 1 77 ? 7.951   -1.326  0.945   1.00 0.00 ? 868 LEU A CD1  1  
ATOM 772  C CD2  . LEU A 1 77 ? 9.704   -0.962  2.686   1.00 0.00 ? 868 LEU A CD2  1  
ATOM 773  H H    . LEU A 1 77 ? 5.103   0.503   3.793   1.00 0.00 ? 868 LEU A H    1  
ATOM 774  H HA   . LEU A 1 77 ? 5.735   -1.729  2.216   1.00 0.00 ? 868 LEU A HA   1  
ATOM 775  H HB2  . LEU A 1 77 ? 7.213   0.310   2.932   1.00 0.00 ? 868 LEU A HB2  1  
ATOM 776  H HB3  . LEU A 1 77 ? 7.625   -0.698  4.317   1.00 0.00 ? 868 LEU A HB3  1  
ATOM 777  H HG   . LEU A 1 77 ? 8.243   -2.538  2.690   1.00 0.00 ? 868 LEU A HG   1  
ATOM 778  H HD11 . LEU A 1 77 ? 7.638   -0.310  0.754   1.00 0.00 ? 868 LEU A HD11 1  
ATOM 779  H HD12 . LEU A 1 77 ? 7.156   -2.004  0.679   1.00 0.00 ? 868 LEU A HD12 1  
ATOM 780  H HD13 . LEU A 1 77 ? 8.826   -1.549  0.350   1.00 0.00 ? 868 LEU A HD13 1  
ATOM 781  H HD21 . LEU A 1 77 ? 9.837   -0.021  2.172   1.00 0.00 ? 868 LEU A HD21 1  
ATOM 782  H HD22 . LEU A 1 77 ? 10.427  -1.676  2.319   1.00 0.00 ? 868 LEU A HD22 1  
ATOM 783  H HD23 . LEU A 1 77 ? 9.852   -0.816  3.745   1.00 0.00 ? 868 LEU A HD23 1  
ATOM 784  N N    . GLN A 1 78 ? 5.730   -2.239  5.453   1.00 0.00 ? 869 GLN A N    1  
ATOM 785  C CA   . GLN A 1 78 ? 5.591   -3.271  6.463   1.00 0.00 ? 869 GLN A CA   1  
ATOM 786  C C    . GLN A 1 78 ? 4.255   -3.974  6.293   1.00 0.00 ? 869 GLN A C    1  
ATOM 787  O O    . GLN A 1 78 ? 4.135   -5.180  6.517   1.00 0.00 ? 869 GLN A O    1  
ATOM 788  C CB   . GLN A 1 78 ? 5.685   -2.660  7.865   1.00 0.00 ? 869 GLN A CB   1  
ATOM 789  C CG   . GLN A 1 78 ? 7.128   -2.213  8.136   1.00 0.00 ? 869 GLN A CG   1  
ATOM 790  C CD   . GLN A 1 78 ? 7.829   -3.241  9.013   1.00 0.00 ? 869 GLN A CD   1  
ATOM 791  O OE1  . GLN A 1 78 ? 8.231   -2.931  10.133  1.00 0.00 ? 869 GLN A OE1  1  
ATOM 792  N NE2  . GLN A 1 78 ? 8.003   -4.451  8.570   1.00 0.00 ? 869 GLN A NE2  1  
ATOM 793  H H    . GLN A 1 78 ? 5.704   -1.292  5.715   1.00 0.00 ? 869 GLN A H    1  
ATOM 794  H HA   . GLN A 1 78 ? 6.382   -3.992  6.341   1.00 0.00 ? 869 GLN A HA   1  
ATOM 795  H HB2  . GLN A 1 78 ? 5.022   -1.810  7.931   1.00 0.00 ? 869 GLN A HB2  1  
ATOM 796  H HB3  . GLN A 1 78 ? 5.396   -3.398  8.599   1.00 0.00 ? 869 GLN A HB3  1  
ATOM 797  H HG2  . GLN A 1 78 ? 7.661   -2.111  7.202   1.00 0.00 ? 869 GLN A HG2  1  
ATOM 798  H HG3  . GLN A 1 78 ? 7.117   -1.260  8.645   1.00 0.00 ? 869 GLN A HG3  1  
ATOM 799  H HE21 . GLN A 1 78 ? 7.686   -4.702  7.672   1.00 0.00 ? 869 GLN A HE21 1  
ATOM 800  H HE22 . GLN A 1 78 ? 8.444   -5.122  9.136   1.00 0.00 ? 869 GLN A HE22 1  
ATOM 801  N N    . ALA A 1 79 ? 3.256   -3.211  5.879   1.00 0.00 ? 870 ALA A N    1  
ATOM 802  C CA   . ALA A 1 79 ? 1.926   -3.745  5.671   1.00 0.00 ? 870 ALA A CA   1  
ATOM 803  C C    . ALA A 1 79 ? 1.955   -4.857  4.643   1.00 0.00 ? 870 ALA A C    1  
ATOM 804  O O    . ALA A 1 79 ? 1.394   -5.930  4.872   1.00 0.00 ? 870 ALA A O    1  
ATOM 805  C CB   . ALA A 1 79 ? 0.967   -2.642  5.220   1.00 0.00 ? 870 ALA A CB   1  
ATOM 806  H H    . ALA A 1 79 ? 3.422   -2.258  5.713   1.00 0.00 ? 870 ALA A H    1  
ATOM 807  H HA   . ALA A 1 79 ? 1.568   -4.148  6.606   1.00 0.00 ? 870 ALA A HA   1  
ATOM 808  H HB1  . ALA A 1 79 ? -0.051  -2.991  5.306   1.00 0.00 ? 870 ALA A HB1  1  
ATOM 809  H HB2  . ALA A 1 79 ? 1.169   -2.380  4.193   1.00 0.00 ? 870 ALA A HB2  1  
ATOM 810  H HB3  . ALA A 1 79 ? 1.100   -1.771  5.844   1.00 0.00 ? 870 ALA A HB3  1  
ATOM 811  N N    . ILE A 1 80 ? 2.618   -4.618  3.510   1.00 0.00 ? 871 ILE A N    1  
ATOM 812  C CA   . ILE A 1 80 ? 2.707   -5.650  2.496   1.00 0.00 ? 871 ILE A CA   1  
ATOM 813  C C    . ILE A 1 80 ? 3.560   -6.799  3.010   1.00 0.00 ? 871 ILE A C    1  
ATOM 814  O O    . ILE A 1 80 ? 3.248   -7.971  2.785   1.00 0.00 ? 871 ILE A O    1  
ATOM 815  C CB   . ILE A 1 80 ? 3.265   -5.113  1.168   1.00 0.00 ? 871 ILE A CB   1  
ATOM 816  C CG1  . ILE A 1 80 ? 4.566   -4.350  1.384   1.00 0.00 ? 871 ILE A CG1  1  
ATOM 817  C CG2  . ILE A 1 80 ? 2.250   -4.187  0.502   1.00 0.00 ? 871 ILE A CG2  1  
ATOM 818  C CD1  . ILE A 1 80 ? 5.237   -4.118  0.025   1.00 0.00 ? 871 ILE A CD1  1  
ATOM 819  H H    . ILE A 1 80 ? 3.058   -3.751  3.367   1.00 0.00 ? 871 ILE A H    1  
ATOM 820  H HA   . ILE A 1 80 ? 1.706   -6.022  2.320   1.00 0.00 ? 871 ILE A HA   1  
ATOM 821  H HB   . ILE A 1 80 ? 3.448   -5.954  0.525   1.00 0.00 ? 871 ILE A HB   1  
ATOM 822  H HG12 . ILE A 1 80 ? 4.350   -3.401  1.850   1.00 0.00 ? 871 ILE A HG12 1  
ATOM 823  H HG21 . ILE A 1 80 ? 2.225   -3.246  1.030   1.00 0.00 ? 871 ILE A HG21 1  
ATOM 824  H HG22 . ILE A 1 80 ? 1.272   -4.643  0.521   1.00 0.00 ? 871 ILE A HG22 1  
ATOM 825  H HG23 . ILE A 1 80 ? 2.545   -4.013  -0.523  1.00 0.00 ? 871 ILE A HG23 1  
ATOM 826  H HD11 . ILE A 1 80 ? 6.305   -4.040  0.159   1.00 0.00 ? 871 ILE A HD11 1  
ATOM 827  H HD12 . ILE A 1 80 ? 4.859   -3.204  -0.409  1.00 0.00 ? 871 ILE A HD12 1  
ATOM 828  H HD13 . ILE A 1 80 ? 5.016   -4.944  -0.638  1.00 0.00 ? 871 ILE A HD13 1  
ATOM 829  N N    . GLN A 1 81 ? 4.616   -6.459  3.747   1.00 0.00 ? 872 GLN A N    1  
ATOM 830  C CA   . GLN A 1 81 ? 5.481   -7.468  4.340   1.00 0.00 ? 872 GLN A CA   1  
ATOM 831  C C    . GLN A 1 81 ? 4.675   -8.350  5.277   1.00 0.00 ? 872 GLN A C    1  
ATOM 832  O O    . GLN A 1 81 ? 4.953   -9.541  5.423   1.00 0.00 ? 872 GLN A O    1  
ATOM 833  C CB   . GLN A 1 81 ? 6.626   -6.807  5.111   1.00 0.00 ? 872 GLN A CB   1  
ATOM 834  C CG   . GLN A 1 81 ? 7.549   -6.078  4.131   1.00 0.00 ? 872 GLN A CG   1  
ATOM 835  C CD   . GLN A 1 81 ? 8.369   -5.021  4.864   1.00 0.00 ? 872 GLN A CD   1  
ATOM 836  O OE1  . GLN A 1 81 ? 8.360   -4.963  6.099   1.00 0.00 ? 872 GLN A OE1  1  
ATOM 837  N NE2  . GLN A 1 81 ? 9.079   -4.181  4.180   1.00 0.00 ? 872 GLN A NE2  1  
ATOM 838  H H    . GLN A 1 81 ? 4.795   -5.508  3.918   1.00 0.00 ? 872 GLN A H    1  
ATOM 839  H HA   . GLN A 1 81 ? 5.897   -8.081  3.555   1.00 0.00 ? 872 GLN A HA   1  
ATOM 840  H HB2  . GLN A 1 81 ? 6.221   -6.104  5.823   1.00 0.00 ? 872 GLN A HB2  1  
ATOM 841  H HB3  . GLN A 1 81 ? 7.191   -7.562  5.637   1.00 0.00 ? 872 GLN A HB3  1  
ATOM 842  H HG2  . GLN A 1 81 ? 8.214   -6.792  3.668   1.00 0.00 ? 872 GLN A HG2  1  
ATOM 843  H HG3  . GLN A 1 81 ? 6.958   -5.600  3.364   1.00 0.00 ? 872 GLN A HG3  1  
ATOM 844  H HE21 . GLN A 1 81 ? 9.088   -4.230  3.202   1.00 0.00 ? 872 GLN A HE21 1  
ATOM 845  H HE22 . GLN A 1 81 ? 9.609   -3.498  4.641   1.00 0.00 ? 872 GLN A HE22 1  
ATOM 846  N N    . LEU A 1 82 ? 3.671   -7.763  5.906   1.00 0.00 ? 873 LEU A N    1  
ATOM 847  C CA   . LEU A 1 82 ? 2.812   -8.501  6.816   1.00 0.00 ? 873 LEU A CA   1  
ATOM 848  C C    . LEU A 1 82 ? 2.016   -9.551  6.049   1.00 0.00 ? 873 LEU A C    1  
ATOM 849  O O    . LEU A 1 82 ? 1.670   -10.601 6.593   1.00 0.00 ? 873 LEU A O    1  
ATOM 850  C CB   . LEU A 1 82 ? 1.852   -7.543  7.545   1.00 0.00 ? 873 LEU A CB   1  
ATOM 851  C CG   . LEU A 1 82 ? 2.187   -7.490  9.048   1.00 0.00 ? 873 LEU A CG   1  
ATOM 852  C CD1  . LEU A 1 82 ? 1.821   -8.820  9.711   1.00 0.00 ? 873 LEU A CD1  1  
ATOM 853  C CD2  . LEU A 1 82 ? 3.685   -7.215  9.245   1.00 0.00 ? 873 LEU A CD2  1  
ATOM 854  H H    . LEU A 1 82 ? 3.500   -6.808  5.750   1.00 0.00 ? 873 LEU A H    1  
ATOM 855  H HA   . LEU A 1 82 ? 3.429   -9.003  7.546   1.00 0.00 ? 873 LEU A HA   1  
ATOM 856  H HB2  . LEU A 1 82 ? 1.946   -6.553  7.123   1.00 0.00 ? 873 LEU A HB2  1  
ATOM 857  H HB3  . LEU A 1 82 ? 0.837   -7.886  7.418   1.00 0.00 ? 873 LEU A HB3  1  
ATOM 858  H HG   . LEU A 1 82 ? 1.611   -6.699  9.509   1.00 0.00 ? 873 LEU A HG   1  
ATOM 859  H HD11 . LEU A 1 82 ? 1.982   -8.743  10.777  1.00 0.00 ? 873 LEU A HD11 1  
ATOM 860  H HD12 . LEU A 1 82 ? 2.440   -9.610  9.313   1.00 0.00 ? 873 LEU A HD12 1  
ATOM 861  H HD13 . LEU A 1 82 ? 0.781   -9.046  9.523   1.00 0.00 ? 873 LEU A HD13 1  
ATOM 862  H HD21 . LEU A 1 82 ? 4.221   -8.150  9.318   1.00 0.00 ? 873 LEU A HD21 1  
ATOM 863  H HD22 . LEU A 1 82 ? 3.828   -6.652  10.156  1.00 0.00 ? 873 LEU A HD22 1  
ATOM 864  H HD23 . LEU A 1 82 ? 4.066   -6.646  8.410   1.00 0.00 ? 873 LEU A HD23 1  
ATOM 865  N N    . LEU A 1 83 ? 1.737   -9.268  4.782   1.00 0.00 ? 874 LEU A N    1  
ATOM 866  C CA   . LEU A 1 83 ? 0.990   -10.201 3.946   1.00 0.00 ? 874 LEU A CA   1  
ATOM 867  C C    . LEU A 1 83 ? 1.847   -11.418 3.607   1.00 0.00 ? 874 LEU A C    1  
ATOM 868  O O    . LEU A 1 83 ? 2.959   -11.275 3.099   1.00 0.00 ? 874 LEU A O    1  
ATOM 869  C CB   . LEU A 1 83 ? 0.534   -9.514  2.651   1.00 0.00 ? 874 LEU A CB   1  
ATOM 870  C CG   . LEU A 1 83 ? -0.281  -8.256  2.988   1.00 0.00 ? 874 LEU A CG   1  
ATOM 871  C CD1  . LEU A 1 83 ? -0.585  -7.482  1.705   1.00 0.00 ? 874 LEU A CD1  1  
ATOM 872  C CD2  . LEU A 1 83 ? -1.599  -8.659  3.660   1.00 0.00 ? 874 LEU A CD2  1  
ATOM 873  H H    . LEU A 1 83 ? 2.051   -8.424  4.397   1.00 0.00 ? 874 LEU A H    1  
ATOM 874  H HA   . LEU A 1 83 ? 0.116   -10.522 4.491   1.00 0.00 ? 874 LEU A HA   1  
ATOM 875  H HB2  . LEU A 1 83 ? 1.404   -9.243  2.070   1.00 0.00 ? 874 LEU A HB2  1  
ATOM 876  H HB3  . LEU A 1 83 ? -0.078  -10.197 2.080   1.00 0.00 ? 874 LEU A HB3  1  
ATOM 877  H HG   . LEU A 1 83 ? 0.290   -7.625  3.654   1.00 0.00 ? 874 LEU A HG   1  
ATOM 878  H HD11 . LEU A 1 83 ? 0.292   -7.452  1.077   1.00 0.00 ? 874 LEU A HD11 1  
ATOM 879  H HD12 . LEU A 1 83 ? -0.881  -6.475  1.956   1.00 0.00 ? 874 LEU A HD12 1  
ATOM 880  H HD13 . LEU A 1 83 ? -1.390  -7.968  1.176   1.00 0.00 ? 874 LEU A HD13 1  
ATOM 881  H HD21 . LEU A 1 83 ? -2.304  -7.844  3.582   1.00 0.00 ? 874 LEU A HD21 1  
ATOM 882  H HD22 . LEU A 1 83 ? -1.422  -8.880  4.702   1.00 0.00 ? 874 LEU A HD22 1  
ATOM 883  H HD23 . LEU A 1 83 ? -2.005  -9.531  3.171   1.00 0.00 ? 874 LEU A HD23 1  
ATOM 884  N N    . PRO A 1 84 ? 1.357   -12.605 3.889   1.00 0.00 ? 875 PRO A N    1  
ATOM 885  C CA   . PRO A 1 84 ? 2.097   -13.874 3.613   1.00 0.00 ? 875 PRO A CA   1  
ATOM 886  C C    . PRO A 1 84 ? 2.773   -13.859 2.242   1.00 0.00 ? 875 PRO A C    1  
ATOM 887  O O    . PRO A 1 84 ? 2.234   -13.299 1.285   1.00 0.00 ? 875 PRO A O    1  
ATOM 888  C CB   . PRO A 1 84 ? 0.996   -14.931 3.661   1.00 0.00 ? 875 PRO A CB   1  
ATOM 889  C CG   . PRO A 1 84 ? -0.009  -14.393 4.625   1.00 0.00 ? 875 PRO A CG   1  
ATOM 890  C CD   . PRO A 1 84 ? 0.040   -12.866 4.502   1.00 0.00 ? 875 PRO A CD   1  
ATOM 891  H HA   . PRO A 1 84 ? 2.812   -14.079 4.392   1.00 0.00 ? 875 PRO A HA   1  
ATOM 892  H HB2  . PRO A 1 84 ? 0.557   -15.058 2.680   1.00 0.00 ? 875 PRO A HB2  1  
ATOM 893  H HB3  . PRO A 1 84 ? 1.384   -15.869 4.023   1.00 0.00 ? 875 PRO A HB3  1  
ATOM 894  H HG2  . PRO A 1 84 ? -0.995  -14.761 4.376   1.00 0.00 ? 875 PRO A HG2  1  
ATOM 895  H HG3  . PRO A 1 84 ? 0.251   -14.679 5.632   1.00 0.00 ? 875 PRO A HG3  1  
ATOM 896  H HD2  . PRO A 1 84 ? -0.762  -12.513 3.867   1.00 0.00 ? 875 PRO A HD2  1  
ATOM 897  H HD3  . PRO A 1 84 ? -0.012  -12.405 5.477   1.00 0.00 ? 875 PRO A HD3  1  
ATOM 898  N N    . LYS A 1 85 ? 3.937   -14.493 2.148   1.00 0.00 ? 876 LYS A N    1  
ATOM 899  C CA   . LYS A 1 85 ? 4.671   -14.563 0.886   1.00 0.00 ? 876 LYS A CA   1  
ATOM 900  C C    . LYS A 1 85 ? 4.201   -15.750 0.053   1.00 0.00 ? 876 LYS A C    1  
ATOM 901  O O    . LYS A 1 85 ? 3.580   -16.629 0.610   1.00 0.00 ? 876 LYS A O    1  
ATOM 902  C CB   . LYS A 1 85 ? 6.176   -14.683 1.151   1.00 0.00 ? 876 LYS A CB   1  
ATOM 903  C CG   . LYS A 1 85 ? 6.628   -13.548 2.078   1.00 0.00 ? 876 LYS A CG   1  
ATOM 904  C CD   . LYS A 1 85 ? 8.142   -13.643 2.310   1.00 0.00 ? 876 LYS A CD   1  
ATOM 905  C CE   . LYS A 1 85 ? 8.544   -12.733 3.480   1.00 0.00 ? 876 LYS A CE   1  
ATOM 906  N NZ   . LYS A 1 85 ? 8.014   -11.358 3.254   1.00 0.00 ? 876 LYS A NZ   1  
ATOM 907  H H    . LYS A 1 85 ? 4.303   -14.935 2.942   1.00 0.00 ? 876 LYS A H    1  
ATOM 908  H HA   . LYS A 1 85 ? 4.492   -13.652 0.330   1.00 0.00 ? 876 LYS A HA   1  
ATOM 909  N N    . GLN A 1 23 ? -10.863 -8.080  3.487   1.00 0.00 ? 814 GLN A N    2  
ATOM 910  C CA   . GLN A 1 23 ? -9.834  -8.540  2.521   1.00 0.00 ? 814 GLN A CA   2  
ATOM 911  C C    . GLN A 1 23 ? -9.501  -7.421  1.528   1.00 0.00 ? 814 GLN A C    2  
ATOM 912  O O    . GLN A 1 23 ? -8.444  -7.447  0.891   1.00 0.00 ? 814 GLN A O    2  
ATOM 913  C CB   . GLN A 1 23 ? -10.331 -9.790  1.768   1.00 0.00 ? 814 GLN A CB   2  
ATOM 914  C CG   . GLN A 1 23 ? -11.689 -9.514  1.095   1.00 0.00 ? 814 GLN A CG   2  
ATOM 915  C CD   . GLN A 1 23 ? -12.819 -9.926  2.024   1.00 0.00 ? 814 GLN A CD   2  
ATOM 916  O OE1  . GLN A 1 23 ? -12.891 -9.444  3.152   1.00 0.00 ? 814 GLN A OE1  2  
ATOM 917  N NE2  . GLN A 1 23 ? -13.703 -10.788 1.625   1.00 0.00 ? 814 GLN A NE2  2  
ATOM 918  H HA   . GLN A 1 23 ? -8.939  -8.795  3.069   1.00 0.00 ? 814 GLN A HA   2  
ATOM 919  H HB2  . GLN A 1 23 ? -9.605  -10.057 1.015   1.00 0.00 ? 814 GLN A HB2  2  
ATOM 920  H HB3  . GLN A 1 23 ? -10.437 -10.609 2.464   1.00 0.00 ? 814 GLN A HB3  2  
ATOM 921  H HG2  . GLN A 1 23 ? -11.779 -8.463  0.867   1.00 0.00 ? 814 GLN A HG2  2  
ATOM 922  H HG3  . GLN A 1 23 ? -11.755 -10.084 0.180   1.00 0.00 ? 814 GLN A HG3  2  
ATOM 923  H HE21 . GLN A 1 23 ? -13.643 -11.177 0.726   1.00 0.00 ? 814 GLN A HE21 2  
ATOM 924  H HE22 . GLN A 1 23 ? -14.434 -11.052 2.222   1.00 0.00 ? 814 GLN A HE22 2  
ATOM 925  N N    . THR A 1 24 ? -10.405 -6.457  1.376   1.00 0.00 ? 815 THR A N    2  
ATOM 926  C CA   . THR A 1 24 ? -10.191 -5.367  0.430   1.00 0.00 ? 815 THR A CA   2  
ATOM 927  C C    . THR A 1 24 ? -9.240  -4.325  1.006   1.00 0.00 ? 815 THR A C    2  
ATOM 928  O O    . THR A 1 24 ? -9.004  -4.276  2.218   1.00 0.00 ? 815 THR A O    2  
ATOM 929  C CB   . THR A 1 24 ? -11.535 -4.711  0.068   1.00 0.00 ? 815 THR A CB   2  
ATOM 930  O OG1  . THR A 1 24 ? -12.600 -5.600  0.399   1.00 0.00 ? 815 THR A OG1  2  
ATOM 931  C CG2  . THR A 1 24 ? -11.577 -4.400  -1.432  1.00 0.00 ? 815 THR A CG2  2  
ATOM 932  H H    . THR A 1 24 ? -11.242 -6.483  1.883   1.00 0.00 ? 815 THR A H    2  
ATOM 933  H HA   . THR A 1 24 ? -9.751  -5.771  -0.468  1.00 0.00 ? 815 THR A HA   2  
ATOM 934  H HB   . THR A 1 24 ? -11.646 -3.790  0.619   1.00 0.00 ? 815 THR A HB   2  
ATOM 935  H HG21 . THR A 1 24 ? -11.158 -5.225  -1.991  1.00 0.00 ? 815 THR A HG21 2  
ATOM 936  H HG22 . THR A 1 24 ? -11.006 -3.506  -1.633  1.00 0.00 ? 815 THR A HG22 2  
ATOM 937  H HG23 . THR A 1 24 ? -12.601 -4.243  -1.740  1.00 0.00 ? 815 THR A HG23 2  
ATOM 938  N N    . VAL A 1 25 ? -8.690  -3.498  0.130   1.00 0.00 ? 816 VAL A N    2  
ATOM 939  C CA   . VAL A 1 25 ? -7.767  -2.462  0.541   1.00 0.00 ? 816 VAL A CA   2  
ATOM 940  C C    . VAL A 1 25 ? -8.469  -1.453  1.444   1.00 0.00 ? 816 VAL A C    2  
ATOM 941  O O    . VAL A 1 25 ? -8.766  -0.335  1.034   1.00 0.00 ? 816 VAL A O    2  
ATOM 942  C CB   . VAL A 1 25 ? -7.186  -1.753  -0.691  1.00 0.00 ? 816 VAL A CB   2  
ATOM 943  C CG1  . VAL A 1 25 ? -6.077  -2.612  -1.307  1.00 0.00 ? 816 VAL A CG1  2  
ATOM 944  C CG2  . VAL A 1 25 ? -8.292  -1.530  -1.735  1.00 0.00 ? 816 VAL A CG2  2  
ATOM 945  H H    . VAL A 1 25 ? -8.907  -3.588  -0.821  1.00 0.00 ? 816 VAL A H    2  
ATOM 946  H HA   . VAL A 1 25 ? -6.956  -2.917  1.091   1.00 0.00 ? 816 VAL A HA   2  
ATOM 947  H HB   . VAL A 1 25 ? -6.778  -0.803  -0.382  1.00 0.00 ? 816 VAL A HB   2  
ATOM 948  H HG11 . VAL A 1 25 ? -5.824  -2.229  -2.286  1.00 0.00 ? 816 VAL A HG11 2  
ATOM 949  H HG12 . VAL A 1 25 ? -6.418  -3.633  -1.401  1.00 0.00 ? 816 VAL A HG12 2  
ATOM 950  H HG13 . VAL A 1 25 ? -5.202  -2.582  -0.675  1.00 0.00 ? 816 VAL A HG13 2  
ATOM 951  H HG21 . VAL A 1 25 ? -8.471  -2.448  -2.275  1.00 0.00 ? 816 VAL A HG21 2  
ATOM 952  H HG22 . VAL A 1 25 ? -7.979  -0.763  -2.428  1.00 0.00 ? 816 VAL A HG22 2  
ATOM 953  H HG23 . VAL A 1 25 ? -9.201  -1.217  -1.243  1.00 0.00 ? 816 VAL A HG23 2  
ATOM 954  N N    . GLY A 1 26 ? -8.751  -1.862  2.662   1.00 0.00 ? 817 GLY A N    2  
ATOM 955  C CA   . GLY A 1 26 ? -9.429  -0.999  3.623   1.00 0.00 ? 817 GLY A CA   2  
ATOM 956  C C    . GLY A 1 26 ? -9.156  -1.464  5.035   1.00 0.00 ? 817 GLY A C    2  
ATOM 957  O O    . GLY A 1 26 ? -8.295  -0.912  5.717   1.00 0.00 ? 817 GLY A O    2  
ATOM 958  H H    . GLY A 1 26 ? -8.510  -2.780  2.917   1.00 0.00 ? 817 GLY A H    2  
ATOM 959  H HA2  . GLY A 1 26 ? -9.068  0.013   3.507   1.00 0.00 ? 817 GLY A HA2  2  
ATOM 960  H HA3  . GLY A 1 26 ? -10.490 -1.016  3.445   1.00 0.00 ? 817 GLY A HA3  2  
ATOM 961  N N    . GLN A 1 27 ? -9.849  -2.520  5.459   1.00 0.00 ? 818 GLN A N    2  
ATOM 962  C CA   . GLN A 1 27 ? -9.630  -3.064  6.789   1.00 0.00 ? 818 GLN A CA   2  
ATOM 963  C C    . GLN A 1 27 ? -8.151  -3.305  6.983   1.00 0.00 ? 818 GLN A C    2  
ATOM 964  O O    . GLN A 1 27 ? -7.579  -2.941  8.008   1.00 0.00 ? 818 GLN A O    2  
ATOM 965  C CB   . GLN A 1 27 ? -10.408 -4.376  6.977   1.00 0.00 ? 818 GLN A CB   2  
ATOM 966  C CG   . GLN A 1 27 ? -10.988 -4.436  8.394   1.00 0.00 ? 818 GLN A CG   2  
ATOM 967  C CD   . GLN A 1 27 ? -12.348 -3.744  8.441   1.00 0.00 ? 818 GLN A CD   2  
ATOM 968  O OE1  . GLN A 1 27 ? -13.162 -4.037  9.312   1.00 0.00 ? 818 GLN A OE1  2  
ATOM 969  N NE2  . GLN A 1 27 ? -12.644 -2.843  7.555   1.00 0.00 ? 818 GLN A NE2  2  
ATOM 970  H H    . GLN A 1 27 ? -10.495 -2.949  4.858   1.00 0.00 ? 818 GLN A H    2  
ATOM 971  H HA   . GLN A 1 27 ? -9.967  -2.344  7.519   1.00 0.00 ? 818 GLN A HA   2  
ATOM 972  H HB2  . GLN A 1 27 ? -11.214 -4.428  6.260   1.00 0.00 ? 818 GLN A HB2  2  
ATOM 973  H HB3  . GLN A 1 27 ? -9.745  -5.217  6.832   1.00 0.00 ? 818 GLN A HB3  2  
ATOM 974  H HG2  . GLN A 1 27 ? -11.105 -5.470  8.686   1.00 0.00 ? 818 GLN A HG2  2  
ATOM 975  H HG3  . GLN A 1 27 ? -10.315 -3.948  9.083   1.00 0.00 ? 818 GLN A HG3  2  
ATOM 976  H HE21 . GLN A 1 27 ? -11.997 -2.606  6.858   1.00 0.00 ? 818 GLN A HE21 2  
ATOM 977  H HE22 . GLN A 1 27 ? -13.517 -2.399  7.582   1.00 0.00 ? 818 GLN A HE22 2  
ATOM 978  N N    . TRP A 1 28 ? -7.525  -3.855  5.958   1.00 0.00 ? 819 TRP A N    2  
ATOM 979  C CA   . TRP A 1 28 ? -6.094  -4.075  5.978   1.00 0.00 ? 819 TRP A CA   2  
ATOM 980  C C    . TRP A 1 28 ? -5.382  -2.766  6.327   1.00 0.00 ? 819 TRP A C    2  
ATOM 981  O O    . TRP A 1 28 ? -4.681  -2.675  7.334   1.00 0.00 ? 819 TRP A O    2  
ATOM 982  C CB   . TRP A 1 28 ? -5.634  -4.589  4.606   1.00 0.00 ? 819 TRP A CB   2  
ATOM 983  C CG   . TRP A 1 28 ? -4.166  -4.855  4.627   1.00 0.00 ? 819 TRP A CG   2  
ATOM 984  C CD1  . TRP A 1 28 ? -3.570  -5.882  5.271   1.00 0.00 ? 819 TRP A CD1  2  
ATOM 985  C CD2  . TRP A 1 28 ? -3.107  -4.103  3.984   1.00 0.00 ? 819 TRP A CD2  2  
ATOM 986  N NE1  . TRP A 1 28 ? -2.206  -5.803  5.061   1.00 0.00 ? 819 TRP A NE1  2  
ATOM 987  C CE2  . TRP A 1 28 ? -1.873  -4.722  4.274   1.00 0.00 ? 819 TRP A CE2  2  
ATOM 988  C CE3  . TRP A 1 28 ? -3.098  -2.949  3.182   1.00 0.00 ? 819 TRP A CE3  2  
ATOM 989  C CZ2  . TRP A 1 28 ? -0.675  -4.218  3.788   1.00 0.00 ? 819 TRP A CZ2  2  
ATOM 990  C CZ3  . TRP A 1 28 ? -1.888  -2.437  2.690   1.00 0.00 ? 819 TRP A CZ3  2  
ATOM 991  C CH2  . TRP A 1 28 ? -0.680  -3.072  2.995   1.00 0.00 ? 819 TRP A CH2  2  
ATOM 992  H H    . TRP A 1 28 ? -8.033  -4.075  5.150   1.00 0.00 ? 819 TRP A H    2  
ATOM 993  H HA   . TRP A 1 28 ? -5.860  -4.816  6.729   1.00 0.00 ? 819 TRP A HA   2  
ATOM 994  H HB2  . TRP A 1 28 ? -6.157  -5.504  4.371   1.00 0.00 ? 819 TRP A HB2  2  
ATOM 995  H HB3  . TRP A 1 28 ? -5.853  -3.848  3.853   1.00 0.00 ? 819 TRP A HB3  2  
ATOM 996  H HD1  . TRP A 1 28 ? -4.074  -6.639  5.853   1.00 0.00 ? 819 TRP A HD1  2  
ATOM 997  N N    . LEU A 1 29 ? -5.637  -1.734  5.528   1.00 0.00 ? 820 LEU A N    2  
ATOM 998  C CA   . LEU A 1 29 ? -5.074  -0.408  5.780   1.00 0.00 ? 820 LEU A CA   2  
ATOM 999  C C    . LEU A 1 29 ? -5.423  0.045   7.189   1.00 0.00 ? 820 LEU A C    2  
ATOM 1000 O O    . LEU A 1 29 ? -4.549  0.452   7.969   1.00 0.00 ? 820 LEU A O    2  
ATOM 1001 C CB   . LEU A 1 29 ? -5.627  0.604   4.768   1.00 0.00 ? 820 LEU A CB   2  
ATOM 1002 C CG   . LEU A 1 29 ? -5.382  0.098   3.340   1.00 0.00 ? 820 LEU A CG   2  
ATOM 1003 C CD1  . LEU A 1 29 ? -6.218  0.915   2.357   1.00 0.00 ? 820 LEU A CD1  2  
ATOM 1004 C CD2  . LEU A 1 29 ? -3.899  0.247   2.995   1.00 0.00 ? 820 LEU A CD2  2  
ATOM 1005 H H    . LEU A 1 29 ? -6.255  -1.856  4.779   1.00 0.00 ? 820 LEU A H    2  
ATOM 1006 H HA   . LEU A 1 29 ? -4.000  -0.453  5.676   1.00 0.00 ? 820 LEU A HA   2  
ATOM 1007 H HB2  . LEU A 1 29 ? -6.687  0.732   4.933   1.00 0.00 ? 820 LEU A HB2  2  
ATOM 1008 H HB3  . LEU A 1 29 ? -5.128  1.553   4.903   1.00 0.00 ? 820 LEU A HB3  2  
ATOM 1009 H HG   . LEU A 1 29 ? -5.670  -0.940  3.269   1.00 0.00 ? 820 LEU A HG   2  
ATOM 1010 H HD11 . LEU A 1 29 ? -7.248  0.597   2.412   1.00 0.00 ? 820 LEU A HD11 2  
ATOM 1011 H HD12 . LEU A 1 29 ? -5.849  0.762   1.354   1.00 0.00 ? 820 LEU A HD12 2  
ATOM 1012 H HD13 . LEU A 1 29 ? -6.156  1.962   2.609   1.00 0.00 ? 820 LEU A HD13 2  
ATOM 1013 H HD21 . LEU A 1 29 ? -3.569  1.245   3.237   1.00 0.00 ? 820 LEU A HD21 2  
ATOM 1014 H HD22 . LEU A 1 29 ? -3.754  0.065   1.941   1.00 0.00 ? 820 LEU A HD22 2  
ATOM 1015 H HD23 . LEU A 1 29 ? -3.325  -0.465  3.565   1.00 0.00 ? 820 LEU A HD23 2  
ATOM 1016 N N    . GLU A 1 30 ? -6.700  -0.045  7.519   1.00 0.00 ? 821 GLU A N    2  
ATOM 1017 C CA   . GLU A 1 30 ? -7.170  0.333   8.835   1.00 0.00 ? 821 GLU A CA   2  
ATOM 1018 C C    . GLU A 1 30 ? -6.434  -0.472  9.907   1.00 0.00 ? 821 GLU A C    2  
ATOM 1019 O O    . GLU A 1 30 ? -6.196  0.019   11.012  1.00 0.00 ? 821 GLU A O    2  
ATOM 1020 C CB   . GLU A 1 30 ? -8.689  0.114   8.938   1.00 0.00 ? 821 GLU A CB   2  
ATOM 1021 C CG   . GLU A 1 30 ? -9.432  1.321   8.324   1.00 0.00 ? 821 GLU A CG   2  
ATOM 1022 C CD   . GLU A 1 30 ? -10.342 0.879   7.176   1.00 0.00 ? 821 GLU A CD   2  
ATOM 1023 O OE1  . GLU A 1 30 ? -11.041 -0.103  7.339   1.00 0.00 ? 821 GLU A OE1  2  
ATOM 1024 O OE2  . GLU A 1 30 ? -10.346 1.546   6.160   1.00 0.00 ? 821 GLU A OE2  2  
ATOM 1025 H H    . GLU A 1 30 ? -7.341  -0.387  6.858   1.00 0.00 ? 821 GLU A H    2  
ATOM 1026 H HA   . GLU A 1 30 ? -6.957  1.380   8.987   1.00 0.00 ? 821 GLU A HA   2  
ATOM 1027 N N    . SER A 1 31 ? -6.040  -1.691  9.558   1.00 0.00 ? 822 SER A N    2  
ATOM 1028 C CA   . SER A 1 31 ? -5.290  -2.535  10.478  1.00 0.00 ? 822 SER A CA   2  
ATOM 1029 C C    . SER A 1 31 ? -3.892  -1.967  10.684  1.00 0.00 ? 822 SER A C    2  
ATOM 1030 O O    . SER A 1 31 ? -3.463  -1.740  11.823  1.00 0.00 ? 822 SER A O    2  
ATOM 1031 C CB   . SER A 1 31 ? -5.208  -3.967  9.943   1.00 0.00 ? 822 SER A CB   2  
ATOM 1032 O OG   . SER A 1 31 ? -6.510  -4.386  9.521   1.00 0.00 ? 822 SER A OG   2  
ATOM 1033 H H    . SER A 1 31 ? -6.229  -2.015  8.651   1.00 0.00 ? 822 SER A H    2  
ATOM 1034 H HA   . SER A 1 31 ? -5.799  -2.548  11.430  1.00 0.00 ? 822 SER A HA   2  
ATOM 1035 H HB2  . SER A 1 31 ? -4.532  -4.009  9.106   1.00 0.00 ? 822 SER A HB2  2  
ATOM 1036 H HB3  . SER A 1 31 ? -4.837  -4.618  10.724  1.00 0.00 ? 822 SER A HB3  2  
ATOM 1037 H HG   . SER A 1 31 ? -6.827  -3.746  8.861   1.00 0.00 ? 822 SER A HG   2  
ATOM 1038 N N    . ILE A 1 32 ? -3.201  -1.686  9.585   1.00 0.00 ? 823 ILE A N    2  
ATOM 1039 C CA   . ILE A 1 32 ? -1.871  -1.088  9.675   1.00 0.00 ? 823 ILE A CA   2  
ATOM 1040 C C    . ILE A 1 32 ? -1.970  0.259   10.379  1.00 0.00 ? 823 ILE A C    2  
ATOM 1041 O O    . ILE A 1 32 ? -1.090  0.634   11.157  1.00 0.00 ? 823 ILE A O    2  
ATOM 1042 C CB   . ILE A 1 32 ? -1.219  -0.915  8.285   1.00 0.00 ? 823 ILE A CB   2  
ATOM 1043 C CG1  . ILE A 1 32 ? -2.040  -1.636  7.213   1.00 0.00 ? 823 ILE A CG1  2  
ATOM 1044 C CG2  . ILE A 1 32 ? 0.190   -1.503  8.303   1.00 0.00 ? 823 ILE A CG2  2  
ATOM 1045 C CD1  . ILE A 1 32 ? -1.305  -1.564  5.875   1.00 0.00 ? 823 ILE A CD1  2  
ATOM 1046 H H    . ILE A 1 32 ? -3.609  -1.852  8.708   1.00 0.00 ? 823 ILE A H    2  
ATOM 1047 H HA   . ILE A 1 32 ? -1.251  -1.739  10.276  1.00 0.00 ? 823 ILE A HA   2  
ATOM 1048 H HB   . ILE A 1 32 ? -1.157  0.137   8.050   1.00 0.00 ? 823 ILE A HB   2  
ATOM 1049 H HG12 . ILE A 1 32 ? -2.174  -2.672  7.491   1.00 0.00 ? 823 ILE A HG12 2  
ATOM 1050 H HG21 . ILE A 1 32 ? 0.124   -2.580  8.279   1.00 0.00 ? 823 ILE A HG21 2  
ATOM 1051 H HG22 . ILE A 1 32 ? 0.708   -1.192  9.198   1.00 0.00 ? 823 ILE A HG22 2  
ATOM 1052 H HG23 . ILE A 1 32 ? 0.730   -1.158  7.434   1.00 0.00 ? 823 ILE A HG23 2  
ATOM 1053 H HD11 . ILE A 1 32 ? -0.783  -2.493  5.706   1.00 0.00 ? 823 ILE A HD11 2  
ATOM 1054 H HD12 . ILE A 1 32 ? -0.596  -0.750  5.888   1.00 0.00 ? 823 ILE A HD12 2  
ATOM 1055 H HD13 . ILE A 1 32 ? -2.019  -1.406  5.082   1.00 0.00 ? 823 ILE A HD13 2  
ATOM 1056 N N    . GLY A 1 33 ? -3.075  0.960   10.143  1.00 0.00 ? 824 GLY A N    2  
ATOM 1057 C CA   . GLY A 1 33 ? -3.322  2.235   10.809  1.00 0.00 ? 824 GLY A CA   2  
ATOM 1058 C C    . GLY A 1 33 ? -3.245  3.421   9.854   1.00 0.00 ? 824 GLY A C    2  
ATOM 1059 O O    . GLY A 1 33 ? -2.888  4.528   10.267  1.00 0.00 ? 824 GLY A O    2  
ATOM 1060 H H    . GLY A 1 33 ? -3.757  0.591   9.537   1.00 0.00 ? 824 GLY A H    2  
ATOM 1061 H HA2  . GLY A 1 33 ? -4.307  2.209   11.253  1.00 0.00 ? 824 GLY A HA2  2  
ATOM 1062 H HA3  . GLY A 1 33 ? -2.592  2.371   11.594  1.00 0.00 ? 824 GLY A HA3  2  
ATOM 1063 N N    . LEU A 1 34 ? -3.617  3.218   8.594   1.00 0.00 ? 825 LEU A N    2  
ATOM 1064 C CA   . LEU A 1 34 ? -3.616  4.326   7.638   1.00 0.00 ? 825 LEU A CA   2  
ATOM 1065 C C    . LEU A 1 34 ? -4.749  4.215   6.619   1.00 0.00 ? 825 LEU A C    2  
ATOM 1066 O O    . LEU A 1 34 ? -4.560  3.728   5.509   1.00 0.00 ? 825 LEU A O    2  
ATOM 1067 C CB   . LEU A 1 34 ? -2.251  4.497   6.917   1.00 0.00 ? 825 LEU A CB   2  
ATOM 1068 C CG   . LEU A 1 34 ? -1.520  3.154   6.676   1.00 0.00 ? 825 LEU A CG   2  
ATOM 1069 C CD1  . LEU A 1 34 ? -0.955  2.620   7.981   1.00 0.00 ? 825 LEU A CD1  2  
ATOM 1070 C CD2  . LEU A 1 34 ? -2.461  2.124   6.051   1.00 0.00 ? 825 LEU A CD2  2  
ATOM 1071 H H    . LEU A 1 34 ? -3.928  2.329   8.312   1.00 0.00 ? 825 LEU A H    2  
ATOM 1072 H HA   . LEU A 1 34 ? -3.794  5.229   8.204   1.00 0.00 ? 825 LEU A HA   2  
ATOM 1073 H HB2  . LEU A 1 34 ? -2.417  4.981   5.968   1.00 0.00 ? 825 LEU A HB2  2  
ATOM 1074 H HB3  . LEU A 1 34 ? -1.629  5.133   7.526   1.00 0.00 ? 825 LEU A HB3  2  
ATOM 1075 H HG   . LEU A 1 34 ? -0.695  3.335   6.002   1.00 0.00 ? 825 LEU A HG   2  
ATOM 1076 H HD11 . LEU A 1 34 ? -0.072  2.037   7.769   1.00 0.00 ? 825 LEU A HD11 2  
ATOM 1077 H HD12 . LEU A 1 34 ? -1.690  2.000   8.467   1.00 0.00 ? 825 LEU A HD12 2  
ATOM 1078 H HD13 . LEU A 1 34 ? -0.693  3.448   8.620   1.00 0.00 ? 825 LEU A HD13 2  
ATOM 1079 H HD21 . LEU A 1 34 ? -2.740  2.457   5.064   1.00 0.00 ? 825 LEU A HD21 2  
ATOM 1080 H HD22 . LEU A 1 34 ? -3.342  2.006   6.659   1.00 0.00 ? 825 LEU A HD22 2  
ATOM 1081 H HD23 . LEU A 1 34 ? -1.948  1.177   5.975   1.00 0.00 ? 825 LEU A HD23 2  
ATOM 1082 N N    . PRO A 1 35 ? -5.906  4.711   6.959   1.00 0.00 ? 826 PRO A N    2  
ATOM 1083 C CA   . PRO A 1 35 ? -7.068  4.724   6.032   1.00 0.00 ? 826 PRO A CA   2  
ATOM 1084 C C    . PRO A 1 35 ? -6.806  5.659   4.852   1.00 0.00 ? 826 PRO A C    2  
ATOM 1085 O O    . PRO A 1 35 ? -5.846  6.440   4.868   1.00 0.00 ? 826 PRO A O    2  
ATOM 1086 C CB   . PRO A 1 35 ? -8.236  5.244   6.889   1.00 0.00 ? 826 PRO A CB   2  
ATOM 1087 C CG   . PRO A 1 35 ? -7.756  5.204   8.306   1.00 0.00 ? 826 PRO A CG   2  
ATOM 1088 C CD   . PRO A 1 35 ? -6.237  5.307   8.256   1.00 0.00 ? 826 PRO A CD   2  
ATOM 1089 H HA   . PRO A 1 35 ? -7.296  3.728   5.688   1.00 0.00 ? 826 PRO A HA   2  
ATOM 1090 H HB2  . PRO A 1 35 ? -8.488  6.257   6.604   1.00 0.00 ? 826 PRO A HB2  2  
ATOM 1091 H HB3  . PRO A 1 35 ? -9.095  4.601   6.776   1.00 0.00 ? 826 PRO A HB3  2  
ATOM 1092 H HG2  . PRO A 1 35 ? -8.173  6.036   8.859   1.00 0.00 ? 826 PRO A HG2  2  
ATOM 1093 H HG3  . PRO A 1 35 ? -8.037  4.270   8.768   1.00 0.00 ? 826 PRO A HG3  2  
ATOM 1094 H HD2  . PRO A 1 35 ? -5.926  6.342   8.298   1.00 0.00 ? 826 PRO A HD2  2  
ATOM 1095 H HD3  . PRO A 1 35 ? -5.787  4.735   9.054   1.00 0.00 ? 826 PRO A HD3  2  
ATOM 1096 N N    . GLN A 1 36 ? -7.662  5.587   3.845   1.00 0.00 ? 827 GLN A N    2  
ATOM 1097 C CA   . GLN A 1 36 ? -7.536  6.435   2.658   1.00 0.00 ? 827 GLN A CA   2  
ATOM 1098 C C    . GLN A 1 36 ? -6.346  6.010   1.800   1.00 0.00 ? 827 GLN A C    2  
ATOM 1099 O O    . GLN A 1 36 ? -5.799  6.808   1.038   1.00 0.00 ? 827 GLN A O    2  
ATOM 1100 C CB   . GLN A 1 36 ? -7.409  7.922   3.042   1.00 0.00 ? 827 GLN A CB   2  
ATOM 1101 C CG   . GLN A 1 36 ? -8.452  8.282   4.116   1.00 0.00 ? 827 GLN A CG   2  
ATOM 1102 C CD   . GLN A 1 36 ? -9.813  8.531   3.472   1.00 0.00 ? 827 GLN A CD   2  
ATOM 1103 O OE1  . GLN A 1 36 ? -10.279 7.724   2.658   1.00 0.00 ? 827 GLN A OE1  2  
ATOM 1104 N NE2  . GLN A 1 36 ? -10.481 9.596   3.784   1.00 0.00 ? 827 GLN A NE2  2  
ATOM 1105 H H    . GLN A 1 36 ? -8.407  4.952   3.902   1.00 0.00 ? 827 GLN A H    2  
ATOM 1106 H HA   . GLN A 1 36 ? -8.430  6.313   2.065   1.00 0.00 ? 827 GLN A HA   2  
ATOM 1107 H HB2  . GLN A 1 36 ? -6.417  8.117   3.420   1.00 0.00 ? 827 GLN A HB2  2  
ATOM 1108 H HB3  . GLN A 1 36 ? -7.580  8.530   2.166   1.00 0.00 ? 827 GLN A HB3  2  
ATOM 1109 H HG2  . GLN A 1 36 ? -8.538  7.477   4.828   1.00 0.00 ? 827 GLN A HG2  2  
ATOM 1110 H HG3  . GLN A 1 36 ? -8.136  9.177   4.630   1.00 0.00 ? 827 GLN A HG3  2  
ATOM 1111 H HE21 . GLN A 1 36 ? -10.112 10.235  4.429   1.00 0.00 ? 827 GLN A HE21 2  
ATOM 1112 H HE22 . GLN A 1 36 ? -11.357 9.764   3.378   1.00 0.00 ? 827 GLN A HE22 2  
ATOM 1113 N N    . TYR A 1 37 ? -5.990  4.735   1.886   1.00 0.00 ? 828 TYR A N    2  
ATOM 1114 C CA   . TYR A 1 37 ? -4.916  4.185   1.059   1.00 0.00 ? 828 TYR A CA   2  
ATOM 1115 C C    . TYR A 1 37 ? -5.533  3.354   -0.056  1.00 0.00 ? 828 TYR A C    2  
ATOM 1116 O O    . TYR A 1 37 ? -4.839  2.871   -0.953  1.00 0.00 ? 828 TYR A O    2  
ATOM 1117 C CB   . TYR A 1 37 ? -4.010  3.278   1.901   1.00 0.00 ? 828 TYR A CB   2  
ATOM 1118 C CG   . TYR A 1 37 ? -2.706  3.961   2.229   1.00 0.00 ? 828 TYR A CG   2  
ATOM 1119 C CD1  . TYR A 1 37 ? -2.604  4.753   3.374   1.00 0.00 ? 828 TYR A CD1  2  
ATOM 1120 C CD2  . TYR A 1 37 ? -1.594  3.779   1.402   1.00 0.00 ? 828 TYR A CD2  2  
ATOM 1121 C CE1  . TYR A 1 37 ? -1.392  5.361   3.695   1.00 0.00 ? 828 TYR A CE1  2  
ATOM 1122 C CE2  . TYR A 1 37 ? -0.381  4.394   1.722   1.00 0.00 ? 828 TYR A CE2  2  
ATOM 1123 C CZ   . TYR A 1 37 ? -0.283  5.184   2.872   1.00 0.00 ? 828 TYR A CZ   2  
ATOM 1124 O OH   . TYR A 1 37 ? 0.910   5.775   3.200   1.00 0.00 ? 828 TYR A OH   2  
ATOM 1125 H H    . TYR A 1 37 ? -6.491  4.140   2.482   1.00 0.00 ? 828 TYR A H    2  
ATOM 1126 H HA   . TYR A 1 37 ? -4.328  4.988   0.635   1.00 0.00 ? 828 TYR A HA   2  
ATOM 1127 H HB2  . TYR A 1 37 ? -4.510  3.022   2.822   1.00 0.00 ? 828 TYR A HB2  2  
ATOM 1128 H HB3  . TYR A 1 37 ? -3.800  2.375   1.345   1.00 0.00 ? 828 TYR A HB3  2  
ATOM 1129 H HH   . TYR A 1 37 ? 1.536   5.080   3.420   1.00 0.00 ? 828 TYR A HH   2  
ATOM 1130 N N    . GLU A 1 38 ? -6.852  3.216   0.004   1.00 0.00 ? 829 GLU A N    2  
ATOM 1131 C CA   . GLU A 1 38 ? -7.600  2.457   -0.990  1.00 0.00 ? 829 GLU A CA   2  
ATOM 1132 C C    . GLU A 1 38 ? -7.533  3.155   -2.327  1.00 0.00 ? 829 GLU A C    2  
ATOM 1133 O O    . GLU A 1 38 ? -6.922  2.658   -3.271  1.00 0.00 ? 829 GLU A O    2  
ATOM 1134 C CB   . GLU A 1 38 ? -9.072  2.311   -0.556  1.00 0.00 ? 829 GLU A CB   2  
ATOM 1135 C CG   . GLU A 1 38 ? -9.357  3.219   0.654   1.00 0.00 ? 829 GLU A CG   2  
ATOM 1136 C CD   . GLU A 1 38 ? -10.836 3.204   0.973   1.00 0.00 ? 829 GLU A CD   2  
ATOM 1137 O OE1  . GLU A 1 38 ? -11.252 2.345   1.720   1.00 0.00 ? 829 GLU A OE1  2  
ATOM 1138 O OE2  . GLU A 1 38 ? -11.536 4.053   0.467   1.00 0.00 ? 829 GLU A OE2  2  
ATOM 1139 H H    . GLU A 1 38 ? -7.337  3.644   0.735   1.00 0.00 ? 829 GLU A H    2  
ATOM 1140 H HA   . GLU A 1 38 ? -7.166  1.472   -1.084  1.00 0.00 ? 829 GLU A HA   2  
ATOM 1141 N N    . ASN A 1 39 ? -8.139  4.326   -2.385  1.00 0.00 ? 830 ASN A N    2  
ATOM 1142 C CA   . ASN A 1 39 ? -8.135  5.130   -3.593  1.00 0.00 ? 830 ASN A CA   2  
ATOM 1143 C C    . ASN A 1 39 ? -6.739  5.176   -4.180  1.00 0.00 ? 830 ASN A C    2  
ATOM 1144 O O    . ASN A 1 39 ? -6.563  5.124   -5.397  1.00 0.00 ? 830 ASN A O    2  
ATOM 1145 C CB   . ASN A 1 39 ? -8.603  6.550   -3.273  1.00 0.00 ? 830 ASN A CB   2  
ATOM 1146 C CG   . ASN A 1 39 ? -7.631  7.217   -2.302  1.00 0.00 ? 830 ASN A CG   2  
ATOM 1147 O OD1  . ASN A 1 39 ? -6.999  6.534   -1.482  1.00 0.00 ? 830 ASN A OD1  2  
ATOM 1148 N ND2  . ASN A 1 39 ? -7.468  8.504   -2.340  1.00 0.00 ? 830 ASN A ND2  2  
ATOM 1149 H H    . ASN A 1 39 ? -8.588  4.669   -1.584  1.00 0.00 ? 830 ASN A H    2  
ATOM 1150 H HA   . ASN A 1 39 ? -8.810  4.696   -4.313  1.00 0.00 ? 830 ASN A HA   2  
ATOM 1151 H HB2  . ASN A 1 39 ? -8.650  7.126   -4.187  1.00 0.00 ? 830 ASN A HB2  2  
ATOM 1152 H HB3  . ASN A 1 39 ? -9.585  6.511   -2.825  1.00 0.00 ? 830 ASN A HB3  2  
ATOM 1153 H HD21 . ASN A 1 39 ? -7.968  9.043   -2.989  1.00 0.00 ? 830 ASN A HD21 2  
ATOM 1154 H HD22 . ASN A 1 39 ? -6.845  8.940   -1.721  1.00 0.00 ? 830 ASN A HD22 2  
ATOM 1155 N N    . HIS A 1 40 ? -5.749  5.281   -3.311  1.00 0.00 ? 831 HIS A N    2  
ATOM 1156 C CA   . HIS A 1 40 ? -4.365  5.337   -3.744  1.00 0.00 ? 831 HIS A CA   2  
ATOM 1157 C C    . HIS A 1 40 ? -3.976  4.037   -4.437  1.00 0.00 ? 831 HIS A C    2  
ATOM 1158 O O    . HIS A 1 40 ? -3.609  4.033   -5.616  1.00 0.00 ? 831 HIS A O    2  
ATOM 1159 C CB   . HIS A 1 40 ? -3.445  5.583   -2.542  1.00 0.00 ? 831 HIS A CB   2  
ATOM 1160 C CG   . HIS A 1 40 ? -3.615  6.998   -2.052  1.00 0.00 ? 831 HIS A CG   2  
ATOM 1161 N ND1  . HIS A 1 40 ? -4.718  7.404   -1.309  1.00 0.00 ? 831 HIS A ND1  2  
ATOM 1162 C CD2  . HIS A 1 40 ? -2.827  8.112   -2.189  1.00 0.00 ? 831 HIS A CD2  2  
ATOM 1163 C CE1  . HIS A 1 40 ? -4.555  8.711   -1.030  1.00 0.00 ? 831 HIS A CE1  2  
ATOM 1164 N NE2  . HIS A 1 40 ? -3.422  9.191   -1.543  1.00 0.00 ? 831 HIS A NE2  2  
ATOM 1165 H H    . HIS A 1 40 ? -5.961  5.329   -2.354  1.00 0.00 ? 831 HIS A H    2  
ATOM 1166 H HA   . HIS A 1 40 ? -4.249  6.152   -4.441  1.00 0.00 ? 831 HIS A HA   2  
ATOM 1167 H HB2  . HIS A 1 40 ? -3.691  4.892   -1.749  1.00 0.00 ? 831 HIS A HB2  2  
ATOM 1168 H HB3  . HIS A 1 40 ? -2.418  5.429   -2.842  1.00 0.00 ? 831 HIS A HB3  2  
ATOM 1169 N N    . LEU A 1 41 ? -4.102  2.928   -3.717  1.00 0.00 ? 832 LEU A N    2  
ATOM 1170 C CA   . LEU A 1 41 ? -3.788  1.630   -4.283  1.00 0.00 ? 832 LEU A CA   2  
ATOM 1171 C C    . LEU A 1 41 ? -4.664  1.368   -5.495  1.00 0.00 ? 832 LEU A C    2  
ATOM 1172 O O    . LEU A 1 41 ? -4.182  0.938   -6.545  1.00 0.00 ? 832 LEU A O    2  
ATOM 1173 C CB   . LEU A 1 41 ? -3.998  0.529   -3.235  1.00 0.00 ? 832 LEU A CB   2  
ATOM 1174 C CG   . LEU A 1 41 ? -2.654  0.150   -2.593  1.00 0.00 ? 832 LEU A CG   2  
ATOM 1175 C CD1  . LEU A 1 41 ? -2.117  1.327   -1.776  1.00 0.00 ? 832 LEU A CD1  2  
ATOM 1176 C CD2  . LEU A 1 41 ? -2.852  -1.055  -1.671  1.00 0.00 ? 832 LEU A CD2  2  
ATOM 1177 H H    . LEU A 1 41 ? -4.434  2.978   -2.796  1.00 0.00 ? 832 LEU A H    2  
ATOM 1178 H HA   . LEU A 1 41 ? -2.753  1.625   -4.591  1.00 0.00 ? 832 LEU A HA   2  
ATOM 1179 H HB2  . LEU A 1 41 ? -4.677  0.879   -2.475  1.00 0.00 ? 832 LEU A HB2  2  
ATOM 1180 H HB3  . LEU A 1 41 ? -4.421  -0.338  -3.715  1.00 0.00 ? 832 LEU A HB3  2  
ATOM 1181 H HG   . LEU A 1 41 ? -1.941  -0.099  -3.366  1.00 0.00 ? 832 LEU A HG   2  
ATOM 1182 H HD11 . LEU A 1 41 ? -1.175  1.048   -1.326  1.00 0.00 ? 832 LEU A HD11 2  
ATOM 1183 H HD12 . LEU A 1 41 ? -2.824  1.582   -1.001  1.00 0.00 ? 832 LEU A HD12 2  
ATOM 1184 H HD13 . LEU A 1 41 ? -1.966  2.179   -2.422  1.00 0.00 ? 832 LEU A HD13 2  
ATOM 1185 H HD21 . LEU A 1 41 ? -1.916  -1.295  -1.189  1.00 0.00 ? 832 LEU A HD21 2  
ATOM 1186 H HD22 . LEU A 1 41 ? -3.182  -1.903  -2.252  1.00 0.00 ? 832 LEU A HD22 2  
ATOM 1187 H HD23 . LEU A 1 41 ? -3.593  -0.819  -0.921  1.00 0.00 ? 832 LEU A HD23 2  
ATOM 1188 N N    . MET A 1 42 ? -5.951  1.654   -5.352  1.00 0.00 ? 833 MET A N    2  
ATOM 1189 C CA   . MET A 1 42 ? -6.897  1.470   -6.441  1.00 0.00 ? 833 MET A CA   2  
ATOM 1190 C C    . MET A 1 42 ? -6.463  2.268   -7.658  1.00 0.00 ? 833 MET A C    2  
ATOM 1191 O O    . MET A 1 42 ? -6.271  1.711   -8.737  1.00 0.00 ? 833 MET A O    2  
ATOM 1192 C CB   . MET A 1 42 ? -8.304  1.895   -6.007  1.00 0.00 ? 833 MET A CB   2  
ATOM 1193 C CG   . MET A 1 42 ? -8.832  0.922   -4.947  1.00 0.00 ? 833 MET A CG   2  
ATOM 1194 S SD   . MET A 1 42 ? -9.351  -0.621  -5.751  1.00 0.00 ? 833 MET A SD   2  
ATOM 1195 C CE   . MET A 1 42 ? -7.945  -1.647  -5.240  1.00 0.00 ? 833 MET A CE   2  
ATOM 1196 H H    . MET A 1 42 ? -6.268  2.015   -4.495  1.00 0.00 ? 833 MET A H    2  
ATOM 1197 H HA   . MET A 1 42 ? -6.918  0.423   -6.704  1.00 0.00 ? 833 MET A HA   2  
ATOM 1198 H HB2  . MET A 1 42 ? -8.266  2.895   -5.596  1.00 0.00 ? 833 MET A HB2  2  
ATOM 1199 H HB3  . MET A 1 42 ? -8.963  1.885   -6.863  1.00 0.00 ? 833 MET A HB3  2  
ATOM 1200 H HG2  . MET A 1 42 ? -8.056  0.716   -4.225  1.00 0.00 ? 833 MET A HG2  2  
ATOM 1201 H HG3  . MET A 1 42 ? -9.676  1.367   -4.442  1.00 0.00 ? 833 MET A HG3  2  
ATOM 1202 H HE1  . MET A 1 42 ? -7.619  -2.252  -6.074  1.00 0.00 ? 833 MET A HE1  2  
ATOM 1203 H HE2  . MET A 1 42 ? -8.245  -2.297  -4.433  1.00 0.00 ? 833 MET A HE2  2  
ATOM 1204 H HE3  . MET A 1 42 ? -7.133  -1.017  -4.904  1.00 0.00 ? 833 MET A HE3  2  
ATOM 1205 N N    . ALA A 1 43 ? -6.263  3.568   -7.473  1.00 0.00 ? 834 ALA A N    2  
ATOM 1206 C CA   . ALA A 1 43 ? -5.803  4.417   -8.562  1.00 0.00 ? 834 ALA A CA   2  
ATOM 1207 C C    . ALA A 1 43 ? -4.580  3.792   -9.207  1.00 0.00 ? 834 ALA A C    2  
ATOM 1208 O O    . ALA A 1 43 ? -4.545  3.565   -10.419 1.00 0.00 ? 834 ALA A O    2  
ATOM 1209 C CB   . ALA A 1 43 ? -5.459  5.817   -8.042  1.00 0.00 ? 834 ALA A CB   2  
ATOM 1210 H H    . ALA A 1 43 ? -6.398  3.956   -6.581  1.00 0.00 ? 834 ALA A H    2  
ATOM 1211 H HA   . ALA A 1 43 ? -6.588  4.499   -9.300  1.00 0.00 ? 834 ALA A HA   2  
ATOM 1212 H HB1  . ALA A 1 43 ? -4.805  5.735   -7.187  1.00 0.00 ? 834 ALA A HB1  2  
ATOM 1213 H HB2  . ALA A 1 43 ? -6.367  6.327   -7.755  1.00 0.00 ? 834 ALA A HB2  2  
ATOM 1214 H HB3  . ALA A 1 43 ? -4.964  6.379   -8.821  1.00 0.00 ? 834 ALA A HB3  2  
ATOM 1215 N N    . ASN A 1 44 ? -3.598  3.467   -8.380  1.00 0.00 ? 835 ASN A N    2  
ATOM 1216 C CA   . ASN A 1 44 ? -2.387  2.820   -8.865  1.00 0.00 ? 835 ASN A CA   2  
ATOM 1217 C C    . ASN A 1 44 ? -2.717  1.462   -9.469  1.00 0.00 ? 835 ASN A C    2  
ATOM 1218 O O    . ASN A 1 44 ? -1.928  0.900   -10.232 1.00 0.00 ? 835 ASN A O    2  
ATOM 1219 C CB   . ASN A 1 44 ? -1.378  2.648   -7.726  1.00 0.00 ? 835 ASN A CB   2  
ATOM 1220 C CG   . ASN A 1 44 ? -0.077  2.069   -8.267  1.00 0.00 ? 835 ASN A CG   2  
ATOM 1221 O OD1  . ASN A 1 44 ? 0.322   2.382   -9.392  1.00 0.00 ? 835 ASN A OD1  2  
ATOM 1222 N ND2  . ASN A 1 44 ? 0.611   1.252   -7.542  1.00 0.00 ? 835 ASN A ND2  2  
ATOM 1223 H H    . ASN A 1 44 ? -3.703  3.640   -7.418  1.00 0.00 ? 835 ASN A H    2  
ATOM 1224 H HA   . ASN A 1 44 ? -1.943  3.441   -9.629  1.00 0.00 ? 835 ASN A HA   2  
ATOM 1225 H HB2  . ASN A 1 44 ? -1.180  3.608   -7.272  1.00 0.00 ? 835 ASN A HB2  2  
ATOM 1226 H HB3  . ASN A 1 44 ? -1.784  1.979   -6.983  1.00 0.00 ? 835 ASN A HB3  2  
ATOM 1227 H HD21 . ASN A 1 44 ? 0.307   1.004   -6.643  1.00 0.00 ? 835 ASN A HD21 2  
ATOM 1228 H HD22 . ASN A 1 44 ? 1.447   0.871   -7.886  1.00 0.00 ? 835 ASN A HD22 2  
ATOM 1229 N N    . GLY A 1 45 ? -3.883  0.938   -9.129  1.00 0.00 ? 836 GLY A N    2  
ATOM 1230 C CA   . GLY A 1 45 ? -4.314  -0.359  -9.632  1.00 0.00 ? 836 GLY A CA   2  
ATOM 1231 C C    . GLY A 1 45 ? -3.700  -1.469  -8.809  1.00 0.00 ? 836 GLY A C    2  
ATOM 1232 O O    . GLY A 1 45 ? -3.476  -2.574  -9.303  1.00 0.00 ? 836 GLY A O    2  
ATOM 1233 H H    . GLY A 1 45 ? -4.472  1.429   -8.516  1.00 0.00 ? 836 GLY A H    2  
ATOM 1234 H HA2  . GLY A 1 45 ? -5.392  -0.423  -9.575  1.00 0.00 ? 836 GLY A HA2  2  
ATOM 1235 H HA3  . GLY A 1 45 ? -4.003  -0.469  -10.660 1.00 0.00 ? 836 GLY A HA3  2  
ATOM 1236 N N    . PHE A 1 46 ? -3.419  -1.168  -7.555  1.00 0.00 ? 837 PHE A N    2  
ATOM 1237 C CA   . PHE A 1 46 ? -2.819  -2.133  -6.654  1.00 0.00 ? 837 PHE A CA   2  
ATOM 1238 C C    . PHE A 1 46 ? -3.889  -2.802  -5.810  1.00 0.00 ? 837 PHE A C    2  
ATOM 1239 O O    . PHE A 1 46 ? -4.139  -2.404  -4.672  1.00 0.00 ? 837 PHE A O    2  
ATOM 1240 C CB   . PHE A 1 46 ? -1.786  -1.436  -5.758  1.00 0.00 ? 837 PHE A CB   2  
ATOM 1241 C CG   . PHE A 1 46 ? -0.411  -1.500  -6.403  1.00 0.00 ? 837 PHE A CG   2  
ATOM 1242 C CD1  . PHE A 1 46 ? -0.281  -1.584  -7.802  1.00 0.00 ? 837 PHE A CD1  2  
ATOM 1243 C CD2  . PHE A 1 46 ? 0.732   -1.473  -5.602  1.00 0.00 ? 837 PHE A CD2  2  
ATOM 1244 C CE1  . PHE A 1 46 ? 0.989   -1.640  -8.384  1.00 0.00 ? 837 PHE A CE1  2  
ATOM 1245 C CE2  . PHE A 1 46 ? 2.000   -1.530  -6.188  1.00 0.00 ? 837 PHE A CE2  2  
ATOM 1246 C CZ   . PHE A 1 46 ? 2.129   -1.614  -7.576  1.00 0.00 ? 837 PHE A CZ   2  
ATOM 1247 H H    . PHE A 1 46 ? -3.623  -0.265  -7.222  1.00 0.00 ? 837 PHE A H    2  
ATOM 1248 H HA   . PHE A 1 46 ? -2.316  -2.894  -7.233  1.00 0.00 ? 837 PHE A HA   2  
ATOM 1249 H HB2  . PHE A 1 46 ? -2.071  -0.403  -5.622  1.00 0.00 ? 837 PHE A HB2  2  
ATOM 1250 H HB3  . PHE A 1 46 ? -1.757  -1.924  -4.793  1.00 0.00 ? 837 PHE A HB3  2  
ATOM 1251 H HZ   . PHE A 1 46 ? 3.110   -1.658  -8.026  1.00 0.00 ? 837 PHE A HZ   2  
ATOM 1252 N N    . ASP A 1 47 ? -4.524  -3.811  -6.380  1.00 0.00 ? 838 ASP A N    2  
ATOM 1253 C CA   . ASP A 1 47 ? -5.573  -4.537  -5.682  1.00 0.00 ? 838 ASP A CA   2  
ATOM 1254 C C    . ASP A 1 47 ? -4.998  -5.745  -4.969  1.00 0.00 ? 838 ASP A C    2  
ATOM 1255 O O    . ASP A 1 47 ? -3.873  -6.162  -5.249  1.00 0.00 ? 838 ASP A O    2  
ATOM 1256 C CB   . ASP A 1 47 ? -6.657  -4.991  -6.664  1.00 0.00 ? 838 ASP A CB   2  
ATOM 1257 C CG   . ASP A 1 47 ? -7.730  -5.777  -5.932  1.00 0.00 ? 838 ASP A CG   2  
ATOM 1258 O OD1  . ASP A 1 47 ? -8.168  -5.322  -4.897  1.00 0.00 ? 838 ASP A OD1  2  
ATOM 1259 O OD2  . ASP A 1 47 ? -8.103  -6.819  -6.416  1.00 0.00 ? 838 ASP A OD2  2  
ATOM 1260 H H    . ASP A 1 47 ? -4.280  -4.078  -7.291  1.00 0.00 ? 838 ASP A H    2  
ATOM 1261 H HA   . ASP A 1 47 ? -6.025  -3.884  -4.950  1.00 0.00 ? 838 ASP A HA   2  
ATOM 1262 N N    . ASN A 1 48 ? -5.782  -6.313  -4.069  1.00 0.00 ? 839 ASN A N    2  
ATOM 1263 C CA   . ASN A 1 48 ? -5.369  -7.493  -3.315  1.00 0.00 ? 839 ASN A CA   2  
ATOM 1264 C C    . ASN A 1 48 ? -4.057  -7.243  -2.582  1.00 0.00 ? 839 ASN A C    2  
ATOM 1265 O O    . ASN A 1 48 ? -2.971  -7.558  -3.087  1.00 0.00 ? 839 ASN A O    2  
ATOM 1266 C CB   . ASN A 1 48 ? -5.231  -8.704  -4.239  1.00 0.00 ? 839 ASN A CB   2  
ATOM 1267 C CG   . ASN A 1 48 ? -5.065  -9.970  -3.407  1.00 0.00 ? 839 ASN A CG   2  
ATOM 1268 O OD1  . ASN A 1 48 ? -4.175  -10.044 -2.559  1.00 0.00 ? 839 ASN A OD1  2  
ATOM 1269 N ND2  . ASN A 1 48 ? -5.870  -10.969 -3.594  1.00 0.00 ? 839 ASN A ND2  2  
ATOM 1270 H H    . ASN A 1 48 ? -6.674  -5.934  -3.914  1.00 0.00 ? 839 ASN A H    2  
ATOM 1271 H HA   . ASN A 1 48 ? -6.129  -7.714  -2.581  1.00 0.00 ? 839 ASN A HA   2  
ATOM 1272 H HB2  . ASN A 1 48 ? -6.115  -8.787  -4.854  1.00 0.00 ? 839 ASN A HB2  2  
ATOM 1273 H HB3  . ASN A 1 48 ? -4.367  -8.577  -4.873  1.00 0.00 ? 839 ASN A HB3  2  
ATOM 1274 H HD21 . ASN A 1 48 ? -6.580  -10.908 -4.266  1.00 0.00 ? 839 ASN A HD21 2  
ATOM 1275 H HD22 . ASN A 1 48 ? -5.766  -11.787 -3.063  1.00 0.00 ? 839 ASN A HD22 2  
ATOM 1276 N N    . VAL A 1 49 ? -4.163  -6.681  -1.388  1.00 0.00 ? 840 VAL A N    2  
ATOM 1277 C CA   . VAL A 1 49 ? -2.992  -6.392  -0.573  1.00 0.00 ? 840 VAL A CA   2  
ATOM 1278 C C    . VAL A 1 49 ? -2.040  -7.590  -0.552  1.00 0.00 ? 840 VAL A C    2  
ATOM 1279 O O    . VAL A 1 49 ? -0.833  -7.445  -0.776  1.00 0.00 ? 840 VAL A O    2  
ATOM 1280 C CB   . VAL A 1 49 ? -3.425  -6.019  0.854   1.00 0.00 ? 840 VAL A CB   2  
ATOM 1281 C CG1  . VAL A 1 49 ? -4.211  -4.706  0.817   1.00 0.00 ? 840 VAL A CG1  2  
ATOM 1282 C CG2  . VAL A 1 49 ? -4.323  -7.123  1.437   1.00 0.00 ? 840 VAL A CG2  2  
ATOM 1283 H H    . VAL A 1 49 ? -5.053  -6.457  -1.044  1.00 0.00 ? 840 VAL A H    2  
ATOM 1284 H HA   . VAL A 1 49 ? -2.472  -5.550  -1.006  1.00 0.00 ? 840 VAL A HA   2  
ATOM 1285 H HB   . VAL A 1 49 ? -2.549  -5.892  1.474   1.00 0.00 ? 840 VAL A HB   2  
ATOM 1286 H HG11 . VAL A 1 49 ? -4.974  -4.762  0.056   1.00 0.00 ? 840 VAL A HG11 2  
ATOM 1287 H HG12 . VAL A 1 49 ? -3.539  -3.890  0.597   1.00 0.00 ? 840 VAL A HG12 2  
ATOM 1288 H HG13 . VAL A 1 49 ? -4.675  -4.540  1.778   1.00 0.00 ? 840 VAL A HG13 2  
ATOM 1289 H HG21 . VAL A 1 49 ? -4.806  -6.753  2.331   1.00 0.00 ? 840 VAL A HG21 2  
ATOM 1290 H HG22 . VAL A 1 49 ? -3.725  -7.985  1.690   1.00 0.00 ? 840 VAL A HG22 2  
ATOM 1291 H HG23 . VAL A 1 49 ? -5.075  -7.403  0.715   1.00 0.00 ? 840 VAL A HG23 2  
ATOM 1292 N N    . GLN A 1 50 ? -2.597  -8.777  -0.312  1.00 0.00 ? 841 GLN A N    2  
ATOM 1293 C CA   . GLN A 1 50 ? -1.798  -9.997  -0.299  1.00 0.00 ? 841 GLN A CA   2  
ATOM 1294 C C    . GLN A 1 50 ? -0.983  -10.082 -1.577  1.00 0.00 ? 841 GLN A C    2  
ATOM 1295 O O    . GLN A 1 50 ? 0.250   -10.186 -1.544  1.00 0.00 ? 841 GLN A O    2  
ATOM 1296 C CB   . GLN A 1 50 ? -2.706  -11.234 -0.173  1.00 0.00 ? 841 GLN A CB   2  
ATOM 1297 C CG   . GLN A 1 50 ? -2.800  -11.669 1.296   1.00 0.00 ? 841 GLN A CG   2  
ATOM 1298 C CD   . GLN A 1 50 ? -1.501  -12.344 1.729   1.00 0.00 ? 841 GLN A CD   2  
ATOM 1299 O OE1  . GLN A 1 50 ? -0.718  -12.788 0.888   1.00 0.00 ? 841 GLN A OE1  2  
ATOM 1300 N NE2  . GLN A 1 50 ? -1.221  -12.443 2.990   1.00 0.00 ? 841 GLN A NE2  2  
ATOM 1301 H H    . GLN A 1 50 ? -3.563  -8.830  -0.169  1.00 0.00 ? 841 GLN A H    2  
ATOM 1302 H HA   . GLN A 1 50 ? -1.123  -9.965  0.542   1.00 0.00 ? 841 GLN A HA   2  
ATOM 1303 H HB2  . GLN A 1 50 ? -3.693  -10.998 -0.540  1.00 0.00 ? 841 GLN A HB2  2  
ATOM 1304 H HB3  . GLN A 1 50 ? -2.294  -12.044 -0.757  1.00 0.00 ? 841 GLN A HB3  2  
ATOM 1305 H HG2  . GLN A 1 50 ? -2.982  -10.805 1.918   1.00 0.00 ? 841 GLN A HG2  2  
ATOM 1306 H HG3  . GLN A 1 50 ? -3.617  -12.368 1.410   1.00 0.00 ? 841 GLN A HG3  2  
ATOM 1307 H HE21 . GLN A 1 50 ? -1.841  -12.089 3.661   1.00 0.00 ? 841 GLN A HE21 2  
ATOM 1308 H HE22 . GLN A 1 50 ? -0.385  -12.873 3.274   1.00 0.00 ? 841 GLN A HE22 2  
ATOM 1309 N N    . PHE A 1 51 ? -1.673  -9.994  -2.700  1.00 0.00 ? 842 PHE A N    2  
ATOM 1310 C CA   . PHE A 1 51 ? -1.018  -10.017 -3.992  1.00 0.00 ? 842 PHE A CA   2  
ATOM 1311 C C    . PHE A 1 51 ? 0.003   -8.901  -4.065  1.00 0.00 ? 842 PHE A C    2  
ATOM 1312 O O    . PHE A 1 51 ? 1.155   -9.126  -4.419  1.00 0.00 ? 842 PHE A O    2  
ATOM 1313 C CB   . PHE A 1 51 ? -2.050  -9.853  -5.113  1.00 0.00 ? 842 PHE A CB   2  
ATOM 1314 C CG   . PHE A 1 51 ? -1.447  -10.249 -6.445  1.00 0.00 ? 842 PHE A CG   2  
ATOM 1315 C CD1  . PHE A 1 51 ? -0.795  -11.482 -6.588  1.00 0.00 ? 842 PHE A CD1  2  
ATOM 1316 C CD2  . PHE A 1 51 ? -1.551  -9.385  -7.541  1.00 0.00 ? 842 PHE A CD2  2  
ATOM 1317 C CE1  . PHE A 1 51 ? -0.249  -11.845 -7.822  1.00 0.00 ? 842 PHE A CE1  2  
ATOM 1318 C CE2  . PHE A 1 51 ? -1.005  -9.752  -8.775  1.00 0.00 ? 842 PHE A CE2  2  
ATOM 1319 C CZ   . PHE A 1 51 ? -0.355  -10.980 -8.916  1.00 0.00 ? 842 PHE A CZ   2  
ATOM 1320 H H    . PHE A 1 51 ? -2.650  -9.880  -2.655  1.00 0.00 ? 842 PHE A H    2  
ATOM 1321 H HA   . PHE A 1 51 ? -0.515  -10.964 -4.112  1.00 0.00 ? 842 PHE A HA   2  
ATOM 1322 H HB2  . PHE A 1 51 ? -2.905  -10.481 -4.907  1.00 0.00 ? 842 PHE A HB2  2  
ATOM 1323 H HB3  . PHE A 1 51 ? -2.366  -8.820  -5.156  1.00 0.00 ? 842 PHE A HB3  2  
ATOM 1324 H HZ   . PHE A 1 51 ? 0.064   -11.264 -9.871  1.00 0.00 ? 842 PHE A HZ   2  
ATOM 1325 N N    . MET A 1 52 ? -0.423  -7.696  -3.701  1.00 0.00 ? 843 MET A N    2  
ATOM 1326 C CA   . MET A 1 52 ? 0.468   -6.540  -3.712  1.00 0.00 ? 843 MET A CA   2  
ATOM 1327 C C    . MET A 1 52 ? 1.797   -6.888  -3.050  1.00 0.00 ? 843 MET A C    2  
ATOM 1328 O O    . MET A 1 52 ? 2.861   -6.773  -3.667  1.00 0.00 ? 843 MET A O    2  
ATOM 1329 C CB   . MET A 1 52 ? -0.183  -5.368  -2.962  1.00 0.00 ? 843 MET A CB   2  
ATOM 1330 C CG   . MET A 1 52 ? 0.462   -4.046  -3.396  1.00 0.00 ? 843 MET A CG   2  
ATOM 1331 S SD   . MET A 1 52 ? -0.046  -2.731  -2.253  1.00 0.00 ? 843 MET A SD   2  
ATOM 1332 C CE   . MET A 1 52 ? 1.496   -1.775  -2.271  1.00 0.00 ? 843 MET A CE   2  
ATOM 1333 H H    . MET A 1 52 ? -1.357  -7.585  -3.410  1.00 0.00 ? 843 MET A H    2  
ATOM 1334 H HA   . MET A 1 52 ? 0.648   -6.243  -4.734  1.00 0.00 ? 843 MET A HA   2  
ATOM 1335 H HB2  . MET A 1 52 ? -1.242  -5.344  -3.176  1.00 0.00 ? 843 MET A HB2  2  
ATOM 1336 H HB3  . MET A 1 52 ? -0.039  -5.497  -1.899  1.00 0.00 ? 843 MET A HB3  2  
ATOM 1337 H HG2  . MET A 1 52 ? 1.538   -4.146  -3.381  1.00 0.00 ? 843 MET A HG2  2  
ATOM 1338 H HG3  . MET A 1 52 ? 0.138   -3.798  -4.397  1.00 0.00 ? 843 MET A HG3  2  
ATOM 1339 H HE1  . MET A 1 52 ? 2.229   -2.271  -2.893  1.00 0.00 ? 843 MET A HE1  2  
ATOM 1340 H HE2  . MET A 1 52 ? 1.882   -1.689  -1.268  1.00 0.00 ? 843 MET A HE2  2  
ATOM 1341 H HE3  . MET A 1 52 ? 1.299   -0.783  -2.655  1.00 0.00 ? 843 MET A HE3  2  
ATOM 1342 N N    . GLY A 1 53 ? 1.727   -7.341  -1.807  1.00 0.00 ? 844 GLY A N    2  
ATOM 1343 C CA   . GLY A 1 53 ? 2.927   -7.714  -1.065  1.00 0.00 ? 844 GLY A CA   2  
ATOM 1344 C C    . GLY A 1 53 ? 3.629   -8.882  -1.717  1.00 0.00 ? 844 GLY A C    2  
ATOM 1345 O O    . GLY A 1 53 ? 4.859   -8.983  -1.682  1.00 0.00 ? 844 GLY A O    2  
ATOM 1346 H H    . GLY A 1 53 ? 0.846   -7.431  -1.380  1.00 0.00 ? 844 GLY A H    2  
ATOM 1347 H HA2  . GLY A 1 53 ? 3.602   -6.870  -1.034  1.00 0.00 ? 844 GLY A HA2  2  
ATOM 1348 H HA3  . GLY A 1 53 ? 2.651   -7.989  -0.059  1.00 0.00 ? 844 GLY A HA3  2  
ATOM 1349 N N    . SER A 1 54 ? 2.853   -9.762  -2.313  1.00 0.00 ? 845 SER A N    2  
ATOM 1350 C CA   . SER A 1 54 ? 3.403   -10.929 -2.975  1.00 0.00 ? 845 SER A CA   2  
ATOM 1351 C C    . SER A 1 54 ? 3.733   -10.623 -4.431  1.00 0.00 ? 845 SER A C    2  
ATOM 1352 O O    . SER A 1 54 ? 4.045   -11.531 -5.212  1.00 0.00 ? 845 SER A O    2  
ATOM 1353 C CB   . SER A 1 54 ? 2.409   -12.080 -2.902  1.00 0.00 ? 845 SER A CB   2  
ATOM 1354 O OG   . SER A 1 54 ? 1.748   -12.056 -1.634  1.00 0.00 ? 845 SER A OG   2  
ATOM 1355 H H    . SER A 1 54 ? 1.880   -9.627  -2.311  1.00 0.00 ? 845 SER A H    2  
ATOM 1356 H HA   . SER A 1 54 ? 4.310   -11.227 -2.470  1.00 0.00 ? 845 SER A HA   2  
ATOM 1357 H HB2  . SER A 1 54 ? 1.677   -11.980 -3.688  1.00 0.00 ? 845 SER A HB2  2  
ATOM 1358 H HB3  . SER A 1 54 ? 2.944   -13.009 -3.036  1.00 0.00 ? 845 SER A HB3  2  
ATOM 1359 H HG   . SER A 1 54 ? 1.224   -11.239 -1.582  1.00 0.00 ? 845 SER A HG   2  
ATOM 1360 N N    . ASN A 1 55 ? 3.640   -9.353  -4.805  1.00 0.00 ? 846 ASN A N    2  
ATOM 1361 C CA   . ASN A 1 55 ? 3.906   -8.958  -6.182  1.00 0.00 ? 846 ASN A CA   2  
ATOM 1362 C C    . ASN A 1 55 ? 4.870   -7.790  -6.264  1.00 0.00 ? 846 ASN A C    2  
ATOM 1363 O O    . ASN A 1 55 ? 5.843   -7.843  -7.018  1.00 0.00 ? 846 ASN A O    2  
ATOM 1364 C CB   . ASN A 1 55 ? 2.605   -8.596  -6.902  1.00 0.00 ? 846 ASN A CB   2  
ATOM 1365 C CG   . ASN A 1 55 ? 2.844   -8.483  -8.410  1.00 0.00 ? 846 ASN A CG   2  
ATOM 1366 O OD1  . ASN A 1 55 ? 1.892   -8.519  -9.189  1.00 0.00 ? 846 ASN A OD1  2  
ATOM 1367 N ND2  . ASN A 1 55 ? 4.052   -8.355  -8.876  1.00 0.00 ? 846 ASN A ND2  2  
ATOM 1368 H H    . ASN A 1 55 ? 3.367   -8.677  -4.145  1.00 0.00 ? 846 ASN A H    2  
ATOM 1369 H HA   . ASN A 1 55 ? 4.349   -9.796  -6.700  1.00 0.00 ? 846 ASN A HA   2  
ATOM 1370 H HB2  . ASN A 1 55 ? 1.869   -9.365  -6.714  1.00 0.00 ? 846 ASN A HB2  2  
ATOM 1371 H HB3  . ASN A 1 55 ? 2.238   -7.652  -6.529  1.00 0.00 ? 846 ASN A HB3  2  
ATOM 1372 H HD21 . ASN A 1 55 ? 4.824   -8.330  -8.270  1.00 0.00 ? 846 ASN A HD21 2  
ATOM 1373 H HD22 . ASN A 1 55 ? 4.198   -8.279  -9.844  1.00 0.00 ? 846 ASN A HD22 2  
ATOM 1374 N N    . VAL A 1 56 ? 4.581   -6.711  -5.550  1.00 0.00 ? 847 VAL A N    2  
ATOM 1375 C CA   . VAL A 1 56 ? 5.427   -5.527  -5.637  1.00 0.00 ? 847 VAL A CA   2  
ATOM 1376 C C    . VAL A 1 56 ? 5.423   -4.723  -4.339  1.00 0.00 ? 847 VAL A C    2  
ATOM 1377 O O    . VAL A 1 56 ? 4.369   -4.357  -3.820  1.00 0.00 ? 847 VAL A O    2  
ATOM 1378 C CB   . VAL A 1 56 ? 4.982   -4.648  -6.826  1.00 0.00 ? 847 VAL A CB   2  
ATOM 1379 C CG1  . VAL A 1 56 ? 3.452   -4.578  -6.880  1.00 0.00 ? 847 VAL A CG1  2  
ATOM 1380 C CG2  . VAL A 1 56 ? 5.552   -3.229  -6.680  1.00 0.00 ? 847 VAL A CG2  2  
ATOM 1381 H H    . VAL A 1 56 ? 3.771   -6.689  -4.990  1.00 0.00 ? 847 VAL A H    2  
ATOM 1382 H HA   . VAL A 1 56 ? 6.439   -5.850  -5.825  1.00 0.00 ? 847 VAL A HA   2  
ATOM 1383 H HB   . VAL A 1 56 ? 5.344   -5.091  -7.743  1.00 0.00 ? 847 VAL A HB   2  
ATOM 1384 H HG11 . VAL A 1 56 ? 3.075   -4.155  -5.960  1.00 0.00 ? 847 VAL A HG11 2  
ATOM 1385 H HG12 . VAL A 1 56 ? 3.046   -5.570  -7.013  1.00 0.00 ? 847 VAL A HG12 2  
ATOM 1386 H HG13 . VAL A 1 56 ? 3.151   -3.956  -7.710  1.00 0.00 ? 847 VAL A HG13 2  
ATOM 1387 H HG21 . VAL A 1 56 ? 5.427   -2.696  -7.611  1.00 0.00 ? 847 VAL A HG21 2  
ATOM 1388 H HG22 . VAL A 1 56 ? 6.602   -3.282  -6.435  1.00 0.00 ? 847 VAL A HG22 2  
ATOM 1389 H HG23 . VAL A 1 56 ? 5.024   -2.705  -5.896  1.00 0.00 ? 847 VAL A HG23 2  
ATOM 1390 N N    . MET A 1 57 ? 6.619   -4.407  -3.866  1.00 0.00 ? 848 MET A N    2  
ATOM 1391 C CA   . MET A 1 57 ? 6.800   -3.584  -2.680  1.00 0.00 ? 848 MET A CA   2  
ATOM 1392 C C    . MET A 1 57 ? 7.972   -2.643  -2.915  1.00 0.00 ? 848 MET A C    2  
ATOM 1393 O O    . MET A 1 57 ? 9.128   -3.067  -2.877  1.00 0.00 ? 848 MET A O    2  
ATOM 1394 C CB   . MET A 1 57 ? 7.078   -4.468  -1.452  1.00 0.00 ? 848 MET A CB   2  
ATOM 1395 C CG   . MET A 1 57 ? 8.063   -5.585  -1.823  1.00 0.00 ? 848 MET A CG   2  
ATOM 1396 S SD   . MET A 1 57 ? 9.451   -5.572  -0.665  1.00 0.00 ? 848 MET A SD   2  
ATOM 1397 C CE   . MET A 1 57 ? 10.453  -6.824  -1.501  1.00 0.00 ? 848 MET A CE   2  
ATOM 1398 H H    . MET A 1 57 ? 7.416   -4.689  -4.364  1.00 0.00 ? 848 MET A H    2  
ATOM 1399 H HA   . MET A 1 57 ? 5.905   -3.005  -2.507  1.00 0.00 ? 848 MET A HA   2  
ATOM 1400 H HB2  . MET A 1 57 ? 7.499   -3.864  -0.662  1.00 0.00 ? 848 MET A HB2  2  
ATOM 1401 H HB3  . MET A 1 57 ? 6.154   -4.910  -1.111  1.00 0.00 ? 848 MET A HB3  2  
ATOM 1402 H HG2  . MET A 1 57 ? 7.561   -6.540  -1.770  1.00 0.00 ? 848 MET A HG2  2  
ATOM 1403 H HG3  . MET A 1 57 ? 8.433   -5.432  -2.826  1.00 0.00 ? 848 MET A HG3  2  
ATOM 1404 H HE1  . MET A 1 57 ? 11.035  -6.353  -2.281  1.00 0.00 ? 848 MET A HE1  2  
ATOM 1405 H HE2  . MET A 1 57 ? 9.813   -7.574  -1.938  1.00 0.00 ? 848 MET A HE2  2  
ATOM 1406 H HE3  . MET A 1 57 ? 11.111  -7.294  -0.785  1.00 0.00 ? 848 MET A HE3  2  
ATOM 1407 N N    . GLU A 1 58 ? 7.686   -1.387  -3.212  1.00 0.00 ? 849 GLU A N    2  
ATOM 1408 C CA   . GLU A 1 58 ? 8.750   -0.436  -3.515  1.00 0.00 ? 849 GLU A CA   2  
ATOM 1409 C C    . GLU A 1 58 ? 8.402   0.965   -3.053  1.00 0.00 ? 849 GLU A C    2  
ATOM 1410 O O    . GLU A 1 58 ? 7.234   1.303   -2.874  1.00 0.00 ? 849 GLU A O    2  
ATOM 1411 C CB   . GLU A 1 58 ? 9.019   -0.419  -5.031  1.00 0.00 ? 849 GLU A CB   2  
ATOM 1412 C CG   . GLU A 1 58 ? 10.429  -0.952  -5.318  1.00 0.00 ? 849 GLU A CG   2  
ATOM 1413 C CD   . GLU A 1 58 ? 11.433  0.195   -5.359  1.00 0.00 ? 849 GLU A CD   2  
ATOM 1414 O OE1  . GLU A 1 58 ? 11.223  1.175   -4.667  1.00 0.00 ? 849 GLU A OE1  2  
ATOM 1415 O OE2  . GLU A 1 58 ? 12.400  0.074   -6.075  1.00 0.00 ? 849 GLU A OE2  2  
ATOM 1416 H H    . GLU A 1 58 ? 6.750   -1.098  -3.269  1.00 0.00 ? 849 GLU A H    2  
ATOM 1417 H HA   . GLU A 1 58 ? 9.652   -0.746  -3.014  1.00 0.00 ? 849 GLU A HA   2  
ATOM 1418 N N    . ASP A 1 59 ? 9.427   1.798   -2.956  1.00 0.00 ? 850 ASP A N    2  
ATOM 1419 C CA   . ASP A 1 59 ? 9.253   3.196   -2.612  1.00 0.00 ? 850 ASP A CA   2  
ATOM 1420 C C    . ASP A 1 59 ? 8.602   3.902   -3.780  1.00 0.00 ? 850 ASP A C    2  
ATOM 1421 O O    . ASP A 1 59 ? 7.754   4.785   -3.609  1.00 0.00 ? 850 ASP A O    2  
ATOM 1422 C CB   . ASP A 1 59 ? 10.615  3.837   -2.322  1.00 0.00 ? 850 ASP A CB   2  
ATOM 1423 C CG   . ASP A 1 59 ? 10.452  5.005   -1.381  1.00 0.00 ? 850 ASP A CG   2  
ATOM 1424 O OD1  . ASP A 1 59 ? 9.795   5.953   -1.747  1.00 0.00 ? 850 ASP A OD1  2  
ATOM 1425 O OD2  . ASP A 1 59 ? 10.988  4.943   -0.298  1.00 0.00 ? 850 ASP A OD2  2  
ATOM 1426 H H    . ASP A 1 59 ? 10.323  1.470   -3.192  1.00 0.00 ? 850 ASP A H    2  
ATOM 1427 H HA   . ASP A 1 59 ? 8.624   3.284   -1.739  1.00 0.00 ? 850 ASP A HA   2  
ATOM 1428 N N    . GLN A 1 60 ? 8.986   3.473   -4.977  1.00 0.00 ? 851 GLN A N    2  
ATOM 1429 C CA   . GLN A 1 60 ? 8.432   4.020   -6.203  1.00 0.00 ? 851 GLN A CA   2  
ATOM 1430 C C    . GLN A 1 60 ? 6.917   4.006   -6.140  1.00 0.00 ? 851 GLN A C    2  
ATOM 1431 O O    . GLN A 1 60 ? 6.259   4.945   -6.586  1.00 0.00 ? 851 GLN A O    2  
ATOM 1432 C CB   . GLN A 1 60 ? 8.893   3.194   -7.409  1.00 0.00 ? 851 GLN A CB   2  
ATOM 1433 C CG   . GLN A 1 60 ? 10.418  3.243   -7.537  1.00 0.00 ? 851 GLN A CG   2  
ATOM 1434 C CD   . GLN A 1 60 ? 10.832  2.832   -8.945  1.00 0.00 ? 851 GLN A CD   2  
ATOM 1435 O OE1  . GLN A 1 60 ? 11.941  3.144   -9.384  1.00 0.00 ? 851 GLN A OE1  2  
ATOM 1436 N NE2  . GLN A 1 60 ? 10.008  2.152   -9.687  1.00 0.00 ? 851 GLN A NE2  2  
ATOM 1437 H H    . GLN A 1 60 ? 9.647   2.750   -5.029  1.00 0.00 ? 851 GLN A H    2  
ATOM 1438 H HA   . GLN A 1 60 ? 8.775   5.036   -6.325  1.00 0.00 ? 851 GLN A HA   2  
ATOM 1439 H HB2  . GLN A 1 60 ? 8.578   2.169   -7.279  1.00 0.00 ? 851 GLN A HB2  2  
ATOM 1440 H HB3  . GLN A 1 60 ? 8.446   3.593   -8.308  1.00 0.00 ? 851 GLN A HB3  2  
ATOM 1441 H HG2  . GLN A 1 60 ? 10.767  4.246   -7.336  1.00 0.00 ? 851 GLN A HG2  2  
ATOM 1442 H HG3  . GLN A 1 60 ? 10.859  2.561   -6.825  1.00 0.00 ? 851 GLN A HG3  2  
ATOM 1443 H HE21 . GLN A 1 60 ? 9.125   1.904   -9.340  1.00 0.00 ? 851 GLN A HE21 2  
ATOM 1444 H HE22 . GLN A 1 60 ? 10.267  1.889   -10.597 1.00 0.00 ? 851 GLN A HE22 2  
ATOM 1445 N N    . ASP A 1 61 ? 6.372   2.925   -5.595  1.00 0.00 ? 852 ASP A N    2  
ATOM 1446 C CA   . ASP A 1 61 ? 4.929   2.770   -5.482  1.00 0.00 ? 852 ASP A CA   2  
ATOM 1447 C C    . ASP A 1 61 ? 4.338   3.876   -4.637  1.00 0.00 ? 852 ASP A C    2  
ATOM 1448 O O    . ASP A 1 61 ? 3.483   4.633   -5.094  1.00 0.00 ? 852 ASP A O    2  
ATOM 1449 C CB   . ASP A 1 61 ? 4.581   1.413   -4.866  1.00 0.00 ? 852 ASP A CB   2  
ATOM 1450 C CG   . ASP A 1 61 ? 3.084   1.326   -4.634  1.00 0.00 ? 852 ASP A CG   2  
ATOM 1451 O OD1  . ASP A 1 61 ? 2.357   1.368   -5.605  1.00 0.00 ? 852 ASP A OD1  2  
ATOM 1452 O OD2  . ASP A 1 61 ? 2.688   1.228   -3.492  1.00 0.00 ? 852 ASP A OD2  2  
ATOM 1453 H H    . ASP A 1 61 ? 6.955   2.210   -5.270  1.00 0.00 ? 852 ASP A H    2  
ATOM 1454 H HA   . ASP A 1 61 ? 4.496   2.821   -6.467  1.00 0.00 ? 852 ASP A HA   2  
ATOM 1455 N N    . LEU A 1 62 ? 4.826   3.994   -3.418  1.00 0.00 ? 853 LEU A N    2  
ATOM 1456 C CA   . LEU A 1 62 ? 4.348   5.027   -2.517  1.00 0.00 ? 853 LEU A CA   2  
ATOM 1457 C C    . LEU A 1 62 ? 4.497   6.380   -3.184  1.00 0.00 ? 853 LEU A C    2  
ATOM 1458 O O    . LEU A 1 62 ? 3.605   7.234   -3.106  1.00 0.00 ? 853 LEU A O    2  
ATOM 1459 C CB   . LEU A 1 62 ? 5.144   4.993   -1.212  1.00 0.00 ? 853 LEU A CB   2  
ATOM 1460 C CG   . LEU A 1 62 ? 5.096   3.577   -0.615  1.00 0.00 ? 853 LEU A CG   2  
ATOM 1461 C CD1  . LEU A 1 62 ? 6.236   3.404   0.388   1.00 0.00 ? 853 LEU A CD1  2  
ATOM 1462 C CD2  . LEU A 1 62 ? 3.753   3.358   0.092   1.00 0.00 ? 853 LEU A CD2  2  
ATOM 1463 H H    . LEU A 1 62 ? 5.526   3.375   -3.124  1.00 0.00 ? 853 LEU A H    2  
ATOM 1464 H HA   . LEU A 1 62 ? 3.305   4.849   -2.300  1.00 0.00 ? 853 LEU A HA   2  
ATOM 1465 H HB2  . LEU A 1 62 ? 6.169   5.268   -1.417  1.00 0.00 ? 853 LEU A HB2  2  
ATOM 1466 H HB3  . LEU A 1 62 ? 4.717   5.693   -0.512  1.00 0.00 ? 853 LEU A HB3  2  
ATOM 1467 H HG   . LEU A 1 62 ? 5.212   2.847   -1.404  1.00 0.00 ? 853 LEU A HG   2  
ATOM 1468 H HD11 . LEU A 1 62 ? 7.016   2.807   -0.059  1.00 0.00 ? 853 LEU A HD11 2  
ATOM 1469 H HD12 . LEU A 1 62 ? 5.866   2.906   1.273   1.00 0.00 ? 853 LEU A HD12 2  
ATOM 1470 H HD13 . LEU A 1 62 ? 6.632   4.370   0.658   1.00 0.00 ? 853 LEU A HD13 2  
ATOM 1471 H HD21 . LEU A 1 62 ? 3.409   4.286   0.522   1.00 0.00 ? 853 LEU A HD21 2  
ATOM 1472 H HD22 . LEU A 1 62 ? 3.874   2.623   0.874   1.00 0.00 ? 853 LEU A HD22 2  
ATOM 1473 H HD23 . LEU A 1 62 ? 3.027   3.000   -0.624  1.00 0.00 ? 853 LEU A HD23 2  
ATOM 1474 N N    . LEU A 1 63 ? 5.597   6.546   -3.895  1.00 0.00 ? 854 LEU A N    2  
ATOM 1475 C CA   . LEU A 1 63 ? 5.833   7.763   -4.652  1.00 0.00 ? 854 LEU A CA   2  
ATOM 1476 C C    . LEU A 1 63 ? 4.789   7.887   -5.759  1.00 0.00 ? 854 LEU A C    2  
ATOM 1477 O O    . LEU A 1 63 ? 4.158   8.933   -5.925  1.00 0.00 ? 854 LEU A O    2  
ATOM 1478 C CB   . LEU A 1 63 ? 7.238   7.739   -5.270  1.00 0.00 ? 854 LEU A CB   2  
ATOM 1479 C CG   . LEU A 1 63 ? 8.133   8.772   -4.576  1.00 0.00 ? 854 LEU A CG   2  
ATOM 1480 C CD1  . LEU A 1 63 ? 8.573   8.242   -3.211  1.00 0.00 ? 854 LEU A CD1  2  
ATOM 1481 C CD2  . LEU A 1 63 ? 9.369   9.033   -5.440  1.00 0.00 ? 854 LEU A CD2  2  
ATOM 1482 H H    . LEU A 1 63 ? 6.243   5.807   -3.945  1.00 0.00 ? 854 LEU A H    2  
ATOM 1483 H HA   . LEU A 1 63 ? 5.750   8.612   -3.989  1.00 0.00 ? 854 LEU A HA   2  
ATOM 1484 H HB2  . LEU A 1 63 ? 7.665   6.754   -5.158  1.00 0.00 ? 854 LEU A HB2  2  
ATOM 1485 H HB3  . LEU A 1 63 ? 7.170   7.979   -6.321  1.00 0.00 ? 854 LEU A HB3  2  
ATOM 1486 H HG   . LEU A 1 63 ? 7.584   9.692   -4.444  1.00 0.00 ? 854 LEU A HG   2  
ATOM 1487 H HD11 . LEU A 1 63 ? 9.598   7.908   -3.266  1.00 0.00 ? 854 LEU A HD11 2  
ATOM 1488 H HD12 . LEU A 1 63 ? 7.942   7.415   -2.919  1.00 0.00 ? 854 LEU A HD12 2  
ATOM 1489 H HD13 . LEU A 1 63 ? 8.493   9.031   -2.479  1.00 0.00 ? 854 LEU A HD13 2  
ATOM 1490 H HD21 . LEU A 1 63 ? 10.195  9.320   -4.808  1.00 0.00 ? 854 LEU A HD21 2  
ATOM 1491 H HD22 . LEU A 1 63 ? 9.157   9.829   -6.138  1.00 0.00 ? 854 LEU A HD22 2  
ATOM 1492 H HD23 . LEU A 1 63 ? 9.625   8.138   -5.985  1.00 0.00 ? 854 LEU A HD23 2  
ATOM 1493 N N    . GLU A 1 64 ? 4.602   6.802   -6.503  1.00 0.00 ? 855 GLU A N    2  
ATOM 1494 C CA   . GLU A 1 64 ? 3.634   6.770   -7.591  1.00 0.00 ? 855 GLU A CA   2  
ATOM 1495 C C    . GLU A 1 64 ? 2.290   7.298   -7.133  1.00 0.00 ? 855 GLU A C    2  
ATOM 1496 O O    . GLU A 1 64 ? 1.682   8.137   -7.802  1.00 0.00 ? 855 GLU A O    2  
ATOM 1497 C CB   . GLU A 1 64 ? 3.470   5.341   -8.115  1.00 0.00 ? 855 GLU A CB   2  
ATOM 1498 C CG   . GLU A 1 64 ? 4.513   5.061   -9.198  1.00 0.00 ? 855 GLU A CG   2  
ATOM 1499 C CD   . GLU A 1 64 ? 3.845   4.457   -10.410 1.00 0.00 ? 855 GLU A CD   2  
ATOM 1500 O OE1  . GLU A 1 64 ? 2.905   5.050   -10.899 1.00 0.00 ? 855 GLU A OE1  2  
ATOM 1501 O OE2  . GLU A 1 64 ? 4.277   3.413   -10.835 1.00 0.00 ? 855 GLU A OE2  2  
ATOM 1502 H H    . GLU A 1 64 ? 5.127   5.996   -6.308  1.00 0.00 ? 855 GLU A H    2  
ATOM 1503 H HA   . GLU A 1 64 ? 3.995   7.394   -8.395  1.00 0.00 ? 855 GLU A HA   2  
ATOM 1504 N N    . ILE A 1 65 ? 1.821   6.803   -6.001  1.00 0.00 ? 856 ILE A N    2  
ATOM 1505 C CA   . ILE A 1 65 ? 0.536   7.239   -5.464  1.00 0.00 ? 856 ILE A CA   2  
ATOM 1506 C C    . ILE A 1 65 ? 0.695   8.536   -4.683  1.00 0.00 ? 856 ILE A C    2  
ATOM 1507 O O    . ILE A 1 65 ? -0.253  9.020   -4.059  1.00 0.00 ? 856 ILE A O    2  
ATOM 1508 C CB   . ILE A 1 65 ? -0.101  6.152   -4.571  1.00 0.00 ? 856 ILE A CB   2  
ATOM 1509 C CG1  . ILE A 1 65 ? 0.919   5.045   -4.262  1.00 0.00 ? 856 ILE A CG1  2  
ATOM 1510 C CG2  . ILE A 1 65 ? -1.289  5.538   -5.300  1.00 0.00 ? 856 ILE A CG2  2  
ATOM 1511 C CD1  . ILE A 1 65 ? 0.285   4.000   -3.342  1.00 0.00 ? 856 ILE A CD1  2  
ATOM 1512 H H    . ILE A 1 65 ? 2.353   6.132   -5.517  1.00 0.00 ? 856 ILE A H    2  
ATOM 1513 H HA   . ILE A 1 65 ? -0.127  7.432   -6.295  1.00 0.00 ? 856 ILE A HA   2  
ATOM 1514 H HB   . ILE A 1 65 ? -0.444  6.602   -3.650  1.00 0.00 ? 856 ILE A HB   2  
ATOM 1515 H HG12 . ILE A 1 65 ? 1.220   4.563   -5.181  1.00 0.00 ? 856 ILE A HG12 2  
ATOM 1516 H HG21 . ILE A 1 65 ? -2.158  6.160   -5.156  1.00 0.00 ? 856 ILE A HG21 2  
ATOM 1517 H HG22 . ILE A 1 65 ? -1.479  4.550   -4.910  1.00 0.00 ? 856 ILE A HG22 2  
ATOM 1518 H HG23 . ILE A 1 65 ? -1.066  5.471   -6.354  1.00 0.00 ? 856 ILE A HG23 2  
ATOM 1519 H HD11 . ILE A 1 65 ? 0.118   4.428   -2.366  1.00 0.00 ? 856 ILE A HD11 2  
ATOM 1520 H HD12 . ILE A 1 65 ? 0.951   3.152   -3.255  1.00 0.00 ? 856 ILE A HD12 2  
ATOM 1521 H HD13 . ILE A 1 65 ? -0.655  3.673   -3.761  1.00 0.00 ? 856 ILE A HD13 2  
ATOM 1522 N N    . GLY A 1 66 ? 1.888   9.098   -4.729  1.00 0.00 ? 857 GLY A N    2  
ATOM 1523 C CA   . GLY A 1 66 ? 2.167   10.340  -4.030  1.00 0.00 ? 857 GLY A CA   2  
ATOM 1524 C C    . GLY A 1 66 ? 1.870   10.203  -2.549  1.00 0.00 ? 857 GLY A C    2  
ATOM 1525 O O    . GLY A 1 66 ? 1.317   11.119  -1.927  1.00 0.00 ? 857 GLY A O    2  
ATOM 1526 H H    . GLY A 1 66 ? 2.603   8.667   -5.246  1.00 0.00 ? 857 GLY A H    2  
ATOM 1527 H HA2  . GLY A 1 66 ? 3.208   10.598  -4.165  1.00 0.00 ? 857 GLY A HA2  2  
ATOM 1528 H HA3  . GLY A 1 66 ? 1.550   11.124  -4.442  1.00 0.00 ? 857 GLY A HA3  2  
ATOM 1529 N N    . ILE A 1 67 ? 2.237   9.065   -1.981  1.00 0.00 ? 858 ILE A N    2  
ATOM 1530 C CA   . ILE A 1 67 ? 2.014   8.826   -0.565  1.00 0.00 ? 858 ILE A CA   2  
ATOM 1531 C C    . ILE A 1 67 ? 2.887   9.764   0.260   1.00 0.00 ? 858 ILE A C    2  
ATOM 1532 O O    . ILE A 1 67 ? 4.078   9.934   -0.031  1.00 0.00 ? 858 ILE A O    2  
ATOM 1533 C CB   . ILE A 1 67 ? 2.331   7.370   -0.216  1.00 0.00 ? 858 ILE A CB   2  
ATOM 1534 C CG1  . ILE A 1 67 ? 1.409   6.429   -1.014  1.00 0.00 ? 858 ILE A CG1  2  
ATOM 1535 C CG2  . ILE A 1 67 ? 2.115   7.142   1.276   1.00 0.00 ? 858 ILE A CG2  2  
ATOM 1536 C CD1  . ILE A 1 67 ? -0.045  6.587   -0.539  1.00 0.00 ? 858 ILE A CD1  2  
ATOM 1537 H H    . ILE A 1 67 ? 2.679   8.372   -2.524  1.00 0.00 ? 858 ILE A H    2  
ATOM 1538 H HA   . ILE A 1 67 ? 0.977   9.022   -0.339  1.00 0.00 ? 858 ILE A HA   2  
ATOM 1539 H HB   . ILE A 1 67 ? 3.361   7.164   -0.465  1.00 0.00 ? 858 ILE A HB   2  
ATOM 1540 H HG12 . ILE A 1 67 ? 1.473   6.668   -2.064  1.00 0.00 ? 858 ILE A HG12 2  
ATOM 1541 H HG21 . ILE A 1 67 ? 1.100   7.405   1.537   1.00 0.00 ? 858 ILE A HG21 2  
ATOM 1542 H HG22 . ILE A 1 67 ? 2.801   7.751   1.843   1.00 0.00 ? 858 ILE A HG22 2  
ATOM 1543 H HG23 . ILE A 1 67 ? 2.282   6.101   1.502   1.00 0.00 ? 858 ILE A HG23 2  
ATOM 1544 H HD11 . ILE A 1 67 ? -0.515  7.391   -1.084  1.00 0.00 ? 858 ILE A HD11 2  
ATOM 1545 H HD12 . ILE A 1 67 ? -0.068  6.810   0.517   1.00 0.00 ? 858 ILE A HD12 2  
ATOM 1546 H HD13 . ILE A 1 67 ? -0.586  5.669   -0.719  1.00 0.00 ? 858 ILE A HD13 2  
ATOM 1547 N N    . LEU A 1 68 ? 2.291   10.394  1.260   1.00 0.00 ? 859 LEU A N    2  
ATOM 1548 C CA   . LEU A 1 68 ? 3.015   11.345  2.097   1.00 0.00 ? 859 LEU A CA   2  
ATOM 1549 C C    . LEU A 1 68 ? 3.525   10.698  3.380   1.00 0.00 ? 859 LEU A C    2  
ATOM 1550 O O    . LEU A 1 68 ? 4.727   10.474  3.537   1.00 0.00 ? 859 LEU A O    2  
ATOM 1551 C CB   . LEU A 1 68 ? 2.119   12.541  2.435   1.00 0.00 ? 859 LEU A CB   2  
ATOM 1552 C CG   . LEU A 1 68 ? 2.061   13.502  1.240   1.00 0.00 ? 859 LEU A CG   2  
ATOM 1553 C CD1  . LEU A 1 68 ? 1.107   14.651  1.555   1.00 0.00 ? 859 LEU A CD1  2  
ATOM 1554 C CD2  . LEU A 1 68 ? 3.458   14.071  0.960   1.00 0.00 ? 859 LEU A CD2  2  
ATOM 1555 H H    . LEU A 1 68 ? 1.338   10.232  1.428   1.00 0.00 ? 859 LEU A H    2  
ATOM 1556 H HA   . LEU A 1 68 ? 3.869   11.709  1.543   1.00 0.00 ? 859 LEU A HA   2  
ATOM 1557 H HB2  . LEU A 1 68 ? 1.124   12.188  2.667   1.00 0.00 ? 859 LEU A HB2  2  
ATOM 1558 H HB3  . LEU A 1 68 ? 2.520   13.060  3.293   1.00 0.00 ? 859 LEU A HB3  2  
ATOM 1559 H HG   . LEU A 1 68 ? 1.702   12.971  0.370   1.00 0.00 ? 859 LEU A HG   2  
ATOM 1560 H HD11 . LEU A 1 68 ? 1.402   15.123  2.480   1.00 0.00 ? 859 LEU A HD11 2  
ATOM 1561 H HD12 . LEU A 1 68 ? 0.100   14.271  1.651   1.00 0.00 ? 859 LEU A HD12 2  
ATOM 1562 H HD13 . LEU A 1 68 ? 1.142   15.377  0.755   1.00 0.00 ? 859 LEU A HD13 2  
ATOM 1563 H HD21 . LEU A 1 68 ? 4.034   14.093  1.873   1.00 0.00 ? 859 LEU A HD21 2  
ATOM 1564 H HD22 . LEU A 1 68 ? 3.367   15.074  0.570   1.00 0.00 ? 859 LEU A HD22 2  
ATOM 1565 H HD23 . LEU A 1 68 ? 3.961   13.450  0.232   1.00 0.00 ? 859 LEU A HD23 2  
ATOM 1566 N N    . ASN A 1 69 ? 2.610   10.449  4.315   1.00 0.00 ? 860 ASN A N    2  
ATOM 1567 C CA   . ASN A 1 69 ? 2.969   9.882   5.619   1.00 0.00 ? 860 ASN A CA   2  
ATOM 1568 C C    . ASN A 1 69 ? 4.008   8.770   5.492   1.00 0.00 ? 860 ASN A C    2  
ATOM 1569 O O    . ASN A 1 69 ? 3.683   7.635   5.123   1.00 0.00 ? 860 ASN A O    2  
ATOM 1570 C CB   . ASN A 1 69 ? 1.725   9.351   6.336   1.00 0.00 ? 860 ASN A CB   2  
ATOM 1571 C CG   . ASN A 1 69 ? 2.085   8.926   7.759   1.00 0.00 ? 860 ASN A CG   2  
ATOM 1572 O OD1  . ASN A 1 69 ? 2.929   8.051   7.951   1.00 0.00 ? 860 ASN A OD1  2  
ATOM 1573 N ND2  . ASN A 1 69 ? 1.496   9.493   8.770   1.00 0.00 ? 860 ASN A ND2  2  
ATOM 1574 H H    . ASN A 1 69 ? 1.675   10.686  4.140   1.00 0.00 ? 860 ASN A H    2  
ATOM 1575 H HA   . ASN A 1 69 ? 3.389   10.673  6.220   1.00 0.00 ? 860 ASN A HA   2  
ATOM 1576 H HB2  . ASN A 1 69 ? 0.975   10.127  6.370   1.00 0.00 ? 860 ASN A HB2  2  
ATOM 1577 H HB3  . ASN A 1 69 ? 1.338   8.500   5.797   1.00 0.00 ? 860 ASN A HB3  2  
ATOM 1578 H HD21 . ASN A 1 69 ? 0.825   10.192  8.621   1.00 0.00 ? 860 ASN A HD21 2  
ATOM 1579 H HD22 . ASN A 1 69 ? 1.723   9.221   9.682   1.00 0.00 ? 860 ASN A HD22 2  
ATOM 1580 N N    . SER A 1 70 ? 5.251   9.096   5.818   1.00 0.00 ? 861 SER A N    2  
ATOM 1581 C CA   . SER A 1 70 ? 6.333   8.128   5.761   1.00 0.00 ? 861 SER A CA   2  
ATOM 1582 C C    . SER A 1 70 ? 6.013   6.917   6.633   1.00 0.00 ? 861 SER A C    2  
ATOM 1583 O O    . SER A 1 70 ? 6.301   5.778   6.262   1.00 0.00 ? 861 SER A O    2  
ATOM 1584 C CB   . SER A 1 70 ? 7.637   8.780   6.220   1.00 0.00 ? 861 SER A CB   2  
ATOM 1585 O OG   . SER A 1 70 ? 7.493   10.204  6.181   1.00 0.00 ? 861 SER A OG   2  
ATOM 1586 H H    . SER A 1 70 ? 5.447   10.009  6.117   1.00 0.00 ? 861 SER A H    2  
ATOM 1587 H HA   . SER A 1 70 ? 6.452   7.801   4.739   1.00 0.00 ? 861 SER A HA   2  
ATOM 1588 H HB2  . SER A 1 70 ? 7.864   8.473   7.230   1.00 0.00 ? 861 SER A HB2  2  
ATOM 1589 H HB3  . SER A 1 70 ? 8.439   8.462   5.568   1.00 0.00 ? 861 SER A HB3  2  
ATOM 1590 H HG   . SER A 1 70 ? 7.676   10.542  7.067   1.00 0.00 ? 861 SER A HG   2  
ATOM 1591 N N    . GLY A 1 71 ? 5.390   7.167   7.775   1.00 0.00 ? 862 GLY A N    2  
ATOM 1592 C CA   . GLY A 1 71 ? 5.004   6.093   8.678   1.00 0.00 ? 862 GLY A CA   2  
ATOM 1593 C C    . GLY A 1 71 ? 4.101   5.121   7.961   1.00 0.00 ? 862 GLY A C    2  
ATOM 1594 O O    . GLY A 1 71 ? 4.368   3.918   7.917   1.00 0.00 ? 862 GLY A O    2  
ATOM 1595 H H    . GLY A 1 71 ? 5.157   8.092   8.002   1.00 0.00 ? 862 GLY A H    2  
ATOM 1596 H HA2  . GLY A 1 71 ? 5.888   5.580   9.022   1.00 0.00 ? 862 GLY A HA2  2  
ATOM 1597 H HA3  . GLY A 1 71 ? 4.475   6.507   9.523   1.00 0.00 ? 862 GLY A HA3  2  
ATOM 1598 N N    . HIS A 1 72 ? 3.058   5.649   7.351   1.00 0.00 ? 863 HIS A N    2  
ATOM 1599 C CA   . HIS A 1 72 ? 2.142   4.828   6.591   1.00 0.00 ? 863 HIS A CA   2  
ATOM 1600 C C    . HIS A 1 72 ? 2.881   4.150   5.455   1.00 0.00 ? 863 HIS A C    2  
ATOM 1601 O O    . HIS A 1 72 ? 2.642   2.982   5.159   1.00 0.00 ? 863 HIS A O    2  
ATOM 1602 C CB   . HIS A 1 72 ? 0.993   5.669   6.037   1.00 0.00 ? 863 HIS A CB   2  
ATOM 1603 C CG   . HIS A 1 72 ? 0.316   6.408   7.155   1.00 0.00 ? 863 HIS A CG   2  
ATOM 1604 N ND1  . HIS A 1 72 ? 0.635   6.189   8.487   1.00 0.00 ? 863 HIS A ND1  2  
ATOM 1605 C CD2  . HIS A 1 72 ? -0.678  7.355   7.158   1.00 0.00 ? 863 HIS A CD2  2  
ATOM 1606 C CE1  . HIS A 1 72 ? -0.157  6.986   9.228   1.00 0.00 ? 863 HIS A CE1  2  
ATOM 1607 N NE2  . HIS A 1 72 ? -0.975  7.717   8.469   1.00 0.00 ? 863 HIS A NE2  2  
ATOM 1608 H H    . HIS A 1 72 ? 2.921   6.624   7.393   1.00 0.00 ? 863 HIS A H    2  
ATOM 1609 H HA   . HIS A 1 72 ? 1.732   4.070   7.243   1.00 0.00 ? 863 HIS A HA   2  
ATOM 1610 H HB2  . HIS A 1 72 ? 1.371   6.371   5.313   1.00 0.00 ? 863 HIS A HB2  2  
ATOM 1611 H HB3  . HIS A 1 72 ? 0.280   5.018   5.556   1.00 0.00 ? 863 HIS A HB3  2  
ATOM 1612 N N    . ARG A 1 73 ? 3.794   4.884   4.823   1.00 0.00 ? 864 ARG A N    2  
ATOM 1613 C CA   . ARG A 1 73 ? 4.575   4.330   3.724   1.00 0.00 ? 864 ARG A CA   2  
ATOM 1614 C C    . ARG A 1 73 ? 5.288   3.058   4.167   1.00 0.00 ? 864 ARG A C    2  
ATOM 1615 O O    . ARG A 1 73 ? 5.091   1.988   3.581   1.00 0.00 ? 864 ARG A O    2  
ATOM 1616 C CB   . ARG A 1 73 ? 5.617   5.341   3.239   1.00 0.00 ? 864 ARG A CB   2  
ATOM 1617 C CG   . ARG A 1 73 ? 4.957   6.422   2.372   1.00 0.00 ? 864 ARG A CG   2  
ATOM 1618 C CD   . ARG A 1 73 ? 6.040   7.229   1.632   1.00 0.00 ? 864 ARG A CD   2  
ATOM 1619 N NE   . ARG A 1 73 ? 7.368   6.687   1.939   1.00 0.00 ? 864 ARG A NE   2  
ATOM 1620 C CZ   . ARG A 1 73 ? 8.253   6.388   0.987   1.00 0.00 ? 864 ARG A CZ   2  
ATOM 1621 N NH1  . ARG A 1 73 ? 8.013   6.697   -0.262  1.00 0.00 ? 864 ARG A NH1  2  
ATOM 1622 N NH2  . ARG A 1 73 ? 9.374   5.810   1.312   1.00 0.00 ? 864 ARG A NH2  2  
ATOM 1623 H H    . ARG A 1 73 ? 3.946   5.813   5.109   1.00 0.00 ? 864 ARG A H    2  
ATOM 1624 H HA   . ARG A 1 73 ? 3.913   4.092   2.905   1.00 0.00 ? 864 ARG A HA   2  
ATOM 1625 N N    . GLN A 1 74 ? 6.107   3.173   5.210   1.00 0.00 ? 865 GLN A N    2  
ATOM 1626 C CA   . GLN A 1 74 ? 6.835   2.016   5.711   1.00 0.00 ? 865 GLN A CA   2  
ATOM 1627 C C    . GLN A 1 74 ? 5.875   0.989   6.269   1.00 0.00 ? 865 GLN A C    2  
ATOM 1628 O O    . GLN A 1 74 ? 6.069   -0.214  6.091   1.00 0.00 ? 865 GLN A O    2  
ATOM 1629 C CB   . GLN A 1 74 ? 7.878   2.416   6.766   1.00 0.00 ? 865 GLN A CB   2  
ATOM 1630 C CG   . GLN A 1 74 ? 7.225   3.214   7.899   1.00 0.00 ? 865 GLN A CG   2  
ATOM 1631 C CD   . GLN A 1 74 ? 8.304   3.851   8.767   1.00 0.00 ? 865 GLN A CD   2  
ATOM 1632 O OE1  . GLN A 1 74 ? 8.037   4.816   9.487   1.00 0.00 ? 865 GLN A OE1  2  
ATOM 1633 N NE2  . GLN A 1 74 ? 9.511   3.373   8.744   1.00 0.00 ? 865 GLN A NE2  2  
ATOM 1634 H H    . GLN A 1 74 ? 6.220   4.047   5.641   1.00 0.00 ? 865 GLN A H    2  
ATOM 1635 H HA   . GLN A 1 74 ? 7.353   1.565   4.875   1.00 0.00 ? 865 GLN A HA   2  
ATOM 1636 H HB2  . GLN A 1 74 ? 8.332   1.524   7.171   1.00 0.00 ? 865 GLN A HB2  2  
ATOM 1637 H HB3  . GLN A 1 74 ? 8.637   3.021   6.296   1.00 0.00 ? 865 GLN A HB3  2  
ATOM 1638 H HG2  . GLN A 1 74 ? 6.599   3.986   7.483   1.00 0.00 ? 865 GLN A HG2  2  
ATOM 1639 H HG3  . GLN A 1 74 ? 6.624   2.554   8.508   1.00 0.00 ? 865 GLN A HG3  2  
ATOM 1640 H HE21 . GLN A 1 74 ? 9.724   2.608   8.169   1.00 0.00 ? 865 GLN A HE21 2  
ATOM 1641 H HE22 . GLN A 1 74 ? 10.214  3.773   9.299   1.00 0.00 ? 865 GLN A HE22 2  
ATOM 1642 N N    . ARG A 1 75 ? 4.804   1.464   6.898   1.00 0.00 ? 866 ARG A N    2  
ATOM 1643 C CA   . ARG A 1 75 ? 3.790   0.561   7.419   1.00 0.00 ? 866 ARG A CA   2  
ATOM 1644 C C    . ARG A 1 75 ? 3.259   -0.285  6.278   1.00 0.00 ? 866 ARG A C    2  
ATOM 1645 O O    . ARG A 1 75 ? 3.289   -1.507  6.335   1.00 0.00 ? 866 ARG A O    2  
ATOM 1646 C CB   . ARG A 1 75 ? 2.629   1.347   8.050   1.00 0.00 ? 866 ARG A CB   2  
ATOM 1647 C CG   . ARG A 1 75 ? 2.964   1.729   9.503   1.00 0.00 ? 866 ARG A CG   2  
ATOM 1648 C CD   . ARG A 1 75 ? 1.913   1.131   10.462  1.00 0.00 ? 866 ARG A CD   2  
ATOM 1649 N NE   . ARG A 1 75 ? 2.520   0.092   11.292  1.00 0.00 ? 866 ARG A NE   2  
ATOM 1650 C CZ   . ARG A 1 75 ? 1.878   -0.457  12.327  1.00 0.00 ? 866 ARG A CZ   2  
ATOM 1651 N NH1  . ARG A 1 75 ? 0.628   -0.158  12.562  1.00 0.00 ? 866 ARG A NH1  2  
ATOM 1652 N NH2  . ARG A 1 75 ? 2.493   -1.313  13.087  1.00 0.00 ? 866 ARG A NH2  2  
ATOM 1653 H H    . ARG A 1 75 ? 4.684   2.436   6.978   1.00 0.00 ? 866 ARG A H    2  
ATOM 1654 H HA   . ARG A 1 75 ? 4.232   -0.084  8.163   1.00 0.00 ? 866 ARG A HA   2  
ATOM 1655 N N    . ILE A 1 76 ? 2.805   0.383   5.227   1.00 0.00 ? 867 ILE A N    2  
ATOM 1656 C CA   . ILE A 1 76 ? 2.295   -0.299  4.053   1.00 0.00 ? 867 ILE A CA   2  
ATOM 1657 C C    . ILE A 1 76 ? 3.354   -1.236  3.485   1.00 0.00 ? 867 ILE A C    2  
ATOM 1658 O O    . ILE A 1 76 ? 3.098   -2.424  3.284   1.00 0.00 ? 867 ILE A O    2  
ATOM 1659 C CB   . ILE A 1 76 ? 1.875   0.731   2.990   1.00 0.00 ? 867 ILE A CB   2  
ATOM 1660 C CG1  . ILE A 1 76 ? 0.705   1.577   3.526   1.00 0.00 ? 867 ILE A CG1  2  
ATOM 1661 C CG2  . ILE A 1 76 ? 1.446   0.016   1.699   1.00 0.00 ? 867 ILE A CG2  2  
ATOM 1662 C CD1  . ILE A 1 76 ? -0.626  0.880   3.233   1.00 0.00 ? 867 ILE A CD1  2  
ATOM 1663 H H    . ILE A 1 76 ? 2.833   1.365   5.235   1.00 0.00 ? 867 ILE A H    2  
ATOM 1664 H HA   . ILE A 1 76 ? 1.429   -0.879  4.334   1.00 0.00 ? 867 ILE A HA   2  
ATOM 1665 H HB   . ILE A 1 76 ? 2.716   1.375   2.772   1.00 0.00 ? 867 ILE A HB   2  
ATOM 1666 H HG12 . ILE A 1 76 ? 0.810   1.708   4.593   1.00 0.00 ? 867 ILE A HG12 2  
ATOM 1667 H HG21 . ILE A 1 76 ? 2.314   -0.397  1.207   1.00 0.00 ? 867 ILE A HG21 2  
ATOM 1668 H HG22 . ILE A 1 76 ? 0.964   0.724   1.040   1.00 0.00 ? 867 ILE A HG22 2  
ATOM 1669 H HG23 . ILE A 1 76 ? 0.754   -0.778  1.937   1.00 0.00 ? 867 ILE A HG23 2  
ATOM 1670 H HD11 . ILE A 1 76 ? -0.821  0.909   2.171   1.00 0.00 ? 867 ILE A HD11 2  
ATOM 1671 H HD12 . ILE A 1 76 ? -1.419  1.387   3.757   1.00 0.00 ? 867 ILE A HD12 2  
ATOM 1672 H HD13 . ILE A 1 76 ? -0.575  -0.147  3.562   1.00 0.00 ? 867 ILE A HD13 2  
ATOM 1673 N N    . LEU A 1 77 ? 4.542   -0.695  3.229   1.00 0.00 ? 868 LEU A N    2  
ATOM 1674 C CA   . LEU A 1 77 ? 5.634   -1.488  2.667   1.00 0.00 ? 868 LEU A CA   2  
ATOM 1675 C C    . LEU A 1 77 ? 5.891   -2.725  3.514   1.00 0.00 ? 868 LEU A C    2  
ATOM 1676 O O    . LEU A 1 77 ? 5.891   -3.853  3.007   1.00 0.00 ? 868 LEU A O    2  
ATOM 1677 C CB   . LEU A 1 77 ? 6.915   -0.644  2.574   1.00 0.00 ? 868 LEU A CB   2  
ATOM 1678 C CG   . LEU A 1 77 ? 7.812   -1.181  1.445   1.00 0.00 ? 868 LEU A CG   2  
ATOM 1679 C CD1  . LEU A 1 77 ? 7.256   -0.743  0.086   1.00 0.00 ? 868 LEU A CD1  2  
ATOM 1680 C CD2  . LEU A 1 77 ? 9.230   -0.628  1.612   1.00 0.00 ? 868 LEU A CD2  2  
ATOM 1681 H H    . LEU A 1 77 ? 4.684   0.260   3.413   1.00 0.00 ? 868 LEU A H    2  
ATOM 1682 H HA   . LEU A 1 77 ? 5.354   -1.802  1.676   1.00 0.00 ? 868 LEU A HA   2  
ATOM 1683 H HB2  . LEU A 1 77 ? 6.653   0.385   2.372   1.00 0.00 ? 868 LEU A HB2  2  
ATOM 1684 H HB3  . LEU A 1 77 ? 7.449   -0.699  3.511   1.00 0.00 ? 868 LEU A HB3  2  
ATOM 1685 H HG   . LEU A 1 77 ? 7.837   -2.261  1.489   1.00 0.00 ? 868 LEU A HG   2  
ATOM 1686 H HD11 . LEU A 1 77 ? 6.444   -1.394  -0.201  1.00 0.00 ? 868 LEU A HD11 2  
ATOM 1687 H HD12 . LEU A 1 77 ? 8.039   -0.797  -0.655  1.00 0.00 ? 868 LEU A HD12 2  
ATOM 1688 H HD13 . LEU A 1 77 ? 6.896   0.274   0.151   1.00 0.00 ? 868 LEU A HD13 2  
ATOM 1689 H HD21 . LEU A 1 77 ? 9.823   -0.889  0.747   1.00 0.00 ? 868 LEU A HD21 2  
ATOM 1690 H HD22 . LEU A 1 77 ? 9.683   -1.051  2.496   1.00 0.00 ? 868 LEU A HD22 2  
ATOM 1691 H HD23 . LEU A 1 77 ? 9.190   0.448   1.708   1.00 0.00 ? 868 LEU A HD23 2  
ATOM 1692 N N    . GLN A 1 78 ? 6.088   -2.521  4.798   1.00 0.00 ? 869 GLN A N    2  
ATOM 1693 C CA   . GLN A 1 78 ? 6.325   -3.633  5.698   1.00 0.00 ? 869 GLN A CA   2  
ATOM 1694 C C    . GLN A 1 78 ? 5.083   -4.504  5.794   1.00 0.00 ? 869 GLN A C    2  
ATOM 1695 O O    . GLN A 1 78 ? 5.175   -5.734  5.827   1.00 0.00 ? 869 GLN A O    2  
ATOM 1696 C CB   . GLN A 1 78 ? 6.719   -3.125  7.090   1.00 0.00 ? 869 GLN A CB   2  
ATOM 1697 C CG   . GLN A 1 78 ? 8.106   -2.474  7.027   1.00 0.00 ? 869 GLN A CG   2  
ATOM 1698 C CD   . GLN A 1 78 ? 9.169   -3.532  6.757   1.00 0.00 ? 869 GLN A CD   2  
ATOM 1699 O OE1  . GLN A 1 78 ? 9.600   -3.703  5.615   1.00 0.00 ? 869 GLN A OE1  2  
ATOM 1700 N NE2  . GLN A 1 78 ? 9.619   -4.255  7.733   1.00 0.00 ? 869 GLN A NE2  2  
ATOM 1701 H H    . GLN A 1 78 ? 6.059   -1.604  5.148   1.00 0.00 ? 869 GLN A H    2  
ATOM 1702 H HA   . GLN A 1 78 ? 7.134   -4.230  5.305   1.00 0.00 ? 869 GLN A HA   2  
ATOM 1703 H HB2  . GLN A 1 78 ? 5.992   -2.400  7.428   1.00 0.00 ? 869 GLN A HB2  2  
ATOM 1704 H HB3  . GLN A 1 78 ? 6.745   -3.955  7.782   1.00 0.00 ? 869 GLN A HB3  2  
ATOM 1705 H HG2  . GLN A 1 78 ? 8.120   -1.737  6.237   1.00 0.00 ? 869 GLN A HG2  2  
ATOM 1706 H HG3  . GLN A 1 78 ? 8.317   -1.988  7.968   1.00 0.00 ? 869 GLN A HG3  2  
ATOM 1707 H HE21 . GLN A 1 78 ? 9.276   -4.123  8.641   1.00 0.00 ? 869 GLN A HE21 2  
ATOM 1708 H HE22 . GLN A 1 78 ? 10.306  -4.936  7.563   1.00 0.00 ? 869 GLN A HE22 2  
ATOM 1709 N N    . ALA A 1 79 ? 3.921   -3.865  5.845   1.00 0.00 ? 870 ALA A N    2  
ATOM 1710 C CA   . ALA A 1 79 ? 2.668   -4.591  5.957   1.00 0.00 ? 870 ALA A CA   2  
ATOM 1711 C C    . ALA A 1 79 ? 2.475   -5.530  4.784   1.00 0.00 ? 870 ALA A C    2  
ATOM 1712 O O    . ALA A 1 79 ? 2.214   -6.716  4.977   1.00 0.00 ? 870 ALA A O    2  
ATOM 1713 C CB   . ALA A 1 79 ? 1.492   -3.624  6.044   1.00 0.00 ? 870 ALA A CB   2  
ATOM 1714 H H    . ALA A 1 79 ? 3.910   -2.883  5.821   1.00 0.00 ? 870 ALA A H    2  
ATOM 1715 H HA   . ALA A 1 79 ? 2.693   -5.177  6.863   1.00 0.00 ? 870 ALA A HA   2  
ATOM 1716 H HB1  . ALA A 1 79 ? 1.632   -2.970  6.890   1.00 0.00 ? 870 ALA A HB1  2  
ATOM 1717 H HB2  . ALA A 1 79 ? 0.575   -4.182  6.171   1.00 0.00 ? 870 ALA A HB2  2  
ATOM 1718 H HB3  . ALA A 1 79 ? 1.436   -3.038  5.139   1.00 0.00 ? 870 ALA A HB3  2  
ATOM 1719 N N    . ILE A 1 80 ? 2.642   -5.026  3.560   1.00 0.00 ? 871 ILE A N    2  
ATOM 1720 C CA   . ILE A 1 80 ? 2.501   -5.889  2.407   1.00 0.00 ? 871 ILE A CA   2  
ATOM 1721 C C    . ILE A 1 80 ? 3.533   -6.992  2.477   1.00 0.00 ? 871 ILE A C    2  
ATOM 1722 O O    . ILE A 1 80 ? 3.229   -8.153  2.232   1.00 0.00 ? 871 ILE A O    2  
ATOM 1723 C CB   . ILE A 1 80 ? 2.612   -5.114  1.079   1.00 0.00 ? 871 ILE A CB   2  
ATOM 1724 C CG1  . ILE A 1 80 ? 3.972   -4.425  0.960   1.00 0.00 ? 871 ILE A CG1  2  
ATOM 1725 C CG2  . ILE A 1 80 ? 1.508   -4.066  0.987   1.00 0.00 ? 871 ILE A CG2  2  
ATOM 1726 C CD1  . ILE A 1 80 ? 4.073   -3.758  -0.414  1.00 0.00 ? 871 ILE A CD1  2  
ATOM 1727 H H    . ILE A 1 80 ? 2.880   -4.081  3.437   1.00 0.00 ? 871 ILE A H    2  
ATOM 1728 H HA   . ILE A 1 80 ? 1.524   -6.349  2.456   1.00 0.00 ? 871 ILE A HA   2  
ATOM 1729 H HB   . ILE A 1 80 ? 2.487   -5.810  0.269   1.00 0.00 ? 871 ILE A HB   2  
ATOM 1730 H HG12 . ILE A 1 80 ? 4.062   -3.674  1.729   1.00 0.00 ? 871 ILE A HG12 2  
ATOM 1731 H HG21 . ILE A 1 80 ? 1.361   -3.794  -0.049  1.00 0.00 ? 871 ILE A HG21 2  
ATOM 1732 H HG22 . ILE A 1 80 ? 1.798   -3.190  1.546   1.00 0.00 ? 871 ILE A HG22 2  
ATOM 1733 H HG23 . ILE A 1 80 ? 0.590   -4.469  1.385   1.00 0.00 ? 871 ILE A HG23 2  
ATOM 1734 H HD11 . ILE A 1 80 ? 4.060   -4.514  -1.188  1.00 0.00 ? 871 ILE A HD11 2  
ATOM 1735 H HD12 . ILE A 1 80 ? 4.991   -3.194  -0.472  1.00 0.00 ? 871 ILE A HD12 2  
ATOM 1736 H HD13 . ILE A 1 80 ? 3.235   -3.092  -0.551  1.00 0.00 ? 871 ILE A HD13 2  
ATOM 1737 N N    . GLN A 1 81 ? 4.742   -6.635  2.888   1.00 0.00 ? 872 GLN A N    2  
ATOM 1738 C CA   . GLN A 1 81 ? 5.793   -7.623  3.058   1.00 0.00 ? 872 GLN A CA   2  
ATOM 1739 C C    . GLN A 1 81 ? 5.420   -8.593  4.173   1.00 0.00 ? 872 GLN A C    2  
ATOM 1740 O O    . GLN A 1 81 ? 5.968   -9.695  4.262   1.00 0.00 ? 872 GLN A O    2  
ATOM 1741 C CB   . GLN A 1 81 ? 7.124   -6.940  3.377   1.00 0.00 ? 872 GLN A CB   2  
ATOM 1742 C CG   . GLN A 1 81 ? 7.764   -6.435  2.079   1.00 0.00 ? 872 GLN A CG   2  
ATOM 1743 C CD   . GLN A 1 81 ? 8.591   -7.545  1.444   1.00 0.00 ? 872 GLN A CD   2  
ATOM 1744 O OE1  . GLN A 1 81 ? 8.037   -8.447  0.800   1.00 0.00 ? 872 GLN A OE1  2  
ATOM 1745 N NE2  . GLN A 1 81 ? 9.878   -7.548  1.592   1.00 0.00 ? 872 GLN A NE2  2  
ATOM 1746 H H    . GLN A 1 81 ? 4.917   -5.696  3.121   1.00 0.00 ? 872 GLN A H    2  
ATOM 1747 H HA   . GLN A 1 81 ? 5.897   -8.180  2.138   1.00 0.00 ? 872 GLN A HA   2  
ATOM 1748 H HB2  . GLN A 1 81 ? 6.954   -6.109  4.045   1.00 0.00 ? 872 GLN A HB2  2  
ATOM 1749 H HB3  . GLN A 1 81 ? 7.789   -7.650  3.848   1.00 0.00 ? 872 GLN A HB3  2  
ATOM 1750 H HG2  . GLN A 1 81 ? 6.992   -6.121  1.391   1.00 0.00 ? 872 GLN A HG2  2  
ATOM 1751 H HG3  . GLN A 1 81 ? 8.406   -5.594  2.298   1.00 0.00 ? 872 GLN A HG3  2  
ATOM 1752 H HE21 . GLN A 1 81 ? 10.312  -6.838  2.111   1.00 0.00 ? 872 GLN A HE21 2  
ATOM 1753 H HE22 . GLN A 1 81 ? 10.419  -8.256  1.184   1.00 0.00 ? 872 GLN A HE22 2  
ATOM 1754 N N    . LEU A 1 82 ? 4.475   -8.181  5.015   1.00 0.00 ? 873 LEU A N    2  
ATOM 1755 C CA   . LEU A 1 82 ? 4.006   -9.015  6.121   1.00 0.00 ? 873 LEU A CA   2  
ATOM 1756 C C    . LEU A 1 82 ? 2.833   -9.882  5.679   1.00 0.00 ? 873 LEU A C    2  
ATOM 1757 O O    . LEU A 1 82 ? 2.286   -10.652 6.473   1.00 0.00 ? 873 LEU A O    2  
ATOM 1758 C CB   . LEU A 1 82 ? 3.576   -8.132  7.308   1.00 0.00 ? 873 LEU A CB   2  
ATOM 1759 C CG   . LEU A 1 82 ? 4.338   -8.541  8.579   1.00 0.00 ? 873 LEU A CG   2  
ATOM 1760 C CD1  . LEU A 1 82 ? 3.924   -9.952  9.004   1.00 0.00 ? 873 LEU A CD1  2  
ATOM 1761 C CD2  . LEU A 1 82 ? 5.846   -8.507  8.309   1.00 0.00 ? 873 LEU A CD2  2  
ATOM 1762 H H    . LEU A 1 82 ? 4.076   -7.293  4.888   1.00 0.00 ? 873 LEU A H    2  
ATOM 1763 H HA   . LEU A 1 82 ? 4.810   -9.658  6.438   1.00 0.00 ? 873 LEU A HA   2  
ATOM 1764 H HB2  . LEU A 1 82 ? 3.787   -7.098  7.081   1.00 0.00 ? 873 LEU A HB2  2  
ATOM 1765 H HB3  . LEU A 1 82 ? 2.515   -8.247  7.478   1.00 0.00 ? 873 LEU A HB3  2  
ATOM 1766 H HG   . LEU A 1 82 ? 4.096   -7.849  9.374   1.00 0.00 ? 873 LEU A HG   2  
ATOM 1767 H HD11 . LEU A 1 82 ? 4.305   -10.673 8.297   1.00 0.00 ? 873 LEU A HD11 2  
ATOM 1768 H HD12 . LEU A 1 82 ? 2.847   -10.019 9.039   1.00 0.00 ? 873 LEU A HD12 2  
ATOM 1769 H HD13 . LEU A 1 82 ? 4.327   -10.165 9.984   1.00 0.00 ? 873 LEU A HD13 2  
ATOM 1770 H HD21 . LEU A 1 82 ? 6.032   -8.016  7.365   1.00 0.00 ? 873 LEU A HD21 2  
ATOM 1771 H HD22 . LEU A 1 82 ? 6.232   -9.514  8.277   1.00 0.00 ? 873 LEU A HD22 2  
ATOM 1772 H HD23 . LEU A 1 82 ? 6.340   -7.960  9.097   1.00 0.00 ? 873 LEU A HD23 2  
ATOM 1773 N N    . LEU A 1 83 ? 2.428   -9.739  4.426   1.00 0.00 ? 874 LEU A N    2  
ATOM 1774 C CA   . LEU A 1 83 ? 1.302   -10.504 3.910   1.00 0.00 ? 874 LEU A CA   2  
ATOM 1775 C C    . LEU A 1 83 ? 1.740   -11.893 3.422   1.00 0.00 ? 874 LEU A C    2  
ATOM 1776 O O    . LEU A 1 83 ? 1.151   -12.900 3.810   1.00 0.00 ? 874 LEU A O    2  
ATOM 1777 C CB   . LEU A 1 83 ? 0.592   -9.737  2.782   1.00 0.00 ? 874 LEU A CB   2  
ATOM 1778 C CG   . LEU A 1 83 ? -0.089  -8.484  3.353   1.00 0.00 ? 874 LEU A CG   2  
ATOM 1779 C CD1  . LEU A 1 83 ? -0.614  -7.617  2.210   1.00 0.00 ? 874 LEU A CD1  2  
ATOM 1780 C CD2  . LEU A 1 83 ? -1.259  -8.895  4.254   1.00 0.00 ? 874 LEU A CD2  2  
ATOM 1781 H H    . LEU A 1 83 ? 2.879   -9.092  3.843   1.00 0.00 ? 874 LEU A H    2  
ATOM 1782 H HA   . LEU A 1 83 ? 0.597   -10.646 4.716   1.00 0.00 ? 874 LEU A HA   2  
ATOM 1783 H HB2  . LEU A 1 83 ? 1.308   -9.444  2.032   1.00 0.00 ? 874 LEU A HB2  2  
ATOM 1784 H HB3  . LEU A 1 83 ? -0.153  -10.373 2.334   1.00 0.00 ? 874 LEU A HB3  2  
ATOM 1785 H HG   . LEU A 1 83 ? 0.629   -7.917  3.927   1.00 0.00 ? 874 LEU A HG   2  
ATOM 1786 H HD11 . LEU A 1 83 ? 0.090   -7.621  1.391   1.00 0.00 ? 874 LEU A HD11 2  
ATOM 1787 H HD12 . LEU A 1 83 ? -0.752  -6.606  2.559   1.00 0.00 ? 874 LEU A HD12 2  
ATOM 1788 H HD13 . LEU A 1 83 ? -1.561  -8.009  1.870   1.00 0.00 ? 874 LEU A HD13 2  
ATOM 1789 H HD21 . LEU A 1 83 ? -0.928  -8.928  5.281   1.00 0.00 ? 874 LEU A HD21 2  
ATOM 1790 H HD22 . LEU A 1 83 ? -1.621  -9.869  3.961   1.00 0.00 ? 874 LEU A HD22 2  
ATOM 1791 H HD23 . LEU A 1 83 ? -2.059  -8.175  4.159   1.00 0.00 ? 874 LEU A HD23 2  
ATOM 1792 N N    . PRO A 1 84 ? 2.741   -11.968 2.565   1.00 0.00 ? 875 PRO A N    2  
ATOM 1793 C CA   . PRO A 1 84 ? 3.223   -13.269 2.012   1.00 0.00 ? 875 PRO A CA   2  
ATOM 1794 C C    . PRO A 1 84 ? 4.065   -14.062 3.015   1.00 0.00 ? 875 PRO A C    2  
ATOM 1795 O O    . PRO A 1 84 ? 4.426   -15.218 2.757   1.00 0.00 ? 875 PRO A O    2  
ATOM 1796 C CB   . PRO A 1 84 ? 4.072   -12.850 0.816   1.00 0.00 ? 875 PRO A CB   2  
ATOM 1797 C CG   . PRO A 1 84 ? 4.590   -11.495 1.167   1.00 0.00 ? 875 PRO A CG   2  
ATOM 1798 C CD   . PRO A 1 84 ? 3.517   -10.832 2.032   1.00 0.00 ? 875 PRO A CD   2  
ATOM 1799 H HA   . PRO A 1 84 ? 2.395   -13.861 1.655   1.00 0.00 ? 875 PRO A HA   2  
ATOM 1800 H HB2  . PRO A 1 84 ? 4.889   -13.543 0.683   1.00 0.00 ? 875 PRO A HB2  2  
ATOM 1801 H HB3  . PRO A 1 84 ? 3.471   -12.795 -0.078  1.00 0.00 ? 875 PRO A HB3  2  
ATOM 1802 H HG2  . PRO A 1 84 ? 5.519   -11.583 1.714   1.00 0.00 ? 875 PRO A HG2  2  
ATOM 1803 H HG3  . PRO A 1 84 ? 4.738   -10.910 0.272   1.00 0.00 ? 875 PRO A HG3  2  
ATOM 1804 H HD2  . PRO A 1 84 ? 3.977   -10.266 2.827   1.00 0.00 ? 875 PRO A HD2  2  
ATOM 1805 H HD3  . PRO A 1 84 ? 2.886   -10.207 1.423   1.00 0.00 ? 875 PRO A HD3  2  
ATOM 1806 N N    . LYS A 1 85 ? 4.398   -13.437 4.135   1.00 0.00 ? 876 LYS A N    2  
ATOM 1807 C CA   . LYS A 1 85 ? 5.217   -14.084 5.153   1.00 0.00 ? 876 LYS A CA   2  
ATOM 1808 C C    . LYS A 1 85 ? 5.071   -13.371 6.487   1.00 0.00 ? 876 LYS A C    2  
ATOM 1809 O O    . LYS A 1 85 ? 4.981   -14.040 7.487   1.00 0.00 ? 876 LYS A O    2  
ATOM 1810 C CB   . LYS A 1 85 ? 6.693   -14.085 4.731   1.00 0.00 ? 876 LYS A CB   2  
ATOM 1811 C CG   . LYS A 1 85 ? 7.029   -12.770 4.006   1.00 0.00 ? 876 LYS A CG   2  
ATOM 1812 C CD   . LYS A 1 85 ? 8.397   -12.243 4.477   1.00 0.00 ? 876 LYS A CD   2  
ATOM 1813 C CE   . LYS A 1 85 ? 8.282   -11.653 5.893   1.00 0.00 ? 876 LYS A CE   2  
ATOM 1814 N NZ   . LYS A 1 85 ? 7.029   -10.862 6.013   1.00 0.00 ? 876 LYS A NZ   2  
ATOM 1815 H H    . LYS A 1 85 ? 4.098   -12.516 4.278   1.00 0.00 ? 876 LYS A H    2  
ATOM 1816 H HA   . LYS A 1 85 ? 4.890   -15.108 5.262   1.00 0.00 ? 876 LYS A HA   2  
ATOM 1817 N N    . GLN A 1 23 ? -10.113 -7.465  3.113   1.00 0.00 ? 814 GLN A N    3  
ATOM 1818 C CA   . GLN A 1 23 ? -9.232  -8.297  2.245   1.00 0.00 ? 814 GLN A CA   3  
ATOM 1819 C C    . GLN A 1 23 ? -8.717  -7.435  1.097   1.00 0.00 ? 814 GLN A C    3  
ATOM 1820 O O    . GLN A 1 23 ? -7.556  -7.545  0.690   1.00 0.00 ? 814 GLN A O    3  
ATOM 1821 C CB   . GLN A 1 23 ? -10.005 -9.520  1.688   1.00 0.00 ? 814 GLN A CB   3  
ATOM 1822 C CG   . GLN A 1 23 ? -11.453 -9.551  2.212   1.00 0.00 ? 814 GLN A CG   3  
ATOM 1823 C CD   . GLN A 1 23 ? -12.275 -8.449  1.555   1.00 0.00 ? 814 GLN A CD   3  
ATOM 1824 O OE1  . GLN A 1 23 ? -11.771 -7.346  1.344   1.00 0.00 ? 814 GLN A OE1  3  
ATOM 1825 N NE2  . GLN A 1 23 ? -13.504 -8.676  1.218   1.00 0.00 ? 814 GLN A NE2  3  
ATOM 1826 H HA   . GLN A 1 23 ? -8.390  -8.640  2.830   1.00 0.00 ? 814 GLN A HA   3  
ATOM 1827 H HB2  . GLN A 1 23 ? -10.023 -9.471  0.611   1.00 0.00 ? 814 GLN A HB2  3  
ATOM 1828 H HB3  . GLN A 1 23 ? -9.500  -10.425 1.991   1.00 0.00 ? 814 GLN A HB3  3  
ATOM 1829 H HG2  . GLN A 1 23 ? -11.891 -10.507 1.969   1.00 0.00 ? 814 GLN A HG2  3  
ATOM 1830 H HG3  . GLN A 1 23 ? -11.462 -9.420  3.283   1.00 0.00 ? 814 GLN A HG3  3  
ATOM 1831 H HE21 . GLN A 1 23 ? -13.906 -9.555  1.384   1.00 0.00 ? 814 GLN A HE21 3  
ATOM 1832 H HE22 . GLN A 1 23 ? -14.034 -7.968  0.794   1.00 0.00 ? 814 GLN A HE22 3  
ATOM 1833 N N    . THR A 1 24 ? -9.575  -6.570  0.597   1.00 0.00 ? 815 THR A N    3  
ATOM 1834 C CA   . THR A 1 24 ? -9.219  -5.668  -0.484  1.00 0.00 ? 815 THR A CA   3  
ATOM 1835 C C    . THR A 1 24 ? -8.404  -4.501  0.065   1.00 0.00 ? 815 THR A C    3  
ATOM 1836 O O    . THR A 1 24 ? -8.330  -4.306  1.288   1.00 0.00 ? 815 THR A O    3  
ATOM 1837 C CB   . THR A 1 24 ? -10.492 -5.149  -1.158  1.00 0.00 ? 815 THR A CB   3  
ATOM 1838 O OG1  . THR A 1 24 ? -11.320 -4.517  -0.183  1.00 0.00 ? 815 THR A OG1  3  
ATOM 1839 C CG2  . THR A 1 24 ? -11.252 -6.321  -1.781  1.00 0.00 ? 815 THR A CG2  3  
ATOM 1840 H H    . THR A 1 24 ? -10.485 -6.531  0.969   1.00 0.00 ? 815 THR A H    3  
ATOM 1841 H HA   . THR A 1 24 ? -8.628  -6.200  -1.213  1.00 0.00 ? 815 THR A HA   3  
ATOM 1842 H HB   . THR A 1 24 ? -10.233 -4.445  -1.935  1.00 0.00 ? 815 THR A HB   3  
ATOM 1843 H HG21 . THR A 1 24 ? -10.635 -6.785  -2.539  1.00 0.00 ? 815 THR A HG21 3  
ATOM 1844 H HG22 . THR A 1 24 ? -12.164 -5.962  -2.233  1.00 0.00 ? 815 THR A HG22 3  
ATOM 1845 H HG23 . THR A 1 24 ? -11.489 -7.049  -1.020  1.00 0.00 ? 815 THR A HG23 3  
ATOM 1846 N N    . VAL A 1 25 ? -7.762  -3.748  -0.817  1.00 0.00 ? 816 VAL A N    3  
ATOM 1847 C CA   . VAL A 1 25 ? -6.956  -2.622  -0.380  1.00 0.00 ? 816 VAL A CA   3  
