data_2KH2
# 
_entry.id   2KH2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2KH2         pdb_00002kh2 10.2210/pdb2kh2/pdb 
RCSB  RCSB101111   ?            ?                   
WWPDB D_1000101111 ?            ?                   
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KH2 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-23 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wilkinson, I.C.' 1 
'Hall, C.J.'      2 
'Veverka, V.'     3 
'Muskett, F.W.'   4 
'Stephens, P.E.'  5 
'Taylor, R.J.'    6 
'Henry, A.J.'     7 
'Carr, M.D.'      8 
# 
_citation.id                        primary 
_citation.title                     
;High resolution NMR-based model for the structure of a scFv-IL-1beta complex: potential for NMR as a key tool in therapeutic antibody design and development.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                31928 
_citation.page_last                 31935 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19776018 
_citation.pdbx_database_id_DOI      10.1074/jbc.M109.025304 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wilkinson, I.C.' 1 ? 
primary 'Hall, C.J.'      2 ? 
primary 'Veverka, V.'     3 ? 
primary 'Shi, J.Y.'       4 ? 
primary 'Muskett, F.W.'   5 ? 
primary 'Stephens, P.E.'  6 ? 
primary 'Taylor, R.J.'    7 ? 
primary 'Henry, A.J.'     8 ? 
primary 'Carr, M.D.'      9 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Interleukin-1 beta' 17395.832 1 ? ? ? ? 
2 polymer man scFv                 27393.309 1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IL-1 beta, Catabolin' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
;APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
A ? 
2 'polypeptide(L)' no no 
;DIQMTQSPSSLSASVGDRVTITCRTSGNIHNYLTWYQQKPGKAPQLLIYNAKTLADGVPSRFSGSGSGTQFTLTISSLQP
EDFANYYCQHFWSLPFTFGQGTKVEIKRTGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFDFSR
YDMSWVRQAPGKRLEWVAYISSGGGSTYFPDTVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARQNKKLTWFDYWGQ
GTLVTVSSHHHHHH
;
;DIQMTQSPSSLSASVGDRVTITCRTSGNIHNYLTWYQQKPGKAPQLLIYNAKTLADGVPSRFSGSGSGTQFTLTISSLQP
EDFANYYCQHFWSLPFTFGQGTKVEIKRTGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFDFSR
YDMSWVRQAPGKRLEWVAYISSGGGSTYFPDTVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARQNKKLTWFDYWGQ
GTLVTVSSHHHHHH
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   VAL n 
1 4   ARG n 
1 5   SER n 
1 6   LEU n 
1 7   ASN n 
1 8   CYS n 
1 9   THR n 
1 10  LEU n 
1 11  ARG n 
1 12  ASP n 
1 13  SER n 
1 14  GLN n 
1 15  GLN n 
1 16  LYS n 
1 17  SER n 
1 18  LEU n 
1 19  VAL n 
1 20  MET n 
1 21  SER n 
1 22  GLY n 
1 23  PRO n 
1 24  TYR n 
1 25  GLU n 
1 26  LEU n 
1 27  LYS n 
1 28  ALA n 
1 29  LEU n 
1 30  HIS n 
1 31  LEU n 
1 32  GLN n 
1 33  GLY n 
1 34  GLN n 
1 35  ASP n 
1 36  MET n 
1 37  GLU n 
1 38  GLN n 
1 39  GLN n 
1 40  VAL n 
1 41  VAL n 
1 42  PHE n 
1 43  SER n 
1 44  MET n 
1 45  SER n 
1 46  PHE n 
1 47  VAL n 
1 48  GLN n 
1 49  GLY n 
1 50  GLU n 
1 51  GLU n 
1 52  SER n 
1 53  ASN n 
1 54  ASP n 
1 55  LYS n 
1 56  ILE n 
1 57  PRO n 
1 58  VAL n 
1 59  ALA n 
1 60  LEU n 
1 61  GLY n 
1 62  LEU n 
1 63  LYS n 
1 64  GLU n 
1 65  LYS n 
1 66  ASN n 
1 67  LEU n 
1 68  TYR n 
1 69  LEU n 
1 70  SER n 
1 71  CYS n 
1 72  VAL n 
1 73  LEU n 
1 74  LYS n 
1 75  ASP n 
1 76  ASP n 
1 77  LYS n 
1 78  PRO n 
1 79  THR n 
1 80  LEU n 
1 81  GLN n 
1 82  LEU n 
1 83  GLU n 
1 84  SER n 
1 85  VAL n 
1 86  ASP n 
1 87  PRO n 
1 88  LYS n 
1 89  ASN n 
1 90  TYR n 
1 91  PRO n 
1 92  LYS n 
1 93  LYS n 
1 94  LYS n 
1 95  MET n 
1 96  GLU n 
1 97  LYS n 
1 98  ARG n 
1 99  PHE n 
1 100 VAL n 
1 101 PHE n 
1 102 ASN n 
1 103 LYS n 
1 104 ILE n 
1 105 GLU n 
1 106 ILE n 
1 107 ASN n 
1 108 ASN n 
1 109 LYS n 
1 110 LEU n 
1 111 GLU n 
1 112 PHE n 
1 113 GLU n 
1 114 SER n 
1 115 ALA n 
1 116 GLN n 
1 117 PHE n 
1 118 PRO n 
1 119 ASN n 
1 120 TRP n 
1 121 TYR n 
1 122 ILE n 
1 123 SER n 
1 124 THR n 
1 125 SER n 
1 126 GLN n 
1 127 ALA n 
1 128 GLU n 
1 129 ASN n 
1 130 MET n 
1 131 PRO n 
1 132 VAL n 
1 133 PHE n 
1 134 LEU n 
1 135 GLY n 
1 136 GLY n 
1 137 THR n 
1 138 LYS n 
1 139 GLY n 
1 140 GLY n 
1 141 GLN n 
1 142 ASP n 
1 143 ILE n 
1 144 THR n 
1 145 ASP n 
1 146 PHE n 
1 147 THR n 
1 148 MET n 
1 149 GLN n 
1 150 PHE n 
1 151 VAL n 
1 152 SER n 
1 153 SER n 
2 1   ASP n 
2 2   ILE n 
2 3   GLN n 
2 4   MET n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   SER n 
2 10  SER n 
2 11  LEU n 
2 12  SER n 
2 13  ALA n 
2 14  SER n 
2 15  VAL n 
2 16  GLY n 
2 17  ASP n 
2 18  ARG n 
2 19  VAL n 
2 20  THR n 
2 21  ILE n 
2 22  THR n 
2 23  CYS n 
2 24  ARG n 
2 25  THR n 
2 26  SER n 
2 27  GLY n 
2 28  ASN n 
2 29  ILE n 
2 30  HIS n 
2 31  ASN n 
2 32  TYR n 
2 33  LEU n 
2 34  THR n 
2 35  TRP n 
2 36  TYR n 
2 37  GLN n 
2 38  GLN n 
2 39  LYS n 
2 40  PRO n 
2 41  GLY n 
2 42  LYS n 
2 43  ALA n 
2 44  PRO n 
2 45  GLN n 
2 46  LEU n 
2 47  LEU n 
2 48  ILE n 
2 49  TYR n 
2 50  ASN n 
2 51  ALA n 
2 52  LYS n 
2 53  THR n 
2 54  LEU n 
2 55  ALA n 
2 56  ASP n 
2 57  GLY n 
2 58  VAL n 
2 59  PRO n 
2 60  SER n 
2 61  ARG n 
2 62  PHE n 
2 63  SER n 
2 64  GLY n 
2 65  SER n 
2 66  GLY n 
2 67  SER n 
2 68  GLY n 
2 69  THR n 
2 70  GLN n 
2 71  PHE n 
2 72  THR n 
2 73  LEU n 
2 74  THR n 
2 75  ILE n 
2 76  SER n 
2 77  SER n 
2 78  LEU n 
2 79  GLN n 
2 80  PRO n 
2 81  GLU n 
2 82  ASP n 
2 83  PHE n 
2 84  ALA n 
2 85  ASN n 
2 86  TYR n 
2 87  TYR n 
2 88  CYS n 
2 89  GLN n 
2 90  HIS n 
2 91  PHE n 
2 92  TRP n 
2 93  SER n 
2 94  LEU n 
2 95  PRO n 
2 96  PHE n 
2 97  THR n 
2 98  PHE n 
2 99  GLY n 
2 100 GLN n 
2 101 GLY n 
2 102 THR n 
2 103 LYS n 
2 104 VAL n 
2 105 GLU n 
2 106 ILE n 
2 107 LYS n 
2 108 ARG n 
2 109 THR n 
2 110 GLY n 
2 111 GLY n 
2 112 GLY n 
2 113 GLY n 
2 114 SER n 
2 115 GLY n 
2 116 GLY n 
2 117 GLY n 
2 118 GLY n 
2 119 SER n 
2 120 GLY n 
2 121 GLY n 
2 122 GLY n 
2 123 GLY n 
2 124 SER n 
2 125 GLY n 
2 126 GLY n 
2 127 GLY n 
2 128 GLY n 
2 129 SER n 
2 130 GLU n 
2 131 VAL n 
2 132 GLN n 
2 133 LEU n 
2 134 VAL n 
2 135 GLU n 
2 136 SER n 
2 137 GLY n 
2 138 GLY n 
2 139 GLY n 
2 140 LEU n 
2 141 VAL n 
2 142 GLN n 
2 143 PRO n 
2 144 GLY n 
2 145 GLY n 
2 146 SER n 
2 147 LEU n 
2 148 ARG n 
2 149 LEU n 
2 150 SER n 
2 151 CYS n 
2 152 ALA n 
2 153 ALA n 
2 154 SER n 
2 155 GLY n 
2 156 PHE n 
2 157 ASP n 
2 158 PHE n 
2 159 SER n 
2 160 ARG n 
2 161 TYR n 
2 162 ASP n 
2 163 MET n 
2 164 SER n 
2 165 TRP n 
2 166 VAL n 
2 167 ARG n 
2 168 GLN n 
2 169 ALA n 
2 170 PRO n 
2 171 GLY n 
2 172 LYS n 
2 173 ARG n 
2 174 LEU n 
2 175 GLU n 
2 176 TRP n 
2 177 VAL n 
2 178 ALA n 
2 179 TYR n 
2 180 ILE n 
2 181 SER n 
2 182 SER n 
2 183 GLY n 
2 184 GLY n 
2 185 GLY n 
2 186 SER n 
2 187 THR n 
2 188 TYR n 
2 189 PHE n 
2 190 PRO n 
2 191 ASP n 
2 192 THR n 
2 193 VAL n 
2 194 LYS n 
2 195 GLY n 
2 196 ARG n 
2 197 PHE n 
2 198 THR n 
2 199 ILE n 
2 200 SER n 
2 201 ARG n 
2 202 ASP n 
2 203 ASN n 
2 204 ALA n 
2 205 LYS n 
2 206 ASN n 
2 207 THR n 
2 208 LEU n 
2 209 TYR n 
2 210 LEU n 
2 211 GLN n 
2 212 MET n 
2 213 ASN n 
2 214 SER n 
2 215 LEU n 
2 216 ARG n 
2 217 ALA n 
2 218 GLU n 
2 219 ASP n 
2 220 THR n 
2 221 ALA n 
2 222 VAL n 
2 223 TYR n 
2 224 TYR n 
2 225 CYS n 
2 226 ALA n 
2 227 ARG n 
2 228 GLN n 
2 229 ASN n 
2 230 LYS n 
2 231 LYS n 
2 232 LEU n 
2 233 THR n 
2 234 TRP n 
2 235 PHE n 
2 236 ASP n 
2 237 TYR n 
2 238 TRP n 
2 239 GLY n 
2 240 GLN n 
2 241 GLY n 
2 242 THR n 
2 243 LEU n 
2 244 VAL n 
2 245 THR n 
2 246 VAL n 
2 247 SER n 
2 248 SER n 
2 249 HIS n 
2 250 HIS n 
2 251 HIS n 
2 252 HIS n 
2 253 HIS n 
2 254 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'IL1B, IL1F2' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? 
? ? ? ? plasmid ? ? ? pet-21 ? ? 
2 1 sample ? ? ? mouse ? ?             ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? 
? ? ? ? plasmid ? ? ? pTTod  ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP IL1B_HUMAN P01584 1 
;APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
117 ? 
2 PDB 2KH2       2KH2   2 
;DIQMTQSPSSLSASVGDRVTITCRTSGNIHNYLTWYQQKPGKAPQLLIYNAKTLADGVPSRFSGSGSGTQFTLTISSLQP
EDFANYYCQHFWSLPFTFGQGTKVEIKRTGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFDFSR
YDMSWVRQAPGKRLEWVAYISSGGGSTYFPDTVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARQNKKLTWFDYWGQ
GTLVTVSSHHHHHH
;
?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KH2 A 1 ? 153 ? P01584 117 ? 269 ? 1 153 
2 2 2KH2 B 1 ? 254 ? 2KH2   1   ? 254 ? 1 254 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  3 '2D 1H-15N HSQC'  
1 2  4 '2D 1H-15N HSQC'  
1 3  5 '2D 1H-15N HSQC'  
1 4  6 '2D 1H-15N HSQC'  
1 5  1 '3D CBCA(CO)NH'   
1 6  2 '3D CBCA(CO)NH'   
1 7  1 '3D HNCO'         
1 8  2 '3D HNCO'         
1 9  1 '3D HNCA'         
1 10 2 '3D HNCA'         
1 11 1 '3D HNCACB'       
1 12 2 '3D HNCACB'       
1 13 1 '3D CBCA(CO)NH'   
1 14 2 '3D CBCA(CO)NH'   
1 15 3 '3D 1H-15N NOESY' 
1 16 4 '3D 1H-15N NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      150 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         313 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'400-700 uM [U-13C; U-15N; U-2H] IL1B, 400-700 uM scFv, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' 
'400-700 uM [U-13C; U-15N; U-2H] scFv, 400-700 uM IL1B, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' 
'200-500 uM [U-15N] IL1B, 200-500 uM scFv, 90% H2O/10% D2O'              3 '90% H2O/10% D2O' 
'600 uM [U-15N] scFv, 600 uM IL1B, 90% H2O/10% D2O'                      4 '90% H2O/10% D2O' 
'250 uM [U-15N] IL1B, 250 uM scFv, 4 mg/mL Pf1 phage, 90% H2O/10% D2O'   5 '90% H2O/10% D2O' 
'250 uM [U-15N] scFv, 250 uM IL1B, 4 mg/mL Pf1 phage, 90% H2O/10% D2O'   6 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker AVANCE 1 'Bruker Avance' 
600 Bruker DRX    2 'Bruker DRX'    
# 
_pdbx_nmr_refine.entry_id           2KH2 
_pdbx_nmr_refine.method             'simulated annealing, molecular dynamics' 
_pdbx_nmr_refine.details            'Refined as part of the HADDOCK docking protocol' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'all calculated structures submitted' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            77 
_pdbx_nmr_ensemble.conformers_submitted_total_number             77 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KH2 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KH2 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'     collection                  TopSpin 2.0   1 
'Bruker Biospin'     processing                  TopSpin 2.0   2 
Goddard              'chemical shift assignment' Sparky  3.110 3 
Goddard              'peak picking'              Sparky  3.110 4 
'Utrecht University' 'structure solution'        HADDOCK 2.0   5 
'Utrecht University' refinement                  HADDOCK 2.0   6 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KH2 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KH2 
_struct.title                     'Solution structure of a scFv-IL-1B complex' 
_struct.pdbx_model_details        'closest to the average, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KH2 
_struct_keywords.pdbx_keywords   'Cytokine/IMMUNE SYSTEM' 
_struct_keywords.text            
'scFv, single chain Fv, IL-1B, antibody, Cytokine, Inflammatory response, Mitogen, Pyrogen, Secreted, Cytokine-IMMUNE SYSTEM COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 35  ? GLN A 39  ? ASP A 35  GLN A 39  5 ? 5 
HELX_P HELX_P2 2 GLU A 96  ? ARG A 98  ? GLU A 96  ARG A 98  5 ? 3 
HELX_P HELX_P3 3 GLN B 79  ? PHE B 83  ? GLN B 79  PHE B 83  5 ? 5 
HELX_P HELX_P4 4 ARG B 216 ? THR B 220 ? ARG B 216 THR B 220 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 88  SG ? ? B CYS 23  B CYS 88  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf2 disulf ? ? B CYS 151 SG ? ? ? 1_555 B CYS 225 SG ? ? B CYS 151 B CYS 225 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1   TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 1  0.09  
2   SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 1  0.00  
3   LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 1  -0.04 
4   TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 2  -0.59 
5   SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 2  -0.45 
6   LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 2  -0.12 
7   TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 3  -0.30 
8   SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 3  -0.50 
9   LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 3  -0.17 
10  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 4  -0.44 
11  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 4  -0.37 
12  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 4  -0.30 
13  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 5  -0.15 
14  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 5  -0.35 
15  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 5  0.45  
16  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 6  -0.47 
17  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 6  -0.26 
18  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 6  -0.61 
19  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 7  -0.54 
20  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 7  -0.44 
21  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 7  -0.63 
22  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 8  -0.05 
23  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 8  -0.51 
24  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 8  -0.15 
25  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 9  -0.17 
26  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 9  -0.47 
27  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 9  -0.25 
28  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 10 -0.25 
29  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 10 -0.35 
30  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 10 0.19  
31  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 11 -0.29 
32  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 11 -0.31 
33  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 11 -0.86 
34  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 12 -0.13 
35  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 12 -0.28 
36  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 12 -0.25 
37  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 13 0.00  
38  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 13 -0.12 
39  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 13 -0.42 
40  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 14 0.10  
41  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 14 -0.38 
42  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 14 -1.11 
43  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 15 -0.29 
44  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 15 -0.26 
45  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 15 -0.10 
46  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 16 -0.20 
47  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 16 -0.65 
48  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 16 -0.66 
49  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 17 -0.23 
50  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 17 -0.51 
51  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 17 -0.09 
52  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 18 0.14  
53  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 18 -0.64 
54  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 18 -0.29 
55  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 19 -0.39 
56  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 19 -0.47 
57  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 19 -0.36 
58  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 20 -0.11 
59  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 20 -0.38 
60  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 20 0.02  
61  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 21 0.08  
62  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 21 -0.23 
63  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 21 -0.57 
64  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 22 -0.51 
65  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 22 -0.42 
66  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 22 0.03  
67  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 23 -0.37 
68  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 23 -0.91 
69  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 23 -0.25 
70  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 24 0.42  
71  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 24 -0.29 
72  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 24 -0.40 
73  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 25 -0.06 
74  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 25 -0.37 
75  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 25 0.34  
76  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 26 0.18  
77  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 26 -0.36 
78  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 26 -0.35 
79  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 27 0.26  
80  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 27 -0.48 
81  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 27 -1.48 
82  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 28 -0.01 
83  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 28 -0.70 
84  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 28 -0.52 
85  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 29 -0.05 
86  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 29 -0.38 
87  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 29 -0.60 
88  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 30 -0.41 
89  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 30 -0.35 
90  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 30 -0.26 
91  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 31 -0.31 
92  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 31 -0.41 
93  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 31 -0.64 
94  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 32 -0.02 
95  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 32 -0.52 
96  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 32 -0.36 
97  TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 33 -0.13 
98  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 33 -0.64 
99  LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 33 0.30  
100 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 34 -0.12 
101 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 34 -0.28 
102 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 34 -0.81 
103 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 35 -0.06 
104 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 35 -0.60 
105 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 35 -0.40 
106 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 36 -0.08 
107 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 36 -0.48 
108 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 36 -0.51 
109 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 37 0.15  
110 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 37 -0.70 
111 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 37 -0.35 
112 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 38 -0.38 
113 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 38 -0.58 
114 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 38 0.03  
115 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 39 -0.15 
116 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 39 -0.67 
117 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 39 -0.22 
118 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 40 -0.44 
119 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 40 -0.79 
120 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 40 0.01  
121 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 41 0.07  
122 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 41 -0.51 
123 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 41 -0.18 
124 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 42 0.31  
125 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 42 -0.85 
126 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 42 -0.47 
127 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 43 -0.36 
128 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 43 -0.44 
129 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 43 -0.45 
130 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 44 -0.37 
131 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 44 -0.36 
132 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 44 0.20  
133 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 45 -0.22 
134 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 45 -0.10 
135 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 45 -0.46 
136 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 46 -0.16 
137 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 46 -0.09 
138 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 46 -0.14 
139 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 47 -0.49 
140 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 47 -0.85 
141 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 47 -0.39 
142 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 48 -0.32 
143 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 48 -0.30 
144 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 48 -0.58 
145 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 49 -0.40 
146 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 49 -0.22 
147 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 49 -0.24 
148 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 50 0.08  
149 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 50 -0.31 
150 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 50 -1.16 
151 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 51 -0.03 
152 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 51 -0.27 
153 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 51 -1.09 
154 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 52 0.09  
155 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 52 -0.21 
156 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 52 -0.48 
157 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 53 -0.27 
158 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 53 -0.14 
159 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 53 -0.34 
160 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 54 -0.48 
161 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 54 -0.46 
162 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 54 -0.79 
163 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 55 0.21  
164 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 55 -0.28 
165 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 55 -0.79 
166 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 56 0.41  
167 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 56 -0.44 
168 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 56 -0.51 
169 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 57 -0.11 
170 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 57 -0.11 
171 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 57 -0.26 
172 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 58 -0.63 
173 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 58 0.13  
174 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 58 -0.32 
175 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 59 0.05  
176 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 59 -0.26 
177 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 59 -0.43 
178 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 60 0.13  
179 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 60 -0.50 
180 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 60 -1.01 
181 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 61 -0.65 
182 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 61 -0.36 
183 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 61 -0.90 
184 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 62 -0.12 
185 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 62 -0.29 
186 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 62 -0.48 
187 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 63 -0.12 
188 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 63 0.14  
189 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 63 -0.57 
190 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 64 0.04  
191 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 64 -0.51 
192 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 64 0.06  
193 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 65 -0.80 
194 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 65 0.22  
195 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 65 0.18  
196 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 66 -0.45 
197 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 66 -0.07 
198 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 66 -0.05 
199 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 67 0.03  
200 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 67 -0.13 
201 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 67 -0.29 
202 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 68 0.30  
203 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 68 -0.40 
204 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 68 -0.04 
205 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 69 0.00  
206 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 69 -0.39 
207 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 69 -0.58 
208 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 70 -0.34 
209 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 70 0.13  
210 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 70 -0.89 
211 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 71 0.11  
212 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 71 -0.42 
213 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 71 -0.38 
214 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 72 0.28  
215 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 72 -0.50 
216 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 72 -0.99 
217 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 73 -0.56 
218 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 73 -0.03 
219 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 73 -0.78 
220 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 74 0.02  
221 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 74 -0.43 
222 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 74 -0.41 
223 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 75 -0.40 
224 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 75 -0.26 
225 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 75 -0.06 
226 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 76 -0.28 
227 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 76 -0.52 
228 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 76 -0.78 
229 TYR 90 A . ? TYR 90 A PRO 91 A ? PRO 91 A 77 -0.23 
230 SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 77 -0.11 
231 LEU 94 B . ? LEU 94 B PRO 95 B ? PRO 95 B 77 0.35  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 6 ? 
G ? 4 ? 
H ? 5 ? 
I ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 5   ? ASP A 12  ? SER A 5   ASP A 12  
A 2 PHE A 42  ? PHE A 46  ? PHE A 42  PHE A 46  
A 3 LYS A 55  ? LEU A 62  ? LYS A 55  LEU A 62  
A 4 VAL A 100 ? GLU A 105 ? VAL A 100 GLU A 105 
A 5 LEU A 110 ? SER A 114 ? LEU A 110 SER A 114 
A 6 PHE A 146 ? PHE A 150 ? PHE A 146 PHE A 150 
A 7 SER A 5   ? ASP A 12  ? SER A 5   ASP A 12  
B 1 SER A 17  ? MET A 20  ? SER A 17  MET A 20  
B 2 LEU A 26  ? LEU A 29  ? LEU A 26  LEU A 29  
B 3 MET A 130 ? PRO A 131 ? MET A 130 PRO A 131 
C 1 LEU A 67  ? LYS A 74  ? LEU A 67  LYS A 74  
C 2 LYS A 77  ? SER A 84  ? LYS A 77  SER A 84  
D 1 TYR A 121 ? SER A 123 ? TYR A 121 SER A 123 
D 2 PHE A 133 ? GLY A 135 ? PHE A 133 GLY A 135 
E 1 MET B 4   ? SER B 7   ? MET B 4   SER B 7   
E 2 VAL B 19  ? THR B 25  ? VAL B 19  THR B 25  
E 3 GLN B 70  ? ILE B 75  ? GLN B 70  ILE B 75  
E 4 PHE B 62  ? SER B 67  ? PHE B 62  SER B 67  
F 1 SER B 10  ? ALA B 13  ? SER B 10  ALA B 13  
F 2 THR B 102 ? ILE B 106 ? THR B 102 ILE B 106 
F 3 ASN B 85  ? HIS B 90  ? ASN B 85  HIS B 90  
F 4 LEU B 33  ? GLN B 38  ? LEU B 33  GLN B 38  
F 5 PRO B 44  ? TYR B 49  ? PRO B 44  TYR B 49  
F 6 THR B 53  ? LEU B 54  ? THR B 53  LEU B 54  
G 1 GLN B 132 ? SER B 136 ? GLN B 132 SER B 136 
G 2 LEU B 147 ? SER B 154 ? LEU B 147 SER B 154 
G 3 THR B 207 ? MET B 212 ? THR B 207 MET B 212 
G 4 PHE B 197 ? ASP B 202 ? PHE B 197 ASP B 202 
H 1 LEU B 140 ? VAL B 141 ? LEU B 140 VAL B 141 
H 2 THR B 242 ? VAL B 246 ? THR B 242 VAL B 246 
H 3 ALA B 221 ? ARG B 227 ? ALA B 221 ARG B 227 
H 4 MET B 163 ? GLN B 168 ? MET B 163 GLN B 168 
H 5 LEU B 174 ? ILE B 180 ? LEU B 174 ILE B 180 
I 1 LEU B 140 ? VAL B 141 ? LEU B 140 VAL B 141 
I 2 THR B 242 ? VAL B 246 ? THR B 242 VAL B 246 
I 3 ALA B 221 ? ARG B 227 ? ALA B 221 ARG B 227 
I 4 TYR B 237 ? TRP B 238 ? TYR B 237 TRP B 238 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 6   ? N LEU A 6   O MET A 44  ? O MET A 44  
A 2 3 N SER A 43  ? N SER A 43  O GLY A 61  ? O GLY A 61  
A 3 4 N VAL A 58  ? N VAL A 58  O PHE A 101 ? O PHE A 101 
A 4 5 N ASN A 102 ? N ASN A 102 O GLU A 113 ? O GLU A 113 
A 5 6 N LEU A 110 ? N LEU A 110 O PHE A 146 ? O PHE A 146 
A 6 7 O GLN A 149 ? O GLN A 149 N THR A 9   ? N THR A 9   
B 1 2 N SER A 17  ? N SER A 17  O LEU A 29  ? O LEU A 29  
B 2 3 N ALA A 28  ? N ALA A 28  O MET A 130 ? O MET A 130 
C 1 2 N VAL A 72  ? N VAL A 72  O THR A 79  ? O THR A 79  
D 1 2 N SER A 123 ? N SER A 123 O PHE A 133 ? O PHE A 133 
E 1 2 N THR B 5   ? N THR B 5   O ARG B 24  ? O ARG B 24  
E 2 3 N ILE B 21  ? N ILE B 21  O LEU B 73  ? O LEU B 73  
E 3 4 O THR B 74  ? O THR B 74  N SER B 63  ? N SER B 63  
F 1 2 N LEU B 11  ? N LEU B 11  O GLU B 105 ? O GLU B 105 
F 2 3 O THR B 102 ? O THR B 102 N TYR B 86  ? N TYR B 86  
F 3 4 O GLN B 89  ? O GLN B 89  N THR B 34  ? N THR B 34  
F 4 5 N TRP B 35  ? N TRP B 35  O ILE B 48  ? O ILE B 48  
F 5 6 N TYR B 49  ? N TYR B 49  O THR B 53  ? O THR B 53  
G 1 2 N SER B 136 ? N SER B 136 O SER B 150 ? O SER B 150 
G 2 3 N LEU B 149 ? N LEU B 149 O LEU B 210 ? O LEU B 210 
G 3 4 O TYR B 209 ? O TYR B 209 N SER B 200 ? N SER B 200 
H 1 2 N VAL B 141 ? N VAL B 141 O THR B 245 ? O THR B 245 
H 2 3 O THR B 242 ? O THR B 242 N TYR B 223 ? N TYR B 223 
H 3 4 O VAL B 222 ? O VAL B 222 N GLN B 168 ? N GLN B 168 
H 4 5 N ARG B 167 ? N ARG B 167 O GLU B 175 ? O GLU B 175 
I 1 2 N VAL B 141 ? N VAL B 141 O THR B 245 ? O THR B 245 
I 2 3 O THR B 242 ? O THR B 242 N TYR B 223 ? N TYR B 223 
I 3 4 N ARG B 227 ? N ARG B 227 O TYR B 237 ? O TYR B 237 
# 
_atom_sites.entry_id                    2KH2 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . ALA A 1 1   ? -6.735  -24.006 10.769  1.00 0.00 ? 1   ALA A N    1  
ATOM 2      C CA   . ALA A 1 1   ? -8.096  -23.471 10.547  1.00 0.00 ? 1   ALA A CA   1  
ATOM 3      C C    . ALA A 1 1   ? -8.715  -24.096 9.304   1.00 0.00 ? 1   ALA A C    1  
ATOM 4      O O    . ALA A 1 1   ? -8.206  -23.918 8.197   1.00 0.00 ? 1   ALA A O    1  
ATOM 5      C CB   . ALA A 1 1   ? -8.053  -21.956 10.411  1.00 0.00 ? 1   ALA A CB   1  
ATOM 6      H H1   . ALA A 1 1   ? -6.773  -25.036 10.902  1.00 0.00 ? 1   ALA A H1   1  
ATOM 7      H H2   . ALA A 1 1   ? -6.313  -23.575 11.614  1.00 0.00 ? 1   ALA A H2   1  
ATOM 8      H H3   . ALA A 1 1   ? -6.133  -23.798 9.948   1.00 0.00 ? 1   ALA A H3   1  
ATOM 9      H HA   . ALA A 1 1   ? -8.712  -23.726 11.409  1.00 0.00 ? 1   ALA A HA   1  
ATOM 10     H HB1  . ALA A 1 1   ? -7.623  -21.523 11.315  1.00 0.00 ? 1   ALA A HB1  1  
ATOM 11     H HB2  . ALA A 1 1   ? -7.440  -21.686 9.552   1.00 0.00 ? 1   ALA A HB2  1  
ATOM 12     H HB3  . ALA A 1 1   ? -9.063  -21.572 10.271  1.00 0.00 ? 1   ALA A HB3  1  
ATOM 13     N N    . PRO A 1 2   ? -9.810  -24.856 9.477   1.00 0.00 ? 2   PRO A N    1  
ATOM 14     C CA   . PRO A 1 2   ? -10.506 -25.512 8.364   1.00 0.00 ? 2   PRO A CA   1  
ATOM 15     C C    . PRO A 1 2   ? -11.104 -24.497 7.392   1.00 0.00 ? 2   PRO A C    1  
ATOM 16     O O    . PRO A 1 2   ? -11.032 -24.666 6.172   1.00 0.00 ? 2   PRO A O    1  
ATOM 17     C CB   . PRO A 1 2   ? -11.618 -26.313 9.051   1.00 0.00 ? 2   PRO A CB   1  
ATOM 18     C CG   . PRO A 1 2   ? -11.796 -25.666 10.384  1.00 0.00 ? 2   PRO A CG   1  
ATOM 19     C CD   . PRO A 1 2   ? -10.447 -25.140 10.775  1.00 0.00 ? 2   PRO A CD   1  
ATOM 20     H HA   . PRO A 1 2   ? -9.831  -26.176 7.825   1.00 0.00 ? 2   PRO A HA   1  
ATOM 21     H HB2  . PRO A 1 2   ? -12.541 -26.304 8.471   1.00 0.00 ? 2   PRO A HB2  1  
ATOM 22     H HB3  . PRO A 1 2   ? -11.269 -27.334 9.205   1.00 0.00 ? 2   PRO A HB3  1  
ATOM 23     H HG2  . PRO A 1 2   ? -12.476 -24.822 10.268  1.00 0.00 ? 2   PRO A HG2  1  
ATOM 24     H HG3  . PRO A 1 2   ? -12.178 -26.371 11.123  1.00 0.00 ? 2   PRO A HG3  1  
ATOM 25     H HD2  . PRO A 1 2   ? -10.534 -24.246 11.392  1.00 0.00 ? 2   PRO A HD2  1  
ATOM 26     H HD3  . PRO A 1 2   ? -9.880  -25.909 11.298  1.00 0.00 ? 2   PRO A HD3  1  
ATOM 27     N N    . VAL A 1 3   ? -11.691 -23.441 7.936   1.00 0.00 ? 3   VAL A N    1  
ATOM 28     C CA   . VAL A 1 3   ? -12.286 -22.398 7.121   1.00 0.00 ? 3   VAL A CA   1  
ATOM 29     C C    . VAL A 1 3   ? -11.671 -21.041 7.458   1.00 0.00 ? 3   VAL A C    1  
ATOM 30     O O    . VAL A 1 3   ? -11.724 -20.583 8.599   1.00 0.00 ? 3   VAL A O    1  
ATOM 31     C CB   . VAL A 1 3   ? -13.829 -22.358 7.239   1.00 0.00 ? 3   VAL A CB   1  
ATOM 32     C CG1  . VAL A 1 3   ? -14.280 -22.282 8.691   1.00 0.00 ? 3   VAL A CG1  1  
ATOM 33     C CG2  . VAL A 1 3   ? -14.414 -21.213 6.424   1.00 0.00 ? 3   VAL A CG2  1  
ATOM 34     H H    . VAL A 1 3   ? -11.717 -23.356 8.915   1.00 0.00 ? 3   VAL A H    1  
ATOM 35     H HA   . VAL A 1 3   ? -12.045 -22.624 6.082   1.00 0.00 ? 3   VAL A HA   1  
ATOM 36     H HB   . VAL A 1 3   ? -14.215 -23.289 6.823   1.00 0.00 ? 3   VAL A HB   1  
ATOM 37     H HG11 . VAL A 1 3   ? -15.369 -22.290 8.746   1.00 0.00 ? 3   VAL A HG11 1  
ATOM 38     H HG12 . VAL A 1 3   ? -13.886 -23.139 9.237   1.00 0.00 ? 3   VAL A HG12 1  
ATOM 39     H HG13 . VAL A 1 3   ? -13.904 -21.362 9.139   1.00 0.00 ? 3   VAL A HG13 1  
ATOM 40     H HG21 . VAL A 1 3   ? -14.116 -21.322 5.381   1.00 0.00 ? 3   VAL A HG21 1  
ATOM 41     H HG22 . VAL A 1 3   ? -15.502 -21.225 6.490   1.00 0.00 ? 3   VAL A HG22 1  
ATOM 42     H HG23 . VAL A 1 3   ? -14.040 -20.265 6.811   1.00 0.00 ? 3   VAL A HG23 1  
ATOM 43     N N    . ARG A 1 4   ? -11.054 -20.424 6.464   1.00 0.00 ? 4   ARG A N    1  
ATOM 44     C CA   . ARG A 1 4   ? -10.423 -19.128 6.648   1.00 0.00 ? 4   ARG A CA   1  
ATOM 45     C C    . ARG A 1 4   ? -11.433 -18.013 6.402   1.00 0.00 ? 4   ARG A C    1  
ATOM 46     O O    . ARG A 1 4   ? -12.372 -18.176 5.616   1.00 0.00 ? 4   ARG A O    1  
ATOM 47     C CB   . ARG A 1 4   ? -9.227  -18.987 5.700   1.00 0.00 ? 4   ARG A CB   1  
ATOM 48     C CG   . ARG A 1 4   ? -8.040  -19.870 6.053   1.00 0.00 ? 4   ARG A CG   1  
ATOM 49     C CD   . ARG A 1 4   ? -7.074  -19.996 4.885   1.00 0.00 ? 4   ARG A CD   1  
ATOM 50     N NE   . ARG A 1 4   ? -7.650  -20.757 3.774   1.00 0.00 ? 4   ARG A NE   1  
ATOM 51     C CZ   . ARG A 1 4   ? -6.949  -21.222 2.740   1.00 0.00 ? 4   ARG A CZ   1  
ATOM 52     N NH1  . ARG A 1 4   ? -5.642  -20.998 2.658   1.00 0.00 ? 4   ARG A NH1  1  
ATOM 53     N NH2  . ARG A 1 4   ? -7.561  -21.913 1.786   1.00 0.00 ? 4   ARG A NH2  1  
ATOM 54     H H    . ARG A 1 4   ? -11.034 -20.843 5.584   1.00 0.00 ? 4   ARG A H    1  
ATOM 55     H HA   . ARG A 1 4   ? -10.066 -19.058 7.675   1.00 0.00 ? 4   ARG A HA   1  
ATOM 56     H HB2  . ARG A 1 4   ? -9.556  -19.243 4.693   1.00 0.00 ? 4   ARG A HB2  1  
ATOM 57     H HB3  . ARG A 1 4   ? -8.896  -17.948 5.721   1.00 0.00 ? 4   ARG A HB3  1  
ATOM 58     H HG2  . ARG A 1 4   ? -7.515  -19.435 6.903   1.00 0.00 ? 4   ARG A HG2  1  
ATOM 59     H HG3  . ARG A 1 4   ? -8.404  -20.863 6.319   1.00 0.00 ? 4   ARG A HG3  1  
ATOM 60     H HD2  . ARG A 1 4   ? -6.815  -18.997 4.532   1.00 0.00 ? 4   ARG A HD2  1  
ATOM 61     H HD3  . ARG A 1 4   ? -6.170  -20.500 5.227   1.00 0.00 ? 4   ARG A HD3  1  
ATOM 62     H HE   . ARG A 1 4   ? -8.613  -20.934 3.808   1.00 0.00 ? 4   ARG A HE   1  
ATOM 63     H HH11 . ARG A 1 4   ? -5.170  -20.473 3.376   1.00 0.00 ? 4   ARG A HH11 1  
ATOM 64     H HH12 . ARG A 1 4   ? -5.113  -21.353 1.876   1.00 0.00 ? 4   ARG A HH12 1  
ATOM 65     H HH21 . ARG A 1 4   ? -8.548  -22.086 1.839   1.00 0.00 ? 4   ARG A HH21 1  
ATOM 66     H HH22 . ARG A 1 4   ? -7.038  -22.275 1.007   1.00 0.00 ? 4   ARG A HH22 1  
ATOM 67     N N    . SER A 1 5   ? -11.240 -16.884 7.066   1.00 0.00 ? 5   SER A N    1  
ATOM 68     C CA   . SER A 1 5   ? -12.143 -15.757 6.916   1.00 0.00 ? 5   SER A CA   1  
ATOM 69     C C    . SER A 1 5   ? -11.422 -14.434 7.108   1.00 0.00 ? 5   SER A C    1  
ATOM 70     O O    . SER A 1 5   ? -10.611 -14.282 8.022   1.00 0.00 ? 5   SER A O    1  
ATOM 71     C CB   . SER A 1 5   ? -13.324 -15.869 7.887   1.00 0.00 ? 5   SER A CB   1  
ATOM 72     O OG   . SER A 1 5   ? -14.249 -16.846 7.439   1.00 0.00 ? 5   SER A OG   1  
ATOM 73     H H    . SER A 1 5   ? -10.470 -16.801 7.670   1.00 0.00 ? 5   SER A H    1  
ATOM 74     H HA   . SER A 1 5   ? -12.536 -15.782 5.900   1.00 0.00 ? 5   SER A HA   1  
ATOM 75     H HB2  . SER A 1 5   ? -12.953 -16.152 8.871   1.00 0.00 ? 5   SER A HB2  1  
ATOM 76     H HB3  . SER A 1 5   ? -13.827 -14.904 7.952   1.00 0.00 ? 5   SER A HB3  1  
ATOM 77     H HG   . SER A 1 5   ? -14.042 -17.076 6.526   1.00 0.00 ? 5   SER A HG   1  
ATOM 78     N N    . LEU A 1 6   ? -11.715 -13.494 6.230   1.00 0.00 ? 6   LEU A N    1  
ATOM 79     C CA   . LEU A 1 6   ? -11.124 -12.168 6.293   1.00 0.00 ? 6   LEU A CA   1  
ATOM 80     C C    . LEU A 1 6   ? -12.231 -11.129 6.398   1.00 0.00 ? 6   LEU A C    1  
ATOM 81     O O    . LEU A 1 6   ? -13.382 -11.415 6.066   1.00 0.00 ? 6   LEU A O    1  
ATOM 82     C CB   . LEU A 1 6   ? -10.233 -11.895 5.077   1.00 0.00 ? 6   LEU A CB   1  
ATOM 83     C CG   . LEU A 1 6   ? -10.455 -12.781 3.845   1.00 0.00 ? 6   LEU A CG   1  
ATOM 84     C CD1  . LEU A 1 6   ? -11.562 -12.225 2.962   1.00 0.00 ? 6   LEU A CD1  1  
ATOM 85     C CD2  . LEU A 1 6   ? -9.163  -12.941 3.057   1.00 0.00 ? 6   LEU A CD2  1  
ATOM 86     H H    . LEU A 1 6   ? -12.370 -13.690 5.524   1.00 0.00 ? 6   LEU A H    1  
ATOM 87     H HA   . LEU A 1 6   ? -10.506 -12.111 7.189   1.00 0.00 ? 6   LEU A HA   1  
ATOM 88     H HB2  . LEU A 1 6   ? -10.397 -10.861 4.774   1.00 0.00 ? 6   LEU A HB2  1  
ATOM 89     H HB3  . LEU A 1 6   ? -9.197  -12.022 5.393   1.00 0.00 ? 6   LEU A HB3  1  
ATOM 90     H HG   . LEU A 1 6   ? -10.764 -13.768 4.190   1.00 0.00 ? 6   LEU A HG   1  
ATOM 91     H HD11 . LEU A 1 6   ? -11.722 -12.882 2.107   1.00 0.00 ? 6   LEU A HD11 1  
ATOM 92     H HD12 . LEU A 1 6   ? -12.484 -12.155 3.540   1.00 0.00 ? 6   LEU A HD12 1  
ATOM 93     H HD13 . LEU A 1 6   ? -11.279 -11.234 2.608   1.00 0.00 ? 6   LEU A HD13 1  
ATOM 94     H HD21 . LEU A 1 6   ? -8.398  -13.375 3.701   1.00 0.00 ? 6   LEU A HD21 1  
ATOM 95     H HD22 . LEU A 1 6   ? -9.329  -13.596 2.202   1.00 0.00 ? 6   LEU A HD22 1  
ATOM 96     H HD23 . LEU A 1 6   ? -8.831  -11.965 2.705   1.00 0.00 ? 6   LEU A HD23 1  
ATOM 97     N N    . ASN A 1 7   ? -11.888 -9.929  6.838   1.00 0.00 ? 7   ASN A N    1  
ATOM 98     C CA   . ASN A 1 7   ? -12.877 -8.873  7.001   1.00 0.00 ? 7   ASN A CA   1  
ATOM 99     C C    . ASN A 1 7   ? -12.590 -7.720  6.057   1.00 0.00 ? 7   ASN A C    1  
ATOM 100    O O    . ASN A 1 7   ? -11.454 -7.249  5.964   1.00 0.00 ? 7   ASN A O    1  
ATOM 101    C CB   . ASN A 1 7   ? -12.898 -8.369  8.445   1.00 0.00 ? 7   ASN A CB   1  
ATOM 102    C CG   . ASN A 1 7   ? -13.340 -9.425  9.438   1.00 0.00 ? 7   ASN A CG   1  
ATOM 103    O OD1  . ASN A 1 7   ? -14.154 -10.290 9.126   1.00 0.00 ? 7   ASN A OD1  1  
ATOM 104    N ND2  . ASN A 1 7   ? -12.815 -9.352  10.648  1.00 0.00 ? 7   ASN A ND2  1  
ATOM 105    H H    . ASN A 1 7   ? -10.946 -9.735  7.029   1.00 0.00 ? 7   ASN A H    1  
ATOM 106    H HA   . ASN A 1 7   ? -13.857 -9.284  6.761   1.00 0.00 ? 7   ASN A HA   1  
ATOM 107    H HB2  . ASN A 1 7   ? -11.895 -8.038  8.712   1.00 0.00 ? 7   ASN A HB2  1  
ATOM 108    H HB3  . ASN A 1 7   ? -13.584 -7.524  8.509   1.00 0.00 ? 7   ASN A HB3  1  
ATOM 109    H HD21 . ASN A 1 7   ? -12.173 -8.617  10.833  1.00 0.00 ? 7   ASN A HD21 1  
ATOM 110    H HD22 . ASN A 1 7   ? -13.078 -10.022 11.308  1.00 0.00 ? 7   ASN A HD22 1  
ATOM 111    N N    . CYS A 1 8   ? -13.618 -7.275  5.353   1.00 0.00 ? 8   CYS A N    1  
ATOM 112    C CA   . CYS A 1 8   ? -13.466 -6.182  4.410   1.00 0.00 ? 8   CYS A CA   1  
ATOM 113    C C    . CYS A 1 8   ? -14.743 -5.355  4.299   1.00 0.00 ? 8   CYS A C    1  
ATOM 114    O O    . CYS A 1 8   ? -15.821 -5.790  4.709   1.00 0.00 ? 8   CYS A O    1  
ATOM 115    C CB   . CYS A 1 8   ? -13.061 -6.725  3.038   1.00 0.00 ? 8   CYS A CB   1  
ATOM 116    S SG   . CYS A 1 8   ? -13.652 -8.399  2.707   1.00 0.00 ? 8   CYS A SG   1  
ATOM 117    H H    . CYS A 1 8   ? -14.503 -7.692  5.469   1.00 0.00 ? 8   CYS A H    1  
ATOM 118    H HA   . CYS A 1 8   ? -12.670 -5.533  4.773   1.00 0.00 ? 8   CYS A HA   1  
ATOM 119    H HB2  . CYS A 1 8   ? -13.466 -6.058  2.277   1.00 0.00 ? 8   CYS A HB2  1  
ATOM 120    H HB3  . CYS A 1 8   ? -11.972 -6.724  2.982   1.00 0.00 ? 8   CYS A HB3  1  
ATOM 121    H HG   . CYS A 1 8   ? -12.830 -9.247  3.308   1.00 0.00 ? 8   CYS A HG   1  
ATOM 122    N N    . THR A 1 9   ? -14.605 -4.152  3.762   1.00 0.00 ? 9   THR A N    1  
ATOM 123    C CA   . THR A 1 9   ? -15.734 -3.260  3.574   1.00 0.00 ? 9   THR A CA   1  
ATOM 124    C C    . THR A 1 9   ? -16.069 -3.176  2.087   1.00 0.00 ? 9   THR A C    1  
ATOM 125    O O    . THR A 1 9   ? -15.205 -3.421  1.241   1.00 0.00 ? 9   THR A O    1  
ATOM 126    C CB   . THR A 1 9   ? -15.416 -1.854  4.112   1.00 0.00 ? 9   THR A CB   1  
ATOM 127    O OG1  . THR A 1 9   ? -14.067 -1.505  3.765   1.00 0.00 ? 9   THR A OG1  1  
ATOM 128    C CG2  . THR A 1 9   ? -15.567 -1.819  5.623   1.00 0.00 ? 9   THR A CG2  1  
ATOM 129    H H    . THR A 1 9   ? -13.715 -3.854  3.479   1.00 0.00 ? 9   THR A H    1  
ATOM 130    H HA   . THR A 1 9   ? -16.592 -3.659  4.115   1.00 0.00 ? 9   THR A HA   1  
ATOM 131    H HB   . THR A 1 9   ? -16.103 -1.135  3.665   1.00 0.00 ? 9   THR A HB   1  
ATOM 132    H HG1  . THR A 1 9   ? -13.491 -1.661  4.523   1.00 0.00 ? 9   THR A HG1  1  
ATOM 133    H HG21 . THR A 1 9   ? -14.879 -2.535  6.073   1.00 0.00 ? 9   THR A HG21 1  
ATOM 134    H HG22 . THR A 1 9   ? -15.340 -0.819  5.992   1.00 0.00 ? 9   THR A HG22 1  
ATOM 135    H HG23 . THR A 1 9   ? -16.590 -2.080  5.891   1.00 0.00 ? 9   THR A HG23 1  
ATOM 136    N N    . LEU A 1 10  ? -17.311 -2.831  1.765   1.00 0.00 ? 10  LEU A N    1  
ATOM 137    C CA   . LEU A 1 10  ? -17.733 -2.740  0.373   1.00 0.00 ? 10  LEU A CA   1  
ATOM 138    C C    . LEU A 1 10  ? -18.238 -1.342  0.036   1.00 0.00 ? 10  LEU A C    1  
ATOM 139    O O    . LEU A 1 10  ? -18.942 -0.718  0.832   1.00 0.00 ? 10  LEU A O    1  
ATOM 140    C CB   . LEU A 1 10  ? -18.834 -3.767  0.081   1.00 0.00 ? 10  LEU A CB   1  
ATOM 141    C CG   . LEU A 1 10  ? -18.558 -5.209  0.518   1.00 0.00 ? 10  LEU A CG   1  
ATOM 142    C CD1  . LEU A 1 10  ? -19.826 -6.043  0.435   1.00 0.00 ? 10  LEU A CD1  1  
ATOM 143    C CD2  . LEU A 1 10  ? -17.451 -5.829  -0.323  1.00 0.00 ? 10  LEU A CD2  1  
ATOM 144    H H    . LEU A 1 10  ? -17.957 -2.631  2.474   1.00 0.00 ? 10  LEU A H    1  
ATOM 145    H HA   . LEU A 1 10  ? -16.872 -2.960  -0.258  1.00 0.00 ? 10  LEU A HA   1  
ATOM 146    H HB2  . LEU A 1 10  ? -19.739 -3.435  0.589   1.00 0.00 ? 10  LEU A HB2  1  
ATOM 147    H HB3  . LEU A 1 10  ? -19.002 -3.775  -0.995  1.00 0.00 ? 10  LEU A HB3  1  
ATOM 148    H HG   . LEU A 1 10  ? -18.227 -5.193  1.557   1.00 0.00 ? 10  LEU A HG   1  
ATOM 149    H HD11 . LEU A 1 10  ? -19.623 -7.059  0.771   1.00 0.00 ? 10  LEU A HD11 1  
ATOM 150    H HD12 . LEU A 1 10  ? -20.594 -5.599  1.069   1.00 0.00 ? 10  LEU A HD12 1  
ATOM 151    H HD13 . LEU A 1 10  ? -20.176 -6.067  -0.597  1.00 0.00 ? 10  LEU A HD13 1  
ATOM 152    H HD21 . LEU A 1 10  ? -16.544 -5.233  -0.225  1.00 0.00 ? 10  LEU A HD21 1  
ATOM 153    H HD22 . LEU A 1 10  ? -17.252 -6.846  0.017   1.00 0.00 ? 10  LEU A HD22 1  
ATOM 154    H HD23 . LEU A 1 10  ? -17.759 -5.852  -1.368  1.00 0.00 ? 10  LEU A HD23 1  
ATOM 155    N N    . ARG A 1 11  ? -17.863 -0.853  -1.141  1.00 0.00 ? 11  ARG A N    1  
ATOM 156    C CA   . ARG A 1 11  ? -18.292 0.461   -1.612  1.00 0.00 ? 11  ARG A CA   1  
ATOM 157    C C    . ARG A 1 11  ? -18.761 0.356   -3.059  1.00 0.00 ? 11  ARG A C    1  
ATOM 158    O O    . ARG A 1 11  ? -18.238 -0.453  -3.821  1.00 0.00 ? 11  ARG A O    1  
ATOM 159    C CB   . ARG A 1 11  ? -17.166 1.495   -1.503  1.00 0.00 ? 11  ARG A CB   1  
ATOM 160    C CG   . ARG A 1 11  ? -16.641 1.724   -0.094  1.00 0.00 ? 11  ARG A CG   1  
ATOM 161    C CD   . ARG A 1 11  ? -15.841 3.018   -0.005  1.00 0.00 ? 11  ARG A CD   1  
ATOM 162    N NE   . ARG A 1 11  ? -15.060 3.271   -1.219  1.00 0.00 ? 11  ARG A NE   1  
ATOM 163    C CZ   . ARG A 1 11  ? -13.730 3.373   -1.253  1.00 0.00 ? 11  ARG A CZ   1  
ATOM 164    N NH1  . ARG A 1 11  ? -13.016 3.271   -0.136  1.00 0.00 ? 11  ARG A NH1  1  
ATOM 165    N NH2  . ARG A 1 11  ? -13.117 3.592   -2.408  1.00 0.00 ? 11  ARG A NH2  1  
ATOM 166    H H    . ARG A 1 11  ? -17.283 -1.395  -1.716  1.00 0.00 ? 11  ARG A H    1  
ATOM 167    H HA   . ARG A 1 11  ? -19.126 0.792   -0.994  1.00 0.00 ? 11  ARG A HA   1  
ATOM 168    H HB2  . ARG A 1 11  ? -16.335 1.158   -2.123  1.00 0.00 ? 11  ARG A HB2  1  
ATOM 169    H HB3  . ARG A 1 11  ? -17.541 2.445   -1.882  1.00 0.00 ? 11  ARG A HB3  1  
ATOM 170    H HG2  . ARG A 1 11  ? -17.484 1.780   0.594   1.00 0.00 ? 11  ARG A HG2  1  
ATOM 171    H HG3  . ARG A 1 11  ? -15.998 0.889   0.186   1.00 0.00 ? 11  ARG A HG3  1  
ATOM 172    H HD2  . ARG A 1 11  ? -16.530 3.848   0.149   1.00 0.00 ? 11  ARG A HD2  1  
ATOM 173    H HD3  . ARG A 1 11  ? -15.161 2.954   0.844   1.00 0.00 ? 11  ARG A HD3  1  
ATOM 174    H HE   . ARG A 1 11  ? -15.562 3.367   -2.060  1.00 0.00 ? 11  ARG A HE   1  
ATOM 175    H HH11 . ARG A 1 11  ? -13.474 3.115   0.741   1.00 0.00 ? 11  ARG A HH11 1  
ATOM 176    H HH12 . ARG A 1 11  ? -12.017 3.353   -0.166  1.00 0.00 ? 11  ARG A HH12 1  
ATOM 177    H HH21 . ARG A 1 11  ? -13.656 3.680   -3.253  1.00 0.00 ? 11  ARG A HH21 1  
ATOM 178    H HH22 . ARG A 1 11  ? -12.112 3.670   -2.448  1.00 0.00 ? 11  ARG A HH22 1  
ATOM 179    N N    . ASP A 1 12  ? -19.749 1.159   -3.423  1.00 0.00 ? 12  ASP A N    1  
ATOM 180    C CA   . ASP A 1 12  ? -20.294 1.140   -4.780  1.00 0.00 ? 12  ASP A CA   1  
ATOM 181    C C    . ASP A 1 12  ? -19.471 1.993   -5.754  1.00 0.00 ? 12  ASP A C    1  
ATOM 182    O O    . ASP A 1 12  ? -18.461 2.595   -5.375  1.00 0.00 ? 12  ASP A O    1  
ATOM 183    C CB   . ASP A 1 12  ? -21.776 1.559   -4.785  1.00 0.00 ? 12  ASP A CB   1  
ATOM 184    C CG   . ASP A 1 12  ? -21.991 3.062   -4.794  1.00 0.00 ? 12  ASP A CG   1  
ATOM 185    O OD1  . ASP A 1 12  ? -21.133 3.793   -4.268  1.00 0.00 ? 12  ASP A OD1  1  
ATOM 186    O OD2  . ASP A 1 12  ? -23.024 3.522   -5.324  1.00 0.00 ? 12  ASP A OD2  1  
ATOM 187    H H    . ASP A 1 12  ? -20.133 1.768   -2.760  1.00 0.00 ? 12  ASP A H    1  
ATOM 188    H HA   . ASP A 1 12  ? -20.243 0.109   -5.130  1.00 0.00 ? 12  ASP A HA   1  
ATOM 189    H HB2  . ASP A 1 12  ? -22.250 1.138   -5.671  1.00 0.00 ? 12  ASP A HB2  1  
ATOM 190    H HB3  . ASP A 1 12  ? -22.252 1.148   -3.894  1.00 0.00 ? 12  ASP A HB3  1  
ATOM 191    H HD2  . ASP A 1 12  ? -23.092 4.479   -5.291  1.00 0.00 ? 12  ASP A HD2  1  
ATOM 192    N N    . SER A 1 13  ? -19.898 2.014   -7.015  1.00 0.00 ? 13  SER A N    1  
ATOM 193    C CA   . SER A 1 13  ? -19.231 2.788   -8.064  1.00 0.00 ? 13  SER A CA   1  
ATOM 194    C C    . SER A 1 13  ? -19.271 4.297   -7.801  1.00 0.00 ? 13  SER A C    1  
ATOM 195    O O    . SER A 1 13  ? -18.578 5.073   -8.464  1.00 0.00 ? 13  SER A O    1  
ATOM 196    C CB   . SER A 1 13  ? -19.870 2.473   -9.413  1.00 0.00 ? 13  SER A CB   1  
ATOM 197    O OG   . SER A 1 13  ? -20.889 1.500   -9.260  1.00 0.00 ? 13  SER A OG   1  
ATOM 198    H H    . SER A 1 13  ? -20.668 1.452   -7.259  1.00 0.00 ? 13  SER A H    1  
ATOM 199    H HA   . SER A 1 13  ? -18.187 2.478   -8.094  1.00 0.00 ? 13  SER A HA   1  
ATOM 200    H HB2  . SER A 1 13  ? -20.303 3.384   -9.827  1.00 0.00 ? 13  SER A HB2  1  
ATOM 201    H HB3  . SER A 1 13  ? -19.108 2.092   -10.092 1.00 0.00 ? 13  SER A HB3  1  
ATOM 202    H HG   . SER A 1 13  ? -20.701 0.735   -9.836  1.00 0.00 ? 13  SER A HG   1  
ATOM 203    N N    . GLN A 1 14  ? -20.070 4.708   -6.824  1.00 0.00 ? 14  GLN A N    1  
ATOM 204    C CA   . GLN A 1 14  ? -20.187 6.115   -6.475  1.00 0.00 ? 14  GLN A CA   1  
ATOM 205    C C    . GLN A 1 14  ? -19.399 6.407   -5.205  1.00 0.00 ? 14  GLN A C    1  
ATOM 206    O O    . GLN A 1 14  ? -19.459 7.511   -4.656  1.00 0.00 ? 14  GLN A O    1  
ATOM 207    C CB   . GLN A 1 14  ? -21.652 6.533   -6.309  1.00 0.00 ? 14  GLN A CB   1  
ATOM 208    C CG   . GLN A 1 14  ? -22.434 6.603   -7.615  1.00 0.00 ? 14  GLN A CG   1  
ATOM 209    C CD   . GLN A 1 14  ? -21.772 7.492   -8.652  1.00 0.00 ? 14  GLN A CD   1  
ATOM 210    O OE1  . GLN A 1 14  ? -21.087 8.460   -8.316  1.00 0.00 ? 14  GLN A OE1  1  
ATOM 211    N NE2  . GLN A 1 14  ? -21.978 7.176   -9.921  1.00 0.00 ? 14  GLN A NE2  1  
ATOM 212    H H    . GLN A 1 14  ? -20.563 4.040   -6.299  1.00 0.00 ? 14  GLN A H    1  
ATOM 213    H HA   . GLN A 1 14  ? -19.758 6.700   -7.289  1.00 0.00 ? 14  GLN A HA   1  
ATOM 214    H HB2  . GLN A 1 14  ? -22.142 5.810   -5.656  1.00 0.00 ? 14  GLN A HB2  1  
ATOM 215    H HB3  . GLN A 1 14  ? -21.677 7.518   -5.843  1.00 0.00 ? 14  GLN A HB3  1  
ATOM 216    H HG2  . GLN A 1 14  ? -22.523 5.596   -8.023  1.00 0.00 ? 14  GLN A HG2  1  
ATOM 217    H HG3  . GLN A 1 14  ? -23.430 6.994   -7.404  1.00 0.00 ? 14  GLN A HG3  1  
ATOM 218    H HE21 . GLN A 1 14  ? -22.544 6.398   -10.120 1.00 0.00 ? 14  GLN A HE21 1  
ATOM 219    H HE22 . GLN A 1 14  ? -21.546 7.723   -10.613 1.00 0.00 ? 14  GLN A HE22 1  
ATOM 220    N N    . GLN A 1 15  ? -18.673 5.390   -4.744  1.00 0.00 ? 15  GLN A N    1  
ATOM 221    C CA   . GLN A 1 15  ? -17.843 5.480   -3.546  1.00 0.00 ? 15  GLN A CA   1  
ATOM 222    C C    . GLN A 1 15  ? -18.684 5.632   -2.281  1.00 0.00 ? 15  GLN A C    1  
ATOM 223    O O    . GLN A 1 15  ? -18.245 6.220   -1.291  1.00 0.00 ? 15  GLN A O    1  
ATOM 224    C CB   . GLN A 1 15  ? -16.763 6.567   -3.662  1.00 0.00 ? 15  GLN A CB   1  
ATOM 225    C CG   . GLN A 1 15  ? -15.832 6.418   -4.867  1.00 0.00 ? 15  GLN A CG   1  
ATOM 226    C CD   . GLN A 1 15  ? -14.880 5.229   -4.773  1.00 0.00 ? 15  GLN A CD   1  
ATOM 227    O OE1  . GLN A 1 15  ? -15.203 4.193   -4.188  1.00 0.00 ? 15  GLN A OE1  1  
ATOM 228    N NE2  . GLN A 1 15  ? -13.689 5.377   -5.342  1.00 0.00 ? 15  GLN A NE2  1  
ATOM 229    H H    . GLN A 1 15  ? -18.717 4.527   -5.210  1.00 0.00 ? 15  GLN A H    1  
ATOM 230    H HA   . GLN A 1 15  ? -17.319 4.528   -3.463  1.00 0.00 ? 15  GLN A HA   1  
ATOM 231    H HB2  . GLN A 1 15  ? -17.261 7.534   -3.736  1.00 0.00 ? 15  GLN A HB2  1  
ATOM 232    H HB3  . GLN A 1 15  ? -16.155 6.539   -2.758  1.00 0.00 ? 15  GLN A HB3  1  
ATOM 233    H HG2  . GLN A 1 15  ? -16.443 6.299   -5.762  1.00 0.00 ? 15  GLN A HG2  1  
ATOM 234    H HG3  . GLN A 1 15  ? -15.238 7.328   -4.957  1.00 0.00 ? 15  GLN A HG3  1  
ATOM 235    H HE21 . GLN A 1 15  ? -13.490 6.233   -5.781  1.00 0.00 ? 15  GLN A HE21 1  
ATOM 236    H HE22 . GLN A 1 15  ? -13.059 4.626   -5.312  1.00 0.00 ? 15  GLN A HE22 1  
ATOM 237    N N    . LYS A 1 16  ? -19.899 5.092   -2.319  1.00 0.00 ? 16  LYS A N    1  
ATOM 238    C CA   . LYS A 1 16  ? -20.793 5.142   -1.170  1.00 0.00 ? 16  LYS A CA   1  
ATOM 239    C C    . LYS A 1 16  ? -20.420 4.029   -0.202  1.00 0.00 ? 16  LYS A C    1  
ATOM 240    O O    . LYS A 1 16  ? -19.756 3.066   -0.582  1.00 0.00 ? 16  LYS A O    1  
ATOM 241    C CB   . LYS A 1 16  ? -22.261 4.993   -1.595  1.00 0.00 ? 16  LYS A CB   1  
ATOM 242    C CG   . LYS A 1 16  ? -22.749 6.047   -2.578  1.00 0.00 ? 16  LYS A CG   1  
ATOM 243    C CD   . LYS A 1 16  ? -24.263 6.223   -2.513  1.00 0.00 ? 16  LYS A CD   1  
ATOM 244    C CE   . LYS A 1 16  ? -25.012 5.020   -3.072  1.00 0.00 ? 16  LYS A CE   1  
ATOM 245    N NZ   . LYS A 1 16  ? -25.035 5.008   -4.560  1.00 0.00 ? 16  LYS A NZ   1  
ATOM 246    H H    . LYS A 1 16  ? -20.200 4.634   -3.145  1.00 0.00 ? 16  LYS A H    1  
ATOM 247    H HA   . LYS A 1 16  ? -20.669 6.104   -0.674  1.00 0.00 ? 16  LYS A HA   1  
ATOM 248    H HB2  . LYS A 1 16  ? -22.382 4.015   -2.059  1.00 0.00 ? 16  LYS A HB2  1  
ATOM 249    H HB3  . LYS A 1 16  ? -22.880 5.051   -0.700  1.00 0.00 ? 16  LYS A HB3  1  
ATOM 250    H HG2  . LYS A 1 16  ? -22.273 6.999   -2.341  1.00 0.00 ? 16  LYS A HG2  1  
ATOM 251    H HG3  . LYS A 1 16  ? -22.471 5.744   -3.587  1.00 0.00 ? 16  LYS A HG3  1  
ATOM 252    H HD2  . LYS A 1 16  ? -24.555 6.364   -1.473  1.00 0.00 ? 16  LYS A HD2  1  
ATOM 253    H HD3  . LYS A 1 16  ? -24.538 7.105   -3.091  1.00 0.00 ? 16  LYS A HD3  1  
ATOM 254    H HE2  . LYS A 1 16  ? -24.527 4.109   -2.721  1.00 0.00 ? 16  LYS A HE2  1  
ATOM 255    H HE3  . LYS A 1 16  ? -26.039 5.044   -2.705  1.00 0.00 ? 16  LYS A HE3  1  
ATOM 256    H HZ1  . LYS A 1 16  ? -24.192 4.504   -4.930  1.00 0.00 ? 16  LYS A HZ1  1  
ATOM 257    H HZ2  . LYS A 1 16  ? -25.038 5.979   -4.929  1.00 0.00 ? 16  LYS A HZ2  1  
ATOM 258    H HZ3  . LYS A 1 16  ? -25.890 4.520   -4.898  1.00 0.00 ? 16  LYS A HZ3  1  
ATOM 259    N N    . SER A 1 17  ? -20.840 4.157   1.040   1.00 0.00 ? 17  SER A N    1  
ATOM 260    C CA   . SER A 1 17  ? -20.534 3.160   2.047   1.00 0.00 ? 17  SER A CA   1  
ATOM 261    C C    . SER A 1 17  ? -21.806 2.489   2.548   1.00 0.00 ? 17  SER A C    1  
ATOM 262    O O    . SER A 1 17  ? -22.877 3.103   2.571   1.00 0.00 ? 17  SER A O    1  
ATOM 263    C CB   . SER A 1 17  ? -19.774 3.808   3.202   1.00 0.00 ? 17  SER A CB   1  
ATOM 264    O OG   . SER A 1 17  ? -18.734 4.633   2.708   1.00 0.00 ? 17  SER A OG   1  
ATOM 265    H H    . SER A 1 17  ? -21.394 4.932   1.288   1.00 0.00 ? 17  SER A H    1  
ATOM 266    H HA   . SER A 1 17  ? -19.897 2.399   1.595   1.00 0.00 ? 17  SER A HA   1  
ATOM 267    H HB2  . SER A 1 17  ? -20.464 4.413   3.791   1.00 0.00 ? 17  SER A HB2  1  
ATOM 268    H HB3  . SER A 1 17  ? -19.345 3.028   3.832   1.00 0.00 ? 17  SER A HB3  1  
ATOM 269    H HG   . SER A 1 17  ? -18.762 4.641   1.748   1.00 0.00 ? 17  SER A HG   1  
ATOM 270    N N    . LEU A 1 18  ? -21.686 1.226   2.924   1.00 0.00 ? 18  LEU A N    1  
ATOM 271    C CA   . LEU A 1 18  ? -22.816 0.465   3.429   1.00 0.00 ? 18  LEU A CA   1  
ATOM 272    C C    . LEU A 1 18  ? -22.941 0.647   4.935   1.00 0.00 ? 18  LEU A C    1  
ATOM 273    O O    . LEU A 1 18  ? -21.994 0.391   5.684   1.00 0.00 ? 18  LEU A O    1  
ATOM 274    C CB   . LEU A 1 18  ? -22.654 -1.019  3.091   1.00 0.00 ? 18  LEU A CB   1  
ATOM 275    C CG   . LEU A 1 18  ? -22.488 -1.363  1.606   1.00 0.00 ? 18  LEU A CG   1  
ATOM 276    C CD1  . LEU A 1 18  ? -22.293 -2.861  1.422   1.00 0.00 ? 18  LEU A CD1  1  
ATOM 277    C CD2  . LEU A 1 18  ? -23.680 -0.873  0.798   1.00 0.00 ? 18  LEU A CD2  1  
ATOM 278    H H    . LEU A 1 18  ? -20.810 0.792   2.864   1.00 0.00 ? 18  LEU A H    1  
ATOM 279    H HA   . LEU A 1 18  ? -23.723 0.837   2.952   1.00 0.00 ? 18  LEU A HA   1  
ATOM 280    H HB2  . LEU A 1 18  ? -21.774 -1.386  3.618   1.00 0.00 ? 18  LEU A HB2  1  
ATOM 281    H HB3  . LEU A 1 18  ? -23.540 -1.541  3.455   1.00 0.00 ? 18  LEU A HB3  1  
ATOM 282    H HG   . LEU A 1 18  ? -21.596 -0.856  1.238   1.00 0.00 ? 18  LEU A HG   1  
ATOM 283    H HD11 . LEU A 1 18  ? -22.151 -3.089  0.365   1.00 0.00 ? 18  LEU A HD11 1  
ATOM 284    H HD12 . LEU A 1 18  ? -21.416 -3.184  1.982   1.00 0.00 ? 18  LEU A HD12 1  
ATOM 285    H HD13 . LEU A 1 18  ? -23.173 -3.389  1.789   1.00 0.00 ? 18  LEU A HD13 1  
ATOM 286    H HD21 . LEU A 1 18  ? -23.781 0.206   0.920   1.00 0.00 ? 18  LEU A HD21 1  
ATOM 287    H HD22 . LEU A 1 18  ? -23.533 -1.104  -0.258  1.00 0.00 ? 18  LEU A HD22 1  
ATOM 288    H HD23 . LEU A 1 18  ? -24.585 -1.365  1.152   1.00 0.00 ? 18  LEU A HD23 1  
ATOM 289    N N    . VAL A 1 19  ? -24.109 1.090   5.368   1.00 0.00 ? 19  VAL A N    1  
ATOM 290    C CA   . VAL A 1 19  ? -24.372 1.315   6.781   1.00 0.00 ? 19  VAL A CA   1  
ATOM 291    C C    . VAL A 1 19  ? -25.649 0.594   7.200   1.00 0.00 ? 19  VAL A C    1  
ATOM 292    O O    . VAL A 1 19  ? -26.568 0.419   6.396   1.00 0.00 ? 19  VAL A O    1  
ATOM 293    C CB   . VAL A 1 19  ? -24.484 2.817   7.129   1.00 0.00 ? 19  VAL A CB   1  
ATOM 294    C CG1  . VAL A 1 19  ? -23.119 3.486   7.072   1.00 0.00 ? 19  VAL A CG1  1  
ATOM 295    C CG2  . VAL A 1 19  ? -25.466 3.522   6.200   1.00 0.00 ? 19  VAL A CG2  1  
ATOM 296    H H    . VAL A 1 19  ? -24.827 1.257   4.715   1.00 0.00 ? 19  VAL A H    1  
ATOM 297    H HA   . VAL A 1 19  ? -23.538 0.898   7.344   1.00 0.00 ? 19  VAL A HA   1  
ATOM 298    H HB   . VAL A 1 19  ? -24.862 2.901   8.148   1.00 0.00 ? 19  VAL A HB   1  
ATOM 299    H HG11 . VAL A 1 19  ? -23.210 4.538   7.345   1.00 0.00 ? 19  VAL A HG11 1  
ATOM 300    H HG12 . VAL A 1 19  ? -22.443 2.990   7.769   1.00 0.00 ? 19  VAL A HG12 1  
ATOM 301    H HG13 . VAL A 1 19  ? -22.719 3.410   6.061   1.00 0.00 ? 19  VAL A HG13 1  
ATOM 302    H HG21 . VAL A 1 19  ? -26.444 3.049   6.281   1.00 0.00 ? 19  VAL A HG21 1  
ATOM 303    H HG22 . VAL A 1 19  ? -25.549 4.573   6.477   1.00 0.00 ? 19  VAL A HG22 1  
ATOM 304    H HG23 . VAL A 1 19  ? -25.110 3.447   5.172   1.00 0.00 ? 19  VAL A HG23 1  
ATOM 305    N N    . MET A 1 20  ? -25.700 0.168   8.452   1.00 0.00 ? 20  MET A N    1  
ATOM 306    C CA   . MET A 1 20  ? -26.863 -0.535  8.966   1.00 0.00 ? 20  MET A CA   1  
ATOM 307    C C    . MET A 1 20  ? -27.953 0.450   9.359   1.00 0.00 ? 20  MET A C    1  
ATOM 308    O O    . MET A 1 20  ? -27.768 1.271   10.259  1.00 0.00 ? 20  MET A O    1  
ATOM 309    C CB   . MET A 1 20  ? -26.494 -1.423  10.158  1.00 0.00 ? 20  MET A CB   1  
ATOM 310    C CG   . MET A 1 20  ? -25.718 -2.676  9.787   1.00 0.00 ? 20  MET A CG   1  
ATOM 311    S SD   . MET A 1 20  ? -26.689 -3.837  8.806   1.00 0.00 ? 20  MET A SD   1  
ATOM 312    C CE   . MET A 1 20  ? -27.902 -4.374  10.011  1.00 0.00 ? 20  MET A CE   1  
ATOM 313    H H    . MET A 1 20  ? -24.940 0.339   9.048   1.00 0.00 ? 20  MET A H    1  
ATOM 314    H HA   . MET A 1 20  ? -27.248 -1.174  8.171   1.00 0.00 ? 20  MET A HA   1  
ATOM 315    H HB2  . MET A 1 20  ? -25.886 -0.836  10.846  1.00 0.00 ? 20  MET A HB2  1  
ATOM 316    H HB3  . MET A 1 20  ? -27.415 -1.727  10.655  1.00 0.00 ? 20  MET A HB3  1  
ATOM 317    H HG2  . MET A 1 20  ? -24.836 -2.388  9.216   1.00 0.00 ? 20  MET A HG2  1  
ATOM 318    H HG3  . MET A 1 20  ? -25.396 -3.174  10.702  1.00 0.00 ? 20  MET A HG3  1  
ATOM 319    H HE1  . MET A 1 20  ? -28.473 -3.513  10.358  1.00 0.00 ? 20  MET A HE1  1  
ATOM 320    H HE2  . MET A 1 20  ? -28.581 -5.098  9.560   1.00 0.00 ? 20  MET A HE2  1  
ATOM 321    H HE3  . MET A 1 20  ? -27.393 -4.837  10.856  1.00 0.00 ? 20  MET A HE3  1  
ATOM 322    N N    . SER A 1 21  ? -29.075 0.373   8.663   1.00 0.00 ? 21  SER A N    1  
ATOM 323    C CA   . SER A 1 21  ? -30.210 1.237   8.936   1.00 0.00 ? 21  SER A CA   1  
ATOM 324    C C    . SER A 1 21  ? -30.938 0.698   10.158  1.00 0.00 ? 21  SER A C    1  
ATOM 325    O O    . SER A 1 21  ? -30.853 1.264   11.249  1.00 0.00 ? 21  SER A O    1  
ATOM 326    C CB   . SER A 1 21  ? -31.137 1.254   7.717   1.00 0.00 ? 21  SER A CB   1  
ATOM 327    O OG   . SER A 1 21  ? -32.305 2.026   7.935   1.00 0.00 ? 21  SER A OG   1  
ATOM 328    H H    . SER A 1 21  ? -29.150 -0.305  7.956   1.00 0.00 ? 21  SER A H    1  
ATOM 329    H HA   . SER A 1 21  ? -29.860 2.250   9.137   1.00 0.00 ? 21  SER A HA   1  
ATOM 330    H HB2  . SER A 1 21  ? -30.595 1.673   6.869   1.00 0.00 ? 21  SER A HB2  1  
ATOM 331    H HB3  . SER A 1 21  ? -31.434 0.230   7.488   1.00 0.00 ? 21  SER A HB3  1  
ATOM 332    H HG   . SER A 1 21  ? -32.934 1.859   7.211   1.00 0.00 ? 21  SER A HG   1  
ATOM 333    N N    . GLY A 1 22  ? -31.645 -0.402  9.968   1.00 0.00 ? 22  GLY A N    1  
ATOM 334    C CA   . GLY A 1 22  ? -32.343 -1.033  11.058  1.00 0.00 ? 22  GLY A CA   1  
ATOM 335    C C    . GLY A 1 22  ? -31.652 -2.330  11.409  1.00 0.00 ? 22  GLY A C    1  
ATOM 336    O O    . GLY A 1 22  ? -30.626 -2.650  10.814  1.00 0.00 ? 22  GLY A O    1  
ATOM 337    H H    . GLY A 1 22  ? -31.702 -0.788  9.071   1.00 0.00 ? 22  GLY A H    1  
ATOM 338    H HA2  . GLY A 1 22  ? -32.340 -0.373  11.925  1.00 0.00 ? 22  GLY A HA2  1  
ATOM 339    H HA3  . GLY A 1 22  ? -33.373 -1.237  10.764  1.00 0.00 ? 22  GLY A HA3  1  
ATOM 340    N N    . PRO A 1 23  ? -32.192 -3.110  12.351  1.00 0.00 ? 23  PRO A N    1  
ATOM 341    C CA   . PRO A 1 23  ? -31.593 -4.386  12.756  1.00 0.00 ? 23  PRO A CA   1  
ATOM 342    C C    . PRO A 1 23  ? -31.444 -5.357  11.585  1.00 0.00 ? 23  PRO A C    1  