ATOM 1848 C C    . VAL A 1 25 ? -7.837  -1.574  0.310   1.00 0.00 ? 816 VAL A C    3  
ATOM 1849 O O    . VAL A 1 25 ? -8.132  -0.518  -0.251  1.00 0.00 ? 816 VAL A O    3  
ATOM 1850 C CB   . VAL A 1 25 ? -6.211  -1.998  -1.566  1.00 0.00 ? 816 VAL A CB   3  
ATOM 1851 C CG1  . VAL A 1 25 ? -5.028  -2.889  -1.957  1.00 0.00 ? 816 VAL A CG1  3  
ATOM 1852 C CG2  . VAL A 1 25 ? -7.156  -1.854  -2.769  1.00 0.00 ? 816 VAL A CG2  3  
ATOM 1853 H H    . VAL A 1 25 ? -7.825  -3.952  -1.775  1.00 0.00 ? 816 VAL A H    3  
ATOM 1854 H HA   . VAL A 1 25 ? -6.230  -2.980  0.337   1.00 0.00 ? 816 VAL A HA   3  
ATOM 1855 H HB   . VAL A 1 25 ? -5.846  -1.026  -1.270  1.00 0.00 ? 816 VAL A HB   3  
ATOM 1856 H HG11 . VAL A 1 25 ? -4.315  -2.920  -1.146  1.00 0.00 ? 816 VAL A HG11 3  
ATOM 1857 H HG12 . VAL A 1 25 ? -4.550  -2.484  -2.836  1.00 0.00 ? 816 VAL A HG12 3  
ATOM 1858 H HG13 . VAL A 1 25 ? -5.380  -3.888  -2.166  1.00 0.00 ? 816 VAL A HG13 3  
ATOM 1859 H HG21 . VAL A 1 25 ? -7.414  -2.829  -3.150  1.00 0.00 ? 816 VAL A HG21 3  
ATOM 1860 H HG22 . VAL A 1 25 ? -6.659  -1.290  -3.546  1.00 0.00 ? 816 VAL A HG22 3  
ATOM 1861 H HG23 . VAL A 1 25 ? -8.051  -1.333  -2.468  1.00 0.00 ? 816 VAL A HG23 3  
ATOM 1862 N N    . GLY A 1 26 ? -8.281  -1.900  1.508   1.00 0.00 ? 817 GLY A N    3  
ATOM 1863 C CA   . GLY A 1 26 ? -9.149  -1.019  2.282   1.00 0.00 ? 817 GLY A CA   3  
ATOM 1864 C C    . GLY A 1 26 ? -9.069  -1.362  3.758   1.00 0.00 ? 817 GLY A C    3  
ATOM 1865 O O    . GLY A 1 26 ? -8.304  -0.746  4.508   1.00 0.00 ? 817 GLY A O    3  
ATOM 1866 H H    . GLY A 1 26 ? -8.038  -2.778  1.875   1.00 0.00 ? 817 GLY A H    3  
ATOM 1867 H HA2  . GLY A 1 26 ? -8.843  0.006   2.133   1.00 0.00 ? 817 GLY A HA2  3  
ATOM 1868 H HA3  . GLY A 1 26 ? -10.170 -1.137  1.948   1.00 0.00 ? 817 GLY A HA3  3  
ATOM 1869 N N    . GLN A 1 27 ? -9.814  -2.386  4.169   1.00 0.00 ? 818 GLN A N    3  
ATOM 1870 C CA   . GLN A 1 27 ? -9.785  -2.824  5.556   1.00 0.00 ? 818 GLN A CA   3  
ATOM 1871 C C    . GLN A 1 27 ? -8.342  -3.052  5.980   1.00 0.00 ? 818 GLN A C    3  
ATOM 1872 O O    . GLN A 1 27 ? -7.916  -2.619  7.051   1.00 0.00 ? 818 GLN A O    3  
ATOM 1873 C CB   . GLN A 1 27 ? -10.638 -4.111  5.727   1.00 0.00 ? 818 GLN A CB   3  
ATOM 1874 C CG   . GLN A 1 27 ? -9.903  -5.170  6.578   1.00 0.00 ? 818 GLN A CG   3  
ATOM 1875 C CD   . GLN A 1 27 ? -8.982  -6.019  5.698   1.00 0.00 ? 818 GLN A CD   3  
ATOM 1876 O OE1  . GLN A 1 27 ? -8.951  -5.850  4.473   1.00 0.00 ? 818 GLN A OE1  3  
ATOM 1877 N NE2  . GLN A 1 27 ? -8.229  -6.917  6.243   1.00 0.00 ? 818 GLN A NE2  3  
ATOM 1878 H H    . GLN A 1 27 ? -10.371 -2.867  3.520   1.00 0.00 ? 818 GLN A H    3  
ATOM 1879 H HA   . GLN A 1 27 ? -10.207 -2.041  6.170   1.00 0.00 ? 818 GLN A HA   3  
ATOM 1880 H HB2  . GLN A 1 27 ? -11.566 -3.855  6.214   1.00 0.00 ? 818 GLN A HB2  3  
ATOM 1881 H HB3  . GLN A 1 27 ? -10.858 -4.529  4.757   1.00 0.00 ? 818 GLN A HB3  3  
ATOM 1882 H HG2  . GLN A 1 27 ? -9.325  -4.687  7.351   1.00 0.00 ? 818 GLN A HG2  3  
ATOM 1883 H HG3  . GLN A 1 27 ? -10.634 -5.814  7.042   1.00 0.00 ? 818 GLN A HG3  3  
ATOM 1884 H HE21 . GLN A 1 27 ? -8.251  -7.053  7.215   1.00 0.00 ? 818 GLN A HE21 3  
ATOM 1885 H HE22 . GLN A 1 27 ? -7.638  -7.467  5.688   1.00 0.00 ? 818 GLN A HE22 3  
ATOM 1886 N N    . TRP A 1 28 ? -7.585  -3.690  5.111   1.00 0.00 ? 819 TRP A N    3  
ATOM 1887 C CA   . TRP A 1 28 ? -6.174  -3.933  5.363   1.00 0.00 ? 819 TRP A CA   3  
ATOM 1888 C C    . TRP A 1 28 ? -5.491  -2.632  5.785   1.00 0.00 ? 819 TRP A C    3  
ATOM 1889 O O    . TRP A 1 28 ? -4.905  -2.545  6.868   1.00 0.00 ? 819 TRP A O    3  
ATOM 1890 C CB   . TRP A 1 28 ? -5.523  -4.485  4.089   1.00 0.00 ? 819 TRP A CB   3  
ATOM 1891 C CG   . TRP A 1 28 ? -4.055  -4.674  4.290   1.00 0.00 ? 819 TRP A CG   3  
ATOM 1892 C CD1  . TRP A 1 28 ? -3.492  -5.521  5.181   1.00 0.00 ? 819 TRP A CD1  3  
ATOM 1893 C CD2  . TRP A 1 28 ? -2.959  -4.026  3.591   1.00 0.00 ? 819 TRP A CD2  3  
ATOM 1894 N NE1  . TRP A 1 28 ? -2.115  -5.431  5.069   1.00 0.00 ? 819 TRP A NE1  3  
ATOM 1895 C CE2  . TRP A 1 28 ? -1.742  -4.522  4.100   1.00 0.00 ? 819 TRP A CE2  3  
ATOM 1896 C CE3  . TRP A 1 28 ? -2.906  -3.060  2.569   1.00 0.00 ? 819 TRP A CE3  3  
ATOM 1897 C CZ2  . TRP A 1 28 ? -0.515  -4.082  3.614   1.00 0.00 ? 819 TRP A CZ2  3  
ATOM 1898 C CZ3  . TRP A 1 28 ? -1.669  -2.613  2.077   1.00 0.00 ? 819 TRP A CZ3  3  
ATOM 1899 C CH2  . TRP A 1 28 ? -0.476  -3.126  2.600   1.00 0.00 ? 819 TRP A CH2  3  
ATOM 1900 H H    . TRP A 1 28 ? -7.981  -3.984  4.263   1.00 0.00 ? 819 TRP A H    3  
ATOM 1901 H HA   . TRP A 1 28 ? -6.074  -4.663  6.153   1.00 0.00 ? 819 TRP A HA   3  
ATOM 1902 H HB2  . TRP A 1 28 ? -5.971  -5.437  3.842   1.00 0.00 ? 819 TRP A HB2  3  
ATOM 1903 H HB3  . TRP A 1 28 ? -5.687  -3.794  3.276   1.00 0.00 ? 819 TRP A HB3  3  
ATOM 1904 H HD1  . TRP A 1 28 ? -4.026  -6.162  5.868   1.00 0.00 ? 819 TRP A HD1  3  
ATOM 1905 N N    . LEU A 1 29 ? -5.612  -1.616  4.942   1.00 0.00 ? 820 LEU A N    3  
ATOM 1906 C CA   . LEU A 1 29 ? -5.035  -0.308  5.224   1.00 0.00 ? 820 LEU A CA   3  
ATOM 1907 C C    . LEU A 1 29 ? -5.519  0.215   6.568   1.00 0.00 ? 820 LEU A C    3  
ATOM 1908 O O    . LEU A 1 29 ? -4.724  0.676   7.392   1.00 0.00 ? 820 LEU A O    3  
ATOM 1909 C CB   . LEU A 1 29 ? -5.403  0.673   4.117   1.00 0.00 ? 820 LEU A CB   3  
ATOM 1910 C CG   . LEU A 1 29 ? -4.896  0.140   2.773   1.00 0.00 ? 820 LEU A CG   3  
ATOM 1911 C CD1  . LEU A 1 29 ? -5.683  0.783   1.637   1.00 0.00 ? 820 LEU A CD1  3  
ATOM 1912 C CD2  . LEU A 1 29 ? -3.412  0.477   2.617   1.00 0.00 ? 820 LEU A CD2  3  
ATOM 1913 H H    . LEU A 1 29 ? -6.124  -1.742  4.118   1.00 0.00 ? 820 LEU A H    3  
ATOM 1914 H HA   . LEU A 1 29 ? -3.959  -0.403  5.254   1.00 0.00 ? 820 LEU A HA   3  
ATOM 1915 H HB2  . LEU A 1 29 ? -6.478  0.780   4.087   1.00 0.00 ? 820 LEU A HB2  3  
ATOM 1916 H HB3  . LEU A 1 29 ? -4.950  1.631   4.321   1.00 0.00 ? 820 LEU A HB3  3  
ATOM 1917 H HG   . LEU A 1 29 ? -5.031  -0.931  2.733   1.00 0.00 ? 820 LEU A HG   3  
ATOM 1918 H HD11 . LEU A 1 29 ? -5.610  0.164   0.755   1.00 0.00 ? 820 LEU A HD11 3  
ATOM 1919 H HD12 . LEU A 1 29 ? -5.275  1.761   1.426   1.00 0.00 ? 820 LEU A HD12 3  
ATOM 1920 H HD13 . LEU A 1 29 ? -6.719  0.879   1.922   1.00 0.00 ? 820 LEU A HD13 3  
ATOM 1921 H HD21 . LEU A 1 29 ? -2.853  0.020   3.421   1.00 0.00 ? 820 LEU A HD21 3  
ATOM 1922 H HD22 . LEU A 1 29 ? -3.281  1.549   2.649   1.00 0.00 ? 820 LEU A HD22 3  
ATOM 1923 H HD23 . LEU A 1 29 ? -3.055  0.098   1.671   1.00 0.00 ? 820 LEU A HD23 3  
ATOM 1924 N N    . GLU A 1 30 ? -6.815  0.111   6.810   1.00 0.00 ? 821 GLU A N    3  
ATOM 1925 C CA   . GLU A 1 30 ? -7.365  0.535   8.088   1.00 0.00 ? 821 GLU A CA   3  
ATOM 1926 C C    . GLU A 1 30 ? -6.712  -0.262  9.204   1.00 0.00 ? 821 GLU A C    3  
ATOM 1927 O O    . GLU A 1 30 ? -6.310  0.290   10.232  1.00 0.00 ? 821 GLU A O    3  
ATOM 1928 C CB   . GLU A 1 30 ? -8.880  0.325   8.121   1.00 0.00 ? 821 GLU A CB   3  
ATOM 1929 C CG   . GLU A 1 30 ? -9.552  1.242   7.099   1.00 0.00 ? 821 GLU A CG   3  
ATOM 1930 C CD   . GLU A 1 30 ? -11.040 1.283   7.354   1.00 0.00 ? 821 GLU A CD   3  
ATOM 1931 O OE1  . GLU A 1 30 ? -11.679 0.278   7.137   1.00 0.00 ? 821 GLU A OE1  3  
ATOM 1932 O OE2  . GLU A 1 30 ? -11.525 2.319   7.764   1.00 0.00 ? 821 GLU A OE2  3  
ATOM 1933 H H    . GLU A 1 30 ? -7.402  -0.285  6.129   1.00 0.00 ? 821 GLU A H    3  
ATOM 1934 H HA   . GLU A 1 30 ? -7.150  1.583   8.233   1.00 0.00 ? 821 GLU A HA   3  
ATOM 1935 N N    . SER A 1 31 ? -6.568  -1.558  8.974   1.00 0.00 ? 822 SER A N    3  
ATOM 1936 C CA   . SER A 1 31 ? -5.925  -2.436  9.940   1.00 0.00 ? 822 SER A CA   3  
ATOM 1937 C C    . SER A 1 31 ? -4.559  -1.884  10.325  1.00 0.00 ? 822 SER A C    3  
ATOM 1938 O O    . SER A 1 31 ? -4.164  -1.938  11.491  1.00 0.00 ? 822 SER A O    3  
ATOM 1939 C CB   . SER A 1 31 ? -5.786  -3.842  9.359   1.00 0.00 ? 822 SER A CB   3  
ATOM 1940 O OG   . SER A 1 31 ? -6.963  -4.155  8.606   1.00 0.00 ? 822 SER A OG   3  
ATOM 1941 H H    . SER A 1 31 ? -6.881  -1.924  8.121   1.00 0.00 ? 822 SER A H    3  
ATOM 1942 H HA   . SER A 1 31 ? -6.540  -2.486  10.826  1.00 0.00 ? 822 SER A HA   3  
ATOM 1943 H HB2  . SER A 1 31 ? -4.923  -3.887  8.711   1.00 0.00 ? 822 SER A HB2  3  
ATOM 1944 H HB3  . SER A 1 31 ? -5.653  -4.549  10.168  1.00 0.00 ? 822 SER A HB3  3  
ATOM 1945 H HG   . SER A 1 31 ? -7.021  -3.527  7.868   1.00 0.00 ? 822 SER A HG   3  
ATOM 1946 N N    . ILE A 1 32 ? -3.860  -1.313  9.352   1.00 0.00 ? 823 ILE A N    3  
ATOM 1947 C CA   . ILE A 1 32 ? -2.561  -0.705  9.614   1.00 0.00 ? 823 ILE A CA   3  
ATOM 1948 C C    . ILE A 1 32 ? -2.714  0.799   9.855   1.00 0.00 ? 823 ILE A C    3  
ATOM 1949 O O    . ILE A 1 32 ? -1.730  1.539   9.901   1.00 0.00 ? 823 ILE A O    3  
ATOM 1950 C CB   . ILE A 1 32 ? -1.577  -0.980  8.462   1.00 0.00 ? 823 ILE A CB   3  
ATOM 1951 C CG1  . ILE A 1 32 ? -2.211  -0.585  7.125   1.00 0.00 ? 823 ILE A CG1  3  
ATOM 1952 C CG2  . ILE A 1 32 ? -1.227  -2.474  8.432   1.00 0.00 ? 823 ILE A CG2  3  
ATOM 1953 C CD1  . ILE A 1 32 ? -1.258  -0.935  5.980   1.00 0.00 ? 823 ILE A CD1  3  
ATOM 1954 H H    . ILE A 1 32 ? -4.239  -1.271  8.445   1.00 0.00 ? 823 ILE A H    3  
ATOM 1955 H HA   . ILE A 1 32 ? -2.160  -1.142  10.518  1.00 0.00 ? 823 ILE A HA   3  
ATOM 1956 H HB   . ILE A 1 32 ? -0.675  -0.407  8.624   1.00 0.00 ? 823 ILE A HB   3  
ATOM 1957 H HG12 . ILE A 1 32 ? -3.136  -1.127  6.995   1.00 0.00 ? 823 ILE A HG12 3  
ATOM 1958 H HG21 . ILE A 1 32 ? -0.161  -2.593  8.549   1.00 0.00 ? 823 ILE A HG21 3  
ATOM 1959 H HG22 . ILE A 1 32 ? -1.535  -2.900  7.488   1.00 0.00 ? 823 ILE A HG22 3  
ATOM 1960 H HG23 . ILE A 1 32 ? -1.736  -2.985  9.237   1.00 0.00 ? 823 ILE A HG23 3  
ATOM 1961 H HD11 . ILE A 1 32 ? -1.499  -0.337  5.117   1.00 0.00 ? 823 ILE A HD11 3  
ATOM 1962 H HD12 . ILE A 1 32 ? -1.364  -1.981  5.736   1.00 0.00 ? 823 ILE A HD12 3  
ATOM 1963 H HD13 . ILE A 1 32 ? -0.239  -0.738  6.283   1.00 0.00 ? 823 ILE A HD13 3  
ATOM 1964 N N    . GLY A 1 33 ? -3.953  1.230   10.056  1.00 0.00 ? 824 GLY A N    3  
ATOM 1965 C CA   . GLY A 1 33 ? -4.248  2.629   10.350  1.00 0.00 ? 824 GLY A CA   3  
ATOM 1966 C C    . GLY A 1 33 ? -3.761  3.552   9.250   1.00 0.00 ? 824 GLY A C    3  
ATOM 1967 O O    . GLY A 1 33 ? -3.225  4.627   9.523   1.00 0.00 ? 824 GLY A O    3  
ATOM 1968 H H    . GLY A 1 33 ? -4.691  0.584   10.031  1.00 0.00 ? 824 GLY A H    3  
ATOM 1969 H HA2  . GLY A 1 33 ? -5.315  2.749   10.463  1.00 0.00 ? 824 GLY A HA2  3  
ATOM 1970 H HA3  . GLY A 1 33 ? -3.765  2.905   11.275  1.00 0.00 ? 824 GLY A HA3  3  
ATOM 1971 N N    . LEU A 1 34 ? -3.963  3.148   8.008   1.00 0.00 ? 825 LEU A N    3  
ATOM 1972 C CA   . LEU A 1 34 ? -3.549  3.967   6.878   1.00 0.00 ? 825 LEU A CA   3  
ATOM 1973 C C    . LEU A 1 34 ? -4.750  4.348   6.012   1.00 0.00 ? 825 LEU A C    3  
ATOM 1974 O O    . LEU A 1 34 ? -4.904  3.869   4.882   1.00 0.00 ? 825 LEU A O    3  
ATOM 1975 C CB   . LEU A 1 34 ? -2.495  3.230   6.053   1.00 0.00 ? 825 LEU A CB   3  
ATOM 1976 C CG   . LEU A 1 34 ? -1.154  3.264   6.807   1.00 0.00 ? 825 LEU A CG   3  
ATOM 1977 C CD1  . LEU A 1 34 ? -0.293  2.073   6.397   1.00 0.00 ? 825 LEU A CD1  3  
ATOM 1978 C CD2  . LEU A 1 34 ? -0.410  4.562   6.480   1.00 0.00 ? 825 LEU A CD2  3  
ATOM 1979 H H    . LEU A 1 34 ? -4.405  2.285   7.846   1.00 0.00 ? 825 LEU A H    3  
ATOM 1980 H HA   . LEU A 1 34 ? -3.108  4.878   7.256   1.00 0.00 ? 825 LEU A HA   3  
ATOM 1981 H HB2  . LEU A 1 34 ? -2.810  2.210   5.901   1.00 0.00 ? 825 LEU A HB2  3  
ATOM 1982 H HB3  . LEU A 1 34 ? -2.386  3.714   5.099   1.00 0.00 ? 825 LEU A HB3  3  
ATOM 1983 H HG   . LEU A 1 34 ? -1.340  3.212   7.871   1.00 0.00 ? 825 LEU A HG   3  
ATOM 1984 H HD11 . LEU A 1 34 ? 0.718   2.406   6.226   1.00 0.00 ? 825 LEU A HD11 3  
ATOM 1985 H HD12 . LEU A 1 34 ? -0.686  1.633   5.495   1.00 0.00 ? 825 LEU A HD12 3  
ATOM 1986 H HD13 . LEU A 1 34 ? -0.299  1.340   7.190   1.00 0.00 ? 825 LEU A HD13 3  
ATOM 1987 H HD21 . LEU A 1 34 ? -1.080  5.401   6.591   1.00 0.00 ? 825 LEU A HD21 3  
ATOM 1988 H HD22 . LEU A 1 34 ? -0.044  4.522   5.466   1.00 0.00 ? 825 LEU A HD22 3  
ATOM 1989 H HD23 . LEU A 1 34 ? 0.422   4.677   7.158   1.00 0.00 ? 825 LEU A HD23 3  
ATOM 1990 N N    . PRO A 1 35 ? -5.603  5.201   6.525   1.00 0.00 ? 826 PRO A N    3  
ATOM 1991 C CA   . PRO A 1 35 ? -6.820  5.667   5.796   1.00 0.00 ? 826 PRO A CA   3  
ATOM 1992 C C    . PRO A 1 35 ? -6.467  6.595   4.635   1.00 0.00 ? 826 PRO A C    3  
ATOM 1993 O O    . PRO A 1 35 ? -5.346  7.105   4.557   1.00 0.00 ? 826 PRO A O    3  
ATOM 1994 C CB   . PRO A 1 35 ? -7.616  6.418   6.865   1.00 0.00 ? 826 PRO A CB   3  
ATOM 1995 C CG   . PRO A 1 35 ? -6.600  6.872   7.859   1.00 0.00 ? 826 PRO A CG   3  
ATOM 1996 C CD   . PRO A 1 35 ? -5.498  5.815   7.864   1.00 0.00 ? 826 PRO A CD   3  
ATOM 1997 H HA   . PRO A 1 35 ? -7.405  4.829   5.455   1.00 0.00 ? 826 PRO A HA   3  
ATOM 1998 H HB2  . PRO A 1 35 ? -8.129  7.262   6.426   1.00 0.00 ? 826 PRO A HB2  3  
ATOM 1999 H HB3  . PRO A 1 35 ? -8.320  5.754   7.341   1.00 0.00 ? 826 PRO A HB3  3  
ATOM 2000 H HG2  . PRO A 1 35 ? -6.201  7.834   7.567   1.00 0.00 ? 826 PRO A HG2  3  
ATOM 2001 H HG3  . PRO A 1 35 ? -7.038  6.931   8.842   1.00 0.00 ? 826 PRO A HG3  3  
ATOM 2002 H HD2  . PRO A 1 35 ? -4.532  6.278   8.007   1.00 0.00 ? 826 PRO A HD2  3  
ATOM 2003 H HD3  . PRO A 1 35 ? -5.686  5.074   8.625   1.00 0.00 ? 826 PRO A HD3  3  
ATOM 2004 N N    . GLN A 1 36 ? -7.433  6.817   3.750   1.00 0.00 ? 827 GLN A N    3  
ATOM 2005 C CA   . GLN A 1 36 ? -7.251  7.695   2.590   1.00 0.00 ? 827 GLN A CA   3  
ATOM 2006 C C    . GLN A 1 36 ? -6.289  7.091   1.577   1.00 0.00 ? 827 GLN A C    3  
ATOM 2007 O O    . GLN A 1 36 ? -6.075  7.654   0.498   1.00 0.00 ? 827 GLN A O    3  
ATOM 2008 C CB   . GLN A 1 36 ? -6.748  9.082   3.022   1.00 0.00 ? 827 GLN A CB   3  
ATOM 2009 C CG   . GLN A 1 36 ? -7.668  9.649   4.107   1.00 0.00 ? 827 GLN A CG   3  
ATOM 2010 C CD   . GLN A 1 36 ? -7.128  10.983  4.594   1.00 0.00 ? 827 GLN A CD   3  
ATOM 2011 O OE1  . GLN A 1 36 ? -7.178  11.978  3.866   1.00 0.00 ? 827 GLN A OE1  3  
ATOM 2012 N NE2  . GLN A 1 36 ? -6.617  11.071  5.782   1.00 0.00 ? 827 GLN A NE2  3  
ATOM 2013 H H    . GLN A 1 36 ? -8.303  6.382   3.877   1.00 0.00 ? 827 GLN A H    3  
ATOM 2014 H HA   . GLN A 1 36 ? -8.209  7.820   2.108   1.00 0.00 ? 827 GLN A HA   3  
ATOM 2015 H HB2  . GLN A 1 36 ? -5.740  9.003   3.402   1.00 0.00 ? 827 GLN A HB2  3  
ATOM 2016 H HB3  . GLN A 1 36 ? -6.754  9.745   2.169   1.00 0.00 ? 827 GLN A HB3  3  
ATOM 2017 H HG2  . GLN A 1 36 ? -8.658  9.791   3.699   1.00 0.00 ? 827 GLN A HG2  3  
ATOM 2018 H HG3  . GLN A 1 36 ? -7.718  8.961   4.936   1.00 0.00 ? 827 GLN A HG3  3  
ATOM 2019 H HE21 . GLN A 1 36 ? -6.582  10.280  6.359   1.00 0.00 ? 827 GLN A HE21 3  
ATOM 2020 H HE22 . GLN A 1 36 ? -6.262  11.927  6.103   1.00 0.00 ? 827 GLN A HE22 3  
ATOM 2021 N N    . TYR A 1 37 ? -5.712  5.945   1.907   1.00 0.00 ? 828 TYR A N    3  
ATOM 2022 C CA   . TYR A 1 37 ? -4.775  5.301   1.002   1.00 0.00 ? 828 TYR A CA   3  
ATOM 2023 C C    . TYR A 1 37 ? -5.435  4.141   0.291   1.00 0.00 ? 828 TYR A C    3  
ATOM 2024 O O    . TYR A 1 37 ? -4.856  3.554   -0.624  1.00 0.00 ? 828 TYR A O    3  
ATOM 2025 C CB   . TYR A 1 37 ? -3.536  4.814   1.760   1.00 0.00 ? 828 TYR A CB   3  
ATOM 2026 C CG   . TYR A 1 37 ? -2.825  5.984   2.430   1.00 0.00 ? 828 TYR A CG   3  
ATOM 2027 C CD1  . TYR A 1 37 ? -3.102  7.311   2.052   1.00 0.00 ? 828 TYR A CD1  3  
ATOM 2028 C CD2  . TYR A 1 37 ? -1.892  5.732   3.436   1.00 0.00 ? 828 TYR A CD2  3  
ATOM 2029 C CE1  . TYR A 1 37 ? -2.443  8.369   2.682   1.00 0.00 ? 828 TYR A CE1  3  
ATOM 2030 C CE2  . TYR A 1 37 ? -1.235  6.790   4.066   1.00 0.00 ? 828 TYR A CE2  3  
ATOM 2031 C CZ   . TYR A 1 37 ? -1.510  8.111   3.690   1.00 0.00 ? 828 TYR A CZ   3  
ATOM 2032 O OH   . TYR A 1 37 ? -0.862  9.157   4.308   1.00 0.00 ? 828 TYR A OH   3  
ATOM 2033 H H    . TYR A 1 37 ? -5.911  5.530   2.771   1.00 0.00 ? 828 TYR A H    3  
ATOM 2034 H HA   . TYR A 1 37 ? -4.461  6.015   0.258   1.00 0.00 ? 828 TYR A HA   3  
ATOM 2035 H HB2  . TYR A 1 37 ? -3.836  4.098   2.511   1.00 0.00 ? 828 TYR A HB2  3  
ATOM 2036 H HB3  . TYR A 1 37 ? -2.860  4.337   1.066   1.00 0.00 ? 828 TYR A HB3  3  
ATOM 2037 H HH   . TYR A 1 37 ? -1.455  9.514   4.980   1.00 0.00 ? 828 TYR A HH   3  
ATOM 2038 N N    . GLU A 1 38 ? -6.684  3.871   0.643   1.00 0.00 ? 829 GLU A N    3  
ATOM 2039 C CA   . GLU A 1 38 ? -7.437  2.841   -0.044  1.00 0.00 ? 829 GLU A CA   3  
ATOM 2040 C C    . GLU A 1 38 ? -7.787  3.336   -1.428  1.00 0.00 ? 829 GLU A C    3  
ATOM 2041 O O    . GLU A 1 38 ? -7.498  2.681   -2.428  1.00 0.00 ? 829 GLU A O    3  
ATOM 2042 C CB   . GLU A 1 38 ? -8.707  2.444   0.750   1.00 0.00 ? 829 GLU A CB   3  
ATOM 2043 C CG   . GLU A 1 38 ? -9.728  3.600   0.795   1.00 0.00 ? 829 GLU A CG   3  
ATOM 2044 C CD   . GLU A 1 38 ? -9.116  4.826   1.434   1.00 0.00 ? 829 GLU A CD   3  
ATOM 2045 O OE1  . GLU A 1 38 ? -8.805  4.767   2.605   1.00 0.00 ? 829 GLU A OE1  3  
ATOM 2046 O OE2  . GLU A 1 38 ? -8.955  5.805   0.738   1.00 0.00 ? 829 GLU A OE2  3  
ATOM 2047 H H    . GLU A 1 38 ? -7.121  4.417   1.328   1.00 0.00 ? 829 GLU A H    3  
ATOM 2048 H HA   . GLU A 1 38 ? -6.808  1.970   -0.152  1.00 0.00 ? 829 GLU A HA   3  
ATOM 2049 N N    . ASN A 1 39 ? -8.330  4.546   -1.484  1.00 0.00 ? 830 ASN A N    3  
ATOM 2050 C CA   . ASN A 1 39 ? -8.645  5.176   -2.750  1.00 0.00 ? 830 ASN A CA   3  
ATOM 2051 C C    . ASN A 1 39 ? -7.380  5.325   -3.564  1.00 0.00 ? 830 ASN A C    3  
ATOM 2052 O O    . ASN A 1 39 ? -7.396  5.184   -4.779  1.00 0.00 ? 830 ASN A O    3  
ATOM 2053 C CB   . ASN A 1 39 ? -9.281  6.548   -2.526  1.00 0.00 ? 830 ASN A CB   3  
ATOM 2054 C CG   . ASN A 1 39 ? -10.732 6.383   -2.105  1.00 0.00 ? 830 ASN A CG   3  
ATOM 2055 O OD1  . ASN A 1 39 ? -11.638 6.489   -2.935  1.00 0.00 ? 830 ASN A OD1  3  
ATOM 2056 N ND2  . ASN A 1 39 ? -11.012 6.117   -0.869  1.00 0.00 ? 830 ASN A ND2  3  
ATOM 2057 H H    . ASN A 1 39 ? -8.476  5.042   -0.646  1.00 0.00 ? 830 ASN A H    3  
ATOM 2058 H HA   . ASN A 1 39 ? -9.341  4.552   -3.291  1.00 0.00 ? 830 ASN A HA   3  
ATOM 2059 H HB2  . ASN A 1 39 ? -8.737  7.077   -1.757  1.00 0.00 ? 830 ASN A HB2  3  
ATOM 2060 H HB3  . ASN A 1 39 ? -9.238  7.115   -3.445  1.00 0.00 ? 830 ASN A HB3  3  
ATOM 2061 H HD21 . ASN A 1 39 ? -10.286 6.022   -0.211  1.00 0.00 ? 830 ASN A HD21 3  
ATOM 2062 H HD22 . ASN A 1 39 ? -11.945 6.008   -0.588  1.00 0.00 ? 830 ASN A HD22 3  
ATOM 2063 N N    . HIS A 1 40 ? -6.272  5.574   -2.875  1.00 0.00 ? 831 HIS A N    3  
ATOM 2064 C CA   . HIS A 1 40 ? -4.981  5.702   -3.537  1.00 0.00 ? 831 HIS A CA   3  
ATOM 2065 C C    . HIS A 1 40 ? -4.681  4.437   -4.328  1.00 0.00 ? 831 HIS A C    3  
ATOM 2066 O O    . HIS A 1 40 ? -4.491  4.478   -5.545  1.00 0.00 ? 831 HIS A O    3  
ATOM 2067 C CB   . HIS A 1 40 ? -3.872  5.930   -2.501  1.00 0.00 ? 831 HIS A CB   3  
ATOM 2068 C CG   . HIS A 1 40 ? -3.714  7.400   -2.225  1.00 0.00 ? 831 HIS A CG   3  
ATOM 2069 N ND1  . HIS A 1 40 ? -4.539  8.091   -1.342  1.00 0.00 ? 831 HIS A ND1  3  
ATOM 2070 C CD2  . HIS A 1 40 ? -2.822  8.323   -2.702  1.00 0.00 ? 831 HIS A CD2  3  
ATOM 2071 C CE1  . HIS A 1 40 ? -4.121  9.369   -1.322  1.00 0.00 ? 831 HIS A CE1  3  
ATOM 2072 N NE2  . HIS A 1 40 ? -3.079  9.564   -2.133  1.00 0.00 ? 831 HIS A NE2  3  
ATOM 2073 H H    . HIS A 1 40 ? -6.324  5.647   -1.901  1.00 0.00 ? 831 HIS A H    3  
ATOM 2074 H HA   . HIS A 1 40 ? -5.011  6.543   -4.213  1.00 0.00 ? 831 HIS A HA   3  
ATOM 2075 H HB2  . HIS A 1 40 ? -4.115  5.413   -1.589  1.00 0.00 ? 831 HIS A HB2  3  
ATOM 2076 H HB3  . HIS A 1 40 ? -2.941  5.541   -2.888  1.00 0.00 ? 831 HIS A HB3  3  
ATOM 2077 N N    . LEU A 1 41 ? -4.665  3.306   -3.632  1.00 0.00 ? 832 LEU A N    3  
ATOM 2078 C CA   . LEU A 1 41 ? -4.410  2.032   -4.269  1.00 0.00 ? 832 LEU A CA   3  
ATOM 2079 C C    . LEU A 1 41 ? -5.525  1.705   -5.252  1.00 0.00 ? 832 LEU A C    3  
ATOM 2080 O O    . LEU A 1 41 ? -5.266  1.286   -6.385  1.00 0.00 ? 832 LEU A O    3  
ATOM 2081 C CB   . LEU A 1 41 ? -4.290  0.936   -3.214  1.00 0.00 ? 832 LEU A CB   3  
ATOM 2082 C CG   . LEU A 1 41 ? -3.065  1.217   -2.324  1.00 0.00 ? 832 LEU A CG   3  
ATOM 2083 C CD1  . LEU A 1 41 ? -3.366  0.815   -0.883  1.00 0.00 ? 832 LEU A CD1  3  
ATOM 2084 C CD2  . LEU A 1 41 ? -1.866  0.415   -2.832  1.00 0.00 ? 832 LEU A CD2  3  
ATOM 2085 H H    . LEU A 1 41 ? -4.840  3.325   -2.667  1.00 0.00 ? 832 LEU A H    3  
ATOM 2086 H HA   . LEU A 1 41 ? -3.477  2.094   -4.811  1.00 0.00 ? 832 LEU A HA   3  
ATOM 2087 H HB2  . LEU A 1 41 ? -5.189  0.915   -2.616  1.00 0.00 ? 832 LEU A HB2  3  
ATOM 2088 H HB3  . LEU A 1 41 ? -4.167  -0.015  -3.702  1.00 0.00 ? 832 LEU A HB3  3  
ATOM 2089 H HG   . LEU A 1 41 ? -2.834  2.272   -2.353  1.00 0.00 ? 832 LEU A HG   3  
ATOM 2090 H HD11 . LEU A 1 41 ? -4.309  1.242   -0.579  1.00 0.00 ? 832 LEU A HD11 3  
ATOM 2091 H HD12 . LEU A 1 41 ? -2.581  1.183   -0.240  1.00 0.00 ? 832 LEU A HD12 3  
ATOM 2092 H HD13 . LEU A 1 41 ? -3.418  -0.262  -0.811  1.00 0.00 ? 832 LEU A HD13 3  
ATOM 2093 H HD21 . LEU A 1 41 ? -2.009  -0.630  -2.598  1.00 0.00 ? 832 LEU A HD21 3  
ATOM 2094 H HD22 . LEU A 1 41 ? -0.966  0.769   -2.351  1.00 0.00 ? 832 LEU A HD22 3  
ATOM 2095 H HD23 . LEU A 1 41 ? -1.775  0.534   -3.901  1.00 0.00 ? 832 LEU A HD23 3  
ATOM 2096 N N    . MET A 1 42 ? -6.765  1.945   -4.829  1.00 0.00 ? 833 MET A N    3  
ATOM 2097 C CA   . MET A 1 42 ? -7.914  1.720   -5.695  1.00 0.00 ? 833 MET A CA   3  
ATOM 2098 C C    . MET A 1 42 ? -7.753  2.531   -6.970  1.00 0.00 ? 833 MET A C    3  
ATOM 2099 O O    . MET A 1 42 ? -7.814  1.991   -8.075  1.00 0.00 ? 833 MET A O    3  
ATOM 2100 C CB   . MET A 1 42 ? -9.218  2.122   -4.981  1.00 0.00 ? 833 MET A CB   3  
ATOM 2101 C CG   . MET A 1 42 ? -10.242 0.984   -5.076  1.00 0.00 ? 833 MET A CG   3  
ATOM 2102 S SD   . MET A 1 42 ? -10.283 0.073   -3.508  1.00 0.00 ? 833 MET A SD   3  
ATOM 2103 C CE   . MET A 1 42 ? -11.203 1.302   -2.546  1.00 0.00 ? 833 MET A CE   3  
ATOM 2104 H H    . MET A 1 42 ? -6.902  2.306   -3.927  1.00 0.00 ? 833 MET A H    3  
ATOM 2105 H HA   . MET A 1 42 ? -7.957  0.672   -5.949  1.00 0.00 ? 833 MET A HA   3  
ATOM 2106 H HB2  . MET A 1 42 ? -9.013  2.332   -3.944  1.00 0.00 ? 833 MET A HB2  3  
ATOM 2107 H HB3  . MET A 1 42 ? -9.628  3.006   -5.449  1.00 0.00 ? 833 MET A HB3  3  
ATOM 2108 H HG2  . MET A 1 42 ? -11.218 1.400   -5.275  1.00 0.00 ? 833 MET A HG2  3  
ATOM 2109 H HG3  . MET A 1 42 ? -9.971  0.311   -5.877  1.00 0.00 ? 833 MET A HG3  3  
ATOM 2110 H HE1  . MET A 1 42 ? -11.529 0.859   -1.615  1.00 0.00 ? 833 MET A HE1  3  
ATOM 2111 H HE2  . MET A 1 42 ? -12.068 1.632   -3.102  1.00 0.00 ? 833 MET A HE2  3  
ATOM 2112 H HE3  . MET A 1 42 ? -10.567 2.152   -2.346  1.00 0.00 ? 833 MET A HE3  3  
ATOM 2113 N N    . ALA A 1 43 ? -7.502  3.824   -6.808  1.00 0.00 ? 834 ALA A N    3  
ATOM 2114 C CA   . ALA A 1 43 ? -7.279  4.703   -7.945  1.00 0.00 ? 834 ALA A CA   3  
ATOM 2115 C C    . ALA A 1 43 ? -6.101  4.194   -8.746  1.00 0.00 ? 834 ALA A C    3  
ATOM 2116 O O    . ALA A 1 43 ? -6.150  4.120   -9.973  1.00 0.00 ? 834 ALA A O    3  
ATOM 2117 C CB   . ALA A 1 43 ? -7.006  6.135   -7.471  1.00 0.00 ? 834 ALA A CB   3  
ATOM 2118 H H    . ALA A 1 43 ? -7.431  4.188   -5.899  1.00 0.00 ? 834 ALA A H    3  
ATOM 2119 H HA   . ALA A 1 43 ? -8.160  4.701   -8.571  1.00 0.00 ? 834 ALA A HA   3  
ATOM 2120 H HB1  . ALA A 1 43 ? -6.892  6.782   -8.328  1.00 0.00 ? 834 ALA A HB1  3  
ATOM 2121 H HB2  . ALA A 1 43 ? -6.099  6.155   -6.885  1.00 0.00 ? 834 ALA A HB2  3  
ATOM 2122 H HB3  . ALA A 1 43 ? -7.832  6.480   -6.867  1.00 0.00 ? 834 ALA A HB3  3  
ATOM 2123 N N    . ASN A 1 44 ? -5.056  3.790   -8.038  1.00 0.00 ? 835 ASN A N    3  
ATOM 2124 C CA   . ASN A 1 44 ? -3.879  3.225   -8.682  1.00 0.00 ? 835 ASN A CA   3  
ATOM 2125 C C    . ASN A 1 44 ? -4.223  1.879   -9.303  1.00 0.00 ? 835 ASN A C    3  
ATOM 2126 O O    . ASN A 1 44 ? -3.378  1.236   -9.925  1.00 0.00 ? 835 ASN A O    3  
ATOM 2127 C CB   . ASN A 1 44 ? -2.746  3.055   -7.665  1.00 0.00 ? 835 ASN A CB   3  
ATOM 2128 C CG   . ASN A 1 44 ? -1.458  2.654   -8.379  1.00 0.00 ? 835 ASN A CG   3  
ATOM 2129 O OD1  . ASN A 1 44 ? -1.108  1.474   -8.414  1.00 0.00 ? 835 ASN A OD1  3  
ATOM 2130 N ND2  . ASN A 1 44 ? -0.731  3.568   -8.952  1.00 0.00 ? 835 ASN A ND2  3  
ATOM 2131 H H    . ASN A 1 44 ? -5.092  3.843   -7.058  1.00 0.00 ? 835 ASN A H    3  
ATOM 2132 H HA   . ASN A 1 44 ? -3.551  3.894   -9.461  1.00 0.00 ? 835 ASN A HA   3  
ATOM 2133 H HB2  . ASN A 1 44 ? -2.593  3.986   -7.142  1.00 0.00 ? 835 ASN A HB2  3  
ATOM 2134 H HB3  . ASN A 1 44 ? -3.014  2.285   -6.957  1.00 0.00 ? 835 ASN A HB3  3  
ATOM 2135 H HD21 . ASN A 1 44 ? -1.010  4.508   -8.926  1.00 0.00 ? 835 ASN A HD21 3  
ATOM 2136 H HD22 . ASN A 1 44 ? 0.099   3.316   -9.411  1.00 0.00 ? 835 ASN A HD22 3  
ATOM 2137 N N    . GLY A 1 45 ? -5.472  1.460   -9.129  1.00 0.00 ? 836 GLY A N    3  
ATOM 2138 C CA   . GLY A 1 45 ? -5.935  0.195   -9.668  1.00 0.00 ? 836 GLY A CA   3  
ATOM 2139 C C    . GLY A 1 45 ? -5.110  -0.950  -9.126  1.00 0.00 ? 836 GLY A C    3  
ATOM 2140 O O    . GLY A 1 45 ? -4.983  -1.993  -9.770  1.00 0.00 ? 836 GLY A O    3  
ATOM 2141 H H    . GLY A 1 45 ? -6.100  2.012   -8.618  1.00 0.00 ? 836 GLY A H    3  
ATOM 2142 H HA2  . GLY A 1 45 ? -6.971  0.051   -9.396  1.00 0.00 ? 836 GLY A HA2  3  
ATOM 2143 H HA3  . GLY A 1 45 ? -5.847  0.213   -10.743 1.00 0.00 ? 836 GLY A HA3  3  
ATOM 2144 N N    . PHE A 1 46 ? -4.548  -0.758  -7.939  1.00 0.00 ? 837 PHE A N    3  
ATOM 2145 C CA   . PHE A 1 46 ? -3.730  -1.788  -7.313  1.00 0.00 ? 837 PHE A CA   3  
ATOM 2146 C C    . PHE A 1 46 ? -4.491  -2.455  -6.181  1.00 0.00 ? 837 PHE A C    3  
ATOM 2147 O O    . PHE A 1 46 ? -4.531  -1.942  -5.064  1.00 0.00 ? 837 PHE A O    3  
ATOM 2148 C CB   . PHE A 1 46 ? -2.420  -1.184  -6.773  1.00 0.00 ? 837 PHE A CB   3  
ATOM 2149 C CG   . PHE A 1 46 ? -1.247  -2.106  -7.079  1.00 0.00 ? 837 PHE A CG   3  
ATOM 2150 C CD1  . PHE A 1 46 ? -1.425  -3.501  -7.115  1.00 0.00 ? 837 PHE A CD1  3  
ATOM 2151 C CD2  . PHE A 1 46 ? 0.022   -1.561  -7.325  1.00 0.00 ? 837 PHE A CD2  3  
ATOM 2152 C CE1  . PHE A 1 46 ? -0.338  -4.341  -7.394  1.00 0.00 ? 837 PHE A CE1  3  
ATOM 2153 C CE2  . PHE A 1 46 ? 1.107   -2.403  -7.604  1.00 0.00 ? 837 PHE A CE2  3  
ATOM 2154 C CZ   . PHE A 1 46 ? 0.927   -3.791  -7.638  1.00 0.00 ? 837 PHE A CZ   3  
ATOM 2155 H H    . PHE A 1 46 ? -4.695  0.092   -7.468  1.00 0.00 ? 837 PHE A H    3  
ATOM 2156 H HA   . PHE A 1 46 ? -3.486  -2.532  -8.057  1.00 0.00 ? 837 PHE A HA   3  
ATOM 2157 H HB2  . PHE A 1 46 ? -2.252  -0.224  -7.236  1.00 0.00 ? 837 PHE A HB2  3  
ATOM 2158 H HB3  . PHE A 1 46 ? -2.501  -1.052  -5.703  1.00 0.00 ? 837 PHE A HB3  3  
ATOM 2159 H HZ   . PHE A 1 46 ? 1.766   -4.439  -7.854  1.00 0.00 ? 837 PHE A HZ   3  
ATOM 2160 N N    . ASP A 1 47 ? -5.081  -3.605  -6.469  1.00 0.00 ? 838 ASP A N    3  
ATOM 2161 C CA   . ASP A 1 47 ? -5.821  -4.356  -5.460  1.00 0.00 ? 838 ASP A CA   3  
ATOM 2162 C C    . ASP A 1 47 ? -5.071  -5.620  -5.097  1.00 0.00 ? 838 ASP A C    3  
ATOM 2163 O O    . ASP A 1 47 ? -4.025  -5.919  -5.681  1.00 0.00 ? 838 ASP A O    3  
ATOM 2164 C CB   . ASP A 1 47 ? -7.225  -4.714  -5.961  1.00 0.00 ? 838 ASP A CB   3  
ATOM 2165 C CG   . ASP A 1 47 ? -8.212  -4.738  -4.798  1.00 0.00 ? 838 ASP A CG   3  
ATOM 2166 O OD1  . ASP A 1 47 ? -7.840  -5.187  -3.723  1.00 0.00 ? 838 ASP A OD1  3  
ATOM 2167 O OD2  . ASP A 1 47 ? -9.329  -4.311  -4.999  1.00 0.00 ? 838 ASP A OD2  3  
ATOM 2168 H H    . ASP A 1 47 ? -5.004  -3.970  -7.375  1.00 0.00 ? 838 ASP A H    3  
ATOM 2169 H HA   . ASP A 1 47 ? -5.916  -3.745  -4.574  1.00 0.00 ? 838 ASP A HA   3  
ATOM 2170 N N    . ASN A 1 48 ? -5.607  -6.353  -4.138  1.00 0.00 ? 839 ASN A N    3  
ATOM 2171 C CA   . ASN A 1 48 ? -4.997  -7.601  -3.677  1.00 0.00 ? 839 ASN A CA   3  
ATOM 2172 C C    . ASN A 1 48 ? -3.715  -7.319  -2.919  1.00 0.00 ? 839 ASN A C    3  
ATOM 2173 O O    . ASN A 1 48 ? -2.606  -7.424  -3.466  1.00 0.00 ? 839 ASN A O    3  
ATOM 2174 C CB   . ASN A 1 48 ? -4.721  -8.548  -4.844  1.00 0.00 ? 839 ASN A CB   3  
ATOM 2175 C CG   . ASN A 1 48 ? -4.437  -9.949  -4.316  1.00 0.00 ? 839 ASN A CG   3  
ATOM 2176 O OD1  . ASN A 1 48 ? -3.714  -10.108 -3.327  1.00 0.00 ? 839 ASN A OD1  3  
ATOM 2177 N ND2  . ASN A 1 48 ? -4.953  -10.977 -4.915  1.00 0.00 ? 839 ASN A ND2  3  
ATOM 2178 H H    . ASN A 1 48 ? -6.446  -6.044  -3.727  1.00 0.00 ? 839 ASN A H    3  
ATOM 2179 H HA   . ASN A 1 48 ? -5.688  -8.084  -3.002  1.00 0.00 ? 839 ASN A HA   3  
ATOM 2180 H HB2  . ASN A 1 48 ? -5.582  -8.574  -5.495  1.00 0.00 ? 839 ASN A HB2  3  
ATOM 2181 H HB3  . ASN A 1 48 ? -3.864  -8.197  -5.398  1.00 0.00 ? 839 ASN A HB3  3  
ATOM 2182 H HD21 . ASN A 1 48 ? -5.520  -10.850 -5.706  1.00 0.00 ? 839 ASN A HD21 3  
ATOM 2183 H HD22 . ASN A 1 48 ? -4.778  -11.881 -4.580  1.00 0.00 ? 839 ASN A HD22 3  
ATOM 2184 N N    . VAL A 1 49 ? -3.868  -6.950  -1.660  1.00 0.00 ? 840 VAL A N    3  
ATOM 2185 C CA   . VAL A 1 49 ? -2.735  -6.636  -0.817  1.00 0.00 ? 840 VAL A CA   3  
ATOM 2186 C C    . VAL A 1 49 ? -1.711  -7.773  -0.836  1.00 0.00 ? 840 VAL A C    3  
ATOM 2187 O O    . VAL A 1 49 ? -0.499  -7.531  -0.840  1.00 0.00 ? 840 VAL A O    3  
ATOM 2188 C CB   . VAL A 1 49 ? -3.210  -6.340  0.613   1.00 0.00 ? 840 VAL A CB   3  
ATOM 2189 C CG1  . VAL A 1 49 ? -4.050  -5.061  0.606   1.00 0.00 ? 840 VAL A CG1  3  
ATOM 2190 C CG2  . VAL A 1 49 ? -4.075  -7.496  1.131   1.00 0.00 ? 840 VAL A CG2  3  
ATOM 2191 H H    . VAL A 1 49 ? -4.773  -6.883  -1.290  1.00 0.00 ? 840 VAL A H    3  
ATOM 2192 H HA   . VAL A 1 49 ? -2.260  -5.748  -1.207  1.00 0.00 ? 840 VAL A HA   3  
ATOM 2193 H HB   . VAL A 1 49 ? -2.354  -6.199  1.257   1.00 0.00 ? 840 VAL A HB   3  
ATOM 2194 H HG11 . VAL A 1 49 ? -3.417  -4.219  0.364   1.00 0.00 ? 840 VAL A HG11 3  
ATOM 2195 H HG12 . VAL A 1 49 ? -4.488  -4.916  1.581   1.00 0.00 ? 840 VAL A HG12 3  
ATOM 2196 H HG13 . VAL A 1 49 ? -4.834  -5.146  -0.131  1.00 0.00 ? 840 VAL A HG13 3  
ATOM 2197 H HG21 . VAL A 1 49 ? -3.645  -8.440  0.839   1.00 0.00 ? 840 VAL A HG21 3  
ATOM 2198 H HG22 . VAL A 1 49 ? -5.071  -7.409  0.721   1.00 0.00 ? 840 VAL A HG22 3  
ATOM 2199 H HG23 . VAL A 1 49 ? -4.129  -7.443  2.210   1.00 0.00 ? 840 VAL A HG23 3  
ATOM 2200 N N    . GLN A 1 50 ? -2.200  -9.010  -0.912  1.00 0.00 ? 841 GLN A N    3  
ATOM 2201 C CA   . GLN A 1 50 ? -1.310  -10.164 -0.994  1.00 0.00 ? 841 GLN A CA   3  
ATOM 2202 C C    . GLN A 1 50 ? -0.490  -10.072 -2.263  1.00 0.00 ? 841 GLN A C    3  
ATOM 2203 O O    . GLN A 1 50 ? 0.747   -10.030 -2.227  1.00 0.00 ? 841 GLN A O    3  
ATOM 2204 C CB   . GLN A 1 50 ? -2.107  -11.478 -0.998  1.00 0.00 ? 841 GLN A CB   3  
ATOM 2205 C CG   . GLN A 1 50 ? -3.315  -11.375 -0.062  1.00 0.00 ? 841 GLN A CG   3  
ATOM 2206 C CD   . GLN A 1 50 ? -3.874  -12.768 0.211   1.00 0.00 ? 841 GLN A CD   3  
ATOM 2207 O OE1  . GLN A 1 50 ? -3.625  -13.703 -0.561  1.00 0.00 ? 841 GLN A OE1  3  
ATOM 2208 N NE2  . GLN A 1 50 ? -4.611  -12.968 1.259   1.00 0.00 ? 841 GLN A NE2  3  
ATOM 2209 H H    . GLN A 1 50 ? -3.170  -9.141  -0.957  1.00 0.00 ? 841 GLN A H    3  
ATOM 2210 H HA   . GLN A 1 50 ? -0.644  -10.158 -0.143  1.00 0.00 ? 841 GLN A HA   3  
ATOM 2211 H HB2  . GLN A 1 50 ? -2.450  -11.690 -2.000  1.00 0.00 ? 841 GLN A HB2  3  
ATOM 2212 H HB3  . GLN A 1 50 ? -1.468  -12.284 -0.666  1.00 0.00 ? 841 GLN A HB3  3  
ATOM 2213 H HG2  . GLN A 1 50 ? -3.013  -10.918 0.869   1.00 0.00 ? 841 GLN A HG2  3  
ATOM 2214 H HG3  . GLN A 1 50 ? -4.081  -10.772 -0.528  1.00 0.00 ? 841 GLN A HG3  3  
ATOM 2215 H HE21 . GLN A 1 50 ? -4.808  -12.230 1.873   1.00 0.00 ? 841 GLN A HE21 3  
ATOM 2216 H HE22 . GLN A 1 50 ? -4.970  -13.864 1.438   1.00 0.00 ? 841 GLN A HE22 3  
ATOM 2217 N N    . PHE A 1 51 ? -1.185  -9.996  -3.387  1.00 0.00 ? 842 PHE A N    3  
ATOM 2218 C CA   . PHE A 1 51 ? -0.525  -9.862  -4.667  1.00 0.00 ? 842 PHE A CA   3  
ATOM 2219 C C    . PHE A 1 51 ? 0.408   -8.668  -4.631  1.00 0.00 ? 842 PHE A C    3  
ATOM 2220 O O    . PHE A 1 51 ? 1.556   -8.760  -5.052  1.00 0.00 ? 842 PHE A O    3  
ATOM 2221 C CB   . PHE A 1 51 ? -1.560  -9.688  -5.787  1.00 0.00 ? 842 PHE A CB   3  
ATOM 2222 C CG   . PHE A 1 51 ? -0.977  -10.136 -7.110  1.00 0.00 ? 842 PHE A CG   3  
ATOM 2223 C CD1  . PHE A 1 51 ? -0.510  -11.448 -7.263  1.00 0.00 ? 842 PHE A CD1  3  
ATOM 2224 C CD2  . PHE A 1 51 ? -0.909  -9.241  -8.185  1.00 0.00 ? 842 PHE A CD2  3  
ATOM 2225 C CE1  . PHE A 1 51 ? 0.023   -11.863 -8.487  1.00 0.00 ? 842 PHE A CE1  3  
ATOM 2226 C CE2  . PHE A 1 51 ? -0.376  -9.659  -9.409  1.00 0.00 ? 842 PHE A CE2  3  
ATOM 2227 C CZ   . PHE A 1 51 ? 0.090   -10.968 -9.561  1.00 0.00 ? 842 PHE A CZ   3  
ATOM 2228 H H    . PHE A 1 51 ? -2.169  -9.999  -3.343  1.00 0.00 ? 842 PHE A H    3  
ATOM 2229 H HA   . PHE A 1 51 ? 0.052   -10.754 -4.856  1.00 0.00 ? 842 PHE A HA   3  
ATOM 2230 H HB2  . PHE A 1 51 ? -2.429  -10.288 -5.567  1.00 0.00 ? 842 PHE A HB2  3  
ATOM 2231 H HB3  . PHE A 1 51 ? -1.847  -8.648  -5.856  1.00 0.00 ? 842 PHE A HB3  3  
ATOM 2232 H HZ   . PHE A 1 51 ? 0.502   -11.289 -10.507 1.00 0.00 ? 842 PHE A HZ   3  
ATOM 2233 N N    . MET A 1 52 ? -0.089  -7.555  -4.095  1.00 0.00 ? 843 MET A N    3  
ATOM 2234 C CA   . MET A 1 52 ? 0.713   -6.339  -3.983  1.00 0.00 ? 843 MET A CA   3  
ATOM 2235 C C    . MET A 1 52 ? 2.003   -6.618  -3.228  1.00 0.00 ? 843 MET A C    3  
ATOM 2236 O O    . MET A 1 52 ? 3.103   -6.400  -3.747  1.00 0.00 ? 843 MET A O    3  
ATOM 2237 C CB   . MET A 1 52 ? -0.080  -5.256  -3.238  1.00 0.00 ? 843 MET A CB   3  
ATOM 2238 C CG   . MET A 1 52 ? -0.670  -4.259  -4.234  1.00 0.00 ? 843 MET A CG   3  
ATOM 2239 S SD   . MET A 1 52 ? -1.262  -2.802  -3.340  1.00 0.00 ? 843 MET A SD   3  
ATOM 2240 C CE   . MET A 1 52 ? 0.347   -2.000  -3.107  1.00 0.00 ? 843 MET A CE   3  
ATOM 2241 H H    . MET A 1 52 ? -1.012  -7.558  -3.753  1.00 0.00 ? 843 MET A H    3  
ATOM 2242 H HA   . MET A 1 52 ? 0.952   -5.978  -4.971  1.00 0.00 ? 843 MET A HA   3  
ATOM 2243 H HB2  . MET A 1 52 ? -0.879  -5.719  -2.681  1.00 0.00 ? 843 MET A HB2  3  
ATOM 2244 H HB3  . MET A 1 52 ? 0.575   -4.734  -2.555  1.00 0.00 ? 843 MET A HB3  3  
ATOM 2245 H HG2  . MET A 1 52 ? 0.089   -3.962  -4.944  1.00 0.00 ? 843 MET A HG2  3  
ATOM 2246 H HG3  . MET A 1 52 ? -1.495  -4.719  -4.757  1.00 0.00 ? 843 MET A HG3  3  
ATOM 2247 H HE1  . MET A 1 52 ? 1.139   -2.698  -3.338  1.00 0.00 ? 843 MET A HE1  3  
ATOM 2248 H HE2  . MET A 1 52 ? 0.447   -1.679  -2.082  1.00 0.00 ? 843 MET A HE2  3  
ATOM 2249 H HE3  . MET A 1 52 ? 0.413   -1.138  -3.758  1.00 0.00 ? 843 MET A HE3  3  
ATOM 2250 N N    . GLY A 1 53 ? 1.866   -7.124  -2.010  1.00 0.00 ? 844 GLY A N    3  
ATOM 2251 C CA   . GLY A 1 53 ? 3.024   -7.439  -1.190  1.00 0.00 ? 844 GLY A CA   3  
ATOM 2252 C C    . GLY A 1 53 ? 3.926   -8.411  -1.907  1.00 0.00 ? 844 GLY A C    3  
ATOM 2253 O O    . GLY A 1 53 ? 5.146   -8.379  -1.751  1.00 0.00 ? 844 GLY A O    3  
ATOM 2254 H H    . GLY A 1 53 ? 0.965   -7.293  -1.655  1.00 0.00 ? 844 GLY A H    3  
ATOM 2255 H HA2  . GLY A 1 53 ? 3.572   -6.530  -0.987  1.00 0.00 ? 844 GLY A HA2  3  
ATOM 2256 H HA3  . GLY A 1 53 ? 2.699   -7.880  -0.260  1.00 0.00 ? 844 GLY A HA3  3  
ATOM 2257 N N    . SER A 1 54 ? 3.324   -9.267  -2.703  1.00 0.00 ? 845 SER A N    3  
ATOM 2258 C CA   . SER A 1 54 ? 4.068   -10.256 -3.453  1.00 0.00 ? 845 SER A CA   3  
ATOM 2259 C C    . SER A 1 54 ? 4.328   -9.785  -4.879  1.00 0.00 ? 845 SER A C    3  
ATOM 2260 O O    . SER A 1 54 ? 4.560   -10.601 -5.781  1.00 0.00 ? 845 SER A O    3  
ATOM 2261 C CB   . SER A 1 54 ? 3.301   -11.568 -3.471  1.00 0.00 ? 845 SER A CB   3  
ATOM 2262 O OG   . SER A 1 54 ? 2.503   -11.662 -2.288  1.00 0.00 ? 845 SER A OG   3  
ATOM 2263 H H    . SER A 1 54 ? 2.347   -9.234  -2.790  1.00 0.00 ? 845 SER A H    3  
ATOM 2264 H HA   . SER A 1 54 ? 5.017   -10.424 -2.966  1.00 0.00 ? 845 SER A HA   3  
ATOM 2265 H HB2  . SER A 1 54 ? 2.661   -11.605 -4.338  1.00 0.00 ? 845 SER A HB2  3  
ATOM 2266 H HB3  . SER A 1 54 ? 4.010   -12.379 -3.519  1.00 0.00 ? 845 SER A HB3  3  
ATOM 2267 H HG   . SER A 1 54 ? 1.829   -10.960 -2.323  1.00 0.00 ? 845 SER A HG   3  
ATOM 2268 N N    . ASN A 1 55 ? 4.284   -8.479  -5.096  1.00 0.00 ? 846 ASN A N    3  
ATOM 2269 C CA   . ASN A 1 55 ? 4.522   -7.944  -6.437  1.00 0.00 ? 846 ASN A CA   3  
ATOM 2270 C C    . ASN A 1 55 ? 5.544   -6.836  -6.421  1.00 0.00 ? 846 ASN A C    3  
ATOM 2271 O O    . ASN A 1 55 ? 6.541   -6.904  -7.135  1.00 0.00 ? 846 ASN A O    3  
ATOM 2272 C CB   . ASN A 1 55 ? 3.223   -7.427  -7.055  1.00 0.00 ? 846 ASN A CB   3  
ATOM 2273 C CG   . ASN A 1 55 ? 2.622   -8.498  -7.949  1.00 0.00 ? 846 ASN A CG   3  
ATOM 2274 O OD1  . ASN A 1 55 ? 2.886   -8.526  -9.150  1.00 0.00 ? 846 ASN A OD1  3  
ATOM 2275 N ND2  . ASN A 1 55 ? 1.843   -9.390  -7.435  1.00 0.00 ? 846 ASN A ND2  3  
ATOM 2276 H H    . ASN A 1 55 ? 4.090   -7.871  -4.346  1.00 0.00 ? 846 ASN A H    3  
ATOM 2277 H HA   . ASN A 1 55 ? 4.898   -8.738  -7.064  1.00 0.00 ? 846 ASN A HA   3  
ATOM 2278 H HB2  . ASN A 1 55 ? 2.525   -7.169  -6.274  1.00 0.00 ? 846 ASN A HB2  3  
ATOM 2279 H HB3  . ASN A 1 55 ? 3.431   -6.549  -7.646  1.00 0.00 ? 846 ASN A HB3  3  
ATOM 2280 H HD21 . ASN A 1 55 ? 1.647   -9.370  -6.473  1.00 0.00 ? 846 ASN A HD21 3  
ATOM 2281 H HD22 . ASN A 1 55 ? 1.445   -10.084 -8.002  1.00 0.00 ? 846 ASN A HD22 3  
ATOM 2282 N N    . VAL A 1 56 ? 5.303   -5.812  -5.624  1.00 0.00 ? 847 VAL A N    3  
ATOM 2283 C CA   . VAL A 1 56 ? 6.229   -4.697  -5.555  1.00 0.00 ? 847 VAL A CA   3  
ATOM 2284 C C    . VAL A 1 56 ? 6.132   -3.978  -4.217  1.00 0.00 ? 847 VAL A C    3  
ATOM 2285 O O    . VAL A 1 56 ? 5.051   -3.549  -3.810  1.00 0.00 ? 847 VAL A O    3  
ATOM 2286 C CB   . VAL A 1 56 ? 5.970   -3.719  -6.718  1.00 0.00 ? 847 VAL A CB   3  
ATOM 2287 C CG1  . VAL A 1 56 ? 4.570   -3.106  -6.592  1.00 0.00 ? 847 VAL A CG1  3  
ATOM 2288 C CG2  . VAL A 1 56 ? 7.021   -2.603  -6.703  1.00 0.00 ? 847 VAL A CG2  3  
ATOM 2289 H H    . VAL A 1 56 ? 4.489   -5.800  -5.074  1.00 0.00 ? 847 VAL A H    3  
ATOM 2290 H HA   . VAL A 1 56 ? 7.231   -5.085  -5.659  1.00 0.00 ? 847 VAL A HA   3  
ATOM 2291 H HB   . VAL A 1 56 ? 6.032   -4.263  -7.649  1.00 0.00 ? 847 VAL A HB   3  
ATOM 2292 H HG11 . VAL A 1 56 ? 4.601   -2.275  -5.902  1.00 0.00 ? 847 VAL A HG11 3  
ATOM 2293 H HG12 . VAL A 1 56 ? 3.877   -3.849  -6.228  1.00 0.00 ? 847 VAL A HG12 3  
ATOM 2294 H HG13 . VAL A 1 56 ? 4.246   -2.755  -7.560  1.00 0.00 ? 847 VAL A HG13 3  
ATOM 2295 H HG21 . VAL A 1 56 ? 6.836   -1.922  -7.520  1.00 0.00 ? 847 VAL A HG21 3  
ATOM 2296 H HG22 . VAL A 1 56 ? 8.007   -3.030  -6.808  1.00 0.00 ? 847 VAL A HG22 3  
ATOM 2297 H HG23 . VAL A 1 56 ? 6.961   -2.063  -5.768  1.00 0.00 ? 847 VAL A HG23 3  
ATOM 2298 N N    . MET A 1 57 ? 7.266   -3.818  -3.557  1.00 0.00 ? 848 MET A N    3  
ATOM 2299 C CA   . MET A 1 57 ? 7.312   -3.086  -2.305  1.00 0.00 ? 848 MET A CA   3  
ATOM 2300 C C    . MET A 1 57 ? 8.574   -2.243  -2.235  1.00 0.00 ? 848 MET A C    3  
ATOM 2301 O O    . MET A 1 57 ? 9.663   -2.761  -1.948  1.00 0.00 ? 848 MET A O    3  
ATOM 2302 C CB   . MET A 1 57 ? 7.247   -4.045  -1.104  1.00 0.00 ? 848 MET A CB   3  
ATOM 2303 C CG   . MET A 1 57 ? 8.009   -5.338  -1.419  1.00 0.00 ? 848 MET A CG   3  
ATOM 2304 S SD   . MET A 1 57 ? 8.232   -6.286  0.107   1.00 0.00 ? 848 MET A SD   3  
ATOM 2305 C CE   . MET A 1 57 ? 6.486   -6.663  0.406   1.00 0.00 ? 848 MET A CE   3  
ATOM 2306 H H    . MET A 1 57 ? 8.099   -4.155  -3.946  1.00 0.00 ? 848 MET A H    3  
ATOM 2307 H HA   . MET A 1 57 ? 6.456   -2.426  -2.262  1.00 0.00 ? 848 MET A HA   3  
ATOM 2308 H HB2  . MET A 1 57 ? 7.688   -3.569  -0.241  1.00 0.00 ? 848 MET A HB2  3  
ATOM 2309 H HB3  . MET A 1 57 ? 6.216   -4.281  -0.896  1.00 0.00 ? 848 MET A HB3  3  
ATOM 2310 H HG2  . MET A 1 57 ? 7.447   -5.924  -2.131  1.00 0.00 ? 848 MET A HG2  3  
ATOM 2311 H HG3  . MET A 1 57 ? 8.976   -5.097  -1.837  1.00 0.00 ? 848 MET A HG3  3  
ATOM 2312 H HE1  . MET A 1 57 ? 6.389   -7.695  0.713   1.00 0.00 ? 848 MET A HE1  3  
ATOM 2313 H HE2  . MET A 1 57 ? 5.918   -6.511  -0.499  1.00 0.00 ? 848 MET A HE2  3  
ATOM 2314 H HE3  . MET A 1 57 ? 6.105   -6.012  1.179   1.00 0.00 ? 848 MET A HE3  3  
ATOM 2315 N N    . GLU A 1 58 ? 8.434   -0.956  -2.492  1.00 0.00 ? 849 GLU A N    3  
ATOM 2316 C CA   . GLU A 1 58 ? 9.559   -0.038  -2.459  1.00 0.00 ? 849 GLU A CA   3  
ATOM 2317 C C    . GLU A 1 58 ? 9.072   1.392   -2.258  1.00 0.00 ? 849 GLU A C    3  
ATOM 2318 O O    . GLU A 1 58 ? 7.894   1.631   -1.983  1.00 0.00 ? 849 GLU A O    3  
ATOM 2319 C CB   . GLU A 1 58 ? 10.362  -0.134  -3.767  1.00 0.00 ? 849 GLU A CB   3  
ATOM 2320 C CG   . GLU A 1 58 ? 11.355  -1.296  -3.687  1.00 0.00 ? 849 GLU A CG   3  
ATOM 2321 C CD   . GLU A 1 58 ? 12.504  -1.058  -4.639  1.00 0.00 ? 849 GLU A CD   3  
ATOM 2322 O OE1  . GLU A 1 58 ? 12.301  -1.195  -5.821  1.00 0.00 ? 849 GLU A OE1  3  
ATOM 2323 O OE2  . GLU A 1 58 ? 13.570  -0.738  -4.178  1.00 0.00 ? 849 GLU A OE2  3  
ATOM 2324 H H    . GLU A 1 58 ? 7.543   -0.605  -2.734  1.00 0.00 ? 849 GLU A H    3  
ATOM 2325 H HA   . GLU A 1 58 ? 10.204  -0.304  -1.637  1.00 0.00 ? 849 GLU A HA   3  
ATOM 2326 N N    . ASP A 1 59 ? 9.985   2.334   -2.367  1.00 0.00 ? 850 ASP A N    3  
ATOM 2327 C CA   . ASP A 1 59 ? 9.658   3.740   -2.207  1.00 0.00 ? 850 ASP A CA   3  
ATOM 2328 C C    . ASP A 1 59 ? 8.899   4.264   -3.411  1.00 0.00 ? 850 ASP A C    3  
ATOM 2329 O O    . ASP A 1 59 ? 7.825   4.860   -3.277  1.00 0.00 ? 850 ASP A O    3  
ATOM 2330 C CB   . ASP A 1 59 ? 10.933  4.565   -1.991  1.00 0.00 ? 850 ASP A CB   3  
ATOM 2331 C CG   . ASP A 1 59 ? 11.851  4.447   -3.199  1.00 0.00 ? 850 ASP A CG   3  
ATOM 2332 O OD1  . ASP A 1 59 ? 12.003  3.351   -3.701  1.00 0.00 ? 850 ASP A OD1  3  
ATOM 2333 O OD2  . ASP A 1 59 ? 12.397  5.451   -3.599  1.00 0.00 ? 850 ASP A OD2  3  
ATOM 2334 H H    . ASP A 1 59 ? 10.910  2.082   -2.576  1.00 0.00 ? 850 ASP A H    3  
ATOM 2335 H HA   . ASP A 1 59 ? 9.031   3.848   -1.344  1.00 0.00 ? 850 ASP A HA   3  
ATOM 2336 N N    . GLN A 1 60 ? 9.494   4.084   -4.576  1.00 0.00 ? 851 GLN A N    3  
ATOM 2337 C CA   . GLN A 1 60 ? 8.930   4.583   -5.827  1.00 0.00 ? 851 GLN A CA   3  
ATOM 2338 C C    . GLN A 1 60 ? 7.456   4.223   -5.971  1.00 0.00 ? 851 GLN A C    3  
ATOM 2339 O O    . GLN A 1 60 ? 6.620   5.096   -6.194  1.00 0.00 ? 851 GLN A O    3  
ATOM 2340 C CB   . GLN A 1 60 ? 9.720   4.033   -7.025  1.00 0.00 ? 851 GLN A CB   3  
ATOM 2341 C CG   . GLN A 1 60 ? 11.192  3.853   -6.638  1.00 0.00 ? 851 GLN A CG   3  
ATOM 2342 C CD   . GLN A 1 60 ? 12.033  3.622   -7.882  1.00 0.00 ? 851 GLN A CD   3  
ATOM 2343 O OE1  . GLN A 1 60 ? 12.334  2.475   -8.224  1.00 0.00 ? 851 GLN A OE1  3  
ATOM 2344 N NE2  . GLN A 1 60 ? 12.431  4.635   -8.583  1.00 0.00 ? 851 GLN A NE2  3  
ATOM 2345 H H    . GLN A 1 60 ? 10.367  3.636   -4.587  1.00 0.00 ? 851 GLN A H    3  
ATOM 2346 H HA   . GLN A 1 60 ? 9.020   5.659   -5.832  1.00 0.00 ? 851 GLN A HA   3  
ATOM 2347 H HB2  . GLN A 1 60 ? 9.307   3.081   -7.324  1.00 0.00 ? 851 GLN A HB2  3  
ATOM 2348 H HB3  . GLN A 1 60 ? 9.650   4.728   -7.849  1.00 0.00 ? 851 GLN A HB3  3  
ATOM 2349 H HG2  . GLN A 1 60 ? 11.543  4.736   -6.126  1.00 0.00 ? 851 GLN A HG2  3  
ATOM 2350 H HG3  . GLN A 1 60 ? 11.287  2.998   -5.985  1.00 0.00 ? 851 GLN A HG3  3  
ATOM 2351 H HE21 . GLN A 1 60 ? 12.189  5.547   -8.309  1.00 0.00 ? 851 GLN A HE21 3  
ATOM 2352 H HE22 . GLN A 1 60 ? 12.976  4.496   -9.385  1.00 0.00 ? 851 GLN A HE22 3  
ATOM 2353 N N    . ASP A 1 61 ? 7.142   2.941   -5.860  1.00 0.00 ? 852 ASP A N    3  
ATOM 2354 C CA   . ASP A 1 61 ? 5.759   2.486   -6.015  1.00 0.00 ? 852 ASP A CA   3  
ATOM 2355 C C    . ASP A 1 61 ? 4.855   3.177   -5.021  1.00 0.00 ? 852 ASP A C    3  
ATOM 2356 O O    . ASP A 1 61 ? 3.839   3.772   -5.399  1.00 0.00 ? 852 ASP A O    3  
ATOM 2357 C CB   . ASP A 1 61 ? 5.646   0.960   -5.853  1.00 0.00 ? 852 ASP A CB   3  
ATOM 2358 C CG   . ASP A 1 61 ? 6.867   0.410   -5.158  1.00 0.00 ? 852 ASP A CG   3  
ATOM 2359 O OD1  . ASP A 1 61 ? 7.939   0.497   -5.736  1.00 0.00 ? 852 ASP A OD1  3  
ATOM 2360 O OD2  . ASP A 1 61 ? 6.725   -0.084  -4.061  1.00 0.00 ? 852 ASP A OD2  3  
ATOM 2361 H H    . ASP A 1 61 ? 7.852   2.284   -5.683  1.00 0.00 ? 852 ASP A H    3  
ATOM 2362 H HA   . ASP A 1 61 ? 5.433   2.748   -7.011  1.00 0.00 ? 852 ASP A HA   3  
ATOM 2363 N N    . LEU A 1 62 ? 5.221   3.111   -3.752  1.00 0.00 ? 853 LEU A N    3  
ATOM 2364 C CA   . LEU A 1 62 ? 4.432   3.752   -2.712  1.00 0.00 ? 853 LEU A CA   3  
ATOM 2365 C C    . LEU A 1 62 ? 4.290   5.231   -3.014  1.00 0.00 ? 853 LEU A C    3  
ATOM 2366 O O    . LEU A 1 62 ? 3.208   5.806   -2.878  1.00 0.00 ? 853 LEU A O    3  
ATOM 2367 C CB   . LEU A 1 62 ? 5.090   3.560   -1.347  1.00 0.00 ? 853 LEU A CB   3  
ATOM 2368 C CG   . LEU A 1 62 ? 4.813   2.140   -0.837  1.00 0.00 ? 853 LEU A CG   3  
ATOM 2369 C CD1  . LEU A 1 62 ? 5.711   1.844   0.362   1.00 0.00 ? 853 LEU A CD1  3  
ATOM 2370 C CD2  . LEU A 1 62 ? 3.339   2.016   -0.417  1.00 0.00 ? 853 LEU A CD2  3  
ATOM 2371 H H    . LEU A 1 62 ? 6.042   2.626   -3.515  1.00 0.00 ? 853 LEU A H    3  
ATOM 2372 H HA   . LEU A 1 62 ? 3.450   3.302   -2.694  1.00 0.00 ? 853 LEU A HA   3  
ATOM 2373 H HB2  . LEU A 1 62 ? 6.156   3.712   -1.444  1.00 0.00 ? 853 LEU A HB2  3  
ATOM 2374 H HB3  . LEU A 1 62 ? 4.687   4.278   -0.649  1.00 0.00 ? 853 LEU A HB3  3  
ATOM 2375 H HG   . LEU A 1 62 ? 5.029   1.429   -1.624  1.00 0.00 ? 853 LEU A HG   3  
ATOM 2376 H HD11 . LEU A 1 62 ? 6.223   2.746   0.655   1.00 0.00 ? 853 LEU A HD11 3  
ATOM 2377 H HD12 . LEU A 1 62 ? 6.435   1.092   0.089   1.00 0.00 ? 853 LEU A HD12 3  
ATOM 2378 H HD13 . LEU A 1 62 ? 5.112   1.486   1.186   1.00 0.00 ? 853 LEU A HD13 3  
ATOM 2379 H HD21 . LEU A 1 62 ? 2.810   2.927   -0.655  1.00 0.00 ? 853 LEU A HD21 3  
ATOM 2380 H HD22 . LEU A 1 62 ? 3.279   1.834   0.646   1.00 0.00 ? 853 LEU A HD22 3  
ATOM 2381 H HD23 . LEU A 1 62 ? 2.887   1.191   -0.947  1.00 0.00 ? 853 LEU A HD23 3  
ATOM 2382 N N    . LEU A 1 63 ? 5.374   5.836   -3.468  1.00 0.00 ? 854 LEU A N    3  
ATOM 2383 C CA   . LEU A 1 63 ? 5.346   7.243   -3.845  1.00 0.00 ? 854 LEU A CA   3  
ATOM 2384 C C    . LEU A 1 63 ? 4.432   7.431   -5.046  1.00 0.00 ? 854 LEU A C    3  
ATOM 2385 O O    . LEU A 1 63 ? 3.580   8.322   -5.065  1.00 0.00 ? 854 LEU A O    3  
ATOM 2386 C CB   . LEU A 1 63 ? 6.760   7.737   -4.186  1.00 0.00 ? 854 LEU A CB   3  
ATOM 2387 C CG   . LEU A 1 63 ? 7.045   9.054   -3.453  1.00 0.00 ? 854 LEU A CG   3  
ATOM 2388 C CD1  . LEU A 1 63 ? 8.519   9.414   -3.608  1.00 0.00 ? 854 LEU A CD1  3  
ATOM 2389 C CD2  . LEU A 1 63 ? 6.187   10.173  -4.049  1.00 0.00 ? 854 LEU A CD2  3  
ATOM 2390 H H    . LEU A 1 63 ? 6.198   5.314   -3.582  1.00 0.00 ? 854 LEU A H    3  
ATOM 2391 H HA   . LEU A 1 63 ? 4.960   7.822   -3.018  1.00 0.00 ? 854 LEU A HA   3  
ATOM 2392 H HB2  . LEU A 1 63 ? 7.486   6.995   -3.889  1.00 0.00 ? 854 LEU A HB2  3  
ATOM 2393 H HB3  . LEU A 1 63 ? 6.837   7.900   -5.252  1.00 0.00 ? 854 LEU A HB3  3  
ATOM 2394 H HG   . LEU A 1 63 ? 6.817   8.941   -2.402  1.00 0.00 ? 854 LEU A HG   3  
ATOM 2395 H HD11 . LEU A 1 63 ? 8.798   9.350   -4.649  1.00 0.00 ? 854 LEU A HD11 3  
ATOM 2396 H HD12 . LEU A 1 63 ? 9.121   8.727   -3.032  1.00 0.00 ? 854 LEU A HD12 3  
ATOM 2397 H HD13 . LEU A 1 63 ? 8.685   10.422  -3.253  1.00 0.00 ? 854 LEU A HD13 3  
ATOM 2398 H HD21 . LEU A 1 63 ? 5.143   9.970   -3.860  1.00 0.00 ? 854 LEU A HD21 3  
ATOM 2399 H HD22 . LEU A 1 63 ? 6.356   10.233  -5.114  1.00 0.00 ? 854 LEU A HD22 3  
ATOM 2400 H HD23 . LEU A 1 63 ? 6.457   11.114  -3.591  1.00 0.00 ? 854 LEU A HD23 3  
ATOM 2401 N N    . GLU A 1 64 ? 4.612   6.574   -6.042  1.00 0.00 ? 855 GLU A N    3  
ATOM 2402 C CA   . GLU A 1 64 ? 3.812   6.621   -7.258  1.00 0.00 ? 855 GLU A CA   3  
ATOM 2403 C C    . GLU A 1 64 ? 2.333   6.775   -6.933  1.00 0.00 ? 855 GLU A C    3  
ATOM 2404 O O    . GLU A 1 64 ? 1.646   7.617   -7.515  1.00 0.00 ? 855 GLU A O    3  
ATOM 2405 C CB   . GLU A 1 64 ? 4.031   5.349   -8.083  1.00 0.00 ? 855 GLU A CB   3  
ATOM 2406 C CG   . GLU A 1 64 ? 4.791   5.685   -9.366  1.00 0.00 ? 855 GLU A CG   3  
ATOM 2407 C CD   . GLU A 1 64 ? 3.831   6.226   -10.399 1.00 0.00 ? 855 GLU A CD   3  
ATOM 2408 O OE1  . GLU A 1 64 ? 3.319   7.307   -10.194 1.00 0.00 ? 855 GLU A OE1  3  
ATOM 2409 O OE2  . GLU A 1 64 ? 3.614   5.556   -11.377 1.00 0.00 ? 855 GLU A OE2  3  
ATOM 2410 H H    . GLU A 1 64 ? 5.307   5.886   -5.957  1.00 0.00 ? 855 GLU A H    3  
ATOM 2411 H HA   . GLU A 1 64 ? 4.127   7.471   -7.843  1.00 0.00 ? 855 GLU A HA   3  
ATOM 2412 N N    . ILE A 1 65 ? 1.843   5.955   -6.009  1.00 0.00 ? 856 ILE A N    3  
ATOM 2413 C CA   . ILE A 1 65 ? 0.438   6.020   -5.623  1.00 0.00 ? 856 ILE A CA   3  
ATOM 2414 C C    . ILE A 1 65 ? 0.080   7.438   -5.190  1.00 0.00 ? 856 ILE A C    3  
ATOM 2415 O O    . ILE A 1 65 ? -1.027  7.919   -5.447  1.00 0.00 ? 856 ILE A O    3  
ATOM 2416 C CB   . ILE A 1 65 ? 0.126   5.026   -4.484  1.00 0.00 ? 856 ILE A CB   3  
ATOM 2417 C CG1  . ILE A 1 65 ? 1.135   3.865   -4.503  1.00 0.00 ? 856 ILE A CG1  3  
ATOM 2418 C CG2  . ILE A 1 65 ? -1.284  4.463   -4.672  1.00 0.00 ? 856 ILE A CG2  3  
ATOM 2419 C CD1  . ILE A 1 65 ? 0.592   2.693   -3.682  1.00 0.00 ? 856 ILE A CD1  3  
ATOM 2420 H H    . ILE A 1 65 ? 2.436   5.297   -5.585  1.00 0.00 ? 856 ILE A H    3  
ATOM 2421 H HA   . ILE A 1 65 ? -0.162  5.763   -6.483  1.00 0.00 ? 856 ILE A HA   3  
ATOM 2422 H HB   . ILE A 1 65 ? 0.180   5.543   -3.536  1.00 0.00 ? 856 ILE A HB   3  
ATOM 2423 H HG12 . ILE A 1 65 ? 1.297   3.541   -5.521  1.00 0.00 ? 856 ILE A HG12 3  
ATOM 2424 H HG21 . ILE A 1 65 ? -1.954  5.254   -4.978  1.00 0.00 ? 856 ILE A HG21 3  
ATOM 2425 H HG22 . ILE A 1 65 ? -1.626  4.036   -3.741  1.00 0.00 ? 856 ILE A HG22 3  
ATOM 2426 H HG23 . ILE A 1 65 ? -1.261  3.696   -5.430  1.00 0.00 ? 856 ILE A HG23 3  
ATOM 2427 H HD11 . ILE A 1 65 ? 0.191   3.059   -2.748  1.00 0.00 ? 856 ILE A HD11 3  
ATOM 2428 H HD12 . ILE A 1 65 ? 1.391   1.994   -3.481  1.00 0.00 ? 856 ILE A HD12 3  
ATOM 2429 H HD13 . ILE A 1 65 ? -0.189  2.196   -4.238  1.00 0.00 ? 856 ILE A HD13 3  
ATOM 2430 N N    . GLY A 1 66 ? 1.031   8.111   -4.559  1.00 0.00 ? 857 GLY A N    3  
ATOM 2431 C CA   . GLY A 1 66 ? 0.828   9.483   -4.108  1.00 0.00 ? 857 GLY A CA   3  
ATOM 2432 C C    . GLY A 1 66 ? 0.388   9.520   -2.655  1.00 0.00 ? 857 GLY A C    3  
ATOM 2433 O O    . GLY A 1 66 ? -0.514  10.278  -2.289  1.00 0.00 ? 857 GLY A O    3  
ATOM 2434 H H    . GLY A 1 66 ? 1.901   7.681   -4.408  1.00 0.00 ? 857 GLY A H    3  
ATOM 2435 H HA2  . GLY A 1 66 ? 1.755   10.026  -4.211  1.00 0.00 ? 857 GLY A HA2  3  
ATOM 2436 H HA3  . GLY A 1 66 ? 0.072   9.955   -4.717  1.00 0.00 ? 857 GLY A HA3  3  
ATOM 2437 N N    . ILE A 1 67 ? 1.030   8.707   -1.829  1.00 0.00 ? 858 ILE A N    3  
ATOM 2438 C CA   . ILE A 1 67 ? 0.707   8.657   -0.406  1.00 0.00 ? 858 ILE A CA   3  
ATOM 2439 C C    . ILE A 1 67 ? 1.278   9.884   0.307   1.00 0.00 ? 858 ILE A C    3  
ATOM 2440 O O    . ILE A 1 67 ? 2.281   10.456  -0.136  1.00 0.00 ? 858 ILE A O    3  
ATOM 2441 C CB   . ILE A 1 67 ? 1.263   7.369   0.230   1.00 0.00 ? 858 ILE A CB   3  
ATOM 2442 C CG1  . ILE A 1 67 ? 1.057   6.168   -0.718  1.00 0.00 ? 858 ILE A CG1  3  
ATOM 2443 C CG2  . ILE A 1 67 ? 0.538   7.097   1.548   1.00 0.00 ? 858 ILE A CG2  3  
ATOM 2444 C CD1  . ILE A 1 67 ? -0.409  5.714   -0.678  1.00 0.00 ? 858 ILE A CD1  3  
ATOM 2445 H H    . ILE A 1 67 ? 1.746   8.137   -2.178  1.00 0.00 ? 858 ILE A H    3  
ATOM 2446 H HA   . ILE A 1 67 ? -0.368  8.664   -0.300  1.00 0.00 ? 858 ILE A HA   3  
ATOM 2447 H HB   . ILE A 1 67 ? 2.316   7.503   0.427   1.00 0.00 ? 858 ILE A HB   3  
ATOM 2448 H HG12 . ILE A 1 67 ? 1.321   6.445   -1.727  1.00 0.00 ? 858 ILE A HG12 3  
ATOM 2449 H HG21 . ILE A 1 67 ? -0.515  7.303   1.425   1.00 0.00 ? 858 ILE A HG21 3  
ATOM 2450 H HG22 . ILE A 1 67 ? 0.943   7.728   2.325   1.00 0.00 ? 858 ILE A HG22 3  
ATOM 2451 H HG23 . ILE A 1 67 ? 0.667   6.060   1.819   1.00 0.00 ? 858 ILE A HG23 3  
ATOM 2452 H HD11 . ILE A 1 67 ? -0.571  4.954   -1.428  1.00 0.00 ? 858 ILE A HD11 3  
ATOM 2453 H HD12 . ILE A 1 67 ? -1.055  6.556   -0.872  1.00 0.00 ? 858 ILE A HD12 3  
ATOM 2454 H HD13 . ILE A 1 67 ? -0.634  5.307   0.298   1.00 0.00 ? 858 ILE A HD13 3  
ATOM 2455 N N    . LEU A 1 68 ? 0.627   10.295  1.396   1.00 0.00 ? 859 LEU A N    3  
ATOM 2456 C CA   . LEU A 1 68 ? 1.059   11.474  2.149   1.00 0.00 ? 859 LEU A CA   3  
ATOM 2457 C C    . LEU A 1 68 ? 1.931   11.089  3.343   1.00 0.00 ? 859 LEU A C    3  
ATOM 2458 O O    . LEU A 1 68 ? 3.148   11.285  3.323   1.00 0.00 ? 859 LEU A O    3  
ATOM 2459 C CB   . LEU A 1 68 ? -0.166  12.267  2.639   1.00 0.00 ? 859 LEU A CB   3  
ATOM 2460 C CG   . LEU A 1 68 ? -0.500  13.395  1.652   1.00 0.00 ? 859 LEU A CG   3  
ATOM 2461 C CD1  . LEU A 1 68 ? 0.528   14.524  1.781   1.00 0.00 ? 859 LEU A CD1  3  
ATOM 2462 C CD2  . LEU A 1 68 ? -0.486  12.856  0.220   1.00 0.00 ? 859 LEU A CD2  3  
ATOM 2463 H H    . LEU A 1 68 ? -0.171  9.810   1.690   1.00 0.00 ? 859 LEU A H    3  
ATOM 2464 H HA   . LEU A 1 68 ? 1.638   12.110  1.499   1.00 0.00 ? 859 LEU A HA   3  
ATOM 2465 H HB2  . LEU A 1 68 ? -1.013  11.605  2.730   1.00 0.00 ? 859 LEU A HB2  3  
ATOM 2466 H HB3  . LEU A 1 68 ? 0.052   12.697  3.603   1.00 0.00 ? 859 LEU A HB3  3  
ATOM 2467 H HG   . LEU A 1 68 ? -1.481  13.783  1.884   1.00 0.00 ? 859 LEU A HG   3  
ATOM 2468 H HD11 . LEU A 1 68 ? 0.771   14.678  2.822   1.00 0.00 ? 859 LEU A HD11 3  
ATOM 2469 H HD12 . LEU A 1 68 ? 0.113   15.434  1.372   1.00 0.00 ? 859 LEU A HD12 3  
ATOM 2470 H HD13 . LEU A 1 68 ? 1.424   14.264  1.236   1.00 0.00 ? 859 LEU A HD13 3  
ATOM 2471 H HD21 . LEU A 1 68 ? 0.532   12.805  -0.138  1.00 0.00 ? 859 LEU A HD21 3  
ATOM 2472 H HD22 . LEU A 1 68 ? -1.057  13.517  -0.413  1.00 0.00 ? 859 LEU A HD22 3  
ATOM 2473 H HD23 . LEU A 1 68 ? -0.925  11.870  0.202   1.00 0.00 ? 859 LEU A HD23 3  
ATOM 2474 N N    . ASN A 1 69 ? 1.302   10.556  4.388   1.00 0.00 ? 860 ASN A N    3  
ATOM 2475 C CA   . ASN A 1 69 ? 2.027   10.170  5.602   1.00 0.00 ? 860 ASN A CA   3  
ATOM 2476 C C    . ASN A 1 69 ? 3.223   9.307   5.259   1.00 0.00 ? 860 ASN A C    3  
ATOM 2477 O O    . ASN A 1 69 ? 3.078   8.116   4.996   1.00 0.00 ? 860 ASN A O    3  
ATOM 2478 C CB   . ASN A 1 69 ? 1.101   9.416   6.566   1.00 0.00 ? 860 ASN A CB   3  
ATOM 2479 C CG   . ASN A 1 69 ? 1.900   8.838   7.739   1.00 0.00 ? 860 ASN A CG   3  
ATOM 2480 O OD1  . ASN A 1 69 ? 3.112   9.044   7.836   1.00 0.00 ? 860 ASN A OD1  3  
ATOM 2481 N ND2  . ASN A 1 69 ? 1.292   8.123   8.637   1.00 0.00 ? 860 ASN A ND2  3  
ATOM 2482 H H    . ASN A 1 69 ? 0.330   10.428  4.345   1.00 0.00 ? 860 ASN A H    3  
ATOM 2483 H HA   . ASN A 1 69 ? 2.377   11.066  6.094   1.00 0.00 ? 860 ASN A HA   3  
ATOM 2484 H HB2  . ASN A 1 69 ? 0.357   10.099  6.946   1.00 0.00 ? 860 ASN A HB2  3  
ATOM 2485 H HB3  . ASN A 1 69 ? 0.614   8.610   6.037   1.00 0.00 ? 860 ASN A HB3  3  
ATOM 2486 H HD21 . ASN A 1 69 ? 0.328   7.956   8.564   1.00 0.00 ? 860 ASN A HD21 3  
ATOM 2487 H HD22 . ASN A 1 69 ? 1.796   7.753   9.393   1.00 0.00 ? 860 ASN A HD22 3  
ATOM 2488 N N    . SER A 1 70 ? 4.400   9.906   5.264   1.00 0.00 ? 861 SER A N    3  
ATOM 2489 C CA   . SER A 1 70 ? 5.628   9.188   4.947   1.00 0.00 ? 861 SER A CA   3  
ATOM 2490 C C    . SER A 1 70 ? 5.674   7.841   5.669   1.00 0.00 ? 861 SER A C    3  
ATOM 2491 O O    . SER A 1 70 ? 6.168   6.848   5.127   1.00 0.00 ? 861 SER A O    3  
ATOM 2492 C CB   . SER A 1 70 ? 6.840   10.036  5.343   1.00 0.00 ? 861 SER A CB   3  
ATOM 2493 O OG   . SER A 1 70 ? 6.462   11.418  5.373   1.00 0.00 ? 861 SER A OG   3  
ATOM 2494 H H    . SER A 1 70 ? 4.449   10.859  5.481   1.00 0.00 ? 861 SER A H    3  
ATOM 2495 H HA   . SER A 1 70 ? 5.665   9.014   3.882   1.00 0.00 ? 861 SER A HA   3  
ATOM 2496 H HB2  . SER A 1 70 ? 7.186   9.743   6.322   1.00 0.00 ? 861 SER A HB2  3  
ATOM 2497 H HB3  . SER A 1 70 ? 7.638   9.877   4.628   1.00 0.00 ? 861 SER A HB3  3  
ATOM 2498 H HG   . SER A 1 70 ? 7.262   11.930  5.570   1.00 0.00 ? 861 SER A HG   3  
ATOM 2499 N N    . GLY A 1 71 ? 5.125   7.804   6.871   1.00 0.00 ? 862 GLY A N    3  
ATOM 2500 C CA   . GLY A 1 71 ? 5.089   6.574   7.648   1.00 0.00 ? 862 GLY A CA   3  
ATOM 2501 C C    . GLY A 1 71 ? 4.473   5.444   6.844   1.00 0.00 ? 862 GLY A C    3  
ATOM 2502 O O    . GLY A 1 71 ? 4.795   4.273   7.054   1.00 0.00 ? 862 GLY A O    3  
ATOM 2503 H H    . GLY A 1 71 ? 4.716   8.617   7.239   1.00 0.00 ? 862 GLY A H    3  
ATOM 2504 H HA2  . GLY A 1 71 ? 6.098   6.304   7.925   1.00 0.00 ? 862 GLY A HA2  3  
ATOM 2505 H HA3  . GLY A 1 71 ? 4.503   6.731   8.541   1.00 0.00 ? 862 GLY A HA3  3  
ATOM 2506 N N    . HIS A 1 72 ? 3.593   5.799   5.907   1.00 0.00 ? 863 HIS A N    3  
ATOM 2507 C CA   . HIS A 1 72 ? 2.943   4.803   5.069   1.00 0.00 ? 863 HIS A CA   3  
ATOM 2508 C C    . HIS A 1 72 ? 3.959   3.837   4.498   1.00 0.00 ? 863 HIS A C    3  
ATOM 2509 O O    . HIS A 1 72 ? 3.748   2.639   4.508   1.00 0.00 ? 863 HIS A O    3  
ATOM 2510 C CB   . HIS A 1 72 ? 2.152   5.468   3.925   1.00 0.00 ? 863 HIS A CB   3  
ATOM 2511 C CG   . HIS A 1 72 ? 3.097   5.972   2.858   1.00 0.00 ? 863 HIS A CG   3  
ATOM 2512 N ND1  . HIS A 1 72 ? 3.740   7.188   2.966   1.00 0.00 ? 863 HIS A ND1  3  
ATOM 2513 C CD2  . HIS A 1 72 ? 3.505   5.440   1.659   1.00 0.00 ? 863 HIS A CD2  3  
ATOM 2514 C CE1  . HIS A 1 72 ? 4.494   7.355   1.864   1.00 0.00 ? 863 HIS A CE1  3  
ATOM 2515 N NE2  . HIS A 1 72 ? 4.388   6.319   1.033   1.00 0.00 ? 863 HIS A NE2  3  
ATOM 2516 H H    . HIS A 1 72 ? 3.385   6.751   5.775   1.00 0.00 ? 863 HIS A H    3  
ATOM 2517 H HA   . HIS A 1 72 ? 2.250   4.245   5.680   1.00 0.00 ? 863 HIS A HA   3  
ATOM 2518 H HB2  . HIS A 1 72 ? 1.478   4.744   3.492   1.00 0.00 ? 863 HIS A HB2  3  
ATOM 2519 H HB3  . HIS A 1 72 ? 1.581   6.295   4.318   1.00 0.00 ? 863 HIS A HB3  3  
ATOM 2520 N N    . ARG A 1 73 ? 5.052   4.364   3.986   1.00 0.00 ? 864 ARG A N    3  
ATOM 2521 C CA   . ARG A 1 73 ? 6.073   3.519   3.389   1.00 0.00 ? 864 ARG A CA   3  
ATOM 2522 C C    . ARG A 1 73 ? 6.472   2.408   4.339   1.00 0.00 ? 864 ARG A C    3  
ATOM 2523 O O    . ARG A 1 73 ? 6.361   1.225   4.009   1.00 0.00 ? 864 ARG A O    3  
ATOM 2524 C CB   . ARG A 1 73 ? 7.303   4.349   3.024   1.00 0.00 ? 864 ARG A CB   3  
ATOM 2525 C CG   . ARG A 1 73 ? 7.072   5.066   1.682   1.00 0.00 ? 864 ARG A CG   3  
ATOM 2526 C CD   . ARG A 1 73 ? 8.133   4.635   0.662   1.00 0.00 ? 864 ARG A CD   3  
ATOM 2527 N NE   . ARG A 1 73 ? 9.381   4.275   1.337   1.00 0.00 ? 864 ARG A NE   3  
ATOM 2528 C CZ   . ARG A 1 73 ? 9.922   3.055   1.241   1.00 0.00 ? 864 ARG A CZ   3  
ATOM 2529 N NH1  . ARG A 1 73 ? 9.346   2.130   0.511   1.00 0.00 ? 864 ARG A NH1  3  
ATOM 2530 N NH2  . ARG A 1 73 ? 11.021  2.789   1.879   1.00 0.00 ? 864 ARG A NH2  3  
ATOM 2531 H H    . ARG A 1 73 ? 5.169   5.338   3.995   1.00 0.00 ? 864 ARG A H    3  
ATOM 2532 H HA   . ARG A 1 73 ? 5.671   3.079   2.494   1.00 0.00 ? 864 ARG A HA   3  
ATOM 2533 N N    . GLN A 1 74 ? 6.915   2.792   5.517   1.00 0.00 ? 865 GLN A N    3  
ATOM 2534 C CA   . GLN A 1 74 ? 7.329   1.833   6.527   1.00 0.00 ? 865 GLN A CA   3  
ATOM 2535 C C    . GLN A 1 74 ? 6.146   0.983   6.965   1.00 0.00 ? 865 GLN A C    3  
ATOM 2536 O O    . GLN A 1 74 ? 6.227   -0.245  7.005   1.00 0.00 ? 865 GLN A O    3  
ATOM 2537 C CB   . GLN A 1 74 ? 7.936   2.575   7.734   1.00 0.00 ? 865 GLN A CB   3  
ATOM 2538 C CG   . GLN A 1 74 ? 8.024   1.641   8.954   1.00 0.00 ? 865 GLN A CG   3  
ATOM 2539 C CD   . GLN A 1 74 ? 6.961   2.021   9.982   1.00 0.00 ? 865 GLN A CD   3  
ATOM 2540 O OE1  . GLN A 1 74 ? 6.320   1.146   10.569  1.00 0.00 ? 865 GLN A OE1  3  
ATOM 2541 N NE2  . GLN A 1 74 ? 6.734   3.274   10.238  1.00 0.00 ? 865 GLN A NE2  3  
ATOM 2542 H H    . GLN A 1 74 ? 6.960   3.750   5.711   1.00 0.00 ? 865 GLN A H    3  
ATOM 2543 H HA   . GLN A 1 74 ? 8.082   1.187   6.103   1.00 0.00 ? 865 GLN A HA   3  
ATOM 2544 H HB2  . GLN A 1 74 ? 8.927   2.918   7.476   1.00 0.00 ? 865 GLN A HB2  3  
ATOM 2545 H HB3  . GLN A 1 74 ? 7.315   3.426   7.974   1.00 0.00 ? 865 GLN A HB3  3  
ATOM 2546 H HG2  . GLN A 1 74 ? 7.875   0.617   8.644   1.00 0.00 ? 865 GLN A HG2  3  
ATOM 2547 H HG3  . GLN A 1 74 ? 9.000   1.736   9.405   1.00 0.00 ? 865 GLN A HG3  3  
ATOM 2548 H HE21 . GLN A 1 74 ? 7.244   3.971   9.773   1.00 0.00 ? 865 GLN A HE21 3  
ATOM 2549 H HE22 . GLN A 1 74 ? 6.054   3.527   10.898  1.00 0.00 ? 865 GLN A HE22 3  
ATOM 2550 N N    . ARG A 1 75 ? 5.053   1.641   7.294   1.00 0.00 ? 866 ARG A N    3  
ATOM 2551 C CA   . ARG A 1 75 ? 3.858   0.945   7.739   1.00 0.00 ? 866 ARG A CA   3  
ATOM 2552 C C    . ARG A 1 75 ? 3.374   -0.032  6.670   1.00 0.00 ? 866 ARG A C    3  
ATOM 2553 O O    . ARG A 1 75 ? 3.143   -1.212  6.951   1.00 0.00 ? 866 ARG A O    3  
ATOM 2554 C CB   . ARG A 1 75 ? 2.751   1.953   8.067   1.00 0.00 ? 866 ARG A CB   3  
ATOM 2555 C CG   . ARG A 1 75 ? 3.229   2.913   9.170   1.00 0.00 ? 866 ARG A CG   3  
ATOM 2556 C CD   . ARG A 1 75 ? 2.930   2.309   10.544  1.00 0.00 ? 866 ARG A CD   3  
ATOM 2557 N NE   . ARG A 1 75 ? 1.509   1.979   10.655  1.00 0.00 ? 866 ARG A NE   3  
ATOM 2558 C CZ   . ARG A 1 75 ? 1.078   0.964   11.408  1.00 0.00 ? 866 ARG A CZ   3  
ATOM 2559 N NH1  . ARG A 1 75 ? 1.929   0.247   12.087  1.00 0.00 ? 866 ARG A NH1  3  
ATOM 2560 N NH2  . ARG A 1 75 ? -0.188  0.697   11.470  1.00 0.00 ? 866 ARG A NH2  3  
ATOM 2561 H H    . ARG A 1 75 ? 5.047   2.622   7.241   1.00 0.00 ? 866 ARG A H    3  
ATOM 2562 H HA   . ARG A 1 75 ? 4.095   0.389   8.634   1.00 0.00 ? 866 ARG A HA   3  
ATOM 2563 N N    . ILE A 1 76 ? 3.216   0.469   5.453   1.00 0.00 ? 867 ILE A N    3  
ATOM 2564 C CA   . ILE A 1 76 ? 2.743   -0.344  4.344   1.00 0.00 ? 867 ILE A CA   3  
ATOM 2565 C C    . ILE A 1 76 ? 3.732   -1.454  4.008   1.00 0.00 ? 867 ILE A C    3  
ATOM 2566 O O    . ILE A 1 76 ? 3.356   -2.622  3.963   1.00 0.00 ? 867 ILE A O    3  
ATOM 2567 C CB   . ILE A 1 76 ? 2.495   0.534   3.100   1.00 0.00 ? 867 ILE A CB   3  
ATOM 2568 C CG1  . ILE A 1 76 ? 1.489   1.656   3.447   1.00 0.00 ? 867 ILE A CG1  3  
ATOM 2569 C CG2  . ILE A 1 76 ? 1.944   -0.324  1.953   1.00 0.00 ? 867 ILE A CG2  3  
ATOM 2570 C CD1  . ILE A 1 76 ? 0.068   1.252   3.038   1.00 0.00 ? 867 ILE A CD1  3  
ATOM 2571 H H    . ILE A 1 76 ? 3.417   1.416   5.295   1.00 0.00 ? 867 ILE A H    3  
ATOM 2572 H HA   . ILE A 1 76 ? 1.806   -0.795  4.631   1.00 0.00 ? 867 ILE A HA   3  
ATOM 2573 H HB   . ILE A 1 76 ? 3.433   0.972   2.790   1.00 0.00 ? 867 ILE A HB   3  
ATOM 2574 H HG12 . ILE A 1 76 ? 1.509   1.839   4.510   1.00 0.00 ? 867 ILE A HG12 3  
ATOM 2575 H HG21 . ILE A 1 76 ? 2.700   -1.019  1.622   1.00 0.00 ? 867 ILE A HG21 3  
ATOM 2576 H HG22 . ILE A 1 76 ? 1.657   0.315   1.132   1.00 0.00 ? 867 ILE A HG22 3  
ATOM 2577 H HG23 . ILE A 1 76 ? 1.078   -0.871  2.298   1.00 0.00 ? 867 ILE A HG23 3  
ATOM 2578 H HD11 . ILE A 1 76 ? -0.003  1.215   1.961   1.00 0.00 ? 867 ILE A HD11 3  
ATOM 2579 H HD12 . ILE A 1 76 ? -0.631  1.982   3.418   1.00 0.00 ? 867 ILE A HD12 3  
ATOM 2580 H HD13 . ILE A 1 76 ? -0.164  0.282   3.451   1.00 0.00 ? 867 ILE A HD13 3  
ATOM 2581 N N    . LEU A 1 77 ? 4.991   -1.092  3.746   1.00 0.00 ? 868 LEU A N    3  
ATOM 2582 C CA   . LEU A 1 77 ? 5.982   -2.097  3.364   1.00 0.00 ? 868 LEU A CA   3  
ATOM 2583 C C    . LEU A 1 77 ? 6.013   -3.222  4.379   1.00 0.00 ? 868 LEU A C    3  
ATOM 2584 O O    . LEU A 1 77 ? 5.940   -4.403  4.019   1.00 0.00 ? 868 LEU A O    3  
ATOM 2585 C CB   . LEU A 1 77 ? 7.386   -1.465  3.169   1.00 0.00 ? 868 LEU A CB   3  
ATOM 2586 C CG   . LEU A 1 77 ? 8.138   -1.332  4.506   1.00 0.00 ? 868 LEU A CG   3  
ATOM 2587 C CD1  . LEU A 1 77 ? 8.833   -2.655  4.851   1.00 0.00 ? 868 LEU A CD1  3  
ATOM 2588 C CD2  . LEU A 1 77 ? 9.200   -0.233  4.378   1.00 0.00 ? 868 LEU A CD2  3  
ATOM 2589 H H    . LEU A 1 77 ? 5.247   -0.144  3.783   1.00 0.00 ? 868 LEU A H    3  
ATOM 2590 H HA   . LEU A 1 77 ? 5.668   -2.518  2.421   1.00 0.00 ? 868 LEU A HA   3  
ATOM 2591 H HB2  . LEU A 1 77 ? 7.960   -2.092  2.507   1.00 0.00 ? 868 LEU A HB2  3  
ATOM 2592 H HB3  . LEU A 1 77 ? 7.276   -0.488  2.723   1.00 0.00 ? 868 LEU A HB3  3  
ATOM 2593 H HG   . LEU A 1 77 ? 7.445   -1.070  5.291   1.00 0.00 ? 868 LEU A HG   3  
ATOM 2594 H HD11 . LEU A 1 77 ? 9.895   -2.489  4.956   1.00 0.00 ? 868 LEU A HD11 3  
ATOM 2595 H HD12 . LEU A 1 77 ? 8.663   -3.376  4.065   1.00 0.00 ? 868 LEU A HD12 3  
ATOM 2596 H HD13 . LEU A 1 77 ? 8.440   -3.038  5.780   1.00 0.00 ? 868 LEU A HD13 3  
ATOM 2597 H HD21 . LEU A 1 77 ? 9.941   -0.533  3.652   1.00 0.00 ? 868 LEU A HD21 3  
ATOM 2598 H HD22 . LEU A 1 77 ? 9.678   -0.084  5.334   1.00 0.00 ? 868 LEU A HD22 3  
ATOM 2599 H HD23 . LEU A 1 77 ? 8.734   0.687   4.060   1.00 0.00 ? 868 LEU A HD23 3  
ATOM 2600 N N    . GLN A 1 78 ? 6.035   -2.859  5.639   1.00 0.00 ? 869 GLN A N    3  
ATOM 2601 C CA   . GLN A 1 78 ? 5.995   -3.845  6.699   1.00 0.00 ? 869 GLN A CA   3  
ATOM 2602 C C    . GLN A 1 78 ? 4.675   -4.595  6.649   1.00 0.00 ? 869 GLN A C    3  
ATOM 2603 O O    . GLN A 1 78 ? 4.627   -5.822  6.832   1.00 0.00 ? 869 GLN A O    3  
ATOM 2604 C CB   . GLN A 1 78 ? 6.146   -3.165  8.060   1.00 0.00 ? 869 GLN A CB   3  
ATOM 2605 C CG   . GLN A 1 78 ? 7.605   -2.753  8.276   1.00 0.00 ? 869 GLN A CG   3  
ATOM 2606 C CD   . GLN A 1 78 ? 7.793   -2.238  9.694   1.00 0.00 ? 869 GLN A CD   3  
ATOM 2607 O OE1  . GLN A 1 78 ? 7.119   -2.701  10.619  1.00 0.00 ? 869 GLN A OE1  3  
ATOM 2608 N NE2  . GLN A 1 78 ? 8.665   -1.309  9.927   1.00 0.00 ? 869 GLN A NE2  3  
ATOM 2609 H H    . GLN A 1 78 ? 6.034   -1.903  5.857   1.00 0.00 ? 869 GLN A H    3  
ATOM 2610 H HA   . GLN A 1 78 ? 6.805   -4.546  6.564   1.00 0.00 ? 869 GLN A HA   3  
ATOM 2611 H HB2  . GLN A 1 78 ? 5.513   -2.291  8.100   1.00 0.00 ? 869 GLN A HB2  3  
ATOM 2612 H HB3  . GLN A 1 78 ? 5.853   -3.854  8.836   1.00 0.00 ? 869 GLN A HB3  3  
ATOM 2613 H HG2  . GLN A 1 78 ? 8.248   -3.606  8.116   1.00 0.00 ? 869 GLN A HG2  3  
ATOM 2614 H HG3  . GLN A 1 78 ? 7.865   -1.972  7.576   1.00 0.00 ? 869 GLN A HG3  3  
ATOM 2615 H HE21 . GLN A 1 78 ? 9.201   -0.941  9.192   1.00 0.00 ? 869 GLN A HE21 3  
ATOM 2616 H HE22 . GLN A 1 78 ? 8.789   -0.973  10.839  1.00 0.00 ? 869 GLN A HE22 3  
ATOM 2617 N N    . ALA A 1 79 ? 3.598   -3.856  6.414   1.00 0.00 ? 870 ALA A N    3  
ATOM 2618 C CA   . ALA A 1 79 ? 2.276   -4.449  6.364   1.00 0.00 ? 870 ALA A CA   3  
ATOM 2619 C C    . ALA A 1 79 ? 2.191   -5.509  5.273   1.00 0.00 ? 870 ALA A C    3  
ATOM 2620 O O    . ALA A 1 79 ? 1.750   -6.630  5.532   1.00 0.00 ? 870 ALA A O    3  
ATOM 2621 C CB   . ALA A 1 79 ? 1.209   -3.374  6.137   1.00 0.00 ? 870 ALA A CB   3  
ATOM 2622 H H    . ALA A 1 79 ? 3.698   -2.887  6.288   1.00 0.00 ? 870 ALA A H    3  
ATOM 2623 H HA   . ALA A 1 79 ? 2.082   -4.921  7.316   1.00 0.00 ? 870 ALA A HA   3  
ATOM 2624 H HB1  . ALA A 1 79 ? 1.276   -2.628  6.915   1.00 0.00 ? 870 ALA A HB1  3  
ATOM 2625 H HB2  . ALA A 1 79 ? 0.230   -3.829  6.163   1.00 0.00 ? 870 ALA A HB2  3  
ATOM 2626 H HB3  . ALA A 1 79 ? 1.362   -2.906  5.176   1.00 0.00 ? 870 ALA A HB3  3  
ATOM 2627 N N    . ILE A 1 80 ? 2.629   -5.174  4.055   1.00 0.00 ? 871 ILE A N    3  
ATOM 2628 C CA   . ILE A 1 80 ? 2.588   -6.156  2.973   1.00 0.00 ? 871 ILE A CA   3  
ATOM 2629 C C    . ILE A 1 80 ? 3.567   -7.284  3.247   1.00 0.00 ? 871 ILE A C    3  
ATOM 2630 O O    . ILE A 1 80 ? 3.244   -8.454  3.054   1.00 0.00 ? 871 ILE A O    3  
ATOM 2631 C CB   . ILE A 1 80 ? 2.866   -5.534  1.584   1.00 0.00 ? 871 ILE A CB   3  
ATOM 2632 C CG1  . ILE A 1 80 ? 3.494   -4.149  1.712   1.00 0.00 ? 871 ILE A CG1  3  
ATOM 2633 C CG2  . ILE A 1 80 ? 1.556   -5.411  0.800   1.00 0.00 ? 871 ILE A CG2  3  
ATOM 2634 C CD1  . ILE A 1 80 ? 3.942   -3.669  0.326   1.00 0.00 ? 871 ILE A CD1  3  
ATOM 2635 H H    . ILE A 1 80 ? 2.990   -4.274  3.894   1.00 0.00 ? 871 ILE A H    3  
ATOM 2636 H HA   . ILE A 1 80 ? 1.595   -6.583  2.963   1.00 0.00 ? 871 ILE A HA   3  
ATOM 2637 H HB   . ILE A 1 80 ? 3.535   -6.190  1.045   1.00 0.00 ? 871 ILE A HB   3  
ATOM 2638 H HG12 . ILE A 1 80 ? 2.758   -3.463  2.101   1.00 0.00 ? 871 ILE A HG12 3  
ATOM 2639 H HG21 . ILE A 1 80 ? 1.250   -6.385  0.449   1.00 0.00 ? 871 ILE A HG21 3  
ATOM 2640 H HG22 . ILE A 1 80 ? 1.702   -4.755  -0.047  1.00 0.00 ? 871 ILE A HG22 3  
ATOM 2641 H HG23 . ILE A 1 80 ? 0.788   -5.002  1.438   1.00 0.00 ? 871 ILE A HG23 3  
ATOM 2642 H HD11 . ILE A 1 80 ? 4.824   -3.054  0.423   1.00 0.00 ? 871 ILE A HD11 3  
ATOM 2643 H HD12 . ILE A 1 80 ? 3.150   -3.092  -0.126  1.00 0.00 ? 871 ILE A HD12 3  
ATOM 2644 H HD13 . ILE A 1 80 ? 4.164   -4.521  -0.303  1.00 0.00 ? 871 ILE A HD13 3  
ATOM 2645 N N    . GLN A 1 81 ? 4.759   -6.935  3.723   1.00 0.00 ? 872 GLN A N    3  
ATOM 2646 C CA   . GLN A 1 81 ? 5.767   -7.944  4.032   1.00 0.00 ? 872 GLN A CA   3  
ATOM 2647 C C    . GLN A 1 81 ? 5.187   -9.007  4.959   1.00 0.00 ? 872 GLN A C    3  
ATOM 2648 O O    . GLN A 1 81 ? 5.603   -10.167 4.927   1.00 0.00 ? 872 GLN A O    3  
ATOM 2649 C CB   . GLN A 1 81 ? 6.992   -7.293  4.688   1.00 0.00 ? 872 GLN A CB   3  
ATOM 2650 C CG   . GLN A 1 81 ? 7.872   -6.648  3.609   1.00 0.00 ? 872 GLN A CG   3  
ATOM 2651 C CD   . GLN A 1 81 ? 9.094   -5.987  4.244   1.00 0.00 ? 872 GLN A CD   3  
ATOM 2652 O OE1  . GLN A 1 81 ? 9.996   -5.540  3.537   1.00 0.00 ? 872 GLN A OE1  3  
ATOM 2653 N NE2  . GLN A 1 81 ? 9.181   -5.895  5.537   1.00 0.00 ? 872 GLN A NE2  3  
ATOM 2654 H H    . GLN A 1 81 ? 4.961   -5.985  3.875   1.00 0.00 ? 872 GLN A H    3  
ATOM 2655 H HA   . GLN A 1 81 ? 6.078   -8.418  3.113   1.00 0.00 ? 872 GLN A HA   3  
ATOM 2656 H HB2  . GLN A 1 81 ? 6.668   -6.541  5.392   1.00 0.00 ? 872 GLN A HB2  3  
ATOM 2657 H HB3  . GLN A 1 81 ? 7.564   -8.049  5.206   1.00 0.00 ? 872 GLN A HB3  3  
ATOM 2658 H HG2  . GLN A 1 81 ? 8.199   -7.406  2.913   1.00 0.00 ? 872 GLN A HG2  3  
ATOM 2659 H HG3  . GLN A 1 81 ? 7.303   -5.902  3.076   1.00 0.00 ? 872 GLN A HG3  3  
ATOM 2660 H HE21 . GLN A 1 81 ? 8.466   -6.249  6.106   1.00 0.00 ? 872 GLN A HE21 3  
ATOM 2661 H HE22 . GLN A 1 81 ? 9.964   -5.469  5.946   1.00 0.00 ? 872 GLN A HE22 3  
ATOM 2662 N N    . LEU A 1 82 ? 4.229   -8.603  5.782   1.00 0.00 ? 873 LEU A N    3  
ATOM 2663 C CA   . LEU A 1 82 ? 3.592   -9.522  6.724   1.00 0.00 ? 873 LEU A CA   3  
ATOM 2664 C C    . LEU A 1 82 ? 2.520   -10.373 6.035   1.00 0.00 ? 873 LEU A C    3  
ATOM 2665 O O    . LEU A 1 82 ? 2.124   -11.423 6.554   1.00 0.00 ? 873 LEU A O    3  
ATOM 2666 C CB   . LEU A 1 82 ? 2.958   -8.737  7.885   1.00 0.00 ? 873 LEU A CB   3  
ATOM 2667 C CG   . LEU A 1 82 ? 3.736   -8.998  9.186   1.00 0.00 ? 873 LEU A CG   3  
ATOM 2668 C CD1  . LEU A 1 82 ? 3.623   -10.476 9.573   1.00 0.00 ? 873 LEU A CD1  3  
ATOM 2669 C CD2  . LEU A 1 82 ? 5.214   -8.627  8.991   1.00 0.00 ? 873 LEU A CD2  3  
ATOM 2670 H H    . LEU A 1 82 ? 3.952   -7.661  5.767   1.00 0.00 ? 873 LEU A H    3  
ATOM 2671 H HA   . LEU A 1 82 ? 4.346   -10.182 7.125   1.00 0.00 ? 873 LEU A HA   3  
ATOM 2672 H HB2  . LEU A 1 82 ? 2.977   -7.682  7.659   1.00 0.00 ? 873 LEU A HB2  3  
ATOM 2673 H HB3  . LEU A 1 82 ? 1.933   -9.053  8.016   1.00 0.00 ? 873 LEU A HB3  3  
ATOM 2674 H HG   . LEU A 1 82 ? 3.312   -8.394  9.977   1.00 0.00 ? 873 LEU A HG   3  
ATOM 2675 H HD11 . LEU A 1 82 ? 4.485   -11.017 9.212   1.00 0.00 ? 873 LEU A HD11 3  
ATOM 2676 H HD12 . LEU A 1 82 ? 2.728   -10.899 9.143   1.00 0.00 ? 873 LEU A HD12 3  
ATOM 2677 H HD13 . LEU A 1 82 ? 3.574   -10.560 10.648  1.00 0.00 ? 873 LEU A HD13 3  
ATOM 2678 H HD21 . LEU A 1 82 ? 5.795   -9.522  8.820   1.00 0.00 ? 873 LEU A HD21 3  
ATOM 2679 H HD22 . LEU A 1 82 ? 5.579   -8.128  9.876   1.00 0.00 ? 873 LEU A HD22 3  
ATOM 2680 H HD23 . LEU A 1 82 ? 5.318   -7.966  8.143   1.00 0.00 ? 873 LEU A HD23 3  
ATOM 2681 N N    . LEU A 1 83 ? 2.033   -9.913  4.887   1.00 0.00 ? 874 LEU A N    3  
ATOM 2682 C CA   . LEU A 1 83 ? 0.984   -10.639 4.164   1.00 0.00 ? 874 LEU A CA   3  
ATOM 2683 C C    . LEU A 1 83 ? 1.501   -11.977 3.648   1.00 0.00 ? 874 LEU A C    3  
ATOM 2684 O O    . LEU A 1 83 ? 2.699   -12.139 3.415   1.00 0.00 ? 874 LEU A O    3  
ATOM 2685 C CB   . LEU A 1 83 ? 0.461   -9.805  2.987   1.00 0.00 ? 874 LEU A CB   3  
ATOM 2686 C CG   . LEU A 1 83 ? -0.248  -8.549  3.509   1.00 0.00 ? 874 LEU A CG   3  
ATOM 2687 C CD1  . LEU A 1 83 ? -0.671  -7.678  2.329   1.00 0.00 ? 874 LEU A CD1  3  
ATOM 2688 C CD2  . LEU A 1 83 ? -1.493  -8.949  4.310   1.00 0.00 ? 874 LEU A CD2  3  
ATOM 2689 H H    . LEU A 1 83 ? 2.374   -9.069  4.522   1.00 0.00 ? 874 LEU A H    3  
ATOM 2690 H HA   . LEU A 1 83 ? 0.169   -10.822 4.846   1.00 0.00 ? 874 LEU A HA   3  
ATOM 2691 H HB2  . LEU A 1 83 ? 1.290   -9.520  2.354   1.00 0.00 ? 874 LEU A HB2  3  
ATOM 2692 H HB3  . LEU A 1 83 ? -0.235  -10.397 2.411   1.00 0.00 ? 874 LEU A HB3  3  
ATOM 2693 H HG   . LEU A 1 83 ? 0.427   -7.991  4.141   1.00 0.00 ? 874 LEU A HG   3  
ATOM 2694 H HD11 . LEU A 1 83 ? -0.838  -6.668  2.671   1.00 0.00 ? 874 LEU A HD11 3  
ATOM 2695 H HD12 . LEU A 1 83 ? -1.581  -8.070  1.903   1.00 0.00 ? 874 LEU A HD12 3  
ATOM 2696 H HD13 . LEU A 1 83 ? 0.105   -7.680  1.578   1.00 0.00 ? 874 LEU A HD13 3  
ATOM 2697 H HD21 . LEU A 1 83 ? -1.200  -9.293  5.290   1.00 0.00 ? 874 LEU A HD21 3  
ATOM 2698 H HD22 . LEU A 1 83 ? -2.023  -9.735  3.794   1.00 0.00 ? 874 LEU A HD22 3  
ATOM 2699 H HD23 . LEU A 1 83 ? -2.144  -8.091  4.413   1.00 0.00 ? 874 LEU A HD23 3  
ATOM 2700 N N    . PRO A 1 84 ? 0.615   -12.928 3.445   1.00 0.00 ? 875 PRO A N    3  
ATOM 2701 C CA   . PRO A 1 84 ? 0.991   -14.272 2.917   1.00 0.00 ? 875 PRO A CA   3  
ATOM 2702 C C    . PRO A 1 84 ? 1.785   -14.155 1.622   1.00 0.00 ? 875 PRO A C    3  
ATOM 2703 O O    . PRO A 1 84 ? 1.598   -13.204 0.855   1.00 0.00 ? 875 PRO A O    3  
ATOM 2704 C CB   . PRO A 1 84 ? -0.355  -14.958 2.664   1.00 0.00 ? 875 PRO A CB   3  
ATOM 2705 C CG   . PRO A 1 84 ? -1.326  -14.265 3.565   1.00 0.00 ? 875 PRO A CG   3  
ATOM 2706 C CD   . PRO A 1 84 ? -0.835  -12.824 3.700   1.00 0.00 ? 875 PRO A CD   3  
ATOM 2707 H HA   . PRO A 1 84 ? 1.542   -14.833 3.653   1.00 0.00 ? 875 PRO A HA   3  
ATOM 2708 H HB2  . PRO A 1 84 ? -0.645  -14.840 1.628   1.00 0.00 ? 875 PRO A HB2  3  
ATOM 2709 H HB3  . PRO A 1 84 ? -0.300  -16.005 2.922   1.00 0.00 ? 875 PRO A HB3  3  
ATOM 2710 H HG2  . PRO A 1 84 ? -2.316  -14.291 3.130   1.00 0.00 ? 875 PRO A HG2  3  
ATOM 2711 H HG3  . PRO A 1 84 ? -1.336  -14.734 4.538   1.00 0.00 ? 875 PRO A HG3  3  
ATOM 2712 H HD2  . PRO A 1 84 ? -1.315  -12.194 2.963   1.00 0.00 ? 875 PRO A HD2  3  
ATOM 2713 H HD3  . PRO A 1 84 ? -1.012  -12.454 4.698   1.00 0.00 ? 875 PRO A HD3  3  
ATOM 2714 N N    . LYS A 1 85 ? 2.657   -15.115 1.380   1.00 0.00 ? 876 LYS A N    3  
ATOM 2715 C CA   . LYS A 1 85 ? 3.470   -15.115 0.174   1.00 0.00 ? 876 LYS A CA   3  
ATOM 2716 C C    . LYS A 1 85 ? 2.847   -16.006 -0.895  1.00 0.00 ? 876 LYS A C    3  
ATOM 2717 O O    . LYS A 1 85 ? 1.867   -16.652 -0.603  1.00 0.00 ? 876 LYS A O    3  
ATOM 2718 C CB   . LYS A 1 85 ? 4.892   -15.600 0.493   1.00 0.00 ? 876 LYS A CB   3  
ATOM 2719 C CG   . LYS A 1 85 ? 5.900   -14.479 0.206   1.00 0.00 ? 876 LYS A CG   3  
ATOM 2720 C CD   . LYS A 1 85 ? 6.013   -14.250 -1.310  1.00 0.00 ? 876 LYS A CD   3  
ATOM 2721 C CE   . LYS A 1 85 ? 6.707   -15.452 -1.970  1.00 0.00 ? 876 LYS A CE   3  
ATOM 2722 N NZ   . LYS A 1 85 ? 5.688   -16.406 -2.486  1.00 0.00 ? 876 LYS A NZ   3  
ATOM 2723 H H    . LYS A 1 85 ? 2.753   -15.847 2.025   1.00 0.00 ? 876 LYS A H    3  
ATOM 2724 H HA   . LYS A 1 85 ? 3.526   -14.105 -0.205  1.00 0.00 ? 876 LYS A HA   3  
ATOM 2725 N N    . GLN A 1 23 ? -6.408  -8.656  5.147   1.00 0.00 ? 814 GLN A N    4  
ATOM 2726 C CA   . GLN A 1 23 ? -7.410  -9.388  4.339   1.00 0.00 ? 814 GLN A CA   4  
ATOM 2727 C C    . GLN A 1 23 ? -7.569  -8.669  2.999   1.00 0.00 ? 814 GLN A C    4  
ATOM 2728 O O    . GLN A 1 23 ? -6.598  -8.491  2.264   1.00 0.00 ? 814 GLN A O    4  
ATOM 2729 C CB   . GLN A 1 23 ? -8.747  -9.433  5.108   1.00 0.00 ? 814 GLN A CB   4  
ATOM 2730 C CG   . GLN A 1 23 ? -9.664  -10.513 4.519   1.00 0.00 ? 814 GLN A CG   4  
ATOM 2731 C CD   . GLN A 1 23 ? -11.075 -9.970  4.394   1.00 0.00 ? 814 GLN A CD   4  
ATOM 2732 O OE1  . GLN A 1 23 ? -11.268 -8.866  3.875   1.00 0.00 ? 814 GLN A OE1  4  
ATOM 2733 N NE2  . GLN A 1 23 ? -12.073 -10.663 4.839   1.00 0.00 ? 814 GLN A NE2  4  
ATOM 2734 H HA   . GLN A 1 23 ? -7.057  -10.394 4.164   1.00 0.00 ? 814 GLN A HA   4  
ATOM 2735 H HB2  . GLN A 1 23 ? -8.555  -9.661  6.146   1.00 0.00 ? 814 GLN A HB2  4  
ATOM 2736 H HB3  . GLN A 1 23 ? -9.237  -8.474  5.042   1.00 0.00 ? 814 GLN A HB3  4  
ATOM 2737 H HG2  . GLN A 1 23 ? -9.306  -10.812 3.544   1.00 0.00 ? 814 GLN A HG2  4  
ATOM 2738 H HG3  . GLN A 1 23 ? -9.673  -11.371 5.175   1.00 0.00 ? 814 GLN A HG3  4  
ATOM 2739 H HE21 . GLN A 1 23 ? -11.917 -11.537 5.255   1.00 0.00 ? 814 GLN A HE21 4  
ATOM 2740 H HE22 . GLN A 1 23 ? -12.987 -10.317 4.759   1.00 0.00 ? 814 GLN A HE22 4  
ATOM 2741 N N    . THR A 1 24 ? -8.778  -8.228  2.702   1.00 0.00 ? 815 THR A N    4  
ATOM 2742 C CA   . THR A 1 24 ? -9.051  -7.511  1.470   1.00 0.00 ? 815 THR A CA   4  
ATOM 2743 C C    . THR A 1 24 ? -8.590  -6.065  1.591   1.00 0.00 ? 815 THR A C    4  
ATOM 2744 O O    . THR A 1 24 ? -8.288  -5.588  2.694   1.00 0.00 ? 815 THR A O    4  
ATOM 2745 C CB   . THR A 1 24 ? -10.549 -7.556  1.158   1.00 0.00 ? 815 THR A CB   4  
ATOM 2746 O OG1  . THR A 1 24 ? -11.066 -8.838  1.502   1.00 0.00 ? 815 THR A OG1  4  
ATOM 2747 C CG2  . THR A 1 24 ? -10.779 -7.300  -0.331  1.00 0.00 ? 815 THR A CG2  4  
ATOM 2748 H H    . THR A 1 24 ? -9.514  -8.378  3.330   1.00 0.00 ? 815 THR A H    4  
ATOM 2749 H HA   . THR A 1 24 ? -8.510  -7.987  0.664   1.00 0.00 ? 815 THR A HA   4  
ATOM 2750 H HB   . THR A 1 24 ? -11.056 -6.791  1.728   1.00 0.00 ? 815 THR A HB   4  
ATOM 2751 H HG21 . THR A 1 24 ? -11.120 -6.284  -0.474  1.00 0.00 ? 815 THR A HG21 4  
ATOM 2752 H HG22 . THR A 1 24 ? -11.530 -7.983  -0.700  1.00 0.00 ? 815 THR A HG22 4  
ATOM 2753 H HG23 . THR A 1 24 ? -9.859  -7.451  -0.877  1.00 0.00 ? 815 THR A HG23 4  
ATOM 2754 N N    . VAL A 1 25 ? -8.533  -5.364  0.463   1.00 0.00 ? 816 VAL A N    4  
ATOM 2755 C CA   . VAL A 1 25 ? -8.120  -3.977  0.478   1.00 0.00 ? 816 VAL A CA   4  
ATOM 2756 C C    . VAL A 1 25 ? -9.084  -3.188  1.357   1.00 0.00 ? 816 VAL A C    4  
ATOM 2757 O O    . VAL A 1 25 ? -10.140 -3.703  1.749   1.00 0.00 ? 816 VAL A O    4  
ATOM 2758 C CB   . VAL A 1 25 ? -8.099  -3.408  -0.953  1.00 0.00 ? 816 VAL A CB   4  
ATOM 2759 C CG1  . VAL A 1 25 ? -6.757  -3.735  -1.620  1.00 0.00 ? 816 VAL A CG1  4  
ATOM 2760 C CG2  . VAL A 1 25 ? -9.235  -4.029  -1.782  1.00 0.00 ? 816 VAL A CG2  4  
ATOM 2761 H H    . VAL A 1 25 ? -8.784  -5.781  -0.386  1.00 0.00 ? 816 VAL A H    4  
ATOM 2762 H HA   . VAL A 1 25 ? -7.128  -3.912  0.900   1.00 0.00 ? 816 VAL A HA   4  
ATOM 2763 H HB   . VAL A 1 25 ? -8.224  -2.335  -0.910  1.00 0.00 ? 816 VAL A HB   4  
ATOM 2764 H HG11 . VAL A 1 25 ? -6.800  -3.467  -2.665  1.00 0.00 ? 816 VAL A HG11 4  
ATOM 2765 H HG12 . VAL A 1 25 ? -6.556  -4.792  -1.531  1.00 0.00 ? 816 VAL A HG12 4  
ATOM 2766 H HG13 . VAL A 1 25 ? -5.969  -3.174  -1.139  1.00 0.00 ? 816 VAL A HG13 4  
ATOM 2767 H HG21 . VAL A 1 25 ? -9.627  -3.285  -2.460  1.00 0.00 ? 816 VAL A HG21 4  
ATOM 2768 H HG22 . VAL A 1 25 ? -10.024 -4.369  -1.129  1.00 0.00 ? 816 VAL A HG22 4  
ATOM 2769 H HG23 . VAL A 1 25 ? -8.853  -4.864  -2.352  1.00 0.00 ? 816 VAL A HG23 4  
ATOM 2770 N N    . GLY A 1 26 ? -8.695  -1.994  1.743   1.00 0.00 ? 817 GLY A N    4  
ATOM 2771 C CA   . GLY A 1 26 ? -9.504  -1.221  2.668   1.00 0.00 ? 817 GLY A CA   4  
ATOM 2772 C C    . GLY A 1 26 ? -9.320  -1.786  4.066   1.00 0.00 ? 817 GLY A C    4  
ATOM 2773 O O    . GLY A 1 26 ? -8.630  -1.194  4.897   1.00 0.00 ? 817 GLY A O    4  
ATOM 2774 H H    . GLY A 1 26 ? -7.828  -1.643  1.450   1.00 0.00 ? 817 GLY A H    4  
ATOM 2775 H HA2  . GLY A 1 26 ? -9.190  -0.187  2.641   1.00 0.00 ? 817 GLY A HA2  4  
ATOM 2776 H HA3  . GLY A 1 26 ? -10.546 -1.291  2.392   1.00 0.00 ? 817 GLY A HA3  4  
ATOM 2777 N N    . GLN A 1 27 ? -9.837  -2.999  4.283   1.00 0.00 ? 818 GLN A N    4  
ATOM 2778 C CA   . GLN A 1 27 ? -9.638  -3.691  5.558   1.00 0.00 ? 818 GLN A CA   4  
ATOM 2779 C C    . GLN A 1 27 ? -8.158  -3.721  5.870   1.00 0.00 ? 818 GLN A C    4  
ATOM 2780 O O    . GLN A 1 27 ? -7.740  -3.524  7.010   1.00 0.00 ? 818 GLN A O    4  
ATOM 2781 C CB   . GLN A 1 27 ? -10.173 -5.131  5.475   1.00 0.00 ? 818 GLN A CB   4  
ATOM 2782 C CG   . GLN A 1 27 ? -9.949  -5.853  6.818   1.00 0.00 ? 818 GLN A CG   4  
ATOM 2783 C CD   . GLN A 1 27 ? -8.649  -6.669  6.791   1.00 0.00 ? 818 GLN A CD   4  
ATOM 2784 O OE1  . GLN A 1 27 ? -7.980  -6.764  5.752   1.00 0.00 ? 818 GLN A OE1  4  
ATOM 2785 N NE2  . GLN A 1 27 ? -8.252  -7.268  7.869   1.00 0.00 ? 818 GLN A NE2  4  
ATOM 2786 H H    . GLN A 1 27 ? -10.301 -3.459  3.548   1.00 0.00 ? 818 GLN A H    4  
ATOM 2787 H HA   . GLN A 1 27 ? -10.161 -3.158  6.339   1.00 0.00 ? 818 GLN A HA   4  
ATOM 2788 H HB2  . GLN A 1 27 ? -11.230 -5.107  5.254   1.00 0.00 ? 818 GLN A HB2  4  
ATOM 2789 H HB3  . GLN A 1 27 ? -9.656  -5.664  4.691   1.00 0.00 ? 818 GLN A HB3  4  
ATOM 2790 H HG2  . GLN A 1 27 ? -9.894  -5.124  7.613   1.00 0.00 ? 818 GLN A HG2  4  
ATOM 2791 H HG3  . GLN A 1 27 ? -10.780 -6.517  7.004   1.00 0.00 ? 818 GLN A HG3  4  
ATOM 2792 H HE21 . GLN A 1 27 ? -8.780  -7.199  8.691   1.00 0.00 ? 818 GLN A HE21 4  
ATOM 2793 H HE22 . GLN A 1 27 ? -7.420  -7.787  7.865   1.00 0.00 ? 818 GLN A HE22 4  
ATOM 2794 N N    . TRP A 1 28 ? -7.374  -3.944  4.836   1.00 0.00 ? 819 TRP A N    4  
ATOM 2795 C CA   . TRP A 1 28 ? -5.932  -3.968  4.955   1.00 0.00 ? 819 TRP A CA   4  
ATOM 2796 C C    . TRP A 1 28 ? -5.435  -2.623  5.474   1.00 0.00 ? 819 TRP A C    4  
ATOM 2797 O O    . TRP A 1 28 ? -4.769  -2.547  6.509   1.00 0.00 ? 819 TRP A O    4  
ATOM 2798 C CB   . TRP A 1 28 ? -5.328  -4.256  3.584   1.00 0.00 ? 819 TRP A CB   4  
ATOM 2799 C CG   . TRP A 1 28 ? -3.854  -4.443  3.684   1.00 0.00 ? 819 TRP A CG   4  
ATOM 2800 C CD1  . TRP A 1 28 ? -3.236  -5.432  4.370   1.00 0.00 ? 819 TRP A CD1  4  
ATOM 2801 C CD2  . TRP A 1 28 ? -2.806  -3.645  3.078   1.00 0.00 ? 819 TRP A CD2  4  
ATOM 2802 N NE1  . TRP A 1 28 ? -1.872  -5.289  4.216   1.00 0.00 ? 819 TRP A NE1  4  
ATOM 2803 C CE2  . TRP A 1 28 ? -1.558  -4.200  3.427   1.00 0.00 ? 819 TRP A CE2  4  
ATOM 2804 C CE3  . TRP A 1 28 ? -2.818  -2.497  2.259   1.00 0.00 ? 819 TRP A CE3  4  
ATOM 2805 C CZ2  . TRP A 1 28 ? -0.366  -3.645  2.983   1.00 0.00 ? 819 TRP A CZ2  4  
ATOM 2806 C CZ3  . TRP A 1 28 ? -1.614  -1.935  1.810   1.00 0.00 ? 819 TRP A CZ3  4  
ATOM 2807 C CH2  . TRP A 1 28 ? -0.390  -2.511  2.171   1.00 0.00 ? 819 TRP A CH2  4  
ATOM 2808 H H    . TRP A 1 28 ? -7.783  -4.084  3.956   1.00 0.00 ? 819 TRP A H    4  
ATOM 2809 H HA   . TRP A 1 28 ? -5.639  -4.750  5.640   1.00 0.00 ? 819 TRP A HA   4  
ATOM 2810 H HB2  . TRP A 1 28 ? -5.770  -5.155  3.181   1.00 0.00 ? 819 TRP A HB2  4  
ATOM 2811 H HB3  . TRP A 1 28 ? -5.539  -3.429  2.921   1.00 0.00 ? 819 TRP A HB3  4  
ATOM 2812 H HD1  . TRP A 1 28 ? -3.727  -6.207  4.942   1.00 0.00 ? 819 TRP A HD1  4  
ATOM 2813 N N    . LEU A 1 29 ? -5.811  -1.558  4.768   1.00 0.00 ? 820 LEU A N    4  
ATOM 2814 C CA   . LEU A 1 29 ? -5.442  -0.206  5.166   1.00 0.00 ? 820 LEU A CA   4  
ATOM 2815 C C    . LEU A 1 29 ? -5.884  0.052   6.598   1.00 0.00 ? 820 LEU A C    4  
ATOM 2816 O O    . LEU A 1 29 ? -5.117  0.569   7.419   1.00 0.00 ? 820 LEU A O    4  
ATOM 2817 C CB   . LEU A 1 29 ? -6.088  0.812   4.223   1.00 0.00 ? 820 LEU A CB   4  
ATOM 2818 C CG   . LEU A 1 29 ? -5.501  0.639   2.814   1.00 0.00 ? 820 LEU A CG   4  
ATOM 2819 C CD1  . LEU A 1 29 ? -6.320  1.444   1.811   1.00 0.00 ? 820 LEU A CD1  4  
ATOM 2820 C CD2  . LEU A 1 29 ? -4.049  1.132   2.798   1.00 0.00 ? 820 LEU A CD2  4  
ATOM 2821 H H    . LEU A 1 29 ? -6.374  -1.686  3.980   1.00 0.00 ? 820 LEU A H    4  
ATOM 2822 H HA   . LEU A 1 29 ? -4.368  -0.102  5.105   1.00 0.00 ? 820 LEU A HA   4  
ATOM 2823 H HB2  . LEU A 1 29 ? -7.157  0.650   4.198   1.00 0.00 ? 820 LEU A HB2  4  
ATOM 2824 H HB3  . LEU A 1 29 ? -5.885  1.812   4.577   1.00 0.00 ? 820 LEU A HB3  4  
ATOM 2825 H HG   . LEU A 1 29 ? -5.532  -0.404  2.537   1.00 0.00 ? 820 LEU A HG   4  
ATOM 2826 H HD11 . LEU A 1 29 ? -6.186  2.499   1.996   1.00 0.00 ? 820 LEU A HD11 4  
ATOM 2827 H HD12 . LEU A 1 29 ? -7.365  1.188   1.908   1.00 0.00 ? 820 LEU A HD12 4  
ATOM 2828 H HD13 . LEU A 1 29 ? -5.987  1.209   0.811   1.00 0.00 ? 820 LEU A HD13 4  
ATOM 2829 H HD21 . LEU A 1 29 ? -3.949  1.987   3.450   1.00 0.00 ? 820 LEU A HD21 4  
ATOM 2830 H HD22 . LEU A 1 29 ? -3.775  1.414   1.792   1.00 0.00 ? 820 LEU A HD22 4  
ATOM 2831 H HD23 . LEU A 1 29 ? -3.398  0.341   3.137   1.00 0.00 ? 820 LEU A HD23 4  
ATOM 2832 N N    . GLU A 1 30 ? -7.106  -0.353  6.907   1.00 0.00 ? 821 GLU A N    4  
ATOM 2833 C CA   . GLU A 1 30 ? -7.626  -0.216  8.255   1.00 0.00 ? 821 GLU A CA   4  
ATOM 2834 C C    . GLU A 1 30 ? -6.780  -1.043  9.212   1.00 0.00 ? 821 GLU A C    4  
ATOM 2835 O O    . GLU A 1 30 ? -6.332  -0.553  10.252  1.00 0.00 ? 821 GLU A O    4  
ATOM 2836 C CB   . GLU A 1 30 ? -9.087  -0.683  8.312   1.00 0.00 ? 821 GLU A CB   4  
ATOM 2837 C CG   . GLU A 1 30 ? -9.956  0.226   7.432   1.00 0.00 ? 821 GLU A CG   4  
ATOM 2838 C CD   . GLU A 1 30 ? -11.420 -0.069  7.674   1.00 0.00 ? 821 GLU A CD   4  
ATOM 2839 O OE1  . GLU A 1 30 ? -11.827 -1.189  7.445   1.00 0.00 ? 821 GLU A OE1  4  
ATOM 2840 O OE2  . GLU A 1 30 ? -12.123 0.828   8.087   1.00 0.00 ? 821 GLU A OE2  4  
ATOM 2841 H H    . GLU A 1 30 ? -7.657  -0.783  6.216   1.00 0.00 ? 821 GLU A H    4  
ATOM 2842 H HA   . GLU A 1 30 ? -7.577  0.823   8.551   1.00 0.00 ? 821 GLU A HA   4  
ATOM 2843 N N    . SER A 1 31 ? -6.533  -2.290  8.834   1.00 0.00 ? 822 SER A N    4  
ATOM 2844 C CA   . SER A 1 31 ? -5.716  -3.184  9.640   1.00 0.00 ? 822 SER A CA   4  
ATOM 2845 C C    . SER A 1 31 ? -4.380  -2.533  9.963   1.00 0.00 ? 822 SER A C    4  
ATOM 2846 O O    . SER A 1 31 ? -3.976  -2.465  11.128  1.00 0.00 ? 822 SER A O    4  
ATOM 2847 C CB   . SER A 1 31 ? -5.488  -4.504  8.901   1.00 0.00 ? 822 SER A CB   4  
ATOM 2848 O OG   . SER A 1 31 ? -6.751  -5.091  8.577   1.00 0.00 ? 822 SER A OG   4  
ATOM 2849 H H    . SER A 1 31 ? -6.897  -2.608  7.982   1.00 0.00 ? 822 SER A H    4  
ATOM 2850 H HA   . SER A 1 31 ? -6.234  -3.390  10.564  1.00 0.00 ? 822 SER A HA   4  
ATOM 2851 H HB2  . SER A 1 31 ? -4.939  -4.322  7.990   1.00 0.00 ? 822 SER A HB2  4  
ATOM 2852 H HB3  . SER A 1 31 ? -4.910  -5.168  9.530   1.00 0.00 ? 822 SER A HB3  4  
ATOM 2853 H HG   . SER A 1 31 ? -7.220  -4.476  7.991   1.00 0.00 ? 822 SER A HG   4  
ATOM 2854 N N    . ILE A 1 32 ? -3.703  -2.034  8.937   1.00 0.00 ? 823 ILE A N    4  
ATOM 2855 C CA   . ILE A 1 32 ? -2.420  -1.373  9.134   1.00 0.00 ? 823 ILE A CA   4  
ATOM 2856 C C    . ILE A 1 32 ? -2.619  0.013   9.754   1.00 0.00 ? 823 ILE A C    4  
ATOM 2857 O O    . ILE A 1 32 ? -1.656  0.737   10.014  1.00 0.00 ? 823 ILE A O    4  
ATOM 2858 C CB   . ILE A 1 32 ? -1.656  -1.268  7.802   1.00 0.00 ? 823 ILE A CB   4  
ATOM 2859 C CG1  . ILE A 1 32 ? -2.388  -0.311  6.861   1.00 0.00 ? 823 ILE A CG1  4  
ATOM 2860 C CG2  . ILE A 1 32 ? -1.571  -2.653  7.142   1.00 0.00 ? 823 ILE A CG2  4  
ATOM 2861 C CD1  . ILE A 1 32 ? -1.603  -0.171  5.553   1.00 0.00 ? 823 ILE A CD1  4  
ATOM 2862 H H    . ILE A 1 32 ? -4.079  -2.100  8.031   1.00 0.00 ? 823 ILE A H    4  
ATOM 2863 H HA   . ILE A 1 32 ? -1.832  -1.967  9.821   1.00 0.00 ? 823 ILE A HA   4  
ATOM 2864 H HB   . ILE A 1 32 ? -0.658  -0.901  7.994   1.00 0.00 ? 823 ILE A HB   4  
ATOM 2865 H HG12 . ILE A 1 32 ? -3.369  -0.708  6.653   1.00 0.00 ? 823 ILE A HG12 4  
ATOM 2866 H HG21 . ILE A 1 32 ? -2.446  -3.233  7.395   1.00 0.00 ? 823 ILE A HG21 4  
ATOM 2867 H HG22 . ILE A 1 32 ? -0.688  -3.166  7.490   1.00 0.00 ? 823 ILE A HG22 4  
ATOM 2868 H HG23 . ILE A 1 32 ? -1.517  -2.540  6.069   1.00 0.00 ? 823 ILE A HG23 4  
ATOM 2869 H HD11 . ILE A 1 32 ? -2.021  0.637   4.970   1.00 0.00 ? 823 ILE A HD11 4  
ATOM 2870 H HD12 . ILE A 1 32 ? -1.672  -1.091  4.992   1.00 0.00 ? 823 ILE A HD12 4  
ATOM 2871 H HD13 . ILE A 1 32 ? -0.568  0.041   5.772   1.00 0.00 ? 823 ILE A HD13 4  
ATOM 2872 N N    . GLY A 1 33 ? -3.876  0.367   9.998   1.00 0.00 ? 824 GLY A N    4  
ATOM 2873 C CA   . GLY A 1 33 ? -4.208  1.648   10.604  1.00 0.00 ? 824 GLY A CA   4  
ATOM 2874 C C    . GLY A 1 33 ? -3.829  2.808   9.700   1.00 0.00 ? 824 GLY A C    4  
ATOM 2875 O O    . GLY A 1 33 ? -3.376  3.850   10.176  1.00 0.00 ? 824 GLY A O    4  
ATOM 2876 H H    . GLY A 1 33 ? -4.602  -0.253  9.775   1.00 0.00 ? 824 GLY A H    4  
ATOM 2877 H HA2  . GLY A 1 33 ? -5.270  1.682   10.796  1.00 0.00 ? 824 GLY A HA2  4  
ATOM 2878 H HA3  . GLY A 1 33 ? -3.676  1.745   11.540  1.00 0.00 ? 824 GLY A HA3  4  
ATOM 2879 N N    . LEU A 1 34 ? -4.032  2.638   8.399   1.00 0.00 ? 825 LEU A N    4  
ATOM 2880 C CA   . LEU A 1 34 ? -3.727  3.695   7.436   1.00 0.00 ? 825 LEU A CA   4  
ATOM 2881 C C    . LEU A 1 34 ? -4.883  3.881   6.462   1.00 0.00 ? 825 LEU A C    4  
ATOM 2882 O O    . LEU A 1 34 ? -4.737  3.668   5.257   1.00 0.00 ? 825 LEU A O    4  
ATOM 2883 C CB   . LEU A 1 34 ? -2.438  3.377   6.668   1.00 0.00 ? 825 LEU A CB   4  
ATOM 2884 C CG   . LEU A 1 34 ? -1.220  3.619   7.573   1.00 0.00 ? 825 LEU A CG   4  
ATOM 2885 C CD1  . LEU A 1 34 ? 0.054   3.203   6.840   1.00 0.00 ? 825 LEU A CD1  4  
ATOM 2886 C CD2  . LEU A 1 34 ? -1.132  5.107   7.934   1.00 0.00 ? 825 LEU A CD2  4  
ATOM 2887 H H    . LEU A 1 34 ? -4.413  1.790   8.076   1.00 0.00 ? 825 LEU A H    4  
ATOM 2888 H HA   . LEU A 1 34 ? -3.589  4.622   7.974   1.00 0.00 ? 825 LEU A HA   4  
ATOM 2889 H HB2  . LEU A 1 34 ? -2.458  2.348   6.345   1.00 0.00 ? 825 LEU A HB2  4  
ATOM 2890 H HB3  . LEU A 1 34 ? -2.372  4.019   5.802   1.00 0.00 ? 825 LEU A HB3  4  
ATOM 2891 H HG   . LEU A 1 34 ? -1.322  3.031   8.473   1.00 0.00 ? 825 LEU A HG   4  
ATOM 2892 H HD11 . LEU A 1 34 ? 0.040   2.136   6.667   1.00 0.00 ? 825 LEU A HD11 4  
ATOM 2893 H HD12 . LEU A 1 34 ? 0.914   3.456   7.443   1.00 0.00 ? 825 LEU A HD12 4  
ATOM 2894 H HD13 . LEU A 1 34 ? 0.115   3.721   5.894   1.00 0.00 ? 825 LEU A HD13 4  
ATOM 2895 H HD21 . LEU A 1 34 ? -0.096  5.387   8.054   1.00 0.00 ? 825 LEU A HD21 4  
ATOM 2896 H HD22 . LEU A 1 34 ? -1.661  5.286   8.857   1.00 0.00 ? 825 LEU A HD22 4  
ATOM 2897 H HD23 . LEU A 1 34 ? -1.573  5.701   7.146   1.00 0.00 ? 825 LEU A HD23 4  
ATOM 2898 N N    . PRO A 1 35 ? -6.022  4.279   6.957   1.00 0.00 ? 826 PRO A N    4  
ATOM 2899 C CA   . PRO A 1 35 ? -7.226  4.513   6.114   1.00 0.00 ? 826 PRO A CA   4  
ATOM 2900 C C    . PRO A 1 35 ? -7.051  5.733   5.210   1.00 0.00 ? 826 PRO A C    4  
ATOM 2901 O O    . PRO A 1 35 ? -6.106  6.516   5.380   1.00 0.00 ? 826 PRO A O    4  
ATOM 2902 C CB   . PRO A 1 35 ? -8.350  4.747   7.131   1.00 0.00 ? 826 PRO A CB   4  
ATOM 2903 C CG   . PRO A 1 35 ? -7.662  5.217   8.373   1.00 0.00 ? 826 PRO A CG   4  
ATOM 2904 C CD   . PRO A 1 35 ? -6.287  4.549   8.384   1.00 0.00 ? 826 PRO A CD   4  
ATOM 2905 H HA   . PRO A 1 35 ? -7.458  3.636   5.531   1.00 0.00 ? 826 PRO A HA   4  
ATOM 2906 H HB2  . PRO A 1 35 ? -9.036  5.499   6.769   1.00 0.00 ? 826 PRO A HB2  4  
ATOM 2907 H HB3  . PRO A 1 35 ? -8.875  3.825   7.333   1.00 0.00 ? 826 PRO A HB3  4  
ATOM 2908 H HG2  . PRO A 1 35 ? -7.559  6.294   8.357   1.00 0.00 ? 826 PRO A HG2  4  
ATOM 2909 H HG3  . PRO A 1 35 ? -8.214  4.908   9.247   1.00 0.00 ? 826 PRO A HG3  4  
ATOM 2910 H HD2  . PRO A 1 35 ? -5.546  5.219   8.798   1.00 0.00 ? 826 PRO A HD2  4  
ATOM 2911 H HD3  . PRO A 1 35 ? -6.316  3.622   8.936   1.00 0.00 ? 826 PRO A HD3  4  
ATOM 2912 N N    . GLN A 1 36 ? -7.968  5.896   4.269   1.00 0.00 ? 827 GLN A N    4  
ATOM 2913 C CA   . GLN A 1 36 ? -7.947  7.028   3.339   1.00 0.00 ? 827 GLN A CA   4  
ATOM 2914 C C    . GLN A 1 36 ? -6.843  6.872   2.295   1.00 0.00 ? 827 GLN A C    4  
ATOM 2915 O O    . GLN A 1 36 ? -6.337  7.863   1.762   1.00 0.00 ? 827 GLN A O    4  
ATOM 2916 C CB   . GLN A 1 36 ? -7.783  8.362   4.094   1.00 0.00 ? 827 GLN A CB   4  
ATOM 2917 C CG   . GLN A 1 36 ? -8.789  8.428   5.258   1.00 0.00 ? 827 GLN A CG   4  
ATOM 2918 C CD   . GLN A 1 36 ? -8.086  8.854   6.543   1.00 0.00 ? 827 GLN A CD   4  
ATOM 2919 O OE1  . GLN A 1 36 ? -8.566  9.743   7.246   1.00 0.00 ? 827 GLN A OE1  4  
ATOM 2920 N NE2  . GLN A 1 36 ? -6.981  8.277   6.896   1.00 0.00 ? 827 GLN A NE2  4  
ATOM 2921 H H    . GLN A 1 36 ? -8.695  5.241   4.196   1.00 0.00 ? 827 GLN A H    4  
ATOM 2922 H HA   . GLN A 1 36 ? -8.893  7.051   2.818   1.00 0.00 ? 827 GLN A HA   4  
ATOM 2923 H HB2  . GLN A 1 36 ? -6.776  8.447   4.473   1.00 0.00 ? 827 GLN A HB2  4  
ATOM 2924 H HB3  . GLN A 1 36 ? -7.973  9.180   3.415   1.00 0.00 ? 827 GLN A HB3  4  
ATOM 2925 H HG2  . GLN A 1 36 ? -9.558  9.148   5.019   1.00 0.00 ? 827 GLN A HG2  4  
ATOM 2926 H HG3  . GLN A 1 36 ? -9.245  7.461   5.404   1.00 0.00 ? 827 GLN A HG3  4  
ATOM 2927 H HE21 . GLN A 1 36 ? -6.594  7.566   6.337   1.00 0.00 ? 827 GLN A HE21 4  
ATOM 2928 H HE22 . GLN A 1 36 ? -6.527  8.546   7.722   1.00 0.00 ? 827 GLN A HE22 4  
ATOM 2929 N N    . TYR A 1 37 ? -6.502  5.629   1.974   1.00 0.00 ? 828 TYR A N    4  
ATOM 2930 C CA   . TYR A 1 37 ? -5.489  5.357   0.951   1.00 0.00 ? 828 TYR A CA   4  
ATOM 2931 C C    . TYR A 1 37 ? -6.045  4.410   -0.113  1.00 0.00 ? 828 TYR A C    4  
ATOM 2932 O O    . TYR A 1 37 ? -5.380  4.126   -1.107  1.00 0.00 ? 828 TYR A O    4  
ATOM 2933 C CB   . TYR A 1 37 ? -4.246  4.715   1.590   1.00 0.00 ? 828 TYR A CB   4  
ATOM 2934 C CG   . TYR A 1 37 ? -3.328  5.776   2.172   1.00 0.00 ? 828 TYR A CG   4  
ATOM 2935 C CD1  . TYR A 1 37 ? -2.846  6.819   1.369   1.00 0.00 ? 828 TYR A CD1  4  
ATOM 2936 C CD2  . TYR A 1 37 ? -2.951  5.702   3.518   1.00 0.00 ? 828 TYR A CD2  4  
ATOM 2937 C CE1  . TYR A 1 37 ? -1.988  7.782   1.916   1.00 0.00 ? 828 TYR A CE1  4  
ATOM 2938 C CE2  . TYR A 1 37 ? -2.098  6.664   4.062   1.00 0.00 ? 828 TYR A CE2  4  
ATOM 2939 C CZ   . TYR A 1 37 ? -1.617  7.704   3.263   1.00 0.00 ? 828 TYR A CZ   4  
ATOM 2940 O OH   . TYR A 1 37 ? -0.771  8.650   3.802   1.00 0.00 ? 828 TYR A OH   4  
ATOM 2941 H H    . TYR A 1 37 ? -6.963  4.878   2.405   1.00 0.00 ? 828 TYR A H    4  
ATOM 2942 H HA   . TYR A 1 37 ? -5.199  6.282   0.478   1.00 0.00 ? 828 TYR A HA   4  
ATOM 2943 H HB2  . TYR A 1 37 ? -4.556  4.040   2.374   1.00 0.00 ? 828 TYR A HB2  4  
ATOM 2944 H HB3  . TYR A 1 37 ? -3.711  4.158   0.836   1.00 0.00 ? 828 TYR A HB3  4  
ATOM 2945 H HH   . TYR A 1 37 ? -1.280  9.463   3.914   1.00 0.00 ? 828 TYR A HH   4  
ATOM 2946 N N    . GLU A 1 38 ? -7.268  3.934   0.102   1.00 0.00 ? 829 GLU A N    4  
ATOM 2947 C CA   . GLU A 1 38 ? -7.907  3.010   -0.830  1.00 0.00 ? 829 GLU A CA   4  
ATOM 2948 C C    . GLU A 1 38 ? -7.987  3.616   -2.220  1.00 0.00 ? 829 GLU A C    4  
ATOM 2949 O O    . GLU A 1 38 ? -7.423  3.080   -3.174  1.00 0.00 ? 829 GLU A O    4  
ATOM 2950 C CB   . GLU A 1 38 ? -9.314  2.641   -0.333  1.00 0.00 ? 829 GLU A CB   4  
ATOM 2951 C CG   . GLU A 1 38 ? -9.858  1.457   -1.145  1.00 0.00 ? 829 GLU A CG   4  
ATOM 2952 C CD   . GLU A 1 38 ? -9.568  0.151   -0.426  1.00 0.00 ? 829 GLU A CD   4  
ATOM 2953 O OE1  . GLU A 1 38 ? -8.425  -0.083  -0.101  1.00 0.00 ? 829 GLU A OE1  4  
ATOM 2954 O OE2  . GLU A 1 38 ? -10.502 -0.601  -0.220  1.00 0.00 ? 829 GLU A OE2  4  
ATOM 2955 H H    . GLU A 1 38 ? -7.747  4.204   0.910   1.00 0.00 ? 829 GLU A H    4  
ATOM 2956 H HA   . GLU A 1 38 ? -7.314  2.110   -0.879  1.00 0.00 ? 829 GLU A HA   4  
ATOM 2957 N N    . ASN A 1 39 ? -8.690  4.736   -2.333  1.00 0.00 ? 830 ASN A N    4  
ATOM 2958 C CA   . ASN A 1 39 ? -8.838  5.410   -3.619  1.00 0.00 ? 830 ASN A CA   4  
ATOM 2959 C C    . ASN A 1 39 ? -7.494  5.490   -4.319  1.00 0.00 ? 830 ASN A C    4  
ATOM 2960 O O    . ASN A 1 39 ? -7.376  5.167   -5.499  1.00 0.00 ? 830 ASN A O    4  
ATOM 2961 C CB   . ASN A 1 39 ? -9.418  6.823   -3.426  1.00 0.00 ? 830 ASN A CB   4  
ATOM 2962 C CG   . ASN A 1 39 ? -8.868  7.771   -4.491  1.00 0.00 ? 830 ASN A CG   4  
ATOM 2963 O OD1  . ASN A 1 39 ? -8.047  8.640   -4.187  1.00 0.00 ? 830 ASN A OD1  4  
ATOM 2964 N ND2  . ASN A 1 39 ? -9.264  7.653   -5.723  1.00 0.00 ? 830 ASN A ND2  4  
ATOM 2965 H H    . ASN A 1 39 ? -9.117  5.114   -1.535  1.00 0.00 ? 830 ASN A H    4  
ATOM 2966 H HA   . ASN A 1 39 ? -9.516  4.838   -4.234  1.00 0.00 ? 830 ASN A HA   4  
ATOM 2967 H HB2  . ASN A 1 39 ? -10.494 6.780   -3.507  1.00 0.00 ? 830 ASN A HB2  4  
ATOM 2968 H HB3  . ASN A 1 39 ? -9.150  7.192   -2.449  1.00 0.00 ? 830 ASN A HB3  4  
ATOM 2969 H HD21 . ASN A 1 39 ? -9.912  6.958   -5.967  1.00 0.00 ? 830 ASN A HD21 4  
ATOM 2970 H HD22 . ASN A 1 39 ? -8.916  8.258   -6.411  1.00 0.00 ? 830 ASN A HD22 4  
ATOM 2971 N N    . HIS A 1 40 ? -6.478  5.894   -3.575  1.00 0.00 ? 831 HIS A N    4  
ATOM 2972 C CA   . HIS A 1 40 ? -5.135  5.989   -4.120  1.00 0.00 ? 831 HIS A CA   4  
ATOM 2973 C C    . HIS A 1 40 ? -4.631  4.613   -4.516  1.00 0.00 ? 831 HIS A C    4  
ATOM 2974 O O    . HIS A 1 40 ? -4.155  4.413   -5.638  1.00 0.00 ? 831 HIS A O    4  
ATOM 2975 C CB   . HIS A 1 40 ? -4.188  6.615   -3.098  1.00 0.00 ? 831 HIS A CB   4  
ATOM 2976 C CG   . HIS A 1 40 ? -4.251  8.106   -3.214  1.00 0.00 ? 831 HIS A CG   4  
ATOM 2977 N ND1  . HIS A 1 40 ? -5.252  8.852   -2.617  1.00 0.00 ? 831 HIS A ND1  4  
ATOM 2978 C CD2  . HIS A 1 40 ? -3.448  9.003   -3.866  1.00 0.00 ? 831 HIS A CD2  4  
ATOM 2979 C CE1  . HIS A 1 40 ? -5.026  10.144  -2.918  1.00 0.00 ? 831 HIS A CE1  4  
ATOM 2980 N NE2  . HIS A 1 40 ? -3.937  10.291  -3.678  1.00 0.00 ? 831 HIS A NE2  4  
ATOM 2981 H H    . HIS A 1 40 ? -6.633  6.115   -2.633  1.00 0.00 ? 831 HIS A H    4  
ATOM 2982 H HA   . HIS A 1 40 ? -5.160  6.616   -5.000  1.00 0.00 ? 831 HIS A HA   4  
ATOM 2983 H HB2  . HIS A 1 40 ? -4.474  6.313   -2.100  1.00 0.00 ? 831 HIS A HB2  4  
ATOM 2984 H HB3  . HIS A 1 40 ? -3.181  6.284   -3.296  1.00 0.00 ? 831 HIS A HB3  4  
ATOM 2985 N N    . LEU A 1 41 ? -4.765  3.658   -3.604  1.00 0.00 ? 832 LEU A N    4  
ATOM 2986 C CA   . LEU A 1 41 ? -4.347  2.298   -3.871  1.00 0.00 ? 832 LEU A CA   4  
ATOM 2987 C C    . LEU A 1 41 ? -5.015  1.803   -5.141  1.00 0.00 ? 832 LEU A C    4  
ATOM 2988 O O    . LEU A 1 41 ? -4.350  1.337   -6.072  1.00 0.00 ? 832 LEU A O    4  
ATOM 2989 C CB   . LEU A 1 41 ? -4.732  1.390   -2.691  1.00 0.00 ? 832 LEU A CB   4  
ATOM 2990 C CG   . LEU A 1 41 ? -3.498  1.096   -1.824  1.00 0.00 ? 832 LEU A CG   4  
ATOM 2991 C CD1  . LEU A 1 41 ? -3.282  2.234   -0.828  1.00 0.00 ? 832 LEU A CD1  4  
ATOM 2992 C CD2  . LEU A 1 41 ? -3.712  -0.213  -1.056  1.00 0.00 ? 832 LEU A CD2  4  
ATOM 2993 H H    . LEU A 1 41 ? -5.172  3.868   -2.736  1.00 0.00 ? 832 LEU A H    4  
ATOM 2994 H HA   . LEU A 1 41 ? -3.275  2.273   -4.000  1.00 0.00 ? 832 LEU A HA   4  
ATOM 2995 H HB2  . LEU A 1 41 ? -5.486  1.880   -2.094  1.00 0.00 ? 832 LEU A HB2  4  
ATOM 2996 H HB3  . LEU A 1 41 ? -5.135  0.465   -3.069  1.00 0.00 ? 832 LEU A HB3  4  
ATOM 2997 H HG   . LEU A 1 41 ? -2.625  1.012   -2.451  1.00 0.00 ? 832 LEU A HG   4  
ATOM 2998 H HD11 . LEU A 1 41 ? -3.167  3.165   -1.362  1.00 0.00 ? 832 LEU A HD11 4  
ATOM 2999 H HD12 . LEU A 1 41 ? -2.392  2.040   -0.247  1.00 0.00 ? 832 LEU A HD12 4  
ATOM 3000 H HD13 . LEU A 1 41 ? -4.134  2.300   -0.168  1.00 0.00 ? 832 LEU A HD13 4  
ATOM 3001 H HD21 . LEU A 1 41 ? -2.815  -0.457  -0.508  1.00 0.00 ? 832 LEU A HD21 4  
ATOM 3002 H HD22 . LEU A 1 41 ? -3.935  -1.008  -1.751  1.00 0.00 ? 832 LEU A HD22 4  
ATOM 3003 H HD23 . LEU A 1 41 ? -4.534  -0.095  -0.365  1.00 0.00 ? 832 LEU A HD23 4  
ATOM 3004 N N    . MET A 1 42 ? -6.328  1.937   -5.188  1.00 0.00 ? 833 MET A N    4  
ATOM 3005 C CA   . MET A 1 42 ? -7.086  1.533   -6.354  1.00 0.00 ? 833 MET A CA   4  
ATOM 3006 C C    . MET A 1 42 ? -6.629  2.317   -7.568  1.00 0.00 ? 833 MET A C    4  
ATOM 3007 O O    . MET A 1 42 ? -6.282  1.739   -8.595  1.00 0.00 ? 833 MET A O    4  
ATOM 3008 C CB   . MET A 1 42 ? -8.576  1.766   -6.121  1.00 0.00 ? 833 MET A CB   4  
ATOM 3009 C CG   . MET A 1 42 ? -9.055  0.901   -4.950  1.00 0.00 ? 833 MET A CG   4  
ATOM 3010 S SD   . MET A 1 42 ? -10.649 1.515   -4.346  1.00 0.00 ? 833 MET A SD   4  
ATOM 3011 C CE   . MET A 1 42 ? -11.391 1.892   -5.955  1.00 0.00 ? 833 MET A CE   4  
ATOM 3012 H H    . MET A 1 42 ? -6.797  2.341   -4.424  1.00 0.00 ? 833 MET A H    4  
ATOM 3013 H HA   . MET A 1 42 ? -6.922  0.481   -6.533  1.00 0.00 ? 833 MET A HA   4  
ATOM 3014 H HB2  . MET A 1 42 ? -8.747  2.809   -5.899  1.00 0.00 ? 833 MET A HB2  4  
ATOM 3015 H HB3  . MET A 1 42 ? -9.121  1.493   -7.013  1.00 0.00 ? 833 MET A HB3  4  
ATOM 3016 H HG2  . MET A 1 42 ? -9.164  -0.120  -5.281  1.00 0.00 ? 833 MET A HG2  4  
ATOM 3017 H HG3  . MET A 1 42 ? -8.329  0.940   -4.151  1.00 0.00 ? 833 MET A HG3  4  
ATOM 3018 H HE1  . MET A 1 42 ? -10.881 2.736   -6.397  1.00 0.00 ? 833 MET A HE1  4  
ATOM 3019 H HE2  . MET A 1 42 ? -12.433 2.136   -5.827  1.00 0.00 ? 833 MET A HE2  4  
ATOM 3020 H HE3  . MET A 1 42 ? -11.307 1.028   -6.600  1.00 0.00 ? 833 MET A HE3  4  
ATOM 3021 N N    . ALA A 1 43 ? -6.620  3.638   -7.440  1.00 0.00 ? 834 ALA A N    4  
ATOM 3022 C CA   . ALA A 1 43 ? -6.194  4.511   -8.529  1.00 0.00 ? 834 ALA A CA   4  
ATOM 3023 C C    . ALA A 1 43 ? -4.863  4.046   -9.093  1.00 0.00 ? 834 ALA A C    4  
ATOM 3024 O O    . ALA A 1 43 ? -4.718  3.862   -10.302 1.00 0.00 ? 834 ALA A O    4  
ATOM 3025 C CB   . ALA A 1 43 ? -6.071  5.957   -8.042  1.00 0.00 ? 834 ALA A CB   4  
ATOM 3026 H H    . ALA A 1 43 ? -6.905  4.036   -6.587  1.00 0.00 ? 834 ALA A H    4  
ATOM 3027 H HA   . ALA A 1 43 ? -6.936  4.472   -9.312  1.00 0.00 ? 834 ALA A HA   4  
ATOM 3028 H HB1  . ALA A 1 43 ? -5.704  6.577   -8.847  1.00 0.00 ? 834 ALA A HB1  4  
ATOM 3029 H HB2  . ALA A 1 43 ? -5.381  6.002   -7.213  1.00 0.00 ? 834 ALA A HB2  4  
ATOM 3030 H HB3  . ALA A 1 43 ? -7.039  6.316   -7.725  1.00 0.00 ? 834 ALA A HB3  4  
ATOM 3031 N N    . ASN A 1 44 ? -3.896  3.847   -8.216  1.00 0.00 ? 835 ASN A N    4  
ATOM 3032 C CA   . ASN A 1 44 ? -2.579  3.387   -8.639  1.00 0.00 ? 835 ASN A CA   4  
ATOM 3033 C C    . ASN A 1 44 ? -2.669  1.980   -9.202  1.00 0.00 ? 835 ASN A C    4  
ATOM 3034 O O    . ASN A 1 44 ? -1.876  1.592   -10.059 1.00 0.00 ? 835 ASN A O    4  
ATOM 3035 C CB   . ASN A 1 44 ? -1.600  3.416   -7.466  1.00 0.00 ? 835 ASN A CB   4  
ATOM 3036 C CG   . ASN A 1 44 ? -0.332  2.646   -7.818  1.00 0.00 ? 835 ASN A CG   4  
ATOM 3037 O OD1  . ASN A 1 44 ? -0.299  1.422   -7.709  1.00 0.00 ? 835 ASN A OD1  4  
ATOM 3038 N ND2  . ASN A 1 44 ? 0.714   3.286   -8.234  1.00 0.00 ? 835 ASN A ND2  4  
ATOM 3039 H H    . ASN A 1 44 ? -4.072  4.003   -7.261  1.00 0.00 ? 835 ASN A H    4  
ATOM 3040 H HA   . ASN A 1 44 ? -2.211  4.046   -9.412  1.00 0.00 ? 835 ASN A HA   4  
ATOM 3041 H HB2  . ASN A 1 44 ? -1.347  4.441   -7.242  1.00 0.00 ? 835 ASN A HB2  4  
ATOM 3042 H HB3  . ASN A 1 44 ? -2.065  2.964   -6.603  1.00 0.00 ? 835 ASN A HB3  4  
ATOM 3043 H HD21 . ASN A 1 44 ? 0.688   4.261   -8.325  1.00 0.00 ? 835 ASN A HD21 4  
ATOM 3044 H HD22 . ASN A 1 44 ? 1.534   2.796   -8.455  1.00 0.00 ? 835 ASN A HD22 4  
ATOM 3045 N N    . GLY A 1 45 ? -3.640  1.220   -8.723  1.00 0.00 ? 836 GLY A N    4  
ATOM 3046 C CA   . GLY A 1 45 ? -3.839  -0.147  -9.189  1.00 0.00 ? 836 GLY A CA   4  
ATOM 3047 C C    . GLY A 1 45 ? -3.316  -1.154  -8.177  1.00 0.00 ? 836 GLY A C    4  
ATOM 3048 O O    . GLY A 1 45 ? -2.808  -2.211  -8.549  1.00 0.00 ? 836 GLY A O    4  
ATOM 3049 H H    . GLY A 1 45 ? -4.250  1.586   -8.046  1.00 0.00 ? 836 GLY A H    4  
ATOM 3050 H HA2  . GLY A 1 45 ? -4.895  -0.315  -9.345  1.00 0.00 ? 836 GLY A HA2  4  
ATOM 3051 H HA3  . GLY A 1 45 ? -3.319  -0.286  -10.125 1.00 0.00 ? 836 GLY A HA3  4  
ATOM 3052 N N    . PHE A 1 46 ? -3.447  -0.832  -6.896  1.00 0.00 ? 837 PHE A N    4  
ATOM 3053 C CA   . PHE A 1 46 ? -2.997  -1.736  -5.842  1.00 0.00 ? 837 PHE A CA   4  
ATOM 3054 C C    . PHE A 1 46 ? -3.883  -2.972  -5.804  1.00 0.00 ? 837 PHE A C    4  
ATOM 3055 O O    . PHE A 1 46 ? -4.989  -2.938  -5.253  1.00 0.00 ? 837 PHE A O    4  
ATOM 3056 C CB   . PHE A 1 46 ? -3.033  -1.037  -4.475  1.00 0.00 ? 837 PHE A CB   4  
ATOM 3057 C CG   . PHE A 1 46 ? -1.693  -0.397  -4.174  1.00 0.00 ? 837 PHE A CG   4  
ATOM 3058 C CD1  . PHE A 1 46 ? -1.135  0.517   -5.071  1.00 0.00 ? 837 PHE A CD1  4  
ATOM 3059 C CD2  . PHE A 1 46 ? -1.015  -0.715  -2.990  1.00 0.00 ? 837 PHE A CD2  4  
ATOM 3060 C CE1  . PHE A 1 46 ? 0.101   1.114   -4.786  1.00 0.00 ? 837 PHE A CE1  4  
ATOM 3061 C CE2  . PHE A 1 46 ? 0.219   -0.118  -2.706  1.00 0.00 ? 837 PHE A CE2  4  
ATOM 3062 C CZ   . PHE A 1 46 ? 0.777   0.796   -3.606  1.00 0.00 ? 837 PHE A CZ   4  
ATOM 3063 H H    . PHE A 1 46 ? -3.866  0.025   -6.653  1.00 0.00 ? 837 PHE A H    4  
ATOM 3064 H HA   . PHE A 1 46 ? -1.982  -2.040  -6.053  1.00 0.00 ? 837 PHE A HA   4  
ATOM 3065 H HB2  . PHE A 1 46 ? -3.796  -0.278  -4.483  1.00 0.00 ? 837 PHE A HB2  4  
ATOM 3066 H HB3  . PHE A 1 46 ? -3.266  -1.760  -3.708  1.00 0.00 ? 837 PHE A HB3  4  
ATOM 3067 H HZ   . PHE A 1 46 ? 1.729   1.258   -3.390  1.00 0.00 ? 837 PHE A HZ   4  
ATOM 3068 N N    . ASP A 1 47 ? -3.407  -4.055  -6.395  1.00 0.00 ? 838 ASP A N    4  
ATOM 3069 C CA   . ASP A 1 47 ? -4.162  -5.305  -6.416  1.00 0.00 ? 838 ASP A CA   4  
ATOM 3070 C C    . ASP A 1 47 ? -4.186  -5.925  -5.033  1.00 0.00 ? 838 ASP A C    4  
ATOM 3071 O O    . ASP A 1 47 ? -3.570  -5.397  -4.107  1.00 0.00 ? 838 ASP A O    4  
ATOM 3072 C CB   . ASP A 1 47 ? -3.556  -6.289  -7.420  1.00 0.00 ? 838 ASP A CB   4  
ATOM 3073 C CG   . ASP A 1 47 ? -4.608  -7.284  -7.857  1.00 0.00 ? 838 ASP A CG   4  
ATOM 3074 O OD1  . ASP A 1 47 ? -5.527  -6.881  -8.532  1.00 0.00 ? 838 ASP A OD1  4  
ATOM 3075 O OD2  . ASP A 1 47 ? -4.488  -8.436  -7.511  1.00 0.00 ? 838 ASP A OD2  4  
ATOM 3076 H H    . ASP A 1 47 ? -2.525  -4.018  -6.821  1.00 0.00 ? 838 ASP A H    4  
ATOM 3077 H HA   . ASP A 1 47 ? -5.178  -5.089  -6.710  1.00 0.00 ? 838 ASP A HA   4  
ATOM 3078 N N    . ASN A 1 48 ? -4.904  -7.040  -4.891  1.00 0.00 ? 839 ASN A N    4  
ATOM 3079 C CA   . ASN A 1 48 ? -5.003  -7.727  -3.600  1.00 0.00 ? 839 ASN A CA   4  
ATOM 3080 C C    . ASN A 1 48 ? -3.724  -7.542  -2.798  1.00 0.00 ? 839 ASN A C    4  
ATOM 3081 O O    . ASN A 1 48 ? -2.643  -7.971  -3.220  1.00 0.00 ? 839 ASN A O    4  
ATOM 3082 C CB   . ASN A 1 48 ? -5.279  -9.226  -3.799  1.00 0.00 ? 839 ASN A CB   4  
ATOM 3083 C CG   . ASN A 1 48 ? -5.313  -9.949  -2.446  1.00 0.00 ? 839 ASN A CG   4  
ATOM 3084 O OD1  . ASN A 1 48 ? -4.886  -9.398  -1.429  1.00 0.00 ? 839 ASN A OD1  4  
ATOM 3085 N ND2  . ASN A 1 48 ? -5.793  -11.155 -2.373  1.00 0.00 ? 839 ASN A ND2  4  
ATOM 3086 H H    . ASN A 1 48 ? -5.376  -7.405  -5.667  1.00 0.00 ? 839 ASN A H    4  
ATOM 3087 H HA   . ASN A 1 48 ? -5.826  -7.299  -3.047  1.00 0.00 ? 839 ASN A HA   4  
ATOM 3088 H HB2  . ASN A 1 48 ? -6.232  -9.351  -4.293  1.00 0.00 ? 839 ASN A HB2  4  
ATOM 3089 H HB3  . ASN A 1 48 ? -4.502  -9.657  -4.412  1.00 0.00 ? 839 ASN A HB3  4  
ATOM 3090 H HD21 . ASN A 1 48 ? -6.130  -11.595 -3.181  1.00 0.00 ? 839 ASN A HD21 4  
ATOM 3091 H HD22 . ASN A 1 48 ? -5.816  -11.627 -1.511  1.00 0.00 ? 839 ASN A HD22 4  
ATOM 3092 N N    . VAL A 1 49 ? -3.849  -6.885  -1.658  1.00 0.00 ? 840 VAL A N    4  
ATOM 3093 C CA   . VAL A 1 49 ? -2.709  -6.618  -0.801  1.00 0.00 ? 840 VAL A CA   4  
ATOM 3094 C C    . VAL A 1 49 ? -1.852  -7.867  -0.632  1.00 0.00 ? 840 VAL A C    4  
ATOM 3095 O O    . VAL A 1 49 ? -0.621  -7.799  -0.674  1.00 0.00 ? 840 VAL A O    4  
ATOM 3096 C CB   . VAL A 1 49 ? -3.190  -6.100  0.558   1.00 0.00 ? 840 VAL A CB   4  
ATOM 3097 C CG1  . VAL A 1 49 ? -3.949  -4.788  0.354   1.00 0.00 ? 840 VAL A CG1  4  
ATOM 3098 C CG2  . VAL A 1 49 ? -4.125  -7.131  1.207   1.00 0.00 ? 840 VAL A CG2  4  
ATOM 3099 H H    . VAL A 1 49 ? -4.731  -6.560  -1.391  1.00 0.00 ? 840 VAL A H    4  
ATOM 3100 H HA   . VAL A 1 49 ? -2.108  -5.850  -1.264  1.00 0.00 ? 840 VAL A HA   4  
ATOM 3101 H HB   . VAL A 1 49 ? -2.335  -5.925  1.198   1.00 0.00 ? 840 VAL A HB   4  
ATOM 3102 H HG11 . VAL A 1 49 ? -4.545  -4.848  -0.545  1.00 0.00 ? 840 VAL A HG11 4  
ATOM 3103 H HG12 . VAL A 1 49 ? -3.245  -3.975  0.262   1.00 0.00 ? 840 VAL A HG12 4  
ATOM 3104 H HG13 . VAL A 1 49 ? -4.595  -4.610  1.200   1.00 0.00 ? 840 VAL A HG13 4  
ATOM 3105 H HG21 . VAL A 1 49 ? -4.724  -6.645  1.964   1.00 0.00 ? 840 VAL A HG21 4  
ATOM 3106 H HG22 . VAL A 1 49 ? -3.541  -7.913  1.667   1.00 0.00 ? 840 VAL A HG22 4  
ATOM 3107 H HG23 . VAL A 1 49 ? -4.775  -7.561  0.460   1.00 0.00 ? 840 VAL A HG23 4  
ATOM 3108 N N    . GLN A 1 50 ? -2.507  -9.015  -0.496  1.00 0.00 ? 841 GLN A N    4  
ATOM 3109 C CA   . GLN A 1 50 ? -1.793  -10.276 -0.377  1.00 0.00 ? 841 GLN A CA   4  
ATOM 3110 C C    . GLN A 1 50 ? -0.950  -10.497 -1.621  1.00 0.00 ? 841 GLN A C    4  
ATOM 3111 O O    . GLN A 1 50 ? 0.253   -10.772 -1.536  1.00 0.00 ? 841 GLN A O    4  
ATOM 3112 C CB   . GLN A 1 50 ? -2.779  -11.436 -0.199  1.00 0.00 ? 841 GLN A CB   4  
ATOM 3113 C CG   . GLN A 1 50 ? -3.716  -11.144 0.987   1.00 0.00 ? 841 GLN A CG   4  
ATOM 3114 C CD   . GLN A 1 50 ? -5.162  -11.415 0.586   1.00 0.00 ? 841 GLN A CD   4  
ATOM 3115 O OE1  . GLN A 1 50 ? -5.439  -12.392 -0.110  1.00 0.00 ? 841 GLN A OE1  4  
ATOM 3116 N NE2  . GLN A 1 50 ? -6.101  -10.607 0.973   1.00 0.00 ? 841 GLN A NE2  4  
ATOM 3117 H H    . GLN A 1 50 ? -3.490  -9.013  -0.518  1.00 0.00 ? 841 GLN A H    4  
ATOM 3118 H HA   . GLN A 1 50 ? -1.142  -10.232 0.484   1.00 0.00 ? 841 GLN A HA   4  
ATOM 3119 H HB2  . GLN A 1 50 ? -3.359  -11.555 -1.102  1.00 0.00 ? 841 GLN A HB2  4  
ATOM 3120 H HB3  . GLN A 1 50 ? -2.230  -12.344 -0.003  1.00 0.00 ? 841 GLN A HB3  4  
ATOM 3121 H HG2  . GLN A 1 50 ? -3.450  -11.783 1.816   1.00 0.00 ? 841 GLN A HG2  4  
ATOM 3122 H HG3  . GLN A 1 50 ? -3.616  -10.112 1.290   1.00 0.00 ? 841 GLN A HG3  4  
ATOM 3123 H HE21 . GLN A 1 50 ? -5.883  -9.821  1.522   1.00 0.00 ? 841 GLN A HE21 4  
ATOM 3124 H HE22 . GLN A 1 50 ? -7.032  -10.779 0.719   1.00 0.00 ? 841 GLN A HE22 4  
ATOM 3125 N N    . PHE A 1 51 ? -1.569  -10.300 -2.777  1.00 0.00 ? 842 PHE A N    4  
ATOM 3126 C CA   . PHE A 1 51 ? -0.859  -10.406 -4.036  1.00 0.00 ? 842 PHE A CA   4  
ATOM 3127 C C    . PHE A 1 51 ? 0.250   -9.375  -4.061  1.00 0.00 ? 842 PHE A C    4  
ATOM 3128 O O    . PHE A 1 51 ? 1.407   -9.702  -4.288  1.00 0.00 ? 842 PHE A O    4  
ATOM 3129 C CB   . PHE A 1 51 ? -1.820  -10.181 -5.221  1.00 0.00 ? 842 PHE A CB   4  
ATOM 3130 C CG   . PHE A 1 51 ? -1.033  -9.821  -6.467  1.00 0.00 ? 842 PHE A CG   4  
ATOM 3131 C CD1  . PHE A 1 51 ? -0.586  -10.827 -7.328  1.00 0.00 ? 842 PHE A CD1  4  
ATOM 3132 C CD2  . PHE A 1 51 ? -0.754  -8.479  -6.756  1.00 0.00 ? 842 PHE A CD2  4  
ATOM 3133 C CE1  . PHE A 1 51 ? 0.138   -10.493 -8.477  1.00 0.00 ? 842 PHE A CE1  4  
ATOM 3134 C CE2  . PHE A 1 51 ? -0.030  -8.146  -7.906  1.00 0.00 ? 842 PHE A CE2  4  
ATOM 3135 C CZ   . PHE A 1 51 ? 0.417   -9.154  -8.767  1.00 0.00 ? 842 PHE A CZ   4  
ATOM 3136 H H    . PHE A 1 51 ? -2.509  -10.022 -2.774  1.00 0.00 ? 842 PHE A H    4  
ATOM 3137 H HA   . PHE A 1 51 ? -0.425  -11.393 -4.117  1.00 0.00 ? 842 PHE A HA   4  
ATOM 3138 H HB2  . PHE A 1 51 ? -2.382  -11.086 -5.402  1.00 0.00 ? 842 PHE A HB2  4  
ATOM 3139 H HB3  . PHE A 1 51 ? -2.502  -9.378  -4.987  1.00 0.00 ? 842 PHE A HB3  4  
ATOM 3140 H HZ   . PHE A 1 51 ? 0.978   -8.897  -9.655  1.00 0.00 ? 842 PHE A HZ   4  
ATOM 3141 N N    . MET A 1 52 ? -0.112  -8.126  -3.778  1.00 0.00 ? 843 MET A N    4  
ATOM 3142 C CA   . MET A 1 52 ? 0.863   -7.042  -3.735  1.00 0.00 ? 843 MET A CA   4  
ATOM 3143 C C    . MET A 1 52 ? 2.050   -7.440  -2.874  1.00 0.00 ? 843 MET A C    4  
ATOM 3144 O O    . MET A 1 52 ? 3.197   -7.439  -3.331  1.00 0.00 ? 843 MET A O    4  
ATOM 3145 C CB   . MET A 1 52 ? 0.221   -5.777  -3.158  1.00 0.00 ? 843 MET A CB   4  
ATOM 3146 C CG   . MET A 1 52 ? -0.643  -5.094  -4.223  1.00 0.00 ? 843 MET A CG   4  
ATOM 3147 S SD   . MET A 1 52 ? 0.382   -3.976  -5.212  1.00 0.00 ? 843 MET A SD   4  
ATOM 3148 C CE   . MET A 1 52 ? 0.942   -2.908  -3.860  1.00 0.00 ? 843 MET A CE   4  
ATOM 3149 H H    . MET A 1 52 ? -1.056  -7.939  -3.568  1.00 0.00 ? 843 MET A H    4  
ATOM 3150 H HA   . MET A 1 52 ? 1.206   -6.833  -4.737  1.00 0.00 ? 843 MET A HA   4  
ATOM 3151 H HB2  . MET A 1 52 ? -0.392  -6.044  -2.310  1.00 0.00 ? 843 MET A HB2  4  
ATOM 3152 H HB3  . MET A 1 52 ? 0.997   -5.101  -2.834  1.00 0.00 ? 843 MET A HB3  4  
ATOM 3153 H HG2  . MET A 1 52 ? -1.087  -5.840  -4.866  1.00 0.00 ? 843 MET A HG2  4  
ATOM 3154 H HG3  . MET A 1 52 ? -1.428  -4.529  -3.741  1.00 0.00 ? 843 MET A HG3  4  
ATOM 3155 H HE1  . MET A 1 52 ? 1.910   -3.242  -3.514  1.00 0.00 ? 843 MET A HE1  4  
ATOM 3156 H HE2  . MET A 1 52 ? 0.239   -2.947  -3.041  1.00 0.00 ? 843 MET A HE2  4  
ATOM 3157 H HE3  . MET A 1 52 ? 1.012   -1.890  -4.219  1.00 0.00 ? 843 MET A HE3  4  
ATOM 3158 N N    . GLY A 1 53 ? 1.763   -7.810  -1.631  1.00 0.00 ? 844 GLY A N    4  
ATOM 3159 C CA   . GLY A 1 53 ? 2.801   -8.232  -0.702  1.00 0.00 ? 844 GLY A CA   4  
ATOM 3160 C C    . GLY A 1 53 ? 3.594   -9.383  -1.274  1.00 0.00 ? 844 GLY A C    4  
ATOM 3161 O O    . GLY A 1 53 ? 4.771   -9.551  -0.962  1.00 0.00 ? 844 GLY A O    4  
ATOM 3162 H H    . GLY A 1 53 ? 0.826   -7.811  -1.337  1.00 0.00 ? 844 GLY A H    4  
ATOM 3163 H HA2  . GLY A 1 53 ? 3.469   -7.404  -0.519  1.00 0.00 ? 844 GLY A HA2  4  
ATOM 3164 H HA3  . GLY A 1 53 ? 2.348   -8.541  0.227   1.00 0.00 ? 844 GLY A HA3  4  
ATOM 3165 N N    . SER A 1 54 ? 2.956   -10.163 -2.119  1.00 0.00 ? 845 SER A N    4  
ATOM 3166 C CA   . SER A 1 54 ? 3.611   -11.293 -2.752  1.00 0.00 ? 845 SER A CA   4  
ATOM 3167 C C    . SER A 1 54 ? 3.989   -10.957 -4.187  1.00 0.00 ? 845 SER A C    4  
ATOM 3168 O O    . SER A 1 54 ? 4.284   -11.852 -4.989  1.00 0.00 ? 845 SER A O    4  
ATOM 3169 C CB   . SER A 1 54 ? 2.684   -12.500 -2.739  1.00 0.00 ? 845 SER A CB   4  
ATOM 3170 O OG   . SER A 1 54 ? 1.934   -12.513 -1.522  1.00 0.00 ? 845 SER A OG   4  
ATOM 3171 H H    . SER A 1 54 ? 2.019   -9.971  -2.340  1.00 0.00 ? 845 SER A H    4  
ATOM 3172 H HA   . SER A 1 54 ? 4.508   -11.540 -2.203  1.00 0.00 ? 845 SER A HA   4  
ATOM 3173 H HB2  . SER A 1 54 ? 2.003   -12.441 -3.574  1.00 0.00 ? 845 SER A HB2  4  
ATOM 3174 H HB3  . SER A 1 54 ? 3.280   -13.395 -2.833  1.00 0.00 ? 845 SER A HB3  4  
ATOM 3175 H HG   . SER A 1 54 ? 1.354   -11.732 -1.517  1.00 0.00 ? 845 SER A HG   4  
ATOM 3176 N N    . ASN A 1 55 ? 3.935   -9.679  -4.526  1.00 0.00 ? 846 ASN A N    4  
ATOM 3177 C CA   . ASN A 1 55 ? 4.221   -9.258  -5.888  1.00 0.00 ? 846 ASN A CA   4  
ATOM 3178 C C    . ASN A 1 55 ? 5.293   -8.185  -5.938  1.00 0.00 ? 846 ASN A C    4  
ATOM 3179 O O    . ASN A 1 55 ? 6.288   -8.330  -6.657  1.00 0.00 ? 846 ASN A O    4  
ATOM 3180 C CB   . ASN A 1 55 ? 2.943   -8.742  -6.556  1.00 0.00 ? 846 ASN A CB   4  
ATOM 3181 C CG   . ASN A 1 55 ? 3.285   -7.967  -7.820  1.00 0.00 ? 846 ASN A CG   4  
ATOM 3182 O OD1  . ASN A 1 55 ? 3.140   -6.748  -7.857  1.00 0.00 ? 846 ASN A OD1  4  
ATOM 3183 N ND2  . ASN A 1 55 ? 3.732   -8.600  -8.861  1.00 0.00 ? 846 ASN A ND2  4  
ATOM 3184 H H    . ASN A 1 55 ? 3.663   -9.011  -3.855  1.00 0.00 ? 846 ASN A H    4  
ATOM 3185 H HA   . ASN A 1 55 ? 4.569   -10.111 -6.452  1.00 0.00 ? 846 ASN A HA   4  
ATOM 3186 H HB2  . ASN A 1 55 ? 2.306   -9.578  -6.806  1.00 0.00 ? 846 ASN A HB2  4  
ATOM 3187 H HB3  . ASN A 1 55 ? 2.422   -8.092  -5.872  1.00 0.00 ? 846 ASN A HB3  4  
ATOM 3188 H HD21 . ASN A 1 55 ? 3.849   -9.574  -8.833  1.00 0.00 ? 846 ASN A HD21 4  
ATOM 3189 H HD22 . ASN A 1 55 ? 3.954   -8.104  -9.676  1.00 0.00 ? 846 ASN A HD22 4  
ATOM 3190 N N    . VAL A 1 56 ? 5.096   -7.099  -5.206  1.00 0.00 ? 847 VAL A N    4  
ATOM 3191 C CA   . VAL A 1 56 ? 6.060   -6.011  -5.233  1.00 0.00 ? 847 VAL A CA   4  
ATOM 3192 C C    . VAL A 1 56 ? 6.058   -5.213  -3.936  1.00 0.00 ? 847 VAL A C    4  
ATOM 3193 O O    . VAL A 1 56 ? 5.002   -4.909  -3.380  1.00 0.00 ? 847 VAL A O    4  
ATOM 3194 C CB   . VAL A 1 56 ? 5.770   -5.086  -6.427  1.00 0.00 ? 847 VAL A CB   4  
ATOM 3195 C CG1  . VAL A 1 56 ? 4.386   -4.445  -6.271  1.00 0.00 ? 847 VAL A CG1  4  
ATOM 3196 C CG2  . VAL A 1 56 ? 6.834   -3.986  -6.505  1.00 0.00 ? 847 VAL A CG2  4  
ATOM 3197 H H    . VAL A 1 56 ? 4.285   -7.016  -4.655  1.00 0.00 ? 847 VAL A H    4  
ATOM 3198 H HA   . VAL A 1 56 ? 7.044   -6.432  -5.370  1.00 0.00 ? 847 VAL A HA   4  
ATOM 3199 H HB   . VAL A 1 56 ? 5.786   -5.671  -7.338  1.00 0.00 ? 847 VAL A HB   4  
ATOM 3200 H HG11 . VAL A 1 56 ? 3.662   -5.199  -6.002  1.00 0.00 ? 847 VAL A HG11 4  
ATOM 3201 H HG12 . VAL A 1 56 ? 4.097   -3.987  -7.205  1.00 0.00 ? 847 VAL A HG12 4  
ATOM 3202 H HG13 . VAL A 1 56 ? 4.422   -3.689  -5.501  1.00 0.00 ? 847 VAL A HG13 4  
ATOM 3203 H HG21 . VAL A 1 56 ? 7.740   -4.315  -6.021  1.00 0.00 ? 847 VAL A HG21 4  
ATOM 3204 H HG22 . VAL A 1 56 ? 6.470   -3.092  -6.021  1.00 0.00 ? 847 VAL A HG22 4  
ATOM 3205 H HG23 . VAL A 1 56 ? 7.040   -3.772  -7.542  1.00 0.00 ? 847 VAL A HG23 4  
ATOM 3206 N N    . MET A 1 57 ? 7.250   -4.823  -3.503  1.00 0.00 ? 848 MET A N    4  
ATOM 3207 C CA   . MET A 1 57 ? 7.414   -3.991  -2.326  1.00 0.00 ? 848 MET A CA   4  
ATOM 3208 C C    . MET A 1 57 ? 8.511   -2.965  -2.576  1.00 0.00 ? 848 MET A C    4  
ATOM 3209 O O    . MET A 1 57 ? 9.698   -3.303  -2.578  1.00 0.00 ? 848 MET A O    4  
ATOM 3210 C CB   . MET A 1 57 ? 7.756   -4.845  -1.091  1.00 0.00 ? 848 MET A CB   4  
ATOM 3211 C CG   . MET A 1 57 ? 8.756   -5.946  -1.469  1.00 0.00 ? 848 MET A CG   4  
ATOM 3212 S SD   . MET A 1 57 ? 9.743   -6.384  -0.014  1.00 0.00 ? 848 MET A SD   4  
ATOM 3213 C CE   . MET A 1 57 ? 10.866  -4.962  -0.058  1.00 0.00 ? 848 MET A CE   4  
ATOM 3214 H H    . MET A 1 57 ? 8.045   -5.058  -4.025  1.00 0.00 ? 848 MET A H    4  
ATOM 3215 H HA   . MET A 1 57 ? 6.487   -3.469  -2.145  1.00 0.00 ? 848 MET A HA   4  
ATOM 3216 H HB2  . MET A 1 57 ? 8.188   -4.215  -0.328  1.00 0.00 ? 848 MET A HB2  4  
ATOM 3217 H HB3  . MET A 1 57 ? 6.855   -5.301  -0.710  1.00 0.00 ? 848 MET A HB3  4  
ATOM 3218 H HG2  . MET A 1 57 ? 8.216   -6.817  -1.812  1.00 0.00 ? 848 MET A HG2  4  
ATOM 3219 H HG3  . MET A 1 57 ? 9.408   -5.597  -2.256  1.00 0.00 ? 848 MET A HG3  4  
ATOM 3220 H HE1  . MET A 1 57 ? 11.217  -4.812  -1.070  1.00 0.00 ? 848 MET A HE1  4  
ATOM 3221 H HE2  . MET A 1 57 ? 11.711  -5.148  0.585   1.00 0.00 ? 848 MET A HE2  4  
ATOM 3222 H HE3  . MET A 1 57 ? 10.345  -4.081  0.286   1.00 0.00 ? 848 MET A HE3  4  
ATOM 3223 N N    . GLU A 1 58 ? 8.118   -1.729  -2.831  1.00 0.00 ? 849 GLU A N    4  
ATOM 3224 C CA   . GLU A 1 58 ? 9.083   -0.675  -3.118  1.00 0.00 ? 849 GLU A CA   4  
ATOM 3225 C C    . GLU A 1 58 ? 8.549   0.679   -2.678  1.00 0.00 ? 849 GLU A C    4  
ATOM 3226 O O    . GLU A 1 58 ? 7.356   0.827   -2.411  1.00 0.00 ? 849 GLU A O    4  
ATOM 3227 C CB   . GLU A 1 58 ? 9.394   -0.643  -4.618  1.00 0.00 ? 849 GLU A CB   4  
ATOM 3228 C CG   . GLU A 1 58 ? 10.898  -0.456  -4.842  1.00 0.00 ? 849 GLU A CG   4  
ATOM 3229 C CD   . GLU A 1 58 ? 11.170  0.944   -5.340  1.00 0.00 ? 849 GLU A CD   4  
ATOM 3230 O OE1  . GLU A 1 58 ? 11.290  1.827   -4.523  1.00 0.00 ? 849 GLU A OE1  4  
ATOM 3231 O OE2  . GLU A 1 58 ? 11.249  1.116   -6.537  1.00 0.00 ? 849 GLU A OE2  4  
ATOM 3232 H H    . GLU A 1 58 ? 7.162   -1.517  -2.851  1.00 0.00 ? 849 GLU A H    4  
ATOM 3233 H HA   . GLU A 1 58 ? 9.994   -0.880  -2.578  1.00 0.00 ? 849 GLU A HA   4  
ATOM 3234 N N    . ASP A 1 59 ? 9.434   1.664   -2.635  1.00 0.00 ? 850 ASP A N    4  
ATOM 3235 C CA   . ASP A 1 59 ? 9.058   3.020   -2.255  1.00 0.00 ? 850 ASP A CA   4  
ATOM 3236 C C    . ASP A 1 59 ? 8.241   3.666   -3.357  1.00 0.00 ? 850 ASP A C    4  
ATOM 3237 O O    . ASP A 1 59 ? 7.222   4.308   -3.096  1.00 0.00 ? 850 ASP A O    4  
ATOM 3238 C CB   . ASP A 1 59 ? 10.319  3.866   -1.964  1.00 0.00 ? 850 ASP A CB   4  
ATOM 3239 C CG   . ASP A 1 59 ? 10.369  5.102   -2.856  1.00 0.00 ? 850 ASP A CG   4  
ATOM 3240 O OD1  . ASP A 1 59 ? 9.650   6.041   -2.582  1.00 0.00 ? 850 ASP A OD1  4  
ATOM 3241 O OD2  . ASP A 1 59 ? 11.138  5.099   -3.793  1.00 0.00 ? 850 ASP A OD2  4  
ATOM 3242 H H    . ASP A 1 59 ? 10.362  1.479   -2.892  1.00 0.00 ? 850 ASP A H    4  
ATOM 3243 H HA   . ASP A 1 59 ? 8.458   2.975   -1.360  1.00 0.00 ? 850 ASP A HA   4  
ATOM 3244 N N    . GLN A 1 60 ? 8.719   3.520   -4.580  1.00 0.00 ? 851 GLN A N    4  
ATOM 3245 C CA   . GLN A 1 60 ? 8.070   4.121   -5.737  1.00 0.00 ? 851 GLN A CA   4  
ATOM 3246 C C    . GLN A 1 60 ? 6.575   3.836   -5.748  1.00 0.00 ? 851 GLN A C    4  
ATOM 3247 O O    . GLN A 1 60 ? 5.773   4.743   -5.943  1.00 0.00 ? 851 GLN A O    4  
ATOM 3248 C CB   . GLN A 1 60 ? 8.708   3.610   -7.029  1.00 0.00 ? 851 GLN A CB   4  
ATOM 3249 C CG   . GLN A 1 60 ? 10.220  3.858   -6.991  1.00 0.00 ? 851 GLN A CG   4  
ATOM 3250 C CD   . GLN A 1 60 ? 10.508  5.339   -7.157  1.00 0.00 ? 851 GLN A CD   4  
ATOM 3251 O OE1  . GLN A 1 60 ? 10.438  5.866   -8.268  1.00 0.00 ? 851 GLN A OE1  4  
ATOM 3252 N NE2  . GLN A 1 60 ? 10.817  6.052   -6.119  1.00 0.00 ? 851 GLN A NE2  4  
ATOM 3253 H H    . GLN A 1 60 ? 9.554   3.017   -4.701  1.00 0.00 ? 851 GLN A H    4  
ATOM 3254 H HA   . GLN A 1 60 ? 8.211   5.190   -5.689  1.00 0.00 ? 851 GLN A HA   4  
ATOM 3255 H HB2  . GLN A 1 60 ? 8.516   2.552   -7.130  1.00 0.00 ? 851 GLN A HB2  4  
ATOM 3256 H HB3  . GLN A 1 60 ? 8.280   4.134   -7.870  1.00 0.00 ? 851 GLN A HB3  4  
ATOM 3257 H HG2  . GLN A 1 60 ? 10.618  3.523   -6.046  1.00 0.00 ? 851 GLN A HG2  4  
ATOM 3258 H HG3  . GLN A 1 60 ? 10.692  3.309   -7.790  1.00 0.00 ? 851 GLN A HG3  4  
ATOM 3259 H HE21 . GLN A 1 60 ? 10.864  5.630   -5.228  1.00 0.00 ? 851 GLN A HE21 4  
ATOM 3260 H HE22 . GLN A 1 60 ? 11.007  7.007   -6.217  1.00 0.00 ? 851 GLN A HE22 4  
ATOM 3261 N N    . ASP A 1 61 ? 6.205   2.578   -5.540  1.00 0.00 ? 852 ASP A N    4  
ATOM 3262 C CA   . ASP A 1 61 ? 4.796   2.194   -5.542  1.00 0.00 ? 852 ASP A CA   4  
ATOM 3263 C C    . ASP A 1 61 ? 4.030   3.012   -4.515  1.00 0.00 ? 852 ASP A C    4  
ATOM 3264 O O    . ASP A 1 61 ? 2.998   3.624   -4.822  1.00 0.00 ? 852 ASP A O    4  
ATOM 3265 C CB   . ASP A 1 61 ? 4.652   0.696   -5.226  1.00 0.00 ? 852 ASP A CB   4  
ATOM 3266 C CG   . ASP A 1 61 ? 5.439   -0.128  -6.230  1.00 0.00 ? 852 ASP A CG   4  
ATOM 3267 O OD1  . ASP A 1 61 ? 6.652   -0.093  -6.171  1.00 0.00 ? 852 ASP A OD1  4  
ATOM 3268 O OD2  . ASP A 1 61 ? 4.820   -0.780  -7.055  1.00 0.00 ? 852 ASP A OD2  4  
ATOM 3269 H H    . ASP A 1 61 ? 6.888   1.890   -5.393  1.00 0.00 ? 852 ASP A H    4  
ATOM 3270 H HA   . ASP A 1 61 ? 4.383   2.383   -6.523  1.00 0.00 ? 852 ASP A HA   4  
ATOM 3271 N N    . LEU A 1 62 ? 4.555   3.055   -3.304  1.00 0.00 ? 853 LEU A N    4  
ATOM 3272 C CA   . LEU A 1 62 ? 3.937   3.836   -2.246  1.00 0.00 ? 853 LEU A CA   4  
ATOM 3273 C C    . LEU A 1 62 ? 3.980   5.309   -2.607  1.00 0.00 ? 853 LEU A C    4  
ATOM 3274 O O    . LEU A 1 62 ? 2.963   5.998   -2.586  1.00 0.00 ? 853 LEU A O    4  
ATOM 3275 C CB   . LEU A 1 62 ? 4.659   3.607   -0.922  1.00 0.00 ? 853 LEU A CB   4  
ATOM 3276 C CG   . LEU A 1 62 ? 4.947   2.111   -0.728  1.00 0.00 ? 853 LEU A CG   4  
ATOM 3277 C CD1  . LEU A 1 62 ? 5.434   1.863   0.698   1.00 0.00 ? 853 LEU A CD1  4  
ATOM 3278 C CD2  . LEU A 1 62 ? 3.673   1.294   -0.978  1.00 0.00 ? 853 LEU A CD2  4  
ATOM 3279 H H    . LEU A 1 62 ? 5.391   2.575   -3.131  1.00 0.00 ? 853 LEU A H    4  
ATOM 3280 H HA   . LEU A 1 62 ? 2.907   3.532   -2.142  1.00 0.00 ? 853 LEU A HA   4  
ATOM 3281 H HB2  . LEU A 1 62 ? 5.585   4.157   -0.937  1.00 0.00 ? 853 LEU A HB2  4  
ATOM 3282 H HB3  . LEU A 1 62 ? 4.044   3.964   -0.111  1.00 0.00 ? 853 LEU A HB3  4  
ATOM 3283 H HG   . LEU A 1 62 ? 5.717   1.804   -1.420  1.00 0.00 ? 853 LEU A HG   4  
ATOM 3284 H HD11 . LEU A 1 62 ? 5.310   0.819   0.945   1.00 0.00 ? 853 LEU A HD11 4  
ATOM 3285 H HD12 . LEU A 1 62 ? 4.862   2.465   1.387   1.00 0.00 ? 853 LEU A HD12 4  
ATOM 3286 H HD13 . LEU A 1 62 ? 6.479   2.126   0.772   1.00 0.00 ? 853 LEU A HD13 4  
ATOM 3287 H HD21 . LEU A 1 62 ? 3.538   1.155   -2.040  1.00 0.00 ? 853 LEU A HD21 4  
ATOM 3288 H HD22 . LEU A 1 62 ? 2.820   1.815   -0.570  1.00 0.00 ? 853 LEU A HD22 4  
ATOM 3289 H HD23 . LEU A 1 62 ? 3.768   0.330   -0.500  1.00 0.00 ? 853 LEU A HD23 4  
ATOM 3290 N N    . LEU A 1 63 ? 5.156   5.786   -2.968  1.00 0.00 ? 854 LEU A N    4  
ATOM 3291 C CA   . LEU A 1 63 ? 5.296   7.172   -3.377  1.00 0.00 ? 854 LEU A CA   4  
ATOM 3292 C C    . LEU A 1 63 ? 4.310   7.478   -4.500  1.00 0.00 ? 854 LEU A C    4  
ATOM 3293 O O    . LEU A 1 63 ? 3.697   8.547   -4.532  1.00 0.00 ? 854 LEU A O    4  
ATOM 3294 C CB   . LEU A 1 63 ? 6.726   7.460   -3.845  1.00 0.00 ? 854 LEU A CB   4  
ATOM 3295 C CG   . LEU A 1 63 ? 7.092   8.915   -3.509  1.00 0.00 ? 854 LEU A CG   4  
ATOM 3296 C CD1  . LEU A 1 63 ? 7.811   8.970   -2.159  1.00 0.00 ? 854 LEU A CD1  4  
ATOM 3297 C CD2  . LEU A 1 63 ? 8.012   9.476   -4.597  1.00 0.00 ? 854 LEU A CD2  4  
ATOM 3298 H H    . LEU A 1 63 ? 5.937   5.186   -2.978  1.00 0.00 ? 854 LEU A H    4  
ATOM 3299 H HA   . LEU A 1 63 ? 5.068   7.807   -2.533  1.00 0.00 ? 854 LEU A HA   4  
ATOM 3300 H HB2  . LEU A 1 63 ? 7.409   6.785   -3.349  1.00 0.00 ? 854 LEU A HB2  4  
ATOM 3301 H HB3  . LEU A 1 63 ? 6.788   7.312   -4.914  1.00 0.00 ? 854 LEU A HB3  4  
ATOM 3302 H HG   . LEU A 1 63 ? 6.191   9.511   -3.454  1.00 0.00 ? 854 LEU A HG   4  
ATOM 3303 H HD11 . LEU A 1 63 ? 8.787   8.517   -2.251  1.00 0.00 ? 854 LEU A HD11 4  
ATOM 3304 H HD12 . LEU A 1 63 ? 7.235   8.436   -1.418  1.00 0.00 ? 854 LEU A HD12 4  
ATOM 3305 H HD13 . LEU A 1 63 ? 7.922   10.000  -1.853  1.00 0.00 ? 854 LEU A HD13 4  
ATOM 3306 H HD21 . LEU A 1 63 ? 7.417   9.960   -5.356  1.00 0.00 ? 854 LEU A HD21 4  
ATOM 3307 H HD22 . LEU A 1 63 ? 8.579   8.673   -5.040  1.00 0.00 ? 854 LEU A HD22 4  
ATOM 3308 H HD23 . LEU A 1 63 ? 8.689   10.196  -4.161  1.00 0.00 ? 854 LEU A HD23 4  
ATOM 3309 N N    . GLU A 1 64 ? 4.143   6.518   -5.407  1.00 0.00 ? 855 GLU A N    4  
ATOM 3310 C CA   . GLU A 1 64 ? 3.215   6.670   -6.519  1.00 0.00 ? 855 GLU A CA   4  
ATOM 3311 C C    . GLU A 1 64 ? 1.828   7.023   -6.005  1.00 0.00 ? 855 GLU A C    4  
ATOM 3312 O O    . GLU A 1 64 ? 1.212   7.983   -6.476  1.00 0.00 ? 855 GLU A O    4  
ATOM 3313 C CB   . GLU A 1 64 ? 3.158   5.382   -7.354  1.00 0.00 ? 855 GLU A CB   4  
ATOM 3314 C CG   . GLU A 1 64 ? 4.030   5.535   -8.612  1.00 0.00 ? 855 GLU A CG   4  
ATOM 3315 C CD   . GLU A 1 64 ? 3.153   5.709   -9.836  1.00 0.00 ? 855 GLU A CD   4  
ATOM 3316 O OE1  . GLU A 1 64 ? 2.330   6.595   -9.828  1.00 0.00 ? 855 GLU A OE1  4  
ATOM 3317 O OE2  . GLU A 1 64 ? 3.313   4.951   -10.764 1.00 0.00 ? 855 GLU A OE2  4  
ATOM 3318 H H    . GLU A 1 64 ? 4.650   5.681   -5.319  1.00 0.00 ? 855 GLU A H    4  
ATOM 3319 H HA   . GLU A 1 64 ? 3.561   7.478   -7.146  1.00 0.00 ? 855 GLU A HA   4  
ATOM 3320 N N    . ILE A 1 65 ? 1.348   6.279   -5.007  1.00 0.00 ? 856 ILE A N    4  
ATOM 3321 C CA   . ILE A 1 65 ? 0.039   6.585   -4.422  1.00 0.00 ? 856 ILE A CA   4  
ATOM 3322 C C    . ILE A 1 65 ? 0.130   7.823   -3.533  1.00 0.00 ? 856 ILE A C    4  
ATOM 3323 O O    . ILE A 1 65 ? -0.830  8.189   -2.855  1.00 0.00 ? 856 ILE A O    4  
ATOM 3324 C CB   . ILE A 1 65 ? -0.532  5.392   -3.632  1.00 0.00 ? 856 ILE A CB   4  
ATOM 3325 C CG1  . ILE A 1 65 ? 0.544   4.765   -2.753  1.00 0.00 ? 856 ILE A CG1  4  
ATOM 3326 C CG2  . ILE A 1 65 ? -1.060  4.346   -4.602  1.00 0.00 ? 856 ILE A CG2  4  
ATOM 3327 C CD1  . ILE A 1 65 ? -0.066  3.631   -1.926  1.00 0.00 ? 856 ILE A CD1  4  
ATOM 3328 H H    . ILE A 1 65 ? 1.890   5.543   -4.646  1.00 0.00 ? 856 ILE A H    4  
ATOM 3329 H HA   . ILE A 1 65 ? -0.639  6.817   -5.233  1.00 0.00 ? 856 ILE A HA   4  
ATOM 3330 H HB   . ILE A 1 65 ? -1.346  5.744   -3.013  1.00 0.00 ? 856 ILE A HB   4  
ATOM 3331 H HG12 . ILE A 1 65 ? 1.338   4.374   -3.370  1.00 0.00 ? 856 ILE A HG12 4  
ATOM 3332 H HG21 . ILE A 1 65 ? -1.445  3.503   -4.047  1.00 0.00 ? 856 ILE A HG21 4  
ATOM 3333 H HG22 . ILE A 1 65 ? -0.257  4.019   -5.245  1.00 0.00 ? 856 ILE A HG22 4  
ATOM 3334 H HG23 . ILE A 1 65 ? -1.851  4.779   -5.194  1.00 0.00 ? 856 ILE A HG23 4  
ATOM 3335 H HD11 . ILE A 1 65 ? 0.701   3.171   -1.322  1.00 0.00 ? 856 ILE A HD11 4  
ATOM 3336 H HD12 . ILE A 1 65 ? -0.494  2.893   -2.589  1.00 0.00 ? 856 ILE A HD12 4  
ATOM 3337 H HD13 . ILE A 1 65 ? -0.840  4.029   -1.286  1.00 0.00 ? 856 ILE A HD13 4  
ATOM 3338 N N    . GLY A 1 66 ? 1.281   8.479   -3.573  1.00 0.00 ? 857 GLY A N    4  
ATOM 3339 C CA   . GLY A 1 66 ? 1.496   9.704   -2.817  1.00 0.00 ? 857 GLY A CA   4  
ATOM 3340 C C    . GLY A 1 66 ? 1.373   9.479   -1.323  1.00 0.00 ? 857 GLY A C    4  
ATOM 3341 O O    . GLY A 1 66 ? 0.786   10.301  -0.614  1.00 0.00 ? 857 GLY A O    4  
ATOM 3342 H H    . GLY A 1 66 ? 2.002   8.149   -4.150  1.00 0.00 ? 857 GLY A H    4  
ATOM 3343 H HA2  . GLY A 1 66 ? 2.484   10.082  -3.035  1.00 0.00 ? 857 GLY A HA2  4  
ATOM 3344 H HA3  . GLY A 1 66 ? 0.765   10.437  -3.123  1.00 0.00 ? 857 GLY A HA3  4  
ATOM 3345 N N    . ILE A 1 67 ? 1.950   8.388   -0.829  1.00 0.00 ? 858 ILE A N    4  
ATOM 3346 C CA   . ILE A 1 67 ? 1.914   8.116   0.602   1.00 0.00 ? 858 ILE A CA   4  
ATOM 3347 C C    . ILE A 1 67 ? 2.388   9.355   1.368   1.00 0.00 ? 858 ILE A C    4  
ATOM 3348 O O    . ILE A 1 67 ? 3.479   9.874   1.110   1.00 0.00 ? 858 ILE A O    4  
ATOM 3349 C CB   . ILE A 1 67 ? 2.788   6.893   0.948   1.00 0.00 ? 858 ILE A CB   4  
ATOM 3350 C CG1  . ILE A 1 67 ? 2.056   5.599   0.561   1.00 0.00 ? 858 ILE A CG1  4  
ATOM 3351 C CG2  . ILE A 1 67 ? 3.076   6.867   2.444   1.00 0.00 ? 858 ILE A CG2  4  
ATOM 3352 C CD1  . ILE A 1 67 ? 0.667   5.564   1.212   1.00 0.00 ? 858 ILE A CD1  4  
ATOM 3353 H H    . ILE A 1 67 ? 2.426   7.776   -1.430  1.00 0.00 ? 858 ILE A H    4  
ATOM 3354 H HA   . ILE A 1 67 ? 0.892   7.914   0.883   1.00 0.00 ? 858 ILE A HA   4  
ATOM 3355 H HB   . ILE A 1 67 ? 3.722   6.957   0.407   1.00 0.00 ? 858 ILE A HB   4  
ATOM 3356 H HG12 . ILE A 1 67 ? 1.955   5.545   -0.510  1.00 0.00 ? 858 ILE A HG12 4  
ATOM 3357 H HG21 . ILE A 1 67 ? 4.029   7.335   2.638   1.00 0.00 ? 858 ILE A HG21 4  
ATOM 3358 H HG22 . ILE A 1 67 ? 3.101   5.842   2.784   1.00 0.00 ? 858 ILE A HG22 4  
ATOM 3359 H HG23 . ILE A 1 67 ? 2.298   7.399   2.969   1.00 0.00 ? 858 ILE A HG23 4  
ATOM 3360 H HD11 . ILE A 1 67 ? 0.373   4.537   1.371   1.00 0.00 ? 858 ILE A HD11 4  
ATOM 3361 H HD12 . ILE A 1 67 ? -0.050  6.042   0.560   1.00 0.00 ? 858 ILE A HD12 4  
ATOM 3362 H HD13 . ILE A 1 67 ? 0.694   6.080   2.161   1.00 0.00 ? 858 ILE A HD13 4  
ATOM 3363 N N    . LEU A 1 68 ? 1.534   9.851   2.258   1.00 0.00 ? 859 LEU A N    4  
ATOM 3364 C CA   . LEU A 1 68 ? 1.813   11.074  3.014   1.00 0.00 ? 859 LEU A CA   4  
ATOM 3365 C C    . LEU A 1 68 ? 3.273   11.170  3.459   1.00 0.00 ? 859 LEU A C    4  
ATOM 3366 O O    . LEU A 1 68 ? 4.029   11.995  2.941   1.00 0.00 ? 859 LEU A O    4  
ATOM 3367 C CB   . LEU A 1 68 ? 0.885   11.178  4.233   1.00 0.00 ? 859 LEU A CB   4  
ATOM 3368 C CG   . LEU A 1 68 ? -0.511  11.638  3.780   1.00 0.00 ? 859 LEU A CG   4  
ATOM 3369 C CD1  . LEU A 1 68 ? -1.506  11.484  4.932   1.00 0.00 ? 859 LEU A CD1  4  
ATOM 3370 C CD2  . LEU A 1 68 ? -0.455  13.112  3.359   1.00 0.00 ? 859 LEU A CD2  4  
ATOM 3371 H H    . LEU A 1 68 ? 0.667   9.410   2.378   1.00 0.00 ? 859 LEU A H    4  
ATOM 3372 H HA   . LEU A 1 68 ? 1.611   11.916  2.369   1.00 0.00 ? 859 LEU A HA   4  
ATOM 3373 H HB2  . LEU A 1 68 ? 0.818   10.214  4.716   1.00 0.00 ? 859 LEU A HB2  4  
ATOM 3374 H HB3  . LEU A 1 68 ? 1.290   11.898  4.930   1.00 0.00 ? 859 LEU A HB3  4  
ATOM 3375 H HG   . LEU A 1 68 ? -0.836  11.036  2.944   1.00 0.00 ? 859 LEU A HG   4  
ATOM 3376 H HD11 . LEU A 1 68 ? -1.376  12.296  5.632   1.00 0.00 ? 859 LEU A HD11 4  
ATOM 3377 H HD12 . LEU A 1 68 ? -1.338  10.545  5.440   1.00 0.00 ? 859 LEU A HD12 4  
ATOM 3378 H HD13 . LEU A 1 68 ? -2.513  11.508  4.542   1.00 0.00 ? 859 LEU A HD13 4  
ATOM 3379 H HD21 . LEU A 1 68 ? -0.120  13.181  2.334   1.00 0.00 ? 859 LEU A HD21 4  
ATOM 3380 H HD22 . LEU A 1 68 ? 0.229   13.649  3.999   1.00 0.00 ? 859 LEU A HD22 4  
ATOM 3381 H HD23 . LEU A 1 68 ? -1.440  13.547  3.442   1.00 0.00 ? 859 LEU A HD23 4  
ATOM 3382 N N    . ASN A 1 69 ? 3.651   10.374  4.452   1.00 0.00 ? 860 ASN A N    4  
ATOM 3383 C CA   . ASN A 1 69 ? 5.011   10.440  4.990   1.00 0.00 ? 860 ASN A CA   4  
ATOM 3384 C C    . ASN A 1 69 ? 5.720   9.097   4.925   1.00 0.00 ? 860 ASN A C    4  
ATOM 3385 O O    . ASN A 1 69 ? 5.138   8.081   4.524   1.00 0.00 ? 860 ASN A O    4  
ATOM 3386 C CB   . ASN A 1 69 ? 4.989   10.938  6.441   1.00 0.00 ? 860 ASN A CB   4  
ATOM 3387 C CG   . ASN A 1 69 ? 4.255   9.945   7.339   1.00 0.00 ? 860 ASN A CG   4  
ATOM 3388 O OD1  . ASN A 1 69 ? 4.437   8.734   7.212   1.00 0.00 ? 860 ASN A OD1  4  
ATOM 3389 N ND2  . ASN A 1 69 ? 3.433   10.384  8.239   1.00 0.00 ? 860 ASN A ND2  4  
ATOM 3390 H H    . ASN A 1 69 ? 3.001   9.765   4.858   1.00 0.00 ? 860 ASN A H    4  
ATOM 3391 H HA   . ASN A 1 69 ? 5.577   11.149  4.405   1.00 0.00 ? 860 ASN A HA   4  
ATOM 3392 H HB2  . ASN A 1 69 ? 6.003   11.054  6.793   1.00 0.00 ? 860 ASN A HB2  4  
ATOM 3393 H HB3  . ASN A 1 69 ? 4.491   11.894  6.479   1.00 0.00 ? 860 ASN A HB3  4  
ATOM 3394 H HD21 . ASN A 1 69 ? 3.283   11.347  8.341   1.00 0.00 ? 860 ASN A HD21 4  
ATOM 3395 H HD22 . ASN A 1 69 ? 2.964   9.751   8.823   1.00 0.00 ? 860 ASN A HD22 4  
ATOM 3396 N N    . SER A 1 70 ? 6.978   9.103   5.344   1.00 0.00 ? 861 SER A N    4  
ATOM 3397 C CA   . SER A 1 70 ? 7.790   7.905   5.364   1.00 0.00 ? 861 SER A CA   4  
ATOM 3398 C C    . SER A 1 70 ? 7.185   6.863   6.289   1.00 0.00 ? 861 SER A C    4  
ATOM 3399 O O    . SER A 1 70 ? 7.155   5.682   5.962   1.00 0.00 ? 861 SER A O    4  
ATOM 3400 C CB   . SER A 1 70 ? 9.202   8.251   5.819   1.00 0.00 ? 861 SER A CB   4  
ATOM 3401 O OG   . SER A 1 70 ? 9.614   9.462   5.181   1.00 0.00 ? 861 SER A OG   4  
ATOM 3402 H H    . SER A 1 70 ? 7.365   9.942   5.662   1.00 0.00 ? 861 SER A H    4  
ATOM 3403 H HA   . SER A 1 70 ? 7.842   7.496   4.366   1.00 0.00 ? 861 SER A HA   4  
ATOM 3404 H HB2  . SER A 1 70 ? 9.214   8.391   6.887   1.00 0.00 ? 861 SER A HB2  4  
ATOM 3405 H HB3  . SER A 1 70 ? 9.871   7.441   5.562   1.00 0.00 ? 861 SER A HB3  4  
ATOM 3406 H HG   . SER A 1 70 ? 10.580  9.435   5.129   1.00 0.00 ? 861 SER A HG   4  
ATOM 3407 N N    . GLY A 1 71 ? 6.656   7.312   7.421   1.00 0.00 ? 862 GLY A N    4  
ATOM 3408 C CA   . GLY A 1 71 ? 6.013   6.403   8.356   1.00 0.00 ? 862 GLY A CA   4  
ATOM 3409 C C    . GLY A 1 71 ? 4.962   5.595   7.626   1.00 0.00 ? 862 GLY A C    4  
ATOM 3410 O O    . GLY A 1 71 ? 4.980   4.365   7.651   1.00 0.00 ? 862 GLY A O    4  
ATOM 3411 H H    . GLY A 1 71 ? 6.669   8.272   7.616   1.00 0.00 ? 862 GLY A H    4  
ATOM 3412 H HA2  . GLY A 1 71 ? 6.754   5.740   8.779   1.00 0.00 ? 862 GLY A HA2  4  
ATOM 3413 H HA3  . GLY A 1 71 ? 5.539   6.969   9.144   1.00 0.00 ? 862 GLY A HA3  4  
ATOM 3414 N N    . HIS A 1 72 ? 4.093   6.294   6.911   1.00 0.00 ? 863 HIS A N    4  
ATOM 3415 C CA   . HIS A 1 72 ? 3.079   5.636   6.106   1.00 0.00 ? 863 HIS A CA   4  
ATOM 3416 C C    . HIS A 1 72 ? 3.754   4.725   5.094   1.00 0.00 ? 863 HIS A C    4  
ATOM 3417 O O    . HIS A 1 72 ? 3.433   3.541   4.997   1.00 0.00 ? 863 HIS A O    4  
ATOM 3418 C CB   . HIS A 1 72 ? 2.221   6.675   5.374   1.00 0.00 ? 863 HIS A CB   4  
ATOM 3419 C CG   . HIS A 1 72 ? 1.315   7.371   6.348   1.00 0.00 ? 863 HIS A CG   4  
ATOM 3420 N ND1  . HIS A 1 72 ? 0.177   8.053   5.942   1.00 0.00 ? 863 HIS A ND1  4  
ATOM 3421 C CD2  . HIS A 1 72 ? 1.364   7.503   7.714   1.00 0.00 ? 863 HIS A CD2  4  
ATOM 3422 C CE1  . HIS A 1 72 ? -0.406  8.557   7.046   1.00 0.00 ? 863 HIS A CE1  4  
ATOM 3423 N NE2  . HIS A 1 72 ? 0.279   8.250   8.153   1.00 0.00 ? 863 HIS A NE2  4  
ATOM 3424 H H    . HIS A 1 72 ? 4.171   7.275   6.891   1.00 0.00 ? 863 HIS A H    4  
ATOM 3425 H HA   . HIS A 1 72 ? 2.445   5.043   6.748   1.00 0.00 ? 863 HIS A HA   4  
ATOM 3426 H HB2  . HIS A 1 72 ? 2.866   7.401   4.904   1.00 0.00 ? 863 HIS A HB2  4  
ATOM 3427 H HB3  . HIS A 1 72 ? 1.625   6.178   4.621   1.00 0.00 ? 863 HIS A HB3  4  
ATOM 3428 N N    . ARG A 1 73 ? 4.720   5.280   4.367   1.00 0.00 ? 864 ARG A N    4  
ATOM 3429 C CA   . ARG A 1 73 ? 5.476   4.509   3.385   1.00 0.00 ? 864 ARG A CA   4  
ATOM 3430 C C    . ARG A 1 73 ? 6.034   3.253   4.046   1.00 0.00 ? 864 ARG A C    4  
ATOM 3431 O O    . ARG A 1 73 ? 5.792   2.129   3.595   1.00 0.00 ? 864 ARG A O    4  
ATOM 3432 C CB   . ARG A 1 73 ? 6.635   5.362   2.824   1.00 0.00 ? 864 ARG A CB   4  
ATOM 3433 C CG   . ARG A 1 73 ? 6.520   5.498   1.291   1.00 0.00 ? 864 ARG A CG   4  
ATOM 3434 C CD   . ARG A 1 73 ? 7.635   4.680   0.603   1.00 0.00 ? 864 ARG A CD   4  
ATOM 3435 N NE   . ARG A 1 73 ? 8.504   5.543   -0.202  1.00 0.00 ? 864 ARG A NE   4  
ATOM 3436 C CZ   . ARG A 1 73 ? 9.354   6.411   0.352   1.00 0.00 ? 864 ARG A CZ   4  
ATOM 3437 N NH1  . ARG A 1 73 ? 9.383   6.560   1.645   1.00 0.00 ? 864 ARG A NH1  4  
ATOM 3438 N NH2  . ARG A 1 73 ? 10.151  7.102   -0.407  1.00 0.00 ? 864 ARG A NH2  4  
ATOM 3439 H H    . ARG A 1 73 ? 4.944   6.225   4.518   1.00 0.00 ? 864 ARG A H    4  
ATOM 3440 H HA   . ARG A 1 73 ? 4.819   4.223   2.579   1.00 0.00 ? 864 ARG A HA   4  
ATOM 3441 N N    . GLN A 1 74 ? 6.764   3.461   5.128   1.00 0.00 ? 865 GLN A N    4  
ATOM 3442 C CA   . GLN A 1 74 ? 7.357   2.374   5.885   1.00 0.00 ? 865 GLN A CA   4  
ATOM 3443 C C    . GLN A 1 74 ? 6.288   1.379   6.314   1.00 0.00 ? 865 GLN A C    4  
ATOM 3444 O O    . GLN A 1 74 ? 6.429   0.170   6.109   1.00 0.00 ? 865 GLN A O    4  
ATOM 3445 C CB   . GLN A 1 74 ? 8.071   2.939   7.123   1.00 0.00 ? 865 GLN A CB   4  
ATOM 3446 C CG   . GLN A 1 74 ? 9.194   1.994   7.565   1.00 0.00 ? 865 GLN A CG   4  
ATOM 3447 C CD   . GLN A 1 74 ? 8.677   0.996   8.595   1.00 0.00 ? 865 GLN A CD   4  
ATOM 3448 O OE1  . GLN A 1 74 ? 7.516   1.072   9.015   1.00 0.00 ? 865 GLN A OE1  4  
ATOM 3449 N NE2  . GLN A 1 74 ? 9.466   0.068   9.035   1.00 0.00 ? 865 GLN A NE2  4  
ATOM 3450 H H    . GLN A 1 74 ? 6.899   4.386   5.437   1.00 0.00 ? 865 GLN A H    4  
ATOM 3451 H HA   . GLN A 1 74 ? 8.081   1.871   5.264   1.00 0.00 ? 865 GLN A HA   4  
ATOM 3452 H HB2  . GLN A 1 74 ? 8.494   3.904   6.880   1.00 0.00 ? 865 GLN A HB2  4  
ATOM 3453 H HB3  . GLN A 1 74 ? 7.362   3.056   7.928   1.00 0.00 ? 865 GLN A HB3  4  
ATOM 3454 H HG2  . GLN A 1 74 ? 9.575   1.458   6.708   1.00 0.00 ? 865 GLN A HG2  4  
ATOM 3455 H HG3  . GLN A 1 74 ? 9.992   2.574   8.004   1.00 0.00 ? 865 GLN A HG3  4  
ATOM 3456 H HE21 . GLN A 1 74 ? 10.389  0.014   8.708   1.00 0.00 ? 865 GLN A HE21 4  
ATOM 3457 H HE22 . GLN A 1 74 ? 9.136   -0.584  9.690   1.00 0.00 ? 865 GLN A HE22 4  
ATOM 3458 N N    . ARG A 1 75 ? 5.221   1.891   6.910   1.00 0.00 ? 866 ARG A N    4  
ATOM 3459 C CA   . ARG A 1 75 ? 4.134   1.043   7.373   1.00 0.00 ? 866 ARG A CA   4  
ATOM 3460 C C    . ARG A 1 75 ? 3.544   0.251   6.219   1.00 0.00 ? 866 ARG A C    4  
ATOM 3461 O O    . ARG A 1 75 ? 3.437   -0.970  6.288   1.00 0.00 ? 866 ARG A O    4  
ATOM 3462 C CB   . ARG A 1 75 ? 3.043   1.882   8.047   1.00 0.00 ? 866 ARG A CB   4  
ATOM 3463 C CG   . ARG A 1 75 ? 3.159   1.754   9.573   1.00 0.00 ? 866 ARG A CG   4  
ATOM 3464 C CD   . ARG A 1 75 ? 4.545   2.225   10.038  1.00 0.00 ? 866 ARG A CD   4  
ATOM 3465 N NE   . ARG A 1 75 ? 5.446   1.085   10.209  1.00 0.00 ? 866 ARG A NE   4  
ATOM 3466 C CZ   . ARG A 1 75 ? 5.285   0.205   11.200  1.00 0.00 ? 866 ARG A CZ   4  
ATOM 3467 N NH1  . ARG A 1 75 ? 4.282   0.328   12.029  1.00 0.00 ? 866 ARG A NH1  4  
ATOM 3468 N NH2  . ARG A 1 75 ? 6.119   -0.783  11.333  1.00 0.00 ? 866 ARG A NH2  4  
ATOM 3469 H H    . ARG A 1 75 ? 5.167   2.863   7.043   1.00 0.00 ? 866 ARG A H    4  
ATOM 3470 H HA   . ARG A 1 75 ? 4.529   0.344   8.096   1.00 0.00 ? 866 ARG A HA   4  
ATOM 3471 N N    . ILE A 1 76 ? 3.172   0.945   5.157   1.00 0.00 ? 867 ILE A N    4  
ATOM 3472 C CA   . ILE A 1 76 ? 2.609   0.284   3.992   1.00 0.00 ? 867 ILE A CA   4  
ATOM 3473 C C    . ILE A 1 76 ? 3.587   -0.763  3.463   1.00 0.00 ? 867 ILE A C    4  
ATOM 3474 O O    . ILE A 1 76 ? 3.208   -1.914  3.216   1.00 0.00 ? 867 ILE A O    4  
ATOM 3475 C CB   . ILE A 1 76 ? 2.270   1.315   2.903   1.00 0.00 ? 867 ILE A CB   4  
ATOM 3476 C CG1  . ILE A 1 76 ? 1.237   2.323   3.452   1.00 0.00 ? 867 ILE A CG1  4  
ATOM 3477 C CG2  . ILE A 1 76 ? 1.689   0.604   1.672   1.00 0.00 ? 867 ILE A CG2  4  
ATOM 3478 C CD1  . ILE A 1 76 ? -0.187  1.795   3.230   1.00 0.00 ? 867 ILE A CD1  4  
ATOM 3479 H H    . ILE A 1 76 ? 3.290   1.922   5.151   1.00 0.00 ? 867 ILE A H    4  
ATOM 3480 H HA   . ILE A 1 76 ? 1.700   -0.217  4.292   1.00 0.00 ? 867 ILE A HA   4  
ATOM 3481 H HB   . ILE A 1 76 ? 3.172   1.839   2.618   1.00 0.00 ? 867 ILE A HB   4  
ATOM 3482 H HG12 . ILE A 1 76 ? 1.401   2.466   4.510   1.00 0.00 ? 867 ILE A HG12 4  
ATOM 3483 H HG21 . ILE A 1 76 ? 1.324   1.341   0.972   1.00 0.00 ? 867 ILE A HG21 4  
ATOM 3484 H HG22 . ILE A 1 76 ? 0.871   -0.032  1.978   1.00 0.00 ? 867 ILE A HG22 4  
ATOM 3485 H HG23 . ILE A 1 76 ? 2.455   0.007   1.202   1.00 0.00 ? 867 ILE A HG23 4  
ATOM 3486 H HD11 . ILE A 1 76 ? -0.487  1.982   2.210   1.00 0.00 ? 867 ILE A HD11 4  
ATOM 3487 H HD12 . ILE A 1 76 ? -0.867  2.298   3.902   1.00 0.00 ? 867 ILE A HD12 4  
ATOM 3488 H HD13 . ILE A 1 76 ? -0.216  0.732   3.424   1.00 0.00 ? 867 ILE A HD13 4  
ATOM 3489 N N    . LEU A 1 77 ? 4.854   -0.376  3.329   1.00 0.00 ? 868 LEU A N    4  
ATOM 3490 C CA   . LEU A 1 77 ? 5.877   -1.308  2.870   1.00 0.00 ? 868 LEU A CA   4  
ATOM 3491 C C    . LEU A 1 77 ? 5.958   -2.495  3.816   1.00 0.00 ? 868 LEU A C    4  
ATOM 3492 O O    . LEU A 1 77 ? 5.911   -3.653  3.394   1.00 0.00 ? 868 LEU A O    4  
ATOM 3493 C CB   . LEU A 1 77 ? 7.245   -0.614  2.781   1.00 0.00 ? 868 LEU A CB   4  
ATOM 3494 C CG   . LEU A 1 77 ? 8.163   -1.404  1.829   1.00 0.00 ? 868 LEU A CG   4  
ATOM 3495 C CD1  . LEU A 1 77 ? 7.849   -1.039  0.373   1.00 0.00 ? 868 LEU A CD1  4  
ATOM 3496 C CD2  . LEU A 1 77 ? 9.629   -1.073  2.135   1.00 0.00 ? 868 LEU A CD2  4  
ATOM 3497 H H    . LEU A 1 77 ? 5.106   0.544   3.570   1.00 0.00 ? 868 LEU A H    4  
ATOM 3498 H HA   . LEU A 1 77 ? 5.602   -1.665  1.890   1.00 0.00 ? 868 LEU A HA   4  
ATOM 3499 H HB2  . LEU A 1 77 ? 7.114   0.394   2.415   1.00 0.00 ? 868 LEU A HB2  4  
ATOM 3500 H HB3  . LEU A 1 77 ? 7.693   -0.580  3.764   1.00 0.00 ? 868 LEU A HB3  4  
ATOM 3501 H HG   . LEU A 1 77 ? 7.994   -2.463  1.971   1.00 0.00 ? 868 LEU A HG   4  
ATOM 3502 H HD11 . LEU A 1 77 ? 7.336   -0.088  0.333   1.00 0.00 ? 868 LEU A HD11 4  
ATOM 3503 H HD12 . LEU A 1 77 ? 7.221   -1.800  -0.061  1.00 0.00 ? 868 LEU A HD12 4  
ATOM 3504 H HD13 . LEU A 1 77 ? 8.769   -0.973  -0.189  1.00 0.00 ? 868 LEU A HD13 4  
ATOM 3505 H HD21 . LEU A 1 77 ? 9.708   -0.056  2.489   1.00 0.00 ? 868 LEU A HD21 4  
ATOM 3506 H HD22 . LEU A 1 77 ? 10.222  -1.188  1.240   1.00 0.00 ? 868 LEU A HD22 4  
ATOM 3507 H HD23 . LEU A 1 77 ? 9.997   -1.745  2.895   1.00 0.00 ? 868 LEU A HD23 4  
ATOM 3508 N N    . GLN A 1 78 ? 6.048   -2.203  5.100   1.00 0.00 ? 869 GLN A N    4  
ATOM 3509 C CA   . GLN A 1 78 ? 6.097   -3.249  6.107   1.00 0.00 ? 869 GLN A CA   4  
ATOM 3510 C C    . GLN A 1 78 ? 4.824   -4.075  6.059   1.00 0.00 ? 869 GLN A C    4  
ATOM 3511 O O    . GLN A 1 78 ? 4.858   -5.297  6.195   1.00 0.00 ? 869 GLN A O    4  
ATOM 3512 C CB   . GLN A 1 78 ? 6.261   -2.641  7.507   1.00 0.00 ? 869 GLN A CB   4  
ATOM 3513 C CG   . GLN A 1 78 ? 7.742   -2.361  7.786   1.00 0.00 ? 869 GLN A CG   4  
ATOM 3514 C CD   . GLN A 1 78 ? 8.032   -2.552  9.268   1.00 0.00 ? 869 GLN A CD   4  
ATOM 3515 O OE1  . GLN A 1 78 ? 7.951   -1.599  10.048  1.00 0.00 ? 869 GLN A OE1  4  
ATOM 3516 N NE2  . GLN A 1 78 ? 8.356   -3.728  9.712   1.00 0.00 ? 869 GLN A NE2  4  
ATOM 3517 H H    . GLN A 1 78 ? 6.059   -1.260  5.375   1.00 0.00 ? 869 GLN A H    4  
ATOM 3518 H HA   . GLN A 1 78 ? 6.940   -3.892  5.905   1.00 0.00 ? 869 GLN A HA   4  
ATOM 3519 H HB2  . GLN A 1 78 ? 5.701   -1.720  7.566   1.00 0.00 ? 869 GLN A HB2  4  
ATOM 3520 H HB3  . GLN A 1 78 ? 5.886   -3.337  8.243   1.00 0.00 ? 869 GLN A HB3  4  
ATOM 3521 H HG2  . GLN A 1 78 ? 8.357   -3.036  7.210   1.00 0.00 ? 869 GLN A HG2  4  
ATOM 3522 H HG3  . GLN A 1 78 ? 7.971   -1.343  7.507   1.00 0.00 ? 869 GLN A HG3  4  
ATOM 3523 H HE21 . GLN A 1 78 ? 8.414   -4.487  9.095   1.00 0.00 ? 869 GLN A HE21 4  
ATOM 3524 H HE22 . GLN A 1 78 ? 8.545   -3.858  10.666  1.00 0.00 ? 869 GLN A HE22 4  
ATOM 3525 N N    . ALA A 1 79 ? 3.700   -3.400  5.868   1.00 0.00 ? 870 ALA A N    4  
ATOM 3526 C CA   . ALA A 1 79 ? 2.413   -4.071  5.828   1.00 0.00 ? 870 ALA A CA   4  
ATOM 3527 C C    . ALA A 1 79 ? 2.382   -5.110  4.723   1.00 0.00 ? 870 ALA A C    4  
ATOM 3528 O O    . ALA A 1 79 ? 2.026   -6.264  4.965   1.00 0.00 ? 870 ALA A O    4  
ATOM 3529 C CB   . ALA A 1 79 ? 1.290   -3.056  5.616   1.00 0.00 ? 870 ALA A CB   4  
ATOM 3530 H H    . ALA A 1 79 ? 3.739   -2.422  5.772   1.00 0.00 ? 870 ALA A H    4  
ATOM 3531 H HA   . ALA A 1 79 ? 2.252   -4.565  6.775   1.00 0.00 ? 870 ALA A HA   4  
ATOM 3532 H HB1  . ALA A 1 79 ? 1.449   -2.524  4.690   1.00 0.00 ? 870 ALA A HB1  4  
ATOM 3533 H HB2  . ALA A 1 79 ? 1.276   -2.353  6.435   1.00 0.00 ? 870 ALA A HB2  4  
ATOM 3534 H HB3  . ALA A 1 79 ? 0.344   -3.575  5.572   1.00 0.00 ? 870 ALA A HB3  4  
ATOM 3535 N N    . ILE A 1 80 ? 2.787   -4.720  3.514   1.00 0.00 ? 871 ILE A N    4  
ATOM 3536 C CA   . ILE A 1 80 ? 2.807   -5.666  2.414   1.00 0.00 ? 871 ILE A CA   4  
ATOM 3537 C C    . ILE A 1 80 ? 3.862   -6.731  2.667   1.00 0.00 ? 871 ILE A C    4  
ATOM 3538 O O    . ILE A 1 80 ? 3.657   -7.909  2.370   1.00 0.00 ? 871 ILE A O    4  
ATOM 3539 C CB   . ILE A 1 80 ? 3.058   -4.966  1.068   1.00 0.00 ? 871 ILE A CB   4  
ATOM 3540 C CG1  . ILE A 1 80 ? 4.406   -4.253  1.070   1.00 0.00 ? 871 ILE A CG1  4  
ATOM 3541 C CG2  . ILE A 1 80 ? 1.960   -3.947  0.795   1.00 0.00 ? 871 ILE A CG2  4  
ATOM 3542 C CD1  . ILE A 1 80 ? 4.721   -3.787  -0.348  1.00 0.00 ? 871 ILE A CD1  4  
ATOM 3543 H H    . ILE A 1 80 ? 3.083   -3.796  3.366   1.00 0.00 ? 871 ILE A H    4  
ATOM 3544 H HA   . ILE A 1 80 ? 1.840   -6.144  2.375   1.00 0.00 ? 871 ILE A HA   4  
ATOM 3545 H HB   . ILE A 1 80 ? 3.043   -5.708  0.287   1.00 0.00 ? 871 ILE A HB   4  
ATOM 3546 H HG12 . ILE A 1 80 ? 4.356   -3.399  1.728   1.00 0.00 ? 871 ILE A HG12 4  
ATOM 3547 H HG21 . ILE A 1 80 ? 2.022   -3.624  -0.234  1.00 0.00 ? 871 ILE A HG21 4  
ATOM 3548 H HG22 . ILE A 1 80 ? 2.099   -3.098  1.445   1.00 0.00 ? 871 ILE A HG22 4  
ATOM 3549 H HG23 . ILE A 1 80 ? 0.995   -4.395  0.975   1.00 0.00 ? 871 ILE A HG23 4  
ATOM 3550 H HD11 . ILE A 1 80 ? 3.938   -3.129  -0.693  1.00 0.00 ? 871 ILE A HD11 4  
ATOM 3551 H HD12 . ILE A 1 80 ? 4.784   -4.644  -1.005  1.00 0.00 ? 871 ILE A HD12 4  
ATOM 3552 H HD13 . ILE A 1 80 ? 5.660   -3.256  -0.348  1.00 0.00 ? 871 ILE A HD13 4  
ATOM 3553 N N    . GLN A 1 81 ? 4.987   -6.314  3.240   1.00 0.00 ? 872 GLN A N    4  
ATOM 3554 C CA   . GLN A 1 81 ? 6.061   -7.241  3.561   1.00 0.00 ? 872 GLN A CA   4  
ATOM 3555 C C    . GLN A 1 81 ? 5.581   -8.270  4.573   1.00 0.00 ? 872 GLN A C    4  
ATOM 3556 O O    . GLN A 1 81 ? 5.934   -9.442  4.494   1.00 0.00 ? 872 GLN A O    4  
ATOM 3557 C CB   . GLN A 1 81 ? 7.265   -6.487  4.131   1.00 0.00 ? 872 GLN A CB   4  
ATOM 3558 C CG   . GLN A 1 81 ? 8.132   -5.951  2.988   1.00 0.00 ? 872 GLN A CG   4  
ATOM 3559 C CD   . GLN A 1 81 ? 9.514   -5.591  3.515   1.00 0.00 ? 872 GLN A CD   4  
ATOM 3560 O OE1  . GLN A 1 81 ? 10.069  -6.316  4.347   1.00 0.00 ? 872 GLN A OE1  4  
ATOM 3561 N NE2  . GLN A 1 81 ? 10.101  -4.515  3.094   1.00 0.00 ? 872 GLN A NE2  4  
ATOM 3562 H H    . GLN A 1 81 ? 5.087   -5.363  3.466   1.00 0.00 ? 872 GLN A H    4  
ATOM 3563 H HA   . GLN A 1 81 ? 6.365   -7.751  2.661   1.00 0.00 ? 872 GLN A HA   4  
ATOM 3564 H HB2  . GLN A 1 81 ? 6.920   -5.665  4.740   1.00 0.00 ? 872 GLN A HB2  4  
ATOM 3565 H HB3  . GLN A 1 81 ? 7.852   -7.159  4.739   1.00 0.00 ? 872 GLN A HB3  4  
ATOM 3566 H HG2  . GLN A 1 81 ? 8.229   -6.708  2.222   1.00 0.00 ? 872 GLN A HG2  4  
ATOM 3567 H HG3  . GLN A 1 81 ? 7.670   -5.072  2.566   1.00 0.00 ? 872 GLN A HG3  4  
ATOM 3568 H HE21 . GLN A 1 81 ? 9.660   -3.937  2.437   1.00 0.00 ? 872 GLN A HE21 4  
ATOM 3569 H HE22 . GLN A 1 81 ? 10.992  -4.278  3.431   1.00 0.00 ? 872 GLN A HE22 4  
ATOM 3570 N N    . LEU A 1 82 ? 4.792   -7.816  5.536   1.00 0.00 ? 873 LEU A N    4  
ATOM 3571 C CA   . LEU A 1 82 ? 4.277   -8.698  6.578   1.00 0.00 ? 873 LEU A CA   4  
ATOM 3572 C C    . LEU A 1 82 ? 3.294   -9.713  6.002   1.00 0.00 ? 873 LEU A C    4  
ATOM 3573 O O    . LEU A 1 82 ? 3.179   -10.830 6.512   1.00 0.00 ? 873 LEU A O    4  
ATOM 3574 C CB   . LEU A 1 82 ? 3.594   -7.877  7.687   1.00 0.00 ? 873 LEU A CB   4  
ATOM 3575 C CG   . LEU A 1 82 ? 4.514   -7.756  8.917   1.00 0.00 ? 873 LEU A CG   4  
ATOM 3576 C CD1  . LEU A 1 82 ? 4.555   -9.089  9.668   1.00 0.00 ? 873 LEU A CD1  4  
ATOM 3577 C CD2  . LEU A 1 82 ? 5.937   -7.373  8.480   1.00 0.00 ? 873 LEU A CD2  4  
ATOM 3578 H H    . LEU A 1 82 ? 4.561   -6.862  5.558   1.00 0.00 ? 873 LEU A H    4  
ATOM 3579 H HA   . LEU A 1 82 ? 5.107   -9.237  7.011   1.00 0.00 ? 873 LEU A HA   4  
ATOM 3580 H HB2  . LEU A 1 82 ? 3.360   -6.891  7.315   1.00 0.00 ? 873 LEU A HB2  4  
ATOM 3581 H HB3  . LEU A 1 82 ? 2.677   -8.368  7.981   1.00 0.00 ? 873 LEU A HB3  4  
ATOM 3582 H HG   . LEU A 1 82 ? 4.120   -6.994  9.575   1.00 0.00 ? 873 LEU A HG   4  
ATOM 3583 H HD11 . LEU A 1 82 ? 3.575   -9.310  10.064  1.00 0.00 ? 873 LEU A HD11 4  
ATOM 3584 H HD12 . LEU A 1 82 ? 5.259   -9.018  10.483  1.00 0.00 ? 873 LEU A HD12 4  
ATOM 3585 H HD13 . LEU A 1 82 ? 4.861   -9.879  9.000   1.00 0.00 ? 873 LEU A HD13 4  
ATOM 3586 H HD21 . LEU A 1 82 ? 5.897   -6.787  7.575   1.00 0.00 ? 873 LEU A HD21 4  
ATOM 3587 H HD22 . LEU A 1 82 ? 6.516   -8.268  8.304   1.00 0.00 ? 873 LEU A HD22 4  
ATOM 3588 H HD23 . LEU A 1 82 ? 6.403   -6.794  9.263   1.00 0.00 ? 873 LEU A HD23 4  
ATOM 3589 N N    . LEU A 1 83 ? 2.579   -9.321  4.947   1.00 0.00 ? 874 LEU A N    4  
ATOM 3590 C CA   . LEU A 1 83 ? 1.602   -10.213 4.318   1.00 0.00 ? 874 LEU A CA   4  
ATOM 3591 C C    . LEU A 1 83 ? 2.264   -11.524 3.900   1.00 0.00 ? 874 LEU A C    4  
ATOM 3592 O O    . LEU A 1 83 ? 3.087   -11.540 2.986   1.00 0.00 ? 874 LEU A O    4  
ATOM 3593 C CB   . LEU A 1 83 ? 0.978   -9.547  3.079   1.00 0.00 ? 874 LEU A CB   4  
ATOM 3594 C CG   . LEU A 1 83 ? 0.057   -8.394  3.506   1.00 0.00 ? 874 LEU A CG   4  
ATOM 3595 C CD1  . LEU A 1 83 ? -0.300  -7.543  2.285   1.00 0.00 ? 874 LEU A CD1  4  
ATOM 3596 C CD2  . LEU A 1 83 ? -1.231  -8.956  4.122   1.00 0.00 ? 874 LEU A CD2  4  
ATOM 3597 H H    . LEU A 1 83 ? 2.707   -8.419  4.590   1.00 0.00 ? 874 LEU A H    4  
ATOM 3598 H HA   . LEU A 1 83 ? 0.818   -10.422 5.028   1.00 0.00 ? 874 LEU A HA   4  
ATOM 3599 H HB2  . LEU A 1 83 ? 1.766   -9.170  2.446   1.00 0.00 ? 874 LEU A HB2  4  
ATOM 3600 H HB3  . LEU A 1 83 ? 0.404   -10.281 2.533   1.00 0.00 ? 874 LEU A HB3  4  
ATOM 3601 H HG   . LEU A 1 83 ? 0.566   -7.777  4.227   1.00 0.00 ? 874 LEU A HG   4  
ATOM 3602 H HD11 . LEU A 1 83 ? 0.453   -7.663  1.520   1.00 0.00 ? 874 LEU A HD11 4  
ATOM 3603 H HD12 . LEU A 1 83 ? -0.356  -6.505  2.575   1.00 0.00 ? 874 LEU A HD12 4  
ATOM 3604 H HD13 . LEU A 1 83 ? -1.258  -7.858  1.899   1.00 0.00 ? 874 LEU A HD13 4  
ATOM 3605 H HD21 . LEU A 1 83 ? -1.164  -10.031 4.203   1.00 0.00 ? 874 LEU A HD21 4  
ATOM 3606 H HD22 . LEU A 1 83 ? -2.073  -8.698  3.497   1.00 0.00 ? 874 LEU A HD22 4  
ATOM 3607 H HD23 . LEU A 1 83 ? -1.372  -8.529  5.104   1.00 0.00 ? 874 LEU A HD23 4  
ATOM 3608 N N    . PRO A 1 84 ? 1.921   -12.619 4.536   1.00 0.00 ? 875 PRO A N    4  
ATOM 3609 C CA   . PRO A 1 84 ? 2.496   -13.954 4.192   1.00 0.00 ? 875 PRO A CA   4  
ATOM 3610 C C    . PRO A 1 84 ? 2.357   -14.246 2.698   1.00 0.00 ? 875 PRO A C    4  
ATOM 3611 O O    . PRO A 1 84 ? 1.247   -14.489 2.205   1.00 0.00 ? 875 PRO A O    4  
ATOM 3612 C CB   . PRO A 1 84 ? 1.661   -14.937 5.020   1.00 0.00 ? 875 PRO A CB   4  
ATOM 3613 C CG   . PRO A 1 84 ? 1.136   -14.132 6.168   1.00 0.00 ? 875 PRO A CG   4  
ATOM 3614 C CD   . PRO A 1 84 ? 0.954   -12.705 5.645   1.00 0.00 ? 875 PRO A CD   4  
ATOM 3615 H HA   . PRO A 1 84 ? 3.525   -14.018 4.501   1.00 0.00 ? 875 PRO A HA   4  
ATOM 3616 H HB2  . PRO A 1 84 ? 0.848   -15.330 4.424   1.00 0.00 ? 875 PRO A HB2  4  
ATOM 3617 H HB3  . PRO A 1 84 ? 2.282   -15.739 5.388   1.00 0.00 ? 875 PRO A HB3  4  
ATOM 3618 H HG2  . PRO A 1 84 ? 0.190   -14.537 6.502   1.00 0.00 ? 875 PRO A HG2  4  
ATOM 3619 H HG3  . PRO A 1 84 ? 1.846   -14.127 6.980   1.00 0.00 ? 875 PRO A HG3  4  
ATOM 3620 H HD2  . PRO A 1 84 ? -0.058  -12.556 5.292   1.00 0.00 ? 875 PRO A HD2  4  
ATOM 3621 H HD3  . PRO A 1 84 ? 1.201   -11.986 6.410   1.00 0.00 ? 875 PRO A HD3  4  
ATOM 3622 N N    . LYS A 1 85 ? 3.471   -14.191 1.977   1.00 0.00 ? 876 LYS A N    4  
ATOM 3623 C CA   . LYS A 1 85 ? 3.452   -14.428 0.538   1.00 0.00 ? 876 LYS A CA   4  
ATOM 3624 C C    . LYS A 1 85 ? 3.447   -15.918 0.229   1.00 0.00 ? 876 LYS A C    4  
ATOM 3625 O O    . LYS A 1 85 ? 2.827   -16.297 -0.739  1.00 0.00 ? 876 LYS A O    4  
ATOM 3626 C CB   . LYS A 1 85 ? 4.654   -13.755 -0.144  1.00 0.00 ? 876 LYS A CB   4  
ATOM 3627 C CG   . LYS A 1 85 ? 5.936   -14.008 0.668   1.00 0.00 ? 876 LYS A CG   4  
ATOM 3628 C CD   . LYS A 1 85 ? 7.046   -14.543 -0.254  1.00 0.00 ? 876 LYS A CD   4  
ATOM 3629 C CE   . LYS A 1 85 ? 6.888   -16.060 -0.450  1.00 0.00 ? 876 LYS A CE   4  
ATOM 3630 N NZ   . LYS A 1 85 ? 6.494   -16.695 0.836   1.00 0.00 ? 876 LYS A NZ   4  
ATOM 3631 H H    . LYS A 1 85 ? 4.317   -13.972 2.419   1.00 0.00 ? 876 LYS A H    4  
ATOM 3632 H HA   . LYS A 1 85 ? 2.549   -13.989 0.141   1.00 0.00 ? 876 LYS A HA   4  
ATOM 3633 N N    . GLN A 1 23 ? -7.350  -8.552  3.553   1.00 0.00 ? 814 GLN A N    5  
ATOM 3634 C CA   . GLN A 1 23 ? -8.611  -8.505  2.770   1.00 0.00 ? 814 GLN A CA   5  
ATOM 3635 C C    . GLN A 1 23 ? -8.476  -7.448  1.678   1.00 0.00 ? 814 GLN A C    5  
ATOM 3636 O O    . GLN A 1 23 ? -7.425  -7.326  1.049   1.00 0.00 ? 814 GLN A O    5  
ATOM 3637 C CB   . GLN A 1 23 ? -9.792  -8.172  3.707   1.00 0.00 ? 814 GLN A CB   5  
ATOM 3638 C CG   . GLN A 1 23 ? -11.081 -8.823  3.173   1.00 0.00 ? 814 GLN A CG   5  
ATOM 3639 C CD   . GLN A 1 23 ? -12.056 -9.076  4.318   1.00 0.00 ? 814 GLN A CD   5  
ATOM 3640 O OE1  . GLN A 1 23 ? -11.775 -8.722  5.467   1.00 0.00 ? 814 GLN A OE1  5  
ATOM 3641 N NE2  . GLN A 1 23 ? -13.181 -9.672  4.082   1.00 0.00 ? 814 GLN A NE2  5  
ATOM 3642 H HA   . GLN A 1 23 ? -8.775  -9.467  2.311   1.00 0.00 ? 814 GLN A HA   5  
ATOM 3643 H HB2  . GLN A 1 23 ? -9.582  -8.555  4.696   1.00 0.00 ? 814 GLN A HB2  5  
ATOM 3644 H HB3  . GLN A 1 23 ? -9.929  -7.103  3.765   1.00 0.00 ? 814 GLN A HB3  5  
ATOM 3645 H HG2  . GLN A 1 23 ? -11.545 -8.168  2.451   1.00 0.00 ? 814 GLN A HG2  5  
ATOM 3646 H HG3  . GLN A 1 23 ? -10.842 -9.764  2.699   1.00 0.00 ? 814 GLN A HG3  5  
ATOM 3647 H HE21 . GLN A 1 23 ? -13.406 -9.958  3.172   1.00 0.00 ? 814 GLN A HE21 5  
ATOM 3648 H HE22 . GLN A 1 23 ? -13.813 -9.837  4.813   1.00 0.00 ? 814 GLN A HE22 5  
ATOM 3649 N N    . THR A 1 24 ? -9.529  -6.676  1.474   1.00 0.00 ? 815 THR A N    5  
ATOM 3650 C CA   . THR A 1 24 ? -9.536  -5.630  0.472   1.00 0.00 ? 815 THR A CA   5  
ATOM 3651 C C    . THR A 1 24 ? -8.772  -4.409  0.984   1.00 0.00 ? 815 THR A C    5  
ATOM 3652 O O    . THR A 1 24 ? -8.450  -4.325  2.181   1.00 0.00 ? 815 THR A O    5  
ATOM 3653 C CB   . THR A 1 24 ? -10.987 -5.257  0.144   1.00 0.00 ? 815 THR A CB   5  
ATOM 3654 O OG1  . THR A 1 24 ? -11.811 -5.569  1.268   1.00 0.00 ? 815 THR A OG1  5  
ATOM 3655 C CG2  . THR A 1 24 ? -11.467 -6.062  -1.066  1.00 0.00 ? 815 THR A CG2  5  
ATOM 3656 H H    . THR A 1 24 ? -10.337 -6.806  2.012   1.00 0.00 ? 815 THR A H    5  
ATOM 3657 H HA   . THR A 1 24 ? -9.056  -5.995  -0.425  1.00 0.00 ? 815 THR A HA   5  
ATOM 3658 H HB   . THR A 1 24 ? -11.055 -4.202  -0.080  1.00 0.00 ? 815 THR A HB   5  
ATOM 3659 H HG21 . THR A 1 24 ? -10.680 -6.115  -1.805  1.00 0.00 ? 815 THR A HG21 5  
ATOM 3660 H HG22 . THR A 1 24 ? -12.332 -5.584  -1.500  1.00 0.00 ? 815 THR A HG22 5  
ATOM 3661 H HG23 . THR A 1 24 ? -11.729 -7.062  -0.752  1.00 0.00 ? 815 THR A HG23 5  
ATOM 3662 N N    . VAL A 1 25 ? -8.433  -3.489  0.081   1.00 0.00 ? 816 VAL A N    5  
ATOM 3663 C CA   . VAL A 1 25 ? -7.684  -2.306  0.471   1.00 0.00 ? 816 VAL A CA   5  
ATOM 3664 C C    . VAL A 1 25 ? -8.500  -1.460  1.446   1.00 0.00 ? 816 VAL A C    5  
ATOM 3665 O O    . VAL A 1 25 ? -9.009  -0.397  1.101   1.00 0.00 ? 816 VAL A O    5  
ATOM 3666 C CB   . VAL A 1 25 ? -7.303  -1.472  -0.763  1.00 0.00 ? 816 VAL A CB   5  
ATOM 3667 C CG1  . VAL A 1 25 ? -6.158  -2.156  -1.518  1.00 0.00 ? 816 VAL A CG1  5  
ATOM 3668 C CG2  . VAL A 1 25 ? -8.512  -1.328  -1.697  1.00 0.00 ? 816 VAL A CG2  5  
ATOM 3669 H H    . VAL A 1 25 ? -8.679  -3.611  -0.860  1.00 0.00 ? 816 VAL A H    5  
ATOM 3670 H HA   . VAL A 1 25 ? -6.778  -2.622  0.967   1.00 0.00 ? 816 VAL A HA   5  
ATOM 3671 H HB   . VAL A 1 25 ? -6.981  -0.497  -0.430  1.00 0.00 ? 816 VAL A HB   5  
ATOM 3672 H HG11 . VAL A 1 25 ? -5.262  -2.131  -0.917  1.00 0.00 ? 816 VAL A HG11 5  
ATOM 3673 H HG12 . VAL A 1 25 ? -5.980  -1.635  -2.447  1.00 0.00 ? 816 VAL A HG12 5  
ATOM 3674 H HG13 . VAL A 1 25 ? -6.424  -3.180  -1.729  1.00 0.00 ? 816 VAL A HG13 5  
ATOM 3675 H HG21 . VAL A 1 25 ? -8.378  -1.959  -2.562  1.00 0.00 ? 816 VAL A HG21 5  
ATOM 3676 H HG22 . VAL A 1 25 ? -8.597  -0.302  -2.015  1.00 0.00 ? 816 VAL A HG22 5  
ATOM 3677 H HG23 . VAL A 1 25 ? -9.414  -1.616  -1.177  1.00 0.00 ? 816 VAL A HG23 5  
ATOM 3678 N N    . GLY A 1 26 ? -8.628  -1.958  2.649   1.00 0.00 ? 817 GLY A N    5  
ATOM 3679 C CA   . GLY A 1 26 ? -9.383  -1.287  3.695   1.00 0.00 ? 817 GLY A CA   5  
ATOM 3680 C C    . GLY A 1 26 ? -8.928  -1.790  5.043   1.00 0.00 ? 817 GLY A C    5  
ATOM 3681 O O    . GLY A 1 26 ? -8.143  -1.138  5.723   1.00 0.00 ? 817 GLY A O    5  
ATOM 3682 H H    . GLY A 1 26 ? -8.216  -2.828  2.840   1.00 0.00 ? 817 GLY A H    5  
ATOM 3683 H HA2  . GLY A 1 26 ? -9.227  -0.219  3.628   1.00 0.00 ? 817 GLY A HA2  5  
ATOM 3684 H HA3  . GLY A 1 26 ? -10.432 -1.507  3.573   1.00 0.00 ? 817 GLY A HA3  5  
ATOM 3685 N N    . GLN A 1 27 ? -9.340  -3.005  5.377   1.00 0.00 ? 818 GLN A N    5  
ATOM 3686 C CA   . GLN A 1 27 ? -8.907  -3.649  6.608   1.00 0.00 ? 818 GLN A CA   5  
ATOM 3687 C C    . GLN A 1 27 ? -7.386  -3.599  6.673   1.00 0.00 ? 818 GLN A C    5  
ATOM 3688 O O    . GLN A 1 27 ? -6.800  -3.205  7.685   1.00 0.00 ? 818 GLN A O    5  
ATOM 3689 C CB   . GLN A 1 27 ? -9.422  -5.111  6.620   1.00 0.00 ? 818 GLN A CB   5  
ATOM 3690 C CG   . GLN A 1 27 ? -8.504  -6.039  7.442   1.00 0.00 ? 818 GLN A CG   5  
ATOM 3691 C CD   . GLN A 1 27 ? -8.134  -7.264  6.611   1.00 0.00 ? 818 GLN A CD   5  
ATOM 3692 O OE1  . GLN A 1 27 ? -7.571  -7.129  5.518   1.00 0.00 ? 818 GLN A OE1  5  
ATOM 3693 N NE2  . GLN A 1 27 ? -8.428  -8.449  7.048   1.00 0.00 ? 818 GLN A NE2  5  
ATOM 3694 H H    . GLN A 1 27 ? -9.908  -3.500  4.750   1.00 0.00 ? 818 GLN A H    5  
ATOM 3695 H HA   . GLN A 1 27 ? -9.322  -3.118  7.452   1.00 0.00 ? 818 GLN A HA   5  
ATOM 3696 H HB2  . GLN A 1 27 ? -10.414 -5.133  7.045   1.00 0.00 ? 818 GLN A HB2  5  
ATOM 3697 H HB3  . GLN A 1 27 ? -9.472  -5.475  5.604   1.00 0.00 ? 818 GLN A HB3  5  
ATOM 3698 H HG2  . GLN A 1 27 ? -7.606  -5.526  7.746   1.00 0.00 ? 818 GLN A HG2  5  
ATOM 3699 H HG3  . GLN A 1 27 ? -9.038  -6.364  8.322   1.00 0.00 ? 818 GLN A HG3  5  
ATOM 3700 H HE21 . GLN A 1 27 ? -8.885  -8.557  7.908   1.00 0.00 ? 818 GLN A HE21 5  
ATOM 3701 H HE22 . GLN A 1 27 ? -8.196  -9.243  6.520   1.00 0.00 ? 818 GLN A HE22 5  
ATOM 3702 N N    . TRP A 1 28 ? -6.762  -3.938  5.558   1.00 0.00 ? 819 TRP A N    5  
ATOM 3703 C CA   . TRP A 1 28 ? -5.312  -3.879  5.431   1.00 0.00 ? 819 TRP A CA   5  
ATOM 3704 C C    . TRP A 1 28 ? -4.819  -2.488  5.830   1.00 0.00 ? 819 TRP A C    5  
ATOM 3705 O O    . TRP A 1 28 ? -4.088  -2.321  6.814   1.00 0.00 ? 819 TRP A O    5  
ATOM 3706 C CB   . TRP A 1 28 ? -4.937  -4.167  3.967   1.00 0.00 ? 819 TRP A CB   5  
ATOM 3707 C CG   . TRP A 1 28 ? -3.470  -4.419  3.820   1.00 0.00 ? 819 TRP A CG   5  
ATOM 3708 C CD1  . TRP A 1 28 ? -2.773  -5.384  4.464   1.00 0.00 ? 819 TRP A CD1  5  
ATOM 3709 C CD2  . TRP A 1 28 ? -2.515  -3.725  2.966   1.00 0.00 ? 819 TRP A CD2  5  
ATOM 3710 N NE1  . TRP A 1 28 ? -1.452  -5.324  4.052   1.00 0.00 ? 819 TRP A NE1  5  
ATOM 3711 C CE2  . TRP A 1 28 ? -1.248  -4.318  3.131   1.00 0.00 ? 819 TRP A CE2  5  
ATOM 3712 C CE3  . TRP A 1 28 ? -2.628  -2.644  2.067   1.00 0.00 ? 819 TRP A CE3  5  
ATOM 3713 C CZ2  . TRP A 1 28 ? -0.135  -3.865  2.435   1.00 0.00 ? 819 TRP A CZ2  5  
ATOM 3714 C CZ3  . TRP A 1 28 ? -1.499  -2.184  1.363   1.00 0.00 ? 819 TRP A CZ3  5  
ATOM 3715 C CH2  . TRP A 1 28 ? -0.254  -2.800  1.552   1.00 0.00 ? 819 TRP A CH2  5  
ATOM 3716 H H    . TRP A 1 28 ? -7.300  -4.195  4.781   1.00 0.00 ? 819 TRP A H    5  
ATOM 3717 H HA   . TRP A 1 28 ? -4.861  -4.624  6.067   1.00 0.00 ? 819 TRP A HA   5  
ATOM 3718 H HB2  . TRP A 1 28 ? -5.475  -5.038  3.626   1.00 0.00 ? 819 TRP A HB2  5  
ATOM 3719 H HB3  . TRP A 1 28 ? -5.215  -3.321  3.356   1.00 0.00 ? 819 TRP A HB3  5  
ATOM 3720 H HD1  . TRP A 1 28 ? -3.177  -6.087  5.178   1.00 0.00 ? 819 TRP A HD1  5  
ATOM 3721 N N    . LEU A 1 29 ? -5.261  -1.494  5.072   1.00 0.00 ? 820 LEU A N    5  
ATOM 3722 C CA   . LEU A 1 29 ? -4.903  -0.105  5.320   1.00 0.00 ? 820 LEU A CA   5  
ATOM 3723 C C    . LEU A 1 29 ? -5.238  0.298   6.752   1.00 0.00 ? 820 LEU A C    5  
ATOM 3724 O O    . LEU A 1 29 ? -4.419  0.906   7.448   1.00 0.00 ? 820 LEU A O    5  
ATOM 3725 C CB   . LEU A 1 29 ? -5.652  0.800   4.340   1.00 0.00 ? 820 LEU A CB   5  
ATOM 3726 C CG   . LEU A 1 29 ? -5.260  0.441   2.899   1.00 0.00 ? 820 LEU A CG   5  
ATOM 3727 C CD1  . LEU A 1 29 ? -6.206  1.133   1.922   1.00 0.00 ? 820 LEU A CD1  5  
ATOM 3728 C CD2  . LEU A 1 29 ? -3.824  0.901   2.627   1.00 0.00 ? 820 LEU A CD2  5  
ATOM 3729 H H    . LEU A 1 29 ? -5.863  -1.702  4.329   1.00 0.00 ? 820 LEU A H    5  
ATOM 3730 H HA   . LEU A 1 29 ? -3.841  0.019   5.157   1.00 0.00 ? 820 LEU A HA   5  
ATOM 3731 H HB2  . LEU A 1 29 ? -6.717  0.669   4.474   1.00 0.00 ? 820 LEU A HB2  5  
ATOM 3732 H HB3  . LEU A 1 29 ? -5.394  1.827   4.536   1.00 0.00 ? 820 LEU A HB3  5  
ATOM 3733 H HG   . LEU A 1 29 ? -5.331  -0.629  2.762   1.00 0.00 ? 820 LEU A HG   5  
ATOM 3734 H HD11 . LEU A 1 29 ? -7.194  0.710   2.015   1.00 0.00 ? 820 LEU A HD11 5  
ATOM 3735 H HD12 . LEU A 1 29 ? -5.848  0.990   0.913   1.00 0.00 ? 820 LEU A HD12 5  
ATOM 3736 H HD13 . LEU A 1 29 ? -6.245  2.189   2.144   1.00 0.00 ? 820 LEU A HD13 5  
ATOM 3737 H HD21 . LEU A 1 29 ? -3.131  0.182   3.039   1.00 0.00 ? 820 LEU A HD21 5  
ATOM 3738 H HD22 . LEU A 1 29 ? -3.659  1.865   3.088   1.00 0.00 ? 820 LEU A HD22 5  
ATOM 3739 H HD23 . LEU A 1 29 ? -3.667  0.981   1.562   1.00 0.00 ? 820 LEU A HD23 5  
ATOM 3740 N N    . GLU A 1 30 ? -6.444  -0.032  7.186   1.00 0.00 ? 821 GLU A N    5  
ATOM 3741 C CA   . GLU A 1 30 ? -6.878  0.300   8.534   1.00 0.00 ? 821 GLU A CA   5  
ATOM 3742 C C    . GLU A 1 30 ? -5.923  -0.288  9.555   1.00 0.00 ? 821 GLU A C    5  
ATOM 3743 O O    . GLU A 1 30 ? -5.497  0.398   10.485  1.00 0.00 ? 821 GLU A O    5  
ATOM 3744 C CB   . GLU A 1 30 ? -8.292  -0.227  8.787   1.00 0.00 ? 821 GLU A CB   5  
ATOM 3745 C CG   . GLU A 1 30 ? -9.297  0.571   7.946   1.00 0.00 ? 821 GLU A CG   5  
ATOM 3746 C CD   . GLU A 1 30 ? -10.114 1.483   8.838   1.00 0.00 ? 821 GLU A CD   5  
ATOM 3747 O OE1  . GLU A 1 30 ? -10.756 0.980   9.731   1.00 0.00 ? 821 GLU A OE1  5  
ATOM 3748 O OE2  . GLU A 1 30 ? -10.092 2.671   8.614   1.00 0.00 ? 821 GLU A OE2  5  
ATOM 3749 H H    . GLU A 1 30 ? -7.057  -0.509  6.585   1.00 0.00 ? 821 GLU A H    5  
ATOM 3750 H HA   . GLU A 1 30 ? -6.883  1.374   8.643   1.00 0.00 ? 821 GLU A HA   5  
ATOM 3751 N N    . SER A 1 31 ? -5.583  -1.554  9.376   1.00 0.00 ? 822 SER A N    5  
ATOM 3752 C CA   . SER A 1 31 ? -4.670  -2.225  10.289  1.00 0.00 ? 822 SER A CA   5  
ATOM 3753 C C    . SER A 1 31 ? -3.387  -1.420  10.448  1.00 0.00 ? 822 SER A C    5  
ATOM 3754 O O    . SER A 1 31 ? -2.967  -1.116  11.566  1.00 0.00 ? 822 SER A O    5  
ATOM 3755 C CB   . SER A 1 31 ? -4.347  -3.629  9.776   1.00 0.00 ? 822 SER A CB   5  
ATOM 3756 O OG   . SER A 1 31 ? -5.560  -4.287  9.411   1.00 0.00 ? 822 SER A OG   5  
ATOM 3757 H H    . SER A 1 31 ? -5.954  -2.046  8.610   1.00 0.00 ? 822 SER A H    5  
ATOM 3758 H HA   . SER A 1 31 ? -5.146  -2.313  11.254  1.00 0.00 ? 822 SER A HA   5  
ATOM 3759 H HB2  . SER A 1 31 ? -3.706  -3.564  8.910   1.00 0.00 ? 822 SER A HB2  5  
ATOM 3760 H HB3  . SER A 1 31 ? -3.835  -4.181  10.552  1.00 0.00 ? 822 SER A HB3  5  
ATOM 3761 H HG   . SER A 1 31 ? -5.971  -3.783  8.689   1.00 0.00 ? 822 SER A HG   5  
ATOM 3762 N N    . ILE A 1 32 ? -2.778  -1.058  9.330   1.00 0.00 ? 823 ILE A N    5  
ATOM 3763 C CA   . ILE A 1 32 ? -1.549  -0.272  9.369   1.00 0.00 ? 823 ILE A CA   5  
ATOM 3764 C C    . ILE A 1 32 ? -1.842  1.186   9.714   1.00 0.00 ? 823 ILE A C    5  
ATOM 3765 O O    . ILE A 1 32 ? -0.933  1.958   10.028  1.00 0.00 ? 823 ILE A O    5  
ATOM 3766 C CB   . ILE A 1 32 ? -0.803  -0.376  8.034   1.00 0.00 ? 823 ILE A CB   5  
ATOM 3767 C CG1  . ILE A 1 32 ? -1.733  0.032   6.879   1.00 0.00 ? 823 ILE A CG1  5  
ATOM 3768 C CG2  . ILE A 1 32 ? -0.338  -1.823  7.829   1.00 0.00 ? 823 ILE A CG2  5  
ATOM 3769 C CD1  . ILE A 1 32 ? -1.050  -0.252  5.541   1.00 0.00 ? 823 ILE A CD1  5  
ATOM 3770 H H    . ILE A 1 32 ? -3.166  -1.315  8.465   1.00 0.00 ? 823 ILE A H    5  
ATOM 3771 H HA   . ILE A 1 32 ? -0.914  -0.674  10.146  1.00 0.00 ? 823 ILE A HA   5  
ATOM 3772 H HB   . ILE A 1 32 ? 0.059   0.276   8.060   1.00 0.00 ? 823 ILE A HB   5  
ATOM 3773 H HG12 . ILE A 1 32 ? -2.649  -0.536  6.935   1.00 0.00 ? 823 ILE A HG12 5  
ATOM 3774 H HG21 . ILE A 1 32 ? -0.573  -2.409  8.705   1.00 0.00 ? 823 ILE A HG21 5  
ATOM 3775 H HG22 . ILE A 1 32 ? 0.729   -1.836  7.670   1.00 0.00 ? 823 ILE A HG22 5  
ATOM 3776 H HG23 . ILE A 1 32 ? -0.837  -2.247  6.971   1.00 0.00 ? 823 ILE A HG23 5  
ATOM 3777 H HD11 . ILE A 1 32 ? -1.257  -1.268  5.242   1.00 0.00 ? 823 ILE A HD11 5  
ATOM 3778 H HD12 . ILE A 1 32 ? 0.016   -0.119  5.642   1.00 0.00 ? 823 ILE A HD12 5  
ATOM 3779 H HD13 . ILE A 1 32 ? -1.429  0.427   4.791   1.00 0.00 ? 823 ILE A HD13 5  
ATOM 3780 N N    . GLY A 1 33 ? -3.118  1.545   9.686   1.00 0.00 ? 824 GLY A N    5  
ATOM 3781 C CA   . GLY A 1 33 ? -3.538  2.896   10.029  1.00 0.00 ? 824 GLY A CA   5  
ATOM 3782 C C    . GLY A 1 33 ? -3.371  3.850   8.858   1.00 0.00 ? 824 GLY A C    5  
ATOM 3783 O O    . GLY A 1 33 ? -3.105  5.037   9.051   1.00 0.00 ? 824 GLY A O    5  
ATOM 3784 H H    . GLY A 1 33 ? -3.797  0.879   9.447   1.00 0.00 ? 824 GLY A H    5  
ATOM 3785 H HA2  . GLY A 1 33 ? -4.577  2.877   10.325  1.00 0.00 ? 824 GLY A HA2  5  
ATOM 3786 H HA3  . GLY A 1 33 ? -2.944  3.251   10.856  1.00 0.00 ? 824 GLY A HA3  5  
ATOM 3787 N N    . LEU A 1 34 ? -3.565  3.343   7.647   1.00 0.00 ? 825 LEU A N    5  
ATOM 3788 C CA   . LEU A 1 34 ? -3.462  4.179   6.449   1.00 0.00 ? 825 LEU A CA   5  
ATOM 3789 C C    . LEU A 1 34 ? -4.753  4.110   5.633   1.00 0.00 ? 825 LEU A C    5  
ATOM 3790 O O    . LEU A 1 34 ? -4.727  3.839   4.431   1.00 0.00 ? 825 LEU A O    5  
ATOM 3791 C CB   . LEU A 1 34 ? -2.273  3.735   5.590   1.00 0.00 ? 825 LEU A CB   5  
ATOM 3792 C CG   . LEU A 1 34 ? -0.983  3.805   6.421   1.00 0.00 ? 825 LEU A CG   5  
ATOM 3793 C CD1  . LEU A 1 34 ? 0.161   3.156   5.648   1.00 0.00 ? 825 LEU A CD1  5  
ATOM 3794 C CD2  . LEU A 1 34 ? -0.632  5.269   6.708   1.00 0.00 ? 825 LEU A CD2  5  
ATOM 3795 H H    . LEU A 1 34 ? -3.805  2.395   7.551   1.00 0.00 ? 825 LEU A H    5  
ATOM 3796 H HA   . LEU A 1 34 ? -3.306  5.205   6.750   1.00 0.00 ? 825 LEU A HA   5  
ATOM 3797 H HB2  . LEU A 1 34 ? -2.437  2.724   5.248   1.00 0.00 ? 825 LEU A HB2  5  
ATOM 3798 H HB3  . LEU A 1 34 ? -2.188  4.391   4.737   1.00 0.00 ? 825 LEU A HB3  5  
ATOM 3799 H HG   . LEU A 1 34 ? -1.125  3.276   7.353   1.00 0.00 ? 825 LEU A HG   5  
ATOM 3800 H HD11 . LEU A 1 34 ? 1.036   3.113   6.278   1.00 0.00 ? 825 LEU A HD11 5  
ATOM 3801 H HD12 . LEU A 1 34 ? 0.378   3.741   4.767   1.00 0.00 ? 825 LEU A HD12 5  
ATOM 3802 H HD13 . LEU A 1 34 ? -0.122  2.156   5.358   1.00 0.00 ? 825 LEU A HD13 5  
ATOM 3803 H HD21 . LEU A 1 34 ? -1.263  5.642   7.501   1.00 0.00 ? 825 LEU A HD21 5  
ATOM 3804 H HD22 . LEU A 1 34 ? -0.785  5.861   5.818   1.00 0.00 ? 825 LEU A HD22 5  
ATOM 3805 H HD23 . LEU A 1 34 ? 0.402   5.338   7.012   1.00 0.00 ? 825 LEU A HD23 5  
ATOM 3806 N N    . PRO A 1 35 ? -5.877  4.332   6.270   1.00 0.00 ? 826 PRO A N    5  
ATOM 3807 C CA   . PRO A 1 35 ? -7.210  4.275   5.599   1.00 0.00 ? 826 PRO A CA   5  
ATOM 3808 C C    . PRO A 1 35 ? -7.350  5.333   4.509   1.00 0.00 ? 826 PRO A C    5  
ATOM 3809 O O    . PRO A 1 35 ? -6.523  6.238   4.398   1.00 0.00 ? 826 PRO A O    5  
ATOM 3810 C CB   . PRO A 1 35 ? -8.211  4.524   6.731   1.00 0.00 ? 826 PRO A CB   5  
ATOM 3811 C CG   . PRO A 1 35 ? -7.427  5.185   7.819   1.00 0.00 ? 826 PRO A CG   5  
ATOM 3812 C CD   . PRO A 1 35 ? -6.000  4.666   7.697   1.00 0.00 ? 826 PRO A CD   5  
ATOM 3813 H HA   . PRO A 1 35 ? -7.385  3.292   5.193   1.00 0.00 ? 826 PRO A HA   5  
ATOM 3814 H HB2  . PRO A 1 35 ? -9.006  5.171   6.388   1.00 0.00 ? 826 PRO A HB2  5  
ATOM 3815 H HB3  . PRO A 1 35 ? -8.613  3.590   7.085   1.00 0.00 ? 826 PRO A HB3  5  
ATOM 3816 H HG2  . PRO A 1 35 ? -7.450  6.258   7.693   1.00 0.00 ? 826 PRO A HG2  5  
ATOM 3817 H HG3  . PRO A 1 35 ? -7.825  4.915   8.786   1.00 0.00 ? 826 PRO A HG3  5  
ATOM 3818 H HD2  . PRO A 1 35 ? -5.294  5.437   7.978   1.00 0.00 ? 826 PRO A HD2  5  
ATOM 3819 H HD3  . PRO A 1 35 ? -5.865  3.780   8.297   1.00 0.00 ? 826 PRO A HD3  5  
ATOM 3820 N N    . GLN A 1 36 ? -8.407  5.211   3.716   1.00 0.00 ? 827 GLN A N    5  
ATOM 3821 C CA   . GLN A 1 36 ? -8.673  6.156   2.634   1.00 0.00 ? 827 GLN A CA   5  
ATOM 3822 C C    . GLN A 1 36 ? -7.571  6.103   1.581   1.00 0.00 ? 827 GLN A C    5  
ATOM 3823 O O    . GLN A 1 36 ? -7.403  7.035   0.794   1.00 0.00 ? 827 GLN A O    5  
ATOM 3824 C CB   . GLN A 1 36 ? -8.814  7.585   3.183   1.00 0.00 ? 827 GLN A CB   5  
ATOM 3825 C CG   . GLN A 1 36 ? -9.842  7.608   4.328   1.00 0.00 ? 827 GLN A CG   5  
ATOM 3826 C CD   . GLN A 1 36 ? -11.243 7.811   3.767   1.00 0.00 ? 827 GLN A CD   5  
ATOM 3827 O OE1  . GLN A 1 36 ? -11.933 6.839   3.446   1.00 0.00 ? 827 GLN A OE1  5  
ATOM 3828 N NE2  . GLN A 1 36 ? -11.709 9.015   3.627   1.00 0.00 ? 827 GLN A NE2  5  
ATOM 3829 H H    . GLN A 1 36 ? -9.031  4.471   3.864   1.00 0.00 ? 827 GLN A H    5  
ATOM 3830 H HA   . GLN A 1 36 ? -9.602  5.878   2.162   1.00 0.00 ? 827 GLN A HA   5  
ATOM 3831 H HB2  . GLN A 1 36 ? -7.858  7.931   3.547   1.00 0.00 ? 827 GLN A HB2  5  
ATOM 3832 H HB3  . GLN A 1 36 ? -9.151  8.237   2.390   1.00 0.00 ? 827 GLN A HB3  5  
ATOM 3833 H HG2  . GLN A 1 36 ? -9.806  6.674   4.870   1.00 0.00 ? 827 GLN A HG2  5  
ATOM 3834 H HG3  . GLN A 1 36 ? -9.609  8.418   5.002   1.00 0.00 ? 827 GLN A HG3  5  
ATOM 3835 H HE21 . GLN A 1 36 ? -11.162 9.787   3.883   1.00 0.00 ? 827 GLN A HE21 5  
ATOM 3836 H HE22 . GLN A 1 36 ? -12.607 9.153   3.260   1.00 0.00 ? 827 GLN A HE22 5  
ATOM 3837 N N    . TYR A 1 37 ? -6.838  4.999   1.555   1.00 0.00 ? 828 TYR A N    5  
ATOM 3838 C CA   . TYR A 1 37 ? -5.768  4.806   0.574   1.00 0.00 ? 828 TYR A CA   5  
ATOM 3839 C C    . TYR A 1 37 ? -6.233  3.832   -0.504  1.00 0.00 ? 828 TYR A C    5  
ATOM 3840 O O    . TYR A 1 37 ? -5.504  3.541   -1.455  1.00 0.00 ? 828 TYR A O    5  
ATOM 3841 C CB   . TYR A 1 37 ? -4.510  4.243   1.261   1.00 0.00 ? 828 TYR A CB   5  
ATOM 3842 C CG   . TYR A 1 37 ? -3.652  5.362   1.826   1.00 0.00 ? 828 TYR A CG   5  
ATOM 3843 C CD1  . TYR A 1 37 ? -4.245  6.506   2.380   1.00 0.00 ? 828 TYR A CD1  5  
ATOM 3844 C CD2  . TYR A 1 37 ? -2.258  5.245   1.801   1.00 0.00 ? 828 TYR A CD2  5  
ATOM 3845 C CE1  . TYR A 1 37 ? -3.446  7.525   2.903   1.00 0.00 ? 828 TYR A CE1  5  
ATOM 3846 C CE2  . TYR A 1 37 ? -1.459  6.265   2.326   1.00 0.00 ? 828 TYR A CE2  5  
ATOM 3847 C CZ   . TYR A 1 37 ? -2.054  7.404   2.877   1.00 0.00 ? 828 TYR A CZ   5  
ATOM 3848 O OH   . TYR A 1 37 ? -1.266  8.407   3.398   1.00 0.00 ? 828 TYR A OH   5  
ATOM 3849 H H    . TYR A 1 37 ? -7.029  4.287   2.200   1.00 0.00 ? 828 TYR A H    5  
ATOM 3850 H HA   . TYR A 1 37 ? -5.525  5.753   0.116   1.00 0.00 ? 828 TYR A HA   5  
ATOM 3851 H HB2  . TYR A 1 37 ? -4.803  3.586   2.066   1.00 0.00 ? 828 TYR A HB2  5  
ATOM 3852 H HB3  . TYR A 1 37 ? -3.934  3.683   0.540   1.00 0.00 ? 828 TYR A HB3  5  
ATOM 3853 H HH   . TYR A 1 37 ? -1.394  8.410   4.354   1.00 0.00 ? 828 TYR A HH   5  
ATOM 3854 N N    . GLU A 1 38 ? -7.447  3.319   -0.328  1.00 0.00 ? 829 GLU A N    5  
ATOM 3855 C CA   . GLU A 1 38 ? -8.029  2.352   -1.257  1.00 0.00 ? 829 GLU A CA   5  
ATOM 3856 C C    . GLU A 1 38 ? -8.044  2.892   -2.676  1.00 0.00 ? 829 GLU A C    5  
ATOM 3857 O O    . GLU A 1 38 ? -7.239  2.484   -3.519  1.00 0.00 ? 829 GLU A O    5  
ATOM 3858 C CB   . GLU A 1 38 ? -9.466  1.982   -0.830  1.00 0.00 ? 829 GLU A CB   5  
ATOM 3859 C CG   . GLU A 1 38 ? -9.918  2.864   0.348   1.00 0.00 ? 829 GLU A CG   5  
ATOM 3860 C CD   . GLU A 1 38 ? -11.385 2.619   0.659   1.00 0.00 ? 829 GLU A CD   5  
ATOM 3861 O OE1  . GLU A 1 38 ? -12.123 2.307   -0.248  1.00 0.00 ? 829 GLU A OE1  5  
ATOM 3862 O OE2  . GLU A 1 38 ? -11.755 2.757   1.803   1.00 0.00 ? 829 GLU A OE2  5  
ATOM 3863 H H    . GLU A 1 38 ? -7.965  3.588   0.457   1.00 0.00 ? 829 GLU A H    5  
ATOM 3864 H HA   . GLU A 1 38 ? -7.428  1.455   -1.239  1.00 0.00 ? 829 GLU A HA   5  
ATOM 3865 N N    . ASN A 1 39 ? -8.980  3.796   -2.945  1.00 0.00 ? 830 ASN A N    5  
ATOM 3866 C CA   . ASN A 1 39 ? -9.119  4.376   -4.275  1.00 0.00 ? 830 ASN A CA   5  
ATOM 3867 C C    . ASN A 1 39 ? -7.770  4.803   -4.813  1.00 0.00 ? 830 ASN A C    5  
ATOM 3868 O O    . ASN A 1 39 ? -7.495  4.670   -6.003  1.00 0.00 ? 830 ASN A O    5  
ATOM 3869 C CB   . ASN A 1 39 ? -10.072 5.576   -4.245  1.00 0.00 ? 830 ASN A CB   5  
ATOM 3870 C CG   . ASN A 1 39 ? -11.083 5.467   -5.380  1.00 0.00 ? 830 ASN A CG   5  
ATOM 3871 O OD1  . ASN A 1 39 ? -12.292 5.356   -5.132  1.00 0.00 ? 830 ASN A OD1  5  
ATOM 3872 N ND2  . ASN A 1 39 ? -10.671 5.488   -6.609  1.00 0.00 ? 830 ASN A ND2  5  
ATOM 3873 H H    . ASN A 1 39 ? -9.598  4.065   -2.231  1.00 0.00 ? 830 ASN A H    5  
ATOM 3874 H HA   . ASN A 1 39 ? -9.530  3.626   -4.934  1.00 0.00 ? 830 ASN A HA   5  
ATOM 3875 H HB2  . ASN A 1 39 ? -10.594 5.595   -3.303  1.00 0.00 ? 830 ASN A HB2  5  
ATOM 3876 H HB3  . ASN A 1 39 ? -9.508  6.491   -4.358  1.00 0.00 ? 830 ASN A HB3  5  
ATOM 3877 H HD21 . ASN A 1 39 ? -9.714  5.574   -6.805  1.00 0.00 ? 830 ASN A HD21 5  
ATOM 3878 H HD22 . ASN A 1 39 ? -11.313 5.416   -7.346  1.00 0.00 ? 830 ASN A HD22 5  
ATOM 3879 N N    . HIS A 1 40 ? -6.926  5.313   -3.931  1.00 0.00 ? 831 HIS A N    5  
ATOM 3880 C CA   . HIS A 1 40 ? -5.601  5.757   -4.326  1.00 0.00 ? 831 HIS A CA   5  
ATOM 3881 C C    . HIS A 1 40 ? -4.780  4.585   -4.850  1.00 0.00 ? 831 HIS A C    5  
ATOM 3882 O O    . HIS A 1 40 ? -4.324  4.595   -6.001  1.00 0.00 ? 831 HIS A O    5  
ATOM 3883 C CB   . HIS A 1 40 ? -4.881  6.407   -3.137  1.00 0.00 ? 831 HIS A CB   5  
ATOM 3884 C CG   . HIS A 1 40 ? -5.091  7.896   -3.175  1.00 0.00 ? 831 HIS A CG   5  
ATOM 3885 N ND1  . HIS A 1 40 ? -6.341  8.472   -2.996  1.00 0.00 ? 831 HIS A ND1  5  
ATOM 3886 C CD2  . HIS A 1 40 ? -4.221  8.937   -3.370  1.00 0.00 ? 831 HIS A CD2  5  
ATOM 3887 C CE1  . HIS A 1 40 ? -6.185  9.808   -3.087  1.00 0.00 ? 831 HIS A CE1  5  
ATOM 3888 N NE2  . HIS A 1 40 ? -4.911  10.143  -3.316  1.00 0.00 ? 831 HIS A NE2  5  
ATOM 3889 H H    . HIS A 1 40 ? -7.201  5.389   -2.994  1.00 0.00 ? 831 HIS A H    5  
ATOM 3890 H HA   . HIS A 1 40 ? -5.702  6.491   -5.112  1.00 0.00 ? 831 HIS A HA   5  
ATOM 3891 H HB2  . HIS A 1 40 ? -5.275  6.011   -2.213  1.00 0.00 ? 831 HIS A HB2  5  
ATOM 3892 H HB3  . HIS A 1 40 ? -3.823  6.195   -3.193  1.00 0.00 ? 831 HIS A HB3  5  
ATOM 3893 N N    . LEU A 1 41 ? -4.612  3.567   -4.014  1.00 0.00 ? 832 LEU A N    5  
ATOM 3894 C CA   . LEU A 1 41 ? -3.859  2.390   -4.406  1.00 0.00 ? 832 LEU A CA   5  
ATOM 3895 C C    . LEU A 1 41 ? -4.527  1.716   -5.592  1.00 0.00 ? 832 LEU A C    5  
ATOM 3896 O O    . LEU A 1 41 ? -3.886  1.446   -6.612  1.00 0.00 ? 832 LEU A O    5  
ATOM 3897 C CB   . LEU A 1 41 ? -3.759  1.403   -3.232  1.00 0.00 ? 832 LEU A CB   5  
ATOM 3898 C CG   . LEU A 1 41 ? -2.360  1.483   -2.595  1.00 0.00 ? 832 LEU A CG   5  
ATOM 3899 C CD1  . LEU A 1 41 ? -2.291  2.679   -1.642  1.00 0.00 ? 832 LEU A CD1  5  
ATOM 3900 C CD2  . LEU A 1 41 ? -2.084  0.196   -1.809  1.00 0.00 ? 832 LEU A CD2  5  
ATOM 3901 H H    . LEU A 1 41 ? -5.014  3.600   -3.118  1.00 0.00 ? 832 LEU A H    5  
ATOM 3902 H HA   . LEU A 1 41 ? -2.865  2.694   -4.693  1.00 0.00 ? 832 LEU A HA   5  
ATOM 3903 H HB2  . LEU A 1 41 ? -4.509  1.642   -2.494  1.00 0.00 ? 832 LEU A HB2  5  
ATOM 3904 H HB3  . LEU A 1 41 ? -3.930  0.402   -3.595  1.00 0.00 ? 832 LEU A HB3  5  
ATOM 3905 H HG   . LEU A 1 41 ? -1.616  1.601   -3.369  1.00 0.00 ? 832 LEU A HG   5  
ATOM 3906 H HD11 . LEU A 1 41 ? -1.258  2.920   -1.441  1.00 0.00 ? 832 LEU A HD11 5  
ATOM 3907 H HD12 . LEU A 1 41 ? -2.787  2.429   -0.715  1.00 0.00 ? 832 LEU A HD12 5  
ATOM 3908 H HD13 . LEU A 1 41 ? -2.779  3.533   -2.090  1.00 0.00 ? 832 LEU A HD13 5  
ATOM 3909 H HD21 . LEU A 1 41 ? -2.299  -0.661  -2.431  1.00 0.00 ? 832 LEU A HD21 5  
ATOM 3910 H HD22 . LEU A 1 41 ? -2.709  0.169   -0.929  1.00 0.00 ? 832 LEU A HD22 5  
ATOM 3911 H HD23 . LEU A 1 41 ? -1.045  0.174   -1.514  1.00 0.00 ? 832 LEU A HD23 5  
ATOM 3912 N N    . MET A 1 42 ? -5.818  1.459   -5.460  1.00 0.00 ? 833 MET A N    5  
ATOM 3913 C CA   . MET A 1 42 ? -6.575  0.823   -6.524  1.00 0.00 ? 833 MET A CA   5  
ATOM 3914 C C    . MET A 1 42 ? -6.428  1.600   -7.823  1.00 0.00 ? 833 MET A C    5  
ATOM 3915 O O    . MET A 1 42 ? -6.154  1.017   -8.871  1.00 0.00 ? 833 MET A O    5  
ATOM 3916 C CB   . MET A 1 42 ? -8.051  0.707   -6.138  1.00 0.00 ? 833 MET A CB   5  
ATOM 3917 C CG   . MET A 1 42 ? -8.198  -0.291  -4.979  1.00 0.00 ? 833 MET A CG   5  
ATOM 3918 S SD   . MET A 1 42 ? -9.749  -1.207  -5.159  1.00 0.00 ? 833 MET A SD   5  
ATOM 3919 C CE   . MET A 1 42 ? -10.803 -0.056  -4.244  1.00 0.00 ? 833 MET A CE   5  
ATOM 3920 H H    . MET A 1 42 ? -6.275  1.713   -4.626  1.00 0.00 ? 833 MET A H    5  
ATOM 3921 H HA   . MET A 1 42 ? -6.181  -0.171  -6.677  1.00 0.00 ? 833 MET A HA   5  
ATOM 3922 H HB2  . MET A 1 42 ? -8.422  1.676   -5.835  1.00 0.00 ? 833 MET A HB2  5  
ATOM 3923 H HB3  . MET A 1 42 ? -8.615  0.354   -6.986  1.00 0.00 ? 833 MET A HB3  5  
ATOM 3924 H HG2  . MET A 1 42 ? -7.369  -0.986  -4.992  1.00 0.00 ? 833 MET A HG2  5  
ATOM 3925 H HG3  . MET A 1 42 ? -8.201  0.245   -4.042  1.00 0.00 ? 833 MET A HG3  5  
ATOM 3926 H HE1  . MET A 1 42 ? -10.507 0.960   -4.462  1.00 0.00 ? 833 MET A HE1  5  
ATOM 3927 H HE2  . MET A 1 42 ? -10.702 -0.233  -3.185  1.00 0.00 ? 833 MET A HE2  5  
ATOM 3928 H HE3  . MET A 1 42 ? -11.835 -0.209  -4.531  1.00 0.00 ? 833 MET A HE3  5  
ATOM 3929 N N    . ALA A 1 43 ? -6.582  2.920   -7.751  1.00 0.00 ? 834 ALA A N    5  
ATOM 3930 C CA   . ALA A 1 43 ? -6.428  3.755   -8.940  1.00 0.00 ? 834 ALA A CA   5  
ATOM 3931 C C    . ALA A 1 43 ? -5.064  3.523   -9.562  1.00 0.00 ? 834 ALA A C    5  
ATOM 3932 O O    . ALA A 1 43 ? -4.917  3.519   -10.784 1.00 0.00 ? 834 ALA A O    5  
ATOM 3933 C CB   . ALA A 1 43 ? -6.586  5.236   -8.585  1.00 0.00 ? 834 ALA A CB   5  
ATOM 3934 H H    . ALA A 1 43 ? -6.782  3.339   -6.886  1.00 0.00 ? 834 ALA A H    5  
ATOM 3935 H HA   . ALA A 1 43 ? -7.190  3.486   -9.658  1.00 0.00 ? 834 ALA A HA   5  
ATOM 3936 H HB1  . ALA A 1 43 ? -7.628  5.453   -8.405  1.00 0.00 ? 834 ALA A HB1  5  
ATOM 3937 H HB2  . ALA A 1 43 ? -6.232  5.843   -9.407  1.00 0.00 ? 834 ALA A HB2  5  
ATOM 3938 H HB3  . ALA A 1 43 ? -6.011  5.461   -7.701  1.00 0.00 ? 834 ALA A HB3  5  
ATOM 3939 N N    . ASN A 1 44 ? -4.068  3.310   -8.712  1.00 0.00 ? 835 ASN A N    5  
ATOM 3940 C CA   . ASN A 1 44 ? -2.712  3.050   -9.181  1.00 0.00 ? 835 ASN A CA   5  
ATOM 3941 C C    . ASN A 1 44 ? -2.553  1.594   -9.587  1.00 0.00 ? 835 ASN A C    5  
ATOM 3942 O O    . ASN A 1 44 ? -1.448  1.138   -9.892  1.00 0.00 ? 835 ASN A O    5  
ATOM 3943 C CB   . ASN A 1 44 ? -1.691  3.396   -8.100  1.00 0.00 ? 835 ASN A CB   5  
ATOM 3944 C CG   . ASN A 1 44 ? -0.429  3.945   -8.747  1.00 0.00 ? 835 ASN A CG   5  
ATOM 3945 O OD1  . ASN A 1 44 ? -0.321  5.156   -8.960  1.00 0.00 ? 835 ASN A OD1  5  
ATOM 3946 N ND2  . ASN A 1 44 ? 0.531   3.134   -9.083  1.00 0.00 ? 835 ASN A ND2  5  
ATOM 3947 H H    . ASN A 1 44 ? -4.253  3.313   -7.746  1.00 0.00 ? 835 ASN A H    5  
ATOM 3948 H HA   . ASN A 1 44 ? -2.523  3.670   -10.045 1.00 0.00 ? 835 ASN A HA   5  
ATOM 3949 H HB2  . ASN A 1 44 ? -2.108  4.138   -7.435  1.00 0.00 ? 835 ASN A HB2  5  
ATOM 3950 H HB3  . ASN A 1 44 ? -1.447  2.507   -7.540  1.00 0.00 ? 835 ASN A HB3  5  
ATOM 3951 H HD21 . ASN A 1 44 ? 0.441   2.171   -8.919  1.00 0.00 ? 835 ASN A HD21 5  
ATOM 3952 H HD22 . ASN A 1 44 ? 1.352   3.483   -9.500  1.00 0.00 ? 835 ASN A HD22 5  
ATOM 3953 N N    . GLY A 1 45 ? -3.655  0.859   -9.567  1.00 0.00 ? 836 GLY A N    5  
ATOM 3954 C CA   . GLY A 1 45 ? -3.639  -0.551  -9.926  1.00 0.00 ? 836 GLY A CA   5  
ATOM 3955 C C    . GLY A 1 45 ? -3.153  -1.408  -8.771  1.00 0.00 ? 836 GLY A C    5  
ATOM 3956 O O    . GLY A 1 45 ? -3.104  -2.635  -8.875  1.00 0.00 ? 836 GLY A O    5  
ATOM 3957 H H    . GLY A 1 45 ? -4.503  1.270   -9.298  1.00 0.00 ? 836 GLY A H    5  
ATOM 3958 H HA2  . GLY A 1 45 ? -4.638  -0.856  -10.197 1.00 0.00 ? 836 GLY A HA2  5  
ATOM 3959 H HA3  . GLY A 1 45 ? -2.983  -0.697  -10.772 1.00 0.00 ? 836 GLY A HA3  5  
ATOM 3960 N N    . PHE A 1 46 ? -2.808  -0.767  -7.661  1.00 0.00 ? 837 PHE A N    5  
ATOM 3961 C CA   . PHE A 1 46 ? -2.339  -1.494  -6.489  1.00 0.00 ? 837 PHE A CA   5  
ATOM 3962 C C    . PHE A 1 46 ? -3.488  -2.252  -5.837  1.00 0.00 ? 837 PHE A C    5  
ATOM 3963 O O    . PHE A 1 46 ? -3.751  -2.104  -4.642  1.00 0.00 ? 837 PHE A O    5  
ATOM 3964 C CB   . PHE A 1 46 ? -1.689  -0.533  -5.482  1.00 0.00 ? 837 PHE A CB   5  
ATOM 3965 C CG   . PHE A 1 46 ? -0.407  0.049   -6.061  1.00 0.00 ? 837 PHE A CG   5  
ATOM 3966 C CD1  . PHE A 1 46 ? 0.466   -0.756  -6.812  1.00 0.00 ? 837 PHE A CD1  5  
ATOM 3967 C CD2  . PHE A 1 46 ? -0.092  1.394   -5.843  1.00 0.00 ? 837 PHE A CD2  5  
ATOM 3968 C CE1  . PHE A 1 46 ? 1.642   -0.213  -7.338  1.00 0.00 ? 837 PHE A CE1  5  
ATOM 3969 C CE2  . PHE A 1 46 ? 1.084   1.934   -6.371  1.00 0.00 ? 837 PHE A CE2  5  
ATOM 3970 C CZ   . PHE A 1 46 ? 1.950   1.131   -7.117  1.00 0.00 ? 837 PHE A CZ   5  
ATOM 3971 H H    . PHE A 1 46 ? -2.883  0.209   -7.617  1.00 0.00 ? 837 PHE A H    5  
ATOM 3972 H HA   . PHE A 1 46 ? -1.603  -2.215  -6.806  1.00 0.00 ? 837 PHE A HA   5  
ATOM 3973 H HB2  . PHE A 1 46 ? -2.379  0.266   -5.258  1.00 0.00 ? 837 PHE A HB2  5  
ATOM 3974 H HB3  . PHE A 1 46 ? -1.464  -1.065  -4.572  1.00 0.00 ? 837 PHE A HB3  5  
ATOM 3975 H HZ   . PHE A 1 46 ? 2.859   1.550   -7.525  1.00 0.00 ? 837 PHE A HZ   5  
ATOM 3976 N N    . ASP A 1 47 ? -4.159  -3.073  -6.634  1.00 0.00 ? 838 ASP A N    5  
ATOM 3977 C CA   . ASP A 1 47 ? -5.272  -3.879  -6.150  1.00 0.00 ? 838 ASP A CA   5  
ATOM 3978 C C    . ASP A 1 47 ? -4.751  -5.155  -5.499  1.00 0.00 ? 838 ASP A C    5  
ATOM 3979 O O    . ASP A 1 47 ? -3.605  -5.554  -5.729  1.00 0.00 ? 838 ASP A O    5  
ATOM 3980 C CB   . ASP A 1 47 ? -6.220  -4.226  -7.312  1.00 0.00 ? 838 ASP A CB   5  
ATOM 3981 C CG   . ASP A 1 47 ? -7.071  -5.431  -6.958  1.00 0.00 ? 838 ASP A CG   5  
ATOM 3982 O OD1  . ASP A 1 47 ? -8.098  -5.244  -6.342  1.00 0.00 ? 838 ASP A OD1  5  
ATOM 3983 O OD2  . ASP A 1 47 ? -6.686  -6.525  -7.307  1.00 0.00 ? 838 ASP A OD2  5  
ATOM 3984 H H    . ASP A 1 47 ? -3.883  -3.147  -7.574  1.00 0.00 ? 838 ASP A H    5  
ATOM 3985 H HA   . ASP A 1 47 ? -5.819  -3.312  -5.413  1.00 0.00 ? 838 ASP A HA   5  
ATOM 3986 N N    . ASN A 1 48 ? -5.596  -5.789  -4.695  1.00 0.00 ? 839 ASN A N    5  
ATOM 3987 C CA   . ASN A 1 48 ? -5.231  -7.019  -3.994  1.00 0.00 ? 839 ASN A CA   5  
ATOM 3988 C C    . ASN A 1 48 ? -3.952  -6.825  -3.209  1.00 0.00 ? 839 ASN A C    5  
ATOM 3989 O O    . ASN A 1 48 ? -2.861  -7.176  -3.670  1.00 0.00 ? 839 ASN A O    5  
ATOM 3990 C CB   . ASN A 1 48 ? -5.073  -8.187  -4.966  1.00 0.00 ? 839 ASN A CB   5  
ATOM 3991 C CG   . ASN A 1 48 ? -5.040  -9.494  -4.183  1.00 0.00 ? 839 ASN A CG   5  
ATOM 3992 O OD1  . ASN A 1 48 ? -4.101  -9.744  -3.427  1.00 0.00 ? 839 ASN A OD1  5  
ATOM 3993 N ND2  . ASN A 1 48 ? -6.015  -10.341 -4.308  1.00 0.00 ? 839 ASN A ND2  5  
ATOM 3994 H H    . ASN A 1 48 ? -6.491  -5.416  -4.566  1.00 0.00 ? 839 ASN A H    5  
ATOM 3995 H HA   . ASN A 1 48 ? -6.019  -7.261  -3.299  1.00 0.00 ? 839 ASN A HA   5  
ATOM 3996 H HB2  . ASN A 1 48 ? -5.905  -8.195  -5.655  1.00 0.00 ? 839 ASN A HB2  5  
ATOM 3997 H HB3  . ASN A 1 48 ? -4.151  -8.076  -5.516  1.00 0.00 ? 839 ASN A HB3  5  
ATOM 3998 H HD21 . ASN A 1 48 ? -6.768  -10.141 -4.903  1.00 0.00 ? 839 ASN A HD21 5  
ATOM 3999 H HD22 . ASN A 1 48 ? -6.001  -11.182 -3.805  1.00 0.00 ? 839 ASN A HD22 5  