ATOM 343    O O    . PRO A 1 23  ? -30.555 -6.204  11.580  1.00 0.00 ? 23  PRO A O    1  
ATOM 344    C CB   . PRO A 1 23  ? -32.584 -4.946  13.790  1.00 0.00 ? 23  PRO A CB   1  
ATOM 345    C CG   . PRO A 1 23  ? -33.842 -4.169  13.593  1.00 0.00 ? 23  PRO A CG   1  
ATOM 346    C CD   . PRO A 1 23  ? -33.418 -2.815  13.103  1.00 0.00 ? 23  PRO A CD   1  
ATOM 347    H HA   . PRO A 1 23  ? -30.617 -4.221  13.212  1.00 0.00 ? 23  PRO A HA   1  
ATOM 348    H HB2  . PRO A 1 23  ? -32.745 -6.015  13.655  1.00 0.00 ? 23  PRO A HB2  1  
ATOM 349    H HB3  . PRO A 1 23  ? -32.201 -4.736  14.788  1.00 0.00 ? 23  PRO A HB3  1  
ATOM 350    H HG2  . PRO A 1 23  ? -34.426 -4.653  12.810  1.00 0.00 ? 23  PRO A HG2  1  
ATOM 351    H HG3  . PRO A 1 23  ? -34.418 -4.098  14.516  1.00 0.00 ? 23  PRO A HG3  1  
ATOM 352    H HD2  . PRO A 1 23  ? -34.185 -2.360  12.476  1.00 0.00 ? 23  PRO A HD2  1  
ATOM 353    H HD3  . PRO A 1 23  ? -33.183 -2.165  13.946  1.00 0.00 ? 23  PRO A HD3  1  
ATOM 354    N N    . TYR A 1 24  ? -32.322 -5.231  10.594  1.00 0.00 ? 24  TYR A N    1  
ATOM 355    C CA   . TYR A 1 24  ? -32.279 -6.101  9.423   1.00 0.00 ? 24  TYR A CA   1  
ATOM 356    C C    . TYR A 1 24  ? -32.389 -5.290  8.134   1.00 0.00 ? 24  TYR A C    1  
ATOM 357    O O    . TYR A 1 24  ? -32.949 -5.752  7.141   1.00 0.00 ? 24  TYR A O    1  
ATOM 358    C CB   . TYR A 1 24  ? -33.401 -7.142  9.488   1.00 0.00 ? 24  TYR A CB   1  
ATOM 359    C CG   . TYR A 1 24  ? -33.379 -7.976  10.751  1.00 0.00 ? 24  TYR A CG   1  
ATOM 360    C CD1  . TYR A 1 24  ? -32.426 -8.970  10.936  1.00 0.00 ? 24  TYR A CD1  1  
ATOM 361    C CD2  . TYR A 1 24  ? -34.307 -7.763  11.764  1.00 0.00 ? 24  TYR A CD2  1  
ATOM 362    C CE1  . TYR A 1 24  ? -32.400 -9.726  12.091  1.00 0.00 ? 24  TYR A CE1  1  
ATOM 363    C CE2  . TYR A 1 24  ? -34.287 -8.520  12.921  1.00 0.00 ? 24  TYR A CE2  1  
ATOM 364    C CZ   . TYR A 1 24  ? -33.332 -9.497  13.078  1.00 0.00 ? 24  TYR A CZ   1  
ATOM 365    O OH   . TYR A 1 24  ? -33.299 -10.243 14.234  1.00 0.00 ? 24  TYR A OH   1  
ATOM 366    H H    . TYR A 1 24  ? -33.024 -4.550  10.657  1.00 0.00 ? 24  TYR A H    1  
ATOM 367    H HA   . TYR A 1 24  ? -31.322 -6.623  9.423   1.00 0.00 ? 24  TYR A HA   1  
ATOM 368    H HB2  . TYR A 1 24  ? -34.359 -6.626  9.429   1.00 0.00 ? 24  TYR A HB2  1  
ATOM 369    H HB3  . TYR A 1 24  ? -33.308 -7.808  8.631   1.00 0.00 ? 24  TYR A HB3  1  
ATOM 370    H HD1  . TYR A 1 24  ? -31.694 -9.154  10.163  1.00 0.00 ? 24  TYR A HD1  1  
ATOM 371    H HD2  . TYR A 1 24  ? -35.056 -6.995  11.644  1.00 0.00 ? 24  TYR A HD2  1  
ATOM 372    H HE1  . TYR A 1 24  ? -31.651 -10.494 12.219  1.00 0.00 ? 24  TYR A HE1  1  
ATOM 373    H HE2  . TYR A 1 24  ? -35.016 -8.343  13.698  1.00 0.00 ? 24  TYR A HE2  1  
ATOM 374    H HH   . TYR A 1 24  ? -32.409 -10.605 14.359  1.00 0.00 ? 24  TYR A HH   1  
ATOM 375    N N    . GLU A 1 25  ? -31.843 -4.079  8.143   1.00 0.00 ? 25  GLU A N    1  
ATOM 376    C CA   . GLU A 1 25  ? -31.897 -3.216  6.966   1.00 0.00 ? 25  GLU A CA   1  
ATOM 377    C C    . GLU A 1 25  ? -30.543 -2.570  6.682   1.00 0.00 ? 25  GLU A C    1  
ATOM 378    O O    . GLU A 1 25  ? -29.885 -2.066  7.587   1.00 0.00 ? 25  GLU A O    1  
ATOM 379    C CB   . GLU A 1 25  ? -32.961 -2.135  7.160   1.00 0.00 ? 25  GLU A CB   1  
ATOM 380    C CG   . GLU A 1 25  ? -33.281 -1.337  5.908   1.00 0.00 ? 25  GLU A CG   1  
ATOM 381    C CD   . GLU A 1 25  ? -34.140 -0.124  6.198   1.00 0.00 ? 25  GLU A CD   1  
ATOM 382    O OE1  . GLU A 1 25  ? -35.232 -0.290  6.773   1.00 0.00 ? 25  GLU A OE1  1  
ATOM 383    O OE2  . GLU A 1 25  ? -33.725 1.001   5.861   1.00 0.00 ? 25  GLU A OE2  1  
ATOM 384    H H    . GLU A 1 25  ? -31.396 -3.759  8.955   1.00 0.00 ? 25  GLU A H    1  
ATOM 385    H HA   . GLU A 1 25  ? -32.174 -3.829  6.108   1.00 0.00 ? 25  GLU A HA   1  
ATOM 386    H HB2  . GLU A 1 25  ? -33.878 -2.617  7.501   1.00 0.00 ? 25  GLU A HB2  1  
ATOM 387    H HB3  . GLU A 1 25  ? -32.608 -1.443  7.924   1.00 0.00 ? 25  GLU A HB3  1  
ATOM 388    H HG2  . GLU A 1 25  ? -32.346 -1.005  5.455   1.00 0.00 ? 25  GLU A HG2  1  
ATOM 389    H HG3  . GLU A 1 25  ? -33.809 -1.982  5.206   1.00 0.00 ? 25  GLU A HG3  1  
ATOM 390    H HE2  . GLU A 1 25  ? -34.321 1.722   6.078   1.00 0.00 ? 25  GLU A HE2  1  
ATOM 391    N N    . LEU A 1 26  ? -30.148 -2.572  5.418   1.00 0.00 ? 26  LEU A N    1  
ATOM 392    C CA   . LEU A 1 26  ? -28.879 -1.989  5.003   1.00 0.00 ? 26  LEU A CA   1  
ATOM 393    C C    . LEU A 1 26  ? -29.113 -0.836  4.033   1.00 0.00 ? 26  LEU A C    1  
ATOM 394    O O    . LEU A 1 26  ? -29.985 -0.916  3.164   1.00 0.00 ? 26  LEU A O    1  
ATOM 395    C CB   . LEU A 1 26  ? -28.005 -3.052  4.331   1.00 0.00 ? 26  LEU A CB   1  
ATOM 396    C CG   . LEU A 1 26  ? -26.954 -3.724  5.215   1.00 0.00 ? 26  LEU A CG   1  
ATOM 397    C CD1  . LEU A 1 26  ? -26.453 -5.001  4.561   1.00 0.00 ? 26  LEU A CD1  1  
ATOM 398    C CD2  . LEU A 1 26  ? -25.796 -2.774  5.481   1.00 0.00 ? 26  LEU A CD2  1  
ATOM 399    H H    . LEU A 1 26  ? -30.733 -2.968  4.739   1.00 0.00 ? 26  LEU A H    1  
ATOM 400    H HA   . LEU A 1 26  ? -28.364 -1.611  5.886   1.00 0.00 ? 26  LEU A HA   1  
ATOM 401    H HB2  . LEU A 1 26  ? -28.664 -3.831  3.949   1.00 0.00 ? 26  LEU A HB2  1  
ATOM 402    H HB3  . LEU A 1 26  ? -27.484 -2.577  3.500   1.00 0.00 ? 26  LEU A HB3  1  
ATOM 403    H HG   . LEU A 1 26  ? -27.417 -3.981  6.168   1.00 0.00 ? 26  LEU A HG   1  
ATOM 404    H HD11 . LEU A 1 26  ? -25.718 -5.482  5.207   1.00 0.00 ? 26  LEU A HD11 1  
ATOM 405    H HD12 . LEU A 1 26  ? -27.291 -5.679  4.400   1.00 0.00 ? 26  LEU A HD12 1  
ATOM 406    H HD13 . LEU A 1 26  ? -25.990 -4.761  3.604   1.00 0.00 ? 26  LEU A HD13 1  
ATOM 407    H HD21 . LEU A 1 26  ? -26.169 -1.874  5.970   1.00 0.00 ? 26  LEU A HD21 1  
ATOM 408    H HD22 . LEU A 1 26  ? -25.063 -3.258  6.127   1.00 0.00 ? 26  LEU A HD22 1  
ATOM 409    H HD23 . LEU A 1 26  ? -25.323 -2.505  4.537   1.00 0.00 ? 26  LEU A HD23 1  
ATOM 410    N N    . LYS A 1 27  ? -28.339 0.230   4.187   1.00 0.00 ? 27  LYS A N    1  
ATOM 411    C CA   . LYS A 1 27  ? -28.455 1.393   3.321   1.00 0.00 ? 27  LYS A CA   1  
ATOM 412    C C    . LYS A 1 27  ? -27.090 1.770   2.766   1.00 0.00 ? 27  LYS A C    1  
ATOM 413    O O    . LYS A 1 27  ? -26.063 1.498   3.388   1.00 0.00 ? 27  LYS A O    1  
ATOM 414    C CB   . LYS A 1 27  ? -29.042 2.589   4.080   1.00 0.00 ? 27  LYS A CB   1  
ATOM 415    C CG   . LYS A 1 27  ? -30.536 2.507   4.350   1.00 0.00 ? 27  LYS A CG   1  
ATOM 416    C CD   . LYS A 1 27  ? -31.094 3.857   4.789   1.00 0.00 ? 27  LYS A CD   1  
ATOM 417    C CE   . LYS A 1 27  ? -30.395 4.373   6.041   1.00 0.00 ? 27  LYS A CE   1  
ATOM 418    N NZ   . LYS A 1 27  ? -30.719 5.797   6.317   1.00 0.00 ? 27  LYS A NZ   1  
ATOM 419    H H    . LYS A 1 27  ? -27.656 0.230   4.896   1.00 0.00 ? 27  LYS A H    1  
ATOM 420    H HA   . LYS A 1 27  ? -29.119 1.142   2.493   1.00 0.00 ? 27  LYS A HA   1  
ATOM 421    H HB2  . LYS A 1 27  ? -28.529 2.666   5.039   1.00 0.00 ? 27  LYS A HB2  1  
ATOM 422    H HB3  . LYS A 1 27  ? -28.852 3.488   3.494   1.00 0.00 ? 27  LYS A HB3  1  
ATOM 423    H HG2  . LYS A 1 27  ? -31.044 2.193   3.438   1.00 0.00 ? 27  LYS A HG2  1  
ATOM 424    H HG3  . LYS A 1 27  ? -30.715 1.775   5.137   1.00 0.00 ? 27  LYS A HG3  1  
ATOM 425    H HD2  . LYS A 1 27  ? -30.953 4.578   3.983   1.00 0.00 ? 27  LYS A HD2  1  
ATOM 426    H HD3  . LYS A 1 27  ? -32.158 3.749   4.998   1.00 0.00 ? 27  LYS A HD3  1  
ATOM 427    H HE2  . LYS A 1 27  ? -30.708 3.769   6.893   1.00 0.00 ? 27  LYS A HE2  1  
ATOM 428    H HE3  . LYS A 1 27  ? -29.318 4.275   5.908   1.00 0.00 ? 27  LYS A HE3  1  
ATOM 429    H HZ1  . LYS A 1 27  ? -30.029 6.196   6.988   1.00 0.00 ? 27  LYS A HZ1  1  
ATOM 430    H HZ2  . LYS A 1 27  ? -31.670 5.879   6.725   1.00 0.00 ? 27  LYS A HZ2  1  
ATOM 431    H HZ3  . LYS A 1 27  ? -30.683 6.350   5.435   1.00 0.00 ? 27  LYS A HZ3  1  
ATOM 432    N N    . ALA A 1 28  ? -27.081 2.390   1.596   1.00 0.00 ? 28  ALA A N    1  
ATOM 433    C CA   . ALA A 1 28  ? -25.844 2.819   0.964   1.00 0.00 ? 28  ALA A CA   1  
ATOM 434    C C    . ALA A 1 28  ? -25.867 4.323   0.754   1.00 0.00 ? 28  ALA A C    1  
ATOM 435    O O    . ALA A 1 28  ? -26.732 4.847   0.049   1.00 0.00 ? 28  ALA A O    1  
ATOM 436    C CB   . ALA A 1 28  ? -25.638 2.099   -0.359  1.00 0.00 ? 28  ALA A CB   1  
ATOM 437    H H    . ALA A 1 28  ? -27.933 2.563   1.139   1.00 0.00 ? 28  ALA A H    1  
ATOM 438    H HA   . ALA A 1 28  ? -25.015 2.571   1.627   1.00 0.00 ? 28  ALA A HA   1  
ATOM 439    H HB1  . ALA A 1 28  ? -24.698 2.416   -0.809  1.00 0.00 ? 28  ALA A HB1  1  
ATOM 440    H HB2  . ALA A 1 28  ? -25.611 1.023   -0.186  1.00 0.00 ? 28  ALA A HB2  1  
ATOM 441    H HB3  . ALA A 1 28  ? -26.461 2.337   -1.033  1.00 0.00 ? 28  ALA A HB3  1  
ATOM 442    N N    . LEU A 1 29  ? -24.926 5.017   1.374   1.00 0.00 ? 29  LEU A N    1  
ATOM 443    C CA   . LEU A 1 29  ? -24.849 6.462   1.257   1.00 0.00 ? 29  LEU A CA   1  
ATOM 444    C C    . LEU A 1 29  ? -23.408 6.942   1.337   1.00 0.00 ? 29  LEU A C    1  
ATOM 445    O O    . LEU A 1 29  ? -22.511 6.188   1.708   1.00 0.00 ? 29  LEU A O    1  
ATOM 446    C CB   . LEU A 1 29  ? -25.718 7.151   2.318   1.00 0.00 ? 29  LEU A CB   1  
ATOM 447    C CG   . LEU A 1 29  ? -25.696 6.549   3.728   1.00 0.00 ? 29  LEU A CG   1  
ATOM 448    C CD1  . LEU A 1 29  ? -24.565 7.138   4.558   1.00 0.00 ? 29  LEU A CD1  1  
ATOM 449    C CD2  . LEU A 1 29  ? -27.034 6.762   4.419   1.00 0.00 ? 29  LEU A CD2  1  
ATOM 450    H H    . LEU A 1 29  ? -24.255 4.546   1.916   1.00 0.00 ? 29  LEU A H    1  
ATOM 451    H HA   . LEU A 1 29  ? -25.239 6.734   0.276   1.00 0.00 ? 29  LEU A HA   1  
ATOM 452    H HB2  . LEU A 1 29  ? -25.384 8.186   2.396   1.00 0.00 ? 29  LEU A HB2  1  
ATOM 453    H HB3  . LEU A 1 29  ? -26.749 7.127   1.965   1.00 0.00 ? 29  LEU A HB3  1  
ATOM 454    H HG   . LEU A 1 29  ? -25.527 5.477   3.637   1.00 0.00 ? 29  LEU A HG   1  
ATOM 455    H HD11 . LEU A 1 29  ? -24.552 6.681   5.547   1.00 0.00 ? 29  LEU A HD11 1  
ATOM 456    H HD12 . LEU A 1 29  ? -23.614 6.946   4.060   1.00 0.00 ? 29  LEU A HD12 1  
ATOM 457    H HD13 . LEU A 1 29  ? -24.711 8.213   4.659   1.00 0.00 ? 29  LEU A HD13 1  
ATOM 458    H HD21 . LEU A 1 29  ? -27.825 6.303   3.826   1.00 0.00 ? 29  LEU A HD21 1  
ATOM 459    H HD22 . LEU A 1 29  ? -27.016 6.306   5.409   1.00 0.00 ? 29  LEU A HD22 1  
ATOM 460    H HD23 . LEU A 1 29  ? -27.226 7.830   4.517   1.00 0.00 ? 29  LEU A HD23 1  
ATOM 461    N N    . HIS A 1 30  ? -23.189 8.191   0.963   1.00 0.00 ? 30  HIS A N    1  
ATOM 462    C CA   . HIS A 1 30  ? -21.858 8.776   0.999   1.00 0.00 ? 30  HIS A CA   1  
ATOM 463    C C    . HIS A 1 30  ? -21.413 9.002   2.438   1.00 0.00 ? 30  HIS A C    1  
ATOM 464    O O    . HIS A 1 30  ? -22.120 9.630   3.228   1.00 0.00 ? 30  HIS A O    1  
ATOM 465    C CB   . HIS A 1 30  ? -21.807 10.081  0.200   1.00 0.00 ? 30  HIS A CB   1  
ATOM 466    C CG   . HIS A 1 30  ? -21.826 9.875   -1.285  1.00 0.00 ? 30  HIS A CG   1  
ATOM 467    N ND1  . HIS A 1 30  ? -22.982 9.647   -2.002  1.00 0.00 ? 30  HIS A ND1  1  
ATOM 468    C CD2  . HIS A 1 30  ? -20.819 9.865   -2.189  1.00 0.00 ? 30  HIS A CD2  1  
ATOM 469    C CE1  . HIS A 1 30  ? -22.684 9.508   -3.281  1.00 0.00 ? 30  HIS A CE1  1  
ATOM 470    N NE2  . HIS A 1 30  ? -21.379 9.635   -3.420  1.00 0.00 ? 30  HIS A NE2  1  
ATOM 471    H H    . HIS A 1 30  ? -23.954 8.731   0.654   1.00 0.00 ? 30  HIS A H    1  
ATOM 472    H HA   . HIS A 1 30  ? -21.169 8.069   0.536   1.00 0.00 ? 30  HIS A HA   1  
ATOM 473    H HB2  . HIS A 1 30  ? -22.666 10.692  0.476   1.00 0.00 ? 30  HIS A HB2  1  
ATOM 474    H HB3  . HIS A 1 30  ? -20.894 10.615  0.464   1.00 0.00 ? 30  HIS A HB3  1  
ATOM 475    H HD1  . HIS A 1 30  ? -23.900 9.583   -1.622  1.00 0.00 ? 30  HIS A HD1  1  
ATOM 476    H HD2  . HIS A 1 30  ? -19.770 10.010  -1.981  1.00 0.00 ? 30  HIS A HD2  1  
ATOM 477    H HE1  . HIS A 1 30  ? -23.390 9.322   -4.077  1.00 0.00 ? 30  HIS A HE1  1  
ATOM 478    H HE2  . HIS A 1 30  ? -20.883 9.502   -4.260  1.00 0.00 ? 30  HIS A HE2  1  
ATOM 479    N N    . LEU A 1 31  ? -20.246 8.474   2.770   1.00 0.00 ? 31  LEU A N    1  
ATOM 480    C CA   . LEU A 1 31  ? -19.697 8.596   4.110   1.00 0.00 ? 31  LEU A CA   1  
ATOM 481    C C    . LEU A 1 31  ? -18.292 9.177   4.032   1.00 0.00 ? 31  LEU A C    1  
ATOM 482    O O    . LEU A 1 31  ? -17.372 8.527   3.539   1.00 0.00 ? 31  LEU A O    1  
ATOM 483    C CB   . LEU A 1 31  ? -19.659 7.218   4.776   1.00 0.00 ? 31  LEU A CB   1  
ATOM 484    C CG   . LEU A 1 31  ? -19.768 7.193   6.300   1.00 0.00 ? 31  LEU A CG   1  
ATOM 485    C CD1  . LEU A 1 31  ? -21.043 7.880   6.758   1.00 0.00 ? 31  LEU A CD1  1  
ATOM 486    C CD2  . LEU A 1 31  ? -19.719 5.760   6.808   1.00 0.00 ? 31  LEU A CD2  1  
ATOM 487    H H    . LEU A 1 31  ? -19.727 7.997   2.090   1.00 0.00 ? 31  LEU A H    1  
ATOM 488    H HA   . LEU A 1 31  ? -20.330 9.261   4.698   1.00 0.00 ? 31  LEU A HA   1  
ATOM 489    H HB2  . LEU A 1 31  ? -20.486 6.634   4.375   1.00 0.00 ? 31  LEU A HB2  1  
ATOM 490    H HB3  . LEU A 1 31  ? -18.715 6.746   4.504   1.00 0.00 ? 31  LEU A HB3  1  
ATOM 491    H HG   . LEU A 1 31  ? -18.918 7.735   6.715   1.00 0.00 ? 31  LEU A HG   1  
ATOM 492    H HD11 . LEU A 1 31  ? -21.098 7.870   7.847   1.00 0.00 ? 31  LEU A HD11 1  
ATOM 493    H HD12 . LEU A 1 31  ? -21.046 8.911   6.405   1.00 0.00 ? 31  LEU A HD12 1  
ATOM 494    H HD13 . LEU A 1 31  ? -21.906 7.354   6.348   1.00 0.00 ? 31  LEU A HD13 1  
ATOM 495    H HD21 . LEU A 1 31  ? -18.785 5.295   6.491   1.00 0.00 ? 31  LEU A HD21 1  
ATOM 496    H HD22 . LEU A 1 31  ? -19.775 5.753   7.896   1.00 0.00 ? 31  LEU A HD22 1  
ATOM 497    H HD23 . LEU A 1 31  ? -20.561 5.201   6.399   1.00 0.00 ? 31  LEU A HD23 1  
ATOM 498    N N    . GLN A 1 32  ? -18.132 10.406  4.499   1.00 0.00 ? 32  GLN A N    1  
ATOM 499    C CA   . GLN A 1 32  ? -16.838 11.071  4.457   1.00 0.00 ? 32  GLN A CA   1  
ATOM 500    C C    . GLN A 1 32  ? -16.523 11.739  5.789   1.00 0.00 ? 32  GLN A C    1  
ATOM 501    O O    . GLN A 1 32  ? -17.092 11.377  6.822   1.00 0.00 ? 32  GLN A O    1  
ATOM 502    C CB   . GLN A 1 32  ? -16.810 12.100  3.325   1.00 0.00 ? 32  GLN A CB   1  
ATOM 503    C CG   . GLN A 1 32  ? -16.875 11.495  1.933   1.00 0.00 ? 32  GLN A CG   1  
ATOM 504    C CD   . GLN A 1 32  ? -17.218 12.518  0.873   1.00 0.00 ? 32  GLN A CD   1  
ATOM 505    O OE1  . GLN A 1 32  ? -18.389 12.749  0.575   1.00 0.00 ? 32  GLN A OE1  1  
ATOM 506    N NE2  . GLN A 1 32  ? -16.206 13.128  0.289   1.00 0.00 ? 32  GLN A NE2  1  
ATOM 507    H H    . GLN A 1 32  ? -18.900 10.874  4.895   1.00 0.00 ? 32  GLN A H    1  
ATOM 508    H HA   . GLN A 1 32  ? -16.075 10.318  4.260   1.00 0.00 ? 32  GLN A HA   1  
ATOM 509    H HB2  . GLN A 1 32  ? -17.664 12.767  3.448   1.00 0.00 ? 32  GLN A HB2  1  
ATOM 510    H HB3  . GLN A 1 32  ? -15.887 12.674  3.407   1.00 0.00 ? 32  GLN A HB3  1  
ATOM 511    H HG2  . GLN A 1 32  ? -15.905 11.057  1.696   1.00 0.00 ? 32  GLN A HG2  1  
ATOM 512    H HG3  . GLN A 1 32  ? -17.634 10.713  1.925   1.00 0.00 ? 32  GLN A HG3  1  
ATOM 513    H HE21 . GLN A 1 32  ? -15.295 12.886  0.566   1.00 0.00 ? 32  GLN A HE21 1  
ATOM 514    H HE22 . GLN A 1 32  ? -16.403 13.807  -0.393  1.00 0.00 ? 32  GLN A HE22 1  
ATOM 515    N N    . GLY A 1 33  ? -15.626 12.723  5.753   1.00 0.00 ? 33  GLY A N    1  
ATOM 516    C CA   . GLY A 1 33  ? -15.236 13.431  6.955   1.00 0.00 ? 33  GLY A CA   1  
ATOM 517    C C    . GLY A 1 33  ? -14.751 12.498  8.040   1.00 0.00 ? 33  GLY A C    1  
ATOM 518    O O    . GLY A 1 33  ? -13.955 11.596  7.788   1.00 0.00 ? 33  GLY A O    1  
ATOM 519    H H    . GLY A 1 33  ? -15.237 12.987  4.895   1.00 0.00 ? 33  GLY A H    1  
ATOM 520    H HA2  . GLY A 1 33  ? -14.434 14.128  6.707   1.00 0.00 ? 33  GLY A HA2  1  
ATOM 521    H HA3  . GLY A 1 33  ? -16.095 13.989  7.329   1.00 0.00 ? 33  GLY A HA3  1  
ATOM 522    N N    . GLN A 1 34  ? -15.253 12.697  9.244   1.00 0.00 ? 34  GLN A N    1  
ATOM 523    C CA   . GLN A 1 34  ? -14.873 11.867  10.371  1.00 0.00 ? 34  GLN A CA   1  
ATOM 524    C C    . GLN A 1 34  ? -15.983 10.879  10.692  1.00 0.00 ? 34  GLN A C    1  
ATOM 525    O O    . GLN A 1 34  ? -16.018 10.290  11.770  1.00 0.00 ? 34  GLN A O    1  
ATOM 526    C CB   . GLN A 1 34  ? -14.553 12.735  11.589  1.00 0.00 ? 34  GLN A CB   1  
ATOM 527    C CG   . GLN A 1 34  ? -13.167 12.491  12.164  1.00 0.00 ? 34  GLN A CG   1  
ATOM 528    C CD   . GLN A 1 34  ? -12.066 12.661  11.134  1.00 0.00 ? 34  GLN A CD   1  
ATOM 529    O OE1  . GLN A 1 34  ? -12.152 13.500  10.236  1.00 0.00 ? 34  GLN A OE1  1  
ATOM 530    N NE2  . GLN A 1 34  ? -11.023 11.859  11.248  1.00 0.00 ? 34  GLN A NE2  1  
ATOM 531    H H    . GLN A 1 34  ? -15.900 13.424  9.378   1.00 0.00 ? 34  GLN A H    1  
ATOM 532    H HA   . GLN A 1 34  ? -13.978 11.308  10.100  1.00 0.00 ? 34  GLN A HA   1  
ATOM 533    H HB2  . GLN A 1 34  ? -14.623 13.782  11.293  1.00 0.00 ? 34  GLN A HB2  1  
ATOM 534    H HB3  . GLN A 1 34  ? -15.289 12.526  12.364  1.00 0.00 ? 34  GLN A HB3  1  
ATOM 535    H HG2  . GLN A 1 34  ? -12.997 13.195  12.978  1.00 0.00 ? 34  GLN A HG2  1  
ATOM 536    H HG3  . GLN A 1 34  ? -13.126 11.474  12.555  1.00 0.00 ? 34  GLN A HG3  1  
ATOM 537    H HE21 . GLN A 1 34  ? -11.019 11.207  11.985  1.00 0.00 ? 34  GLN A HE21 1  
ATOM 538    H HE22 . GLN A 1 34  ? -10.300 11.944  10.596  1.00 0.00 ? 34  GLN A HE22 1  
ATOM 539    N N    . ASP A 1 35  ? -16.893 10.691  9.745   1.00 0.00 ? 35  ASP A N    1  
ATOM 540    C CA   . ASP A 1 35  ? -18.009 9.778   9.930   1.00 0.00 ? 35  ASP A CA   1  
ATOM 541    C C    . ASP A 1 35  ? -17.757 8.471   9.195   1.00 0.00 ? 35  ASP A C    1  
ATOM 542    O O    . ASP A 1 35  ? -18.575 7.556   9.246   1.00 0.00 ? 35  ASP A O    1  
ATOM 543    C CB   . ASP A 1 35  ? -19.312 10.397  9.415   1.00 0.00 ? 35  ASP A CB   1  
ATOM 544    C CG   . ASP A 1 35  ? -19.639 11.729  10.056  1.00 0.00 ? 35  ASP A CG   1  
ATOM 545    O OD1  . ASP A 1 35  ? -19.524 12.765  9.367   1.00 0.00 ? 35  ASP A OD1  1  
ATOM 546    O OD2  . ASP A 1 35  ? -20.011 11.748  11.250  1.00 0.00 ? 35  ASP A OD2  1  
ATOM 547    H H    . ASP A 1 35  ? -16.810 11.178  8.893   1.00 0.00 ? 35  ASP A H    1  
ATOM 548    H HA   . ASP A 1 35  ? -18.112 9.572   10.995  1.00 0.00 ? 35  ASP A HA   1  
ATOM 549    H HB2  . ASP A 1 35  ? -19.226 10.542  8.338   1.00 0.00 ? 35  ASP A HB2  1  
ATOM 550    H HB3  . ASP A 1 35  ? -20.129 9.705   9.619   1.00 0.00 ? 35  ASP A HB3  1  
ATOM 551    H HD2  . ASP A 1 35  ? -20.200 12.626  11.589  1.00 0.00 ? 35  ASP A HD2  1  
ATOM 552    N N    . MET A 1 36  ? -16.600 8.382   8.547   1.00 0.00 ? 36  MET A N    1  
ATOM 553    C CA   . MET A 1 36  ? -16.240 7.200   7.768   1.00 0.00 ? 36  MET A CA   1  
ATOM 554    C C    . MET A 1 36  ? -16.108 5.949   8.635   1.00 0.00 ? 36  MET A C    1  
ATOM 555    O O    . MET A 1 36  ? -16.402 4.842   8.185   1.00 0.00 ? 36  MET A O    1  
ATOM 556    C CB   . MET A 1 36  ? -14.940 7.444   6.995   1.00 0.00 ? 36  MET A CB   1  
ATOM 557    C CG   . MET A 1 36  ? -14.479 6.256   6.165   1.00 0.00 ? 36  MET A CG   1  
ATOM 558    S SD   . MET A 1 36  ? -12.930 6.570   5.296   1.00 0.00 ? 36  MET A SD   1  
ATOM 559    C CE   . MET A 1 36  ? -13.458 7.804   4.110   1.00 0.00 ? 36  MET A CE   1  
ATOM 560    H H    . MET A 1 36  ? -15.962 9.123   8.606   1.00 0.00 ? 36  MET A H    1  
ATOM 561    H HA   . MET A 1 36  ? -17.038 7.026   7.047   1.00 0.00 ? 36  MET A HA   1  
ATOM 562    H HB2  . MET A 1 36  ? -15.094 8.291   6.326   1.00 0.00 ? 36  MET A HB2  1  
ATOM 563    H HB3  . MET A 1 36  ? -14.156 7.685   7.712   1.00 0.00 ? 36  MET A HB3  1  
ATOM 564    H HG2  . MET A 1 36  ? -14.344 5.398   6.823   1.00 0.00 ? 36  MET A HG2  1  
ATOM 565    H HG3  . MET A 1 36  ? -15.250 6.017   5.432   1.00 0.00 ? 36  MET A HG3  1  
ATOM 566    H HE1  . MET A 1 36  ? -13.847 8.673   4.641   1.00 0.00 ? 36  MET A HE1  1  
ATOM 567    H HE2  . MET A 1 36  ? -12.615 8.108   3.490   1.00 0.00 ? 36  MET A HE2  1  
ATOM 568    H HE3  . MET A 1 36  ? -14.240 7.386   3.475   1.00 0.00 ? 36  MET A HE3  1  
ATOM 569    N N    . GLU A 1 37  ? -15.697 6.124   9.886   1.00 0.00 ? 37  GLU A N    1  
ATOM 570    C CA   . GLU A 1 37  ? -15.512 4.993   10.784  1.00 0.00 ? 37  GLU A CA   1  
ATOM 571    C C    . GLU A 1 37  ? -16.818 4.313   11.198  1.00 0.00 ? 37  GLU A C    1  
ATOM 572    O O    . GLU A 1 37  ? -16.805 3.314   11.916  1.00 0.00 ? 37  GLU A O    1  
ATOM 573    C CB   . GLU A 1 37  ? -14.645 5.359   11.985  1.00 0.00 ? 37  GLU A CB   1  
ATOM 574    C CG   . GLU A 1 37  ? -13.165 5.480   11.649  1.00 0.00 ? 37  GLU A CG   1  
ATOM 575    C CD   . GLU A 1 37  ? -12.563 4.174   11.160  1.00 0.00 ? 37  GLU A CD   1  
ATOM 576    O OE1  . GLU A 1 37  ? -12.596 3.915   9.935   1.00 0.00 ? 37  GLU A OE1  1  
ATOM 577    O OE2  . GLU A 1 37  ? -12.048 3.402   11.998  1.00 0.00 ? 37  GLU A OE2  1  
ATOM 578    H H    . GLU A 1 37  ? -15.516 7.033   10.207  1.00 0.00 ? 37  GLU A H    1  
ATOM 579    H HA   . GLU A 1 37  ? -14.951 4.252   10.215  1.00 0.00 ? 37  GLU A HA   1  
ATOM 580    H HB2  . GLU A 1 37  ? -14.988 6.315   12.380  1.00 0.00 ? 37  GLU A HB2  1  
ATOM 581    H HB3  . GLU A 1 37  ? -14.764 4.587   12.745  1.00 0.00 ? 37  GLU A HB3  1  
ATOM 582    H HG2  . GLU A 1 37  ? -13.044 6.233   10.871  1.00 0.00 ? 37  GLU A HG2  1  
ATOM 583    H HG3  . GLU A 1 37  ? -12.629 5.798   12.543  1.00 0.00 ? 37  GLU A HG3  1  
ATOM 584    H HE2  . GLU A 1 37  ? -11.685 2.598   11.620  1.00 0.00 ? 37  GLU A HE2  1  
ATOM 585    N N    . GLN A 1 38  ? -17.945 4.838   10.726  1.00 0.00 ? 38  GLN A N    1  
ATOM 586    C CA   . GLN A 1 38  ? -19.248 4.249   11.026  1.00 0.00 ? 38  GLN A CA   1  
ATOM 587    C C    . GLN A 1 38  ? -19.542 3.133   10.027  1.00 0.00 ? 38  GLN A C    1  
ATOM 588    O O    . GLN A 1 38  ? -20.640 2.573   9.999   1.00 0.00 ? 38  GLN A O    1  
ATOM 589    C CB   . GLN A 1 38  ? -20.356 5.303   10.952  1.00 0.00 ? 38  GLN A CB   1  
ATOM 590    C CG   . GLN A 1 38  ? -20.220 6.440   11.951  1.00 0.00 ? 38  GLN A CG   1  
ATOM 591    C CD   . GLN A 1 38  ? -21.384 7.410   11.883  1.00 0.00 ? 38  GLN A CD   1  
ATOM 592    O OE1  . GLN A 1 38  ? -22.368 7.274   12.611  1.00 0.00 ? 38  GLN A OE1  1  
ATOM 593    N NE2  . GLN A 1 38  ? -21.289 8.385   10.997  1.00 0.00 ? 38  GLN A NE2  1  
ATOM 594    H H    . GLN A 1 38  ? -17.900 5.638   10.158  1.00 0.00 ? 38  GLN A H    1  
ATOM 595    H HA   . GLN A 1 38  ? -19.221 3.834   12.034  1.00 0.00 ? 38  GLN A HA   1  
ATOM 596    H HB2  . GLN A 1 38  ? -20.353 5.730   9.949   1.00 0.00 ? 38  GLN A HB2  1  
ATOM 597    H HB3  . GLN A 1 38  ? -21.310 4.806   11.132  1.00 0.00 ? 38  GLN A HB3  1  
ATOM 598    H HG2  . GLN A 1 38  ? -20.169 6.022   12.956  1.00 0.00 ? 38  GLN A HG2  1  
ATOM 599    H HG3  . GLN A 1 38  ? -19.298 6.983   11.741  1.00 0.00 ? 38  GLN A HG3  1  
ATOM 600    H HE21 . GLN A 1 38  ? -20.483 8.425   10.439  1.00 0.00 ? 38  GLN A HE21 1  
ATOM 601    H HE22 . GLN A 1 38  ? -22.024 9.028   10.932  1.00 0.00 ? 38  GLN A HE22 1  
ATOM 602    N N    . GLN A 1 39  ? -18.545 2.828   9.208   1.00 0.00 ? 39  GLN A N    1  
ATOM 603    C CA   . GLN A 1 39  ? -18.658 1.798   8.187   1.00 0.00 ? 39  GLN A CA   1  
ATOM 604    C C    . GLN A 1 39  ? -18.834 0.405   8.797   1.00 0.00 ? 39  GLN A C    1  
ATOM 605    O O    . GLN A 1 39  ? -18.247 0.085   9.837   1.00 0.00 ? 39  GLN A O    1  
ATOM 606    C CB   . GLN A 1 39  ? -17.429 1.826   7.262   1.00 0.00 ? 39  GLN A CB   1  
ATOM 607    C CG   . GLN A 1 39  ? -16.222 1.032   7.757   1.00 0.00 ? 39  GLN A CG   1  
ATOM 608    C CD   . GLN A 1 39  ? -14.982 1.883   7.969   1.00 0.00 ? 39  GLN A CD   1  
ATOM 609    O OE1  . GLN A 1 39  ? -14.228 2.150   7.032   1.00 0.00 ? 39  GLN A OE1  1  
ATOM 610    N NE2  . GLN A 1 39  ? -14.738 2.280   9.208   1.00 0.00 ? 39  GLN A NE2  1  
ATOM 611    H H    . GLN A 1 39  ? -17.701 3.317   9.294   1.00 0.00 ? 39  GLN A H    1  
ATOM 612    H HA   . GLN A 1 39  ? -19.542 2.019   7.589   1.00 0.00 ? 39  GLN A HA   1  
ATOM 613    H HB2  . GLN A 1 39  ? -17.726 1.419   6.295   1.00 0.00 ? 39  GLN A HB2  1  
ATOM 614    H HB3  . GLN A 1 39  ? -17.123 2.865   7.141   1.00 0.00 ? 39  GLN A HB3  1  
ATOM 615    H HG2  . GLN A 1 39  ? -16.483 0.560   8.704   1.00 0.00 ? 39  GLN A HG2  1  
ATOM 616    H HG3  . GLN A 1 39  ? -15.991 0.260   7.023   1.00 0.00 ? 39  GLN A HG3  1  
ATOM 617    H HE21 . GLN A 1 39  ? -15.360 2.003   9.915   1.00 0.00 ? 39  GLN A HE21 1  
ATOM 618    H HE22 . GLN A 1 39  ? -13.944 2.844   9.371   1.00 0.00 ? 39  GLN A HE22 1  
ATOM 619    N N    . VAL A 1 40  ? -19.656 -0.410  8.146   1.00 0.00 ? 40  VAL A N    1  
ATOM 620    C CA   . VAL A 1 40  ? -19.899 -1.775  8.592   1.00 0.00 ? 40  VAL A CA   1  
ATOM 621    C C    . VAL A 1 40  ? -18.921 -2.704  7.882   1.00 0.00 ? 40  VAL A C    1  
ATOM 622    O O    . VAL A 1 40  ? -18.671 -2.549  6.687   1.00 0.00 ? 40  VAL A O    1  
ATOM 623    C CB   . VAL A 1 40  ? -21.348 -2.219  8.286   1.00 0.00 ? 40  VAL A CB   1  
ATOM 624    C CG1  . VAL A 1 40  ? -21.621 -3.613  8.834   1.00 0.00 ? 40  VAL A CG1  1  
ATOM 625    C CG2  . VAL A 1 40  ? -22.344 -1.222  8.856   1.00 0.00 ? 40  VAL A CG2  1  
ATOM 626    H H    . VAL A 1 40  ? -20.111 -0.086  7.340   1.00 0.00 ? 40  VAL A H    1  
ATOM 627    H HA   . VAL A 1 40  ? -19.734 -1.828  9.668   1.00 0.00 ? 40  VAL A HA   1  
ATOM 628    H HB   . VAL A 1 40  ? -21.474 -2.248  7.203   1.00 0.00 ? 40  VAL A HB   1  
ATOM 629    H HG11 . VAL A 1 40  ? -22.639 -3.915  8.589   1.00 0.00 ? 40  VAL A HG11 1  
ATOM 630    H HG12 . VAL A 1 40  ? -20.919 -4.320  8.393   1.00 0.00 ? 40  VAL A HG12 1  
ATOM 631    H HG13 . VAL A 1 40  ? -21.498 -3.607  9.917   1.00 0.00 ? 40  VAL A HG13 1  
ATOM 632    H HG21 . VAL A 1 40  ? -22.156 -0.237  8.429   1.00 0.00 ? 40  VAL A HG21 1  
ATOM 633    H HG22 . VAL A 1 40  ? -23.360 -1.533  8.612   1.00 0.00 ? 40  VAL A HG22 1  
ATOM 634    H HG23 . VAL A 1 40  ? -22.230 -1.175  9.939   1.00 0.00 ? 40  VAL A HG23 1  
ATOM 635    N N    . VAL A 1 41  ? -18.372 -3.663  8.609   1.00 0.00 ? 41  VAL A N    1  
ATOM 636    C CA   . VAL A 1 41  ? -17.410 -4.589  8.035   1.00 0.00 ? 41  VAL A CA   1  
ATOM 637    C C    . VAL A 1 41  ? -18.035 -5.970  7.893   1.00 0.00 ? 41  VAL A C    1  
ATOM 638    O O    . VAL A 1 41  ? -18.710 -6.451  8.807   1.00 0.00 ? 41  VAL A O    1  
ATOM 639    C CB   . VAL A 1 41  ? -16.130 -4.688  8.896   1.00 0.00 ? 41  VAL A CB   1  
ATOM 640    C CG1  . VAL A 1 41  ? -15.051 -5.473  8.164   1.00 0.00 ? 41  VAL A CG1  1  
ATOM 641    C CG2  . VAL A 1 41  ? -15.618 -3.304  9.276   1.00 0.00 ? 41  VAL A CG2  1  
ATOM 642    H H    . VAL A 1 41  ? -18.650 -3.787  9.543   1.00 0.00 ? 41  VAL A H    1  
ATOM 643    H HA   . VAL A 1 41  ? -17.135 -4.224  7.045   1.00 0.00 ? 41  VAL A HA   1  
ATOM 644    H HB   . VAL A 1 41  ? -16.378 -5.222  9.813   1.00 0.00 ? 41  VAL A HB   1  
ATOM 645    H HG11 . VAL A 1 41  ? -14.164 -5.557  8.793   1.00 0.00 ? 41  VAL A HG11 1  
ATOM 646    H HG12 . VAL A 1 41  ? -15.424 -6.471  7.931   1.00 0.00 ? 41  VAL A HG12 1  
ATOM 647    H HG13 . VAL A 1 41  ? -14.791 -4.958  7.240   1.00 0.00 ? 41  VAL A HG13 1  
ATOM 648    H HG21 . VAL A 1 41  ? -16.393 -2.770  9.826   1.00 0.00 ? 41  VAL A HG21 1  
ATOM 649    H HG22 . VAL A 1 41  ? -14.730 -3.396  9.901   1.00 0.00 ? 41  VAL A HG22 1  
ATOM 650    H HG23 . VAL A 1 41  ? -15.367 -2.749  8.372   1.00 0.00 ? 41  VAL A HG23 1  
ATOM 651    N N    . PHE A 1 42  ? -17.822 -6.598  6.748   1.00 0.00 ? 42  PHE A N    1  
ATOM 652    C CA   . PHE A 1 42  ? -18.370 -7.917  6.488   1.00 0.00 ? 42  PHE A CA   1  
ATOM 653    C C    . PHE A 1 42  ? -17.279 -8.978  6.497   1.00 0.00 ? 42  PHE A C    1  
ATOM 654    O O    . PHE A 1 42  ? -16.165 -8.741  6.026   1.00 0.00 ? 42  PHE A O    1  
ATOM 655    C CB   . PHE A 1 42  ? -19.115 -7.933  5.151   1.00 0.00 ? 42  PHE A CB   1  
ATOM 656    C CG   . PHE A 1 42  ? -20.349 -7.074  5.131   1.00 0.00 ? 42  PHE A CG   1  
ATOM 657    C CD1  . PHE A 1 42  ? -21.575 -7.595  5.505   1.00 0.00 ? 42  PHE A CD1  1  
ATOM 658    C CD2  . PHE A 1 42  ? -20.283 -5.746  4.738   1.00 0.00 ? 42  PHE A CD2  1  
ATOM 659    C CE1  . PHE A 1 42  ? -22.712 -6.812  5.490   1.00 0.00 ? 42  PHE A CE1  1  
ATOM 660    C CE2  . PHE A 1 42  ? -21.415 -4.957  4.721   1.00 0.00 ? 42  PHE A CE2  1  
ATOM 661    C CZ   . PHE A 1 42  ? -22.632 -5.490  5.098   1.00 0.00 ? 42  PHE A CZ   1  
ATOM 662    H H    . PHE A 1 42  ? -17.284 -6.158  6.052   1.00 0.00 ? 42  PHE A H    1  
ATOM 663    H HA   . PHE A 1 42  ? -19.081 -8.149  7.281   1.00 0.00 ? 42  PHE A HA   1  
ATOM 664    H HB2  . PHE A 1 42  ? -18.437 -7.583  4.372   1.00 0.00 ? 42  PHE A HB2  1  
ATOM 665    H HB3  . PHE A 1 42  ? -19.404 -8.960  4.927   1.00 0.00 ? 42  PHE A HB3  1  
ATOM 666    H HD1  . PHE A 1 42  ? -21.644 -8.628  5.813   1.00 0.00 ? 42  PHE A HD1  1  
ATOM 667    H HD2  . PHE A 1 42  ? -19.334 -5.325  4.442   1.00 0.00 ? 42  PHE A HD2  1  
ATOM 668    H HE1  . PHE A 1 42  ? -23.663 -7.232  5.784   1.00 0.00 ? 42  PHE A HE1  1  
ATOM 669    H HE2  . PHE A 1 42  ? -21.349 -3.924  4.413   1.00 0.00 ? 42  PHE A HE2  1  
ATOM 670    H HZ   . PHE A 1 42  ? -23.520 -4.874  5.085   1.00 0.00 ? 42  PHE A HZ   1  
ATOM 671    N N    . SER A 1 43  ? -17.602 -10.135 7.054   1.00 0.00 ? 43  SER A N    1  
ATOM 672    C CA   . SER A 1 43  ? -16.668 -11.241 7.121   1.00 0.00 ? 43  SER A CA   1  
ATOM 673    C C    . SER A 1 43  ? -16.887 -12.185 5.944   1.00 0.00 ? 43  SER A C    1  
ATOM 674    O O    . SER A 1 43  ? -18.009 -12.622 5.690   1.00 0.00 ? 43  SER A O    1  
ATOM 675    C CB   . SER A 1 43  ? -16.856 -11.994 8.437   1.00 0.00 ? 43  SER A CB   1  
ATOM 676    O OG   . SER A 1 43  ? -16.671 -11.128 9.544   1.00 0.00 ? 43  SER A OG   1  
ATOM 677    H H    . SER A 1 43  ? -18.503 -10.250 7.433   1.00 0.00 ? 43  SER A H    1  
ATOM 678    H HA   . SER A 1 43  ? -15.652 -10.848 7.077   1.00 0.00 ? 43  SER A HA   1  
ATOM 679    H HB2  . SER A 1 43  ? -17.864 -12.408 8.472   1.00 0.00 ? 43  SER A HB2  1  
ATOM 680    H HB3  . SER A 1 43  ? -16.129 -12.804 8.493   1.00 0.00 ? 43  SER A HB3  1  
ATOM 681    H HG   . SER A 1 43  ? -15.807 -10.700 9.468   1.00 0.00 ? 43  SER A HG   1  
ATOM 682    N N    . MET A 1 44  ? -15.817 -12.481 5.223   1.00 0.00 ? 44  MET A N    1  
ATOM 683    C CA   . MET A 1 44  ? -15.891 -13.371 4.072   1.00 0.00 ? 44  MET A CA   1  
ATOM 684    C C    . MET A 1 44  ? -15.322 -14.741 4.411   1.00 0.00 ? 44  MET A C    1  
ATOM 685    O O    . MET A 1 44  ? -14.125 -14.880 4.672   1.00 0.00 ? 44  MET A O    1  
ATOM 686    C CB   . MET A 1 44  ? -15.139 -12.789 2.874   1.00 0.00 ? 44  MET A CB   1  
ATOM 687    C CG   . MET A 1 44  ? -15.828 -11.614 2.197   1.00 0.00 ? 44  MET A CG   1  
ATOM 688    S SD   . MET A 1 44  ? -15.133 -11.265 0.567   1.00 0.00 ? 44  MET A SD   1  
ATOM 689    C CE   . MET A 1 44  ? -15.894 -9.686  0.201   1.00 0.00 ? 44  MET A CE   1  
ATOM 690    H H    . MET A 1 44  ? -14.947 -12.096 5.478   1.00 0.00 ? 44  MET A H    1  
ATOM 691    H HA   . MET A 1 44  ? -16.940 -13.486 3.800   1.00 0.00 ? 44  MET A HA   1  
ATOM 692    H HB2  . MET A 1 44  ? -14.160 -12.456 3.217   1.00 0.00 ? 44  MET A HB2  1  
ATOM 693    H HB3  . MET A 1 44  ? -15.015 -13.580 2.135   1.00 0.00 ? 44  MET A HB3  1  
ATOM 694    H HG2  . MET A 1 44  ? -16.889 -11.839 2.087   1.00 0.00 ? 44  MET A HG2  1  
ATOM 695    H HG3  . MET A 1 44  ? -15.720 -10.729 2.824   1.00 0.00 ? 44  MET A HG3  1  
ATOM 696    H HE1  . MET A 1 44  ? -15.607 -8.960  0.962   1.00 0.00 ? 44  MET A HE1  1  
ATOM 697    H HE2  . MET A 1 44  ? -15.566 -9.332  -0.776  1.00 0.00 ? 44  MET A HE2  1  
ATOM 698    H HE3  . MET A 1 44  ? -16.978 -9.799  0.197   1.00 0.00 ? 44  MET A HE3  1  
ATOM 699    N N    . SER A 1 45  ? -16.185 -15.740 4.419   1.00 0.00 ? 45  SER A N    1  
ATOM 700    C CA   . SER A 1 45  ? -15.775 -17.100 4.717   1.00 0.00 ? 45  SER A CA   1  
ATOM 701    C C    . SER A 1 45  ? -15.599 -17.908 3.437   1.00 0.00 ? 45  SER A C    1  
ATOM 702    O O    . SER A 1 45  ? -16.400 -17.789 2.507   1.00 0.00 ? 45  SER A O    1  
ATOM 703    C CB   . SER A 1 45  ? -16.807 -17.768 5.625   1.00 0.00 ? 45  SER A CB   1  
ATOM 704    O OG   . SER A 1 45  ? -17.089 -16.950 6.746   1.00 0.00 ? 45  SER A OG   1  
ATOM 705    H H    . SER A 1 45  ? -17.126 -15.556 4.229   1.00 0.00 ? 45  SER A H    1  
ATOM 706    H HA   . SER A 1 45  ? -14.819 -17.064 5.240   1.00 0.00 ? 45  SER A HA   1  
ATOM 707    H HB2  . SER A 1 45  ? -17.726 -17.934 5.062   1.00 0.00 ? 45  SER A HB2  1  
ATOM 708    H HB3  . SER A 1 45  ? -16.414 -18.725 5.970   1.00 0.00 ? 45  SER A HB3  1  
ATOM 709    H HG   . SER A 1 45  ? -16.268 -16.759 7.220   1.00 0.00 ? 45  SER A HG   1  
ATOM 710    N N    . PHE A 1 46  ? -14.557 -18.732 3.396   1.00 0.00 ? 46  PHE A N    1  
ATOM 711    C CA   . PHE A 1 46  ? -14.287 -19.567 2.229   1.00 0.00 ? 46  PHE A CA   1  
ATOM 712    C C    . PHE A 1 46  ? -15.178 -20.806 2.259   1.00 0.00 ? 46  PHE A C    1  
ATOM 713    O O    . PHE A 1 46  ? -14.758 -21.889 2.688   1.00 0.00 ? 46  PHE A O    1  
ATOM 714    C CB   . PHE A 1 46  ? -12.806 -19.962 2.165   1.00 0.00 ? 46  PHE A CB   1  
ATOM 715    C CG   . PHE A 1 46  ? -11.881 -18.818 1.845   1.00 0.00 ? 46  PHE A CG   1  
ATOM 716    C CD1  . PHE A 1 46  ? -11.955 -18.167 0.625   1.00 0.00 ? 46  PHE A CD1  1  
ATOM 717    C CD2  . PHE A 1 46  ? -10.936 -18.393 2.767   1.00 0.00 ? 46  PHE A CD2  1  
ATOM 718    C CE1  . PHE A 1 46  ? -11.106 -17.115 0.331   1.00 0.00 ? 46  PHE A CE1  1  
ATOM 719    C CE2  . PHE A 1 46  ? -10.085 -17.343 2.480   1.00 0.00 ? 46  PHE A CE2  1  
ATOM 720    C CZ   . PHE A 1 46  ? -10.170 -16.703 1.259   1.00 0.00 ? 46  PHE A CZ   1  
ATOM 721    H H    . PHE A 1 46  ? -13.975 -18.805 4.182   1.00 0.00 ? 46  PHE A H    1  
ATOM 722    H HA   . PHE A 1 46  ? -14.525 -18.990 1.335   1.00 0.00 ? 46  PHE A HA   1  
ATOM 723    H HB2  . PHE A 1 46  ? -12.518 -20.381 3.129   1.00 0.00 ? 46  PHE A HB2  1  
ATOM 724    H HB3  . PHE A 1 46  ? -12.685 -20.729 1.400   1.00 0.00 ? 46  PHE A HB3  1  
ATOM 725    H HD1  . PHE A 1 46  ? -12.684 -18.484 -0.106  1.00 0.00 ? 46  PHE A HD1  1  
ATOM 726    H HD2  . PHE A 1 46  ? -10.865 -18.890 3.723   1.00 0.00 ? 46  PHE A HD2  1  
ATOM 727    H HE1  . PHE A 1 46  ? -11.175 -16.617 -0.625  1.00 0.00 ? 46  PHE A HE1  1  
ATOM 728    H HE2  . PHE A 1 46  ? -9.355  -17.023 3.209   1.00 0.00 ? 46  PHE A HE2  1  
ATOM 729    H HZ   . PHE A 1 46  ? -9.508  -15.881 1.032   1.00 0.00 ? 46  PHE A HZ   1  
ATOM 730    N N    . VAL A 1 47  ? -16.411 -20.627 1.809   1.00 0.00 ? 47  VAL A N    1  
ATOM 731    C CA   . VAL A 1 47  ? -17.402 -21.695 1.794   1.00 0.00 ? 47  VAL A CA   1  
ATOM 732    C C    . VAL A 1 47  ? -17.199 -22.665 0.629   1.00 0.00 ? 47  VAL A C    1  
ATOM 733    O O    . VAL A 1 47  ? -16.109 -22.760 0.062   1.00 0.00 ? 47  VAL A O    1  
ATOM 734    C CB   . VAL A 1 47  ? -18.838 -21.122 1.762   1.00 0.00 ? 47  VAL A CB   1  
ATOM 735    C CG1  . VAL A 1 47  ? -19.113 -20.320 3.024   1.00 0.00 ? 47  VAL A CG1  1  
ATOM 736    C CG2  . VAL A 1 47  ? -19.056 -20.260 0.528   1.00 0.00 ? 47  VAL A CG2  1  
ATOM 737    H H    . VAL A 1 47  ? -16.665 -19.742 1.468   1.00 0.00 ? 47  VAL A H    1  
ATOM 738    H HA   . VAL A 1 47  ? -17.285 -22.258 2.720   1.00 0.00 ? 47  VAL A HA   1  
ATOM 739    H HB   . VAL A 1 47  ? -19.538 -21.956 1.724   1.00 0.00 ? 47  VAL A HB   1  
ATOM 740    H HG11 . VAL A 1 47  ? -20.134 -19.940 3.003   1.00 0.00 ? 47  VAL A HG11 1  
ATOM 741    H HG12 . VAL A 1 47  ? -18.983 -20.960 3.896   1.00 0.00 ? 47  VAL A HG12 1  
ATOM 742    H HG13 . VAL A 1 47  ? -18.417 -19.483 3.081   1.00 0.00 ? 47  VAL A HG13 1  
ATOM 743    H HG21 . VAL A 1 47  ? -18.881 -20.857 -0.367  1.00 0.00 ? 47  VAL A HG21 1  
ATOM 744    H HG22 . VAL A 1 47  ? -20.078 -19.882 0.515   1.00 0.00 ? 47  VAL A HG22 1  
ATOM 745    H HG23 . VAL A 1 47  ? -18.361 -19.420 0.545   1.00 0.00 ? 47  VAL A HG23 1  
ATOM 746    N N    . GLN A 1 48  ? -18.250 -23.404 0.300   1.00 0.00 ? 48  GLN A N    1  
ATOM 747    C CA   . GLN A 1 48  ? -18.205 -24.365 -0.787  1.00 0.00 ? 48  GLN A CA   1  
ATOM 748    C C    . GLN A 1 48  ? -19.272 -24.025 -1.818  1.00 0.00 ? 48  GLN A C    1  
ATOM 749    O O    . GLN A 1 48  ? -20.397 -23.663 -1.462  1.00 0.00 ? 48  GLN A O    1  
ATOM 750    C CB   . GLN A 1 48  ? -18.424 -25.781 -0.246  1.00 0.00 ? 48  GLN A CB   1  
ATOM 751    C CG   . GLN A 1 48  ? -17.403 -26.802 -0.725  1.00 0.00 ? 48  GLN A CG   1  
ATOM 752    C CD   . GLN A 1 48  ? -15.973 -26.331 -0.548  1.00 0.00 ? 48  GLN A CD   1  
ATOM 753    O OE1  . GLN A 1 48  ? -15.395 -26.448 0.532   1.00 0.00 ? 48  GLN A OE1  1  
ATOM 754    N NE2  . GLN A 1 48  ? -15.381 -25.819 -1.615  1.00 0.00 ? 48  GLN A NE2  1  
ATOM 755    H H    . GLN A 1 48  ? -19.085 -23.296 0.803   1.00 0.00 ? 48  GLN A H    1  
ATOM 756    H HA   . GLN A 1 48  ? -17.224 -24.315 -1.260  1.00 0.00 ? 48  GLN A HA   1  
ATOM 757    H HB2  . GLN A 1 48  ? -18.379 -25.741 0.843   1.00 0.00 ? 48  GLN A HB2  1  
ATOM 758    H HB3  . GLN A 1 48  ? -19.413 -26.116 -0.557  1.00 0.00 ? 48  GLN A HB3  1  
ATOM 759    H HG2  . GLN A 1 48  ? -17.540 -27.725 -0.161  1.00 0.00 ? 48  GLN A HG2  1  
ATOM 760    H HG3  . GLN A 1 48  ? -17.578 -27.000 -1.783  1.00 0.00 ? 48  GLN A HG3  1  
ATOM 761    H HE21 . GLN A 1 48  ? -15.890 -25.778 -2.455  1.00 0.00 ? 48  GLN A HE21 1  
ATOM 762    H HE22 . GLN A 1 48  ? -14.462 -25.490 -1.523  1.00 0.00 ? 48  GLN A HE22 1  
ATOM 763    N N    . GLY A 1 49  ? -18.913 -24.135 -3.089  1.00 0.00 ? 49  GLY A N    1  
ATOM 764    C CA   . GLY A 1 49  ? -19.839 -23.831 -4.159  1.00 0.00 ? 49  GLY A CA   1  
ATOM 765    C C    . GLY A 1 49  ? -19.112 -23.676 -5.477  1.00 0.00 ? 49  GLY A C    1  
ATOM 766    O O    . GLY A 1 49  ? -18.079 -24.311 -5.692  1.00 0.00 ? 49  GLY A O    1  
ATOM 767    H H    . GLY A 1 49  ? -18.005 -24.433 -3.308  1.00 0.00 ? 49  GLY A H    1  
ATOM 768    H HA2  . GLY A 1 49  ? -20.564 -24.640 -4.244  1.00 0.00 ? 49  GLY A HA2  1  
ATOM 769    H HA3  . GLY A 1 49  ? -20.361 -22.902 -3.927  1.00 0.00 ? 49  GLY A HA3  1  
ATOM 770    N N    . GLU A 1 50  ? -19.639 -22.835 -6.353  1.00 0.00 ? 50  GLU A N    1  
ATOM 771    C CA   . GLU A 1 50  ? -19.025 -22.604 -7.654  1.00 0.00 ? 50  GLU A CA   1  
ATOM 772    C C    . GLU A 1 50  ? -17.748 -21.780 -7.516  1.00 0.00 ? 50  GLU A C    1  
ATOM 773    O O    . GLU A 1 50  ? -17.801 -20.580 -7.243  1.00 0.00 ? 50  GLU A O    1  
ATOM 774    C CB   . GLU A 1 50  ? -20.008 -21.895 -8.588  1.00 0.00 ? 50  GLU A CB   1  
ATOM 775    C CG   . GLU A 1 50  ? -19.652 -22.017 -10.058 1.00 0.00 ? 50  GLU A CG   1  
ATOM 776    C CD   . GLU A 1 50  ? -19.652 -23.457 -10.526 1.00 0.00 ? 50  GLU A CD   1  
ATOM 777    O OE1  . GLU A 1 50  ? -20.700 -23.922 -11.018 1.00 0.00 ? 50  GLU A OE1  1  
ATOM 778    O OE2  . GLU A 1 50  ? -18.609 -24.132 -10.392 1.00 0.00 ? 50  GLU A OE2  1  
ATOM 779    H H    . GLU A 1 50  ? -20.463 -22.359 -6.124  1.00 0.00 ? 50  GLU A H    1  
ATOM 780    H HA   . GLU A 1 50  ? -18.769 -23.571 -8.087  1.00 0.00 ? 50  GLU A HA   1  
ATOM 781    H HB2  . GLU A 1 50  ? -20.997 -22.326 -8.437  1.00 0.00 ? 50  GLU A HB2  1  
ATOM 782    H HB3  . GLU A 1 50  ? -20.029 -20.837 -8.326  1.00 0.00 ? 50  GLU A HB3  1  
ATOM 783    H HG2  . GLU A 1 50  ? -20.379 -21.455 -10.645 1.00 0.00 ? 50  GLU A HG2  1  
ATOM 784    H HG3  . GLU A 1 50  ? -18.659 -21.595 -10.218 1.00 0.00 ? 50  GLU A HG3  1  
ATOM 785    H HE2  . GLU A 1 50  ? -18.683 -25.036 -10.707 1.00 0.00 ? 50  GLU A HE2  1  
ATOM 786    N N    . GLU A 1 51  ? -16.606 -22.427 -7.706  1.00 0.00 ? 51  GLU A N    1  
ATOM 787    C CA   . GLU A 1 51  ? -15.320 -21.754 -7.597  1.00 0.00 ? 51  GLU A CA   1  
ATOM 788    C C    . GLU A 1 51  ? -14.619 -21.673 -8.951  1.00 0.00 ? 51  GLU A C    1  
ATOM 789    O O    . GLU A 1 51  ? -14.731 -22.581 -9.777  1.00 0.00 ? 51  GLU A O    1  
ATOM 790    C CB   . GLU A 1 51  ? -14.425 -22.476 -6.587  1.00 0.00 ? 51  GLU A CB   1  
ATOM 791    C CG   . GLU A 1 51  ? -13.103 -21.774 -6.321  1.00 0.00 ? 51  GLU A CG   1  
ATOM 792    C CD   . GLU A 1 51  ? -12.154 -22.605 -5.487  1.00 0.00 ? 51  GLU A CD   1  
ATOM 793    O OE1  . GLU A 1 51  ? -11.645 -23.627 -5.996  1.00 0.00 ? 51  GLU A OE1  1  
ATOM 794    O OE2  . GLU A 1 51  ? -11.897 -22.233 -4.325  1.00 0.00 ? 51  GLU A OE2  1  
ATOM 795    H H    . GLU A 1 51  ? -16.630 -23.381 -7.934  1.00 0.00 ? 51  GLU A H    1  
ATOM 796    H HA   . GLU A 1 51  ? -15.498 -20.740 -7.239  1.00 0.00 ? 51  GLU A HA   1  
ATOM 797    H HB2  . GLU A 1 51  ? -14.966 -22.556 -5.644  1.00 0.00 ? 51  GLU A HB2  1  
ATOM 798    H HB3  . GLU A 1 51  ? -14.211 -23.475 -6.969  1.00 0.00 ? 51  GLU A HB3  1  
ATOM 799    H HG2  . GLU A 1 51  ? -12.627 -21.552 -7.276  1.00 0.00 ? 51  GLU A HG2  1  
ATOM 800    H HG3  . GLU A 1 51  ? -13.303 -20.840 -5.795  1.00 0.00 ? 51  GLU A HG3  1  
ATOM 801    H HE2  . GLU A 1 51  ? -11.284 -22.805 -3.856  1.00 0.00 ? 51  GLU A HE2  1  
ATOM 802    N N    . SER A 1 52  ? -13.903 -20.580 -9.167  1.00 0.00 ? 52  SER A N    1  
ATOM 803    C CA   . SER A 1 52  ? -13.163 -20.360 -10.399 1.00 0.00 ? 52  SER A CA   1  
ATOM 804    C C    . SER A 1 52  ? -12.065 -19.334 -10.147 1.00 0.00 ? 52  SER A C    1  
ATOM 805    O O    . SER A 1 52  ? -11.838 -18.934 -9.004  1.00 0.00 ? 52  SER A O    1  
ATOM 806    C CB   . SER A 1 52  ? -14.104 -19.881 -11.507 1.00 0.00 ? 52  SER A CB   1  
ATOM 807    O OG   . SER A 1 52  ? -15.017 -18.919 -11.014 1.00 0.00 ? 52  SER A OG   1  
ATOM 808    H H    . SER A 1 52  ? -13.865 -19.889 -8.468  1.00 0.00 ? 52  SER A H    1  
ATOM 809    H HA   . SER A 1 52  ? -12.707 -21.301 -10.708 1.00 0.00 ? 52  SER A HA   1  
ATOM 810    H HB2  . SER A 1 52  ? -13.514 -19.435 -12.308 1.00 0.00 ? 52  SER A HB2  1  
ATOM 811    H HB3  . SER A 1 52  ? -14.660 -20.733 -11.897 1.00 0.00 ? 52  SER A HB3  1  
ATOM 812    H HG   . SER A 1 52  ? -15.087 -19.012 -10.053 1.00 0.00 ? 52  SER A HG   1  
ATOM 813    N N    . ASN A 1 53  ? -11.395 -18.900 -11.202 1.00 0.00 ? 53  ASN A N    1  
ATOM 814    C CA   . ASN A 1 53  ? -10.326 -17.919 -11.065 1.00 0.00 ? 53  ASN A CA   1  
ATOM 815    C C    . ASN A 1 53  ? -10.893 -16.506 -10.976 1.00 0.00 ? 53  ASN A C    1  
ATOM 816    O O    . ASN A 1 53  ? -10.253 -15.591 -10.451 1.00 0.00 ? 53  ASN A O    1  
ATOM 817    C CB   . ASN A 1 53  ? -9.364  -18.024 -12.247 1.00 0.00 ? 53  ASN A CB   1  
ATOM 818    C CG   . ASN A 1 53  ? -7.929  -17.727 -11.861 1.00 0.00 ? 53  ASN A CG   1  
ATOM 819    O OD1  . ASN A 1 53  ? -7.480  -16.582 -11.909 1.00 0.00 ? 53  ASN A OD1  1  
ATOM 820    N ND2  . ASN A 1 53  ? -7.193  -18.762 -11.488 1.00 0.00 ? 53  ASN A ND2  1  
ATOM 821    H H    . ASN A 1 53  ? -11.613 -19.253 -12.092 1.00 0.00 ? 53  ASN A H    1  
ATOM 822    H HA   . ASN A 1 53  ? -9.777  -18.133 -10.147 1.00 0.00 ? 53  ASN A HA   1  
ATOM 823    H HB2  . ASN A 1 53  ? -9.416  -19.034 -12.652 1.00 0.00 ? 53  ASN A HB2  1  
ATOM 824    H HB3  . ASN A 1 53  ? -9.673  -17.313 -13.014 1.00 0.00 ? 53  ASN A HB3  1  
ATOM 825    H HD21 . ASN A 1 53  ? -7.610  -19.651 -11.481 1.00 0.00 ? 53  ASN A HD21 1  
ATOM 826    H HD22 . ASN A 1 53  ? -6.257  -18.603 -11.241 1.00 0.00 ? 53  ASN A HD22 1  
ATOM 827    N N    . ASP A 1 54  ? -12.105 -16.336 -11.484 1.00 0.00 ? 54  ASP A N    1  
ATOM 828    C CA   . ASP A 1 54  ? -12.765 -15.038 -11.473 1.00 0.00 ? 54  ASP A CA   1  
ATOM 829    C C    . ASP A 1 54  ? -13.857 -14.976 -10.413 1.00 0.00 ? 54  ASP A C    1  
ATOM 830    O O    . ASP A 1 54  ? -14.007 -13.967 -9.731  1.00 0.00 ? 54  ASP A O    1  
ATOM 831    C CB   . ASP A 1 54  ? -13.330 -14.688 -12.854 1.00 0.00 ? 54  ASP A CB   1  
ATOM 832    C CG   . ASP A 1 54  ? -14.407 -15.649 -13.324 1.00 0.00 ? 54  ASP A CG   1  
ATOM 833    O OD1  . ASP A 1 54  ? -14.062 -16.730 -13.842 1.00 0.00 ? 54  ASP A OD1  1  
ATOM 834    O OD2  . ASP A 1 54  ? -15.600 -15.330 -13.184 1.00 0.00 ? 54  ASP A OD2  1  
ATOM 835    H H    . ASP A 1 54  ? -12.570 -17.113 -11.864 1.00 0.00 ? 54  ASP A H    1  
ATOM 836    H HA   . ASP A 1 54  ? -12.012 -14.291 -11.222 1.00 0.00 ? 54  ASP A HA   1  
ATOM 837    H HB2  . ASP A 1 54  ? -13.755 -13.685 -12.811 1.00 0.00 ? 54  ASP A HB2  1  
ATOM 838    H HB3  . ASP A 1 54  ? -12.514 -14.701 -13.577 1.00 0.00 ? 54  ASP A HB3  1  
ATOM 839    H HD2  . ASP A 1 54  ? -16.224 -15.985 -13.505 1.00 0.00 ? 54  ASP A HD2  1  
ATOM 840    N N    . LYS A 1 55  ? -14.612 -16.058 -10.278 1.00 0.00 ? 55  LYS A N    1  
ATOM 841    C CA   . LYS A 1 55  ? -15.697 -16.126 -9.311  1.00 0.00 ? 55  LYS A CA   1  
ATOM 842    C C    . LYS A 1 55  ? -15.320 -16.991 -8.109  1.00 0.00 ? 55  LYS A C    1  
ATOM 843    O O    . LYS A 1 55  ? -14.903 -18.142 -8.259  1.00 0.00 ? 55  LYS A O    1  
ATOM 844    C CB   . LYS A 1 55  ? -16.957 -16.665 -9.993  1.00 0.00 ? 55  LYS A CB   1  
ATOM 845    C CG   . LYS A 1 55  ? -17.966 -17.323 -9.069  1.00 0.00 ? 55  LYS A CG   1  
ATOM 846    C CD   . LYS A 1 55  ? -19.016 -18.086 -9.861  1.00 0.00 ? 55  LYS A CD   1  
ATOM 847    C CE   . LYS A 1 55  ? -19.903 -17.145 -10.662 1.00 0.00 ? 55  LYS A CE   1  
ATOM 848    N NZ   . LYS A 1 55  ? -21.221 -17.753 -10.965 1.00 0.00 ? 55  LYS A NZ   1  
ATOM 849    H H    . LYS A 1 55  ? -14.446 -16.829 -10.861 1.00 0.00 ? 55  LYS A H    1  
ATOM 850    H HA   . LYS A 1 55  ? -15.900 -15.116 -8.955  1.00 0.00 ? 55  LYS A HA   1  
ATOM 851    H HB2  . LYS A 1 55  ? -17.451 -15.832 -10.492 1.00 0.00 ? 55  LYS A HB2  1  
ATOM 852    H HB3  . LYS A 1 55  ? -16.649 -17.402 -10.734 1.00 0.00 ? 55  LYS A HB3  1  
ATOM 853    H HG2  . LYS A 1 55  ? -17.445 -18.016 -8.408  1.00 0.00 ? 55  LYS A HG2  1  
ATOM 854    H HG3  . LYS A 1 55  ? -18.458 -16.554 -8.474  1.00 0.00 ? 55  LYS A HG3  1  
ATOM 855    H HD2  . LYS A 1 55  ? -18.516 -18.770 -10.547 1.00 0.00 ? 55  LYS A HD2  1  
ATOM 856    H HD3  . LYS A 1 55  ? -19.638 -18.655 -9.170  1.00 0.00 ? 55  LYS A HD3  1  
ATOM 857    H HE2  . LYS A 1 55  ? -20.059 -16.231 -10.088 1.00 0.00 ? 55  LYS A HE2  1  
ATOM 858    H HE3  . LYS A 1 55  ? -19.403 -16.899 -11.599 1.00 0.00 ? 55  LYS A HE3  1  
ATOM 859    H HZ1  . LYS A 1 55  ? -21.516 -18.369 -10.181 1.00 0.00 ? 55  LYS A HZ1  1  
ATOM 860    H HZ2  . LYS A 1 55  ? -21.167 -18.315 -11.837 1.00 0.00 ? 55  LYS A HZ2  1  
ATOM 861    H HZ3  . LYS A 1 55  ? -21.941 -17.002 -11.091 1.00 0.00 ? 55  LYS A HZ3  1  
ATOM 862    N N    . ILE A 1 56  ? -15.461 -16.422 -6.920  1.00 0.00 ? 56  ILE A N    1  
ATOM 863    C CA   . ILE A 1 56  ? -15.151 -17.122 -5.683  1.00 0.00 ? 56  ILE A CA   1  
ATOM 864    C C    . ILE A 1 56  ? -16.378 -17.138 -4.770  1.00 0.00 ? 56  ILE A C    1  
ATOM 865    O O    . ILE A 1 56  ? -16.943 -16.085 -4.465  1.00 0.00 ? 56  ILE A O    1  
ATOM 866    C CB   . ILE A 1 56  ? -13.968 -16.454 -4.940  1.00 0.00 ? 56  ILE A CB   1  
ATOM 867    C CG1  . ILE A 1 56  ? -12.675 -16.551 -5.760  1.00 0.00 ? 56  ILE A CG1  1  
ATOM 868    C CG2  . ILE A 1 56  ? -13.772 -17.056 -3.553  1.00 0.00 ? 56  ILE A CG2  1  
ATOM 869    C CD1  . ILE A 1 56  ? -12.150 -17.961 -5.928  1.00 0.00 ? 56  ILE A CD1  1  
ATOM 870    H H    . ILE A 1 56  ? -15.789 -15.498 -6.873  1.00 0.00 ? 56  ILE A H    1  
ATOM 871    H HA   . ILE A 1 56  ? -14.876 -18.148 -5.929  1.00 0.00 ? 56  ILE A HA   1  
ATOM 872    H HB   . ILE A 1 56  ? -14.207 -15.398 -4.815  1.00 0.00 ? 56  ILE A HB   1  
ATOM 873    H HG12 . ILE A 1 56  ? -12.867 -16.137 -6.750  1.00 0.00 ? 56  ILE A HG12 1  
ATOM 874    H HG13 . ILE A 1 56  ? -11.908 -15.958 -5.261  1.00 0.00 ? 56  ILE A HG13 1  
ATOM 875    H HG21 . ILE A 1 56  ? -12.956 -16.549 -3.038  1.00 0.00 ? 56  ILE A HG21 1  
ATOM 876    H HG22 . ILE A 1 56  ? -14.689 -16.940 -2.976  1.00 0.00 ? 56  ILE A HG22 1  
ATOM 877    H HG23 . ILE A 1 56  ? -13.534 -18.115 -3.649  1.00 0.00 ? 56  ILE A HG23 1  
ATOM 878    H HD11 . ILE A 1 56  ? -12.902 -18.567 -6.435  1.00 0.00 ? 56  ILE A HD11 1  
ATOM 879    H HD12 . ILE A 1 56  ? -11.234 -17.962 -6.519  1.00 0.00 ? 56  ILE A HD12 1  
ATOM 880    H HD13 . ILE A 1 56  ? -11.941 -18.387 -4.947  1.00 0.00 ? 56  ILE A HD13 1  
ATOM 881    N N    . PRO A 1 57  ? -16.811 -18.328 -4.337  1.00 0.00 ? 57  PRO A N    1  
ATOM 882    C CA   . PRO A 1 57  ? -17.969 -18.474 -3.453  1.00 0.00 ? 57  PRO A CA   1  
ATOM 883    C C    . PRO A 1 57  ? -17.613 -18.125 -2.012  1.00 0.00 ? 57  PRO A C    1  
ATOM 884    O O    . PRO A 1 57  ? -16.763 -18.768 -1.394  1.00 0.00 ? 57  PRO A O    1  
ATOM 885    C CB   . PRO A 1 57  ? -18.317 -19.958 -3.579  1.00 0.00 ? 57  PRO A CB   1  
ATOM 886    C CG   . PRO A 1 57  ? -17.021 -20.626 -3.888  1.00 0.00 ? 57  PRO A CG   1  
ATOM 887    C CD   . PRO A 1 57  ? -16.206 -19.632 -4.674  1.00 0.00 ? 57  PRO A CD   1  
ATOM 888    H HA   . PRO A 1 57  ? -18.799 -17.851 -3.788  1.00 0.00 ? 57  PRO A HA   1  
ATOM 889    H HB2  . PRO A 1 57  ? -18.767 -20.347 -2.666  1.00 0.00 ? 57  PRO A HB2  1  
ATOM 890    H HB3  . PRO A 1 57  ? -18.988 -20.091 -4.428  1.00 0.00 ? 57  PRO A HB3  1  
ATOM 891    H HG2  . PRO A 1 57  ? -16.507 -20.826 -2.948  1.00 0.00 ? 57  PRO A HG2  1  
ATOM 892    H HG3  . PRO A 1 57  ? -17.171 -21.548 -4.449  1.00 0.00 ? 57  PRO A HG3  1  
ATOM 893    H HD2  . PRO A 1 57  ? -15.154 -19.676 -4.391  1.00 0.00 ? 57  PRO A HD2  1  
ATOM 894    H HD3  . PRO A 1 57  ? -16.320 -19.818 -5.741  1.00 0.00 ? 57  PRO A HD3  1  
ATOM 895    N N    . VAL A 1 58  ? -18.262 -17.100 -1.485  1.00 0.00 ? 58  VAL A N    1  
ATOM 896    C CA   . VAL A 1 58  ? -18.004 -16.658 -0.123  1.00 0.00 ? 58  VAL A CA   1  
ATOM 897    C C    . VAL A 1 58  ? -19.303 -16.300 0.588   1.00 0.00 ? 58  VAL A C    1  
ATOM 898    O O    . VAL A 1 58  ? -20.323 -16.040 -0.053  1.00 0.00 ? 58  VAL A O    1  
ATOM 899    C CB   . VAL A 1 58  ? -17.063 -15.430 -0.080  1.00 0.00 ? 58  VAL A CB   1  
ATOM 900    C CG1  . VAL A 1 58  ? -15.624 -15.835 -0.371  1.00 0.00 ? 58  VAL A CG1  1  
ATOM 901    C CG2  . VAL A 1 58  ? -17.526 -14.351 -1.049  1.00 0.00 ? 58  VAL A CG2  1  
ATOM 902    H H    . VAL A 1 58  ? -18.946 -16.636 -2.021  1.00 0.00 ? 58  VAL A H    1  
ATOM 903    H HA   . VAL A 1 58  ? -17.527 -17.480 0.410   1.00 0.00 ? 58  VAL A HA   1  
ATOM 904    H HB   . VAL A 1 58  ? -17.099 -15.016 0.928   1.00 0.00 ? 58  VAL A HB   1  
ATOM 905    H HG11 . VAL A 1 58  ? -14.973 -14.963 -0.308  1.00 0.00 ? 58  VAL A HG11 1  
ATOM 906    H HG12 . VAL A 1 58  ? -15.303 -16.579 0.358   1.00 0.00 ? 58  VAL A HG12 1  
ATOM 907    H HG13 . VAL A 1 58  ? -15.563 -16.259 -1.373  1.00 0.00 ? 58  VAL A HG13 1  
ATOM 908    H HG21 . VAL A 1 58  ? -18.544 -14.050 -0.797  1.00 0.00 ? 58  VAL A HG21 1  
ATOM 909    H HG22 . VAL A 1 58  ? -16.868 -13.485 -0.983  1.00 0.00 ? 58  VAL A HG22 1  
ATOM 910    H HG23 . VAL A 1 58  ? -17.505 -14.743 -2.065  1.00 0.00 ? 58  VAL A HG23 1  
ATOM 911    N N    . ALA A 1 59  ? -19.260 -16.317 1.909   1.00 0.00 ? 59  ALA A N    1  
ATOM 912    C CA   . ALA A 1 59  ? -20.412 -15.960 2.720   1.00 0.00 ? 59  ALA A CA   1  
ATOM 913    C C    . ALA A 1 59  ? -20.265 -14.513 3.167   1.00 0.00 ? 59  ALA A C    1  
ATOM 914    O O    . ALA A 1 59  ? -19.144 -14.016 3.286   1.00 0.00 ? 59  ALA A O    1  
ATOM 915    C CB   . ALA A 1 59  ? -20.522 -16.878 3.928   1.00 0.00 ? 59  ALA A CB   1  
ATOM 916    H H    . ALA A 1 59  ? -18.427 -16.576 2.353   1.00 0.00 ? 59  ALA A H    1  
ATOM 917    H HA   . ALA A 1 59  ? -21.315 -16.060 2.117   1.00 0.00 ? 59  ALA A HA   1  
ATOM 918    H HB1  . ALA A 1 59  ? -21.394 -16.601 4.520   1.00 0.00 ? 59  ALA A HB1  1  
ATOM 919    H HB2  . ALA A 1 59  ? -20.626 -17.909 3.591   1.00 0.00 ? 59  ALA A HB2  1  
ATOM 920    H HB3  . ALA A 1 59  ? -19.624 -16.784 4.538   1.00 0.00 ? 59  ALA A HB3  1  
ATOM 921    N N    . LEU A 1 60  ? -21.377 -13.838 3.410   1.00 0.00 ? 60  LEU A N    1  
ATOM 922    C CA   . LEU A 1 60  ? -21.338 -12.444 3.828   1.00 0.00 ? 60  LEU A CA   1  
ATOM 923    C C    . LEU A 1 60  ? -22.116 -12.218 5.117   1.00 0.00 ? 60  LEU A C    1  
ATOM 924    O O    . LEU A 1 60  ? -23.351 -12.216 5.118   1.00 0.00 ? 60  LEU A O    1  
ATOM 925    C CB   . LEU A 1 60  ? -21.868 -11.528 2.721   1.00 0.00 ? 60  LEU A CB   1  
ATOM 926    C CG   . LEU A 1 60  ? -20.972 -11.351 1.492   1.00 0.00 ? 60  LEU A CG   1  
ATOM 927    C CD1  . LEU A 1 60  ? -21.669 -10.493 0.447   1.00 0.00 ? 60  LEU A CD1  1  
ATOM 928    C CD2  . LEU A 1 60  ? -19.639 -10.733 1.884   1.00 0.00 ? 60  LEU A CD2  1  
ATOM 929    H H    . LEU A 1 60  ? -22.243 -14.291 3.320   1.00 0.00 ? 60  LEU A H    1  
ATOM 930    H HA   . LEU A 1 60  ? -20.295 -12.184 4.014   1.00 0.00 ? 60  LEU A HA   1  
ATOM 931    H HB2  . LEU A 1 60  ? -22.819 -11.938 2.380   1.00 0.00 ? 60  LEU A HB2  1  
ATOM 932    H HB3  . LEU A 1 60  ? -22.033 -10.543 3.156   1.00 0.00 ? 60  LEU A HB3  1  
ATOM 933    H HG   . LEU A 1 60  ? -20.781 -12.333 1.061   1.00 0.00 ? 60  LEU A HG   1  
ATOM 934    H HD11 . LEU A 1 60  ? -21.032 -10.390 -0.431  1.00 0.00 ? 60  LEU A HD11 1  
ATOM 935    H HD12 . LEU A 1 60  ? -22.608 -10.966 0.159   1.00 0.00 ? 60  LEU A HD12 1  
ATOM 936    H HD13 . LEU A 1 60  ? -21.872 -9.506  0.864   1.00 0.00 ? 60  LEU A HD13 1  
ATOM 937    H HD21 . LEU A 1 60  ? -19.144 -11.374 2.614   1.00 0.00 ? 60  LEU A HD21 1  
ATOM 938    H HD22 . LEU A 1 60  ? -19.005 -10.632 1.003   1.00 0.00 ? 60  LEU A HD22 1  
ATOM 939    H HD23 . LEU A 1 60  ? -19.810 -9.750  2.322   1.00 0.00 ? 60  LEU A HD23 1  
ATOM 940    N N    . GLY A 1 61  ? -21.392 -12.036 6.209   1.00 0.00 ? 61  GLY A N    1  
ATOM 941    C CA   . GLY A 1 61  ? -22.023 -11.797 7.487   1.00 0.00 ? 61  GLY A CA   1  
ATOM 942    C C    . GLY A 1 61  ? -21.424 -10.588 8.168   1.00 0.00 ? 61  GLY A C    1  
ATOM 943    O O    . GLY A 1 61  ? -20.303 -10.187 7.847   1.00 0.00 ? 61  GLY A O    1  
ATOM 944    H H    . GLY A 1 61  ? -20.413 -12.062 6.155   1.00 0.00 ? 61  GLY A H    1  
ATOM 945    H HA2  . GLY A 1 61  ? -23.089 -11.628 7.333   1.00 0.00 ? 61  GLY A HA2  1  
ATOM 946    H HA3  . GLY A 1 61  ? -21.884 -12.671 8.124   1.00 0.00 ? 61  GLY A HA3  1  
ATOM 947    N N    . LEU A 1 62  ? -22.166 -10.001 9.093   1.00 0.00 ? 62  LEU A N    1  
ATOM 948    C CA   . LEU A 1 62  ? -21.698 -8.825  9.812   1.00 0.00 ? 62  LEU A CA   1  
ATOM 949    C C    . LEU A 1 62  ? -20.624 -9.204  10.827  1.00 0.00 ? 62  LEU A C    1  
ATOM 950    O O    . LEU A 1 62  ? -20.759 -10.203 11.537  1.00 0.00 ? 62  LEU A O    1  
ATOM 951    C CB   . LEU A 1 62  ? -22.863 -8.127  10.521  1.00 0.00 ? 62  LEU A CB   1  
ATOM 952    C CG   . LEU A 1 62  ? -23.607 -7.053  9.722   1.00 0.00 ? 62  LEU A CG   1  
ATOM 953    C CD1  . LEU A 1 62  ? -24.511 -7.675  8.670   1.00 0.00 ? 62  LEU A CD1  1  
ATOM 954    C CD2  . LEU A 1 62  ? -24.401 -6.151  10.652  1.00 0.00 ? 62  LEU A CD2  1  
ATOM 955    H H    . LEU A 1 62  ? -23.050 -10.375 9.305   1.00 0.00 ? 62  LEU A H    1  
ATOM 956    H HA   . LEU A 1 62  ? -21.265 -8.133  9.090   1.00 0.00 ? 62  LEU A HA   1  
ATOM 957    H HB2  . LEU A 1 62  ? -23.587 -8.893  10.801  1.00 0.00 ? 62  LEU A HB2  1  
ATOM 958    H HB3  . LEU A 1 62  ? -22.468 -7.655  11.421  1.00 0.00 ? 62  LEU A HB3  1  
ATOM 959    H HG   . LEU A 1 62  ? -22.866 -6.441  9.209   1.00 0.00 ? 62  LEU A HG   1  
ATOM 960    H HD11 . LEU A 1 62  ? -25.010 -6.893  8.098   1.00 0.00 ? 62  LEU A HD11 1  
ATOM 961    H HD12 . LEU A 1 62  ? -23.913 -8.288  7.996   1.00 0.00 ? 62  LEU A HD12 1  
ATOM 962    H HD13 . LEU A 1 62  ? -25.260 -8.298  9.159   1.00 0.00 ? 62  LEU A HD13 1  
ATOM 963    H HD21 . LEU A 1 62  ? -23.726 -5.689  11.372  1.00 0.00 ? 62  LEU A HD21 1  
ATOM 964    H HD22 . LEU A 1 62  ? -24.901 -5.373  10.075  1.00 0.00 ? 62  LEU A HD22 1  
ATOM 965    H HD23 . LEU A 1 62  ? -25.147 -6.744  11.182  1.00 0.00 ? 62  LEU A HD23 1  
ATOM 966    N N    . LYS A 1 63  ? -19.564 -8.405  10.884  1.00 0.00 ? 63  LYS A N    1  
ATOM 967    C CA   . LYS A 1 63  ? -18.466 -8.646  11.813  1.00 0.00 ? 63  LYS A CA   1  
ATOM 968    C C    . LYS A 1 63  ? -18.983 -8.709  13.246  1.00 0.00 ? 63  LYS A C    1  
ATOM 969    O O    . LYS A 1 63  ? -19.764 -7.850  13.670  1.00 0.00 ? 63  LYS A O    1  
ATOM 970    C CB   . LYS A 1 63  ? -17.397 -7.556  11.676  1.00 0.00 ? 63  LYS A CB   1  
ATOM 971    C CG   . LYS A 1 63  ? -15.980 -8.047  11.929  1.00 0.00 ? 63  LYS A CG   1  
ATOM 972    C CD   . LYS A 1 63  ? -14.945 -7.011  11.519  1.00 0.00 ? 63  LYS A CD   1  
ATOM 973    C CE   . LYS A 1 63  ? -14.695 -5.987  12.615  1.00 0.00 ? 63  LYS A CE   1  
ATOM 974    N NZ   . LYS A 1 63  ? -14.008 -6.577  13.795  1.00 0.00 ? 63  LYS A NZ   1  
ATOM 975    H H    . LYS A 1 63  ? -19.513 -7.635  10.275  1.00 0.00 ? 63  LYS A H    1  
ATOM 976    H HA   . LYS A 1 63  ? -18.014 -9.606  11.566  1.00 0.00 ? 63  LYS A HA   1  
ATOM 977    H HB2  . LYS A 1 63  ? -17.446 -7.154  10.664  1.00 0.00 ? 63  LYS A HB2  1  
ATOM 978    H HB3  . LYS A 1 63  ? -17.620 -6.765  12.392  1.00 0.00 ? 63  LYS A HB3  1  
ATOM 979    H HG2  . LYS A 1 63  ? -15.864 -8.261  12.991  1.00 0.00 ? 63  LYS A HG2  1  
ATOM 980    H HG3  . LYS A 1 63  ? -15.814 -8.959  11.355  1.00 0.00 ? 63  LYS A HG3  1  
ATOM 981    H HD2  . LYS A 1 63  ? -14.008 -7.520  11.293  1.00 0.00 ? 63  LYS A HD2  1  
ATOM 982    H HD3  . LYS A 1 63  ? -15.300 -6.493  10.628  1.00 0.00 ? 63  LYS A HD3  1  
ATOM 983    H HE2  . LYS A 1 63  ? -14.075 -5.185  12.212  1.00 0.00 ? 63  LYS A HE2  1  
ATOM 984    H HE3  . LYS A 1 63  ? -15.651 -5.574  12.935  1.00 0.00 ? 63  LYS A HE3  1  
ATOM 985    H HZ1  . LYS A 1 63  ? -14.620 -7.296  14.245  1.00 0.00 ? 63  LYS A HZ1  1  
ATOM 986    H HZ2  . LYS A 1 63  ? -13.798 -5.836  14.493  1.00 0.00 ? 63  LYS A HZ2  1  
ATOM 987    H HZ3  . LYS A 1 63  ? -13.113 -7.026  13.506  1.00 0.00 ? 63  LYS A HZ3  1  
ATOM 988    N N    . GLU A 1 64  ? -18.546 -9.738  13.973  1.00 0.00 ? 64  GLU A N    1  
ATOM 989    C CA   . GLU A 1 64  ? -18.945 -9.973  15.365  1.00 0.00 ? 64  GLU A CA   1  
ATOM 990    C C    . GLU A 1 64  ? -20.458 -9.899  15.586  1.00 0.00 ? 64  GLU A C    1  
ATOM 991    O O    . GLU A 1 64  ? -20.936 -9.324  16.566  1.00 0.00 ? 64  GLU A O    1  
ATOM 992    C CB   . GLU A 1 64  ? -18.139 -9.161  16.397  1.00 0.00 ? 64  GLU A CB   1  
ATOM 993    C CG   . GLU A 1 64  ? -18.166 -7.648  16.230  1.00 0.00 ? 64  GLU A CG   1  
ATOM 994    C CD   . GLU A 1 64  ? -16.957 -7.106  15.490  1.00 0.00 ? 64  GLU A CD   1  
ATOM 995    O OE1  . GLU A 1 64  ? -16.871 -5.873  15.311  1.00 0.00 ? 64  GLU A OE1  1  
ATOM 996    O OE2  . GLU A 1 64  ? -16.081 -7.901  15.092  1.00 0.00 ? 64  GLU A OE2  1  
ATOM 997    H H    . GLU A 1 64  ? -17.928 -10.373 13.554  1.00 0.00 ? 64  GLU A H    1  
ATOM 998    H HA   . GLU A 1 64  ? -18.679 -11.013 15.553  1.00 0.00 ? 64  GLU A HA   1  
ATOM 999    H HB2  . GLU A 1 64  ? -18.534 -9.394  17.386  1.00 0.00 ? 64  GLU A HB2  1  
ATOM 1000   H HB3  . GLU A 1 64  ? -17.099 -9.483  16.336  1.00 0.00 ? 64  GLU A HB3  1  
ATOM 1001   H HG2  . GLU A 1 64  ? -19.064 -7.375  15.675  1.00 0.00 ? 64  GLU A HG2  1  
ATOM 1002   H HG3  . GLU A 1 64  ? -18.203 -7.189  17.218  1.00 0.00 ? 64  GLU A HG3  1  
ATOM 1003   H HE2  . GLU A 1 64  ? -15.347 -7.484  14.636  1.00 0.00 ? 64  GLU A HE2  1  
ATOM 1004   N N    . LYS A 1 65  ? -21.206 -10.485 14.655  1.00 0.00 ? 65  LYS A N    1  
ATOM 1005   C CA   . LYS A 1 65  ? -22.661 -10.523 14.730  1.00 0.00 ? 65  LYS A CA   1  
ATOM 1006   C C    . LYS A 1 65  ? -23.190 -11.731 13.960  1.00 0.00 ? 65  LYS A C    1  
ATOM 1007   O O    . LYS A 1 65  ? -22.595 -12.147 12.970  1.00 0.00 ? 65  LYS A O    1  
ATOM 1008   C CB   . LYS A 1 65  ? -23.263 -9.228  14.172  1.00 0.00 ? 65  LYS A CB   1  
ATOM 1009   C CG   . LYS A 1 65  ? -23.651 -8.217  15.240  1.00 0.00 ? 65  LYS A CG   1  
ATOM 1010   C CD   . LYS A 1 65  ? -23.785 -6.817  14.663  1.00 0.00 ? 65  LYS A CD   1  
ATOM 1011   C CE   . LYS A 1 65  ? -22.425 -6.214  14.343  1.00 0.00 ? 65  LYS A CE   1  
ATOM 1012   N NZ   . LYS A 1 65  ? -21.559 -6.104  15.549  1.00 0.00 ? 65  LYS A NZ   1  
ATOM 1013   H H    . LYS A 1 65  ? -20.763 -10.897 13.881  1.00 0.00 ? 65  LYS A H    1  
ATOM 1014   H HA   . LYS A 1 65  ? -22.951 -10.619 15.776  1.00 0.00 ? 65  LYS A HA   1  
ATOM 1015   H HB2  . LYS A 1 65  ? -22.530 -8.765  13.512  1.00 0.00 ? 65  LYS A HB2  1  
ATOM 1016   H HB3  . LYS A 1 65  ? -24.156 -9.483  13.601  1.00 0.00 ? 65  LYS A HB3  1  
ATOM 1017   H HG2  . LYS A 1 65  ? -24.605 -8.512  15.677  1.00 0.00 ? 65  LYS A HG2  1  
ATOM 1018   H HG3  . LYS A 1 65  ? -22.884 -8.208  16.014  1.00 0.00 ? 65  LYS A HG3  1  
ATOM 1019   H HD2  . LYS A 1 65  ? -24.375 -6.866  13.747  1.00 0.00 ? 65  LYS A HD2  1  
ATOM 1020   H HD3  . LYS A 1 65  ? -24.292 -6.182  15.388  1.00 0.00 ? 65  LYS A HD3  1  
ATOM 1021   H HE2  . LYS A 1 65  ? -21.925 -6.843  13.607  1.00 0.00 ? 65  LYS A HE2  1  
ATOM 1022   H HE3  . LYS A 1 65  ? -22.571 -5.219  13.923  1.00 0.00 ? 65  LYS A HE3  1  
ATOM 1023   H HZ1  . LYS A 1 65  ? -20.655 -5.653  15.302  1.00 0.00 ? 65  LYS A HZ1  1  
ATOM 1024   H HZ2  . LYS A 1 65  ? -21.366 -7.049  15.940  1.00 0.00 ? 65  LYS A HZ2  1  
ATOM 1025   H HZ3  . LYS A 1 65  ? -22.029 -5.530  16.278  1.00 0.00 ? 65  LYS A HZ3  1  
ATOM 1026   N N    . ASN A 1 66  ? -24.303 -12.295 14.410  1.00 0.00 ? 66  ASN A N    1  
ATOM 1027   C CA   . ASN A 1 66  ? -24.886 -13.463 13.749  1.00 0.00 ? 66  ASN A CA   1  
ATOM 1028   C C    . ASN A 1 66  ? -25.868 -13.067 12.651  1.00 0.00 ? 66  ASN A C    1  
ATOM 1029   O O    . ASN A 1 66  ? -26.768 -13.831 12.295  1.00 0.00 ? 66  ASN A O    1  
ATOM 1030   C CB   . ASN A 1 66  ? -25.537 -14.418 14.757  1.00 0.00 ? 66  ASN A CB   1  
ATOM 1031   C CG   . ASN A 1 66  ? -26.739 -13.832 15.472  1.00 0.00 ? 66  ASN A CG   1  
ATOM 1032   O OD1  . ASN A 1 66  ? -26.776 -12.641 15.791  1.00 0.00 ? 66  ASN A OD1  1  
ATOM 1033   N ND2  . ASN A 1 66  ? -27.736 -14.669 15.724  1.00 0.00 ? 66  ASN A ND2  1  