ATOM 4000 N N    . VAL A 1 49 ? -4.088  -6.254  -2.025  1.00 0.00 ? 840 VAL A N    5  
ATOM 4001 C CA   . VAL A 1 49 ? -2.946  -5.987  -1.174  1.00 0.00 ? 840 VAL A CA   5  
ATOM 4002 C C    . VAL A 1 49 ? -2.012  -7.194  -1.120  1.00 0.00 ? 840 VAL A C    5  
ATOM 4003 O O    . VAL A 1 49 ? -0.804  -7.061  -1.323  1.00 0.00 ? 840 VAL A O    5  
ATOM 4004 C CB   . VAL A 1 49 ? -3.421  -5.609  0.239   1.00 0.00 ? 840 VAL A CB   5  
ATOM 4005 C CG1  . VAL A 1 49 ? -4.265  -4.335  0.165   1.00 0.00 ? 840 VAL A CG1  5  
ATOM 4006 C CG2  . VAL A 1 49 ? -4.277  -6.740  0.827   1.00 0.00 ? 840 VAL A CG2  5  
ATOM 4007 H H    . VAL A 1 49 ? -4.982  -5.991  -1.724  1.00 0.00 ? 840 VAL A H    5  
ATOM 4008 H HA   . VAL A 1 49 ? -2.401  -5.151  -1.584  1.00 0.00 ? 840 VAL A HA   5  
ATOM 4009 H HB   . VAL A 1 49 ? -2.560  -5.433  0.870   1.00 0.00 ? 840 VAL A HB   5  
ATOM 4010 H HG11 . VAL A 1 49 ? -5.113  -4.499  -0.483  1.00 0.00 ? 840 VAL A HG11 5  
ATOM 4011 H HG12 . VAL A 1 49 ? -3.663  -3.527  -0.224  1.00 0.00 ? 840 VAL A HG12 5  
ATOM 4012 H HG13 . VAL A 1 49 ? -4.613  -4.080  1.154   1.00 0.00 ? 840 VAL A HG13 5  
ATOM 4013 H HG21 . VAL A 1 49 ? -4.838  -6.361  1.670   1.00 0.00 ? 840 VAL A HG21 5  
ATOM 4014 H HG22 . VAL A 1 49 ? -3.639  -7.543  1.162   1.00 0.00 ? 840 VAL A HG22 5  
ATOM 4015 H HG23 . VAL A 1 49 ? -4.963  -7.108  0.080   1.00 0.00 ? 840 VAL A HG23 5  
ATOM 4016 N N    . GLN A 1 50 ? -2.580  -8.368  -0.863  1.00 0.00 ? 841 GLN A N    5  
ATOM 4017 C CA   . GLN A 1 50 ? -1.788  -9.593  -0.793  1.00 0.00 ? 841 GLN A CA   5  
ATOM 4018 C C    . GLN A 1 50 ? -0.935  -9.739  -2.035  1.00 0.00 ? 841 GLN A C    5  
ATOM 4019 O O    . GLN A 1 50 ? 0.299   -9.809  -1.953  1.00 0.00 ? 841 GLN A O    5  
ATOM 4020 C CB   . GLN A 1 50 ? -2.695  -10.814 -0.644  1.00 0.00 ? 841 GLN A CB   5  
ATOM 4021 C CG   . GLN A 1 50 ? -3.733  -10.564 0.457   1.00 0.00 ? 841 GLN A CG   5  
ATOM 4022 C CD   . GLN A 1 50 ? -5.086  -10.231 -0.160  1.00 0.00 ? 841 GLN A CD   5  
ATOM 4023 O OE1  . GLN A 1 50 ? -5.814  -9.390  0.364   1.00 0.00 ? 841 GLN A OE1  5  
ATOM 4024 N NE2  . GLN A 1 50 ? -5.470  -10.836 -1.238  1.00 0.00 ? 841 GLN A NE2  5  
ATOM 4025 H H    . GLN A 1 50 ? -3.548  -8.410  -0.725  1.00 0.00 ? 841 GLN A H    5  
ATOM 4026 H HA   . GLN A 1 50 ? -1.138  -9.537  0.064   1.00 0.00 ? 841 GLN A HA   5  
ATOM 4027 H HB2  . GLN A 1 50 ? -3.192  -11.002 -1.584  1.00 0.00 ? 841 GLN A HB2  5  
ATOM 4028 H HB3  . GLN A 1 50 ? -2.097  -11.675 -0.381  1.00 0.00 ? 841 GLN A HB3  5  
ATOM 4029 H HG2  . GLN A 1 50 ? -3.827  -11.454 1.065   1.00 0.00 ? 841 GLN A HG2  5  
ATOM 4030 H HG3  . GLN A 1 50 ? -3.411  -9.744  1.081   1.00 0.00 ? 841 GLN A HG3  5  
ATOM 4031 H HE21 . GLN A 1 50 ? -4.892  -11.509 -1.658  1.00 0.00 ? 841 GLN A HE21 5  
ATOM 4032 H HE22 . GLN A 1 50 ? -6.342  -10.626 -1.637  1.00 0.00 ? 841 GLN A HE22 5  
ATOM 4033 N N    . PHE A 1 51 ? -1.584  -9.763  -3.189  1.00 0.00 ? 842 PHE A N    5  
ATOM 4034 C CA   . PHE A 1 51 ? -0.869  -9.875  -4.443  1.00 0.00 ? 842 PHE A CA   5  
ATOM 4035 C C    . PHE A 1 51 ? 0.074   -8.706  -4.593  1.00 0.00 ? 842 PHE A C    5  
ATOM 4036 O O    . PHE A 1 51 ? 1.243   -8.886  -4.898  1.00 0.00 ? 842 PHE A O    5  
ATOM 4037 C CB   . PHE A 1 51 ? -1.842  -9.916  -5.629  1.00 0.00 ? 842 PHE A CB   5  
ATOM 4038 C CG   . PHE A 1 51 ? -1.625  -11.186 -6.418  1.00 0.00 ? 842 PHE A CG   5  
ATOM 4039 C CD1  . PHE A 1 51 ? -0.684  -11.216 -7.452  1.00 0.00 ? 842 PHE A CD1  5  
ATOM 4040 C CD2  . PHE A 1 51 ? -2.365  -12.334 -6.113  1.00 0.00 ? 842 PHE A CD2  5  
ATOM 4041 C CE1  . PHE A 1 51 ? -0.485  -12.392 -8.181  1.00 0.00 ? 842 PHE A CE1  5  
ATOM 4042 C CE2  . PHE A 1 51 ? -2.165  -13.509 -6.842  1.00 0.00 ? 842 PHE A CE2  5  
ATOM 4043 C CZ   . PHE A 1 51 ? -1.225  -13.537 -7.877  1.00 0.00 ? 842 PHE A CZ   5  
ATOM 4044 H H    . PHE A 1 51 ? -2.566  -9.685  -3.194  1.00 0.00 ? 842 PHE A H    5  
ATOM 4045 H HA   . PHE A 1 51 ? -0.293  -10.788 -4.432  1.00 0.00 ? 842 PHE A HA   5  
ATOM 4046 H HB2  . PHE A 1 51 ? -2.857  -9.888  -5.268  1.00 0.00 ? 842 PHE A HB2  5  
ATOM 4047 H HB3  . PHE A 1 51 ? -1.668  -9.064  -6.270  1.00 0.00 ? 842 PHE A HB3  5  
ATOM 4048 H HZ   . PHE A 1 51 ? -1.070  -14.446 -8.442  1.00 0.00 ? 842 PHE A HZ   5  
ATOM 4049 N N    . MET A 1 52 ? -0.439  -7.505  -4.353  1.00 0.00 ? 843 MET A N    5  
ATOM 4050 C CA   . MET A 1 52 ? 0.373   -6.297  -4.451  1.00 0.00 ? 843 MET A CA   5  
ATOM 4051 C C    . MET A 1 52 ? 1.648   -6.442  -3.631  1.00 0.00 ? 843 MET A C    5  
ATOM 4052 O O    . MET A 1 52 ? 2.760   -6.327  -4.159  1.00 0.00 ? 843 MET A O    5  
ATOM 4053 C CB   . MET A 1 52 ? -0.423  -5.079  -3.958  1.00 0.00 ? 843 MET A CB   5  
ATOM 4054 C CG   . MET A 1 52 ? -0.532  -4.049  -5.083  1.00 0.00 ? 843 MET A CG   5  
ATOM 4055 S SD   . MET A 1 52 ? 1.123   -3.670  -5.717  1.00 0.00 ? 843 MET A SD   5  
ATOM 4056 C CE   . MET A 1 52 ? 1.737   -2.776  -4.263  1.00 0.00 ? 843 MET A CE   5  
ATOM 4057 H H    . MET A 1 52 ? -1.387  -7.430  -4.094  1.00 0.00 ? 843 MET A H    5  
ATOM 4058 H HA   . MET A 1 52 ? 0.637   -6.143  -5.485  1.00 0.00 ? 843 MET A HA   5  
ATOM 4059 H HB2  . MET A 1 52 ? -1.412  -5.388  -3.657  1.00 0.00 ? 843 MET A HB2  5  
ATOM 4060 H HB3  . MET A 1 52 ? 0.084   -4.631  -3.117  1.00 0.00 ? 843 MET A HB3  5  
ATOM 4061 H HG2  . MET A 1 52 ? -1.142  -4.452  -5.879  1.00 0.00 ? 843 MET A HG2  5  
ATOM 4062 H HG3  . MET A 1 52 ? -0.990  -3.150  -4.702  1.00 0.00 ? 843 MET A HG3  5  
ATOM 4063 H HE1  . MET A 1 52 ? 2.229   -1.868  -4.584  1.00 0.00 ? 843 MET A HE1  5  
ATOM 4064 H HE2  . MET A 1 52 ? 2.446   -3.391  -3.730  1.00 0.00 ? 843 MET A HE2  5  
ATOM 4065 H HE3  . MET A 1 52 ? 0.913   -2.534  -3.607  1.00 0.00 ? 843 MET A HE3  5  
ATOM 4066 N N    . GLY A 1 53 ? 1.487   -6.733  -2.349  1.00 0.00 ? 844 GLY A N    5  
ATOM 4067 C CA   . GLY A 1 53 ? 2.629   -6.920  -1.475  1.00 0.00 ? 844 GLY A CA   5  
ATOM 4068 C C    . GLY A 1 53 ? 3.510   -8.022  -2.005  1.00 0.00 ? 844 GLY A C    5  
ATOM 4069 O O    . GLY A 1 53 ? 4.732   -7.895  -2.049  1.00 0.00 ? 844 GLY A O    5  
ATOM 4070 H H    . GLY A 1 53 ? 0.580   -6.846  -1.988  1.00 0.00 ? 844 GLY A H    5  
ATOM 4071 H HA2  . GLY A 1 53 ? 3.193   -6.000  -1.428  1.00 0.00 ? 844 GLY A HA2  5  
ATOM 4072 H HA3  . GLY A 1 53 ? 2.283   -7.187  -0.489  1.00 0.00 ? 844 GLY A HA3  5  
ATOM 4073 N N    . SER A 1 54 ? 2.883   -9.090  -2.445  1.00 0.00 ? 845 SER A N    5  
ATOM 4074 C CA   . SER A 1 54 ? 3.603   -10.208 -3.007  1.00 0.00 ? 845 SER A CA   5  
ATOM 4075 C C    . SER A 1 54 ? 3.896   -9.965  -4.482  1.00 0.00 ? 845 SER A C    5  
ATOM 4076 O O    . SER A 1 54 ? 4.266   -10.888 -5.214  1.00 0.00 ? 845 SER A O    5  
ATOM 4077 C CB   . SER A 1 54 ? 2.785   -11.480 -2.846  1.00 0.00 ? 845 SER A CB   5  
ATOM 4078 O OG   . SER A 1 54 ? 2.057   -11.423 -1.615  1.00 0.00 ? 845 SER A OG   5  
ATOM 4079 H H    . SER A 1 54 ? 1.902   -9.120  -2.413  1.00 0.00 ? 845 SER A H    5  
ATOM 4080 H HA   . SER A 1 54 ? 4.538   -10.328 -2.480  1.00 0.00 ? 845 SER A HA   5  
ATOM 4081 H HB2  . SER A 1 54 ? 2.091   -11.574 -3.668  1.00 0.00 ? 845 SER A HB2  5  
ATOM 4082 H HB3  . SER A 1 54 ? 3.457   -12.323 -2.853  1.00 0.00 ? 845 SER A HB3  5  
ATOM 4083 H HG   . SER A 1 54 ? 1.347   -10.769 -1.723  1.00 0.00 ? 845 SER A HG   5  
ATOM 4084 N N    . ASN A 1 55 ? 3.712   -8.729  -4.922  1.00 0.00 ? 846 ASN A N    5  
ATOM 4085 C CA   . ASN A 1 55 ? 3.938   -8.381  -6.324  1.00 0.00 ? 846 ASN A CA   5  
ATOM 4086 C C    . ASN A 1 55 ? 5.129   -7.464  -6.465  1.00 0.00 ? 846 ASN A C    5  
ATOM 4087 O O    . ASN A 1 55 ? 6.048   -7.746  -7.232  1.00 0.00 ? 846 ASN A O    5  
ATOM 4088 C CB   . ASN A 1 55 ? 2.696   -7.708  -6.926  1.00 0.00 ? 846 ASN A CB   5  
ATOM 4089 C CG   . ASN A 1 55 ? 3.053   -7.021  -8.241  1.00 0.00 ? 846 ASN A CG   5  
ATOM 4090 O OD1  . ASN A 1 55 ? 3.611   -7.654  -9.140  1.00 0.00 ? 846 ASN A OD1  5  
ATOM 4091 N ND2  . ASN A 1 55 ? 2.768   -5.763  -8.409  1.00 0.00 ? 846 ASN A ND2  5  
ATOM 4092 H H    . ASN A 1 55 ? 3.406   -8.039  -4.293  1.00 0.00 ? 846 ASN A H    5  
ATOM 4093 H HA   . ASN A 1 55 ? 4.136   -9.285  -6.880  1.00 0.00 ? 846 ASN A HA   5  
ATOM 4094 H HB2  . ASN A 1 55 ? 1.937   -8.455  -7.108  1.00 0.00 ? 846 ASN A HB2  5  
ATOM 4095 H HB3  . ASN A 1 55 ? 2.315   -6.975  -6.235  1.00 0.00 ? 846 ASN A HB3  5  
ATOM 4096 H HD21 . ASN A 1 55 ? 2.326   -5.259  -7.693  1.00 0.00 ? 846 ASN A HD21 5  
ATOM 4097 H HD22 . ASN A 1 55 ? 2.992   -5.316  -9.252  1.00 0.00 ? 846 ASN A HD22 5  
ATOM 4098 N N    . VAL A 1 56 ? 5.120   -6.365  -5.733  1.00 0.00 ? 847 VAL A N    5  
ATOM 4099 C CA   . VAL A 1 56 ? 6.216   -5.418  -5.803  1.00 0.00 ? 847 VAL A CA   5  
ATOM 4100 C C    . VAL A 1 56 ? 6.359   -4.648  -4.499  1.00 0.00 ? 847 VAL A C    5  
ATOM 4101 O O    . VAL A 1 56 ? 5.367   -4.277  -3.870  1.00 0.00 ? 847 VAL A O    5  
ATOM 4102 C CB   . VAL A 1 56 ? 6.004   -4.446  -6.981  1.00 0.00 ? 847 VAL A CB   5  
ATOM 4103 C CG1  . VAL A 1 56 ? 4.708   -3.652  -6.778  1.00 0.00 ? 847 VAL A CG1  5  
ATOM 4104 C CG2  . VAL A 1 56 ? 7.189   -3.476  -7.076  1.00 0.00 ? 847 VAL A CG2  5  
ATOM 4105 H H    . VAL A 1 56 ? 4.363   -6.182  -5.132  1.00 0.00 ? 847 VAL A H    5  
ATOM 4106 H HA   . VAL A 1 56 ? 7.130   -5.966  -5.978  1.00 0.00 ? 847 VAL A HA   5  
ATOM 4107 H HB   . VAL A 1 56 ? 5.929   -5.016  -7.897  1.00 0.00 ? 847 VAL A HB   5  
ATOM 4108 H HG11 . VAL A 1 56 ? 3.938   -4.304  -6.392  1.00 0.00 ? 847 VAL A HG11 5  
ATOM 4109 H HG12 . VAL A 1 56 ? 4.387   -3.238  -7.722  1.00 0.00 ? 847 VAL A HG12 5  
ATOM 4110 H HG13 . VAL A 1 56 ? 4.883   -2.849  -6.076  1.00 0.00 ? 847 VAL A HG13 5  
ATOM 4111 H HG21 . VAL A 1 56 ? 7.049   -2.820  -7.921  1.00 0.00 ? 847 VAL A HG21 5  
ATOM 4112 H HG22 . VAL A 1 56 ? 8.106   -4.032  -7.202  1.00 0.00 ? 847 VAL A HG22 5  
ATOM 4113 H HG23 . VAL A 1 56 ? 7.247   -2.886  -6.172  1.00 0.00 ? 847 VAL A HG23 5  
ATOM 4114 N N    . MET A 1 57 ? 7.598   -4.382  -4.121  1.00 0.00 ? 848 MET A N    5  
ATOM 4115 C CA   . MET A 1 57 ? 7.885   -3.617  -2.924  1.00 0.00 ? 848 MET A CA   5  
ATOM 4116 C C    . MET A 1 57 ? 8.964   -2.593  -3.231  1.00 0.00 ? 848 MET A C    5  
ATOM 4117 O O    . MET A 1 57 ? 10.149  -2.936  -3.310  1.00 0.00 ? 848 MET A O    5  
ATOM 4118 C CB   . MET A 1 57 ? 8.361   -4.543  -1.791  1.00 0.00 ? 848 MET A CB   5  
ATOM 4119 C CG   . MET A 1 57 ? 7.577   -5.859  -1.816  1.00 0.00 ? 848 MET A CG   5  
ATOM 4120 S SD   . MET A 1 57 ? 8.271   -6.989  -0.577  1.00 0.00 ? 848 MET A SD   5  
ATOM 4121 C CE   . MET A 1 57 ? 6.712   -7.686  0.021   1.00 0.00 ? 848 MET A CE   5  
ATOM 4122 H H    . MET A 1 57 ? 8.342   -4.683  -4.681  1.00 0.00 ? 848 MET A H    5  
ATOM 4123 H HA   . MET A 1 57 ? 6.990   -3.104  -2.604  1.00 0.00 ? 848 MET A HA   5  
ATOM 4124 H HB2  . MET A 1 57 ? 9.414   -4.750  -1.915  1.00 0.00 ? 848 MET A HB2  5  
ATOM 4125 H HB3  . MET A 1 57 ? 8.203   -4.054  -0.843  1.00 0.00 ? 848 MET A HB3  5  
ATOM 4126 H HG2  . MET A 1 57 ? 6.537   -5.664  -1.596  1.00 0.00 ? 848 MET A HG2  5  
ATOM 4127 H HG3  . MET A 1 57 ? 7.653   -6.307  -2.795  1.00 0.00 ? 848 MET A HG3  5  
ATOM 4128 H HE1  . MET A 1 57 ? 5.919   -6.963  -0.101  1.00 0.00 ? 848 MET A HE1  5  
ATOM 4129 H HE2  . MET A 1 57 ? 6.803   -7.936  1.066   1.00 0.00 ? 848 MET A HE2  5  
ATOM 4130 H HE3  . MET A 1 57 ? 6.483   -8.583  -0.538  1.00 0.00 ? 848 MET A HE3  5  
ATOM 4131 N N    . GLU A 1 58 ? 8.553   -1.346  -3.407  1.00 0.00 ? 849 GLU A N    5  
ATOM 4132 C CA   . GLU A 1 58 ? 9.479   -0.260  -3.708  1.00 0.00 ? 849 GLU A CA   5  
ATOM 4133 C C    . GLU A 1 58 ? 8.856   1.056   -3.305  1.00 0.00 ? 849 GLU A C    5  
ATOM 4134 O O    . GLU A 1 58 ? 7.699   1.297   -3.595  1.00 0.00 ? 849 GLU A O    5  
ATOM 4135 C CB   . GLU A 1 58 ? 9.804   -0.218  -5.209  1.00 0.00 ? 849 GLU A CB   5  
ATOM 4136 C CG   . GLU A 1 58 ? 10.999  -1.118  -5.529  1.00 0.00 ? 849 GLU A CG   5  
ATOM 4137 C CD   . GLU A 1 58 ? 12.242  -0.614  -4.824  1.00 0.00 ? 849 GLU A CD   5  
ATOM 4138 O OE1  . GLU A 1 58 ? 12.591  0.530   -5.023  1.00 0.00 ? 849 GLU A OE1  5  
ATOM 4139 O OE2  . GLU A 1 58 ? 12.832  -1.379  -4.098  1.00 0.00 ? 849 GLU A OE2  5  
ATOM 4140 H H    . GLU A 1 58 ? 7.593   -1.142  -3.331  1.00 0.00 ? 849 GLU A H    5  
ATOM 4141 H HA   . GLU A 1 58 ? 10.392  -0.410  -3.152  1.00 0.00 ? 849 GLU A HA   5  
ATOM 4142 N N    . ASP A 1 59 ? 9.638   1.919   -2.676  1.00 0.00 ? 850 ASP A N    5  
ATOM 4143 C CA   . ASP A 1 59 ? 9.140   3.228   -2.237  1.00 0.00 ? 850 ASP A CA   5  
ATOM 4144 C C    . ASP A 1 59 ? 8.317   3.901   -3.328  1.00 0.00 ? 850 ASP A C    5  
ATOM 4145 O O    . ASP A 1 59 ? 7.436   4.722   -3.043  1.00 0.00 ? 850 ASP A O    5  
ATOM 4146 C CB   . ASP A 1 59 ? 10.311  4.132   -1.842  1.00 0.00 ? 850 ASP A CB   5  
ATOM 4147 C CG   . ASP A 1 59 ? 10.918  4.786   -3.072  1.00 0.00 ? 850 ASP A CG   5  
ATOM 4148 O OD1  . ASP A 1 59 ? 11.289  4.073   -3.977  1.00 0.00 ? 850 ASP A OD1  5  
ATOM 4149 O OD2  . ASP A 1 59 ? 11.004  5.992   -3.092  1.00 0.00 ? 850 ASP A OD2  5  
ATOM 4150 H H    . ASP A 1 59 ? 10.570  1.675   -2.499  1.00 0.00 ? 850 ASP A H    5  
ATOM 4151 H HA   . ASP A 1 59 ? 8.508   3.084   -1.373  1.00 0.00 ? 850 ASP A HA   5  
ATOM 4152 N N    . GLN A 1 60 ? 8.603   3.558   -4.568  1.00 0.00 ? 851 GLN A N    5  
ATOM 4153 C CA   . GLN A 1 60 ? 7.879   4.118   -5.690  1.00 0.00 ? 851 GLN A CA   5  
ATOM 4154 C C    . GLN A 1 60 ? 6.385   3.866   -5.540  1.00 0.00 ? 851 GLN A C    5  
ATOM 4155 O O    . GLN A 1 60 ? 5.570   4.598   -6.092  1.00 0.00 ? 851 GLN A O    5  
ATOM 4156 C CB   . GLN A 1 60 ? 8.371   3.514   -7.010  1.00 0.00 ? 851 GLN A CB   5  
ATOM 4157 C CG   . GLN A 1 60 ? 8.452   1.986   -6.896  1.00 0.00 ? 851 GLN A CG   5  
ATOM 4158 C CD   . GLN A 1 60 ? 7.480   1.331   -7.868  1.00 0.00 ? 851 GLN A CD   5  
ATOM 4159 O OE1  . GLN A 1 60 ? 7.886   0.521   -8.700  1.00 0.00 ? 851 GLN A OE1  5  
ATOM 4160 N NE2  . GLN A 1 60 ? 6.217   1.630   -7.813  1.00 0.00 ? 851 GLN A NE2  5  
ATOM 4161 H H    . GLN A 1 60 ? 9.317   2.911   -4.730  1.00 0.00 ? 851 GLN A H    5  
ATOM 4162 H HA   . GLN A 1 60 ? 8.053   5.183   -5.715  1.00 0.00 ? 851 GLN A HA   5  
ATOM 4163 H HB2  . GLN A 1 60 ? 7.674   3.775   -7.789  1.00 0.00 ? 851 GLN A HB2  5  
ATOM 4164 H HB3  . GLN A 1 60 ? 9.346   3.910   -7.250  1.00 0.00 ? 851 GLN A HB3  5  
ATOM 4165 H HG2  . GLN A 1 60 ? 9.455   1.668   -7.137  1.00 0.00 ? 851 GLN A HG2  5  
ATOM 4166 H HG3  . GLN A 1 60 ? 8.208   1.679   -5.891  1.00 0.00 ? 851 GLN A HG3  5  
ATOM 4167 H HE21 . GLN A 1 60 ? 5.891   2.274   -7.150  1.00 0.00 ? 851 GLN A HE21 5  
ATOM 4168 H HE22 . GLN A 1 60 ? 5.588   1.209   -8.435  1.00 0.00 ? 851 GLN A HE22 5  
ATOM 4169 N N    . ASP A 1 61 ? 6.036   2.806   -4.815  1.00 0.00 ? 852 ASP A N    5  
ATOM 4170 C CA   . ASP A 1 61 ? 4.635   2.434   -4.632  1.00 0.00 ? 852 ASP A CA   5  
ATOM 4171 C C    . ASP A 1 61 ? 3.837   3.592   -4.046  1.00 0.00 ? 852 ASP A C    5  
ATOM 4172 O O    . ASP A 1 61 ? 2.937   4.146   -4.695  1.00 0.00 ? 852 ASP A O    5  
ATOM 4173 C CB   . ASP A 1 61 ? 4.523   1.185   -3.708  1.00 0.00 ? 852 ASP A CB   5  
ATOM 4174 C CG   . ASP A 1 61 ? 5.410   1.306   -2.448  1.00 0.00 ? 852 ASP A CG   5  
ATOM 4175 O OD1  . ASP A 1 61 ? 5.770   2.415   -2.079  1.00 0.00 ? 852 ASP A OD1  5  
ATOM 4176 O OD2  . ASP A 1 61 ? 5.720   0.276   -1.866  1.00 0.00 ? 852 ASP A OD2  5  
ATOM 4177 H H    . ASP A 1 61 ? 6.737   2.248   -4.411  1.00 0.00 ? 852 ASP A H    5  
ATOM 4178 H HA   . ASP A 1 61 ? 4.217   2.180   -5.595  1.00 0.00 ? 852 ASP A HA   5  
ATOM 4179 N N    . LEU A 1 62 ? 4.195   3.988   -2.860  1.00 0.00 ? 853 LEU A N    5  
ATOM 4180 C CA   . LEU A 1 62 ? 3.543   5.093   -2.211  1.00 0.00 ? 853 LEU A CA   5  
ATOM 4181 C C    . LEU A 1 62 ? 3.848   6.374   -2.951  1.00 0.00 ? 853 LEU A C    5  
ATOM 4182 O O    . LEU A 1 62 ? 3.046   7.314   -2.956  1.00 0.00 ? 853 LEU A O    5  
ATOM 4183 C CB   . LEU A 1 62 ? 3.989   5.180   -0.768  1.00 0.00 ? 853 LEU A CB   5  
ATOM 4184 C CG   . LEU A 1 62 ? 3.626   3.867   -0.060  1.00 0.00 ? 853 LEU A CG   5  
ATOM 4185 C CD1  . LEU A 1 62 ? 4.602   3.605   1.081   1.00 0.00 ? 853 LEU A CD1  5  
ATOM 4186 C CD2  . LEU A 1 62 ? 2.197   3.948   0.486   1.00 0.00 ? 853 LEU A CD2  5  
ATOM 4187 H H    . LEU A 1 62 ? 4.942   3.525   -2.413  1.00 0.00 ? 853 LEU A H    5  
ATOM 4188 H HA   . LEU A 1 62 ? 2.478   4.923   -2.232  1.00 0.00 ? 853 LEU A HA   5  
ATOM 4189 H HB2  . LEU A 1 62 ? 5.058   5.340   -0.735  1.00 0.00 ? 853 LEU A HB2  5  
ATOM 4190 H HB3  . LEU A 1 62 ? 3.481   6.001   -0.292  1.00 0.00 ? 853 LEU A HB3  5  
ATOM 4191 H HG   . LEU A 1 62 ? 3.694   3.049   -0.765  1.00 0.00 ? 853 LEU A HG   5  
ATOM 4192 H HD11 . LEU A 1 62 ? 5.288   2.825   0.783   1.00 0.00 ? 853 LEU A HD11 5  
ATOM 4193 H HD12 . LEU A 1 62 ? 4.063   3.292   1.962   1.00 0.00 ? 853 LEU A HD12 5  
ATOM 4194 H HD13 . LEU A 1 62 ? 5.158   4.502   1.299   1.00 0.00 ? 853 LEU A HD13 5  
ATOM 4195 H HD21 . LEU A 1 62 ? 1.594   4.564   -0.163  1.00 0.00 ? 853 LEU A HD21 5  
ATOM 4196 H HD22 . LEU A 1 62 ? 2.206   4.370   1.480   1.00 0.00 ? 853 LEU A HD22 5  
ATOM 4197 H HD23 . LEU A 1 62 ? 1.776   2.953   0.523   1.00 0.00 ? 853 LEU A HD23 5  
ATOM 4198 N N    . LEU A 1 63 ? 4.977   6.384   -3.637  1.00 0.00 ? 854 LEU A N    5  
ATOM 4199 C CA   . LEU A 1 63 ? 5.333   7.527   -4.455  1.00 0.00 ? 854 LEU A CA   5  
ATOM 4200 C C    . LEU A 1 63 ? 4.333   7.652   -5.593  1.00 0.00 ? 854 LEU A C    5  
ATOM 4201 O O    . LEU A 1 63 ? 3.901   8.751   -5.940  1.00 0.00 ? 854 LEU A O    5  
ATOM 4202 C CB   . LEU A 1 63 ? 6.750   7.367   -5.020  1.00 0.00 ? 854 LEU A CB   5  
ATOM 4203 C CG   . LEU A 1 63 ? 7.349   8.750   -5.317  1.00 0.00 ? 854 LEU A CG   5  
ATOM 4204 C CD1  . LEU A 1 63 ? 7.523   9.534   -4.010  1.00 0.00 ? 854 LEU A CD1  5  
ATOM 4205 C CD2  . LEU A 1 63 ? 8.711   8.579   -5.992  1.00 0.00 ? 854 LEU A CD2  5  
ATOM 4206 H H    . LEU A 1 63 ? 5.550   5.585   -3.628  1.00 0.00 ? 854 LEU A H    5  
ATOM 4207 H HA   . LEU A 1 63 ? 5.290   8.418   -3.848  1.00 0.00 ? 854 LEU A HA   5  
ATOM 4208 H HB2  . LEU A 1 63 ? 7.369   6.850   -4.302  1.00 0.00 ? 854 LEU A HB2  5  
ATOM 4209 H HB3  . LEU A 1 63 ? 6.707   6.796   -5.936  1.00 0.00 ? 854 LEU A HB3  5  
ATOM 4210 H HG   . LEU A 1 63 ? 6.684   9.294   -5.972  1.00 0.00 ? 854 LEU A HG   5  
ATOM 4211 H HD11 . LEU A 1 63 ? 7.555   8.852   -3.173  1.00 0.00 ? 854 LEU A HD11 5  
ATOM 4212 H HD12 . LEU A 1 63 ? 6.695   10.215  -3.885  1.00 0.00 ? 854 LEU A HD12 5  
ATOM 4213 H HD13 . LEU A 1 63 ? 8.443   10.098  -4.046  1.00 0.00 ? 854 LEU A HD13 5  
ATOM 4214 H HD21 . LEU A 1 63 ? 9.061   9.537   -6.346  1.00 0.00 ? 854 LEU A HD21 5  
ATOM 4215 H HD22 . LEU A 1 63 ? 8.622   7.899   -6.827  1.00 0.00 ? 854 LEU A HD22 5  
ATOM 4216 H HD23 . LEU A 1 63 ? 9.418   8.182   -5.279  1.00 0.00 ? 854 LEU A HD23 5  
ATOM 4217 N N    . GLU A 1 64 ? 3.938   6.503   -6.146  1.00 0.00 ? 855 GLU A N    5  
ATOM 4218 C CA   . GLU A 1 64 ? 2.958   6.472   -7.220  1.00 0.00 ? 855 GLU A CA   5  
ATOM 4219 C C    . GLU A 1 64 ? 1.670   7.142   -6.771  1.00 0.00 ? 855 GLU A C    5  
ATOM 4220 O O    . GLU A 1 64 ? 1.175   8.060   -7.432  1.00 0.00 ? 855 GLU A O    5  
ATOM 4221 C CB   . GLU A 1 64 ? 2.668   5.027   -7.641  1.00 0.00 ? 855 GLU A CB   5  
ATOM 4222 C CG   . GLU A 1 64 ? 3.825   4.472   -8.478  1.00 0.00 ? 855 GLU A CG   5  
ATOM 4223 C CD   . GLU A 1 64 ? 3.572   4.735   -9.946  1.00 0.00 ? 855 GLU A CD   5  
ATOM 4224 O OE1  . GLU A 1 64 ? 2.640   4.168   -10.478 1.00 0.00 ? 855 GLU A OE1  5  
ATOM 4225 O OE2  . GLU A 1 64 ? 4.311   5.499   -10.521 1.00 0.00 ? 855 GLU A OE2  5  
ATOM 4226 H H    . GLU A 1 64 ? 4.304   5.656   -5.805  1.00 0.00 ? 855 GLU A H    5  
ATOM 4227 H HA   . GLU A 1 64 ? 3.352   7.010   -8.069  1.00 0.00 ? 855 GLU A HA   5  
ATOM 4228 N N    . ILE A 1 65 ? 1.125   6.691   -5.640  1.00 0.00 ? 856 ILE A N    5  
ATOM 4229 C CA   . ILE A 1 65 ? -0.112  7.290   -5.122  1.00 0.00 ? 856 ILE A CA   5  
ATOM 4230 C C    . ILE A 1 65 ? 0.139   8.713   -4.617  1.00 0.00 ? 856 ILE A C    5  
ATOM 4231 O O    . ILE A 1 65 ? -0.801  9.457   -4.340  1.00 0.00 ? 856 ILE A O    5  
ATOM 4232 C CB   . ILE A 1 65 ? -0.757  6.428   -4.015  1.00 0.00 ? 856 ILE A CB   5  
ATOM 4233 C CG1  . ILE A 1 65 ? 0.315   5.629   -3.246  1.00 0.00 ? 856 ILE A CG1  5  
ATOM 4234 C CG2  . ILE A 1 65 ? -1.764  5.467   -4.646  1.00 0.00 ? 856 ILE A CG2  5  
ATOM 4235 C CD1  . ILE A 1 65 ? 0.335   4.170   -3.724  1.00 0.00 ? 856 ILE A CD1  5  
ATOM 4236 H H    . ILE A 1 65 ? 1.563   5.957   -5.153  1.00 0.00 ? 856 ILE A H    5  
ATOM 4237 H HA   . ILE A 1 65 ? -0.808  7.360   -5.947  1.00 0.00 ? 856 ILE A HA   5  
ATOM 4238 H HB   . ILE A 1 65 ? -1.284  7.082   -3.332  1.00 0.00 ? 856 ILE A HB   5  
ATOM 4239 H HG12 . ILE A 1 65 ? 1.283   6.074   -3.400  1.00 0.00 ? 856 ILE A HG12 5  
ATOM 4240 H HG21 . ILE A 1 65 ? -2.597  6.031   -5.037  1.00 0.00 ? 856 ILE A HG21 5  
ATOM 4241 H HG22 . ILE A 1 65 ? -2.116  4.771   -3.899  1.00 0.00 ? 856 ILE A HG22 5  
ATOM 4242 H HG23 . ILE A 1 65 ? -1.288  4.924   -5.448  1.00 0.00 ? 856 ILE A HG23 5  
ATOM 4243 H HD11 . ILE A 1 65 ? 0.446   4.146   -4.797  1.00 0.00 ? 856 ILE A HD11 5  
ATOM 4244 H HD12 . ILE A 1 65 ? -0.590  3.688   -3.448  1.00 0.00 ? 856 ILE A HD12 5  
ATOM 4245 H HD13 . ILE A 1 65 ? 1.160   3.647   -3.265  1.00 0.00 ? 856 ILE A HD13 5  
ATOM 4246 N N    . GLY A 1 66 ? 1.405   9.093   -4.543  1.00 0.00 ? 857 GLY A N    5  
ATOM 4247 C CA   . GLY A 1 66 ? 1.775   10.444  -4.129  1.00 0.00 ? 857 GLY A CA   5  
ATOM 4248 C C    . GLY A 1 66 ? 1.690   10.627  -2.620  1.00 0.00 ? 857 GLY A C    5  
ATOM 4249 O O    . GLY A 1 66 ? 1.294   11.692  -2.139  1.00 0.00 ? 857 GLY A O    5  
ATOM 4250 H H    . GLY A 1 66 ? 2.109   8.464   -4.807  1.00 0.00 ? 857 GLY A H    5  
ATOM 4251 H HA2  . GLY A 1 66 ? 2.786   10.646  -4.450  1.00 0.00 ? 857 GLY A HA2  5  
ATOM 4252 H HA3  . GLY A 1 66 ? 1.110   11.150  -4.603  1.00 0.00 ? 857 GLY A HA3  5  
ATOM 4253 N N    . ILE A 1 67 ? 2.096   9.613   -1.871  1.00 0.00 ? 858 ILE A N    5  
ATOM 4254 C CA   . ILE A 1 67 ? 2.096   9.711   -0.415  1.00 0.00 ? 858 ILE A CA   5  
ATOM 4255 C C    . ILE A 1 67 ? 3.347   10.453  0.050   1.00 0.00 ? 858 ILE A C    5  
ATOM 4256 O O    . ILE A 1 67 ? 4.469   10.039  -0.249  1.00 0.00 ? 858 ILE A O    5  
ATOM 4257 C CB   . ILE A 1 67 ? 2.050   8.313   0.218   1.00 0.00 ? 858 ILE A CB   5  
ATOM 4258 C CG1  . ILE A 1 67 ? 0.986   7.454   -0.485  1.00 0.00 ? 858 ILE A CG1  5  
ATOM 4259 C CG2  . ILE A 1 67 ? 1.708   8.426   1.708   1.00 0.00 ? 858 ILE A CG2  5  
ATOM 4260 C CD1  . ILE A 1 67 ? -0.406  8.060   -0.271  1.00 0.00 ? 858 ILE A CD1  5  
ATOM 4261 H H    . ILE A 1 67 ? 2.435   8.797   -2.303  1.00 0.00 ? 858 ILE A H    5  
ATOM 4262 H HA   . ILE A 1 67 ? 1.223   10.267  -0.104  1.00 0.00 ? 858 ILE A HA   5  
ATOM 4263 H HB   . ILE A 1 67 ? 3.020   7.854   0.109   1.00 0.00 ? 858 ILE A HB   5  
ATOM 4264 H HG12 . ILE A 1 67 ? 1.198   7.411   -1.543  1.00 0.00 ? 858 ILE A HG12 5  
ATOM 4265 H HG21 . ILE A 1 67 ? 1.384   7.465   2.078   1.00 0.00 ? 858 ILE A HG21 5  
ATOM 4266 H HG22 . ILE A 1 67 ? 0.914   9.146   1.844   1.00 0.00 ? 858 ILE A HG22 5  
ATOM 4267 H HG23 . ILE A 1 67 ? 2.583   8.745   2.256   1.00 0.00 ? 858 ILE A HG23 5  
ATOM 4268 H HD11 . ILE A 1 67 ? -0.482  8.457   0.730   1.00 0.00 ? 858 ILE A HD11 5  
ATOM 4269 H HD12 . ILE A 1 67 ? -1.156  7.294   -0.408  1.00 0.00 ? 858 ILE A HD12 5  
ATOM 4270 H HD13 . ILE A 1 67 ? -0.568  8.854   -0.986  1.00 0.00 ? 858 ILE A HD13 5  
ATOM 4271 N N    . LEU A 1 68 ? 3.150   11.565  0.748   1.00 0.00 ? 859 LEU A N    5  
ATOM 4272 C CA   . LEU A 1 68 ? 4.268   12.385  1.216   1.00 0.00 ? 859 LEU A CA   5  
ATOM 4273 C C    . LEU A 1 68 ? 4.643   12.048  2.656   1.00 0.00 ? 859 LEU A C    5  
ATOM 4274 O O    . LEU A 1 68 ? 5.684   12.485  3.153   1.00 0.00 ? 859 LEU A O    5  
ATOM 4275 C CB   . LEU A 1 68 ? 3.913   13.871  1.105   1.00 0.00 ? 859 LEU A CB   5  
ATOM 4276 C CG   . LEU A 1 68 ? 3.415   14.177  -0.316  1.00 0.00 ? 859 LEU A CG   5  
ATOM 4277 C CD1  . LEU A 1 68 ? 2.920   15.619  -0.386  1.00 0.00 ? 859 LEU A CD1  5  
ATOM 4278 C CD2  . LEU A 1 68 ? 4.561   13.985  -1.318  1.00 0.00 ? 859 LEU A CD2  5  
ATOM 4279 H H    . LEU A 1 68 ? 2.234   11.857  0.936   1.00 0.00 ? 859 LEU A H    5  
ATOM 4280 H HA   . LEU A 1 68 ? 5.125   12.194  0.588   1.00 0.00 ? 859 LEU A HA   5  
ATOM 4281 H HB2  . LEU A 1 68 ? 3.140   14.106  1.822   1.00 0.00 ? 859 LEU A HB2  5  
ATOM 4282 H HB3  . LEU A 1 68 ? 4.789   14.466  1.315   1.00 0.00 ? 859 LEU A HB3  5  
ATOM 4283 H HG   . LEU A 1 68 ? 2.600   13.511  -0.563  1.00 0.00 ? 859 LEU A HG   5  
ATOM 4284 H HD11 . LEU A 1 68 ? 2.444   15.789  -1.340  1.00 0.00 ? 859 LEU A HD11 5  
ATOM 4285 H HD12 . LEU A 1 68 ? 3.758   16.291  -0.278  1.00 0.00 ? 859 LEU A HD12 5  
ATOM 4286 H HD13 . LEU A 1 68 ? 2.210   15.794  0.408   1.00 0.00 ? 859 LEU A HD13 5  
ATOM 4287 H HD21 . LEU A 1 68 ? 4.694   12.932  -1.515  1.00 0.00 ? 859 LEU A HD21 5  
ATOM 4288 H HD22 . LEU A 1 68 ? 5.473   14.395  -0.911  1.00 0.00 ? 859 LEU A HD22 5  
ATOM 4289 H HD23 . LEU A 1 68 ? 4.319   14.494  -2.239  1.00 0.00 ? 859 LEU A HD23 5  
ATOM 4290 N N    . ASN A 1 69 ? 3.797   11.285  3.322   1.00 0.00 ? 860 ASN A N    5  
ATOM 4291 C CA   . ASN A 1 69 ? 4.055   10.887  4.708   1.00 0.00 ? 860 ASN A CA   5  
ATOM 4292 C C    . ASN A 1 69 ? 5.323   10.043  4.777   1.00 0.00 ? 860 ASN A C    5  
ATOM 4293 O O    . ASN A 1 69 ? 5.786   9.547   3.760   1.00 0.00 ? 860 ASN A O    5  
ATOM 4294 C CB   . ASN A 1 69 ? 2.861   10.085  5.251   1.00 0.00 ? 860 ASN A CB   5  
ATOM 4295 C CG   . ASN A 1 69 ? 3.231   9.403   6.562   1.00 0.00 ? 860 ASN A CG   5  
ATOM 4296 O OD1  . ASN A 1 69 ? 3.466   8.192   6.588   1.00 0.00 ? 860 ASN A OD1  5  
ATOM 4297 N ND2  . ASN A 1 69 ? 3.295   10.101  7.652   1.00 0.00 ? 860 ASN A ND2  5  
ATOM 4298 H H    . ASN A 1 69 ? 2.978   10.980  2.876   1.00 0.00 ? 860 ASN A H    5  
ATOM 4299 H HA   . ASN A 1 69 ? 4.187   11.773  5.311   1.00 0.00 ? 860 ASN A HA   5  
ATOM 4300 H HB2  . ASN A 1 69 ? 2.027   10.751  5.415   1.00 0.00 ? 860 ASN A HB2  5  
ATOM 4301 H HB3  . ASN A 1 69 ? 2.578   9.334   4.528   1.00 0.00 ? 860 ASN A HB3  5  
ATOM 4302 H HD21 . ASN A 1 69 ? 3.104   11.064  7.632   1.00 0.00 ? 860 ASN A HD21 5  
ATOM 4303 H HD22 . ASN A 1 69 ? 3.535   9.669   8.499   1.00 0.00 ? 860 ASN A HD22 5  
ATOM 4304 N N    . SER A 1 70 ? 5.895   9.900   5.968   1.00 0.00 ? 861 SER A N    5  
ATOM 4305 C CA   . SER A 1 70 ? 7.102   9.086   6.131   1.00 0.00 ? 861 SER A CA   5  
ATOM 4306 C C    . SER A 1 70 ? 6.754   7.648   6.546   1.00 0.00 ? 861 SER A C    5  
ATOM 4307 O O    . SER A 1 70 ? 7.223   6.676   5.942   1.00 0.00 ? 861 SER A O    5  
ATOM 4308 C CB   . SER A 1 70 ? 8.037   9.713   7.164   1.00 0.00 ? 861 SER A CB   5  
ATOM 4309 O OG   . SER A 1 70 ? 7.976   11.137  7.062   1.00 0.00 ? 861 SER A OG   5  
ATOM 4310 H H    . SER A 1 70 ? 5.499   10.332  6.753   1.00 0.00 ? 861 SER A H    5  
ATOM 4311 H HA   . SER A 1 70 ? 7.618   9.047   5.183   1.00 0.00 ? 861 SER A HA   5  
ATOM 4312 H HB2  . SER A 1 70 ? 7.740   9.412   8.155   1.00 0.00 ? 861 SER A HB2  5  
ATOM 4313 H HB3  . SER A 1 70 ? 9.045   9.365   6.980   1.00 0.00 ? 861 SER A HB3  5  
ATOM 4314 H HG   . SER A 1 70 ? 8.704   11.417  6.489   1.00 0.00 ? 861 SER A HG   5  
ATOM 4315 N N    . GLY A 1 71 ? 5.968   7.530   7.610   1.00 0.00 ? 862 GLY A N    5  
ATOM 4316 C CA   . GLY A 1 71 ? 5.600   6.232   8.176   1.00 0.00 ? 862 GLY A CA   5  
ATOM 4317 C C    . GLY A 1 71 ? 4.990   5.290   7.147   1.00 0.00 ? 862 GLY A C    5  
ATOM 4318 O O    . GLY A 1 71 ? 5.297   4.094   7.139   1.00 0.00 ? 862 GLY A O    5  
ATOM 4319 H H    . GLY A 1 71 ? 5.660   8.345   8.061   1.00 0.00 ? 862 GLY A H    5  
ATOM 4320 H HA2  . GLY A 1 71 ? 6.484   5.771   8.590   1.00 0.00 ? 862 GLY A HA2  5  
ATOM 4321 H HA3  . GLY A 1 71 ? 4.886   6.387   8.971   1.00 0.00 ? 862 GLY A HA3  5  
ATOM 4322 N N    . HIS A 1 72 ? 4.092   5.811   6.316   1.00 0.00 ? 863 HIS A N    5  
ATOM 4323 C CA   . HIS A 1 72 ? 3.405   4.982   5.323   1.00 0.00 ? 863 HIS A CA   5  
ATOM 4324 C C    . HIS A 1 72 ? 4.353   3.960   4.704   1.00 0.00 ? 863 HIS A C    5  
ATOM 4325 O O    . HIS A 1 72 ? 4.024   2.786   4.604   1.00 0.00 ? 863 HIS A O    5  
ATOM 4326 C CB   . HIS A 1 72 ? 2.766   5.851   4.227   1.00 0.00 ? 863 HIS A CB   5  
ATOM 4327 C CG   . HIS A 1 72 ? 3.839   6.456   3.371   1.00 0.00 ? 863 HIS A CG   5  
ATOM 4328 N ND1  . HIS A 1 72 ? 3.810   6.396   1.988   1.00 0.00 ? 863 HIS A ND1  5  
ATOM 4329 C CD2  . HIS A 1 72 ? 4.978   7.132   3.690   1.00 0.00 ? 863 HIS A CD2  5  
ATOM 4330 C CE1  . HIS A 1 72 ? 4.913   7.027   1.535   1.00 0.00 ? 863 HIS A CE1  5  
ATOM 4331 N NE2  . HIS A 1 72 ? 5.657   7.491   2.533   1.00 0.00 ? 863 HIS A NE2  5  
ATOM 4332 H H    . HIS A 1 72 ? 3.862   6.763   6.395   1.00 0.00 ? 863 HIS A H    5  
ATOM 4333 H HA   . HIS A 1 72 ? 2.617   4.445   5.830   1.00 0.00 ? 863 HIS A HA   5  
ATOM 4334 H HB2  . HIS A 1 72 ? 2.118   5.238   3.617   1.00 0.00 ? 863 HIS A HB2  5  
ATOM 4335 H HB3  . HIS A 1 72 ? 2.184   6.637   4.685   1.00 0.00 ? 863 HIS A HB3  5  
ATOM 4336 N N    . ARG A 1 73 ? 5.533   4.413   4.307   1.00 0.00 ? 864 ARG A N    5  
ATOM 4337 C CA   . ARG A 1 73 ? 6.528   3.528   3.712   1.00 0.00 ? 864 ARG A CA   5  
ATOM 4338 C C    . ARG A 1 73 ? 6.810   2.356   4.636   1.00 0.00 ? 864 ARG A C    5  
ATOM 4339 O O    . ARG A 1 73 ? 6.669   1.194   4.248   1.00 0.00 ? 864 ARG A O    5  
ATOM 4340 C CB   . ARG A 1 73 ? 7.825   4.301   3.444   1.00 0.00 ? 864 ARG A CB   5  
ATOM 4341 C CG   . ARG A 1 73 ? 7.771   4.964   2.059   1.00 0.00 ? 864 ARG A CG   5  
ATOM 4342 C CD   . ARG A 1 73 ? 7.940   3.919   0.930   1.00 0.00 ? 864 ARG A CD   5  
ATOM 4343 N NE   . ARG A 1 73 ? 8.261   2.585   1.465   1.00 0.00 ? 864 ARG A NE   5  
ATOM 4344 C CZ   . ARG A 1 73 ? 7.812   1.456   0.886   1.00 0.00 ? 864 ARG A CZ   5  
ATOM 4345 N NH1  . ARG A 1 73 ? 7.058   1.517   -0.181  1.00 0.00 ? 864 ARG A NH1  5  
ATOM 4346 N NH2  . ARG A 1 73 ? 8.137   0.298   1.386   1.00 0.00 ? 864 ARG A NH2  5  
ATOM 4347 H H    . ARG A 1 73 ? 5.745   5.361   4.426   1.00 0.00 ? 864 ARG A H    5  
ATOM 4348 H HA   . ARG A 1 73 ? 6.151   3.145   2.779   1.00 0.00 ? 864 ARG A HA   5  
ATOM 4349 N N    . GLN A 1 74 ? 7.191   2.669   5.860   1.00 0.00 ? 865 GLN A N    5  
ATOM 4350 C CA   . GLN A 1 74 ? 7.485   1.647   6.851   1.00 0.00 ? 865 GLN A CA   5  
ATOM 4351 C C    . GLN A 1 74 ? 6.251   0.809   7.123   1.00 0.00 ? 865 GLN A C    5  
ATOM 4352 O O    . GLN A 1 74 ? 6.300   -0.418  7.104   1.00 0.00 ? 865 GLN A O    5  
ATOM 4353 C CB   . GLN A 1 74 ? 7.963   2.293   8.159   1.00 0.00 ? 865 GLN A CB   5  
ATOM 4354 C CG   . GLN A 1 74 ? 9.112   3.266   7.873   1.00 0.00 ? 865 GLN A CG   5  
ATOM 4355 C CD   . GLN A 1 74 ? 10.343  2.496   7.425   1.00 0.00 ? 865 GLN A CD   5  
ATOM 4356 O OE1  . GLN A 1 74 ? 10.491  2.198   6.242   1.00 0.00 ? 865 GLN A OE1  5  
ATOM 4357 N NE2  . GLN A 1 74 ? 11.230  2.140   8.302   1.00 0.00 ? 865 GLN A NE2  5  
ATOM 4358 H H    . GLN A 1 74 ? 7.261   3.615   6.107   1.00 0.00 ? 865 GLN A H    5  
ATOM 4359 H HA   . GLN A 1 74 ? 8.267   1.007   6.474   1.00 0.00 ? 865 GLN A HA   5  
ATOM 4360 H HB2  . GLN A 1 74 ? 7.144   2.826   8.618   1.00 0.00 ? 865 GLN A HB2  5  
ATOM 4361 H HB3  . GLN A 1 74 ? 8.310   1.522   8.831   1.00 0.00 ? 865 GLN A HB3  5  
ATOM 4362 H HG2  . GLN A 1 74 ? 8.818   3.957   7.096   1.00 0.00 ? 865 GLN A HG2  5  
ATOM 4363 H HG3  . GLN A 1 74 ? 9.345   3.820   8.770   1.00 0.00 ? 865 GLN A HG3  5  
ATOM 4364 H HE21 . GLN A 1 74 ? 11.105  2.364   9.246   1.00 0.00 ? 865 GLN A HE21 5  
ATOM 4365 H HE22 . GLN A 1 74 ? 12.029  1.647   8.018   1.00 0.00 ? 865 GLN A HE22 5  
ATOM 4366 N N    . ARG A 1 75 ? 5.149   1.477   7.386   1.00 0.00 ? 866 ARG A N    5  
ATOM 4367 C CA   . ARG A 1 75 ? 3.905   0.796   7.681   1.00 0.00 ? 866 ARG A CA   5  
ATOM 4368 C C    . ARG A 1 75 ? 3.476   -0.086  6.517   1.00 0.00 ? 866 ARG A C    5  
ATOM 4369 O O    . ARG A 1 75 ? 3.197   -1.270  6.697   1.00 0.00 ? 866 ARG A O    5  
ATOM 4370 C CB   . ARG A 1 75 ? 2.815   1.815   8.008   1.00 0.00 ? 866 ARG A CB   5  
ATOM 4371 C CG   . ARG A 1 75 ? 3.157   2.530   9.324   1.00 0.00 ? 866 ARG A CG   5  
ATOM 4372 C CD   . ARG A 1 75 ? 2.870   1.597   10.511  1.00 0.00 ? 866 ARG A CD   5  
ATOM 4373 N NE   . ARG A 1 75 ? 4.051   0.782   10.835  1.00 0.00 ? 866 ARG A NE   5  
ATOM 4374 C CZ   . ARG A 1 75 ? 4.870   1.089   11.846  1.00 0.00 ? 866 ARG A CZ   5  
ATOM 4375 N NH1  . ARG A 1 75 ? 4.695   2.189   12.521  1.00 0.00 ? 866 ARG A NH1  5  
ATOM 4376 N NH2  . ARG A 1 75 ? 5.856   0.291   12.145  1.00 0.00 ? 866 ARG A NH2  5  
ATOM 4377 H H    . ARG A 1 75 ? 5.176   2.461   7.388   1.00 0.00 ? 866 ARG A H    5  
ATOM 4378 H HA   . ARG A 1 75 ? 4.055   0.167   8.543   1.00 0.00 ? 866 ARG A HA   5  
ATOM 4379 N N    . ILE A 1 76 ? 3.424   0.488   5.329   1.00 0.00 ? 867 ILE A N    5  
ATOM 4380 C CA   . ILE A 1 76 ? 3.020   -0.258  4.151   1.00 0.00 ? 867 ILE A CA   5  
ATOM 4381 C C    . ILE A 1 76 ? 3.954   -1.436  3.910   1.00 0.00 ? 867 ILE A C    5  
ATOM 4382 O O    . ILE A 1 76 ? 3.494   -2.556  3.691   1.00 0.00 ? 867 ILE A O    5  
ATOM 4383 C CB   . ILE A 1 76 ? 2.967   0.661   2.922   1.00 0.00 ? 867 ILE A CB   5  
ATOM 4384 C CG1  . ILE A 1 76 ? 1.849   1.700   3.121   1.00 0.00 ? 867 ILE A CG1  5  
ATOM 4385 C CG2  . ILE A 1 76 ? 2.678   -0.165  1.660   1.00 0.00 ? 867 ILE A CG2  5  
ATOM 4386 C CD1  . ILE A 1 76 ? 0.488   1.088   2.759   1.00 0.00 ? 867 ILE A CD1  5  
ATOM 4387 H H    . ILE A 1 76 ? 3.660   1.436   5.239   1.00 0.00 ? 867 ILE A H    5  
ATOM 4388 H HA   . ILE A 1 76 ? 2.030   -0.649  4.327   1.00 0.00 ? 867 ILE A HA   5  
ATOM 4389 H HB   . ILE A 1 76 ? 3.916   1.164   2.809   1.00 0.00 ? 867 ILE A HB   5  
ATOM 4390 H HG12 . ILE A 1 76 ? 1.837   2.018   4.153   1.00 0.00 ? 867 ILE A HG12 5  
ATOM 4391 H HG21 . ILE A 1 76 ? 2.370   0.495   0.861   1.00 0.00 ? 867 ILE A HG21 5  
ATOM 4392 H HG22 . ILE A 1 76 ? 1.887   -0.873  1.864   1.00 0.00 ? 867 ILE A HG22 5  
ATOM 4393 H HG23 . ILE A 1 76 ? 3.570   -0.697  1.362   1.00 0.00 ? 867 ILE A HG23 5  
ATOM 4394 H HD11 . ILE A 1 76 ? -0.304  1.684   3.190   1.00 0.00 ? 867 ILE A HD11 5  
ATOM 4395 H HD12 . ILE A 1 76 ? 0.427   0.082   3.148   1.00 0.00 ? 867 ILE A HD12 5  
ATOM 4396 H HD13 . ILE A 1 76 ? 0.377   1.064   1.686   1.00 0.00 ? 867 ILE A HD13 5  
ATOM 4397 N N    . LEU A 1 77 ? 5.268   -1.197  3.979   1.00 0.00 ? 868 LEU A N    5  
ATOM 4398 C CA   . LEU A 1 77 ? 6.221   -2.286  3.788   1.00 0.00 ? 868 LEU A CA   5  
ATOM 4399 C C    . LEU A 1 77 ? 5.900   -3.414  4.753   1.00 0.00 ? 868 LEU A C    5  
ATOM 4400 O O    . LEU A 1 77 ? 5.808   -4.582  4.366   1.00 0.00 ? 868 LEU A O    5  
ATOM 4401 C CB   . LEU A 1 77 ? 7.683   -1.789  3.948   1.00 0.00 ? 868 LEU A CB   5  
ATOM 4402 C CG   . LEU A 1 77 ? 8.238   -2.085  5.353   1.00 0.00 ? 868 LEU A CG   5  
ATOM 4403 C CD1  . LEU A 1 77 ? 8.673   -3.554  5.449   1.00 0.00 ? 868 LEU A CD1  5  
ATOM 4404 C CD2  . LEU A 1 77 ? 9.450   -1.188  5.618   1.00 0.00 ? 868 LEU A CD2  5  
ATOM 4405 H H    . LEU A 1 77 ? 5.590   -0.290  4.181   1.00 0.00 ? 868 LEU A H    5  
ATOM 4406 H HA   . LEU A 1 77 ? 6.094   -2.663  2.783   1.00 0.00 ? 868 LEU A HA   5  
ATOM 4407 H HB2  . LEU A 1 77 ? 8.296   -2.294  3.223   1.00 0.00 ? 868 LEU A HB2  5  
ATOM 4408 H HB3  . LEU A 1 77 ? 7.720   -0.727  3.764   1.00 0.00 ? 868 LEU A HB3  5  
ATOM 4409 H HG   . LEU A 1 77 ? 7.482   -1.889  6.092   1.00 0.00 ? 868 LEU A HG   5  
ATOM 4410 H HD11 . LEU A 1 77 ? 8.169   -4.024  6.281   1.00 0.00 ? 868 LEU A HD11 5  
ATOM 4411 H HD12 . LEU A 1 77 ? 9.740   -3.607  5.603   1.00 0.00 ? 868 LEU A HD12 5  
ATOM 4412 H HD13 . LEU A 1 77 ? 8.419   -4.073  4.537   1.00 0.00 ? 868 LEU A HD13 5  
ATOM 4413 H HD21 . LEU A 1 77 ? 10.346  -1.676  5.263   1.00 0.00 ? 868 LEU A HD21 5  
ATOM 4414 H HD22 . LEU A 1 77 ? 9.536   -1.008  6.678   1.00 0.00 ? 868 LEU A HD22 5  
ATOM 4415 H HD23 . LEU A 1 77 ? 9.327   -0.245  5.104   1.00 0.00 ? 868 LEU A HD23 5  
ATOM 4416 N N    . GLN A 1 78 ? 5.650   -3.045  5.991   1.00 0.00 ? 869 GLN A N    5  
ATOM 4417 C CA   . GLN A 1 78 ? 5.253   -4.008  6.999   1.00 0.00 ? 869 GLN A CA   5  
ATOM 4418 C C    . GLN A 1 78 ? 3.906   -4.603  6.622   1.00 0.00 ? 869 GLN A C    5  
ATOM 4419 O O    . GLN A 1 78 ? 3.670   -5.807  6.787   1.00 0.00 ? 869 GLN A O    5  
ATOM 4420 C CB   . GLN A 1 78 ? 5.141   -3.335  8.371   1.00 0.00 ? 869 GLN A CB   5  
ATOM 4421 C CG   . GLN A 1 78 ? 6.516   -2.830  8.819   1.00 0.00 ? 869 GLN A CG   5  
ATOM 4422 C CD   . GLN A 1 78 ? 6.369   -1.535  9.610   1.00 0.00 ? 869 GLN A CD   5  
ATOM 4423 O OE1  . GLN A 1 78 ? 5.276   -1.220  10.104  1.00 0.00 ? 869 GLN A OE1  5  
ATOM 4424 N NE2  . GLN A 1 78 ? 7.400   -0.760  9.767   1.00 0.00 ? 869 GLN A NE2  5  
ATOM 4425 H H    . GLN A 1 78 ? 5.691   -2.091  6.213   1.00 0.00 ? 869 GLN A H    5  
ATOM 4426 H HA   . GLN A 1 78 ? 5.991   -4.793  7.049   1.00 0.00 ? 869 GLN A HA   5  
ATOM 4427 H HB2  . GLN A 1 78 ? 4.452   -2.506  8.306   1.00 0.00 ? 869 GLN A HB2  5  
ATOM 4428 H HB3  . GLN A 1 78 ? 4.772   -4.049  9.092   1.00 0.00 ? 869 GLN A HB3  5  
ATOM 4429 H HG2  . GLN A 1 78 ? 6.983   -3.577  9.443   1.00 0.00 ? 869 GLN A HG2  5  
ATOM 4430 H HG3  . GLN A 1 78 ? 7.138   -2.651  7.955   1.00 0.00 ? 869 GLN A HG3  5  
ATOM 4431 H HE21 . GLN A 1 78 ? 8.264   -1.015  9.378   1.00 0.00 ? 869 GLN A HE21 5  
ATOM 4432 H HE22 . GLN A 1 78 ? 7.321   0.076   10.273  1.00 0.00 ? 869 GLN A HE22 5  
ATOM 4433 N N    . ALA A 1 79 ? 3.028   -3.749  6.115   1.00 0.00 ? 870 ALA A N    5  
ATOM 4434 C CA   . ALA A 1 79 ? 1.698   -4.166  5.720   1.00 0.00 ? 870 ALA A CA   5  
ATOM 4435 C C    . ALA A 1 79 ? 1.770   -5.248  4.664   1.00 0.00 ? 870 ALA A C    5  
ATOM 4436 O O    . ALA A 1 79 ? 1.118   -6.287  4.789   1.00 0.00 ? 870 ALA A O    5  
ATOM 4437 C CB   . ALA A 1 79 ? 0.911   -2.973  5.177   1.00 0.00 ? 870 ALA A CB   5  
ATOM 4438 H H    . ALA A 1 79 ? 3.285   -2.807  6.016   1.00 0.00 ? 870 ALA A H    5  
ATOM 4439 H HA   . ALA A 1 79 ? 1.181   -4.553  6.585   1.00 0.00 ? 870 ALA A HA   5  
ATOM 4440 H HB1  . ALA A 1 79 ? 1.123   -2.098  5.771   1.00 0.00 ? 870 ALA A HB1  5  
ATOM 4441 H HB2  . ALA A 1 79 ? -0.145  -3.190  5.219   1.00 0.00 ? 870 ALA A HB2  5  
ATOM 4442 H HB3  . ALA A 1 79 ? 1.198   -2.788  4.153   1.00 0.00 ? 870 ALA A HB3  5  
ATOM 4443 N N    . ILE A 1 80 ? 2.568   -5.019  3.624   1.00 0.00 ? 871 ILE A N    5  
ATOM 4444 C CA   . ILE A 1 80 ? 2.709   -6.011  2.584   1.00 0.00 ? 871 ILE A CA   5  
ATOM 4445 C C    . ILE A 1 80 ? 3.431   -7.228  3.126   1.00 0.00 ? 871 ILE A C    5  
ATOM 4446 O O    . ILE A 1 80 ? 2.998   -8.353  2.922   1.00 0.00 ? 871 ILE A O    5  
ATOM 4447 C CB   . ILE A 1 80 ? 3.428   -5.450  1.343   1.00 0.00 ? 871 ILE A CB   5  
ATOM 4448 C CG1  . ILE A 1 80 ? 4.721   -4.742  1.735   1.00 0.00 ? 871 ILE A CG1  5  
ATOM 4449 C CG2  . ILE A 1 80 ? 2.521   -4.451  0.623   1.00 0.00 ? 871 ILE A CG2  5  
ATOM 4450 C CD1  . ILE A 1 80 ? 5.433   -4.261  0.467   1.00 0.00 ? 871 ILE A CD1  5  
ATOM 4451 H H    . ILE A 1 80 ? 3.075   -4.180  3.569   1.00 0.00 ? 871 ILE A H    5  
ATOM 4452 H HA   . ILE A 1 80 ? 1.716   -6.320  2.288   1.00 0.00 ? 871 ILE A HA   5  
ATOM 4453 H HB   . ILE A 1 80 ? 3.653   -6.270  0.679   1.00 0.00 ? 871 ILE A HB   5  
ATOM 4454 H HG12 . ILE A 1 80 ? 4.484   -3.893  2.354   1.00 0.00 ? 871 ILE A HG12 5  
ATOM 4455 H HG21 . ILE A 1 80 ? 2.410   -3.566  1.233   1.00 0.00 ? 871 ILE A HG21 5  
ATOM 4456 H HG22 . ILE A 1 80 ? 1.553   -4.895  0.447   1.00 0.00 ? 871 ILE A HG22 5  
ATOM 4457 H HG23 . ILE A 1 80 ? 2.968   -4.176  -0.321  1.00 0.00 ? 871 ILE A HG23 5  
ATOM 4458 H HD11 . ILE A 1 80 ? 6.499   -4.383  0.584   1.00 0.00 ? 871 ILE A HD11 5  
ATOM 4459 H HD12 . ILE A 1 80 ? 5.205   -3.219  0.300   1.00 0.00 ? 871 ILE A HD12 5  
ATOM 4460 H HD13 . ILE A 1 80 ? 5.094   -4.840  -0.383  1.00 0.00 ? 871 ILE A HD13 5  
ATOM 4461 N N    . GLN A 1 81 ? 4.510   -6.990  3.866   1.00 0.00 ? 872 GLN A N    5  
ATOM 4462 C CA   . GLN A 1 81 ? 5.268   -8.081  4.471   1.00 0.00 ? 872 GLN A CA   5  
ATOM 4463 C C    . GLN A 1 81 ? 4.349   -8.971  5.299   1.00 0.00 ? 872 GLN A C    5  
ATOM 4464 O O    . GLN A 1 81 ? 4.605   -10.163 5.459   1.00 0.00 ? 872 GLN A O    5  
ATOM 4465 C CB   . GLN A 1 81 ? 6.385   -7.525  5.362   1.00 0.00 ? 872 GLN A CB   5  
ATOM 4466 C CG   . GLN A 1 81 ? 7.548   -7.037  4.491   1.00 0.00 ? 872 GLN A CG   5  
ATOM 4467 C CD   . GLN A 1 81 ? 8.345   -8.227  3.975   1.00 0.00 ? 872 GLN A CD   5  
ATOM 4468 O OE1  . GLN A 1 81 ? 8.437   -8.434  2.767   1.00 0.00 ? 872 GLN A OE1  5  
ATOM 4469 N NE2  . GLN A 1 81 ? 8.927   -9.023  4.816   1.00 0.00 ? 872 GLN A NE2  5  
ATOM 4470 H H    . GLN A 1 81 ? 4.790   -6.062  4.029   1.00 0.00 ? 872 GLN A H    5  
ATOM 4471 H HA   . GLN A 1 81 ? 5.710   -8.675  3.686   1.00 0.00 ? 872 GLN A HA   5  
ATOM 4472 H HB2  . GLN A 1 81 ? 6.002   -6.703  5.946   1.00 0.00 ? 872 GLN A HB2  5  
ATOM 4473 H HB3  . GLN A 1 81 ? 6.736   -8.303  6.025   1.00 0.00 ? 872 GLN A HB3  5  
ATOM 4474 H HG2  . GLN A 1 81 ? 7.162   -6.472  3.656   1.00 0.00 ? 872 GLN A HG2  5  
ATOM 4475 H HG3  . GLN A 1 81 ? 8.195   -6.404  5.081   1.00 0.00 ? 872 GLN A HG3  5  
ATOM 4476 H HE21 . GLN A 1 81 ? 8.852   -8.857  5.779   1.00 0.00 ? 872 GLN A HE21 5  
ATOM 4477 H HE22 . GLN A 1 81 ? 9.444   -9.791  4.492   1.00 0.00 ? 872 GLN A HE22 5  
ATOM 4478 N N    . LEU A 1 82 ? 3.291   -8.384  5.830   1.00 0.00 ? 873 LEU A N    5  
ATOM 4479 C CA   . LEU A 1 82 ? 2.341   -9.123  6.655   1.00 0.00 ? 873 LEU A CA   5  
ATOM 4480 C C    . LEU A 1 82 ? 1.453   -10.030 5.805   1.00 0.00 ? 873 LEU A C    5  
ATOM 4481 O O    . LEU A 1 82 ? 0.782   -10.921 6.334   1.00 0.00 ? 873 LEU A O    5  
ATOM 4482 C CB   . LEU A 1 82 ? 1.456   -8.145  7.453   1.00 0.00 ? 873 LEU A CB   5  
ATOM 4483 C CG   . LEU A 1 82 ? 1.482   -8.492  8.955   1.00 0.00 ? 873 LEU A CG   5  
ATOM 4484 C CD1  . LEU A 1 82 ? 1.055   -9.947  9.173   1.00 0.00 ? 873 LEU A CD1  5  
ATOM 4485 C CD2  . LEU A 1 82 ? 2.892   -8.279  9.518   1.00 0.00 ? 873 LEU A CD2  5  
ATOM 4486 H H    . LEU A 1 82 ? 3.149   -7.424  5.679   1.00 0.00 ? 873 LEU A H    5  
ATOM 4487 H HA   . LEU A 1 82 ? 2.893   -9.734  7.350   1.00 0.00 ? 873 LEU A HA   5  
ATOM 4488 H HB2  . LEU A 1 82 ? 1.817   -7.137  7.313   1.00 0.00 ? 873 LEU A HB2  5  
ATOM 4489 H HB3  . LEU A 1 82 ? 0.439   -8.207  7.094   1.00 0.00 ? 873 LEU A HB3  5  
ATOM 4490 H HG   . LEU A 1 82 ? 0.787   -7.846  9.472   1.00 0.00 ? 873 LEU A HG   5  
ATOM 4491 H HD11 . LEU A 1 82 ? 0.800   -10.091 10.212  1.00 0.00 ? 873 LEU A HD11 5  
ATOM 4492 H HD12 . LEU A 1 82 ? 1.866   -10.610 8.911   1.00 0.00 ? 873 LEU A HD12 5  
ATOM 4493 H HD13 . LEU A 1 82 ? 0.195   -10.169 8.560   1.00 0.00 ? 873 LEU A HD13 5  
ATOM 4494 H HD21 . LEU A 1 82 ? 3.037   -8.919  10.376  1.00 0.00 ? 873 LEU A HD21 5  
ATOM 4495 H HD22 . LEU A 1 82 ? 3.008   -7.249  9.818   1.00 0.00 ? 873 LEU A HD22 5  
ATOM 4496 H HD23 . LEU A 1 82 ? 3.626   -8.518  8.764   1.00 0.00 ? 873 LEU A HD23 5  
ATOM 4497 N N    . LEU A 1 83 ? 1.410   -9.784  4.505   1.00 0.00 ? 874 LEU A N    5  
ATOM 4498 C CA   . LEU A 1 83 ? 0.537   -10.562 3.629   1.00 0.00 ? 874 LEU A CA   5  
ATOM 4499 C C    . LEU A 1 83 ? 1.101   -11.962 3.321   1.00 0.00 ? 874 LEU A C    5  
ATOM 4500 O O    . LEU A 1 83 ? 0.423   -12.958 3.562   1.00 0.00 ? 874 LEU A O    5  
ATOM 4501 C CB   . LEU A 1 83 ? 0.199   -9.779  2.348   1.00 0.00 ? 874 LEU A CB   5  
ATOM 4502 C CG   . LEU A 1 83 ? -0.275  -8.369  2.738   1.00 0.00 ? 874 LEU A CG   5  
ATOM 4503 C CD1  . LEU A 1 83 ? -0.464  -7.516  1.489   1.00 0.00 ? 874 LEU A CD1  5  
ATOM 4504 C CD2  . LEU A 1 83 ? -1.605  -8.461  3.494   1.00 0.00 ? 874 LEU A CD2  5  
ATOM 4505 H H    . LEU A 1 83 ? 1.938   -9.046  4.130   1.00 0.00 ? 874 LEU A H    5  
ATOM 4506 H HA   . LEU A 1 83 ? -0.388  -10.716 4.169   1.00 0.00 ? 874 LEU A HA   5  
ATOM 4507 H HB2  . LEU A 1 83 ? 1.059   -9.706  1.702   1.00 0.00 ? 874 LEU A HB2  5  
ATOM 4508 H HB3  . LEU A 1 83 ? -0.599  -10.288 1.828   1.00 0.00 ? 874 LEU A HB3  5  
ATOM 4509 H HG   . LEU A 1 83 ? 0.468   -7.906  3.371   1.00 0.00 ? 874 LEU A HG   5  
ATOM 4510 H HD11 . LEU A 1 83 ? -0.294  -6.479  1.733   1.00 0.00 ? 874 LEU A HD11 5  
ATOM 4511 H HD12 . LEU A 1 83 ? -1.473  -7.634  1.131   1.00 0.00 ? 874 LEU A HD12 5  
ATOM 4512 H HD13 . LEU A 1 83 ? 0.232   -7.825  0.723   1.00 0.00 ? 874 LEU A HD13 5  
ATOM 4513 H HD21 . LEU A 1 83 ? -2.130  -9.357  3.198   1.00 0.00 ? 874 LEU A HD21 5  
ATOM 4514 H HD22 . LEU A 1 83 ? -2.212  -7.599  3.262   1.00 0.00 ? 874 LEU A HD22 5  
ATOM 4515 H HD23 . LEU A 1 83 ? -1.414  -8.489  4.556   1.00 0.00 ? 874 LEU A HD23 5  
ATOM 4516 N N    . PRO A 1 84 ? 2.323   -12.072 2.829   1.00 0.00 ? 875 PRO A N    5  
ATOM 4517 C CA   . PRO A 1 84 ? 2.937   -13.404 2.540   1.00 0.00 ? 875 PRO A CA   5  
ATOM 4518 C C    . PRO A 1 84 ? 2.933   -14.298 3.779   1.00 0.00 ? 875 PRO A C    5  
ATOM 4519 O O    . PRO A 1 84 ? 3.657   -14.035 4.746   1.00 0.00 ? 875 PRO A O    5  
ATOM 4520 C CB   . PRO A 1 84 ? 4.375   -13.071 2.123   1.00 0.00 ? 875 PRO A CB   5  
ATOM 4521 C CG   . PRO A 1 84 ? 4.341   -11.644 1.687   1.00 0.00 ? 875 PRO A CG   5  
ATOM 4522 C CD   . PRO A 1 84 ? 3.238   -10.968 2.502   1.00 0.00 ? 875 PRO A CD   5  
ATOM 4523 H HA   . PRO A 1 84 ? 2.434   -13.886 1.717   1.00 0.00 ? 875 PRO A HA   5  
ATOM 4524 H HB2  . PRO A 1 84 ? 5.045   -13.196 2.962   1.00 0.00 ? 875 PRO A HB2  5  
ATOM 4525 H HB3  . PRO A 1 84 ? 4.685   -13.698 1.300   1.00 0.00 ? 875 PRO A HB3  5  
ATOM 4526 H HG2  . PRO A 1 84 ? 5.297   -11.176 1.881   1.00 0.00 ? 875 PRO A HG2  5  
ATOM 4527 H HG3  . PRO A 1 84 ? 4.100   -11.579 0.636   1.00 0.00 ? 875 PRO A HG3  5  
ATOM 4528 H HD2  . PRO A 1 84 ? 3.648   -10.524 3.397   1.00 0.00 ? 875 PRO A HD2  5  
ATOM 4529 H HD3  . PRO A 1 84 ? 2.738   -10.234 1.898   1.00 0.00 ? 875 PRO A HD3  5  
ATOM 4530 N N    . LYS A 1 85 ? 2.119   -15.346 3.753   1.00 0.00 ? 876 LYS A N    5  
ATOM 4531 C CA   . LYS A 1 85 ? 2.035   -16.270 4.876   1.00 0.00 ? 876 LYS A CA   5  
ATOM 4532 C C    . LYS A 1 85 ? 3.179   -17.265 4.823   1.00 0.00 ? 876 LYS A C    5  
ATOM 4533 O O    . LYS A 1 85 ? 3.520   -17.677 3.742   1.00 0.00 ? 876 LYS A O    5  
ATOM 4534 C CB   . LYS A 1 85 ? 0.702   -17.024 4.854   1.00 0.00 ? 876 LYS A CB   5  
ATOM 4535 C CG   . LYS A 1 85 ? 0.343   -17.483 6.278   1.00 0.00 ? 876 LYS A CG   5  
ATOM 4536 C CD   . LYS A 1 85 ? 0.053   -18.992 6.286   1.00 0.00 ? 876 LYS A CD   5  
ATOM 4537 C CE   . LYS A 1 85 ? 1.367   -19.786 6.198   1.00 0.00 ? 876 LYS A CE   5  
ATOM 4538 N NZ   . LYS A 1 85 ? 2.372   -19.207 7.130   1.00 0.00 ? 876 LYS A NZ   5  
ATOM 4539 H H    . LYS A 1 85 ? 1.566   -15.502 2.958   1.00 0.00 ? 876 LYS A H    5  
ATOM 4540 H HA   . LYS A 1 85 ? 2.097   -15.704 5.794   1.00 0.00 ? 876 LYS A HA   5  
ATOM 4541 N N    . GLN A 1 23 ? -8.455  -8.303  3.307   1.00 0.00 ? 814 GLN A N    6  
ATOM 4542 C CA   . GLN A 1 23 ? -7.861  -8.845  2.054   1.00 0.00 ? 814 GLN A CA   6  
ATOM 4543 C C    . GLN A 1 23 ? -7.774  -7.737  1.008   1.00 0.00 ? 814 GLN A C    6  
ATOM 4544 O O    . GLN A 1 23 ? -6.753  -7.570  0.347   1.00 0.00 ? 814 GLN A O    6  
ATOM 4545 C CB   . GLN A 1 23 ? -8.703  -10.032 1.520   1.00 0.00 ? 814 GLN A CB   6  
ATOM 4546 C CG   . GLN A 1 23 ? -10.214 -9.724  1.593   1.00 0.00 ? 814 GLN A CG   6  
ATOM 4547 C CD   . GLN A 1 23 ? -10.773 -10.138 2.949   1.00 0.00 ? 814 GLN A CD   6  
ATOM 4548 O OE1  . GLN A 1 23 ? -10.353 -9.607  3.979   1.00 0.00 ? 814 GLN A OE1  6  
ATOM 4549 N NE2  . GLN A 1 23 ? -11.686 -11.054 3.015   1.00 0.00 ? 814 GLN A NE2  6  
ATOM 4550 H HA   . GLN A 1 23 ? -6.861  -9.191  2.268   1.00 0.00 ? 814 GLN A HA   6  
ATOM 4551 H HB2  . GLN A 1 23 ? -8.431  -10.217 0.491   1.00 0.00 ? 814 GLN A HB2  6  
ATOM 4552 H HB3  . GLN A 1 23 ? -8.489  -10.913 2.106   1.00 0.00 ? 814 GLN A HB3  6  
ATOM 4553 H HG2  . GLN A 1 23 ? -10.392 -8.675  1.437   1.00 0.00 ? 814 GLN A HG2  6  
ATOM 4554 H HG3  . GLN A 1 23 ? -10.723 -10.283 0.821   1.00 0.00 ? 814 GLN A HG3  6  
ATOM 4555 H HE21 . GLN A 1 23 ? -12.015 -11.479 2.195   1.00 0.00 ? 814 GLN A HE21 6  
ATOM 4556 H HE22 . GLN A 1 23 ? -12.052 -11.321 3.885   1.00 0.00 ? 814 GLN A HE22 6  
ATOM 4557 N N    . THR A 1 24 ? -8.844  -6.987  0.865   1.00 0.00 ? 815 THR A N    6  
ATOM 4558 C CA   . THR A 1 24 ? -8.889  -5.903  -0.089  1.00 0.00 ? 815 THR A CA   6  
ATOM 4559 C C    . THR A 1 24 ? -8.260  -4.650  0.506   1.00 0.00 ? 815 THR A C    6  
ATOM 4560 O O    . THR A 1 24 ? -8.073  -4.553  1.729   1.00 0.00 ? 815 THR A O    6  
ATOM 4561 C CB   . THR A 1 24 ? -10.339 -5.632  -0.480  1.00 0.00 ? 815 THR A CB   6  
ATOM 4562 O OG1  . THR A 1 24 ? -11.174 -5.805  0.668   1.00 0.00 ? 815 THR A OG1  6  
ATOM 4563 C CG2  . THR A 1 24 ? -10.765 -6.618  -1.571  1.00 0.00 ? 815 THR A CG2  6  
ATOM 4564 H H    . THR A 1 24 ? -9.631  -7.156  1.416   1.00 0.00 ? 815 THR A H    6  
ATOM 4565 H HA   . THR A 1 24 ? -8.337  -6.187  -0.972  1.00 0.00 ? 815 THR A HA   6  
ATOM 4566 H HB   . THR A 1 24 ? -10.434 -4.625  -0.858  1.00 0.00 ? 815 THR A HB   6  
ATOM 4567 H HG21 . THR A 1 24 ? -11.781 -6.410  -1.870  1.00 0.00 ? 815 THR A HG21 6  
ATOM 4568 H HG22 . THR A 1 24 ? -10.698 -7.628  -1.194  1.00 0.00 ? 815 THR A HG22 6  
ATOM 4569 H HG23 . THR A 1 24 ? -10.113 -6.511  -2.425  1.00 0.00 ? 815 THR A HG23 6  
ATOM 4570 N N    . VAL A 1 25 ? -7.935  -3.696  -0.348  1.00 0.00 ? 816 VAL A N    6  
ATOM 4571 C CA   . VAL A 1 25 ? -7.342  -2.458  0.112   1.00 0.00 ? 816 VAL A CA   6  
ATOM 4572 C C    . VAL A 1 25 ? -8.321  -1.701  1.008   1.00 0.00 ? 816 VAL A C    6  
ATOM 4573 O O    . VAL A 1 25 ? -9.464  -2.126  1.193   1.00 0.00 ? 816 VAL A O    6  
ATOM 4574 C CB   . VAL A 1 25 ? -6.914  -1.597  -1.085  1.00 0.00 ? 816 VAL A CB   6  
ATOM 4575 C CG1  . VAL A 1 25 ? -5.658  -2.197  -1.713  1.00 0.00 ? 816 VAL A CG1  6  
ATOM 4576 C CG2  . VAL A 1 25 ? -8.031  -1.561  -2.134  1.00 0.00 ? 816 VAL A CG2  6  
ATOM 4577 H H    . VAL A 1 25 ? -8.104  -3.822  -1.305  1.00 0.00 ? 816 VAL A H    6  
ATOM 4578 H HA   . VAL A 1 25 ? -6.464  -2.699  0.695   1.00 0.00 ? 816 VAL A HA   6  
ATOM 4579 H HB   . VAL A 1 25 ? -6.701  -0.595  -0.748  1.00 0.00 ? 816 VAL A HB   6  
ATOM 4580 H HG11 . VAL A 1 25 ? -4.800  -1.968  -1.102  1.00 0.00 ? 816 VAL A HG11 6  
ATOM 4581 H HG12 . VAL A 1 25 ? -5.515  -1.786  -2.701  1.00 0.00 ? 816 VAL A HG12 6  
ATOM 4582 H HG13 . VAL A 1 25 ? -5.768  -3.269  -1.787  1.00 0.00 ? 816 VAL A HG13 6  
ATOM 4583 H HG21 . VAL A 1 25 ? -7.764  -0.863  -2.914  1.00 0.00 ? 816 VAL A HG21 6  
ATOM 4584 H HG22 . VAL A 1 25 ? -8.954  -1.244  -1.672  1.00 0.00 ? 816 VAL A HG22 6  
ATOM 4585 H HG23 . VAL A 1 25 ? -8.160  -2.541  -2.563  1.00 0.00 ? 816 VAL A HG23 6  
ATOM 4586 N N    . GLY A 1 26 ? -7.862  -0.613  1.596   1.00 0.00 ? 817 GLY A N    6  
ATOM 4587 C CA   . GLY A 1 26 ? -8.694  0.158   2.505   1.00 0.00 ? 817 GLY A CA   6  
ATOM 4588 C C    . GLY A 1 26 ? -8.731  -0.513  3.860   1.00 0.00 ? 817 GLY A C    6  
ATOM 4589 O O    . GLY A 1 26 ? -8.035  -0.101  4.779   1.00 0.00 ? 817 GLY A O    6  
ATOM 4590 H H    . GLY A 1 26 ? -6.938  -0.341  1.446   1.00 0.00 ? 817 GLY A H    6  
ATOM 4591 H HA2  . GLY A 1 26 ? -8.287  1.154   2.607   1.00 0.00 ? 817 GLY A HA2  6  
ATOM 4592 H HA3  . GLY A 1 26 ? -9.697  0.218   2.115   1.00 0.00 ? 817 GLY A HA3  6  
ATOM 4593 N N    . GLN A 1 27 ? -9.494  -1.595  3.961   1.00 0.00 ? 818 GLN A N    6  
ATOM 4594 C CA   . GLN A 1 27 ? -9.566  -2.354  5.204   1.00 0.00 ? 818 GLN A CA   6  
ATOM 4595 C C    . GLN A 1 27 ? -8.163  -2.714  5.666   1.00 0.00 ? 818 GLN A C    6  
ATOM 4596 O O    . GLN A 1 27 ? -7.778  -2.455  6.811   1.00 0.00 ? 818 GLN A O    6  
ATOM 4597 C CB   . GLN A 1 27 ? -10.389 -3.633  5.000   1.00 0.00 ? 818 GLN A CB   6  
ATOM 4598 C CG   . GLN A 1 27 ? -10.616 -4.327  6.348   1.00 0.00 ? 818 GLN A CG   6  
ATOM 4599 C CD   . GLN A 1 27 ? -10.144 -5.773  6.279   1.00 0.00 ? 818 GLN A CD   6  
ATOM 4600 O OE1  . GLN A 1 27 ? -8.947  -6.045  6.400   1.00 0.00 ? 818 GLN A OE1  6  
ATOM 4601 N NE2  . GLN A 1 27 ? -11.008 -6.721  6.091   1.00 0.00 ? 818 GLN A NE2  6  
ATOM 4602 H H    . GLN A 1 27 ? -9.991  -1.906  3.173   1.00 0.00 ? 818 GLN A H    6  
ATOM 4603 H HA   . GLN A 1 27 ? -10.042 -1.745  5.960   1.00 0.00 ? 818 GLN A HA   6  
ATOM 4604 H HB2  . GLN A 1 27 ? -11.344 -3.379  4.563   1.00 0.00 ? 818 GLN A HB2  6  
ATOM 4605 H HB3  . GLN A 1 27 ? -9.858  -4.303  4.338   1.00 0.00 ? 818 GLN A HB3  6  
ATOM 4606 H HG2  . GLN A 1 27 ? -10.071 -3.809  7.124   1.00 0.00 ? 818 GLN A HG2  6  
ATOM 4607 H HG3  . GLN A 1 27 ? -11.670 -4.309  6.581   1.00 0.00 ? 818 GLN A HG3  6  
ATOM 4608 H HE21 . GLN A 1 27 ? -11.959 -6.502  5.994   1.00 0.00 ? 818 GLN A HE21 6  
ATOM 4609 H HE22 . GLN A 1 27 ? -10.715 -7.655  6.048   1.00 0.00 ? 818 GLN A HE22 6  
ATOM 4610 N N    . TRP A 1 28 ? -7.394  -3.287  4.756   1.00 0.00 ? 819 TRP A N    6  
ATOM 4611 C CA   . TRP A 1 28 ? -6.017  -3.654  5.040   1.00 0.00 ? 819 TRP A CA   6  
ATOM 4612 C C    . TRP A 1 28 ? -5.232  -2.413  5.458   1.00 0.00 ? 819 TRP A C    6  
ATOM 4613 O O    . TRP A 1 28 ? -4.625  -2.375  6.533   1.00 0.00 ? 819 TRP A O    6  
ATOM 4614 C CB   . TRP A 1 28 ? -5.394  -4.286  3.786   1.00 0.00 ? 819 TRP A CB   6  
ATOM 4615 C CG   . TRP A 1 28 ? -3.939  -4.555  3.997   1.00 0.00 ? 819 TRP A CG   6  
ATOM 4616 C CD1  . TRP A 1 28 ? -3.431  -5.563  4.742   1.00 0.00 ? 819 TRP A CD1  6  
ATOM 4617 C CD2  . TRP A 1 28 ? -2.800  -3.833  3.456   1.00 0.00 ? 819 TRP A CD2  6  
ATOM 4618 N NE1  . TRP A 1 28 ? -2.049  -5.501  4.686   1.00 0.00 ? 819 TRP A NE1  6  
ATOM 4619 C CE2  . TRP A 1 28 ? -1.617  -4.449  3.905   1.00 0.00 ? 819 TRP A CE2  6  
ATOM 4620 C CE3  . TRP A 1 28 ? -2.684  -2.709  2.623   1.00 0.00 ? 819 TRP A CE3  6  
ATOM 4621 C CZ2  . TRP A 1 28 ? -0.367  -3.970  3.542   1.00 0.00 ? 819 TRP A CZ2  6  
ATOM 4622 C CZ3  . TRP A 1 28 ? -1.420  -2.223  2.255   1.00 0.00 ? 819 TRP A CZ3  6  
ATOM 4623 C CH2  . TRP A 1 28 ? -0.265  -2.855  2.717   1.00 0.00 ? 819 TRP A CH2  6  
ATOM 4624 H H    . TRP A 1 28 ? -7.758  -3.448  3.859   1.00 0.00 ? 819 TRP A H    6  
ATOM 4625 H HA   . TRP A 1 28 ? -6.000  -4.376  5.843   1.00 0.00 ? 819 TRP A HA   6  
ATOM 4626 H HB2  . TRP A 1 28 ? -5.897  -5.216  3.567   1.00 0.00 ? 819 TRP A HB2  6  
ATOM 4627 H HB3  . TRP A 1 28 ? -5.515  -3.614  2.950   1.00 0.00 ? 819 TRP A HB3  6  
ATOM 4628 H HD1  . TRP A 1 28 ? -4.007  -6.295  5.289   1.00 0.00 ? 819 TRP A HD1  6  
ATOM 4629 N N    . LEU A 1 29 ? -5.291  -1.387  4.616   1.00 0.00 ? 820 LEU A N    6  
ATOM 4630 C CA   . LEU A 1 29 ? -4.618  -0.123  4.891   1.00 0.00 ? 820 LEU A CA   6  
ATOM 4631 C C    . LEU A 1 29 ? -5.041  0.423   6.251   1.00 0.00 ? 820 LEU A C    6  
ATOM 4632 O O    . LEU A 1 29 ? -4.206  0.735   7.100   1.00 0.00 ? 820 LEU A O    6  
ATOM 4633 C CB   . LEU A 1 29 ? -4.947  0.895   3.792   1.00 0.00 ? 820 LEU A CB   6  
ATOM 4634 C CG   . LEU A 1 29 ? -4.482  0.343   2.436   1.00 0.00 ? 820 LEU A CG   6  
ATOM 4635 C CD1  . LEU A 1 29 ? -5.285  0.977   1.298   1.00 0.00 ? 820 LEU A CD1  6  
ATOM 4636 C CD2  . LEU A 1 29 ? -2.997  0.654   2.246   1.00 0.00 ? 820 LEU A CD2  6  
ATOM 4637 H H    . LEU A 1 29 ? -5.824  -1.476  3.802   1.00 0.00 ? 820 LEU A H    6  
ATOM 4638 H HA   . LEU A 1 29 ? -3.551  -0.290  4.897   1.00 0.00 ? 820 LEU A HA   6  
ATOM 4639 H HB2  . LEU A 1 29 ? -6.012  1.077   3.778   1.00 0.00 ? 820 LEU A HB2  6  
ATOM 4640 H HB3  . LEU A 1 29 ? -4.428  1.817   4.001   1.00 0.00 ? 820 LEU A HB3  6  
ATOM 4641 H HG   . LEU A 1 29 ? -4.634  -0.723  2.414   1.00 0.00 ? 820 LEU A HG   6  
ATOM 4642 H HD11 . LEU A 1 29 ? -6.148  1.492   1.693   1.00 0.00 ? 820 LEU A HD11 6  
ATOM 4643 H HD12 . LEU A 1 29 ? -5.601  0.205   0.617   1.00 0.00 ? 820 LEU A HD12 6  
ATOM 4644 H HD13 . LEU A 1 29 ? -4.663  1.674   0.762   1.00 0.00 ? 820 LEU A HD13 6  
ATOM 4645 H HD21 . LEU A 1 29 ? -2.825  1.708   2.403   1.00 0.00 ? 820 LEU A HD21 6  
ATOM 4646 H HD22 . LEU A 1 29 ? -2.695  0.386   1.243   1.00 0.00 ? 820 LEU A HD22 6  
ATOM 4647 H HD23 . LEU A 1 29 ? -2.417  0.087   2.959   1.00 0.00 ? 820 LEU A HD23 6  
ATOM 4648 N N    . GLU A 1 30 ? -6.338  0.502   6.465   1.00 0.00 ? 821 GLU A N    6  
ATOM 4649 C CA   . GLU A 1 30 ? -6.862  0.973   7.733   1.00 0.00 ? 821 GLU A CA   6  
ATOM 4650 C C    . GLU A 1 30 ? -6.318  0.118   8.865   1.00 0.00 ? 821 GLU A C    6  
ATOM 4651 O O    . GLU A 1 30 ? -5.817  0.634   9.869   1.00 0.00 ? 821 GLU A O    6  
ATOM 4652 C CB   . GLU A 1 30 ? -8.395  0.916   7.727   1.00 0.00 ? 821 GLU A CB   6  
ATOM 4653 C CG   . GLU A 1 30 ? -8.956  2.197   7.105   1.00 0.00 ? 821 GLU A CG   6  
ATOM 4654 C CD   . GLU A 1 30 ? -10.323 2.493   7.680   1.00 0.00 ? 821 GLU A CD   6  
ATOM 4655 O OE1  . GLU A 1 30 ? -10.386 2.953   8.802   1.00 0.00 ? 821 GLU A OE1  6  
ATOM 4656 O OE2  . GLU A 1 30 ? -11.290 2.255   6.994   1.00 0.00 ? 821 GLU A OE2  6  
ATOM 4657 H H    . GLU A 1 30 ? -6.960  0.219   5.760   1.00 0.00 ? 821 GLU A H    6  
ATOM 4658 H HA   . GLU A 1 30 ? -6.550  1.996   7.885   1.00 0.00 ? 821 GLU A HA   6  
ATOM 4659 N N    . SER A 1 31 ? -6.400  -1.189  8.690   1.00 0.00 ? 822 SER A N    6  
ATOM 4660 C CA   . SER A 1 31 ? -5.908  -2.119  9.689   1.00 0.00 ? 822 SER A CA   6  
ATOM 4661 C C    . SER A 1 31 ? -4.462  -1.804  10.060  1.00 0.00 ? 822 SER A C    6  
ATOM 4662 O O    . SER A 1 31 ? -4.125  -1.705  11.246  1.00 0.00 ? 822 SER A O    6  
ATOM 4663 C CB   . SER A 1 31 ? -6.024  -3.551  9.173   1.00 0.00 ? 822 SER A CB   6  
ATOM 4664 O OG   . SER A 1 31 ? -7.379  -3.798  8.780   1.00 0.00 ? 822 SER A OG   6  
ATOM 4665 H H    . SER A 1 31 ? -6.795  -1.536  7.860   1.00 0.00 ? 822 SER A H    6  
ATOM 4666 H HA   . SER A 1 31 ? -6.517  -2.025  10.576  1.00 0.00 ? 822 SER A HA   6  
ATOM 4667 H HB2  . SER A 1 31 ? -5.376  -3.685  8.320   1.00 0.00 ? 822 SER A HB2  6  
ATOM 4668 H HB3  . SER A 1 31 ? -5.723  -4.236  9.954   1.00 0.00 ? 822 SER A HB3  6  
ATOM 4669 H HG   . SER A 1 31 ? -7.520  -3.354  7.925   1.00 0.00 ? 822 SER A HG   6  
ATOM 4670 N N    . ILE A 1 32 ? -3.612  -1.626  9.056   1.00 0.00 ? 823 ILE A N    6  
ATOM 4671 C CA   . ILE A 1 32 ? -2.211  -1.309  9.313   1.00 0.00 ? 823 ILE A CA   6  
ATOM 4672 C C    . ILE A 1 32 ? -2.055  0.141   9.785   1.00 0.00 ? 823 ILE A C    6  
ATOM 4673 O O    . ILE A 1 32 ? -0.954  0.579   10.126  1.00 0.00 ? 823 ILE A O    6  
ATOM 4674 C CB   . ILE A 1 32 ? -1.352  -1.581  8.067   1.00 0.00 ? 823 ILE A CB   6  
ATOM 4675 C CG1  . ILE A 1 32 ? -1.785  -0.665  6.918   1.00 0.00 ? 823 ILE A CG1  6  
ATOM 4676 C CG2  . ILE A 1 32 ? -1.531  -3.044  7.637   1.00 0.00 ? 823 ILE A CG2  6  
ATOM 4677 C CD1  . ILE A 1 32 ? -0.834  -0.846  5.731   1.00 0.00 ? 823 ILE A CD1  6  
ATOM 4678 H H    . ILE A 1 32 ? -3.930  -1.702  8.128   1.00 0.00 ? 823 ILE A H    6  
ATOM 4679 H HA   . ILE A 1 32 ? -1.866  -1.952  10.110  1.00 0.00 ? 823 ILE A HA   6  
ATOM 4680 H HB   . ILE A 1 32 ? -0.313  -1.403  8.310   1.00 0.00 ? 823 ILE A HB   6  
ATOM 4681 H HG12 . ILE A 1 32 ? -2.785  -0.931  6.616   1.00 0.00 ? 823 ILE A HG12 6  
ATOM 4682 H HG21 . ILE A 1 32 ? -1.629  -3.096  6.562   1.00 0.00 ? 823 ILE A HG21 6  
ATOM 4683 H HG22 . ILE A 1 32 ? -2.419  -3.454  8.093   1.00 0.00 ? 823 ILE A HG22 6  
ATOM 4684 H HG23 . ILE A 1 32 ? -0.671  -3.619  7.947   1.00 0.00 ? 823 ILE A HG23 6  
ATOM 4685 H HD11 . ILE A 1 32 ? 0.183   -0.672  6.050   1.00 0.00 ? 823 ILE A HD11 6  
ATOM 4686 H HD12 . ILE A 1 32 ? -1.091  -0.145  4.954   1.00 0.00 ? 823 ILE A HD12 6  
ATOM 4687 H HD13 . ILE A 1 32 ? -0.925  -1.853  5.350   1.00 0.00 ? 823 ILE A HD13 6  
ATOM 4688 N N    . GLY A 1 33 ? -3.172  0.859   9.851   1.00 0.00 ? 824 GLY A N    6  
ATOM 4689 C CA   . GLY A 1 33 ? -3.169  2.232   10.338  1.00 0.00 ? 824 GLY A CA   6  
ATOM 4690 C C    . GLY A 1 33 ? -2.982  3.237   9.215   1.00 0.00 ? 824 GLY A C    6  
ATOM 4691 O O    . GLY A 1 33 ? -2.460  4.329   9.438   1.00 0.00 ? 824 GLY A O    6  
ATOM 4692 H H    . GLY A 1 33 ? -4.025  0.447   9.596   1.00 0.00 ? 824 GLY A H    6  
ATOM 4693 H HA2  . GLY A 1 33 ? -4.106  2.430   10.835  1.00 0.00 ? 824 GLY A HA2  6  
ATOM 4694 H HA3  . GLY A 1 33 ? -2.364  2.350   11.049  1.00 0.00 ? 824 GLY A HA3  6  
ATOM 4695 N N    . LEU A 1 34 ? -3.416  2.884   8.015   1.00 0.00 ? 825 LEU A N    6  
ATOM 4696 C CA   . LEU A 1 34 ? -3.291  3.783   6.872   1.00 0.00 ? 825 LEU A CA   6  
ATOM 4697 C C    . LEU A 1 34 ? -4.651  4.058   6.229   1.00 0.00 ? 825 LEU A C    6  
ATOM 4698 O O    . LEU A 1 34 ? -4.924  3.612   5.115   1.00 0.00 ? 825 LEU A O    6  
ATOM 4699 C CB   . LEU A 1 34 ? -2.331  3.190   5.834   1.00 0.00 ? 825 LEU A CB   6  
ATOM 4700 C CG   . LEU A 1 34 ? -0.928  3.046   6.445   1.00 0.00 ? 825 LEU A CG   6  
ATOM 4701 C CD1  . LEU A 1 34 ? 0.006   2.388   5.432   1.00 0.00 ? 825 LEU A CD1  6  
ATOM 4702 C CD2  . LEU A 1 34 ? -0.378  4.429   6.817   1.00 0.00 ? 825 LEU A CD2  6  
ATOM 4703 H H    . LEU A 1 34 ? -3.834  2.002   7.884   1.00 0.00 ? 825 LEU A H    6  
ATOM 4704 H HA   . LEU A 1 34 ? -2.884  4.723   7.212   1.00 0.00 ? 825 LEU A HA   6  
ATOM 4705 H HB2  . LEU A 1 34 ? -2.697  2.221   5.527   1.00 0.00 ? 825 LEU A HB2  6  
ATOM 4706 H HB3  . LEU A 1 34 ? -2.285  3.844   4.976   1.00 0.00 ? 825 LEU A HB3  6  
ATOM 4707 H HG   . LEU A 1 34 ? -0.985  2.427   7.331   1.00 0.00 ? 825 LEU A HG   6  
ATOM 4708 H HD11 . LEU A 1 34 ? 0.622   1.657   5.935   1.00 0.00 ? 825 LEU A HD11 6  
ATOM 4709 H HD12 . LEU A 1 34 ? 0.635   3.140   4.982   1.00 0.00 ? 825 LEU A HD12 6  
ATOM 4710 H HD13 . LEU A 1 34 ? -0.576  1.901   4.666   1.00 0.00 ? 825 LEU A HD13 6  
ATOM 4711 H HD21 . LEU A 1 34 ? -0.626  5.139   6.042   1.00 0.00 ? 825 LEU A HD21 6  
ATOM 4712 H HD22 . LEU A 1 34 ? 0.695   4.371   6.923   1.00 0.00 ? 825 LEU A HD22 6  
ATOM 4713 H HD23 . LEU A 1 34 ? -0.809  4.750   7.753   1.00 0.00 ? 825 LEU A HD23 6  
ATOM 4714 N N    . PRO A 1 35 ? -5.494  4.810   6.893   1.00 0.00 ? 826 PRO A N    6  
ATOM 4715 C CA   . PRO A 1 35 ? -6.829  5.176   6.347   1.00 0.00 ? 826 PRO A CA   6  
ATOM 4716 C C    . PRO A 1 35 ? -6.696  6.206   5.232   1.00 0.00 ? 826 PRO A C    6  
ATOM 4717 O O    . PRO A 1 35 ? -5.780  7.035   5.258   1.00 0.00 ? 826 PRO A O    6  
ATOM 4718 C CB   . PRO A 1 35 ? -7.567  5.769   7.551   1.00 0.00 ? 826 PRO A CB   6  
ATOM 4719 C CG   . PRO A 1 35 ? -6.491  6.278   8.458   1.00 0.00 ? 826 PRO A CG   6  
ATOM 4720 C CD   . PRO A 1 35 ? -5.264  5.387   8.228   1.00 0.00 ? 826 PRO A CD   6  
ATOM 4721 H HA   . PRO A 1 35 ? -7.358  4.302   6.000   1.00 0.00 ? 826 PRO A HA   6  
ATOM 4722 H HB2  . PRO A 1 35 ? -8.211  6.577   7.233   1.00 0.00 ? 826 PRO A HB2  6  
ATOM 4723 H HB3  . PRO A 1 35 ? -8.141  5.007   8.056   1.00 0.00 ? 826 PRO A HB3  6  
ATOM 4724 H HG2  . PRO A 1 35 ? -6.261  7.306   8.212   1.00 0.00 ? 826 PRO A HG2  6  
ATOM 4725 H HG3  . PRO A 1 35 ? -6.801  6.200   9.489   1.00 0.00 ? 826 PRO A HG3  6  
ATOM 4726 H HD2  . PRO A 1 35 ? -4.361  5.983   8.241   1.00 0.00 ? 826 PRO A HD2  6  
ATOM 4727 H HD3  . PRO A 1 35 ? -5.217  4.603   8.968   1.00 0.00 ? 826 PRO A HD3  6  
ATOM 4728 N N    . GLN A 1 36 ? -7.593  6.140   4.252   1.00 0.00 ? 827 GLN A N    6  
ATOM 4729 C CA   . GLN A 1 36 ? -7.572  7.056   3.107   1.00 0.00 ? 827 GLN A CA   6  
ATOM 4730 C C    . GLN A 1 36 ? -6.592  6.567   2.042   1.00 0.00 ? 827 GLN A C    6  
ATOM 4731 O O    . GLN A 1 36 ? -6.208  7.317   1.136   1.00 0.00 ? 827 GLN A O    6  
ATOM 4732 C CB   . GLN A 1 36 ? -7.204  8.487   3.553   1.00 0.00 ? 827 GLN A CB   6  
ATOM 4733 C CG   . GLN A 1 36 ? -7.564  9.495   2.453   1.00 0.00 ? 827 GLN A CG   6  
ATOM 4734 C CD   . GLN A 1 36 ? -6.319  10.270  2.037   1.00 0.00 ? 827 GLN A CD   6  
ATOM 4735 O OE1  . GLN A 1 36 ? -6.349  11.497  1.959   1.00 0.00 ? 827 GLN A OE1  6  
ATOM 4736 N NE2  . GLN A 1 36 ? -5.225  9.627   1.765   1.00 0.00 ? 827 GLN A NE2  6  
ATOM 4737 H H    . GLN A 1 36 ? -8.281  5.439   4.285   1.00 0.00 ? 827 GLN A H    6  
ATOM 4738 H HA   . GLN A 1 36 ? -8.562  7.075   2.674   1.00 0.00 ? 827 GLN A HA   6  
ATOM 4739 H HB2  . GLN A 1 36 ? -7.744  8.735   4.455   1.00 0.00 ? 827 GLN A HB2  6  
ATOM 4740 H HB3  . GLN A 1 36 ? -6.143  8.541   3.747   1.00 0.00 ? 827 GLN A HB3  6  
ATOM 4741 H HG2  . GLN A 1 36 ? -7.965  8.974   1.595   1.00 0.00 ? 827 GLN A HG2  6  
ATOM 4742 H HG3  . GLN A 1 36 ? -8.304  10.187  2.828   1.00 0.00 ? 827 GLN A HG3  6  
ATOM 4743 H HE21 . GLN A 1 36 ? -5.206  8.648   1.826   1.00 0.00 ? 827 GLN A HE21 6  
ATOM 4744 H HE22 . GLN A 1 36 ? -4.417  10.116  1.495   1.00 0.00 ? 827 GLN A HE22 6  
ATOM 4745 N N    . TYR A 1 37 ? -6.217  5.301   2.128   1.00 0.00 ? 828 TYR A N    6  
ATOM 4746 C CA   . TYR A 1 37 ? -5.310  4.720   1.147   1.00 0.00 ? 828 TYR A CA   6  
ATOM 4747 C C    . TYR A 1 37 ? -6.084  3.823   0.187   1.00 0.00 ? 828 TYR A C    6  
ATOM 4748 O O    . TYR A 1 37 ? -5.527  3.316   -0.789  1.00 0.00 ? 828 TYR A O    6  
ATOM 4749 C CB   . TYR A 1 37 ? -4.229  3.887   1.846   1.00 0.00 ? 828 TYR A CB   6  
ATOM 4750 C CG   . TYR A 1 37 ? -3.176  4.775   2.474   1.00 0.00 ? 828 TYR A CG   6  
ATOM 4751 C CD1  . TYR A 1 37 ? -3.529  5.704   3.458   1.00 0.00 ? 828 TYR A CD1  6  
ATOM 4752 C CD2  . TYR A 1 37 ? -1.840  4.646   2.082   1.00 0.00 ? 828 TYR A CD2  6  
ATOM 4753 C CE1  . TYR A 1 37 ? -2.545  6.506   4.043   1.00 0.00 ? 828 TYR A CE1  6  
ATOM 4754 C CE2  . TYR A 1 37 ? -0.860  5.445   2.671   1.00 0.00 ? 828 TYR A CE2  6  
ATOM 4755 C CZ   . TYR A 1 37 ? -1.211  6.375   3.651   1.00 0.00 ? 828 TYR A CZ   6  
ATOM 4756 O OH   . TYR A 1 37 ? -0.239  7.156   4.233   1.00 0.00 ? 828 TYR A OH   6  
ATOM 4757 H H    . TYR A 1 37 ? -6.581  4.738   2.847   1.00 0.00 ? 828 TYR A H    6  
ATOM 4758 H HA   . TYR A 1 37 ? -4.831  5.512   0.589   1.00 0.00 ? 828 TYR A HA   6  
ATOM 4759 H HB2  . TYR A 1 37 ? -4.685  3.281   2.614   1.00 0.00 ? 828 TYR A HB2  6  
ATOM 4760 H HB3  . TYR A 1 37 ? -3.757  3.247   1.119   1.00 0.00 ? 828 TYR A HB3  6  
ATOM 4761 H HH   . TYR A 1 37 ? -0.325  8.058   3.881   1.00 0.00 ? 828 TYR A HH   6  
ATOM 4762 N N    . GLU A 1 38 ? -7.375  3.646   0.456   1.00 0.00 ? 829 GLU A N    6  
ATOM 4763 C CA   . GLU A 1 38 ? -8.223  2.813   -0.398  1.00 0.00 ? 829 GLU A CA   6  
ATOM 4764 C C    . GLU A 1 38 ? -8.325  3.413   -1.780  1.00 0.00 ? 829 GLU A C    6  
ATOM 4765 O O    . GLU A 1 38 ? -7.716  2.922   -2.723  1.00 0.00 ? 829 GLU A O    6  
ATOM 4766 C CB   . GLU A 1 38 ? -9.632  2.662   0.201   1.00 0.00 ? 829 GLU A CB   6  
ATOM 4767 C CG   . GLU A 1 38 ? -9.947  3.849   1.115   1.00 0.00 ? 829 GLU A CG   6  
ATOM 4768 C CD   . GLU A 1 38 ? -9.463  3.553   2.512   1.00 0.00 ? 829 GLU A CD   6  
ATOM 4769 O OE1  . GLU A 1 38 ? -10.158 2.856   3.215   1.00 0.00 ? 829 GLU A OE1  6  
ATOM 4770 O OE2  . GLU A 1 38 ? -8.401  4.015   2.856   1.00 0.00 ? 829 GLU A OE2  6  
ATOM 4771 H H    . GLU A 1 38 ? -7.766  4.081   1.246   1.00 0.00 ? 829 GLU A H    6  
ATOM 4772 H HA   . GLU A 1 38 ? -7.777  1.833   -0.480  1.00 0.00 ? 829 GLU A HA   6  
ATOM 4773 N N    . ASN A 1 39 ? -9.088  4.493   -1.890  1.00 0.00 ? 830 ASN A N    6  
ATOM 4774 C CA   . ASN A 1 39 ? -9.263  5.173   -3.167  1.00 0.00 ? 830 ASN A CA   6  
ATOM 4775 C C    . ASN A 1 39 ? -7.923  5.324   -3.861  1.00 0.00 ? 830 ASN A C    6  
ATOM 4776 O O    . ASN A 1 39 ? -7.828  5.226   -5.081  1.00 0.00 ? 830 ASN A O    6  
ATOM 4777 C CB   . ASN A 1 39 ? -9.896  6.556   -2.954  1.00 0.00 ? 830 ASN A CB   6  
ATOM 4778 C CG   . ASN A 1 39 ? -11.416 6.457   -3.046  1.00 0.00 ? 830 ASN A CG   6  
ATOM 4779 O OD1  . ASN A 1 39 ? -12.112 6.637   -2.042  1.00 0.00 ? 830 ASN A OD1  6  
ATOM 4780 N ND2  . ASN A 1 39 ? -11.977 6.185   -4.185  1.00 0.00 ? 830 ASN A ND2  6  
ATOM 4781 H H    . ASN A 1 39 ? -9.540  4.840   -1.091  1.00 0.00 ? 830 ASN A H    6  
ATOM 4782 H HA   . ASN A 1 39 ? -9.916  4.585   -3.795  1.00 0.00 ? 830 ASN A HA   6  
ATOM 4783 H HB2  . ASN A 1 39 ? -9.618  6.934   -1.982  1.00 0.00 ? 830 ASN A HB2  6  
ATOM 4784 H HB3  . ASN A 1 39 ? -9.539  7.237   -3.712  1.00 0.00 ? 830 ASN A HB3  6  
ATOM 4785 H HD21 . ASN A 1 39 ? -11.427 6.044   -4.986  1.00 0.00 ? 830 ASN A HD21 6  
ATOM 4786 H HD22 . ASN A 1 39 ? -12.954 6.121   -4.248  1.00 0.00 ? 830 ASN A HD22 6  
ATOM 4787 N N    . HIS A 1 40 ? -6.882  5.522   -3.066  1.00 0.00 ? 831 HIS A N    6  
ATOM 4788 C CA   . HIS A 1 40 ? -5.537  5.659   -3.595  1.00 0.00 ? 831 HIS A CA   6  
ATOM 4789 C C    . HIS A 1 40 ? -5.087  4.368   -4.273  1.00 0.00 ? 831 HIS A C    6  
ATOM 4790 O O    . HIS A 1 40 ? -4.764  4.362   -5.464  1.00 0.00 ? 831 HIS A O    6  
ATOM 4791 C CB   . HIS A 1 40 ? -4.564  6.041   -2.472  1.00 0.00 ? 831 HIS A CB   6  
ATOM 4792 C CG   . HIS A 1 40 ? -4.680  7.516   -2.204  1.00 0.00 ? 831 HIS A CG   6  
ATOM 4793 N ND1  . HIS A 1 40 ? -5.283  8.026   -1.060  1.00 0.00 ? 831 HIS A ND1  6  
ATOM 4794 C CD2  . HIS A 1 40 ? -4.296  8.608   -2.941  1.00 0.00 ? 831 HIS A CD2  6  
ATOM 4795 C CE1  . HIS A 1 40 ? -5.244  9.368   -1.151  1.00 0.00 ? 831 HIS A CE1  6  
ATOM 4796 N NE2  . HIS A 1 40 ? -4.655  9.773   -2.275  1.00 0.00 ? 831 HIS A NE2  6  
ATOM 4797 H H    . HIS A 1 40 ? -7.024  5.563   -2.098  1.00 0.00 ? 831 HIS A H    6  
ATOM 4798 H HA   . HIS A 1 40 ? -5.536  6.448   -4.332  1.00 0.00 ? 831 HIS A HA   6  
ATOM 4799 H HB2  . HIS A 1 40 ? -4.804  5.487   -1.578  1.00 0.00 ? 831 HIS A HB2  6  
ATOM 4800 H HB3  . HIS A 1 40 ? -3.555  5.812   -2.775  1.00 0.00 ? 831 HIS A HB3  6  
ATOM 4801 N N    . LEU A 1 41 ? -5.093  3.269   -3.528  1.00 0.00 ? 832 LEU A N    6  
ATOM 4802 C CA   . LEU A 1 41 ? -4.702  1.987   -4.092  1.00 0.00 ? 832 LEU A CA   6  
ATOM 4803 C C    . LEU A 1 41 ? -5.742  1.519   -5.105  1.00 0.00 ? 832 LEU A C    6  
ATOM 4804 O O    . LEU A 1 41 ? -5.400  0.926   -6.132  1.00 0.00 ? 832 LEU A O    6  
ATOM 4805 C CB   . LEU A 1 41 ? -4.531  0.937   -2.987  1.00 0.00 ? 832 LEU A CB   6  
ATOM 4806 C CG   . LEU A 1 41 ? -3.060  0.881   -2.540  1.00 0.00 ? 832 LEU A CG   6  
ATOM 4807 C CD1  . LEU A 1 41 ? -2.738  2.085   -1.655  1.00 0.00 ? 832 LEU A CD1  6  
ATOM 4808 C CD2  . LEU A 1 41 ? -2.816  -0.402  -1.745  1.00 0.00 ? 832 LEU A CD2  6  
ATOM 4809 H H    . LEU A 1 41 ? -5.380  3.311   -2.589  1.00 0.00 ? 832 LEU A H    6  
ATOM 4810 H HA   . LEU A 1 41 ? -3.759  2.111   -4.602  1.00 0.00 ? 832 LEU A HA   6  
ATOM 4811 H HB2  . LEU A 1 41 ? -5.159  1.186   -2.148  1.00 0.00 ? 832 LEU A HB2  6  
ATOM 4812 H HB3  . LEU A 1 41 ? -4.821  -0.024  -3.375  1.00 0.00 ? 832 LEU A HB3  6  
ATOM 4813 H HG   . LEU A 1 41 ? -2.415  0.895   -3.408  1.00 0.00 ? 832 LEU A HG   6  
ATOM 4814 H HD11 . LEU A 1 41 ? -3.430  2.119   -0.827  1.00 0.00 ? 832 LEU A HD11 6  
ATOM 4815 H HD12 . LEU A 1 41 ? -2.821  2.993   -2.232  1.00 0.00 ? 832 LEU A HD12 6  
ATOM 4816 H HD13 . LEU A 1 41 ? -1.731  1.988   -1.275  1.00 0.00 ? 832 LEU A HD13 6  
ATOM 4817 H HD21 . LEU A 1 41 ? -1.769  -0.472  -1.489  1.00 0.00 ? 832 LEU A HD21 6  
ATOM 4818 H HD22 . LEU A 1 41 ? -3.092  -1.257  -2.346  1.00 0.00 ? 832 LEU A HD22 6  
ATOM 4819 H HD23 . LEU A 1 41 ? -3.406  -0.387  -0.842  1.00 0.00 ? 832 LEU A HD23 6  
ATOM 4820 N N    . MET A 1 42 ? -7.009  1.807   -4.819  1.00 0.00 ? 833 MET A N    6  
ATOM 4821 C CA   . MET A 1 42 ? -8.097  1.434   -5.715  1.00 0.00 ? 833 MET A CA   6  
ATOM 4822 C C    . MET A 1 42 ? -7.908  2.093   -7.070  1.00 0.00 ? 833 MET A C    6  
ATOM 4823 O O    . MET A 1 42 ? -7.804  1.411   -8.090  1.00 0.00 ? 833 MET A O    6  
ATOM 4824 C CB   . MET A 1 42 ? -9.451  1.841   -5.120  1.00 0.00 ? 833 MET A CB   6  
ATOM 4825 C CG   . MET A 1 42 ? -9.798  0.916   -3.944  1.00 0.00 ? 833 MET A CG   6  
ATOM 4826 S SD   . MET A 1 42 ? -11.593 0.879   -3.704  1.00 0.00 ? 833 MET A SD   6  
ATOM 4827 C CE   . MET A 1 42 ? -11.838 2.656   -3.443  1.00 0.00 ? 833 MET A CE   6  
ATOM 4828 H H    . MET A 1 42 ? -7.212  2.295   -3.991  1.00 0.00 ? 833 MET A H    6  
ATOM 4829 H HA   . MET A 1 42 ? -8.085  0.362   -5.850  1.00 0.00 ? 833 MET A HA   6  
ATOM 4830 H HB2  . MET A 1 42 ? -9.399  2.863   -4.778  1.00 0.00 ? 833 MET A HB2  6  
ATOM 4831 H HB3  . MET A 1 42 ? -10.216 1.755   -5.878  1.00 0.00 ? 833 MET A HB3  6  
ATOM 4832 H HG2  . MET A 1 42 ? -9.450  -0.085  -4.157  1.00 0.00 ? 833 MET A HG2  6  
ATOM 4833 H HG3  . MET A 1 42 ? -9.322  1.274   -3.044  1.00 0.00 ? 833 MET A HG3  6  
ATOM 4834 H HE1  . MET A 1 42 ? -12.833 2.825   -3.057  1.00 0.00 ? 833 MET A HE1  6  
ATOM 4835 H HE2  . MET A 1 42 ? -11.730 3.181   -4.380  1.00 0.00 ? 833 MET A HE2  6  
ATOM 4836 H HE3  . MET A 1 42 ? -11.103 3.021   -2.741  1.00 0.00 ? 833 MET A HE3  6  
ATOM 4837 N N    . ALA A 1 43 ? -7.809  3.422   -7.079  1.00 0.00 ? 834 ALA A N    6  
ATOM 4838 C CA   . ALA A 1 43 ? -7.574  4.146   -8.325  1.00 0.00 ? 834 ALA A CA   6  
ATOM 4839 C C    . ALA A 1 43 ? -6.319  3.613   -8.975  1.00 0.00 ? 834 ALA A C    6  
ATOM 4840 O O    . ALA A 1 43 ? -6.293  3.325   -10.173 1.00 0.00 ? 834 ALA A O    6  
ATOM 4841 C CB   . ALA A 1 43 ? -7.419  5.644   -8.061  1.00 0.00 ? 834 ALA A CB   6  
ATOM 4842 H H    . ALA A 1 43 ? -7.862  3.920   -6.232  1.00 0.00 ? 834 ALA A H    6  
ATOM 4843 H HA   . ALA A 1 43 ? -8.412  3.988   -8.989  1.00 0.00 ? 834 ALA A HA   6  
ATOM 4844 H HB1  . ALA A 1 43 ? -6.893  5.801   -7.131  1.00 0.00 ? 834 ALA A HB1  6  
ATOM 4845 H HB2  . ALA A 1 43 ? -8.394  6.103   -8.008  1.00 0.00 ? 834 ALA A HB2  6  
ATOM 4846 H HB3  . ALA A 1 43 ? -6.858  6.094   -8.869  1.00 0.00 ? 834 ALA A HB3  6  
ATOM 4847 N N    . ASN A 1 44 ? -5.292  3.435   -8.161  1.00 0.00 ? 835 ASN A N    6  
ATOM 4848 C CA   . ASN A 1 44 ? -4.026  2.884   -8.622  1.00 0.00 ? 835 ASN A CA   6  
ATOM 4849 C C    . ASN A 1 44 ? -4.215  1.439   -9.084  1.00 0.00 ? 835 ASN A C    6  
ATOM 4850 O O    . ASN A 1 44 ? -3.315  0.835   -9.661  1.00 0.00 ? 835 ASN A O    6  
ATOM 4851 C CB   . ASN A 1 44 ? -2.994  2.948   -7.485  1.00 0.00 ? 835 ASN A CB   6  
ATOM 4852 C CG   . ASN A 1 44 ? -1.673  2.308   -7.903  1.00 0.00 ? 835 ASN A CG   6  
ATOM 4853 O OD1  . ASN A 1 44 ? -1.264  2.412   -9.059  1.00 0.00 ? 835 ASN A OD1  6  
ATOM 4854 N ND2  . ASN A 1 44 ? -0.975  1.661   -7.021  1.00 0.00 ? 835 ASN A ND2  6  
ATOM 4855 H H    . ASN A 1 44 ? -5.397  3.659   -7.210  1.00 0.00 ? 835 ASN A H    6  
ATOM 4856 H HA   . ASN A 1 44 ? -3.664  3.470   -9.453  1.00 0.00 ? 835 ASN A HA   6  
ATOM 4857 H HB2  . ASN A 1 44 ? -2.819  3.983   -7.227  1.00 0.00 ? 835 ASN A HB2  6  
ATOM 4858 H HB3  . ASN A 1 44 ? -3.385  2.429   -6.624  1.00 0.00 ? 835 ASN A HB3  6  
ATOM 4859 H HD21 . ASN A 1 44 ? -1.293  1.586   -6.098  1.00 0.00 ? 835 ASN A HD21 6  
ATOM 4860 H HD22 . ASN A 1 44 ? -0.125  1.243   -7.275  1.00 0.00 ? 835 ASN A HD22 6  
ATOM 4861 N N    . GLY A 1 45 ? -5.391  0.888   -8.819  1.00 0.00 ? 836 GLY A N    6  
ATOM 4862 C CA   . GLY A 1 45 ? -5.686  -0.485  -9.202  1.00 0.00 ? 836 GLY A CA   6  
ATOM 4863 C C    . GLY A 1 45 ? -4.739  -1.436  -8.501  1.00 0.00 ? 836 GLY A C    6  
ATOM 4864 O O    . GLY A 1 45 ? -4.311  -2.443  -9.074  1.00 0.00 ? 836 GLY A O    6  
ATOM 4865 H H    . GLY A 1 45 ? -6.074  1.410   -8.346  1.00 0.00 ? 836 GLY A H    6  
ATOM 4866 H HA2  . GLY A 1 45 ? -6.703  -0.720  -8.926  1.00 0.00 ? 836 GLY A HA2  6  
ATOM 4867 H HA3  . GLY A 1 45 ? -5.569  -0.593  -10.269 1.00 0.00 ? 836 GLY A HA3  6  
ATOM 4868 N N    . PHE A 1 46 ? -4.388  -1.098  -7.270  1.00 0.00 ? 837 PHE A N    6  
ATOM 4869 C CA   . PHE A 1 46 ? -3.465  -1.907  -6.491  1.00 0.00 ? 837 PHE A CA   6  
ATOM 4870 C C    . PHE A 1 46 ? -4.201  -2.644  -5.380  1.00 0.00 ? 837 PHE A C    6  
ATOM 4871 O O    . PHE A 1 46 ? -3.791  -2.620  -4.221  1.00 0.00 ? 837 PHE A O    6  
ATOM 4872 C CB   . PHE A 1 46 ? -2.343  -1.024  -5.916  1.00 0.00 ? 837 PHE A CB   6  
ATOM 4873 C CG   . PHE A 1 46 ? -1.084  -1.219  -6.742  1.00 0.00 ? 837 PHE A CG   6  
ATOM 4874 C CD1  . PHE A 1 46 ? -1.129  -1.071  -8.136  1.00 0.00 ? 837 PHE A CD1  6  
ATOM 4875 C CD2  . PHE A 1 46 ? 0.119   -1.557  -6.118  1.00 0.00 ? 837 PHE A CD2  6  
ATOM 4876 C CE1  . PHE A 1 46 ? 0.028   -1.259  -8.898  1.00 0.00 ? 837 PHE A CE1  6  
ATOM 4877 C CE2  . PHE A 1 46 ? 1.276   -1.748  -6.883  1.00 0.00 ? 837 PHE A CE2  6  
ATOM 4878 C CZ   . PHE A 1 46 ? 1.231   -1.599  -8.272  1.00 0.00 ? 837 PHE A CZ   6  
ATOM 4879 H H    . PHE A 1 46 ? -4.752  -0.272  -6.876  1.00 0.00 ? 837 PHE A H    6  
ATOM 4880 H HA   . PHE A 1 46 ? -3.019  -2.646  -7.142  1.00 0.00 ? 837 PHE A HA   6  
ATOM 4881 H HB2  . PHE A 1 46 ? -2.647  0.011   -5.958  1.00 0.00 ? 837 PHE A HB2  6  
ATOM 4882 H HB3  . PHE A 1 46 ? -2.150  -1.293  -4.886  1.00 0.00 ? 837 PHE A HB3  6  
ATOM 4883 H HZ   . PHE A 1 46 ? 2.126   -1.747  -8.861  1.00 0.00 ? 837 PHE A HZ   6  
ATOM 4884 N N    . ASP A 1 47 ? -5.282  -3.317  -5.751  1.00 0.00 ? 838 ASP A N    6  
ATOM 4885 C CA   . ASP A 1 47 ? -6.066  -4.093  -4.794  1.00 0.00 ? 838 ASP A CA   6  
ATOM 4886 C C    . ASP A 1 47 ? -5.364  -5.410  -4.491  1.00 0.00 ? 838 ASP A C    6  
ATOM 4887 O O    . ASP A 1 47 ? -4.321  -5.710  -5.076  1.00 0.00 ? 838 ASP A O    6  
ATOM 4888 C CB   . ASP A 1 47 ? -7.476  -4.358  -5.336  1.00 0.00 ? 838 ASP A CB   6  
ATOM 4889 C CG   . ASP A 1 47 ? -8.472  -4.469  -4.188  1.00 0.00 ? 838 ASP A CG   6  
ATOM 4890 O OD1  . ASP A 1 47 ? -8.201  -5.204  -3.257  1.00 0.00 ? 838 ASP A OD1  6  
ATOM 4891 O OD2  . ASP A 1 47 ? -9.496  -3.827  -4.260  1.00 0.00 ? 838 ASP A OD2  6  
ATOM 4892 H H    . ASP A 1 47 ? -5.546  -3.311  -6.695  1.00 0.00 ? 838 ASP A H    6  
ATOM 4893 H HA   . ASP A 1 47 ? -6.147  -3.527  -3.878  1.00 0.00 ? 838 ASP A HA   6  
ATOM 4894 N N    . ASN A 1 48 ? -5.925  -6.185  -3.576  1.00 0.00 ? 839 ASN A N    6  
ATOM 4895 C CA   . ASN A 1 48 ? -5.329  -7.466  -3.189  1.00 0.00 ? 839 ASN A CA   6  
ATOM 4896 C C    . ASN A 1 48 ? -3.883  -7.251  -2.767  1.00 0.00 ? 839 ASN A C    6  
ATOM 4897 O O    . ASN A 1 48 ? -2.942  -7.692  -3.442  1.00 0.00 ? 839 ASN A O    6  
ATOM 4898 C CB   . ASN A 1 48 ? -5.404  -8.471  -4.350  1.00 0.00 ? 839 ASN A CB   6  
ATOM 4899 C CG   . ASN A 1 48 ? -5.728  -9.857  -3.817  1.00 0.00 ? 839 ASN A CG   6  
ATOM 4900 O OD1  . ASN A 1 48 ? -6.622  -10.007 -2.982  1.00 0.00 ? 839 ASN A OD1  6  
ATOM 4901 N ND2  . ASN A 1 48 ? -5.063  -10.883 -4.244  1.00 0.00 ? 839 ASN A ND2  6  
ATOM 4902 H H    . ASN A 1 48 ? -6.758  -5.884  -3.144  1.00 0.00 ? 839 ASN A H    6  
ATOM 4903 H HA   . ASN A 1 48 ? -5.877  -7.862  -2.347  1.00 0.00 ? 839 ASN A HA   6  
ATOM 4904 H HB2  . ASN A 1 48 ? -6.179  -8.164  -5.037  1.00 0.00 ? 839 ASN A HB2  6  
ATOM 4905 H HB3  . ASN A 1 48 ? -4.458  -8.498  -4.872  1.00 0.00 ? 839 ASN A HB3  6  
ATOM 4906 H HD21 . ASN A 1 48 ? -4.353  -10.764 -4.909  1.00 0.00 ? 839 ASN A HD21 6  
ATOM 4907 H HD22 . ASN A 1 48 ? -5.273  -11.780 -3.908  1.00 0.00 ? 839 ASN A HD22 6  
ATOM 4908 N N    . VAL A 1 49 ? -3.720  -6.532  -1.675  1.00 0.00 ? 840 VAL A N    6  
ATOM 4909 C CA   . VAL A 1 49 ? -2.407  -6.172  -1.164  1.00 0.00 ? 840 VAL A CA   6  
ATOM 4910 C C    . VAL A 1 49 ? -1.435  -7.354  -1.172  1.00 0.00 ? 840 VAL A C    6  
ATOM 4911 O O    . VAL A 1 49 ? -0.221  -7.166  -1.314  1.00 0.00 ? 840 VAL A O    6  
ATOM 4912 C CB   . VAL A 1 49 ? -2.550  -5.589  0.242   1.00 0.00 ? 840 VAL A CB   6  
ATOM 4913 C CG1  . VAL A 1 49 ? -3.240  -4.225  0.145   1.00 0.00 ? 840 VAL A CG1  6  
ATOM 4914 C CG2  . VAL A 1 49 ? -3.408  -6.524  1.109   1.00 0.00 ? 840 VAL A CG2  6  
ATOM 4915 H H    . VAL A 1 49 ? -4.515  -6.196  -1.212  1.00 0.00 ? 840 VAL A H    6  
ATOM 4916 H HA   . VAL A 1 49 ? -2.000  -5.403  -1.803  1.00 0.00 ? 840 VAL A HA   6  
ATOM 4917 H HB   . VAL A 1 49 ? -1.571  -5.466  0.686   1.00 0.00 ? 840 VAL A HB   6  
ATOM 4918 H HG11 . VAL A 1 49 ? -3.777  -4.155  -0.790  1.00 0.00 ? 840 VAL A HG11 6  
ATOM 4919 H HG12 . VAL A 1 49 ? -2.496  -3.443  0.187   1.00 0.00 ? 840 VAL A HG12 6  
ATOM 4920 H HG13 . VAL A 1 49 ? -3.933  -4.112  0.965   1.00 0.00 ? 840 VAL A HG13 6  
ATOM 4921 H HG21 . VAL A 1 49 ? -3.238  -7.551  0.826   1.00 0.00 ? 840 VAL A HG21 6  
ATOM 4922 H HG22 . VAL A 1 49 ? -4.453  -6.285  0.975   1.00 0.00 ? 840 VAL A HG22 6  
ATOM 4923 H HG23 . VAL A 1 49 ? -3.145  -6.391  2.148   1.00 0.00 ? 840 VAL A HG23 6  
ATOM 4924 N N    . GLN A 1 50 ? -1.960  -8.567  -1.061  1.00 0.00 ? 841 GLN A N    6  
ATOM 4925 C CA   . GLN A 1 50 ? -1.099  -9.748  -1.109  1.00 0.00 ? 841 GLN A CA   6  
ATOM 4926 C C    . GLN A 1 50 ? -0.227  -9.685  -2.354  1.00 0.00 ? 841 GLN A C    6  
ATOM 4927 O O    . GLN A 1 50 ? 0.980   -9.948  -2.304  1.00 0.00 ? 841 GLN A O    6  
ATOM 4928 C CB   . GLN A 1 50 ? -1.917  -11.063 -1.101  1.00 0.00 ? 841 GLN A CB   6  
ATOM 4929 C CG   . GLN A 1 50 ? -3.374  -10.801 -1.497  1.00 0.00 ? 841 GLN A CG   6  
ATOM 4930 C CD   . GLN A 1 50 ? -4.124  -10.180 -0.332  1.00 0.00 ? 841 GLN A CD   6  
ATOM 4931 O OE1  . GLN A 1 50 ? -4.571  -9.046  -0.430  1.00 0.00 ? 841 GLN A OE1  6  
ATOM 4932 N NE2  . GLN A 1 50 ? -4.275  -10.849 0.771   1.00 0.00 ? 841 GLN A NE2  6  
ATOM 4933 H H    . GLN A 1 50 ? -2.933  -8.660  -0.978  1.00 0.00 ? 841 GLN A H    6  
ATOM 4934 H HA   . GLN A 1 50 ? -0.453  -9.733  -0.242  1.00 0.00 ? 841 GLN A HA   6  
ATOM 4935 H HB2  . GLN A 1 50 ? -1.481  -11.759 -1.802  1.00 0.00 ? 841 GLN A HB2  6  
ATOM 4936 H HB3  . GLN A 1 50 ? -1.890  -11.495 -0.111  1.00 0.00 ? 841 GLN A HB3  6  
ATOM 4937 H HG2  . GLN A 1 50 ? -3.405  -10.133 -2.345  1.00 0.00 ? 841 GLN A HG2  6  
ATOM 4938 H HG3  . GLN A 1 50 ? -3.844  -11.736 -1.765  1.00 0.00 ? 841 GLN A HG3  6  
ATOM 4939 H HE21 . GLN A 1 50 ? -3.909  -11.756 0.853   1.00 0.00 ? 841 GLN A HE21 6  
ATOM 4940 H HE22 . GLN A 1 50 ? -4.752  -10.446 1.526   1.00 0.00 ? 841 GLN A HE22 6  
ATOM 4941 N N    . PHE A 1 51 ? -0.832  -9.269  -3.460  1.00 0.00 ? 842 PHE A N    6  
ATOM 4942 C CA   . PHE A 1 51 ? -0.102  -9.109  -4.701  1.00 0.00 ? 842 PHE A CA   6  
ATOM 4943 C C    . PHE A 1 51 ? 0.969   -8.056  -4.524  1.00 0.00 ? 842 PHE A C    6  
ATOM 4944 O O    . PHE A 1 51 ? 2.126   -8.282  -4.843  1.00 0.00 ? 842 PHE A O    6  
ATOM 4945 C CB   . PHE A 1 51 ? -1.050  -8.698  -5.834  1.00 0.00 ? 842 PHE A CB   6  
ATOM 4946 C CG   . PHE A 1 51 ? -2.042  -9.812  -6.145  1.00 0.00 ? 842 PHE A CG   6  
ATOM 4947 C CD1  . PHE A 1 51 ? -1.915  -11.081 -5.549  1.00 0.00 ? 842 PHE A CD1  6  
ATOM 4948 C CD2  . PHE A 1 51 ? -3.093  -9.568  -7.038  1.00 0.00 ? 842 PHE A CD2  6  
ATOM 4949 C CE1  . PHE A 1 51 ? -2.836  -12.088 -5.851  1.00 0.00 ? 842 PHE A CE1  6  
ATOM 4950 C CE2  . PHE A 1 51 ? -4.010  -10.578 -7.336  1.00 0.00 ? 842 PHE A CE2  6  
ATOM 4951 C CZ   . PHE A 1 51 ? -3.883  -11.837 -6.743  1.00 0.00 ? 842 PHE A CZ   6  
ATOM 4952 H H    . PHE A 1 51 ? -1.781  -9.019  -3.428  1.00 0.00 ? 842 PHE A H    6  
ATOM 4953 H HA   . PHE A 1 51 ? 0.373   -10.043 -4.962  1.00 0.00 ? 842 PHE A HA   6  
ATOM 4954 H HB2  . PHE A 1 51 ? -1.593  -7.810  -5.543  1.00 0.00 ? 842 PHE A HB2  6  
ATOM 4955 H HB3  . PHE A 1 51 ? -0.468  -8.484  -6.717  1.00 0.00 ? 842 PHE A HB3  6  
ATOM 4956 H HZ   . PHE A 1 51 ? -4.594  -12.616 -6.975  1.00 0.00 ? 842 PHE A HZ   6  
ATOM 4957 N N    . MET A 1 52 ? 0.581   -6.910  -3.979  1.00 0.00 ? 843 MET A N    6  
ATOM 4958 C CA   . MET A 1 52 ? 1.529   -5.830  -3.740  1.00 0.00 ? 843 MET A CA   6  
ATOM 4959 C C    . MET A 1 52 ? 2.761   -6.361  -3.026  1.00 0.00 ? 843 MET A C    6  
ATOM 4960 O O    . MET A 1 52 ? 3.881   -6.240  -3.523  1.00 0.00 ? 843 MET A O    6  
ATOM 4961 C CB   . MET A 1 52 ? 0.882   -4.732  -2.886  1.00 0.00 ? 843 MET A CB   6  
ATOM 4962 C CG   . MET A 1 52 ? -0.174  -3.991  -3.707  1.00 0.00 ? 843 MET A CG   6  
ATOM 4963 S SD   . MET A 1 52 ? -0.790  -2.575  -2.757  1.00 0.00 ? 843 MET A SD   6  
ATOM 4964 C CE   . MET A 1 52 ? 0.772   -1.660  -2.639  1.00 0.00 ? 843 MET A CE   6  
ATOM 4965 H H    . MET A 1 52 ? -0.356  -6.798  -3.718  1.00 0.00 ? 843 MET A H    6  
ATOM 4966 H HA   . MET A 1 52 ? 1.827   -5.404  -4.686  1.00 0.00 ? 843 MET A HA   6  
ATOM 4967 H HB2  . MET A 1 52 ? 0.419   -5.173  -2.017  1.00 0.00 ? 843 MET A HB2  6  
ATOM 4968 H HB3  . MET A 1 52 ? 1.641   -4.036  -2.566  1.00 0.00 ? 843 MET A HB3  6  
ATOM 4969 H HG2  . MET A 1 52 ? 0.262   -3.646  -4.632  1.00 0.00 ? 843 MET A HG2  6  
ATOM 4970 H HG3  . MET A 1 52 ? -0.996  -4.658  -3.928  1.00 0.00 ? 843 MET A HG3  6  
ATOM 4971 H HE1  . MET A 1 52 ? 1.474   -2.036  -3.371  1.00 0.00 ? 843 MET A HE1  6  
ATOM 4972 H HE2  . MET A 1 52 ? 1.193   -1.780  -1.654  1.00 0.00 ? 843 MET A HE2  6  
ATOM 4973 H HE3  . MET A 1 52 ? 0.586   -0.610  -2.817  1.00 0.00 ? 843 MET A HE3  6  
ATOM 4974 N N    . GLY A 1 53 ? 2.539   -6.982  -1.878  1.00 0.00 ? 844 GLY A N    6  
ATOM 4975 C CA   . GLY A 1 53 ? 3.631   -7.550  -1.096  1.00 0.00 ? 844 GLY A CA   6  
ATOM 4976 C C    . GLY A 1 53 ? 4.432   -8.540  -1.915  1.00 0.00 ? 844 GLY A C    6  
ATOM 4977 O O    . GLY A 1 53 ? 5.645   -8.666  -1.742  1.00 0.00 ? 844 GLY A O    6  
ATOM 4978 H H    . GLY A 1 53 ? 1.614   -7.070  -1.554  1.00 0.00 ? 844 GLY A H    6  
ATOM 4979 H HA2  . GLY A 1 53 ? 4.282   -6.754  -0.769  1.00 0.00 ? 844 GLY A HA2  6  
ATOM 4980 H HA3  . GLY A 1 53 ? 3.225   -8.057  -0.234  1.00 0.00 ? 844 GLY A HA3  6  
ATOM 4981 N N    . SER A 1 54 ? 3.755   -9.246  -2.798  1.00 0.00 ? 845 SER A N    6  
ATOM 4982 C CA   . SER A 1 54 ? 4.407   -10.240 -3.633  1.00 0.00 ? 845 SER A CA   6  
ATOM 4983 C C    . SER A 1 54 ? 4.922   -9.624  -4.931  1.00 0.00 ? 845 SER A C    6  
ATOM 4984 O O    . SER A 1 54 ? 5.636   -10.281 -5.698  1.00 0.00 ? 845 SER A O    6  
ATOM 4985 C CB   . SER A 1 54 ? 3.428   -11.364 -3.956  1.00 0.00 ? 845 SER A CB   6  
ATOM 4986 O OG   . SER A 1 54 ? 2.620   -11.631 -2.807  1.00 0.00 ? 845 SER A OG   6  
ATOM 4987 H H    . SER A 1 54 ? 2.788   -9.107  -2.887  1.00 0.00 ? 845 SER A H    6  
ATOM 4988 H HA   . SER A 1 54 ? 5.241   -10.661 -3.093  1.00 0.00 ? 845 SER A HA   6  
ATOM 4989 H HB2  . SER A 1 54 ? 2.791   -11.066 -4.774  1.00 0.00 ? 845 SER A HB2  6  
ATOM 4990 H HB3  . SER A 1 54 ? 3.984   -12.244 -4.245  1.00 0.00 ? 845 SER A HB3  6  
ATOM 4991 H HG   . SER A 1 54 ? 2.092   -10.835 -2.618  1.00 0.00 ? 845 SER A HG   6  
ATOM 4992 N N    . ASN A 1 55 ? 4.535   -8.385  -5.195  1.00 0.00 ? 846 ASN A N    6  
ATOM 4993 C CA   . ASN A 1 55 ? 4.923   -7.723  -6.437  1.00 0.00 ? 846 ASN A CA   6  
ATOM 4994 C C    . ASN A 1 55 ? 6.000   -6.678  -6.208  1.00 0.00 ? 846 ASN A C    6  
ATOM 4995 O O    . ASN A 1 55 ? 7.046   -6.702  -6.864  1.00 0.00 ? 846 ASN A O    6  
ATOM 4996 C CB   . ASN A 1 55 ? 3.694   -7.070  -7.095  1.00 0.00 ? 846 ASN A CB   6  
ATOM 4997 C CG   . ASN A 1 55 ? 4.119   -6.023  -8.132  1.00 0.00 ? 846 ASN A CG   6  
ATOM 4998 O OD1  . ASN A 1 55 ? 5.218   -6.098  -8.689  1.00 0.00 ? 846 ASN A OD1  6  
ATOM 4999 N ND2  . ASN A 1 55 ? 3.311   -5.049  -8.427  1.00 0.00 ? 846 ASN A ND2  6  
ATOM 5000 H H    . ASN A 1 55 ? 3.946   -7.919  -4.560  1.00 0.00 ? 846 ASN A H    6  
ATOM 5001 H HA   . ASN A 1 55 ? 5.306   -8.467  -7.119  1.00 0.00 ? 846 ASN A HA   6  
ATOM 5002 H HB2  . ASN A 1 55 ? 3.105   -7.833  -7.581  1.00 0.00 ? 846 ASN A HB2  6  
ATOM 5003 H HB3  . ASN A 1 55 ? 3.097   -6.594  -6.333  1.00 0.00 ? 846 ASN A HB3  6  
ATOM 5004 H HD21 . ASN A 1 55 ? 2.437   -4.985  -7.989  1.00 0.00 ? 846 ASN A HD21 6  
ATOM 5005 H HD22 . ASN A 1 55 ? 3.575   -4.377  -9.092  1.00 0.00 ? 846 ASN A HD22 6  
ATOM 5006 N N    . VAL A 1 56 ? 5.746   -5.745  -5.310  1.00 0.00 ? 847 VAL A N    6  
ATOM 5007 C CA   . VAL A 1 56 ? 6.700   -4.675  -5.066  1.00 0.00 ? 847 VAL A CA   6  
ATOM 5008 C C    . VAL A 1 56 ? 6.581   -4.139  -3.650  1.00 0.00 ? 847 VAL A C    6  
ATOM 5009 O O    . VAL A 1 56 ? 5.480   -3.910  -3.152  1.00 0.00 ? 847 VAL A O    6  
ATOM 5010 C CB   . VAL A 1 56 ? 6.473   -3.539  -6.081  1.00 0.00 ? 847 VAL A CB   6  
ATOM 5011 C CG1  . VAL A 1 56 ? 4.996   -3.124  -6.069  1.00 0.00 ? 847 VAL A CG1  6  
ATOM 5012 C CG2  . VAL A 1 56 ? 7.345   -2.326  -5.719  1.00 0.00 ? 847 VAL A CG2  6  
ATOM 5013 H H    . VAL A 1 56 ? 4.895   -5.754  -4.816  1.00 0.00 ? 847 VAL A H    6  
ATOM 5014 H HA   . VAL A 1 56 ? 7.697   -5.062  -5.209  1.00 0.00 ? 847 VAL A HA   6  
ATOM 5015 H HB   . VAL A 1 56 ? 6.732   -3.891  -7.069  1.00 0.00 ? 847 VAL A HB   6  
ATOM 5016 H HG11 . VAL A 1 56 ? 4.867   -2.273  -5.417  1.00 0.00 ? 847 VAL A HG11 6  
ATOM 5017 H HG12 . VAL A 1 56 ? 4.388   -3.940  -5.711  1.00 0.00 ? 847 VAL A HG12 6  
ATOM 5018 H HG13 . VAL A 1 56 ? 4.687   -2.859  -7.068  1.00 0.00 ? 847 VAL A HG13 6  
ATOM 5019 H HG21 . VAL A 1 56 ? 7.431   -1.676  -6.578  1.00 0.00 ? 847 VAL A HG21 6  
ATOM 5020 H HG22 . VAL A 1 56 ? 8.327   -2.658  -5.421  1.00 0.00 ? 847 VAL A HG22 6  
ATOM 5021 H HG23 . VAL A 1 56 ? 6.887   -1.783  -4.904  1.00 0.00 ? 847 VAL A HG23 6  
ATOM 5022 N N    . MET A 1 57 ? 7.719   -3.886  -3.031  1.00 0.00 ? 848 MET A N    6  
ATOM 5023 C CA   . MET A 1 57 ? 7.746   -3.308  -1.706  1.00 0.00 ? 848 MET A CA   6  
ATOM 5024 C C    . MET A 1 57 ? 8.865   -2.282  -1.613  1.00 0.00 ? 848 MET A C    6  
ATOM 5025 O O    . MET A 1 57 ? 10.030  -2.643  -1.438  1.00 0.00 ? 848 MET A O    6  
ATOM 5026 C CB   . MET A 1 57 ? 7.951   -4.407  -0.652  1.00 0.00 ? 848 MET A CB   6  
ATOM 5027 C CG   . MET A 1 57 ? 8.983   -5.428  -1.147  1.00 0.00 ? 848 MET A CG   6  
ATOM 5028 S SD   . MET A 1 57 ? 9.406   -6.545  0.211   1.00 0.00 ? 848 MET A SD   6  
ATOM 5029 C CE   . MET A 1 57 ? 7.822   -7.418  0.296   1.00 0.00 ? 848 MET A CE   6  
ATOM 5030 H H    . MET A 1 57 ? 8.566   -4.051  -3.496  1.00 0.00 ? 848 MET A H    6  
ATOM 5031 H HA   . MET A 1 57 ? 6.800   -2.820  -1.517  1.00 0.00 ? 848 MET A HA   6  
ATOM 5032 H HB2  . MET A 1 57 ? 8.303   -3.963  0.267   1.00 0.00 ? 848 MET A HB2  6  
ATOM 5033 H HB3  . MET A 1 57 ? 7.016   -4.912  -0.474  1.00 0.00 ? 848 MET A HB3  6  
ATOM 5034 H HG2  . MET A 1 57 ? 8.567   -5.997  -1.965  1.00 0.00 ? 848 MET A HG2  6  
ATOM 5035 H HG3  . MET A 1 57 ? 9.873   -4.918  -1.481  1.00 0.00 ? 848 MET A HG3  6  
ATOM 5036 H HE1  . MET A 1 57 ? 7.383   -7.465  -0.691  1.00 0.00 ? 848 MET A HE1  6  
ATOM 5037 H HE2  . MET A 1 57 ? 7.151   -6.896  0.958   1.00 0.00 ? 848 MET A HE2  6  
ATOM 5038 H HE3  . MET A 1 57 ? 7.987   -8.419  0.674   1.00 0.00 ? 848 MET A HE3  6  
ATOM 5039 N N    . GLU A 1 58 ? 8.511   -1.004  -1.711  1.00 0.00 ? 849 GLU A N    6  
ATOM 5040 C CA   . GLU A 1 58 ? 9.498   0.066   -1.629  1.00 0.00 ? 849 GLU A CA   6  
ATOM 5041 C C    . GLU A 1 58 ? 8.837   1.439   -1.745  1.00 0.00 ? 849 GLU A C    6  
ATOM 5042 O O    . GLU A 1 58 ? 7.632   1.585   -1.517  1.00 0.00 ? 849 GLU A O    6  
ATOM 5043 C CB   . GLU A 1 58 ? 10.576  -0.099  -2.717  1.00 0.00 ? 849 GLU A CB   6  
ATOM 5044 C CG   . GLU A 1 58 ? 9.959   0.085   -4.112  1.00 0.00 ? 849 GLU A CG   6  
ATOM 5045 C CD   . GLU A 1 58 ? 10.811  1.043   -4.921  1.00 0.00 ? 849 GLU A CD   6  
ATOM 5046 O OE1  . GLU A 1 58 ? 10.938  2.177   -4.513  1.00 0.00 ? 849 GLU A OE1  6  
ATOM 5047 O OE2  . GLU A 1 58 ? 11.340  0.624   -5.926  1.00 0.00 ? 849 GLU A OE2  6  
ATOM 5048 H H    . GLU A 1 58 ? 7.568   -0.773  -1.841  1.00 0.00 ? 849 GLU A H    6  
ATOM 5049 H HA   . GLU A 1 58 ? 9.980   0.007   -0.666  1.00 0.00 ? 849 GLU A HA   6  
ATOM 5050 N N    . ASP A 1 59 ? 9.643   2.442   -2.059  1.00 0.00 ? 850 ASP A N    6  
ATOM 5051 C CA   . ASP A 1 59 ? 9.171   3.814   -2.176  1.00 0.00 ? 850 ASP A CA   6  
ATOM 5052 C C    . ASP A 1 59 ? 8.340   4.030   -3.432  1.00 0.00 ? 850 ASP A C    6  
ATOM 5053 O O    . ASP A 1 59 ? 7.256   4.613   -3.371  1.00 0.00 ? 850 ASP A O    6  
ATOM 5054 C CB   . ASP A 1 59 ? 10.361  4.780   -2.175  1.00 0.00 ? 850 ASP A CB   6  
ATOM 5055 C CG   . ASP A 1 59 ? 11.321  4.423   -1.057  1.00 0.00 ? 850 ASP A CG   6  
ATOM 5056 O OD1  . ASP A 1 59 ? 12.093  3.511   -1.238  1.00 0.00 ? 850 ASP A OD1  6  
ATOM 5057 O OD2  . ASP A 1 59 ? 11.260  5.058   -0.022  1.00 0.00 ? 850 ASP A OD2  6  
ATOM 5058 H H    . ASP A 1 59 ? 10.596  2.260   -2.206  1.00 0.00 ? 850 ASP A H    6  
ATOM 5059 H HA   . ASP A 1 59 ? 8.555   4.037   -1.323  1.00 0.00 ? 850 ASP A HA   6  
ATOM 5060 N N    . GLN A 1 60 ? 8.877   3.616   -4.575  1.00 0.00 ? 851 GLN A N    6  
ATOM 5061 C CA   . GLN A 1 60 ? 8.215   3.839   -5.864  1.00 0.00 ? 851 GLN A CA   6  
ATOM 5062 C C    . GLN A 1 60 ? 6.747   3.457   -5.814  1.00 0.00 ? 851 GLN A C    6  
ATOM 5063 O O    . GLN A 1 60 ? 5.908   4.121   -6.422  1.00 0.00 ? 851 GLN A O    6  
ATOM 5064 C CB   . GLN A 1 60 ? 8.914   3.047   -6.976  1.00 0.00 ? 851 GLN A CB   6  
ATOM 5065 C CG   . GLN A 1 60 ? 10.351  3.554   -7.152  1.00 0.00 ? 851 GLN A CG   6  
ATOM 5066 C CD   . GLN A 1 60 ? 10.400  4.658   -8.204  1.00 0.00 ? 851 GLN A CD   6  
ATOM 5067 O OE1  . GLN A 1 60 ? 10.902  5.751   -7.933  1.00 0.00 ? 851 GLN A OE1  6  
ATOM 5068 N NE2  . GLN A 1 60 ? 9.917   4.441   -9.390  1.00 0.00 ? 851 GLN A NE2  6  
ATOM 5069 H H    . GLN A 1 60 ? 9.766   3.189   -4.556  1.00 0.00 ? 851 GLN A H    6  
ATOM 5070 H HA   . GLN A 1 60 ? 8.285   4.890   -6.103  1.00 0.00 ? 851 GLN A HA   6  
ATOM 5071 H HB2  . GLN A 1 60 ? 8.929   1.998   -6.713  1.00 0.00 ? 851 GLN A HB2  6  
ATOM 5072 H HB3  . GLN A 1 60 ? 8.372   3.174   -7.901  1.00 0.00 ? 851 GLN A HB3  6  
ATOM 5073 H HG2  . GLN A 1 60 ? 10.716  3.940   -6.212  1.00 0.00 ? 851 GLN A HG2  6  
ATOM 5074 H HG3  . GLN A 1 60 ? 10.979  2.734   -7.467  1.00 0.00 ? 851 GLN A HG3  6  
ATOM 5075 H HE21 . GLN A 1 60 ? 9.522   3.570   -9.610  1.00 0.00 ? 851 GLN A HE21 6  
ATOM 5076 H HE22 . GLN A 1 60 ? 9.944   5.147   -10.071 1.00 0.00 ? 851 GLN A HE22 6  