ATOM 1034   H H    . ASN A 1 66  ? -24.746 -11.924 15.202  1.00 0.00 ? 66  ASN A H    1  
ATOM 1035   H HA   . ASN A 1 66  ? -24.065 -14.001 13.274  1.00 0.00 ? 66  ASN A HA   1  
ATOM 1036   H HB2  . ASN A 1 66  ? -25.856 -15.315 14.225  1.00 0.00 ? 66  ASN A HB2  1  
ATOM 1037   H HB3  . ASN A 1 66  ? -24.793 -14.691 15.505  1.00 0.00 ? 66  ASN A HB3  1  
ATOM 1038   H HD21 . ASN A 1 66  ? -27.641 -15.606 15.431  1.00 0.00 ? 66  ASN A HD21 1  
ATOM 1039   H HD22 . ASN A 1 66  ? -28.522 -14.327 16.197  1.00 0.00 ? 66  ASN A HD22 1  
ATOM 1040   N N    . LEU A 1 67  ? -25.678 -11.876 12.104  1.00 0.00 ? 67  LEU A N    1  
ATOM 1041   C CA   . LEU A 1 67  ? -26.531 -11.379 11.037  1.00 0.00 ? 67  LEU A CA   1  
ATOM 1042   C C    . LEU A 1 67  ? -25.868 -11.663 9.698   1.00 0.00 ? 67  LEU A C    1  
ATOM 1043   O O    . LEU A 1 67  ? -24.768 -11.177 9.427   1.00 0.00 ? 67  LEU A O    1  
ATOM 1044   C CB   . LEU A 1 67  ? -26.759 -9.874  11.202  1.00 0.00 ? 67  LEU A CB   1  
ATOM 1045   C CG   . LEU A 1 67  ? -27.365 -9.419  12.535  1.00 0.00 ? 67  LEU A CG   1  
ATOM 1046   C CD1  . LEU A 1 67  ? -27.453 -7.900  12.594  1.00 0.00 ? 67  LEU A CD1  1  
ATOM 1047   C CD2  . LEU A 1 67  ? -28.736 -10.045 12.747  1.00 0.00 ? 67  LEU A CD2  1  
ATOM 1048   H H    . LEU A 1 67  ? -24.932 -11.325 12.417  1.00 0.00 ? 67  LEU A H    1  
ATOM 1049   H HA   . LEU A 1 67  ? -27.492 -11.892 11.080  1.00 0.00 ? 67  LEU A HA   1  
ATOM 1050   H HB2  . LEU A 1 67  ? -25.795 -9.377  11.089  1.00 0.00 ? 67  LEU A HB2  1  
ATOM 1051   H HB3  . LEU A 1 67  ? -27.430 -9.551  10.406  1.00 0.00 ? 67  LEU A HB3  1  
ATOM 1052   H HG   . LEU A 1 67  ? -26.710 -9.754  13.340  1.00 0.00 ? 67  LEU A HG   1  
ATOM 1053   H HD11 . LEU A 1 67  ? -27.863 -7.590  13.555  1.00 0.00 ? 67  LEU A HD11 1  
ATOM 1054   H HD12 . LEU A 1 67  ? -26.457 -7.475  12.472  1.00 0.00 ? 67  LEU A HD12 1  
ATOM 1055   H HD13 . LEU A 1 67  ? -28.101 -7.544  11.793  1.00 0.00 ? 67  LEU A HD13 1  
ATOM 1056   H HD21 . LEU A 1 67  ? -28.644 -11.131 12.731  1.00 0.00 ? 67  LEU A HD21 1  
ATOM 1057   H HD22 . LEU A 1 67  ? -29.142 -9.731  13.708  1.00 0.00 ? 67  LEU A HD22 1  
ATOM 1058   H HD23 . LEU A 1 67  ? -29.407 -9.726  11.949  1.00 0.00 ? 67  LEU A HD23 1  
ATOM 1059   N N    . TYR A 1 68  ? -26.528 -12.457 8.866   1.00 0.00 ? 68  TYR A N    1  
ATOM 1060   C CA   . TYR A 1 68  ? -25.979 -12.822 7.567   1.00 0.00 ? 68  TYR A CA   1  
ATOM 1061   C C    . TYR A 1 68  ? -26.899 -12.419 6.425   1.00 0.00 ? 68  TYR A C    1  
ATOM 1062   O O    . TYR A 1 68  ? -28.125 -12.422 6.572   1.00 0.00 ? 68  TYR A O    1  
ATOM 1063   C CB   . TYR A 1 68  ? -25.704 -14.329 7.507   1.00 0.00 ? 68  TYR A CB   1  
ATOM 1064   C CG   . TYR A 1 68  ? -24.335 -14.724 8.010   1.00 0.00 ? 68  TYR A CG   1  
ATOM 1065   C CD1  . TYR A 1 68  ? -24.004 -14.609 9.354   1.00 0.00 ? 68  TYR A CD1  1  
ATOM 1066   C CD2  . TYR A 1 68  ? -23.370 -15.209 7.138   1.00 0.00 ? 68  TYR A CD2  1  
ATOM 1067   C CE1  . TYR A 1 68  ? -22.752 -14.966 9.817   1.00 0.00 ? 68  TYR A CE1  1  
ATOM 1068   C CE2  . TYR A 1 68  ? -22.116 -15.569 7.591   1.00 0.00 ? 68  TYR A CE2  1  
ATOM 1069   C CZ   . TYR A 1 68  ? -21.812 -15.445 8.930   1.00 0.00 ? 68  TYR A CZ   1  
ATOM 1070   O OH   . TYR A 1 68  ? -20.564 -15.799 9.382   1.00 0.00 ? 68  TYR A OH   1  
ATOM 1071   H H    . TYR A 1 68  ? -27.420 -12.784 9.118   1.00 0.00 ? 68  TYR A H    1  
ATOM 1072   H HA   . TYR A 1 68  ? -25.033 -12.294 7.445   1.00 0.00 ? 68  TYR A HA   1  
ATOM 1073   H HB2  . TYR A 1 68  ? -26.454 -14.842 8.109   1.00 0.00 ? 68  TYR A HB2  1  
ATOM 1074   H HB3  . TYR A 1 68  ? -25.801 -14.659 6.473   1.00 0.00 ? 68  TYR A HB3  1  
ATOM 1075   H HD1  . TYR A 1 68  ? -24.740 -14.234 10.051  1.00 0.00 ? 68  TYR A HD1  1  
ATOM 1076   H HD2  . TYR A 1 68  ? -23.603 -15.306 6.088   1.00 0.00 ? 68  TYR A HD2  1  
ATOM 1077   H HE1  . TYR A 1 68  ? -22.511 -14.870 10.865  1.00 0.00 ? 68  TYR A HE1  1  
ATOM 1078   H HE2  . TYR A 1 68  ? -21.377 -15.946 6.900   1.00 0.00 ? 68  TYR A HE2  1  
ATOM 1079   H HH   . TYR A 1 68  ? -20.612 -16.021 10.313  1.00 0.00 ? 68  TYR A HH   1  
ATOM 1080   N N    . LEU A 1 69  ? -26.295 -12.061 5.299   1.00 0.00 ? 69  LEU A N    1  
ATOM 1081   C CA   . LEU A 1 69  ? -27.046 -11.669 4.114   1.00 0.00 ? 69  LEU A CA   1  
ATOM 1082   C C    . LEU A 1 69  ? -27.656 -12.901 3.463   1.00 0.00 ? 69  LEU A C    1  
ATOM 1083   O O    . LEU A 1 69  ? -26.953 -13.866 3.169   1.00 0.00 ? 69  LEU A O    1  
ATOM 1084   C CB   . LEU A 1 69  ? -26.141 -10.936 3.121   1.00 0.00 ? 69  LEU A CB   1  
ATOM 1085   C CG   . LEU A 1 69  ? -25.736 -9.512  3.505   1.00 0.00 ? 69  LEU A CG   1  
ATOM 1086   C CD1  . LEU A 1 69  ? -24.763 -8.942  2.485   1.00 0.00 ? 69  LEU A CD1  1  
ATOM 1087   C CD2  . LEU A 1 69  ? -26.964 -8.626  3.629   1.00 0.00 ? 69  LEU A CD2  1  
ATOM 1088   H H    . LEU A 1 69  ? -25.314 -12.065 5.265   1.00 0.00 ? 69  LEU A H    1  
ATOM 1089   H HA   . LEU A 1 69  ? -27.848 -10.996 4.418   1.00 0.00 ? 69  LEU A HA   1  
ATOM 1090   H HB2  . LEU A 1 69  ? -25.229 -11.523 3.006   1.00 0.00 ? 69  LEU A HB2  1  
ATOM 1091   H HB3  . LEU A 1 69  ? -26.665 -10.888 2.166   1.00 0.00 ? 69  LEU A HB3  1  
ATOM 1092   H HG   . LEU A 1 69  ? -25.237 -9.545  4.473   1.00 0.00 ? 69  LEU A HG   1  
ATOM 1093   H HD11 . LEU A 1 69  ? -24.467 -7.935  2.780   1.00 0.00 ? 69  LEU A HD11 1  
ATOM 1094   H HD12 . LEU A 1 69  ? -23.880 -9.577  2.432   1.00 0.00 ? 69  LEU A HD12 1  
ATOM 1095   H HD13 . LEU A 1 69  ? -25.244 -8.905  1.507   1.00 0.00 ? 69  LEU A HD13 1  
ATOM 1096   H HD21 . LEU A 1 69  ? -27.634 -9.039  4.383   1.00 0.00 ? 69  LEU A HD21 1  
ATOM 1097   H HD22 . LEU A 1 69  ? -26.665 -7.620  3.923   1.00 0.00 ? 69  LEU A HD22 1  
ATOM 1098   H HD23 . LEU A 1 69  ? -27.479 -8.584  2.669   1.00 0.00 ? 69  LEU A HD23 1  
ATOM 1099   N N    . SER A 1 70  ? -28.958 -12.871 3.255   1.00 0.00 ? 70  SER A N    1  
ATOM 1100   C CA   . SER A 1 70  ? -29.652 -13.999 2.665   1.00 0.00 ? 70  SER A CA   1  
ATOM 1101   C C    . SER A 1 70  ? -30.467 -13.586 1.447   1.00 0.00 ? 70  SER A C    1  
ATOM 1102   O O    . SER A 1 70  ? -31.086 -12.520 1.430   1.00 0.00 ? 70  SER A O    1  
ATOM 1103   C CB   . SER A 1 70  ? -30.561 -14.636 3.715   1.00 0.00 ? 70  SER A CB   1  
ATOM 1104   O OG   . SER A 1 70  ? -31.153 -15.831 3.246   1.00 0.00 ? 70  SER A OG   1  
ATOM 1105   H H    . SER A 1 70  ? -29.469 -12.073 3.515   1.00 0.00 ? 70  SER A H    1  
ATOM 1106   H HA   . SER A 1 70  ? -28.910 -14.732 2.350   1.00 0.00 ? 70  SER A HA   1  
ATOM 1107   H HB2  . SER A 1 70  ? -29.970 -14.861 4.603   1.00 0.00 ? 70  SER A HB2  1  
ATOM 1108   H HB3  . SER A 1 70  ? -31.351 -13.931 3.973   1.00 0.00 ? 70  SER A HB3  1  
ATOM 1109   H HG   . SER A 1 70  ? -31.703 -16.207 3.955   1.00 0.00 ? 70  SER A HG   1  
ATOM 1110   N N    . CYS A 1 71  ? -30.452 -14.436 0.431   1.00 0.00 ? 71  CYS A N    1  
ATOM 1111   C CA   . CYS A 1 71  ? -31.202 -14.197 -0.787  1.00 0.00 ? 71  CYS A CA   1  
ATOM 1112   C C    . CYS A 1 71  ? -32.395 -15.145 -0.832  1.00 0.00 ? 71  CYS A C    1  
ATOM 1113   O O    . CYS A 1 71  ? -32.228 -16.361 -0.948  1.00 0.00 ? 71  CYS A O    1  
ATOM 1114   C CB   . CYS A 1 71  ? -30.311 -14.430 -2.008  1.00 0.00 ? 71  CYS A CB   1  
ATOM 1115   S SG   . CYS A 1 71  ? -28.537 -14.381 -1.661  1.00 0.00 ? 71  CYS A SG   1  
ATOM 1116   H H    . CYS A 1 71  ? -29.916 -15.257 0.508   1.00 0.00 ? 71  CYS A H    1  
ATOM 1117   H HA   . CYS A 1 71  ? -31.557 -13.167 -0.792  1.00 0.00 ? 71  CYS A HA   1  
ATOM 1118   H HB2  . CYS A 1 71  ? -30.554 -15.409 -2.419  1.00 0.00 ? 71  CYS A HB2  1  
ATOM 1119   H HB3  . CYS A 1 71  ? -30.539 -13.658 -2.742  1.00 0.00 ? 71  CYS A HB3  1  
ATOM 1120   H HG   . CYS A 1 71  ? -28.313 -15.079 -0.553  1.00 0.00 ? 71  CYS A HG   1  
ATOM 1121   N N    . VAL A 1 72  ? -33.597 -14.596 -0.738  1.00 0.00 ? 72  VAL A N    1  
ATOM 1122   C CA   . VAL A 1 72  ? -34.807 -15.409 -0.748  1.00 0.00 ? 72  VAL A CA   1  
ATOM 1123   C C    . VAL A 1 72  ? -35.862 -14.797 -1.659  1.00 0.00 ? 72  VAL A C    1  
ATOM 1124   O O    . VAL A 1 72  ? -35.724 -13.663 -2.113  1.00 0.00 ? 72  VAL A O    1  
ATOM 1125   C CB   . VAL A 1 72  ? -35.406 -15.577 0.666   1.00 0.00 ? 72  VAL A CB   1  
ATOM 1126   C CG1  . VAL A 1 72  ? -34.484 -16.399 1.558   1.00 0.00 ? 72  VAL A CG1  1  
ATOM 1127   C CG2  . VAL A 1 72  ? -35.706 -14.225 1.296   1.00 0.00 ? 72  VAL A CG2  1  
ATOM 1128   H H    . VAL A 1 72  ? -33.677 -13.617 -0.704  1.00 0.00 ? 72  VAL A H    1  
ATOM 1129   H HA   . VAL A 1 72  ? -34.543 -16.395 -1.131  1.00 0.00 ? 72  VAL A HA   1  
ATOM 1130   H HB   . VAL A 1 72  ? -36.348 -16.118 0.570   1.00 0.00 ? 72  VAL A HB   1  
ATOM 1131   H HG11 . VAL A 1 72  ? -34.937 -16.530 2.540   1.00 0.00 ? 72  VAL A HG11 1  
ATOM 1132   H HG12 . VAL A 1 72  ? -34.318 -17.376 1.103   1.00 0.00 ? 72  VAL A HG12 1  
ATOM 1133   H HG13 . VAL A 1 72  ? -33.531 -15.882 1.666   1.00 0.00 ? 72  VAL A HG13 1  
ATOM 1134   H HG21 . VAL A 1 72  ? -36.398 -13.674 0.659   1.00 0.00 ? 72  VAL A HG21 1  
ATOM 1135   H HG22 . VAL A 1 72  ? -36.154 -14.364 2.280   1.00 0.00 ? 72  VAL A HG22 1  
ATOM 1136   H HG23 . VAL A 1 72  ? -34.779 -13.660 1.399   1.00 0.00 ? 72  VAL A HG23 1  
ATOM 1137   N N    . LEU A 1 73  ? -36.913 -15.554 -1.921  1.00 0.00 ? 73  LEU A N    1  
ATOM 1138   C CA   . LEU A 1 73  ? -38.004 -15.090 -2.762  1.00 0.00 ? 73  LEU A CA   1  
ATOM 1139   C C    . LEU A 1 73  ? -39.127 -14.554 -1.890  1.00 0.00 ? 73  LEU A C    1  
ATOM 1140   O O    . LEU A 1 73  ? -39.666 -15.278 -1.056  1.00 0.00 ? 73  LEU A O    1  
ATOM 1141   C CB   . LEU A 1 73  ? -38.540 -16.242 -3.618  1.00 0.00 ? 73  LEU A CB   1  
ATOM 1142   C CG   . LEU A 1 73  ? -37.631 -16.740 -4.742  1.00 0.00 ? 73  LEU A CG   1  
ATOM 1143   C CD1  . LEU A 1 73  ? -37.718 -18.253 -4.866  1.00 0.00 ? 73  LEU A CD1  1  
ATOM 1144   C CD2  . LEU A 1 73  ? -38.002 -16.074 -6.059  1.00 0.00 ? 73  LEU A CD2  1  
ATOM 1145   H H    . LEU A 1 73  ? -36.961 -16.451 -1.530  1.00 0.00 ? 73  LEU A H    1  
ATOM 1146   H HA   . LEU A 1 73  ? -37.639 -14.297 -3.414  1.00 0.00 ? 73  LEU A HA   1  
ATOM 1147   H HB2  . LEU A 1 73  ? -38.736 -17.084 -2.954  1.00 0.00 ? 73  LEU A HB2  1  
ATOM 1148   H HB3  . LEU A 1 73  ? -39.474 -15.911 -4.070  1.00 0.00 ? 73  LEU A HB3  1  
ATOM 1149   H HG   . LEU A 1 73  ? -36.603 -16.472 -4.498  1.00 0.00 ? 73  LEU A HG   1  
ATOM 1150   H HD11 . LEU A 1 73  ? -37.052 -18.598 -5.657  1.00 0.00 ? 73  LEU A HD11 1  
ATOM 1151   H HD12 . LEU A 1 73  ? -37.424 -18.711 -3.921  1.00 0.00 ? 73  LEU A HD12 1  
ATOM 1152   H HD13 . LEU A 1 73  ? -38.742 -18.539 -5.105  1.00 0.00 ? 73  LEU A HD13 1  
ATOM 1153   H HD21 . LEU A 1 73  ? -37.909 -14.993 -5.957  1.00 0.00 ? 73  LEU A HD21 1  
ATOM 1154   H HD22 . LEU A 1 73  ? -37.335 -16.421 -6.848  1.00 0.00 ? 73  LEU A HD22 1  
ATOM 1155   H HD23 . LEU A 1 73  ? -39.030 -16.328 -6.317  1.00 0.00 ? 73  LEU A HD23 1  
ATOM 1156   N N    . LYS A 1 74  ? -39.475 -13.289 -2.069  1.00 0.00 ? 74  LYS A N    1  
ATOM 1157   C CA   . LYS A 1 74  ? -40.544 -12.672 -1.305  1.00 0.00 ? 74  LYS A CA   1  
ATOM 1158   C C    . LYS A 1 74  ? -41.571 -12.135 -2.283  1.00 0.00 ? 74  LYS A C    1  
ATOM 1159   O O    . LYS A 1 74  ? -41.255 -11.259 -3.093  1.00 0.00 ? 74  LYS A O    1  
ATOM 1160   C CB   . LYS A 1 74  ? -40.003 -11.515 -0.463  1.00 0.00 ? 74  LYS A CB   1  
ATOM 1161   C CG   . LYS A 1 74  ? -39.103 -11.925 0.688   1.00 0.00 ? 74  LYS A CG   1  
ATOM 1162   C CD   . LYS A 1 74  ? -38.481 -10.704 1.346   1.00 0.00 ? 74  LYS A CD   1  
ATOM 1163   C CE   . LYS A 1 74  ? -37.591 -11.089 2.515   1.00 0.00 ? 74  LYS A CE   1  
ATOM 1164   N NZ   . LYS A 1 74  ? -38.371 -11.384 3.746   1.00 0.00 ? 74  LYS A NZ   1  
ATOM 1165   H H    . LYS A 1 74  ? -39.034 -12.739 -2.757  1.00 0.00 ? 74  LYS A H    1  
ATOM 1166   H HA   . LYS A 1 74  ? -41.002 -13.414 -0.651  1.00 0.00 ? 74  LYS A HA   1  
ATOM 1167   H HB2  . LYS A 1 74  ? -39.434 -10.856 -1.119  1.00 0.00 ? 74  LYS A HB2  1  
ATOM 1168   H HB3  . LYS A 1 74  ? -40.853 -10.971 -0.051  1.00 0.00 ? 74  LYS A HB3  1  
ATOM 1169   H HG2  . LYS A 1 74  ? -39.692 -12.468 1.427   1.00 0.00 ? 74  LYS A HG2  1  
ATOM 1170   H HG3  . LYS A 1 74  ? -38.310 -12.570 0.310   1.00 0.00 ? 74  LYS A HG3  1  
ATOM 1171   H HD2  . LYS A 1 74  ? -37.883 -10.171 0.607   1.00 0.00 ? 74  LYS A HD2  1  
ATOM 1172   H HD3  . LYS A 1 74  ? -39.277 -10.053 1.707   1.00 0.00 ? 74  LYS A HD3  1  
ATOM 1173   H HE2  . LYS A 1 74  ? -37.016 -11.974 2.242   1.00 0.00 ? 74  LYS A HE2  1  
ATOM 1174   H HE3  . LYS A 1 74  ? -36.906 -10.267 2.721   1.00 0.00 ? 74  LYS A HE3  1  
ATOM 1175   H HZ1  . LYS A 1 74  ? -38.885 -10.533 4.059   1.00 0.00 ? 74  LYS A HZ1  1  
ATOM 1176   H HZ2  . LYS A 1 74  ? -37.730 -11.687 4.509   1.00 0.00 ? 74  LYS A HZ2  1  
ATOM 1177   H HZ3  . LYS A 1 74  ? -39.059 -12.144 3.565   1.00 0.00 ? 74  LYS A HZ3  1  
ATOM 1178   N N    . ASP A 1 75  ? -42.775 -12.686 -2.236  1.00 0.00 ? 75  ASP A N    1  
ATOM 1179   C CA   . ASP A 1 75  ? -43.851 -12.269 -3.131  1.00 0.00 ? 75  ASP A CA   1  
ATOM 1180   C C    . ASP A 1 75  ? -43.435 -12.454 -4.589  1.00 0.00 ? 75  ASP A C    1  
ATOM 1181   O O    . ASP A 1 75  ? -43.496 -11.526 -5.399  1.00 0.00 ? 75  ASP A O    1  
ATOM 1182   C CB   . ASP A 1 75  ? -44.277 -10.823 -2.850  1.00 0.00 ? 75  ASP A CB   1  
ATOM 1183   C CG   . ASP A 1 75  ? -45.531 -10.411 -3.598  1.00 0.00 ? 75  ASP A CG   1  
ATOM 1184   O OD1  . ASP A 1 75  ? -45.538 -9.308  -4.183  1.00 0.00 ? 75  ASP A OD1  1  
ATOM 1185   O OD2  . ASP A 1 75  ? -46.519 -11.181 -3.598  1.00 0.00 ? 75  ASP A OD2  1  
ATOM 1186   H H    . ASP A 1 75  ? -42.949 -13.396 -1.581  1.00 0.00 ? 75  ASP A H    1  
ATOM 1187   H HA   . ASP A 1 75  ? -44.709 -12.913 -2.941  1.00 0.00 ? 75  ASP A HA   1  
ATOM 1188   H HB2  . ASP A 1 75  ? -44.461 -10.717 -1.780  1.00 0.00 ? 75  ASP A HB2  1  
ATOM 1189   H HB3  . ASP A 1 75  ? -43.465 -10.158 -3.142  1.00 0.00 ? 75  ASP A HB3  1  
ATOM 1190   H HD2  . ASP A 1 75  ? -47.275 -10.852 -4.090  1.00 0.00 ? 75  ASP A HD2  1  
ATOM 1191   N N    . ASP A 1 76  ? -42.989 -13.673 -4.902  1.00 0.00 ? 76  ASP A N    1  
ATOM 1192   C CA   . ASP A 1 76  ? -42.550 -14.037 -6.253  1.00 0.00 ? 76  ASP A CA   1  
ATOM 1193   C C    . ASP A 1 76  ? -41.411 -13.163 -6.783  1.00 0.00 ? 76  ASP A C    1  
ATOM 1194   O O    . ASP A 1 76  ? -41.227 -13.037 -7.997  1.00 0.00 ? 76  ASP A O    1  
ATOM 1195   C CB   . ASP A 1 76  ? -43.729 -14.056 -7.235  1.00 0.00 ? 76  ASP A CB   1  
ATOM 1196   C CG   . ASP A 1 76  ? -44.653 -15.238 -7.018  1.00 0.00 ? 76  ASP A CG   1  
ATOM 1197   O OD1  . ASP A 1 76  ? -45.622 -15.114 -6.238  1.00 0.00 ? 76  ASP A OD1  1  
ATOM 1198   O OD2  . ASP A 1 76  ? -44.418 -16.301 -7.630  1.00 0.00 ? 76  ASP A OD2  1  
ATOM 1199   H H    . ASP A 1 76  ? -42.993 -14.372 -4.214  1.00 0.00 ? 76  ASP A H    1  
ATOM 1200   H HA   . ASP A 1 76  ? -42.166 -15.055 -6.189  1.00 0.00 ? 76  ASP A HA   1  
ATOM 1201   H HB2  . ASP A 1 76  ? -44.302 -13.137 -7.111  1.00 0.00 ? 76  ASP A HB2  1  
ATOM 1202   H HB3  . ASP A 1 76  ? -43.337 -14.101 -8.251  1.00 0.00 ? 76  ASP A HB3  1  
ATOM 1203   H HD2  . ASP A 1 76  ? -45.042 -17.006 -7.447  1.00 0.00 ? 76  ASP A HD2  1  
ATOM 1204   N N    . LYS A 1 77  ? -40.650 -12.549 -5.887  1.00 0.00 ? 77  LYS A N    1  
ATOM 1205   C CA   . LYS A 1 77  ? -39.535 -11.708 -6.295  1.00 0.00 ? 77  LYS A CA   1  
ATOM 1206   C C    . LYS A 1 77  ? -38.318 -11.935 -5.402  1.00 0.00 ? 77  LYS A C    1  
ATOM 1207   O O    . LYS A 1 77  ? -38.425 -11.880 -4.176  1.00 0.00 ? 77  LYS A O    1  
ATOM 1208   C CB   . LYS A 1 77  ? -39.947 -10.232 -6.250  1.00 0.00 ? 77  LYS A CB   1  
ATOM 1209   C CG   . LYS A 1 77  ? -39.114 -9.321  -7.138  1.00 0.00 ? 77  LYS A CG   1  
ATOM 1210   C CD   . LYS A 1 77  ? -39.287 -9.675  -8.606  1.00 0.00 ? 77  LYS A CD   1  
ATOM 1211   C CE   . LYS A 1 77  ? -40.732 -9.508  -9.051  1.00 0.00 ? 77  LYS A CE   1  
ATOM 1212   N NZ   . LYS A 1 77  ? -41.277 -10.751 -9.656  1.00 0.00 ? 77  LYS A NZ   1  
ATOM 1213   H H    . LYS A 1 77  ? -40.861 -12.625 -4.934  1.00 0.00 ? 77  LYS A H    1  
ATOM 1214   H HA   . LYS A 1 77  ? -39.267 -11.966 -7.320  1.00 0.00 ? 77  LYS A HA   1  
ATOM 1215   H HB2  . LYS A 1 77  ? -40.987 -10.159 -6.565  1.00 0.00 ? 77  LYS A HB2  1  
ATOM 1216   H HB3  . LYS A 1 77  ? -39.854 -9.883  -5.221  1.00 0.00 ? 77  LYS A HB3  1  
ATOM 1217   H HG2  . LYS A 1 77  ? -39.429 -8.289  -6.983  1.00 0.00 ? 77  LYS A HG2  1  
ATOM 1218   H HG3  . LYS A 1 77  ? -38.063 -9.425  -6.869  1.00 0.00 ? 77  LYS A HG3  1  
ATOM 1219   H HD2  . LYS A 1 77  ? -38.653 -9.022  -9.206  1.00 0.00 ? 77  LYS A HD2  1  
ATOM 1220   H HD3  . LYS A 1 77  ? -38.986 -10.712 -8.758  1.00 0.00 ? 77  LYS A HD3  1  
ATOM 1221   H HE2  . LYS A 1 77  ? -41.338 -9.241  -8.186  1.00 0.00 ? 77  LYS A HE2  1  
ATOM 1222   H HE3  . LYS A 1 77  ? -40.784 -8.705  -9.786  1.00 0.00 ? 77  LYS A HE3  1  
ATOM 1223   H HZ1  . LYS A 1 77  ? -42.279 -10.617 -9.905  1.00 0.00 ? 77  LYS A HZ1  1  
ATOM 1224   H HZ2  . LYS A 1 77  ? -41.202 -11.545 -8.986  1.00 0.00 ? 77  LYS A HZ2  1  
ATOM 1225   H HZ3  . LYS A 1 77  ? -40.752 -10.989 -10.521 1.00 0.00 ? 77  LYS A HZ3  1  
ATOM 1226   N N    . PRO A 1 78  ? -37.151 -12.222 -6.001  1.00 0.00 ? 78  PRO A N    1  
ATOM 1227   C CA   . PRO A 1 78  ? -35.908 -12.435 -5.251  1.00 0.00 ? 78  PRO A CA   1  
ATOM 1228   C C    . PRO A 1 78  ? -35.499 -11.162 -4.515  1.00 0.00 ? 78  PRO A C    1  
ATOM 1229   O O    . PRO A 1 78  ? -35.329 -10.109 -5.126  1.00 0.00 ? 78  PRO A O    1  
ATOM 1230   C CB   . PRO A 1 78  ? -34.878 -12.774 -6.336  1.00 0.00 ? 78  PRO A CB   1  
ATOM 1231   C CG   . PRO A 1 78  ? -35.684 -13.175 -7.524  1.00 0.00 ? 78  PRO A CG   1  
ATOM 1232   C CD   . PRO A 1 78  ? -36.950 -12.374 -7.450  1.00 0.00 ? 78  PRO A CD   1  
ATOM 1233   H HA   . PRO A 1 78  ? -36.012 -13.257 -4.542  1.00 0.00 ? 78  PRO A HA   1  
ATOM 1234   H HB2  . PRO A 1 78  ? -34.229 -11.926 -6.555  1.00 0.00 ? 78  PRO A HB2  1  
ATOM 1235   H HB3  . PRO A 1 78  ? -34.293 -13.633 -6.007  1.00 0.00 ? 78  PRO A HB3  1  
ATOM 1236   H HG2  . PRO A 1 78  ? -35.141 -12.884 -8.423  1.00 0.00 ? 78  PRO A HG2  1  
ATOM 1237   H HG3  . PRO A 1 78  ? -35.888 -14.246 -7.526  1.00 0.00 ? 78  PRO A HG3  1  
ATOM 1238   H HD2  . PRO A 1 78  ? -36.843 -11.413 -7.954  1.00 0.00 ? 78  PRO A HD2  1  
ATOM 1239   H HD3  . PRO A 1 78  ? -37.779 -12.936 -7.879  1.00 0.00 ? 78  PRO A HD3  1  
ATOM 1240   N N    . THR A 1 79  ? -35.362 -11.260 -3.204  1.00 0.00 ? 79  THR A N    1  
ATOM 1241   C CA   . THR A 1 79  ? -34.995 -10.114 -2.389  1.00 0.00 ? 79  THR A CA   1  
ATOM 1242   C C    . THR A 1 79  ? -33.908 -10.481 -1.381  1.00 0.00 ? 79  THR A C    1  
ATOM 1243   O O    . THR A 1 79  ? -33.773 -11.644 -0.987  1.00 0.00 ? 79  THR A O    1  
ATOM 1244   C CB   . THR A 1 79  ? -36.221 -9.566  -1.633  1.00 0.00 ? 79  THR A CB   1  
ATOM 1245   O OG1  . THR A 1 79  ? -37.415 -9.908  -2.351  1.00 0.00 ? 79  THR A OG1  1  
ATOM 1246   C CG2  . THR A 1 79  ? -36.135 -8.053  -1.500  1.00 0.00 ? 79  THR A CG2  1  
ATOM 1247   H H    . THR A 1 79  ? -35.493 -12.133 -2.770  1.00 0.00 ? 79  THR A H    1  
ATOM 1248   H HA   . THR A 1 79  ? -34.614 -9.336  -3.050  1.00 0.00 ? 79  THR A HA   1  
ATOM 1249   H HB   . THR A 1 79  ? -36.256 -10.012 -0.639  1.00 0.00 ? 79  THR A HB   1  
ATOM 1250   H HG1  . THR A 1 79  ? -37.191 -10.517 -3.066  1.00 0.00 ? 79  THR A HG1  1  
ATOM 1251   H HG21 . THR A 1 79  ? -36.101 -7.603  -2.492  1.00 0.00 ? 79  THR A HG21 1  
ATOM 1252   H HG22 . THR A 1 79  ? -37.006 -7.679  -0.962  1.00 0.00 ? 79  THR A HG22 1  
ATOM 1253   H HG23 . THR A 1 79  ? -35.231 -7.788  -0.951  1.00 0.00 ? 79  THR A HG23 1  
ATOM 1254   N N    . LEU A 1 80  ? -33.139 -9.480  -0.976  1.00 0.00 ? 80  LEU A N    1  
ATOM 1255   C CA   . LEU A 1 80  ? -32.067 -9.666  -0.009  1.00 0.00 ? 80  LEU A CA   1  
ATOM 1256   C C    . LEU A 1 80  ? -32.583 -9.325  1.384   1.00 0.00 ? 80  LEU A C    1  
ATOM 1257   O O    . LEU A 1 80  ? -33.415 -8.431  1.540   1.00 0.00 ? 80  LEU A O    1  
ATOM 1258   C CB   . LEU A 1 80  ? -30.880 -8.763  -0.370  1.00 0.00 ? 80  LEU A CB   1  
ATOM 1259   C CG   . LEU A 1 80  ? -29.586 -8.976  0.420   1.00 0.00 ? 80  LEU A CG   1  
ATOM 1260   C CD1  . LEU A 1 80  ? -28.974 -10.327 0.097   1.00 0.00 ? 80  LEU A CD1  1  
ATOM 1261   C CD2  . LEU A 1 80  ? -28.596 -7.857  0.135   1.00 0.00 ? 80  LEU A CD2  1  
ATOM 1262   H H    . LEU A 1 80  ? -33.308 -8.585  -1.325  1.00 0.00 ? 80  LEU A H    1  
ATOM 1263   H HA   . LEU A 1 80  ? -31.743 -10.706 -0.028  1.00 0.00 ? 80  LEU A HA   1  
ATOM 1264   H HB2  . LEU A 1 80  ? -30.653 -8.922  -1.424  1.00 0.00 ? 80  LEU A HB2  1  
ATOM 1265   H HB3  . LEU A 1 80  ? -31.193 -7.730  -0.218  1.00 0.00 ? 80  LEU A HB3  1  
ATOM 1266   H HG   . LEU A 1 80  ? -29.827 -8.956  1.483   1.00 0.00 ? 80  LEU A HG   1  
ATOM 1267   H HD11 . LEU A 1 80  ? -28.067 -10.473 0.683   1.00 0.00 ? 80  LEU A HD11 1  
ATOM 1268   H HD12 . LEU A 1 80  ? -29.689 -11.115 0.336   1.00 0.00 ? 80  LEU A HD12 1  
ATOM 1269   H HD13 . LEU A 1 80  ? -28.729 -10.370 -0.965  1.00 0.00 ? 80  LEU A HD13 1  
ATOM 1270   H HD21 . LEU A 1 80  ? -29.044 -6.900  0.402   1.00 0.00 ? 80  LEU A HD21 1  
ATOM 1271   H HD22 . LEU A 1 80  ? -27.689 -8.007  0.722   1.00 0.00 ? 80  LEU A HD22 1  
ATOM 1272   H HD23 . LEU A 1 80  ? -28.344 -7.857  -0.925  1.00 0.00 ? 80  LEU A HD23 1  
ATOM 1273   N N    . GLN A 1 81  ? -32.105 -10.042 2.388   1.00 0.00 ? 81  GLN A N    1  
ATOM 1274   C CA   . GLN A 1 81  ? -32.525 -9.816  3.762   1.00 0.00 ? 81  GLN A CA   1  
ATOM 1275   C C    . GLN A 1 81  ? -31.434 -10.229 4.741   1.00 0.00 ? 81  GLN A C    1  
ATOM 1276   O O    . GLN A 1 81  ? -30.424 -10.811 4.346   1.00 0.00 ? 81  GLN A O    1  
ATOM 1277   C CB   . GLN A 1 81  ? -33.812 -10.583 4.069   1.00 0.00 ? 81  GLN A CB   1  
ATOM 1278   C CG   . GLN A 1 81  ? -33.726 -12.078 3.799   1.00 0.00 ? 81  GLN A CG   1  
ATOM 1279   C CD   . GLN A 1 81  ? -34.840 -12.863 4.468   1.00 0.00 ? 81  GLN A CD   1  
ATOM 1280   O OE1  . GLN A 1 81  ? -35.922 -12.338 4.726   1.00 0.00 ? 81  GLN A OE1  1  
ATOM 1281   N NE2  . GLN A 1 81  ? -34.589 -14.130 4.744   1.00 0.00 ? 81  GLN A NE2  1  
ATOM 1282   H H    . GLN A 1 81  ? -31.443 -10.746 2.200   1.00 0.00 ? 81  GLN A H    1  
ATOM 1283   H HA   . GLN A 1 81  ? -32.718 -8.750  3.886   1.00 0.00 ? 81  GLN A HA   1  
ATOM 1284   H HB2  . GLN A 1 81  ? -34.054 -10.438 5.122   1.00 0.00 ? 81  GLN A HB2  1  
ATOM 1285   H HB3  . GLN A 1 81  ? -34.611 -10.170 3.453   1.00 0.00 ? 81  GLN A HB3  1  
ATOM 1286   H HG2  . GLN A 1 81  ? -33.781 -12.243 2.723   1.00 0.00 ? 81  GLN A HG2  1  
ATOM 1287   H HG3  . GLN A 1 81  ? -32.769 -12.445 4.171   1.00 0.00 ? 81  GLN A HG3  1  
ATOM 1288   H HE21 . GLN A 1 81  ? -33.711 -14.493 4.506   1.00 0.00 ? 81  GLN A HE21 1  
ATOM 1289   H HE22 . GLN A 1 81  ? -35.294 -14.655 5.176   1.00 0.00 ? 81  GLN A HE22 1  
ATOM 1290   N N    . LEU A 1 82  ? -31.649 -9.928  6.014   1.00 0.00 ? 82  LEU A N    1  
ATOM 1291   C CA   . LEU A 1 82  ? -30.702 -10.279 7.062   1.00 0.00 ? 82  LEU A CA   1  
ATOM 1292   C C    . LEU A 1 82  ? -31.287 -11.382 7.935   1.00 0.00 ? 82  LEU A C    1  
ATOM 1293   O O    . LEU A 1 82  ? -32.357 -11.220 8.521   1.00 0.00 ? 82  LEU A O    1  
ATOM 1294   C CB   . LEU A 1 82  ? -30.373 -9.057  7.932   1.00 0.00 ? 82  LEU A CB   1  
ATOM 1295   C CG   . LEU A 1 82  ? -29.230 -8.148  7.464   1.00 0.00 ? 82  LEU A CG   1  
ATOM 1296   C CD1  . LEU A 1 82  ? -27.945 -8.938  7.270   1.00 0.00 ? 82  LEU A CD1  1  
ATOM 1297   C CD2  . LEU A 1 82  ? -29.605 -7.387  6.202   1.00 0.00 ? 82  LEU A CD2  1  
ATOM 1298   H H    . LEU A 1 82  ? -32.475 -9.461  6.258   1.00 0.00 ? 82  LEU A H    1  
ATOM 1299   H HA   . LEU A 1 82  ? -29.784 -10.638 6.597   1.00 0.00 ? 82  LEU A HA   1  
ATOM 1300   H HB2  . LEU A 1 82  ? -31.274 -8.446  7.992   1.00 0.00 ? 82  LEU A HB2  1  
ATOM 1301   H HB3  . LEU A 1 82  ? -30.115 -9.422  8.926   1.00 0.00 ? 82  LEU A HB3  1  
ATOM 1302   H HG   . LEU A 1 82  ? -29.050 -7.414  8.249   1.00 0.00 ? 82  LEU A HG   1  
ATOM 1303   H HD11 . LEU A 1 82  ? -27.137 -8.270  6.973   1.00 0.00 ? 82  LEU A HD11 1  
ATOM 1304   H HD12 . LEU A 1 82  ? -27.679 -9.431  8.205   1.00 0.00 ? 82  LEU A HD12 1  
ATOM 1305   H HD13 . LEU A 1 82  ? -28.096 -9.689  6.494   1.00 0.00 ? 82  LEU A HD13 1  
ATOM 1306   H HD21 . LEU A 1 82  ? -30.502 -6.796  6.390   1.00 0.00 ? 82  LEU A HD21 1  
ATOM 1307   H HD22 . LEU A 1 82  ? -28.792 -6.722  5.910   1.00 0.00 ? 82  LEU A HD22 1  
ATOM 1308   H HD23 . LEU A 1 82  ? -29.799 -8.095  5.396   1.00 0.00 ? 82  LEU A HD23 1  
ATOM 1309   N N    . GLU A 1 83  ? -30.594 -12.509 8.010   1.00 0.00 ? 83  GLU A N    1  
ATOM 1310   C CA   . GLU A 1 83  ? -31.054 -13.632 8.813   1.00 0.00 ? 83  GLU A CA   1  
ATOM 1311   C C    . GLU A 1 83  ? -30.185 -13.830 10.050  1.00 0.00 ? 83  GLU A C    1  
ATOM 1312   O O    . GLU A 1 83  ? -28.953 -13.774 9.972   1.00 0.00 ? 83  GLU A O    1  
ATOM 1313   C CB   . GLU A 1 83  ? -31.091 -14.917 7.983   1.00 0.00 ? 83  GLU A CB   1  
ATOM 1314   C CG   . GLU A 1 83  ? -32.353 -15.081 7.153   1.00 0.00 ? 83  GLU A CG   1  
ATOM 1315   C CD   . GLU A 1 83  ? -32.471 -16.459 6.533   1.00 0.00 ? 83  GLU A CD   1  
ATOM 1316   O OE1  . GLU A 1 83  ? -32.513 -17.455 7.285   1.00 0.00 ? 83  GLU A OE1  1  
ATOM 1317   O OE2  . GLU A 1 83  ? -32.533 -16.556 5.289   1.00 0.00 ? 83  GLU A OE2  1  
ATOM 1318   H H    . GLU A 1 83  ? -29.741 -12.585 7.521   1.00 0.00 ? 83  GLU A H    1  
ATOM 1319   H HA   . GLU A 1 83  ? -32.069 -13.410 9.143   1.00 0.00 ? 83  GLU A HA   1  
ATOM 1320   H HB2  . GLU A 1 83  ? -30.235 -14.914 7.309   1.00 0.00 ? 83  GLU A HB2  1  
ATOM 1321   H HB3  . GLU A 1 83  ? -31.015 -15.766 8.663   1.00 0.00 ? 83  GLU A HB3  1  
ATOM 1322   H HG2  . GLU A 1 83  ? -33.218 -14.911 7.794   1.00 0.00 ? 83  GLU A HG2  1  
ATOM 1323   H HG3  . GLU A 1 83  ? -32.346 -14.339 6.356   1.00 0.00 ? 83  GLU A HG3  1  
ATOM 1324   H HE2  . GLU A 1 83  ? -32.609 -17.457 4.967   1.00 0.00 ? 83  GLU A HE2  1  
ATOM 1325   N N    . SER A 1 84  ? -30.837 -14.045 11.187  1.00 0.00 ? 84  SER A N    1  
ATOM 1326   C CA   . SER A 1 84  ? -30.140 -14.273 12.442  1.00 0.00 ? 84  SER A CA   1  
ATOM 1327   C C    . SER A 1 84  ? -29.855 -15.764 12.599  1.00 0.00 ? 84  SER A C    1  
ATOM 1328   O O    . SER A 1 84  ? -30.652 -16.507 13.176  1.00 0.00 ? 84  SER A O    1  
ATOM 1329   C CB   . SER A 1 84  ? -30.976 -13.767 13.619  1.00 0.00 ? 84  SER A CB   1  
ATOM 1330   O OG   . SER A 1 84  ? -31.455 -12.456 13.376  1.00 0.00 ? 84  SER A OG   1  
ATOM 1331   H H    . SER A 1 84  ? -31.818 -14.052 11.179  1.00 0.00 ? 84  SER A H    1  
ATOM 1332   H HA   . SER A 1 84  ? -29.195 -13.730 12.424  1.00 0.00 ? 84  SER A HA   1  
ATOM 1333   H HB2  . SER A 1 84  ? -31.825 -14.435 13.766  1.00 0.00 ? 84  SER A HB2  1  
ATOM 1334   H HB3  . SER A 1 84  ? -30.359 -13.760 14.518  1.00 0.00 ? 84  SER A HB3  1  
ATOM 1335   H HG   . SER A 1 84  ? -31.929 -12.439 12.535  1.00 0.00 ? 84  SER A HG   1  
ATOM 1336   N N    . VAL A 1 85  ? -28.726 -16.196 12.061  1.00 0.00 ? 85  VAL A N    1  
ATOM 1337   C CA   . VAL A 1 85  ? -28.337 -17.597 12.111  1.00 0.00 ? 85  VAL A CA   1  
ATOM 1338   C C    . VAL A 1 85  ? -27.849 -18.003 13.499  1.00 0.00 ? 85  VAL A C    1  
ATOM 1339   O O    . VAL A 1 85  ? -27.490 -17.153 14.315  1.00 0.00 ? 85  VAL A O    1  
ATOM 1340   C CB   . VAL A 1 85  ? -27.247 -17.923 11.068  1.00 0.00 ? 85  VAL A CB   1  
ATOM 1341   C CG1  . VAL A 1 85  ? -27.815 -17.842 9.660   1.00 0.00 ? 85  VAL A CG1  1  
ATOM 1342   C CG2  . VAL A 1 85  ? -26.057 -16.986 11.220  1.00 0.00 ? 85  VAL A CG2  1  
ATOM 1343   H H    . VAL A 1 85  ? -28.130 -15.549 11.625  1.00 0.00 ? 85  VAL A H    1  
ATOM 1344   H HA   . VAL A 1 85  ? -29.221 -18.190 11.876  1.00 0.00 ? 85  VAL A HA   1  
ATOM 1345   H HB   . VAL A 1 85  ? -26.903 -18.943 11.241  1.00 0.00 ? 85  VAL A HB   1  
ATOM 1346   H HG11 . VAL A 1 85  ? -27.042 -18.096 8.935   1.00 0.00 ? 85  VAL A HG11 1  
ATOM 1347   H HG12 . VAL A 1 85  ? -28.646 -18.542 9.563   1.00 0.00 ? 85  VAL A HG12 1  
ATOM 1348   H HG13 . VAL A 1 85  ? -28.170 -16.829 9.469   1.00 0.00 ? 85  VAL A HG13 1  
ATOM 1349   H HG21 . VAL A 1 85  ? -25.648 -17.080 12.226  1.00 0.00 ? 85  VAL A HG21 1  
ATOM 1350   H HG22 . VAL A 1 85  ? -25.289 -17.243 10.491  1.00 0.00 ? 85  VAL A HG22 1  
ATOM 1351   H HG23 . VAL A 1 85  ? -26.382 -15.958 11.056  1.00 0.00 ? 85  VAL A HG23 1  
ATOM 1352   N N    . ASP A 1 86  ? -27.881 -19.310 13.757  1.00 0.00 ? 86  ASP A N    1  
ATOM 1353   C CA   . ASP A 1 86  ? -27.430 -19.872 15.032  1.00 0.00 ? 86  ASP A CA   1  
ATOM 1354   C C    . ASP A 1 86  ? -26.026 -19.375 15.380  1.00 0.00 ? 86  ASP A C    1  
ATOM 1355   O O    . ASP A 1 86  ? -25.069 -19.626 14.647  1.00 0.00 ? 86  ASP A O    1  
ATOM 1356   C CB   . ASP A 1 86  ? -27.455 -21.403 14.982  1.00 0.00 ? 86  ASP A CB   1  
ATOM 1357   C CG   . ASP A 1 86  ? -27.302 -22.041 16.350  1.00 0.00 ? 86  ASP A CG   1  
ATOM 1358   O OD1  . ASP A 1 86  ? -28.199 -22.800 16.764  1.00 0.00 ? 86  ASP A OD1  1  
ATOM 1359   O OD2  . ASP A 1 86  ? -26.281 -21.797 17.018  1.00 0.00 ? 86  ASP A OD2  1  
ATOM 1360   H H    . ASP A 1 86  ? -28.253 -19.906 13.074  1.00 0.00 ? 86  ASP A H    1  
ATOM 1361   H HA   . ASP A 1 86  ? -28.116 -19.540 15.811  1.00 0.00 ? 86  ASP A HA   1  
ATOM 1362   H HB2  . ASP A 1 86  ? -28.405 -21.723 14.553  1.00 0.00 ? 86  ASP A HB2  1  
ATOM 1363   H HB3  . ASP A 1 86  ? -26.640 -21.745 14.344  1.00 0.00 ? 86  ASP A HB3  1  
ATOM 1364   H HD2  . ASP A 1 86  ? -26.252 -22.238 17.871  1.00 0.00 ? 86  ASP A HD2  1  
ATOM 1365   N N    . PRO A 1 87  ? -25.894 -18.680 16.517  1.00 0.00 ? 87  PRO A N    1  
ATOM 1366   C CA   . PRO A 1 87  ? -24.620 -18.101 16.966  1.00 0.00 ? 87  PRO A CA   1  
ATOM 1367   C C    . PRO A 1 87  ? -23.527 -19.127 17.282  1.00 0.00 ? 87  PRO A C    1  
ATOM 1368   O O    . PRO A 1 87  ? -22.348 -18.776 17.359  1.00 0.00 ? 87  PRO A O    1  
ATOM 1369   C CB   . PRO A 1 87  ? -24.997 -17.323 18.235  1.00 0.00 ? 87  PRO A CB   1  
ATOM 1370   C CG   . PRO A 1 87  ? -26.478 -17.171 18.172  1.00 0.00 ? 87  PRO A CG   1  
ATOM 1371   C CD   . PRO A 1 87  ? -26.983 -18.392 17.464  1.00 0.00 ? 87  PRO A CD   1  
ATOM 1372   H HA   . PRO A 1 87  ? -24.241 -17.419 16.204  1.00 0.00 ? 87  PRO A HA   1  
ATOM 1373   H HB2  . PRO A 1 87  ? -24.682 -17.846 19.138  1.00 0.00 ? 87  PRO A HB2  1  
ATOM 1374   H HB3  . PRO A 1 87  ? -24.545 -16.332 18.185  1.00 0.00 ? 87  PRO A HB3  1  
ATOM 1375   H HG2  . PRO A 1 87  ? -26.869 -17.173 19.190  1.00 0.00 ? 87  PRO A HG2  1  
ATOM 1376   H HG3  . PRO A 1 87  ? -26.767 -16.258 17.650  1.00 0.00 ? 87  PRO A HG3  1  
ATOM 1377   H HD2  . PRO A 1 87  ? -27.155 -19.214 18.159  1.00 0.00 ? 87  PRO A HD2  1  
ATOM 1378   H HD3  . PRO A 1 87  ? -27.896 -18.162 16.916  1.00 0.00 ? 87  PRO A HD3  1  
ATOM 1379   N N    . LYS A 1 88  ? -23.898 -20.385 17.473  1.00 0.00 ? 88  LYS A N    1  
ATOM 1380   C CA   . LYS A 1 88  ? -22.906 -21.409 17.791  1.00 0.00 ? 88  LYS A CA   1  
ATOM 1381   C C    . LYS A 1 88  ? -22.753 -22.433 16.671  1.00 0.00 ? 88  LYS A C    1  
ATOM 1382   O O    . LYS A 1 88  ? -21.799 -23.211 16.660  1.00 0.00 ? 88  LYS A O    1  
ATOM 1383   C CB   . LYS A 1 88  ? -23.222 -22.097 19.122  1.00 0.00 ? 88  LYS A CB   1  
ATOM 1384   C CG   . LYS A 1 88  ? -24.452 -22.984 19.085  1.00 0.00 ? 88  LYS A CG   1  
ATOM 1385   C CD   . LYS A 1 88  ? -25.046 -23.166 20.467  1.00 0.00 ? 88  LYS A CD   1  
ATOM 1386   C CE   . LYS A 1 88  ? -26.494 -23.611 20.376  1.00 0.00 ? 88  LYS A CE   1  
ATOM 1387   N NZ   . LYS A 1 88  ? -27.321 -22.639 19.611  1.00 0.00 ? 88  LYS A NZ   1  
ATOM 1388   H H    . LYS A 1 88  ? -24.851 -20.634 17.399  1.00 0.00 ? 88  LYS A H    1  
ATOM 1389   H HA   . LYS A 1 88  ? -21.948 -20.901 17.903  1.00 0.00 ? 88  LYS A HA   1  
ATOM 1390   H HB2  . LYS A 1 88  ? -22.366 -22.711 19.401  1.00 0.00 ? 88  LYS A HB2  1  
ATOM 1391   H HB3  . LYS A 1 88  ? -23.378 -21.327 19.877  1.00 0.00 ? 88  LYS A HB3  1  
ATOM 1392   H HG2  . LYS A 1 88  ? -25.198 -22.527 18.435  1.00 0.00 ? 88  LYS A HG2  1  
ATOM 1393   H HG3  . LYS A 1 88  ? -24.174 -23.960 18.688  1.00 0.00 ? 88  LYS A HG3  1  
ATOM 1394   H HD2  . LYS A 1 88  ? -24.474 -23.920 21.006  1.00 0.00 ? 88  LYS A HD2  1  
ATOM 1395   H HD3  . LYS A 1 88  ? -24.997 -22.219 21.004  1.00 0.00 ? 88  LYS A HD3  1  
ATOM 1396   H HE2  . LYS A 1 88  ? -26.536 -24.580 19.881  1.00 0.00 ? 88  LYS A HE2  1  
ATOM 1397   H HE3  . LYS A 1 88  ? -26.899 -23.705 21.384  1.00 0.00 ? 88  LYS A HE3  1  
ATOM 1398   H HZ1  . LYS A 1 88  ? -27.258 -21.699 20.044  1.00 0.00 ? 88  LYS A HZ1  1  
ATOM 1399   H HZ2  . LYS A 1 88  ? -28.316 -22.939 19.608  1.00 0.00 ? 88  LYS A HZ2  1  
ATOM 1400   H HZ3  . LYS A 1 88  ? -26.989 -22.575 18.624  1.00 0.00 ? 88  LYS A HZ3  1  
ATOM 1401   N N    . ASN A 1 89  ? -23.689 -22.436 15.733  1.00 0.00 ? 89  ASN A N    1  
ATOM 1402   C CA   . ASN A 1 89  ? -23.637 -23.374 14.614  1.00 0.00 ? 89  ASN A CA   1  
ATOM 1403   C C    . ASN A 1 89  ? -23.181 -22.681 13.339  1.00 0.00 ? 89  ASN A C    1  
ATOM 1404   O O    . ASN A 1 89  ? -23.083 -23.304 12.279  1.00 0.00 ? 89  ASN A O    1  
ATOM 1405   C CB   . ASN A 1 89  ? -24.996 -24.043 14.391  1.00 0.00 ? 89  ASN A CB   1  
ATOM 1406   C CG   . ASN A 1 89  ? -25.213 -25.251 15.282  1.00 0.00 ? 89  ASN A CG   1  
ATOM 1407   O OD1  . ASN A 1 89  ? -24.664 -26.326 15.032  1.00 0.00 ? 89  ASN A OD1  1  
ATOM 1408   N ND2  . ASN A 1 89  ? -26.024 -25.090 16.318  1.00 0.00 ? 89  ASN A ND2  1  
ATOM 1409   H H    . ASN A 1 89  ? -24.434 -21.799 15.793  1.00 0.00 ? 89  ASN A H    1  
ATOM 1410   H HA   . ASN A 1 89  ? -22.911 -24.149 14.861  1.00 0.00 ? 89  ASN A HA   1  
ATOM 1411   H HB2  . ASN A 1 89  ? -25.780 -23.314 14.593  1.00 0.00 ? 89  ASN A HB2  1  
ATOM 1412   H HB3  . ASN A 1 89  ? -25.061 -24.362 13.351  1.00 0.00 ? 89  ASN A HB3  1  
ATOM 1413   H HD21 . ASN A 1 89  ? -26.436 -24.210 16.455  1.00 0.00 ? 89  ASN A HD21 1  
ATOM 1414   H HD22 . ASN A 1 89  ? -26.188 -25.863 16.902  1.00 0.00 ? 89  ASN A HD22 1  
ATOM 1415   N N    . TYR A 1 90  ? -22.898 -21.394 13.450  1.00 0.00 ? 90  TYR A N    1  
ATOM 1416   C CA   . TYR A 1 90  ? -22.456 -20.598 12.318  1.00 0.00 ? 90  TYR A CA   1  
ATOM 1417   C C    . TYR A 1 90  ? -21.280 -19.722 12.737  1.00 0.00 ? 90  TYR A C    1  
ATOM 1418   O O    . TYR A 1 90  ? -21.179 -19.335 13.901  1.00 0.00 ? 90  TYR A O    1  
ATOM 1419   C CB   . TYR A 1 90  ? -23.604 -19.729 11.787  1.00 0.00 ? 90  TYR A CB   1  
ATOM 1420   C CG   . TYR A 1 90  ? -24.643 -20.481 10.976  1.00 0.00 ? 90  TYR A CG   1  
ATOM 1421   C CD1  . TYR A 1 90  ? -25.650 -21.210 11.595  1.00 0.00 ? 90  TYR A CD1  1  
ATOM 1422   C CD2  . TYR A 1 90  ? -24.622 -20.451 9.586   1.00 0.00 ? 90  TYR A CD2  1  
ATOM 1423   C CE1  . TYR A 1 90  ? -26.602 -21.890 10.857  1.00 0.00 ? 90  TYR A CE1  1  
ATOM 1424   C CE2  . TYR A 1 90  ? -25.569 -21.128 8.841   1.00 0.00 ? 90  TYR A CE2  1  
ATOM 1425   C CZ   . TYR A 1 90  ? -26.557 -21.847 9.480   1.00 0.00 ? 90  TYR A CZ   1  
ATOM 1426   O OH   . TYR A 1 90  ? -27.504 -22.522 8.739   1.00 0.00 ? 90  TYR A OH   1  
ATOM 1427   H H    . TYR A 1 90  ? -22.962 -20.967 14.328  1.00 0.00 ? 90  TYR A H    1  
ATOM 1428   H HA   . TYR A 1 90  ? -22.131 -21.271 11.524  1.00 0.00 ? 90  TYR A HA   1  
ATOM 1429   H HB2  . TYR A 1 90  ? -24.103 -19.264 12.637  1.00 0.00 ? 90  TYR A HB2  1  
ATOM 1430   H HB3  . TYR A 1 90  ? -23.179 -18.946 11.159  1.00 0.00 ? 90  TYR A HB3  1  
ATOM 1431   H HD1  . TYR A 1 90  ? -25.691 -21.247 12.674  1.00 0.00 ? 90  TYR A HD1  1  
ATOM 1432   H HD2  . TYR A 1 90  ? -23.851 -19.889 9.080   1.00 0.00 ? 90  TYR A HD2  1  
ATOM 1433   H HE1  . TYR A 1 90  ? -27.377 -22.453 11.357  1.00 0.00 ? 90  TYR A HE1  1  
ATOM 1434   H HE2  . TYR A 1 90  ? -25.536 -21.094 7.762   1.00 0.00 ? 90  TYR A HE2  1  
ATOM 1435   H HH   . TYR A 1 90  ? -27.275 -22.468 7.792   1.00 0.00 ? 90  TYR A HH   1  
ATOM 1436   N N    . PRO A 1 91  ? -20.376 -19.393 11.803  1.00 0.00 ? 91  PRO A N    1  
ATOM 1437   C CA   . PRO A 1 91  ? -20.466 -19.831 10.409  1.00 0.00 ? 91  PRO A CA   1  
ATOM 1438   C C    . PRO A 1 91  ? -19.943 -21.252 10.204  1.00 0.00 ? 91  PRO A C    1  
ATOM 1439   O O    . PRO A 1 91  ? -19.463 -21.897 11.137  1.00 0.00 ? 91  PRO A O    1  
ATOM 1440   C CB   . PRO A 1 91  ? -19.562 -18.835 9.684   1.00 0.00 ? 91  PRO A CB   1  
ATOM 1441   C CG   . PRO A 1 91  ? -18.521 -18.478 10.690  1.00 0.00 ? 91  PRO A CG   1  
ATOM 1442   C CD   . PRO A 1 91  ? -19.183 -18.560 12.040  1.00 0.00 ? 91  PRO A CD   1  
ATOM 1443   H HA   . PRO A 1 91  ? -21.492 -19.765 10.047  1.00 0.00 ? 91  PRO A HA   1  
ATOM 1444   H HB2  . PRO A 1 91  ? -19.126 -19.263 8.781   1.00 0.00 ? 91  PRO A HB2  1  
ATOM 1445   H HB3  . PRO A 1 91  ? -20.140 -17.942 9.447   1.00 0.00 ? 91  PRO A HB3  1  
ATOM 1446   H HG2  . PRO A 1 91  ? -17.733 -19.229 10.647  1.00 0.00 ? 91  PRO A HG2  1  
ATOM 1447   H HG3  . PRO A 1 91  ? -18.116 -17.483 10.507  1.00 0.00 ? 91  PRO A HG3  1  
ATOM 1448   H HD2  . PRO A 1 91  ? -18.517 -19.008 12.778  1.00 0.00 ? 91  PRO A HD2  1  
ATOM 1449   H HD3  . PRO A 1 91  ? -19.495 -17.568 12.364  1.00 0.00 ? 91  PRO A HD3  1  
ATOM 1450   N N    . LYS A 1 92  ? -20.036 -21.722 8.972   1.00 0.00 ? 92  LYS A N    1  
ATOM 1451   C CA   . LYS A 1 92  ? -19.580 -23.054 8.608   1.00 0.00 ? 92  LYS A CA   1  
ATOM 1452   C C    . LYS A 1 92  ? -19.075 -23.024 7.174   1.00 0.00 ? 92  LYS A C    1  
ATOM 1453   O O    . LYS A 1 92  ? -19.331 -22.060 6.455   1.00 0.00 ? 92  LYS A O    1  
ATOM 1454   C CB   . LYS A 1 92  ? -20.723 -24.070 8.754   1.00 0.00 ? 92  LYS A CB   1  
ATOM 1455   C CG   . LYS A 1 92  ? -22.031 -23.635 8.110   1.00 0.00 ? 92  LYS A CG   1  
ATOM 1456   C CD   . LYS A 1 92  ? -23.093 -24.717 8.207   1.00 0.00 ? 92  LYS A CD   1  
ATOM 1457   C CE   . LYS A 1 92  ? -24.381 -24.277 7.530   1.00 0.00 ? 92  LYS A CE   1  
ATOM 1458   N NZ   . LYS A 1 92  ? -25.312 -25.415 7.306   1.00 0.00 ? 92  LYS A NZ   1  
ATOM 1459   H H    . LYS A 1 92  ? -20.406 -21.143 8.270   1.00 0.00 ? 92  LYS A H    1  
ATOM 1460   H HA   . LYS A 1 92  ? -18.765 -23.344 9.271   1.00 0.00 ? 92  LYS A HA   1  
ATOM 1461   H HB2  . LYS A 1 92  ? -20.409 -25.006 8.292   1.00 0.00 ? 92  LYS A HB2  1  
ATOM 1462   H HB3  . LYS A 1 92  ? -20.903 -24.232 9.817   1.00 0.00 ? 92  LYS A HB3  1  
ATOM 1463   H HG2  . LYS A 1 92  ? -22.392 -22.739 8.615   1.00 0.00 ? 92  LYS A HG2  1  
ATOM 1464   H HG3  . LYS A 1 92  ? -21.850 -23.411 7.059   1.00 0.00 ? 92  LYS A HG3  1  
ATOM 1465   H HD2  . LYS A 1 92  ? -22.726 -25.621 7.722   1.00 0.00 ? 92  LYS A HD2  1  
ATOM 1466   H HD3  . LYS A 1 92  ? -23.295 -24.924 9.258   1.00 0.00 ? 92  LYS A HD3  1  
ATOM 1467   H HE2  . LYS A 1 92  ? -24.875 -23.536 8.159   1.00 0.00 ? 92  LYS A HE2  1  
ATOM 1468   H HE3  . LYS A 1 92  ? -24.138 -23.826 6.568   1.00 0.00 ? 92  LYS A HE3  1  
ATOM 1469   H HZ1  . LYS A 1 92  ? -24.867 -26.128 6.695   1.00 0.00 ? 92  LYS A HZ1  1  
ATOM 1470   H HZ2  . LYS A 1 92  ? -26.188 -25.076 6.844   1.00 0.00 ? 92  LYS A HZ2  1  
ATOM 1471   H HZ3  . LYS A 1 92  ? -25.565 -25.862 8.212   1.00 0.00 ? 92  LYS A HZ3  1  
ATOM 1472   N N    . LYS A 1 93  ? -18.344 -24.049 6.760   1.00 0.00 ? 93  LYS A N    1  
ATOM 1473   C CA   . LYS A 1 93  ? -17.828 -24.088 5.399   1.00 0.00 ? 93  LYS A CA   1  
ATOM 1474   C C    . LYS A 1 93  ? -18.950 -24.351 4.401   1.00 0.00 ? 93  LYS A C    1  
ATOM 1475   O O    . LYS A 1 93  ? -19.064 -23.668 3.387   1.00 0.00 ? 93  LYS A O    1  
ATOM 1476   C CB   . LYS A 1 93  ? -16.688 -25.094 5.234   1.00 0.00 ? 93  LYS A CB   1  
ATOM 1477   C CG   . LYS A 1 93  ? -15.657 -24.657 4.202   1.00 0.00 ? 93  LYS A CG   1  
ATOM 1478   C CD   . LYS A 1 93  ? -14.570 -25.699 4.001   1.00 0.00 ? 93  LYS A CD   1  
ATOM 1479   C CE   . LYS A 1 93  ? -13.441 -25.148 3.142   1.00 0.00 ? 93  LYS A CE   1  
ATOM 1480   N NZ   . LYS A 1 93  ? -13.945 -24.536 1.882   1.00 0.00 ? 93  LYS A NZ   1  
ATOM 1481   H H    . LYS A 1 93  ? -18.144 -24.783 7.379   1.00 0.00 ? 93  LYS A H    1  
ATOM 1482   H HA   . LYS A 1 93  ? -17.420 -23.100 5.184   1.00 0.00 ? 93  LYS A HA   1  
ATOM 1483   H HB2  . LYS A 1 93  ? -16.188 -25.215 6.195   1.00 0.00 ? 93  LYS A HB2  1  
ATOM 1484   H HB3  . LYS A 1 93  ? -17.110 -26.050 4.922   1.00 0.00 ? 93  LYS A HB3  1  
ATOM 1485   H HG2  . LYS A 1 93  ? -16.162 -24.488 3.251   1.00 0.00 ? 93  LYS A HG2  1  
ATOM 1486   H HG3  . LYS A 1 93  ? -15.196 -23.728 4.538   1.00 0.00 ? 93  LYS A HG3  1  
ATOM 1487   H HD2  . LYS A 1 93  ? -14.171 -25.990 4.972   1.00 0.00 ? 93  LYS A HD2  1  
ATOM 1488   H HD3  . LYS A 1 93  ? -14.999 -26.571 3.508   1.00 0.00 ? 93  LYS A HD3  1  
ATOM 1489   H HE2  . LYS A 1 93  ? -12.901 -24.391 3.711   1.00 0.00 ? 93  LYS A HE2  1  
ATOM 1490   H HE3  . LYS A 1 93  ? -12.759 -25.961 2.892   1.00 0.00 ? 93  LYS A HE3  1  
ATOM 1491   H HZ1  . LYS A 1 93  ? -13.152 -24.336 1.240   1.00 0.00 ? 93  LYS A HZ1  1  
ATOM 1492   H HZ2  . LYS A 1 93  ? -14.447 -23.645 2.086   1.00 0.00 ? 93  LYS A HZ2  1  
ATOM 1493   H HZ3  . LYS A 1 93  ? -14.603 -25.189 1.404   1.00 0.00 ? 93  LYS A HZ3  1  
ATOM 1494   N N    . LYS A 1 94  ? -19.778 -25.343 4.680   1.00 0.00 ? 94  LYS A N    1  
ATOM 1495   C CA   . LYS A 1 94  ? -20.892 -25.659 3.806   1.00 0.00 ? 94  LYS A CA   1  
ATOM 1496   C C    . LYS A 1 94  ? -22.124 -24.877 4.243   1.00 0.00 ? 94  LYS A C    1  
ATOM 1497   O O    . LYS A 1 94  ? -22.956 -25.379 4.999   1.00 0.00 ? 94  LYS A O    1  
ATOM 1498   C CB   . LYS A 1 94  ? -21.179 -27.165 3.837   1.00 0.00 ? 94  LYS A CB   1  
ATOM 1499   C CG   . LYS A 1 94  ? -22.178 -27.641 2.792   1.00 0.00 ? 94  LYS A CG   1  
ATOM 1500   C CD   . LYS A 1 94  ? -21.685 -27.358 1.382   1.00 0.00 ? 94  LYS A CD   1  
ATOM 1501   C CE   . LYS A 1 94  ? -21.771 -28.595 0.503   1.00 0.00 ? 94  LYS A CE   1  
ATOM 1502   N NZ   . LYS A 1 94  ? -20.791 -29.638 0.912   1.00 0.00 ? 94  LYS A NZ   1  
ATOM 1503   H H    . LYS A 1 94  ? -19.637 -25.899 5.476   1.00 0.00 ? 94  LYS A H    1  
ATOM 1504   H HA   . LYS A 1 94  ? -20.632 -25.372 2.787   1.00 0.00 ? 94  LYS A HA   1  
ATOM 1505   H HB2  . LYS A 1 94  ? -20.240 -27.694 3.675   1.00 0.00 ? 94  LYS A HB2  1  
ATOM 1506   H HB3  . LYS A 1 94  ? -21.572 -27.416 4.822   1.00 0.00 ? 94  LYS A HB3  1  
ATOM 1507   H HG2  . LYS A 1 94  ? -22.326 -28.715 2.906   1.00 0.00 ? 94  LYS A HG2  1  
ATOM 1508   H HG3  . LYS A 1 94  ? -23.126 -27.126 2.946   1.00 0.00 ? 94  LYS A HG3  1  
ATOM 1509   H HD2  . LYS A 1 94  ? -22.297 -26.569 0.945   1.00 0.00 ? 94  LYS A HD2  1  
ATOM 1510   H HD3  . LYS A 1 94  ? -20.647 -27.028 1.430   1.00 0.00 ? 94  LYS A HD3  1  
ATOM 1511   H HE2  . LYS A 1 94  ? -22.777 -29.009 0.573   1.00 0.00 ? 94  LYS A HE2  1  
ATOM 1512   H HE3  . LYS A 1 94  ? -21.572 -28.309 -0.530  1.00 0.00 ? 94  LYS A HE3  1  
ATOM 1513   H HZ1  . LYS A 1 94  ? -19.850 -29.215 1.040   1.00 0.00 ? 94  LYS A HZ1  1  
ATOM 1514   H HZ2  . LYS A 1 94  ? -20.728 -30.378 0.181   1.00 0.00 ? 94  LYS A HZ2  1  
ATOM 1515   H HZ3  . LYS A 1 94  ? -21.085 -30.078 1.807   1.00 0.00 ? 94  LYS A HZ3  1  
ATOM 1516   N N    . MET A 1 95  ? -22.230 -23.642 3.776   1.00 0.00 ? 95  MET A N    1  
ATOM 1517   C CA   . MET A 1 95  ? -23.356 -22.787 4.129   1.00 0.00 ? 95  MET A CA   1  
ATOM 1518   C C    . MET A 1 95  ? -24.478 -22.969 3.125   1.00 0.00 ? 95  MET A C    1  
ATOM 1519   O O    . MET A 1 95  ? -24.241 -23.426 2.002   1.00 0.00 ? 95  MET A O    1  
ATOM 1520   C CB   . MET A 1 95  ? -22.928 -21.315 4.137   1.00 0.00 ? 95  MET A CB   1  
ATOM 1521   C CG   . MET A 1 95  ? -21.914 -20.954 5.210   1.00 0.00 ? 95  MET A CG   1  
ATOM 1522   S SD   . MET A 1 95  ? -22.675 -20.464 6.770   1.00 0.00 ? 95  MET A SD   1  
ATOM 1523   C CE   . MET A 1 95  ? -23.489 -18.942 6.288   1.00 0.00 ? 95  MET A CE   1  
ATOM 1524   H H    . MET A 1 95  ? -21.556 -23.295 3.157   1.00 0.00 ? 95  MET A H    1  
ATOM 1525   H HA   . MET A 1 95  ? -23.711 -23.063 5.122   1.00 0.00 ? 95  MET A HA   1  
ATOM 1526   H HB2  . MET A 1 95  ? -22.491 -21.083 3.165   1.00 0.00 ? 95  MET A HB2  1  
ATOM 1527   H HB3  . MET A 1 95  ? -23.817 -20.703 4.291   1.00 0.00 ? 95  MET A HB3  1  
ATOM 1528   H HG2  . MET A 1 95  ? -21.272 -21.816 5.391   1.00 0.00 ? 95  MET A HG2  1  
ATOM 1529   H HG3  . MET A 1 95  ? -21.298 -20.130 4.848   1.00 0.00 ? 95  MET A HG3  1  
ATOM 1530   H HE1  . MET A 1 95  ? -24.209 -19.152 5.497   1.00 0.00 ? 95  MET A HE1  1  
ATOM 1531   H HE2  . MET A 1 95  ? -24.009 -18.511 7.143   1.00 0.00 ? 95  MET A HE2  1  
ATOM 1532   H HE3  . MET A 1 95  ? -22.745 -18.234 5.924   1.00 0.00 ? 95  MET A HE3  1  
ATOM 1533   N N    . GLU A 1 96  ? -25.694 -22.626 3.536   1.00 0.00 ? 96  GLU A N    1  
ATOM 1534   C CA   . GLU A 1 96  ? -26.858 -22.726 2.667   1.00 0.00 ? 96  GLU A CA   1  
ATOM 1535   C C    . GLU A 1 96  ? -26.656 -21.871 1.419   1.00 0.00 ? 96  GLU A C    1  
ATOM 1536   O O    . GLU A 1 96  ? -26.073 -20.788 1.493   1.00 0.00 ? 96  GLU A O    1  
ATOM 1537   C CB   . GLU A 1 96  ? -28.120 -22.281 3.413   1.00 0.00 ? 96  GLU A CB   1  
ATOM 1538   C CG   . GLU A 1 96  ? -28.643 -23.278 4.442   1.00 0.00 ? 96  GLU A CG   1  
ATOM 1539   C CD   . GLU A 1 96  ? -27.682 -23.529 5.593   1.00 0.00 ? 96  GLU A CD   1  
ATOM 1540   O OE1  . GLU A 1 96  ? -27.590 -24.688 6.052   1.00 0.00 ? 96  GLU A OE1  1  
ATOM 1541   O OE2  . GLU A 1 96  ? -27.011 -22.577 6.042   1.00 0.00 ? 96  GLU A OE2  1  
ATOM 1542   H H    . GLU A 1 96  ? -25.823 -22.317 4.463   1.00 0.00 ? 96  GLU A H    1  
ATOM 1543   H HA   . GLU A 1 96  ? -26.979 -23.766 2.366   1.00 0.00 ? 96  GLU A HA   1  
ATOM 1544   H HB2  . GLU A 1 96  ? -27.897 -21.347 3.929   1.00 0.00 ? 96  GLU A HB2  1  
ATOM 1545   H HB3  . GLU A 1 96  ? -28.906 -22.110 2.677   1.00 0.00 ? 96  GLU A HB3  1  
ATOM 1546   H HG2  . GLU A 1 96  ? -29.578 -22.894 4.851   1.00 0.00 ? 96  GLU A HG2  1  
ATOM 1547   H HG3  . GLU A 1 96  ? -28.835 -24.225 3.938   1.00 0.00 ? 96  GLU A HG3  1  
ATOM 1548   H HE2  . GLU A 1 96  ? -26.426 -22.814 6.766   1.00 0.00 ? 96  GLU A HE2  1  
ATOM 1549   N N    . LYS A 1 97  ? -27.153 -22.353 0.285   1.00 0.00 ? 97  LYS A N    1  
ATOM 1550   C CA   . LYS A 1 97  ? -27.003 -21.657 -0.994  1.00 0.00 ? 97  LYS A CA   1  
ATOM 1551   C C    . LYS A 1 97  ? -27.542 -20.227 -0.969  1.00 0.00 ? 97  LYS A C    1  
ATOM 1552   O O    . LYS A 1 97  ? -27.083 -19.372 -1.726  1.00 0.00 ? 97  LYS A O    1  
ATOM 1553   C CB   . LYS A 1 97  ? -27.639 -22.454 -2.134  1.00 0.00 ? 97  LYS A CB   1  
ATOM 1554   C CG   . LYS A 1 97  ? -26.706 -22.690 -3.311  1.00 0.00 ? 97  LYS A CG   1  
ATOM 1555   C CD   . LYS A 1 97  ? -25.488 -23.499 -2.893  1.00 0.00 ? 97  LYS A CD   1  
ATOM 1556   C CE   . LYS A 1 97  ? -24.459 -23.582 -4.010  1.00 0.00 ? 97  LYS A CE   1  
ATOM 1557   N NZ   . LYS A 1 97  ? -24.994 -24.272 -5.215  1.00 0.00 ? 97  LYS A NZ   1  
ATOM 1558   H H    . LYS A 1 97  ? -27.640 -23.207 0.308   1.00 0.00 ? 97  LYS A H    1  
ATOM 1559   H HA   . LYS A 1 97  ? -25.934 -21.595 -1.194  1.00 0.00 ? 97  LYS A HA   1  
ATOM 1560   H HB2  . LYS A 1 97  ? -27.952 -23.423 -1.744  1.00 0.00 ? 97  LYS A HB2  1  
ATOM 1561   H HB3  . LYS A 1 97  ? -28.512 -21.908 -2.491  1.00 0.00 ? 97  LYS A HB3  1  
ATOM 1562   H HG2  . LYS A 1 97  ? -27.244 -23.232 -4.088  1.00 0.00 ? 97  LYS A HG2  1  
ATOM 1563   H HG3  . LYS A 1 97  ? -26.376 -21.727 -3.702  1.00 0.00 ? 97  LYS A HG3  1  
ATOM 1564   H HD2  . LYS A 1 97  ? -25.030 -23.025 -2.025  1.00 0.00 ? 97  LYS A HD2  1  
ATOM 1565   H HD3  . LYS A 1 97  ? -25.807 -24.507 -2.631  1.00 0.00 ? 97  LYS A HD3  1  
ATOM 1566   H HE2  . LYS A 1 97  ? -24.158 -22.572 -4.287  1.00 0.00 ? 97  LYS A HE2  1  
ATOM 1567   H HE3  . LYS A 1 97  ? -23.589 -24.129 -3.648  1.00 0.00 ? 97  LYS A HE3  1  
ATOM 1568   H HZ1  . LYS A 1 97  ? -24.245 -24.374 -5.930  1.00 0.00 ? 97  LYS A HZ1  1  
ATOM 1569   H HZ2  . LYS A 1 97  ? -25.777 -23.726 -5.628  1.00 0.00 ? 97  LYS A HZ2  1  
ATOM 1570   H HZ3  . LYS A 1 97  ? -25.342 -25.219 -4.962  1.00 0.00 ? 97  LYS A HZ3  1  
ATOM 1571   N N    . ARG A 1 98  ? -28.504 -19.966 -0.096  1.00 0.00 ? 98  ARG A N    1  
ATOM 1572   C CA   . ARG A 1 98  ? -29.082 -18.631 0.011   1.00 0.00 ? 98  ARG A CA   1  
ATOM 1573   C C    . ARG A 1 98  ? -28.135 -17.660 0.722   1.00 0.00 ? 98  ARG A C    1  
ATOM 1574   O O    . ARG A 1 98  ? -28.339 -16.446 0.685   1.00 0.00 ? 98  ARG A O    1  
ATOM 1575   C CB   . ARG A 1 98  ? -30.460 -18.663 0.681   1.00 0.00 ? 98  ARG A CB   1  
ATOM 1576   C CG   . ARG A 1 98  ? -30.447 -18.928 2.179   1.00 0.00 ? 98  ARG A CG   1  
ATOM 1577   C CD   . ARG A 1 98  ? -31.865 -19.056 2.711   1.00 0.00 ? 98  ARG A CD   1  
ATOM 1578   N NE   . ARG A 1 98  ? -31.931 -18.988 4.171   1.00 0.00 ? 98  ARG A NE   1  
ATOM 1579   C CZ   . ARG A 1 98  ? -32.003 -20.055 4.968   1.00 0.00 ? 98  ARG A CZ   1  
ATOM 1580   N NH1  . ARG A 1 98  ? -31.975 -21.280 4.454   1.00 0.00 ? 98  ARG A NH1  1  
ATOM 1581   N NH2  . ARG A 1 98  ? -32.111 -19.890 6.282   1.00 0.00 ? 98  ARG A NH2  1  
ATOM 1582   H H    . ARG A 1 98  ? -28.834 -20.690 0.479   1.00 0.00 ? 98  ARG A H    1  
ATOM 1583   H HA   . ARG A 1 98  ? -29.223 -18.262 -1.005  1.00 0.00 ? 98  ARG A HA   1  
ATOM 1584   H HB2  . ARG A 1 98  ? -30.939 -17.699 0.513   1.00 0.00 ? 98  ARG A HB2  1  
ATOM 1585   H HB3  . ARG A 1 98  ? -31.047 -19.449 0.206   1.00 0.00 ? 98  ARG A HB3  1  
ATOM 1586   H HG2  . ARG A 1 98  ? -29.906 -19.853 2.374   1.00 0.00 ? 98  ARG A HG2  1  
ATOM 1587   H HG3  . ARG A 1 98  ? -29.948 -18.101 2.684   1.00 0.00 ? 98  ARG A HG3  1  
ATOM 1588   H HD2  . ARG A 1 98  ? -32.469 -18.248 2.296   1.00 0.00 ? 98  ARG A HD2  1  
ATOM 1589   H HD3  . ARG A 1 98  ? -32.276 -20.012 2.387   1.00 0.00 ? 98  ARG A HD3  1  
ATOM 1590   H HE   . ARG A 1 98  ? -31.942 -18.086 4.582   1.00 0.00 ? 98  ARG A HE   1  
ATOM 1591   H HH11 . ARG A 1 98  ? -31.898 -21.407 3.463   1.00 0.00 ? 98  ARG A HH11 1  
ATOM 1592   H HH12 . ARG A 1 98  ? -32.032 -22.084 5.052   1.00 0.00 ? 98  ARG A HH12 1  
ATOM 1593   H HH21 . ARG A 1 98  ? -32.139 -18.956 6.677   1.00 0.00 ? 98  ARG A HH21 1  
ATOM 1594   H HH22 . ARG A 1 98  ? -32.166 -20.684 6.890   1.00 0.00 ? 98  ARG A HH22 1  
ATOM 1595   N N    . PHE A 1 99  ? -27.097 -18.207 1.352   1.00 0.00 ? 99  PHE A N    1  
ATOM 1596   C CA   . PHE A 1 99  ? -26.108 -17.401 2.067   1.00 0.00 ? 99  PHE A CA   1  
ATOM 1597   C C    . PHE A 1 99  ? -24.782 -17.399 1.315   1.00 0.00 ? 99  PHE A C    1  
ATOM 1598   O O    . PHE A 1 99  ? -23.815 -16.759 1.735   1.00 0.00 ? 99  PHE A O    1  
ATOM 1599   C CB   . PHE A 1 99  ? -25.866 -17.967 3.470   1.00 0.00 ? 99  PHE A CB   1  
ATOM 1600   C CG   . PHE A 1 99  ? -27.024 -17.856 4.416   1.00 0.00 ? 99  PHE A CG   1  
ATOM 1601   C CD1  . PHE A 1 99  ? -27.415 -16.625 4.912   1.00 0.00 ? 99  PHE A CD1  1  
ATOM 1602   C CD2  . PHE A 1 99  ? -27.714 -18.986 4.818   1.00 0.00 ? 99  PHE A CD2  1  
ATOM 1603   C CE1  . PHE A 1 99  ? -28.475 -16.522 5.790   1.00 0.00 ? 99  PHE A CE1  1  
ATOM 1604   C CE2  . PHE A 1 99  ? -28.773 -18.892 5.698   1.00 0.00 ? 99  PHE A CE2  1  
ATOM 1605   C CZ   . PHE A 1 99  ? -29.155 -17.657 6.184   1.00 0.00 ? 99  PHE A CZ   1  
ATOM 1606   H H    . PHE A 1 99  ? -26.985 -19.182 1.329   1.00 0.00 ? 99  PHE A H    1  
ATOM 1607   H HA   . PHE A 1 99  ? -26.481 -16.380 2.149   1.00 0.00 ? 99  PHE A HA   1  
ATOM 1608   H HB2  . PHE A 1 99  ? -25.609 -19.022 3.371   1.00 0.00 ? 99  PHE A HB2  1  
ATOM 1609   H HB3  . PHE A 1 99  ? -25.018 -17.440 3.907   1.00 0.00 ? 99  PHE A HB3  1  
ATOM 1610   H HD1  . PHE A 1 99  ? -26.884 -15.735 4.608   1.00 0.00 ? 99  PHE A HD1  1  
ATOM 1611   H HD2  . PHE A 1 99  ? -27.420 -19.953 4.438   1.00 0.00 ? 99  PHE A HD2  1  
ATOM 1612   H HE1  . PHE A 1 99  ? -28.772 -15.555 6.168   1.00 0.00 ? 99  PHE A HE1  1  
ATOM 1613   H HE2  . PHE A 1 99  ? -29.303 -19.781 6.005   1.00 0.00 ? 99  PHE A HE2  1  
ATOM 1614   H HZ   . PHE A 1 99  ? -29.984 -17.579 6.871   1.00 0.00 ? 99  PHE A HZ   1  
ATOM 1615   N N    . VAL A 1 100 ? -24.737 -18.128 0.210   1.00 0.00 ? 100 VAL A N    1  
ATOM 1616   C CA   . VAL A 1 100 ? -23.525 -18.223 -0.589  1.00 0.00 ? 100 VAL A CA   1  
ATOM 1617   C C    . VAL A 1 100 ? -23.551 -17.232 -1.739  1.00 0.00 ? 100 VAL A C    1  
ATOM 1618   O O    . VAL A 1 100 ? -24.406 -17.306 -2.625  1.00 0.00 ? 100 VAL A O    1  
ATOM 1619   C CB   . VAL A 1 100 ? -23.317 -19.650 -1.145  1.00 0.00 ? 100 VAL A CB   1  
ATOM 1620   C CG1  . VAL A 1 100 ? -22.090 -19.713 -2.048  1.00 0.00 ? 100 VAL A CG1  1  
ATOM 1621   C CG2  . VAL A 1 100 ? -23.189 -20.652 -0.008  1.00 0.00 ? 100 VAL A CG2  1  
ATOM 1622   H H    . VAL A 1 100 ? -25.546 -18.588 -0.092  1.00 0.00 ? 100 VAL A H    1  
ATOM 1623   H HA   . VAL A 1 100 ? -22.682 -17.981 0.057   1.00 0.00 ? 100 VAL A HA   1  
ATOM 1624   H HB   . VAL A 1 100 ? -24.192 -19.915 -1.739  1.00 0.00 ? 100 VAL A HB   1  
ATOM 1625   H HG11 . VAL A 1 100 ? -21.974 -20.721 -2.446  1.00 0.00 ? 100 VAL A HG11 1  
ATOM 1626   H HG12 . VAL A 1 100 ? -22.211 -19.012 -2.873  1.00 0.00 ? 100 VAL A HG12 1  
ATOM 1627   H HG13 . VAL A 1 100 ? -21.203 -19.448 -1.473  1.00 0.00 ? 100 VAL A HG13 1  
ATOM 1628   H HG21 . VAL A 1 100 ? -24.087 -20.617 0.609   1.00 0.00 ? 100 VAL A HG21 1  
ATOM 1629   H HG22 . VAL A 1 100 ? -23.067 -21.657 -0.413  1.00 0.00 ? 100 VAL A HG22 1  
ATOM 1630   H HG23 . VAL A 1 100 ? -22.320 -20.400 0.600   1.00 0.00 ? 100 VAL A HG23 1  
ATOM 1631   N N    . PHE A 1 101 ? -22.608 -16.306 -1.726  1.00 0.00 ? 101 PHE A N    1  
ATOM 1632   C CA   . PHE A 1 101 ? -22.506 -15.307 -2.767  1.00 0.00 ? 101 PHE A CA   1  
ATOM 1633   C C    . PHE A 1 101 ? -21.334 -15.629 -3.676  1.00 0.00 ? 101 PHE A C    1  
ATOM 1634   O O    . PHE A 1 101 ? -20.307 -16.145 -3.233  1.00 0.00 ? 101 PHE A O    1  
ATOM 1635   C CB   . PHE A 1 101 ? -22.339 -13.909 -2.168  1.00 0.00 ? 101 PHE A CB   1  
ATOM 1636   C CG   . PHE A 1 101 ? -23.621 -13.314 -1.664  1.00 0.00 ? 101 PHE A CG   1  
ATOM 1637   C CD1  . PHE A 1 101 ? -24.477 -12.653 -2.529  1.00 0.00 ? 101 PHE A CD1  1  
ATOM 1638   C CD2  . PHE A 1 101 ? -23.971 -13.419 -0.328  1.00 0.00 ? 101 PHE A CD2  1  
ATOM 1639   C CE1  . PHE A 1 101 ? -25.661 -12.107 -2.072  1.00 0.00 ? 101 PHE A CE1  1  
ATOM 1640   C CE2  . PHE A 1 101 ? -25.152 -12.875 0.137   1.00 0.00 ? 101 PHE A CE2  1  
ATOM 1641   C CZ   . PHE A 1 101 ? -25.999 -12.219 -0.736  1.00 0.00 ? 101 PHE A CZ   1  
ATOM 1642   H H    . PHE A 1 101 ? -21.944 -16.293 -0.999  1.00 0.00 ? 101 PHE A H    1  
ATOM 1643   H HA   . PHE A 1 101 ? -23.424 -15.326 -3.355  1.00 0.00 ? 101 PHE A HA   1  
ATOM 1644   H HB2  . PHE A 1 101 ? -21.634 -13.968 -1.340  1.00 0.00 ? 101 PHE A HB2  1  
ATOM 1645   H HB3  . PHE A 1 101 ? -21.927 -13.250 -2.933  1.00 0.00 ? 101 PHE A HB3  1  
ATOM 1646   H HD1  . PHE A 1 101 ? -24.217 -12.563 -3.573  1.00 0.00 ? 101 PHE A HD1  1  
ATOM 1647   H HD2  . PHE A 1 101 ? -23.312 -13.931 0.358   1.00 0.00 ? 101 PHE A HD2  1  
ATOM 1648   H HE1  . PHE A 1 101 ? -26.321 -11.595 -2.756  1.00 0.00 ? 101 PHE A HE1  1  
ATOM 1649   H HE2  . PHE A 1 101 ? -25.414 -12.962 1.181   1.00 0.00 ? 101 PHE A HE2  1  
ATOM 1650   H HZ   . PHE A 1 101 ? -26.924 -11.793 -0.374  1.00 0.00 ? 101 PHE A HZ   1  
ATOM 1651   N N    . ASN A 1 102 ? -21.497 -15.341 -4.947  1.00 0.00 ? 102 ASN A N    1  
ATOM 1652   C CA   . ASN A 1 102 ? -20.461 -15.592 -5.927  1.00 0.00 ? 102 ASN A CA   1  
ATOM 1653   C C    . ASN A 1 102 ? -19.719 -14.299 -6.215  1.00 0.00 ? 102 ASN A C    1  
ATOM 1654   O O    . ASN A 1 102 ? -20.146 -13.498 -7.047  1.00 0.00 ? 102 ASN A O    1  
ATOM 1655   C CB   . ASN A 1 102 ? -21.061 -16.171 -7.215  1.00 0.00 ? 102 ASN A CB   1  
ATOM 1656   C CG   . ASN A 1 102 ? -21.409 -17.654 -7.115  1.00 0.00 ? 102 ASN A CG   1  
ATOM 1657   O OD1  . ASN A 1 102 ? -21.543 -18.344 -8.125  1.00 0.00 ? 102 ASN A OD1  1  
ATOM 1658   N ND2  . ASN A 1 102 ? -21.549 -18.160 -5.899  1.00 0.00 ? 102 ASN A ND2  1  
ATOM 1659   H H    . ASN A 1 102 ? -22.344 -14.922 -5.240  1.00 0.00 ? 102 ASN A H    1  
ATOM 1660   H HA   . ASN A 1 102 ? -19.759 -16.317 -5.515  1.00 0.00 ? 102 ASN A HA   1  
ATOM 1661   H HB2  . ASN A 1 102 ? -21.970 -15.618 -7.452  1.00 0.00 ? 102 ASN A HB2  1  
ATOM 1662   H HB3  . ASN A 1 102 ? -20.341 -16.040 -8.022  1.00 0.00 ? 102 ASN A HB3  1  
ATOM 1663   H HD21 . ASN A 1 102 ? -21.424 -17.564 -5.131  1.00 0.00 ? 102 ASN A HD21 1  
ATOM 1664   H HD22 . ASN A 1 102 ? -21.777 -19.109 -5.818  1.00 0.00 ? 102 ASN A HD22 1  
ATOM 1665   N N    . LYS A 1 103 ? -18.633 -14.088 -5.492  1.00 0.00 ? 103 LYS A N    1  
ATOM 1666   C CA   . LYS A 1 103 ? -17.827 -12.887 -5.658  1.00 0.00 ? 103 LYS A CA   1  
ATOM 1667   C C    . LYS A 1 103 ? -16.968 -13.000 -6.908  1.00 0.00 ? 103 LYS A C    1  
ATOM 1668   O O    . LYS A 1 103 ? -15.937 -13.678 -6.906  1.00 0.00 ? 103 LYS A O    1  
ATOM 1669   C CB   . LYS A 1 103 ? -16.954 -12.659 -4.425  1.00 0.00 ? 103 LYS A CB   1  
ATOM 1670   C CG   . LYS A 1 103 ? -16.014 -11.466 -4.537  1.00 0.00 ? 103 LYS A CG   1  
ATOM 1671   C CD   . LYS A 1 103 ? -14.859 -11.578 -3.552  1.00 0.00 ? 103 LYS A CD   1  
ATOM 1672   C CE   . LYS A 1 103 ? -14.073 -12.868 -3.753  1.00 0.00 ? 103 LYS A CE   1  
ATOM 1673   N NZ   . LYS A 1 103 ? -13.657 -13.053 -5.169  1.00 0.00 ? 103 LYS A NZ   1  
ATOM 1674   H H    . LYS A 1 103 ? -18.361 -14.763 -4.833  1.00 0.00 ? 103 LYS A H    1  
ATOM 1675   H HA   . LYS A 1 103 ? -18.497 -12.035 -5.771  1.00 0.00 ? 103 LYS A HA   1  
ATOM 1676   H HB2  . LYS A 1 103 ? -17.608 -12.499 -3.568  1.00 0.00 ? 103 LYS A HB2  1  
ATOM 1677   H HB3  . LYS A 1 103 ? -16.353 -13.553 -4.262  1.00 0.00 ? 103 LYS A HB3  1  
ATOM 1678   H HG2  . LYS A 1 103 ? -15.614 -11.423 -5.550  1.00 0.00 ? 103 LYS A HG2  1  
ATOM 1679   H HG3  . LYS A 1 103 ? -16.572 -10.554 -4.328  1.00 0.00 ? 103 LYS A HG3  1  
ATOM 1680   H HD2  . LYS A 1 103 ? -14.190 -10.730 -3.695  1.00 0.00 ? 103 LYS A HD2  1  
ATOM 1681   H HD3  . LYS A 1 103 ? -15.257 -11.560 -2.538  1.00 0.00 ? 103 LYS A HD3  1  
ATOM 1682   H HE2  . LYS A 1 103 ? -13.183 -12.840 -3.124  1.00 0.00 ? 103 LYS A HE2  1  
ATOM 1683   H HE3  . LYS A 1 103 ? -14.696 -13.711 -3.455  1.00 0.00 ? 103 LYS A HE3  1  
ATOM 1684   H HZ1  . LYS A 1 103 ? -13.053 -13.889 -5.265  1.00 0.00 ? 103 LYS A HZ1  1  
ATOM 1685   H HZ2  . LYS A 1 103 ? -13.121 -12.213 -5.499  1.00 0.00 ? 103 LYS A HZ2  1  
ATOM 1686   H HZ3  . LYS A 1 103 ? -14.493 -13.170 -5.778  1.00 0.00 ? 103 LYS A HZ3  1  
ATOM 1687   N N    . ILE A 1 104 ? -17.405 -12.341 -7.967  1.00 0.00 ? 104 ILE A N    1  
ATOM 1688   C CA   . ILE A 1 104 ? -16.703 -12.364 -9.240  1.00 0.00 ? 104 ILE A CA   1  
ATOM 1689   C C    . ILE A 1 104 ? -15.898 -11.082 -9.415  1.00 0.00 ? 104 ILE A C    1  
ATOM 1690   O O    . ILE A 1 104 ? -16.245 -10.049 -8.848  1.00 0.00 ? 104 ILE A O    1  
ATOM 1691   C CB   . ILE A 1 104 ? -17.707 -12.486 -10.407 1.00 0.00 ? 104 ILE A CB   1  
ATOM 1692   C CG1  . ILE A 1 104 ? -18.786 -13.524 -10.083 1.00 0.00 ? 104 ILE A CG1  1  
ATOM 1693   C CG2  . ILE A 1 104 ? -16.992 -12.849 -11.699 1.00 0.00 ? 104 ILE A CG2  1  
ATOM 1694   C CD1  . ILE A 1 104 ? -19.960 -13.511 -11.037 1.00 0.00 ? 104 ILE A CD1  1  
ATOM 1695   H H    . ILE A 1 104 ? -18.226 -11.801 -7.887  1.00 0.00 ? 104 ILE A H    1  
ATOM 1696   H HA   . ILE A 1 104 ? -16.028 -13.220 -9.255  1.00 0.00 ? 104 ILE A HA   1  
ATOM 1697   H HB   . ILE A 1 104 ? -18.192 -11.519 -10.544 1.00 0.00 ? 104 ILE A HB   1  
ATOM 1698   H HG12 . ILE A 1 104 ? -18.330 -14.514 -10.116 1.00 0.00 ? 104 ILE A HG12 1  
ATOM 1699   H HG13 . ILE A 1 104 ? -19.159 -13.329 -9.078  1.00 0.00 ? 104 ILE A HG13 1  
ATOM 1700   H HG21 . ILE A 1 104 ? -17.711 -12.908 -12.516 1.00 0.00 ? 104 ILE A HG21 1  
ATOM 1701   H HG22 . ILE A 1 104 ? -16.248 -12.086 -11.928 1.00 0.00 ? 104 ILE A HG22 1  
ATOM 1702   H HG23 . ILE A 1 104 ? -16.499 -13.814 -11.581 1.00 0.00 ? 104 ILE A HG23 1  
ATOM 1703   H HD11 . ILE A 1 104 ? -19.606 -13.714 -12.047 1.00 0.00 ? 104 ILE A HD11 1  
ATOM 1704   H HD12 . ILE A 1 104 ? -20.691 -14.270 -10.756 1.00 0.00 ? 104 ILE A HD12 1  
ATOM 1705   H HD13 . ILE A 1 104 ? -20.436 -12.531 -11.008 1.00 0.00 ? 104 ILE A HD13 1  
ATOM 1706   N N    . GLU A 1 105 ? -14.831 -11.155 -10.196 1.00 0.00 ? 105 GLU A N    1  
ATOM 1707   C CA   . GLU A 1 105 ? -13.977 -10.004 -10.458 1.00 0.00 ? 105 GLU A CA   1  
ATOM 1708   C C    . GLU A 1 105 ? -13.626 -9.960  -11.939 1.00 0.00 ? 105 GLU A C    1  
ATOM 1709   O O    . GLU A 1 105 ? -12.613 -10.520 -12.360 1.00 0.00 ? 105 GLU A O    1  
ATOM 1710   C CB   . GLU A 1 105 ? -12.692 -10.070 -9.625  1.00 0.00 ? 105 GLU A CB   1  
ATOM 1711   C CG   . GLU A 1 105 ? -12.891 -9.844  -8.137  1.00 0.00 ? 105 GLU A CG   1  
ATOM 1712   C CD   . GLU A 1 105 ? -12.532 -11.059 -7.304  1.00 0.00 ? 105 GLU A CD   1  
ATOM 1713   O OE1  . GLU A 1 105 ? -12.507 -10.943 -6.063  1.00 0.00 ? 105 GLU A OE1  1  
ATOM 1714   O OE2  . GLU A 1 105 ? -12.282 -12.139 -7.882  1.00 0.00 ? 105 GLU A OE2  1  
ATOM 1715   H H    . GLU A 1 105 ? -14.623 -12.001 -10.644 1.00 0.00 ? 105 GLU A H    1  
ATOM 1716   H HA   . GLU A 1 105 ? -14.521 -9.098  -10.191 1.00 0.00 ? 105 GLU A HA   1  
ATOM 1717   H HB2  . GLU A 1 105 ? -12.248 -11.056 -9.763  1.00 0.00 ? 105 GLU A HB2  1  
ATOM 1718   H HB3  . GLU A 1 105 ? -12.006 -9.308  -9.996  1.00 0.00 ? 105 GLU A HB3  1  
ATOM 1719   H HG2  . GLU A 1 105 ? -12.264 -9.009  -7.824  1.00 0.00 ? 105 GLU A HG2  1  
ATOM 1720   H HG3  . GLU A 1 105 ? -13.936 -9.594  -7.958  1.00 0.00 ? 105 GLU A HG3  1  
ATOM 1721   H HE2  . GLU A 1 105 ? -12.066 -12.863 -7.289  1.00 0.00 ? 105 GLU A HE2  1  
ATOM 1722   N N    . ILE A 1 106 ? -14.491 -9.334  -12.728 1.00 0.00 ? 106 ILE A N    1  
ATOM 1723   C CA   . ILE A 1 106 ? -14.284 -9.227  -14.169 1.00 0.00 ? 106 ILE A CA   1  