ATOM 5077 N N    . ASP A 1 61 ? 6.436   2.388   -5.103  1.00 0.00 ? 852 ASP A N    6  
ATOM 5078 C CA   . ASP A 1 61 ? 5.055   1.935   -5.003  1.00 0.00 ? 852 ASP A CA   6  
ATOM 5079 C C    . ASP A 1 61 ? 4.173   3.035   -4.434  1.00 0.00 ? 852 ASP A C    6  
ATOM 5080 O O    . ASP A 1 61 ? 3.252   3.528   -5.102  1.00 0.00 ? 852 ASP A O    6  
ATOM 5081 C CB   . ASP A 1 61 ? 4.962   0.697   -4.115  1.00 0.00 ? 852 ASP A CB   6  
ATOM 5082 C CG   . ASP A 1 61 ? 3.517   0.256   -4.017  1.00 0.00 ? 852 ASP A CG   6  
ATOM 5083 O OD1  . ASP A 1 61 ? 2.813   0.787   -3.183  1.00 0.00 ? 852 ASP A OD1  6  
ATOM 5084 O OD2  . ASP A 1 61 ? 3.126   -0.587  -4.797  1.00 0.00 ? 852 ASP A OD2  6  
ATOM 5085 H H    . ASP A 1 61 ? 7.147   1.892   -4.647  1.00 0.00 ? 852 ASP A H    6  
ATOM 5086 H HA   . ASP A 1 61 ? 4.696   1.682   -5.988  1.00 0.00 ? 852 ASP A HA   6  
ATOM 5087 N N    . LEU A 1 62 ? 4.469   3.435   -3.213  1.00 0.00 ? 853 LEU A N    6  
ATOM 5088 C CA   . LEU A 1 62 ? 3.718   4.492   -2.564  1.00 0.00 ? 853 LEU A CA   6  
ATOM 5089 C C    . LEU A 1 62 ? 3.900   5.790   -3.321  1.00 0.00 ? 853 LEU A C    6  
ATOM 5090 O O    . LEU A 1 62 ? 2.953   6.568   -3.489  1.00 0.00 ? 853 LEU A O    6  
ATOM 5091 C CB   . LEU A 1 62 ? 4.174   4.654   -1.122  1.00 0.00 ? 853 LEU A CB   6  
ATOM 5092 C CG   . LEU A 1 62 ? 3.824   3.386   -0.337  1.00 0.00 ? 853 LEU A CG   6  
ATOM 5093 C CD1  . LEU A 1 62 ? 4.718   3.279   0.890   1.00 0.00 ? 853 LEU A CD1  6  
ATOM 5094 C CD2  . LEU A 1 62 ? 2.355   3.435   0.098   1.00 0.00 ? 853 LEU A CD2  6  
ATOM 5095 H H    . LEU A 1 62 ? 5.221   3.016   -2.745  1.00 0.00 ? 853 LEU A H    6  
ATOM 5096 H HA   . LEU A 1 62 ? 2.672   4.224   -2.569  1.00 0.00 ? 853 LEU A HA   6  
ATOM 5097 H HB2  . LEU A 1 62 ? 5.244   4.818   -1.104  1.00 0.00 ? 853 LEU A HB2  6  
ATOM 5098 H HB3  . LEU A 1 62 ? 3.673   5.501   -0.682  1.00 0.00 ? 853 LEU A HB3  6  
ATOM 5099 H HG   . LEU A 1 62 ? 3.985   2.519   -0.966  1.00 0.00 ? 853 LEU A HG   6  
ATOM 5100 H HD11 . LEU A 1 62 ? 5.476   2.532   0.708   1.00 0.00 ? 853 LEU A HD11 6  
ATOM 5101 H HD12 . LEU A 1 62 ? 4.129   2.994   1.750   1.00 0.00 ? 853 LEU A HD12 6  
ATOM 5102 H HD13 . LEU A 1 62 ? 5.192   4.231   1.078   1.00 0.00 ? 853 LEU A HD13 6  
ATOM 5103 H HD21 . LEU A 1 62 ? 2.269   3.939   1.049   1.00 0.00 ? 853 LEU A HD21 6  
ATOM 5104 H HD22 . LEU A 1 62 ? 1.979   2.426   0.190   1.00 0.00 ? 853 LEU A HD22 6  
ATOM 5105 H HD23 . LEU A 1 62 ? 1.774   3.961   -0.645  1.00 0.00 ? 853 LEU A HD23 6  
ATOM 5106 N N    . LEU A 1 63 ? 5.114   6.005   -3.804  1.00 0.00 ? 854 LEU A N    6  
ATOM 5107 C CA   . LEU A 1 63 ? 5.417   7.193   -4.587  1.00 0.00 ? 854 LEU A CA   6  
ATOM 5108 C C    . LEU A 1 63 ? 4.452   7.287   -5.753  1.00 0.00 ? 854 LEU A C    6  
ATOM 5109 O O    . LEU A 1 63 ? 3.850   8.335   -5.994  1.00 0.00 ? 854 LEU A O    6  
ATOM 5110 C CB   . LEU A 1 63 ? 6.859   7.139   -5.110  1.00 0.00 ? 854 LEU A CB   6  
ATOM 5111 C CG   . LEU A 1 63 ? 7.402   8.561   -5.280  1.00 0.00 ? 854 LEU A CG   6  
ATOM 5112 C CD1  . LEU A 1 63 ? 7.823   9.118   -3.920  1.00 0.00 ? 854 LEU A CD1  6  
ATOM 5113 C CD2  . LEU A 1 63 ? 8.616   8.538   -6.213  1.00 0.00 ? 854 LEU A CD2  6  
ATOM 5114 H H    . LEU A 1 63 ? 5.815   5.331   -3.648  1.00 0.00 ? 854 LEU A H    6  
ATOM 5115 H HA   . LEU A 1 63 ? 5.299   8.064   -3.962  1.00 0.00 ? 854 LEU A HA   6  
ATOM 5116 H HB2  . LEU A 1 63 ? 7.479   6.598   -4.410  1.00 0.00 ? 854 LEU A HB2  6  
ATOM 5117 H HB3  . LEU A 1 63 ? 6.873   6.635   -6.065  1.00 0.00 ? 854 LEU A HB3  6  
ATOM 5118 H HG   . LEU A 1 63 ? 6.633   9.194   -5.703  1.00 0.00 ? 854 LEU A HG   6  
ATOM 5119 H HD11 . LEU A 1 63 ? 7.024   8.987   -3.207  1.00 0.00 ? 854 LEU A HD11 6  
ATOM 5120 H HD12 . LEU A 1 63 ? 8.044   10.170  -4.019  1.00 0.00 ? 854 LEU A HD12 6  
ATOM 5121 H HD13 . LEU A 1 63 ? 8.704   8.598   -3.573  1.00 0.00 ? 854 LEU A HD13 6  
ATOM 5122 H HD21 . LEU A 1 63 ? 9.454   8.080   -5.707  1.00 0.00 ? 854 LEU A HD21 6  
ATOM 5123 H HD22 . LEU A 1 63 ? 8.873   9.549   -6.492  1.00 0.00 ? 854 LEU A HD22 6  
ATOM 5124 H HD23 . LEU A 1 63 ? 8.377   7.971   -7.100  1.00 0.00 ? 854 LEU A HD23 6  
ATOM 5125 N N    . GLU A 1 64 ? 4.273   6.171   -6.448  1.00 0.00 ? 855 GLU A N    6  
ATOM 5126 C CA   . GLU A 1 64 ? 3.345   6.116   -7.560  1.00 0.00 ? 855 GLU A CA   6  
ATOM 5127 C C    . GLU A 1 64 ? 1.978   6.612   -7.120  1.00 0.00 ? 855 GLU A C    6  
ATOM 5128 O O    . GLU A 1 64 ? 1.411   7.525   -7.726  1.00 0.00 ? 855 GLU A O    6  
ATOM 5129 C CB   . GLU A 1 64 ? 3.235   4.684   -8.084  1.00 0.00 ? 855 GLU A CB   6  
ATOM 5130 C CG   . GLU A 1 64 ? 4.395   4.395   -9.038  1.00 0.00 ? 855 GLU A CG   6  
ATOM 5131 C CD   . GLU A 1 64 ? 4.067   4.916   -10.418 1.00 0.00 ? 855 GLU A CD   6  
ATOM 5132 O OE1  . GLU A 1 64 ? 3.388   4.222   -11.138 1.00 0.00 ? 855 GLU A OE1  6  
ATOM 5133 O OE2  . GLU A 1 64 ? 4.506   5.995   -10.743 1.00 0.00 ? 855 GLU A OE2  6  
ATOM 5134 H H    . GLU A 1 64 ? 4.760   5.358   -6.189  1.00 0.00 ? 855 GLU A H    6  
ATOM 5135 H HA   . GLU A 1 64 ? 3.708   6.752   -8.351  1.00 0.00 ? 855 GLU A HA   6  
ATOM 5136 N N    . ILE A 1 65 ? 1.463   6.032   -6.042  1.00 0.00 ? 856 ILE A N    6  
ATOM 5137 C CA   . ILE A 1 65 ? 0.168   6.453   -5.516  1.00 0.00 ? 856 ILE A CA   6  
ATOM 5138 C C    . ILE A 1 65 ? 0.234   7.910   -5.054  1.00 0.00 ? 856 ILE A C    6  
ATOM 5139 O O    . ILE A 1 65 ? -0.795  8.563   -4.871  1.00 0.00 ? 856 ILE A O    6  
ATOM 5140 C CB   . ILE A 1 65 ? -0.290  5.543   -4.357  1.00 0.00 ? 856 ILE A CB   6  
ATOM 5141 C CG1  . ILE A 1 65 ? 0.490   4.220   -4.383  1.00 0.00 ? 856 ILE A CG1  6  
ATOM 5142 C CG2  . ILE A 1 65 ? -1.778  5.246   -4.505  1.00 0.00 ? 856 ILE A CG2  6  
ATOM 5143 C CD1  . ILE A 1 65 ? -0.151  3.221   -3.417  1.00 0.00 ? 856 ILE A CD1  6  
ATOM 5144 H H    . ILE A 1 65 ? 1.973   5.326   -5.590  1.00 0.00 ? 856 ILE A H    6  
ATOM 5145 H HA   . ILE A 1 65 ? -0.556  6.388   -6.316  1.00 0.00 ? 856 ILE A HA   6  
ATOM 5146 H HB   . ILE A 1 65 ? -0.122  6.053   -3.418  1.00 0.00 ? 856 ILE A HB   6  
ATOM 5147 H HG12 . ILE A 1 65 ? 0.475   3.809   -5.382  1.00 0.00 ? 856 ILE A HG12 6  
ATOM 5148 H HG21 . ILE A 1 65 ? -1.939  4.679   -5.409  1.00 0.00 ? 856 ILE A HG21 6  
ATOM 5149 H HG22 . ILE A 1 65 ? -2.329  6.173   -4.558  1.00 0.00 ? 856 ILE A HG22 6  
ATOM 5150 H HG23 . ILE A 1 65 ? -2.116  4.671   -3.657  1.00 0.00 ? 856 ILE A HG23 6  
ATOM 5151 H HD11 . ILE A 1 65 ? -1.027  2.788   -3.878  1.00 0.00 ? 856 ILE A HD11 6  
ATOM 5152 H HD12 . ILE A 1 65 ? -0.436  3.727   -2.507  1.00 0.00 ? 856 ILE A HD12 6  
ATOM 5153 H HD13 . ILE A 1 65 ? 0.558   2.438   -3.188  1.00 0.00 ? 856 ILE A HD13 6  
ATOM 5154 N N    . GLY A 1 66 ? 1.448   8.419   -4.899  1.00 0.00 ? 857 GLY A N    6  
ATOM 5155 C CA   . GLY A 1 66 ? 1.654   9.806   -4.501  1.00 0.00 ? 857 GLY A CA   6  
ATOM 5156 C C    . GLY A 1 66 ? 1.503   9.991   -3.003  1.00 0.00 ? 857 GLY A C    6  
ATOM 5157 O O    . GLY A 1 66 ? 1.093   11.062  -2.540  1.00 0.00 ? 857 GLY A O    6  
ATOM 5158 H H    . GLY A 1 66 ? 2.229   7.854   -5.078  1.00 0.00 ? 857 GLY A H    6  
ATOM 5159 H HA2  . GLY A 1 66 ? 2.647   10.112  -4.792  1.00 0.00 ? 857 GLY A HA2  6  
ATOM 5160 H HA3  . GLY A 1 66 ? 0.931   10.428  -5.005  1.00 0.00 ? 857 GLY A HA3  6  
ATOM 5161 N N    . ILE A 1 67 ? 1.853   8.968   -2.242  1.00 0.00 ? 858 ILE A N    6  
ATOM 5162 C CA   . ILE A 1 67 ? 1.769   9.054   -0.792  1.00 0.00 ? 858 ILE A CA   6  
ATOM 5163 C C    . ILE A 1 67 ? 2.921   9.899   -0.247  1.00 0.00 ? 858 ILE A C    6  
ATOM 5164 O O    . ILE A 1 67 ? 4.067   9.447   -0.202  1.00 0.00 ? 858 ILE A O    6  
ATOM 5165 C CB   . ILE A 1 67 ? 1.796   7.651   -0.166  1.00 0.00 ? 858 ILE A CB   6  
ATOM 5166 C CG1  . ILE A 1 67 ? 0.824   6.727   -0.914  1.00 0.00 ? 858 ILE A CG1  6  
ATOM 5167 C CG2  . ILE A 1 67 ? 1.380   7.736   1.304   1.00 0.00 ? 858 ILE A CG2  6  
ATOM 5168 C CD1  . ILE A 1 67 ? -0.594  7.310   -0.861  1.00 0.00 ? 858 ILE A CD1  6  
ATOM 5169 H H    . ILE A 1 67 ? 2.193   8.149   -2.662  1.00 0.00 ? 858 ILE A H    6  
ATOM 5170 H HA   . ILE A 1 67 ? 0.836   9.532   -0.532  1.00 0.00 ? 858 ILE A HA   6  
ATOM 5171 H HB   . ILE A 1 67 ? 2.800   7.259   -0.232  1.00 0.00 ? 858 ILE A HB   6  
ATOM 5172 H HG12 . ILE A 1 67 ? 1.138   6.631   -1.943  1.00 0.00 ? 858 ILE A HG12 6  
ATOM 5173 H HG21 . ILE A 1 67 ? 2.048   8.402   1.828   1.00 0.00 ? 858 ILE A HG21 6  
ATOM 5174 H HG22 . ILE A 1 67 ? 1.428   6.755   1.750   1.00 0.00 ? 858 ILE A HG22 6  
ATOM 5175 H HG23 . ILE A 1 67 ? 0.370   8.112   1.371   1.00 0.00 ? 858 ILE A HG23 6  
ATOM 5176 H HD11 . ILE A 1 67 ? -0.678  8.123   -1.569  1.00 0.00 ? 858 ILE A HD11 6  
ATOM 5177 H HD12 . ILE A 1 67 ? -0.800  7.679   0.133   1.00 0.00 ? 858 ILE A HD12 6  
ATOM 5178 H HD13 . ILE A 1 67 ? -1.309  6.541   -1.113  1.00 0.00 ? 858 ILE A HD13 6  
ATOM 5179 N N    . LEU A 1 68 ? 2.611   11.126  0.153   1.00 0.00 ? 859 LEU A N    6  
ATOM 5180 C CA   . LEU A 1 68 ? 3.621   12.042  0.681   1.00 0.00 ? 859 LEU A CA   6  
ATOM 5181 C C    . LEU A 1 68 ? 3.943   11.721  2.134   1.00 0.00 ? 859 LEU A C    6  
ATOM 5182 O O    . LEU A 1 68 ? 4.894   12.260  2.700   1.00 0.00 ? 859 LEU A O    6  
ATOM 5183 C CB   . LEU A 1 68 ? 3.131   13.494  0.573   1.00 0.00 ? 859 LEU A CB   6  
ATOM 5184 C CG   . LEU A 1 68 ? 2.782   13.820  -0.888  1.00 0.00 ? 859 LEU A CG   6  
ATOM 5185 C CD1  . LEU A 1 68 ? 1.989   15.128  -0.950  1.00 0.00 ? 859 LEU A CD1  6  
ATOM 5186 C CD2  . LEU A 1 68 ? 4.069   13.971  -1.706  1.00 0.00 ? 859 LEU A CD2  6  
ATOM 5187 H H    . LEU A 1 68 ? 1.679   11.427  0.089   1.00 0.00 ? 859 LEU A H    6  
ATOM 5188 H HA   . LEU A 1 68 ? 4.524   11.942  0.096   1.00 0.00 ? 859 LEU A HA   6  
ATOM 5189 H HB2  . LEU A 1 68 ? 2.254   13.619  1.194   1.00 0.00 ? 859 LEU A HB2  6  
ATOM 5190 H HB3  . LEU A 1 68 ? 3.907   14.161  0.916   1.00 0.00 ? 859 LEU A HB3  6  
ATOM 5191 H HG   . LEU A 1 68 ? 2.180   13.023  -1.301  1.00 0.00 ? 859 LEU A HG   6  
ATOM 5192 H HD11 . LEU A 1 68 ? 1.305   15.177  -0.115  1.00 0.00 ? 859 LEU A HD11 6  
ATOM 5193 H HD12 . LEU A 1 68 ? 1.431   15.164  -1.873  1.00 0.00 ? 859 LEU A HD12 6  
ATOM 5194 H HD13 . LEU A 1 68 ? 2.669   15.965  -0.909  1.00 0.00 ? 859 LEU A HD13 6  
ATOM 5195 H HD21 . LEU A 1 68 ? 3.945   14.761  -2.432  1.00 0.00 ? 859 LEU A HD21 6  
ATOM 5196 H HD22 . LEU A 1 68 ? 4.280   13.045  -2.219  1.00 0.00 ? 859 LEU A HD22 6  
ATOM 5197 H HD23 . LEU A 1 68 ? 4.892   14.214  -1.050  1.00 0.00 ? 859 LEU A HD23 6  
ATOM 5198 N N    . ASN A 1 69 ? 3.133   10.864  2.739   1.00 0.00 ? 860 ASN A N    6  
ATOM 5199 C CA   . ASN A 1 69 ? 3.318   10.489  4.143   1.00 0.00 ? 860 ASN A CA   6  
ATOM 5200 C C    . ASN A 1 69 ? 4.750   10.029  4.410   1.00 0.00 ? 860 ASN A C    6  
ATOM 5201 O O    . ASN A 1 69 ? 5.490   9.687   3.484   1.00 0.00 ? 860 ASN A O    6  
ATOM 5202 C CB   . ASN A 1 69 ? 2.337   9.379   4.529   1.00 0.00 ? 860 ASN A CB   6  
ATOM 5203 C CG   . ASN A 1 69 ? 0.911   9.917   4.521   1.00 0.00 ? 860 ASN A CG   6  
ATOM 5204 O OD1  . ASN A 1 69 ? 0.080   9.464   3.729   1.00 0.00 ? 860 ASN A OD1  6  
ATOM 5205 N ND2  . ASN A 1 69 ? 0.573   10.857  5.348   1.00 0.00 ? 860 ASN A ND2  6  
ATOM 5206 H H    . ASN A 1 69 ? 2.380   10.490  2.234   1.00 0.00 ? 860 ASN A H    6  
ATOM 5207 H HA   . ASN A 1 69 ? 3.115   11.353  4.758   1.00 0.00 ? 860 ASN A HA   6  
ATOM 5208 H HB2  . ASN A 1 69 ? 2.419   8.568   3.823   1.00 0.00 ? 860 ASN A HB2  6  
ATOM 5209 H HB3  . ASN A 1 69 ? 2.575   9.016   5.517   1.00 0.00 ? 860 ASN A HB3  6  
ATOM 5210 H HD21 . ASN A 1 69 ? 1.234   11.221  5.975   1.00 0.00 ? 860 ASN A HD21 6  
ATOM 5211 H HD22 . ASN A 1 69 ? -0.342  11.207  5.348   1.00 0.00 ? 860 ASN A HD22 6  
ATOM 5212 N N    . SER A 1 70 ? 5.146   10.046  5.676   1.00 0.00 ? 861 SER A N    6  
ATOM 5213 C CA   . SER A 1 70 ? 6.493   9.632   6.066   1.00 0.00 ? 861 SER A CA   6  
ATOM 5214 C C    . SER A 1 70 ? 6.541   8.145   6.454   1.00 0.00 ? 861 SER A C    6  
ATOM 5215 O O    . SER A 1 70 ? 7.394   7.392   5.981   1.00 0.00 ? 861 SER A O    6  
ATOM 5216 C CB   . SER A 1 70 ? 6.986   10.493  7.232   1.00 0.00 ? 861 SER A CB   6  
ATOM 5217 O OG   . SER A 1 70 ? 5.874   11.177  7.816   1.00 0.00 ? 861 SER A OG   6  
ATOM 5218 H H    . SER A 1 70 ? 4.522   10.348  6.370   1.00 0.00 ? 861 SER A H    6  
ATOM 5219 H HA   . SER A 1 70 ? 7.158   9.787   5.228   1.00 0.00 ? 861 SER A HA   6  
ATOM 5220 H HB2  . SER A 1 70 ? 7.453   9.869   7.977   1.00 0.00 ? 861 SER A HB2  6  
ATOM 5221 H HB3  . SER A 1 70 ? 7.716   11.203  6.864   1.00 0.00 ? 861 SER A HB3  6  
ATOM 5222 H HG   . SER A 1 70 ? 5.729   11.986  7.306   1.00 0.00 ? 861 SER A HG   6  
ATOM 5223 N N    . GLY A 1 71 ? 5.661   7.749   7.368   1.00 0.00 ? 862 GLY A N    6  
ATOM 5224 C CA   . GLY A 1 71 ? 5.654   6.379   7.893   1.00 0.00 ? 862 GLY A CA   6  
ATOM 5225 C C    . GLY A 1 71 ? 5.037   5.372   6.927   1.00 0.00 ? 862 GLY A C    6  
ATOM 5226 O O    . GLY A 1 71 ? 5.419   4.199   6.929   1.00 0.00 ? 862 GLY A O    6  
ATOM 5227 H H    . GLY A 1 71 ? 5.032   8.403   7.741   1.00 0.00 ? 862 GLY A H    6  
ATOM 5228 H HA2  . GLY A 1 71 ? 6.671   6.082   8.104   1.00 0.00 ? 862 GLY A HA2  6  
ATOM 5229 H HA3  . GLY A 1 71 ? 5.093   6.365   8.817   1.00 0.00 ? 862 GLY A HA3  6  
ATOM 5230 N N    . HIS A 1 72 ? 4.052   5.809   6.144   1.00 0.00 ? 863 HIS A N    6  
ATOM 5231 C CA   . HIS A 1 72 ? 3.352   4.907   5.214   1.00 0.00 ? 863 HIS A CA   6  
ATOM 5232 C C    . HIS A 1 72 ? 4.292   3.846   4.645   1.00 0.00 ? 863 HIS A C    6  
ATOM 5233 O O    . HIS A 1 72 ? 3.958   2.667   4.620   1.00 0.00 ? 863 HIS A O    6  
ATOM 5234 C CB   . HIS A 1 72 ? 2.696   5.692   4.070   1.00 0.00 ? 863 HIS A CB   6  
ATOM 5235 C CG   . HIS A 1 72 ? 3.750   6.336   3.212   1.00 0.00 ? 863 HIS A CG   6  
ATOM 5236 N ND1  . HIS A 1 72 ? 3.766   6.205   1.831   1.00 0.00 ? 863 HIS A ND1  6  
ATOM 5237 C CD2  . HIS A 1 72 ? 4.815   7.134   3.522   1.00 0.00 ? 863 HIS A CD2  6  
ATOM 5238 C CE1  . HIS A 1 72 ? 4.814   6.914   1.369   1.00 0.00 ? 863 HIS A CE1  6  
ATOM 5239 N NE2  . HIS A 1 72 ? 5.485   7.501   2.360   1.00 0.00 ? 863 HIS A NE2  6  
ATOM 5240 H H    . HIS A 1 72 ? 3.761   6.743   6.222   1.00 0.00 ? 863 HIS A H    6  
ATOM 5241 H HA   . HIS A 1 72 ? 2.573   4.401   5.766   1.00 0.00 ? 863 HIS A HA   6  
ATOM 5242 H HB2  . HIS A 1 72 ? 2.105   5.016   3.470   1.00 0.00 ? 863 HIS A HB2  6  
ATOM 5243 H HB3  . HIS A 1 72 ? 2.051   6.454   4.483   1.00 0.00 ? 863 HIS A HB3  6  
ATOM 5244 N N    . ARG A 1 73 ? 5.467   4.274   4.199   1.00 0.00 ? 864 ARG A N    6  
ATOM 5245 C CA   . ARG A 1 73 ? 6.451   3.351   3.639   1.00 0.00 ? 864 ARG A CA   6  
ATOM 5246 C C    . ARG A 1 73 ? 6.698   2.197   4.589   1.00 0.00 ? 864 ARG A C    6  
ATOM 5247 O O    . ARG A 1 73 ? 6.520   1.030   4.229   1.00 0.00 ? 864 ARG A O    6  
ATOM 5248 C CB   . ARG A 1 73 ? 7.770   4.084   3.380   1.00 0.00 ? 864 ARG A CB   6  
ATOM 5249 C CG   . ARG A 1 73 ? 7.591   5.095   2.245   1.00 0.00 ? 864 ARG A CG   6  
ATOM 5250 C CD   . ARG A 1 73 ? 7.908   4.447   0.888   1.00 0.00 ? 864 ARG A CD   6  
ATOM 5251 N NE   . ARG A 1 73 ? 9.273   3.913   0.869   1.00 0.00 ? 864 ARG A NE   6  
ATOM 5252 C CZ   . ARG A 1 73 ? 9.555   2.642   1.172   1.00 0.00 ? 864 ARG A CZ   6  
ATOM 5253 N NH1  . ARG A 1 73 ? 8.599   1.822   1.523   1.00 0.00 ? 864 ARG A NH1  6  
ATOM 5254 N NH2  . ARG A 1 73 ? 10.784  2.223   1.112   1.00 0.00 ? 864 ARG A NH2  6  
ATOM 5255 H H    . ARG A 1 73 ? 5.675   5.229   4.252   1.00 0.00 ? 864 ARG A H    6  
ATOM 5256 H HA   . ARG A 1 73 ? 6.084   2.959   2.708   1.00 0.00 ? 864 ARG A HA   6  
ATOM 5257 N N    . GLN A 1 74 ? 7.091   2.534   5.799   1.00 0.00 ? 865 GLN A N    6  
ATOM 5258 C CA   . GLN A 1 74 ? 7.365   1.543   6.821   1.00 0.00 ? 865 GLN A CA   6  
ATOM 5259 C C    . GLN A 1 74 ? 6.118   0.726   7.117   1.00 0.00 ? 865 GLN A C    6  
ATOM 5260 O O    . GLN A 1 74 ? 6.162   -0.505  7.147   1.00 0.00 ? 865 GLN A O    6  
ATOM 5261 C CB   . GLN A 1 74 ? 7.849   2.236   8.098   1.00 0.00 ? 865 GLN A CB   6  
ATOM 5262 C CG   . GLN A 1 74 ? 8.423   1.202   9.071   1.00 0.00 ? 865 GLN A CG   6  
ATOM 5263 C CD   . GLN A 1 74 ? 8.376   1.744   10.494  1.00 0.00 ? 865 GLN A CD   6  
ATOM 5264 O OE1  . GLN A 1 74 ? 7.703   2.749   10.760  1.00 0.00 ? 865 GLN A OE1  6  
ATOM 5265 N NE2  . GLN A 1 74 ? 9.042   1.145   11.430  1.00 0.00 ? 865 GLN A NE2  6  
ATOM 5266 H H    . GLN A 1 74 ? 7.191   3.484   6.013   1.00 0.00 ? 865 GLN A H    6  
ATOM 5267 H HA   . GLN A 1 74 ? 8.143   0.882   6.470   1.00 0.00 ? 865 GLN A HA   6  
ATOM 5268 H HB2  . GLN A 1 74 ? 8.615   2.958   7.849   1.00 0.00 ? 865 GLN A HB2  6  
ATOM 5269 H HB3  . GLN A 1 74 ? 7.019   2.745   8.566   1.00 0.00 ? 865 GLN A HB3  6  
ATOM 5270 H HG2  . GLN A 1 74 ? 7.845   0.291   9.015   1.00 0.00 ? 865 GLN A HG2  6  
ATOM 5271 H HG3  . GLN A 1 74 ? 9.448   0.991   8.806   1.00 0.00 ? 865 GLN A HG3  6  
ATOM 5272 H HE21 . GLN A 1 74 ? 9.573   0.347   11.226  1.00 0.00 ? 865 GLN A HE21 6  
ATOM 5273 H HE22 . GLN A 1 74 ? 9.017   1.492   12.348  1.00 0.00 ? 865 GLN A HE22 6  
ATOM 5274 N N    . ARG A 1 75 ? 5.010   1.417   7.344   1.00 0.00 ? 866 ARG A N    6  
ATOM 5275 C CA   . ARG A 1 75 ? 3.750   0.752   7.656   1.00 0.00 ? 866 ARG A CA   6  
ATOM 5276 C C    . ARG A 1 75 ? 3.356   -0.199  6.537   1.00 0.00 ? 866 ARG A C    6  
ATOM 5277 O O    . ARG A 1 75 ? 2.977   -1.341  6.786   1.00 0.00 ? 866 ARG A O    6  
ATOM 5278 C CB   . ARG A 1 75 ? 2.640   1.788   7.875   1.00 0.00 ? 866 ARG A CB   6  
ATOM 5279 C CG   . ARG A 1 75 ? 3.034   2.750   9.007   1.00 0.00 ? 866 ARG A CG   6  
ATOM 5280 C CD   . ARG A 1 75 ? 2.294   2.362   10.294  1.00 0.00 ? 866 ARG A CD   6  
ATOM 5281 N NE   . ARG A 1 75 ? 2.701   1.028   10.737  1.00 0.00 ? 866 ARG A NE   6  
ATOM 5282 C CZ   . ARG A 1 75 ? 2.046   0.382   11.700  1.00 0.00 ? 866 ARG A CZ   6  
ATOM 5283 N NH1  . ARG A 1 75 ? 1.002   0.932   12.261  1.00 0.00 ? 866 ARG A NH1  6  
ATOM 5284 N NH2  . ARG A 1 75 ? 2.450   -0.800  12.075  1.00 0.00 ? 866 ARG A NH2  6  
ATOM 5285 H H    . ARG A 1 75 ? 5.044   2.399   7.307   1.00 0.00 ? 866 ARG A H    6  
ATOM 5286 H HA   . ARG A 1 75 ? 3.874   0.183   8.564   1.00 0.00 ? 866 ARG A HA   6  
ATOM 5287 N N    . ILE A 1 76 ? 3.446   0.278   5.313   1.00 0.00 ? 867 ILE A N    6  
ATOM 5288 C CA   . ILE A 1 76 ? 3.097   -0.527  4.162   1.00 0.00 ? 867 ILE A CA   6  
ATOM 5289 C C    . ILE A 1 76 ? 4.050   -1.708  4.018   1.00 0.00 ? 867 ILE A C    6  
ATOM 5290 O O    . ILE A 1 76 ? 3.612   -2.841  3.830   1.00 0.00 ? 867 ILE A O    6  
ATOM 5291 C CB   . ILE A 1 76 ? 3.117   0.339   2.891   1.00 0.00 ? 867 ILE A CB   6  
ATOM 5292 C CG1  . ILE A 1 76 ? 1.952   1.342   2.943   1.00 0.00 ? 867 ILE A CG1  6  
ATOM 5293 C CG2  . ILE A 1 76 ? 2.983   -0.543  1.641   1.00 0.00 ? 867 ILE A CG2  6  
ATOM 5294 C CD1  . ILE A 1 76 ? 0.643   0.650   2.544   1.00 0.00 ? 867 ILE A CD1  6  
ATOM 5295 H H    . ILE A 1 76 ? 3.752   1.200   5.177   1.00 0.00 ? 867 ILE A H    6  
ATOM 5296 H HA   . ILE A 1 76 ? 2.096   -0.908  4.300   1.00 0.00 ? 867 ILE A HA   6  
ATOM 5297 H HB   . ILE A 1 76 ? 4.055   0.876   2.846   1.00 0.00 ? 867 ILE A HB   6  
ATOM 5298 H HG12 . ILE A 1 76 ? 1.859   1.727   3.946   1.00 0.00 ? 867 ILE A HG12 6  
ATOM 5299 H HG21 . ILE A 1 76 ? 2.167   -1.236  1.774   1.00 0.00 ? 867 ILE A HG21 6  
ATOM 5300 H HG22 . ILE A 1 76 ? 3.899   -1.092  1.483   1.00 0.00 ? 867 ILE A HG22 6  
ATOM 5301 H HG23 . ILE A 1 76 ? 2.786   0.080   0.780   1.00 0.00 ? 867 ILE A HG23 6  
ATOM 5302 H HD11 . ILE A 1 76 ? 0.716   0.291   1.527   1.00 0.00 ? 867 ILE A HD11 6  
ATOM 5303 H HD12 . ILE A 1 76 ? -0.173  1.352   2.619   1.00 0.00 ? 867 ILE A HD12 6  
ATOM 5304 H HD13 . ILE A 1 76 ? 0.460   -0.183  3.206   1.00 0.00 ? 867 ILE A HD13 6  
ATOM 5305 N N    . LEU A 1 77 ? 5.355   -1.438  4.088   1.00 0.00 ? 868 LEU A N    6  
ATOM 5306 C CA   . LEU A 1 77 ? 6.358   -2.492  3.916   1.00 0.00 ? 868 LEU A CA   6  
ATOM 5307 C C    . LEU A 1 77 ? 6.104   -3.650  4.865   1.00 0.00 ? 868 LEU A C    6  
ATOM 5308 O O    . LEU A 1 77 ? 5.945   -4.799  4.435   1.00 0.00 ? 868 LEU A O    6  
ATOM 5309 C CB   . LEU A 1 77 ? 7.773   -1.933  4.151   1.00 0.00 ? 868 LEU A CB   6  
ATOM 5310 C CG   . LEU A 1 77 ? 8.673   -2.230  2.938   1.00 0.00 ? 868 LEU A CG   6  
ATOM 5311 C CD1  . LEU A 1 77 ? 8.802   -3.745  2.743   1.00 0.00 ? 868 LEU A CD1  6  
ATOM 5312 C CD2  . LEU A 1 77 ? 8.073   -1.595  1.674   1.00 0.00 ? 868 LEU A CD2  6  
ATOM 5313 H H    . LEU A 1 77 ? 5.648   -0.510  4.228   1.00 0.00 ? 868 LEU A H    6  
ATOM 5314 H HA   . LEU A 1 77 ? 6.294   -2.860  2.906   1.00 0.00 ? 868 LEU A HA   6  
ATOM 5315 H HB2  . LEU A 1 77 ? 7.722   -0.867  4.307   1.00 0.00 ? 868 LEU A HB2  6  
ATOM 5316 H HB3  . LEU A 1 77 ? 8.201   -2.396  5.028   1.00 0.00 ? 868 LEU A HB3  6  
ATOM 5317 H HG   . LEU A 1 77 ? 9.655   -1.818  3.120   1.00 0.00 ? 868 LEU A HG   6  
ATOM 5318 H HD11 . LEU A 1 77 ? 7.872   -4.148  2.370   1.00 0.00 ? 868 LEU A HD11 6  
ATOM 5319 H HD12 . LEU A 1 77 ? 9.043   -4.210  3.687   1.00 0.00 ? 868 LEU A HD12 6  
ATOM 5320 H HD13 . LEU A 1 77 ? 9.592   -3.948  2.035   1.00 0.00 ? 868 LEU A HD13 6  
ATOM 5321 H HD21 . LEU A 1 77 ? 7.533   -0.699  1.941   1.00 0.00 ? 868 LEU A HD21 6  
ATOM 5322 H HD22 . LEU A 1 77 ? 7.400   -2.293  1.201   1.00 0.00 ? 868 LEU A HD22 6  
ATOM 5323 H HD23 . LEU A 1 77 ? 8.870   -1.344  0.991   1.00 0.00 ? 868 LEU A HD23 6  
ATOM 5324 N N    . GLN A 1 78 ? 6.036   -3.351  6.147   1.00 0.00 ? 869 GLN A N    6  
ATOM 5325 C CA   . GLN A 1 78 ? 5.778   -4.383  7.136   1.00 0.00 ? 869 GLN A CA   6  
ATOM 5326 C C    . GLN A 1 78 ? 4.426   -5.018  6.881   1.00 0.00 ? 869 GLN A C    6  
ATOM 5327 O O    . GLN A 1 78 ? 4.271   -6.237  6.955   1.00 0.00 ? 869 GLN A O    6  
ATOM 5328 C CB   . GLN A 1 78 ? 5.824   -3.800  8.561   1.00 0.00 ? 869 GLN A CB   6  
ATOM 5329 C CG   . GLN A 1 78 ? 4.791   -2.671  8.700   1.00 0.00 ? 869 GLN A CG   6  
ATOM 5330 C CD   . GLN A 1 78 ? 5.165   -1.748  9.854   1.00 0.00 ? 869 GLN A CD   6  
ATOM 5331 O OE1  . GLN A 1 78 ? 4.292   -1.308  10.609  1.00 0.00 ? 869 GLN A OE1  6  
ATOM 5332 N NE2  . GLN A 1 78 ? 6.404   -1.414  10.034  1.00 0.00 ? 869 GLN A NE2  6  
ATOM 5333 H H    . GLN A 1 78 ? 6.152   -2.417  6.429   1.00 0.00 ? 869 GLN A H    6  
ATOM 5334 H HA   . GLN A 1 78 ? 6.539   -5.144  7.049   1.00 0.00 ? 869 GLN A HA   6  
ATOM 5335 H HB2  . GLN A 1 78 ? 5.601   -4.581  9.272   1.00 0.00 ? 869 GLN A HB2  6  
ATOM 5336 H HB3  . GLN A 1 78 ? 6.810   -3.410  8.755   1.00 0.00 ? 869 GLN A HB3  6  
ATOM 5337 H HG2  . GLN A 1 78 ? 4.762   -2.101  7.786   1.00 0.00 ? 869 GLN A HG2  6  
ATOM 5338 H HG3  . GLN A 1 78 ? 3.816   -3.096  8.886   1.00 0.00 ? 869 GLN A HG3  6  
ATOM 5339 H HE21 . GLN A 1 78 ? 7.096   -1.754  9.428   1.00 0.00 ? 869 GLN A HE21 6  
ATOM 5340 H HE22 . GLN A 1 78 ? 6.652   -0.827  10.778  1.00 0.00 ? 869 GLN A HE22 6  
ATOM 5341 N N    . ALA A 1 79 ? 3.444   -4.181  6.589   1.00 0.00 ? 870 ALA A N    6  
ATOM 5342 C CA   . ALA A 1 79 ? 2.101   -4.656  6.354   1.00 0.00 ? 870 ALA A CA   6  
ATOM 5343 C C    . ALA A 1 79 ? 2.047   -5.628  5.183   1.00 0.00 ? 870 ALA A C    6  
ATOM 5344 O O    . ALA A 1 79 ? 1.468   -6.705  5.302   1.00 0.00 ? 870 ALA A O    6  
ATOM 5345 C CB   . ALA A 1 79 ? 1.165   -3.480  6.097   1.00 0.00 ? 870 ALA A CB   6  
ATOM 5346 H H    . ALA A 1 79 ? 3.628   -3.218  6.551   1.00 0.00 ? 870 ALA A H    6  
ATOM 5347 H HA   . ALA A 1 79 ? 1.760   -5.170  7.239   1.00 0.00 ? 870 ALA A HA   6  
ATOM 5348 H HB1  . ALA A 1 79 ? 1.493   -2.937  5.224   1.00 0.00 ? 870 ALA A HB1  6  
ATOM 5349 H HB2  . ALA A 1 79 ? 1.168   -2.822  6.953   1.00 0.00 ? 870 ALA A HB2  6  
ATOM 5350 H HB3  . ALA A 1 79 ? 0.164   -3.850  5.934   1.00 0.00 ? 870 ALA A HB3  6  
ATOM 5351 N N    . ILE A 1 80 ? 2.636   -5.252  4.042   1.00 0.00 ? 871 ILE A N    6  
ATOM 5352 C CA   . ILE A 1 80 ? 2.602   -6.131  2.886   1.00 0.00 ? 871 ILE A CA   6  
ATOM 5353 C C    . ILE A 1 80 ? 3.426   -7.376  3.136   1.00 0.00 ? 871 ILE A C    6  
ATOM 5354 O O    . ILE A 1 80 ? 2.992   -8.484  2.832   1.00 0.00 ? 871 ILE A O    6  
ATOM 5355 C CB   . ILE A 1 80 ? 3.060   -5.420  1.600   1.00 0.00 ? 871 ILE A CB   6  
ATOM 5356 C CG1  . ILE A 1 80 ? 4.496   -4.914  1.737   1.00 0.00 ? 871 ILE A CG1  6  
ATOM 5357 C CG2  . ILE A 1 80 ? 2.137   -4.243  1.301   1.00 0.00 ? 871 ILE A CG2  6  
ATOM 5358 C CD1  . ILE A 1 80 ? 4.876   -4.126  0.479   1.00 0.00 ? 871 ILE A CD1  6  
ATOM 5359 H H    . ILE A 1 80 ? 3.080   -4.380  3.978   1.00 0.00 ? 871 ILE A H    6  
ATOM 5360 H HA   . ILE A 1 80 ? 1.577   -6.440  2.751   1.00 0.00 ? 871 ILE A HA   6  
ATOM 5361 H HB   . ILE A 1 80 ? 2.998   -6.121  0.786   1.00 0.00 ? 871 ILE A HB   6  
ATOM 5362 H HG12 . ILE A 1 80 ? 4.569   -4.270  2.598   1.00 0.00 ? 871 ILE A HG12 6  
ATOM 5363 H HG21 . ILE A 1 80 ? 2.351   -3.441  1.989   1.00 0.00 ? 871 ILE A HG21 6  
ATOM 5364 H HG22 . ILE A 1 80 ? 1.108   -4.551  1.403   1.00 0.00 ? 871 ILE A HG22 6  
ATOM 5365 H HG23 . ILE A 1 80 ? 2.310   -3.901  0.290   1.00 0.00 ? 871 ILE A HG23 6  
ATOM 5366 H HD11 . ILE A 1 80 ? 4.905   -4.793  -0.373  1.00 0.00 ? 871 ILE A HD11 6  
ATOM 5367 H HD12 . ILE A 1 80 ? 5.843   -3.673  0.618   1.00 0.00 ? 871 ILE A HD12 6  
ATOM 5368 H HD13 . ILE A 1 80 ? 4.143   -3.353  0.302   1.00 0.00 ? 871 ILE A HD13 6  
ATOM 5369 N N    . GLN A 1 81 ? 4.596   -7.206  3.730   1.00 0.00 ? 872 GLN A N    6  
ATOM 5370 C CA   . GLN A 1 81 ? 5.433   -8.350  4.049   1.00 0.00 ? 872 GLN A CA   6  
ATOM 5371 C C    . GLN A 1 81 ? 4.650   -9.330  4.914   1.00 0.00 ? 872 GLN A C    6  
ATOM 5372 O O    . GLN A 1 81 ? 4.857   -10.543 4.848   1.00 0.00 ? 872 GLN A O    6  
ATOM 5373 C CB   . GLN A 1 81 ? 6.707   -7.903  4.775   1.00 0.00 ? 872 GLN A CB   6  
ATOM 5374 C CG   . GLN A 1 81 ? 7.708   -7.342  3.755   1.00 0.00 ? 872 GLN A CG   6  
ATOM 5375 C CD   . GLN A 1 81 ? 9.036   -7.041  4.439   1.00 0.00 ? 872 GLN A CD   6  
ATOM 5376 O OE1  . GLN A 1 81 ? 9.069   -6.761  5.640   1.00 0.00 ? 872 GLN A OE1  6  
ATOM 5377 N NE2  . GLN A 1 81 ? 10.137  -7.087  3.752   1.00 0.00 ? 872 GLN A NE2  6  
ATOM 5378 H H    . GLN A 1 81 ? 4.887   -6.301  3.983   1.00 0.00 ? 872 GLN A H    6  
ATOM 5379 H HA   . GLN A 1 81 ? 5.707   -8.846  3.128   1.00 0.00 ? 872 GLN A HA   6  
ATOM 5380 H HB2  . GLN A 1 81 ? 6.461   -7.141  5.501   1.00 0.00 ? 872 GLN A HB2  6  
ATOM 5381 H HB3  . GLN A 1 81 ? 7.150   -8.749  5.278   1.00 0.00 ? 872 GLN A HB3  6  
ATOM 5382 H HG2  . GLN A 1 81 ? 7.866   -8.068  2.972   1.00 0.00 ? 872 GLN A HG2  6  
ATOM 5383 H HG3  . GLN A 1 81 ? 7.314   -6.431  3.328   1.00 0.00 ? 872 GLN A HG3  6  
ATOM 5384 H HE21 . GLN A 1 81 ? 10.114  -7.315  2.797   1.00 0.00 ? 872 GLN A HE21 6  
ATOM 5385 H HE22 . GLN A 1 81 ? 10.993  -6.892  4.187   1.00 0.00 ? 872 GLN A HE22 6  
ATOM 5386 N N    . LEU A 1 82 ? 3.736   -8.795  5.707   1.00 0.00 ? 873 LEU A N    6  
ATOM 5387 C CA   . LEU A 1 82 ? 2.903   -9.619  6.571   1.00 0.00 ? 873 LEU A CA   6  
ATOM 5388 C C    . LEU A 1 82 ? 1.844   -10.364 5.760   1.00 0.00 ? 873 LEU A C    6  
ATOM 5389 O O    . LEU A 1 82 ? 1.095   -11.177 6.305   1.00 0.00 ? 873 LEU A O    6  
ATOM 5390 C CB   . LEU A 1 82 ? 2.227   -8.751  7.645   1.00 0.00 ? 873 LEU A CB   6  
ATOM 5391 C CG   . LEU A 1 82 ? 2.902   -8.982  9.008   1.00 0.00 ? 873 LEU A CG   6  
ATOM 5392 C CD1  . LEU A 1 82 ? 2.573   -10.389 9.516   1.00 0.00 ? 873 LEU A CD1  6  
ATOM 5393 C CD2  . LEU A 1 82 ? 4.425   -8.831  8.870   1.00 0.00 ? 873 LEU A CD2  6  
ATOM 5394 H H    . LEU A 1 82 ? 3.612   -7.820  5.710   1.00 0.00 ? 873 LEU A H    6  
ATOM 5395 H HA   . LEU A 1 82 ? 3.530   -10.348 7.061   1.00 0.00 ? 873 LEU A HA   6  
ATOM 5396 H HB2  . LEU A 1 82 ? 2.313   -7.710  7.373   1.00 0.00 ? 873 LEU A HB2  6  
ATOM 5397 H HB3  . LEU A 1 82 ? 1.182   -9.016  7.716   1.00 0.00 ? 873 LEU A HB3  6  
ATOM 5398 H HG   . LEU A 1 82 ? 2.529   -8.256  9.714   1.00 0.00 ? 873 LEU A HG   6  
ATOM 5399 H HD11 . LEU A 1 82 ? 2.531   -10.376 10.595  1.00 0.00 ? 873 LEU A HD11 6  
ATOM 5400 H HD12 . LEU A 1 82 ? 3.341   -11.079 9.197   1.00 0.00 ? 873 LEU A HD12 6  
ATOM 5401 H HD13 . LEU A 1 82 ? 1.618   -10.704 9.124   1.00 0.00 ? 873 LEU A HD13 6  
ATOM 5402 H HD21 . LEU A 1 82 ? 4.659   -8.278  7.972   1.00 0.00 ? 873 LEU A HD21 6  
ATOM 5403 H HD22 . LEU A 1 82 ? 4.886   -9.806  8.821   1.00 0.00 ? 873 LEU A HD22 6  
ATOM 5404 H HD23 . LEU A 1 82 ? 4.810   -8.299  9.727   1.00 0.00 ? 873 LEU A HD23 6  
ATOM 5405 N N    . LEU A 1 83 ? 1.784   -10.095 4.463   1.00 0.00 ? 874 LEU A N    6  
ATOM 5406 C CA   . LEU A 1 83 ? 0.817   -10.763 3.601   1.00 0.00 ? 874 LEU A CA   6  
ATOM 5407 C C    . LEU A 1 83 ? 1.420   -12.033 3.015   1.00 0.00 ? 874 LEU A C    6  
ATOM 5408 O O    . LEU A 1 83 ? 2.528   -12.005 2.468   1.00 0.00 ? 874 LEU A O    6  
ATOM 5409 C CB   . LEU A 1 83 ? 0.375   -9.838  2.462   1.00 0.00 ? 874 LEU A CB   6  
ATOM 5410 C CG   . LEU A 1 83 ? -0.205  -8.539  3.038   1.00 0.00 ? 874 LEU A CG   6  
ATOM 5411 C CD1  . LEU A 1 83 ? -0.432  -7.537  1.908   1.00 0.00 ? 874 LEU A CD1  6  
ATOM 5412 C CD2  . LEU A 1 83 ? -1.542  -8.835  3.730   1.00 0.00 ? 874 LEU A CD2  6  
ATOM 5413 H H    . LEU A 1 83 ? 2.406   -9.443  4.072   1.00 0.00 ? 874 LEU A H    6  
ATOM 5414 H HA   . LEU A 1 83 ? -0.049  -11.018 4.192   1.00 0.00 ? 874 LEU A HA   6  
ATOM 5415 H HB2  . LEU A 1 83 ? 1.223   -9.612  1.833   1.00 0.00 ? 874 LEU A HB2  6  
ATOM 5416 H HB3  . LEU A 1 83 ? -0.381  -10.337 1.874   1.00 0.00 ? 874 LEU A HB3  6  
ATOM 5417 H HG   . LEU A 1 83 ? 0.489   -8.122  3.752   1.00 0.00 ? 874 LEU A HG   6  
ATOM 5418 H HD11 . LEU A 1 83 ? 0.462   -7.448  1.308   1.00 0.00 ? 874 LEU A HD11 6  
ATOM 5419 H HD12 . LEU A 1 83 ? -0.682  -6.573  2.325   1.00 0.00 ? 874 LEU A HD12 6  
ATOM 5420 H HD13 . LEU A 1 83 ? -1.246  -7.879  1.288   1.00 0.00 ? 874 LEU A HD13 6  
ATOM 5421 H HD21 . LEU A 1 83 ? -2.093  -9.569  3.159   1.00 0.00 ? 874 LEU A HD21 6  
ATOM 5422 H HD22 . LEU A 1 83 ? -2.123  -7.927  3.794   1.00 0.00 ? 874 LEU A HD22 6  
ATOM 5423 H HD23 . LEU A 1 83 ? -1.360  -9.215  4.724   1.00 0.00 ? 874 LEU A HD23 6  
ATOM 5424 N N    . PRO A 1 84 ? 0.722   -13.139 3.109   1.00 0.00 ? 875 PRO A N    6  
ATOM 5425 C CA   . PRO A 1 84 ? 1.202   -14.438 2.548   1.00 0.00 ? 875 PRO A CA   6  
ATOM 5426 C C    . PRO A 1 84 ? 1.561   -14.306 1.069   1.00 0.00 ? 875 PRO A C    6  
ATOM 5427 O O    . PRO A 1 84 ? 1.137   -13.357 0.401   1.00 0.00 ? 875 PRO A O    6  
ATOM 5428 C CB   . PRO A 1 84 ? 0.008   -15.377 2.728   1.00 0.00 ? 875 PRO A CB   6  
ATOM 5429 C CG   . PRO A 1 84 ? -0.787  -14.786 3.845   1.00 0.00 ? 875 PRO A CG   6  
ATOM 5430 C CD   . PRO A 1 84 ? -0.595  -13.275 3.757   1.00 0.00 ? 875 PRO A CD   6  
ATOM 5431 H HA   . PRO A 1 84 ? 2.037   -14.817 3.114   1.00 0.00 ? 875 PRO A HA   6  
ATOM 5432 H HB2  . PRO A 1 84 ? -0.578  -15.412 1.819   1.00 0.00 ? 875 PRO A HB2  6  
ATOM 5433 H HB3  . PRO A 1 84 ? 0.341   -16.365 2.999   1.00 0.00 ? 875 PRO A HB3  6  
ATOM 5434 H HG2  . PRO A 1 84 ? -1.831  -15.043 3.731   1.00 0.00 ? 875 PRO A HG2  6  
ATOM 5435 H HG3  . PRO A 1 84 ? -0.418  -15.139 4.796   1.00 0.00 ? 875 PRO A HG3  6  
ATOM 5436 H HD2  . PRO A 1 84 ? -1.376  -12.828 3.156   1.00 0.00 ? 875 PRO A HD2  6  
ATOM 5437 H HD3  . PRO A 1 84 ? -0.569  -12.839 4.744   1.00 0.00 ? 875 PRO A HD3  6  
ATOM 5438 N N    . LYS A 1 85 ? 2.330   -15.258 0.563   1.00 0.00 ? 876 LYS A N    6  
ATOM 5439 C CA   . LYS A 1 85 ? 2.736   -15.247 -0.836  1.00 0.00 ? 876 LYS A CA   6  
ATOM 5440 C C    . LYS A 1 85 ? 2.956   -16.664 -1.343  1.00 0.00 ? 876 LYS A C    6  
ATOM 5441 O O    . LYS A 1 85 ? 3.563   -16.812 -2.376  1.00 0.00 ? 876 LYS A O    6  
ATOM 5442 C CB   . LYS A 1 85 ? 4.018   -14.418 -1.011  1.00 0.00 ? 876 LYS A CB   6  
ATOM 5443 C CG   . LYS A 1 85 ? 5.065   -14.868 0.018   1.00 0.00 ? 876 LYS A CG   6  
ATOM 5444 C CD   . LYS A 1 85 ? 6.481   -14.728 -0.573  1.00 0.00 ? 876 LYS A CD   6  
ATOM 5445 C CE   . LYS A 1 85 ? 6.718   -15.772 -1.686  1.00 0.00 ? 876 LYS A CE   6  
ATOM 5446 N NZ   . LYS A 1 85 ? 5.866   -16.970 -1.461  1.00 0.00 ? 876 LYS A NZ   6  
ATOM 5447 H H    . LYS A 1 85 ? 2.628   -15.991 1.142   1.00 0.00 ? 876 LYS A H    6  
ATOM 5448 H HA   . LYS A 1 85 ? 1.951   -14.791 -1.420  1.00 0.00 ? 876 LYS A HA   6  
ATOM 5449 N N    . GLN A 1 23 ? -9.385  -10.482 -0.155  1.00 0.00 ? 814 GLN A N    7  
ATOM 5450 C CA   . GLN A 1 23 ? -10.322 -9.341  -0.337  1.00 0.00 ? 814 GLN A CA   7  
ATOM 5451 C C    . GLN A 1 23 ? -9.532  -8.117  -0.778  1.00 0.00 ? 814 GLN A C    7  
ATOM 5452 O O    . GLN A 1 23 ? -8.309  -8.167  -0.894  1.00 0.00 ? 814 GLN A O    7  
ATOM 5453 C CB   . GLN A 1 23 ? -11.058 -9.048  0.980   1.00 0.00 ? 814 GLN A CB   7  
ATOM 5454 C CG   . GLN A 1 23 ? -12.163 -10.092 1.203   1.00 0.00 ? 814 GLN A CG   7  
ATOM 5455 C CD   . GLN A 1 23 ? -13.341 -9.452  1.927   1.00 0.00 ? 814 GLN A CD   7  
ATOM 5456 O OE1  . GLN A 1 23 ? -14.414 -9.287  1.346   1.00 0.00 ? 814 GLN A OE1  7  
ATOM 5457 N NE2  . GLN A 1 23 ? -13.207 -9.078  3.160   1.00 0.00 ? 814 GLN A NE2  7  
ATOM 5458 H HA   . GLN A 1 23 ? -11.039 -9.588  -1.105  1.00 0.00 ? 814 GLN A HA   7  
ATOM 5459 H HB2  . GLN A 1 23 ? -10.358 -9.079  1.801   1.00 0.00 ? 814 GLN A HB2  7  
ATOM 5460 H HB3  . GLN A 1 23 ? -11.505 -8.066  0.930   1.00 0.00 ? 814 GLN A HB3  7  
ATOM 5461 H HG2  . GLN A 1 23 ? -12.497 -10.479 0.250   1.00 0.00 ? 814 GLN A HG2  7  
ATOM 5462 H HG3  . GLN A 1 23 ? -11.776 -10.905 1.802   1.00 0.00 ? 814 GLN A HG3  7  
ATOM 5463 H HE21 . GLN A 1 23 ? -12.352 -9.208  3.621   1.00 0.00 ? 814 GLN A HE21 7  
ATOM 5464 H HE22 . GLN A 1 23 ? -13.958 -8.661  3.632   1.00 0.00 ? 814 GLN A HE22 7  
ATOM 5465 N N    . THR A 1 24 ? -10.239 -7.027  -1.028  1.00 0.00 ? 815 THR A N    7  
ATOM 5466 C CA   . THR A 1 24 ? -9.622  -5.789  -1.482  1.00 0.00 ? 815 THR A CA   7  
ATOM 5467 C C    . THR A 1 24 ? -8.972  -5.053  -0.315  1.00 0.00 ? 815 THR A C    7  
ATOM 5468 O O    . THR A 1 24 ? -9.172  -5.419  0.842   1.00 0.00 ? 815 THR A O    7  
ATOM 5469 C CB   . THR A 1 24 ? -10.680 -4.904  -2.155  1.00 0.00 ? 815 THR A CB   7  
ATOM 5470 O OG1  . THR A 1 24 ? -11.873 -5.663  -2.331  1.00 0.00 ? 815 THR A OG1  7  
ATOM 5471 C CG2  . THR A 1 24 ? -10.172 -4.439  -3.524  1.00 0.00 ? 815 THR A CG2  7  
ATOM 5472 H H    . THR A 1 24 ? -11.214 -7.052  -0.926  1.00 0.00 ? 815 THR A H    7  
ATOM 5473 H HA   . THR A 1 24 ? -8.860  -6.029  -2.208  1.00 0.00 ? 815 THR A HA   7  
ATOM 5474 H HB   . THR A 1 24 ? -10.884 -4.039  -1.540  1.00 0.00 ? 815 THR A HB   7  
ATOM 5475 H HG21 . THR A 1 24 ? -10.049 -5.292  -4.174  1.00 0.00 ? 815 THR A HG21 7  
ATOM 5476 H HG22 . THR A 1 24 ? -9.224  -3.934  -3.409  1.00 0.00 ? 815 THR A HG22 7  
ATOM 5477 H HG23 . THR A 1 24 ? -10.888 -3.757  -3.960  1.00 0.00 ? 815 THR A HG23 7  
ATOM 5478 N N    . VAL A 1 25 ? -8.142  -4.065  -0.626  1.00 0.00 ? 816 VAL A N    7  
ATOM 5479 C CA   . VAL A 1 25 ? -7.422  -3.319  0.396   1.00 0.00 ? 816 VAL A CA   7  
ATOM 5480 C C    . VAL A 1 25 ? -8.399  -2.583  1.330   1.00 0.00 ? 816 VAL A C    7  
ATOM 5481 O O    . VAL A 1 25 ? -9.190  -3.213  2.022   1.00 0.00 ? 816 VAL A O    7  
ATOM 5482 C CB   . VAL A 1 25 ? -6.451  -2.328  -0.272  1.00 0.00 ? 816 VAL A CB   7  
ATOM 5483 C CG1  . VAL A 1 25 ? -5.324  -3.102  -0.965  1.00 0.00 ? 816 VAL A CG1  7  
ATOM 5484 C CG2  . VAL A 1 25 ? -7.201  -1.489  -1.320  1.00 0.00 ? 816 VAL A CG2  7  
ATOM 5485 H H    . VAL A 1 25 ? -7.983  -3.850  -1.568  1.00 0.00 ? 816 VAL A H    7  
ATOM 5486 H HA   . VAL A 1 25 ? -6.847  -4.017  0.987   1.00 0.00 ? 816 VAL A HA   7  
ATOM 5487 H HB   . VAL A 1 25 ? -6.025  -1.681  0.480   1.00 0.00 ? 816 VAL A HB   7  
ATOM 5488 H HG11 . VAL A 1 25 ? -5.627  -4.127  -1.123  1.00 0.00 ? 816 VAL A HG11 7  
ATOM 5489 H HG12 . VAL A 1 25 ? -4.438  -3.082  -0.346  1.00 0.00 ? 816 VAL A HG12 7  
ATOM 5490 H HG13 . VAL A 1 25 ? -5.102  -2.643  -1.918  1.00 0.00 ? 816 VAL A HG13 7  
ATOM 5491 H HG21 . VAL A 1 25 ? -8.261  -1.502  -1.116  1.00 0.00 ? 816 VAL A HG21 7  
ATOM 5492 H HG22 . VAL A 1 25 ? -7.022  -1.896  -2.305  1.00 0.00 ? 816 VAL A HG22 7  
ATOM 5493 H HG23 . VAL A 1 25 ? -6.842  -0.470  -1.289  1.00 0.00 ? 816 VAL A HG23 7  
ATOM 5494 N N    . GLY A 1 26 ? -8.321  -1.256  1.354   1.00 0.00 ? 817 GLY A N    7  
ATOM 5495 C CA   . GLY A 1 26 ? -9.191  -0.446  2.207   1.00 0.00 ? 817 GLY A CA   7  
ATOM 5496 C C    . GLY A 1 26 ? -9.170  -0.944  3.646   1.00 0.00 ? 817 GLY A C    7  
ATOM 5497 O O    . GLY A 1 26 ? -8.384  -0.469  4.468   1.00 0.00 ? 817 GLY A O    7  
ATOM 5498 H H    . GLY A 1 26 ? -7.665  -0.808  0.786   1.00 0.00 ? 817 GLY A H    7  
ATOM 5499 H HA2  . GLY A 1 26 ? -8.860  0.581   2.181   1.00 0.00 ? 817 GLY A HA2  7  
ATOM 5500 H HA3  . GLY A 1 26 ? -10.203 -0.500  1.833   1.00 0.00 ? 817 GLY A HA3  7  
ATOM 5501 N N    . GLN A 1 27 ? -10.008 -1.923  3.934   1.00 0.00 ? 818 GLN A N    7  
ATOM 5502 C CA   . GLN A 1 27 ? -10.081 -2.505  5.265   1.00 0.00 ? 818 GLN A CA   7  
ATOM 5503 C C    . GLN A 1 27 ? -8.699  -2.930  5.730   1.00 0.00 ? 818 GLN A C    7  
ATOM 5504 O O    . GLN A 1 27 ? -8.331  -2.724  6.886   1.00 0.00 ? 818 GLN A O    7  
ATOM 5505 C CB   . GLN A 1 27 ? -11.032 -3.705  5.262   1.00 0.00 ? 818 GLN A CB   7  
ATOM 5506 C CG   . GLN A 1 27 ? -12.486 -3.215  5.160   1.00 0.00 ? 818 GLN A CG   7  
ATOM 5507 C CD   . GLN A 1 27 ? -12.757 -2.607  3.784   1.00 0.00 ? 818 GLN A CD   7  
ATOM 5508 O OE1  . GLN A 1 27 ? -11.983 -2.810  2.845   1.00 0.00 ? 818 GLN A OE1  7  
ATOM 5509 N NE2  . GLN A 1 27 ? -13.806 -1.868  3.608   1.00 0.00 ? 818 GLN A NE2  7  
ATOM 5510 H H    . GLN A 1 27 ? -10.583 -2.281  3.220   1.00 0.00 ? 818 GLN A H    7  
ATOM 5511 H HA   . GLN A 1 27 ? -10.462 -1.762  5.949   1.00 0.00 ? 818 GLN A HA   7  
ATOM 5512 H HB2  . GLN A 1 27 ? -10.804 -4.343  4.421   1.00 0.00 ? 818 GLN A HB2  7  
ATOM 5513 H HB3  . GLN A 1 27 ? -10.910 -4.264  6.178   1.00 0.00 ? 818 GLN A HB3  7  
ATOM 5514 H HG2  . GLN A 1 27 ? -13.153 -4.049  5.317   1.00 0.00 ? 818 GLN A HG2  7  
ATOM 5515 H HG3  . GLN A 1 27 ? -12.667 -2.470  5.920   1.00 0.00 ? 818 GLN A HG3  7  
ATOM 5516 H HE21 . GLN A 1 27 ? -14.420 -1.703  4.352   1.00 0.00 ? 818 GLN A HE21 7  
ATOM 5517 H HE22 . GLN A 1 27 ? -13.988 -1.474  2.728   1.00 0.00 ? 818 GLN A HE22 7  
ATOM 5518 N N    . TRP A 1 28 ? -7.917  -3.481  4.815   1.00 0.00 ? 819 TRP A N    7  
ATOM 5519 C CA   . TRP A 1 28 ? -6.551  -3.873  5.137   1.00 0.00 ? 819 TRP A CA   7  
ATOM 5520 C C    . TRP A 1 28 ? -5.786  -2.656  5.634   1.00 0.00 ? 819 TRP A C    7  
ATOM 5521 O O    . TRP A 1 28 ? -5.196  -2.670  6.716   1.00 0.00 ? 819 TRP A O    7  
ATOM 5522 C CB   . TRP A 1 28 ? -5.865  -4.456  3.896   1.00 0.00 ? 819 TRP A CB   7  
ATOM 5523 C CG   . TRP A 1 28 ? -4.418  -4.723  4.180   1.00 0.00 ? 819 TRP A CG   7  
ATOM 5524 C CD1  . TRP A 1 28 ? -3.952  -5.656  5.042   1.00 0.00 ? 819 TRP A CD1  7  
ATOM 5525 C CD2  . TRP A 1 28 ? -3.248  -4.071  3.612   1.00 0.00 ? 819 TRP A CD2  7  
ATOM 5526 N NE1  . TRP A 1 28 ? -2.570  -5.616  5.036   1.00 0.00 ? 819 TRP A NE1  7  
ATOM 5527 C CE2  . TRP A 1 28 ? -2.090  -4.656  4.169   1.00 0.00 ? 819 TRP A CE2  7  
ATOM 5528 C CE3  . TRP A 1 28 ? -3.082  -3.036  2.674   1.00 0.00 ? 819 TRP A CE3  7  
ATOM 5529 C CZ2  . TRP A 1 28 ? -0.814  -4.234  3.810   1.00 0.00 ? 819 TRP A CZ2  7  
ATOM 5530 C CZ3  . TRP A 1 28 ? -1.794  -2.608  2.309   1.00 0.00 ? 819 TRP A CZ3  7  
ATOM 5531 C CH2  . TRP A 1 28 ? -0.663  -3.207  2.876   1.00 0.00 ? 819 TRP A CH2  7  
ATOM 5532 H H    . TRP A 1 28 ? -8.255  -3.589  3.900   1.00 0.00 ? 819 TRP A H    7  
ATOM 5533 H HA   . TRP A 1 28 ? -6.571  -4.621  5.916   1.00 0.00 ? 819 TRP A HA   7  
ATOM 5534 H HB2  . TRP A 1 28 ? -6.347  -5.383  3.626   1.00 0.00 ? 819 TRP A HB2  7  
ATOM 5535 H HB3  . TRP A 1 28 ? -5.946  -3.759  3.076   1.00 0.00 ? 819 TRP A HB3  7  
ATOM 5536 H HD1  . TRP A 1 28 ? -4.559  -6.324  5.637   1.00 0.00 ? 819 TRP A HD1  7  
ATOM 5537 N N    . LEU A 1 29 ? -5.863  -1.581  4.860   1.00 0.00 ? 820 LEU A N    7  
ATOM 5538 C CA   . LEU A 1 29 ? -5.231  -0.326  5.229   1.00 0.00 ? 820 LEU A CA   7  
ATOM 5539 C C    . LEU A 1 29 ? -5.770  0.141   6.568   1.00 0.00 ? 820 LEU A C    7  
ATOM 5540 O O    . LEU A 1 29 ? -5.017  0.568   7.447   1.00 0.00 ? 820 LEU A O    7  
ATOM 5541 C CB   . LEU A 1 29 ? -5.502  0.733   4.160   1.00 0.00 ? 820 LEU A CB   7  
ATOM 5542 C CG   . LEU A 1 29 ? -5.106  0.185   2.782   1.00 0.00 ? 820 LEU A CG   7  
ATOM 5543 C CD1  . LEU A 1 29 ? -5.808  0.987   1.686   1.00 0.00 ? 820 LEU A CD1  7  
ATOM 5544 C CD2  . LEU A 1 29 ? -3.589  0.297   2.607   1.00 0.00 ? 820 LEU A CD2  7  
ATOM 5545 H H    . LEU A 1 29 ? -6.397  -1.623  4.042   1.00 0.00 ? 820 LEU A H    7  
ATOM 5546 H HA   . LEU A 1 29 ? -4.164  -0.478  5.307   1.00 0.00 ? 820 LEU A HA   7  
ATOM 5547 H HB2  . LEU A 1 29 ? -6.552  0.988   4.167   1.00 0.00 ? 820 LEU A HB2  7  
ATOM 5548 H HB3  . LEU A 1 29 ? -4.919  1.616   4.376   1.00 0.00 ? 820 LEU A HB3  7  
ATOM 5549 H HG   . LEU A 1 29 ? -5.403  -0.850  2.704   1.00 0.00 ? 820 LEU A HG   7  
ATOM 5550 H HD11 . LEU A 1 29 ? -5.931  2.010   2.007   1.00 0.00 ? 820 LEU A HD11 7  
ATOM 5551 H HD12 . LEU A 1 29 ? -6.777  0.558   1.490   1.00 0.00 ? 820 LEU A HD12 7  
ATOM 5552 H HD13 . LEU A 1 29 ? -5.215  0.964   0.782   1.00 0.00 ? 820 LEU A HD13 7  
ATOM 5553 H HD21 . LEU A 1 29 ? -3.339  0.235   1.559   1.00 0.00 ? 820 LEU A HD21 7  
ATOM 5554 H HD22 . LEU A 1 29 ? -3.107  -0.508  3.141   1.00 0.00 ? 820 LEU A HD22 7  
ATOM 5555 H HD23 . LEU A 1 29 ? -3.248  1.241   3.004   1.00 0.00 ? 820 LEU A HD23 7  
ATOM 5556 N N    . GLU A 1 30 ? -7.077  0.025   6.729   1.00 0.00 ? 821 GLU A N    7  
ATOM 5557 C CA   . GLU A 1 30 ? -7.720  0.393   7.977   1.00 0.00 ? 821 GLU A CA   7  
ATOM 5558 C C    . GLU A 1 30 ? -7.193  -0.486  9.101   1.00 0.00 ? 821 GLU A C    7  
ATOM 5559 O O    . GLU A 1 30 ? -6.895  -0.006  10.196  1.00 0.00 ? 821 GLU A O    7  
ATOM 5560 C CB   . GLU A 1 30 ? -9.242  0.235   7.858   1.00 0.00 ? 821 GLU A CB   7  
ATOM 5561 C CG   . GLU A 1 30 ? -9.942  1.233   8.786   1.00 0.00 ? 821 GLU A CG   7  
ATOM 5562 C CD   . GLU A 1 30 ? -10.071 2.575   8.102   1.00 0.00 ? 821 GLU A CD   7  
ATOM 5563 O OE1  . GLU A 1 30 ? -11.022 2.755   7.376   1.00 0.00 ? 821 GLU A OE1  7  
ATOM 5564 O OE2  . GLU A 1 30 ? -9.210  3.403   8.302   1.00 0.00 ? 821 GLU A OE2  7  
ATOM 5565 H H    . GLU A 1 30 ? -7.615  -0.341  5.994   1.00 0.00 ? 821 GLU A H    7  
ATOM 5566 H HA   . GLU A 1 30 ? -7.489  1.424   8.199   1.00 0.00 ? 821 GLU A HA   7  
ATOM 5567 N N    . SER A 1 31 ? -7.055  -1.771  8.813   1.00 0.00 ? 822 SER A N    7  
ATOM 5568 C CA   . SER A 1 31 ? -6.540  -2.718  9.788   1.00 0.00 ? 822 SER A CA   7  
ATOM 5569 C C    . SER A 1 31 ? -5.162  -2.283  10.267  1.00 0.00 ? 822 SER A C    7  
ATOM 5570 O O    . SER A 1 31 ? -4.894  -2.244  11.470  1.00 0.00 ? 822 SER A O    7  
ATOM 5571 C CB   . SER A 1 31 ? -6.474  -4.119  9.181   1.00 0.00 ? 822 SER A CB   7  
ATOM 5572 O OG   . SER A 1 31 ? -7.705  -4.397  8.499   1.00 0.00 ? 822 SER A OG   7  
ATOM 5573 H H    . SER A 1 31 ? -7.289  -2.082  7.914   1.00 0.00 ? 822 SER A H    7  
ATOM 5574 H HA   . SER A 1 31 ? -7.207  -2.739  10.637  1.00 0.00 ? 822 SER A HA   7  
ATOM 5575 H HB2  . SER A 1 31 ? -5.657  -4.174  8.478   1.00 0.00 ? 822 SER A HB2  7  
ATOM 5576 H HB3  . SER A 1 31 ? -6.308  -4.840  9.972   1.00 0.00 ? 822 SER A HB3  7  
ATOM 5577 H HG   . SER A 1 31 ? -7.905  -3.640  7.923   1.00 0.00 ? 822 SER A HG   7  
ATOM 5578 N N    . ILE A 1 32 ? -4.304  -1.906  9.326   1.00 0.00 ? 823 ILE A N    7  
ATOM 5579 C CA   . ILE A 1 32 ? -2.976  -1.421  9.674   1.00 0.00 ? 823 ILE A CA   7  
ATOM 5580 C C    . ILE A 1 32 ? -3.038  0.062   10.045  1.00 0.00 ? 823 ILE A C    7  
ATOM 5581 O O    . ILE A 1 32 ? -2.009  0.736   10.153  1.00 0.00 ? 823 ILE A O    7  
ATOM 5582 C CB   . ILE A 1 32 ? -1.994  -1.645  8.512   1.00 0.00 ? 823 ILE A CB   7  
ATOM 5583 C CG1  . ILE A 1 32 ? -2.416  -0.805  7.305   1.00 0.00 ? 823 ILE A CG1  7  
ATOM 5584 C CG2  . ILE A 1 32 ? -1.992  -3.127  8.117   1.00 0.00 ? 823 ILE A CG2  7  
ATOM 5585 C CD1  . ILE A 1 32 ? -1.429  -1.023  6.156   1.00 0.00 ? 823 ILE A CD1  7  
ATOM 5586 H H    . ILE A 1 32 ? -4.581  -1.923  8.384   1.00 0.00 ? 823 ILE A H    7  
ATOM 5587 H HA   . ILE A 1 32 ? -2.623  -1.971  10.536  1.00 0.00 ? 823 ILE A HA   7  
ATOM 5588 H HB   . ILE A 1 32 ? -1.000  -1.358  8.829   1.00 0.00 ? 823 ILE A HB   7  
ATOM 5589 H HG12 . ILE A 1 32 ? -3.402  -1.109  6.993   1.00 0.00 ? 823 ILE A HG12 7  
ATOM 5590 H HG21 . ILE A 1 32 ? -2.338  -3.725  8.945   1.00 0.00 ? 823 ILE A HG21 7  
ATOM 5591 H HG22 . ILE A 1 32 ? -0.989  -3.426  7.852   1.00 0.00 ? 823 ILE A HG22 7  
ATOM 5592 H HG23 . ILE A 1 32 ? -2.644  -3.276  7.268   1.00 0.00 ? 823 ILE A HG23 7  
ATOM 5593 H HD11 . ILE A 1 32 ? -1.444  -0.164  5.500   1.00 0.00 ? 823 ILE A HD11 7  
ATOM 5594 H HD12 . ILE A 1 32 ? -1.715  -1.905  5.602   1.00 0.00 ? 823 ILE A HD12 7  
ATOM 5595 H HD13 . ILE A 1 32 ? -0.433  -1.155  6.553   1.00 0.00 ? 823 ILE A HD13 7  
ATOM 5596 N N    . GLY A 1 33 ? -4.251  0.560   10.245  1.00 0.00 ? 824 GLY A N    7  
ATOM 5597 C CA   . GLY A 1 33 ? -4.462  1.950   10.620  1.00 0.00 ? 824 GLY A CA   7  
ATOM 5598 C C    . GLY A 1 33 ? -3.798  2.901   9.639   1.00 0.00 ? 824 GLY A C    7  
ATOM 5599 O O    . GLY A 1 33 ? -3.117  3.846   10.045  1.00 0.00 ? 824 GLY A O    7  
ATOM 5600 H H    . GLY A 1 33 ? -5.030  -0.027  10.144  1.00 0.00 ? 824 GLY A H    7  
ATOM 5601 H HA2  . GLY A 1 33 ? -5.522  2.152   10.648  1.00 0.00 ? 824 GLY A HA2  7  
ATOM 5602 H HA3  . GLY A 1 33 ? -4.046  2.115   11.602  1.00 0.00 ? 824 GLY A HA3  7  
ATOM 5603 N N    . LEU A 1 34 ? -4.000  2.665   8.346   1.00 0.00 ? 825 LEU A N    7  
ATOM 5604 C CA   . LEU A 1 34 ? -3.415  3.528   7.323   1.00 0.00 ? 825 LEU A CA   7  
ATOM 5605 C C    . LEU A 1 34 ? -4.487  4.109   6.396   1.00 0.00 ? 825 LEU A C    7  
ATOM 5606 O O    . LEU A 1 34 ? -4.506  3.820   5.199   1.00 0.00 ? 825 LEU A O    7  
ATOM 5607 C CB   . LEU A 1 34 ? -2.376  2.755   6.492   1.00 0.00 ? 825 LEU A CB   7  
ATOM 5608 C CG   . LEU A 1 34 ? -1.034  2.669   7.245   1.00 0.00 ? 825 LEU A CG   7  
ATOM 5609 C CD1  . LEU A 1 34 ? 0.041   2.133   6.298   1.00 0.00 ? 825 LEU A CD1  7  
ATOM 5610 C CD2  . LEU A 1 34 ? -0.615  4.061   7.740   1.00 0.00 ? 825 LEU A CD2  7  
ATOM 5611 H H    . LEU A 1 34 ? -4.553  1.897   8.073   1.00 0.00 ? 825 LEU A H    7  
ATOM 5612 H HA   . LEU A 1 34 ? -2.919  4.352   7.809   1.00 0.00 ? 825 LEU A HA   7  
ATOM 5613 H HB2  . LEU A 1 34 ? -2.746  1.760   6.296   1.00 0.00 ? 825 LEU A HB2  7  
ATOM 5614 H HB3  . LEU A 1 34 ? -2.223  3.263   5.554   1.00 0.00 ? 825 LEU A HB3  7  
ATOM 5615 H HG   . LEU A 1 34 ? -1.138  1.996   8.084   1.00 0.00 ? 825 LEU A HG   7  
ATOM 5616 H HD11 . LEU A 1 34 ? -0.414  1.846   5.362   1.00 0.00 ? 825 LEU A HD11 7  
ATOM 5617 H HD12 . LEU A 1 34 ? 0.515   1.271   6.743   1.00 0.00 ? 825 LEU A HD12 7  
ATOM 5618 H HD13 . LEU A 1 34 ? 0.782   2.900   6.115   1.00 0.00 ? 825 LEU A HD13 7  
ATOM 5619 H HD21 . LEU A 1 34 ? 0.463   4.113   7.793   1.00 0.00 ? 825 LEU A HD21 7  
ATOM 5620 H HD22 . LEU A 1 34 ? -1.027  4.237   8.722   1.00 0.00 ? 825 LEU A HD22 7  
ATOM 5621 H HD23 . LEU A 1 34 ? -0.975  4.814   7.055   1.00 0.00 ? 825 LEU A HD23 7  
ATOM 5622 N N    . PRO A 1 35 ? -5.351  4.949   6.914   1.00 0.00 ? 826 PRO A N    7  
ATOM 5623 C CA   . PRO A 1 35 ? -6.398  5.630   6.091   1.00 0.00 ? 826 PRO A CA   7  
ATOM 5624 C C    . PRO A 1 35 ? -5.772  6.412   4.927   1.00 0.00 ? 826 PRO A C    7  
ATOM 5625 O O    . PRO A 1 35 ? -4.557  6.622   4.895   1.00 0.00 ? 826 PRO A O    7  
ATOM 5626 C CB   . PRO A 1 35 ? -7.072  6.593   7.075   1.00 0.00 ? 826 PRO A CB   7  
ATOM 5627 C CG   . PRO A 1 35 ? -6.779  6.044   8.433   1.00 0.00 ? 826 PRO A CG   7  
ATOM 5628 C CD   . PRO A 1 35 ? -5.433  5.329   8.333   1.00 0.00 ? 826 PRO A CD   7  
ATOM 5629 H HA   . PRO A 1 35 ? -7.128  4.926   5.734   1.00 0.00 ? 826 PRO A HA   7  
ATOM 5630 H HB2  . PRO A 1 35 ? -6.661  7.586   6.965   1.00 0.00 ? 826 PRO A HB2  7  
ATOM 5631 H HB3  . PRO A 1 35 ? -8.137  6.610   6.911   1.00 0.00 ? 826 PRO A HB3  7  
ATOM 5632 H HG2  . PRO A 1 35 ? -6.726  6.849   9.154   1.00 0.00 ? 826 PRO A HG2  7  
ATOM 5633 H HG3  . PRO A 1 35 ? -7.540  5.334   8.723   1.00 0.00 ? 826 PRO A HG3  7  
ATOM 5634 H HD2  . PRO A 1 35 ? -4.628  5.993   8.611   1.00 0.00 ? 826 PRO A HD2  7  
ATOM 5635 H HD3  . PRO A 1 35 ? -5.435  4.449   8.952   1.00 0.00 ? 826 PRO A HD3  7  
ATOM 5636 N N    . GLN A 1 36 ? -6.610  6.860   3.999   1.00 0.00 ? 827 GLN A N    7  
ATOM 5637 C CA   . GLN A 1 36 ? -6.153  7.645   2.846   1.00 0.00 ? 827 GLN A CA   7  
ATOM 5638 C C    . GLN A 1 36 ? -5.249  6.823   1.929   1.00 0.00 ? 827 GLN A C    7  
ATOM 5639 O O    . GLN A 1 36 ? -4.508  7.380   1.111   1.00 0.00 ? 827 GLN A O    7  
ATOM 5640 C CB   . GLN A 1 36 ? -5.420  8.918   3.306   1.00 0.00 ? 827 GLN A CB   7  
ATOM 5641 C CG   . GLN A 1 36 ? -6.381  9.812   4.101   1.00 0.00 ? 827 GLN A CG   7  
ATOM 5642 C CD   . GLN A 1 36 ? -7.492  10.322  3.191   1.00 0.00 ? 827 GLN A CD   7  
ATOM 5643 O OE1  . GLN A 1 36 ? -7.238  11.123  2.285   1.00 0.00 ? 827 GLN A OE1  7  
ATOM 5644 N NE2  . GLN A 1 36 ? -8.706  9.902   3.367   1.00 0.00 ? 827 GLN A NE2  7  
ATOM 5645 H H    . GLN A 1 36 ? -7.567  6.673   4.098   1.00 0.00 ? 827 GLN A H    7  
ATOM 5646 H HA   . GLN A 1 36 ? -7.022  7.941   2.278   1.00 0.00 ? 827 GLN A HA   7  
ATOM 5647 H HB2  . GLN A 1 36 ? -4.577  8.651   3.924   1.00 0.00 ? 827 GLN A HB2  7  
ATOM 5648 H HB3  . GLN A 1 36 ? -5.068  9.460   2.441   1.00 0.00 ? 827 GLN A HB3  7  
ATOM 5649 H HG2  . GLN A 1 36 ? -6.812  9.245   4.914   1.00 0.00 ? 827 GLN A HG2  7  
ATOM 5650 H HG3  . GLN A 1 36 ? -5.837  10.654  4.504   1.00 0.00 ? 827 GLN A HG3  7  
ATOM 5651 H HE21 . GLN A 1 36 ? -8.904  9.260   4.081   1.00 0.00 ? 827 GLN A HE21 7  
ATOM 5652 H HE22 . GLN A 1 36 ? -9.428  10.226  2.788   1.00 0.00 ? 827 GLN A HE22 7  
ATOM 5653 N N    . TYR A 1 37 ? -5.341  5.509   2.038   1.00 0.00 ? 828 TYR A N    7  
ATOM 5654 C CA   . TYR A 1 37 ? -4.558  4.613   1.186   1.00 0.00 ? 828 TYR A CA   7  
ATOM 5655 C C    . TYR A 1 37 ? -5.483  3.852   0.246   1.00 0.00 ? 828 TYR A C    7  
ATOM 5656 O O    . TYR A 1 37 ? -5.024  3.101   -0.617  1.00 0.00 ? 828 TYR A O    7  
ATOM 5657 C CB   . TYR A 1 37 ? -3.832  3.587   2.052   1.00 0.00 ? 828 TYR A CB   7  
ATOM 5658 C CG   . TYR A 1 37 ? -2.353  3.853   2.113   1.00 0.00 ? 828 TYR A CG   7  
ATOM 5659 C CD1  . TYR A 1 37 ? -1.547  3.577   1.006   1.00 0.00 ? 828 TYR A CD1  7  
ATOM 5660 C CD2  . TYR A 1 37 ? -1.784  4.325   3.292   1.00 0.00 ? 828 TYR A CD2  7  
ATOM 5661 C CE1  . TYR A 1 37 ? -0.170  3.782   1.079   1.00 0.00 ? 828 TYR A CE1  7  
ATOM 5662 C CE2  . TYR A 1 37 ? -0.410  4.520   3.372   1.00 0.00 ? 828 TYR A CE2  7  
ATOM 5663 C CZ   . TYR A 1 37 ? 0.401   4.250   2.263   1.00 0.00 ? 828 TYR A CZ   7  
ATOM 5664 O OH   . TYR A 1 37 ? 1.763   4.429   2.344   1.00 0.00 ? 828 TYR A OH   7  
ATOM 5665 H H    . TYR A 1 37 ? -5.968  5.128   2.686   1.00 0.00 ? 828 TYR A H    7  
ATOM 5666 H HA   . TYR A 1 37 ? -3.833  5.176   0.620   1.00 0.00 ? 828 TYR A HA   7  
ATOM 5667 H HB2  . TYR A 1 37 ? -4.236  3.600   3.049   1.00 0.00 ? 828 TYR A HB2  7  
ATOM 5668 H HB3  . TYR A 1 37 ? -3.985  2.611   1.625   1.00 0.00 ? 828 TYR A HB3  7  
ATOM 5669 H HH   . TYR A 1 37 ? 2.118   3.743   2.926   1.00 0.00 ? 828 TYR A HH   7  
ATOM 5670 N N    . GLU A 1 38 ? -6.784  4.034   0.426   1.00 0.00 ? 829 GLU A N    7  
ATOM 5671 C CA   . GLU A 1 38 ? -7.767  3.337   -0.388  1.00 0.00 ? 829 GLU A CA   7  
ATOM 5672 C C    . GLU A 1 38 ? -7.764  3.886   -1.797  1.00 0.00 ? 829 GLU A C    7  
ATOM 5673 O O    . GLU A 1 38 ? -7.191  3.281   -2.703  1.00 0.00 ? 829 GLU A O    7  
ATOM 5674 C CB   . GLU A 1 38 ? -9.165  3.461   0.238   1.00 0.00 ? 829 GLU A CB   7  
ATOM 5675 C CG   . GLU A 1 38 ? -10.200 2.721   -0.633  1.00 0.00 ? 829 GLU A CG   7  
ATOM 5676 C CD   . GLU A 1 38 ? -10.868 3.684   -1.605  1.00 0.00 ? 829 GLU A CD   7  
ATOM 5677 O OE1  . GLU A 1 38 ? -11.130 4.805   -1.216  1.00 0.00 ? 829 GLU A OE1  7  
ATOM 5678 O OE2  . GLU A 1 38 ? -11.112 3.289   -2.722  1.00 0.00 ? 829 GLU A OE2  7  
ATOM 5679 H H    . GLU A 1 38 ? -7.087  4.637   1.136   1.00 0.00 ? 829 GLU A H    7  
ATOM 5680 H HA   . GLU A 1 38 ? -7.498  2.292   -0.426  1.00 0.00 ? 829 GLU A HA   7  
ATOM 5681 N N    . ASN A 1 39 ? -8.381  5.048   -1.976  1.00 0.00 ? 830 ASN A N    7  
ATOM 5682 C CA   . ASN A 1 39 ? -8.419  5.686   -3.281  1.00 0.00 ? 830 ASN A CA   7  
ATOM 5683 C C    . ASN A 1 39 ? -7.038  5.660   -3.896  1.00 0.00 ? 830 ASN A C    7  
ATOM 5684 O O    . ASN A 1 39 ? -6.889  5.480   -5.098  1.00 0.00 ? 830 ASN A O    7  
ATOM 5685 C CB   . ASN A 1 39 ? -8.911  7.134   -3.167  1.00 0.00 ? 830 ASN A CB   7  
ATOM 5686 C CG   . ASN A 1 39 ? -10.323 7.249   -3.725  1.00 0.00 ? 830 ASN A CG   7  
ATOM 5687 O OD1  . ASN A 1 39 ? -10.560 8.010   -4.667  1.00 0.00 ? 830 ASN A OD1  7  
ATOM 5688 N ND2  . ASN A 1 39 ? -11.279 6.533   -3.208  1.00 0.00 ? 830 ASN A ND2  7  
ATOM 5689 H H    . ASN A 1 39 ? -8.799  5.489   -1.208  1.00 0.00 ? 830 ASN A H    7  
ATOM 5690 H HA   . ASN A 1 39 ? -9.095  5.134   -3.919  1.00 0.00 ? 830 ASN A HA   7  
ATOM 5691 H HB2  . ASN A 1 39 ? -8.908  7.439   -2.131  1.00 0.00 ? 830 ASN A HB2  7  
ATOM 5692 H HB3  . ASN A 1 39 ? -8.255  7.781   -3.730  1.00 0.00 ? 830 ASN A HB3  7  
ATOM 5693 H HD21 . ASN A 1 39 ? -11.091 5.920   -2.461  1.00 0.00 ? 830 ASN A HD21 7  
ATOM 5694 H HD22 . ASN A 1 39 ? -12.192 6.602   -3.559  1.00 0.00 ? 830 ASN A HD22 7  
ATOM 5695 N N    . HIS A 1 40 ? -6.027  5.802   -3.049  1.00 0.00 ? 831 HIS A N    7  
ATOM 5696 C CA   . HIS A 1 40 ? -4.646  5.758   -3.502  1.00 0.00 ? 831 HIS A CA   7  
ATOM 5697 C C    . HIS A 1 40 ? -4.368  4.435   -4.207  1.00 0.00 ? 831 HIS A C    7  
ATOM 5698 O O    . HIS A 1 40 ? -3.979  4.410   -5.378  1.00 0.00 ? 831 HIS A O    7  
ATOM 5699 C CB   . HIS A 1 40 ? -3.692  5.917   -2.310  1.00 0.00 ? 831 HIS A CB   7  
ATOM 5700 C CG   . HIS A 1 40 ? -3.324  7.365   -2.135  1.00 0.00 ? 831 HIS A CG   7  
ATOM 5701 N ND1  . HIS A 1 40 ? -3.457  8.023   -0.920  1.00 0.00 ? 831 HIS A ND1  7  
ATOM 5702 C CD2  . HIS A 1 40 ? -2.813  8.289   -3.009  1.00 0.00 ? 831 HIS A CD2  7  
ATOM 5703 C CE1  . HIS A 1 40 ? -3.029  9.290   -1.099  1.00 0.00 ? 831 HIS A CE1  7  
ATOM 5704 N NE2  . HIS A 1 40 ? -2.626  9.503   -2.355  1.00 0.00 ? 831 HIS A NE2  7  
ATOM 5705 H H    . HIS A 1 40 ? -6.220  5.916   -2.094  1.00 0.00 ? 831 HIS A H    7  
ATOM 5706 H HA   . HIS A 1 40 ? -4.478  6.568   -4.195  1.00 0.00 ? 831 HIS A HA   7  
ATOM 5707 H HB2  . HIS A 1 40 ? -4.173  5.557   -1.414  1.00 0.00 ? 831 HIS A HB2  7  
ATOM 5708 H HB3  . HIS A 1 40 ? -2.795  5.340   -2.488  1.00 0.00 ? 831 HIS A HB3  7  
ATOM 5709 N N    . LEU A 1 41 ? -4.590  3.333   -3.499  1.00 0.00 ? 832 LEU A N    7  
ATOM 5710 C CA   . LEU A 1 41 ? -4.374  2.016   -4.071  1.00 0.00 ? 832 LEU A CA   7  
ATOM 5711 C C    . LEU A 1 41 ? -5.420  1.729   -5.134  1.00 0.00 ? 832 LEU A C    7  
ATOM 5712 O O    . LEU A 1 41 ? -5.104  1.201   -6.202  1.00 0.00 ? 832 LEU A O    7  
ATOM 5713 C CB   . LEU A 1 41 ? -4.424  0.944   -2.977  1.00 0.00 ? 832 LEU A CB   7  
ATOM 5714 C CG   . LEU A 1 41 ? -2.993  0.566   -2.558  1.00 0.00 ? 832 LEU A CG   7  
ATOM 5715 C CD1  . LEU A 1 41 ? -2.436  1.625   -1.608  1.00 0.00 ? 832 LEU A CD1  7  
ATOM 5716 C CD2  . LEU A 1 41 ? -3.008  -0.791  -1.848  1.00 0.00 ? 832 LEU A CD2  7  
ATOM 5717 H H    . LEU A 1 41 ? -4.920  3.403   -2.577  1.00 0.00 ? 832 LEU A H    7  
ATOM 5718 H HA   . LEU A 1 41 ? -3.399  1.997   -4.533  1.00 0.00 ? 832 LEU A HA   7  
ATOM 5719 H HB2  . LEU A 1 41 ? -4.969  1.322   -2.125  1.00 0.00 ? 832 LEU A HB2  7  
ATOM 5720 H HB3  . LEU A 1 41 ? -4.926  0.071   -3.360  1.00 0.00 ? 832 LEU A HB3  7  
ATOM 5721 H HG   . LEU A 1 41 ? -2.362  0.509   -3.434  1.00 0.00 ? 832 LEU A HG   7  
ATOM 5722 H HD11 . LEU A 1 41 ? -1.415  1.382   -1.356  1.00 0.00 ? 832 LEU A HD11 7  
ATOM 5723 H HD12 . LEU A 1 41 ? -3.032  1.646   -0.707  1.00 0.00 ? 832 LEU A HD12 7  
ATOM 5724 H HD13 . LEU A 1 41 ? -2.468  2.594   -2.083  1.00 0.00 ? 832 LEU A HD13 7  
ATOM 5725 H HD21 . LEU A 1 41 ? -3.327  -1.556  -2.540  1.00 0.00 ? 832 LEU A HD21 7  
ATOM 5726 H HD22 . LEU A 1 41 ? -3.688  -0.755  -1.010  1.00 0.00 ? 832 LEU A HD22 7  
ATOM 5727 H HD23 . LEU A 1 41 ? -2.014  -1.022  -1.494  1.00 0.00 ? 832 LEU A HD23 7  
ATOM 5728 N N    . MET A 1 42 ? -6.660  2.098   -4.849  1.00 0.00 ? 833 MET A N    7  
ATOM 5729 C CA   . MET A 1 42 ? -7.746  1.897   -5.795  1.00 0.00 ? 833 MET A CA   7  
ATOM 5730 C C    . MET A 1 42 ? -7.436  2.612   -7.101  1.00 0.00 ? 833 MET A C    7  
ATOM 5731 O O    . MET A 1 42 ? -7.391  1.990   -8.162  1.00 0.00 ? 833 MET A O    7  
ATOM 5732 C CB   . MET A 1 42 ? -9.071  2.406   -5.212  1.00 0.00 ? 833 MET A CB   7  
ATOM 5733 C CG   . MET A 1 42 ? -10.204 1.437   -5.573  1.00 0.00 ? 833 MET A CG   7  
ATOM 5734 S SD   . MET A 1 42 ? -9.725  -0.257  -5.134  1.00 0.00 ? 833 MET A SD   7  
ATOM 5735 C CE   . MET A 1 42 ? -9.470  0.021   -3.365  1.00 0.00 ? 833 MET A CE   7  
ATOM 5736 H H    . MET A 1 42 ? -6.843  2.531   -3.986  1.00 0.00 ? 833 MET A H    7  
ATOM 5737 H HA   . MET A 1 42 ? -7.835  0.841   -5.995  1.00 0.00 ? 833 MET A HA   7  
ATOM 5738 H HB2  . MET A 1 42 ? -8.991  2.481   -4.137  1.00 0.00 ? 833 MET A HB2  7  
ATOM 5739 H HB3  . MET A 1 42 ? -9.294  3.379   -5.620  1.00 0.00 ? 833 MET A HB3  7  
ATOM 5740 H HG2  . MET A 1 42 ? -11.096 1.711   -5.029  1.00 0.00 ? 833 MET A HG2  7  
ATOM 5741 H HG3  . MET A 1 42 ? -10.401 1.491   -6.634  1.00 0.00 ? 833 MET A HG3  7  
ATOM 5742 H HE1  . MET A 1 42 ? -8.453  0.343   -3.195  1.00 0.00 ? 833 MET A HE1  7  
ATOM 5743 H HE2  . MET A 1 42 ? -9.646  -0.897  -2.826  1.00 0.00 ? 833 MET A HE2  7  
ATOM 5744 H HE3  . MET A 1 42 ? -10.161 0.774   -3.015  1.00 0.00 ? 833 MET A HE3  7  
ATOM 5745 N N    . ALA A 1 43 ? -7.172  3.911   -7.015  1.00 0.00 ? 834 ALA A N    7  
ATOM 5746 C CA   . ALA A 1 43 ? -6.810  4.686   -8.196  1.00 0.00 ? 834 ALA A CA   7  
ATOM 5747 C C    . ALA A 1 43 ? -5.589  4.070   -8.844  1.00 0.00 ? 834 ALA A C    7  
ATOM 5748 O O    . ALA A 1 43 ? -5.508  3.954   -10.067 1.00 0.00 ? 834 ALA A O    7  
ATOM 5749 C CB   . ALA A 1 43 ? -6.515  6.139   -7.818  1.00 0.00 ? 834 ALA A CB   7  
ATOM 5750 H H    . ALA A 1 43 ? -7.187  4.349   -6.135  1.00 0.00 ? 834 ALA A H    7  
ATOM 5751 H HA   . ALA A 1 43 ? -7.633  4.664   -8.898  1.00 0.00 ? 834 ALA A HA   7  
ATOM 5752 H HB1  . ALA A 1 43 ? -6.321  6.709   -8.714  1.00 0.00 ? 834 ALA A HB1  7  
ATOM 5753 H HB2  . ALA A 1 43 ? -5.647  6.175   -7.176  1.00 0.00 ? 834 ALA A HB2  7  
ATOM 5754 H HB3  . ALA A 1 43 ? -7.362  6.560   -7.300  1.00 0.00 ? 834 ALA A HB3  7  
ATOM 5755 N N    . ASN A 1 44 ? -4.661  3.630   -8.008  1.00 0.00 ? 835 ASN A N    7  
ATOM 5756 C CA   . ASN A 1 44 ? -3.452  2.969   -8.482  1.00 0.00 ? 835 ASN A CA   7  
ATOM 5757 C C    . ASN A 1 44 ? -3.781  1.568   -8.974  1.00 0.00 ? 835 ASN A C    7  
ATOM 5758 O O    . ASN A 1 44 ? -2.895  0.811   -9.370  1.00 0.00 ? 835 ASN A O    7  
ATOM 5759 C CB   . ASN A 1 44 ? -2.423  2.892   -7.350  1.00 0.00 ? 835 ASN A CB   7  
ATOM 5760 C CG   . ASN A 1 44 ? -1.064  2.444   -7.883  1.00 0.00 ? 835 ASN A CG   7  
ATOM 5761 O OD1  . ASN A 1 44 ? -0.811  2.502   -9.086  1.00 0.00 ? 835 ASN A OD1  7  
ATOM 5762 N ND2  . ASN A 1 44 ? -0.168  2.006   -7.051  1.00 0.00 ? 835 ASN A ND2  7  
ATOM 5763 H H    . ASN A 1 44 ? -4.808  3.726   -7.043  1.00 0.00 ? 835 ASN A H    7  
ATOM 5764 H HA   . ASN A 1 44 ? -3.031  3.539   -9.298  1.00 0.00 ? 835 ASN A HA   7  
ATOM 5765 H HB2  . ASN A 1 44 ? -2.320  3.865   -6.897  1.00 0.00 ? 835 ASN A HB2  7  
ATOM 5766 H HB3  . ASN A 1 44 ? -2.764  2.186   -6.609  1.00 0.00 ? 835 ASN A HB3  7  
ATOM 5767 H HD21 . ASN A 1 44 ? -0.366  1.963   -6.094  1.00 0.00 ? 835 ASN A HD21 7  
ATOM 5768 H HD22 . ASN A 1 44 ? 0.714   1.714   -7.376  1.00 0.00 ? 835 ASN A HD22 7  
ATOM 5769 N N    . GLY A 1 45 ? -5.063  1.219   -8.931  1.00 0.00 ? 836 GLY A N    7  
ATOM 5770 C CA   . GLY A 1 45 ? -5.508  -0.094  -9.363  1.00 0.00 ? 836 GLY A CA   7  
ATOM 5771 C C    . GLY A 1 45 ? -4.761  -1.180  -8.620  1.00 0.00 ? 836 GLY A C    7  
ATOM 5772 O O    . GLY A 1 45 ? -4.443  -2.224  -9.188  1.00 0.00 ? 836 GLY A O    7  
ATOM 5773 H H    . GLY A 1 45 ? -5.724  1.858   -8.590  1.00 0.00 ? 836 GLY A H    7  
ATOM 5774 H HA2  . GLY A 1 45 ? -6.567  -0.192  -9.174  1.00 0.00 ? 836 GLY A HA2  7  
ATOM 5775 H HA3  . GLY A 1 45 ? -5.323  -0.201  -10.420 1.00 0.00 ? 836 GLY A HA3  7  
ATOM 5776 N N    . PHE A 1 46 ? -4.458  -0.924  -7.355  1.00 0.00 ? 837 PHE A N    7  
ATOM 5777 C CA   . PHE A 1 46 ? -3.724  -1.888  -6.547  1.00 0.00 ? 837 PHE A CA   7  
ATOM 5778 C C    . PHE A 1 46 ? -4.652  -2.613  -5.582  1.00 0.00 ? 837 PHE A C    7  
ATOM 5779 O O    . PHE A 1 46 ? -5.026  -2.071  -4.538  1.00 0.00 ? 837 PHE A O    7  
ATOM 5780 C CB   . PHE A 1 46 ? -2.598  -1.197  -5.766  1.00 0.00 ? 837 PHE A CB   7  
ATOM 5781 C CG   . PHE A 1 46 ? -1.346  -2.044  -5.834  1.00 0.00 ? 837 PHE A CG   7  
ATOM 5782 C CD1  . PHE A 1 46 ? -1.381  -3.381  -5.414  1.00 0.00 ? 837 PHE A CD1  7  
ATOM 5783 C CD2  . PHE A 1 46 ? -0.154  -1.497  -6.321  1.00 0.00 ? 837 PHE A CD2  7  
ATOM 5784 C CE1  . PHE A 1 46 ? -0.226  -4.166  -5.482  1.00 0.00 ? 837 PHE A CE1  7  
ATOM 5785 C CE2  . PHE A 1 46 ? 1.001   -2.284  -6.388  1.00 0.00 ? 837 PHE A CE2  7  
ATOM 5786 C CZ   . PHE A 1 46 ? 0.965   -3.617  -5.970  1.00 0.00 ? 837 PHE A CZ   7  
ATOM 5787 H H    . PHE A 1 46 ? -4.726  -0.064  -6.959  1.00 0.00 ? 837 PHE A H    7  
ATOM 5788 H HA   . PHE A 1 46 ? -3.280  -2.619  -7.206  1.00 0.00 ? 837 PHE A HA   7  
ATOM 5789 H HB2  . PHE A 1 46 ? -2.401  -0.225  -6.195  1.00 0.00 ? 837 PHE A HB2  7  
ATOM 5790 H HB3  . PHE A 1 46 ? -2.893  -1.079  -4.734  1.00 0.00 ? 837 PHE A HB3  7  
ATOM 5791 H HZ   . PHE A 1 46 ? 1.858   -4.223  -6.023  1.00 0.00 ? 837 PHE A HZ   7  
ATOM 5792 N N    . ASP A 1 47 ? -4.993  -3.846  -5.919  1.00 0.00 ? 838 ASP A N    7  
ATOM 5793 C CA   . ASP A 1 47 ? -5.834  -4.675  -5.067  1.00 0.00 ? 838 ASP A CA   7  
ATOM 5794 C C    . ASP A 1 47 ? -5.308  -6.102  -5.050  1.00 0.00 ? 838 ASP A C    7  
ATOM 5795 O O    . ASP A 1 47 ? -5.323  -6.786  -6.074  1.00 0.00 ? 838 ASP A O    7  
ATOM 5796 C CB   . ASP A 1 47 ? -7.294  -4.662  -5.553  1.00 0.00 ? 838 ASP A CB   7  
ATOM 5797 C CG   . ASP A 1 47 ? -7.378  -5.108  -7.003  1.00 0.00 ? 838 ASP A CG   7  
ATOM 5798 O OD1  . ASP A 1 47 ? -6.870  -4.401  -7.851  1.00 0.00 ? 838 ASP A OD1  7  
ATOM 5799 O OD2  . ASP A 1 47 ? -7.957  -6.145  -7.251  1.00 0.00 ? 838 ASP A OD2  7  
ATOM 5800 H H    . ASP A 1 47 ? -4.642  -4.228  -6.752  1.00 0.00 ? 838 ASP A H    7  
ATOM 5801 H HA   . ASP A 1 47 ? -5.801  -4.281  -4.062  1.00 0.00 ? 838 ASP A HA   7  
ATOM 5802 N N    . ASN A 1 48 ? -4.828  -6.524  -3.876  1.00 0.00 ? 839 ASN A N    7  
ATOM 5803 C CA   . ASN A 1 48 ? -4.254  -7.870  -3.648  1.00 0.00 ? 839 ASN A CA   7  
ATOM 5804 C C    . ASN A 1 48 ? -3.055  -7.768  -2.717  1.00 0.00 ? 839 ASN A C    7  
ATOM 5805 O O    . ASN A 1 48 ? -1.928  -8.126  -3.084  1.00 0.00 ? 839 ASN A O    7  
ATOM 5806 C CB   . ASN A 1 48 ? -3.832  -8.569  -4.962  1.00 0.00 ? 839 ASN A CB   7  
ATOM 5807 C CG   . ASN A 1 48 ? -2.866  -7.696  -5.769  1.00 0.00 ? 839 ASN A CG   7  
ATOM 5808 O OD1  . ASN A 1 48 ? -2.436  -6.636  -5.306  1.00 0.00 ? 839 ASN A OD1  7  
ATOM 5809 N ND2  . ASN A 1 48 ? -2.503  -8.079  -6.955  1.00 0.00 ? 839 ASN A ND2  7  
ATOM 5810 H H    . ASN A 1 48 ? -4.844  -5.899  -3.122  1.00 0.00 ? 839 ASN A H    7  
ATOM 5811 H HA   . ASN A 1 48 ? -5.004  -8.474  -3.162  1.00 0.00 ? 839 ASN A HA   7  
ATOM 5812 H HB2  . ASN A 1 48 ? -3.345  -9.499  -4.715  1.00 0.00 ? 839 ASN A HB2  7  
ATOM 5813 H HB3  . ASN A 1 48 ? -4.707  -8.785  -5.553  1.00 0.00 ? 839 ASN A HB3  7  
ATOM 5814 H HD21 . ASN A 1 48 ? -2.846  -8.920  -7.327  1.00 0.00 ? 839 ASN A HD21 7  
ATOM 5815 H HD22 . ASN A 1 48 ? -1.890  -7.528  -7.487  1.00 0.00 ? 839 ASN A HD22 7  
ATOM 5816 N N    . VAL A 1 49 ? -3.299  -7.261  -1.513  1.00 0.00 ? 840 VAL A N    7  
ATOM 5817 C CA   . VAL A 1 49 ? -2.241  -7.080  -0.528  1.00 0.00 ? 840 VAL A CA   7  
ATOM 5818 C C    . VAL A 1 49 ? -1.351  -8.319  -0.437  1.00 0.00 ? 840 VAL A C    7  
ATOM 5819 O O    . VAL A 1 49 ? -0.120  -8.216  -0.453  1.00 0.00 ? 840 VAL A O    7  
ATOM 5820 C CB   . VAL A 1 49 ? -2.845  -6.742  0.843   1.00 0.00 ? 840 VAL A CB   7  
ATOM 5821 C CG1  . VAL A 1 49 ? -3.630  -5.434  0.740   1.00 0.00 ? 840 VAL A CG1  7  
ATOM 5822 C CG2  . VAL A 1 49 ? -3.791  -7.863  1.295   1.00 0.00 ? 840 VAL A CG2  7  
ATOM 5823 H H    . VAL A 1 49 ? -4.213  -6.992  -1.285  1.00 0.00 ? 840 VAL A H    7  
ATOM 5824 H HA   . VAL A 1 49 ? -1.627  -6.249  -0.842  1.00 0.00 ? 840 VAL A HA   7  
ATOM 5825 H HB   . VAL A 1 49 ? -2.051  -6.617  1.563   1.00 0.00 ? 840 VAL A HB   7  
ATOM 5826 H HG11 . VAL A 1 49 ? -2.942  -4.603  0.754   1.00 0.00 ? 840 VAL A HG11 7  
ATOM 5827 H HG12 . VAL A 1 49 ? -4.309  -5.355  1.575   1.00 0.00 ? 840 VAL A HG12 7  
ATOM 5828 H HG13 . VAL A 1 49 ? -4.191  -5.419  -0.181  1.00 0.00 ? 840 VAL A HG13 7  
ATOM 5829 H HG21 . VAL A 1 49 ? -4.449  -8.137  0.485   1.00 0.00 ? 840 VAL A HG21 7  
ATOM 5830 H HG22 . VAL A 1 49 ? -4.378  -7.516  2.132   1.00 0.00 ? 840 VAL A HG22 7  
ATOM 5831 H HG23 . VAL A 1 49 ? -3.215  -8.725  1.600   1.00 0.00 ? 840 VAL A HG23 7  
ATOM 5832 N N    . GLN A 1 50 ? -1.974  -9.491  -0.377  1.00 0.00 ? 841 GLN A N    7  
ATOM 5833 C CA   . GLN A 1 50 ? -1.224  -10.736 -0.326  1.00 0.00 ? 841 GLN A CA   7  
ATOM 5834 C C    . GLN A 1 50 ? -0.231  -10.772 -1.479  1.00 0.00 ? 841 GLN A C    7  
ATOM 5835 O O    . GLN A 1 50 ? 0.978   -10.933 -1.276  1.00 0.00 ? 841 GLN A O    7  
ATOM 5836 C CB   . GLN A 1 50 ? -2.178  -11.941 -0.407  1.00 0.00 ? 841 GLN A CB   7  
ATOM 5837 C CG   . GLN A 1 50 ? -1.501  -13.187 0.187   1.00 0.00 ? 841 GLN A CG   7  
ATOM 5838 C CD   . GLN A 1 50 ? -0.346  -13.627 -0.705  1.00 0.00 ? 841 GLN A CD   7  
ATOM 5839 O OE1  . GLN A 1 50 ? -0.449  -13.565 -1.931  1.00 0.00 ? 841 GLN A OE1  7  
ATOM 5840 N NE2  . GLN A 1 50 ? 0.747   -14.065 -0.169  1.00 0.00 ? 841 GLN A NE2  7  
ATOM 5841 H H    . GLN A 1 50 ? -2.953  -9.513  -0.394  1.00 0.00 ? 841 GLN A H    7  
ATOM 5842 H HA   . GLN A 1 50 ? -0.679  -10.777 0.606   1.00 0.00 ? 841 GLN A HA   7  
ATOM 5843 H HB2  . GLN A 1 50 ? -3.079  -11.724 0.150   1.00 0.00 ? 841 GLN A HB2  7  
ATOM 5844 H HB3  . GLN A 1 50 ? -2.433  -12.133 -1.438  1.00 0.00 ? 841 GLN A HB3  7  
ATOM 5845 H HG2  . GLN A 1 50 ? -1.129  -12.960 1.175   1.00 0.00 ? 841 GLN A HG2  7  
ATOM 5846 H HG3  . GLN A 1 50 ? -2.223  -13.988 0.254   1.00 0.00 ? 841 GLN A HG3  7  
ATOM 5847 H HE21 . GLN A 1 50 ? 0.834   -14.117 0.812   1.00 0.00 ? 841 GLN A HE21 7  
ATOM 5848 H HE22 . GLN A 1 50 ? 1.496   -14.342 -0.738  1.00 0.00 ? 841 GLN A HE22 7  
ATOM 5849 N N    . PHE A 1 51 ? -0.742  -10.557 -2.686  1.00 0.00 ? 842 PHE A N    7  
ATOM 5850 C CA   . PHE A 1 51 ? 0.102   -10.504 -3.868  1.00 0.00 ? 842 PHE A CA   7  
ATOM 5851 C C    . PHE A 1 51 ? 1.087   -9.357  -3.729  1.00 0.00 ? 842 PHE A C    7  
ATOM 5852 O O    . PHE A 1 51 ? 2.285   -9.533  -3.909  1.00 0.00 ? 842 PHE A O    7  
ATOM 5853 C CB   . PHE A 1 51 ? -0.755  -10.311 -5.123  1.00 0.00 ? 842 PHE A CB   7  
ATOM 5854 C CG   . PHE A 1 51 ? 0.130   -10.206 -6.350  1.00 0.00 ? 842 PHE A CG   7  
ATOM 5855 C CD1  . PHE A 1 51 ? 0.707   -11.356 -6.900  1.00 0.00 ? 842 PHE A CD1  7  
ATOM 5856 C CD2  . PHE A 1 51 ? 0.366   -8.955  -6.939  1.00 0.00 ? 842 PHE A CD2  7  
ATOM 5857 C CE1  . PHE A 1 51 ? 1.519   -11.257 -8.036  1.00 0.00 ? 842 PHE A CE1  7  
ATOM 5858 C CE2  . PHE A 1 51 ? 1.178   -8.859  -8.074  1.00 0.00 ? 842 PHE A CE2  7  
ATOM 5859 C CZ   . PHE A 1 51 ? 1.754   -10.010 -8.623  1.00 0.00 ? 842 PHE A CZ   7  
ATOM 5860 H H    . PHE A 1 51 ? -1.703  -10.383 -2.773  1.00 0.00 ? 842 PHE A H    7  
ATOM 5861 H HA   . PHE A 1 51 ? 0.649   -11.432 -3.953  1.00 0.00 ? 842 PHE A HA   7  
ATOM 5862 H HB2  . PHE A 1 51 ? -1.425  -11.152 -5.236  1.00 0.00 ? 842 PHE A HB2  7  
ATOM 5863 H HB3  . PHE A 1 51 ? -1.330  -9.405  -5.022  1.00 0.00 ? 842 PHE A HB3  7  
ATOM 5864 H HZ   . PHE A 1 51 ? 2.380   -9.934  -9.501  1.00 0.00 ? 842 PHE A HZ   7  
ATOM 5865 N N    . MET A 1 52 ? 0.569   -8.190  -3.362  1.00 0.00 ? 843 MET A N    7  
ATOM 5866 C CA   . MET A 1 52 ? 1.407   -7.011  -3.161  1.00 0.00 ? 843 MET A CA   7  
ATOM 5867 C C    . MET A 1 52 ? 2.640   -7.380  -2.349  1.00 0.00 ? 843 MET A C    7  
ATOM 5868 O O    . MET A 1 52 ? 3.777   -7.177  -2.787  1.00 0.00 ? 843 MET A O    7  
ATOM 5869 C CB   . MET A 1 52 ? 0.609   -5.928  -2.418  1.00 0.00 ? 843 MET A CB   7  
ATOM 5870 C CG   . MET A 1 52 ? 1.326   -4.579  -2.515  1.00 0.00 ? 843 MET A CG   7  
ATOM 5871 S SD   . MET A 1 52 ? 0.402   -3.350  -1.555  1.00 0.00 ? 843 MET A SD   7  
ATOM 5872 C CE   . MET A 1 52 ? 1.131   -1.870  -2.294  1.00 0.00 ? 843 MET A CE   7  
ATOM 5873 H H    . MET A 1 52 ? -0.399  -8.125  -3.203  1.00 0.00 ? 843 MET A H    7  
ATOM 5874 H HA   . MET A 1 52 ? 1.715   -6.625  -4.121  1.00 0.00 ? 843 MET A HA   7  
ATOM 5875 H HB2  . MET A 1 52 ? -0.377  -5.844  -2.850  1.00 0.00 ? 843 MET A HB2  7  
ATOM 5876 H HB3  . MET A 1 52 ? 0.517   -6.203  -1.378  1.00 0.00 ? 843 MET A HB3  7  
ATOM 5877 H HG2  . MET A 1 52 ? 2.327   -4.670  -2.117  1.00 0.00 ? 843 MET A HG2  7  
ATOM 5878 H HG3  . MET A 1 52 ? 1.378   -4.265  -3.546  1.00 0.00 ? 843 MET A HG3  7  
ATOM 5879 H HE1  . MET A 1 52 ? 0.612   -1.635  -3.214  1.00 0.00 ? 843 MET A HE1  7  
ATOM 5880 H HE2  . MET A 1 52 ? 2.174   -2.043  -2.510  1.00 0.00 ? 843 MET A HE2  7  
ATOM 5881 H HE3  . MET A 1 52 ? 1.043   -1.046  -1.600  1.00 0.00 ? 843 MET A HE3  7  
ATOM 5882 N N    . GLY A 1 53 ? 2.414   -7.948  -1.179  1.00 0.00 ? 844 GLY A N    7  
ATOM 5883 C CA   . GLY A 1 53 ? 3.506   -8.360  -0.311  1.00 0.00 ? 844 GLY A CA   7  
ATOM 5884 C C    . GLY A 1 53 ? 4.263   -9.530  -0.907  1.00 0.00 ? 844 GLY A C    7  
ATOM 5885 O O    . GLY A 1 53 ? 5.464   -9.680  -0.685  1.00 0.00 ? 844 GLY A O    7  
ATOM 5886 H H    . GLY A 1 53 ? 1.485   -8.103  -0.895  1.00 0.00 ? 844 GLY A H    7  
ATOM 5887 H HA2  . GLY A 1 53 ? 4.184   -7.530  -0.174  1.00 0.00 ? 844 GLY A HA2  7  
ATOM 5888 H HA3  . GLY A 1 53 ? 3.105   -8.654  0.647   1.00 0.00 ? 844 GLY A HA3  7  
ATOM 5889 N N    . SER A 1 54 ? 3.560   -10.363 -1.648  1.00 0.00 ? 845 SER A N    7  
ATOM 5890 C CA   . SER A 1 54 ? 4.166   -11.540 -2.248  1.00 0.00 ? 845 SER A CA   7  
ATOM 5891 C C    . SER A 1 54 ? 4.685   -11.269 -3.658  1.00 0.00 ? 845 SER A C    7  
ATOM 5892 O O    . SER A 1 54 ? 5.039   -12.208 -4.374  1.00 0.00 ? 845 SER A O    7  
ATOM 5893 C CB   . SER A 1 54 ? 3.148   -12.674 -2.296  1.00 0.00 ? 845 SER A CB   7  
ATOM 5894 O OG   . SER A 1 54 ? 2.968   -13.205 -0.983  1.00 0.00 ? 845 SER A OG   7  
ATOM 5895 H H    . SER A 1 54 ? 2.600   -10.198 -1.781  1.00 0.00 ? 845 SER A H    7  
ATOM 5896 H HA   . SER A 1 54 ? 4.992   -11.858 -1.631  1.00 0.00 ? 845 SER A HA   7  
ATOM 5897 H HB2  . SER A 1 54 ? 2.205   -12.302 -2.662  1.00 0.00 ? 845 SER A HB2  7  
ATOM 5898 H HB3  . SER A 1 54 ? 3.506   -13.440 -2.971  1.00 0.00 ? 845 SER A HB3  7  
ATOM 5899 H HG   . SER A 1 54 ? 2.320   -12.642 -0.533  1.00 0.00 ? 845 SER A HG   7  
ATOM 5900 N N    . ASN A 1 55 ? 4.695   -10.010 -4.082  1.00 0.00 ? 846 ASN A N    7  
ATOM 5901 C CA   . ASN A 1 55 ? 5.136   -9.706  -5.443  1.00 0.00 ? 846 ASN A CA   7  
ATOM 5902 C C    . ASN A 1 55 ? 6.187   -8.608  -5.487  1.00 0.00 ? 846 ASN A C    7  
ATOM 5903 O O    . ASN A 1 55 ? 7.271   -8.806  -6.044  1.00 0.00 ? 846 ASN A O    7  
ATOM 5904 C CB   . ASN A 1 55 ? 3.939   -9.300  -6.304  1.00 0.00 ? 846 ASN A CB   7  
ATOM 5905 C CG   . ASN A 1 55 ? 4.418   -8.734  -7.634  1.00 0.00 ? 846 ASN A CG   7  
ATOM 5906 O OD1  . ASN A 1 55 ? 4.477   -7.517  -7.805  1.00 0.00 ? 846 ASN A OD1  7  
ATOM 5907 N ND2  . ASN A 1 55 ? 4.770   -9.542  -8.586  1.00 0.00 ? 846 ASN A ND2  7  
ATOM 5908 H H    . ASN A 1 55 ? 4.370   -9.294  -3.497  1.00 0.00 ? 846 ASN A H    7  
ATOM 5909 H HA   . ASN A 1 55 ? 5.565   -10.598 -5.877  1.00 0.00 ? 846 ASN A HA   7  
ATOM 5910 H HB2  . ASN A 1 55 ? 3.318   -10.166 -6.484  1.00 0.00 ? 846 ASN A HB2  7  
ATOM 5911 H HB3  . ASN A 1 55 ? 3.362   -8.549  -5.786  1.00 0.00 ? 846 ASN A HB3  7  
ATOM 5912 H HD21 . ASN A 1 55 ? 4.728   -10.511 -8.447  1.00 0.00 ? 846 ASN A HD21 7  
ATOM 5913 H HD22 . ASN A 1 55 ? 5.079   -9.184  -9.444  1.00 0.00 ? 846 ASN A HD22 7  
ATOM 5914 N N    . VAL A 1 56 ? 5.871   -7.442  -4.935  1.00 0.00 ? 847 VAL A N    7  
ATOM 5915 C CA   . VAL A 1 56 ? 6.819   -6.337  -4.970  1.00 0.00 ? 847 VAL A CA   7  
ATOM 5916 C C    . VAL A 1 56 ? 6.595   -5.346  -3.834  1.00 0.00 ? 847 VAL A C    7  
ATOM 5917 O O    . VAL A 1 56 ? 5.456   -5.059  -3.457  1.00 0.00 ? 847 VAL A O    7  
ATOM 5918 C CB   . VAL A 1 56 ? 6.738   -5.616  -6.330  1.00 0.00 ? 847 VAL A CB   7  
ATOM 5919 C CG1  . VAL A 1 56 ? 5.379   -4.923  -6.477  1.00 0.00 ? 847 VAL A CG1  7  
ATOM 5920 C CG2  . VAL A 1 56 ? 7.857   -4.570  -6.432  1.00 0.00 ? 847 VAL A CG2  7  
ATOM 5921 H H    . VAL A 1 56 ? 4.992   -7.314  -4.518  1.00 0.00 ? 847 VAL A H    7  
ATOM 5922 H HA   . VAL A 1 56 ? 7.813   -6.741  -4.869  1.00 0.00 ? 847 VAL A HA   7  
ATOM 5923 H HB   . VAL A 1 56 ? 6.850   -6.344  -7.121  1.00 0.00 ? 847 VAL A HB   7  
ATOM 5924 H HG11 . VAL A 1 56 ? 5.335   -4.066  -5.821  1.00 0.00 ? 847 VAL A HG11 7  
ATOM 5925 H HG12 . VAL A 1 56 ? 4.589   -5.614  -6.219  1.00 0.00 ? 847 VAL A HG12 7  
ATOM 5926 H HG13 . VAL A 1 56 ? 5.250   -4.599  -7.499  1.00 0.00 ? 847 VAL A HG13 7  
ATOM 5927 H HG21 . VAL A 1 56 ? 7.667   -3.767  -5.735  1.00 0.00 ? 847 VAL A HG21 7  
ATOM 5928 H HG22 . VAL A 1 56 ? 7.887   -4.174  -7.435  1.00 0.00 ? 847 VAL A HG22 7  
ATOM 5929 H HG23 . VAL A 1 56 ? 8.806   -5.032  -6.201  1.00 0.00 ? 847 VAL A HG23 7  
ATOM 5930 N N    . MET A 1 57 ? 7.682   -4.741  -3.384  1.00 0.00 ? 848 MET A N    7  
ATOM 5931 C CA   . MET A 1 57 ? 7.623   -3.679  -2.397  1.00 0.00 ? 848 MET A CA   7  
ATOM 5932 C C    . MET A 1 57 ? 8.363   -2.481  -2.958  1.00 0.00 ? 848 MET A C    7  
ATOM 5933 O O    . MET A 1 57 ? 9.600   -2.473  -3.013  1.00 0.00 ? 848 MET A O    7  
ATOM 5934 C CB   . MET A 1 57 ? 8.262   -4.119  -1.060  1.00 0.00 ? 848 MET A CB   7  
ATOM 5935 C CG   . MET A 1 57 ? 9.039   -5.431  -1.242  1.00 0.00 ? 848 MET A CG   7  
ATOM 5936 S SD   . MET A 1 57 ? 10.048  -5.742  0.230   1.00 0.00 ? 848 MET A SD   7  
ATOM 5937 C CE   . MET A 1 57 ? 11.405  -4.609  -0.169  1.00 0.00 ? 848 MET A CE   7  
ATOM 5938 H H    . MET A 1 57 ? 8.545   -4.953  -3.797  1.00 0.00 ? 848 MET A H    7  
ATOM 5939 H HA   . MET A 1 57 ? 6.589   -3.411  -2.228  1.00 0.00 ? 848 MET A HA   7  
ATOM 5940 H HB2  . MET A 1 57 ? 8.936   -3.349  -0.714  1.00 0.00 ? 848 MET A HB2  7  
ATOM 5941 H HB3  . MET A 1 57 ? 7.485   -4.266  -0.325  1.00 0.00 ? 848 MET A HB3  7  
ATOM 5942 H HG2  . MET A 1 57 ? 8.342   -6.245  -1.376  1.00 0.00 ? 848 MET A HG2  7  
ATOM 5943 H HG3  . MET A 1 57 ? 9.679   -5.361  -2.109  1.00 0.00 ? 848 MET A HG3  7  
ATOM 5944 H HE1  . MET A 1 57 ? 11.091  -3.592  0.018   1.00 0.00 ? 848 MET A HE1  7  
ATOM 5945 H HE2  . MET A 1 57 ? 11.674  -4.713  -1.208  1.00 0.00 ? 848 MET A HE2  7  
ATOM 5946 H HE3  . MET A 1 57 ? 12.263  -4.849  0.444   1.00 0.00 ? 848 MET A HE3  7  
ATOM 5947 N N    . GLU A 1 58 ? 7.615   -1.508  -3.448  1.00 0.00 ? 849 GLU A N    7  
ATOM 5948 C CA   . GLU A 1 58 ? 8.216   -0.352  -4.089  1.00 0.00 ? 849 GLU A CA   7  
ATOM 5949 C C    . GLU A 1 58 ? 7.828   0.941   -3.408  1.00 0.00 ? 849 GLU A C    7  
ATOM 5950 O O    . GLU A 1 58 ? 6.657   1.322   -3.388  1.00 0.00 ? 849 GLU A O    7  
ATOM 5951 C CB   . GLU A 1 58 ? 7.808   -0.297  -5.565  1.00 0.00 ? 849 GLU A CB   7  
ATOM 5952 C CG   . GLU A 1 58 ? 8.690   -1.248  -6.382  1.00 0.00 ? 849 GLU A CG   7  
ATOM 5953 C CD   . GLU A 1 58 ? 9.627   -0.451  -7.264  1.00 0.00 ? 849 GLU A CD   7  
ATOM 5954 O OE1  . GLU A 1 58 ? 10.628  0.012   -6.763  1.00 0.00 ? 849 GLU A OE1  7  
ATOM 5955 O OE2  . GLU A 1 58 ? 9.332   -0.315  -8.430  1.00 0.00 ? 849 GLU A OE2  7  
ATOM 5956 H H    . GLU A 1 58 ? 6.639   -1.593  -3.430  1.00 0.00 ? 849 GLU A H    7  
ATOM 5957 H HA   . GLU A 1 58 ? 9.289   -0.452  -4.046  1.00 0.00 ? 849 GLU A HA   7  
ATOM 5958 N N    . ASP A 1 59 ? 8.831   1.654   -2.933  1.00 0.00 ? 850 ASP A N    7  
ATOM 5959 C CA   . ASP A 1 59 ? 8.626   2.958   -2.345  1.00 0.00 ? 850 ASP A CA   7  
ATOM 5960 C C    . ASP A 1 59 ? 8.090   3.891   -3.413  1.00 0.00 ? 850 ASP A C    7  
ATOM 5961 O O    . ASP A 1 59 ? 7.255   4.757   -3.153  1.00 0.00 ? 850 ASP A O    7  
ATOM 5962 C CB   . ASP A 1 59 ? 9.958   3.494   -1.816  1.00 0.00 ? 850 ASP A CB   7  
ATOM 5963 C CG   . ASP A 1 59 ? 9.734   4.719   -0.961  1.00 0.00 ? 850 ASP A CG   7  
ATOM 5964 O OD1  . ASP A 1 59 ? 9.332   5.724   -1.502  1.00 0.00 ? 850 ASP A OD1  7  
ATOM 5965 O OD2  . ASP A 1 59 ? 9.974   4.637   0.227   1.00 0.00 ? 850 ASP A OD2  7  
ATOM 5966 H H    . ASP A 1 59 ? 9.745   1.320   -3.042  1.00 0.00 ? 850 ASP A H    7  
ATOM 5967 H HA   . ASP A 1 59 ? 7.919   2.889   -1.533  1.00 0.00 ? 850 ASP A HA   7  
ATOM 5968 N N    . GLN A 1 60 ? 8.570   3.681   -4.632  1.00 0.00 ? 851 GLN A N    7  
ATOM 5969 C CA   . GLN A 1 60 ? 8.150   4.476   -5.773  1.00 0.00 ? 851 GLN A CA   7  
ATOM 5970 C C    . GLN A 1 60 ? 6.633   4.487   -5.895  1.00 0.00 ? 851 GLN A C    7  
ATOM 5971 O O    . GLN A 1 60 ? 6.031   5.540   -6.021  1.00 0.00 ? 851 GLN A O    7  
ATOM 5972 C CB   . GLN A 1 60 ? 8.770   3.933   -7.071  1.00 0.00 ? 851 GLN A CB   7  
ATOM 5973 C CG   . GLN A 1 60 ? 10.166  3.369   -6.787  1.00 0.00 ? 851 GLN A CG   7  
ATOM 5974 C CD   . GLN A 1 60 ? 10.908  3.138   -8.094  1.00 0.00 ? 851 GLN A CD   7  
ATOM 5975 O OE1  . GLN A 1 60 ? 11.166  4.085   -8.838  1.00 0.00 ? 851 GLN A OE1  7  
ATOM 5976 N NE2  . GLN A 1 60 ? 11.267  1.936   -8.425  1.00 0.00 ? 851 GLN A NE2  7  
ATOM 5977 H H    . GLN A 1 60 ? 9.219   2.961   -4.761  1.00 0.00 ? 851 GLN A H    7  
ATOM 5978 H HA   . GLN A 1 60 ? 8.489   5.492   -5.632  1.00 0.00 ? 851 GLN A HA   7  
ATOM 5979 H HB2  . GLN A 1 60 ? 8.142   3.151   -7.470  1.00 0.00 ? 851 GLN A HB2  7  
ATOM 5980 H HB3  . GLN A 1 60 ? 8.848   4.732   -7.793  1.00 0.00 ? 851 GLN A HB3  7  
ATOM 5981 H HG2  . GLN A 1 60 ? 10.722  4.068   -6.179  1.00 0.00 ? 851 GLN A HG2  7  
ATOM 5982 H HG3  . GLN A 1 60 ? 10.072  2.431   -6.263  1.00 0.00 ? 851 GLN A HG3  7  
ATOM 5983 H HE21 . GLN A 1 60 ? 11.060  1.178   -7.830  1.00 0.00 ? 851 GLN A HE21 7  
ATOM 5984 H HE22 . GLN A 1 60 ? 11.742  1.778   -9.268  1.00 0.00 ? 851 GLN A HE22 7  
ATOM 5985 N N    . ASP A 1 61 ? 6.020   3.303   -5.849  1.00 0.00 ? 852 ASP A N    7  
ATOM 5986 C CA   . ASP A 1 61 ? 4.564   3.201   -5.973  1.00 0.00 ? 852 ASP A CA   7  
ATOM 5987 C C    . ASP A 1 61 ? 3.893   4.051   -4.915  1.00 0.00 ? 852 ASP A C    7  
ATOM 5988 O O    . ASP A 1 61 ? 2.961   4.808   -5.206  1.00 0.00 ? 852 ASP A O    7  
ATOM 5989 C CB   . ASP A 1 61 ? 4.106   1.735   -5.844  1.00 0.00 ? 852 ASP A CB   7  
ATOM 5990 C CG   . ASP A 1 61 ? 3.215   1.359   -7.022  1.00 0.00 ? 852 ASP A CG   7  
ATOM 5991 O OD1  . ASP A 1 61 ? 3.637   1.555   -8.145  1.00 0.00 ? 852 ASP A OD1  7  
ATOM 5992 O OD2  . ASP A 1 61 ? 2.129   0.875   -6.791  1.00 0.00 ? 852 ASP A OD2  7  
ATOM 5993 H H    . ASP A 1 61 ? 6.554   2.490   -5.743  1.00 0.00 ? 852 ASP A H    7  
ATOM 5994 H HA   . ASP A 1 61 ? 4.273   3.572   -6.944  1.00 0.00 ? 852 ASP A HA   7  
ATOM 5995 N N    . LEU A 1 62 ? 4.407   3.977   -3.699  1.00 0.00 ? 853 LEU A N    7  
ATOM 5996 C CA   . LEU A 1 62 ? 3.889   4.795   -2.618  1.00 0.00 ? 853 LEU A CA   7  
ATOM 5997 C C    . LEU A 1 62 ? 4.039   6.264   -2.984  1.00 0.00 ? 853 LEU A C    7  
ATOM 5998 O O    . LEU A 1 62 ? 3.148   7.078   -2.736  1.00 0.00 ? 853 LEU A O    7  
ATOM 5999 C CB   . LEU A 1 62 ? 4.636   4.498   -1.314  1.00 0.00 ? 853 LEU A CB   7  
ATOM 6000 C CG   . LEU A 1 62 ? 4.565   2.993   -1.002  1.00 0.00 ? 853 LEU A CG   7  
ATOM 6001 C CD1  . LEU A 1 62 ? 5.739   2.591   -0.105  1.00 0.00 ? 853 LEU A CD1  7  
ATOM 6002 C CD2  . LEU A 1 62 ? 3.247   2.677   -0.286  1.00 0.00 ? 853 LEU A CD2  7  
ATOM 6003 H H    . LEU A 1 62 ? 5.180   3.394   -3.542  1.00 0.00 ? 853 LEU A H    7  
ATOM 6004 H HA   . LEU A 1 62 ? 2.841   4.573   -2.482  1.00 0.00 ? 853 LEU A HA   7  
ATOM 6005 H HB2  . LEU A 1 62 ? 5.666   4.805   -1.416  1.00 0.00 ? 853 LEU A HB2  7  
ATOM 6006 H HB3  . LEU A 1 62 ? 4.175   5.052   -0.511  1.00 0.00 ? 853 LEU A HB3  7  
ATOM 6007 H HG   . LEU A 1 62 ? 4.621   2.429   -1.923  1.00 0.00 ? 853 LEU A HG   7  
ATOM 6008 H HD11 . LEU A 1 62 ? 6.390   3.439   0.047   1.00 0.00 ? 853 LEU A HD11 7  
ATOM 6009 H HD12 . LEU A 1 62 ? 6.294   1.796   -0.579  1.00 0.00 ? 853 LEU A HD12 7  
ATOM 6010 H HD13 . LEU A 1 62 ? 5.370   2.246   0.849   1.00 0.00 ? 853 LEU A HD13 7  
ATOM 6011 H HD21 . LEU A 1 62 ? 2.431   2.737   -0.990  1.00 0.00 ? 853 LEU A HD21 7  
ATOM 6012 H HD22 . LEU A 1 62 ? 3.087   3.388   0.513   1.00 0.00 ? 853 LEU A HD22 7  
ATOM 6013 H HD23 . LEU A 1 62 ? 3.292   1.681   0.127   1.00 0.00 ? 853 LEU A HD23 7  
ATOM 6014 N N    . LEU A 1 63 ? 5.147   6.588   -3.623  1.00 0.00 ? 854 LEU A N    7  
ATOM 6015 C CA   . LEU A 1 63 ? 5.377   7.948   -4.076  1.00 0.00 ? 854 LEU A CA   7  
ATOM 6016 C C    . LEU A 1 63 ? 4.472   8.251   -5.257  1.00 0.00 ? 854 LEU A C    7  
ATOM 6017 O O    . LEU A 1 63 ? 3.838   9.302   -5.312  1.00 0.00 ? 854 LEU A O    7  
ATOM 6018 C CB   . LEU A 1 63 ? 6.848   8.147   -4.471  1.00 0.00 ? 854 LEU A CB   7  
ATOM 6019 C CG   . LEU A 1 63 ? 7.549   9.031   -3.426  1.00 0.00 ? 854 LEU A CG   7  
ATOM 6020 C CD1  . LEU A 1 63 ? 7.401   8.408   -2.037  1.00 0.00 ? 854 LEU A CD1  7  
ATOM 6021 C CD2  . LEU A 1 63 ? 9.034   9.152   -3.769  1.00 0.00 ? 854 LEU A CD2  7  
ATOM 6022 H H    . LEU A 1 63 ? 5.804   5.888   -3.828  1.00 0.00 ? 854 LEU A H    7  
ATOM 6023 H HA   . LEU A 1 63 ? 5.133   8.629   -3.274  1.00 0.00 ? 854 LEU A HA   7  
ATOM 6024 H HB2  . LEU A 1 63 ? 7.340   7.186   -4.524  1.00 0.00 ? 854 LEU A HB2  7  
ATOM 6025 H HB3  . LEU A 1 63 ? 6.900   8.630   -5.436  1.00 0.00 ? 854 LEU A HB3  7  
ATOM 6026 H HG   . LEU A 1 63 ? 7.096   10.012  -3.425  1.00 0.00 ? 854 LEU A HG   7  
ATOM 6027 H HD11 . LEU A 1 63 ? 8.152   8.821   -1.380  1.00 0.00 ? 854 LEU A HD11 7  
ATOM 6028 H HD12 . LEU A 1 63 ? 7.529   7.338   -2.103  1.00 0.00 ? 854 LEU A HD12 7  
ATOM 6029 H HD13 . LEU A 1 63 ? 6.421   8.630   -1.642  1.00 0.00 ? 854 LEU A HD13 7  
ATOM 6030 H HD21 . LEU A 1 63 ? 9.561   8.283   -3.404  1.00 0.00 ? 854 LEU A HD21 7  
ATOM 6031 H HD22 . LEU A 1 63 ? 9.437   10.037  -3.300  1.00 0.00 ? 854 LEU A HD22 7  
ATOM 6032 H HD23 . LEU A 1 63 ? 9.155   9.225   -4.839  1.00 0.00 ? 854 LEU A HD23 7  
ATOM 6033 N N    . GLU A 1 64 ? 4.390   7.311   -6.183  1.00 0.00 ? 855 GLU A N    7  
ATOM 6034 C CA   . GLU A 1 64 ? 3.540   7.460   -7.350  1.00 0.00 ? 855 GLU A CA   7  
ATOM 6035 C C    . GLU A 1 64 ? 2.132   7.859   -6.928  1.00 0.00 ? 855 GLU A C    7  
ATOM 6036 O O    . GLU A 1 64 ? 1.599   8.874   -7.394  1.00 0.00 ? 855 GLU A O    7  
ATOM 6037 C CB   . GLU A 1 64 ? 3.509   6.155   -8.149  1.00 0.00 ? 855 GLU A CB   7  
ATOM 6038 C CG   . GLU A 1 64 ? 4.935   5.789   -8.592  1.00 0.00 ? 855 GLU A CG   7  
ATOM 6039 C CD   . GLU A 1 64 ? 5.025   5.773   -10.100 1.00 0.00 ? 855 GLU A CD   7  
ATOM 6040 O OE1  . GLU A 1 64 ? 5.002   6.835   -10.684 1.00 0.00 ? 855 GLU A OE1  7  
ATOM 6041 O OE2  . GLU A 1 64 ? 5.110   4.700   -10.654 1.00 0.00 ? 855 GLU A OE2  7  
ATOM 6042 H H    . GLU A 1 64 ? 4.903   6.483   -6.069  1.00 0.00 ? 855 GLU A H    7  
ATOM 6043 H HA   . GLU A 1 64 ? 3.946   8.240   -7.977  1.00 0.00 ? 855 GLU A HA   7  
ATOM 6044 N N    . ILE A 1 65 ? 1.543   7.089   -6.012  1.00 0.00 ? 856 ILE A N    7  
ATOM 6045 C CA   . ILE A 1 65 ? 0.214   7.417   -5.509  1.00 0.00 ? 856 ILE A CA   7  
ATOM 6046 C C    . ILE A 1 65 ? 0.278   8.687   -4.655  1.00 0.00 ? 856 ILE A C    7  
ATOM 6047 O O    . ILE A 1 65 ? -0.719  9.390   -4.485  1.00 0.00 ? 856 ILE A O    7  
ATOM 6048 C CB   . ILE A 1 65 ? -0.388  6.241   -4.715  1.00 0.00 ? 856 ILE A CB   7  
ATOM 6049 C CG1  . ILE A 1 65 ? 0.379   6.037   -3.411  1.00 0.00 ? 856 ILE A CG1  7  
ATOM 6050 C CG2  . ILE A 1 65 ? -0.309  4.959   -5.551  1.00 0.00 ? 856 ILE A CG2  7  
ATOM 6051 C CD1  . ILE A 1 65 ? -0.025  4.700   -2.778  1.00 0.00 ? 856 ILE A CD1  7  
ATOM 6052 H H    . ILE A 1 65 ? 2.024   6.309   -5.652  1.00 0.00 ? 856 ILE A H    7  
ATOM 6053 H HA   . ILE A 1 65 ? -0.423  7.620   -6.359  1.00 0.00 ? 856 ILE A HA   7  
ATOM 6054 H HB   . ILE A 1 65 ? -1.425  6.457   -4.500  1.00 0.00 ? 856 ILE A HB   7  
ATOM 6055 H HG12 . ILE A 1 65 ? 1.438   6.027   -3.618  1.00 0.00 ? 856 ILE A HG12 7  
ATOM 6056 H HG21 . ILE A 1 65 ? 0.654   4.491   -5.406  1.00 0.00 ? 856 ILE A HG21 7  
ATOM 6057 H HG22 . ILE A 1 65 ? -0.439  5.199   -6.595  1.00 0.00 ? 856 ILE A HG22 7  
ATOM 6058 H HG23 . ILE A 1 65 ? -1.088  4.282   -5.235  1.00 0.00 ? 856 ILE A HG23 7  
ATOM 6059 H HD11 . ILE A 1 65 ? -0.993  4.399   -3.149  1.00 0.00 ? 856 ILE A HD11 7  
ATOM 6060 H HD12 . ILE A 1 65 ? -0.070  4.809   -1.705  1.00 0.00 ? 856 ILE A HD12 7  
ATOM 6061 H HD13 . ILE A 1 65 ? 0.707   3.949   -3.034  1.00 0.00 ? 856 ILE A HD13 7  
ATOM 6062 N N    . GLY A 1 66 ? 1.484   9.026   -4.207  1.00 0.00 ? 857 GLY A N    7  
ATOM 6063 C CA   . GLY A 1 66 ? 1.710   10.267  -3.465  1.00 0.00 ? 857 GLY A CA   7  
ATOM 6064 C C    . GLY A 1 66 ? 1.701   10.081  -1.946  1.00 0.00 ? 857 GLY A C    7  
ATOM 6065 O O    . GLY A 1 66 ? 1.217   10.956  -1.218  1.00 0.00 ? 857 GLY A O    7  
ATOM 6066 H H    . GLY A 1 66 ? 2.254   8.463   -4.436  1.00 0.00 ? 857 GLY A H    7  
ATOM 6067 H HA2  . GLY A 1 66 ? 2.667   10.673  -3.756  1.00 0.00 ? 857 GLY A HA2  7  
ATOM 6068 H HA3  . GLY A 1 66 ? 0.941   10.973  -3.734  1.00 0.00 ? 857 GLY A HA3  7  
ATOM 6069 N N    . ILE A 1 67 ? 2.304   9.004   -1.460  1.00 0.00 ? 858 ILE A N    7  
ATOM 6070 C CA   . ILE A 1 67 ? 2.420   8.801   -0.014  1.00 0.00 ? 858 ILE A CA   7  
ATOM 6071 C C    . ILE A 1 67 ? 3.571   9.654   0.526   1.00 0.00 ? 858 ILE A C    7  
ATOM 6072 O O    . ILE A 1 67 ? 4.730   9.467   0.139   1.00 0.00 ? 858 ILE A O    7  
ATOM 6073 C CB   . ILE A 1 67 ? 2.672   7.320   0.311   1.00 0.00 ? 858 ILE A CB   7  
ATOM 6074 C CG1  . ILE A 1 67 ? 1.546   6.448   -0.277  1.00 0.00 ? 858 ILE A CG1  7  
ATOM 6075 C CG2  . ILE A 1 67 ? 2.729   7.122   1.828   1.00 0.00 ? 858 ILE A CG2  7  
ATOM 6076 C CD1  . ILE A 1 67 ? 0.201   6.790   0.384   1.00 0.00 ? 858 ILE A CD1  7  
ATOM 6077 H H    . ILE A 1 67 ? 2.731   8.364   -2.072  1.00 0.00 ? 858 ILE A H    7  
ATOM 6078 H HA   . ILE A 1 67 ? 1.500   9.116   0.456   1.00 0.00 ? 858 ILE A HA   7  
ATOM 6079 H HB   . ILE A 1 67 ? 3.621   7.025   -0.118  1.00 0.00 ? 858 ILE A HB   7  
ATOM 6080 H HG12 . ILE A 1 67 ? 1.480   6.622   -1.338  1.00 0.00 ? 858 ILE A HG12 7  
ATOM 6081 H HG21 . ILE A 1 67 ? 3.166   6.160   2.045   1.00 0.00 ? 858 ILE A HG21 7  
ATOM 6082 H HG22 . ILE A 1 67 ? 1.729   7.161   2.234   1.00 0.00 ? 858 ILE A HG22 7  
ATOM 6083 H HG23 . ILE A 1 67 ? 3.329   7.899   2.277   1.00 0.00 ? 858 ILE A HG23 7  
ATOM 6084 H HD11 . ILE A 1 67 ? -0.128  7.764   0.056   1.00 0.00 ? 858 ILE A HD11 7  
ATOM 6085 H HD12 . ILE A 1 67 ? 0.315   6.789   1.458   1.00 0.00 ? 858 ILE A HD12 7  
ATOM 6086 H HD13 . ILE A 1 67 ? -0.537  6.049   0.105   1.00 0.00 ? 858 ILE A HD13 7  
ATOM 6087 N N    . LEU A 1 68 ? 3.243   10.617  1.383   1.00 0.00 ? 859 LEU A N    7  
ATOM 6088 C CA   . LEU A 1 68 ? 4.254   11.527  1.922   1.00 0.00 ? 859 LEU A CA   7  
ATOM 6089 C C    . LEU A 1 68 ? 4.966   10.941  3.143   1.00 0.00 ? 859 LEU A C    7  
ATOM 6090 O O    . LEU A 1 68 ? 6.115   10.507  3.051   1.00 0.00 ? 859 LEU A O    7  
ATOM 6091 C CB   . LEU A 1 68 ? 3.624   12.881  2.289   1.00 0.00 ? 859 LEU A CB   7  
ATOM 6092 C CG   . LEU A 1 68 ? 2.184   12.679  2.790   1.00 0.00 ? 859 LEU A CG   7  
ATOM 6093 C CD1  . LEU A 1 68 ? 1.909   13.632  3.949   1.00 0.00 ? 859 LEU A CD1  7  
ATOM 6094 C CD2  . LEU A 1 68 ? 1.202   12.968  1.651   1.00 0.00 ? 859 LEU A CD2  7  
ATOM 6095 H H    . LEU A 1 68 ? 2.304   10.740  1.627   1.00 0.00 ? 859 LEU A H    7  
ATOM 6096 H HA   . LEU A 1 68 ? 4.987   11.703  1.151   1.00 0.00 ? 859 LEU A HA   7  
ATOM 6097 H HB2  . LEU A 1 68 ? 4.215   13.350  3.063   1.00 0.00 ? 859 LEU A HB2  7  
ATOM 6098 H HB3  . LEU A 1 68 ? 3.616   13.518  1.417   1.00 0.00 ? 859 LEU A HB3  7  
ATOM 6099 H HG   . LEU A 1 68 ? 2.052   11.664  3.135   1.00 0.00 ? 859 LEU A HG   7  
ATOM 6100 H HD11 . LEU A 1 68 ? 2.057   14.651  3.622   1.00 0.00 ? 859 LEU A HD11 7  
ATOM 6101 H HD12 . LEU A 1 68 ? 2.583   13.415  4.762   1.00 0.00 ? 859 LEU A HD12 7  
ATOM 6102 H HD13 . LEU A 1 68 ? 0.891   13.508  4.285   1.00 0.00 ? 859 LEU A HD13 7  
ATOM 6103 H HD21 . LEU A 1 68 ? 1.151   14.033  1.481   1.00 0.00 ? 859 LEU A HD21 7  
ATOM 6104 H HD22 . LEU A 1 68 ? 0.222   12.601  1.920   1.00 0.00 ? 859 LEU A HD22 7  
ATOM 6105 H HD23 . LEU A 1 68 ? 1.538   12.475  0.751   1.00 0.00 ? 859 LEU A HD23 7  
ATOM 6106 N N    . ASN A 1 69 ? 4.291   10.941  4.286   1.00 0.00 ? 860 ASN A N    7  
ATOM 6107 C CA   . ASN A 1 69 ? 4.886   10.429  5.521   1.00 0.00 ? 860 ASN A CA   7  
ATOM 6108 C C    . ASN A 1 69 ? 5.384   9.003   5.336   1.00 0.00 ? 860 ASN A C    7  
ATOM 6109 O O    . ASN A 1 69 ? 4.593   8.061   5.271   1.00 0.00 ? 860 ASN A O    7  
ATOM 6110 C CB   . ASN A 1 69 ? 3.883   10.496  6.686   1.00 0.00 ? 860 ASN A CB   7  
ATOM 6111 C CG   . ASN A 1 69 ? 2.477   10.130  6.219   1.00 0.00 ? 860 ASN A CG   7  
ATOM 6112 O OD1  . ASN A 1 69 ? 2.017   10.603  5.174   1.00 0.00 ? 860 ASN A OD1  7  
ATOM 6113 N ND2  . ASN A 1 69 ? 1.759   9.326   6.931   1.00 0.00 ? 860 ASN A ND2  7  
ATOM 6114 H H    . ASN A 1 69 ? 3.380   11.303  4.308   1.00 0.00 ? 860 ASN A H    7  
ATOM 6115 H HA   . ASN A 1 69 ? 5.733   11.054  5.767   1.00 0.00 ? 860 ASN A HA   7  
ATOM 6116 H HB2  . ASN A 1 69 ? 4.191   9.809   7.459   1.00 0.00 ? 860 ASN A HB2  7  
ATOM 6117 H HB3  . ASN A 1 69 ? 3.873   11.497  7.091   1.00 0.00 ? 860 ASN A HB3  7  
ATOM 6118 H HD21 . ASN A 1 69 ? 2.113   8.956   7.766   1.00 0.00 ? 860 ASN A HD21 7  
ATOM 6119 H HD22 . ASN A 1 69 ? 0.856   9.083   6.638   1.00 0.00 ? 860 ASN A HD22 7  
ATOM 6120 N N    . SER A 1 70 ? 6.701   8.853   5.230   1.00 0.00 ? 861 SER A N    7  
ATOM 6121 C CA   . SER A 1 70 ? 7.314   7.544   5.020   1.00 0.00 ? 861 SER A CA   7  
ATOM 6122 C C    . SER A 1 70 ? 6.734   6.488   5.944   1.00 0.00 ? 861 SER A C    7  
ATOM 6123 O O    . SER A 1 70 ? 6.696   5.311   5.592   1.00 0.00 ? 861 SER A O    7  
ATOM 6124 C CB   . SER A 1 70 ? 8.824   7.630   5.194   1.00 0.00 ? 861 SER A CB   7  
ATOM 6125 O OG   . SER A 1 70 ? 9.336   8.600   4.283   1.00 0.00 ? 861 SER A OG   7  
ATOM 6126 H H    . SER A 1 70 ? 7.277   9.646   5.269   1.00 0.00 ? 861 SER A H    7  
ATOM 6127 H HA   . SER A 1 70 ? 7.106   7.237   4.010   1.00 0.00 ? 861 SER A HA   7  
ATOM 6128 H HB2  . SER A 1 70 ? 9.058   7.929   6.204   1.00 0.00 ? 861 SER A HB2  7  
ATOM 6129 H HB3  . SER A 1 70 ? 9.261   6.659   5.002   1.00 0.00 ? 861 SER A HB3  7  
ATOM 6130 H HG   . SER A 1 70 ? 9.712   9.320   4.806   1.00 0.00 ? 861 SER A HG   7  
ATOM 6131 N N    . GLY A 1 71 ? 6.234   6.907   7.091   1.00 0.00 ? 862 GLY A N    7  
ATOM 6132 C CA   . GLY A 1 71 ? 5.609   5.969   8.009   1.00 0.00 ? 862 GLY A CA   7  
ATOM 6133 C C    . GLY A 1 71 ? 4.545   5.188   7.271   1.00 0.00 ? 862 GLY A C    7  
ATOM 6134 O O    . GLY A 1 71 ? 4.407   3.982   7.443   1.00 0.00 ? 862 GLY A O    7  
ATOM 6135 H H    . GLY A 1 71 ? 6.250   7.862   7.306   1.00 0.00 ? 862 GLY A H    7  
ATOM 6136 H HA2  . GLY A 1 71 ? 6.356   5.289   8.394   1.00 0.00 ? 862 GLY A HA2  7  
ATOM 6137 H HA3  . GLY A 1 71 ? 5.151   6.506   8.825   1.00 0.00 ? 862 GLY A HA3  7  
ATOM 6138 N N    . HIS A 1 72 ? 3.848   5.876   6.380   1.00 0.00 ? 863 HIS A N    7  
ATOM 6139 C CA   . HIS A 1 72 ? 2.841   5.244   5.551   1.00 0.00 ? 863 HIS A CA   7  
ATOM 6140 C C    . HIS A 1 72 ? 3.506   4.302   4.561   1.00 0.00 ? 863 HIS A C    7  
ATOM 6141 O O    . HIS A 1 72 ? 2.992   3.217   4.277   1.00 0.00 ? 863 HIS A O    7  
ATOM 6142 C CB   . HIS A 1 72 ? 2.039   6.307   4.807   1.00 0.00 ? 863 HIS A CB   7  
ATOM 6143 C CG   . HIS A 1 72 ? 0.958   6.839   5.699   1.00 0.00 ? 863 HIS A CG   7  
ATOM 6144 N ND1  . HIS A 1 72 ? 1.011   6.714   7.079   1.00 0.00 ? 863 HIS A ND1  7  
ATOM 6145 C CD2  . HIS A 1 72 ? -0.206  7.508   5.426   1.00 0.00 ? 863 HIS A CD2  7  
ATOM 6146 C CE1  . HIS A 1 72 ? -0.093  7.295   7.578   1.00 0.00 ? 863 HIS A CE1  7  
ATOM 6147 N NE2  . HIS A 1 72 ? -0.868  7.795   6.613   1.00 0.00 ? 863 HIS A NE2  7  
ATOM 6148 H H    . HIS A 1 72 ? 4.052   6.828   6.243   1.00 0.00 ? 863 HIS A H    7  
ATOM 6149 H HA   . HIS A 1 72 ? 2.173   4.674   6.179   1.00 0.00 ? 863 HIS A HA   7  
ATOM 6150 H HB2  . HIS A 1 72 ? 2.695   7.111   4.519   1.00 0.00 ? 863 HIS A HB2  7  
ATOM 6151 H HB3  . HIS A 1 72 ? 1.600   5.881   3.922   1.00 0.00 ? 863 HIS A HB3  7  
ATOM 6152 N N    . ARG A 1 73 ? 4.668   4.706   4.066   1.00 0.00 ? 864 ARG A N    7  