ATOM 1724   C C    . ILE A 1 106 ? -13.108 -8.314  -14.510 1.00 0.00 ? 106 ILE A C    1  
ATOM 1725   O O    . ILE A 1 106 ? -12.214 -8.691  -15.270 1.00 0.00 ? 106 ILE A O    1  
ATOM 1726   C CB   . ILE A 1 106 ? -15.555 -8.742  -14.902 1.00 0.00 ? 106 ILE A CB   1  
ATOM 1727   C CG1  . ILE A 1 106 ? -16.211 -7.572  -14.153 1.00 0.00 ? 106 ILE A CG1  1  
ATOM 1728   C CG2  . ILE A 1 106 ? -16.539 -9.890  -15.078 1.00 0.00 ? 106 ILE A CG2  1  
ATOM 1729   C CD1  . ILE A 1 106 ? -17.303 -6.872  -14.934 1.00 0.00 ? 106 ILE A CD1  1  
ATOM 1730   H H    . ILE A 1 106 ? -15.299 -8.947  -12.334 1.00 0.00 ? 106 ILE A H    1  
ATOM 1731   H HA   . ILE A 1 106 ? -14.048 -10.227 -14.535 1.00 0.00 ? 106 ILE A HA   1  
ATOM 1732   H HB   . ILE A 1 106 ? -15.263 -8.389  -15.891 1.00 0.00 ? 106 ILE A HB   1  
ATOM 1733   H HG12 . ILE A 1 106 ? -16.643 -7.957  -13.230 1.00 0.00 ? 106 ILE A HG12 1  
ATOM 1734   H HG13 . ILE A 1 106 ? -15.438 -6.841  -13.916 1.00 0.00 ? 106 ILE A HG13 1  
ATOM 1735   H HG21 . ILE A 1 106 ? -17.419 -9.543  -15.620 1.00 0.00 ? 106 ILE A HG21 1  
ATOM 1736   H HG22 . ILE A 1 106 ? -16.062 -10.693 -15.639 1.00 0.00 ? 106 ILE A HG22 1  
ATOM 1737   H HG23 . ILE A 1 106 ? -16.842 -10.262 -14.099 1.00 0.00 ? 106 ILE A HG23 1  
ATOM 1738   H HD11 . ILE A 1 106 ? -18.090 -7.588  -15.173 1.00 0.00 ? 106 ILE A HD11 1  
ATOM 1739   H HD12 . ILE A 1 106 ? -17.729 -6.056  -14.351 1.00 0.00 ? 106 ILE A HD12 1  
ATOM 1740   H HD13 . ILE A 1 106 ? -16.885 -6.471  -15.858 1.00 0.00 ? 106 ILE A HD13 1  
ATOM 1741   N N    . ASN A 1 107 ? -13.113 -7.116  -13.948 1.00 0.00 ? 107 ASN A N    1  
ATOM 1742   C CA   . ASN A 1 107 ? -12.048 -6.154  -14.193 1.00 0.00 ? 107 ASN A CA   1  
ATOM 1743   C C    . ASN A 1 107 ? -11.425 -5.675  -12.881 1.00 0.00 ? 107 ASN A C    1  
ATOM 1744   O O    . ASN A 1 107 ? -10.807 -6.458  -12.162 1.00 0.00 ? 107 ASN A O    1  
ATOM 1745   C CB   . ASN A 1 107 ? -12.537 -4.978  -15.063 1.00 0.00 ? 107 ASN A CB   1  
ATOM 1746   C CG   . ASN A 1 107 ? -13.872 -4.391  -14.622 1.00 0.00 ? 107 ASN A CG   1  
ATOM 1747   O OD1  . ASN A 1 107 ? -14.179 -4.327  -13.431 1.00 0.00 ? 107 ASN A OD1  1  
ATOM 1748   N ND2  . ASN A 1 107 ? -14.673 -3.954  -15.581 1.00 0.00 ? 107 ASN A ND2  1  
ATOM 1749   H H    . ASN A 1 107 ? -13.851 -6.871  -13.351 1.00 0.00 ? 107 ASN A H    1  
ATOM 1750   H HA   . ASN A 1 107 ? -11.269 -6.670  -14.755 1.00 0.00 ? 107 ASN A HA   1  
ATOM 1751   H HB2  . ASN A 1 107 ? -11.786 -4.189  -15.028 1.00 0.00 ? 107 ASN A HB2  1  
ATOM 1752   H HB3  . ASN A 1 107 ? -12.640 -5.329  -16.090 1.00 0.00 ? 107 ASN A HB3  1  
ATOM 1753   H HD21 . ASN A 1 107 ? -14.369 -4.031  -16.512 1.00 0.00 ? 107 ASN A HD21 1  
ATOM 1754   H HD22 . ASN A 1 107 ? -15.537 -3.567  -15.324 1.00 0.00 ? 107 ASN A HD22 1  
ATOM 1755   N N    . ASN A 1 108 ? -11.586 -4.398  -12.568 1.00 0.00 ? 108 ASN A N    1  
ATOM 1756   C CA   . ASN A 1 108 ? -11.045 -3.845  -11.337 1.00 0.00 ? 108 ASN A CA   1  
ATOM 1757   C C    . ASN A 1 108 ? -12.126 -3.812  -10.265 1.00 0.00 ? 108 ASN A C    1  
ATOM 1758   O O    . ASN A 1 108 ? -11.839 -3.653  -9.081  1.00 0.00 ? 108 ASN A O    1  
ATOM 1759   C CB   . ASN A 1 108 ? -10.481 -2.441  -11.570 1.00 0.00 ? 108 ASN A CB   1  
ATOM 1760   C CG   . ASN A 1 108 ? -9.629  -1.945  -10.412 1.00 0.00 ? 108 ASN A CG   1  
ATOM 1761   O OD1  . ASN A 1 108 ? -9.666  -0.765  -10.057 1.00 0.00 ? 108 ASN A OD1  1  
ATOM 1762   N ND2  . ASN A 1 108 ? -8.843  -2.837  -9.826  1.00 0.00 ? 108 ASN A ND2  1  
ATOM 1763   H H    . ASN A 1 108 ? -12.094 -3.816  -13.172 1.00 0.00 ? 108 ASN A H    1  
ATOM 1764   H HA   . ASN A 1 108 ? -10.234 -4.490  -10.997 1.00 0.00 ? 108 ASN A HA   1  
ATOM 1765   H HB2  . ASN A 1 108 ? -9.871  -2.456  -12.473 1.00 0.00 ? 108 ASN A HB2  1  
ATOM 1766   H HB3  . ASN A 1 108 ? -11.313 -1.750  -11.711 1.00 0.00 ? 108 ASN A HB3  1  
ATOM 1767   H HD21 . ASN A 1 108 ? -8.852  -3.756  -10.166 1.00 0.00 ? 108 ASN A HD21 1  
ATOM 1768   H HD22 . ASN A 1 108 ? -8.287  -2.545  -9.075  1.00 0.00 ? 108 ASN A HD22 1  
ATOM 1769   N N    . LYS A 1 109 ? -13.371 -3.973  -10.695 1.00 0.00 ? 109 LYS A N    1  
ATOM 1770   C CA   . LYS A 1 109 ? -14.505 -3.968  -9.784  1.00 0.00 ? 109 LYS A CA   1  
ATOM 1771   C C    . LYS A 1 109 ? -15.007 -5.391  -9.576  1.00 0.00 ? 109 LYS A C    1  
ATOM 1772   O O    . LYS A 1 109 ? -14.894 -6.233  -10.470 1.00 0.00 ? 109 LYS A O    1  
ATOM 1773   C CB   . LYS A 1 109 ? -15.634 -3.085  -10.331 1.00 0.00 ? 109 LYS A CB   1  
ATOM 1774   C CG   . LYS A 1 109 ? -15.243 -1.632  -10.580 1.00 0.00 ? 109 LYS A CG   1  
ATOM 1775   C CD   . LYS A 1 109 ? -14.757 -0.954  -9.307  1.00 0.00 ? 109 LYS A CD   1  
ATOM 1776   C CE   . LYS A 1 109 ? -15.858 -0.860  -8.263  1.00 0.00 ? 109 LYS A CE   1  
ATOM 1777   N NZ   . LYS A 1 109 ? -16.824 0.228   -8.557  1.00 0.00 ? 109 LYS A NZ   1  
ATOM 1778   H H    . LYS A 1 109 ? -13.532 -4.125  -11.652 1.00 0.00 ? 109 LYS A H    1  
ATOM 1779   H HA   . LYS A 1 109 ? -14.178 -3.565  -8.825  1.00 0.00 ? 109 LYS A HA   1  
ATOM 1780   H HB2  . LYS A 1 109 ? -15.972 -3.512  -11.274 1.00 0.00 ? 109 LYS A HB2  1  
ATOM 1781   H HB3  . LYS A 1 109 ? -16.453 -3.098  -9.612  1.00 0.00 ? 109 LYS A HB3  1  
ATOM 1782   H HG2  . LYS A 1 109 ? -14.445 -1.604  -11.322 1.00 0.00 ? 109 LYS A HG2  1  
ATOM 1783   H HG3  . LYS A 1 109 ? -16.111 -1.093  -10.958 1.00 0.00 ? 109 LYS A HG3  1  
ATOM 1784   H HD2  . LYS A 1 109 ? -13.927 -1.528  -8.895  1.00 0.00 ? 109 LYS A HD2  1  
ATOM 1785   H HD3  . LYS A 1 109 ? -14.416 0.052   -9.552  1.00 0.00 ? 109 LYS A HD3  1  
ATOM 1786   H HE2  . LYS A 1 109 ? -16.396 -1.808  -8.233  1.00 0.00 ? 109 LYS A HE2  1  
ATOM 1787   H HE3  . LYS A 1 109 ? -15.405 -0.674  -7.290  1.00 0.00 ? 109 LYS A HE3  1  
ATOM 1788   H HZ1  . LYS A 1 109 ? -16.318 1.105   -8.788  1.00 0.00 ? 109 LYS A HZ1  1  
ATOM 1789   H HZ2  . LYS A 1 109 ? -17.433 0.398   -7.734  1.00 0.00 ? 109 LYS A HZ2  1  
ATOM 1790   H HZ3  . LYS A 1 109 ? -17.430 -0.038  -9.371  1.00 0.00 ? 109 LYS A HZ3  1  
ATOM 1791   N N    . LEU A 1 110 ? -15.548 -5.657  -8.396  1.00 0.00 ? 110 LEU A N    1  
ATOM 1792   C CA   . LEU A 1 110 ? -16.062 -6.979  -8.078  1.00 0.00 ? 110 LEU A CA   1  
ATOM 1793   C C    . LEU A 1 110 ? -17.587 -6.986  -8.056  1.00 0.00 ? 110 LEU A C    1  
ATOM 1794   O O    . LEU A 1 110 ? -18.216 -6.014  -7.634  1.00 0.00 ? 110 LEU A O    1  
ATOM 1795   C CB   . LEU A 1 110 ? -15.492 -7.496  -6.751  1.00 0.00 ? 110 LEU A CB   1  
ATOM 1796   C CG   . LEU A 1 110 ? -15.218 -6.450  -5.666  1.00 0.00 ? 110 LEU A CG   1  
ATOM 1797   C CD1  . LEU A 1 110 ? -15.537 -7.017  -4.294  1.00 0.00 ? 110 LEU A CD1  1  
ATOM 1798   C CD2  . LEU A 1 110 ? -13.770 -5.987  -5.723  1.00 0.00 ? 110 LEU A CD2  1  
ATOM 1799   H H    . LEU A 1 110 ? -15.613 -4.945  -7.722  1.00 0.00 ? 110 LEU A H    1  
ATOM 1800   H HA   . LEU A 1 110 ? -15.735 -7.656  -8.868  1.00 0.00 ? 110 LEU A HA   1  
ATOM 1801   H HB2  . LEU A 1 110 ? -16.203 -8.216  -6.345  1.00 0.00 ? 110 LEU A HB2  1  
ATOM 1802   H HB3  . LEU A 1 110 ? -14.550 -7.999  -6.970  1.00 0.00 ? 110 LEU A HB3  1  
ATOM 1803   H HG   . LEU A 1 110 ? -15.864 -5.590  -5.844  1.00 0.00 ? 110 LEU A HG   1  
ATOM 1804   H HD11 . LEU A 1 110 ? -15.357 -6.259  -3.531  1.00 0.00 ? 110 LEU A HD11 1  
ATOM 1805   H HD12 . LEU A 1 110 ? -16.583 -7.321  -4.261  1.00 0.00 ? 110 LEU A HD12 1  
ATOM 1806   H HD13 . LEU A 1 110 ? -14.901 -7.881  -4.102  1.00 0.00 ? 110 LEU A HD13 1  
ATOM 1807   H HD21 . LEU A 1 110 ? -13.564 -5.562  -6.706  1.00 0.00 ? 110 LEU A HD21 1  
ATOM 1808   H HD22 . LEU A 1 110 ? -13.594 -5.230  -4.958  1.00 0.00 ? 110 LEU A HD22 1  
ATOM 1809   H HD23 . LEU A 1 110 ? -13.110 -6.837  -5.549  1.00 0.00 ? 110 LEU A HD23 1  
ATOM 1810   N N    . GLU A 1 111 ? -18.165 -8.083  -8.515  1.00 0.00 ? 111 GLU A N    1  
ATOM 1811   C CA   . GLU A 1 111 ? -19.609 -8.245  -8.561  1.00 0.00 ? 111 GLU A CA   1  
ATOM 1812   C C    . GLU A 1 111 ? -20.020 -9.425  -7.691  1.00 0.00 ? 111 GLU A C    1  
ATOM 1813   O O    . GLU A 1 111 ? -19.314 -10.431 -7.624  1.00 0.00 ? 111 GLU A O    1  
ATOM 1814   C CB   . GLU A 1 111 ? -20.084 -8.451  -10.004 1.00 0.00 ? 111 GLU A CB   1  
ATOM 1815   C CG   . GLU A 1 111 ? -19.134 -9.272  -10.865 1.00 0.00 ? 111 GLU A CG   1  
ATOM 1816   C CD   . GLU A 1 111 ? -19.665 -9.503  -12.265 1.00 0.00 ? 111 GLU A CD   1  
ATOM 1817   O OE1  . GLU A 1 111 ? -19.663 -8.557  -13.077 1.00 0.00 ? 111 GLU A OE1  1  
ATOM 1818   O OE2  . GLU A 1 111 ? -20.089 -10.634 -12.567 1.00 0.00 ? 111 GLU A OE2  1  
ATOM 1819   H H    . GLU A 1 111 ? -17.596 -8.825  -8.824  1.00 0.00 ? 111 GLU A H    1  
ATOM 1820   H HA   . GLU A 1 111 ? -20.073 -7.340  -8.168  1.00 0.00 ? 111 GLU A HA   1  
ATOM 1821   H HB2  . GLU A 1 111 ? -21.048 -8.960  -9.978  1.00 0.00 ? 111 GLU A HB2  1  
ATOM 1822   H HB3  . GLU A 1 111 ? -20.205 -7.471  -10.468 1.00 0.00 ? 111 GLU A HB3  1  
ATOM 1823   H HG2  . GLU A 1 111 ? -18.182 -8.746  -10.934 1.00 0.00 ? 111 GLU A HG2  1  
ATOM 1824   H HG3  . GLU A 1 111 ? -18.976 -10.239 -10.387 1.00 0.00 ? 111 GLU A HG3  1  
ATOM 1825   H HE2  . GLU A 1 111 ? -20.410 -10.708 -13.469 1.00 0.00 ? 111 GLU A HE2  1  
ATOM 1826   N N    . PHE A 1 112 ? -21.151 -9.301  -7.016  1.00 0.00 ? 112 PHE A N    1  
ATOM 1827   C CA   . PHE A 1 112 ? -21.630 -10.360 -6.140  1.00 0.00 ? 112 PHE A CA   1  
ATOM 1828   C C    . PHE A 1 112 ? -22.898 -10.997 -6.686  1.00 0.00 ? 112 PHE A C    1  
ATOM 1829   O O    . PHE A 1 112 ? -23.988 -10.452 -6.526  1.00 0.00 ? 112 PHE A O    1  
ATOM 1830   C CB   . PHE A 1 112 ? -21.888 -9.824  -4.730  1.00 0.00 ? 112 PHE A CB   1  
ATOM 1831   C CG   . PHE A 1 112 ? -20.642 -9.519  -3.947  1.00 0.00 ? 112 PHE A CG   1  
ATOM 1832   C CD1  . PHE A 1 112 ? -20.050 -8.266  -4.017  1.00 0.00 ? 112 PHE A CD1  1  
ATOM 1833   C CD2  . PHE A 1 112 ? -20.063 -10.484 -3.137  1.00 0.00 ? 112 PHE A CD2  1  
ATOM 1834   C CE1  . PHE A 1 112 ? -18.906 -7.984  -3.296  1.00 0.00 ? 112 PHE A CE1  1  
ATOM 1835   C CE2  . PHE A 1 112 ? -18.919 -10.207 -2.413  1.00 0.00 ? 112 PHE A CE2  1  
ATOM 1836   C CZ   . PHE A 1 112 ? -18.340 -8.955  -2.493  1.00 0.00 ? 112 PHE A CZ   1  
ATOM 1837   H H    . PHE A 1 112 ? -21.681 -8.483  -7.117  1.00 0.00 ? 112 PHE A H    1  
ATOM 1838   H HA   . PHE A 1 112 ? -20.855 -11.124 -6.084  1.00 0.00 ? 112 PHE A HA   1  
ATOM 1839   H HB2  . PHE A 1 112 ? -22.476 -8.909  -4.810  1.00 0.00 ? 112 PHE A HB2  1  
ATOM 1840   H HB3  . PHE A 1 112 ? -22.468 -10.565 -4.179  1.00 0.00 ? 112 PHE A HB3  1  
ATOM 1841   H HD1  . PHE A 1 112 ? -20.489 -7.503  -4.642  1.00 0.00 ? 112 PHE A HD1  1  
ATOM 1842   H HD2  . PHE A 1 112 ? -20.513 -11.463 -3.070  1.00 0.00 ? 112 PHE A HD2  1  
ATOM 1843   H HE1  . PHE A 1 112 ? -18.455 -7.005  -3.361  1.00 0.00 ? 112 PHE A HE1  1  
ATOM 1844   H HE2  . PHE A 1 112 ? -18.478 -10.968 -1.786  1.00 0.00 ? 112 PHE A HE2  1  
ATOM 1845   H HZ   . PHE A 1 112 ? -17.446 -8.736  -1.928  1.00 0.00 ? 112 PHE A HZ   1  
ATOM 1846   N N    . GLU A 1 113 ? -22.746 -12.140 -7.334  1.00 0.00 ? 113 GLU A N    1  
ATOM 1847   C CA   . GLU A 1 113 ? -23.877 -12.861 -7.892  1.00 0.00 ? 113 GLU A CA   1  
ATOM 1848   C C    . GLU A 1 113 ? -24.399 -13.849 -6.862  1.00 0.00 ? 113 GLU A C    1  
ATOM 1849   O O    . GLU A 1 113 ? -23.620 -14.458 -6.136  1.00 0.00 ? 113 GLU A O    1  
ATOM 1850   C CB   . GLU A 1 113 ? -23.441 -13.612 -9.155  1.00 0.00 ? 113 GLU A CB   1  
ATOM 1851   C CG   . GLU A 1 113 ? -24.554 -14.379 -9.854  1.00 0.00 ? 113 GLU A CG   1  
ATOM 1852   C CD   . GLU A 1 113 ? -24.050 -15.227 -11.004 1.00 0.00 ? 113 GLU A CD   1  
ATOM 1853   O OE1  . GLU A 1 113 ? -24.744 -15.302 -12.040 1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1854   O OE2  . GLU A 1 113 ? -22.964 -15.824 -10.877 1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1855   H H    . GLU A 1 113 ? -21.846 -12.522 -7.436  1.00 0.00 ? 113 GLU A H    1  
ATOM 1856   H HA   . GLU A 1 113 ? -24.665 -12.152 -8.148  1.00 0.00 ? 113 GLU A HA   1  
ATOM 1857   H HB2  . GLU A 1 113 ? -23.035 -12.886 -9.860  1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1858   H HB3  . GLU A 1 113 ? -22.663 -14.323 -8.877  1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1859   H HG2  . GLU A 1 113 ? -25.040 -15.029 -9.127  1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1860   H HG3  . GLU A 1 113 ? -25.282 -13.665 -10.239 1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1861   H HE2  . GLU A 1 113 ? -22.709 -16.342 -11.644 1.00 0.00 ? 113 GLU A HE2  1  
ATOM 1862   N N    . SER A 1 114 ? -25.703 -13.996 -6.778  1.00 0.00 ? 114 SER A N    1  
ATOM 1863   C CA   . SER A 1 114 ? -26.290 -14.923 -5.830  1.00 0.00 ? 114 SER A CA   1  
ATOM 1864   C C    . SER A 1 114 ? -26.247 -16.348 -6.377  1.00 0.00 ? 114 SER A C    1  
ATOM 1865   O O    . SER A 1 114 ? -26.588 -16.584 -7.534  1.00 0.00 ? 114 SER A O    1  
ATOM 1866   C CB   . SER A 1 114 ? -27.733 -14.518 -5.521  1.00 0.00 ? 114 SER A CB   1  
ATOM 1867   O OG   . SER A 1 114 ? -28.328 -15.405 -4.589  1.00 0.00 ? 114 SER A OG   1  
ATOM 1868   H H    . SER A 1 114 ? -26.289 -13.466 -7.364  1.00 0.00 ? 114 SER A H    1  
ATOM 1869   H HA   . SER A 1 114 ? -25.711 -14.886 -4.908  1.00 0.00 ? 114 SER A HA   1  
ATOM 1870   H HB2  . SER A 1 114 ? -27.738 -13.510 -5.105  1.00 0.00 ? 114 SER A HB2  1  
ATOM 1871   H HB3  . SER A 1 114 ? -28.312 -14.532 -6.444  1.00 0.00 ? 114 SER A HB3  1  
ATOM 1872   H HG   . SER A 1 114 ? -28.322 -15.000 -3.711  1.00 0.00 ? 114 SER A HG   1  
ATOM 1873   N N    . ALA A 1 115 ? -25.801 -17.293 -5.554  1.00 0.00 ? 115 ALA A N    1  
ATOM 1874   C CA   . ALA A 1 115 ? -25.751 -18.687 -5.972  1.00 0.00 ? 115 ALA A CA   1  
ATOM 1875   C C    . ALA A 1 115 ? -27.176 -19.214 -6.081  1.00 0.00 ? 115 ALA A C    1  
ATOM 1876   O O    . ALA A 1 115 ? -27.488 -20.065 -6.919  1.00 0.00 ? 115 ALA A O    1  
ATOM 1877   C CB   . ALA A 1 115 ? -24.946 -19.514 -4.980  1.00 0.00 ? 115 ALA A CB   1  
ATOM 1878   H H    . ALA A 1 115 ? -25.497 -17.047 -4.653  1.00 0.00 ? 115 ALA A H    1  
ATOM 1879   H HA   . ALA A 1 115 ? -25.271 -18.747 -6.949  1.00 0.00 ? 115 ALA A HA   1  
ATOM 1880   H HB1  . ALA A 1 115 ? -24.912 -20.552 -5.312  1.00 0.00 ? 115 ALA A HB1  1  
ATOM 1881   H HB2  . ALA A 1 115 ? -23.932 -19.120 -4.917  1.00 0.00 ? 115 ALA A HB2  1  
ATOM 1882   H HB3  . ALA A 1 115 ? -25.417 -19.462 -3.998  1.00 0.00 ? 115 ALA A HB3  1  
ATOM 1883   N N    . GLN A 1 116 ? -28.026 -18.707 -5.199  1.00 0.00 ? 116 GLN A N    1  
ATOM 1884   C CA   . GLN A 1 116 ? -29.433 -19.070 -5.175  1.00 0.00 ? 116 GLN A CA   1  
ATOM 1885   C C    . GLN A 1 116 ? -30.157 -18.501 -6.396  1.00 0.00 ? 116 GLN A C    1  
ATOM 1886   O O    . GLN A 1 116 ? -31.069 -19.131 -6.936  1.00 0.00 ? 116 GLN A O    1  
ATOM 1887   C CB   . GLN A 1 116 ? -30.084 -18.560 -3.884  1.00 0.00 ? 116 GLN A CB   1  
ATOM 1888   C CG   . GLN A 1 116 ? -31.497 -19.072 -3.639  1.00 0.00 ? 116 GLN A CG   1  
ATOM 1889   C CD   . GLN A 1 116 ? -31.546 -20.538 -3.246  1.00 0.00 ? 116 GLN A CD   1  
ATOM 1890   O OE1  . GLN A 1 116 ? -30.701 -21.338 -3.649  1.00 0.00 ? 116 GLN A OE1  1  
ATOM 1891   N NE2  . GLN A 1 116 ? -32.542 -20.902 -2.454  1.00 0.00 ? 116 GLN A NE2  1  
ATOM 1892   H H    . GLN A 1 116 ? -27.676 -18.102 -4.512  1.00 0.00 ? 116 GLN A H    1  
ATOM 1893   H HA   . GLN A 1 116 ? -29.510 -20.157 -5.199  1.00 0.00 ? 116 GLN A HA   1  
ATOM 1894   H HB2  . GLN A 1 116 ? -29.461 -18.869 -3.045  1.00 0.00 ? 116 GLN A HB2  1  
ATOM 1895   H HB3  . GLN A 1 116 ? -30.120 -17.472 -3.929  1.00 0.00 ? 116 GLN A HB3  1  
ATOM 1896   H HG2  . GLN A 1 116 ? -31.946 -18.483 -2.840  1.00 0.00 ? 116 GLN A HG2  1  
ATOM 1897   H HG3  . GLN A 1 116 ? -32.077 -18.938 -4.552  1.00 0.00 ? 116 GLN A HG3  1  
ATOM 1898   H HE21 . GLN A 1 116 ? -33.181 -20.214 -2.170  1.00 0.00 ? 116 GLN A HE21 1  
ATOM 1899   H HE22 . GLN A 1 116 ? -32.605 -21.845 -2.184  1.00 0.00 ? 116 GLN A HE22 1  
ATOM 1900   N N    . PHE A 1 117 ? -29.738 -17.318 -6.838  1.00 0.00 ? 117 PHE A N    1  
ATOM 1901   C CA   . PHE A 1 117 ? -30.350 -16.671 -7.996  1.00 0.00 ? 117 PHE A CA   1  
ATOM 1902   C C    . PHE A 1 117 ? -29.295 -16.252 -9.016  1.00 0.00 ? 117 PHE A C    1  
ATOM 1903   O O    . PHE A 1 117 ? -28.709 -15.175 -8.909  1.00 0.00 ? 117 PHE A O    1  
ATOM 1904   C CB   . PHE A 1 117 ? -31.179 -15.456 -7.569  1.00 0.00 ? 117 PHE A CB   1  
ATOM 1905   C CG   . PHE A 1 117 ? -32.244 -15.776 -6.565  1.00 0.00 ? 117 PHE A CG   1  
ATOM 1906   C CD1  . PHE A 1 117 ? -33.334 -16.554 -6.917  1.00 0.00 ? 117 PHE A CD1  1  
ATOM 1907   C CD2  . PHE A 1 117 ? -32.153 -15.304 -5.267  1.00 0.00 ? 117 PHE A CD2  1  
ATOM 1908   C CE1  . PHE A 1 117 ? -34.313 -16.855 -5.993  1.00 0.00 ? 117 PHE A CE1  1  
ATOM 1909   C CE2  . PHE A 1 117 ? -33.130 -15.601 -4.337  1.00 0.00 ? 117 PHE A CE2  1  
ATOM 1910   C CZ   . PHE A 1 117 ? -34.211 -16.378 -4.701  1.00 0.00 ? 117 PHE A CZ   1  
ATOM 1911   H H    . PHE A 1 117 ? -28.996 -16.872 -6.379  1.00 0.00 ? 117 PHE A H    1  
ATOM 1912   H HA   . PHE A 1 117 ? -31.017 -17.392 -8.469  1.00 0.00 ? 117 PHE A HA   1  
ATOM 1913   H HB2  . PHE A 1 117 ? -30.508 -14.713 -7.138  1.00 0.00 ? 117 PHE A HB2  1  
ATOM 1914   H HB3  . PHE A 1 117 ? -31.652 -15.030 -8.453  1.00 0.00 ? 117 PHE A HB3  1  
ATOM 1915   H HD1  . PHE A 1 117 ? -33.418 -16.929 -7.926  1.00 0.00 ? 117 PHE A HD1  1  
ATOM 1916   H HD2  . PHE A 1 117 ? -31.308 -14.697 -4.978  1.00 0.00 ? 117 PHE A HD2  1  
ATOM 1917   H HE1  . PHE A 1 117 ? -35.159 -17.462 -6.280  1.00 0.00 ? 117 PHE A HE1  1  
ATOM 1918   H HE2  . PHE A 1 117 ? -33.048 -15.226 -3.328  1.00 0.00 ? 117 PHE A HE2  1  
ATOM 1919   H HZ   . PHE A 1 117 ? -34.977 -16.612 -3.977  1.00 0.00 ? 117 PHE A HZ   1  
ATOM 1920   N N    . PRO A 1 118 ? -29.033 -17.110 -10.015 1.00 0.00 ? 118 PRO A N    1  
ATOM 1921   C CA   . PRO A 1 118 ? -28.044 -16.835 -11.064 1.00 0.00 ? 118 PRO A CA   1  
ATOM 1922   C C    . PRO A 1 118 ? -28.364 -15.560 -11.843 1.00 0.00 ? 118 PRO A C    1  
ATOM 1923   O O    . PRO A 1 118 ? -29.520 -15.318 -12.211 1.00 0.00 ? 118 PRO A O    1  
ATOM 1924   C CB   . PRO A 1 118 ? -28.150 -18.051 -11.990 1.00 0.00 ? 118 PRO A CB   1  
ATOM 1925   C CG   . PRO A 1 118 ? -28.743 -19.122 -11.145 1.00 0.00 ? 118 PRO A CG   1  
ATOM 1926   C CD   . PRO A 1 118 ? -29.671 -18.424 -10.195 1.00 0.00 ? 118 PRO A CD   1  
ATOM 1927   H HA   . PRO A 1 118 ? -27.044 -16.759 -10.638 1.00 0.00 ? 118 PRO A HA   1  
ATOM 1928   H HB2  . PRO A 1 118 ? -28.761 -17.841 -12.868 1.00 0.00 ? 118 PRO A HB2  1  
ATOM 1929   H HB3  . PRO A 1 118 ? -27.145 -18.357 -12.284 1.00 0.00 ? 118 PRO A HB3  1  
ATOM 1930   H HG2  . PRO A 1 118 ? -29.332 -19.779 -11.784 1.00 0.00 ? 118 PRO A HG2  1  
ATOM 1931   H HG3  . PRO A 1 118 ? -27.976 -19.685 -10.613 1.00 0.00 ? 118 PRO A HG3  1  
ATOM 1932   H HD2  . PRO A 1 118 ? -30.675 -18.339 -10.611 1.00 0.00 ? 118 PRO A HD2  1  
ATOM 1933   H HD3  . PRO A 1 118 ? -29.699 -18.950 -9.241  1.00 0.00 ? 118 PRO A HD3  1  
ATOM 1934   N N    . ASN A 1 119 ? -27.329 -14.754 -12.080 1.00 0.00 ? 119 ASN A N    1  
ATOM 1935   C CA   . ASN A 1 119 ? -27.441 -13.492 -12.814 1.00 0.00 ? 119 ASN A CA   1  
ATOM 1936   C C    . ASN A 1 119 ? -28.063 -12.373 -11.990 1.00 0.00 ? 119 ASN A C    1  
ATOM 1937   O O    . ASN A 1 119 ? -28.322 -11.282 -12.498 1.00 0.00 ? 119 ASN A O    1  
ATOM 1938   C CB   . ASN A 1 119 ? -28.093 -13.649 -14.189 1.00 0.00 ? 119 ASN A CB   1  
ATOM 1939   C CG   . ASN A 1 119 ? -27.088 -13.968 -15.282 1.00 0.00 ? 119 ASN A CG   1  
ATOM 1940   O OD1  . ASN A 1 119 ? -27.299 -13.635 -16.448 1.00 0.00 ? 119 ASN A OD1  1  
ATOM 1941   N ND2  . ASN A 1 119 ? -25.982 -14.610 -14.920 1.00 0.00 ? 119 ASN A ND2  1  
ATOM 1942   H H    . ASN A 1 119 ? -26.437 -15.011 -11.742 1.00 0.00 ? 119 ASN A H    1  
ATOM 1943   H HA   . ASN A 1 119 ? -26.414 -13.181 -13.008 1.00 0.00 ? 119 ASN A HA   1  
ATOM 1944   H HB2  . ASN A 1 119 ? -28.825 -14.455 -14.139 1.00 0.00 ? 119 ASN A HB2  1  
ATOM 1945   H HB3  . ASN A 1 119 ? -28.601 -12.718 -14.443 1.00 0.00 ? 119 ASN A HB3  1  
ATOM 1946   H HD21 . ASN A 1 119 ? -25.866 -14.847 -13.971 1.00 0.00 ? 119 ASN A HD21 1  
ATOM 1947   H HD22 . ASN A 1 119 ? -25.323 -14.824 -15.612 1.00 0.00 ? 119 ASN A HD22 1  
ATOM 1948   N N    . TRP A 1 120 ? -28.291 -12.648 -10.714 1.00 0.00 ? 120 TRP A N    1  
ATOM 1949   C CA   . TRP A 1 120 ? -28.842 -11.657 -9.804  1.00 0.00 ? 120 TRP A CA   1  
ATOM 1950   C C    . TRP A 1 120 ? -27.738 -11.197 -8.866  1.00 0.00 ? 120 TRP A C    1  
ATOM 1951   O O    . TRP A 1 120 ? -27.168 -11.999 -8.125  1.00 0.00 ? 120 TRP A O    1  
ATOM 1952   C CB   . TRP A 1 120 ? -30.031 -12.216 -9.022  1.00 0.00 ? 120 TRP A CB   1  
ATOM 1953   C CG   . TRP A 1 120 ? -31.301 -12.256 -9.813  1.00 0.00 ? 120 TRP A CG   1  
ATOM 1954   C CD1  . TRP A 1 120 ? -31.606 -13.113 -10.828 1.00 0.00 ? 120 TRP A CD1  1  
ATOM 1955   C CD2  . TRP A 1 120 ? -32.437 -11.399 -9.658  1.00 0.00 ? 120 TRP A CD2  1  
ATOM 1956   N NE1  . TRP A 1 120 ? -32.861 -12.846 -11.314 1.00 0.00 ? 120 TRP A NE1  1  
ATOM 1957   C CE2  . TRP A 1 120 ? -33.393 -11.797 -10.613 1.00 0.00 ? 120 TRP A CE2  1  
ATOM 1958   C CE3  . TRP A 1 120 ? -32.740 -10.333 -8.805  1.00 0.00 ? 120 TRP A CE3  1  
ATOM 1959   C CZ2  . TRP A 1 120 ? -34.629 -11.168 -10.738 1.00 0.00 ? 120 TRP A CZ2  1  
ATOM 1960   C CZ3  . TRP A 1 120 ? -33.967 -9.710  -8.930  1.00 0.00 ? 120 TRP A CZ3  1  
ATOM 1961   C CH2  . TRP A 1 120 ? -34.897 -10.129 -9.890  1.00 0.00 ? 120 TRP A CH2  1  
ATOM 1962   H H    . TRP A 1 120 ? -28.070 -13.540 -10.370 1.00 0.00 ? 120 TRP A H    1  
ATOM 1963   H HA   . TRP A 1 120 ? -29.188 -10.804 -10.388 1.00 0.00 ? 120 TRP A HA   1  
ATOM 1964   H HB2  . TRP A 1 120 ? -29.791 -13.228 -8.697  1.00 0.00 ? 120 TRP A HB2  1  
ATOM 1965   H HB3  . TRP A 1 120 ? -30.190 -11.598 -8.138  1.00 0.00 ? 120 TRP A HB3  1  
ATOM 1966   H HD1  . TRP A 1 120 ? -30.954 -13.890 -11.197 1.00 0.00 ? 120 TRP A HD1  1  
ATOM 1967   H HE1  . TRP A 1 120 ? -33.303 -13.327 -12.046 1.00 0.00 ? 120 TRP A HE1  1  
ATOM 1968   H HE3  . TRP A 1 120 ? -32.028 -10.004 -8.062  1.00 0.00 ? 120 TRP A HE3  1  
ATOM 1969   H HZ2  . TRP A 1 120 ? -35.348 -11.488 -11.477 1.00 0.00 ? 120 TRP A HZ2  1  
ATOM 1970   H HZ3  . TRP A 1 120 ? -34.212 -8.885  -8.278  1.00 0.00 ? 120 TRP A HZ3  1  
ATOM 1971   H HH2  . TRP A 1 120 ? -35.847 -9.620  -9.962  1.00 0.00 ? 120 TRP A HH2  1  
ATOM 1972   N N    . TYR A 1 121 ? -27.428 -9.912  -8.914  1.00 0.00 ? 121 TYR A N    1  
ATOM 1973   C CA   . TYR A 1 121 ? -26.361 -9.354  -8.102  1.00 0.00 ? 121 TYR A CA   1  
ATOM 1974   C C    . TYR A 1 121 ? -26.897 -8.337  -7.109  1.00 0.00 ? 121 TYR A C    1  
ATOM 1975   O O    . TYR A 1 121 ? -28.023 -7.856  -7.239  1.00 0.00 ? 121 TYR A O    1  
ATOM 1976   C CB   . TYR A 1 121 ? -25.330 -8.650  -8.999  1.00 0.00 ? 121 TYR A CB   1  
ATOM 1977   C CG   . TYR A 1 121 ? -24.790 -9.468  -10.153 1.00 0.00 ? 121 TYR A CG   1  
ATOM 1978   C CD1  . TYR A 1 121 ? -25.515 -9.620  -11.327 1.00 0.00 ? 121 TYR A CD1  1  
ATOM 1979   C CD2  . TYR A 1 121 ? -23.543 -10.068 -10.074 1.00 0.00 ? 121 TYR A CD2  1  
ATOM 1980   C CE1  . TYR A 1 121 ? -25.014 -10.348 -12.388 1.00 0.00 ? 121 TYR A CE1  1  
ATOM 1981   C CE2  . TYR A 1 121 ? -23.034 -10.801 -11.129 1.00 0.00 ? 121 TYR A CE2  1  
ATOM 1982   C CZ   . TYR A 1 121 ? -23.774 -10.938 -12.284 1.00 0.00 ? 121 TYR A CZ   1  
ATOM 1983   O OH   . TYR A 1 121 ? -23.266 -11.658 -13.343 1.00 0.00 ? 121 TYR A OH   1  
ATOM 1984   H H    . TYR A 1 121 ? -27.950 -9.314  -9.498  1.00 0.00 ? 121 TYR A H    1  
ATOM 1985   H HA   . TYR A 1 121 ? -25.875 -10.165 -7.560  1.00 0.00 ? 121 TYR A HA   1  
ATOM 1986   H HB2  . TYR A 1 121 ? -25.796 -7.755  -9.410  1.00 0.00 ? 121 TYR A HB2  1  
ATOM 1987   H HB3  . TYR A 1 121 ? -24.488 -8.351  -8.375  1.00 0.00 ? 121 TYR A HB3  1  
ATOM 1988   H HD1  . TYR A 1 121 ? -26.489 -9.161  -11.413 1.00 0.00 ? 121 TYR A HD1  1  
ATOM 1989   H HD2  . TYR A 1 121 ? -22.959 -9.961  -9.172  1.00 0.00 ? 121 TYR A HD2  1  
ATOM 1990   H HE1  . TYR A 1 121 ? -25.591 -10.455 -13.295 1.00 0.00 ? 121 TYR A HE1  1  
ATOM 1991   H HE2  . TYR A 1 121 ? -22.061 -11.263 -11.049 1.00 0.00 ? 121 TYR A HE2  1  
ATOM 1992   H HH   . TYR A 1 121 ? -22.981 -12.524 -13.029 1.00 0.00 ? 121 TYR A HH   1  
ATOM 1993   N N    . ILE A 1 122 ? -26.084 -8.018  -6.112  1.00 0.00 ? 122 ILE A N    1  
ATOM 1994   C CA   . ILE A 1 122 ? -26.452 -7.019  -5.121  1.00 0.00 ? 122 ILE A CA   1  
ATOM 1995   C C    . ILE A 1 122 ? -26.433 -5.661  -5.810  1.00 0.00 ? 122 ILE A C    1  
ATOM 1996   O O    . ILE A 1 122 ? -25.418 -5.271  -6.382  1.00 0.00 ? 122 ILE A O    1  
ATOM 1997   C CB   . ILE A 1 122 ? -25.451 -7.011  -3.947  1.00 0.00 ? 122 ILE A CB   1  
ATOM 1998   C CG1  . ILE A 1 122 ? -25.476 -8.356  -3.216  1.00 0.00 ? 122 ILE A CG1  1  
ATOM 1999   C CG2  . ILE A 1 122 ? -25.754 -5.870  -2.986  1.00 0.00 ? 122 ILE A CG2  1  
ATOM 2000   C CD1  . ILE A 1 122 ? -24.430 -8.485  -2.128  1.00 0.00 ? 122 ILE A CD1  1  
ATOM 2001   H H    . ILE A 1 122 ? -25.214 -8.464  -6.042  1.00 0.00 ? 122 ILE A H    1  
ATOM 2002   H HA   . ILE A 1 122 ? -27.452 -7.232  -4.742  1.00 0.00 ? 122 ILE A HA   1  
ATOM 2003   H HB   . ILE A 1 122 ? -24.450 -6.859  -4.351  1.00 0.00 ? 122 ILE A HB   1  
ATOM 2004   H HG12 . ILE A 1 122 ? -26.459 -8.481  -2.762  1.00 0.00 ? 122 ILE A HG12 1  
ATOM 2005   H HG13 . ILE A 1 122 ? -25.310 -9.147  -3.946  1.00 0.00 ? 122 ILE A HG13 1  
ATOM 2006   H HG21 . ILE A 1 122 ? -25.025 -5.866  -2.176  1.00 0.00 ? 122 ILE A HG21 1  
ATOM 2007   H HG22 . ILE A 1 122 ? -25.704 -4.922  -3.522  1.00 0.00 ? 122 ILE A HG22 1  
ATOM 2008   H HG23 . ILE A 1 122 ? -26.754 -6.001  -2.572  1.00 0.00 ? 122 ILE A HG23 1  
ATOM 2009   H HD11 . ILE A 1 122 ? -24.587 -7.705  -1.383  1.00 0.00 ? 122 ILE A HD11 1  
ATOM 2010   H HD12 . ILE A 1 122 ? -24.498 -9.459  -1.644  1.00 0.00 ? 122 ILE A HD12 1  
ATOM 2011   H HD13 . ILE A 1 122 ? -23.439 -8.373  -2.568  1.00 0.00 ? 122 ILE A HD13 1  
ATOM 2012   N N    . SER A 1 123 ? -27.550 -4.957  -5.783  1.00 0.00 ? 123 SER A N    1  
ATOM 2013   C CA   . SER A 1 123 ? -27.634 -3.672  -6.445  1.00 0.00 ? 123 SER A CA   1  
ATOM 2014   C C    . SER A 1 123 ? -28.068 -2.561  -5.499  1.00 0.00 ? 123 SER A C    1  
ATOM 2015   O O    . SER A 1 123 ? -28.707 -2.805  -4.474  1.00 0.00 ? 123 SER A O    1  
ATOM 2016   C CB   . SER A 1 123 ? -28.601 -3.760  -7.626  1.00 0.00 ? 123 SER A CB   1  
ATOM 2017   O OG   . SER A 1 123 ? -28.388 -4.954  -8.357  1.00 0.00 ? 123 SER A OG   1  
ATOM 2018   H H    . SER A 1 123 ? -28.333 -5.302  -5.296  1.00 0.00 ? 123 SER A H    1  
ATOM 2019   H HA   . SER A 1 123 ? -26.643 -3.426  -6.826  1.00 0.00 ? 123 SER A HA   1  
ATOM 2020   H HB2  . SER A 1 123 ? -29.625 -3.747  -7.253  1.00 0.00 ? 123 SER A HB2  1  
ATOM 2021   H HB3  . SER A 1 123 ? -28.442 -2.905  -8.284  1.00 0.00 ? 123 SER A HB3  1  
ATOM 2022   H HG   . SER A 1 123 ? -27.726 -5.489  -7.905  1.00 0.00 ? 123 SER A HG   1  
ATOM 2023   N N    . THR A 1 124 ? -27.694 -1.341  -5.854  1.00 0.00 ? 124 THR A N    1  
ATOM 2024   C CA   . THR A 1 124 ? -28.041 -0.155  -5.088  1.00 0.00 ? 124 THR A CA   1  
ATOM 2025   C C    . THR A 1 124 ? -28.199 1.007   -6.060  1.00 0.00 ? 124 THR A C    1  
ATOM 2026   O O    . THR A 1 124 ? -27.439 1.116   -7.018  1.00 0.00 ? 124 THR A O    1  
ATOM 2027   C CB   . THR A 1 124 ? -26.948 0.195   -4.061  1.00 0.00 ? 124 THR A CB   1  
ATOM 2028   O OG1  . THR A 1 124 ? -25.890 -0.765  -4.147  1.00 0.00 ? 124 THR A OG1  1  
ATOM 2029   C CG2  . THR A 1 124 ? -27.523 0.188   -2.655  1.00 0.00 ? 124 THR A CG2  1  
ATOM 2030   H H    . THR A 1 124 ? -27.173 -1.221  -6.679  1.00 0.00 ? 124 THR A H    1  
ATOM 2031   H HA   . THR A 1 124 ? -28.981 -0.330  -4.563  1.00 0.00 ? 124 THR A HA   1  
ATOM 2032   H HB   . THR A 1 124 ? -26.554 1.187   -4.282  1.00 0.00 ? 124 THR A HB   1  
ATOM 2033   H HG1  . THR A 1 124 ? -26.191 -1.523  -4.656  1.00 0.00 ? 124 THR A HG1  1  
ATOM 2034   H HG21 . THR A 1 124 ? -27.918 -0.802  -2.429  1.00 0.00 ? 124 THR A HG21 1  
ATOM 2035   H HG22 . THR A 1 124 ? -26.742 0.439   -1.937  1.00 0.00 ? 124 THR A HG22 1  
ATOM 2036   H HG23 . THR A 1 124 ? -28.325 0.923   -2.588  1.00 0.00 ? 124 THR A HG23 1  
ATOM 2037   N N    . SER A 1 125 ? -29.184 1.858   -5.841  1.00 0.00 ? 125 SER A N    1  
ATOM 2038   C CA   . SER A 1 125 ? -29.413 2.982   -6.733  1.00 0.00 ? 125 SER A CA   1  
ATOM 2039   C C    . SER A 1 125 ? -28.318 4.043   -6.615  1.00 0.00 ? 125 SER A C    1  
ATOM 2040   O O    . SER A 1 125 ? -27.597 4.110   -5.614  1.00 0.00 ? 125 SER A O    1  
ATOM 2041   C CB   . SER A 1 125 ? -30.794 3.583   -6.478  1.00 0.00 ? 125 SER A CB   1  
ATOM 2042   O OG   . SER A 1 125 ? -31.780 2.565   -6.488  1.00 0.00 ? 125 SER A OG   1  
ATOM 2043   H H    . SER A 1 125 ? -29.776 1.740   -5.071  1.00 0.00 ? 125 SER A H    1  
ATOM 2044   H HA   . SER A 1 125 ? -29.395 2.600   -7.754  1.00 0.00 ? 125 SER A HA   1  
ATOM 2045   H HB2  . SER A 1 125 ? -30.797 4.078   -5.506  1.00 0.00 ? 125 SER A HB2  1  
ATOM 2046   H HB3  . SER A 1 125 ? -31.020 4.311   -7.257  1.00 0.00 ? 125 SER A HB3  1  
ATOM 2047   H HG   . SER A 1 125 ? -31.605 1.958   -7.230  1.00 0.00 ? 125 SER A HG   1  
ATOM 2048   N N    . GLN A 1 126 ? -28.186 4.852   -7.663  1.00 0.00 ? 126 GLN A N    1  
ATOM 2049   C CA   . GLN A 1 126 ? -27.192 5.921   -7.700  1.00 0.00 ? 126 GLN A CA   1  
ATOM 2050   C C    . GLN A 1 126 ? -27.512 6.965   -6.638  1.00 0.00 ? 126 GLN A C    1  
ATOM 2051   O O    . GLN A 1 126 ? -26.610 7.580   -6.066  1.00 0.00 ? 126 GLN A O    1  
ATOM 2052   C CB   . GLN A 1 126 ? -27.191 6.585   -9.080  1.00 0.00 ? 126 GLN A CB   1  
ATOM 2053   C CG   . GLN A 1 126 ? -27.024 5.626   -10.253 1.00 0.00 ? 126 GLN A CG   1  
ATOM 2054   C CD   . GLN A 1 126 ? -25.582 5.214   -10.485 1.00 0.00 ? 126 GLN A CD   1  
ATOM 2055   O OE1  . GLN A 1 126 ? -24.649 5.951   -10.164 1.00 0.00 ? 126 GLN A OE1  1  
ATOM 2056   N NE2  . GLN A 1 126 ? -25.389 4.037   -11.061 1.00 0.00 ? 126 GLN A NE2  1  
ATOM 2057   H H    . GLN A 1 126 ? -28.775 4.724   -8.439  1.00 0.00 ? 126 GLN A H    1  
ATOM 2058   H HA   . GLN A 1 126 ? -26.208 5.496   -7.504  1.00 0.00 ? 126 GLN A HA   1  
ATOM 2059   H HB2  . GLN A 1 126 ? -28.138 7.110   -9.205  1.00 0.00 ? 126 GLN A HB2  1  
ATOM 2060   H HB3  . GLN A 1 126 ? -26.371 7.302   -9.110  1.00 0.00 ? 126 GLN A HB3  1  
ATOM 2061   H HG2  . GLN A 1 126 ? -27.615 4.732   -10.058 1.00 0.00 ? 126 GLN A HG2  1  
ATOM 2062   H HG3  . GLN A 1 126 ? -27.396 6.112   -11.155 1.00 0.00 ? 126 GLN A HG3  1  
ATOM 2063   H HE21 . GLN A 1 126 ? -26.183 3.504   -11.305 1.00 0.00 ? 126 GLN A HE21 1  
ATOM 2064   H HE22 . GLN A 1 126 ? -24.468 3.743   -11.218 1.00 0.00 ? 126 GLN A HE22 1  
ATOM 2065   N N    . ALA A 1 127 ? -28.806 7.133   -6.381  1.00 0.00 ? 127 ALA A N    1  
ATOM 2066   C CA   . ALA A 1 127 ? -29.302 8.090   -5.402  1.00 0.00 ? 127 ALA A CA   1  
ATOM 2067   C C    . ALA A 1 127 ? -28.719 7.859   -4.009  1.00 0.00 ? 127 ALA A C    1  