ATOM 6153 C CA   . ARG A 1 73 ? 5.429   3.875   3.144   1.00 0.00 ? 864 ARG A CA   7  
ATOM 6154 C C    . ARG A 1 73 ? 5.963   2.659   3.887   1.00 0.00 ? 864 ARG A C    7  
ATOM 6155 O O    . ARG A 1 73 ? 5.732   1.512   3.489   1.00 0.00 ? 864 ARG A O    7  
ATOM 6156 C CB   . ARG A 1 73 ? 6.609   4.670   2.541   1.00 0.00 ? 864 ARG A CB   7  
ATOM 6157 C CG   . ARG A 1 73 ? 6.083   5.841   1.693   1.00 0.00 ? 864 ARG A CG   7  
ATOM 6158 C CD   . ARG A 1 73 ? 7.232   6.438   0.854   1.00 0.00 ? 864 ARG A CD   7  
ATOM 6159 N NE   . ARG A 1 73 ? 8.124   7.238   1.704   1.00 0.00 ? 864 ARG A NE   7  
ATOM 6160 C CZ   . ARG A 1 73 ? 9.240   7.814   1.237   1.00 0.00 ? 864 ARG A CZ   7  
ATOM 6161 N NH1  . ARG A 1 73 ? 9.637   7.596   0.017   1.00 0.00 ? 864 ARG A NH1  7  
ATOM 6162 N NH2  . ARG A 1 73 ? 9.953   8.559   2.029   1.00 0.00 ? 864 ARG A NH2  7  
ATOM 6163 H H    . ARG A 1 73 ? 5.038   5.563   4.358   1.00 0.00 ? 864 ARG A H    7  
ATOM 6164 H HA   . ARG A 1 73 ? 4.780   3.547   2.345   1.00 0.00 ? 864 ARG A HA   7  
ATOM 6165 N N    . GLN A 1 74 ? 6.656   2.926   4.985   1.00 0.00 ? 865 GLN A N    7  
ATOM 6166 C CA   . GLN A 1 74 ? 7.227   1.878   5.817   1.00 0.00 ? 865 GLN A CA   7  
ATOM 6167 C C    . GLN A 1 74 ? 6.154   0.919   6.296   1.00 0.00 ? 865 GLN A C    7  
ATOM 6168 O O    . GLN A 1 74 ? 6.302   -0.300  6.183   1.00 0.00 ? 865 GLN A O    7  
ATOM 6169 C CB   . GLN A 1 74 ? 7.935   2.495   7.026   1.00 0.00 ? 865 GLN A CB   7  
ATOM 6170 C CG   . GLN A 1 74 ? 9.086   3.384   6.552   1.00 0.00 ? 865 GLN A CG   7  
ATOM 6171 C CD   . GLN A 1 74 ? 9.403   4.432   7.608   1.00 0.00 ? 865 GLN A CD   7  
ATOM 6172 O OE1  . GLN A 1 74 ? 8.613   5.348   7.831   1.00 0.00 ? 865 GLN A OE1  7  
ATOM 6173 N NE2  . GLN A 1 74 ? 10.509  4.354   8.278   1.00 0.00 ? 865 GLN A NE2  7  
ATOM 6174 H H    . GLN A 1 74 ? 6.777   3.865   5.249   1.00 0.00 ? 865 GLN A H    7  
ATOM 6175 H HA   . GLN A 1 74 ? 7.954   1.328   5.239   1.00 0.00 ? 865 GLN A HA   7  
ATOM 6176 H HB2  . GLN A 1 74 ? 7.229   3.087   7.592   1.00 0.00 ? 865 GLN A HB2  7  
ATOM 6177 H HB3  . GLN A 1 74 ? 8.327   1.709   7.652   1.00 0.00 ? 865 GLN A HB3  7  
ATOM 6178 H HG2  . GLN A 1 74 ? 9.958   2.771   6.379   1.00 0.00 ? 865 GLN A HG2  7  
ATOM 6179 H HG3  . GLN A 1 74 ? 8.809   3.879   5.632   1.00 0.00 ? 865 GLN A HG3  7  
ATOM 6180 H HE21 . GLN A 1 74 ? 11.138  3.623   8.105   1.00 0.00 ? 865 GLN A HE21 7  
ATOM 6181 H HE22 . GLN A 1 74 ? 10.718  5.029   8.957   1.00 0.00 ? 865 GLN A HE22 7  
ATOM 6182 N N    . ARG A 1 75 ? 5.079   1.466   6.851   1.00 0.00 ? 866 ARG A N    7  
ATOM 6183 C CA   . ARG A 1 75 ? 4.004   0.635   7.363   1.00 0.00 ? 866 ARG A CA   7  
ATOM 6184 C C    . ARG A 1 75 ? 3.451   -0.250  6.265   1.00 0.00 ? 866 ARG A C    7  
ATOM 6185 O O    . ARG A 1 75 ? 3.322   -1.454  6.445   1.00 0.00 ? 866 ARG A O    7  
ATOM 6186 C CB   . ARG A 1 75 ? 2.891   1.496   7.965   1.00 0.00 ? 866 ARG A CB   7  
ATOM 6187 C CG   . ARG A 1 75 ? 3.357   2.062   9.312   1.00 0.00 ? 866 ARG A CG   7  
ATOM 6188 C CD   . ARG A 1 75 ? 2.304   3.032   9.852   1.00 0.00 ? 866 ARG A CD   7  
ATOM 6189 N NE   . ARG A 1 75 ? 1.072   2.314   10.185  1.00 0.00 ? 866 ARG A NE   7  
ATOM 6190 C CZ   . ARG A 1 75 ? 0.994   1.528   11.262  1.00 0.00 ? 866 ARG A CZ   7  
ATOM 6191 N NH1  . ARG A 1 75 ? 2.033   1.388   12.034  1.00 0.00 ? 866 ARG A NH1  7  
ATOM 6192 N NH2  . ARG A 1 75 ? -0.111  0.904   11.537  1.00 0.00 ? 866 ARG A NH2  7  
ATOM 6193 H H    . ARG A 1 75 ? 5.018   2.444   6.930   1.00 0.00 ? 866 ARG A H    7  
ATOM 6194 H HA   . ARG A 1 75 ? 4.406   0.001   8.140   1.00 0.00 ? 866 ARG A HA   7  
ATOM 6195 N N    . ILE A 1 76 ? 3.150   0.340   5.115   1.00 0.00 ? 867 ILE A N    7  
ATOM 6196 C CA   . ILE A 1 76 ? 2.646   -0.439  3.996   1.00 0.00 ? 867 ILE A CA   7  
ATOM 6197 C C    . ILE A 1 76 ? 3.643   -1.524  3.629   1.00 0.00 ? 867 ILE A C    7  
ATOM 6198 O O    . ILE A 1 76 ? 3.291   -2.703  3.562   1.00 0.00 ? 867 ILE A O    7  
ATOM 6199 C CB   . ILE A 1 76 ? 2.376   0.464   2.784   1.00 0.00 ? 867 ILE A CB   7  
ATOM 6200 C CG1  . ILE A 1 76 ? 1.099   1.273   3.026   1.00 0.00 ? 867 ILE A CG1  7  
ATOM 6201 C CG2  . ILE A 1 76 ? 2.202   -0.387  1.517   1.00 0.00 ? 867 ILE A CG2  7  
ATOM 6202 C CD1  . ILE A 1 76 ? -0.131  0.372   2.887   1.00 0.00 ? 867 ILE A CD1  7  
ATOM 6203 H H    . ILE A 1 76 ? 3.290   1.304   5.008   1.00 0.00 ? 867 ILE A H    7  
ATOM 6204 H HA   . ILE A 1 76 ? 1.723   -0.910  4.296   1.00 0.00 ? 867 ILE A HA   7  
ATOM 6205 H HB   . ILE A 1 76 ? 3.212   1.136   2.648   1.00 0.00 ? 867 ILE A HB   7  
ATOM 6206 H HG12 . ILE A 1 76 ? 1.121   1.703   4.015   1.00 0.00 ? 867 ILE A HG12 7  
ATOM 6207 H HG21 . ILE A 1 76 ? 3.171   -0.678  1.140   1.00 0.00 ? 867 ILE A HG21 7  
ATOM 6208 H HG22 . ILE A 1 76 ? 1.684   0.189   0.765   1.00 0.00 ? 867 ILE A HG22 7  
ATOM 6209 H HG23 . ILE A 1 76 ? 1.625   -1.270  1.750   1.00 0.00 ? 867 ILE A HG23 7  
ATOM 6210 H HD11 . ILE A 1 76 ? -1.016  0.938   3.134   1.00 0.00 ? 867 ILE A HD11 7  
ATOM 6211 H HD12 . ILE A 1 76 ? -0.044  -0.469  3.558   1.00 0.00 ? 867 ILE A HD12 7  
ATOM 6212 H HD13 . ILE A 1 76 ? -0.205  0.017   1.870   1.00 0.00 ? 867 ILE A HD13 7  
ATOM 6213 N N    . LEU A 1 77 ? 4.893   -1.127  3.410   1.00 0.00 ? 868 LEU A N    7  
ATOM 6214 C CA   . LEU A 1 77 ? 5.931   -2.084  3.060   1.00 0.00 ? 868 LEU A CA   7  
ATOM 6215 C C    . LEU A 1 77 ? 5.979   -3.189  4.096   1.00 0.00 ? 868 LEU A C    7  
ATOM 6216 O O    . LEU A 1 77 ? 5.855   -4.369  3.771   1.00 0.00 ? 868 LEU A O    7  
ATOM 6217 C CB   . LEU A 1 77 ? 7.300   -1.389  2.968   1.00 0.00 ? 868 LEU A CB   7  
ATOM 6218 C CG   . LEU A 1 77 ? 8.013   -1.814  1.675   1.00 0.00 ? 868 LEU A CG   7  
ATOM 6219 C CD1  . LEU A 1 77 ? 7.390   -1.089  0.479   1.00 0.00 ? 868 LEU A CD1  7  
ATOM 6220 C CD2  . LEU A 1 77 ? 9.497   -1.452  1.767   1.00 0.00 ? 868 LEU A CD2  7  
ATOM 6221 H H    . LEU A 1 77 ? 5.119   -0.173  3.493   1.00 0.00 ? 868 LEU A H    7  
ATOM 6222 H HA   . LEU A 1 77 ? 5.693   -2.516  2.102   1.00 0.00 ? 868 LEU A HA   7  
ATOM 6223 H HB2  . LEU A 1 77 ? 7.162   -0.317  2.972   1.00 0.00 ? 868 LEU A HB2  7  
ATOM 6224 H HB3  . LEU A 1 77 ? 7.906   -1.672  3.818   1.00 0.00 ? 868 LEU A HB3  7  
ATOM 6225 H HG   . LEU A 1 77 ? 7.907   -2.882  1.541   1.00 0.00 ? 868 LEU A HG   7  
ATOM 6226 H HD11 . LEU A 1 77 ? 6.415   -1.503  0.270   1.00 0.00 ? 868 LEU A HD11 7  
ATOM 6227 H HD12 . LEU A 1 77 ? 8.026   -1.210  -0.386  1.00 0.00 ? 868 LEU A HD12 7  
ATOM 6228 H HD13 . LEU A 1 77 ? 7.293   -0.037  0.706   1.00 0.00 ? 868 LEU A HD13 7  
ATOM 6229 H HD21 . LEU A 1 77 ? 9.979   -1.664  0.824   1.00 0.00 ? 868 LEU A HD21 7  
ATOM 6230 H HD22 . LEU A 1 77 ? 9.963   -2.035  2.549   1.00 0.00 ? 868 LEU A HD22 7  
ATOM 6231 H HD23 . LEU A 1 77 ? 9.598   -0.400  1.995   1.00 0.00 ? 868 LEU A HD23 7  
ATOM 6232 N N    . GLN A 1 78 ? 6.115   -2.801  5.343   1.00 0.00 ? 869 GLN A N    7  
ATOM 6233 C CA   . GLN A 1 78 ? 6.142   -3.761  6.428   1.00 0.00 ? 869 GLN A CA   7  
ATOM 6234 C C    . GLN A 1 78 ? 4.861   -4.575  6.449   1.00 0.00 ? 869 GLN A C    7  
ATOM 6235 O O    . GLN A 1 78 ? 4.890   -5.796  6.605   1.00 0.00 ? 869 GLN A O    7  
ATOM 6236 C CB   . GLN A 1 78 ? 6.322   -3.040  7.762   1.00 0.00 ? 869 GLN A CB   7  
ATOM 6237 C CG   . GLN A 1 78 ? 7.742   -2.479  7.848   1.00 0.00 ? 869 GLN A CG   7  
ATOM 6238 C CD   . GLN A 1 78 ? 8.676   -3.533  8.419   1.00 0.00 ? 869 GLN A CD   7  
ATOM 6239 O OE1  . GLN A 1 78 ? 8.861   -3.606  9.633   1.00 0.00 ? 869 GLN A OE1  7  
ATOM 6240 N NE2  . GLN A 1 78 ? 9.267   -4.369  7.619   1.00 0.00 ? 869 GLN A NE2  7  
ATOM 6241 H H    . GLN A 1 78 ? 6.175   -1.841  5.540   1.00 0.00 ? 869 GLN A H    7  
ATOM 6242 H HA   . GLN A 1 78 ? 6.977   -4.430  6.281   1.00 0.00 ? 869 GLN A HA   7  
ATOM 6243 H HB2  . GLN A 1 78 ? 5.606   -2.233  7.835   1.00 0.00 ? 869 GLN A HB2  7  
ATOM 6244 H HB3  . GLN A 1 78 ? 6.163   -3.737  8.572   1.00 0.00 ? 869 GLN A HB3  7  
ATOM 6245 H HG2  . GLN A 1 78 ? 8.074   -2.193  6.860   1.00 0.00 ? 869 GLN A HG2  7  
ATOM 6246 H HG3  . GLN A 1 78 ? 7.748   -1.609  8.486   1.00 0.00 ? 869 GLN A HG3  7  
ATOM 6247 H HE21 . GLN A 1 78 ? 9.109   -4.318  6.651   1.00 0.00 ? 869 GLN A HE21 7  
ATOM 6248 H HE22 . GLN A 1 78 ? 9.871   -5.052  7.980   1.00 0.00 ? 869 GLN A HE22 7  
ATOM 6249 N N    . ALA A 1 79 ? 3.738   -3.897  6.292   1.00 0.00 ? 870 ALA A N    7  
ATOM 6250 C CA   . ALA A 1 79 ? 2.451   -4.565  6.315   1.00 0.00 ? 870 ALA A CA   7  
ATOM 6251 C C    . ALA A 1 79 ? 2.377   -5.626  5.230   1.00 0.00 ? 870 ALA A C    7  
ATOM 6252 O O    . ALA A 1 79 ? 2.024   -6.775  5.506   1.00 0.00 ? 870 ALA A O    7  
ATOM 6253 C CB   . ALA A 1 79 ? 1.318   -3.552  6.138   1.00 0.00 ? 870 ALA A CB   7  
ATOM 6254 H H    . ALA A 1 79 ? 3.775   -2.923  6.173   1.00 0.00 ? 870 ALA A H    7  
ATOM 6255 H HA   . ALA A 1 79 ? 2.334   -5.045  7.275   1.00 0.00 ? 870 ALA A HA   7  
ATOM 6256 H HB1  . ALA A 1 79 ? 1.398   -2.786  6.894   1.00 0.00 ? 870 ALA A HB1  7  
ATOM 6257 H HB2  . ALA A 1 79 ? 0.368   -4.054  6.238   1.00 0.00 ? 870 ALA A HB2  7  
ATOM 6258 H HB3  . ALA A 1 79 ? 1.386   -3.099  5.159   1.00 0.00 ? 870 ALA A HB3  7  
ATOM 6259 N N    . ILE A 1 80 ? 2.741   -5.262  4.000   1.00 0.00 ? 871 ILE A N    7  
ATOM 6260 C CA   . ILE A 1 80 ? 2.724   -6.231  2.922   1.00 0.00 ? 871 ILE A CA   7  
ATOM 6261 C C    . ILE A 1 80 ? 3.792   -7.294  3.146   1.00 0.00 ? 871 ILE A C    7  
ATOM 6262 O O    . ILE A 1 80 ? 3.542   -8.485  2.970   1.00 0.00 ? 871 ILE A O    7  
ATOM 6263 C CB   . ILE A 1 80 ? 2.897   -5.558  1.545   1.00 0.00 ? 871 ILE A CB   7  
ATOM 6264 C CG1  . ILE A 1 80 ? 4.264   -4.877  1.442   1.00 0.00 ? 871 ILE A CG1  7  
ATOM 6265 C CG2  . ILE A 1 80 ? 1.802   -4.517  1.336   1.00 0.00 ? 871 ILE A CG2  7  
ATOM 6266 C CD1  . ILE A 1 80 ? 4.474   -4.378  0.009   1.00 0.00 ? 871 ILE A CD1  7  
ATOM 6267 H H    . ILE A 1 80 ? 3.041   -4.345  3.824   1.00 0.00 ? 871 ILE A H    7  
ATOM 6268 H HA   . ILE A 1 80 ? 1.761   -6.719  2.942   1.00 0.00 ? 871 ILE A HA   7  
ATOM 6269 H HB   . ILE A 1 80 ? 2.805   -6.311  0.782   1.00 0.00 ? 871 ILE A HB   7  
ATOM 6270 H HG12 . ILE A 1 80 ? 4.293   -4.038  2.118   1.00 0.00 ? 871 ILE A HG12 7  
ATOM 6271 H HG21 . ILE A 1 80 ? 0.852   -4.918  1.652   1.00 0.00 ? 871 ILE A HG21 7  
ATOM 6272 H HG22 . ILE A 1 80 ? 1.753   -4.258  0.289   1.00 0.00 ? 871 ILE A HG22 7  
ATOM 6273 H HG23 . ILE A 1 80 ? 2.032   -3.633  1.911   1.00 0.00 ? 871 ILE A HG23 7  
ATOM 6274 H HD11 . ILE A 1 80 ? 5.352   -3.751  -0.027  1.00 0.00 ? 871 ILE A HD11 7  
ATOM 6275 H HD12 . ILE A 1 80 ? 3.612   -3.806  -0.303  1.00 0.00 ? 871 ILE A HD12 7  
ATOM 6276 H HD13 . ILE A 1 80 ? 4.604   -5.222  -0.654  1.00 0.00 ? 871 ILE A HD13 7  
ATOM 6277 N N    . GLN A 1 81 ? 4.974   -6.860  3.566   1.00 0.00 ? 872 GLN A N    7  
ATOM 6278 C CA   . GLN A 1 81 ? 6.067   -7.787  3.840   1.00 0.00 ? 872 GLN A CA   7  
ATOM 6279 C C    . GLN A 1 81 ? 5.631   -8.835  4.855   1.00 0.00 ? 872 GLN A C    7  
ATOM 6280 O O    . GLN A 1 81 ? 6.021   -10.001 4.768   1.00 0.00 ? 872 GLN A O    7  
ATOM 6281 C CB   . GLN A 1 81 ? 7.291   -7.030  4.378   1.00 0.00 ? 872 GLN A CB   7  
ATOM 6282 C CG   . GLN A 1 81 ? 8.038   -6.350  3.223   1.00 0.00 ? 872 GLN A CG   7  
ATOM 6283 C CD   . GLN A 1 81 ? 9.369   -5.796  3.718   1.00 0.00 ? 872 GLN A CD   7  
ATOM 6284 O OE1  . GLN A 1 81 ? 9.415   -5.082  4.729   1.00 0.00 ? 872 GLN A OE1  7  
ATOM 6285 N NE2  . GLN A 1 81 ? 10.458  -6.081  3.075   1.00 0.00 ? 872 GLN A NE2  7  
ATOM 6286 H H    . GLN A 1 81 ? 5.111   -5.897  3.711   1.00 0.00 ? 872 GLN A H    7  
ATOM 6287 H HA   . GLN A 1 81 ? 6.342   -8.285  2.922   1.00 0.00 ? 872 GLN A HA   7  
ATOM 6288 H HB2  . GLN A 1 81 ? 6.968   -6.283  5.088   1.00 0.00 ? 872 GLN A HB2  7  
ATOM 6289 H HB3  . GLN A 1 81 ? 7.955   -7.726  4.868   1.00 0.00 ? 872 GLN A HB3  7  
ATOM 6290 H HG2  . GLN A 1 81 ? 8.220   -7.073  2.441   1.00 0.00 ? 872 GLN A HG2  7  
ATOM 6291 H HG3  . GLN A 1 81 ? 7.442   -5.543  2.828   1.00 0.00 ? 872 GLN A HG3  7  
ATOM 6292 H HE21 . GLN A 1 81 ? 10.421  -6.648  2.277   1.00 0.00 ? 872 GLN A HE21 7  
ATOM 6293 H HE22 . GLN A 1 81 ? 11.322  -5.734  3.384   1.00 0.00 ? 872 GLN A HE22 7  
ATOM 6294 N N    . LEU A 1 82 ? 4.852   -8.404  5.838   1.00 0.00 ? 873 LEU A N    7  
ATOM 6295 C CA   . LEU A 1 82 ? 4.395   -9.294  6.902   1.00 0.00 ? 873 LEU A CA   7  
ATOM 6296 C C    . LEU A 1 82 ? 3.235   -10.181 6.444   1.00 0.00 ? 873 LEU A C    7  
ATOM 6297 O O    . LEU A 1 82 ? 2.939   -11.194 7.080   1.00 0.00 ? 873 LEU A O    7  
ATOM 6298 C CB   . LEU A 1 82 ? 3.978   -8.478  8.136   1.00 0.00 ? 873 LEU A CB   7  
ATOM 6299 C CG   . LEU A 1 82 ? 5.140   -8.408  9.144   1.00 0.00 ? 873 LEU A CG   7  
ATOM 6300 C CD1  . LEU A 1 82 ? 5.316   -9.767  9.831   1.00 0.00 ? 873 LEU A CD1  7  
ATOM 6301 C CD2  . LEU A 1 82 ? 6.443   -8.029  8.424   1.00 0.00 ? 873 LEU A CD2  7  
ATOM 6302 H H    . LEU A 1 82 ? 4.605   -7.452  5.869   1.00 0.00 ? 873 LEU A H    7  
ATOM 6303 H HA   . LEU A 1 82 ? 5.215   -9.937  7.183   1.00 0.00 ? 873 LEU A HA   7  
ATOM 6304 H HB2  . LEU A 1 82 ? 3.703   -7.478  7.830   1.00 0.00 ? 873 LEU A HB2  7  
ATOM 6305 H HB3  . LEU A 1 82 ? 3.127   -8.949  8.606   1.00 0.00 ? 873 LEU A HB3  7  
ATOM 6306 H HG   . LEU A 1 82 ? 4.911   -7.661  9.891   1.00 0.00 ? 873 LEU A HG   7  
ATOM 6307 H HD11 . LEU A 1 82 ? 5.560   -9.613  10.871  1.00 0.00 ? 873 LEU A HD11 7  
ATOM 6308 H HD12 . LEU A 1 82 ? 6.117   -10.313 9.354   1.00 0.00 ? 873 LEU A HD12 7  
ATOM 6309 H HD13 . LEU A 1 82 ? 4.400   -10.336 9.757   1.00 0.00 ? 873 LEU A HD13 7  
ATOM 6310 H HD21 . LEU A 1 82 ? 6.855   -8.900  7.933   1.00 0.00 ? 873 LEU A HD21 7  
ATOM 6311 H HD22 . LEU A 1 82 ? 7.155   -7.656  9.144   1.00 0.00 ? 873 LEU A HD22 7  
ATOM 6312 H HD23 . LEU A 1 82 ? 6.243   -7.263  7.690   1.00 0.00 ? 873 LEU A HD23 7  
ATOM 6313 N N    . LEU A 1 83 ? 2.574   -9.805  5.350   1.00 0.00 ? 874 LEU A N    7  
ATOM 6314 C CA   . LEU A 1 83 ? 1.451   -10.606 4.846   1.00 0.00 ? 874 LEU A CA   7  
ATOM 6315 C C    . LEU A 1 83 ? 1.902   -12.042 4.598   1.00 0.00 ? 874 LEU A C    7  
ATOM 6316 O O    . LEU A 1 83 ? 3.057   -12.279 4.242   1.00 0.00 ? 874 LEU A O    7  
ATOM 6317 C CB   . LEU A 1 83 ? 0.889   -10.013 3.546   1.00 0.00 ? 874 LEU A CB   7  
ATOM 6318 C CG   . LEU A 1 83 ? 0.063   -8.757  3.856   1.00 0.00 ? 874 LEU A CG   7  
ATOM 6319 C CD1  . LEU A 1 83 ? -0.249  -8.017  2.557   1.00 0.00 ? 874 LEU A CD1  7  
ATOM 6320 C CD2  . LEU A 1 83 ? -1.253  -9.153  4.537   1.00 0.00 ? 874 LEU A CD2  7  
ATOM 6321 H H    . LEU A 1 83 ? 2.845   -8.990  4.876   1.00 0.00 ? 874 LEU A H    7  
ATOM 6322 H HA   . LEU A 1 83 ? 0.675   -10.611 5.595   1.00 0.00 ? 874 LEU A HA   7  
ATOM 6323 H HB2  . LEU A 1 83 ? 1.704   -9.760  2.886   1.00 0.00 ? 874 LEU A HB2  7  
ATOM 6324 H HB3  . LEU A 1 83 ? 0.258   -10.745 3.064   1.00 0.00 ? 874 LEU A HB3  7  
ATOM 6325 H HG   . LEU A 1 83 ? 0.628   -8.107  4.507   1.00 0.00 ? 874 LEU A HG   7  
ATOM 6326 H HD11 . LEU A 1 83 ? 0.586   -8.101  1.876   1.00 0.00 ? 874 LEU A HD11 7  
ATOM 6327 H HD12 . LEU A 1 83 ? -0.432  -6.975  2.773   1.00 0.00 ? 874 LEU A HD12 7  
ATOM 6328 H HD13 . LEU A 1 83 ? -1.127  -8.449  2.101   1.00 0.00 ? 874 LEU A HD13 7  
ATOM 6329 H HD21 . LEU A 1 83 ? -1.070  -9.380  5.578   1.00 0.00 ? 874 LEU A HD21 7  
ATOM 6330 H HD22 . LEU A 1 83 ? -1.672  -10.019 4.046   1.00 0.00 ? 874 LEU A HD22 7  
ATOM 6331 H HD23 . LEU A 1 83 ? -1.953  -8.333  4.469   1.00 0.00 ? 874 LEU A HD23 7  
ATOM 6332 N N    . PRO A 1 84 ? 1.023   -12.999 4.776   1.00 0.00 ? 875 PRO A N    7  
ATOM 6333 C CA   . PRO A 1 84 ? 1.352   -14.439 4.569   1.00 0.00 ? 875 PRO A CA   7  
ATOM 6334 C C    . PRO A 1 84 ? 1.954   -14.685 3.190   1.00 0.00 ? 875 PRO A C    7  
ATOM 6335 O O    . PRO A 1 84 ? 1.300   -14.459 2.170   1.00 0.00 ? 875 PRO A O    7  
ATOM 6336 C CB   . PRO A 1 84 ? -0.001  -15.165 4.717   1.00 0.00 ? 875 PRO A CB   7  
ATOM 6337 C CG   . PRO A 1 84 ? -1.047  -14.091 4.697   1.00 0.00 ? 875 PRO A CG   7  
ATOM 6338 C CD   . PRO A 1 84 ? -0.371  -12.817 5.188   1.00 0.00 ? 875 PRO A CD   7  
ATOM 6339 H HA   . PRO A 1 84 ? 2.019   -14.787 5.341   1.00 0.00 ? 875 PRO A HA   7  
ATOM 6340 H HB2  . PRO A 1 84 ? -0.148  -15.848 3.892   1.00 0.00 ? 875 PRO A HB2  7  
ATOM 6341 H HB3  . PRO A 1 84 ? -0.041  -15.697 5.656   1.00 0.00 ? 875 PRO A HB3  7  
ATOM 6342 H HG2  . PRO A 1 84 ? -1.420  -13.958 3.691   1.00 0.00 ? 875 PRO A HG2  7  
ATOM 6343 H HG3  . PRO A 1 84 ? -1.857  -14.347 5.364   1.00 0.00 ? 875 PRO A HG3  7  
ATOM 6344 H HD2  . PRO A 1 84 ? -0.811  -11.949 4.718   1.00 0.00 ? 875 PRO A HD2  7  
ATOM 6345 H HD3  . PRO A 1 84 ? -0.429  -12.745 6.262   1.00 0.00 ? 875 PRO A HD3  7  
ATOM 6346 N N    . LYS A 1 85 ? 3.200   -15.135 3.168   1.00 0.00 ? 876 LYS A N    7  
ATOM 6347 C CA   . LYS A 1 85 ? 3.891   -15.406 1.919   1.00 0.00 ? 876 LYS A CA   7  
ATOM 6348 C C    . LYS A 1 85 ? 3.357   -16.684 1.288   1.00 0.00 ? 876 LYS A C    7  
ATOM 6349 O O    . LYS A 1 85 ? 3.131   -16.683 0.104   1.00 0.00 ? 876 LYS A O    7  
ATOM 6350 C CB   . LYS A 1 85 ? 5.402   -15.535 2.171   1.00 0.00 ? 876 LYS A CB   7  
ATOM 6351 C CG   . LYS A 1 85 ? 6.143   -15.778 0.847   1.00 0.00 ? 876 LYS A CG   7  
ATOM 6352 C CD   . LYS A 1 85 ? 6.204   -14.480 0.030   1.00 0.00 ? 876 LYS A CD   7  
ATOM 6353 C CE   . LYS A 1 85 ? 5.712   -14.752 -1.394  1.00 0.00 ? 876 LYS A CE   7  
ATOM 6354 N NZ   . LYS A 1 85 ? 4.274   -15.117 -1.361  1.00 0.00 ? 876 LYS A NZ   7  
ATOM 6355 H H    . LYS A 1 85 ? 3.666   -15.285 4.016   1.00 0.00 ? 876 LYS A H    7  
ATOM 6356 H HA   . LYS A 1 85 ? 3.722   -14.578 1.245   1.00 0.00 ? 876 LYS A HA   7  
ATOM 6357 N N    . GLN A 1 23 ? -7.787  -9.173  1.801   1.00 0.00 ? 814 GLN A N    8  
ATOM 6358 C CA   . GLN A 1 23 ? -8.830  -8.966  0.766   1.00 0.00 ? 814 GLN A CA   8  
ATOM 6359 C C    . GLN A 1 23 ? -8.418  -7.781  -0.102  1.00 0.00 ? 814 GLN A C    8  
ATOM 6360 O O    . GLN A 1 23 ? -7.228  -7.522  -0.278  1.00 0.00 ? 814 GLN A O    8  
ATOM 6361 C CB   . GLN A 1 23 ? -10.187 -8.692  1.449   1.00 0.00 ? 814 GLN A CB   8  
ATOM 6362 C CG   . GLN A 1 23 ? -10.782 -10.006 1.971   1.00 0.00 ? 814 GLN A CG   8  
ATOM 6363 C CD   . GLN A 1 23 ? -12.275 -9.834  2.217   1.00 0.00 ? 814 GLN A CD   8  
ATOM 6364 O OE1  . GLN A 1 23 ? -12.996 -9.341  1.344   1.00 0.00 ? 814 GLN A OE1  8  
ATOM 6365 N NE2  . GLN A 1 23 ? -12.785 -10.203 3.347   1.00 0.00 ? 814 GLN A NE2  8  
ATOM 6366 H HA   . GLN A 1 23 ? -8.903  -9.848  0.150   1.00 0.00 ? 814 GLN A HA   8  
ATOM 6367 H HB2  . GLN A 1 23 ? -10.049 -8.008  2.273   1.00 0.00 ? 814 GLN A HB2  8  
ATOM 6368 H HB3  . GLN A 1 23 ? -10.874 -8.259  0.738   1.00 0.00 ? 814 GLN A HB3  8  
ATOM 6369 H HG2  . GLN A 1 23 ? -10.628 -10.789 1.242   1.00 0.00 ? 814 GLN A HG2  8  
ATOM 6370 H HG3  . GLN A 1 23 ? -10.299 -10.279 2.897   1.00 0.00 ? 814 GLN A HG3  8  
ATOM 6371 H HE21 . GLN A 1 23 ? -12.210 -10.591 4.041   1.00 0.00 ? 814 GLN A HE21 8  
ATOM 6372 H HE22 . GLN A 1 23 ? -13.746 -10.100 3.511   1.00 0.00 ? 814 GLN A HE22 8  
ATOM 6373 N N    . THR A 1 24 ? -9.395  -7.052  -0.617  1.00 0.00 ? 815 THR A N    8  
ATOM 6374 C CA   . THR A 1 24 ? -9.121  -5.895  -1.443  1.00 0.00 ? 815 THR A CA   8  
ATOM 6375 C C    . THR A 1 24 ? -8.718  -4.712  -0.564  1.00 0.00 ? 815 THR A C    8  
ATOM 6376 O O    . THR A 1 24 ? -8.840  -4.774  0.665   1.00 0.00 ? 815 THR A O    8  
ATOM 6377 C CB   . THR A 1 24 ? -10.351 -5.546  -2.291  1.00 0.00 ? 815 THR A CB   8  
ATOM 6378 O OG1  . THR A 1 24 ? -11.538 -5.774  -1.528  1.00 0.00 ? 815 THR A OG1  8  
ATOM 6379 C CG2  . THR A 1 24 ? -10.378 -6.429  -3.544  1.00 0.00 ? 815 THR A CG2  8  
ATOM 6380 H H    . THR A 1 24 ? -10.326 -7.289  -0.439  1.00 0.00 ? 815 THR A H    8  
ATOM 6381 H HA   . THR A 1 24 ? -8.298  -6.133  -2.101  1.00 0.00 ? 815 THR A HA   8  
ATOM 6382 H HB   . THR A 1 24 ? -10.298 -4.512  -2.593  1.00 0.00 ? 815 THR A HB   8  
ATOM 6383 H HG21 . THR A 1 24 ? -11.326 -6.315  -4.050  1.00 0.00 ? 815 THR A HG21 8  
ATOM 6384 H HG22 . THR A 1 24 ? -10.242 -7.463  -3.265  1.00 0.00 ? 815 THR A HG22 8  
ATOM 6385 H HG23 . THR A 1 24 ? -9.581  -6.133  -4.211  1.00 0.00 ? 815 THR A HG23 8  
ATOM 6386 N N    . VAL A 1 25 ? -8.178  -3.670  -1.172  1.00 0.00 ? 816 VAL A N    8  
ATOM 6387 C CA   . VAL A 1 25 ? -7.698  -2.531  -0.412  1.00 0.00 ? 816 VAL A CA   8  
ATOM 6388 C C    . VAL A 1 25 ? -8.827  -1.906  0.398   1.00 0.00 ? 816 VAL A C    8  
ATOM 6389 O O    . VAL A 1 25 ? -9.679  -1.187  -0.133  1.00 0.00 ? 816 VAL A O    8  
ATOM 6390 C CB   . VAL A 1 25 ? -7.077  -1.485  -1.347  1.00 0.00 ? 816 VAL A CB   8  
ATOM 6391 C CG1  . VAL A 1 25 ? -5.675  -1.934  -1.755  1.00 0.00 ? 816 VAL A CG1  8  
ATOM 6392 C CG2  . VAL A 1 25 ? -7.943  -1.319  -2.608  1.00 0.00 ? 816 VAL A CG2  8  
ATOM 6393 H H    . VAL A 1 25 ? -8.053  -3.690  -2.151  1.00 0.00 ? 816 VAL A H    8  
ATOM 6394 H HA   . VAL A 1 25 ? -6.934  -2.875  0.270   1.00 0.00 ? 816 VAL A HA   8  
ATOM 6395 H HB   . VAL A 1 25 ? -7.009  -0.540  -0.827  1.00 0.00 ? 816 VAL A HB   8  
ATOM 6396 H HG11 . VAL A 1 25 ? -5.310  -1.294  -2.543  1.00 0.00 ? 816 VAL A HG11 8  
ATOM 6397 H HG12 . VAL A 1 25 ? -5.711  -2.954  -2.108  1.00 0.00 ? 816 VAL A HG12 8  
ATOM 6398 H HG13 . VAL A 1 25 ? -5.012  -1.871  -0.905  1.00 0.00 ? 816 VAL A HG13 8  
ATOM 6399 H HG21 . VAL A 1 25 ? -7.391  -1.655  -3.474  1.00 0.00 ? 816 VAL A HG21 8  
ATOM 6400 H HG22 . VAL A 1 25 ? -8.199  -0.278  -2.733  1.00 0.00 ? 816 VAL A HG22 8  
ATOM 6401 H HG23 . VAL A 1 25 ? -8.848  -1.899  -2.513  1.00 0.00 ? 816 VAL A HG23 8  
ATOM 6402 N N    . GLY A 1 26 ? -8.833  -2.213  1.685   1.00 0.00 ? 817 GLY A N    8  
ATOM 6403 C CA   . GLY A 1 26 ? -9.843  -1.716  2.604   1.00 0.00 ? 817 GLY A CA   8  
ATOM 6404 C C    . GLY A 1 26 ? -9.484  -2.115  4.026   1.00 0.00 ? 817 GLY A C    8  
ATOM 6405 O O    . GLY A 1 26 ? -8.707  -1.427  4.695   1.00 0.00 ? 817 GLY A O    8  
ATOM 6406 H H    . GLY A 1 26 ? -8.135  -2.807  2.029   1.00 0.00 ? 817 GLY A H    8  
ATOM 6407 H HA2  . GLY A 1 26 ? -9.891  -0.638  2.531   1.00 0.00 ? 817 GLY A HA2  8  
ATOM 6408 H HA3  . GLY A 1 26 ? -10.803 -2.136  2.348   1.00 0.00 ? 817 GLY A HA3  8  
ATOM 6409 N N    . GLN A 1 27 ? -9.989  -3.268  4.466   1.00 0.00 ? 818 GLN A N    8  
ATOM 6410 C CA   . GLN A 1 27 ? -9.671  -3.765  5.804   1.00 0.00 ? 818 GLN A CA   8  
ATOM 6411 C C    . GLN A 1 27 ? -8.171  -3.767  6.013   1.00 0.00 ? 818 GLN A C    8  
ATOM 6412 O O    . GLN A 1 27 ? -7.688  -3.597  7.129   1.00 0.00 ? 818 GLN A O    8  
ATOM 6413 C CB   . GLN A 1 27 ? -10.221 -5.180  6.008   1.00 0.00 ? 818 GLN A CB   8  
ATOM 6414 C CG   . GLN A 1 27 ? -11.693 -5.235  5.585   1.00 0.00 ? 818 GLN A CG   8  
ATOM 6415 C CD   . GLN A 1 27 ? -11.828 -5.981  4.266   1.00 0.00 ? 818 GLN A CD   8  
ATOM 6416 O OE1  . GLN A 1 27 ? -10.976 -5.839  3.381   1.00 0.00 ? 818 GLN A OE1  8  
ATOM 6417 N NE2  . GLN A 1 27 ? -12.836 -6.773  4.077   1.00 0.00 ? 818 GLN A NE2  8  
ATOM 6418 H H    . GLN A 1 27 ? -10.562 -3.803  3.874   1.00 0.00 ? 818 GLN A H    8  
ATOM 6419 H HA   . GLN A 1 27 ? -10.118 -3.108  6.535   1.00 0.00 ? 818 GLN A HA   8  
ATOM 6420 H HB2  . GLN A 1 27 ? -9.644  -5.879  5.418   1.00 0.00 ? 818 GLN A HB2  8  
ATOM 6421 H HB3  . GLN A 1 27 ? -10.139 -5.448  7.051   1.00 0.00 ? 818 GLN A HB3  8  
ATOM 6422 H HG2  . GLN A 1 27 ? -12.264 -5.749  6.346   1.00 0.00 ? 818 GLN A HG2  8  
ATOM 6423 H HG3  . GLN A 1 27 ? -12.078 -4.233  5.471   1.00 0.00 ? 818 GLN A HG3  8  
ATOM 6424 H HE21 . GLN A 1 27 ? -13.505 -6.890  4.783   1.00 0.00 ? 818 GLN A HE21 8  
ATOM 6425 H HE22 . GLN A 1 27 ? -12.932 -7.252  3.229   1.00 0.00 ? 818 GLN A HE22 8  
ATOM 6426 N N    . TRP A 1 28 ? -7.435  -3.930  4.929   1.00 0.00 ? 819 TRP A N    8  
ATOM 6427 C CA   . TRP A 1 28 ? -5.987  -3.909  4.991   1.00 0.00 ? 819 TRP A CA   8  
ATOM 6428 C C    . TRP A 1 28 ? -5.519  -2.587  5.575   1.00 0.00 ? 819 TRP A C    8  
ATOM 6429 O O    . TRP A 1 28 ? -4.811  -2.554  6.584   1.00 0.00 ? 819 TRP A O    8  
ATOM 6430 C CB   . TRP A 1 28 ? -5.400  -4.096  3.590   1.00 0.00 ? 819 TRP A CB   8  
ATOM 6431 C CG   . TRP A 1 28 ? -3.944  -4.393  3.692   1.00 0.00 ? 819 TRP A CG   8  
ATOM 6432 C CD1  . TRP A 1 28 ? -3.413  -5.503  4.255   1.00 0.00 ? 819 TRP A CD1  8  
ATOM 6433 C CD2  . TRP A 1 28 ? -2.822  -3.595  3.226   1.00 0.00 ? 819 TRP A CD2  8  
ATOM 6434 N NE1  . TRP A 1 28 ? -2.037  -5.433  4.163   1.00 0.00 ? 819 TRP A NE1  8  
ATOM 6435 C CE2  . TRP A 1 28 ? -1.625  -4.276  3.534   1.00 0.00 ? 819 TRP A CE2  8  
ATOM 6436 C CE3  . TRP A 1 28 ? -2.729  -2.354  2.566   1.00 0.00 ? 819 TRP A CE3  8  
ATOM 6437 C CZ2  . TRP A 1 28 ? -0.383  -3.753  3.205   1.00 0.00 ? 819 TRP A CZ2  8  
ATOM 6438 C CZ3  . TRP A 1 28 ? -1.473  -1.823  2.231   1.00 0.00 ? 819 TRP A CZ3  8  
ATOM 6439 C CH2  . TRP A 1 28 ? -0.302  -2.527  2.552   1.00 0.00 ? 819 TRP A CH2  8  
ATOM 6440 H H    . TRP A 1 28 ? -7.881  -4.046  4.066   1.00 0.00 ? 819 TRP A H    8  
ATOM 6441 H HA   . TRP A 1 28 ? -5.647  -4.714  5.624   1.00 0.00 ? 819 TRP A HA   8  
ATOM 6442 H HB2  . TRP A 1 28 ? -5.897  -4.919  3.098   1.00 0.00 ? 819 TRP A HB2  8  
ATOM 6443 H HB3  . TRP A 1 28 ? -5.542  -3.194  3.015   1.00 0.00 ? 819 TRP A HB3  8  
ATOM 6444 H HD1  . TRP A 1 28 ? -3.972  -6.311  4.704   1.00 0.00 ? 819 TRP A HD1  8  
ATOM 6445 N N    . LEU A 1 29 ? -5.968  -1.495  4.965   1.00 0.00 ? 820 LEU A N    8  
ATOM 6446 C CA   . LEU A 1 29 ? -5.639  -0.163  5.444   1.00 0.00 ? 820 LEU A CA   8  
ATOM 6447 C C    . LEU A 1 29 ? -6.033  -0.029  6.899   1.00 0.00 ? 820 LEU A C    8  
ATOM 6448 O O    . LEU A 1 29 ? -5.297  0.549   7.707   1.00 0.00 ? 820 LEU A O    8  
ATOM 6449 C CB   . LEU A 1 29 ? -6.353  0.888   4.600   1.00 0.00 ? 820 LEU A CB   8  
ATOM 6450 C CG   . LEU A 1 29 ? -5.691  0.946   3.219   1.00 0.00 ? 820 LEU A CG   8  
ATOM 6451 C CD1  . LEU A 1 29 ? -6.741  1.222   2.149   1.00 0.00 ? 820 LEU A CD1  8  
ATOM 6452 C CD2  . LEU A 1 29 ? -4.647  2.060   3.207   1.00 0.00 ? 820 LEU A CD2  8  
ATOM 6453 H H    . LEU A 1 29 ? -6.568  -1.589  4.196   1.00 0.00 ? 820 LEU A H    8  
ATOM 6454 H HA   . LEU A 1 29 ? -4.572  -0.012  5.353   1.00 0.00 ? 820 LEU A HA   8  
ATOM 6455 H HB2  . LEU A 1 29 ? -7.397  0.623   4.503   1.00 0.00 ? 820 LEU A HB2  8  
ATOM 6456 H HB3  . LEU A 1 29 ? -6.272  1.854   5.079   1.00 0.00 ? 820 LEU A HB3  8  
ATOM 6457 H HG   . LEU A 1 29 ? -5.213  0.001   3.008   1.00 0.00 ? 820 LEU A HG   8  
ATOM 6458 H HD11 . LEU A 1 29 ? -7.526  0.485   2.212   1.00 0.00 ? 820 LEU A HD11 8  
ATOM 6459 H HD12 . LEU A 1 29 ? -6.275  1.173   1.175   1.00 0.00 ? 820 LEU A HD12 8  
ATOM 6460 H HD13 . LEU A 1 29 ? -7.156  2.208   2.301   1.00 0.00 ? 820 LEU A HD13 8  
ATOM 6461 H HD21 . LEU A 1 29 ? -4.088  2.036   4.130   1.00 0.00 ? 820 LEU A HD21 8  
ATOM 6462 H HD22 . LEU A 1 29 ? -5.142  3.015   3.111   1.00 0.00 ? 820 LEU A HD22 8  
ATOM 6463 H HD23 . LEU A 1 29 ? -3.976  1.912   2.374   1.00 0.00 ? 820 LEU A HD23 8  
ATOM 6464 N N    . GLU A 1 30 ? -7.167  -0.617  7.244   1.00 0.00 ? 821 GLU A N    8  
ATOM 6465 C CA   . GLU A 1 30 ? -7.619  -0.624  8.624   1.00 0.00 ? 821 GLU A CA   8  
ATOM 6466 C C    . GLU A 1 30 ? -6.674  -1.476  9.460   1.00 0.00 ? 821 GLU A C    8  
ATOM 6467 O O    . GLU A 1 30 ? -6.233  -1.068  10.531  1.00 0.00 ? 821 GLU A O    8  
ATOM 6468 C CB   . GLU A 1 30 ? -9.043  -1.183  8.724   1.00 0.00 ? 821 GLU A CB   8  
ATOM 6469 C CG   . GLU A 1 30 ? -9.945  -0.497  7.695   1.00 0.00 ? 821 GLU A CG   8  
ATOM 6470 C CD   . GLU A 1 30 ? -11.391 -0.845  7.973   1.00 0.00 ? 821 GLU A CD   8  
ATOM 6471 O OE1  . GLU A 1 30 ? -11.796 -1.936  7.625   1.00 0.00 ? 821 GLU A OE1  8  
ATOM 6472 O OE2  . GLU A 1 30 ? -12.076 -0.020  8.533   1.00 0.00 ? 821 GLU A OE2  8  
ATOM 6473 H H    . GLU A 1 30 ? -7.685  -1.091  6.558   1.00 0.00 ? 821 GLU A H    8  
ATOM 6474 H HA   . GLU A 1 30 ? -7.609  0.388   9.003   1.00 0.00 ? 821 GLU A HA   8  
ATOM 6475 N N    . SER A 1 31 ? -6.344  -2.651  8.938   1.00 0.00 ? 822 SER A N    8  
ATOM 6476 C CA   . SER A 1 31 ? -5.427  -3.559  9.612   1.00 0.00 ? 822 SER A CA   8  
ATOM 6477 C C    . SER A 1 31 ? -4.133  -2.833  9.958   1.00 0.00 ? 822 SER A C    8  
ATOM 6478 O O    . SER A 1 31 ? -3.692  -2.838  11.109  1.00 0.00 ? 822 SER A O    8  
ATOM 6479 C CB   . SER A 1 31 ? -5.126  -4.769  8.718   1.00 0.00 ? 822 SER A CB   8  
ATOM 6480 O OG   . SER A 1 31 ? -6.354  -5.305  8.200   1.00 0.00 ? 822 SER A OG   8  
ATOM 6481 H H    . SER A 1 31 ? -6.712  -2.901  8.064   1.00 0.00 ? 822 SER A H    8  
ATOM 6482 H HA   . SER A 1 31 ? -5.886  -3.907  10.526  1.00 0.00 ? 822 SER A HA   8  
ATOM 6483 H HB2  . SER A 1 31 ? -4.499  -4.464  7.895   1.00 0.00 ? 822 SER A HB2  8  
ATOM 6484 H HB3  . SER A 1 31 ? -4.601  -5.516  9.298   1.00 0.00 ? 822 SER A HB3  8  
ATOM 6485 H HG   . SER A 1 31 ? -6.879  -4.568  7.842   1.00 0.00 ? 822 SER A HG   8  
ATOM 6486 N N    . ILE A 1 32 ? -3.548  -2.177  8.963   1.00 0.00 ? 823 ILE A N    8  
ATOM 6487 C CA   . ILE A 1 32 ? -2.327  -1.415  9.180   1.00 0.00 ? 823 ILE A CA   8  
ATOM 6488 C C    . ILE A 1 32 ? -2.648  -0.100  9.882   1.00 0.00 ? 823 ILE A C    8  
ATOM 6489 O O    . ILE A 1 32 ? -1.751  0.597   10.370  1.00 0.00 ? 823 ILE A O    8  
ATOM 6490 C CB   . ILE A 1 32 ? -1.622  -1.145  7.843   1.00 0.00 ? 823 ILE A CB   8  
ATOM 6491 C CG1  . ILE A 1 32 ? -2.518  -0.281  6.949   1.00 0.00 ? 823 ILE A CG1  8  
ATOM 6492 C CG2  . ILE A 1 32 ? -1.341  -2.471  7.135   1.00 0.00 ? 823 ILE A CG2  8  
ATOM 6493 C CD1  . ILE A 1 32 ? -1.975  -0.282  5.518   1.00 0.00 ? 823 ILE A CD1  8  
ATOM 6494 H H    . ILE A 1 32 ? -3.960  -2.187  8.072   1.00 0.00 ? 823 ILE A H    8  
ATOM 6495 H HA   . ILE A 1 32 ? -1.667  -1.991  9.812   1.00 0.00 ? 823 ILE A HA   8  
ATOM 6496 H HB   . ILE A 1 32 ? -0.687  -0.633  8.030   1.00 0.00 ? 823 ILE A HB   8  
ATOM 6497 H HG12 . ILE A 1 32 ? -3.515  -0.688  6.952   1.00 0.00 ? 823 ILE A HG12 8  
ATOM 6498 H HG21 . ILE A 1 32 ? -0.718  -2.291  6.273   1.00 0.00 ? 823 ILE A HG21 8  
ATOM 6499 H HG22 . ILE A 1 32 ? -2.275  -2.908  6.814   1.00 0.00 ? 823 ILE A HG22 8  
ATOM 6500 H HG23 . ILE A 1 32 ? -0.839  -3.147  7.810   1.00 0.00 ? 823 ILE A HG23 8  
ATOM 6501 H HD11 . ILE A 1 32 ? -2.343  0.584   4.991   1.00 0.00 ? 823 ILE A HD11 8  
ATOM 6502 H HD12 . ILE A 1 32 ? -2.301  -1.179  5.013   1.00 0.00 ? 823 ILE A HD12 8  
ATOM 6503 H HD13 . ILE A 1 32 ? -0.894  -0.259  5.542   1.00 0.00 ? 823 ILE A HD13 8  
ATOM 6504 N N    . GLY A 1 33 ? -3.931  0.233   9.931   1.00 0.00 ? 824 GLY A N    8  
ATOM 6505 C CA   . GLY A 1 33 ? -4.382  1.456   10.572  1.00 0.00 ? 824 GLY A CA   8  
ATOM 6506 C C    . GLY A 1 33 ? -3.886  2.678   9.823   1.00 0.00 ? 824 GLY A C    8  
ATOM 6507 O O    . GLY A 1 33 ? -3.385  3.626   10.429  1.00 0.00 ? 824 GLY A O    8  
ATOM 6508 H H    . GLY A 1 33 ? -4.595  -0.363  9.523   1.00 0.00 ? 824 GLY A H    8  
ATOM 6509 H HA2  . GLY A 1 33 ? -5.462  1.465   10.597  1.00 0.00 ? 824 GLY A HA2  8  
ATOM 6510 H HA3  . GLY A 1 33 ? -4.004  1.485   11.583  1.00 0.00 ? 824 GLY A HA3  8  
ATOM 6511 N N    . LEU A 1 34 ? -4.026  2.659   8.503   1.00 0.00 ? 825 LEU A N    8  
ATOM 6512 C CA   . LEU A 1 34 ? -3.583  3.780   7.678   1.00 0.00 ? 825 LEU A CA   8  
ATOM 6513 C C    . LEU A 1 34 ? -4.682  4.227   6.720   1.00 0.00 ? 825 LEU A C    8  
ATOM 6514 O O    . LEU A 1 34 ? -4.485  4.246   5.501   1.00 0.00 ? 825 LEU A O    8  
ATOM 6515 C CB   . LEU A 1 34 ? -2.334  3.394   6.879   1.00 0.00 ? 825 LEU A CB   8  
ATOM 6516 C CG   . LEU A 1 34 ? -1.227  2.921   7.830   1.00 0.00 ? 825 LEU A CG   8  
ATOM 6517 C CD1  . LEU A 1 34 ? -0.152  2.192   7.031   1.00 0.00 ? 825 LEU A CD1  8  
ATOM 6518 C CD2  . LEU A 1 34 ? -0.598  4.126   8.533   1.00 0.00 ? 825 LEU A CD2  8  
ATOM 6519 H H    . LEU A 1 34 ? -4.438  1.876   8.073   1.00 0.00 ? 825 LEU A H    8  
ATOM 6520 H HA   . LEU A 1 34 ? -3.333  4.611   8.321   1.00 0.00 ? 825 LEU A HA   8  
ATOM 6521 H HB2  . LEU A 1 34 ? -2.588  2.603   6.189   1.00 0.00 ? 825 LEU A HB2  8  
ATOM 6522 H HB3  . LEU A 1 34 ? -1.991  4.253   6.324   1.00 0.00 ? 825 LEU A HB3  8  
ATOM 6523 H HG   . LEU A 1 34 ? -1.641  2.246   8.565   1.00 0.00 ? 825 LEU A HG   8  
ATOM 6524 H HD11 . LEU A 1 34 ? -0.572  1.823   6.108   1.00 0.00 ? 825 LEU A HD11 8  
ATOM 6525 H HD12 . LEU A 1 34 ? 0.222   1.362   7.607   1.00 0.00 ? 825 LEU A HD12 8  
ATOM 6526 H HD13 . LEU A 1 34 ? 0.656   2.875   6.809   1.00 0.00 ? 825 LEU A HD13 8  
ATOM 6527 H HD21 . LEU A 1 34 ? -1.361  4.679   9.062   1.00 0.00 ? 825 LEU A HD21 8  
ATOM 6528 H HD22 . LEU A 1 34 ? -0.132  4.765   7.799   1.00 0.00 ? 825 LEU A HD22 8  
ATOM 6529 H HD23 . LEU A 1 34 ? 0.149   3.784   9.234   1.00 0.00 ? 825 LEU A HD23 8  
ATOM 6530 N N    . PRO A 1 35 ? -5.822  4.604   7.239   1.00 0.00 ? 826 PRO A N    8  
ATOM 6531 C CA   . PRO A 1 35 ? -6.955  5.079   6.397   1.00 0.00 ? 826 PRO A CA   8  
ATOM 6532 C C    . PRO A 1 35 ? -6.621  6.411   5.729   1.00 0.00 ? 826 PRO A C    8  
ATOM 6533 O O    . PRO A 1 35 ? -6.329  7.393   6.416   1.00 0.00 ? 826 PRO A O    8  
ATOM 6534 C CB   . PRO A 1 35 ? -8.108  5.245   7.395   1.00 0.00 ? 826 PRO A CB   8  
ATOM 6535 C CG   . PRO A 1 35 ? -7.456  5.406   8.732   1.00 0.00 ? 826 PRO A CG   8  
ATOM 6536 C CD   . PRO A 1 35 ? -6.150  4.617   8.675   1.00 0.00 ? 826 PRO A CD   8  
ATOM 6537 H HA   . PRO A 1 35 ? -7.228  4.337   5.663   1.00 0.00 ? 826 PRO A HA   8  
ATOM 6538 H HB2  . PRO A 1 35 ? -8.686  6.124   7.148   1.00 0.00 ? 826 PRO A HB2  8  
ATOM 6539 H HB3  . PRO A 1 35 ? -8.736  4.367   7.397   1.00 0.00 ? 826 PRO A HB3  8  
ATOM 6540 H HG2  . PRO A 1 35 ? -7.258  6.453   8.923   1.00 0.00 ? 826 PRO A HG2  8  
ATOM 6541 H HG3  . PRO A 1 35 ? -8.086  5.000   9.508   1.00 0.00 ? 826 PRO A HG3  8  
ATOM 6542 H HD2  . PRO A 1 35 ? -5.381  5.119   9.247   1.00 0.00 ? 826 PRO A HD2  8  
ATOM 6543 H HD3  . PRO A 1 35 ? -6.298  3.609   9.030   1.00 0.00 ? 826 PRO A HD3  8  
ATOM 6544 N N    . GLN A 1 36 ? -6.690  6.433   4.398   1.00 0.00 ? 827 GLN A N    8  
ATOM 6545 C CA   . GLN A 1 36 ? -6.412  7.636   3.587   1.00 0.00 ? 827 GLN A CA   8  
ATOM 6546 C C    . GLN A 1 36 ? -5.906  7.240   2.204   1.00 0.00 ? 827 GLN A C    8  
ATOM 6547 O O    . GLN A 1 36 ? -5.866  8.068   1.287   1.00 0.00 ? 827 GLN A O    8  
ATOM 6548 C CB   . GLN A 1 36 ? -5.360  8.548   4.252   1.00 0.00 ? 827 GLN A CB   8  
ATOM 6549 C CG   . GLN A 1 36 ? -4.077  7.750   4.532   1.00 0.00 ? 827 GLN A CG   8  
ATOM 6550 C CD   . GLN A 1 36 ? -3.377  8.296   5.767   1.00 0.00 ? 827 GLN A CD   8  
ATOM 6551 O OE1  . GLN A 1 36 ? -2.181  8.602   5.725   1.00 0.00 ? 827 GLN A OE1  8  
ATOM 6552 N NE2  . GLN A 1 36 ? -4.043  8.431   6.867   1.00 0.00 ? 827 GLN A NE2  8  
ATOM 6553 H H    . GLN A 1 36 ? -6.957  5.606   3.929   1.00 0.00 ? 827 GLN A H    8  
ATOM 6554 H HA   . GLN A 1 36 ? -7.330  8.194   3.473   1.00 0.00 ? 827 GLN A HA   8  
ATOM 6555 H HB2  . GLN A 1 36 ? -5.129  9.358   3.574   1.00 0.00 ? 827 GLN A HB2  8  
ATOM 6556 H HB3  . GLN A 1 36 ? -5.745  8.961   5.169   1.00 0.00 ? 827 GLN A HB3  8  
ATOM 6557 H HG2  . GLN A 1 36 ? -4.316  6.709   4.689   1.00 0.00 ? 827 GLN A HG2  8  
ATOM 6558 H HG3  . GLN A 1 36 ? -3.418  7.840   3.683   1.00 0.00 ? 827 GLN A HG3  8  
ATOM 6559 H HE21 . GLN A 1 36 ? -4.992  8.180   6.896   1.00 0.00 ? 827 GLN A HE21 8  
ATOM 6560 H HE22 . GLN A 1 36 ? -3.605  8.784   7.670   1.00 0.00 ? 827 GLN A HE22 8  
ATOM 6561 N N    . TYR A 1 37 ? -5.471  5.990   2.070   1.00 0.00 ? 828 TYR A N    8  
ATOM 6562 C CA   . TYR A 1 37 ? -4.916  5.506   0.806   1.00 0.00 ? 828 TYR A CA   8  
ATOM 6563 C C    . TYR A 1 37 ? -5.890  4.589   0.080   1.00 0.00 ? 828 TYR A C    8  
ATOM 6564 O O    . TYR A 1 37 ? -5.607  4.131   -1.026  1.00 0.00 ? 828 TYR A O    8  
ATOM 6565 C CB   . TYR A 1 37 ? -3.599  4.765   1.055   1.00 0.00 ? 828 TYR A CB   8  
ATOM 6566 C CG   . TYR A 1 37 ? -2.693  5.620   1.907   1.00 0.00 ? 828 TYR A CG   8  
ATOM 6567 C CD1  . TYR A 1 37 ? -2.212  6.835   1.410   1.00 0.00 ? 828 TYR A CD1  8  
ATOM 6568 C CD2  . TYR A 1 37 ? -2.341  5.203   3.196   1.00 0.00 ? 828 TYR A CD2  8  
ATOM 6569 C CE1  . TYR A 1 37 ? -1.383  7.632   2.198   1.00 0.00 ? 828 TYR A CE1  8  
ATOM 6570 C CE2  . TYR A 1 37 ? -1.509  6.000   3.984   1.00 0.00 ? 828 TYR A CE2  8  
ATOM 6571 C CZ   . TYR A 1 37 ? -1.031  7.215   3.486   1.00 0.00 ? 828 TYR A CZ   8  
ATOM 6572 O OH   . TYR A 1 37 ? -0.222  8.004   4.268   1.00 0.00 ? 828 TYR A OH   8  
ATOM 6573 H H    . TYR A 1 37 ? -5.494  5.388   2.844   1.00 0.00 ? 828 TYR A H    8  
ATOM 6574 H HA   . TYR A 1 37 ? -4.709  6.356   0.173   1.00 0.00 ? 828 TYR A HA   8  
ATOM 6575 H HB2  . TYR A 1 37 ? -3.801  3.830   1.557   1.00 0.00 ? 828 TYR A HB2  8  
ATOM 6576 H HB3  . TYR A 1 37 ? -3.120  4.565   0.110   1.00 0.00 ? 828 TYR A HB3  8  
ATOM 6577 H HH   . TYR A 1 37 ? -0.767  8.332   5.000   1.00 0.00 ? 828 TYR A HH   8  
ATOM 6578 N N    . GLU A 1 38 ? -7.027  4.330   0.699   1.00 0.00 ? 829 GLU A N    8  
ATOM 6579 C CA   . GLU A 1 38 ? -8.049  3.474   0.105   1.00 0.00 ? 829 GLU A CA   8  
ATOM 6580 C C    . GLU A 1 38 ? -8.270  3.840   -1.360  1.00 0.00 ? 829 GLU A C    8  
ATOM 6581 O O    . GLU A 1 38 ? -7.848  3.114   -2.270  1.00 0.00 ? 829 GLU A O    8  
ATOM 6582 C CB   . GLU A 1 38 ? -9.365  3.610   0.889   1.00 0.00 ? 829 GLU A CB   8  
ATOM 6583 C CG   . GLU A 1 38 ? -9.466  5.022   1.504   1.00 0.00 ? 829 GLU A CG   8  
ATOM 6584 C CD   . GLU A 1 38 ? -8.927  5.019   2.924   1.00 0.00 ? 829 GLU A CD   8  
ATOM 6585 O OE1  . GLU A 1 38 ? -7.785  4.650   3.102   1.00 0.00 ? 829 GLU A OE1  8  
ATOM 6586 O OE2  . GLU A 1 38 ? -9.661  5.399   3.814   1.00 0.00 ? 829 GLU A OE2  8  
ATOM 6587 H H    . GLU A 1 38 ? -7.195  4.721   1.586   1.00 0.00 ? 829 GLU A H    8  
ATOM 6588 H HA   . GLU A 1 38 ? -7.721  2.448   0.158   1.00 0.00 ? 829 GLU A HA   8  
ATOM 6589 N N    . ASN A 1 39 ? -8.908  4.982   -1.582  1.00 0.00 ? 830 ASN A N    8  
ATOM 6590 C CA   . ASN A 1 39 ? -9.159  5.460   -2.933  1.00 0.00 ? 830 ASN A CA   8  
ATOM 6591 C C    . ASN A 1 39 ? -7.848  5.599   -3.686  1.00 0.00 ? 830 ASN A C    8  
ATOM 6592 O O    . ASN A 1 39 ? -7.779  5.335   -4.877  1.00 0.00 ? 830 ASN A O    8  
ATOM 6593 C CB   . ASN A 1 39 ? -9.897  6.809   -2.900  1.00 0.00 ? 830 ASN A CB   8  
ATOM 6594 C CG   . ASN A 1 39 ? -9.411  7.715   -4.031  1.00 0.00 ? 830 ASN A CG   8  
ATOM 6595 O OD1  . ASN A 1 39 ? -8.489  8.514   -3.837  1.00 0.00 ? 830 ASN A OD1  8  
ATOM 6596 N ND2  . ASN A 1 39 ? -9.970  7.643   -5.200  1.00 0.00 ? 830 ASN A ND2  8  
ATOM 6597 H H    . ASN A 1 39 ? -9.196  5.522   -0.817  1.00 0.00 ? 830 ASN A H    8  
ATOM 6598 H HA   . ASN A 1 39 ? -9.778  4.739   -3.445  1.00 0.00 ? 830 ASN A HA   8  
ATOM 6599 H HB2  . ASN A 1 39 ? -10.955 6.635   -3.013  1.00 0.00 ? 830 ASN A HB2  8  
ATOM 6600 H HB3  . ASN A 1 39 ? -9.715  7.294   -1.953  1.00 0.00 ? 830 ASN A HB3  8  
ATOM 6601 H HD21 . ASN A 1 39 ? -10.701 7.008   -5.355  1.00 0.00 ? 830 ASN A HD21 8  
ATOM 6602 H HD22 . ASN A 1 39 ? -9.661  8.221   -5.930  1.00 0.00 ? 830 ASN A HD22 8  
ATOM 6603 N N    . HIS A 1 40 ? -6.813  6.015   -2.974  1.00 0.00 ? 831 HIS A N    8  
ATOM 6604 C CA   . HIS A 1 40 ? -5.496  6.189   -3.571  1.00 0.00 ? 831 HIS A CA   8  
ATOM 6605 C C    . HIS A 1 40 ? -5.062  4.911   -4.277  1.00 0.00 ? 831 HIS A C    8  
ATOM 6606 O O    . HIS A 1 40 ? -4.791  4.912   -5.485  1.00 0.00 ? 831 HIS A O    8  
ATOM 6607 C CB   . HIS A 1 40 ? -4.475  6.562   -2.488  1.00 0.00 ? 831 HIS A CB   8  
ATOM 6608 C CG   . HIS A 1 40 ? -3.311  7.283   -3.106  1.00 0.00 ? 831 HIS A CG   8  
ATOM 6609 N ND1  . HIS A 1 40 ? -2.645  8.307   -2.450  1.00 0.00 ? 831 HIS A ND1  8  
ATOM 6610 C CD2  . HIS A 1 40 ? -2.676  7.136   -4.312  1.00 0.00 ? 831 HIS A CD2  8  
ATOM 6611 C CE1  . HIS A 1 40 ? -1.656  8.729   -3.260  1.00 0.00 ? 831 HIS A CE1  8  
ATOM 6612 N NE2  . HIS A 1 40 ? -1.633  8.048   -4.406  1.00 0.00 ? 831 HIS A NE2  8  
ATOM 6613 H H    . HIS A 1 40 ? -6.939  6.203   -2.020  1.00 0.00 ? 831 HIS A H    8  
ATOM 6614 H HA   . HIS A 1 40 ? -5.546  6.990   -4.294  1.00 0.00 ? 831 HIS A HA   8  
ATOM 6615 H HB2  . HIS A 1 40 ? -4.946  7.205   -1.759  1.00 0.00 ? 831 HIS A HB2  8  
ATOM 6616 H HB3  . HIS A 1 40 ? -4.122  5.665   -2.000  1.00 0.00 ? 831 HIS A HB3  8  
ATOM 6617 N N    . LEU A 1 41 ? -5.018  3.817   -3.530  1.00 0.00 ? 832 LEU A N    8  
ATOM 6618 C CA   . LEU A 1 41 ? -4.643  2.541   -4.095  1.00 0.00 ? 832 LEU A CA   8  
ATOM 6619 C C    . LEU A 1 41 ? -5.645  2.138   -5.162  1.00 0.00 ? 832 LEU A C    8  
ATOM 6620 O O    . LEU A 1 41 ? -5.267  1.785   -6.283  1.00 0.00 ? 832 LEU A O    8  
ATOM 6621 C CB   . LEU A 1 41 ? -4.586  1.470   -2.999  1.00 0.00 ? 832 LEU A CB   8  
ATOM 6622 C CG   . LEU A 1 41 ? -3.166  1.391   -2.411  1.00 0.00 ? 832 LEU A CG   8  
ATOM 6623 C CD1  . LEU A 1 41 ? -2.932  2.566   -1.463  1.00 0.00 ? 832 LEU A CD1  8  
ATOM 6624 C CD2  . LEU A 1 41 ? -3.008  0.082   -1.632  1.00 0.00 ? 832 LEU A CD2  8  
ATOM 6625 H H    . LEU A 1 41 ? -5.264  3.864   -2.580  1.00 0.00 ? 832 LEU A H    8  
ATOM 6626 H HA   . LEU A 1 41 ? -3.668  2.633   -4.547  1.00 0.00 ? 832 LEU A HA   8  
ATOM 6627 H HB2  . LEU A 1 41 ? -5.293  1.713   -2.220  1.00 0.00 ? 832 LEU A HB2  8  
ATOM 6628 H HB3  . LEU A 1 41 ? -4.848  0.518   -3.428  1.00 0.00 ? 832 LEU A HB3  8  
ATOM 6629 H HG   . LEU A 1 41 ? -2.441  1.426   -3.211  1.00 0.00 ? 832 LEU A HG   8  
ATOM 6630 H HD11 . LEU A 1 41 ? -1.991  2.430   -0.950  1.00 0.00 ? 832 LEU A HD11 8  
ATOM 6631 H HD12 . LEU A 1 41 ? -3.733  2.606   -0.739  1.00 0.00 ? 832 LEU A HD12 8  
ATOM 6632 H HD13 . LEU A 1 41 ? -2.907  3.487   -2.026  1.00 0.00 ? 832 LEU A HD13 8  
ATOM 6633 H HD21 . LEU A 1 41 ? -3.118  -0.756  -2.305  1.00 0.00 ? 832 LEU A HD21 8  
ATOM 6634 H HD22 . LEU A 1 41 ? -3.762  0.026   -0.861  1.00 0.00 ? 832 LEU A HD22 8  
ATOM 6635 H HD23 . LEU A 1 41 ? -2.029  0.050   -1.178  1.00 0.00 ? 832 LEU A HD23 8  
ATOM 6636 N N    . MET A 1 42 ? -6.928  2.213   -4.815  1.00 0.00 ? 833 MET A N    8  
ATOM 6637 C CA   . MET A 1 42 ? -7.991  1.868   -5.751  1.00 0.00 ? 833 MET A CA   8  
ATOM 6638 C C    . MET A 1 42 ? -7.843  2.657   -7.040  1.00 0.00 ? 833 MET A C    8  
ATOM 6639 O O    . MET A 1 42 ? -7.760  2.082   -8.125  1.00 0.00 ? 833 MET A O    8  
ATOM 6640 C CB   . MET A 1 42 ? -9.363  2.149   -5.126  1.00 0.00 ? 833 MET A CB   8  
ATOM 6641 C CG   . MET A 1 42 ? -10.474 1.841   -6.142  1.00 0.00 ? 833 MET A CG   8  
ATOM 6642 S SD   . MET A 1 42 ? -10.035 0.369   -7.099  1.00 0.00 ? 833 MET A SD   8  
ATOM 6643 C CE   . MET A 1 42 ? -10.156 -0.825  -5.748  1.00 0.00 ? 833 MET A CE   8  
ATOM 6644 H H    . MET A 1 42 ? -7.160  2.518   -3.910  1.00 0.00 ? 833 MET A H    8  
ATOM 6645 H HA   . MET A 1 42 ? -7.922  0.814   -5.975  1.00 0.00 ? 833 MET A HA   8  
ATOM 6646 H HB2  . MET A 1 42 ? -9.492  1.531   -4.249  1.00 0.00 ? 833 MET A HB2  8  
ATOM 6647 H HB3  . MET A 1 42 ? -9.422  3.189   -4.840  1.00 0.00 ? 833 MET A HB3  8  
ATOM 6648 H HG2  . MET A 1 42 ? -11.404 1.666   -5.618  1.00 0.00 ? 833 MET A HG2  8  
ATOM 6649 H HG3  . MET A 1 42 ? -10.597 2.682   -6.810  1.00 0.00 ? 833 MET A HG3  8  
ATOM 6650 H HE1  . MET A 1 42 ? -10.965 -0.542  -5.090  1.00 0.00 ? 833 MET A HE1  8  
ATOM 6651 H HE2  . MET A 1 42 ? -9.234  -0.843  -5.189  1.00 0.00 ? 833 MET A HE2  8  
ATOM 6652 H HE3  . MET A 1 42 ? -10.342 -1.807  -6.156  1.00 0.00 ? 833 MET A HE3  8  
ATOM 6653 N N    . ALA A 1 43 ? -7.806  3.974   -6.916  1.00 0.00 ? 834 ALA A N    8  
ATOM 6654 C CA   . ALA A 1 43 ? -7.666  4.848   -8.074  1.00 0.00 ? 834 ALA A CA   8  
ATOM 6655 C C    . ALA A 1 43 ? -6.507  4.395   -8.940  1.00 0.00 ? 834 ALA A C    8  
ATOM 6656 O O    . ALA A 1 43 ? -6.596  4.404   -10.164 1.00 0.00 ? 834 ALA A O    8  
ATOM 6657 C CB   . ALA A 1 43 ? -7.443  6.296   -7.629  1.00 0.00 ? 834 ALA A CB   8  
ATOM 6658 H H    . ALA A 1 43 ? -7.875  4.371   -6.019  1.00 0.00 ? 834 ALA A H    8  
ATOM 6659 H HA   . ALA A 1 43 ? -8.572  4.802   -8.656  1.00 0.00 ? 834 ALA A HA   8  
ATOM 6660 H HB1  . ALA A 1 43 ? -7.281  6.918   -8.497  1.00 0.00 ? 834 ALA A HB1  8  
ATOM 6661 H HB2  . ALA A 1 43 ? -6.577  6.347   -6.985  1.00 0.00 ? 834 ALA A HB2  8  
ATOM 6662 H HB3  . ALA A 1 43 ? -8.312  6.646   -7.093  1.00 0.00 ? 834 ALA A HB3  8  
ATOM 6663 N N    . ASN A 1 44 ? -5.420  3.994   -8.296  1.00 0.00 ? 835 ASN A N    8  
ATOM 6664 C CA   . ASN A 1 44 ? -4.238  3.529   -9.016  1.00 0.00 ? 835 ASN A CA   8  
ATOM 6665 C C    . ASN A 1 44 ? -4.356  2.048   -9.357  1.00 0.00 ? 835 ASN A C    8  
ATOM 6666 O O    . ASN A 1 44 ? -3.408  1.440   -9.847  1.00 0.00 ? 835 ASN A O    8  
ATOM 6667 C CB   . ASN A 1 44 ? -2.973  3.769   -8.185  1.00 0.00 ? 835 ASN A CB   8  
ATOM 6668 C CG   . ASN A 1 44 ? -1.758  3.880   -9.103  1.00 0.00 ? 835 ASN A CG   8  
ATOM 6669 O OD1  . ASN A 1 44 ? -1.774  4.650   -10.068 1.00 0.00 ? 835 ASN A OD1  8  
ATOM 6670 N ND2  . ASN A 1 44 ? -0.704  3.162   -8.864  1.00 0.00 ? 835 ASN A ND2  8  
ATOM 6671 H H    . ASN A 1 44 ? -5.412  4.011   -7.313  1.00 0.00 ? 835 ASN A H    8  
ATOM 6672 H HA   . ASN A 1 44 ? -4.154  4.087   -9.937  1.00 0.00 ? 835 ASN A HA   8  
ATOM 6673 H HB2  . ASN A 1 44 ? -3.084  4.685   -7.624  1.00 0.00 ? 835 ASN A HB2  8  
ATOM 6674 H HB3  . ASN A 1 44 ? -2.832  2.945   -7.502  1.00 0.00 ? 835 ASN A HB3  8  
ATOM 6675 H HD21 . ASN A 1 44 ? -0.684  2.548   -8.099  1.00 0.00 ? 835 ASN A HD21 8  
ATOM 6676 H HD22 . ASN A 1 44 ? 0.079   3.228   -9.452  1.00 0.00 ? 835 ASN A HD22 8  
ATOM 6677 N N    . GLY A 1 45 ? -5.512  1.465   -9.068  1.00 0.00 ? 836 GLY A N    8  
ATOM 6678 C CA   . GLY A 1 45 ? -5.741  0.045   -9.330  1.00 0.00 ? 836 GLY A CA   8  
ATOM 6679 C C    . GLY A 1 45 ? -4.822  -0.816  -8.478  1.00 0.00 ? 836 GLY A C    8  
ATOM 6680 O O    . GLY A 1 45 ? -4.635  -2.007  -8.747  1.00 0.00 ? 836 GLY A O    8  
ATOM 6681 H H    . GLY A 1 45 ? -6.227  1.996   -8.657  1.00 0.00 ? 836 GLY A H    8  
ATOM 6682 H HA2  . GLY A 1 45 ? -6.769  -0.197  -9.106  1.00 0.00 ? 836 GLY A HA2  8  
ATOM 6683 H HA3  . GLY A 1 45 ? -5.546  -0.160  -10.373 1.00 0.00 ? 836 GLY A HA3  8  
ATOM 6684 N N    . PHE A 1 46 ? -4.261  -0.217  -7.443  1.00 0.00 ? 837 PHE A N    8  
ATOM 6685 C CA   . PHE A 1 46 ? -3.365  -0.930  -6.546  1.00 0.00 ? 837 PHE A CA   8  
ATOM 6686 C C    . PHE A 1 46 ? -4.160  -1.741  -5.536  1.00 0.00 ? 837 PHE A C    8  
ATOM 6687 O O    . PHE A 1 46 ? -4.016  -1.560  -4.331  1.00 0.00 ? 837 PHE A O    8  
ATOM 6688 C CB   . PHE A 1 46 ? -2.442  0.066   -5.821  1.00 0.00 ? 837 PHE A CB   8  
ATOM 6689 C CG   . PHE A 1 46 ? -1.192  0.320   -6.649  1.00 0.00 ? 837 PHE A CG   8  
ATOM 6690 C CD1  . PHE A 1 46 ? -1.232  0.209   -8.047  1.00 0.00 ? 837 PHE A CD1  8  
ATOM 6691 C CD2  . PHE A 1 46 ? 0.006   0.671   -6.014  1.00 0.00 ? 837 PHE A CD2  8  
ATOM 6692 C CE1  . PHE A 1 46 ? -0.080  0.448   -8.802  1.00 0.00 ? 837 PHE A CE1  8  
ATOM 6693 C CE2  . PHE A 1 46 ? 1.158   0.910   -6.774  1.00 0.00 ? 837 PHE A CE2  8  
ATOM 6694 C CZ   . PHE A 1 46 ? 1.114   0.797   -8.168  1.00 0.00 ? 837 PHE A CZ   8  
ATOM 6695 H H    . PHE A 1 46 ? -4.465  0.727   -7.265  1.00 0.00 ? 837 PHE A H    8  
ATOM 6696 H HA   . PHE A 1 46 ? -2.755  -1.607  -7.124  1.00 0.00 ? 837 PHE A HA   8  
ATOM 6697 H HB2  . PHE A 1 46 ? -2.970  0.995   -5.672  1.00 0.00 ? 837 PHE A HB2  8  
ATOM 6698 H HB3  . PHE A 1 46 ? -2.162  -0.341  -4.860  1.00 0.00 ? 837 PHE A HB3  8  
ATOM 6699 H HZ   . PHE A 1 46 ? 2.002   0.981   -8.755  1.00 0.00 ? 837 PHE A HZ   8  
ATOM 6700 N N    . ASP A 1 47 ? -4.999  -2.639  -6.035  1.00 0.00 ? 838 ASP A N    8  
ATOM 6701 C CA   . ASP A 1 47 ? -5.804  -3.487  -5.160  1.00 0.00 ? 838 ASP A CA   8  
ATOM 6702 C C    . ASP A 1 47 ? -5.135  -4.834  -4.960  1.00 0.00 ? 838 ASP A C    8  
ATOM 6703 O O    . ASP A 1 47 ? -4.090  -5.111  -5.555  1.00 0.00 ? 838 ASP A O    8  
ATOM 6704 C CB   . ASP A 1 47 ? -7.218  -3.682  -5.718  1.00 0.00 ? 838 ASP A CB   8  
ATOM 6705 C CG   . ASP A 1 47 ? -8.206  -3.868  -4.572  1.00 0.00 ? 838 ASP A CG   8  
ATOM 6706 O OD1  . ASP A 1 47 ? -7.811  -4.381  -3.545  1.00 0.00 ? 838 ASP A OD1  8  
ATOM 6707 O OD2  . ASP A 1 47 ? -9.343  -3.493  -4.735  1.00 0.00 ? 838 ASP A OD2  8  
ATOM 6708 H H    . ASP A 1 47 ? -5.067  -2.743  -7.008  1.00 0.00 ? 838 ASP A H    8  
ATOM 6709 H HA   . ASP A 1 47 ? -5.879  -3.004  -4.198  1.00 0.00 ? 838 ASP A HA   8  
ATOM 6710 N N    . ASN A 1 48 ? -5.729  -5.663  -4.114  1.00 0.00 ? 839 ASN A N    8  
ATOM 6711 C CA   . ASN A 1 48 ? -5.169  -6.978  -3.807  1.00 0.00 ? 839 ASN A CA   8  
ATOM 6712 C C    . ASN A 1 48 ? -3.798  -6.804  -3.173  1.00 0.00 ? 839 ASN A C    8  
ATOM 6713 O O    . ASN A 1 48 ? -2.767  -7.182  -3.745  1.00 0.00 ? 839 ASN A O    8  
ATOM 6714 C CB   . ASN A 1 48 ? -5.067  -7.834  -5.078  1.00 0.00 ? 839 ASN A CB   8  
ATOM 6715 C CG   . ASN A 1 48 ? -4.951  -9.310  -4.715  1.00 0.00 ? 839 ASN A CG   8  
ATOM 6716 O OD1  . ASN A 1 48 ? -5.167  -9.687  -3.562  1.00 0.00 ? 839 ASN A OD1  8  
ATOM 6717 N ND2  . ASN A 1 48 ? -4.625  -10.172 -5.628  1.00 0.00 ? 839 ASN A ND2  8  
ATOM 6718 H H    . ASN A 1 48 ? -6.559  -5.369  -3.671  1.00 0.00 ? 839 ASN A H    8  
ATOM 6719 H HA   . ASN A 1 48 ? -5.817  -7.475  -3.100  1.00 0.00 ? 839 ASN A HA   8  
ATOM 6720 H HB2  . ASN A 1 48 ? -5.953  -7.683  -5.678  1.00 0.00 ? 839 ASN A HB2  8  
ATOM 6721 H HB3  . ASN A 1 48 ? -4.197  -7.535  -5.643  1.00 0.00 ? 839 ASN A HB3  8  
ATOM 6722 H HD21 . ASN A 1 48 ? -4.455  -9.875  -6.546  1.00 0.00 ? 839 ASN A HD21 8  
ATOM 6723 H HD22 . ASN A 1 48 ? -4.544  -11.122 -5.402  1.00 0.00 ? 839 ASN A HD22 8  
ATOM 6724 N N    . VAL A 1 49 ? -3.792  -6.166  -2.018  1.00 0.00 ? 840 VAL A N    8  
ATOM 6725 C CA   . VAL A 1 49 ? -2.563  -5.844  -1.311  1.00 0.00 ? 840 VAL A CA   8  
ATOM 6726 C C    . VAL A 1 49 ? -1.593  -7.029  -1.280  1.00 0.00 ? 840 VAL A C    8  
ATOM 6727 O O    . VAL A 1 49 ? -0.390  -6.860  -1.513  1.00 0.00 ? 840 VAL A O    8  
ATOM 6728 C CB   . VAL A 1 49 ? -2.888  -5.368  0.109   1.00 0.00 ? 840 VAL A CB   8  
ATOM 6729 C CG1  . VAL A 1 49 ? -3.690  -4.065  0.032   1.00 0.00 ? 840 VAL A CG1  8  
ATOM 6730 C CG2  . VAL A 1 49 ? -3.722  -6.430  0.837   1.00 0.00 ? 840 VAL A CG2  8  
ATOM 6731 H H    . VAL A 1 49 ? -4.644  -5.857  -1.649  1.00 0.00 ? 840 VAL A H    8  
ATOM 6732 H HA   . VAL A 1 49 ? -2.081  -5.032  -1.834  1.00 0.00 ? 840 VAL A HA   8  
ATOM 6733 H HB   . VAL A 1 49 ? -1.968  -5.185  0.646   1.00 0.00 ? 840 VAL A HB   8  
ATOM 6734 H HG11 . VAL A 1 49 ? -4.241  -3.928  0.951   1.00 0.00 ? 840 VAL A HG11 8  
ATOM 6735 H HG12 . VAL A 1 49 ? -4.382  -4.112  -0.796  1.00 0.00 ? 840 VAL A HG12 8  
ATOM 6736 H HG13 . VAL A 1 49 ? -3.016  -3.235  -0.110  1.00 0.00 ? 840 VAL A HG13 8  
ATOM 6737 H HG21 . VAL A 1 49 ? -4.606  -6.656  0.261   1.00 0.00 ? 840 VAL A HG21 8  
ATOM 6738 H HG22 . VAL A 1 49 ? -4.015  -6.054  1.805   1.00 0.00 ? 840 VAL A HG22 8  
ATOM 6739 H HG23 . VAL A 1 49 ? -3.137  -7.328  0.966   1.00 0.00 ? 840 VAL A HG23 8  
ATOM 6740 N N    . GLN A 1 50 ? -2.103  -8.224  -1.009  1.00 0.00 ? 841 GLN A N    8  
ATOM 6741 C CA   . GLN A 1 50 ? -1.238  -9.400  -0.978  1.00 0.00 ? 841 GLN A CA   8  
ATOM 6742 C C    . GLN A 1 50 ? -0.433  -9.479  -2.263  1.00 0.00 ? 841 GLN A C    8  
ATOM 6743 O O    . GLN A 1 50 ? 0.767   -9.757  -2.245  1.00 0.00 ? 841 GLN A O    8  
ATOM 6744 C CB   . GLN A 1 50 ? -2.046  -10.692 -0.782  1.00 0.00 ? 841 GLN A CB   8  
ATOM 6745 C CG   . GLN A 1 50 ? -3.352  -10.625 -1.575  1.00 0.00 ? 841 GLN A CG   8  
ATOM 6746 C CD   . GLN A 1 50 ? -4.446  -10.037 -0.707  1.00 0.00 ? 841 GLN A CD   8  
ATOM 6747 O OE1  . GLN A 1 50 ? -4.607  -8.823  -0.655  1.00 0.00 ? 841 GLN A OE1  8  
ATOM 6748 N NE2  . GLN A 1 50 ? -5.198  -10.823 -0.006  1.00 0.00 ? 841 GLN A NE2  8  
ATOM 6749 H H    . GLN A 1 50 ? -3.069  -8.312  -0.841  1.00 0.00 ? 841 GLN A H    8  
ATOM 6750 H HA   . GLN A 1 50 ? -0.549  -9.292  -0.154  1.00 0.00 ? 841 GLN A HA   8  
ATOM 6751 H HB2  . GLN A 1 50 ? -1.460  -11.530 -1.128  1.00 0.00 ? 841 GLN A HB2  8  
ATOM 6752 H HB3  . GLN A 1 50 ? -2.268  -10.821 0.267   1.00 0.00 ? 841 GLN A HB3  8  
ATOM 6753 H HG2  . GLN A 1 50 ? -3.214  -10.009 -2.450  1.00 0.00 ? 841 GLN A HG2  8  
ATOM 6754 H HG3  . GLN A 1 50 ? -3.637  -11.621 -1.881  1.00 0.00 ? 841 GLN A HG3  8  
ATOM 6755 H HE21 . GLN A 1 50 ? -5.058  -11.792 -0.038  1.00 0.00 ? 841 GLN A HE21 8  
ATOM 6756 H HE22 . GLN A 1 50 ? -5.907  -10.452 0.555   1.00 0.00 ? 841 GLN A HE22 8  
ATOM 6757 N N    . PHE A 1 51 ? -1.084  -9.166  -3.376  1.00 0.00 ? 842 PHE A N    8  
ATOM 6758 C CA   . PHE A 1 51 ? -0.407  -9.146  -4.654  1.00 0.00 ? 842 PHE A CA   8  
ATOM 6759 C C    . PHE A 1 51 ? 0.588   -8.015  -4.673  1.00 0.00 ? 842 PHE A C    8  
ATOM 6760 O O    . PHE A 1 51 ? 1.740   -8.209  -5.028  1.00 0.00 ? 842 PHE A O    8  
ATOM 6761 C CB   . PHE A 1 51 ? -1.412  -8.992  -5.804  1.00 0.00 ? 842 PHE A CB   8  
ATOM 6762 C CG   . PHE A 1 51 ? -1.878  -10.359 -6.271  1.00 0.00 ? 842 PHE A CG   8  
ATOM 6763 C CD1  . PHE A 1 51 ? -1.878  -11.450 -5.386  1.00 0.00 ? 842 PHE A CD1  8  
ATOM 6764 C CD2  . PHE A 1 51 ? -2.312  -10.534 -7.590  1.00 0.00 ? 842 PHE A CD2  8  
ATOM 6765 C CE1  . PHE A 1 51 ? -2.308  -12.703 -5.823  1.00 0.00 ? 842 PHE A CE1  8  
ATOM 6766 C CE2  . PHE A 1 51 ? -2.742  -11.791 -8.025  1.00 0.00 ? 842 PHE A CE2  8  
ATOM 6767 C CZ   . PHE A 1 51 ? -2.740  -12.875 -7.142  1.00 0.00 ? 842 PHE A CZ   8  
ATOM 6768 H H    . PHE A 1 51 ? -2.025  -8.893  -3.327  1.00 0.00 ? 842 PHE A H    8  
ATOM 6769 H HA   . PHE A 1 51 ? 0.129   -10.075 -4.780  1.00 0.00 ? 842 PHE A HA   8  
ATOM 6770 H HB2  . PHE A 1 51 ? -2.261  -8.416  -5.472  1.00 0.00 ? 842 PHE A HB2  8  
ATOM 6771 H HB3  . PHE A 1 51 ? -0.934  -8.480  -6.626  1.00 0.00 ? 842 PHE A HB3  8  
ATOM 6772 H HZ   . PHE A 1 51 ? -3.072  -13.846 -7.480  1.00 0.00 ? 842 PHE A HZ   8  
ATOM 6773 N N    . MET A 1 52 ? 0.152   -6.837  -4.227  1.00 0.00 ? 843 MET A N    8  
ATOM 6774 C CA   . MET A 1 52 ? 1.045   -5.687  -4.151  1.00 0.00 ? 843 MET A CA   8  
ATOM 6775 C C    . MET A 1 52 ? 2.341   -6.090  -3.468  1.00 0.00 ? 843 MET A C    8  
ATOM 6776 O O    . MET A 1 52 ? 3.425   -5.963  -4.040  1.00 0.00 ? 843 MET A O    8  
ATOM 6777 C CB   . MET A 1 52 ? 0.391   -4.543  -3.366  1.00 0.00 ? 843 MET A CB   8  
ATOM 6778 C CG   . MET A 1 52 ? -0.773  -3.954  -4.169  1.00 0.00 ? 843 MET A CG   8  
ATOM 6779 S SD   . MET A 1 52 ? -1.614  -2.703  -3.166  1.00 0.00 ? 843 MET A SD   8  
ATOM 6780 C CE   . MET A 1 52 ? -0.204  -1.583  -2.955  1.00 0.00 ? 843 MET A CE   8  
ATOM 6781 H H    . MET A 1 52 ? -0.775  -6.756  -3.911  1.00 0.00 ? 843 MET A H    8  
ATOM 6782 H HA   . MET A 1 52 ? 1.265   -5.344  -5.152  1.00 0.00 ? 843 MET A HA   8  
ATOM 6783 H HB2  . MET A 1 52 ? 0.028   -4.912  -2.421  1.00 0.00 ? 843 MET A HB2  8  
ATOM 6784 H HB3  . MET A 1 52 ? 1.125   -3.773  -3.184  1.00 0.00 ? 843 MET A HB3  8  
ATOM 6785 H HG2  . MET A 1 52 ? -0.395  -3.498  -5.073  1.00 0.00 ? 843 MET A HG2  8  
ATOM 6786 H HG3  . MET A 1 52 ? -1.471  -4.737  -4.427  1.00 0.00 ? 843 MET A HG3  8  
ATOM 6787 H HE1  . MET A 1 52 ? 0.445   -1.651  -3.817  1.00 0.00 ? 843 MET A HE1  8  
ATOM 6788 H HE2  . MET A 1 52 ? 0.350   -1.857  -2.072  1.00 0.00 ? 843 MET A HE2  8  
ATOM 6789 H HE3  . MET A 1 52 ? -0.566  -0.571  -2.847  1.00 0.00 ? 843 MET A HE3  8  
ATOM 6790 N N    . GLY A 1 53 ? 2.218   -6.628  -2.263  1.00 0.00 ? 844 GLY A N    8  
ATOM 6791 C CA   . GLY A 1 53 ? 3.385   -7.093  -1.526  1.00 0.00 ? 844 GLY A CA   8  
ATOM 6792 C C    . GLY A 1 53 ? 4.101   -8.169  -2.313  1.00 0.00 ? 844 GLY A C    8  
ATOM 6793 O O    . GLY A 1 53 ? 5.334   -8.209  -2.357  1.00 0.00 ? 844 GLY A O    8  
ATOM 6794 H H    . GLY A 1 53 ? 1.322   -6.739  -1.876  1.00 0.00 ? 844 GLY A H    8  
ATOM 6795 H HA2  . GLY A 1 53 ? 4.059   -6.263  -1.370  1.00 0.00 ? 844 GLY A HA2  8  
ATOM 6796 H HA3  . GLY A 1 53 ? 3.077   -7.496  -0.573  1.00 0.00 ? 844 GLY A HA3  8  
ATOM 6797 N N    . SER A 1 54 ? 3.325   -9.020  -2.962  1.00 0.00 ? 845 SER A N    8  
ATOM 6798 C CA   . SER A 1 54 ? 3.881   -10.079 -3.780  1.00 0.00 ? 845 SER A CA   8  
ATOM 6799 C C    . SER A 1 54 ? 4.337   -9.528  -5.128  1.00 0.00 ? 845 SER A C    8  
ATOM 6800 O O    . SER A 1 54 ? 4.801   -10.280 -5.987  1.00 0.00 ? 845 SER A O    8  
ATOM 6801 C CB   . SER A 1 54 ? 2.838   -11.190 -3.991  1.00 0.00 ? 845 SER A CB   8  
ATOM 6802 O OG   . SER A 1 54 ? 3.501   -12.437 -4.237  1.00 0.00 ? 845 SER A OG   8  
ATOM 6803 H H    . SER A 1 54 ? 2.349   -8.921  -2.908  1.00 0.00 ? 845 SER A H    8  
ATOM 6804 H HA   . SER A 1 54 ? 4.736   -10.497 -3.273  1.00 0.00 ? 845 SER A HA   8  
ATOM 6805 H HB2  . SER A 1 54 ? 2.226   -11.286 -3.110  1.00 0.00 ? 845 SER A HB2  8  
ATOM 6806 H HB3  . SER A 1 54 ? 2.207   -10.924 -4.829  1.00 0.00 ? 845 SER A HB3  8  
ATOM 6807 H HG   . SER A 1 54 ? 3.092   -13.120 -3.678  1.00 0.00 ? 845 SER A HG   8  
ATOM 6808 N N    . ASN A 1 55 ? 4.203   -8.215  -5.314  1.00 0.00 ? 846 ASN A N    8  
ATOM 6809 C CA   . ASN A 1 55 ? 4.605   -7.590  -6.567  1.00 0.00 ? 846 ASN A CA   8  
ATOM 6810 C C    . ASN A 1 55 ? 5.970   -6.934  -6.413  1.00 0.00 ? 846 ASN A C    8  
ATOM 6811 O O    . ASN A 1 55 ? 6.921   -7.302  -7.107  1.00 0.00 ? 846 ASN A O    8  
ATOM 6812 C CB   . ASN A 1 55 ? 3.527   -6.577  -7.023  1.00 0.00 ? 846 ASN A CB   8  
ATOM 6813 C CG   . ASN A 1 55 ? 4.048   -5.150  -7.001  1.00 0.00 ? 846 ASN A CG   8  
ATOM 6814 O OD1  . ASN A 1 55 ? 4.588   -4.673  -7.999  1.00 0.00 ? 846 ASN A OD1  8  
ATOM 6815 N ND2  . ASN A 1 55 ? 3.919   -4.438  -5.925  1.00 0.00 ? 846 ASN A ND2  8  
ATOM 6816 H H    . ASN A 1 55 ? 3.828   -7.655  -4.596  1.00 0.00 ? 846 ASN A H    8  
ATOM 6817 H HA   . ASN A 1 55 ? 4.684   -8.362  -7.321  1.00 0.00 ? 846 ASN A HA   8  
ATOM 6818 H HB2  . ASN A 1 55 ? 3.222   -6.816  -8.028  1.00 0.00 ? 846 ASN A HB2  8  
ATOM 6819 H HB3  . ASN A 1 55 ? 2.669   -6.651  -6.375  1.00 0.00 ? 846 ASN A HB3  8  
ATOM 6820 H HD21 . ASN A 1 55 ? 3.493   -4.825  -5.130  1.00 0.00 ? 846 ASN A HD21 8  
ATOM 6821 H HD22 . ASN A 1 55 ? 4.233   -3.506  -5.905  1.00 0.00 ? 846 ASN A HD22 8  
ATOM 6822 N N    . VAL A 1 56 ? 6.088   -6.046  -5.435  1.00 0.00 ? 847 VAL A N    8  
ATOM 6823 C CA   . VAL A 1 56 ? 7.366   -5.418  -5.103  1.00 0.00 ? 847 VAL A CA   8  
ATOM 6824 C C    . VAL A 1 56 ? 7.367   -4.995  -3.643  1.00 0.00 ? 847 VAL A C    8  
ATOM 6825 O O    . VAL A 1 56 ? 6.318   -4.668  -3.086  1.00 0.00 ? 847 VAL A O    8  
ATOM 6826 C CB   . VAL A 1 56 ? 7.664   -4.201  -6.009  1.00 0.00 ? 847 VAL A CB   8  
ATOM 6827 C CG1  . VAL A 1 56 ? 7.854   -4.654  -7.459  1.00 0.00 ? 847 VAL A CG1  8  
ATOM 6828 C CG2  . VAL A 1 56 ? 6.515   -3.190  -5.939  1.00 0.00 ? 847 VAL A CG2  8  
ATOM 6829 H H    . VAL A 1 56 ? 5.311   -5.855  -4.866  1.00 0.00 ? 847 VAL A H    8  
ATOM 6830 H HA   . VAL A 1 56 ? 8.147   -6.151  -5.242  1.00 0.00 ? 847 VAL A HA   8  
ATOM 6831 H HB   . VAL A 1 56 ? 8.577   -3.732  -5.668  1.00 0.00 ? 847 VAL A HB   8  
ATOM 6832 H HG11 . VAL A 1 56 ? 8.522   -5.502  -7.488  1.00 0.00 ? 847 VAL A HG11 8  
ATOM 6833 H HG12 . VAL A 1 56 ? 8.277   -3.844  -8.034  1.00 0.00 ? 847 VAL A HG12 8  
ATOM 6834 H HG13 . VAL A 1 56 ? 6.900   -4.932  -7.879  1.00 0.00 ? 847 VAL A HG13 8  
ATOM 6835 H HG21 . VAL A 1 56 ? 5.919   -3.253  -6.836  1.00 0.00 ? 847 VAL A HG21 8  
ATOM 6836 H HG22 . VAL A 1 56 ? 6.921   -2.193  -5.854  1.00 0.00 ? 847 VAL A HG22 8  
ATOM 6837 H HG23 . VAL A 1 56 ? 5.896   -3.395  -5.078  1.00 0.00 ? 847 VAL A HG23 8  
ATOM 6838 N N    . MET A 1 57 ? 8.536   -4.974  -3.033  1.00 0.00 ? 848 MET A N    8  
ATOM 6839 C CA   . MET A 1 57 ? 8.651   -4.543  -1.653  1.00 0.00 ? 848 MET A CA   8  
ATOM 6840 C C    . MET A 1 57 ? 9.643   -3.410  -1.559  1.00 0.00 ? 848 MET A C    8  
ATOM 6841 O O    . MET A 1 57 ? 10.856  -3.633  -1.555  1.00 0.00 ? 848 MET A O    8  
ATOM 6842 C CB   . MET A 1 57 ? 9.115   -5.704  -0.768  1.00 0.00 ? 848 MET A CB   8  
ATOM 6843 C CG   . MET A 1 57 ? 8.148   -6.881  -0.905  1.00 0.00 ? 848 MET A CG   8  
ATOM 6844 S SD   . MET A 1 57 ? 8.627   -8.183  0.257   1.00 0.00 ? 848 MET A SD   8  
ATOM 6845 C CE   . MET A 1 57 ? 9.509   -9.235  -0.925  1.00 0.00 ? 848 MET A CE   8  
ATOM 6846 H H    . MET A 1 57 ? 9.343   -5.214  -3.529  1.00 0.00 ? 848 MET A H    8  
ATOM 6847 H HA   . MET A 1 57 ? 7.689   -4.201  -1.304  1.00 0.00 ? 848 MET A HA   8  
ATOM 6848 H HB2  . MET A 1 57 ? 10.104  -6.008  -1.074  1.00 0.00 ? 848 MET A HB2  8  
ATOM 6849 H HB3  . MET A 1 57 ? 9.142   -5.380  0.261   1.00 0.00 ? 848 MET A HB3  8  
ATOM 6850 H HG2  . MET A 1 57 ? 7.142   -6.552  -0.688  1.00 0.00 ? 848 MET A HG2  8  
ATOM 6851 H HG3  . MET A 1 57 ? 8.188   -7.265  -1.914  1.00 0.00 ? 848 MET A HG3  8  
ATOM 6852 H HE1  . MET A 1 57 ? 9.925   -10.088 -0.406  1.00 0.00 ? 848 MET A HE1  8  
ATOM 6853 H HE2  . MET A 1 57 ? 10.308  -8.677  -1.387  1.00 0.00 ? 848 MET A HE2  8  
ATOM 6854 H HE3  . MET A 1 57 ? 8.821   -9.570  -1.689  1.00 0.00 ? 848 MET A HE3  8  
ATOM 6855 N N    . GLU A 1 58 ? 9.127   -2.199  -1.470  1.00 0.00 ? 849 GLU A N    8  
ATOM 6856 C CA   . GLU A 1 58 ? 9.958   -1.008  -1.370  1.00 0.00 ? 849 GLU A CA   8  
ATOM 6857 C C    . GLU A 1 58 ? 9.102   0.243   -1.448  1.00 0.00 ? 849 GLU A C    8  
ATOM 6858 O O    . GLU A 1 58 ? 7.877   0.164   -1.579  1.00 0.00 ? 849 GLU A O    8  
ATOM 6859 C CB   . GLU A 1 58 ? 11.016  -0.983  -2.490  1.00 0.00 ? 849 GLU A CB   8  
ATOM 6860 C CG   . GLU A 1 58 ? 10.430  -1.536  -3.804  1.00 0.00 ? 849 GLU A CG   8  
ATOM 6861 C CD   . GLU A 1 58 ? 11.341  -2.614  -4.364  1.00 0.00 ? 849 GLU A CD   8  
ATOM 6862 O OE1  . GLU A 1 58 ? 12.528  -2.370  -4.446  1.00 0.00 ? 849 GLU A OE1  8  
ATOM 6863 O OE2  . GLU A 1 58 ? 10.846  -3.666  -4.704  1.00 0.00 ? 849 GLU A OE2  8  
ATOM 6864 H H    . GLU A 1 58 ? 8.153   -2.099  -1.478  1.00 0.00 ? 849 GLU A H    8  
ATOM 6865 H HA   . GLU A 1 58 ? 10.468  -1.021  -0.417  1.00 0.00 ? 849 GLU A HA   8  
ATOM 6866 N N    . ASP A 1 59 ? 9.751   1.395   -1.397  1.00 0.00 ? 850 ASP A N    8  
ATOM 6867 C CA   . ASP A 1 59 ? 9.050   2.668   -1.487  1.00 0.00 ? 850 ASP A CA   8  
ATOM 6868 C C    . ASP A 1 59 ? 8.529   2.894   -2.896  1.00 0.00 ? 850 ASP A C    8  
ATOM 6869 O O    . ASP A 1 59 ? 7.577   3.639   -3.098  1.00 0.00 ? 850 ASP A O    8  
ATOM 6870 C CB   . ASP A 1 59 ? 9.980   3.819   -1.090  1.00 0.00 ? 850 ASP A CB   8  
ATOM 6871 C CG   . ASP A 1 59 ? 10.917  4.164   -2.236  1.00 0.00 ? 850 ASP A CG   8  
ATOM 6872 O OD1  . ASP A 1 59 ? 11.589  3.274   -2.716  1.00 0.00 ? 850 ASP A OD1  8  
ATOM 6873 O OD2  . ASP A 1 59 ? 10.963  5.316   -2.610  1.00 0.00 ? 850 ASP A OD2  8  
ATOM 6874 H H    . ASP A 1 59 ? 10.725  1.390   -1.314  1.00 0.00 ? 850 ASP A H    8  
ATOM 6875 H HA   . ASP A 1 59 ? 8.214   2.651   -0.807  1.00 0.00 ? 850 ASP A HA   8  
ATOM 6876 N N    . GLN A 1 60 ? 9.179   2.265   -3.866  1.00 0.00 ? 851 GLN A N    8  
ATOM 6877 C CA   . GLN A 1 60 ? 8.803   2.420   -5.271  1.00 0.00 ? 851 GLN A CA   8  
ATOM 6878 C C    . GLN A 1 60 ? 7.302   2.249   -5.461  1.00 0.00 ? 851 GLN A C    8  
ATOM 6879 O O    . GLN A 1 60 ? 6.645   3.106   -6.052  1.00 0.00 ? 851 GLN A O    8  
ATOM 6880 C CB   . GLN A 1 60 ? 9.554   1.408   -6.143  1.00 0.00 ? 851 GLN A CB   8  
ATOM 6881 C CG   . GLN A 1 60 ? 11.062  1.557   -5.919  1.00 0.00 ? 851 GLN A CG   8  
ATOM 6882 C CD   . GLN A 1 60 ? 11.822  0.939   -7.082  1.00 0.00 ? 851 GLN A CD   8  
ATOM 6883 O OE1  . GLN A 1 60 ? 12.443  -0.113  -6.930  1.00 0.00 ? 851 GLN A OE1  8  
ATOM 6884 N NE2  . GLN A 1 60 ? 11.813  1.524   -8.236  1.00 0.00 ? 851 GLN A NE2  8  
ATOM 6885 H H    . GLN A 1 60 ? 9.948   1.707   -3.630  1.00 0.00 ? 851 GLN A H    8  
ATOM 6886 H HA   . GLN A 1 60 ? 9.077   3.415   -5.591  1.00 0.00 ? 851 GLN A HA   8  
ATOM 6887 H HB2  . GLN A 1 60 ? 9.244   0.406   -5.884  1.00 0.00 ? 851 GLN A HB2  8  
ATOM 6888 H HB3  . GLN A 1 60 ? 9.328   1.596   -7.182  1.00 0.00 ? 851 GLN A HB3  8  
ATOM 6889 H HG2  . GLN A 1 60 ? 11.313  2.606   -5.847  1.00 0.00 ? 851 GLN A HG2  8  
ATOM 6890 H HG3  . GLN A 1 60 ? 11.344  1.059   -5.005  1.00 0.00 ? 851 GLN A HG3  8  
ATOM 6891 H HE21 . GLN A 1 60 ? 11.318  2.361   -8.358  1.00 0.00 ? 851 GLN A HE21 8  
ATOM 6892 H HE22 . GLN A 1 60 ? 12.304  1.132   -8.990  1.00 0.00 ? 851 GLN A HE22 8  
ATOM 6893 N N    . ASP A 1 61 ? 6.759   1.152   -4.946  1.00 0.00 ? 852 ASP A N    8  
ATOM 6894 C CA   . ASP A 1 61 ? 5.323   0.900   -5.055  1.00 0.00 ? 852 ASP A CA   8  
ATOM 6895 C C    . ASP A 1 61 ? 4.554   2.048   -4.426  1.00 0.00 ? 852 ASP A C    8  
ATOM 6896 O O    . ASP A 1 61 ? 3.702   2.677   -5.062  1.00 0.00 ? 852 ASP A O    8  
ATOM 6897 C CB   . ASP A 1 61 ? 4.953   -0.413  -4.358  1.00 0.00 ? 852 ASP A CB   8  
ATOM 6898 C CG   . ASP A 1 61 ? 3.700   -0.995  -4.987  1.00 0.00 ? 852 ASP A CG   8  
ATOM 6899 O OD1  . ASP A 1 61 ? 2.628   -0.590  -4.603  1.00 0.00 ? 852 ASP A OD1  8  
ATOM 6900 O OD2  . ASP A 1 61 ? 3.834   -1.836  -5.856  1.00 0.00 ? 852 ASP A OD2  8  
ATOM 6901 H H    . ASP A 1 61 ? 7.329   0.509   -4.473  1.00 0.00 ? 852 ASP A H    8  
ATOM 6902 H HA   . ASP A 1 61 ? 5.056   0.829   -6.099  1.00 0.00 ? 852 ASP A HA   8  
ATOM 6903 N N    . LEU A 1 62 ? 4.908   2.356   -3.193  1.00 0.00 ? 853 LEU A N    8  
ATOM 6904 C CA   . LEU A 1 62 ? 4.301   3.465   -2.482  1.00 0.00 ? 853 LEU A CA   8  
ATOM 6905 C C    . LEU A 1 62 ? 4.506   4.752   -3.271  1.00 0.00 ? 853 LEU A C    8  
ATOM 6906 O O    . LEU A 1 62 ? 3.639   5.636   -3.297  1.00 0.00 ? 853 LEU A O    8  
ATOM 6907 C CB   . LEU A 1 62 ? 4.923   3.590   -1.089  1.00 0.00 ? 853 LEU A CB   8  
ATOM 6908 C CG   . LEU A 1 62 ? 4.813   2.235   -0.362  1.00 0.00 ? 853 LEU A CG   8  
ATOM 6909 C CD1  . LEU A 1 62 ? 5.966   2.069   0.635   1.00 0.00 ? 853 LEU A CD1  8  
ATOM 6910 C CD2  . LEU A 1 62 ? 3.483   2.163   0.384   1.00 0.00 ? 853 LEU A CD2  8  
ATOM 6911 H H    . LEU A 1 62 ? 5.624   1.842   -2.765  1.00 0.00 ? 853 LEU A H    8  
ATOM 6912 H HA   . LEU A 1 62 ? 3.242   3.278   -2.378  1.00 0.00 ? 853 LEU A HA   8  
ATOM 6913 H HB2  . LEU A 1 62 ? 5.962   3.872   -1.190  1.00 0.00 ? 853 LEU A HB2  8  
ATOM 6914 H HB3  . LEU A 1 62 ? 4.399   4.346   -0.526  1.00 0.00 ? 853 LEU A HB3  8  
ATOM 6915 H HG   . LEU A 1 62 ? 4.864   1.433   -1.084  1.00 0.00 ? 853 LEU A HG   8  
ATOM 6916 H HD11 . LEU A 1 62 ? 6.709   2.832   0.466   1.00 0.00 ? 853 LEU A HD11 8  
ATOM 6917 H HD12 . LEU A 1 62 ? 6.416   1.097   0.500   1.00 0.00 ? 853 LEU A HD12 8  
ATOM 6918 H HD13 . LEU A 1 62 ? 5.590   2.151   1.646   1.00 0.00 ? 853 LEU A HD13 8  
ATOM 6919 H HD21 . LEU A 1 62 ? 3.436   2.947   1.125   1.00 0.00 ? 853 LEU A HD21 8  
ATOM 6920 H HD22 . LEU A 1 62 ? 3.407   1.203   0.871   1.00 0.00 ? 853 LEU A HD22 8  
ATOM 6921 H HD23 . LEU A 1 62 ? 2.668   2.274   -0.316  1.00 0.00 ? 853 LEU A HD23 8  
ATOM 6922 N N    . LEU A 1 63 ? 5.642   4.829   -3.947  1.00 0.00 ? 854 LEU A N    8  
ATOM 6923 C CA   . LEU A 1 63 ? 5.954   5.971   -4.783  1.00 0.00 ? 854 LEU A CA   8  
ATOM 6924 C C    . LEU A 1 63 ? 5.063   5.960   -6.010  1.00 0.00 ? 854 LEU A C    8  
ATOM 6925 O O    . LEU A 1 63 ? 4.563   6.999   -6.429  1.00 0.00 ? 854 LEU A O    8  
ATOM 6926 C CB   . LEU A 1 63 ? 7.433   5.944   -5.205  1.00 0.00 ? 854 LEU A CB   8  
ATOM 6927 C CG   . LEU A 1 63 ? 8.006   7.369   -5.189  1.00 0.00 ? 854 LEU A CG   8  
ATOM 6928 C CD1  . LEU A 1 63 ? 9.529   7.308   -5.331  1.00 0.00 ? 854 LEU A CD1  8  
ATOM 6929 C CD2  . LEU A 1 63 ? 7.420   8.173   -6.356  1.00 0.00 ? 854 LEU A CD2  8  
ATOM 6930 H H    . LEU A 1 63 ? 6.273   4.079   -3.903  1.00 0.00 ? 854 LEU A H    8  
ATOM 6931 H HA   . LEU A 1 63 ? 5.765   6.875   -4.224  1.00 0.00 ? 854 LEU A HA   8  
ATOM 6932 H HB2  . LEU A 1 63 ? 7.994   5.325   -4.522  1.00 0.00 ? 854 LEU A HB2  8  
ATOM 6933 H HB3  . LEU A 1 63 ? 7.515   5.540   -6.202  1.00 0.00 ? 854 LEU A HB3  8  
ATOM 6934 H HG   . LEU A 1 63 ? 7.756   7.848   -4.253  1.00 0.00 ? 854 LEU A HG   8  
ATOM 6935 H HD11 . LEU A 1 63 ? 9.931   8.310   -5.338  1.00 0.00 ? 854 LEU A HD11 8  
ATOM 6936 H HD12 . LEU A 1 63 ? 9.785   6.812   -6.257  1.00 0.00 ? 854 LEU A HD12 8  
ATOM 6937 H HD13 . LEU A 1 63 ? 9.948   6.757   -4.502  1.00 0.00 ? 854 LEU A HD13 8  
ATOM 6938 H HD21 . LEU A 1 63 ? 6.482   8.614   -6.053  1.00 0.00 ? 854 LEU A HD21 8  
ATOM 6939 H HD22 . LEU A 1 63 ? 7.254   7.520   -7.201  1.00 0.00 ? 854 LEU A HD22 8  
ATOM 6940 H HD23 . LEU A 1 63 ? 8.109   8.954   -6.638  1.00 0.00 ? 854 LEU A HD23 8  
ATOM 6941 N N    . GLU A 1 64 ? 4.840   4.770   -6.568  1.00 0.00 ? 855 GLU A N    8  
ATOM 6942 C CA   . GLU A 1 64 ? 3.974   4.636   -7.730  1.00 0.00 ? 855 GLU A CA   8  
ATOM 6943 C C    . GLU A 1 64 ? 2.633   5.272   -7.443  1.00 0.00 ? 855 GLU A C    8  
ATOM 6944 O O    . GLU A 1 64 ? 2.192   6.167   -8.167  1.00 0.00 ? 855 GLU A O    8  
ATOM 6945 C CB   . GLU A 1 64 ? 3.789   3.158   -8.115  1.00 0.00 ? 855 GLU A CB   8  
ATOM 6946 C CG   . GLU A 1 64 ? 4.947   2.698   -9.011  1.00 0.00 ? 855 GLU A CG   8  
ATOM 6947 C CD   . GLU A 1 64 ? 5.083   3.621   -10.209 1.00 0.00 ? 855 GLU A CD   8  
ATOM 6948 O OE1  . GLU A 1 64 ? 4.279   3.510   -11.106 1.00 0.00 ? 855 GLU A OE1  8  
ATOM 6949 O OE2  . GLU A 1 64 ? 5.983   4.435   -10.208 1.00 0.00 ? 855 GLU A OE2  8  
ATOM 6950 H H    . GLU A 1 64 ? 5.248   3.969   -6.173  1.00 0.00 ? 855 GLU A H    8  
ATOM 6951 H HA   . GLU A 1 64 ? 4.425   5.163   -8.553  1.00 0.00 ? 855 GLU A HA   8  
ATOM 6952 N N    . ILE A 1 65 ? 2.009   4.860   -6.350  1.00 0.00 ? 856 ILE A N    8  
ATOM 6953 C CA   . ILE A 1 65 ? 0.748   5.467   -5.954  1.00 0.00 ? 856 ILE A CA   8  
ATOM 6954 C C    . ILE A 1 65 ? 0.993   6.931   -5.615  1.00 0.00 ? 856 ILE A C    8  
ATOM 6955 O O    . ILE A 1 65 ? 0.158   7.797   -5.890  1.00 0.00 ? 856 ILE A O    8  
ATOM 6956 C CB   . ILE A 1 65 ? 0.107   4.739   -4.746  1.00 0.00 ? 856 ILE A CB   8  
ATOM 6957 C CG1  . ILE A 1 65 ? 1.069   3.687   -4.174  1.00 0.00 ? 856 ILE A CG1  8  
ATOM 6958 C CG2  . ILE A 1 65 ? -1.182  4.044   -5.188  1.00 0.00 ? 856 ILE A CG2  8  
ATOM 6959 C CD1  . ILE A 1 65 ? 0.438   3.034   -2.941  1.00 0.00 ? 856 ILE A CD1  8  
ATOM 6960 H H    . ILE A 1 65 ? 2.430   4.176   -5.786  1.00 0.00 ? 856 ILE A H    8  
ATOM 6961 H HA   . ILE A 1 65 ? 0.072   5.422   -6.795  1.00 0.00 ? 856 ILE A HA   8  
ATOM 6962 H HB   . ILE A 1 65 ? -0.133  5.467   -3.982  1.00 0.00 ? 856 ILE A HB   8  
ATOM 6963 H HG12 . ILE A 1 65 ? 1.259   2.927   -4.918  1.00 0.00 ? 856 ILE A HG12 8  
ATOM 6964 H HG21 . ILE A 1 65 ? -1.789  4.730   -5.759  1.00 0.00 ? 856 ILE A HG21 8  
ATOM 6965 H HG22 . ILE A 1 65 ? -1.730  3.720   -4.314  1.00 0.00 ? 856 ILE A HG22 8  
ATOM 6966 H HG23 . ILE A 1 65 ? -0.936  3.185   -5.795  1.00 0.00 ? 856 ILE A HG23 8  
ATOM 6967 H HD11 . ILE A 1 65 ? 0.528   3.699   -2.095  1.00 0.00 ? 856 ILE A HD11 8  
ATOM 6968 H HD12 . ILE A 1 65 ? 0.950   2.107   -2.728  1.00 0.00 ? 856 ILE A HD12 8  
ATOM 6969 H HD13 . ILE A 1 65 ? -0.606  2.831   -3.131  1.00 0.00 ? 856 ILE A HD13 8  
ATOM 6970 N N    . GLY A 1 66 ? 2.166   7.205   -5.059  1.00 0.00 ? 857 GLY A N    8  
ATOM 6971 C CA   . GLY A 1 66 ? 2.550   8.565   -4.715  1.00 0.00 ? 857 GLY A CA   8  
ATOM 6972 C C    . GLY A 1 66 ? 2.253   8.875   -3.259  1.00 0.00 ? 857 GLY A C    8  
ATOM 6973 O O    . GLY A 1 66 ? 1.762   9.953   -2.936  1.00 0.00 ? 857 GLY A O    8  
ATOM 6974 H H    . GLY A 1 66 ? 2.800   6.473   -4.899  1.00 0.00 ? 857 GLY A H    8  
ATOM 6975 H HA2  . GLY A 1 66 ? 3.608   8.689   -4.895  1.00 0.00 ? 857 GLY A HA2  8  
ATOM 6976 H HA3  . GLY A 1 66 ? 2.005   9.258   -5.338  1.00 0.00 ? 857 GLY A HA3  8  
ATOM 6977 N N    . ILE A 1 67 ? 2.568   7.936   -2.375  1.00 0.00 ? 858 ILE A N    8  
ATOM 6978 C CA   . ILE A 1 67 ? 2.348   8.150   -0.948  1.00 0.00 ? 858 ILE A CA   8  
ATOM 6979 C C    . ILE A 1 67 ? 3.156   9.361   -0.478  1.00 0.00 ? 858 ILE A C    8  
ATOM 6980 O O    . ILE A 1 67 ? 4.256   9.617   -0.984  1.00 0.00 ? 858 ILE A O    8  
ATOM 6981 C CB   . ILE A 1 67 ? 2.745   6.897   -0.148  1.00 0.00 ? 858 ILE A CB   8  
ATOM 6982 C CG1  . ILE A 1 67 ? 1.898   5.696   -0.617  1.00 0.00 ? 858 ILE A CG1  8  
ATOM 6983 C CG2  . ILE A 1 67 ? 2.509   7.134   1.351   1.00 0.00 ? 858 ILE A CG2  8  
ATOM 6984 C CD1  . ILE A 1 67 ? 0.485   5.790   -0.025  1.00 0.00 ? 858 ILE A CD1  8  
ATOM 6985 H H    . ILE A 1 67 ? 2.973   7.096   -2.684  1.00 0.00 ? 858 ILE A H    8  
ATOM 6986 H HA   . ILE A 1 67 ? 1.298   8.352   -0.788  1.00 0.00 ? 858 ILE A HA   8  
ATOM 6987 H HB   . ILE A 1 67 ? 3.792   6.688   -0.314  1.00 0.00 ? 858 ILE A HB   8  
ATOM 6988 H HG12 . ILE A 1 67 ? 1.835   5.694   -1.694  1.00 0.00 ? 858 ILE A HG12 8  
ATOM 6989 H HG21 . ILE A 1 67 ? 3.276   7.786   1.742   1.00 0.00 ? 858 ILE A HG21 8  
ATOM 6990 H HG22 . ILE A 1 67 ? 2.540   6.190   1.873   1.00 0.00 ? 858 ILE A HG22 8  
ATOM 6991 H HG23 . ILE A 1 67 ? 1.540   7.589   1.498   1.00 0.00 ? 858 ILE A HG23 8  
ATOM 6992 H HD11 . ILE A 1 67 ? 0.537   5.704   1.051   1.00 0.00 ? 858 ILE A HD11 8  
ATOM 6993 H HD12 . ILE A 1 67 ? -0.125  4.990   -0.418  1.00 0.00 ? 858 ILE A HD12 8  
ATOM 6994 H HD13 . ILE A 1 67 ? 0.044   6.740   -0.287  1.00 0.00 ? 858 ILE A HD13 8  
ATOM 6995 N N    . LEU A 1 68 ? 2.603   10.115  0.465   1.00 0.00 ? 859 LEU A N    8  
ATOM 6996 C CA   . LEU A 1 68 ? 3.270   11.311  0.970   1.00 0.00 ? 859 LEU A CA   8  
ATOM 6997 C C    . LEU A 1 68 ? 4.043   11.012  2.250   1.00 0.00 ? 859 LEU A C    8  
ATOM 6998 O O    . LEU A 1 68 ? 5.276   10.972  2.251   1.00 0.00 ? 859 LEU A O    8  
ATOM 6999 C CB   . LEU A 1 68 ? 2.243   12.428  1.228   1.00 0.00 ? 859 LEU A CB   8  
ATOM 7000 C CG   . LEU A 1 68 ? 1.261   12.522  0.048   1.00 0.00 ? 859 LEU A CG   8  
ATOM 7001 C CD1  . LEU A 1 68 ? 0.190   13.570  0.353   1.00 0.00 ? 859 LEU A CD1  8  
ATOM 7002 C CD2  . LEU A 1 68 ? 2.018   12.927  -1.222  1.00 0.00 ? 859 LEU A CD2  8  
ATOM 7003 H H    . LEU A 1 68 ? 1.722   9.876   0.821   1.00 0.00 ? 859 LEU A H    8  
ATOM 7004 H HA   . LEU A 1 68 ? 3.969   11.660  0.223   1.00 0.00 ? 859 LEU A HA   8  
ATOM 7005 H HB2  . LEU A 1 68 ? 1.698   12.213  2.136   1.00 0.00 ? 859 LEU A HB2  8  
ATOM 7006 H HB3  . LEU A 1 68 ? 2.761   13.370  1.339   1.00 0.00 ? 859 LEU A HB3  8  
ATOM 7007 H HG   . LEU A 1 68 ? 0.784   11.564  -0.102  1.00 0.00 ? 859 LEU A HG   8  
ATOM 7008 H HD11 . LEU A 1 68 ? 0.622   14.376  0.926   1.00 0.00 ? 859 LEU A HD11 8  
ATOM 7009 H HD12 . LEU A 1 68 ? -0.608  13.112  0.917   1.00 0.00 ? 859 LEU A HD12 8  
ATOM 7010 H HD13 . LEU A 1 68 ? -0.205  13.959  -0.574  1.00 0.00 ? 859 LEU A HD13 8  
ATOM 7011 H HD21 . LEU A 1 68 ? 2.464   12.051  -1.670  1.00 0.00 ? 859 LEU A HD21 8  
ATOM 7012 H HD22 . LEU A 1 68 ? 2.789   13.640  -0.972  1.00 0.00 ? 859 LEU A HD22 8  
ATOM 7013 H HD23 . LEU A 1 68 ? 1.329   13.375  -1.924  1.00 0.00 ? 859 LEU A HD23 8  
ATOM 7014 N N    . ASN A 1 69 ? 3.316   10.825  3.340   1.00 0.00 ? 860 ASN A N    8  
ATOM 7015 C CA   . ASN A 1 69 ? 3.936   10.561  4.632   1.00 0.00 ? 860 ASN A CA   8  
ATOM 7016 C C    . ASN A 1 69 ? 4.716   9.259   4.613   1.00 0.00 ? 860 ASN A C    8  
ATOM 7017 O O    . ASN A 1 69 ? 4.159   8.188   4.360   1.00 0.00 ? 860 ASN A O    8  
ATOM 7018 C CB   . ASN A 1 69 ? 2.885   10.515  5.737   1.00 0.00 ? 860 ASN A CB   8  
ATOM 7019 C CG   . ASN A 1 69 ? 3.553   10.175  7.062   1.00 0.00 ? 860 ASN A CG   8  
ATOM 7020 O OD1  . ASN A 1 69 ? 3.507   9.026   7.502   1.00 0.00 ? 860 ASN A OD1  8  
ATOM 7021 N ND2  . ASN A 1 69 ? 4.185   11.095  7.719   1.00 0.00 ? 860 ASN A ND2  8  
ATOM 7022 H H    . ASN A 1 69 ? 2.340   10.882  3.277   1.00 0.00 ? 860 ASN A H    8  
ATOM 7023 H HA   . ASN A 1 69 ? 4.619   11.368  4.849   1.00 0.00 ? 860 ASN A HA   8  
ATOM 7024 H HB2  . ASN A 1 69 ? 2.401   11.478  5.811   1.00 0.00 ? 860 ASN A HB2  8  
ATOM 7025 H HB3  . ASN A 1 69 ? 2.148   9.760   5.504   1.00 0.00 ? 860 ASN A HB3  8  
ATOM 7026 H HD21 . ASN A 1 69 ? 4.236   12.008  7.363   1.00 0.00 ? 860 ASN A HD21 8  
ATOM 7027 H HD22 . ASN A 1 69 ? 4.613   10.882  8.575   1.00 0.00 ? 860 ASN A HD22 8  
ATOM 7028 N N    . SER A 1 70 ? 6.001   9.354   4.896   1.00 0.00 ? 861 SER A N    8  
ATOM 7029 C CA   . SER A 1 70 ? 6.859   8.187   4.919   1.00 0.00 ? 861 SER A CA   8  
ATOM 7030 C C    . SER A 1 70 ? 6.524   7.285   6.100   1.00 0.00 ? 861 SER A C    8  
ATOM 7031 O O    . SER A 1 70 ? 6.631   6.064   6.005   1.00 0.00 ? 861 SER A O    8  
ATOM 7032 C CB   . SER A 1 70 ? 8.317   8.613   4.971   1.00 0.00 ? 861 SER A CB   8  
ATOM 7033 O OG   . SER A 1 70 ? 8.584   9.472   3.860   1.00 0.00 ? 861 SER A OG   8  
ATOM 7034 H H    . SER A 1 70 ? 6.382   10.232  5.102   1.00 0.00 ? 861 SER A H    8  
ATOM 7035 H HA   . SER A 1 70 ? 6.698   7.632   4.010   1.00 0.00 ? 861 SER A HA   8  
ATOM 7036 H HB2  . SER A 1 70 ? 8.511   9.146   5.887   1.00 0.00 ? 861 SER A HB2  8  
ATOM 7037 H HB3  . SER A 1 70 ? 8.947   7.735   4.934   1.00 0.00 ? 861 SER A HB3  8  
ATOM 7038 H HG   . SER A 1 70 ? 9.539   9.444   3.697   1.00 0.00 ? 861 SER A HG   8  
ATOM 7039 N N    . GLY A 1 71 ? 6.084   7.881   7.198   1.00 0.00 ? 862 GLY A N    8  
ATOM 7040 C CA   . GLY A 1 71 ? 5.701   7.101   8.365   1.00 0.00 ? 862 GLY A CA   8  
ATOM 7041 C C    . GLY A 1 71 ? 4.646   6.087   7.974   1.00 0.00 ? 862 GLY A C    8  
ATOM 7042 O O    . GLY A 1 71 ? 4.815   4.880   8.174   1.00 0.00 ? 862 GLY A O    8  
ATOM 7043 H H    . GLY A 1 71 ? 5.987   8.856   7.215   1.00 0.00 ? 862 GLY A H    8  
ATOM 7044 H HA2  . GLY A 1 71 ? 6.570   6.590   8.753   1.00 0.00 ? 862 GLY A HA2  8  
ATOM 7045 H HA3  . GLY A 1 71 ? 5.299   7.756   9.122   1.00 0.00 ? 862 GLY A HA3  8  
ATOM 7046 N N    . HIS A 1 72 ? 3.593   6.572   7.337   1.00 0.00 ? 863 HIS A N    8  
ATOM 7047 C CA   . HIS A 1 72 ? 2.552   5.698   6.841   1.00 0.00 ? 863 HIS A CA   8  
ATOM 7048 C C    . HIS A 1 72 ? 3.144   4.780   5.789   1.00 0.00 ? 863 HIS A C    8  
ATOM 7049 O O    . HIS A 1 72 ? 2.911   3.571   5.798   1.00 0.00 ? 863 HIS A O    8  
ATOM 7050 C CB   . HIS A 1 72 ? 1.403   6.516   6.240   1.00 0.00 ? 863 HIS A CB   8  
ATOM 7051 C CG   . HIS A 1 72 ? 0.697   7.275   7.335   1.00 0.00 ? 863 HIS A CG   8  
ATOM 7052 N ND1  . HIS A 1 72 ? 1.350   8.209   8.128   1.00 0.00 ? 863 HIS A ND1  8  
ATOM 7053 C CD2  . HIS A 1 72 ? -0.599  7.244   7.786   1.00 0.00 ? 863 HIS A CD2  8  
ATOM 7054 C CE1  . HIS A 1 72 ? 0.451   8.694   9.004   1.00 0.00 ? 863 HIS A CE1  8  
ATOM 7055 N NE2  . HIS A 1 72 ? -0.752  8.138   8.840   1.00 0.00 ? 863 HIS A NE2  8  
ATOM 7056 H H    . HIS A 1 72 ? 3.545   7.537   7.157   1.00 0.00 ? 863 HIS A H    8  
ATOM 7057 H HA   . HIS A 1 72 ? 2.174   5.102   7.658   1.00 0.00 ? 863 HIS A HA   8  
ATOM 7058 H HB2  . HIS A 1 72 ? 1.792   7.206   5.508   1.00 0.00 ? 863 HIS A HB2  8  
ATOM 7059 H HB3  . HIS A 1 72 ? 0.704   5.846   5.761   1.00 0.00 ? 863 HIS A HB3  8  
ATOM 7060 N N    . ARG A 1 73 ? 3.963   5.359   4.916   1.00 0.00 ? 864 ARG A N    8  
ATOM 7061 C CA   . ARG A 1 73 ? 4.645   4.593   3.890   1.00 0.00 ? 864 ARG A CA   8  
ATOM 7062 C C    . ARG A 1 73 ? 5.360   3.407   4.524   1.00 0.00 ? 864 ARG A C    8  
ATOM 7063 O O    . ARG A 1 73 ? 5.140   2.257   4.141   1.00 0.00 ? 864 ARG A O    8  
ATOM 7064 C CB   . ARG A 1 73 ? 5.661   5.485   3.165   1.00 0.00 ? 864 ARG A CB   8  
ATOM 7065 C CG   . ARG A 1 73 ? 6.131   4.796   1.890   1.00 0.00 ? 864 ARG A CG   8  
ATOM 7066 C CD   . ARG A 1 73 ? 6.685   5.832   0.904   1.00 0.00 ? 864 ARG A CD   8  
ATOM 7067 N NE   . ARG A 1 73 ? 7.165   7.026   1.612   1.00 0.00 ? 864 ARG A NE   8  
ATOM 7068 C CZ   . ARG A 1 73 ? 6.826   8.261   1.221   1.00 0.00 ? 864 ARG A CZ   8  
ATOM 7069 N NH1  . ARG A 1 73 ? 6.129   8.430   0.128   1.00 0.00 ? 864 ARG A NH1  8  
ATOM 7070 N NH2  . ARG A 1 73 ? 7.224   9.300   1.908   1.00 0.00 ? 864 ARG A NH2  8  
ATOM 7071 H H    . ARG A 1 73 ? 4.137   6.321   4.985   1.00 0.00 ? 864 ARG A H    8  
ATOM 7072 H HA   . ARG A 1 73 ? 3.919   4.234   3.177   1.00 0.00 ? 864 ARG A HA   8  
ATOM 7073 N N    . GLN A 1 74 ? 6.196   3.698   5.511   1.00 0.00 ? 865 GLN A N    8  
ATOM 7074 C CA   . GLN A 1 74 ? 6.927   2.661   6.221   1.00 0.00 ? 865 GLN A CA   8  
ATOM 7075 C C    . GLN A 1 74 ? 5.966   1.609   6.753   1.00 0.00 ? 865 GLN A C    8  
ATOM 7076 O O    . GLN A 1 74 ? 6.221   0.405   6.636   1.00 0.00 ? 865 GLN A O    8  
ATOM 7077 C CB   . GLN A 1 74 ? 7.730   3.271   7.375   1.00 0.00 ? 865 GLN A CB   8  
ATOM 7078 C CG   . GLN A 1 74 ? 8.971   3.981   6.817   1.00 0.00 ? 865 GLN A CG   8  
ATOM 7079 C CD   . GLN A 1 74 ? 9.400   5.103   7.754   1.00 0.00 ? 865 GLN A CD   8  
ATOM 7080 O OE1  . GLN A 1 74 ? 9.113   5.055   8.956   1.00 0.00 ? 865 GLN A OE1  8  
ATOM 7081 N NE2  . GLN A 1 74 ? 10.072  6.109   7.283   1.00 0.00 ? 865 GLN A NE2  8  
ATOM 7082 H H    . GLN A 1 74 ? 6.312   4.636   5.777   1.00 0.00 ? 865 GLN A H    8  
ATOM 7083 H HA   . GLN A 1 74 ? 7.613   2.186   5.534   1.00 0.00 ? 865 GLN A HA   8  
ATOM 7084 H HB2  . GLN A 1 74 ? 7.113   3.982   7.907   1.00 0.00 ? 865 GLN A HB2  8  
ATOM 7085 H HB3  . GLN A 1 74 ? 8.042   2.490   8.051   1.00 0.00 ? 865 GLN A HB3  8  
ATOM 7086 H HG2  . GLN A 1 74 ? 9.777   3.269   6.720   1.00 0.00 ? 865 GLN A HG2  8  
ATOM 7087 H HG3  . GLN A 1 74 ? 8.742   4.397   5.846   1.00 0.00 ? 865 GLN A HG3  8  
ATOM 7088 H HE21 . GLN A 1 74 ? 10.303  6.146   6.331   1.00 0.00 ? 865 GLN A HE21 8  
ATOM 7089 H HE22 . GLN A 1 74 ? 10.347  6.836   7.881   1.00 0.00 ? 865 GLN A HE22 8  
ATOM 7090 N N    . ARG A 1 75 ? 4.847   2.061   7.316   1.00 0.00 ? 866 ARG A N    8  
ATOM 7091 C CA   . ARG A 1 75 ? 3.839   1.140   7.831   1.00 0.00 ? 866 ARG A CA   8  
ATOM 7092 C C    . ARG A 1 75 ? 3.299   0.278   6.694   1.00 0.00 ? 866 ARG A C    8  
ATOM 7093 O O    . ARG A 1 75 ? 3.208   -0.944  6.815   1.00 0.00 ? 866 ARG A O    8  
ATOM 7094 C CB   . ARG A 1 75 ? 2.689   1.909   8.495   1.00 0.00 ? 866 ARG A CB   8  
ATOM 7095 C CG   . ARG A 1 75 ? 3.152   2.491   9.837   1.00 0.00 ? 866 ARG A CG   8  
ATOM 7096 C CD   . ARG A 1 75 ? 2.939   1.458   10.952  1.00 0.00 ? 866 ARG A CD   8  
ATOM 7097 N NE   . ARG A 1 75 ? 1.540   1.018   10.994  1.00 0.00 ? 866 ARG A NE   8  
ATOM 7098 C CZ   . ARG A 1 75 ? 1.184   -0.113  11.613  1.00 0.00 ? 866 ARG A CZ   8  
ATOM 7099 N NH1  . ARG A 1 75 ? 2.091   -0.867  12.164  1.00 0.00 ? 866 ARG A NH1  8  
ATOM 7100 N NH2  . ARG A 1 75 ? -0.068  -0.463  11.658  1.00 0.00 ? 866 ARG A NH2  8  
ATOM 7101 H H    . ARG A 1 75 ? 4.689   3.031   7.367   1.00 0.00 ? 866 ARG A H    8  
ATOM 7102 H HA   . ARG A 1 75 ? 4.299   0.496   8.565   1.00 0.00 ? 866 ARG A HA   8  
ATOM 7103 N N    . ILE A 1 76 ? 2.979   0.916   5.579   1.00 0.00 ? 867 ILE A N    8  
ATOM 7104 C CA   . ILE A 1 76 ? 2.495   0.192   4.414   1.00 0.00 ? 867 ILE A CA   8  
ATOM 7105 C C    . ILE A 1 76 ? 3.586   -0.751  3.908   1.00 0.00 ? 867 ILE A C    8  
ATOM 7106 O O    . ILE A 1 76 ? 3.321   -1.909  3.574   1.00 0.00 ? 867 ILE A O    8  
ATOM 7107 C CB   . ILE A 1 76 ? 2.096   1.177   3.299   1.00 0.00 ? 867 ILE A CB   8  
ATOM 7108 C CG1  . ILE A 1 76 ? 1.114   2.235   3.857   1.00 0.00 ? 867 ILE A CG1  8  
ATOM 7109 C CG2  . ILE A 1 76 ? 1.435   0.413   2.141   1.00 0.00 ? 867 ILE A CG2  8  
ATOM 7110 C CD1  . ILE A 1 76 ? -0.332  1.871   3.495   1.00 0.00 ? 867 ILE A CD1  8  
ATOM 7111 H H    . ILE A 1 76 ? 3.098   1.890   5.529   1.00 0.00 ? 867 ILE A H    8  
ATOM 7112 H HA   . ILE A 1 76 ? 1.631   -0.390  4.698   1.00 0.00 ? 867 ILE A HA   8  
ATOM 7113 H HB   . ILE A 1 76 ? 2.987   1.667   2.933   1.00 0.00 ? 867 ILE A HB   8  
ATOM 7114 H HG12 . ILE A 1 76 ? 1.207   2.281   4.931   1.00 0.00 ? 867 ILE A HG12 8  
ATOM 7115 H HG21 . ILE A 1 76 ? 0.569   -0.114  2.507   1.00 0.00 ? 867 ILE A HG21 8  
ATOM 7116 H HG22 . ILE A 1 76 ? 2.136   -0.294  1.723   1.00 0.00 ? 867 ILE A HG22 8  
ATOM 7117 H HG23 . ILE A 1 76 ? 1.132   1.112   1.376   1.00 0.00 ? 867 ILE A HG23 8  
ATOM 7118 H HD11 . ILE A 1 76 ? -0.496  2.054   2.444   1.00 0.00 ? 867 ILE A HD11 8  
ATOM 7119 H HD12 . ILE A 1 76 ? -1.012  2.476   4.077   1.00 0.00 ? 867 ILE A HD12 8  
ATOM 7120 H HD13 . ILE A 1 76 ? -0.507  0.828   3.710   1.00 0.00 ? 867 ILE A HD13 8  
ATOM 7121 N N    . LEU A 1 77 ? 4.813   -0.244  3.858   1.00 0.00 ? 868 LEU A N    8  
ATOM 7122 C CA   . LEU A 1 77 ? 5.947   -1.030  3.388   1.00 0.00 ? 868 LEU A CA   8  
ATOM 7123 C C    . LEU A 1 77 ? 6.061   -2.325  4.172   1.00 0.00 ? 868 LEU A C    8  
ATOM 7124 O O    . LEU A 1 77 ? 6.066   -3.416  3.597   1.00 0.00 ? 868 LEU A O    8  
ATOM 7125 C CB   . LEU A 1 77 ? 7.248   -0.222  3.521   1.00 0.00 ? 868 LEU A CB   8  
ATOM 7126 C CG   . LEU A 1 77 ? 8.447   -1.068  3.059   1.00 0.00 ? 868 LEU A CG   8  
ATOM 7127 C CD1  . LEU A 1 77 ? 8.226   -1.552  1.623   1.00 0.00 ? 868 LEU A CD1  8  
ATOM 7128 C CD2  . LEU A 1 77 ? 9.720   -0.219  3.115   1.00 0.00 ? 868 LEU A CD2  8  
ATOM 7129 H H    . LEU A 1 77 ? 4.953   0.688   4.137   1.00 0.00 ? 868 LEU A H    8  
ATOM 7130 H HA   . LEU A 1 77 ? 5.794   -1.265  2.349   1.00 0.00 ? 868 LEU A HA   8  
ATOM 7131 H HB2  . LEU A 1 77 ? 7.176   0.670   2.916   1.00 0.00 ? 868 LEU A HB2  8  
ATOM 7132 H HB3  . LEU A 1 77 ? 7.388   0.059   4.555   1.00 0.00 ? 868 LEU A HB3  8  
ATOM 7133 H HG   . LEU A 1 77 ? 8.556   -1.923  3.711   1.00 0.00 ? 868 LEU A HG   8  
ATOM 7134 H HD11 . LEU A 1 77 ? 7.525   -2.374  1.623   1.00 0.00 ? 868 LEU A HD11 8  
ATOM 7135 H HD12 . LEU A 1 77 ? 9.167   -1.886  1.209   1.00 0.00 ? 868 LEU A HD12 8  
ATOM 7136 H HD13 . LEU A 1 77 ? 7.836   -0.744  1.021   1.00 0.00 ? 868 LEU A HD13 8  
ATOM 7137 H HD21 . LEU A 1 77 ? 10.568  -0.825  2.829   1.00 0.00 ? 868 LEU A HD21 8  
ATOM 7138 H HD22 . LEU A 1 77 ? 9.865   0.148   4.120   1.00 0.00 ? 868 LEU A HD22 8  
ATOM 7139 H HD23 . LEU A 1 77 ? 9.631   0.616   2.435   1.00 0.00 ? 868 LEU A HD23 8  
ATOM 7140 N N    . GLN A 1 78 ? 6.132   -2.213  5.486   1.00 0.00 ? 869 GLN A N    8  
ATOM 7141 C CA   . GLN A 1 78 ? 6.226   -3.399  6.320   1.00 0.00 ? 869 GLN A CA   8  
ATOM 7142 C C    . GLN A 1 78 ? 5.004   -4.276  6.117   1.00 0.00 ? 869 GLN A C    8  
ATOM 7143 O O    . GLN A 1 78 ? 5.105   -5.500  6.074   1.00 0.00 ? 869 GLN A O    8  
ATOM 7144 C CB   . GLN A 1 78 ? 6.375   -3.029  7.806   1.00 0.00 ? 869 GLN A CB   8  
ATOM 7145 C CG   . GLN A 1 78 ? 5.199   -2.160  8.255   1.00 0.00 ? 869 GLN A CG   8  
ATOM 7146 C CD   . GLN A 1 78 ? 5.270   -1.916  9.753   1.00 0.00 ? 869 GLN A CD   8  
ATOM 7147 O OE1  . GLN A 1 78 ? 4.637   -2.631  10.527  1.00 0.00 ? 869 GLN A OE1  8  
ATOM 7148 N NE2  . GLN A 1 78 ? 6.007   -0.953  10.211  1.00 0.00 ? 869 GLN A NE2  8  
ATOM 7149 H H    . GLN A 1 78 ? 6.106   -1.321  5.893   1.00 0.00 ? 869 GLN A H    8  
ATOM 7150 H HA   . GLN A 1 78 ? 7.099   -3.959  6.015   1.00 0.00 ? 869 GLN A HA   8  
ATOM 7151 H HB2  . GLN A 1 78 ? 6.396   -3.933  8.398   1.00 0.00 ? 869 GLN A HB2  8  
ATOM 7152 H HB3  . GLN A 1 78 ? 7.297   -2.487  7.952   1.00 0.00 ? 869 GLN A HB3  8  
ATOM 7153 H HG2  . GLN A 1 78 ? 5.234   -1.216  7.738   1.00 0.00 ? 869 GLN A HG2  8  
ATOM 7154 H HG3  . GLN A 1 78 ? 4.270   -2.660  8.025   1.00 0.00 ? 869 GLN A HG3  8  
ATOM 7155 H HE21 . GLN A 1 78 ? 6.515   -0.385  9.596   1.00 0.00 ? 869 GLN A HE21 8  
ATOM 7156 H HE22 . GLN A 1 78 ? 6.057   -0.793  11.178  1.00 0.00 ? 869 GLN A HE22 8  
ATOM 7157 N N    . ALA A 1 79 ? 3.847   -3.641  5.978   1.00 0.00 ? 870 ALA A N    8  
ATOM 7158 C CA   . ALA A 1 79 ? 2.610   -4.376  5.783   1.00 0.00 ? 870 ALA A CA   8  
ATOM 7159 C C    . ALA A 1 79 ? 2.681   -5.227  4.524   1.00 0.00 ? 870 ALA A C    8  
ATOM 7160 O O    . ALA A 1 79 ? 2.409   -6.429  4.567   1.00 0.00 ? 870 ALA A O    8  
ATOM 7161 C CB   . ALA A 1 79 ? 1.427   -3.414  5.701   1.00 0.00 ? 870 ALA A CB   8  
ATOM 7162 H H    . ALA A 1 79 ? 3.827   -2.660  6.013   1.00 0.00 ? 870 ALA A H    8  
ATOM 7163 H HA   . ALA A 1 79 ? 2.461   -5.028  6.631   1.00 0.00 ? 870 ALA A HA   8  
ATOM 7164 H HB1  . ALA A 1 79 ? 1.500   -2.824  4.799   1.00 0.00 ? 870 ALA A HB1  8  
ATOM 7165 H HB2  . ALA A 1 79 ? 1.436   -2.758  6.560   1.00 0.00 ? 870 ALA A HB2  8  
ATOM 7166 H HB3  . ALA A 1 79 ? 0.506   -3.979  5.689   1.00 0.00 ? 870 ALA A HB3  8  
ATOM 7167 N N    . ILE A 1 80 ? 3.091   -4.624  3.407   1.00 0.00 ? 871 ILE A N    8  
ATOM 7168 C CA   . ILE A 1 80 ? 3.217   -5.383  2.178   1.00 0.00 ? 871 ILE A CA   8  
ATOM 7169 C C    . ILE A 1 80 ? 4.313   -6.429  2.322   1.00 0.00 ? 871 ILE A C    8  
ATOM 7170 O O    . ILE A 1 80 ? 4.173   -7.558  1.850   1.00 0.00 ? 871 ILE A O    8  
ATOM 7171 C CB   . ILE A 1 80 ? 3.468   -4.473  0.962   1.00 0.00 ? 871 ILE A CB   8  
ATOM 7172 C CG1  . ILE A 1 80 ? 4.803   -3.740  1.092   1.00 0.00 ? 871 ILE A CG1  8  
ATOM 7173 C CG2  . ILE A 1 80 ? 2.345   -3.446  0.838   1.00 0.00 ? 871 ILE A CG2  8  
ATOM 7174 C CD1  . ILE A 1 80 ? 5.230   -3.235  -0.291  1.00 0.00 ? 871 ILE A CD1  8  
ATOM 7175 H H    . ILE A 1 80 ? 3.330   -3.672  3.418   1.00 0.00 ? 871 ILE A H    8  
ATOM 7176 H HA   . ILE A 1 80 ? 2.285   -5.907  2.025   1.00 0.00 ? 871 ILE A HA   8  
ATOM 7177 H HB   . ILE A 1 80 ? 3.474   -5.084  0.076   1.00 0.00 ? 871 ILE A HB   8  
ATOM 7178 H HG12 . ILE A 1 80 ? 4.684   -2.901  1.759   1.00 0.00 ? 871 ILE A HG12 8  
ATOM 7179 H HG21 . ILE A 1 80 ? 2.379   -2.999  -0.145  1.00 0.00 ? 871 ILE A HG21 8  
ATOM 7180 H HG22 . ILE A 1 80 ? 2.479   -2.678  1.583   1.00 0.00 ? 871 ILE A HG22 8  
ATOM 7181 H HG23 . ILE A 1 80 ? 1.391   -3.930  0.980   1.00 0.00 ? 871 ILE A HG23 8  
ATOM 7182 H HD11 . ILE A 1 80 ? 6.211   -2.792  -0.227  1.00 0.00 ? 871 ILE A HD11 8  
ATOM 7183 H HD12 . ILE A 1 80 ? 4.523   -2.497  -0.637  1.00 0.00 ? 871 ILE A HD12 8  
ATOM 7184 H HD13 . ILE A 1 80 ? 5.251   -4.062  -0.989  1.00 0.00 ? 871 ILE A HD13 8  
ATOM 7185 N N    . GLN A 1 81 ? 5.384   -6.067  3.025   1.00 0.00 ? 872 GLN A N    8  
ATOM 7186 C CA   . GLN A 1 81 ? 6.462   -7.008  3.280   1.00 0.00 ? 872 GLN A CA   8  
ATOM 7187 C C    . GLN A 1 81 ? 5.930   -8.183  4.089   1.00 0.00 ? 872 GLN A C    8  
ATOM 7188 O O    . GLN A 1 81 ? 6.314   -9.330  3.864   1.00 0.00 ? 872 GLN A O    8  
ATOM 7189 C CB   . GLN A 1 81 ? 7.604   -6.324  4.044   1.00 0.00 ? 872 GLN A CB   8  
ATOM 7190 C CG   . GLN A 1 81 ? 8.358   -5.366  3.111   1.00 0.00 ? 872 GLN A CG   8  
ATOM 7191 C CD   . GLN A 1 81 ? 9.340   -4.511  3.911   1.00 0.00 ? 872 GLN A CD   8  
ATOM 7192 O OE1  . GLN A 1 81 ? 9.209   -4.388  5.133   1.00 0.00 ? 872 GLN A OE1  8  
ATOM 7193 N NE2  . GLN A 1 81 ? 10.319  -3.916  3.302   1.00 0.00 ? 872 GLN A NE2  8  
ATOM 7194 H H    . GLN A 1 81 ? 5.428   -5.163  3.408   1.00 0.00 ? 872 GLN A H    8  
ATOM 7195 H HA   . GLN A 1 81 ? 6.839   -7.373  2.337   1.00 0.00 ? 872 GLN A HA   8  
ATOM 7196 H HB2  . GLN A 1 81 ? 7.199   -5.773  4.880   1.00 0.00 ? 872 GLN A HB2  8  
ATOM 7197 H HB3  . GLN A 1 81 ? 8.290   -7.074  4.412   1.00 0.00 ? 872 GLN A HB3  8  
ATOM 7198 H HG2  . GLN A 1 81 ? 8.900   -5.942  2.375   1.00 0.00 ? 872 GLN A HG2  8  
ATOM 7199 H HG3  . GLN A 1 81 ? 7.651   -4.721  2.608   1.00 0.00 ? 872 GLN A HG3  8  
ATOM 7200 H HE21 . GLN A 1 81 ? 10.430  -4.013  2.332   1.00 0.00 ? 872 GLN A HE21 8  
ATOM 7201 H HE22 . GLN A 1 81 ? 10.952  -3.366  3.811   1.00 0.00 ? 872 GLN A HE22 8  
ATOM 7202 N N    . LEU A 1 82 ? 5.033   -7.887  5.022   1.00 0.00 ? 873 LEU A N    8  
ATOM 7203 C CA   . LEU A 1 82 ? 4.431   -8.915  5.864   1.00 0.00 ? 873 LEU A CA   8  
ATOM 7204 C C    . LEU A 1 82 ? 3.388   -9.717  5.087   1.00 0.00 ? 873 LEU A C    8  
ATOM 7205 O O    . LEU A 1 82 ? 3.233   -10.922 5.302   1.00 0.00 ? 873 LEU A O    8  
ATOM 7206 C CB   . LEU A 1 82 ? 3.779   -8.273  7.093   1.00 0.00 ? 873 LEU A CB   8  
ATOM 7207 C CG   . LEU A 1 82 ? 4.708   -8.400  8.314   1.00 0.00 ? 873 LEU A CG   8  
ATOM 7208 C CD1  . LEU A 1 82 ? 6.145   -8.016  7.935   1.00 0.00 ? 873 LEU A CD1  8  
ATOM 7209 C CD2  . LEU A 1 82 ? 4.215   -7.469  9.418   1.00 0.00 ? 873 LEU A CD2  8  
ATOM 7210 H H    . LEU A 1 82 ? 4.770   -6.950  5.151   1.00 0.00 ? 873 LEU A H    8  
ATOM 7211 H HA   . LEU A 1 82 ? 5.205   -9.589  6.200   1.00 0.00 ? 873 LEU A HA   8  
ATOM 7212 H HB2  . LEU A 1 82 ? 3.584   -7.228  6.892   1.00 0.00 ? 873 LEU A HB2  8  
ATOM 7213 H HB3  . LEU A 1 82 ? 2.845   -8.773  7.305   1.00 0.00 ? 873 LEU A HB3  8  
ATOM 7214 H HG   . LEU A 1 82 ? 4.694   -9.420  8.669   1.00 0.00 ? 873 LEU A HG   8  
ATOM 7215 H HD11 . LEU A 1 82 ? 6.683   -7.725  8.826   1.00 0.00 ? 873 LEU A HD11 8  
ATOM 7216 H HD12 . LEU A 1 82 ? 6.131   -7.189  7.243   1.00 0.00 ? 873 LEU A HD12 8  
ATOM 7217 H HD13 . LEU A 1 82 ? 6.639   -8.861  7.480   1.00 0.00 ? 873 LEU A HD13 8  
ATOM 7218 H HD21 . LEU A 1 82 ? 3.265   -7.822  9.791   1.00 0.00 ? 873 LEU A HD21 8  
ATOM 7219 H HD22 . LEU A 1 82 ? 4.100   -6.472  9.019   1.00 0.00 ? 873 LEU A HD22 8  
ATOM 7220 H HD23 . LEU A 1 82 ? 4.935   -7.454  10.222  1.00 0.00 ? 873 LEU A HD23 8  
ATOM 7221 N N    . LEU A 1 83 ? 2.656   -9.043  4.208   1.00 0.00 ? 874 LEU A N    8  
ATOM 7222 C CA   . LEU A 1 83 ? 1.607   -9.704  3.420   1.00 0.00 ? 874 LEU A CA   8  
ATOM 7223 C C    . LEU A 1 83 ? 2.123   -10.998 2.784   1.00 0.00 ? 874 LEU A C    8  
ATOM 7224 O O    . LEU A 1 83 ? 3.268   -11.057 2.323   1.00 0.00 ? 874 LEU A O    8  
ATOM 7225 C CB   . LEU A 1 83 ? 1.099   -8.768  2.316   1.00 0.00 ? 874 LEU A CB   8  
ATOM 7226 C CG   . LEU A 1 83 ? 0.032   -7.821  2.876   1.00 0.00 ? 874 LEU A CG   8  
ATOM 7227 C CD1  . LEU A 1 83 ? -0.282  -6.738  1.846   1.00 0.00 ? 874 LEU A CD1  8  
ATOM 7228 C CD2  . LEU A 1 83 ? -1.249  -8.607  3.185   1.00 0.00 ? 874 LEU A CD2  8  
ATOM 7229 H H    . LEU A 1 83 ? 2.805   -8.079  4.100   1.00 0.00 ? 874 LEU A H    8  
ATOM 7230 H HA   . LEU A 1 83 ? 0.786   -9.939  4.079   1.00 0.00 ? 874 LEU A HA   8  
ATOM 7231 H HB2  . LEU A 1 83 ? 1.927   -8.194  1.928   1.00 0.00 ? 874 LEU A HB2  8  
ATOM 7232 H HB3  . LEU A 1 83 ? 0.672   -9.359  1.519   1.00 0.00 ? 874 LEU A HB3  8  
ATOM 7233 H HG   . LEU A 1 83 ? 0.401   -7.357  3.779   1.00 0.00 ? 874 LEU A HG   8  
ATOM 7234 H HD11 . LEU A 1 83 ? -1.322  -6.466  1.927   1.00 0.00 ? 874 LEU A HD11 8  
ATOM 7235 H HD12 . LEU A 1 83 ? -0.083  -7.109  0.851   1.00 0.00 ? 874 LEU A HD12 8  
ATOM 7236 H HD13 . LEU A 1 83 ? 0.328   -5.870  2.032   1.00 0.00 ? 874 LEU A HD13 8  
ATOM 7237 H HD21 . LEU A 1 83 ? -1.469  -9.281  2.370   1.00 0.00 ? 874 LEU A HD21 8  
ATOM 7238 H HD22 . LEU A 1 83 ? -2.071  -7.917  3.306   1.00 0.00 ? 874 LEU A HD22 8  
ATOM 7239 H HD23 . LEU A 1 83 ? -1.120  -9.170  4.096   1.00 0.00 ? 874 LEU A HD23 8  
ATOM 7240 N N    . PRO A 1 84 ? 1.290   -12.016 2.718   1.00 0.00 ? 875 PRO A N    8  
ATOM 7241 C CA   . PRO A 1 84 ? 1.662   -13.320 2.085   1.00 0.00 ? 875 PRO A CA   8  
ATOM 7242 C C    . PRO A 1 84 ? 1.900   -13.150 0.587   1.00 0.00 ? 875 PRO A C    8  
ATOM 7243 O O    . PRO A 1 84 ? 1.037   -12.635 -0.134  1.00 0.00 ? 875 PRO A O    8  
ATOM 7244 C CB   . PRO A 1 84 ? 0.450   -14.223 2.350   1.00 0.00 ? 875 PRO A CB   8  
ATOM 7245 C CG   . PRO A 1 84 ? -0.689  -13.292 2.622   1.00 0.00 ? 875 PRO A CG   8  
ATOM 7246 C CD   . PRO A 1 84 ? -0.086  -12.031 3.239   1.00 0.00 ? 875 PRO A CD   8  
ATOM 7247 H HA   . PRO A 1 84 ? 2.530   -13.741 2.566   1.00 0.00 ? 875 PRO A HA   8  
ATOM 7248 H HB2  . PRO A 1 84 ? 0.244   -14.834 1.482   1.00 0.00 ? 875 PRO A HB2  8  
ATOM 7249 H HB3  . PRO A 1 84 ? 0.627   -14.847 3.214   1.00 0.00 ? 875 PRO A HB3  8  
ATOM 7250 H HG2  . PRO A 1 84 ? -1.199  -13.051 1.698   1.00 0.00 ? 875 PRO A HG2  8  
ATOM 7251 H HG3  . PRO A 1 84 ? -1.380  -13.738 3.321   1.00 0.00 ? 875 PRO A HG3  8  
ATOM 7252 H HD2  . PRO A 1 84 ? -0.634  -11.157 2.918   1.00 0.00 ? 875 PRO A HD2  8  
ATOM 7253 H HD3  . PRO A 1 84 ? -0.073  -12.101 4.316   1.00 0.00 ? 875 PRO A HD3  8  
ATOM 7254 N N    . LYS A 1 85 ? 3.083   -13.542 0.132   1.00 0.00 ? 876 LYS A N    8  
ATOM 7255 C CA   . LYS A 1 85 ? 3.458   -13.382 -1.269  1.00 0.00 ? 876 LYS A CA   8  
ATOM 7256 C C    . LYS A 1 85 ? 3.378   -14.705 -2.004  1.00 0.00 ? 876 LYS A C    8  
ATOM 7257 O O    . LYS A 1 85 ? 2.849   -14.726 -3.089  1.00 0.00 ? 876 LYS A O    8  
ATOM 7258 C CB   . LYS A 1 85 ? 4.883   -12.814 -1.380  1.00 0.00 ? 876 LYS A CB   8  
ATOM 7259 C CG   . LYS A 1 85 ? 5.298   -12.182 -0.039  1.00 0.00 ? 876 LYS A CG   8  
ATOM 7260 C CD   . LYS A 1 85 ? 6.099   -10.899 -0.281  1.00 0.00 ? 876 LYS A CD   8  
ATOM 7261 C CE   . LYS A 1 85 ? 5.971   -9.980  0.941   1.00 0.00 ? 876 LYS A CE   8  
ATOM 7262 N NZ   . LYS A 1 85 ? 5.647   -10.789 2.149   1.00 0.00 ? 876 LYS A NZ   8  
ATOM 7263 H H    . LYS A 1 85 ? 3.736   -13.919 0.759   1.00 0.00 ? 876 LYS A H    8  
ATOM 7264 H HA   . LYS A 1 85 ? 2.776   -12.683 -1.728  1.00 0.00 ? 876 LYS A HA   8  
ATOM 7265 N N    . GLN A 1 23 ? -9.627  -9.974  0.639   1.00 0.00 ? 814 GLN A N    9  
ATOM 7266 C CA   . GLN A 1 23 ? -10.723 -9.216  -0.030  1.00 0.00 ? 814 GLN A CA   9  
ATOM 7267 C C    . GLN A 1 23 ? -10.120 -7.999  -0.712  1.00 0.00 ? 814 GLN A C    9  
ATOM 7268 O O    . GLN A 1 23 ? -8.939  -7.991  -1.045  1.00 0.00 ? 814 GLN A O    9  
ATOM 7269 C CB   . GLN A 1 23 ? -11.772 -8.776  1.006   1.00 0.00 ? 814 GLN A CB   9  
ATOM 7270 C CG   . GLN A 1 23 ? -12.021 -9.905  2.010   1.00 0.00 ? 814 GLN A CG   9  
ATOM 7271 C CD   . GLN A 1 23 ? -13.363 -9.707  2.700   1.00 0.00 ? 814 GLN A CD   9  
ATOM 7272 O OE1  . GLN A 1 23 ? -13.774 -8.570  2.948   1.00 0.00 ? 814 GLN A OE1  9  
ATOM 7273 N NE2  . GLN A 1 23 ? -14.074 -10.742 3.027   1.00 0.00 ? 814 GLN A NE2  9  
ATOM 7274 H HA   . GLN A 1 23 ? -11.189 -9.846  -0.774  1.00 0.00 ? 814 GLN A HA   9  
ATOM 7275 H HB2  . GLN A 1 23 ? -11.420 -7.898  1.526   1.00 0.00 ? 814 GLN A HB2  9  
ATOM 7276 H HB3  . GLN A 1 23 ? -12.696 -8.543  0.497   1.00 0.00 ? 814 GLN A HB3  9  
ATOM 7277 H HG2  . GLN A 1 23 ? -12.029 -10.846 1.483   1.00 0.00 ? 814 GLN A HG2  9  
ATOM 7278 H HG3  . GLN A 1 23 ? -11.236 -9.913  2.752   1.00 0.00 ? 814 GLN A HG3  9  
ATOM 7279 H HE21 . GLN A 1 23 ? -13.746 -11.644 2.827   1.00 0.00 ? 814 GLN A HE21 9  
ATOM 7280 H HE22 . GLN A 1 23 ? -14.942 -10.623 3.469   1.00 0.00 ? 814 GLN A HE22 9  
ATOM 7281 N N    . THR A 1 24 ? -10.921 -6.967  -0.899  1.00 0.00 ? 815 THR A N    9  
ATOM 7282 C CA   . THR A 1 24 ? -10.438 -5.751  -1.533  1.00 0.00 ? 815 THR A CA   9  
ATOM 7283 C C    . THR A 1 24 ? -9.650  -4.907  -0.531  1.00 0.00 ? 815 THR A C    9  
ATOM 7284 O O    . THR A 1 24 ? -9.825  -5.045  0.683   1.00 0.00 ? 815 THR A O    9  
ATOM 7285 C CB   . THR A 1 24 ? -11.623 -4.951  -2.090  1.00 0.00 ? 815 THR A CB   9  
ATOM 7286 O OG1  . THR A 1 24 ? -12.835 -5.493  -1.572  1.00 0.00 ? 815 THR A OG1  9  
ATOM 7287 C CG2  . THR A 1 24 ? -11.637 -5.048  -3.619  1.00 0.00 ? 815 THR A CG2  9  
ATOM 7288 H H    . THR A 1 24 ? -11.853 -7.015  -0.599  1.00 0.00 ? 815 THR A H    9  
ATOM 7289 H HA   . THR A 1 24 ? -9.784  -6.021  -2.350  1.00 0.00 ? 815 THR A HA   9  
ATOM 7290 H HB   . THR A 1 24 ? -11.533 -3.913  -1.803  1.00 0.00 ? 815 THR A HB   9  
ATOM 7291 H HG21 . THR A 1 24 ? -12.428 -4.426  -4.012  1.00 0.00 ? 815 THR A HG21 9  
ATOM 7292 H HG22 . THR A 1 24 ? -11.806 -6.073  -3.914  1.00 0.00 ? 815 THR A HG22 9  
ATOM 7293 H HG23 . THR A 1 24 ? -10.689 -4.713  -4.013  1.00 0.00 ? 815 THR A HG23 9  
ATOM 7294 N N    . VAL A 1 25 ? -8.772  -4.051  -1.040  1.00 0.00 ? 816 VAL A N    9  
ATOM 7295 C CA   . VAL A 1 25 ? -7.948  -3.210  -0.184  1.00 0.00 ? 816 VAL A CA   9  
ATOM 7296 C C    . VAL A 1 25 ? -8.816  -2.245  0.626   1.00 0.00 ? 816 VAL A C    9  
ATOM 7297 O O    . VAL A 1 25 ? -9.356  -1.278  0.085   1.00 0.00 ? 816 VAL A O    9  
ATOM 7298 C CB   . VAL A 1 25 ? -6.938  -2.420  -1.032  1.00 0.00 ? 816 VAL A CB   9  
ATOM 7299 C CG1  . VAL A 1 25 ? -5.711  -3.290  -1.311  1.00 0.00 ? 816 VAL A CG1  9  
ATOM 7300 C CG2  . VAL A 1 25 ? -7.581  -2.014  -2.368  1.00 0.00 ? 816 VAL A CG2  9  
ATOM 7301 H H    . VAL A 1 25 ? -8.662  -3.992  -2.010  1.00 0.00 ? 816 VAL A H    9  
ATOM 7302 H HA   . VAL A 1 25 ? -7.402  -3.845  0.500   1.00 0.00 ? 816 VAL A HA   9  
ATOM 7303 H HB   . VAL A 1 25 ? -6.634  -1.535  -0.492  1.00 0.00 ? 816 VAL A HB   9  
ATOM 7304 H HG11 . VAL A 1 25 ? -6.025  -4.275  -1.621  1.00 0.00 ? 816 VAL A HG11 9  
ATOM 7305 H HG12 . VAL A 1 25 ? -5.113  -3.366  -0.416  1.00 0.00 ? 816 VAL A HG12 9  
ATOM 7306 H HG13 . VAL A 1 25 ? -5.122  -2.839  -2.096  1.00 0.00 ? 816 VAL A HG13 9  
ATOM 7307 H HG21 . VAL A 1 25 ? -7.490  -2.825  -3.075  1.00 0.00 ? 816 VAL A HG21 9  
ATOM 7308 H HG22 . VAL A 1 25 ? -7.074  -1.144  -2.757  1.00 0.00 ? 816 VAL A HG22 9  
ATOM 7309 H HG23 . VAL A 1 25 ? -8.625  -1.783  -2.213  1.00 0.00 ? 816 VAL A HG23 9  
ATOM 7310 N N    . GLY A 1 26 ? -8.954  -2.518  1.912   1.00 0.00 ? 817 GLY A N    9  
ATOM 7311 C CA   . GLY A 1 26 ? -9.759  -1.679  2.788   1.00 0.00 ? 817 GLY A CA   9  
ATOM 7312 C C    . GLY A 1 26 ? -9.459  -1.974  4.248   1.00 0.00 ? 817 GLY A C    9  
ATOM 7313 O O    . GLY A 1 26 ? -8.648  -1.288  4.878   1.00 0.00 ? 817 GLY A O    9  
ATOM 7314 H H    . GLY A 1 26 ? -8.508  -3.307  2.287   1.00 0.00 ? 817 GLY A H    9  
ATOM 7315 H HA2  . GLY A 1 26 ? -9.542  -0.641  2.580   1.00 0.00 ? 817 GLY A HA2  9  
ATOM 7316 H HA3  . GLY A 1 26 ? -10.805 -1.865  2.599   1.00 0.00 ? 817 GLY A HA3  9  
ATOM 7317 N N    . GLN A 1 27 ? -10.091 -3.015  4.779   1.00 0.00 ? 818 GLN A N    9  
ATOM 7318 C CA   . GLN A 1 27 ? -9.881  -3.401  6.170   1.00 0.00 ? 818 GLN A CA   9  
ATOM 7319 C C    . GLN A 1 27 ? -8.400  -3.551  6.458   1.00 0.00 ? 818 GLN A C    9  
ATOM 7320 O O    . GLN A 1 27 ? -7.931  -3.212  7.543   1.00 0.00 ? 818 GLN A O    9  
ATOM 7321 C CB   . GLN A 1 27 ? -10.605 -4.714  6.478   1.00 0.00 ? 818 GLN A CB   9  
ATOM 7322 C CG   . GLN A 1 27 ? -12.116 -4.517  6.329   1.00 0.00 ? 818 GLN A CG   9  
ATOM 7323 C CD   . GLN A 1 27 ? -12.814 -5.867  6.315   1.00 0.00 ? 818 GLN A CD   9  
ATOM 7324 O OE1  . GLN A 1 27 ? -13.497 -6.203  5.346   1.00 0.00 ? 818 GLN A OE1  9  
ATOM 7325 N NE2  . GLN A 1 27 ? -12.679 -6.668  7.324   1.00 0.00 ? 818 GLN A NE2  9  
ATOM 7326 H H    . GLN A 1 27 ? -10.707 -3.536  4.223   1.00 0.00 ? 818 GLN A H    9  
ATOM 7327 H HA   . GLN A 1 27 ? -10.280 -2.628  6.808   1.00 0.00 ? 818 GLN A HA   9  
ATOM 7328 H HB2  . GLN A 1 27 ? -10.268 -5.481  5.793   1.00 0.00 ? 818 GLN A HB2  9  
ATOM 7329 H HB3  . GLN A 1 27 ? -10.382 -5.017  7.491   1.00 0.00 ? 818 GLN A HB3  9  
ATOM 7330 H HG2  . GLN A 1 27 ? -12.484 -3.932  7.159   1.00 0.00 ? 818 GLN A HG2  9  
ATOM 7331 H HG3  . GLN A 1 27 ? -12.325 -3.998  5.408   1.00 0.00 ? 818 GLN A HG3  9  
ATOM 7332 H HE21 . GLN A 1 27 ? -12.129 -6.402  8.092   1.00 0.00 ? 818 GLN A HE21 9  
ATOM 7333 H HE22 . GLN A 1 27 ? -13.127 -7.539  7.323   1.00 0.00 ? 818 GLN A HE22 9  
ATOM 7334 N N    . TRP A 1 28 ? -7.663  -4.033  5.475   1.00 0.00 ? 819 TRP A N    9  
ATOM 7335 C CA   . TRP A 1 28 ? -6.226  -4.189  5.616   1.00 0.00 ? 819 TRP A CA   9  
ATOM 7336 C C    . TRP A 1 28 ? -5.604  -2.846  5.980   1.00 0.00 ? 819 TRP A C    9  
ATOM 7337 O O    . TRP A 1 28 ? -4.870  -2.733  6.964   1.00 0.00 ? 819 TRP A O    9  
ATOM 7338 C CB   . TRP A 1 28 ? -5.627  -4.717  4.305   1.00 0.00 ? 819 TRP A CB   9  
ATOM 7339 C CG   . TRP A 1 28 ? -4.134  -4.758  4.397   1.00 0.00 ? 819 TRP A CG   9  
ATOM 7340 C CD1  . TRP A 1 28 ? -3.425  -5.542  5.243   1.00 0.00 ? 819 TRP A CD1  9  
ATOM 7341 C CD2  . TRP A 1 28 ? -3.161  -4.000  3.628   1.00 0.00 ? 819 TRP A CD2  9  
ATOM 7342 N NE1  . TRP A 1 28 ? -2.076  -5.309  5.038   1.00 0.00 ? 819 TRP A NE1  9  
ATOM 7343 C CE2  . TRP A 1 28 ? -1.865  -4.367  4.051   1.00 0.00 ? 819 TRP A CE2  9  
ATOM 7344 C CE3  . TRP A 1 28 ? -3.279  -3.036  2.611   1.00 0.00 ? 819 TRP A CE3  9  
ATOM 7345 C CZ2  . TRP A 1 28 ? -0.726  -3.800  3.488   1.00 0.00 ? 819 TRP A CZ2  9  
ATOM 7346 C CZ3  . TRP A 1 28 ? -2.131  -2.463  2.040   1.00 0.00 ? 819 TRP A CZ3  9  
ATOM 7347 C CH2  . TRP A 1 28 ? -0.857  -2.845  2.479   1.00 0.00 ? 819 TRP A CH2  9  
ATOM 7348 H H    . TRP A 1 28 ? -8.093  -4.269  4.628   1.00 0.00 ? 819 TRP A H    9  
ATOM 7349 H HA   . TRP A 1 28 ? -6.026  -4.898  6.405   1.00 0.00 ? 819 TRP A HA   9  
ATOM 7350 H HB2  . TRP A 1 28 ? -5.997  -5.714  4.118   1.00 0.00 ? 819 TRP A HB2  9  
ATOM 7351 H HB3  . TRP A 1 28 ? -5.919  -4.070  3.491   1.00 0.00 ? 819 TRP A HB3  9  
ATOM 7352 H HD1  . TRP A 1 28 ? -3.843  -6.234  5.959   1.00 0.00 ? 819 TRP A HD1  9  
ATOM 7353 N N    . LEU A 1 29 ? -5.950  -1.822  5.205   1.00 0.00 ? 820 LEU A N    9  
ATOM 7354 C CA   . LEU A 1 29 ? -5.464  -0.469  5.452   1.00 0.00 ? 820 LEU A CA   9  
ATOM 7355 C C    . LEU A 1 29 ? -5.819  -0.031  6.870   1.00 0.00 ? 820 LEU A C    9  
ATOM 7356 O O    . LEU A 1 29 ? -4.962  0.446   7.624   1.00 0.00 ? 820 LEU A O    9  
ATOM 7357 C CB   . LEU A 1 29 ? -6.079  0.498   4.434   1.00 0.00 ? 820 LEU A CB   9  
ATOM 7358 C CG   . LEU A 1 29 ? -5.562  0.159   3.028   1.00 0.00 ? 820 LEU A CG   9  
ATOM 7359 C CD1  . LEU A 1 29 ? -6.441  0.837   1.977   1.00 0.00 ? 820 LEU A CD1  9  
ATOM 7360 C CD2  . LEU A 1 29 ? -4.117  0.652   2.881   1.00 0.00 ? 820 LEU A CD2  9  
ATOM 7361 H H    . LEU A 1 29 ? -6.575  -1.976  4.469   1.00 0.00 ? 820 LEU A H    9  
ATOM 7362 H HA   . LEU A 1 29 ? -4.389  -0.454  5.338   1.00 0.00 ? 820 LEU A HA   9  
ATOM 7363 H HB2  . LEU A 1 29 ? -7.155  0.410   4.460   1.00 0.00 ? 820 LEU A HB2  9  
ATOM 7364 H HB3  . LEU A 1 29 ? -5.798  1.509   4.683   1.00 0.00 ? 820 LEU A HB3  9  
ATOM 7365 H HG   . LEU A 1 29 ? -5.597  -0.911  2.881   1.00 0.00 ? 820 LEU A HG   9  
ATOM 7366 H HD11 . LEU A 1 29 ? -6.737  1.815   2.325   1.00 0.00 ? 820 LEU A HD11 9  
ATOM 7367 H HD12 . LEU A 1 29 ? -7.321  0.235   1.803   1.00 0.00 ? 820 LEU A HD12 9  
ATOM 7368 H HD13 . LEU A 1 29 ? -5.887  0.936   1.055   1.00 0.00 ? 820 LEU A HD13 9  
ATOM 7369 H HD21 . LEU A 1 29 ? -3.968  1.042   1.885   1.00 0.00 ? 820 LEU A HD21 9  
ATOM 7370 H HD22 . LEU A 1 29 ? -3.438  -0.171  3.048   1.00 0.00 ? 820 LEU A HD22 9  
ATOM 7371 H HD23 . LEU A 1 29 ? -3.923  1.428   3.605   1.00 0.00 ? 820 LEU A HD23 9  
ATOM 7372 N N    . GLU A 1 30 ? -7.074  -0.228  7.242   1.00 0.00 ? 821 GLU A N    9  
ATOM 7373 C CA   . GLU A 1 30 ? -7.521  0.113   8.586   1.00 0.00 ? 821 GLU A CA   9  
ATOM 7374 C C    . GLU A 1 30 ? -6.755  -0.715  9.614   1.00 0.00 ? 821 GLU A C    9  
ATOM 7375 O O    . GLU A 1 30 ? -6.289  -0.197  10.634  1.00 0.00 ? 821 GLU A O    9  
ATOM 7376 C CB   . GLU A 1 30 ? -9.026  -0.148  8.733   1.00 0.00 ? 821 GLU A CB   9  
ATOM 7377 C CG   . GLU A 1 30 ? -9.789  0.488   7.564   1.00 0.00 ? 821 GLU A CG   9  
ATOM 7378 C CD   . GLU A 1 30 ? -11.280 0.282   7.752   1.00 0.00 ? 821 GLU A CD   9  
ATOM 7379 O OE1  . GLU A 1 30 ? -11.736 -0.824  7.541   1.00 0.00 ? 821 GLU A OE1  9  
ATOM 7380 O OE2  . GLU A 1 30 ? -11.947 1.227   8.106   1.00 0.00 ? 821 GLU A OE2  9  
ATOM 7381 H H    . GLU A 1 30 ? -7.703  -0.634  6.607   1.00 0.00 ? 821 GLU A H    9  
ATOM 7382 H HA   . GLU A 1 30 ? -7.329  1.162   8.765   1.00 0.00 ? 821 GLU A HA   9  
ATOM 7383 N N    . SER A 1 31 ? -6.632  -2.004  9.337   1.00 0.00 ? 822 SER A N    9  
ATOM 7384 C CA   . SER A 1 31 ? -5.937  -2.918  10.230  1.00 0.00 ? 822 SER A CA   9  
ATOM 7385 C C    . SER A 1 31 ? -4.501  -2.475  10.466  1.00 0.00 ? 822 SER A C    9  
ATOM 7386 O O    . SER A 1 31 ? -4.005  -2.537  11.592  1.00 0.00 ? 822 SER A O    9  
ATOM 7387 C CB   . SER A 1 31 ? -5.973  -4.331  9.664   1.00 0.00 ? 822 SER A CB   9  
ATOM 7388 O OG   . SER A 1 31 ? -7.330  -4.672  9.361   1.00 0.00 ? 822 SER A OG   9  
ATOM 7389 H H    . SER A 1 31 ? -7.028  -2.350  8.509   1.00 0.00 ? 822 SER A H    9  
ATOM 7390 H HA   . SER A 1 31 ? -6.448  -2.919  11.179  1.00 0.00 ? 822 SER A HA   9  
ATOM 7391 H HB2  . SER A 1 31 ? -5.383  -4.380  8.761   1.00 0.00 ? 822 SER A HB2  9  
ATOM 7392 H HB3  . SER A 1 31 ? -5.563  -5.017  10.393  1.00 0.00 ? 822 SER A HB3  9  
ATOM 7393 H HG   . SER A 1 31 ? -7.558  -4.251  8.515   1.00 0.00 ? 822 SER A HG   9  
ATOM 7394 N N    . ILE A 1 32 ? -3.837  -2.005  9.420   1.00 0.00 ? 823 ILE A N    9  
ATOM 7395 C CA   . ILE A 1 32 ? -2.471  -1.528  9.570   1.00 0.00 ? 823 ILE A CA   9  
ATOM 7396 C C    . ILE A 1 32 ? -2.470  -0.119  10.160  1.00 0.00 ? 823 ILE A C    9  
ATOM 7397 O O    . ILE A 1 32 ? -1.416  0.491   10.350  1.00 0.00 ? 823 ILE A O    9  
ATOM 7398 C CB   . ILE A 1 32 ? -1.719  -1.567  8.228   1.00 0.00 ? 823 ILE A CB   9  
ATOM 7399 C CG1  . ILE A 1 32 ? -2.377  -0.614  7.227   1.00 0.00 ? 823 ILE A CG1  9  
ATOM 7400 C CG2  . ILE A 1 32 ? -1.754  -2.991  7.661   1.00 0.00 ? 823 ILE A CG2  9  
ATOM 7401 C CD1  . ILE A 1 32 ? -1.527  -0.539  5.956   1.00 0.00 ? 823 ILE A CD1  9  
ATOM 7402 H H    . ILE A 1 32 ? -4.277  -1.959  8.540   1.00 0.00 ? 823 ILE A H    9  
ATOM 7403 H HA   . ILE A 1 32 ? -1.963  -2.180  10.268  1.00 0.00 ? 823 ILE A HA   9  
ATOM 7404 H HB   . ILE A 1 32 ? -0.690  -1.274  8.391   1.00 0.00 ? 823 ILE A HB   9  
ATOM 7405 H HG12 . ILE A 1 32 ? -3.356  -0.988  6.979   1.00 0.00 ? 823 ILE A HG12 9  
ATOM 7406 H HG21 . ILE A 1 32 ? -1.671  -2.952  6.585   1.00 0.00 ? 823 ILE A HG21 9  
ATOM 7407 H HG22 . ILE A 1 32 ? -2.687  -3.464  7.926   1.00 0.00 ? 823 ILE A HG22 9  
ATOM 7408 H HG23 . ILE A 1 32 ? -0.932  -3.562  8.065   1.00 0.00 ? 823 ILE A HG23 9  
ATOM 7409 H HD11 . ILE A 1 32 ? -1.845  0.304   5.361   1.00 0.00 ? 823 ILE A HD11 9  
ATOM 7410 H HD12 . ILE A 1 32 ? -1.652  -1.449  5.386   1.00 0.00 ? 823 ILE A HD12 9  
ATOM 7411 H HD13 . ILE A 1 32 ? -0.486  -0.422  6.219   1.00 0.00 ? 823 ILE A HD13 9  
ATOM 7412 N N    . GLY A 1 33 ? -3.661  0.375   10.484  1.00 0.00 ? 824 GLY A N    9  
ATOM 7413 C CA   . GLY A 1 33 ? -3.808  1.689   11.093  1.00 0.00 ? 824 GLY A CA   9  
ATOM 7414 C C    . GLY A 1 33 ? -3.651  2.796   10.073  1.00 0.00 ? 824 GLY A C    9  
ATOM 7415 O O    . GLY A 1 33 ? -3.369  3.941   10.431  1.00 0.00 ? 824 GLY A O    9  
ATOM 7416 H H    . GLY A 1 33 ? -4.463  -0.170  10.334  1.00 0.00 ? 824 GLY A H    9  
ATOM 7417 H HA2  . GLY A 1 33 ? -4.786  1.761   11.545  1.00 0.00 ? 824 GLY A HA2  9  
ATOM 7418 H HA3  . GLY A 1 33 ? -3.057  1.810   11.857  1.00 0.00 ? 824 GLY A HA3  9  
ATOM 7419 N N    . LEU A 1 34 ? -3.855  2.472   8.803   1.00 0.00 ? 825 LEU A N    9  
ATOM 7420 C CA   . LEU A 1 34 ? -3.743  3.467   7.744   1.00 0.00 ? 825 LEU A CA   9  
ATOM 7421 C C    . LEU A 1 34 ? -5.065  3.625   7.008   1.00 0.00 ? 825 LEU A C    9  
ATOM 7422 O O    . LEU A 1 34 ? -5.207  3.178   5.875   1.00 0.00 ? 825 LEU A O    9  
ATOM 7423 C CB   . LEU A 1 34 ? -2.648  3.069   6.748   1.00 0.00 ? 825 LEU A CB   9  
ATOM 7424 C CG   . LEU A 1 34 ? -1.290  2.977   7.457   1.00 0.00 ? 825 LEU A CG   9  
ATOM 7425 C CD1  . LEU A 1 34 ? -0.195  2.783   6.415   1.00 0.00 ? 825 LEU A CD1  9  
ATOM 7426 C CD2  . LEU A 1 34 ? -1.014  4.268   8.233   1.00 0.00 ? 825 LEU A CD2  9  
ATOM 7427 H H    . LEU A 1 34 ? -4.101  1.549   8.569   1.00 0.00 ? 825 LEU A H    9  
ATOM 7428 H HA   . LEU A 1 34 ? -3.479  4.417   8.178   1.00 0.00 ? 825 LEU A HA   9  
ATOM 7429 H HB2  . LEU A 1 34 ? -2.897  2.111   6.312   1.00 0.00 ? 825 LEU A HB2  9  
ATOM 7430 H HB3  . LEU A 1 34 ? -2.595  3.809   5.965   1.00 0.00 ? 825 LEU A HB3  9  
ATOM 7431 H HG   . LEU A 1 34 ? -1.292  2.135   8.134   1.00 0.00 ? 825 LEU A HG   9  
ATOM 7432 H HD11 . LEU A 1 34 ? -0.108  1.734   6.173   1.00 0.00 ? 825 LEU A HD11 9  
ATOM 7433 H HD12 . LEU A 1 34 ? 0.743   3.140   6.810   1.00 0.00 ? 825 LEU A HD12 9  
ATOM 7434 H HD13 . LEU A 1 34 ? -0.440  3.340   5.523   1.00 0.00 ? 825 LEU A HD13 9  
ATOM 7435 H HD21 . LEU A 1 34 ? -1.331  5.119   7.649   1.00 0.00 ? 825 LEU A HD21 9  
ATOM 7436 H HD22 . LEU A 1 34 ? 0.046   4.342   8.432   1.00 0.00 ? 825 LEU A HD22 9  
ATOM 7437 H HD23 . LEU A 1 34 ? -1.549  4.250   9.170   1.00 0.00 ? 825 LEU A HD23 9  
ATOM 7438 N N    . PRO A 1 35 ? -6.023  4.267   7.616   1.00 0.00 ? 826 PRO A N    9  
ATOM 7439 C CA   . PRO A 1 35 ? -7.344  4.502   6.976   1.00 0.00 ? 826 PRO A CA   9  
ATOM 7440 C C    . PRO A 1 35 ? -7.254  5.580   5.896   1.00 0.00 ? 826 PRO A C    9  
ATOM 7441 O O    . PRO A 1 35 ? -6.407  6.480   5.974   1.00 0.00 ? 826 PRO A O    9  
ATOM 7442 C CB   . PRO A 1 35 ? -8.231  4.964   8.135   1.00 0.00 ? 826 PRO A CB   9  
ATOM 7443 C CG   . PRO A 1 35 ? -7.291  5.567   9.132   1.00 0.00 ? 826 PRO A CG   9  
ATOM 7444 C CD   . PRO A 1 35 ? -5.954  4.836   8.974   1.00 0.00 ? 826 PRO A CD   9  
ATOM 7445 H HA   . PRO A 1 35 ? -7.743  3.586   6.571   1.00 0.00 ? 826 PRO A HA   9  
ATOM 7446 H HB2  . PRO A 1 35 ? -8.945  5.699   7.790   1.00 0.00 ? 826 PRO A HB2  9  
ATOM 7447 H HB3  . PRO A 1 35 ? -8.742  4.122   8.578   1.00 0.00 ? 826 PRO A HB3  9  
ATOM 7448 H HG2  . PRO A 1 35 ? -7.169  6.624   8.932   1.00 0.00 ? 826 PRO A HG2  9  
ATOM 7449 H HG3  . PRO A 1 35 ? -7.662  5.419   10.135  1.00 0.00 ? 826 PRO A HG3  9  
ATOM 7450 H HD2  . PRO A 1 35 ? -5.130  5.532   9.062   1.00 0.00 ? 826 PRO A HD2  9  
ATOM 7451 H HD3  . PRO A 1 35 ? -5.865  4.043   9.703   1.00 0.00 ? 826 PRO A HD3  9  
ATOM 7452 N N    . GLN A 1 36 ? -8.134  5.493   4.908   1.00 0.00 ? 827 GLN A N    9  
ATOM 7453 C CA   . GLN A 1 36 ? -8.182  6.464   3.815   1.00 0.00 ? 827 GLN A CA   9  
ATOM 7454 C C    . GLN A 1 36 ? -6.996  6.298   2.871   1.00 0.00 ? 827 GLN A C    9  
ATOM 7455 O O    . GLN A 1 36 ? -6.322  7.273   2.526   1.00 0.00 ? 827 GLN A O    9  
ATOM 7456 C CB   . GLN A 1 36 ? -8.229  7.903   4.360   1.00 0.00 ? 827 GLN A CB   9  
ATOM 7457 C CG   . GLN A 1 36 ? -9.168  7.971   5.572   1.00 0.00 ? 827 GLN A CG   9  
ATOM 7458 C CD   . GLN A 1 36 ? -9.996  9.245   5.518   1.00 0.00 ? 827 GLN A CD   9  
ATOM 7459 O OE1  . GLN A 1 36 ? -9.453  10.344  5.650   1.00 0.00 ? 827 GLN A OE1  9  
ATOM 7460 N NE2  . GLN A 1 36 ? -11.274 9.170   5.322   1.00 0.00 ? 827 GLN A NE2  9  
ATOM 7461 H H    . GLN A 1 36 ? -8.782  4.758   4.915   1.00 0.00 ? 827 GLN A H    9  
ATOM 7462 H HA   . GLN A 1 36 ? -9.087  6.288   3.250   1.00 0.00 ? 827 GLN A HA   9  
ATOM 7463 H HB2  . GLN A 1 36 ? -7.235  8.211   4.652   1.00 0.00 ? 827 GLN A HB2  9  
ATOM 7464 H HB3  . GLN A 1 36 ? -8.593  8.564   3.587   1.00 0.00 ? 827 GLN A HB3  9  
ATOM 7465 H HG2  . GLN A 1 36 ? -9.826  7.116   5.567   1.00 0.00 ? 827 GLN A HG2  9  
ATOM 7466 H HG3  . GLN A 1 36 ? -8.583  7.966   6.480   1.00 0.00 ? 827 GLN A HG3  9  
ATOM 7467 H HE21 . GLN A 1 36 ? -11.700 8.295   5.209   1.00 0.00 ? 827 GLN A HE21 9  
ATOM 7468 H HE22 . GLN A 1 36 ? -11.816 9.985   5.287   1.00 0.00 ? 827 GLN A HE22 9  
ATOM 7469 N N    . TYR A 1 37 ? -6.768  5.073   2.427   1.00 0.00 ? 828 TYR A N    9  
ATOM 7470 C CA   . TYR A 1 37 ? -5.691  4.793   1.480   1.00 0.00 ? 828 TYR A CA   9  
ATOM 7471 C C    . TYR A 1 37 ? -6.195  3.907   0.355   1.00 0.00 ? 828 TYR A C    9  
ATOM 7472 O O    . TYR A 1 37 ? -5.460  3.603   -0.591  1.00 0.00 ? 828 TYR A O    9  
ATOM 7473 C CB   . TYR A 1 37 ? -4.512  4.124   2.188   1.00 0.00 ? 828 TYR A CB   9  
ATOM 7474 C CG   . TYR A 1 37 ? -3.628  5.186   2.799   1.00 0.00 ? 828 TYR A CG   9  
ATOM 7475 C CD1  . TYR A 1 37 ? -2.791  5.959   1.985   1.00 0.00 ? 828 TYR A CD1  9  
ATOM 7476 C CD2  . TYR A 1 37 ? -3.655  5.403   4.177   1.00 0.00 ? 828 TYR A CD2  9  
ATOM 7477 C CE1  . TYR A 1 37 ? -1.984  6.946   2.554   1.00 0.00 ? 828 TYR A CE1  9  
ATOM 7478 C CE2  . TYR A 1 37 ? -2.847  6.385   4.745   1.00 0.00 ? 828 TYR A CE2  9  
ATOM 7479 C CZ   . TYR A 1 37 ? -2.012  7.159   3.936   1.00 0.00 ? 828 TYR A CZ   9  
ATOM 7480 O OH   . TYR A 1 37 ? -1.227  8.138   4.504   1.00 0.00 ? 828 TYR A OH   9  
ATOM 7481 H H    . TYR A 1 37 ? -7.359  4.343   2.715   1.00 0.00 ? 828 TYR A H    9  
ATOM 7482 H HA   . TYR A 1 37 ? -5.354  5.727   1.052   1.00 0.00 ? 828 TYR A HA   9  
ATOM 7483 H HB2  . TYR A 1 37 ? -4.882  3.467   2.962   1.00 0.00 ? 828 TYR A HB2  9  
ATOM 7484 H HB3  . TYR A 1 37 ? -3.942  3.549   1.474   1.00 0.00 ? 828 TYR A HB3  9  
ATOM 7485 H HH   . TYR A 1 37 ? -0.402  8.209   3.991   1.00 0.00 ? 828 TYR A HH   9  
ATOM 7486 N N    . GLU A 1 38 ? -7.453  3.508   0.455   1.00 0.00 ? 829 GLU A N    9  
ATOM 7487 C CA   . GLU A 1 38 ? -8.076  2.669   -0.553  1.00 0.00 ? 829 GLU A CA   9  
ATOM 7488 C C    . GLU A 1 38 ? -7.916  3.291   -1.931  1.00 0.00 ? 829 GLU A C    9  
ATOM 7489 O O    . GLU A 1 38 ? -7.345  2.684   -2.835  1.00 0.00 ? 829 GLU A O    9  
ATOM 7490 C CB   . GLU A 1 38 ? -9.567  2.486   -0.234  1.00 0.00 ? 829 GLU A CB   9  
ATOM 7491 C CG   . GLU A 1 38 ? -10.102 3.728   0.511   1.00 0.00 ? 829 GLU A CG   9  
ATOM 7492 C CD   . GLU A 1 38 ? -10.063 3.497   2.007   1.00 0.00 ? 829 GLU A CD   9  
ATOM 7493 O OE1  . GLU A 1 38 ? -8.999  3.622   2.579   1.00 0.00 ? 829 GLU A OE1  9  
ATOM 7494 O OE2  . GLU A 1 38 ? -11.095 3.191   2.560   1.00 0.00 ? 829 GLU A OE2  9  
ATOM 7495 H H    . GLU A 1 38 ? -7.988  3.792   1.230   1.00 0.00 ? 829 GLU A H    9  
ATOM 7496 H HA   . GLU A 1 38 ? -7.601  1.700   -0.548  1.00 0.00 ? 829 GLU A HA   9  
ATOM 7497 N N    . ASN A 1 39 ? -8.423  4.508   -2.075  1.00 0.00 ? 830 ASN A N    9  
ATOM 7498 C CA   . ASN A 1 39 ? -8.342  5.231   -3.338  1.00 0.00 ? 830 ASN A CA   9  
ATOM 7499 C C    . ASN A 1 39 ? -6.927  5.203   -3.887  1.00 0.00 ? 830 ASN A C    9  
ATOM 7500 O O    . ASN A 1 39 ? -6.710  4.860   -5.043  1.00 0.00 ? 830 ASN A O    9  
ATOM 7501 C CB   . ASN A 1 39 ? -8.802  6.688   -3.152  1.00 0.00 ? 830 ASN A CB   9  
ATOM 7502 C CG   . ASN A 1 39 ? -7.860  7.437   -2.201  1.00 0.00 ? 830 ASN A CG   9  
ATOM 7503 O OD1  . ASN A 1 39 ? -7.184  6.819   -1.365  1.00 0.00 ? 830 ASN A OD1  9  
ATOM 7504 N ND2  . ASN A 1 39 ? -7.770  8.729   -2.275  1.00 0.00 ? 830 ASN A ND2  9  
ATOM 7505 H H    . ASN A 1 39 ? -8.860  4.931   -1.308  1.00 0.00 ? 830 ASN A H    9  
ATOM 7506 H HA   . ASN A 1 39 ? -8.997  4.755   -4.052  1.00 0.00 ? 830 ASN A HA   9  
ATOM 7507 H HB2  . ASN A 1 39 ? -8.804  7.181   -4.114  1.00 0.00 ? 830 ASN A HB2  9  
ATOM 7508 H HB3  . ASN A 1 39 ? -9.803  6.698   -2.747  1.00 0.00 ? 830 ASN A HB3  9  
ATOM 7509 H HD21 . ASN A 1 39 ? -8.301  9.222   -2.935  1.00 0.00 ? 830 ASN A HD21 9  
ATOM 7510 H HD22 . ASN A 1 39 ? -7.169  9.214   -1.670  1.00 0.00 ? 830 ASN A HD22 9  
ATOM 7511 N N    . HIS A 1 40 ? -5.973  5.569   -3.050  1.00 0.00 ? 831 HIS A N    9  
ATOM 7512 C CA   . HIS A 1 40 ? -4.574  5.596   -3.448  1.00 0.00 ? 831 HIS A CA   9  
ATOM 7513 C C    . HIS A 1 40 ? -4.174  4.272   -4.078  1.00 0.00 ? 831 HIS A C    9  
ATOM 7514 O O    . HIS A 1 40 ? -3.739  4.220   -5.232  1.00 0.00 ? 831 HIS A O    9  
ATOM 7515 C CB   . HIS A 1 40 ? -3.686  5.872   -2.227  1.00 0.00 ? 831 HIS A CB   9  
ATOM 7516 C CG   . HIS A 1 40 ? -3.790  7.320   -1.839  1.00 0.00 ? 831 HIS A CG   9  
ATOM 7517 N ND1  . HIS A 1 40 ? -4.951  7.870   -1.309  1.00 0.00 ? 831 HIS A ND1  9  
ATOM 7518 C CD2  . HIS A 1 40 ? -2.884  8.348   -1.899  1.00 0.00 ? 831 HIS A CD2  9  
ATOM 7519 C CE1  . HIS A 1 40 ? -4.707  9.175   -1.074  1.00 0.00 ? 831 HIS A CE1  9  
ATOM 7520 N NE2  . HIS A 1 40 ? -3.463  9.516   -1.419  1.00 0.00 ? 831 HIS A NE2  9  
ATOM 7521 H H    . HIS A 1 40 ? -6.221  5.836   -2.138  1.00 0.00 ? 831 HIS A H    9  
ATOM 7522 H HA   . HIS A 1 40 ? -4.428  6.388   -4.168  1.00 0.00 ? 831 HIS A HA   9  
ATOM 7523 H HB2  . HIS A 1 40 ? -4.007  5.254   -1.401  1.00 0.00 ? 831 HIS A HB2  9  
ATOM 7524 H HB3  . HIS A 1 40 ? -2.660  5.638   -2.468  1.00 0.00 ? 831 HIS A HB3  9  
ATOM 7525 N N    . LEU A 1 41 ? -4.338  3.203   -3.323  1.00 0.00 ? 832 LEU A N    9  
ATOM 7526 C CA   . LEU A 1 41 ? -3.999  1.883   -3.802  1.00 0.00 ? 832 LEU A CA   9  
ATOM 7527 C C    . LEU A 1 41 ? -4.874  1.507   -4.990  1.00 0.00 ? 832 LEU A C    9  
ATOM 7528 O O    . LEU A 1 41 ? -4.371  1.120   -6.048  1.00 0.00 ? 832 LEU A O    9  
ATOM 7529 C CB   . LEU A 1 41 ? -4.169  0.860   -2.677  1.00 0.00 ? 832 LEU A CB   9  
ATOM 7530 C CG   . LEU A 1 41 ? -2.853  0.722   -1.896  1.00 0.00 ? 832 LEU A CG   9  
ATOM 7531 C CD1  . LEU A 1 41 ? -2.535  2.035   -1.174  1.00 0.00 ? 832 LEU A CD1  9  
ATOM 7532 C CD2  . LEU A 1 41 ? -2.985  -0.402  -0.866  1.00 0.00 ? 832 LEU A CD2  9  
ATOM 7533 H H    . LEU A 1 41 ? -4.698  3.301   -2.417  1.00 0.00 ? 832 LEU A H    9  
ATOM 7534 H HA   . LEU A 1 41 ? -2.967  1.882   -4.117  1.00 0.00 ? 832 LEU A HA   9  
ATOM 7535 H HB2  . LEU A 1 41 ? -4.957  1.186   -2.013  1.00 0.00 ? 832 LEU A HB2  9  
ATOM 7536 H HB3  . LEU A 1 41 ? -4.437  -0.093  -3.103  1.00 0.00 ? 832 LEU A HB3  9  
ATOM 7537 H HG   . LEU A 1 41 ? -2.049  0.493   -2.582  1.00 0.00 ? 832 LEU A HG   9  
ATOM 7538 H HD11 . LEU A 1 41 ? -2.285  2.796   -1.898  1.00 0.00 ? 832 LEU A HD11 9  
ATOM 7539 H HD12 . LEU A 1 41 ? -1.698  1.884   -0.509  1.00 0.00 ? 832 LEU A HD12 9  
ATOM 7540 H HD13 . LEU A 1 41 ? -3.396  2.350   -0.602  1.00 0.00 ? 832 LEU A HD13 9  
ATOM 7541 H HD21 . LEU A 1 41 ? -2.009  -0.819  -0.667  1.00 0.00 ? 832 LEU A HD21 9  
ATOM 7542 H HD22 . LEU A 1 41 ? -3.634  -1.173  -1.253  1.00 0.00 ? 832 LEU A HD22 9  
ATOM 7543 H HD23 . LEU A 1 41 ? -3.401  -0.007  0.049   1.00 0.00 ? 832 LEU A HD23 9  
ATOM 7544 N N    . MET A 1 42 ? -6.181  1.636   -4.814  1.00 0.00 ? 833 MET A N    9  
ATOM 7545 C CA   . MET A 1 42 ? -7.127  1.315   -5.875  1.00 0.00 ? 833 MET A CA   9  
ATOM 7546 C C    . MET A 1 42 ? -6.768  2.065   -7.150  1.00 0.00 ? 833 MET A C    9  
ATOM 7547 O O    . MET A 1 42 ? -6.652  1.466   -8.223  1.00 0.00 ? 833 MET A O    9  
ATOM 7548 C CB   . MET A 1 42 ? -8.559  1.667   -5.442  1.00 0.00 ? 833 MET A CB   9  
ATOM 7549 C CG   . MET A 1 42 ? -9.572  0.963   -6.358  1.00 0.00 ? 833 MET A CG   9  
ATOM 7550 S SD   . MET A 1 42 ? -9.126  -0.786  -6.533  1.00 0.00 ? 833 MET A SD   9  
ATOM 7551 C CE   . MET A 1 42 ? -9.816  -1.367  -4.965  1.00 0.00 ? 833 MET A CE   9  
ATOM 7552 H H    . MET A 1 42 ? -6.519  1.963   -3.951  1.00 0.00 ? 833 MET A H    9  
ATOM 7553 H HA   . MET A 1 42 ? -7.073  0.254   -6.069  1.00 0.00 ? 833 MET A HA   9  
ATOM 7554 H HB2  . MET A 1 42 ? -8.715  1.349   -4.421  1.00 0.00 ? 833 MET A HB2  9  
ATOM 7555 H HB3  . MET A 1 42 ? -8.702  2.735   -5.510  1.00 0.00 ? 833 MET A HB3  9  
ATOM 7556 H HG2  . MET A 1 42 ? -10.560 1.042   -5.930  1.00 0.00 ? 833 MET A HG2  9  
ATOM 7557 H HG3  . MET A 1 42 ? -9.567  1.437   -7.329  1.00 0.00 ? 833 MET A HG3  9  
ATOM 7558 H HE1  . MET A 1 42 ? -9.115  -2.044  -4.499  1.00 0.00 ? 833 MET A HE1  9  
ATOM 7559 H HE2  . MET A 1 42 ? -10.743 -1.886  -5.147  1.00 0.00 ? 833 MET A HE2  9  
ATOM 7560 H HE3  . MET A 1 42 ? -10.002 -0.524  -4.315  1.00 0.00 ? 833 MET A HE3  9  
ATOM 7561 N N    . ALA A 1 43 ? -6.582  3.373   -7.025  1.00 0.00 ? 834 ALA A N    9  
ATOM 7562 C CA   . ALA A 1 43 ? -6.224  4.202   -8.168  1.00 0.00 ? 834 ALA A CA   9  
ATOM 7563 C C    . ALA A 1 43 ? -4.942  3.692   -8.801  1.00 0.00 ? 834 ALA A C    9  
ATOM 7564 O O    . ALA A 1 43 ? -4.850  3.553   -10.027 1.00 0.00 ? 834 ALA A O    9  
ATOM 7565 C CB   . ALA A 1 43 ? -6.044  5.659   -7.736  1.00 0.00 ? 834 ALA A CB   9  
ATOM 7566 H H    . ALA A 1 43 ? -6.678  3.790   -6.141  1.00 0.00 ? 834 ALA A H    9  
ATOM 7567 H HA   . ALA A 1 43 ? -7.019  4.151   -8.895  1.00 0.00 ? 834 ALA A HA   9  
ATOM 7568 H HB1  . ALA A 1 43 ? -6.970  6.032   -7.325  1.00 0.00 ? 834 ALA A HB1  9  
ATOM 7569 H HB2  . ALA A 1 43 ? -5.764  6.256   -8.591  1.00 0.00 ? 834 ALA A HB2  9  
ATOM 7570 H HB3  . ALA A 1 43 ? -5.268  5.720   -6.986  1.00 0.00 ? 834 ALA A HB3  9  
ATOM 7571 N N    . ASN A 1 44 ? -3.960  3.391   -7.964  1.00 0.00 ? 835 ASN A N    9  
ATOM 7572 C CA   . ASN A 1 44 ? -2.690  2.868   -8.453  1.00 0.00 ? 835 ASN A CA   9  
ATOM 7573 C C    . ASN A 1 44 ? -2.840  1.417   -8.886  1.00 0.00 ? 835 ASN A C    9  
ATOM 7574 O O    . ASN A 1 44 ? -1.861  0.759   -9.235  1.00 0.00 ? 835 ASN A O    9  
ATOM 7575 C CB   . ASN A 1 44 ? -1.603  2.980   -7.382  1.00 0.00 ? 835 ASN A CB   9  
ATOM 7576 C CG   . ASN A 1 44 ? -0.232  2.839   -8.034  1.00 0.00 ? 835 ASN A CG   9  
ATOM 7577 O OD1  . ASN A 1 44 ? 0.499   1.894   -7.751  1.00 0.00 ? 835 ASN A OD1  9  
ATOM 7578 N ND2  . ASN A 1 44 ? 0.159   3.722   -8.898  1.00 0.00 ? 835 ASN A ND2  9  
ATOM 7579 H H    . ASN A 1 44 ? -4.096  3.508   -6.997  1.00 0.00 ? 835 ASN A H    9  
ATOM 7580 H HA   . ASN A 1 44 ? -2.388  3.451   -9.309  1.00 0.00 ? 835 ASN A HA   9  
ATOM 7581 H HB2  . ASN A 1 44 ? -1.675  3.941   -6.894  1.00 0.00 ? 835 ASN A HB2  9  
ATOM 7582 H HB3  . ASN A 1 44 ? -1.733  2.197   -6.651  1.00 0.00 ? 835 ASN A HB3  9  
ATOM 7583 H HD21 . ASN A 1 44 ? -0.422  4.476   -9.127  1.00 0.00 ? 835 ASN A HD21 9  
ATOM 7584 H HD22 . ASN A 1 44 ? 1.040   3.632   -9.330  1.00 0.00 ? 835 ASN A HD22 9  
ATOM 7585 N N    . GLY A 1 45 ? -4.069  0.916   -8.851  1.00 0.00 ? 836 GLY A N    9  
ATOM 7586 C CA   . GLY A 1 45 ? -4.340  -0.462  -9.237  1.00 0.00 ? 836 GLY A CA   9  
ATOM 7587 C C    . GLY A 1 45 ? -3.756  -1.436  -8.229  1.00 0.00 ? 836 GLY A C    9  
ATOM 7588 O O    . GLY A 1 45 ? -3.660  -2.636  -8.491  1.00 0.00 ? 836 GLY A O    9  
ATOM 7589 H H    . GLY A 1 45 ? -4.812  1.482   -8.555  1.00 0.00 ? 836 GLY A H    9  
ATOM 7590 H HA2  . GLY A 1 45 ? -5.409  -0.607  -9.297  1.00 0.00 ? 836 GLY A HA2  9  
ATOM 7591 H HA3  . GLY A 1 45 ? -3.902  -0.654  -10.206 1.00 0.00 ? 836 GLY A HA3  9  
ATOM 7592 N N    . PHE A 1 46 ? -3.387  -0.924  -7.065  1.00 0.00 ? 837 PHE A N    9  
ATOM 7593 C CA   . PHE A 1 46 ? -2.832  -1.763  -6.018  1.00 0.00 ? 837 PHE A CA   9  
ATOM 7594 C C    . PHE A 1 46 ? -3.932  -2.602  -5.382  1.00 0.00 ? 837 PHE A C    9  
ATOM 7595 O O    . PHE A 1 46 ? -4.319  -2.375  -4.232  1.00 0.00 ? 837 PHE A O    9  
ATOM 7596 C CB   . PHE A 1 46 ? -2.123  -0.906  -4.955  1.00 0.00 ? 837 PHE A CB   9  
ATOM 7597 C CG   . PHE A 1 46 ? -0.624  -1.081  -5.077  1.00 0.00 ? 837 PHE A CG   9  
ATOM 7598 C CD1  . PHE A 1 46 ? 0.059   -0.515  -6.156  1.00 0.00 ? 837 PHE A CD1  9  
ATOM 7599 C CD2  . PHE A 1 46 ? 0.081   -1.809  -4.110  1.00 0.00 ? 837 PHE A CD2  9  
ATOM 7600 C CE1  . PHE A 1 46 ? 1.444   -0.675  -6.272  1.00 0.00 ? 837 PHE A CE1  9  
ATOM 7601 C CE2  . PHE A 1 46 ? 1.466   -1.970  -4.226  1.00 0.00 ? 837 PHE A CE2  9  
ATOM 7602 C CZ   . PHE A 1 46 ? 2.146   -1.402  -5.306  1.00 0.00 ? 837 PHE A CZ   9  
ATOM 7603 H H    . PHE A 1 46 ? -3.515  0.036   -6.896  1.00 0.00 ? 837 PHE A H    9  
ATOM 7604 H HA   . PHE A 1 46 ? -2.109  -2.432  -6.464  1.00 0.00 ? 837 PHE A HA   9  
ATOM 7605 H HB2  . PHE A 1 46 ? -2.374  0.132   -5.106  1.00 0.00 ? 837 PHE A HB2  9  
ATOM 7606 H HB3  . PHE A 1 46 ? -2.440  -1.211  -3.970  1.00 0.00 ? 837 PHE A HB3  9  
ATOM 7607 H HZ   . PHE A 1 46 ? 3.218   -1.524  -5.394  1.00 0.00 ? 837 PHE A HZ   9  
ATOM 7608 N N    . ASP A 1 47 ? -4.434  -3.566  -6.142  1.00 0.00 ? 838 ASP A N    9  
ATOM 7609 C CA   . ASP A 1 47 ? -5.487  -4.455  -5.659  1.00 0.00 ? 838 ASP A CA   9  
ATOM 7610 C C    . ASP A 1 47 ? -4.888  -5.781  -5.226  1.00 0.00 ? 838 ASP A C    9  
ATOM 7611 O O    . ASP A 1 47 ? -3.795  -6.143  -5.665  1.00 0.00 ? 838 ASP A O    9  
ATOM 7612 C CB   . ASP A 1 47 ? -6.552  -4.679  -6.753  1.00 0.00 ? 838 ASP A CB   9  
ATOM 7613 C CG   . ASP A 1 47 ? -6.578  -6.137  -7.188  1.00 0.00 ? 838 ASP A CG   9  
ATOM 7614 O OD1  . ASP A 1 47 ? -5.859  -6.474  -8.102  1.00 0.00 ? 838 ASP A OD1  9  
ATOM 7615 O OD2  . ASP A 1 47 ? -7.324  -6.894  -6.605  1.00 0.00 ? 838 ASP A OD2  9  
ATOM 7616 H H    . ASP A 1 47 ? -4.079  -3.687  -7.047  1.00 0.00 ? 838 ASP A H    9  
ATOM 7617 H HA   . ASP A 1 47 ? -5.961  -3.996  -4.804  1.00 0.00 ? 838 ASP A HA   9  
ATOM 7618 N N    . ASN A 1 48 ? -5.609  -6.503  -4.378  1.00 0.00 ? 839 ASN A N    9  
ATOM 7619 C CA   . ASN A 1 48 ? -5.143  -7.793  -3.879  1.00 0.00 ? 839 ASN A CA   9  
ATOM 7620 C C    . ASN A 1 48 ? -3.869  -7.610  -3.062  1.00 0.00 ? 839 ASN A C    9  
ATOM 7621 O O    . ASN A 1 48 ? -2.751  -7.769  -3.575  1.00 0.00 ? 839 ASN A O    9  
ATOM 7622 C CB   . ASN A 1 48 ? -4.899  -8.769  -5.040  1.00 0.00 ? 839 ASN A CB   9  
ATOM 7623 C CG   . ASN A 1 48 ? -4.415  -10.118 -4.511  1.00 0.00 ? 839 ASN A CG   9  
ATOM 7624 O OD1  . ASN A 1 48 ? -3.956  -10.221 -3.370  1.00 0.00 ? 839 ASN A OD1  9  
ATOM 7625 N ND2  . ASN A 1 48 ? -4.486  -11.163 -5.268  1.00 0.00 ? 839 ASN A ND2  9  
ATOM 7626 H H    . ASN A 1 48 ? -6.475  -6.159  -4.078  1.00 0.00 ? 839 ASN A H    9  
ATOM 7627 H HA   . ASN A 1 48 ? -5.908  -8.204  -3.239  1.00 0.00 ? 839 ASN A HA   9  
ATOM 7628 H HB2  . ASN A 1 48 ? -5.823  -8.908  -5.583  1.00 0.00 ? 839 ASN A HB2  9  
ATOM 7629 H HB3  . ASN A 1 48 ? -4.157  -8.357  -5.706  1.00 0.00 ? 839 ASN A HB3  9  
ATOM 7630 H HD21 . ASN A 1 48 ? -4.850  -11.086 -6.174  1.00 0.00 ? 839 ASN A HD21 9  
ATOM 7631 H HD22 . ASN A 1 48 ? -4.177  -12.032 -4.939  1.00 0.00 ? 839 ASN A HD22 9  
ATOM 7632 N N    . VAL A 1 49 ? -4.043  -7.265  -1.789  1.00 0.00 ? 840 VAL A N    9  
ATOM 7633 C CA   . VAL A 1 49 ? -2.914  -7.038  -0.898  1.00 0.00 ? 840 VAL A CA   9  
ATOM 7634 C C    . VAL A 1 49 ? -1.896  -8.170  -1.007  1.00 0.00 ? 840 VAL A C    9  
ATOM 7635 O O    . VAL A 1 49 ? -0.687  -7.923  -1.083  1.00 0.00 ? 840 VAL A O    9  
ATOM 7636 C CB   . VAL A 1 49 ? -3.399  -6.865  0.559   1.00 0.00 ? 840 VAL A CB   9  
ATOM 7637 C CG1  . VAL A 1 49 ? -4.263  -5.609  0.665   1.00 0.00 ? 840 VAL A CG1  9  
ATOM 7638 C CG2  . VAL A 1 49 ? -4.229  -8.080  0.995   1.00 0.00 ? 840 VAL A CG2  9  
ATOM 7639 H H    . VAL A 1 49 ? -4.954  -7.151  -1.444  1.00 0.00 ? 840 VAL A H    9  
ATOM 7640 H HA   . VAL A 1 49 ? -2.426  -6.124  -1.201  1.00 0.00 ? 840 VAL A HA   9  
ATOM 7641 H HB   . VAL A 1 49 ? -2.545  -6.752  1.210   1.00 0.00 ? 840 VAL A HB   9  
ATOM 7642 H HG11 . VAL A 1 49 ? -5.047  -5.645  -0.077  1.00 0.00 ? 840 VAL A HG11 9  
ATOM 7643 H HG12 . VAL A 1 49 ? -3.649  -4.735  0.503   1.00 0.00 ? 840 VAL A HG12 9  
ATOM 7644 H HG13 . VAL A 1 49 ? -4.703  -5.560  1.650   1.00 0.00 ? 840 VAL A HG13 9  
ATOM 7645 H HG21 . VAL A 1 49 ? -3.699  -8.621  1.763   1.00 0.00 ? 840 VAL A HG21 9  
ATOM 7646 H HG22 . VAL A 1 49 ? -4.407  -8.729  0.153   1.00 0.00 ? 840 VAL A HG22 9  
ATOM 7647 H HG23 . VAL A 1 49 ? -5.177  -7.741  1.388   1.00 0.00 ? 840 VAL A HG23 9  
ATOM 7648 N N    . GLN A 1 50 ? -2.386  -9.406  -1.064  1.00 0.00 ? 841 GLN A N    9  
ATOM 7649 C CA   . GLN A 1 50 ? -1.507  -10.557 -1.208  1.00 0.00 ? 841 GLN A CA   9  
ATOM 7650 C C    . GLN A 1 50 ? -0.629  -10.377 -2.433  1.00 0.00 ? 841 GLN A C    9  
ATOM 7651 O O    . GLN A 1 50 ? 0.602   -10.461 -2.353  1.00 0.00 ? 841 GLN A O    9  
ATOM 7652 C CB   . GLN A 1 50 ? -2.326  -11.852 -1.339  1.00 0.00 ? 841 GLN A CB   9  
ATOM 7653 C CG   . GLN A 1 50 ? -1.404  -13.070 -1.178  1.00 0.00 ? 841 GLN A CG   9  
ATOM 7654 C CD   . GLN A 1 50 ? -2.173  -14.354 -1.469  1.00 0.00 ? 841 GLN A CD   9  
ATOM 7655 O OE1  . GLN A 1 50 ? -3.157  -14.336 -2.213  1.00 0.00 ? 841 GLN A OE1  9  
ATOM 7656 N NE2  . GLN A 1 50 ? -1.791  -15.470 -0.930  1.00 0.00 ? 841 GLN A NE2  9  
ATOM 7657 H H    . GLN A 1 50 ? -3.356  -9.536  -1.040  1.00 0.00 ? 841 GLN A H    9  
ATOM 7658 H HA   . GLN A 1 50 ? -0.878  -10.627 -0.333  1.00 0.00 ? 841 GLN A HA   9  
ATOM 7659 H HB2  . GLN A 1 50 ? -3.089  -11.876 -0.575  1.00 0.00 ? 841 GLN A HB2  9  
ATOM 7660 H HB3  . GLN A 1 50 ? -2.793  -11.888 -2.312  1.00 0.00 ? 841 GLN A HB3  9  
ATOM 7661 H HG2  . GLN A 1 50 ? -0.575  -12.988 -1.867  1.00 0.00 ? 841 GLN A HG2  9  
ATOM 7662 H HG3  . GLN A 1 50 ? -1.027  -13.102 -0.168  1.00 0.00 ? 841 GLN A HG3  9  
ATOM 7663 H HE21 . GLN A 1 50 ? -1.008  -15.488 -0.337  1.00 0.00 ? 841 GLN A HE21 9  
ATOM 7664 H HE22 . GLN A 1 50 ? -2.279  -16.298 -1.116  1.00 0.00 ? 841 GLN A HE22 9  
ATOM 7665 N N    . PHE A 1 51 ? -1.263  -10.089 -3.560  1.00 0.00 ? 842 PHE A N    9  
ATOM 7666 C CA   . PHE A 1 51 ? -0.532  -9.858  -4.790  1.00 0.00 ? 842 PHE A CA   9  
ATOM 7667 C C    . PHE A 1 51 ? 0.373   -8.661  -4.623  1.00 0.00 ? 842 PHE A C    9  
ATOM 7668 O O    . PHE A 1 51 ? 1.575   -8.759  -4.818  1.00 0.00 ? 842 PHE A O    9  
ATOM 7669 C CB   . PHE A 1 51 ? -1.492  -9.619  -5.958  1.00 0.00 ? 842 PHE A CB   9  
ATOM 7670 C CG   . PHE A 1 51 ? -1.670  -10.895 -6.753  1.00 0.00 ? 842 PHE A CG   9  
ATOM 7671 C CD1  . PHE A 1 51 ? -1.808  -12.126 -6.097  1.00 0.00 ? 842 PHE A CD1  9  
ATOM 7672 C CD2  . PHE A 1 51 ? -1.698  -10.845 -8.150  1.00 0.00 ? 842 PHE A CD2  9  
ATOM 7673 C CE1  . PHE A 1 51 ? -1.972  -13.299 -6.840  1.00 0.00 ? 842 PHE A CE1  9  
ATOM 7674 C CE2  . PHE A 1 51 ? -1.863  -12.018 -8.891  1.00 0.00 ? 842 PHE A CE2  9  
ATOM 7675 C CZ   . PHE A 1 51 ? -2.001  -13.246 -8.237  1.00 0.00 ? 842 PHE A CZ   9  
ATOM 7676 H H    . PHE A 1 51 ? -2.242  -10.001 -3.552  1.00 0.00 ? 842 PHE A H    9  
ATOM 7677 H HA   . PHE A 1 51 ? 0.076   -10.723 -5.008  1.00 0.00 ? 842 PHE A HA   9  
ATOM 7678 H HB2  . PHE A 1 51 ? -2.443  -9.286  -5.582  1.00 0.00 ? 842 PHE A HB2  9  
ATOM 7679 H HB3  . PHE A 1 51 ? -1.080  -8.856  -6.601  1.00 0.00 ? 842 PHE A HB3  9  
ATOM 7680 H HZ   . PHE A 1 51 ? -2.128  -14.153 -8.812  1.00 0.00 ? 842 PHE A HZ   9  
ATOM 7681 N N    . MET A 1 52 ? -0.204  -7.538  -4.225  1.00 0.00 ? 843 MET A N    9  
ATOM 7682 C CA   . MET A 1 52 ? 0.580   -6.327  -4.010  1.00 0.00 ? 843 MET A CA   9  
ATOM 7683 C C    . MET A 1 52 ? 1.829   -6.645  -3.199  1.00 0.00 ? 843 MET A C    9  
ATOM 7684 O O    . MET A 1 52 ? 2.951   -6.374  -3.629  1.00 0.00 ? 843 MET A O    9  
ATOM 7685 C CB   . MET A 1 52 ? -0.255  -5.275  -3.272  1.00 0.00 ? 843 MET A CB   9  
ATOM 7686 C CG   . MET A 1 52 ? -1.473  -4.886  -4.119  1.00 0.00 ? 843 MET A CG   9  
ATOM 7687 S SD   . MET A 1 52 ? -2.934  -4.735  -3.052  1.00 0.00 ? 843 MET A SD   9  
ATOM 7688 C CE   . MET A 1 52 ? -2.277  -3.494  -1.907  1.00 0.00 ? 843 MET A CE   9  
ATOM 7689 H H    . MET A 1 52 ? -1.173  -7.526  -4.056  1.00 0.00 ? 843 MET A H    9  
ATOM 7690 H HA   . MET A 1 52 ? 0.878   -5.926  -4.967  1.00 0.00 ? 843 MET A HA   9  
ATOM 7691 H HB2  . MET A 1 52 ? -0.584  -5.681  -2.326  1.00 0.00 ? 843 MET A HB2  9  
ATOM 7692 H HB3  . MET A 1 52 ? 0.352   -4.400  -3.095  1.00 0.00 ? 843 MET A HB3  9  
ATOM 7693 H HG2  . MET A 1 52 ? -1.289  -3.944  -4.611  1.00 0.00 ? 843 MET A HG2  9  
ATOM 7694 H HG3  . MET A 1 52 ? -1.655  -5.647  -4.865  1.00 0.00 ? 843 MET A HG3  9  
ATOM 7695 H HE1  . MET A 1 52 ? -1.278  -3.769  -1.604  1.00 0.00 ? 843 MET A HE1  9  
ATOM 7696 H HE2  . MET A 1 52 ? -2.909  -3.440  -1.035  1.00 0.00 ? 843 MET A HE2  9  
ATOM 7697 H HE3  . MET A 1 52 ? -2.267  -2.531  -2.395  1.00 0.00 ? 843 MET A HE3  9  
ATOM 7698 N N    . GLY A 1 53 ? 1.626   -7.240  -2.031  1.00 0.00 ? 844 GLY A N    9  
ATOM 7699 C CA   . GLY A 1 53 ? 2.735   -7.600  -1.158  1.00 0.00 ? 844 GLY A CA   9  
ATOM 7700 C C    . GLY A 1 53 ? 3.646   -8.621  -1.813  1.00 0.00 ? 844 GLY A C    9  
ATOM 7701 O O    . GLY A 1 53 ? 4.796   -8.794  -1.402  1.00 0.00 ? 844 GLY A O    9  
ATOM 7702 H H    . GLY A 1 53 ? 0.706   -7.444  -1.752  1.00 0.00 ? 844 GLY A H    9  
ATOM 7703 H HA2  . GLY A 1 53 ? 3.305   -6.712  -0.937  1.00 0.00 ? 844 GLY A HA2  9  
ATOM 7704 H HA3  . GLY A 1 53 ? 2.345   -8.013  -0.239  1.00 0.00 ? 844 GLY A HA3  9  
ATOM 7705 N N    . SER A 1 54 ? 3.132   -9.310  -2.817  1.00 0.00 ? 845 SER A N    9  
ATOM 7706 C CA   . SER A 1 54 ? 3.906   -10.324 -3.515  1.00 0.00 ? 845 SER A CA   9  
ATOM 7707 C C    . SER A 1 54 ? 4.479   -9.787  -4.826  1.00 0.00 ? 845 SER A C    9  
ATOM 7708 O O    . SER A 1 54 ? 5.429   -10.358 -5.374  1.00 0.00 ? 845 SER A O    9  
ATOM 7709 C CB   . SER A 1 54 ? 3.028   -11.539 -3.804  1.00 0.00 ? 845 SER A CB   9  
ATOM 7710 O OG   . SER A 1 54 ? 2.421   -11.988 -2.587  1.00 0.00 ? 845 SER A OG   9  
ATOM 7711 H H    . SER A 1 54 ? 2.204   -9.142  -3.094  1.00 0.00 ? 845 SER A H    9  
ATOM 7712 H HA   . SER A 1 54 ? 4.724   -10.639 -2.884  1.00 0.00 ? 845 SER A HA   9  
ATOM 7713 H HB2  . SER A 1 54 ? 2.255   -11.265 -4.507  1.00 0.00 ? 845 SER A HB2  9  
ATOM 7714 H HB3  . SER A 1 54 ? 3.635   -12.319 -4.240  1.00 0.00 ? 845 SER A HB3  9  
ATOM 7715 H HG   . SER A 1 54 ? 1.730   -11.342 -2.354  1.00 0.00 ? 845 SER A HG   9  
ATOM 7716 N N    . ASN A 1 55 ? 3.863   -8.739  -5.363  1.00 0.00 ? 846 ASN A N    9  
ATOM 7717 C CA   . ASN A 1 55 ? 4.282   -8.208  -6.657  1.00 0.00 ? 846 ASN A CA   9  
ATOM 7718 C C    . ASN A 1 55 ? 5.371   -7.159  -6.528  1.00 0.00 ? 846 ASN A C    9  
ATOM 7719 O O    . ASN A 1 55 ? 6.435   -7.295  -7.128  1.00 0.00 ? 846 ASN A O    9  
ATOM 7720 C CB   . ASN A 1 55 ? 3.084   -7.593  -7.382  1.00 0.00 ? 846 ASN A CB   9  
ATOM 7721 C CG   . ASN A 1 55 ? 3.552   -6.847  -8.627  1.00 0.00 ? 846 ASN A CG   9  
ATOM 7722 O OD1  . ASN A 1 55 ? 4.395   -7.355  -9.378  1.00 0.00 ? 846 ASN A OD1  9  
ATOM 7723 N ND2  . ASN A 1 55 ? 3.061   -5.677  -8.898  1.00 0.00 ? 846 ASN A ND2  9  
ATOM 7724 H H    . ASN A 1 55 ? 3.076   -8.358  -4.912  1.00 0.00 ? 846 ASN A H    9  
ATOM 7725 H HA   . ASN A 1 55 ? 4.652   -9.021  -7.262  1.00 0.00 ? 846 ASN A HA   9  
ATOM 7726 H HB2  . ASN A 1 55 ? 2.396   -8.373  -7.664  1.00 0.00 ? 846 ASN A HB2  9  
ATOM 7727 H HB3  . ASN A 1 55 ? 2.583   -6.900  -6.722  1.00 0.00 ? 846 ASN A HB3  9  
ATOM 7728 H HD21 . ASN A 1 55 ? 2.390   -5.277  -8.304  1.00 0.00 ? 846 ASN A HD21 9  
ATOM 7729 H HD22 . ASN A 1 55 ? 3.361   -5.189  -9.692  1.00 0.00 ? 846 ASN A HD22 9  
ATOM 7730 N N    . VAL A 1 56 ? 5.106   -6.104  -5.774  1.00 0.00 ? 847 VAL A N    9  
ATOM 7731 C CA   . VAL A 1 56 ? 6.087   -5.041  -5.624  1.00 0.00 ? 847 VAL A CA   9  
ATOM 7732 C C    . VAL A 1 56 ? 5.890   -4.271  -4.321  1.00 0.00 ? 847 VAL A C    9  
ATOM 7733 O O    . VAL A 1 56 ? 4.776   -3.850  -3.998  1.00 0.00 ? 847 VAL A O    9  
ATOM 7734 C CB   . VAL A 1 56 ? 6.022   -4.090  -6.835  1.00 0.00 ? 847 VAL A CB   9  
ATOM 7735 C CG1  . VAL A 1 56 ? 4.643   -3.422  -6.909  1.00 0.00 ? 847 VAL A CG1  9  
ATOM 7736 C CG2  . VAL A 1 56 ? 7.104   -3.012  -6.709  1.00 0.00 ? 847 VAL A CG2  9  
ATOM 7737 H H    . VAL A 1 56 ? 4.237   -6.027  -5.321  1.00 0.00 ? 847 VAL A H    9  
ATOM 7738 H HA   . VAL A 1 56 ? 7.069   -5.490  -5.605  1.00 0.00 ? 847 VAL A HA   9  
ATOM 7739 H HB   . VAL A 1 56 ? 6.185   -4.661  -7.738  1.00 0.00 ? 847 VAL A HB   9  
ATOM 7740 H HG11 . VAL A 1 56 ? 4.695   -2.447  -6.445  1.00 0.00 ? 847 VAL A HG11 9  
ATOM 7741 H HG12 . VAL A 1 56 ? 3.913   -4.026  -6.390  1.00 0.00 ? 847 VAL A HG12 9  
ATOM 7742 H HG13 . VAL A 1 56 ? 4.351   -3.311  -7.942  1.00 0.00 ? 847 VAL A HG13 9  
ATOM 7743 H HG21 . VAL A 1 56 ? 7.030   -2.536  -5.742  1.00 0.00 ? 847 VAL A HG21 9  
ATOM 7744 H HG22 . VAL A 1 56 ? 6.960   -2.272  -7.480  1.00 0.00 ? 847 VAL A HG22 9  
ATOM 7745 H HG23 . VAL A 1 56 ? 8.079   -3.461  -6.817  1.00 0.00 ? 847 VAL A HG23 9  
ATOM 7746 N N    . MET A 1 57 ? 6.978   -4.076  -3.594  1.00 0.00 ? 848 MET A N    9  
ATOM 7747 C CA   . MET A 1 57 ? 6.947   -3.319  -2.355  1.00 0.00 ? 848 MET A CA   9  
ATOM 7748 C C    . MET A 1 57 ? 8.196   -2.457  -2.251  1.00 0.00 ? 848 MET A C    9  
ATOM 7749 O O    . MET A 1 57 ? 9.278   -2.967  -1.938  1.00 0.00 ? 848 MET A O    9  
ATOM 7750 C CB   . MET A 1 57 ? 6.875   -4.266  -1.141  1.00 0.00 ? 848 MET A CB   9  
ATOM 7751 C CG   . MET A 1 57 ? 6.405   -5.660  -1.584  1.00 0.00 ? 848 MET A CG   9  
ATOM 7752 S SD   . MET A 1 57 ? 7.715   -6.467  -2.543  1.00 0.00 ? 848 MET A SD   9  
ATOM 7753 C CE   . MET A 1 57 ? 6.674   -7.691  -3.376  1.00 0.00 ? 848 MET A CE   9  
ATOM 7754 H H    . MET A 1 57 ? 7.834   -4.424  -3.910  1.00 0.00 ? 848 MET A H    9  
ATOM 7755 H HA   . MET A 1 57 ? 6.077   -2.679  -2.351  1.00 0.00 ? 848 MET A HA   9  
ATOM 7756 H HB2  . MET A 1 57 ? 7.854   -4.345  -0.689  1.00 0.00 ? 848 MET A HB2  9  
ATOM 7757 H HB3  . MET A 1 57 ? 6.180   -3.866  -0.420  1.00 0.00 ? 848 MET A HB3  9  
ATOM 7758 H HG2  . MET A 1 57 ? 6.186   -6.256  -0.713  1.00 0.00 ? 848 MET A HG2  9  
ATOM 7759 H HG3  . MET A 1 57 ? 5.515   -5.568  -2.189  1.00 0.00 ? 848 MET A HG3  9  
ATOM 7760 H HE1  . MET A 1 57 ? 6.759   -8.639  -2.864  1.00 0.00 ? 848 MET A HE1  9  
ATOM 7761 H HE2  . MET A 1 57 ? 7.002   -7.811  -4.396  1.00 0.00 ? 848 MET A HE2  9  
ATOM 7762 H HE3  . MET A 1 57 ? 5.646   -7.357  -3.371  1.00 0.00 ? 848 MET A HE3  9  
ATOM 7763 N N    . GLU A 1 58 ? 8.062   -1.167  -2.522  1.00 0.00 ? 849 GLU A N    9  
ATOM 7764 C CA   . GLU A 1 58 ? 9.207   -0.268  -2.452  1.00 0.00 ? 849 GLU A CA   9  
ATOM 7765 C C    . GLU A 1 58 ? 8.789   1.198   -2.570  1.00 0.00 ? 849 GLU A C    9  
ATOM 7766 O O    . GLU A 1 58 ? 7.604   1.531   -2.518  1.00 0.00 ? 849 GLU A O    9  
ATOM 7767 C CB   . GLU A 1 58 ? 10.236  -0.621  -3.537  1.00 0.00 ? 849 GLU A CB   9  
ATOM 7768 C CG   . GLU A 1 58 ? 11.567  -0.993  -2.876  1.00 0.00 ? 849 GLU A CG   9  
ATOM 7769 C CD   . GLU A 1 58 ? 12.136  0.209   -2.152  1.00 0.00 ? 849 GLU A CD   9  
ATOM 7770 O OE1  . GLU A 1 58 ? 12.227  1.244   -2.764  1.00 0.00 ? 849 GLU A OE1  9  
ATOM 7771 O OE2  . GLU A 1 58 ? 12.470  0.080   -0.997  1.00 0.00 ? 849 GLU A OE2  9  
ATOM 7772 H H    . GLU A 1 58 ? 7.183   -0.814  -2.791  1.00 0.00 ? 849 GLU A H    9  
ATOM 7773 H HA   . GLU A 1 58 ? 9.674   -0.405  -1.487  1.00 0.00 ? 849 GLU A HA   9  
ATOM 7774 N N    . ASP A 1 59 ? 9.788   2.067   -2.690  1.00 0.00 ? 850 ASP A N    9  
ATOM 7775 C CA   . ASP A 1 59 ? 9.568   3.509   -2.769  1.00 0.00 ? 850 ASP A CA   9  
ATOM 7776 C C    . ASP A 1 59 ? 8.719   3.883   -3.973  1.00 0.00 ? 850 ASP A C    9  
ATOM 7777 O O    . ASP A 1 59 ? 7.787   4.675   -3.860  1.00 0.00 ? 850 ASP A O    9  
ATOM 7778 C CB   . ASP A 1 59 ? 10.914  4.242   -2.857  1.00 0.00 ? 850 ASP A CB   9  
ATOM 7779 C CG   . ASP A 1 59 ? 11.095  5.144   -1.666  1.00 0.00 ? 850 ASP A CG   9  
ATOM 7780 O OD1  . ASP A 1 59 ? 11.524  4.661   -0.639  1.00 0.00 ? 850 ASP A OD1  9  
ATOM 7781 O OD2  . ASP A 1 59 ? 10.800  6.313   -1.784  1.00 0.00 ? 850 ASP A OD2  9  
ATOM 7782 H H    . ASP A 1 59 ? 10.712  1.727   -2.696  1.00 0.00 ? 850 ASP A H    9  
ATOM 7783 H HA   . ASP A 1 59 ? 9.064   3.833   -1.872  1.00 0.00 ? 850 ASP A HA   9  
ATOM 7784 N N    . GLN A 1 60 ? 9.091   3.360   -5.132  1.00 0.00 ? 851 GLN A N    9  
ATOM 7785 C CA   . GLN A 1 60 ? 8.408   3.700   -6.380  1.00 0.00 ? 851 GLN A CA   9  
ATOM 7786 C C    . GLN A 1 60 ? 6.893   3.614   -6.226  1.00 0.00 ? 851 GLN A C    9  
ATOM 7787 O O    . GLN A 1 60 ? 6.173   4.532   -6.614  1.00 0.00 ? 851 GLN A O    9  
ATOM 7788 C CB   . GLN A 1 60 ? 8.878   2.784   -7.515  1.00 0.00 ? 851 GLN A CB   9  
ATOM 7789 C CG   . GLN A 1 60 ? 10.411  2.685   -7.498  1.00 0.00 ? 851 GLN A CG   9  
ATOM 7790 C CD   . GLN A 1 60 ? 10.916  2.039   -8.784  1.00 0.00 ? 851 GLN A CD   9  
ATOM 7791 O OE1  . GLN A 1 60 ? 12.117  2.079   -9.067  1.00 0.00 ? 851 GLN A OE1  9  
ATOM 7792 N NE2  . GLN A 1 60 ? 10.081  1.453   -9.586  1.00 0.00 ? 851 GLN A NE2  9  
ATOM 7793 H H    . GLN A 1 60 ? 9.874   2.773   -5.156  1.00 0.00 ? 851 GLN A H    9  
ATOM 7794 H HA   . GLN A 1 60 ? 8.666   4.717   -6.638  1.00 0.00 ? 851 GLN A HA   9  
ATOM 7795 H HB2  . GLN A 1 60 ? 8.446   1.801   -7.389  1.00 0.00 ? 851 GLN A HB2  9  
ATOM 7796 H HB3  . GLN A 1 60 ? 8.559   3.199   -8.458  1.00 0.00 ? 851 GLN A HB3  9  
ATOM 7797 H HG2  . GLN A 1 60 ? 10.831  3.675   -7.407  1.00 0.00 ? 851 GLN A HG2  9  
ATOM 7798 H HG3  . GLN A 1 60 ? 10.723  2.087   -6.655  1.00 0.00 ? 851 GLN A HG3  9  
ATOM 7799 H HE21 . GLN A 1 60 ? 9.125   1.425   -9.367  1.00 0.00 ? 851 GLN A HE21 9  
ATOM 7800 H HE22 . GLN A 1 60 ? 10.403  1.037   -10.413 1.00 0.00 ? 851 GLN A HE22 9  
ATOM 7801 N N    . ASP A 1 61 ? 6.419   2.528   -5.643  1.00 0.00 ? 852 ASP A N    9  
ATOM 7802 C CA   . ASP A 1 61 ? 4.984   2.352   -5.428  1.00 0.00 ? 852 ASP A CA   9  
ATOM 7803 C C    . ASP A 1 61 ? 4.442   3.493   -4.589  1.00 0.00 ? 852 ASP A C    9  
ATOM 7804 O O    . ASP A 1 61 ? 3.531   4.219   -5.003  1.00 0.00 ? 852 ASP A O    9  
ATOM 7805 C CB   . ASP A 1 61 ? 4.703   1.015   -4.723  1.00 0.00 ? 852 ASP A CB   9  
ATOM 7806 C CG   . ASP A 1 61 ? 5.708   -0.034  -5.164  1.00 0.00 ? 852 ASP A CG   9  
ATOM 7807 O OD1  . ASP A 1 61 ? 5.895   -0.182  -6.361  1.00 0.00 ? 852 ASP A OD1  9  
ATOM 7808 O OD2  . ASP A 1 61 ? 6.292   -0.663  -4.306  1.00 0.00 ? 852 ASP A OD2  9  
ATOM 7809 H H    . ASP A 1 61 ? 7.041   1.834   -5.338  1.00 0.00 ? 852 ASP A H    9  
ATOM 7810 H HA   . ASP A 1 61 ? 4.484   2.351   -6.385  1.00 0.00 ? 852 ASP A HA   9  
ATOM 7811 N N    . LEU A 1 62 ? 5.032   3.678   -3.426  1.00 0.00 ? 853 LEU A N    9  
ATOM 7812 C CA   . LEU A 1 62 ? 4.626   4.754   -2.542  1.00 0.00 ? 853 LEU A CA   9  
ATOM 7813 C C    . LEU A 1 62 ? 4.741   6.080   -3.274  1.00 0.00 ? 853 LEU A C    9  
ATOM 7814 O O    . LEU A 1 62 ? 3.912   6.981   -3.100  1.00 0.00 ? 853 LEU A O    9  
ATOM 7815 C CB   . LEU A 1 62 ? 5.505   4.768   -1.290  1.00 0.00 ? 853 LEU A CB   9  
ATOM 7816 C CG   . LEU A 1 62 ? 5.541   3.362   -0.667  1.00 0.00 ? 853 LEU A CG   9  
ATOM 7817 C CD1  . LEU A 1 62 ? 6.810   3.204   0.169   1.00 0.00 ? 853 LEU A CD1  9  
ATOM 7818 C CD2  . LEU A 1 62 ? 4.310   3.159   0.224   1.00 0.00 ? 853 LEU A CD2  9  
ATOM 7819 H H    . LEU A 1 62 ? 5.772   3.087   -3.168  1.00 0.00 ? 853 LEU A H    9  
ATOM 7820 H HA   . LEU A 1 62 ? 3.598   4.600   -2.249  1.00 0.00 ? 853 LEU A HA   9  
ATOM 7821 H HB2  . LEU A 1 62 ? 6.506   5.071   -1.566  1.00 0.00 ? 853 LEU A HB2  9  
ATOM 7822 H HB3  . LEU A 1 62 ? 5.101   5.469   -0.577  1.00 0.00 ? 853 LEU A HB3  9  
ATOM 7823 H HG   . LEU A 1 62 ? 5.548   2.617   -1.450  1.00 0.00 ? 853 LEU A HG   9  
ATOM 7824 H HD11 . LEU A 1 62 ? 7.256   4.172   0.341   1.00 0.00 ? 853 LEU A HD11 9  
ATOM 7825 H HD12 . LEU A 1 62 ? 7.509   2.576   -0.362  1.00 0.00 ? 853 LEU A HD12 9  
ATOM 7826 H HD13 . LEU A 1 62 ? 6.563   2.746   1.115   1.00 0.00 ? 853 LEU A HD13 9  
ATOM 7827 H HD21 . LEU A 1 62 ? 4.543   2.444   1.001   1.00 0.00 ? 853 LEU A HD21 9  
ATOM 7828 H HD22 . LEU A 1 62 ? 3.494   2.781   -0.375  1.00 0.00 ? 853 LEU A HD22 9  
ATOM 7829 H HD23 . LEU A 1 62 ? 4.022   4.097   0.672   1.00 0.00 ? 853 LEU A HD23 9  
ATOM 7830 N N    . LEU A 1 63 ? 5.748   6.171   -4.128  1.00 0.00 ? 854 LEU A N    9  
ATOM 7831 C CA   . LEU A 1 63 ? 5.956   7.355   -4.940  1.00 0.00 ? 854 LEU A CA   9  
ATOM 7832 C C    . LEU A 1 63 ? 4.796   7.526   -5.903  1.00 0.00 ? 854 LEU A C    9  
ATOM 7833 O O    . LEU A 1 63 ? 4.227   8.611   -6.014  1.00 0.00 ? 854 LEU A O    9  
ATOM 7834 C CB   . LEU A 1 63 ? 7.272   7.246   -5.726  1.00 0.00 ? 854 LEU A CB   9  
ATOM 7835 C CG   . LEU A 1 63 ? 8.347   8.112   -5.062  1.00 0.00 ? 854 LEU A CG   9  
ATOM 7836 C CD1  . LEU A 1 63 ? 8.734   7.514   -3.710  1.00 0.00 ? 854 LEU A CD1  9  
ATOM 7837 C CD2  . LEU A 1 63 ? 9.585   8.172   -5.962  1.00 0.00 ? 854 LEU A CD2  9  
ATOM 7838 H H    . LEU A 1 63 ? 6.349   5.403   -4.233  1.00 0.00 ? 854 LEU A H    9  
ATOM 7839 H HA   . LEU A 1 63 ? 6.003   8.219   -4.295  1.00 0.00 ? 854 LEU A HA   9  
ATOM 7840 H HB2  . LEU A 1 63 ? 7.595   6.217   -5.742  1.00 0.00 ? 854 LEU A HB2  9  
ATOM 7841 H HB3  . LEU A 1 63 ? 7.113   7.586   -6.739  1.00 0.00 ? 854 LEU A HB3  9  
ATOM 7842 H HG   . LEU A 1 63 ? 7.960   9.108   -4.912  1.00 0.00 ? 854 LEU A HG   9  
ATOM 7843 H HD11 . LEU A 1 63 ? 7.843   7.297   -3.141  1.00 0.00 ? 854 LEU A HD11 9  
ATOM 7844 H HD12 . LEU A 1 63 ? 9.342   8.221   -3.168  1.00 0.00 ? 854 LEU A HD12 9  
ATOM 7845 H HD13 . LEU A 1 63 ? 9.293   6.603   -3.865  1.00 0.00 ? 854 LEU A HD13 9  
ATOM 7846 H HD21 . LEU A 1 63 ? 10.009  7.183   -6.060  1.00 0.00 ? 854 LEU A HD21 9  
ATOM 7847 H HD22 . LEU A 1 63 ? 10.317  8.835   -5.522  1.00 0.00 ? 854 LEU A HD22 9  
ATOM 7848 H HD23 . LEU A 1 63 ? 9.306   8.543   -6.937  1.00 0.00 ? 854 LEU A HD23 9  
ATOM 7849 N N    . GLU A 1 64 ? 4.431   6.441   -6.582  1.00 0.00 ? 855 GLU A N    9  
ATOM 7850 C CA   . GLU A 1 64 ? 3.315   6.472   -7.520  1.00 0.00 ? 855 GLU A CA   9  
ATOM 7851 C C    . GLU A 1 64 ? 2.108   7.148   -6.882  1.00 0.00 ? 855 GLU A C    9  
ATOM 7852 O O    . GLU A 1 64 ? 1.510   8.058   -7.467  1.00 0.00 ? 855 GLU A O    9  
ATOM 7853 C CB   . GLU A 1 64 ? 2.945   5.050   -7.962  1.00 0.00 ? 855 GLU A CB   9  
ATOM 7854 C CG   . GLU A 1 64 ? 3.933   4.562   -9.032  1.00 0.00 ? 855 GLU A CG   9  
ATOM 7855 C CD   . GLU A 1 64 ? 3.341   3.388   -9.789  1.00 0.00 ? 855 GLU A CD   9  
ATOM 7856 O OE1  . GLU A 1 64 ? 2.283   3.550   -10.354 1.00 0.00 ? 855 GLU A OE1  9  
ATOM 7857 O OE2  . GLU A 1 64 ? 3.958   2.347   -9.803  1.00 0.00 ? 855 GLU A OE2  9  
ATOM 7858 H H    . GLU A 1 64 ? 4.915   5.599   -6.437  1.00 0.00 ? 855 GLU A H    9  
ATOM 7859 H HA   . GLU A 1 64 ? 3.610   7.042   -8.390  1.00 0.00 ? 855 GLU A HA   9  
ATOM 7860 N N    . ILE A 1 65 ? 1.770   6.723   -5.669  1.00 0.00 ? 856 ILE A N    9  
ATOM 7861 C CA   . ILE A 1 65 ? 0.646   7.329   -4.950  1.00 0.00 ? 856 ILE A CA   9  
ATOM 7862 C C    . ILE A 1 65 ? 1.099   8.562   -4.177  1.00 0.00 ? 856 ILE A C    9  
ATOM 7863 O O    . ILE A 1 65 ? 0.306   9.195   -3.479  1.00 0.00 ? 856 ILE A O    9  
ATOM 7864 C CB   . ILE A 1 65 ? -0.047  6.326   -3.997  1.00 0.00 ? 856 ILE A CB   9  
ATOM 7865 C CG1  . ILE A 1 65 ? 0.890   5.146   -3.650  1.00 0.00 ? 856 ILE A CG1  9  
ATOM 7866 C CG2  . ILE A 1 65 ? -1.313  5.791   -4.664  1.00 0.00 ? 856 ILE A CG2  9  
ATOM 7867 C CD1  . ILE A 1 65 ? 0.685   3.999   -4.651  1.00 0.00 ? 856 ILE A CD1  9  
ATOM 7868 H H    . ILE A 1 65 ? 2.298   6.008   -5.252  1.00 0.00 ? 856 ILE A H    9  
ATOM 7869 H HA   . ILE A 1 65 ? -0.077  7.656   -5.683  1.00 0.00 ? 856 ILE A HA   9  
ATOM 7870 H HB   . ILE A 1 65 ? -0.328  6.847   -3.091  1.00 0.00 ? 856 ILE A HB   9  
ATOM 7871 H HG12 . ILE A 1 65 ? 1.920   5.465   -3.660  1.00 0.00 ? 856 ILE A HG12 9  
ATOM 7872 H HG21 . ILE A 1 65 ? -1.112  5.600   -5.707  1.00 0.00 ? 856 ILE A HG21 9  
ATOM 7873 H HG22 . ILE A 1 65 ? -2.103  6.523   -4.580  1.00 0.00 ? 856 ILE A HG22 9  
ATOM 7874 H HG23 . ILE A 1 65 ? -1.616  4.873   -4.184  1.00 0.00 ? 856 ILE A HG23 9  
ATOM 7875 H HD11 . ILE A 1 65 ? 0.754   4.380   -5.659  1.00 0.00 ? 856 ILE A HD11 9  
ATOM 7876 H HD12 . ILE A 1 65 ? -0.292  3.560   -4.500  1.00 0.00 ? 856 ILE A HD12 9  
ATOM 7877 H HD13 . ILE A 1 65 ? 1.443   3.246   -4.499  1.00 0.00 ? 856 ILE A HD13 9  
ATOM 7878 N N    . GLY A 1 66 ? 2.368   8.909   -4.323  1.00 0.00 ? 857 GLY A N    9  
ATOM 7879 C CA   . GLY A 1 66 ? 2.925   10.080  -3.652  1.00 0.00 ? 857 GLY A CA   9  
ATOM 7880 C C    . GLY A 1 66 ? 2.668   10.029  -2.156  1.00 0.00 ? 857 GLY A C    9  
ATOM 7881 O O    . GLY A 1 66 ? 2.297   11.034  -1.544  1.00 0.00 ? 857 GLY A O    9  
ATOM 7882 H H    . GLY A 1 66 ? 2.945   8.373   -4.905  1.00 0.00 ? 857 GLY A H    9  
ATOM 7883 H HA2  . GLY A 1 66 ? 3.990   10.113  -3.830  1.00 0.00 ? 857 GLY A HA2  9  
ATOM 7884 H HA3  . GLY A 1 66 ? 2.471   10.971  -4.057  1.00 0.00 ? 857 GLY A HA3  9  
ATOM 7885 N N    . ILE A 1 67 ? 2.859   8.862   -1.563  1.00 0.00 ? 858 ILE A N    9  
ATOM 7886 C CA   . ILE A 1 67 ? 2.642   8.701   -0.130  1.00 0.00 ? 858 ILE A CA   9  
ATOM 7887 C C    . ILE A 1 67 ? 3.627   9.569   0.661   1.00 0.00 ? 858 ILE A C    9  
ATOM 7888 O O    . ILE A 1 67 ? 4.700   9.112   1.050   1.00 0.00 ? 858 ILE A O    9  
ATOM 7889 C CB   . ILE A 1 67 ? 2.791   7.222   0.269   1.00 0.00 ? 858 ILE A CB   9  
ATOM 7890 C CG1  . ILE A 1 67 ? 1.908   6.343   -0.637  1.00 0.00 ? 858 ILE A CG1  9  
ATOM 7891 C CG2  . ILE A 1 67 ? 2.367   7.029   1.730   1.00 0.00 ? 858 ILE A CG2  9  
ATOM 7892 C CD1  . ILE A 1 67 ? 0.432   6.517   -0.257  1.00 0.00 ? 858 ILE A CD1  9  
ATOM 7893 H H    . ILE A 1 67 ? 3.159   8.094   -2.101  1.00 0.00 ? 858 ILE A H    9  
ATOM 7894 H HA   . ILE A 1 67 ? 1.638   9.021   0.104   1.00 0.00 ? 858 ILE A HA   9  
ATOM 7895 H HB   . ILE A 1 67 ? 3.827   6.935   0.156   1.00 0.00 ? 858 ILE A HB   9  
ATOM 7896 H HG12 . ILE A 1 67 ? 2.049   6.629   -1.669  1.00 0.00 ? 858 ILE A HG12 9  
ATOM 7897 H HG21 . ILE A 1 67 ? 1.372   7.426   1.873   1.00 0.00 ? 858 ILE A HG21 9  
ATOM 7898 H HG22 . ILE A 1 67 ? 3.056   7.546   2.381   1.00 0.00 ? 858 ILE A HG22 9  
ATOM 7899 H HG23 . ILE A 1 67 ? 2.369   5.976   1.969   1.00 0.00 ? 858 ILE A HG23 9  
ATOM 7900 H HD11 . ILE A 1 67 ? 0.277   6.174   0.756   1.00 0.00 ? 858 ILE A HD11 9  
ATOM 7901 H HD12 . ILE A 1 67 ? -0.185  5.938   -0.928  1.00 0.00 ? 858 ILE A HD12 9  
ATOM 7902 H HD13 . ILE A 1 67 ? 0.158   7.559   -0.329  1.00 0.00 ? 858 ILE A HD13 9  
ATOM 7903 N N    . LEU A 1 68 ? 3.260   10.830  0.869   1.00 0.00 ? 859 LEU A N    9  
ATOM 7904 C CA   . LEU A 1 68 ? 4.117   11.773  1.593   1.00 0.00 ? 859 LEU A CA   9  
ATOM 7905 C C    . LEU A 1 68 ? 4.476   11.241  2.974   1.00 0.00 ? 859 LEU A C    9  
ATOM 7906 O O    . LEU A 1 68 ? 5.598   11.423  3.449   1.00 0.00 ? 859 LEU A O    9  
ATOM 7907 C CB   . LEU A 1 68 ? 3.419   13.131  1.743   1.00 0.00 ? 859 LEU A CB   9  
ATOM 7908 C CG   . LEU A 1 68 ? 2.781   13.547  0.410   1.00 0.00 ? 859 LEU A CG   9  
ATOM 7909 C CD1  . LEU A 1 68 ? 1.266   13.327  0.467   1.00 0.00 ? 859 LEU A CD1  9  
ATOM 7910 C CD2  . LEU A 1 68 ? 3.071   15.027  0.145   1.00 0.00 ? 859 LEU A CD2  9  
ATOM 7911 H H    . LEU A 1 68 ? 2.401   11.140  0.510   1.00 0.00 ? 859 LEU A H    9  
ATOM 7912 H HA   . LEU A 1 68 ? 5.025   11.918  1.027   1.00 0.00 ? 859 LEU A HA   9  
ATOM 7913 H HB2  . LEU A 1 68 ? 2.661   13.063  2.511   1.00 0.00 ? 859 LEU A HB2  9  
ATOM 7914 H HB3  . LEU A 1 68 ? 4.151   13.872  2.035   1.00 0.00 ? 859 LEU A HB3  9  
ATOM 7915 H HG   . LEU A 1 68 ? 3.193   12.951  -0.391  1.00 0.00 ? 859 LEU A HG   9  
ATOM 7916 H HD11 . LEU A 1 68 ? 1.027   12.596  1.224   1.00 0.00 ? 859 LEU A HD11 9  
ATOM 7917 H HD12 . LEU A 1 68 ? 0.924   12.972  -0.494  1.00 0.00 ? 859 LEU A HD12 9  
ATOM 7918 H HD13 . LEU A 1 68 ? 0.774   14.261  0.697   1.00 0.00 ? 859 LEU A HD13 9  
ATOM 7919 H HD21 . LEU A 1 68 ? 2.624   15.629  0.921   1.00 0.00 ? 859 LEU A HD21 9  
ATOM 7920 H HD22 . LEU A 1 68 ? 2.655   15.307  -0.811  1.00 0.00 ? 859 LEU A HD22 9  
ATOM 7921 H HD23 . LEU A 1 68 ? 4.139   15.188  0.132   1.00 0.00 ? 859 LEU A HD23 9  
ATOM 7922 N N    . ASN A 1 69 ? 3.506   10.630  3.633   1.00 0.00 ? 860 ASN A N    9  
ATOM 7923 C CA   . ASN A 1 69 ? 3.719   10.116  4.984   1.00 0.00 ? 860 ASN A CA   9  
ATOM 7924 C C    . ASN A 1 69 ? 4.719   8.967   4.984   1.00 0.00 ? 860 ASN A C    9  
ATOM 7925 O O    . ASN A 1 69 ? 4.338   7.792   4.932   1.00 0.00 ? 860 ASN A O    9  
ATOM 7926 C CB   . ASN A 1 69 ? 2.392   9.673   5.639   1.00 0.00 ? 860 ASN A CB   9  
ATOM 7927 C CG   . ASN A 1 69 ? 1.251   9.687   4.626   1.00 0.00 ? 860 ASN A CG   9  
ATOM 7928 O OD1  . ASN A 1 69 ? 1.011   8.692   3.938   1.00 0.00 ? 860 ASN A OD1  9  
ATOM 7929 N ND2  . ASN A 1 69 ? 0.529   10.758  4.486   1.00 0.00 ? 860 ASN A ND2  9  
ATOM 7930 H H    . ASN A 1 69 ? 2.627   10.543  3.212   1.00 0.00 ? 860 ASN A H    9  
ATOM 7931 H HA   . ASN A 1 69 ? 4.134   10.917  5.577   1.00 0.00 ? 860 ASN A HA   9  
ATOM 7932 H HB2  . ASN A 1 69 ? 2.503   8.679   6.042   1.00 0.00 ? 860 ASN A HB2  9  
ATOM 7933 H HB3  . ASN A 1 69 ? 2.156   10.349  6.446   1.00 0.00 ? 860 ASN A HB3  9  
ATOM 7934 H HD21 . ASN A 1 69 ? 0.719   11.553  5.030   1.00 0.00 ? 860 ASN A HD21 9  
ATOM 7935 H HD22 . ASN A 1 69 ? -0.207  10.775  3.840   1.00 0.00 ? 860 ASN A HD22 9  
ATOM 7936 N N    . SER A 1 70 ? 5.997   9.311   5.054   1.00 0.00 ? 861 SER A N    9  
ATOM 7937 C CA   . SER A 1 70 ? 7.064   8.316   5.077   1.00 0.00 ? 861 SER A CA   9  
ATOM 7938 C C    . SER A 1 70 ? 6.742   7.205   6.073   1.00 0.00 ? 861 SER A C    9  
ATOM 7939 O O    . SER A 1 70 ? 6.926   6.019   5.783   1.00 0.00 ? 861 SER A O    9  
ATOM 7940 C CB   . SER A 1 70 ? 8.388   8.985   5.441   1.00 0.00 ? 861 SER A CB   9  
ATOM 7941 O OG   . SER A 1 70 ? 8.342   10.362  5.049   1.00 0.00 ? 861 SER A OG   9  
ATOM 7942 H H    . SER A 1 70 ? 6.234   10.262  5.097   1.00 0.00 ? 861 SER A H    9  
ATOM 7943 H HA   . SER A 1 70 ? 7.155   7.882   4.092   1.00 0.00 ? 861 SER A HA   9  
ATOM 7944 H HB2  . SER A 1 70 ? 8.548   8.927   6.506   1.00 0.00 ? 861 SER A HB2  9  
ATOM 7945 H HB3  . SER A 1 70 ? 9.197   8.476   4.935   1.00 0.00 ? 861 SER A HB3  9  
ATOM 7946 H HG   . SER A 1 70 ? 9.251   10.697  5.055   1.00 0.00 ? 861 SER A HG   9  
ATOM 7947 N N    . GLY A 1 71 ? 6.230   7.588   7.231   1.00 0.00 ? 862 GLY A N    9  
ATOM 7948 C CA   . GLY A 1 71 ? 5.853   6.611   8.236   1.00 0.00 ? 862 GLY A CA   9  
ATOM 7949 C C    . GLY A 1 71 ? 4.851   5.628   7.654   1.00 0.00 ? 862 GLY A C    9  
ATOM 7950 O O    . GLY A 1 71 ? 5.060   4.410   7.695   1.00 0.00 ? 862 GLY A O    9  
ATOM 7951 H H    . GLY A 1 71 ? 6.081   8.542   7.401   1.00 0.00 ? 862 GLY A H    9  
ATOM 7952 H HA2  . GLY A 1 71 ? 6.734   6.078   8.561   1.00 0.00 ? 862 GLY A HA2  9  
ATOM 7953 H HA3  . GLY A 1 71 ? 5.407   7.116   9.077   1.00 0.00 ? 862 GLY A HA3  9  
ATOM 7954 N N    . HIS A 1 72 ? 3.785   6.162   7.062   1.00 0.00 ? 863 HIS A N    9  
ATOM 7955 C CA   . HIS A 1 72 ? 2.781   5.324   6.428   1.00 0.00 ? 863 HIS A CA   9  
ATOM 7956 C C    . HIS A 1 72 ? 3.426   4.464   5.358   1.00 0.00 ? 863 HIS A C    9  
ATOM 7957 O O    . HIS A 1 72 ? 3.125   3.282   5.240   1.00 0.00 ? 863 HIS A O    9  
ATOM 7958 C CB   . HIS A 1 72 ? 1.662   6.174   5.809   1.00 0.00 ? 863 HIS A CB   9  
ATOM 7959 C CG   . HIS A 1 72 ? 0.807   6.772   6.902   1.00 0.00 ? 863 HIS A CG   9  
ATOM 7960 N ND1  . HIS A 1 72 ? -0.304  7.558   6.627   1.00 0.00 ? 863 HIS A ND1  9  
ATOM 7961 C CD2  . HIS A 1 72 ? 0.885   6.703   8.273   1.00 0.00 ? 863 HIS A CD2  9  
ATOM 7962 C CE1  . HIS A 1 72 ? -0.843  7.925   7.806   1.00 0.00 ? 863 HIS A CE1  9  
ATOM 7963 N NE2  . HIS A 1 72 ? -0.157  7.430   8.841   1.00 0.00 ? 863 HIS A NE2  9  
ATOM 7964 H H    . HIS A 1 72 ? 3.693   7.137   7.026   1.00 0.00 ? 863 HIS A H    9  
ATOM 7965 H HA   . HIS A 1 72 ? 2.350   4.678   7.178   1.00 0.00 ? 863 HIS A HA   9  
ATOM 7966 H HB2  . HIS A 1 72 ? 2.096   6.958   5.208   1.00 0.00 ? 863 HIS A HB2  9  
ATOM 7967 H HB3  . HIS A 1 72 ? 1.048   5.545   5.179   1.00 0.00 ? 863 HIS A HB3  9  
ATOM 7968 N N    . ARG A 1 73 ? 4.345   5.056   4.598   1.00 0.00 ? 864 ARG A N    9  
ATOM 7969 C CA   . ARG A 1 73 ? 5.052   4.310   3.562   1.00 0.00 ? 864 ARG A CA   9  
ATOM 7970 C C    . ARG A 1 73 ? 5.646   3.045   4.157   1.00 0.00 ? 864 ARG A C    9  
ATOM 7971 O O    . ARG A 1 73 ? 5.353   1.934   3.708   1.00 0.00 ? 864 ARG A O    9  
ATOM 7972 C CB   . ARG A 1 73 ? 6.178   5.154   2.953   1.00 0.00 ? 864 ARG A CB   9  
ATOM 7973 C CG   . ARG A 1 73 ? 5.595   6.355   2.200   1.00 0.00 ? 864 ARG A CG   9  
ATOM 7974 C CD   . ARG A 1 73 ? 6.691   7.012   1.341   1.00 0.00 ? 864 ARG A CD   9  
ATOM 7975 N NE   . ARG A 1 73 ? 8.006   6.448   1.667   1.00 0.00 ? 864 ARG A NE   9  
ATOM 7976 C CZ   . ARG A 1 73 ? 8.946   6.266   0.740   1.00 0.00 ? 864 ARG A CZ   9  
ATOM 7977 N NH1  . ARG A 1 73 ? 8.763   6.707   -0.476  1.00 0.00 ? 864 ARG A NH1  9  
ATOM 7978 N NH2  . ARG A 1 73 ? 10.060  5.678   1.060   1.00 0.00 ? 864 ARG A NH2  9  
ATOM 7979 H H    . ARG A 1 73 ? 4.561   6.003   4.754   1.00 0.00 ? 864 ARG A H    9  
ATOM 7980 H HA   . ARG A 1 73 ? 4.354   4.040   2.785   1.00 0.00 ? 864 ARG A HA   9  
ATOM 7981 N N    . GLN A 1 74 ? 6.459   3.221   5.188   1.00 0.00 ? 865 GLN A N    9  
ATOM 7982 C CA   . GLN A 1 74 ? 7.074   2.094   5.864   1.00 0.00 ? 865 GLN A CA   9  
ATOM 7983 C C    . GLN A 1 74 ? 6.001   1.182   6.427   1.00 0.00 ? 865 GLN A C    9  
ATOM 7984 O O    . GLN A 1 74 ? 6.086   -0.042  6.314   1.00 0.00 ? 865 GLN A O    9  
ATOM 7985 C CB   . GLN A 1 74 ? 7.992   2.583   6.989   1.00 0.00 ? 865 GLN A CB   9  
ATOM 7986 C CG   . GLN A 1 74 ? 9.015   3.583   6.427   1.00 0.00 ? 865 GLN A CG   9  
ATOM 7987 C CD   . GLN A 1 74 ? 10.429  3.048   6.613   1.00 0.00 ? 865 GLN A CD   9  
ATOM 7988 O OE1  . GLN A 1 74 ? 11.205  3.597   7.395   1.00 0.00 ? 865 GLN A OE1  9  
ATOM 7989 N NE2  . GLN A 1 74 ? 10.811  2.000   5.948   1.00 0.00 ? 865 GLN A NE2  9  
ATOM 7990 H H    . GLN A 1 74 ? 6.632   4.132   5.514   1.00 0.00 ? 865 GLN A H    9  
ATOM 7991 H HA   . GLN A 1 74 ? 7.663   1.536   5.150   1.00 0.00 ? 865 GLN A HA   9  
ATOM 7992 H HB2  . GLN A 1 74 ? 7.398   3.063   7.754   1.00 0.00 ? 865 GLN A HB2  9  
ATOM 7993 H HB3  . GLN A 1 74 ? 8.513   1.740   7.417   1.00 0.00 ? 865 GLN A HB3  9  
ATOM 7994 H HG2  . GLN A 1 74 ? 8.829   3.745   5.375   1.00 0.00 ? 865 GLN A HG2  9  
ATOM 7995 H HG3  . GLN A 1 74 ? 8.920   4.523   6.951   1.00 0.00 ? 865 GLN A HG3  9  
ATOM 7996 H HE21 . GLN A 1 74 ? 10.193  1.556   5.331   1.00 0.00 ? 865 GLN A HE21 9  
ATOM 7997 H HE22 . GLN A 1 74 ? 11.722  1.653   6.063   1.00 0.00 ? 865 GLN A HE22 9  
ATOM 7998 N N    . ARG A 1 75 ? 4.968   1.787   7.006   1.00 0.00 ? 866 ARG A N    9  
ATOM 7999 C CA   . ARG A 1 75 ? 3.862   1.023   7.561   1.00 0.00 ? 866 ARG A CA   9  
ATOM 8000 C C    . ARG A 1 75 ? 3.236   0.156   6.475   1.00 0.00 ? 866 ARG A C    9  
ATOM 8001 O O    . ARG A 1 75 ? 3.082   -1.056  6.644   1.00 0.00 ? 866 ARG A O    9  
ATOM 8002 C CB   . ARG A 1 75 ? 2.810   1.969   8.159   1.00 0.00 ? 866 ARG A CB   9  
ATOM 8003 C CG   . ARG A 1 75 ? 1.563   1.178   8.585   1.00 0.00 ? 866 ARG A CG   9  
ATOM 8004 C CD   . ARG A 1 75 ? 1.953   0.088   9.590   1.00 0.00 ? 866 ARG A CD   9  
ATOM 8005 N NE   . ARG A 1 75 ? 0.876   -0.120  10.551  1.00 0.00 ? 866 ARG A NE   9  
ATOM 8006 C CZ   . ARG A 1 75 ? 1.031   -0.895  11.623  1.00 0.00 ? 866 ARG A CZ   9  
ATOM 8007 N NH1  . ARG A 1 75 ? 2.175   -1.492  11.842  1.00 0.00 ? 866 ARG A NH1  9  
ATOM 8008 N NH2  . ARG A 1 75 ? 0.040   -1.053  12.455  1.00 0.00 ? 866 ARG A NH2  9  
ATOM 8009 H H    . ARG A 1 75 ? 4.945   2.769   7.044   1.00 0.00 ? 866 ARG A H    9  
ATOM 8010 H HA   . ARG A 1 75 ? 4.243   0.388   8.346   1.00 0.00 ? 866 ARG A HA   9  
ATOM 8011 N N    . ILE A 1 76 ? 2.917   0.771   5.345   1.00 0.00 ? 867 ILE A N    9  
ATOM 8012 C CA   . ILE A 1 76 ? 2.361   0.035   4.225   1.00 0.00 ? 867 ILE A CA   9  
ATOM 8013 C C    . ILE A 1 76 ? 3.343   -1.044  3.793   1.00 0.00 ? 867 ILE A C    9  
ATOM 8014 O O    . ILE A 1 76 ? 2.960   -2.194  3.564   1.00 0.00 ? 867 ILE A O    9  
ATOM 8015 C CB   . ILE A 1 76 ? 2.068   0.986   3.047   1.00 0.00 ? 867 ILE A CB   9  
ATOM 8016 C CG1  . ILE A 1 76 ? 1.040   2.049   3.482   1.00 0.00 ? 867 ILE A CG1  9  
ATOM 8017 C CG2  . ILE A 1 76 ? 1.514   0.193   1.856   1.00 0.00 ? 867 ILE A CG2  9  
ATOM 8018 C CD1  . ILE A 1 76 ? -0.388  1.528   3.267   1.00 0.00 ? 867 ILE A CD1  9  
ATOM 8019 H H    . ILE A 1 76 ? 3.090   1.733   5.253   1.00 0.00 ? 867 ILE A H    9  
ATOM 8020 H HA   . ILE A 1 76 ? 1.439   -0.434  4.536   1.00 0.00 ? 867 ILE A HA   9  
ATOM 8021 H HB   . ILE A 1 76 ? 2.988   1.472   2.751   1.00 0.00 ? 867 ILE A HB   9  
ATOM 8022 H HG12 . ILE A 1 76 ? 1.182   2.276   4.527   1.00 0.00 ? 867 ILE A HG12 9  
ATOM 8023 H HG21 . ILE A 1 76 ? 1.150   0.880   1.106   1.00 0.00 ? 867 ILE A HG21 9  
ATOM 8024 H HG22 . ILE A 1 76 ? 0.703   -0.437  2.187   1.00 0.00 ? 867 ILE A HG22 9  
ATOM 8025 H HG23 . ILE A 1 76 ? 2.297   -0.418  1.432   1.00 0.00 ? 867 ILE A HG23 9  
ATOM 8026 H HD11 . ILE A 1 76 ? -1.085  2.154   3.803   1.00 0.00 ? 867 ILE A HD11 9  
ATOM 8027 H HD12 . ILE A 1 76 ? -0.462  0.513   3.630   1.00 0.00 ? 867 ILE A HD12 9  
ATOM 8028 H HD13 . ILE A 1 76 ? -0.624  1.550   2.214   1.00 0.00 ? 867 ILE A HD13 9  
ATOM 8029 N N    . LEU A 1 77 ? 4.615   -0.665  3.684   1.00 0.00 ? 868 LEU A N    9  
ATOM 8030 C CA   . LEU A 1 77 ? 5.651   -1.602  3.276   1.00 0.00 ? 868 LEU A CA   9  
ATOM 8031 C C    . LEU A 1 77 ? 5.691   -2.802  4.209   1.00 0.00 ? 868 LEU A C    9  
ATOM 8032 O O    . LEU A 1 77 ? 5.565   -3.944  3.767   1.00 0.00 ? 868 LEU A O    9  
ATOM 8033 C CB   . LEU A 1 77 ? 7.023   -0.915  3.264   1.00 0.00 ? 868 LEU A CB   9  
ATOM 8034 C CG   . LEU A 1 77 ? 7.129   0.023   2.054   1.00 0.00 ? 868 LEU A CG   9  
ATOM 8035 C CD1  . LEU A 1 77 ? 8.243   1.047   2.291   1.00 0.00 ? 868 LEU A CD1  9  
ATOM 8036 C CD2  . LEU A 1 77 ? 7.451   -0.791  0.794   1.00 0.00 ? 868 LEU A CD2  9  
ATOM 8037 H H    . LEU A 1 77 ? 4.857   0.267   3.882   1.00 0.00 ? 868 LEU A H    9  
ATOM 8038 H HA   . LEU A 1 77 ? 5.432   -1.950  2.280   1.00 0.00 ? 868 LEU A HA   9  
ATOM 8039 H HB2  . LEU A 1 77 ? 7.144   -0.349  4.176   1.00 0.00 ? 868 LEU A HB2  9  
ATOM 8040 H HB3  . LEU A 1 77 ? 7.799   -1.664  3.207   1.00 0.00 ? 868 LEU A HB3  9  
ATOM 8041 H HG   . LEU A 1 77 ? 6.191   0.544   1.920   1.00 0.00 ? 868 LEU A HG   9  
ATOM 8042 H HD11 . LEU A 1 77 ? 9.002   0.618   2.928   1.00 0.00 ? 868 LEU A HD11 9  
ATOM 8043 H HD12 . LEU A 1 77 ? 7.829   1.924   2.768   1.00 0.00 ? 868 LEU A HD12 9  
ATOM 8044 H HD13 . LEU A 1 77 ? 8.683   1.328   1.346   1.00 0.00 ? 868 LEU A HD13 9  
ATOM 8045 H HD21 . LEU A 1 77 ? 7.676   -0.118  -0.019  1.00 0.00 ? 868 LEU A HD21 9  
ATOM 8046 H HD22 . LEU A 1 77 ? 6.598   -1.399  0.528   1.00 0.00 ? 868 LEU A HD22 9  
ATOM 8047 H HD23 . LEU A 1 77 ? 8.304   -1.428  0.980   1.00 0.00 ? 868 LEU A HD23 9  
ATOM 8048 N N    . GLN A 1 78 ? 5.845   -2.542  5.501   1.00 0.00 ? 869 GLN A N    9  
ATOM 8049 C CA   . GLN A 1 78 ? 5.889   -3.622  6.479   1.00 0.00 ? 869 GLN A CA   9  
ATOM 8050 C C    . GLN A 1 78 ? 4.593   -4.407  6.453   1.00 0.00 ? 869 GLN A C    9  
ATOM 8051 O O    . GLN A 1 78 ? 4.602   -5.636  6.488   1.00 0.00 ? 869 GLN A O    9  
ATOM 8052 C CB   . GLN A 1 78 ? 6.166   -3.083  7.897   1.00 0.00 ? 869 GLN A CB   9  
ATOM 8053 C CG   . GLN A 1 78 ? 5.017   -2.178  8.354   1.00 0.00 ? 869 GLN A CG   9  
ATOM 8054 C CD   . GLN A 1 78 ? 5.168   -1.829  9.829   1.00 0.00 ? 869 GLN A CD   9  
ATOM 8055 O OE1  . GLN A 1 78 ? 4.174   -1.567  10.509  1.00 0.00 ? 869 GLN A OE1  9  
ATOM 8056 N NE2  . GLN A 1 78 ? 6.346   -1.809  10.369  1.00 0.00 ? 869 GLN A NE2  9  
ATOM 8057 H H    . GLN A 1 78 ? 5.925   -1.610  5.797   1.00 0.00 ? 869 GLN A H    9  
ATOM 8058 H HA   . GLN A 1 78 ? 6.691   -4.291  6.205   1.00 0.00 ? 869 GLN A HA   9  
ATOM 8059 H HB2  . GLN A 1 78 ? 6.259   -3.914  8.582   1.00 0.00 ? 869 GLN A HB2  9  
ATOM 8060 H HB3  . GLN A 1 78 ? 7.086   -2.517  7.893   1.00 0.00 ? 869 GLN A HB3  9  
ATOM 8061 H HG2  . GLN A 1 78 ? 5.031   -1.272  7.775   1.00 0.00 ? 869 GLN A HG2  9  
ATOM 8062 H HG3  . GLN A 1 78 ? 4.074   -2.682  8.210   1.00 0.00 ? 869 GLN A HG3  9  
ATOM 8063 H HE21 . GLN A 1 78 ? 7.136   -2.015  9.829   1.00 0.00 ? 869 GLN A HE21 9  
ATOM 8064 H HE22 . GLN A 1 78 ? 6.446   -1.587  11.317  1.00 0.00 ? 869 GLN A HE22 9  
ATOM 8065 N N    . ALA A 1 79 ? 3.479   -3.695  6.361   1.00 0.00 ? 870 ALA A N    9  
ATOM 8066 C CA   . ALA A 1 79 ? 2.183   -4.341  6.308   1.00 0.00 ? 870 ALA A CA   9  
ATOM 8067 C C    . ALA A 1 79 ? 2.126   -5.265  5.112   1.00 0.00 ? 870 ALA A C    9  
ATOM 8068 O O    . ALA A 1 79 ? 1.775   -6.436  5.236   1.00 0.00 ? 870 ALA A O    9  
ATOM 8069 C CB   . ALA A 1 79 ? 1.070   -3.298  6.214   1.00 0.00 ? 870 ALA A CB   9  
ATOM 8070 H H    . ALA A 1 79 ? 3.534   -2.714  6.314   1.00 0.00 ? 870 ALA A H    9  
ATOM 8071 H HA   . ALA A 1 79 ? 2.043   -4.921  7.208   1.00 0.00 ? 870 ALA A HA   9  
ATOM 8072 H HB1  . ALA A 1 79 ? 1.260   -2.641  5.378   1.00 0.00 ? 870 ALA A HB1  9  
ATOM 8073 H HB2  . ALA A 1 79 ? 1.038   -2.719  7.126   1.00 0.00 ? 870 ALA A HB2  9  
ATOM 8074 H HB3  . ALA A 1 79 ? 0.125   -3.798  6.070   1.00 0.00 ? 870 ALA A HB3  9  
ATOM 8075 N N    . ILE A 1 80 ? 2.524   -4.748  3.959   1.00 0.00 ? 871 ILE A N    9  
ATOM 8076 C CA   . ILE A 1 80 ? 2.558   -5.552  2.754   1.00 0.00 ? 871 ILE A CA   9  
ATOM 8077 C C    . ILE A 1 80 ? 3.536   -6.707  2.943   1.00 0.00 ? 871 ILE A C    9  
ATOM 8078 O O    . ILE A 1 80 ? 3.211   -7.863  2.667   1.00 0.00 ? 871 ILE A O    9  
ATOM 8079 C CB   . ILE A 1 80 ? 2.936   -4.674  1.528   1.00 0.00 ? 871 ILE A CB   9  
ATOM 8080 C CG1  . ILE A 1 80 ? 1.803   -4.731  0.487   1.00 0.00 ? 871 ILE A CG1  9  
ATOM 8081 C CG2  . ILE A 1 80 ? 4.246   -5.155  0.886   1.00 0.00 ? 871 ILE A CG2  9  
ATOM 8082 C CD1  . ILE A 1 80 ? 2.219   -3.974  -0.780  1.00 0.00 ? 871 ILE A CD1  9  
ATOM 8083 H H    . ILE A 1 80 ? 2.832   -3.815  3.930   1.00 0.00 ? 871 ILE A H    9  
ATOM 8084 H HA   . ILE A 1 80 ? 1.573   -5.964  2.599   1.00 0.00 ? 871 ILE A HA   9  
ATOM 8085 H HB   . ILE A 1 80 ? 3.068   -3.652  1.854   1.00 0.00 ? 871 ILE A HB   9  
ATOM 8086 H HG12 . ILE A 1 80 ? 1.594   -5.759  0.236   1.00 0.00 ? 871 ILE A HG12 9  
ATOM 8087 H HG21 . ILE A 1 80 ? 4.359   -4.691  -0.083  1.00 0.00 ? 871 ILE A HG21 9  
ATOM 8088 H HG22 . ILE A 1 80 ? 4.227   -6.228  0.764   1.00 0.00 ? 871 ILE A HG22 9  
ATOM 8089 H HG23 . ILE A 1 80 ? 5.078   -4.876  1.514   1.00 0.00 ? 871 ILE A HG23 9  
ATOM 8090 H HD11 . ILE A 1 80 ? 1.356   -3.490  -1.211  1.00 0.00 ? 871 ILE A HD11 9  
ATOM 8091 H HD12 . ILE A 1 80 ? 2.637   -4.668  -1.495  1.00 0.00 ? 871 ILE A HD12 9  
ATOM 8092 H HD13 . ILE A 1 80 ? 2.962   -3.229  -0.531  1.00 0.00 ? 871 ILE A HD13 9  
ATOM 8093 N N    . GLN A 1 81 ? 4.719   -6.392  3.453   1.00 0.00 ? 872 GLN A N    9  
ATOM 8094 C CA   . GLN A 1 81 ? 5.726   -7.410  3.710   1.00 0.00 ? 872 GLN A CA   9  
ATOM 8095 C C    . GLN A 1 81 ? 5.192   -8.444  4.692   1.00 0.00 ? 872 GLN A C    9  
ATOM 8096 O O    . GLN A 1 81 ? 5.684   -9.574  4.748   1.00 0.00 ? 872 GLN A O    9  
ATOM 8097 C CB   . GLN A 1 81 ? 7.001   -6.771  4.275   1.00 0.00 ? 872 GLN A CB   9  
ATOM 8098 C CG   . GLN A 1 81 ? 7.585   -5.778  3.257   1.00 0.00 ? 872 GLN A CG   9  
ATOM 8099 C CD   . GLN A 1 81 ? 8.899   -6.307  2.706   1.00 0.00 ? 872 GLN A CD   9  
ATOM 8100 O OE1  . GLN A 1 81 ? 8.990   -7.479  2.337   1.00 0.00 ? 872 GLN A OE1  9  
ATOM 8101 N NE2  . GLN A 1 81 ? 9.929   -5.524  2.631   1.00 0.00 ? 872 GLN A NE2  9  
ATOM 8102 H H    . GLN A 1 81 ? 4.910   -5.454  3.680   1.00 0.00 ? 872 GLN A H    9  
ATOM 8103 H HA   . GLN A 1 81 ? 5.967   -7.904  2.782   1.00 0.00 ? 872 GLN A HA   9  
ATOM 8104 H HB2  . GLN A 1 81 ? 6.768   -6.253  5.193   1.00 0.00 ? 872 GLN A HB2  9  
ATOM 8105 H HB3  . GLN A 1 81 ? 7.730   -7.543  4.475   1.00 0.00 ? 872 GLN A HB3  9  
ATOM 8106 H HG2  . GLN A 1 81 ? 6.887   -5.638  2.444   1.00 0.00 ? 872 GLN A HG2  9  
ATOM 8107 H HG3  . GLN A 1 81 ? 7.761   -4.830  3.745   1.00 0.00 ? 872 GLN A HG3  9  
ATOM 8108 H HE21 . GLN A 1 81 ? 9.862   -4.593  2.929   1.00 0.00 ? 872 GLN A HE21 9  
ATOM 8109 H HE22 . GLN A 1 81 ? 10.777  -5.861  2.273   1.00 0.00 ? 872 GLN A HE22 9  
ATOM 8110 N N    . LEU A 1 82 ? 4.193   -8.055  5.469   1.00 0.00 ? 873 LEU A N    9  
ATOM 8111 C CA   . LEU A 1 82 ? 3.600   -8.950  6.456   1.00 0.00 ? 873 LEU A CA   9  
ATOM 8112 C C    . LEU A 1 82 ? 2.494   -9.797  5.834   1.00 0.00 ? 873 LEU A C    9  
ATOM 8113 O O    . LEU A 1 82 ? 1.917   -10.665 6.500   1.00 0.00 ? 873 LEU A O    9  
ATOM 8114 C CB   . LEU A 1 82 ? 3.037   -8.145  7.640   1.00 0.00 ? 873 LEU A CB   9  
ATOM 8115 C CG   . LEU A 1 82 ? 3.863   -8.414  8.910   1.00 0.00 ? 873 LEU A CG   9  
ATOM 8116 C CD1  . LEU A 1 82 ? 3.677   -9.868  9.352   1.00 0.00 ? 873 LEU A CD1  9  
ATOM 8117 C CD2  . LEU A 1 82 ? 5.350   -8.148  8.637   1.00 0.00 ? 873 LEU A CD2  9  
ATOM 8118 H H    . LEU A 1 82 ? 3.850   -7.138  5.388   1.00 0.00 ? 873 LEU A H    9  
ATOM 8119 H HA   . LEU A 1 82 ? 4.367   -9.612  6.824   1.00 0.00 ? 873 LEU A HA   9  
ATOM 8120 H HB2  . LEU A 1 82 ? 3.070   -7.089  7.407   1.00 0.00 ? 873 LEU A HB2  9  
ATOM 8121 H HB3  . LEU A 1 82 ? 2.011   -8.434  7.816   1.00 0.00 ? 873 LEU A HB3  9  
ATOM 8122 H HG   . LEU A 1 82 ? 3.518   -7.760  9.699   1.00 0.00 ? 873 LEU A HG   9  
ATOM 8123 H HD11 . LEU A 1 82 ? 4.072   -9.993  10.349  1.00 0.00 ? 873 LEU A HD11 9  
ATOM 8124 H HD12 . LEU A 1 82 ? 4.198   -10.526 8.674   1.00 0.00 ? 873 LEU A HD12 9  
ATOM 8125 H HD13 . LEU A 1 82 ? 2.625   -10.114 9.352   1.00 0.00 ? 873 LEU A HD13 9  
ATOM 8126 H HD21 . LEU A 1 82 ? 5.814   -9.039  8.240   1.00 0.00 ? 873 LEU A HD21 9  
ATOM 8127 H HD22 . LEU A 1 82 ? 5.840   -7.868  9.558   1.00 0.00 ? 873 LEU A HD22 9  
ATOM 8128 H HD23 . LEU A 1 82 ? 5.450   -7.342  7.923   1.00 0.00 ? 873 LEU A HD23 9  
ATOM 8129 N N    . LEU A 1 83 ? 2.182   -9.540  4.569   1.00 0.00 ? 874 LEU A N    9  
ATOM 8130 C CA   . LEU A 1 83 ? 1.130   -10.293 3.891   1.00 0.00 ? 874 LEU A CA   9  
ATOM 8131 C C    . LEU A 1 83 ? 1.606   -11.698 3.509   1.00 0.00 ? 874 LEU A C    9  
ATOM 8132 O O    . LEU A 1 83 ? 0.919   -12.679 3.787   1.00 0.00 ? 874 LEU A O    9  
ATOM 8133 C CB   . LEU A 1 83 ? 0.626   -9.543  2.651   1.00 0.00 ? 874 LEU A CB   9  
ATOM 8134 C CG   . LEU A 1 83 ? 0.032   -8.195  3.066   1.00 0.00 ? 874 LEU A CG   9  
ATOM 8135 C CD1  . LEU A 1 83 ? -0.258  -7.371  1.821   1.00 0.00 ? 874 LEU A CD1  9  
ATOM 8136 C CD2  . LEU A 1 83 ? -1.272  -8.418  3.838   1.00 0.00 ? 874 LEU A CD2  9  
ATOM 8137 H H    . LEU A 1 83 ? 2.657   -8.830  4.086   1.00 0.00 ? 874 LEU A H    9  
ATOM 8138 H HA   . LEU A 1 83 ? 0.304   -10.401 4.579   1.00 0.00 ? 874 LEU A HA   9  
ATOM 8139 H HB2  . LEU A 1 83 ? 1.439   -9.375  1.965   1.00 0.00 ? 874 LEU A HB2  9  
ATOM 8140 H HB3  . LEU A 1 83 ? -0.138  -10.131 2.162   1.00 0.00 ? 874 LEU A HB3  9  
ATOM 8141 H HG   . LEU A 1 83 ? 0.739   -7.667  3.688   1.00 0.00 ? 874 LEU A HG   9  
ATOM 8142 H HD11 . LEU A 1 83 ? -0.640  -6.402  2.108   1.00 0.00 ? 874 LEU A HD11 9  
ATOM 8143 H HD12 . LEU A 1 83 ? -0.992  -7.887  1.223   1.00 0.00 ? 874 LEU A HD12 9  
ATOM 8144 H HD13 . LEU A 1 83 ? 0.647   -7.249  1.247   1.00 0.00 ? 874 LEU A HD13 9  
ATOM 8145 H HD21 . LEU A 1 83 ? -1.851  -9.191  3.357   1.00 0.00 ? 874 LEU A HD21 9  
ATOM 8146 H HD22 . LEU A 1 83 ? -1.843  -7.501  3.851   1.00 0.00 ? 874 LEU A HD22 9  
ATOM 8147 H HD23 . LEU A 1 83 ? -1.046  -8.713  4.852   1.00 0.00 ? 874 LEU A HD23 9  
ATOM 8148 N N    . PRO A 1 84 ? 2.764   -11.818 2.877   1.00 0.00 ? 875 PRO A N    9  
ATOM 8149 C CA   . PRO A 1 84 ? 3.319   -13.144 2.470   1.00 0.00 ? 875 PRO A CA   9  
ATOM 8150 C C    . PRO A 1 84 ? 3.248   -14.162 3.609   1.00 0.00 ? 875 PRO A C    9  
ATOM 8151 O O    . PRO A 1 84 ? 4.102   -14.164 4.507   1.00 0.00 ? 875 PRO A O    9  
ATOM 8152 C CB   . PRO A 1 84 ? 4.776   -12.834 2.114   1.00 0.00 ? 875 PRO A CB   9  
ATOM 8153 C CG   . PRO A 1 84 ? 4.781   -11.398 1.704   1.00 0.00 ? 875 PRO A CG   9  
ATOM 8154 C CD   . PRO A 1 84 ? 3.659   -10.710 2.487   1.00 0.00 ? 875 PRO A CD   9  
ATOM 8155 H HA   . PRO A 1 84 ? 2.816   -13.516 1.593   1.00 0.00 ? 875 PRO A HA   9  
ATOM 8156 H HB2  . PRO A 1 84 ? 5.414   -12.987 2.973   1.00 0.00 ? 875 PRO A HB2  9  
ATOM 8157 H HB3  . PRO A 1 84 ? 5.102   -13.450 1.290   1.00 0.00 ? 875 PRO A HB3  9  
ATOM 8158 H HG2  . PRO A 1 84 ? 5.736   -10.951 1.947   1.00 0.00 ? 875 PRO A HG2  9  
ATOM 8159 H HG3  . PRO A 1 84 ? 4.585   -11.308 0.646   1.00 0.00 ? 875 PRO A HG3  9  
ATOM 8160 H HD2  . PRO A 1 84 ? 4.058   -10.210 3.356   1.00 0.00 ? 875 PRO A HD2  9  
ATOM 8161 H HD3  . PRO A 1 84 ? 3.137   -10.016 1.851   1.00 0.00 ? 875 PRO A HD3  9  
ATOM 8162 N N    . LYS A 1 85 ? 2.232   -15.017 3.563   1.00 0.00 ? 876 LYS A N    9  
ATOM 8163 C CA   . LYS A 1 85 ? 2.038   -16.044 4.581   1.00 0.00 ? 876 LYS A CA   9  
ATOM 8164 C C    . LYS A 1 85 ? 1.446   -17.305 3.959   1.00 0.00 ? 876 LYS A C    9  
ATOM 8165 O O    . LYS A 1 85 ? 1.461   -18.322 4.610   1.00 0.00 ? 876 LYS A O    9  
ATOM 8166 C CB   . LYS A 1 85 ? 1.105   -15.531 5.681   1.00 0.00 ? 876 LYS A CB   9  
ATOM 8167 C CG   . LYS A 1 85 ? 1.804   -14.428 6.489   1.00 0.00 ? 876 LYS A CG   9  
ATOM 8168 C CD   . LYS A 1 85 ? 1.258   -14.416 7.923   1.00 0.00 ? 876 LYS A CD   9  
ATOM 8169 C CE   . LYS A 1 85 ? 1.333   -12.994 8.493   1.00 0.00 ? 876 LYS A CE   9  
ATOM 8170 N NZ   . LYS A 1 85 ? 0.441   -12.097 7.708   1.00 0.00 ? 876 LYS A NZ   9  
ATOM 8171 H H    . LYS A 1 85 ? 1.592   -14.957 2.825   1.00 0.00 ? 876 LYS A H    9  
ATOM 8172 H HA   . LYS A 1 85 ? 2.994   -16.284 5.023   1.00 0.00 ? 876 LYS A HA   9  
ATOM 8173 N N    . GLN A 1 23 ? -8.536  -8.239  2.694   1.00 0.00 ? 814 GLN A N    10 
ATOM 8174 C CA   . GLN A 1 23 ? -9.737  -7.989  1.865   1.00 0.00 ? 814 GLN A CA   10 
ATOM 8175 C C    . GLN A 1 23 ? -9.372  -6.987  0.777   1.00 0.00 ? 814 GLN A C    10 
ATOM 8176 O O    . GLN A 1 23 ? -8.264  -7.020  0.239   1.00 0.00 ? 814 GLN A O    10 
ATOM 8177 C CB   . GLN A 1 23 ? -10.868 -7.432  2.752   1.00 0.00 ? 814 GLN A CB   10 
ATOM 8178 C CG   . GLN A 1 23 ? -12.233 -7.751  2.124   1.00 0.00 ? 814 GLN A CG   10 
ATOM 8179 C CD   . GLN A 1 23 ? -13.258 -6.707  2.552   1.00 0.00 ? 814 GLN A CD   10 
ATOM 8180 O OE1  . GLN A 1 23 ? -13.194 -6.198  3.673   1.00 0.00 ? 814 GLN A OE1  10 
ATOM 8181 N NE2  . GLN A 1 23 ? -14.192 -6.348  1.728   1.00 0.00 ? 814 GLN A NE2  10 
ATOM 8182 H HA   . GLN A 1 23 ? -10.055 -8.914  1.409   1.00 0.00 ? 814 GLN A HA   10 
ATOM 8183 H HB2  . GLN A 1 23 ? -10.815 -7.887  3.730   1.00 0.00 ? 814 GLN A HB2  10 
ATOM 8184 H HB3  . GLN A 1 23 ? -10.762 -6.363  2.848   1.00 0.00 ? 814 GLN A HB3  10 
ATOM 8185 H HG2  . GLN A 1 23 ? -12.150 -7.749  1.046   1.00 0.00 ? 814 GLN A HG2  10 
ATOM 8186 H HG3  . GLN A 1 23 ? -12.563 -8.724  2.454   1.00 0.00 ? 814 GLN A HG3  10 
ATOM 8187 H HE21 . GLN A 1 23 ? -14.238 -6.749  0.834   1.00 0.00 ? 814 GLN A HE21 10 
ATOM 8188 H HE22 . GLN A 1 23 ? -14.858 -5.681  1.998   1.00 0.00 ? 814 GLN A HE22 10 
ATOM 8189 N N    . THR A 1 24 ? -10.289 -6.088  0.479   1.00 0.00 ? 815 THR A N    10 
ATOM 8190 C CA   . THR A 1 24 ? -10.071 -5.074  -0.532  1.00 0.00 ? 815 THR A CA   10 
ATOM 8191 C C    . THR A 1 24 ? -9.195  -3.951  0.018   1.00 0.00 ? 815 THR A C    10 
ATOM 8192 O O    . THR A 1 24 ? -8.968  -3.860  1.236   1.00 0.00 ? 815 THR A O    10 
ATOM 8193 C CB   . THR A 1 24 ? -11.425 -4.519  -0.985  1.00 0.00 ? 815 THR A CB   10 
ATOM 8194 O OG1  . THR A 1 24 ? -12.418 -4.882  -0.025  1.00 0.00 ? 815 THR A OG1  10 
ATOM 8195 C CG2  . THR A 1 24 ? -11.797 -5.112  -2.345  1.00 0.00 ? 815 THR A CG2  10 
ATOM 8196 H H    . THR A 1 24 ? -11.149 -6.095  0.948   1.00 0.00 ? 815 THR A H    10 
ATOM 8197 H HA   . THR A 1 24 ? -9.578  -5.523  -1.381  1.00 0.00 ? 815 THR A HA   10 
ATOM 8198 H HB   . THR A 1 24 ? -11.375 -3.443  -1.069  1.00 0.00 ? 815 THR A HB   10 
ATOM 8199 H HG21 . THR A 1 24 ? -11.446 -6.132  -2.406  1.00 0.00 ? 815 THR A HG21 10 
ATOM 8200 H HG22 . THR A 1 24 ? -11.342 -4.528  -3.130  1.00 0.00 ? 815 THR A HG22 10 
ATOM 8201 H HG23 . THR A 1 24 ? -12.870 -5.097  -2.462  1.00 0.00 ? 815 THR A HG23 10 
ATOM 8202 N N    . VAL A 1 25 ? -8.669  -3.120  -0.876  1.00 0.00 ? 816 VAL A N    10 
ATOM 8203 C CA   . VAL A 1 25 ? -7.810  -2.029  -0.467  1.00 0.00 ? 816 VAL A CA   10 
ATOM 8204 C C    . VAL A 1 25 ? -8.586  -1.050  0.410   1.00 0.00 ? 816 VAL A C    10 
ATOM 8205 O O    . VAL A 1 25 ? -9.150  -0.068  -0.070  1.00 0.00 ? 816 VAL A O    10 
ATOM 8206 C CB   . VAL A 1 25 ? -7.236  -1.313  -1.693  1.00 0.00 ? 816 VAL A CB   10 
ATOM 8207 C CG1  . VAL A 1 25 ? -6.195  -2.212  -2.371  1.00 0.00 ? 816 VAL A CG1  10 
ATOM 8208 C CG2  . VAL A 1 25 ? -8.359  -1.001  -2.689  1.00 0.00 ? 816 VAL A CG2  10 
ATOM 8209 H H    . VAL A 1 25 ? -8.857  -3.248  -1.829  1.00 0.00 ? 816 VAL A H    10 
ATOM 8210 H HA   . VAL A 1 25 ? -6.993  -2.434  0.111   1.00 0.00 ? 816 VAL A HA   10 
ATOM 8211 H HB   . VAL A 1 25 ? -6.765  -0.395  -1.375  1.00 0.00 ? 816 VAL A HB   10 
ATOM 8212 H HG11 . VAL A 1 25 ? -6.028  -1.868  -3.381  1.00 0.00 ? 816 VAL A HG11 10 
ATOM 8213 H HG12 . VAL A 1 25 ? -6.553  -3.230  -2.394  1.00 0.00 ? 816 VAL A HG12 10 
ATOM 8214 H HG13 . VAL A 1 25 ? -5.267  -2.169  -1.822  1.00 0.00 ? 816 VAL A HG13 10 
ATOM 8215 H HG21 . VAL A 1 25 ? -8.279  -1.658  -3.543  1.00 0.00 ? 816 VAL A HG21 10 
ATOM 8216 H HG22 . VAL A 1 25 ? -8.267  0.024   -3.019  1.00 0.00 ? 816 VAL A HG22 10 
ATOM 8217 H HG23 . VAL A 1 25 ? -9.320  -1.136  -2.216  1.00 0.00 ? 816 VAL A HG23 10 
ATOM 8218 N N    . GLY A 1 26 ? -8.645  -1.365  1.682   1.00 0.00 ? 817 GLY A N    10 
ATOM 8219 C CA   . GLY A 1 26 ? -9.368  -0.565  2.654   1.00 0.00 ? 817 GLY A CA   10 
ATOM 8220 C C    . GLY A 1 26 ? -9.289  -1.230  4.006   1.00 0.00 ? 817 GLY A C    10 
ATOM 8221 O O    . GLY A 1 26 ? -8.587  -0.759  4.897   1.00 0.00 ? 817 GLY A O    10 
ATOM 8222 H H    . GLY A 1 26 ? -8.208  -2.190  1.980   1.00 0.00 ? 817 GLY A H    10 
ATOM 8223 H HA2  . GLY A 1 26 ? -8.933  0.423   2.707   1.00 0.00 ? 817 GLY A HA2  10 
ATOM 8224 H HA3  . GLY A 1 26 ? -10.403 -0.486  2.363   1.00 0.00 ? 817 GLY A HA3  10 
ATOM 8225 N N    . GLN A 1 27 ? -9.930  -2.389  4.125   1.00 0.00 ? 818 GLN A N    10 
ATOM 8226 C CA   . GLN A 1 27 ? -9.869  -3.159  5.357   1.00 0.00 ? 818 GLN A CA   10 
ATOM 8227 C C    . GLN A 1 27 ? -8.422  -3.332  5.760   1.00 0.00 ? 818 GLN A C    10 
ATOM 8228 O O    . GLN A 1 27 ? -8.054  -3.120  6.915   1.00 0.00 ? 818 GLN A O    10 
ATOM 8229 C CB   . GLN A 1 27 ? -10.524 -4.535  5.147   1.00 0.00 ? 818 GLN A CB   10 
ATOM 8230 C CG   . GLN A 1 27 ? -10.017 -5.540  6.197   1.00 0.00 ? 818 GLN A CG   10 
ATOM 8231 C CD   . GLN A 1 27 ? -8.751  -6.234  5.693   1.00 0.00 ? 818 GLN A CD   10 
ATOM 8232 O OE1  . GLN A 1 27 ? -8.708  -6.693  4.546   1.00 0.00 ? 818 GLN A OE1  10 
ATOM 8233 N NE2  . GLN A 1 27 ? -7.712  -6.325  6.468   1.00 0.00 ? 818 GLN A NE2  10 
ATOM 8234 H H    . GLN A 1 27 ? -10.413 -2.749  3.351   1.00 0.00 ? 818 GLN A H    10 
ATOM 8235 H HA   . GLN A 1 27 ? -10.400 -2.630  6.136   1.00 0.00 ? 818 GLN A HA   10 
ATOM 8236 H HB2  . GLN A 1 27 ? -11.593 -4.436  5.237   1.00 0.00 ? 818 GLN A HB2  10 
ATOM 8237 H HB3  . GLN A 1 27 ? -10.282 -4.899  4.161   1.00 0.00 ? 818 GLN A HB3  10 
ATOM 8238 H HG2  . GLN A 1 27 ? -9.806  -5.024  7.123   1.00 0.00 ? 818 GLN A HG2  10 
ATOM 8239 H HG3  . GLN A 1 27 ? -10.781 -6.283  6.372   1.00 0.00 ? 818 GLN A HG3  10 
ATOM 8240 H HE21 . GLN A 1 27 ? -7.734  -5.947  7.376   1.00 0.00 ? 818 GLN A HE21 10 
ATOM 8241 H HE22 . GLN A 1 27 ? -6.904  -6.779  6.150   1.00 0.00 ? 818 GLN A HE22 10 
ATOM 8242 N N    . TRP A 1 28 ? -7.600  -3.692  4.792   1.00 0.00 ? 819 TRP A N    10 
ATOM 8243 C CA   . TRP A 1 28 ? -6.180  -3.857  5.025   1.00 0.00 ? 819 TRP A CA   10 
ATOM 8244 C C    . TRP A 1 28 ? -5.602  -2.566  5.582   1.00 0.00 ? 819 TRP A C    10 
ATOM 8245 O O    . TRP A 1 28 ? -5.003  -2.551  6.659   1.00 0.00 ? 819 TRP A O    10 
ATOM 8246 C CB   . TRP A 1 28 ? -5.481  -4.223  3.714   1.00 0.00 ? 819 TRP A CB   10 
ATOM 8247 C CG   . TRP A 1 28 ? -4.026  -4.445  3.959   1.00 0.00 ? 819 TRP A CG   10 
ATOM 8248 C CD1  . TRP A 1 28 ? -3.505  -5.469  4.670   1.00 0.00 ? 819 TRP A CD1  10 
ATOM 8249 C CD2  . TRP A 1 28 ? -2.899  -3.650  3.502   1.00 0.00 ? 819 TRP A CD2  10 
ATOM 8250 N NE1  . TRP A 1 28 ? -2.130  -5.349  4.676   1.00 0.00 ? 819 TRP A NE1  10 
ATOM 8251 C CE2  . TRP A 1 28 ? -1.709  -4.246  3.970   1.00 0.00 ? 819 TRP A CE2  10 
ATOM 8252 C CE3  . TRP A 1 28 ? -2.794  -2.474  2.732   1.00 0.00 ? 819 TRP A CE3  10 
ATOM 8253 C CZ2  . TRP A 1 28 ? -0.464  -3.708  3.689   1.00 0.00 ? 819 TRP A CZ2  10 
ATOM 8254 C CZ3  . TRP A 1 28 ? -1.531  -1.927  2.446   1.00 0.00 ? 819 TRP A CZ3  10 
ATOM 8255 C CH2  . TRP A 1 28 ? -0.369  -2.547  2.926   1.00 0.00 ? 819 TRP A CH2  10 
ATOM 8256 H H    . TRP A 1 28 ? -7.961  -3.827  3.891   1.00 0.00 ? 819 TRP A H    10 
ATOM 8257 H HA   . TRP A 1 28 ? -6.026  -4.652  5.739   1.00 0.00 ? 819 TRP A HA   10 
ATOM 8258 H HB2  . TRP A 1 28 ? -5.916  -5.127  3.315   1.00 0.00 ? 819 TRP A HB2  10 
ATOM 8259 H HB3  . TRP A 1 28 ? -5.607  -3.420  3.002   1.00 0.00 ? 819 TRP A HB3  10 
ATOM 8260 H HD1  . TRP A 1 28 ? -4.069  -6.253  5.155   1.00 0.00 ? 819 TRP A HD1  10 
ATOM 8261 N N    . LEU A 1 29 ? -5.838  -1.475  4.864   1.00 0.00 ? 820 LEU A N    10 
ATOM 8262 C CA   . LEU A 1 29 ? -5.383  -0.166  5.297   1.00 0.00 ? 820 LEU A CA   10 
ATOM 8263 C C    . LEU A 1 29 ? -5.868  0.113   6.711   1.00 0.00 ? 820 LEU A C    10 
ATOM 8264 O O    . LEU A 1 29 ? -5.091  0.521   7.577   1.00 0.00 ? 820 LEU A O    10 
ATOM 8265 C CB   . LEU A 1 29 ? -5.894  0.910   4.337   1.00 0.00 ? 820 LEU A CB   10 
ATOM 8266 C CG   . LEU A 1 29 ? -5.274  0.687   2.948   1.00 0.00 ? 820 LEU A CG   10 
ATOM 8267 C CD1  . LEU A 1 29 ? -6.038  1.496   1.906   1.00 0.00 ? 820 LEU A CD1  10 
ATOM 8268 C CD2  . LEU A 1 29 ? -3.810  1.131   2.963   1.00 0.00 ? 820 LEU A CD2  10 
ATOM 8269 H H    . LEU A 1 29 ? -6.362  -1.549  4.042   1.00 0.00 ? 820 LEU A H    10 
ATOM 8270 H HA   . LEU A 1 29 ? -4.302  -0.151  5.287   1.00 0.00 ? 820 LEU A HA   10 
ATOM 8271 H HB2  . LEU A 1 29 ? -6.972  0.854   4.274   1.00 0.00 ? 820 LEU A HB2  10 
ATOM 8272 H HB3  . LEU A 1 29 ? -5.609  1.883   4.704   1.00 0.00 ? 820 LEU A HB3  10 
ATOM 8273 H HG   . LEU A 1 29 ? -5.333  -0.361  2.692   1.00 0.00 ? 820 LEU A HG   10 
ATOM 8274 H HD11 . LEU A 1 29 ? -5.566  1.375   0.944   1.00 0.00 ? 820 LEU A HD11 10 
ATOM 8275 H HD12 . LEU A 1 29 ? -6.031  2.539   2.184   1.00 0.00 ? 820 LEU A HD12 10 
ATOM 8276 H HD13 . LEU A 1 29 ? -7.058  1.147   1.853   1.00 0.00 ? 820 LEU A HD13 10 
ATOM 8277 H HD21 . LEU A 1 29 ? -3.466  1.274   1.948   1.00 0.00 ? 820 LEU A HD21 10 
ATOM 8278 H HD22 . LEU A 1 29 ? -3.207  0.374   3.442   1.00 0.00 ? 820 LEU A HD22 10 
ATOM 8279 H HD23 . LEU A 1 29 ? -3.720  2.061   3.507   1.00 0.00 ? 820 LEU A HD23 10 
ATOM 8280 N N    . GLU A 1 30 ? -7.140  -0.159  6.960   1.00 0.00 ? 821 GLU A N    10 
ATOM 8281 C CA   . GLU A 1 30 ? -7.692  0.014   8.293   1.00 0.00 ? 821 GLU A CA   10 
ATOM 8282 C C    . GLU A 1 30 ? -6.951  -0.882  9.267   1.00 0.00 ? 821 GLU A C    10 
ATOM 8283 O O    . GLU A 1 30 ? -6.500  -0.439  10.322  1.00 0.00 ? 821 GLU A O    10 
ATOM 8284 C CB   . GLU A 1 30 ? -9.182  -0.344  8.319   1.00 0.00 ? 821 GLU A CB   10 
ATOM 8285 C CG   . GLU A 1 30 ? -9.914  0.340   7.162   1.00 0.00 ? 821 GLU A CG   10 
ATOM 8286 C CD   . GLU A 1 30 ? -11.092 1.130   7.691   1.00 0.00 ? 821 GLU A CD   10 
ATOM 8287 O OE1  . GLU A 1 30 ? -11.895 0.552   8.394   1.00 0.00 ? 821 GLU A OE1  10 
ATOM 8288 O OE2  . GLU A 1 30 ? -11.178 2.295   7.393   1.00 0.00 ? 821 GLU A OE2  10 
ATOM 8289 H H    . GLU A 1 30 ? -7.707  -0.514  6.240   1.00 0.00 ? 821 GLU A H    10 
ATOM 8290 H HA   . GLU A 1 30 ? -7.572  1.043   8.596   1.00 0.00 ? 821 GLU A HA   10 
ATOM 8291 N N    . SER A 1 31 ? -6.824  -2.144  8.899   1.00 0.00 ? 822 SER A N    10 
ATOM 8292 C CA   . SER A 1 31 ? -6.145  -3.116  9.735   1.00 0.00 ? 822 SER A CA   10 
ATOM 8293 C C    . SER A 1 31 ? -4.759  -2.614  10.130  1.00 0.00 ? 822 SER A C    10 
ATOM 8294 O O    . SER A 1 31 ? -4.377  -2.683  11.303  1.00 0.00 ? 822 SER A O    10 
ATOM 8295 C CB   . SER A 1 31 ? -6.042  -4.459  9.007   1.00 0.00 ? 822 SER A CB   10 
ATOM 8296 O OG   . SER A 1 31 ? -7.321  -4.793  8.442   1.00 0.00 ? 822 SER A OG   10 
ATOM 8297 H H    . SER A 1 31 ? -7.200  -2.427  8.039   1.00 0.00 ? 822 SER A H    10 
ATOM 8298 H HA   . SER A 1 31 ? -6.724  -3.258  10.635  1.00 0.00 ? 822 SER A HA   10 
ATOM 8299 H HB2  . SER A 1 31 ? -5.310  -4.391  8.216   1.00 0.00 ? 822 SER A HB2  10 
ATOM 8300 H HB3  . SER A 1 31 ? -5.729  -5.217  9.711   1.00 0.00 ? 822 SER A HB3  10 
ATOM 8301 H HG   . SER A 1 31 ? -7.598  -4.051  7.880   1.00 0.00 ? 822 SER A HG   10 
ATOM 8302 N N    . ILE A 1 32 ? -4.022  -2.079  9.160   1.00 0.00 ? 823 ILE A N    10 
ATOM 8303 C CA   . ILE A 1 32 ? -2.692  -1.542  9.438   1.00 0.00 ? 823 ILE A CA   10 
ATOM 8304 C C    . ILE A 1 32 ? -2.786  -0.109  9.972   1.00 0.00 ? 823 ILE A C    10 
ATOM 8305 O O    . ILE A 1 32 ? -1.772  0.563   10.165  1.00 0.00 ? 823 ILE A O    10 
ATOM 8306 C CB   . ILE A 1 32 ? -1.809  -1.594  8.178   1.00 0.00 ? 823 ILE A CB   10 
ATOM 8307 C CG1  . ILE A 1 32 ? -2.329  -0.602  7.134   1.00 0.00 ? 823 ILE A CG1  10 
ATOM 8308 C CG2  . ILE A 1 32 ? -1.837  -3.008  7.587   1.00 0.00 ? 823 ILE A CG2  10 
ATOM 8309 C CD1  . ILE A 1 32 ? -1.447  -0.664  5.884   1.00 0.00 ? 823 ILE A CD1  10 
ATOM 8310 H H    . ILE A 1 32 ? -4.383  -2.027  8.248   1.00 0.00 ? 823 ILE A H    10 
ATOM 8311 H HA   . ILE A 1 32 ? -2.233  -2.152  10.201  1.00 0.00 ? 823 ILE A HA   10 
ATOM 8312 H HB   . ILE A 1 32 ? -0.793  -1.342  8.450   1.00 0.00 ? 823 ILE A HB   10 
ATOM 8313 H HG12 . ILE A 1 32 ? -3.342  -0.863  6.873   1.00 0.00 ? 823 ILE A HG12 10 
ATOM 8314 H HG21 . ILE A 1 32 ? -2.835  -3.237  7.243   1.00 0.00 ? 823 ILE A HG21 10 
ATOM 8315 H HG22 . ILE A 1 32 ? -1.543  -3.724  8.339   1.00 0.00 ? 823 ILE A HG22 10 
ATOM 8316 H HG23 . ILE A 1 32 ? -1.154  -3.061  6.753   1.00 0.00 ? 823 ILE A HG23 10 
ATOM 8317 H HD11 . ILE A 1 32 ? -1.807  -1.446  5.232   1.00 0.00 ? 823 ILE A HD11 10 
ATOM 8318 H HD12 . ILE A 1 32 ? -0.428  -0.875  6.167   1.00 0.00 ? 823 ILE A HD12 10 
ATOM 8319 H HD13 . ILE A 1 32 ? -1.487  0.282   5.364   1.00 0.00 ? 823 ILE A HD13 10 
ATOM 8320 N N    . GLY A 1 33 ? -4.002  0.344   10.223  1.00 0.00 ? 824 GLY A N    10 
ATOM 8321 C CA   . GLY A 1 33 ? -4.220  1.681   10.757  1.00 0.00 ? 824 GLY A CA   10 
ATOM 8322 C C    . GLY A 1 33 ? -3.788  2.760   9.772   1.00 0.00 ? 824 GLY A C    10 
ATOM 8323 O O    . GLY A 1 33 ? -3.269  3.801   10.174  1.00 0.00 ? 824 GLY A O    10 
ATOM 8324 H H    . GLY A 1 33 ? -4.776  -0.237  10.062  1.00 0.00 ? 824 GLY A H    10 
ATOM 8325 H HA2  . GLY A 1 33 ? -5.269  1.803   10.979  1.00 0.00 ? 824 GLY A HA2  10 
ATOM 8326 H HA3  . GLY A 1 33 ? -3.652  1.792   11.669  1.00 0.00 ? 824 GLY A HA3  10 
ATOM 8327 N N    . LEU A 1 34 ? -4.035  2.527   8.488   1.00 0.00 ? 825 LEU A N    10 
ATOM 8328 C CA   . LEU A 1 34 ? -3.703  3.511   7.455   1.00 0.00 ? 825 LEU A CA   10 
ATOM 8329 C C    . LEU A 1 34 ? -4.891  3.738   6.517   1.00 0.00 ? 825 LEU A C    10 
ATOM 8330 O O    . LEU A 1 34 ? -4.715  3.857   5.301   1.00 0.00 ? 825 LEU A O    10 
ATOM 8331 C CB   . LEU A 1 34 ? -2.490  3.050   6.639   1.00 0.00 ? 825 LEU A CB   10 
ATOM 8332 C CG   . LEU A 1 34 ? -1.221  3.096   7.500   1.00 0.00 ? 825 LEU A CG   10 
ATOM 8333 C CD1  . LEU A 1 34 ? -0.035  2.595   6.677   1.00 0.00 ? 825 LEU A CD1  10 
ATOM 8334 C CD2  . LEU A 1 34 ? -0.948  4.537   7.950   1.00 0.00 ? 825 LEU A CD2  10 
ATOM 8335 H H    . LEU A 1 34 ? -4.474  1.687   8.221   1.00 0.00 ? 825 LEU A H    10 
ATOM 8336 H HA   . LEU A 1 34 ? -3.464  4.449   7.932   1.00 0.00 ? 825 LEU A HA   10 
ATOM 8337 H HB2  . LEU A 1 34 ? -2.659  2.042   6.290   1.00 0.00 ? 825 LEU A HB2  10 
ATOM 8338 H HB3  . LEU A 1 34 ? -2.369  3.702   5.788   1.00 0.00 ? 825 LEU A HB3  10 
ATOM 8339 H HG   . LEU A 1 34 ? -1.351  2.460   8.365   1.00 0.00 ? 825 LEU A HG   10 
ATOM 8340 H HD11 . LEU A 1 34 ? 0.011   1.518   6.728   1.00 0.00 ? 825 LEU A HD11 10 
ATOM 8341 H HD12 . LEU A 1 34 ? 0.879   3.016   7.068   1.00 0.00 ? 825 LEU A HD12 10 
ATOM 8342 H HD13 . LEU A 1 34 ? -0.157  2.900   5.648   1.00 0.00 ? 825 LEU A HD13 10 
ATOM 8343 H HD21 . LEU A 1 34 ? 0.082   4.626   8.266   1.00 0.00 ? 825 LEU A HD21 10 
ATOM 8344 H HD22 . LEU A 1 34 ? -1.596  4.788   8.777   1.00 0.00 ? 825 LEU A HD22 10 
ATOM 8345 H HD23 . LEU A 1 34 ? -1.130  5.216   7.130   1.00 0.00 ? 825 LEU A HD23 10 
ATOM 8346 N N    . PRO A 1 35 ? -6.089  3.808   7.049   1.00 0.00 ? 826 PRO A N    10 
ATOM 8347 C CA   . PRO A 1 35 ? -7.311  4.025   6.222   1.00 0.00 ? 826 PRO A CA   10 
ATOM 8348 C C    . PRO A 1 35 ? -7.347  5.436   5.659   1.00 0.00 ? 826 PRO A C    10 
ATOM 8349 O O    . PRO A 1 35 ? -7.322  6.406   6.417   1.00 0.00 ? 826 PRO A O    10 
ATOM 8350 C CB   . PRO A 1 35 ? -8.456  3.809   7.205   1.00 0.00 ? 826 PRO A CB   10 
ATOM 8351 C CG   . PRO A 1 35 ? -7.879  4.101   8.552   1.00 0.00 ? 826 PRO A CG   10 
ATOM 8352 C CD   . PRO A 1 35 ? -6.408  3.699   8.482   1.00 0.00 ? 826 PRO A CD   10 
ATOM 8353 H HA   . PRO A 1 35 ? -7.380  3.293   5.432   1.00 0.00 ? 826 PRO A HA   10 
ATOM 8354 H HB2  . PRO A 1 35 ? -9.265  4.487   6.979   1.00 0.00 ? 826 PRO A HB2  10 
ATOM 8355 H HB3  . PRO A 1 35 ? -8.798  2.789   7.168   1.00 0.00 ? 826 PRO A HB3  10 
ATOM 8356 H HG2  . PRO A 1 35 ? -7.972  5.156   8.775   1.00 0.00 ? 826 PRO A HG2  10 
ATOM 8357 H HG3  . PRO A 1 35 ? -8.376  3.513   9.307   1.00 0.00 ? 826 PRO A HG3  10 
ATOM 8358 H HD2  . PRO A 1 35 ? -5.804  4.379   9.067   1.00 0.00 ? 826 PRO A HD2  10 
ATOM 8359 H HD3  . PRO A 1 35 ? -6.277  2.681   8.814   1.00 0.00 ? 826 PRO A HD3  10 
ATOM 8360 N N    . GLN A 1 36 ? -7.424  5.533   4.338   1.00 0.00 ? 827 GLN A N    10 
ATOM 8361 C CA   . GLN A 1 36 ? -7.468  6.814   3.615   1.00 0.00 ? 827 GLN A CA   10 
ATOM 8362 C C    . GLN A 1 36 ? -6.867  6.642   2.232   1.00 0.00 ? 827 GLN A C    10 
ATOM 8363 O O    . GLN A 1 36 ? -6.978  7.529   1.384   1.00 0.00 ? 827 GLN A O    10 
ATOM 8364 C CB   . GLN A 1 36 ? -6.690  7.921   4.355   1.00 0.00 ? 827 GLN A CB   10 
ATOM 8365 C CG   . GLN A 1 36 ? -5.242  7.468   4.607   1.00 0.00 ? 827 GLN A CG   10 
ATOM 8366 C CD   . GLN A 1 36 ? -4.744  8.029   5.929   1.00 0.00 ? 827 GLN A CD   10 
ATOM 8367 O OE1  . GLN A 1 36 ? -3.966  8.986   5.946   1.00 0.00 ? 827 GLN A OE1  10 
ATOM 8368 N NE2  . GLN A 1 36 ? -5.157  7.506   7.037   1.00 0.00 ? 827 GLN A NE2  10 
ATOM 8369 H H    . GLN A 1 36 ? -7.475  4.700   3.812   1.00 0.00 ? 827 GLN A H    10 
ATOM 8370 H HA   . GLN A 1 36 ? -8.500  7.118   3.513   1.00 0.00 ? 827 GLN A HA   10 
ATOM 8371 H HB2  . GLN A 1 36 ? -6.679  8.808   3.740   1.00 0.00 ? 827 GLN A HB2  10 
ATOM 8372 H HB3  . GLN A 1 36 ? -7.169  8.154   5.294   1.00 0.00 ? 827 GLN A HB3  10 
ATOM 8373 H HG2  . GLN A 1 36 ? -5.196  6.389   4.639   1.00 0.00 ? 827 GLN A HG2  10 
ATOM 8374 H HG3  . GLN A 1 36 ? -4.610  7.825   3.808   1.00 0.00 ? 827 GLN A HG3  10 
ATOM 8375 H HE21 . GLN A 1 36 ? -5.793  6.756   7.016   1.00 0.00 ? 827 GLN A HE21 10 
ATOM 8376 H HE22 . GLN A 1 36 ? -4.840  7.853   7.895   1.00 0.00 ? 827 GLN A HE22 10 
ATOM 8377 N N    . TYR A 1 37 ? -6.186  5.517   2.027   1.00 0.00 ? 828 TYR A N    10 
ATOM 8378 C CA   . TYR A 1 37 ? -5.510  5.246   0.762   1.00 0.00 ? 828 TYR A CA   10 
ATOM 8379 C C    . TYR A 1 37 ? -6.293  4.245   -0.074  1.00 0.00 ? 828 TYR A C    10 
ATOM 8380 O O    . TYR A 1 37 ? -5.892  3.913   -1.186  1.00 0.00 ? 828 TYR A O    10 
ATOM 8381 C CB   . TYR A 1 37 ? -4.103  4.697   1.026   1.00 0.00 ? 828 TYR A CB   10 
ATOM 8382 C CG   . TYR A 1 37 ? -3.285  5.719   1.785   1.00 0.00 ? 828 TYR A CG   10 
ATOM 8383 C CD1  . TYR A 1 37 ? -2.987  6.954   1.198   1.00 0.00 ? 828 TYR A CD1  10 
ATOM 8384 C CD2  . TYR A 1 37 ? -2.819  5.426   3.074   1.00 0.00 ? 828 TYR A CD2  10 
ATOM 8385 C CE1  . TYR A 1 37 ? -2.227  7.895   1.897   1.00 0.00 ? 828 TYR A CE1  10 
ATOM 8386 C CE2  . TYR A 1 37 ? -2.056  6.368   3.771   1.00 0.00 ? 828 TYR A CE2  10 
ATOM 8387 C CZ   . TYR A 1 37 ? -1.761  7.603   3.181   1.00 0.00 ? 828 TYR A CZ   10 
ATOM 8388 O OH   . TYR A 1 37 ? -1.006  8.530   3.868   1.00 0.00 ? 828 TYR A OH   10 
ATOM 8389 H H    . TYR A 1 37 ? -6.109  4.865   2.754   1.00 0.00 ? 828 TYR A H    10 
ATOM 8390 H HA   . TYR A 1 37 ? -5.419  6.167   0.209   1.00 0.00 ? 828 TYR A HA   10 
ATOM 8391 H HB2  . TYR A 1 37 ? -4.177  3.789   1.607   1.00 0.00 ? 828 TYR A HB2  10 
ATOM 8392 H HB3  . TYR A 1 37 ? -3.619  4.476   0.086   1.00 0.00 ? 828 TYR A HB3  10 
ATOM 8393 H HH   . TYR A 1 37 ? -1.534  9.335   3.952   1.00 0.00 ? 828 TYR A HH   10 
ATOM 8394 N N    . GLU A 1 38 ? -7.396  3.763   0.475   1.00 0.00 ? 829 GLU A N    10 
ATOM 8395 C CA   . GLU A 1 38 ? -8.245  2.789   -0.206  1.00 0.00 ? 829 GLU A CA   10 
ATOM 8396 C C    . GLU A 1 38 ? -8.391  3.131   -1.693  1.00 0.00 ? 829 GLU A C    10 
ATOM 8397 O O    . GLU A 1 38 ? -7.736  2.524   -2.552  1.00 0.00 ? 829 GLU A O    10 
ATOM 8398 C CB   . GLU A 1 38 ? -9.629  2.738   0.473   1.00 0.00 ? 829 GLU A CB   10 
ATOM 8399 C CG   . GLU A 1 38 ? -9.901  4.062   1.219   1.00 0.00 ? 829 GLU A CG   10 
ATOM 8400 C CD   . GLU A 1 38 ? -9.405  3.979   2.659   1.00 0.00 ? 829 GLU A CD   10 
ATOM 8401 O OE1  . GLU A 1 38 ? -8.231  3.721   2.848   1.00 0.00 ? 829 GLU A OE1  10 
ATOM 8402 O OE2  . GLU A 1 38 ? -10.204 4.194   3.551   1.00 0.00 ? 829 GLU A OE2  10 
ATOM 8403 H H    . GLU A 1 38 ? -7.650  4.055   1.379   1.00 0.00 ? 829 GLU A H    10 
ATOM 8404 H HA   . GLU A 1 38 ? -7.788  1.815   -0.124  1.00 0.00 ? 829 GLU A HA   10 
ATOM 8405 N N    . ASN A 1 39 ? -9.230  4.119   -1.990  1.00 0.00 ? 830 ASN A N    10 
ATOM 8406 C CA   . ASN A 1 39 ? -9.426  4.547   -3.373  1.00 0.00 ? 830 ASN A CA   10 
ATOM 8407 C C    . ASN A 1 39 ? -8.091  4.921   -3.992  1.00 0.00 ? 830 ASN A C    10 
ATOM 8408 O O    . ASN A 1 39 ? -7.833  4.631   -5.154  1.00 0.00 ? 830 ASN A O    10 
ATOM 8409 C CB   . ASN A 1 39 ? -10.384 5.742   -3.441  1.00 0.00 ? 830 ASN A CB   10 
ATOM 8410 C CG   . ASN A 1 39 ? -10.350 6.373   -4.833  1.00 0.00 ? 830 ASN A CG   10 
ATOM 8411 O OD1  . ASN A 1 39 ? -10.447 5.668   -5.842  1.00 0.00 ? 830 ASN A OD1  10 
ATOM 8412 N ND2  . ASN A 1 39 ? -10.227 7.660   -4.950  1.00 0.00 ? 830 ASN A ND2  10 
ATOM 8413 H H    . ASN A 1 39 ? -9.710  4.574   -1.266  1.00 0.00 ? 830 ASN A H    10 
ATOM 8414 H HA   . ASN A 1 39 ? -9.851  3.728   -3.933  1.00 0.00 ? 830 ASN A HA   10 
ATOM 8415 H HB2  . ASN A 1 39 ? -11.387 5.408   -3.225  1.00 0.00 ? 830 ASN A HB2  10 
ATOM 8416 H HB3  . ASN A 1 39 ? -10.086 6.479   -2.710  1.00 0.00 ? 830 ASN A HB3  10 
ATOM 8417 H HD21 . ASN A 1 39 ? -10.158 8.222   -4.148  1.00 0.00 ? 830 ASN A HD21 10 
ATOM 8418 H HD22 . ASN A 1 39 ? -10.202 8.073   -5.840  1.00 0.00 ? 830 ASN A HD22 10 
ATOM 8419 N N    . HIS A 1 40 ? -7.240  5.548   -3.192  1.00 0.00 ? 831 HIS A N    10 
ATOM 8420 C CA   . HIS A 1 40 ? -5.912  5.949   -3.644  1.00 0.00 ? 831 HIS A CA   10 
ATOM 8421 C C    . HIS A 1 40 ? -5.207  4.773   -4.312  1.00 0.00 ? 831 HIS A C    10 
ATOM 8422 O O    . HIS A 1 40 ? -4.744  4.875   -5.456  1.00 0.00 ? 831 HIS A O    10 
ATOM 8423 C CB   . HIS A 1 40 ? -5.084  6.442   -2.450  1.00 0.00 ? 831 HIS A CB   10 
ATOM 8424 C CG   . HIS A 1 40 ? -4.161  7.545   -2.882  1.00 0.00 ? 831 HIS A CG   10 
ATOM 8425 N ND1  . HIS A 1 40 ? -3.897  8.644   -2.077  1.00 0.00 ? 831 HIS A ND1  10 
ATOM 8426 C CD2  . HIS A 1 40 ? -3.419  7.727   -4.018  1.00 0.00 ? 831 HIS A CD2  10 
ATOM 8427 C CE1  . HIS A 1 40 ? -3.024  9.427   -2.737  1.00 0.00 ? 831 HIS A CE1  10 
ATOM 8428 N NE2  . HIS A 1 40 ? -2.701  8.912   -3.924  1.00 0.00 ? 831 HIS A NE2  10 
ATOM 8429 H H    . HIS A 1 40 ? -7.508  5.734   -2.268  1.00 0.00 ? 831 HIS A H    10 
ATOM 8430 H HA   . HIS A 1 40 ? -6.013  6.752   -4.357  1.00 0.00 ? 831 HIS A HA   10 
ATOM 8431 H HB2  . HIS A 1 40 ? -5.747  6.815   -1.686  1.00 0.00 ? 831 HIS A HB2  10 
ATOM 8432 H HB3  . HIS A 1 40 ? -4.503  5.624   -2.053  1.00 0.00 ? 831 HIS A HB3  10 
ATOM 8433 N N    . LEU A 1 41 ? -5.152  3.649   -3.608  1.00 0.00 ? 832 LEU A N    10 
ATOM 8434 C CA   . LEU A 1 41 ? -4.537  2.452   -4.144  1.00 0.00 ? 832 LEU A CA   10 
ATOM 8435 C C    . LEU A 1 41 ? -5.250  2.043   -5.420  1.00 0.00 ? 832 LEU A C    10 
ATOM 8436 O O    . LEU A 1 41 ? -4.623  1.872   -6.474  1.00 0.00 ? 832 LEU A O    10 
ATOM 8437 C CB   . LEU A 1 41 ? -4.609  1.315   -3.115  1.00 0.00 ? 832 LEU A CB   10 
ATOM 8438 C CG   . LEU A 1 41 ? -3.242  1.133   -2.440  1.00 0.00 ? 832 LEU A CG   10 
ATOM 8439 C CD1  . LEU A 1 41 ? -3.048  2.207   -1.370  1.00 0.00 ? 832 LEU A CD1  10 
ATOM 8440 C CD2  . LEU A 1 41 ? -3.176  -0.250  -1.784  1.00 0.00 ? 832 LEU A CD2  10 
ATOM 8441 H H    . LEU A 1 41 ? -5.558  3.617   -2.714  1.00 0.00 ? 832 LEU A H    10 
ATOM 8442 H HA   . LEU A 1 41 ? -3.503  2.659   -4.370  1.00 0.00 ? 832 LEU A HA   10 
ATOM 8443 H HB2  . LEU A 1 41 ? -5.354  1.552   -2.371  1.00 0.00 ? 832 LEU A HB2  10 
ATOM 8444 H HB3  . LEU A 1 41 ? -4.888  0.402   -3.614  1.00 0.00 ? 832 LEU A HB3  10 
ATOM 8445 H HG   . LEU A 1 41 ? -2.458  1.220   -3.179  1.00 0.00 ? 832 LEU A HG   10 
ATOM 8446 H HD11 . LEU A 1 41 ? -3.116  3.185   -1.823  1.00 0.00 ? 832 LEU A HD11 10 
ATOM 8447 H HD12 . LEU A 1 41 ? -2.075  2.090   -0.915  1.00 0.00 ? 832 LEU A HD12 10 
ATOM 8448 H HD13 . LEU A 1 41 ? -3.814  2.107   -0.614  1.00 0.00 ? 832 LEU A HD13 10 
ATOM 8449 H HD21 . LEU A 1 41 ? -3.370  -1.009  -2.528  1.00 0.00 ? 832 LEU A HD21 10 
ATOM 8450 H HD22 . LEU A 1 41 ? -3.916  -0.315  -1.000  1.00 0.00 ? 832 LEU A HD22 10 
ATOM 8451 H HD23 . LEU A 1 41 ? -2.192  -0.402  -1.365  1.00 0.00 ? 832 LEU A HD23 10 
ATOM 8452 N N    . MET A 1 42 ? -6.571  1.928   -5.334  1.00 0.00 ? 833 MET A N    10 
ATOM 8453 C CA   . MET A 1 42 ? -7.377  1.581   -6.494  1.00 0.00 ? 833 MET A CA   10 
ATOM 8454 C C    . MET A 1 42 ? -7.053  2.512   -7.645  1.00 0.00 ? 833 MET A C    10 
ATOM 8455 O O    . MET A 1 42 ? -6.707  2.071   -8.739  1.00 0.00 ? 833 MET A O    10 
ATOM 8456 C CB   . MET A 1 42 ? -8.867  1.687   -6.159  1.00 0.00 ? 833 MET A CB   10 
ATOM 8457 C CG   . MET A 1 42 ? -9.363  0.366   -5.575  1.00 0.00 ? 833 MET A CG   10 
ATOM 8458 S SD   . MET A 1 42 ? -10.599 0.699   -4.293  1.00 0.00 ? 833 MET A SD   10 
ATOM 8459 C CE   . MET A 1 42 ? -11.671 1.775   -5.279  1.00 0.00 ? 833 MET A CE   10 
ATOM 8460 H H    . MET A 1 42 ? -7.011  2.111   -4.473  1.00 0.00 ? 833 MET A H    10 
ATOM 8461 H HA   . MET A 1 42 ? -7.156  0.566   -6.789  1.00 0.00 ? 833 MET A HA   10 
ATOM 8462 H HB2  . MET A 1 42 ? -9.017  2.480   -5.442  1.00 0.00 ? 833 MET A HB2  10 
ATOM 8463 H HB3  . MET A 1 42 ? -9.422  1.910   -7.059  1.00 0.00 ? 833 MET A HB3  10 
ATOM 8464 H HG2  . MET A 1 42 ? -9.807  -0.225  -6.362  1.00 0.00 ? 833 MET A HG2  10 
ATOM 8465 H HG3  . MET A 1 42 ? -8.533  -0.176  -5.146  1.00 0.00 ? 833 MET A HG3  10 
ATOM 8466 H HE1  . MET A 1 42 ? -11.497 1.595   -6.330  1.00 0.00 ? 833 MET A HE1  10 
ATOM 8467 H HE2  . MET A 1 42 ? -11.454 2.808   -5.056  1.00 0.00 ? 833 MET A HE2  10 
ATOM 8468 H HE3  . MET A 1 42 ? -12.705 1.571   -5.038  1.00 0.00 ? 833 MET A HE3  10 
ATOM 8469 N N    . ALA A 1 43 ? -7.166  3.802   -7.387  1.00 0.00 ? 834 ALA A N    10 
ATOM 8470 C CA   . ALA A 1 43 ? -6.881  4.810   -8.396  1.00 0.00 ? 834 ALA A CA   10 
ATOM 8471 C C    . ALA A 1 43 ? -5.543  4.532   -9.056  1.00 0.00 ? 834 ALA A C    10 
ATOM 8472 O O    . ALA A 1 43 ? -5.443  4.476   -10.285 1.00 0.00 ? 834 ALA A O    10 
ATOM 8473 C CB   . ALA A 1 43 ? -6.866  6.203   -7.766  1.00 0.00 ? 834 ALA A CB   10 
ATOM 8474 H H    . ALA A 1 43 ? -7.447  4.083   -6.490  1.00 0.00 ? 834 ALA A H    10 
ATOM 8475 H HA   . ALA A 1 43 ? -7.656  4.777   -9.146  1.00 0.00 ? 834 ALA A HA   10 
ATOM 8476 H HB1  . ALA A 1 43 ? -5.914  6.372   -7.285  1.00 0.00 ? 834 ALA A HB1  10 
ATOM 8477 H HB2  . ALA A 1 43 ? -7.657  6.279   -7.033  1.00 0.00 ? 834 ALA A HB2  10 
ATOM 8478 H HB3  . ALA A 1 43 ? -7.017  6.946   -8.535  1.00 0.00 ? 834 ALA A HB3  10 
ATOM 8479 N N    . ASN A 1 44 ? -4.517  4.347   -8.239  1.00 0.00 ? 835 ASN A N    10 
ATOM 8480 C CA   . ASN A 1 44 ? -3.180  4.068   -8.757  1.00 0.00 ? 835 ASN A CA   10 
ATOM 8481 C C    . ASN A 1 44 ? -3.113  2.677   -9.370  1.00 0.00 ? 835 ASN A C    10 
ATOM 8482 O O    . ASN A 1 44 ? -2.084  2.284   -9.923  1.00 0.00 ? 835 ASN A O    10 
ATOM 8483 C CB   . ASN A 1 44 ? -2.132  4.197   -7.648  1.00 0.00 ? 835 ASN A CB   10 
ATOM 8484 C CG   . ASN A 1 44 ? -0.772  4.506   -8.260  1.00 0.00 ? 835 ASN A CG   10 
ATOM 8485 O OD1  . ASN A 1 44 ? -0.460  5.668   -8.522  1.00 0.00 ? 835 ASN A OD1  10 
ATOM 8486 N ND2  . ASN A 1 44 ? 0.059   3.541   -8.505  1.00 0.00 ? 835 ASN A ND2  10 
ATOM 8487 H H    . ASN A 1 44 ? -4.663  4.397   -7.267  1.00 0.00 ? 835 ASN A H    10 
ATOM 8488 H HA   . ASN A 1 44 ? -2.954  4.789   -9.526  1.00 0.00 ? 835 ASN A HA   10 
ATOM 8489 H HB2  . ASN A 1 44 ? -2.417  4.996   -6.981  1.00 0.00 ? 835 ASN A HB2  10 
ATOM 8490 H HB3  . ASN A 1 44 ? -2.074  3.270   -7.096  1.00 0.00 ? 835 ASN A HB3  10 
ATOM 8491 H HD21 . ASN A 1 44 ? -0.184  2.615   -8.296  1.00 0.00 ? 835 ASN A HD21 10 
ATOM 8492 H HD22 . ASN A 1 44 ? 0.932   3.740   -8.911  1.00 0.00 ? 835 ASN A HD22 10 
ATOM 8493 N N    . GLY A 1 45 ? -4.208  1.937   -9.273  1.00 0.00 ? 836 GLY A N    10 
ATOM 8494 C CA   . GLY A 1 45 ? -4.271  0.585   -9.818  1.00 0.00 ? 836 GLY A CA   10 
ATOM 8495 C C    . GLY A 1 45 ? -3.552  -0.390  -8.906  1.00 0.00 ? 836 GLY A C    10 
ATOM 8496 O O    . GLY A 1 45 ? -3.044  -1.424  -9.354  1.00 0.00 ? 836 GLY A O    10 
ATOM 8497 H H    . GLY A 1 45 ? -4.998  2.303   -8.819  1.00 0.00 ? 836 GLY A H    10 
ATOM 8498 H HA2  . GLY A 1 45 ? -5.306  0.289   -9.915  1.00 0.00 ? 836 GLY A HA2  10 
ATOM 8499 H HA3  . GLY A 1 45 ? -3.802  0.567   -10.791 1.00 0.00 ? 836 GLY A HA3  10 
ATOM 8500 N N    . PHE A 1 46 ? -3.499  -0.053  -7.625  1.00 0.00 ? 837 PHE A N    10 
ATOM 8501 C CA   . PHE A 1 46 ? -2.834  -0.889  -6.637  1.00 0.00 ? 837 PHE A CA   10 
ATOM 8502 C C    . PHE A 1 46 ? -3.854  -1.748  -5.904  1.00 0.00 ? 837 PHE A C    10 
ATOM 8503 O O    . PHE A 1 46 ? -4.317  -1.391  -4.823  1.00 0.00 ? 837 PHE A O    10 
ATOM 8504 C CB   . PHE A 1 46 ? -2.075  -0.005  -5.635  1.00 0.00 ? 837 PHE A CB   10 
ATOM 8505 C CG   . PHE A 1 46 ? -0.696  0.354   -6.176  1.00 0.00 ? 837 PHE A CG   10 
ATOM 8506 C CD1  . PHE A 1 46 ? -0.444  0.341   -7.562  1.00 0.00 ? 837 PHE A CD1  10 
ATOM 8507 C CD2  . PHE A 1 46 ? 0.327   0.705   -5.290  1.00 0.00 ? 837 PHE A CD2  10 
ATOM 8508 C CE1  . PHE A 1 46 ? 0.826   0.679   -8.045  1.00 0.00 ? 837 PHE A CE1  10 
ATOM 8509 C CE2  . PHE A 1 46 ? 1.594   1.041   -5.778  1.00 0.00 ? 837 PHE A CE2  10 
ATOM 8510 C CZ   . PHE A 1 46 ? 1.843   1.028   -7.155  1.00 0.00 ? 837 PHE A CZ   10 
ATOM 8511 H H    . PHE A 1 46 ? -3.922  0.786   -7.330  1.00 0.00 ? 837 PHE A H    10 
ATOM 8512 H HA   . PHE A 1 46 ? -2.127  -1.537  -7.133  1.00 0.00 ? 837 PHE A HA   10 
ATOM 8513 H HB2  . PHE A 1 46 ? -2.638  0.900   -5.465  1.00 0.00 ? 837 PHE A HB2  10 
ATOM 8514 H HB3  . PHE A 1 46 ? -1.970  -0.534  -4.699  1.00 0.00 ? 837 PHE A HB3  10 
ATOM 8515 H HZ   . PHE A 1 46 ? 2.822   1.290   -7.529  1.00 0.00 ? 837 PHE A HZ   10 
ATOM 8516 N N    . ASP A 1 47 ? -4.214  -2.872  -6.507  1.00 0.00 ? 838 ASP A N    10 
ATOM 8517 C CA   . ASP A 1 47 ? -5.190  -3.779  -5.913  1.00 0.00 ? 838 ASP A CA   10 
ATOM 8518 C C    . ASP A 1 47 ? -4.498  -4.981  -5.289  1.00 0.00 ? 838 ASP A C    10 
ATOM 8519 O O    . ASP A 1 47 ? -3.310  -5.218  -5.524  1.00 0.00 ? 838 ASP A O    10 
ATOM 8520 C CB   . ASP A 1 47 ? -6.193  -4.253  -6.974  1.00 0.00 ? 838 ASP A CB   10 
ATOM 8521 C CG   . ASP A 1 47 ? -7.125  -5.302  -6.391  1.00 0.00 ? 838 ASP A CG   10 
ATOM 8522 O OD1  . ASP A 1 47 ? -7.657  -5.068  -5.320  1.00 0.00 ? 838 ASP A OD1  10 
ATOM 8523 O OD2  . ASP A 1 47 ? -7.293  -6.327  -7.012  1.00 0.00 ? 838 ASP A OD2  10 
ATOM 8524 H H    . ASP A 1 47 ? -3.818  -3.099  -7.373  1.00 0.00 ? 838 ASP A H    10 
ATOM 8525 H HA   . ASP A 1 47 ? -5.731  -3.253  -5.141  1.00 0.00 ? 838 ASP A HA   10 
ATOM 8526 N N    . ASN A 1 48 ? -5.260  -5.747  -4.516  1.00 0.00 ? 839 ASN A N    10 
ATOM 8527 C CA   . ASN A 1 48 ? -4.752  -6.948  -3.858  1.00 0.00 ? 839 ASN A CA   10 
ATOM 8528 C C    . ASN A 1 48 ? -3.487  -6.651  -3.062  1.00 0.00 ? 839 ASN A C    10 
ATOM 8529 O O    . ASN A 1 48 ? -2.365  -6.906  -3.520  1.00 0.00 ? 839 ASN A O    10 
ATOM 8530 C CB   . ASN A 1 48 ? -4.486  -8.054  -4.881  1.00 0.00 ? 839 ASN A CB   10 
ATOM 8531 C CG   . ASN A 1 48 ? -4.163  -9.361  -4.163  1.00 0.00 ? 839 ASN A CG   10 
ATOM 8532 O OD1  . ASN A 1 48 ? -3.714  -9.350  -3.013  1.00 0.00 ? 839 ASN A OD1  10 
ATOM 8533 N ND2  . ASN A 1 48 ? -4.362  -10.493 -4.768  1.00 0.00 ? 839 ASN A ND2  10 
ATOM 8534 H H    . ASN A 1 48 ? -6.204  -5.501  -4.398  1.00 0.00 ? 839 ASN A H    10 
ATOM 8535 H HA   . ASN A 1 48 ? -5.507  -7.301  -3.170  1.00 0.00 ? 839 ASN A HA   10 
ATOM 8536 H HB2  . ASN A 1 48 ? -5.362  -8.187  -5.497  1.00 0.00 ? 839 ASN A HB2  10 
ATOM 8537 H HB3  . ASN A 1 48 ? -3.652  -7.771  -5.504  1.00 0.00 ? 839 ASN A HB3  10 
ATOM 8538 H HD21 . ASN A 1 48 ? -4.721  -10.506 -5.681  1.00 0.00 ? 839 ASN A HD21 10 
ATOM 8539 H HD22 . ASN A 1 48 ? -4.144  -11.335 -4.314  1.00 0.00 ? 839 ASN A HD22 10 
ATOM 8540 N N    . VAL A 1 49 ? -3.677  -6.125  -1.864  1.00 0.00 ? 840 VAL A N    10 
ATOM 8541 C CA   . VAL A 1 49 ? -2.567  -5.798  -0.986  1.00 0.00 ? 840 VAL A CA   10 
ATOM 8542 C C    . VAL A 1 49 ? -1.656  -7.013  -0.791  1.00 0.00 ? 840 VAL A C    10 
ATOM 8543 O O    . VAL A 1 49 ? -0.425  -6.896  -0.833  1.00 0.00 ? 840 VAL A O    10 
ATOM 8544 C CB   . VAL A 1 49 ? -3.098  -5.303  0.365   1.00 0.00 ? 840 VAL A CB   10 
ATOM 8545 C CG1  . VAL A 1 49 ? -3.828  -3.971  0.167   1.00 0.00 ? 840 VAL A CG1  10 
ATOM 8546 C CG2  . VAL A 1 49 ? -4.081  -6.332  0.946   1.00 0.00 ? 840 VAL A CG2  10 
ATOM 8547 H H    . VAL A 1 49 ? -4.591  -5.959  -1.559  1.00 0.00 ? 840 VAL A H    10 
ATOM 8548 H HA   . VAL A 1 49 ? -1.991  -5.005  -1.440  1.00 0.00 ? 840 VAL A HA   10 
ATOM 8549 H HB   . VAL A 1 49 ? -2.271  -5.161  1.047   1.00 0.00 ? 840 VAL A HB   10 
ATOM 8550 H HG11 . VAL A 1 49 ? -4.466  -4.030  -0.701  1.00 0.00 ? 840 VAL A HG11 10 
ATOM 8551 H HG12 . VAL A 1 49 ? -3.103  -3.182  0.026   1.00 0.00 ? 840 VAL A HG12 10 
ATOM 8552 H HG13 . VAL A 1 49 ? -4.427  -3.756  1.040   1.00 0.00 ? 840 VAL A HG13 10 
ATOM 8553 H HG21 . VAL A 1 49 ? -4.816  -6.602  0.203   1.00 0.00 ? 840 VAL A HG21 10 
ATOM 8554 H HG22 . VAL A 1 49 ? -4.580  -5.905  1.801   1.00 0.00 ? 840 VAL A HG22 10 
ATOM 8555 H HG23 . VAL A 1 49 ? -3.540  -7.215  1.256   1.00 0.00 ? 840 VAL A HG23 10 
ATOM 8556 N N    . GLN A 1 50 ? -2.265  -8.180  -0.609  1.00 0.00 ? 841 GLN A N    10 
ATOM 8557 C CA   . GLN A 1 50 ? -1.500  -9.405  -0.442  1.00 0.00 ? 841 GLN A CA   10 
ATOM 8558 C C    . GLN A 1 50 ? -0.636  -9.641  -1.666  1.00 0.00 ? 841 GLN A C    10 
ATOM 8559 O O    . GLN A 1 50 ? 0.579   -9.874  -1.556  1.00 0.00 ? 841 GLN A O    10 
ATOM 8560 C CB   . GLN A 1 50 ? -2.435  -10.596 -0.218  1.00 0.00 ? 841 GLN A CB   10 
ATOM 8561 C CG   . GLN A 1 50 ? -1.734  -11.649 0.646   1.00 0.00 ? 841 GLN A CG   10 
ATOM 8562 C CD   . GLN A 1 50 ? -1.973  -13.035 0.072   1.00 0.00 ? 841 GLN A CD   10 
ATOM 8563 O OE1  . GLN A 1 50 ? -3.117  -13.397 -0.218  1.00 0.00 ? 841 GLN A OE1  10 
ATOM 8564 N NE2  . GLN A 1 50 ? -0.971  -13.831 -0.115  1.00 0.00 ? 841 GLN A NE2  10 
ATOM 8565 H H    . GLN A 1 50 ? -3.246  -8.217  -0.613  1.00 0.00 ? 841 GLN A H    10 
ATOM 8566 H HA   . GLN A 1 50 ? -0.860  -9.295  0.420   1.00 0.00 ? 841 GLN A HA   10 
ATOM 8567 H HB2  . GLN A 1 50 ? -3.330  -10.261 0.283   1.00 0.00 ? 841 GLN A HB2  10 
ATOM 8568 H HB3  . GLN A 1 50 ? -2.699  -11.033 -1.171  1.00 0.00 ? 841 GLN A HB3  10 
ATOM 8569 H HG2  . GLN A 1 50 ? -0.672  -11.452 0.671   1.00 0.00 ? 841 GLN A HG2  10 
ATOM 8570 H HG3  . GLN A 1 50 ? -2.128  -11.608 1.651   1.00 0.00 ? 841 GLN A HG3  10 
ATOM 8571 H HE21 . GLN A 1 50 ? -0.062  -13.534 0.115   1.00 0.00 ? 841 GLN A HE21 10 
ATOM 8572 H HE22 . GLN A 1 50 ? -1.112  -14.727 -0.486  1.00 0.00 ? 841 GLN A HE22 10 
ATOM 8573 N N    . PHE A 1 51 ? -1.245  -9.532  -2.839  1.00 0.00 ? 842 PHE A N    10 
ATOM 8574 C CA   . PHE A 1 51 ? -0.500  -9.676  -4.069  1.00 0.00 ? 842 PHE A CA   10 
ATOM 8575 C C    . PHE A 1 51 ? 0.558   -8.607  -4.124  1.00 0.00 ? 842 PHE A C    10 
ATOM 8576 O O    . PHE A 1 51 ? 1.716   -8.896  -4.359  1.00 0.00 ? 842 PHE A O    10 
ATOM 8577 C CB   . PHE A 1 51 ? -1.412  -9.564  -5.291  1.00 0.00 ? 842 PHE A CB   10 
ATOM 8578 C CG   . PHE A 1 51 ? -0.583  -9.680  -6.552  1.00 0.00 ? 842 PHE A CG   10 
ATOM 8579 C CD1  . PHE A 1 51 ? -0.079  -10.924 -6.947  1.00 0.00 ? 842 PHE A CD1  10 
ATOM 8580 C CD2  . PHE A 1 51 ? -0.315  -8.542  -7.319  1.00 0.00 ? 842 PHE A CD2  10 
ATOM 8581 C CE1  . PHE A 1 51 ? 0.692   -11.027 -8.109  1.00 0.00 ? 842 PHE A CE1  10 
ATOM 8582 C CE2  . PHE A 1 51 ? 0.454   -8.648  -8.482  1.00 0.00 ? 842 PHE A CE2  10 
ATOM 8583 C CZ   . PHE A 1 51 ? 0.957   -9.890  -8.877  1.00 0.00 ? 842 PHE A CZ   10 
ATOM 8584 H H    . PHE A 1 51 ? -2.205  -9.312  -2.869  1.00 0.00 ? 842 PHE A H    10 
ATOM 8585 H HA   . PHE A 1 51 ? -0.022  -10.644 -4.075  1.00 0.00 ? 842 PHE A HA   10 
ATOM 8586 H HB2  . PHE A 1 51 ? -2.144  -10.357 -5.271  1.00 0.00 ? 842 PHE A HB2  10 
ATOM 8587 H HB3  . PHE A 1 51 ? -1.910  -8.607  -5.280  1.00 0.00 ? 842 PHE A HB3  10 
ATOM 8588 H HZ   . PHE A 1 51 ? 1.554   -9.972  -9.775  1.00 0.00 ? 842 PHE A HZ   10 
ATOM 8589 N N    . MET A 1 52 ? 0.159   -7.366  -3.850  1.00 0.00 ? 843 MET A N    10 
ATOM 8590 C CA   . MET A 1 52 ? 1.111   -6.260  -3.827  1.00 0.00 ? 843 MET A CA   10 
ATOM 8591 C C    . MET A 1 52 ? 2.348   -6.670  -3.043  1.00 0.00 ? 843 MET A C    10 
ATOM 8592 O O    . MET A 1 52 ? 3.464   -6.668  -3.571  1.00 0.00 ? 843 MET A O    10 
ATOM 8593 C CB   . MET A 1 52 ? 0.477   -5.025  -3.171  1.00 0.00 ? 843 MET A CB   10 
ATOM 8594 C CG   . MET A 1 52 ? -0.184  -4.146  -4.235  1.00 0.00 ? 843 MET A CG   10 
ATOM 8595 S SD   . MET A 1 52 ? -1.112  -2.815  -3.426  1.00 0.00 ? 843 MET A SD   10 
ATOM 8596 C CE   . MET A 1 52 ? 0.301   -1.960  -2.676  1.00 0.00 ? 843 MET A CE   10 
ATOM 8597 H H    . MET A 1 52 ? -0.787  -7.201  -3.629  1.00 0.00 ? 843 MET A H    10 
ATOM 8598 H HA   . MET A 1 52 ? 1.396   -6.016  -4.839  1.00 0.00 ? 843 MET A HA   10 
ATOM 8599 H HB2  . MET A 1 52 ? -0.266  -5.341  -2.457  1.00 0.00 ? 843 MET A HB2  10 
ATOM 8600 H HB3  . MET A 1 52 ? 1.242   -4.457  -2.660  1.00 0.00 ? 843 MET A HB3  10 
ATOM 8601 H HG2  . MET A 1 52 ? 0.574   -3.719  -4.877  1.00 0.00 ? 843 MET A HG2  10 
ATOM 8602 H HG3  . MET A 1 52 ? -0.860  -4.746  -4.826  1.00 0.00 ? 843 MET A HG3  10 
ATOM 8603 H HE1  . MET A 1 52 ? 0.580   -2.459  -1.758  1.00 0.00 ? 843 MET A HE1  10 
ATOM 8604 H HE2  . MET A 1 52 ? 0.034   -0.939  -2.452  1.00 0.00 ? 843 MET A HE2  10 
ATOM 8605 H HE3  . MET A 1 52 ? 1.135   -1.961  -3.364  1.00 0.00 ? 843 MET A HE3  10 
ATOM 8606 N N    . GLY A 1 53 ? 2.135   -7.081  -1.799  1.00 0.00 ? 844 GLY A N    10 
ATOM 8607 C CA   . GLY A 1 53 ? 3.226   -7.540  -0.953  1.00 0.00 ? 844 GLY A CA   10 
ATOM 8608 C C    . GLY A 1 53 ? 3.954   -8.695  -1.605  1.00 0.00 ? 844 GLY A C    10 
ATOM 8609 O O    . GLY A 1 53 ? 5.170   -8.814  -1.500  1.00 0.00 ? 844 GLY A O    10 
ATOM 8610 H H    . GLY A 1 53 ? 1.214   -7.100  -1.453  1.00 0.00 ? 844 GLY A H    10 
ATOM 8611 H HA2  . GLY A 1 53 ? 3.921   -6.728  -0.797  1.00 0.00 ? 844 GLY A HA2  10 
ATOM 8612 H HA3  . GLY A 1 53 ? 2.831   -7.865  -0.003  1.00 0.00 ? 844 GLY A HA3  10 
ATOM 8613 N N    . SER A 1 54 ? 3.207   -9.532  -2.297  1.00 0.00 ? 845 SER A N    10 
ATOM 8614 C CA   . SER A 1 54 ? 3.783   -10.674 -2.988  1.00 0.00 ? 845 SER A CA   10 
ATOM 8615 C C    . SER A 1 54 ? 4.119   -10.320 -4.430  1.00 0.00 ? 845 SER A C    10 
ATOM 8616 O O    . SER A 1 54 ? 4.336   -11.205 -5.260  1.00 0.00 ? 845 SER A O    10 
ATOM 8617 C CB   . SER A 1 54 ? 2.798   -11.836 -2.965  1.00 0.00 ? 845 SER A CB   10 
ATOM 8618 O OG   . SER A 1 54 ? 2.140   -11.880 -1.693  1.00 0.00 ? 845 SER A OG   10 
ATOM 8619 H H    . SER A 1 54 ? 2.241   -9.372  -2.360  1.00 0.00 ? 845 SER A H    10 
ATOM 8620 H HA   . SER A 1 54 ? 4.687   -10.978 -2.483  1.00 0.00 ? 845 SER A HA   10 
ATOM 8621 H HB2  . SER A 1 54 ? 2.063   -11.701 -3.743  1.00 0.00 ? 845 SER A HB2  10 
ATOM 8622 H HB3  . SER A 1 54 ? 3.338   -12.752 -3.148  1.00 0.00 ? 845 SER A HB3  10 
ATOM 8623 H HG   . SER A 1 54 ? 1.572   -11.095 -1.617  1.00 0.00 ? 845 SER A HG   10 
ATOM 8624 N N    . ASN A 1 55 ? 4.112   -9.034  -4.735  1.00 0.00 ? 846 ASN A N    10 
ATOM 8625 C CA   . ASN A 1 55 ? 4.360   -8.577  -6.097  1.00 0.00 ? 846 ASN A CA   10 
ATOM 8626 C C    . ASN A 1 55 ? 5.418   -7.494  -6.134  1.00 0.00 ? 846 ASN A C    10 
ATOM 8627 O O    . ASN A 1 55 ? 6.386   -7.587  -6.895  1.00 0.00 ? 846 ASN A O    10 
ATOM 8628 C CB   . ASN A 1 55 ? 3.065   -8.057  -6.719  1.00 0.00 ? 846 ASN A CB   10 
ATOM 8629 C CG   . ASN A 1 55 ? 3.355   -7.376  -8.048  1.00 0.00 ? 846 ASN A CG   10 
ATOM 8630 O OD1  . ASN A 1 55 ? 3.118   -6.177  -8.196  1.00 0.00 ? 846 ASN A OD1  10 
ATOM 8631 N ND2  . ASN A 1 55 ? 3.848   -8.068  -9.028  1.00 0.00 ? 846 ASN A ND2  10 
ATOM 8632 H H    . ASN A 1 55 ? 3.891   -8.380  -4.036  1.00 0.00 ? 846 ASN A H    10 
ATOM 8633 H HA   . ASN A 1 55 ? 4.704   -9.412  -6.686  1.00 0.00 ? 846 ASN A HA   10 
ATOM 8634 H HB2  . ASN A 1 55 ? 2.390   -8.884  -6.878  1.00 0.00 ? 846 ASN A HB2  10 
ATOM 8635 H HB3  . ASN A 1 55 ? 2.607   -7.347  -6.048  1.00 0.00 ? 846 ASN A HB3  10 
ATOM 8636 H HD21 . ASN A 1 55 ? 4.032   -9.024  -8.911  1.00 0.00 ? 846 ASN A HD21 10 
ATOM 8637 H HD22 . ASN A 1 55 ? 4.041   -7.638  -9.888  1.00 0.00 ? 846 ASN A HD22 10 
ATOM 8638 N N    . VAL A 1 56 ? 5.230   -6.463  -5.332  1.00 0.00 ? 847 VAL A N    10 
ATOM 8639 C CA   . VAL A 1 56 ? 6.170   -5.360  -5.296  1.00 0.00 ? 847 VAL A CA   10 
ATOM 8640 C C    . VAL A 1 56 ? 6.158   -4.689  -3.933  1.00 0.00 ? 847 VAL A C    10 
ATOM 8641 O O    . VAL A 1 56 ? 5.103   -4.331  -3.415  1.00 0.00 ? 847 VAL A O    10 
ATOM 8642 C CB   . VAL A 1 56 ? 5.837   -4.339  -6.402  1.00 0.00 ? 847 VAL A CB   10 
ATOM 8643 C CG1  . VAL A 1 56 ? 4.380   -3.878  -6.272  1.00 0.00 ? 847 VAL A CG1  10 
ATOM 8644 C CG2  . VAL A 1 56 ? 6.767   -3.125  -6.285  1.00 0.00 ? 847 VAL A CG2  10 
ATOM 8645 H H    . VAL A 1 56 ? 4.436   -6.435  -4.749  1.00 0.00 ? 847 VAL A H    10 
ATOM 8646 H HA   . VAL A 1 56 ? 7.162   -5.747  -5.480  1.00 0.00 ? 847 VAL A HA   10 
ATOM 8647 H HB   . VAL A 1 56 ? 5.972   -4.809  -7.364  1.00 0.00 ? 847 VAL A HB   10 
ATOM 8648 H HG11 . VAL A 1 56 ? 4.109   -3.296  -7.141  1.00 0.00 ? 847 VAL A HG11 10 
ATOM 8649 H HG12 . VAL A 1 56 ? 4.267   -3.272  -5.385  1.00 0.00 ? 847 VAL A HG12 10 
ATOM 8650 H HG13 . VAL A 1 56 ? 3.733   -4.740  -6.202  1.00 0.00 ? 847 VAL A HG13 10 
ATOM 8651 H HG21 . VAL A 1 56 ? 6.378   -2.439  -5.547  1.00 0.00 ? 847 VAL A HG21 10 
ATOM 8652 H HG22 . VAL A 1 56 ? 6.833   -2.626  -7.240  1.00 0.00 ? 847 VAL A HG22 10 
ATOM 8653 H HG23 . VAL A 1 56 ? 7.752   -3.451  -5.985  1.00 0.00 ? 847 VAL A HG23 10 
ATOM 8654 N N    . MET A 1 57 ? 7.338   -4.501  -3.372  1.00 0.00 ? 848 MET A N    10 
ATOM 8655 C CA   . MET A 1 57 ? 7.478   -3.837  -2.093  1.00 0.00 ? 848 MET A CA   10 
ATOM 8656 C C    . MET A 1 57 ? 8.677   -2.913  -2.143  1.00 0.00 ? 848 MET A C    10 
ATOM 8657 O O    . MET A 1 57 ? 9.823   -3.362  -2.061  1.00 0.00 ? 848 MET A O    10 
ATOM 8658 C CB   . MET A 1 57 ? 7.659   -4.869  -0.964  1.00 0.00 ? 848 MET A CB   10 
ATOM 8659 C CG   . MET A 1 57 ? 6.901   -6.160  -1.308  1.00 0.00 ? 848 MET A CG   10 
ATOM 8660 S SD   . MET A 1 57 ? 7.270   -7.426  -0.070  1.00 0.00 ? 848 MET A SD   10 
ATOM 8661 C CE   . MET A 1 57 ? 9.036   -7.597  -0.434  1.00 0.00 ? 848 MET A CE   10 
ATOM 8662 H H    . MET A 1 57 ? 8.146   -4.786  -3.846  1.00 0.00 ? 848 MET A H    10 
ATOM 8663 H HA   . MET A 1 57 ? 6.589   -3.254  -1.898  1.00 0.00 ? 848 MET A HA   10 
ATOM 8664 H HB2  . MET A 1 57 ? 8.710   -5.087  -0.846  1.00 0.00 ? 848 MET A HB2  10 
ATOM 8665 H HB3  . MET A 1 57 ? 7.271   -4.462  -0.043  1.00 0.00 ? 848 MET A HB3  10 
ATOM 8666 H HG2  . MET A 1 57 ? 5.839   -5.964  -1.315  1.00 0.00 ? 848 MET A HG2  10 
ATOM 8667 H HG3  . MET A 1 57 ? 7.204   -6.515  -2.282  1.00 0.00 ? 848 MET A HG3  10 
ATOM 8668 H HE1  . MET A 1 57 ? 9.219   -7.342  -1.469  1.00 0.00 ? 848 MET A HE1  10 
ATOM 8669 H HE2  . MET A 1 57 ? 9.346   -8.614  -0.260  1.00 0.00 ? 848 MET A HE2  10 
ATOM 8670 H HE3  . MET A 1 57 ? 9.601   -6.940  0.212   1.00 0.00 ? 848 MET A HE3  10 
ATOM 8671 N N    . GLU A 1 58 ? 8.415   -1.631  -2.306  1.00 0.00 ? 849 GLU A N    10 
ATOM 8672 C CA   . GLU A 1 58 ? 9.477   -0.645  -2.404  1.00 0.00 ? 849 GLU A CA   10 
ATOM 8673 C C    . GLU A 1 58 ? 8.896   0.752   -2.401  1.00 0.00 ? 849 GLU A C    10 
ATOM 8674 O O    . GLU A 1 58 ? 7.734   0.951   -2.752  1.00 0.00 ? 849 GLU A O    10 
ATOM 8675 C CB   . GLU A 1 58 ? 10.299  -0.864  -3.689  1.00 0.00 ? 849 GLU A CB   10 
ATOM 8676 C CG   . GLU A 1 58 ? 9.377   -1.303  -4.841  1.00 0.00 ? 849 GLU A CG   10 
ATOM 8677 C CD   . GLU A 1 58 ? 10.186  -1.997  -5.917  1.00 0.00 ? 849 GLU A CD   10 
ATOM 8678 O OE1  . GLU A 1 58 ? 10.790  -1.307  -6.708  1.00 0.00 ? 849 GLU A OE1  10 
ATOM 8679 O OE2  . GLU A 1 58 ? 10.190  -3.209  -5.940  1.00 0.00 ? 849 GLU A OE2  10 
ATOM 8680 H H    . GLU A 1 58 ? 7.483   -1.336  -2.388  1.00 0.00 ? 849 GLU A H    10 
ATOM 8681 H HA   . GLU A 1 58 ? 10.135  -0.753  -1.554  1.00 0.00 ? 849 GLU A HA   10 
ATOM 8682 N N    . ASP A 1 59 ? 9.712   1.717   -2.025  1.00 0.00 ? 850 ASP A N    10 
ATOM 8683 C CA   . ASP A 1 59 ? 9.285   3.108   -1.986  1.00 0.00 ? 850 ASP A CA   10 
ATOM 8684 C C    . ASP A 1 59 ? 8.542   3.463   -3.264  1.00 0.00 ? 850 ASP A C    10 
ATOM 8685 O O    . ASP A 1 59 ? 7.557   4.204   -3.240  1.00 0.00 ? 850 ASP A O    10 
ATOM 8686 C CB   . ASP A 1 59 ? 10.505  4.032   -1.837  1.00 0.00 ? 850 ASP A CB   10 
ATOM 8687 C CG   . ASP A 1 59 ? 11.332  3.639   -0.625  1.00 0.00 ? 850 ASP A CG   10 
ATOM 8688 O OD1  . ASP A 1 59 ? 11.710  2.492   -0.529  1.00 0.00 ? 850 ASP A OD1  10 
ATOM 8689 O OD2  . ASP A 1 59 ? 11.586  4.498   0.195   1.00 0.00 ? 850 ASP A OD2  10 
ATOM 8690 H H    . ASP A 1 59 ? 10.632  1.493   -1.771  1.00 0.00 ? 850 ASP A H    10 
ATOM 8691 H HA   . ASP A 1 59 ? 8.631   3.254   -1.142  1.00 0.00 ? 850 ASP A HA   10 
ATOM 8692 N N    . GLN A 1 60 ? 9.033   2.938   -4.376  1.00 0.00 ? 851 GLN A N    10 
ATOM 8693 C CA   . GLN A 1 60 ? 8.448   3.207   -5.685  1.00 0.00 ? 851 GLN A CA   10 
ATOM 8694 C C    . GLN A 1 60 ? 6.936   2.965   -5.698  1.00 0.00 ? 851 GLN A C    10 
ATOM 8695 O O    . GLN A 1 60 ? 6.201   3.623   -6.450  1.00 0.00 ? 851 GLN A O    10 
ATOM 8696 C CB   . GLN A 1 60 ? 9.123   2.343   -6.763  1.00 0.00 ? 851 GLN A CB   10 
ATOM 8697 C CG   . GLN A 1 60 ? 10.642  2.286   -6.513  1.00 0.00 ? 851 GLN A CG   10 
ATOM 8698 C CD   . GLN A 1 60 ? 11.374  1.761   -7.750  1.00 0.00 ? 851 GLN A CD   10 
ATOM 8699 O OE1  . GLN A 1 60 ? 12.568  1.463   -7.682  1.00 0.00 ? 851 GLN A OE1  10 
ATOM 8700 N NE2  . GLN A 1 60 ? 10.739  1.626   -8.875  1.00 0.00 ? 851 GLN A NE2  10 
ATOM 8701 H H    . GLN A 1 60 ? 9.825   2.366   -4.314  1.00 0.00 ? 851 GLN A H    10 
ATOM 8702 H HA   . GLN A 1 60 ? 8.626   4.243   -5.927  1.00 0.00 ? 851 GLN A HA   10 
ATOM 8703 H HB2  . GLN A 1 60 ? 8.714   1.343   -6.736  1.00 0.00 ? 851 GLN A HB2  10 
ATOM 8704 H HB3  . GLN A 1 60 ? 8.938   2.782   -7.732  1.00 0.00 ? 851 GLN A HB3  10 
ATOM 8705 H HG2  . GLN A 1 60 ? 11.005  3.278   -6.281  1.00 0.00 ? 851 GLN A HG2  10 
ATOM 8706 H HG3  . GLN A 1 60 ? 10.843  1.630   -5.678  1.00 0.00 ? 851 GLN A HG3  10 
ATOM 8707 H HE21 . GLN A 1 60 ? 9.791   1.863   -8.934  1.00 0.00 ? 851 GLN A HE21 10 
ATOM 8708 H HE22 . GLN A 1 60 ? 11.209  1.292   -9.666  1.00 0.00 ? 851 GLN A HE22 10 
ATOM 8709 N N    . ASP A 1 61 ? 6.469   2.020   -4.884  1.00 0.00 ? 852 ASP A N    10 
ATOM 8710 C CA   . ASP A 1 61 ? 5.039   1.712   -4.837  1.00 0.00 ? 852 ASP A CA   10 
ATOM 8711 C C    . ASP A 1 61 ? 4.266   2.852   -4.176  1.00 0.00 ? 852 ASP A C    10 
ATOM 8712 O O    . ASP A 1 61 ? 3.433   3.503   -4.820  1.00 0.00 ? 852 ASP A O    10 
ATOM 8713 C CB   . ASP A 1 61 ? 4.790   0.365   -4.112  1.00 0.00 ? 852 ASP A CB   10 
ATOM 8714 C CG   . ASP A 1 61 ? 4.079   0.578   -2.784  1.00 0.00 ? 852 ASP A CG   10 
ATOM 8715 O OD1  . ASP A 1 61 ? 2.864   0.644   -2.790  1.00 0.00 ? 852 ASP A OD1  10 
ATOM 8716 O OD2  . ASP A 1 61 ? 4.762   0.675   -1.784  1.00 0.00 ? 852 ASP A OD2  10 
ATOM 8717 H H    . ASP A 1 61 ? 7.090   1.524   -4.304  1.00 0.00 ? 852 ASP A H    10 
ATOM 8718 H HA   . ASP A 1 61 ? 4.683   1.624   -5.852  1.00 0.00 ? 852 ASP A HA   10 
ATOM 8719 N N    . LEU A 1 62 ? 4.574   3.124   -2.917  1.00 0.00 ? 853 LEU A N    10 
ATOM 8720 C CA   . LEU A 1 62 ? 3.920   4.204   -2.205  1.00 0.00 ? 853 LEU A CA   10 
ATOM 8721 C C    . LEU A 1 62 ? 4.111   5.505   -2.960  1.00 0.00 ? 853 LEU A C    10 
ATOM 8722 O O    . LEU A 1 62 ? 3.196   6.338   -3.037  1.00 0.00 ? 853 LEU A O    10 
ATOM 8723 C CB   . LEU A 1 62 ? 4.494   4.328   -0.799  1.00 0.00 ? 853 LEU A CB   10 
ATOM 8724 C CG   . LEU A 1 62 ? 3.791   3.325   0.133   1.00 0.00 ? 853 LEU A CG   10 
ATOM 8725 C CD1  . LEU A 1 62 ? 4.800   2.308   0.661   1.00 0.00 ? 853 LEU A CD1  10 
ATOM 8726 C CD2  . LEU A 1 62 ? 3.157   4.069   1.308   1.00 0.00 ? 853 LEU A CD2  10 
ATOM 8727 H H    . LEU A 1 62 ? 5.252   2.584   -2.457  1.00 0.00 ? 853 LEU A H    10 
ATOM 8728 H HA   . LEU A 1 62 ? 2.866   3.986   -2.133  1.00 0.00 ? 853 LEU A HA   10 
ATOM 8729 H HB2  . LEU A 1 62 ? 5.552   4.119   -0.839  1.00 0.00 ? 853 LEU A HB2  10 
ATOM 8730 H HB3  . LEU A 1 62 ? 4.341   5.333   -0.437  1.00 0.00 ? 853 LEU A HB3  10 
ATOM 8731 H HG   . LEU A 1 62 ? 3.024   2.796   -0.418  1.00 0.00 ? 853 LEU A HG   10 
ATOM 8732 H HD11 . LEU A 1 62 ? 5.143   2.607   1.639   1.00 0.00 ? 853 LEU A HD11 10 
ATOM 8733 H HD12 . LEU A 1 62 ? 5.636   2.240   -0.018  1.00 0.00 ? 853 LEU A HD12 10 
ATOM 8734 H HD13 . LEU A 1 62 ? 4.321   1.344   0.729   1.00 0.00 ? 853 LEU A HD13 10 
ATOM 8735 H HD21 . LEU A 1 62 ? 3.678   4.998   1.475   1.00 0.00 ? 853 LEU A HD21 10 
ATOM 8736 H HD22 . LEU A 1 62 ? 3.221   3.460   2.195   1.00 0.00 ? 853 LEU A HD22 10 
ATOM 8737 H HD23 . LEU A 1 62 ? 2.121   4.270   1.084   1.00 0.00 ? 853 LEU A HD23 10 
ATOM 8738 N N    . LEU A 1 63 ? 5.284   5.663   -3.558  1.00 0.00 ? 854 LEU A N    10 
ATOM 8739 C CA   . LEU A 1 63 ? 5.564   6.846   -4.352  1.00 0.00 ? 854 LEU A CA   10 
ATOM 8740 C C    . LEU A 1 63 ? 4.585   6.925   -5.507  1.00 0.00 ? 854 LEU A C    10 
ATOM 8741 O O    . LEU A 1 63 ? 4.051   7.992   -5.809  1.00 0.00 ? 854 LEU A O    10 
ATOM 8742 C CB   . LEU A 1 63 ? 7.002   6.814   -4.889  1.00 0.00 ? 854 LEU A CB   10 
ATOM 8743 C CG   . LEU A 1 63 ? 7.899   7.754   -4.067  1.00 0.00 ? 854 LEU A CG   10 
ATOM 8744 C CD1  . LEU A 1 63 ? 7.481   9.209   -4.299  1.00 0.00 ? 854 LEU A CD1  10 
ATOM 8745 C CD2  . LEU A 1 63 ? 7.781   7.419   -2.573  1.00 0.00 ? 854 LEU A CD2  10 
ATOM 8746 H H    . LEU A 1 63 ? 5.961   4.953   -3.484  1.00 0.00 ? 854 LEU A H    10 
ATOM 8747 H HA   . LEU A 1 63 ? 5.438   7.719   -3.730  1.00 0.00 ? 854 LEU A HA   10 
ATOM 8748 H HB2  . LEU A 1 63 ? 7.389   5.807   -4.835  1.00 0.00 ? 854 LEU A HB2  10 
ATOM 8749 H HB3  . LEU A 1 63 ? 7.005   7.137   -5.920  1.00 0.00 ? 854 LEU A HB3  10 
ATOM 8750 H HG   . LEU A 1 63 ? 8.925   7.628   -4.385  1.00 0.00 ? 854 LEU A HG   10 
ATOM 8751 H HD11 . LEU A 1 63 ? 7.301   9.372   -5.351  1.00 0.00 ? 854 LEU A HD11 10 
ATOM 8752 H HD12 . LEU A 1 63 ? 8.271   9.865   -3.965  1.00 0.00 ? 854 LEU A HD12 10 
ATOM 8753 H HD13 . LEU A 1 63 ? 6.581   9.424   -3.742  1.00 0.00 ? 854 LEU A HD13 10 
ATOM 8754 H HD21 . LEU A 1 63 ? 7.022   8.039   -2.119  1.00 0.00 ? 854 LEU A HD21 10 
ATOM 8755 H HD22 . LEU A 1 63 ? 8.729   7.605   -2.091  1.00 0.00 ? 854 LEU A HD22 10 
ATOM 8756 H HD23 . LEU A 1 63 ? 7.517   6.380   -2.452  1.00 0.00 ? 854 LEU A HD23 10 
ATOM 8757 N N    . GLU A 1 64 ? 4.324   5.777   -6.130  1.00 0.00 ? 855 GLU A N    10 
ATOM 8758 C CA   . GLU A 1 64 ? 3.375   5.710   -7.233  1.00 0.00 ? 855 GLU A CA   10 
ATOM 8759 C C    . GLU A 1 64 ? 2.031   6.250   -6.786  1.00 0.00 ? 855 GLU A C    10 
ATOM 8760 O O    . GLU A 1 64 ? 1.531   7.240   -7.329  1.00 0.00 ? 855 GLU A O    10 
ATOM 8761 C CB   . GLU A 1 64 ? 3.221   4.261   -7.720  1.00 0.00 ? 855 GLU A CB   10 
ATOM 8762 C CG   . GLU A 1 64 ? 3.613   4.161   -9.197  1.00 0.00 ? 855 GLU A CG   10 
ATOM 8763 C CD   . GLU A 1 64 ? 2.613   4.911   -10.055 1.00 0.00 ? 855 GLU A CD   10 
ATOM 8764 O OE1  . GLU A 1 64 ? 1.645   4.304   -10.468 1.00 0.00 ? 855 GLU A OE1  10 
ATOM 8765 O OE2  . GLU A 1 64 ? 2.826   6.079   -10.294 1.00 0.00 ? 855 GLU A OE2  10 
ATOM 8766 H H    . GLU A 1 64 ? 4.765   4.955   -5.824  1.00 0.00 ? 855 GLU A H    10 
ATOM 8767 H HA   . GLU A 1 64 ? 3.744   6.317   -8.044  1.00 0.00 ? 855 GLU A HA   10 
ATOM 8768 N N    . ILE A 1 65 ? 1.465   5.628   -5.765  1.00 0.00 ? 856 ILE A N    10 
ATOM 8769 C CA   . ILE A 1 65 ? 0.195   6.095   -5.226  1.00 0.00 ? 856 ILE A CA   10 
ATOM 8770 C C    . ILE A 1 65 ? 0.345   7.539   -4.764  1.00 0.00 ? 856 ILE A C    10 
ATOM 8771 O O    . ILE A 1 65 ? -0.600  8.321   -4.820  1.00 0.00 ? 856 ILE A O    10 
ATOM 8772 C CB   . ILE A 1 65 ? -0.287  5.207   -4.051  1.00 0.00 ? 856 ILE A CB   10 
ATOM 8773 C CG1  . ILE A 1 65 ? 0.667   4.024   -3.843  1.00 0.00 ? 856 ILE A CG1  10 
ATOM 8774 C CG2  . ILE A 1 65 ? -1.687  4.664   -4.348  1.00 0.00 ? 856 ILE A CG2  10 
ATOM 8775 C CD1  . ILE A 1 65 ? 0.118   3.110   -2.744  1.00 0.00 ? 856 ILE A CD1  10 
ATOM 8776 H H    . ILE A 1 65 ? 1.930   4.870   -5.352  1.00 0.00 ? 856 ILE A H    10 
ATOM 8777 H HA   . ILE A 1 65 ? -0.540  6.064   -6.016  1.00 0.00 ? 856 ILE A HA   10 
ATOM 8778 H HB   . ILE A 1 65 ? -0.328  5.805   -3.152  1.00 0.00 ? 856 ILE A HB   10 
ATOM 8779 H HG12 . ILE A 1 65 ? 0.755   3.459   -4.759  1.00 0.00 ? 856 ILE A HG12 10 
ATOM 8780 H HG21 . ILE A 1 65 ? -2.259  5.403   -4.886  1.00 0.00 ? 856 ILE A HG21 10 
ATOM 8781 H HG22 . ILE A 1 65 ? -2.183  4.432   -3.418  1.00 0.00 ? 856 ILE A HG22 10 
ATOM 8782 H HG23 . ILE A 1 65 ? -1.604  3.767   -4.941  1.00 0.00 ? 856 ILE A HG23 10 
ATOM 8783 H HD11 . ILE A 1 65 ? -0.115  3.696   -1.869  1.00 0.00 ? 856 ILE A HD11 10 
ATOM 8784 H HD12 . ILE A 1 65 ? 0.859   2.365   -2.493  1.00 0.00 ? 856 ILE A HD12 10 
ATOM 8785 H HD13 . ILE A 1 65 ? -0.777  2.620   -3.098  1.00 0.00 ? 856 ILE A HD13 10 
ATOM 8786 N N    . GLY A 1 66 ? 1.551   7.889   -4.345  1.00 0.00 ? 857 GLY A N    10 
ATOM 8787 C CA   . GLY A 1 66 ? 1.845   9.238   -3.884  1.00 0.00 ? 857 GLY A CA   10 
ATOM 8788 C C    . GLY A 1 66 ? 1.769   9.322   -2.371  1.00 0.00 ? 857 GLY A C    10 
ATOM 8789 O O    . GLY A 1 66 ? 1.369   10.347  -1.813  1.00 0.00 ? 857 GLY A O    10 
ATOM 8790 H H    . GLY A 1 66 ? 2.268   7.218   -4.345  1.00 0.00 ? 857 GLY A H    10 
ATOM 8791 H HA2  . GLY A 1 66 ? 2.838   9.515   -4.207  1.00 0.00 ? 857 GLY A HA2  10 
ATOM 8792 H HA3  . GLY A 1 66 ? 1.128   9.925   -4.309  1.00 0.00 ? 857 GLY A HA3  10 
ATOM 8793 N N    . ILE A 1 67 ? 2.181   8.251   -1.709  1.00 0.00 ? 858 ILE A N    10 
ATOM 8794 C CA   . ILE A 1 67 ? 2.190   8.212   -0.254  1.00 0.00 ? 858 ILE A CA   10 
ATOM 8795 C C    . ILE A 1 67 ? 3.590   8.539   0.265   1.00 0.00 ? 858 ILE A C    10 
ATOM 8796 O O    . ILE A 1 67 ? 4.404   7.644   0.497   1.00 0.00 ? 858 ILE A O    10 
ATOM 8797 C CB   . ILE A 1 67 ? 1.750   6.826   0.252   1.00 0.00 ? 858 ILE A CB   10 
ATOM 8798 C CG1  . ILE A 1 67 ? 0.766   6.185   -0.741  1.00 0.00 ? 858 ILE A CG1  10 
ATOM 8799 C CG2  . ILE A 1 67 ? 1.069   6.964   1.617   1.00 0.00 ? 858 ILE A CG2  10 
ATOM 8800 C CD1  . ILE A 1 67 ? -0.461  7.086   -0.918  1.00 0.00 ? 858 ILE A CD1  10 
ATOM 8801 H H    . ILE A 1 67 ? 2.513   7.473   -2.211  1.00 0.00 ? 858 ILE A H    10 
ATOM 8802 H HA   . ILE A 1 67 ? 1.500   8.952   0.117   1.00 0.00 ? 858 ILE A HA   10 
ATOM 8803 H HB   . ILE A 1 67 ? 2.622   6.200   0.352   1.00 0.00 ? 858 ILE A HB   10 
ATOM 8804 H HG12 . ILE A 1 67 ? 1.255   6.042   -1.693  1.00 0.00 ? 858 ILE A HG12 10 
ATOM 8805 H HG21 . ILE A 1 67 ? 1.820   7.071   2.385   1.00 0.00 ? 858 ILE A HG21 10 
ATOM 8806 H HG22 . ILE A 1 67 ? 0.475   6.083   1.811   1.00 0.00 ? 858 ILE A HG22 10 
ATOM 8807 H HG23 . ILE A 1 67 ? 0.428   7.833   1.614   1.00 0.00 ? 858 ILE A HG23 10 
ATOM 8808 H HD11 . ILE A 1 67 ? -0.366  7.651   -1.833  1.00 0.00 ? 858 ILE A HD11 10 
ATOM 8809 H HD12 . ILE A 1 67 ? -0.537  7.767   -0.083  1.00 0.00 ? 858 ILE A HD12 10 
ATOM 8810 H HD13 . ILE A 1 67 ? -1.350  6.477   -0.965  1.00 0.00 ? 858 ILE A HD13 10 
ATOM 8811 N N    . LEU A 1 68 ? 3.870   9.824   0.414   1.00 0.00 ? 859 LEU A N    10 
ATOM 8812 C CA   . LEU A 1 68 ? 5.180   10.274  0.877   1.00 0.00 ? 859 LEU A CA   10 
ATOM 8813 C C    . LEU A 1 68 ? 5.330   10.062  2.374   1.00 0.00 ? 859 LEU A C    10 
ATOM 8814 O O    . LEU A 1 68 ? 6.442   9.956   2.886   1.00 0.00 ? 859 LEU A O    10 
ATOM 8815 C CB   . LEU A 1 68 ? 5.383   11.759  0.548   1.00 0.00 ? 859 LEU A CB   10 
ATOM 8816 C CG   . LEU A 1 68 ? 4.847   12.067  -0.859  1.00 0.00 ? 859 LEU A CG   10 
ATOM 8817 C CD1  . LEU A 1 68 ? 4.759   13.578  -1.049  1.00 0.00 ? 859 LEU A CD1  10 
ATOM 8818 C CD2  . LEU A 1 68 ? 5.789   11.474  -1.912  1.00 0.00 ? 859 LEU A CD2  10 
ATOM 8819 H H    . LEU A 1 68 ? 3.185   10.488  0.195   1.00 0.00 ? 859 LEU A H    10 
ATOM 8820 H HA   . LEU A 1 68 ? 5.944   9.704   0.368   1.00 0.00 ? 859 LEU A HA   10 
ATOM 8821 H HB2  . LEU A 1 68 ? 4.854   12.357  1.276   1.00 0.00 ? 859 LEU A HB2  10 
ATOM 8822 H HB3  . LEU A 1 68 ? 6.436   11.994  0.591   1.00 0.00 ? 859 LEU A HB3  10 
ATOM 8823 H HG   . LEU A 1 68 ? 3.859   11.645  -0.975  1.00 0.00 ? 859 LEU A HG   10 
ATOM 8824 H HD11 . LEU A 1 68 ? 4.298   13.787  -2.003  1.00 0.00 ? 859 LEU A HD11 10 
ATOM 8825 H HD12 . LEU A 1 68 ? 5.750   14.006  -1.023  1.00 0.00 ? 859 LEU A HD12 10 
ATOM 8826 H HD13 . LEU A 1 68 ? 4.160   14.007  -0.260  1.00 0.00 ? 859 LEU A HD13 10 
ATOM 8827 H HD21 . LEU A 1 68 ? 6.808   11.754  -1.687  1.00 0.00 ? 859 LEU A HD21 10 
ATOM 8828 H HD22 . LEU A 1 68 ? 5.520   11.850  -2.888  1.00 0.00 ? 859 LEU A HD22 10 
ATOM 8829 H HD23 . LEU A 1 68 ? 5.702   10.398  -1.906  1.00 0.00 ? 859 LEU A HD23 10 
ATOM 8830 N N    . ASN A 1 69 ? 4.204   10.023  3.076   1.00 0.00 ? 860 ASN A N    10 
ATOM 8831 C CA   . ASN A 1 69 ? 4.213   9.840   4.529   1.00 0.00 ? 860 ASN A CA   10 
ATOM 8832 C C    . ASN A 1 69 ? 5.214   8.759   4.930   1.00 0.00 ? 860 ASN A C    10 
ATOM 8833 O O    . ASN A 1 69 ? 4.938   7.564   4.791   1.00 0.00 ? 860 ASN A O    10 
ATOM 8834 C CB   . ASN A 1 69 ? 2.813   9.462   5.030   1.00 0.00 ? 860 ASN A CB   10 
ATOM 8835 C CG   . ASN A 1 69 ? 2.254   10.568  5.912   1.00 0.00 ? 860 ASN A CG   10 
ATOM 8836 O OD1  . ASN A 1 69 ? 2.895   10.972  6.881   1.00 0.00 ? 860 ASN A OD1  10 
ATOM 8837 N ND2  . ASN A 1 69 ? 1.100   11.085  5.641   1.00 0.00 ? 860 ASN A ND2  10 
ATOM 8838 H H    . ASN A 1 69 ? 3.351   10.132  2.606   1.00 0.00 ? 860 ASN A H    10 
ATOM 8839 H HA   . ASN A 1 69 ? 4.507   10.772  4.991   1.00 0.00 ? 860 ASN A HA   10 
ATOM 8840 H HB2  . ASN A 1 69 ? 2.155   9.302   4.189   1.00 0.00 ? 860 ASN A HB2  10 
ATOM 8841 H HB3  . ASN A 1 69 ? 2.881   8.554   5.608   1.00 0.00 ? 860 ASN A HB3  10 
ATOM 8842 H HD21 . ASN A 1 69 ? 0.585   10.767  4.870   1.00 0.00 ? 860 ASN A HD21 10 
ATOM 8843 H HD22 . ASN A 1 69 ? 0.737   11.799  6.206   1.00 0.00 ? 860 ASN A HD22 10 
ATOM 8844 N N    . SER A 1 70 ? 6.377   9.183   5.404   1.00 0.00 ? 861 SER A N    10 
ATOM 8845 C CA   . SER A 1 70 ? 7.432   8.257   5.797   1.00 0.00 ? 861 SER A CA   10 
ATOM 8846 C C    . SER A 1 70 ? 6.881   7.111   6.637   1.00 0.00 ? 861 SER A C    10 
ATOM 8847 O O    . SER A 1 70 ? 7.103   5.932   6.323   1.00 0.00 ? 861 SER A O    10 
ATOM 8848 C CB   . SER A 1 70 ? 8.510   9.011   6.576   1.00 0.00 ? 861 SER A CB   10 
ATOM 8849 O OG   . SER A 1 70 ? 8.433   10.404  6.253   1.00 0.00 ? 861 SER A OG   10 
ATOM 8850 H H    . SER A 1 70 ? 6.547   10.146  5.476   1.00 0.00 ? 861 SER A H    10 
ATOM 8851 H HA   . SER A 1 70 ? 7.882   7.845   4.908   1.00 0.00 ? 861 SER A HA   10 
ATOM 8852 H HB2  . SER A 1 70 ? 8.354   8.882   7.636   1.00 0.00 ? 861 SER A HB2  10 
ATOM 8853 H HB3  . SER A 1 70 ? 9.480   8.613   6.310   1.00 0.00 ? 861 SER A HB3  10 
ATOM 8854 H HG   . SER A 1 70 ? 9.205   10.621  5.712   1.00 0.00 ? 861 SER A HG   10 
ATOM 8855 N N    . GLY A 1 71 ? 6.152   7.455   7.685   1.00 0.00 ? 862 GLY A N    10 
ATOM 8856 C CA   . GLY A 1 71 ? 5.555   6.459   8.564   1.00 0.00 ? 862 GLY A CA   10 
ATOM 8857 C C    . GLY A 1 71 ? 4.651   5.527   7.782   1.00 0.00 ? 862 GLY A C    10 
ATOM 8858 O O    . GLY A 1 71 ? 4.684   4.311   7.970   1.00 0.00 ? 862 GLY A O    10 
ATOM 8859 H H    . GLY A 1 71 ? 6.000   8.405   7.866   1.00 0.00 ? 862 GLY A H    10 
ATOM 8860 H HA2  . GLY A 1 71 ? 6.342   5.885   9.033   1.00 0.00 ? 862 GLY A HA2  10 
ATOM 8861 H HA3  . GLY A 1 71 ? 4.976   6.955   9.327   1.00 0.00 ? 862 GLY A HA3  10 
ATOM 8862 N N    . HIS A 1 72 ? 3.867   6.089   6.876   1.00 0.00 ? 863 HIS A N    10 
ATOM 8863 C CA   . HIS A 1 72 ? 2.996   5.274   6.045   1.00 0.00 ? 863 HIS A CA   10 
ATOM 8864 C C    . HIS A 1 72 ? 3.840   4.464   5.079   1.00 0.00 ? 863 HIS A C    10 
ATOM 8865 O O    . HIS A 1 72 ? 3.595   3.277   4.869   1.00 0.00 ? 863 HIS A O    10 
ATOM 8866 C CB   . HIS A 1 72 ? 1.996   6.146   5.266   1.00 0.00 ? 863 HIS A CB   10 
ATOM 8867 C CG   . HIS A 1 72 ? 1.143   6.939   6.233   1.00 0.00 ? 863 HIS A CG   10 
ATOM 8868 N ND1  . HIS A 1 72 ? 0.106   7.762   5.808   1.00 0.00 ? 863 HIS A ND1  10 
ATOM 8869 C CD2  . HIS A 1 72 ? 1.167   7.046   7.603   1.00 0.00 ? 863 HIS A CD2  10 
ATOM 8870 C CE1  . HIS A 1 72 ? -0.443  8.319   6.906   1.00 0.00 ? 863 HIS A CE1  10 
ATOM 8871 N NE2  . HIS A 1 72 ? 0.167   7.918   8.024   1.00 0.00 ? 863 HIS A NE2  10 
ATOM 8872 H H    . HIS A 1 72 ? 3.901   7.061   6.744   1.00 0.00 ? 863 HIS A H    10 
ATOM 8873 H HA   . HIS A 1 72 ? 2.448   4.593   6.679   1.00 0.00 ? 863 HIS A HA   10 
ATOM 8874 H HB2  . HIS A 1 72 ? 2.534   6.818   4.615   1.00 0.00 ? 863 HIS A HB2  10 
ATOM 8875 H HB3  . HIS A 1 72 ? 1.360   5.508   4.670   1.00 0.00 ? 863 HIS A HB3  10 
ATOM 8876 N N    . ARG A 1 73 ? 4.855   5.112   4.512   1.00 0.00 ? 864 ARG A N    10 
ATOM 8877 C CA   . ARG A 1 73 ? 5.756   4.449   3.577   1.00 0.00 ? 864 ARG A CA   10 
ATOM 8878 C C    . ARG A 1 73 ? 6.312   3.171   4.180   1.00 0.00 ? 864 ARG A C    10 
ATOM 8879 O O    . ARG A 1 73 ? 6.182   2.092   3.599   1.00 0.00 ? 864 ARG A O    10 
ATOM 8880 C CB   . ARG A 1 73 ? 6.919   5.385   3.191   1.00 0.00 ? 864 ARG A CB   10 
ATOM 8881 C CG   . ARG A 1 73 ? 6.771   5.833   1.729   1.00 0.00 ? 864 ARG A CG   10 
ATOM 8882 C CD   . ARG A 1 73 ? 7.312   4.749   0.782   1.00 0.00 ? 864 ARG A CD   10 
ATOM 8883 N NE   . ARG A 1 73 ? 8.720   4.448   1.068   1.00 0.00 ? 864 ARG A NE   10 
ATOM 8884 C CZ   . ARG A 1 73 ? 9.100   3.328   1.701   1.00 0.00 ? 864 ARG A CZ   10 
ATOM 8885 N NH1  . ARG A 1 73 ? 8.208   2.485   2.147   1.00 0.00 ? 864 ARG A NH1  10 
ATOM 8886 N NH2  . ARG A 1 73 ? 10.362  3.081   1.868   1.00 0.00 ? 864 ARG A NH2  10 
ATOM 8887 H H    . ARG A 1 73 ? 5.002   6.058   4.737   1.00 0.00 ? 864 ARG A H    10 
ATOM 8888 H HA   . ARG A 1 73 ? 5.201   4.202   2.690   1.00 0.00 ? 864 ARG A HA   10 
ATOM 8889 N N    . GLN A 1 74 ? 6.948   3.296   5.333   1.00 0.00 ? 865 GLN A N    10 
ATOM 8890 C CA   . GLN A 1 74 ? 7.542   2.141   5.990   1.00 0.00 ? 865 GLN A CA   10 
ATOM 8891 C C    . GLN A 1 74 ? 6.476   1.150   6.411   1.00 0.00 ? 865 GLN A C    10 
ATOM 8892 O O    . GLN A 1 74 ? 6.618   -0.053  6.194   1.00 0.00 ? 865 GLN A O    10 
ATOM 8893 C CB   . GLN A 1 74 ? 8.388   2.562   7.203   1.00 0.00 ? 865 GLN A CB   10 
ATOM 8894 C CG   . GLN A 1 74 ? 7.580   3.475   8.136   1.00 0.00 ? 865 GLN A CG   10 
ATOM 8895 C CD   . GLN A 1 74 ? 6.964   2.662   9.270   1.00 0.00 ? 865 GLN A CD   10 
ATOM 8896 O OE1  . GLN A 1 74 ? 7.612   1.779   9.826   1.00 0.00 ? 865 GLN A OE1  10 
ATOM 8897 N NE2  . GLN A 1 74 ? 5.747   2.900   9.642   1.00 0.00 ? 865 GLN A NE2  10 
ATOM 8898 H H    . GLN A 1 74 ? 7.030   4.186   5.738   1.00 0.00 ? 865 GLN A H    10 
ATOM 8899 H HA   . GLN A 1 74 ? 8.190   1.649   5.280   1.00 0.00 ? 865 GLN A HA   10 
ATOM 8900 H HB2  . GLN A 1 74 ? 8.699   1.679   7.744   1.00 0.00 ? 865 GLN A HB2  10 
ATOM 8901 H HB3  . GLN A 1 74 ? 9.263   3.091   6.858   1.00 0.00 ? 865 GLN A HB3  10 
ATOM 8902 H HG2  . GLN A 1 74 ? 8.235   4.225   8.554   1.00 0.00 ? 865 GLN A HG2  10 
ATOM 8903 H HG3  . GLN A 1 74 ? 6.798   3.962   7.578   1.00 0.00 ? 865 GLN A HG3  10 
ATOM 8904 H HE21 . GLN A 1 74 ? 5.225   3.601   9.190   1.00 0.00 ? 865 GLN A HE21 10 
ATOM 8905 H HE22 . GLN A 1 74 ? 5.343   2.387   10.375  1.00 0.00 ? 865 GLN A HE22 10 
ATOM 8906 N N    . ARG A 1 75 ? 5.401   1.655   7.007   1.00 0.00 ? 866 ARG A N    10 
ATOM 8907 C CA   . ARG A 1 75 ? 4.326   0.788   7.455   1.00 0.00 ? 866 ARG A CA   10 
ATOM 8908 C C    . ARG A 1 75 ? 3.759   -0.006  6.292   1.00 0.00 ? 866 ARG A C    10 
ATOM 8909 O O    . ARG A 1 75 ? 3.710   -1.224  6.341   1.00 0.00 ? 866 ARG A O    10 
ATOM 8910 C CB   . ARG A 1 75 ? 3.208   1.589   8.132   1.00 0.00 ? 866 ARG A CB   10 
ATOM 8911 C CG   . ARG A 1 75 ? 2.098   0.621   8.571   1.00 0.00 ? 866 ARG A CG   10 
ATOM 8912 C CD   . ARG A 1 75 ? 1.096   1.338   9.475   1.00 0.00 ? 866 ARG A CD   10 
ATOM 8913 N NE   . ARG A 1 75 ? 1.698   1.639   10.769  1.00 0.00 ? 866 ARG A NE   10 
ATOM 8914 C CZ   . ARG A 1 75 ? 0.982   1.631   11.900  1.00 0.00 ? 866 ARG A CZ   10 
ATOM 8915 N NH1  . ARG A 1 75 ? -0.289  1.326   11.874  1.00 0.00 ? 866 ARG A NH1  10 
ATOM 8916 N NH2  . ARG A 1 75 ? 1.558   1.921   13.032  1.00 0.00 ? 866 ARG A NH2  10 
ATOM 8917 H H    . ARG A 1 75 ? 5.338   2.624   7.152   1.00 0.00 ? 866 ARG A H    10 
ATOM 8918 H HA   . ARG A 1 75 ? 4.732   0.092   8.175   1.00 0.00 ? 866 ARG A HA   10 
ATOM 8919 N N    . ILE A 1 76 ? 3.332   0.688   5.244   1.00 0.00 ? 867 ILE A N    10 
ATOM 8920 C CA   . ILE A 1 76 ? 2.773   0.013   4.084   1.00 0.00 ? 867 ILE A CA   10 
ATOM 8921 C C    . ILE A 1 76 ? 3.745   -1.044  3.572   1.00 0.00 ? 867 ILE A C    10 
ATOM 8922 O O    . ILE A 1 76 ? 3.386   -2.218  3.454   1.00 0.00 ? 867 ILE A O    10 
ATOM 8923 C CB   . ILE A 1 76 ? 2.445   1.030   2.979   1.00 0.00 ? 867 ILE A CB   10 
ATOM 8924 C CG1  . ILE A 1 76 ? 1.299   1.950   3.452   1.00 0.00 ? 867 ILE A CG1  10 
ATOM 8925 C CG2  . ILE A 1 76 ? 2.025   0.302   1.693   1.00 0.00 ? 867 ILE A CG2  10 
ATOM 8926 C CD1  . ILE A 1 76 ? -0.057  1.282   3.185   1.00 0.00 ? 867 ILE A CD1  10 
ATOM 8927 H H    . ILE A 1 76 ? 3.400   1.669   5.246   1.00 0.00 ? 867 ILE A H    10 
ATOM 8928 H HA   . ILE A 1 76 ? 1.860   -0.480  4.383   1.00 0.00 ? 867 ILE A HA   10 
ATOM 8929 H HB   . ILE A 1 76 ? 3.326   1.621   2.778   1.00 0.00 ? 867 ILE A HB   10 
ATOM 8930 H HG12 . ILE A 1 76 ? 1.402   2.135   4.511   1.00 0.00 ? 867 ILE A HG12 10 
ATOM 8931 H HG21 . ILE A 1 76 ? 2.866   -0.245  1.290   1.00 0.00 ? 867 ILE A HG21 10 
ATOM 8932 H HG22 . ILE A 1 76 ? 1.692   1.026   0.963   1.00 0.00 ? 867 ILE A HG22 10 
ATOM 8933 H HG23 . ILE A 1 76 ? 1.219   -0.383  1.908   1.00 0.00 ? 867 ILE A HG23 10 
ATOM 8934 H HD11 . ILE A 1 76 ? -0.013  0.243   3.475   1.00 0.00 ? 867 ILE A HD11 10 
ATOM 8935 H HD12 . ILE A 1 76 ? -0.291  1.353   2.133   1.00 0.00 ? 867 ILE A HD12 10 
ATOM 8936 H HD13 . ILE A 1 76 ? -0.824  1.783   3.756   1.00 0.00 ? 867 ILE A HD13 10 
ATOM 8937 N N    . LEU A 1 77 ? 4.983   -0.634  3.303   1.00 0.00 ? 868 LEU A N    10 
ATOM 8938 C CA   . LEU A 1 77 ? 5.998   -1.571  2.829   1.00 0.00 ? 868 LEU A CA   10 
ATOM 8939 C C    . LEU A 1 77 ? 6.116   -2.740  3.790   1.00 0.00 ? 868 LEU A C    10 
ATOM 8940 O O    . LEU A 1 77 ? 5.966   -3.899  3.403   1.00 0.00 ? 868 LEU A O    10 
ATOM 8941 C CB   . LEU A 1 77 ? 7.361   -0.873  2.691   1.00 0.00 ? 868 LEU A CB   10 
ATOM 8942 C CG   . LEU A 1 77 ? 7.876   -1.019  1.249   1.00 0.00 ? 868 LEU A CG   10 
ATOM 8943 C CD1  . LEU A 1 77 ? 7.156   -0.021  0.339   1.00 0.00 ? 868 LEU A CD1  10 
ATOM 8944 C CD2  . LEU A 1 77 ? 9.386   -0.748  1.207   1.00 0.00 ? 868 LEU A CD2  10 
ATOM 8945 H H    . LEU A 1 77 ? 5.219   0.309   3.443   1.00 0.00 ? 868 LEU A H    10 
ATOM 8946 H HA   . LEU A 1 77 ? 5.696   -1.942  1.864   1.00 0.00 ? 868 LEU A HA   10 
ATOM 8947 H HB2  . LEU A 1 77 ? 7.256   0.173   2.936   1.00 0.00 ? 868 LEU A HB2  10 
ATOM 8948 H HB3  . LEU A 1 77 ? 8.068   -1.329  3.369   1.00 0.00 ? 868 LEU A HB3  10 
ATOM 8949 H HG   . LEU A 1 77 ? 7.678   -2.022  0.897   1.00 0.00 ? 868 LEU A HG   10 
ATOM 8950 H HD11 . LEU A 1 77 ? 7.741   0.881   0.246   1.00 0.00 ? 868 LEU A HD11 10 
ATOM 8951 H HD12 . LEU A 1 77 ? 6.189   0.218   0.755   1.00 0.00 ? 868 LEU A HD12 10 
ATOM 8952 H HD13 . LEU A 1 77 ? 7.017   -0.459  -0.638  1.00 0.00 ? 868 LEU A HD13 10 
ATOM 8953 H HD21 . LEU A 1 77 ? 9.565   0.284   0.946   1.00 0.00 ? 868 LEU A HD21 10 
ATOM 8954 H HD22 . LEU A 1 77 ? 9.843   -1.389  0.468   1.00 0.00 ? 868 LEU A HD22 10 
ATOM 8955 H HD23 . LEU A 1 77 ? 9.820   -0.955  2.173   1.00 0.00 ? 868 LEU A HD23 10 
ATOM 8956 N N    . GLN A 1 78 ? 6.352   -2.428  5.049   1.00 0.00 ? 869 GLN A N    10 
ATOM 8957 C CA   . GLN A 1 78 ? 6.459   -3.455  6.070   1.00 0.00 ? 869 GLN A CA   10 
ATOM 8958 C C    . GLN A 1 78 ? 5.185   -4.282  6.111   1.00 0.00 ? 869 GLN A C    10 
ATOM 8959 O O    . GLN A 1 78 ? 5.227   -5.513  6.220   1.00 0.00 ? 869 GLN A O    10 
ATOM 8960 C CB   . GLN A 1 78 ? 6.698   -2.813  7.440   1.00 0.00 ? 869 GLN A CB   10 
ATOM 8961 C CG   . GLN A 1 78 ? 8.164   -2.383  7.568   1.00 0.00 ? 869 GLN A CG   10 
ATOM 8962 C CD   . GLN A 1 78 ? 8.808   -3.109  8.737   1.00 0.00 ? 869 GLN A CD   10 
ATOM 8963 O OE1  . GLN A 1 78 ? 8.697   -2.664  9.880   1.00 0.00 ? 869 GLN A OE1  10 
ATOM 8964 N NE2  . GLN A 1 78 ? 9.458   -4.209  8.530   1.00 0.00 ? 869 GLN A NE2  10 
ATOM 8965 H H    . GLN A 1 78 ? 6.435   -1.483  5.300   1.00 0.00 ? 869 GLN A H    10 
ATOM 8966 H HA   . GLN A 1 78 ? 7.291   -4.101  5.837   1.00 0.00 ? 869 GLN A HA   10 
ATOM 8967 H HB2  . GLN A 1 78 ? 6.057   -1.951  7.552   1.00 0.00 ? 869 GLN A HB2  10 
ATOM 8968 H HB3  . GLN A 1 78 ? 6.469   -3.527  8.216   1.00 0.00 ? 869 GLN A HB3  10 
ATOM 8969 H HG2  . GLN A 1 78 ? 8.695   -2.620  6.656   1.00 0.00 ? 869 GLN A HG2  10 
ATOM 8970 H HG3  . GLN A 1 78 ? 8.212   -1.318  7.740   1.00 0.00 ? 869 GLN A HG3  10 
ATOM 8971 H HE21 . GLN A 1 78 ? 9.532   -4.570  7.623   1.00 0.00 ? 869 GLN A HE21 10 
ATOM 8972 H HE22 . GLN A 1 78 ? 9.876   -4.683  9.279   1.00 0.00 ? 869 GLN A HE22 10 
ATOM 8973 N N    . ALA A 1 79 ? 4.054   -3.600  6.042   1.00 0.00 ? 870 ALA A N    10 
ATOM 8974 C CA   . ALA A 1 79 ? 2.765   -4.259  6.097   1.00 0.00 ? 870 ALA A CA   10 
ATOM 8975 C C    . ALA A 1 79 ? 2.609   -5.246  4.956   1.00 0.00 ? 870 ALA A C    10 
ATOM 8976 O O    . ALA A 1 79 ? 2.269   -6.407  5.184   1.00 0.00 ? 870 ALA A O    10 
ATOM 8977 C CB   . ALA A 1 79 ? 1.635   -3.227  6.057   1.00 0.00 ? 870 ALA A CB   10 
ATOM 8978 H H    . ALA A 1 79 ? 4.089   -2.622  5.970   1.00 0.00 ? 870 ALA A H    10 
ATOM 8979 H HA   . ALA A 1 79 ? 2.699   -4.799  7.029   1.00 0.00 ? 870 ALA A HA   10 
ATOM 8980 H HB1  . ALA A 1 79 ? 1.739   -2.546  6.889   1.00 0.00 ? 870 ALA A HB1  10 
ATOM 8981 H HB2  . ALA A 1 79 ? 0.684   -3.732  6.126   1.00 0.00 ? 870 ALA A HB2  10 
ATOM 8982 H HB3  . ALA A 1 79 ? 1.683   -2.673  5.131   1.00 0.00 ? 870 ALA A HB3  10 
ATOM 8983 N N    . ILE A 1 80 ? 2.889   -4.806  3.731   1.00 0.00 ? 871 ILE A N    10 
ATOM 8984 C CA   . ILE A 1 80 ? 2.789   -5.702  2.596   1.00 0.00 ? 871 ILE A CA   10 
ATOM 8985 C C    . ILE A 1 80 ? 3.848   -6.791  2.702   1.00 0.00 ? 871 ILE A C    10 
ATOM 8986 O O    . ILE A 1 80 ? 3.591   -7.955  2.391   1.00 0.00 ? 871 ILE A O    10 
ATOM 8987 C CB   . ILE A 1 80 ? 2.914   -4.945  1.261   1.00 0.00 ? 871 ILE A CB   10 
ATOM 8988 C CG1  . ILE A 1 80 ? 4.272   -4.250  1.158   1.00 0.00 ? 871 ILE A CG1  10 
ATOM 8989 C CG2  . ILE A 1 80 ? 1.806   -3.901  1.145   1.00 0.00 ? 871 ILE A CG2  10 
ATOM 8990 C CD1  . ILE A 1 80 ? 4.402   -3.598  -0.221  1.00 0.00 ? 871 ILE A CD1  10 
ATOM 8991 H H    . ILE A 1 80 ? 3.181   -3.878  3.593   1.00 0.00 ? 871 ILE A H    10 
ATOM 8992 H HA   . ILE A 1 80 ? 1.816   -6.169  2.634   1.00 0.00 ? 871 ILE A HA   10 
ATOM 8993 H HB   . ILE A 1 80 ? 2.804   -5.651  0.456   1.00 0.00 ? 871 ILE A HB   10 
ATOM 8994 H HG12 . ILE A 1 80 ? 4.340   -3.490  1.918   1.00 0.00 ? 871 ILE A HG12 10 
ATOM 8995 H HG21 . ILE A 1 80 ? 1.696   -3.610  0.111   1.00 0.00 ? 871 ILE A HG21 10 
ATOM 8996 H HG22 . ILE A 1 80 ? 2.069   -3.034  1.731   1.00 0.00 ? 871 ILE A HG22 10 
ATOM 8997 H HG23 . ILE A 1 80 ? 0.875   -4.315  1.502   1.00 0.00 ? 871 ILE A HG23 10 
ATOM 8998 H HD11 . ILE A 1 80 ? 3.568   -2.931  -0.387  1.00 0.00 ? 871 ILE A HD11 10 
ATOM 8999 H HD12 . ILE A 1 80 ? 4.409   -4.359  -0.987  1.00 0.00 ? 871 ILE A HD12 10 
ATOM 9000 H HD13 . ILE A 1 80 ? 5.322   -3.035  -0.265  1.00 0.00 ? 871 ILE A HD13 10 
ATOM 9001 N N    . GLN A 1 81 ? 5.030   -6.413  3.182   1.00 0.00 ? 872 GLN A N    10 
ATOM 9002 C CA   . GLN A 1 81 ? 6.111   -7.374  3.371   1.00 0.00 ? 872 GLN A CA   10 
ATOM 9003 C C    . GLN A 1 81 ? 5.672   -8.471  4.329   1.00 0.00 ? 872 GLN A C    10 
ATOM 9004 O O    . GLN A 1 81 ? 6.126   -9.615  4.232   1.00 0.00 ? 872 GLN A O    10 
ATOM 9005 C CB   . GLN A 1 81 ? 7.357   -6.676  3.936   1.00 0.00 ? 872 GLN A CB   10 
ATOM 9006 C CG   . GLN A 1 81 ? 8.081   -5.906  2.824   1.00 0.00 ? 872 GLN A CG   10 
ATOM 9007 C CD   . GLN A 1 81 ? 9.579   -6.145  2.918   1.00 0.00 ? 872 GLN A CD   10 
ATOM 9008 O OE1  . GLN A 1 81 ? 10.343  -5.209  3.147   1.00 0.00 ? 872 GLN A OE1  10 
ATOM 9009 N NE2  . GLN A 1 81 ? 10.050  -7.341  2.759   1.00 0.00 ? 872 GLN A NE2  10 
ATOM 9010 H H    . GLN A 1 81 ? 5.169   -5.474  3.437   1.00 0.00 ? 872 GLN A H    10 
ATOM 9011 H HA   . GLN A 1 81 ? 6.359   -7.817  2.418   1.00 0.00 ? 872 GLN A HA   10 
ATOM 9012 H HB2  . GLN A 1 81 ? 7.062   -5.989  4.715   1.00 0.00 ? 872 GLN A HB2  10 
ATOM 9013 H HB3  . GLN A 1 81 ? 8.026   -7.416  4.351   1.00 0.00 ? 872 GLN A HB3  10 
ATOM 9014 H HG2  . GLN A 1 81 ? 7.724   -6.233  1.860   1.00 0.00 ? 872 GLN A HG2  10 
ATOM 9015 H HG3  . GLN A 1 81 ? 7.888   -4.850  2.933   1.00 0.00 ? 872 GLN A HG3  10 
ATOM 9016 H HE21 . GLN A 1 81 ? 9.443   -8.091  2.579   1.00 0.00 ? 872 GLN A HE21 10 
ATOM 9017 H HE22 . GLN A 1 81 ? 11.016  -7.501  2.816   1.00 0.00 ? 872 GLN A HE22 10 
ATOM 9018 N N    . LEU A 1 82 ? 4.815   -8.111  5.272   1.00 0.00 ? 873 LEU A N    10 
ATOM 9019 C CA   . LEU A 1 82 ? 4.336   -9.062  6.267   1.00 0.00 ? 873 LEU A CA   10 
ATOM 9020 C C    . LEU A 1 82 ? 3.212   -9.930  5.707   1.00 0.00 ? 873 LEU A C    10 
ATOM 9021 O O    . LEU A 1 82 ? 2.943   -11.015 6.223   1.00 0.00 ? 873 LEU A O    10 
ATOM 9022 C CB   . LEU A 1 82 ? 3.856   -8.323  7.525   1.00 0.00 ? 873 LEU A CB   10 
ATOM 9023 C CG   . LEU A 1 82 ? 4.905   -8.450  8.648   1.00 0.00 ? 873 LEU A CG   10 
ATOM 9024 C CD1  . LEU A 1 82 ? 4.921   -9.884  9.183   1.00 0.00 ? 873 LEU A CD1  10 
ATOM 9025 C CD2  . LEU A 1 82 ? 6.300   -8.089  8.112   1.00 0.00 ? 873 LEU A CD2  10 
ATOM 9026 H H    . LEU A 1 82 ? 4.512   -7.178  5.313   1.00 0.00 ? 873 LEU A H    10 
ATOM 9027 H HA   . LEU A 1 82 ? 5.155   -9.709  6.541   1.00 0.00 ? 873 LEU A HA   10 
ATOM 9028 H HB2  . LEU A 1 82 ? 3.698   -7.279  7.294   1.00 0.00 ? 873 LEU A HB2  10 
ATOM 9029 H HB3  . LEU A 1 82 ? 2.924   -8.755  7.860   1.00 0.00 ? 873 LEU A HB3  10 
ATOM 9030 H HG   . LEU A 1 82 ? 4.641   -7.782  9.455   1.00 0.00 ? 873 LEU A HG   10 
ATOM 9031 H HD11 . LEU A 1 82 ? 4.788   -10.583 8.370   1.00 0.00 ? 873 LEU A HD11 10 
ATOM 9032 H HD12 . LEU A 1 82 ? 4.121   -10.008 9.896   1.00 0.00 ? 873 LEU A HD12 10 
ATOM 9033 H HD13 . LEU A 1 82 ? 5.866   -10.076 9.670   1.00 0.00 ? 873 LEU A HD13 10 
ATOM 9034 H HD21 . LEU A 1 82 ? 6.798   -8.983  7.763   1.00 0.00 ? 873 LEU A HD21 10 
ATOM 9035 H HD22 . LEU A 1 82 ? 6.884   -7.646  8.904   1.00 0.00 ? 873 LEU A HD22 10 
ATOM 9036 H HD23 . LEU A 1 82 ? 6.210   -7.386  7.296   1.00 0.00 ? 873 LEU A HD23 10 
ATOM 9037 N N    . LEU A 1 83 ? 2.560   -9.459  4.651   1.00 0.00 ? 874 LEU A N    10 
ATOM 9038 C CA   . LEU A 1 83 ? 1.477   -10.225 4.039   1.00 0.00 ? 874 LEU A CA   10 
ATOM 9039 C C    . LEU A 1 83 ? 2.014   -11.543 3.486   1.00 0.00 ? 874 LEU A C    10 
ATOM 9040 O O    . LEU A 1 83 ? 3.156   -11.605 3.020   1.00 0.00 ? 874 LEU A O    10 
ATOM 9041 C CB   . LEU A 1 83 ? 0.816   -9.427  2.901   1.00 0.00 ? 874 LEU A CB   10 
ATOM 9042 C CG   . LEU A 1 83 ? 0.104   -8.190  3.469   1.00 0.00 ? 874 LEU A CG   10 
ATOM 9043 C CD1  . LEU A 1 83 ? -0.456  -7.344  2.320   1.00 0.00 ? 874 LEU A CD1  10 
ATOM 9044 C CD2  . LEU A 1 83 ? -1.049  -8.629  4.382   1.00 0.00 ? 874 LEU A CD2  10 
ATOM 9045 H H    . LEU A 1 83 ? 2.816   -8.592  4.272   1.00 0.00 ? 874 LEU A H    10 
ATOM 9046 H HA   . LEU A 1 83 ? 0.736   -10.437 4.795   1.00 0.00 ? 874 LEU A HA   10 
ATOM 9047 H HB2  . LEU A 1 83 ? 1.574   -9.118  2.196   1.00 0.00 ? 874 LEU A HB2  10 
ATOM 9048 H HB3  . LEU A 1 83 ? 0.097   -10.055 2.397   1.00 0.00 ? 874 LEU A HB3  10 
ATOM 9049 H HG   . LEU A 1 83 ? 0.808   -7.598  4.033   1.00 0.00 ? 874 LEU A HG   10 
ATOM 9050 H HD11 . LEU A 1 83 ? -0.622  -6.335  2.664   1.00 0.00 ? 874 LEU A HD11 10 
ATOM 9051 H HD12 . LEU A 1 83 ? -1.392  -7.765  1.984   1.00 0.00 ? 874 LEU A HD12 10 
ATOM 9052 H HD13 . LEU A 1 83 ? 0.246   -7.331  1.497   1.00 0.00 ? 874 LEU A HD13 10 
ATOM 9053 H HD21 . LEU A 1 83 ? -0.708  -8.652  5.407   1.00 0.00 ? 874 LEU A HD21 10 
ATOM 9054 H HD22 . LEU A 1 83 ? -1.391  -9.611  4.094   1.00 0.00 ? 874 LEU A HD22 10 
ATOM 9055 H HD23 . LEU A 1 83 ? -1.865  -7.927  4.295   1.00 0.00 ? 874 LEU A HD23 10 
ATOM 9056 N N    . PRO A 1 84 ? 1.223   -12.585 3.513   1.00 0.00 ? 875 PRO A N    10 
ATOM 9057 C CA   . PRO A 1 84 ? 1.634   -13.913 2.980   1.00 0.00 ? 875 PRO A CA   10 
ATOM 9058 C C    . PRO A 1 84 ? 1.588   -13.928 1.458   1.00 0.00 ? 875 PRO A C    10 
ATOM 9059 O O    . PRO A 1 84 ? 1.191   -12.940 0.835   1.00 0.00 ? 875 PRO A O    10 
ATOM 9060 C CB   . PRO A 1 84 ? 0.598   -14.871 3.564   1.00 0.00 ? 875 PRO A CB   10 
ATOM 9061 C CG   . PRO A 1 84 ? -0.627  -14.040 3.774   1.00 0.00 ? 875 PRO A CG   10 
ATOM 9062 C CD   . PRO A 1 84 ? -0.149  -12.610 4.054   1.00 0.00 ? 875 PRO A CD   10 
ATOM 9063 H HA   . PRO A 1 84 ? 2.613   -14.189 3.338   1.00 0.00 ? 875 PRO A HA   10 
ATOM 9064 H HB2  . PRO A 1 84 ? 0.400   -15.676 2.869   1.00 0.00 ? 875 PRO A HB2  10 
ATOM 9065 H HB3  . PRO A 1 84 ? 0.939   -15.265 4.509   1.00 0.00 ? 875 PRO A HB3  10 
ATOM 9066 H HG2  . PRO A 1 84 ? -1.250  -14.067 2.890   1.00 0.00 ? 875 PRO A HG2  10 
ATOM 9067 H HG3  . PRO A 1 84 ? -1.178  -14.404 4.628   1.00 0.00 ? 875 PRO A HG3  10 
ATOM 9068 H HD2  . PRO A 1 84 ? -0.781  -11.897 3.540   1.00 0.00 ? 875 PRO A HD2  10 
ATOM 9069 H HD3  . PRO A 1 84 ? -0.135  -12.415 5.114   1.00 0.00 ? 875 PRO A HD3  10 
ATOM 9070 N N    . LYS A 1 85 ? 1.964   -15.049 0.863   1.00 0.00 ? 876 LYS A N    10 
ATOM 9071 C CA   . LYS A 1 85 ? 1.942   -15.177 -0.586  1.00 0.00 ? 876 LYS A CA   10 
ATOM 9072 C C    . LYS A 1 85 ? 0.850   -16.146 -1.025  1.00 0.00 ? 876 LYS A C    10 
ATOM 9073 O O    . LYS A 1 85 ? 0.497   -17.002 -0.248  1.00 0.00 ? 876 LYS A O    10 
ATOM 9074 C CB   . LYS A 1 85 ? 3.308   -15.643 -1.107  1.00 0.00 ? 876 LYS A CB   10 
ATOM 9075 C CG   . LYS A 1 85 ? 3.841   -16.785 -0.236  1.00 0.00 ? 876 LYS A CG   10 
ATOM 9076 C CD   . LYS A 1 85 ? 5.155   -17.310 -0.831  1.00 0.00 ? 876 LYS A CD   10 
ATOM 9077 C CE   . LYS A 1 85 ? 5.610   -18.580 -0.089  1.00 0.00 ? 876 LYS A CE   10 
ATOM 9078 N NZ   . LYS A 1 85 ? 5.000   -18.634 1.270   1.00 0.00 ? 876 LYS A NZ   10 
ATOM 9079 H H    . LYS A 1 85 ? 2.245   -15.814 1.408   1.00 0.00 ? 876 LYS A H    10 
ATOM 9080 H HA   . LYS A 1 85 ? 1.732   -14.204 -1.007  1.00 0.00 ? 876 LYS A HA   10 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   792 ?   ?   ?   A . n 
A 1 2   SER 2   793 ?   ?   ?   A . n 
A 1 3   ASP 3   794 ?   ?   ?   A . n 
A 1 4   ILE 4   795 ?   ?   ?   A . n 
A 1 5   THR 5   796 ?   ?   ?   A . n 
A 1 6   SER 6   797 ?   ?   ?   A . n 
A 1 7   LEU 7   798 ?   ?   ?   A . n 
A 1 8   TYR 8   799 ?   ?   ?   A . n 
A 1 9   LYS 9   800 ?   ?   ?   A . n 
A 1 10  LYS 10  801 ?   ?   ?   A . n 
A 1 11  ALA 11  802 ?   ?   ?   A . n 
A 1 12  GLY 12  803 ?   ?   ?   A . n 
A 1 13  SER 13  804 ?   ?   ?   A . n 
A 1 14  GLU 14  805 ?   ?   ?   A . n 
A 1 15  MET 15  806 ?   ?   ?   A . n 
A 1 16  ASN 16  807 ?   ?   ?   A . n 
A 1 17  GLY 17  808 ?   ?   ?   A . n 
A 1 18  PRO 18  809 ?   ?   ?   A . n 
A 1 19  ARG 19  810 ?   ?   ?   A . n 
A 1 20  CYS 20  811 ?   ?   ?   A . n 
A 1 21  PRO 21  812 ?   ?   ?   A . n 
A 1 22  VAL 22  813 ?   ?   ?   A . n 
A 1 23  GLN 23  814 814 GLN GLN A . n 
A 1 24  THR 24  815 815 THR THR A . n 
A 1 25  VAL 25  816 816 VAL VAL A . n 
A 1 26  GLY 26  817 817 GLY GLY A . n 
A 1 27  GLN 27  818 818 GLN GLN A . n 
A 1 28  TRP 28  819 819 TRP TRP A . n 
A 1 29  LEU 29  820 820 LEU LEU A . n 
A 1 30  GLU 30  821 821 GLU GLU A . n 
A 1 31  SER 31  822 822 SER SER A . n 
A 1 32  ILE 32  823 823 ILE ILE A . n 
A 1 33  GLY 33  824 824 GLY GLY A . n 
A 1 34  LEU 34  825 825 LEU LEU A . n 
A 1 35  PRO 35  826 826 PRO PRO A . n 
A 1 36  GLN 36  827 827 GLN GLN A . n 
A 1 37  TYR 37  828 828 TYR TYR A . n 
A 1 38  GLU 38  829 829 GLU GLU A . n 
A 1 39  ASN 39  830 830 ASN ASN A . n 
A 1 40  HIS 40  831 831 HIS HIS A . n 
A 1 41  LEU 41  832 832 LEU LEU A . n 
A 1 42  MET 42  833 833 MET MET A . n 
A 1 43  ALA 43  834 834 ALA ALA A . n 
A 1 44  ASN 44  835 835 ASN ASN A . n 
A 1 45  GLY 45  836 836 GLY GLY A . n 
A 1 46  PHE 46  837 837 PHE PHE A . n 
A 1 47  ASP 47  838 838 ASP ASP A . n 
A 1 48  ASN 48  839 839 ASN ASN A . n 
A 1 49  VAL 49  840 840 VAL VAL A . n 
A 1 50  GLN 50  841 841 GLN GLN A . n 
A 1 51  PHE 51  842 842 PHE PHE A . n 
A 1 52  MET 52  843 843 MET MET A . n 
A 1 53  GLY 53  844 844 GLY GLY A . n 
A 1 54  SER 54  845 845 SER SER A . n 
A 1 55  ASN 55  846 846 ASN ASN A . n 
A 1 56  VAL 56  847 847 VAL VAL A . n 
A 1 57  MET 57  848 848 MET MET A . n 
A 1 58  GLU 58  849 849 GLU GLU A . n 
A 1 59  ASP 59  850 850 ASP ASP A . n 
A 1 60  GLN 60  851 851 GLN GLN A . n 
A 1 61  ASP 61  852 852 ASP ASP A . n 
A 1 62  LEU 62  853 853 LEU LEU A . n 
A 1 63  LEU 63  854 854 LEU LEU A . n 
A 1 64  GLU 64  855 855 GLU GLU A . n 
A 1 65  ILE 65  856 856 ILE ILE A . n 
A 1 66  GLY 66  857 857 GLY GLY A . n 
A 1 67  ILE 67  858 858 ILE ILE A . n 
A 1 68  LEU 68  859 859 LEU LEU A . n 
A 1 69  ASN 69  860 860 ASN ASN A . n 
A 1 70  SER 70  861 861 SER SER A . n 
A 1 71  GLY 71  862 862 GLY GLY A . n 
A 1 72  HIS 72  863 863 HIS HIS A . n 
A 1 73  ARG 73  864 864 ARG ARG A . n 
A 1 74  GLN 74  865 865 GLN GLN A . n 
A 1 75  ARG 75  866 866 ARG ARG A . n 
A 1 76  ILE 76  867 867 ILE ILE A . n 
A 1 77  LEU 77  868 868 LEU LEU A . n 
A 1 78  GLN 78  869 869 GLN GLN A . n 
A 1 79  ALA 79  870 870 ALA ALA A . n 
A 1 80  ILE 80  871 871 ILE ILE A . n 
A 1 81  GLN 81  872 872 GLN GLN A . n 
A 1 82  LEU 82  873 873 LEU LEU A . n 
A 1 83  LEU 83  874 874 LEU LEU A . n 
A 1 84  PRO 84  875 875 PRO PRO A . n 
A 1 85  LYS 85  876 876 LYS LYS A . n 
A 1 86  MET 86  877 ?   ?   ?   A . n 
A 1 87  ARG 87  878 ?   ?   ?   A . n 
A 1 88  PRO 88  879 ?   ?   ?   A . n 
A 1 89  ILE 89  880 ?   ?   ?   A . n 
A 1 90  GLY 90  881 ?   ?   ?   A . n 
A 1 91  HIS 91  882 ?   ?   ?   A . n 
A 1 92  ASP 92  883 ?   ?   ?   A . n 
A 1 93  GLY 93  884 ?   ?   ?   A . n 
A 1 94  TYR 94  885 ?   ?   ?   A . n 
A 1 95  HIS 95  886 ?   ?   ?   A . n 
A 1 96  PRO 96  887 ?   ?   ?   A . n 
A 1 97  THR 97  888 ?   ?   ?   A . n 
A 1 98  SER 98  889 ?   ?   ?   A . n 
A 1 99  VAL 99  890 ?   ?   ?   A . n 
A 1 100 ALA 100 891 ?   ?   ?   A . n 
A 1 101 GLU 101 892 ?   ?   ?   A . n 
A 1 102 TRP 102 893 ?   ?   ?   A . n 
A 1 103 LEU 103 894 ?   ?   ?   A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-02-02 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
'AIDA1 SAM1-1'       0.8  ? mM '[U-98% 13C; U-98% 15N]' 1 
D2O-2                10   ? %  ?                        1 
H2O-3                90   ? %  ?                        1 
'sodium chloride-4'  150  ? mM ?                        1 
'sodium phosphate-5' 20   ? mM ?                        1 
'sodium azide-6'     0.05 ? %  ?                        1 
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2KE7 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         661 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  351 
_pdbx_nmr_constraints.NOE_long_range_total_count                    86 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  66 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    158 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1   1  O    A GLN 841 ? ? HG   A SER 845 ? ? 1.41 
2   1  O    A GLN 818 ? ? H    A SER 822 ? ? 1.49 
3   1  O    A SER 861 ? ? H    A GLN 865 ? ? 1.49 
4   1  O    A GLN 818 ? ? HG   A SER 822 ? ? 1.51 
5   1  OD1  A ASN 839 ? ? H    A PHE 842 ? ? 1.52 
6   1  O    A ASN 830 ? ? H    A ALA 834 ? ? 1.54 
7   1  OE2  A GLU 829 ? ? H    A ASN 830 ? ? 1.55 
8   1  O    A HIS 863 ? ? H    A ILE 867 ? ? 1.57 
9   1  OE2  A GLU 829 ? ? HD21 A ASN 830 ? ? 1.58 
10  1  HE21 A GLN 841 ? ? OG   A SER 845 ? ? 1.58 
11  2  O    A GLN 818 ? ? HG   A SER 822 ? ? 1.39 
12  2  O    A GLN 841 ? ? HG   A SER 845 ? ? 1.43 
13  2  O    A LEU 832 ? ? H    A PHE 837 ? ? 1.49 
14  2  O    A GLU 829 ? ? H    A MET 833 ? ? 1.53 
15  2  OD1  A ASN 860 ? ? H    A HIS 863 ? ? 1.53 
16  2  OD1  A ASN 839 ? ? H    A PHE 842 ? ? 1.54 
17  2  O    A GLN 851 ? ? H    A GLU 855 ? ? 1.57 
18  2  O    A GLY 817 ? ? H    A GLU 821 ? ? 1.58 
19  2  O    A LEU 853 ? ? H    A ILE 858 ? ? 1.58 
20  2  O    A ARG 866 ? ? H    A ALA 870 ? ? 1.59 
21  3  O    A GLN 841 ? ? HG   A SER 845 ? ? 1.43 
22  3  O    A HIS 863 ? ? H    A ILE 867 ? ? 1.49 
23  3  O    A ASN 830 ? ? H    A ALA 834 ? ? 1.50 
24  3  O    A GLN 818 ? ? HG   A SER 822 ? ? 1.51 
25  3  OD1  A ASN 839 ? ? H    A PHE 842 ? ? 1.55 
26  3  O    A PHE 842 ? ? HD21 A ASN 846 ? ? 1.55 
27  3  O    A GLN 851 ? ? H    A GLU 855 ? ? 1.55 
28  3  OE1  A GLN 814 ? ? H    A THR 815 ? ? 1.57 
29  4  O    A SER 861 ? ? H    A GLN 865 ? ? 1.42 
30  4  O    A GLN 841 ? ? HG   A SER 845 ? ? 1.46 
31  4  O    A GLN 818 ? ? HG   A SER 822 ? ? 1.46 
32  4  O    A PRO 826 ? ? HE21 A GLN 827 ? ? 1.50 
33  4  O    A LEU 832 ? ? H    A PHE 837 ? ? 1.51 
34  4  OD1  A ASN 860 ? ? H    A HIS 863 ? ? 1.52 
35  4  OD2  A ASP 850 ? ? HE21 A GLN 851 ? ? 1.55 
36  4  O    A LEU 820 ? ? H    A LEU 825 ? ? 1.56 
37  4  O    A ASP 850 ? ? H    A LEU 854 ? ? 1.56 
38  4  O    A ARG 866 ? ? H    A ALA 870 ? ? 1.57 
39  4  O    A GLN 818 ? ? H    A SER 822 ? ? 1.58 
40  4  O    A GLU 829 ? ? H    A MET 833 ? ? 1.58 
41  4  O    A GLN 851 ? ? H    A GLU 855 ? ? 1.59 
42  4  O    A VAL 840 ? ? H    A GLY 844 ? ? 1.59 
43  5  OD1  A ASP 852 ? ? H    A LEU 853 ? ? 1.42 
44  5  O    A GLN 818 ? ? HG   A SER 822 ? ? 1.42 
45  5  O    A GLN 841 ? ? HG   A SER 845 ? ? 1.44 
46  5  OD1  A ASN 860 ? ? H    A HIS 863 ? ? 1.50 
47  5  O    A GLY 817 ? ? H    A GLU 821 ? ? 1.52 
48  5  O    A HIS 863 ? ? H    A ILE 867 ? ? 1.54 
49  5  O    A VAL 840 ? ? H    A GLY 844 ? ? 1.55 
50  5  OD1  A ASN 839 ? ? H    A PHE 842 ? ? 1.55 
51  5  O    A ASN 839 ? ? H    A MET 843 ? ? 1.55 
52  5  O    A GLU 849 ? ? H    A ASP 852 ? ? 1.58 
53  6  O    A GLN 818 ? ? HG   A SER 822 ? ? 1.45 
54  6  O    A GLN 841 ? ? HG   A SER 845 ? ? 1.46 
55  6  HH   A TYR 828 ? ? OD1  A ASN 860 ? ? 1.47 
56  6  O    A GLY 817 ? ? H    A GLU 821 ? ? 1.49 
57  6  O    A GLU 829 ? ? H    A MET 833 ? ? 1.50 
58  6  O    A LEU 820 ? ? H    A LEU 825 ? ? 1.54 
59  6  OE1  A GLU 849 ? ? H    A GLN 851 ? ? 1.55 
60  6  O    A LEU 832 ? ? H    A PHE 837 ? ? 1.55 
61  6  O    A HIS 863 ? ? H    A ILE 867 ? ? 1.58 
62  6  OD1  A ASP 838 ? ? H    A ASN 839 ? ? 1.60 
63  7  O    A GLN 818 ? ? HG   A SER 822 ? ? 1.45 
64  7  O    A GLN 851 ? ? H    A GLU 855 ? ? 1.47 
65  7  HE21 A GLN 841 ? ? O    A PRO 875 ? ? 1.48 
66  7  O    A SER 861 ? ? H    A GLN 865 ? ? 1.49 
67  7  O    A LEU 853 ? ? H    A ILE 858 ? ? 1.51 
68  7  O    A LEU 832 ? ? H    A PHE 837 ? ? 1.52 
69  7  O    A GLU 829 ? ? H    A MET 833 ? ? 1.53 
70  7  O    A ASN 839 ? ? H    A MET 843 ? ? 1.53 
71  7  O    A LEU 820 ? ? H    A LEU 825 ? ? 1.54 
72  7  O    A ARG 866 ? ? H    A ALA 870 ? ? 1.56 
73  7  O    A ASN 830 ? ? H    A ALA 834 ? ? 1.56 
74  7  O    A GLN 818 ? ? H    A SER 822 ? ? 1.60 
75  8  O    A GLN 818 ? ? HG   A SER 822 ? ? 1.45 
76  8  O    A SER 861 ? ? H    A GLN 865 ? ? 1.48 
77  8  O    A ASN 830 ? ? H    A ALA 834 ? ? 1.50 
78  8  H    A GLN 827 ? ? OE1  A GLU 829 ? ? 1.51 
79  8  O    A GLN 818 ? ? H    A SER 822 ? ? 1.52 
80  8  OD1  A ASN 860 ? ? H    A HIS 863 ? ? 1.53 
81  8  H    A VAL 816 ? ? OD1  A ASP 838 ? ? 1.57 
82  8  O    A MET 843 ? ? HD21 A ASN 846 ? ? 1.58 
83  8  O    A ARG 864 ? ? H    A LEU 868 ? ? 1.58 
84  8  O    A ASP 850 ? ? H    A LEU 854 ? ? 1.59 
85  8  OD1  A ASP 838 ? ? H    A ASN 839 ? ? 1.60 
86  9  O    A GLN 841 ? ? HG   A SER 845 ? ? 1.43 
87  9  O    A GLN 818 ? ? HG   A SER 822 ? ? 1.47 
88  9  HH   A TYR 828 ? ? OD1  A ASN 860 ? ? 1.49 
89  9  O    A ASN 830 ? ? H    A ALA 834 ? ? 1.53 
90  9  O    A HIS 863 ? ? H    A ILE 867 ? ? 1.55 
91  9  O    A PHE 842 ? ? H    A ASN 846 ? ? 1.56 
92  9  O    A GLU 829 ? ? H    A MET 833 ? ? 1.56 
93  9  OD1  A ASN 830 ? ? H    A HIS 831 ? ? 1.58 
94  9  O    A GLN 818 ? ? H    A SER 822 ? ? 1.58 
95  9  OE1  A GLU 849 ? ? H    A ASP 850 ? ? 1.59 
96  10 O    A GLN 818 ? ? HG   A SER 822 ? ? 1.42 
97  10 O    A LEU 820 ? ? H    A LEU 825 ? ? 1.47 
98  10 O    A ASN 830 ? ? H    A ALA 834 ? ? 1.49 
99  10 O    A ARG 866 ? ? H    A ALA 870 ? ? 1.50 
100 10 O    A ASN 860 ? ? H    A ARG 864 ? ? 1.51 
101 10 O    A GLY 862 ? ? HE21 A GLN 865 ? ? 1.51 
102 10 OD1  A ASN 839 ? ? H    A PHE 842 ? ? 1.52 
103 10 O    A MET 843 ? ? H    A VAL 847 ? ? 1.54 
104 10 O    A LEU 832 ? ? H    A PHE 837 ? ? 1.55 
105 10 O    A LEU 853 ? ? H    A ILE 858 ? ? 1.56 
106 10 HE21 A GLN 841 ? ? O    A PRO 875 ? ? 1.56 
107 10 H    A GLN 827 ? ? OE1  A GLU 829 ? ? 1.57 
108 10 O    A GLN 818 ? ? H    A SER 822 ? ? 1.57 
109 10 O    A GLN 841 ? ? HG   A SER 845 ? ? 1.57 
110 10 O    A TYR 828 ? ? H    A LEU 832 ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  ASN A 839 ? ? 56.15   76.43   
2  1  ASN A 846 ? ? -131.59 -54.22  
3  1  LEU A 859 ? ? -76.96  -74.00  
4  1  ASN A 860 ? ? -38.40  110.81  
5  2  VAL A 816 ? ? -63.83  72.71   
6  2  ASN A 839 ? ? 55.78   86.17   
7  2  ASN A 846 ? ? -130.33 -52.54  
8  2  LEU A 859 ? ? -96.49  -74.42  
9  2  ASN A 860 ? ? -41.75  103.11  
10 3  VAL A 816 ? ? -63.05  72.42   
11 3  LEU A 825 ? ? -119.36 70.10   
12 3  GLN A 827 ? ? 69.12   -3.86   
13 3  ASN A 839 ? ? 70.03   80.63   
14 3  ASN A 846 ? ? -129.85 -55.72  
15 3  LEU A 859 ? ? -96.48  -74.58  
16 3  ASN A 860 ? ? -50.54  101.53  
17 4  PHE A 837 ? ? -68.74  99.82   
18 4  ASN A 839 ? ? -31.48  116.82  
19 4  ASN A 846 ? ? -126.23 -54.37  
20 4  LEU A 859 ? ? -39.65  -73.49  
21 4  PRO A 875 ? ? -52.22  107.42  
22 5  VAL A 816 ? ? -63.21  71.98   
23 5  GLU A 829 ? ? -55.53  -76.20  
24 5  ASN A 839 ? ? 53.35   82.37   
25 6  GLN A 827 ? ? 83.31   17.28   
26 6  GLU A 829 ? ? -63.88  -73.91  
27 6  PHE A 837 ? ? -107.63 50.22   
28 6  GLU A 849 ? ? -179.00 -161.69 
29 7  VAL A 816 ? ? -62.14  -118.05 
30 7  GLU A 829 ? ? -71.11  -77.43  
31 7  ASN A 839 ? ? 141.47  59.82   
32 7  ASN A 846 ? ? -129.31 -56.55  
33 7  LEU A 859 ? ? -84.71  -75.71  
34 7  ASN A 860 ? ? -55.00  105.03  
35 8  VAL A 816 ? ? -59.58  101.92  
36 8  GLN A 827 ? ? 152.24  -16.97  
37 8  GLU A 829 ? ? -45.48  -72.49  
38 8  ASN A 839 ? ? 61.53   62.89   
39 8  GLU A 849 ? ? 173.28  -178.59 
40 8  LEU A 859 ? ? -96.16  -73.26  
41 9  LEU A 825 ? ? -118.98 74.29   
42 9  GLN A 827 ? ? 72.01   50.50   
43 9  ASN A 839 ? ? 63.38   83.67   
44 9  GLU A 849 ? ? -170.41 -171.60 
45 9  ILE A 858 ? ? -63.69  85.66   
46 9  ASN A 860 ? ? -66.42  85.91   
47 9  PRO A 875 ? ? -47.11  99.24   
48 10 VAL A 816 ? ? -63.07  84.58   
49 10 GLN A 827 ? ? 151.58  -13.28  
50 10 GLU A 829 ? ? -40.93  -77.34  
51 10 ASN A 839 ? ? 52.37   81.38   
52 10 ASN A 846 ? ? -129.67 -52.32  
53 10 ASN A 860 ? ? -43.22  101.27  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1  Y 1 A GLY 792 ? A GLY 1   
2   1  Y 1 A SER 793 ? A SER 2   
3   1  Y 1 A ASP 794 ? A ASP 3   
4   1  Y 1 A ILE 795 ? A ILE 4   
5   1  Y 1 A THR 796 ? A THR 5   
6   1  Y 1 A SER 797 ? A SER 6   
7   1  Y 1 A LEU 798 ? A LEU 7   
8   1  Y 1 A TYR 799 ? A TYR 8   
9   1  Y 1 A LYS 800 ? A LYS 9   
10  1  Y 1 A LYS 801 ? A LYS 10  
11  1  Y 1 A ALA 802 ? A ALA 11  
12  1  Y 1 A GLY 803 ? A GLY 12  
13  1  Y 1 A SER 804 ? A SER 13  
14  1  Y 1 A GLU 805 ? A GLU 14  
15  1  Y 1 A MET 806 ? A MET 15  
16  1  Y 1 A ASN 807 ? A ASN 16  
17  1  Y 1 A GLY 808 ? A GLY 17  
18  1  Y 1 A PRO 809 ? A PRO 18  
19  1  Y 1 A ARG 810 ? A ARG 19  
20  1  Y 1 A CYS 811 ? A CYS 20  
21  1  Y 1 A PRO 812 ? A PRO 21  
22  1  Y 1 A VAL 813 ? A VAL 22  
23  1  Y 1 A MET 877 ? A MET 86  
24  1  Y 1 A ARG 878 ? A ARG 87  
25  1  Y 1 A PRO 879 ? A PRO 88  
26  1  Y 1 A ILE 880 ? A ILE 89  
27  1  Y 1 A GLY 881 ? A GLY 90  
28  1  Y 1 A HIS 882 ? A HIS 91  
29  1  Y 1 A ASP 883 ? A ASP 92  
30  1  Y 1 A GLY 884 ? A GLY 93  
31  1  Y 1 A TYR 885 ? A TYR 94  
32  1  Y 1 A HIS 886 ? A HIS 95  
33  1  Y 1 A PRO 887 ? A PRO 96  
34  1  Y 1 A THR 888 ? A THR 97  
35  1  Y 1 A SER 889 ? A SER 98  
36  1  Y 1 A VAL 890 ? A VAL 99  
37  1  Y 1 A ALA 891 ? A ALA 100 
38  1  Y 1 A GLU 892 ? A GLU 101 
39  1  Y 1 A TRP 893 ? A TRP 102 
40  1  Y 1 A LEU 894 ? A LEU 103 
41  2  Y 1 A GLY 792 ? A GLY 1   
42  2  Y 1 A SER 793 ? A SER 2   
43  2  Y 1 A ASP 794 ? A ASP 3   
44  2  Y 1 A ILE 795 ? A ILE 4   
45  2  Y 1 A THR 796 ? A THR 5   
46  2  Y 1 A SER 797 ? A SER 6   
47  2  Y 1 A LEU 798 ? A LEU 7   
48  2  Y 1 A TYR 799 ? A TYR 8   
49  2  Y 1 A LYS 800 ? A LYS 9   
50  2  Y 1 A LYS 801 ? A LYS 10  
51  2  Y 1 A ALA 802 ? A ALA 11  
52  2  Y 1 A GLY 803 ? A GLY 12  
53  2  Y 1 A SER 804 ? A SER 13  
54  2  Y 1 A GLU 805 ? A GLU 14  
55  2  Y 1 A MET 806 ? A MET 15  
56  2  Y 1 A ASN 807 ? A ASN 16  
57  2  Y 1 A GLY 808 ? A GLY 17  
58  2  Y 1 A PRO 809 ? A PRO 18  
59  2  Y 1 A ARG 810 ? A ARG 19  
60  2  Y 1 A CYS 811 ? A CYS 20  
61  2  Y 1 A PRO 812 ? A PRO 21  
62  2  Y 1 A VAL 813 ? A VAL 22  
63  2  Y 1 A MET 877 ? A MET 86  
64  2  Y 1 A ARG 878 ? A ARG 87  
65  2  Y 1 A PRO 879 ? A PRO 88  
66  2  Y 1 A ILE 880 ? A ILE 89  
67  2  Y 1 A GLY 881 ? A GLY 90  
68  2  Y 1 A HIS 882 ? A HIS 91  
69  2  Y 1 A ASP 883 ? A ASP 92  
70  2  Y 1 A GLY 884 ? A GLY 93  
71  2  Y 1 A TYR 885 ? A TYR 94  
72  2  Y 1 A HIS 886 ? A HIS 95  
73  2  Y 1 A PRO 887 ? A PRO 96  
74  2  Y 1 A THR 888 ? A THR 97  
75  2  Y 1 A SER 889 ? A SER 98  
76  2  Y 1 A VAL 890 ? A VAL 99  
77  2  Y 1 A ALA 891 ? A ALA 100 
78  2  Y 1 A GLU 892 ? A GLU 101 
79  2  Y 1 A TRP 893 ? A TRP 102 
80  2  Y 1 A LEU 894 ? A LEU 103 
81  3  Y 1 A GLY 792 ? A GLY 1   
82  3  Y 1 A SER 793 ? A SER 2   
83  3  Y 1 A ASP 794 ? A ASP 3   
84  3  Y 1 A ILE 795 ? A ILE 4   
85  3  Y 1 A THR 796 ? A THR 5   
86  3  Y 1 A SER 797 ? A SER 6   
87  3  Y 1 A LEU 798 ? A LEU 7   
88  3  Y 1 A TYR 799 ? A TYR 8   
89  3  Y 1 A LYS 800 ? A LYS 9   
90  3  Y 1 A LYS 801 ? A LYS 10  
91  3  Y 1 A ALA 802 ? A ALA 11  
92  3  Y 1 A GLY 803 ? A GLY 12  
93  3  Y 1 A SER 804 ? A SER 13  
94  3  Y 1 A GLU 805 ? A GLU 14  
95  3  Y 1 A MET 806 ? A MET 15  
96  3  Y 1 A ASN 807 ? A ASN 16  
97  3  Y 1 A GLY 808 ? A GLY 17  
98  3  Y 1 A PRO 809 ? A PRO 18  
99  3  Y 1 A ARG 810 ? A ARG 19  
100 3  Y 1 A CYS 811 ? A CYS 20  
101 3  Y 1 A PRO 812 ? A PRO 21  
102 3  Y 1 A VAL 813 ? A VAL 22  
103 3  Y 1 A MET 877 ? A MET 86  
104 3  Y 1 A ARG 878 ? A ARG 87  
105 3  Y 1 A PRO 879 ? A PRO 88  
106 3  Y 1 A ILE 880 ? A ILE 89  
107 3  Y 1 A GLY 881 ? A GLY 90  
108 3  Y 1 A HIS 882 ? A HIS 91  
109 3  Y 1 A ASP 883 ? A ASP 92  
110 3  Y 1 A GLY 884 ? A GLY 93  
111 3  Y 1 A TYR 885 ? A TYR 94  
112 3  Y 1 A HIS 886 ? A HIS 95  
113 3  Y 1 A PRO 887 ? A PRO 96  
114 3  Y 1 A THR 888 ? A THR 97  
115 3  Y 1 A SER 889 ? A SER 98  
116 3  Y 1 A VAL 890 ? A VAL 99  
117 3  Y 1 A ALA 891 ? A ALA 100 
118 3  Y 1 A GLU 892 ? A GLU 101 
119 3  Y 1 A TRP 893 ? A TRP 102 
120 3  Y 1 A LEU 894 ? A LEU 103 
121 4  Y 1 A GLY 792 ? A GLY 1   
122 4  Y 1 A SER 793 ? A SER 2   
123 4  Y 1 A ASP 794 ? A ASP 3   
124 4  Y 1 A ILE 795 ? A ILE 4   
125 4  Y 1 A THR 796 ? A THR 5   
126 4  Y 1 A SER 797 ? A SER 6   
127 4  Y 1 A LEU 798 ? A LEU 7   
128 4  Y 1 A TYR 799 ? A TYR 8   
129 4  Y 1 A LYS 800 ? A LYS 9   
130 4  Y 1 A LYS 801 ? A LYS 10  
131 4  Y 1 A ALA 802 ? A ALA 11  
132 4  Y 1 A GLY 803 ? A GLY 12  
133 4  Y 1 A SER 804 ? A SER 13  
134 4  Y 1 A GLU 805 ? A GLU 14  
135 4  Y 1 A MET 806 ? A MET 15  
136 4  Y 1 A ASN 807 ? A ASN 16  
137 4  Y 1 A GLY 808 ? A GLY 17  
138 4  Y 1 A PRO 809 ? A PRO 18  
139 4  Y 1 A ARG 810 ? A ARG 19  
140 4  Y 1 A CYS 811 ? A CYS 20  
141 4  Y 1 A PRO 812 ? A PRO 21  
142 4  Y 1 A VAL 813 ? A VAL 22  
143 4  Y 1 A MET 877 ? A MET 86  
144 4  Y 1 A ARG 878 ? A ARG 87  
145 4  Y 1 A PRO 879 ? A PRO 88  
146 4  Y 1 A ILE 880 ? A ILE 89  
147 4  Y 1 A GLY 881 ? A GLY 90  
148 4  Y 1 A HIS 882 ? A HIS 91  
149 4  Y 1 A ASP 883 ? A ASP 92  
150 4  Y 1 A GLY 884 ? A GLY 93  
151 4  Y 1 A TYR 885 ? A TYR 94  
152 4  Y 1 A HIS 886 ? A HIS 95  
153 4  Y 1 A PRO 887 ? A PRO 96  
154 4  Y 1 A THR 888 ? A THR 97  
155 4  Y 1 A SER 889 ? A SER 98  
156 4  Y 1 A VAL 890 ? A VAL 99  
157 4  Y 1 A ALA 891 ? A ALA 100 
158 4  Y 1 A GLU 892 ? A GLU 101 
159 4  Y 1 A TRP 893 ? A TRP 102 
160 4  Y 1 A LEU 894 ? A LEU 103 
161 5  Y 1 A GLY 792 ? A GLY 1   
162 5  Y 1 A SER 793 ? A SER 2   
163 5  Y 1 A ASP 794 ? A ASP 3   
164 5  Y 1 A ILE 795 ? A ILE 4   
165 5  Y 1 A THR 796 ? A THR 5   
166 5  Y 1 A SER 797 ? A SER 6   
167 5  Y 1 A LEU 798 ? A LEU 7   
168 5  Y 1 A TYR 799 ? A TYR 8   
169 5  Y 1 A LYS 800 ? A LYS 9   
170 5  Y 1 A LYS 801 ? A LYS 10  
171 5  Y 1 A ALA 802 ? A ALA 11  
172 5  Y 1 A GLY 803 ? A GLY 12  
173 5  Y 1 A SER 804 ? A SER 13  
174 5  Y 1 A GLU 805 ? A GLU 14  
175 5  Y 1 A MET 806 ? A MET 15  
176 5  Y 1 A ASN 807 ? A ASN 16  
177 5  Y 1 A GLY 808 ? A GLY 17  
178 5  Y 1 A PRO 809 ? A PRO 18  
179 5  Y 1 A ARG 810 ? A ARG 19  
180 5  Y 1 A CYS 811 ? A CYS 20  
181 5  Y 1 A PRO 812 ? A PRO 21  
182 5  Y 1 A VAL 813 ? A VAL 22  
183 5  Y 1 A MET 877 ? A MET 86  
184 5  Y 1 A ARG 878 ? A ARG 87  
185 5  Y 1 A PRO 879 ? A PRO 88  
186 5  Y 1 A ILE 880 ? A ILE 89  
187 5  Y 1 A GLY 881 ? A GLY 90  
188 5  Y 1 A HIS 882 ? A HIS 91  
189 5  Y 1 A ASP 883 ? A ASP 92  
190 5  Y 1 A GLY 884 ? A GLY 93  
191 5  Y 1 A TYR 885 ? A TYR 94  
192 5  Y 1 A HIS 886 ? A HIS 95  
193 5  Y 1 A PRO 887 ? A PRO 96  
194 5  Y 1 A THR 888 ? A THR 97  
195 5  Y 1 A SER 889 ? A SER 98  
196 5  Y 1 A VAL 890 ? A VAL 99  
197 5  Y 1 A ALA 891 ? A ALA 100 
198 5  Y 1 A GLU 892 ? A GLU 101 
199 5  Y 1 A TRP 893 ? A TRP 102 
200 5  Y 1 A LEU 894 ? A LEU 103 
201 6  Y 1 A GLY 792 ? A GLY 1   
202 6  Y 1 A SER 793 ? A SER 2   
203 6  Y 1 A ASP 794 ? A ASP 3   
204 6  Y 1 A ILE 795 ? A ILE 4   
205 6  Y 1 A THR 796 ? A THR 5   
206 6  Y 1 A SER 797 ? A SER 6   
207 6  Y 1 A LEU 798 ? A LEU 7   
208 6  Y 1 A TYR 799 ? A TYR 8   
209 6  Y 1 A LYS 800 ? A LYS 9   
210 6  Y 1 A LYS 801 ? A LYS 10  
211 6  Y 1 A ALA 802 ? A ALA 11  
212 6  Y 1 A GLY 803 ? A GLY 12  
213 6  Y 1 A SER 804 ? A SER 13  
214 6  Y 1 A GLU 805 ? A GLU 14  
215 6  Y 1 A MET 806 ? A MET 15  
216 6  Y 1 A ASN 807 ? A ASN 16  
217 6  Y 1 A GLY 808 ? A GLY 17  
218 6  Y 1 A PRO 809 ? A PRO 18  
219 6  Y 1 A ARG 810 ? A ARG 19  
220 6  Y 1 A CYS 811 ? A CYS 20  
221 6  Y 1 A PRO 812 ? A PRO 21  
222 6  Y 1 A VAL 813 ? A VAL 22  
223 6  Y 1 A MET 877 ? A MET 86  
224 6  Y 1 A ARG 878 ? A ARG 87  
225 6  Y 1 A PRO 879 ? A PRO 88  
226 6  Y 1 A ILE 880 ? A ILE 89  
227 6  Y 1 A GLY 881 ? A GLY 90  
228 6  Y 1 A HIS 882 ? A HIS 91  
229 6  Y 1 A ASP 883 ? A ASP 92  
230 6  Y 1 A GLY 884 ? A GLY 93  
231 6  Y 1 A TYR 885 ? A TYR 94  
232 6  Y 1 A HIS 886 ? A HIS 95  
233 6  Y 1 A PRO 887 ? A PRO 96  
234 6  Y 1 A THR 888 ? A THR 97  
235 6  Y 1 A SER 889 ? A SER 98  
236 6  Y 1 A VAL 890 ? A VAL 99  
237 6  Y 1 A ALA 891 ? A ALA 100 
238 6  Y 1 A GLU 892 ? A GLU 101 
239 6  Y 1 A TRP 893 ? A TRP 102 
240 6  Y 1 A LEU 894 ? A LEU 103 
241 7  Y 1 A GLY 792 ? A GLY 1   
242 7  Y 1 A SER 793 ? A SER 2   
243 7  Y 1 A ASP 794 ? A ASP 3   
244 7  Y 1 A ILE 795 ? A ILE 4   
245 7  Y 1 A THR 796 ? A THR 5   
246 7  Y 1 A SER 797 ? A SER 6   
247 7  Y 1 A LEU 798 ? A LEU 7   
248 7  Y 1 A TYR 799 ? A TYR 8   
249 7  Y 1 A LYS 800 ? A LYS 9   
250 7  Y 1 A LYS 801 ? A LYS 10  
251 7  Y 1 A ALA 802 ? A ALA 11  
252 7  Y 1 A GLY 803 ? A GLY 12  
253 7  Y 1 A SER 804 ? A SER 13  
254 7  Y 1 A GLU 805 ? A GLU 14  
255 7  Y 1 A MET 806 ? A MET 15  
256 7  Y 1 A ASN 807 ? A ASN 16  
257 7  Y 1 A GLY 808 ? A GLY 17  
258 7  Y 1 A PRO 809 ? A PRO 18  
259 7  Y 1 A ARG 810 ? A ARG 19  
260 7  Y 1 A CYS 811 ? A CYS 20  
261 7  Y 1 A PRO 812 ? A PRO 21  
262 7  Y 1 A VAL 813 ? A VAL 22  
263 7  Y 1 A MET 877 ? A MET 86  
264 7  Y 1 A ARG 878 ? A ARG 87  
265 7  Y 1 A PRO 879 ? A PRO 88  
266 7  Y 1 A ILE 880 ? A ILE 89  
267 7  Y 1 A GLY 881 ? A GLY 90  
268 7  Y 1 A HIS 882 ? A HIS 91  
269 7  Y 1 A ASP 883 ? A ASP 92  
270 7  Y 1 A GLY 884 ? A GLY 93  
271 7  Y 1 A TYR 885 ? A TYR 94  
272 7  Y 1 A HIS 886 ? A HIS 95  
273 7  Y 1 A PRO 887 ? A PRO 96  
274 7  Y 1 A THR 888 ? A THR 97  
275 7  Y 1 A SER 889 ? A SER 98  
276 7  Y 1 A VAL 890 ? A VAL 99  
277 7  Y 1 A ALA 891 ? A ALA 100 
278 7  Y 1 A GLU 892 ? A GLU 101 
279 7  Y 1 A TRP 893 ? A TRP 102 
280 7  Y 1 A LEU 894 ? A LEU 103 
281 8  Y 1 A GLY 792 ? A GLY 1   
282 8  Y 1 A SER 793 ? A SER 2   
283 8  Y 1 A ASP 794 ? A ASP 3   
284 8  Y 1 A ILE 795 ? A ILE 4   
285 8  Y 1 A THR 796 ? A THR 5   
286 8  Y 1 A SER 797 ? A SER 6   
287 8  Y 1 A LEU 798 ? A LEU 7   
288 8  Y 1 A TYR 799 ? A TYR 8   
289 8  Y 1 A LYS 800 ? A LYS 9   
290 8  Y 1 A LYS 801 ? A LYS 10  
291 8  Y 1 A ALA 802 ? A ALA 11  
292 8  Y 1 A GLY 803 ? A GLY 12  
293 8  Y 1 A SER 804 ? A SER 13  
294 8  Y 1 A GLU 805 ? A GLU 14  
295 8  Y 1 A MET 806 ? A MET 15  
296 8  Y 1 A ASN 807 ? A ASN 16  
297 8  Y 1 A GLY 808 ? A GLY 17  
298 8  Y 1 A PRO 809 ? A PRO 18  
299 8  Y 1 A ARG 810 ? A ARG 19  
300 8  Y 1 A CYS 811 ? A CYS 20  
301 8  Y 1 A PRO 812 ? A PRO 21  
302 8  Y 1 A VAL 813 ? A VAL 22  
303 8  Y 1 A MET 877 ? A MET 86  
304 8  Y 1 A ARG 878 ? A ARG 87  
305 8  Y 1 A PRO 879 ? A PRO 88  
306 8  Y 1 A ILE 880 ? A ILE 89  
307 8  Y 1 A GLY 881 ? A GLY 90  
308 8  Y 1 A HIS 882 ? A HIS 91  
309 8  Y 1 A ASP 883 ? A ASP 92  
310 8  Y 1 A GLY 884 ? A GLY 93  
311 8  Y 1 A TYR 885 ? A TYR 94  
312 8  Y 1 A HIS 886 ? A HIS 95  
313 8  Y 1 A PRO 887 ? A PRO 96  
314 8  Y 1 A THR 888 ? A THR 97  
315 8  Y 1 A SER 889 ? A SER 98  
316 8  Y 1 A VAL 890 ? A VAL 99  
317 8  Y 1 A ALA 891 ? A ALA 100 
318 8  Y 1 A GLU 892 ? A GLU 101 
319 8  Y 1 A TRP 893 ? A TRP 102 
320 8  Y 1 A LEU 894 ? A LEU 103 
321 9  Y 1 A GLY 792 ? A GLY 1   
322 9  Y 1 A SER 793 ? A SER 2   
323 9  Y 1 A ASP 794 ? A ASP 3   
324 9  Y 1 A ILE 795 ? A ILE 4   
325 9  Y 1 A THR 796 ? A THR 5   
326 9  Y 1 A SER 797 ? A SER 6   
327 9  Y 1 A LEU 798 ? A LEU 7   
328 9  Y 1 A TYR 799 ? A TYR 8   
329 9  Y 1 A LYS 800 ? A LYS 9   
330 9  Y 1 A LYS 801 ? A LYS 10  
331 9  Y 1 A ALA 802 ? A ALA 11  
332 9  Y 1 A GLY 803 ? A GLY 12  
333 9  Y 1 A SER 804 ? A SER 13  
334 9  Y 1 A GLU 805 ? A GLU 14  
335 9  Y 1 A MET 806 ? A MET 15  
336 9  Y 1 A ASN 807 ? A ASN 16  
337 9  Y 1 A GLY 808 ? A GLY 17  
338 9  Y 1 A PRO 809 ? A PRO 18  
339 9  Y 1 A ARG 810 ? A ARG 19  
340 9  Y 1 A CYS 811 ? A CYS 20  
341 9  Y 1 A PRO 812 ? A PRO 21  
342 9  Y 1 A VAL 813 ? A VAL 22  
343 9  Y 1 A MET 877 ? A MET 86  
344 9  Y 1 A ARG 878 ? A ARG 87  
345 9  Y 1 A PRO 879 ? A PRO 88  
346 9  Y 1 A ILE 880 ? A ILE 89  
347 9  Y 1 A GLY 881 ? A GLY 90  
348 9  Y 1 A HIS 882 ? A HIS 91  
349 9  Y 1 A ASP 883 ? A ASP 92  
350 9  Y 1 A GLY 884 ? A GLY 93  
351 9  Y 1 A TYR 885 ? A TYR 94  
352 9  Y 1 A HIS 886 ? A HIS 95  
353 9  Y 1 A PRO 887 ? A PRO 96  
354 9  Y 1 A THR 888 ? A THR 97  
355 9  Y 1 A SER 889 ? A SER 98  
356 9  Y 1 A VAL 890 ? A VAL 99  
357 9  Y 1 A ALA 891 ? A ALA 100 
358 9  Y 1 A GLU 892 ? A GLU 101 
359 9  Y 1 A TRP 893 ? A TRP 102 
360 9  Y 1 A LEU 894 ? A LEU 103 
361 10 Y 1 A GLY 792 ? A GLY 1   
362 10 Y 1 A SER 793 ? A SER 2   
363 10 Y 1 A ASP 794 ? A ASP 3   
364 10 Y 1 A ILE 795 ? A ILE 4   
365 10 Y 1 A THR 796 ? A THR 5   
366 10 Y 1 A SER 797 ? A SER 6   
367 10 Y 1 A LEU 798 ? A LEU 7   
368 10 Y 1 A TYR 799 ? A TYR 8   
369 10 Y 1 A LYS 800 ? A LYS 9   
370 10 Y 1 A LYS 801 ? A LYS 10  
371 10 Y 1 A ALA 802 ? A ALA 11  
372 10 Y 1 A GLY 803 ? A GLY 12  
373 10 Y 1 A SER 804 ? A SER 13  
374 10 Y 1 A GLU 805 ? A GLU 14  
375 10 Y 1 A MET 806 ? A MET 15  
376 10 Y 1 A ASN 807 ? A ASN 16  
377 10 Y 1 A GLY 808 ? A GLY 17  
378 10 Y 1 A PRO 809 ? A PRO 18  
379 10 Y 1 A ARG 810 ? A ARG 19  
380 10 Y 1 A CYS 811 ? A CYS 20  
381 10 Y 1 A PRO 812 ? A PRO 21  
382 10 Y 1 A VAL 813 ? A VAL 22  
383 10 Y 1 A MET 877 ? A MET 86  
384 10 Y 1 A ARG 878 ? A ARG 87  
385 10 Y 1 A PRO 879 ? A PRO 88  
386 10 Y 1 A ILE 880 ? A ILE 89  
387 10 Y 1 A GLY 881 ? A GLY 90  
388 10 Y 1 A HIS 882 ? A HIS 91  
389 10 Y 1 A ASP 883 ? A ASP 92  
390 10 Y 1 A GLY 884 ? A GLY 93  
391 10 Y 1 A TYR 885 ? A TYR 94  
392 10 Y 1 A HIS 886 ? A HIS 95  
393 10 Y 1 A PRO 887 ? A PRO 96  
394 10 Y 1 A THR 888 ? A THR 97  
395 10 Y 1 A SER 889 ? A SER 98  
396 10 Y 1 A VAL 890 ? A VAL 99  
397 10 Y 1 A ALA 891 ? A ALA 100 
398 10 Y 1 A GLU 892 ? A GLU 101 
399 10 Y 1 A TRP 893 ? A TRP 102 
400 10 Y 1 A LEU 894 ? A LEU 103 
#