ATOM 2068   O O    . ALA A 1 127 ? -28.248 6.765   -3.680  1.00 0.00 ? 127 ALA A O    1  
ATOM 2069   C CB   . ALA A 1 127 ? -30.821 8.046   -5.356  1.00 0.00 ? 127 ALA A CB   1  
ATOM 2070   H H    . ALA A 1 127 ? -29.455 6.597   -6.879  1.00 0.00 ? 127 ALA A H    1  
ATOM 2071   H HA   . ALA A 1 127 ? -28.999 9.084   -5.730  1.00 0.00 ? 127 ALA A HA   1  
ATOM 2072   H HB1  . ALA A 1 127 ? -31.193 8.793   -4.656  1.00 0.00 ? 127 ALA A HB1  1  
ATOM 2073   H HB2  . ALA A 1 127 ? -31.218 8.252   -6.350  1.00 0.00 ? 127 ALA A HB2  1  
ATOM 2074   H HB3  . ALA A 1 127 ? -31.145 7.056   -5.034  1.00 0.00 ? 127 ALA A HB3  1  
ATOM 2075   N N    . GLU A 1 128 ? -28.775 8.899   -3.193  1.00 0.00 ? 128 GLU A N    1  
ATOM 2076   C CA   . GLU A 1 128 ? -28.251 8.852   -1.837  1.00 0.00 ? 128 GLU A CA   1  
ATOM 2077   C C    . GLU A 1 128 ? -29.321 8.382   -0.854  1.00 0.00 ? 128 GLU A C    1  
ATOM 2078   O O    . GLU A 1 128 ? -30.510 8.662   -1.039  1.00 0.00 ? 128 GLU A O    1  
ATOM 2079   C CB   . GLU A 1 128 ? -27.752 10.248  -1.442  1.00 0.00 ? 128 GLU A CB   1  
ATOM 2080   C CG   . GLU A 1 128 ? -27.138 10.336  -0.054  1.00 0.00 ? 128 GLU A CG   1  
ATOM 2081   C CD   . GLU A 1 128 ? -25.674 9.949   -0.032  1.00 0.00 ? 128 GLU A CD   1  
ATOM 2082   O OE1  . GLU A 1 128 ? -25.266 9.065   -0.813  1.00 0.00 ? 128 GLU A OE1  1  
ATOM 2083   O OE2  . GLU A 1 128 ? -24.919 10.522  0.775   1.00 0.00 ? 128 GLU A OE2  1  
ATOM 2084   H H    . GLU A 1 128 ? -29.198 9.727   -3.509  1.00 0.00 ? 128 GLU A H    1  
ATOM 2085   H HA   . GLU A 1 128 ? -27.415 8.154   -1.808  1.00 0.00 ? 128 GLU A HA   1  
ATOM 2086   H HB2  . GLU A 1 128 ? -26.998 10.557  -2.167  1.00 0.00 ? 128 GLU A HB2  1  
ATOM 2087   H HB3  . GLU A 1 128 ? -28.597 10.935  -1.483  1.00 0.00 ? 128 GLU A HB3  1  
ATOM 2088   H HG2  . GLU A 1 128 ? -27.234 11.361  0.305   1.00 0.00 ? 128 GLU A HG2  1  
ATOM 2089   H HG3  . GLU A 1 128 ? -27.685 9.670   0.612   1.00 0.00 ? 128 GLU A HG3  1  
ATOM 2090   H HE2  . GLU A 1 128 ? -24.006 10.228  0.737   1.00 0.00 ? 128 GLU A HE2  1  
ATOM 2091   N N    . ASN A 1 129 ? -28.891 7.645   0.174   1.00 0.00 ? 129 ASN A N    1  
ATOM 2092   C CA   . ASN A 1 129 ? -29.787 7.133   1.219   1.00 0.00 ? 129 ASN A CA   1  
ATOM 2093   C C    . ASN A 1 129 ? -30.687 6.014   0.697   1.00 0.00 ? 129 ASN A C    1  
ATOM 2094   O O    . ASN A 1 129 ? -31.787 5.787   1.203   1.00 0.00 ? 129 ASN A O    1  
ATOM 2095   C CB   . ASN A 1 129 ? -30.613 8.264   1.850   1.00 0.00 ? 129 ASN A CB   1  
ATOM 2096   C CG   . ASN A 1 129 ? -31.222 7.887   3.187   1.00 0.00 ? 129 ASN A CG   1  
ATOM 2097   O OD1  . ASN A 1 129 ? -30.647 7.110   3.951   1.00 0.00 ? 129 ASN A OD1  1  
ATOM 2098   N ND2  . ASN A 1 129 ? -32.389 8.440   3.478   1.00 0.00 ? 129 ASN A ND2  1  
ATOM 2099   H H    . ASN A 1 129 ? -27.939 7.421   0.222   1.00 0.00 ? 129 ASN A H    1  
ATOM 2100   H HA   . ASN A 1 129 ? -29.158 6.709   2.002   1.00 0.00 ? 129 ASN A HA   1  
ATOM 2101   H HB2  . ASN A 1 129 ? -29.964 9.128   1.994   1.00 0.00 ? 129 ASN A HB2  1  
ATOM 2102   H HB3  . ASN A 1 129 ? -31.418 8.530   1.165   1.00 0.00 ? 129 ASN A HB3  1  
ATOM 2103   H HD21 . ASN A 1 129 ? -32.786 9.054   2.821   1.00 0.00 ? 129 ASN A HD21 1  
ATOM 2104   H HD22 . ASN A 1 129 ? -32.811 8.215   4.332   1.00 0.00 ? 129 ASN A HD22 1  
ATOM 2105   N N    . MET A 1 130 ? -30.209 5.307   -0.310  1.00 0.00 ? 130 MET A N    1  
ATOM 2106   C CA   . MET A 1 130 ? -30.968 4.208   -0.892  1.00 0.00 ? 130 MET A CA   1  
ATOM 2107   C C    . MET A 1 130 ? -30.592 2.883   -0.239  1.00 0.00 ? 130 MET A C    1  
ATOM 2108   O O    . MET A 1 130 ? -29.422 2.642   0.060   1.00 0.00 ? 130 MET A O    1  
ATOM 2109   C CB   . MET A 1 130 ? -30.753 4.142   -2.406  1.00 0.00 ? 130 MET A CB   1  
ATOM 2110   C CG   . MET A 1 130 ? -31.474 5.236   -3.181  1.00 0.00 ? 130 MET A CG   1  
ATOM 2111   S SD   . MET A 1 130 ? -33.270 5.169   -3.001  1.00 0.00 ? 130 MET A SD   1  
ATOM 2112   C CE   . MET A 1 130 ? -33.640 3.616   -3.815  1.00 0.00 ? 130 MET A CE   1  
ATOM 2113   H H    . MET A 1 130 ? -29.323 5.520   -0.668  1.00 0.00 ? 130 MET A H    1  
ATOM 2114   H HA   . MET A 1 130 ? -32.025 4.394   -0.705  1.00 0.00 ? 130 MET A HA   1  
ATOM 2115   H HB2  . MET A 1 130 ? -29.685 4.227   -2.605  1.00 0.00 ? 130 MET A HB2  1  
ATOM 2116   H HB3  . MET A 1 130 ? -31.113 3.176   -2.761  1.00 0.00 ? 130 MET A HB3  1  
ATOM 2117   H HG2  . MET A 1 130 ? -31.123 6.205   -2.826  1.00 0.00 ? 130 MET A HG2  1  
ATOM 2118   H HG3  . MET A 1 130 ? -31.224 5.140   -4.237  1.00 0.00 ? 130 MET A HG3  1  
ATOM 2119   H HE1  . MET A 1 130 ? -33.121 2.806   -3.303  1.00 0.00 ? 130 MET A HE1  1  
ATOM 2120   H HE2  . MET A 1 130 ? -34.713 3.428   -3.789  1.00 0.00 ? 130 MET A HE2  1  
ATOM 2121   H HE3  . MET A 1 130 ? -33.308 3.663   -4.852  1.00 0.00 ? 130 MET A HE3  1  
ATOM 2122   N N    . PRO A 1 131 ? -31.586 2.017   0.014   1.00 0.00 ? 131 PRO A N    1  
ATOM 2123   C CA   . PRO A 1 131 ? -31.362 0.706   0.628   1.00 0.00 ? 131 PRO A CA   1  
ATOM 2124   C C    . PRO A 1 131 ? -30.717 -0.273  -0.349  1.00 0.00 ? 131 PRO A C    1  
ATOM 2125   O O    . PRO A 1 131 ? -30.619 0.003   -1.548  1.00 0.00 ? 131 PRO A O    1  
ATOM 2126   C CB   . PRO A 1 131 ? -32.778 0.223   0.998   1.00 0.00 ? 131 PRO A CB   1  
ATOM 2127   C CG   . PRO A 1 131 ? -33.676 1.397   0.774   1.00 0.00 ? 131 PRO A CG   1  
ATOM 2128   C CD   . PRO A 1 131 ? -33.008 2.245   -0.268  1.00 0.00 ? 131 PRO A CD   1  
ATOM 2129   H HA   . PRO A 1 131 ? -30.741 0.797   1.519   1.00 0.00 ? 131 PRO A HA   1  
ATOM 2130   H HB2  . PRO A 1 131 ? -33.079 -0.634  0.395   1.00 0.00 ? 131 PRO A HB2  1  
ATOM 2131   H HB3  . PRO A 1 131 ? -32.794 -0.026  2.059   1.00 0.00 ? 131 PRO A HB3  1  
ATOM 2132   H HG2  . PRO A 1 131 ? -34.621 1.033   0.369   1.00 0.00 ? 131 PRO A HG2  1  
ATOM 2133   H HG3  . PRO A 1 131 ? -33.841 1.955   1.696   1.00 0.00 ? 131 PRO A HG3  1  
ATOM 2134   H HD2  . PRO A 1 131 ? -33.285 1.934   -1.276  1.00 0.00 ? 131 PRO A HD2  1  
ATOM 2135   H HD3  . PRO A 1 131 ? -33.250 3.297   -0.115  1.00 0.00 ? 131 PRO A HD3  1  
ATOM 2136   N N    . VAL A 1 132 ? -30.302 -1.424  0.163   1.00 0.00 ? 132 VAL A N    1  
ATOM 2137   C CA   . VAL A 1 132 ? -29.664 -2.444  -0.655  1.00 0.00 ? 132 VAL A CA   1  
ATOM 2138   C C    . VAL A 1 132 ? -30.692 -3.486  -1.091  1.00 0.00 ? 132 VAL A C    1  
ATOM 2139   O O    . VAL A 1 132 ? -31.500 -3.946  -0.282  1.00 0.00 ? 132 VAL A O    1  
ATOM 2140   C CB   . VAL A 1 132 ? -28.516 -3.136  0.115   1.00 0.00 ? 132 VAL A CB   1  
ATOM 2141   C CG1  . VAL A 1 132 ? -27.810 -4.155  -0.763  1.00 0.00 ? 132 VAL A CG1  1  
ATOM 2142   C CG2  . VAL A 1 132 ? -27.523 -2.109  0.636   1.00 0.00 ? 132 VAL A CG2  1  
ATOM 2143   H H    . VAL A 1 132 ? -30.453 -1.610  1.115   1.00 0.00 ? 132 VAL A H    1  
ATOM 2144   H HA   . VAL A 1 132 ? -29.250 -1.964  -1.542  1.00 0.00 ? 132 VAL A HA   1  
ATOM 2145   H HB   . VAL A 1 132 ? -28.946 -3.660  0.969   1.00 0.00 ? 132 VAL A HB   1  
ATOM 2146   H HG11 . VAL A 1 132 ? -27.020 -4.648  -0.197  1.00 0.00 ? 132 VAL A HG11 1  
ATOM 2147   H HG12 . VAL A 1 132 ? -28.529 -4.901  -1.103  1.00 0.00 ? 132 VAL A HG12 1  
ATOM 2148   H HG13 . VAL A 1 132 ? -27.375 -3.650  -1.626  1.00 0.00 ? 132 VAL A HG13 1  
ATOM 2149   H HG21 . VAL A 1 132 ? -28.039 -1.405  1.289   1.00 0.00 ? 132 VAL A HG21 1  
ATOM 2150   H HG22 . VAL A 1 132 ? -26.733 -2.610  1.197   1.00 0.00 ? 132 VAL A HG22 1  
ATOM 2151   H HG23 . VAL A 1 132 ? -27.084 -1.571  -0.204  1.00 0.00 ? 132 VAL A HG23 1  
ATOM 2152   N N    . PHE A 1 133 ? -30.668 -3.845  -2.370  1.00 0.00 ? 133 PHE A N    1  
ATOM 2153   C CA   . PHE A 1 133 ? -31.600 -4.826  -2.907  1.00 0.00 ? 133 PHE A CA   1  
ATOM 2154   C C    . PHE A 1 133 ? -30.919 -5.720  -3.937  1.00 0.00 ? 133 PHE A C    1  
ATOM 2155   O O    . PHE A 1 133 ? -29.762 -5.503  -4.290  1.00 0.00 ? 133 PHE A O    1  
ATOM 2156   C CB   . PHE A 1 133 ? -32.825 -4.135  -3.523  1.00 0.00 ? 133 PHE A CB   1  
ATOM 2157   C CG   . PHE A 1 133 ? -32.498 -2.967  -4.416  1.00 0.00 ? 133 PHE A CG   1  
ATOM 2158   C CD1  . PHE A 1 133 ? -32.194 -3.161  -5.753  1.00 0.00 ? 133 PHE A CD1  1  
ATOM 2159   C CD2  . PHE A 1 133 ? -32.497 -1.675  -3.914  1.00 0.00 ? 133 PHE A CD2  1  
ATOM 2160   C CE1  . PHE A 1 133 ? -31.896 -2.091  -6.571  1.00 0.00 ? 133 PHE A CE1  1  
ATOM 2161   C CE2  . PHE A 1 133 ? -32.198 -0.601  -4.727  1.00 0.00 ? 133 PHE A CE2  1  
ATOM 2162   C CZ   . PHE A 1 133 ? -31.898 -0.810  -6.058  1.00 0.00 ? 133 PHE A CZ   1  
ATOM 2163   H H    . PHE A 1 133 ? -29.998 -3.445  -2.972  1.00 0.00 ? 133 PHE A H    1  
ATOM 2164   H HA   . PHE A 1 133 ? -31.940 -5.452  -2.082  1.00 0.00 ? 133 PHE A HA   1  
ATOM 2165   H HB2  . PHE A 1 133 ? -33.377 -4.871  -4.108  1.00 0.00 ? 133 PHE A HB2  1  
ATOM 2166   H HB3  . PHE A 1 133 ? -33.464 -3.781  -2.714  1.00 0.00 ? 133 PHE A HB3  1  
ATOM 2167   H HD1  . PHE A 1 133 ? -32.189 -4.161  -6.160  1.00 0.00 ? 133 PHE A HD1  1  
ATOM 2168   H HD2  . PHE A 1 133 ? -32.732 -1.507  -2.873  1.00 0.00 ? 133 PHE A HD2  1  
ATOM 2169   H HE1  . PHE A 1 133 ? -31.662 -2.256  -7.613  1.00 0.00 ? 133 PHE A HE1  1  
ATOM 2170   H HE2  . PHE A 1 133 ? -32.200 0.401   -4.323  1.00 0.00 ? 133 PHE A HE2  1  
ATOM 2171   H HZ   . PHE A 1 133 ? -31.664 0.028   -6.697  1.00 0.00 ? 133 PHE A HZ   1  
ATOM 2172   N N    . LEU A 1 134 ? -31.631 -6.733  -4.400  1.00 0.00 ? 134 LEU A N    1  
ATOM 2173   C CA   . LEU A 1 134 ? -31.099 -7.651  -5.393  1.00 0.00 ? 134 LEU A CA   1  
ATOM 2174   C C    . LEU A 1 134 ? -31.599 -7.254  -6.778  1.00 0.00 ? 134 LEU A C    1  
ATOM 2175   O O    . LEU A 1 134 ? -32.796 -7.051  -6.972  1.00 0.00 ? 134 LEU A O    1  
ATOM 2176   C CB   . LEU A 1 134 ? -31.532 -9.082  -5.066  1.00 0.00 ? 134 LEU A CB   1  
ATOM 2177   C CG   . LEU A 1 134 ? -30.579 -10.192 -5.505  1.00 0.00 ? 134 LEU A CG   1  
ATOM 2178   C CD1  . LEU A 1 134 ? -29.266 -10.106 -4.745  1.00 0.00 ? 134 LEU A CD1  1  
ATOM 2179   C CD2  . LEU A 1 134 ? -31.225 -11.556 -5.315  1.00 0.00 ? 134 LEU A CD2  1  
ATOM 2180   H H    . LEU A 1 134 ? -32.536 -6.872  -4.060  1.00 0.00 ? 134 LEU A H    1  
ATOM 2181   H HA   . LEU A 1 134 ? -30.010 -7.597  -5.377  1.00 0.00 ? 134 LEU A HA   1  
ATOM 2182   H HB2  . LEU A 1 134 ? -31.650 -9.154  -3.984  1.00 0.00 ? 134 LEU A HB2  1  
ATOM 2183   H HB3  . LEU A 1 134 ? -32.493 -9.257  -5.549  1.00 0.00 ? 134 LEU A HB3  1  
ATOM 2184   H HG   . LEU A 1 134 ? -30.368 -10.060 -6.566  1.00 0.00 ? 134 LEU A HG   1  
ATOM 2185   H HD11 . LEU A 1 134 ? -28.589 -10.890 -5.085  1.00 0.00 ? 134 LEU A HD11 1  
ATOM 2186   H HD12 . LEU A 1 134 ? -28.808 -9.133  -4.921  1.00 0.00 ? 134 LEU A HD12 1  
ATOM 2187   H HD13 . LEU A 1 134 ? -29.456 -10.231 -3.679  1.00 0.00 ? 134 LEU A HD13 1  
ATOM 2188   H HD21 . LEU A 1 134 ? -32.148 -11.603 -5.893  1.00 0.00 ? 134 LEU A HD21 1  
ATOM 2189   H HD22 . LEU A 1 134 ? -30.546 -12.338 -5.655  1.00 0.00 ? 134 LEU A HD22 1  
ATOM 2190   H HD23 . LEU A 1 134 ? -31.450 -11.706 -4.259  1.00 0.00 ? 134 LEU A HD23 1  
ATOM 2191   N N    . GLY A 1 135 ? -30.683 -7.136  -7.729  1.00 0.00 ? 135 GLY A N    1  
ATOM 2192   C CA   . GLY A 1 135 ? -31.053 -6.755  -9.075  1.00 0.00 ? 135 GLY A CA   1  
ATOM 2193   C C    . GLY A 1 135 ? -30.561 -7.746  -10.108 1.00 0.00 ? 135 GLY A C    1  
ATOM 2194   O O    . GLY A 1 135 ? -29.532 -8.393  -9.922  1.00 0.00 ? 135 GLY A O    1  
ATOM 2195   H H    . GLY A 1 135 ? -29.737 -7.306  -7.513  1.00 0.00 ? 135 GLY A H    1  
ATOM 2196   H HA2  . GLY A 1 135 ? -32.139 -6.694  -9.136  1.00 0.00 ? 135 GLY A HA2  1  
ATOM 2197   H HA3  . GLY A 1 135 ? -30.624 -5.777  -9.293  1.00 0.00 ? 135 GLY A HA3  1  
ATOM 2198   N N    . GLY A 1 136 ? -31.289 -7.854  -11.206 1.00 0.00 ? 136 GLY A N    1  
ATOM 2199   C CA   . GLY A 1 136 ? -30.908 -8.782  -12.254 1.00 0.00 ? 136 GLY A CA   1  
ATOM 2200   C C    . GLY A 1 136 ? -30.465 -8.064  -13.509 1.00 0.00 ? 136 GLY A C    1  
ATOM 2201   O O    . GLY A 1 136 ? -30.368 -8.662  -14.581 1.00 0.00 ? 136 GLY A O    1  
ATOM 2202   H H    . GLY A 1 136 ? -32.084 -7.295  -11.316 1.00 0.00 ? 136 GLY A H    1  
ATOM 2203   H HA2  . GLY A 1 136 ? -30.088 -9.402  -11.894 1.00 0.00 ? 136 GLY A HA2  1  
ATOM 2204   H HA3  . GLY A 1 136 ? -31.762 -9.415  -12.492 1.00 0.00 ? 136 GLY A HA3  1  
ATOM 2205   N N    . THR A 1 137 ? -30.196 -6.777  -13.376 1.00 0.00 ? 137 THR A N    1  
ATOM 2206   C CA   . THR A 1 137 ? -29.769 -5.966  -14.503 1.00 0.00 ? 137 THR A CA   1  
ATOM 2207   C C    . THR A 1 137 ? -28.397 -5.347  -14.253 1.00 0.00 ? 137 THR A C    1  
ATOM 2208   O O    . THR A 1 137 ? -28.279 -4.142  -14.015 1.00 0.00 ? 137 THR A O    1  
ATOM 2209   C CB   . THR A 1 137 ? -30.795 -4.853  -14.792 1.00 0.00 ? 137 THR A CB   1  
ATOM 2210   O OG1  . THR A 1 137 ? -31.447 -4.474  -13.567 1.00 0.00 ? 137 THR A OG1  1  
ATOM 2211   C CG2  . THR A 1 137 ? -31.837 -5.338  -15.785 1.00 0.00 ? 137 THR A CG2  1  
ATOM 2212   H H    . THR A 1 137 ? -30.289 -6.356  -12.498 1.00 0.00 ? 137 THR A H    1  
ATOM 2213   H HA   . THR A 1 137 ? -29.703 -6.613  -15.378 1.00 0.00 ? 137 THR A HA   1  
ATOM 2214   H HB   . THR A 1 137 ? -30.277 -3.989  -15.208 1.00 0.00 ? 137 THR A HB   1  
ATOM 2215   H HG1  . THR A 1 137 ? -31.124 -3.608  -13.286 1.00 0.00 ? 137 THR A HG1  1  
ATOM 2216   H HG21 . THR A 1 137 ? -32.358 -6.202  -15.372 1.00 0.00 ? 137 THR A HG21 1  
ATOM 2217   H HG22 . THR A 1 137 ? -32.555 -4.542  -15.983 1.00 0.00 ? 137 THR A HG22 1  
ATOM 2218   H HG23 . THR A 1 137 ? -31.346 -5.622  -16.716 1.00 0.00 ? 137 THR A HG23 1  
ATOM 2219   N N    . LYS A 1 138 ? -27.366 -6.179  -14.291 1.00 0.00 ? 138 LYS A N    1  
ATOM 2220   C CA   . LYS A 1 138 ? -26.006 -5.715  -14.072 1.00 0.00 ? 138 LYS A CA   1  
ATOM 2221   C C    . LYS A 1 138 ? -25.565 -4.778  -15.186 1.00 0.00 ? 138 LYS A C    1  
ATOM 2222   O O    . LYS A 1 138 ? -25.748 -5.074  -16.370 1.00 0.00 ? 138 LYS A O    1  
ATOM 2223   C CB   . LYS A 1 138 ? -25.041 -6.894  -13.973 1.00 0.00 ? 138 LYS A CB   1  
ATOM 2224   C CG   . LYS A 1 138 ? -23.625 -6.499  -13.579 1.00 0.00 ? 138 LYS A CG   1  
ATOM 2225   C CD   . LYS A 1 138 ? -22.727 -7.714  -13.446 1.00 0.00 ? 138 LYS A CD   1  
ATOM 2226   C CE   . LYS A 1 138 ? -22.454 -8.352  -14.796 1.00 0.00 ? 138 LYS A CE   1  
ATOM 2227   N NZ   . LYS A 1 138 ? -21.640 -9.588  -14.668 1.00 0.00 ? 138 LYS A NZ   1  
ATOM 2228   H H    . LYS A 1 138 ? -27.524 -7.131  -14.470 1.00 0.00 ? 138 LYS A H    1  
ATOM 2229   H HA   . LYS A 1 138 ? -25.983 -5.168  -13.129 1.00 0.00 ? 138 LYS A HA   1  
ATOM 2230   H HB2  . LYS A 1 138 ? -25.423 -7.589  -13.225 1.00 0.00 ? 138 LYS A HB2  1  
ATOM 2231   H HB3  . LYS A 1 138 ? -25.002 -7.389  -14.943 1.00 0.00 ? 138 LYS A HB3  1  
ATOM 2232   H HG2  . LYS A 1 138 ? -23.216 -5.839  -14.344 1.00 0.00 ? 138 LYS A HG2  1  
ATOM 2233   H HG3  . LYS A 1 138 ? -23.656 -5.975  -12.624 1.00 0.00 ? 138 LYS A HG3  1  
ATOM 2234   H HD2  . LYS A 1 138 ? -21.780 -7.409  -13.000 1.00 0.00 ? 138 LYS A HD2  1  
ATOM 2235   H HD3  . LYS A 1 138 ? -23.213 -8.445  -12.800 1.00 0.00 ? 138 LYS A HD3  1  
ATOM 2236   H HE2  . LYS A 1 138 ? -23.405 -8.602  -15.268 1.00 0.00 ? 138 LYS A HE2  1  
ATOM 2237   H HE3  . LYS A 1 138 ? -21.919 -7.639  -15.423 1.00 0.00 ? 138 LYS A HE3  1  
ATOM 2238   H HZ1  . LYS A 1 138 ? -20.780 -9.393  -14.102 1.00 0.00 ? 138 LYS A HZ1  1  
ATOM 2239   H HZ2  . LYS A 1 138 ? -21.355 -9.928  -15.607 1.00 0.00 ? 138 LYS A HZ2  1  
ATOM 2240   H HZ3  . LYS A 1 138 ? -22.189 -10.335 -14.191 1.00 0.00 ? 138 LYS A HZ3  1  
ATOM 2241   N N    . GLY A 1 139 ? -24.998 -3.644  -14.802 1.00 0.00 ? 139 GLY A N    1  
ATOM 2242   C CA   . GLY A 1 139 ? -24.539 -2.678  -15.776 1.00 0.00 ? 139 GLY A CA   1  
ATOM 2243   C C    . GLY A 1 139 ? -25.658 -1.779  -16.261 1.00 0.00 ? 139 GLY A C    1  
ATOM 2244   O O    . GLY A 1 139 ? -25.519 -1.086  -17.271 1.00 0.00 ? 139 GLY A O    1  
ATOM 2245   H H    . GLY A 1 139 ? -24.891 -3.461  -13.840 1.00 0.00 ? 139 GLY A H    1  
ATOM 2246   H HA2  . GLY A 1 139 ? -23.763 -2.061  -15.322 1.00 0.00 ? 139 GLY A HA2  1  
ATOM 2247   H HA3  . GLY A 1 139 ? -24.121 -3.211  -16.630 1.00 0.00 ? 139 GLY A HA3  1  
ATOM 2248   N N    . GLY A 1 140 ? -26.772 -1.794  -15.539 1.00 0.00 ? 140 GLY A N    1  
ATOM 2249   C CA   . GLY A 1 140 ? -27.905 -0.971  -15.905 1.00 0.00 ? 140 GLY A CA   1  
ATOM 2250   C C    . GLY A 1 140 ? -27.857 0.380   -15.223 1.00 0.00 ? 140 GLY A C    1  
ATOM 2251   O O    . GLY A 1 140 ? -26.836 1.070   -15.264 1.00 0.00 ? 140 GLY A O    1  
ATOM 2252   H H    . GLY A 1 140 ? -26.825 -2.372  -14.748 1.00 0.00 ? 140 GLY A H    1  
ATOM 2253   H HA2  . GLY A 1 140 ? -27.900 -0.824  -16.985 1.00 0.00 ? 140 GLY A HA2  1  
ATOM 2254   H HA3  . GLY A 1 140 ? -28.822 -1.483  -15.615 1.00 0.00 ? 140 GLY A HA3  1  
ATOM 2255   N N    . GLN A 1 141 ? -28.954 0.758   -14.584 1.00 0.00 ? 141 GLN A N    1  
ATOM 2256   C CA   . GLN A 1 141 ? -29.026 2.032   -13.886 1.00 0.00 ? 141 GLN A CA   1  
ATOM 2257   C C    . GLN A 1 141 ? -28.474 1.878   -12.474 1.00 0.00 ? 141 GLN A C    1  
ATOM 2258   O O    . GLN A 1 141 ? -27.621 2.650   -12.034 1.00 0.00 ? 141 GLN A O    1  
ATOM 2259   C CB   . GLN A 1 141 ? -30.473 2.534   -13.821 1.00 0.00 ? 141 GLN A CB   1  
ATOM 2260   C CG   . GLN A 1 141 ? -31.267 2.372   -15.111 1.00 0.00 ? 141 GLN A CG   1  
ATOM 2261   C CD   . GLN A 1 141 ? -31.969 1.027   -15.212 1.00 0.00 ? 141 GLN A CD   1  
ATOM 2262   O OE1  . GLN A 1 141 ? -32.325 0.421   -14.204 1.00 0.00 ? 141 GLN A OE1  1  
ATOM 2263   N NE2  . GLN A 1 141 ? -32.166 0.549   -16.429 1.00 0.00 ? 141 GLN A NE2  1  
ATOM 2264   H H    . GLN A 1 141 ? -29.733 0.165   -14.577 1.00 0.00 ? 141 GLN A H    1  
ATOM 2265   H HA   . GLN A 1 141 ? -28.423 2.760   -14.428 1.00 0.00 ? 141 GLN A HA   1  
ATOM 2266   H HB2  . GLN A 1 141 ? -30.988 1.982   -13.035 1.00 0.00 ? 141 GLN A HB2  1  
ATOM 2267   H HB3  . GLN A 1 141 ? -30.452 3.594   -13.567 1.00 0.00 ? 141 GLN A HB3  1  
ATOM 2268   H HG2  . GLN A 1 141 ? -32.018 3.161   -15.160 1.00 0.00 ? 141 GLN A HG2  1  
ATOM 2269   H HG3  . GLN A 1 141 ? -30.585 2.473   -15.955 1.00 0.00 ? 141 GLN A HG3  1  
ATOM 2270   H HE21 . GLN A 1 141 ? -31.851 1.080   -17.193 1.00 0.00 ? 141 GLN A HE21 1  
ATOM 2271   H HE22 . GLN A 1 141 ? -32.625 -0.312  -16.520 1.00 0.00 ? 141 GLN A HE22 1  
ATOM 2272   N N    . ASP A 1 142 ? -28.970 0.865   -11.779 1.00 0.00 ? 142 ASP A N    1  
ATOM 2273   C CA   . ASP A 1 142 ? -28.550 0.588   -10.414 1.00 0.00 ? 142 ASP A CA   1  
ATOM 2274   C C    . ASP A 1 142 ? -27.146 -0.010  -10.375 1.00 0.00 ? 142 ASP A C    1  
ATOM 2275   O O    . ASP A 1 142 ? -26.768 -0.809  -11.237 1.00 0.00 ? 142 ASP A O    1  
ATOM 2276   C CB   . ASP A 1 142 ? -29.557 -0.319  -9.699  1.00 0.00 ? 142 ASP A CB   1  
ATOM 2277   C CG   . ASP A 1 142 ? -30.936 0.310   -9.579  1.00 0.00 ? 142 ASP A CG   1  
ATOM 2278   O OD1  . ASP A 1 142 ? -31.158 1.103   -8.639  1.00 0.00 ? 142 ASP A OD1  1  
ATOM 2279   O OD2  . ASP A 1 142 ? -31.808 0.015   -10.426 1.00 0.00 ? 142 ASP A OD2  1  
ATOM 2280   H H    . ASP A 1 142 ? -29.656 0.302   -12.194 1.00 0.00 ? 142 ASP A H    1  
ATOM 2281   H HA   . ASP A 1 142 ? -28.522 1.539   -9.881  1.00 0.00 ? 142 ASP A HA   1  
ATOM 2282   H HB2  . ASP A 1 142 ? -29.646 -1.251  -10.257 1.00 0.00 ? 142 ASP A HB2  1  
ATOM 2283   H HB3  . ASP A 1 142 ? -29.184 -0.535  -8.698  1.00 0.00 ? 142 ASP A HB3  1  
ATOM 2284   H HD2  . ASP A 1 142 ? -32.653 0.449   -10.288 1.00 0.00 ? 142 ASP A HD2  1  
ATOM 2285   N N    . ILE A 1 143 ? -26.378 0.402   -9.373  1.00 0.00 ? 143 ILE A N    1  
ATOM 2286   C CA   . ILE A 1 143 ? -25.009 -0.062  -9.187  1.00 0.00 ? 143 ILE A CA   1  
ATOM 2287   C C    . ILE A 1 143 ? -24.962 -1.567  -8.962  1.00 0.00 ? 143 ILE A C    1  
ATOM 2288   O O    . ILE A 1 143 ? -25.668 -2.098  -8.105  1.00 0.00 ? 143 ILE A O    1  
ATOM 2289   C CB   . ILE A 1 143 ? -24.328 0.655   -7.995  1.00 0.00 ? 143 ILE A CB   1  
ATOM 2290   C CG1  . ILE A 1 143 ? -24.003 2.107   -8.347  1.00 0.00 ? 143 ILE A CG1  1  
ATOM 2291   C CG2  . ILE A 1 143 ? -23.072 -0.081  -7.551  1.00 0.00 ? 143 ILE A CG2  1  
ATOM 2292   C CD1  . ILE A 1 143 ? -24.986 3.105   -7.784  1.00 0.00 ? 143 ILE A CD1  1  
ATOM 2293   H H    . ILE A 1 143 ? -26.751 1.042   -8.728  1.00 0.00 ? 143 ILE A H    1  
ATOM 2294   H HA   . ILE A 1 143 ? -24.451 0.171   -10.095 1.00 0.00 ? 143 ILE A HA   1  
ATOM 2295   H HB   . ILE A 1 143 ? -25.029 0.658   -7.161  1.00 0.00 ? 143 ILE A HB   1  
ATOM 2296   H HG12 . ILE A 1 143 ? -23.013 2.343   -7.957  1.00 0.00 ? 143 ILE A HG12 1  
ATOM 2297   H HG13 . ILE A 1 143 ? -23.999 2.206   -9.433  1.00 0.00 ? 143 ILE A HG13 1  
ATOM 2298   H HG21 . ILE A 1 143 ? -22.627 0.424   -6.694  1.00 0.00 ? 143 ILE A HG21 1  
ATOM 2299   H HG22 . ILE A 1 143 ? -23.332 -1.102  -7.272  1.00 0.00 ? 143 ILE A HG22 1  
ATOM 2300   H HG23 . ILE A 1 143 ? -22.355 -0.100  -8.371  1.00 0.00 ? 143 ILE A HG23 1  
ATOM 2301   H HD11 . ILE A 1 143 ? -24.997 3.026   -6.697  1.00 0.00 ? 143 ILE A HD11 1  
ATOM 2302   H HD12 . ILE A 1 143 ? -24.705 4.120   -8.065  1.00 0.00 ? 143 ILE A HD12 1  
ATOM 2303   H HD13 . ILE A 1 143 ? -25.981 2.890   -8.174  1.00 0.00 ? 143 ILE A HD13 1  
ATOM 2304   N N    . THR A 1 144 ? -24.145 -2.242  -9.756  1.00 0.00 ? 144 THR A N    1  
ATOM 2305   C CA   . THR A 1 144 ? -23.988 -3.681  -9.643  1.00 0.00 ? 144 THR A CA   1  
ATOM 2306   C C    . THR A 1 144 ? -22.525 -4.070  -9.408  1.00 0.00 ? 144 THR A C    1  
ATOM 2307   O O    . THR A 1 144 ? -22.195 -5.254  -9.310  1.00 0.00 ? 144 THR A O    1  
ATOM 2308   C CB   . THR A 1 144 ? -24.524 -4.388  -10.900 1.00 0.00 ? 144 THR A CB   1  
ATOM 2309   O OG1  . THR A 1 144 ? -25.015 -3.405  -11.829 1.00 0.00 ? 144 THR A OG1  1  
ATOM 2310   C CG2  . THR A 1 144 ? -25.659 -5.329  -10.527 1.00 0.00 ? 144 THR A CG2  1  
ATOM 2311   H H    . THR A 1 144 ? -23.657 -1.755  -10.454 1.00 0.00 ? 144 THR A H    1  
ATOM 2312   H HA   . THR A 1 144 ? -24.572 -4.015  -8.785  1.00 0.00 ? 144 THR A HA   1  
ATOM 2313   H HB   . THR A 1 144 ? -23.719 -4.958  -11.364 1.00 0.00 ? 144 THR A HB   1  
ATOM 2314   H HG1  . THR A 1 144 ? -25.603 -2.795  -11.364 1.00 0.00 ? 144 THR A HG1  1  
ATOM 2315   H HG21 . THR A 1 144 ? -26.466 -4.759  -10.065 1.00 0.00 ? 144 THR A HG21 1  
ATOM 2316   H HG22 . THR A 1 144 ? -26.034 -5.825  -11.422 1.00 0.00 ? 144 THR A HG22 1  
ATOM 2317   H HG23 . THR A 1 144 ? -25.294 -6.077  -9.824  1.00 0.00 ? 144 THR A HG23 1  
ATOM 2318   N N    . ASP A 1 145 ? -21.657 -3.065  -9.317  1.00 0.00 ? 145 ASP A N    1  
ATOM 2319   C CA   . ASP A 1 145 ? -20.230 -3.291  -9.092  1.00 0.00 ? 145 ASP A CA   1  
ATOM 2320   C C    . ASP A 1 145 ? -19.793 -2.671  -7.765  1.00 0.00 ? 145 ASP A C    1  
ATOM 2321   O O    . ASP A 1 145 ? -20.230 -1.578  -7.407  1.00 0.00 ? 145 ASP A O    1  
ATOM 2322   C CB   . ASP A 1 145 ? -19.397 -2.737  -10.256 1.00 0.00 ? 145 ASP A CB   1  
ATOM 2323   C CG   . ASP A 1 145 ? -19.527 -1.234  -10.432 1.00 0.00 ? 145 ASP A CG   1  
ATOM 2324   O OD1  . ASP A 1 145 ? -20.653 -0.749  -10.666 1.00 0.00 ? 145 ASP A OD1  1  
ATOM 2325   O OD2  . ASP A 1 145 ? -18.498 -0.531  -10.342 1.00 0.00 ? 145 ASP A OD2  1  
ATOM 2326   H H    . ASP A 1 145 ? -21.983 -2.143  -9.397  1.00 0.00 ? 145 ASP A H    1  
ATOM 2327   H HA   . ASP A 1 145 ? -20.064 -4.367  -9.038  1.00 0.00 ? 145 ASP A HA   1  
ATOM 2328   H HB2  . ASP A 1 145 ? -18.348 -2.974  -10.075 1.00 0.00 ? 145 ASP A HB2  1  
ATOM 2329   H HB3  . ASP A 1 145 ? -19.721 -3.222  -11.176 1.00 0.00 ? 145 ASP A HB3  1  
ATOM 2330   H HD2  . ASP A 1 145 ? -18.653 0.408   -10.465 1.00 0.00 ? 145 ASP A HD2  1  
ATOM 2331   N N    . PHE A 1 146 ? -18.912 -3.356  -7.045  1.00 0.00 ? 146 PHE A N    1  
ATOM 2332   C CA   . PHE A 1 146 ? -18.454 -2.874  -5.746  1.00 0.00 ? 146 PHE A CA   1  
ATOM 2333   C C    . PHE A 1 146 ? -16.940 -2.996  -5.596  1.00 0.00 ? 146 PHE A C    1  
ATOM 2334   O O    . PHE A 1 146 ? -16.253 -3.516  -6.478  1.00 0.00 ? 146 PHE A O    1  
ATOM 2335   C CB   . PHE A 1 146 ? -19.149 -3.642  -4.612  1.00 0.00 ? 146 PHE A CB   1  
ATOM 2336   C CG   . PHE A 1 146 ? -20.619 -3.359  -4.471  1.00 0.00 ? 146 PHE A CG   1  
ATOM 2337   C CD1  . PHE A 1 146 ? -21.064 -2.320  -3.667  1.00 0.00 ? 146 PHE A CD1  1  
ATOM 2338   C CD2  . PHE A 1 146 ? -21.556 -4.131  -5.138  1.00 0.00 ? 146 PHE A CD2  1  
ATOM 2339   C CE1  . PHE A 1 146 ? -22.415 -2.057  -3.533  1.00 0.00 ? 146 PHE A CE1  1  
ATOM 2340   C CE2  . PHE A 1 146 ? -22.906 -3.875  -5.008  1.00 0.00 ? 146 PHE A CE2  1  
ATOM 2341   C CZ   . PHE A 1 146 ? -23.337 -2.837  -4.205  1.00 0.00 ? 146 PHE A CZ   1  
ATOM 2342   H H    . PHE A 1 146 ? -18.535 -4.188  -7.413  1.00 0.00 ? 146 PHE A H    1  
ATOM 2343   H HA   . PHE A 1 146 ? -18.723 -1.821  -5.666  1.00 0.00 ? 146 PHE A HA   1  
ATOM 2344   H HB2  . PHE A 1 146 ? -19.022 -4.710  -4.793  1.00 0.00 ? 146 PHE A HB2  1  
ATOM 2345   H HB3  . PHE A 1 146 ? -18.659 -3.386  -3.673  1.00 0.00 ? 146 PHE A HB3  1  
ATOM 2346   H HD1  . PHE A 1 146 ? -20.347 -1.708  -3.140  1.00 0.00 ? 146 PHE A HD1  1  
ATOM 2347   H HD2  . PHE A 1 146 ? -21.225 -4.943  -5.768  1.00 0.00 ? 146 PHE A HD2  1  
ATOM 2348   H HE1  . PHE A 1 146 ? -22.748 -1.245  -2.904  1.00 0.00 ? 146 PHE A HE1  1  
ATOM 2349   H HE2  . PHE A 1 146 ? -23.624 -4.486  -5.535  1.00 0.00 ? 146 PHE A HE2  1  
ATOM 2350   H HZ   . PHE A 1 146 ? -24.393 -2.635  -4.102  1.00 0.00 ? 146 PHE A HZ   1  
ATOM 2351   N N    . THR A 1 147 ? -16.429 -2.481  -4.484  1.00 0.00 ? 147 THR A N    1  
ATOM 2352   C CA   . THR A 1 147 ? -15.007 -2.534  -4.174  1.00 0.00 ? 147 THR A CA   1  
ATOM 2353   C C    . THR A 1 147 ? -14.790 -3.346  -2.898  1.00 0.00 ? 147 THR A C    1  
ATOM 2354   O O    . THR A 1 147 ? -15.745 -3.639  -2.176  1.00 0.00 ? 147 THR A O    1  
ATOM 2355   C CB   . THR A 1 147 ? -14.430 -1.120  -3.958  1.00 0.00 ? 147 THR A CB   1  
ATOM 2356   O OG1  . THR A 1 147 ? -15.246 -0.402  -3.028  1.00 0.00 ? 147 THR A OG1  1  
ATOM 2357   C CG2  . THR A 1 147 ? -14.365 -0.351  -5.263  1.00 0.00 ? 147 THR A CG2  1  
ATOM 2358   H H    . THR A 1 147 ? -17.034 -2.041  -3.850  1.00 0.00 ? 147 THR A H    1  
ATOM 2359   H HA   . THR A 1 147 ? -14.485 -3.011  -5.003  1.00 0.00 ? 147 THR A HA   1  
ATOM 2360   H HB   . THR A 1 147 ? -13.423 -1.212  -3.552  1.00 0.00 ? 147 THR A HB   1  
ATOM 2361   H HG1  . THR A 1 147 ? -14.712 -0.175  -2.252  1.00 0.00 ? 147 THR A HG1  1  
ATOM 2362   H HG21 . THR A 1 147 ? -15.369 -0.253  -5.677  1.00 0.00 ? 147 THR A HG21 1  
ATOM 2363   H HG22 . THR A 1 147 ? -13.948 0.641   -5.090  1.00 0.00 ? 147 THR A HG22 1  
ATOM 2364   H HG23 . THR A 1 147 ? -13.733 -0.889  -5.969  1.00 0.00 ? 147 THR A HG23 1  
ATOM 2365   N N    . MET A 1 148 ? -13.543 -3.698  -2.619  1.00 0.00 ? 148 MET A N    1  
ATOM 2366   C CA   . MET A 1 148 ? -13.212 -4.471  -1.430  1.00 0.00 ? 148 MET A CA   1  
ATOM 2367   C C    . MET A 1 148 ? -12.026 -3.846  -0.700  1.00 0.00 ? 148 MET A C    1  
ATOM 2368   O O    . MET A 1 148 ? -10.950 -3.683  -1.275  1.00 0.00 ? 148 MET A O    1  
ATOM 2369   C CB   . MET A 1 148 ? -12.903 -5.922  -1.820  1.00 0.00 ? 148 MET A CB   1  
ATOM 2370   C CG   . MET A 1 148 ? -12.416 -6.806  -0.681  1.00 0.00 ? 148 MET A CG   1  
ATOM 2371   S SD   . MET A 1 148 ? -12.220 -8.532  -1.172  1.00 0.00 ? 148 MET A SD   1  
ATOM 2372   C CE   . MET A 1 148 ? -11.127 -8.369  -2.583  1.00 0.00 ? 148 MET A CE   1  
ATOM 2373   H H    . MET A 1 148 ? -12.822 -3.431  -3.226  1.00 0.00 ? 148 MET A H    1  
ATOM 2374   H HA   . MET A 1 148 ? -14.074 -4.465  -0.763  1.00 0.00 ? 148 MET A HA   1  
ATOM 2375   H HB2  . MET A 1 148 ? -13.812 -6.365  -2.226  1.00 0.00 ? 148 MET A HB2  1  
ATOM 2376   H HB3  . MET A 1 148 ? -12.131 -5.908  -2.589  1.00 0.00 ? 148 MET A HB3  1  
ATOM 2377   H HG2  . MET A 1 148 ? -11.455 -6.430  -0.329  1.00 0.00 ? 148 MET A HG2  1  
ATOM 2378   H HG3  . MET A 1 148 ? -13.133 -6.753  0.138   1.00 0.00 ? 148 MET A HG3  1  
ATOM 2379   H HE1  . MET A 1 148 ? -10.196 -7.899  -2.267  1.00 0.00 ? 148 MET A HE1  1  
ATOM 2380   H HE2  . MET A 1 148 ? -10.909 -9.352  -3.002  1.00 0.00 ? 148 MET A HE2  1  
ATOM 2381   H HE3  . MET A 1 148 ? -11.606 -7.752  -3.343  1.00 0.00 ? 148 MET A HE3  1  
ATOM 2382   N N    . GLN A 1 149 ? -12.232 -3.469  0.556   1.00 0.00 ? 149 GLN A N    1  
ATOM 2383   C CA   . GLN A 1 149 ? -11.168 -2.871  1.356   1.00 0.00 ? 149 GLN A CA   1  
ATOM 2384   C C    . GLN A 1 149 ? -10.937 -3.675  2.631   1.00 0.00 ? 149 GLN A C    1  
ATOM 2385   O O    . GLN A 1 149 ? -11.821 -3.752  3.486   1.00 0.00 ? 149 GLN A O    1  
ATOM 2386   C CB   . GLN A 1 149 ? -11.491 -1.418  1.719   1.00 0.00 ? 149 GLN A CB   1  
ATOM 2387   C CG   . GLN A 1 149 ? -11.682 -0.479  0.537   1.00 0.00 ? 149 GLN A CG   1  
ATOM 2388   C CD   . GLN A 1 149 ? -13.123 -0.394  0.070   1.00 0.00 ? 149 GLN A CD   1  
ATOM 2389   O OE1  . GLN A 1 149 ? -13.394 -0.133  -1.100  1.00 0.00 ? 149 GLN A OE1  1  
ATOM 2390   N NE2  . GLN A 1 149 ? -14.060 -0.606  0.980   1.00 0.00 ? 149 GLN A NE2  1  
ATOM 2391   H H    . GLN A 1 149 ? -13.124 -3.589  0.954   1.00 0.00 ? 149 GLN A H    1  
ATOM 2392   H HA   . GLN A 1 149 ? -10.253 -2.884  0.763   1.00 0.00 ? 149 GLN A HA   1  
ATOM 2393   H HB2  . GLN A 1 149 ? -12.411 -1.414  2.304   1.00 0.00 ? 149 GLN A HB2  1  
ATOM 2394   H HB3  . GLN A 1 149 ? -10.672 -1.033  2.327   1.00 0.00 ? 149 GLN A HB3  1  
ATOM 2395   H HG2  . GLN A 1 149 ? -11.351 0.518   0.828   1.00 0.00 ? 149 GLN A HG2  1  
ATOM 2396   H HG3  . GLN A 1 149 ? -11.068 -0.833  -0.291  1.00 0.00 ? 149 GLN A HG3  1  
ATOM 2397   H HE21 . GLN A 1 149 ? -13.779 -0.801  1.903   1.00 0.00 ? 149 GLN A HE21 1  
ATOM 2398   H HE22 . GLN A 1 149 ? -14.996 -0.576  0.696   1.00 0.00 ? 149 GLN A HE22 1  
ATOM 2399   N N    . PHE A 1 150 ? -9.761  -4.286  2.753   1.00 0.00 ? 150 PHE A N    1  
ATOM 2400   C CA   . PHE A 1 150 ? -9.427  -5.072  3.937   1.00 0.00 ? 150 PHE A CA   1  
ATOM 2401   C C    . PHE A 1 150 ? -9.104  -4.160  5.114   1.00 0.00 ? 150 PHE A C    1  
ATOM 2402   O O    . PHE A 1 150 ? -8.358  -3.190  4.970   1.00 0.00 ? 150 PHE A O    1  
ATOM 2403   C CB   . PHE A 1 150 ? -8.235  -5.992  3.655   1.00 0.00 ? 150 PHE A CB   1  
ATOM 2404   C CG   . PHE A 1 150 ? -8.506  -7.069  2.646   1.00 0.00 ? 150 PHE A CG   1  
ATOM 2405   C CD1  . PHE A 1 150 ? -9.248  -8.188  2.986   1.00 0.00 ? 150 PHE A CD1  1  
ATOM 2406   C CD2  . PHE A 1 150 ? -8.018  -6.961  1.356   1.00 0.00 ? 150 PHE A CD2  1  
ATOM 2407   C CE1  . PHE A 1 150 ? -9.498  -9.179  2.058   1.00 0.00 ? 150 PHE A CE1  1  
ATOM 2408   C CE2  . PHE A 1 150 ? -8.263  -7.948  0.423   1.00 0.00 ? 150 PHE A CE2  1  
ATOM 2409   C CZ   . PHE A 1 150 ? -9.004  -9.058  0.774   1.00 0.00 ? 150 PHE A CZ   1  
ATOM 2410   H H    . PHE A 1 150 ? -9.100  -4.207  2.036   1.00 0.00 ? 150 PHE A H    1  
ATOM 2411   H HA   . PHE A 1 150 ? -10.290 -5.686  4.196   1.00 0.00 ? 150 PHE A HA   1  
ATOM 2412   H HB2  . PHE A 1 150 ? -7.408  -5.382  3.293   1.00 0.00 ? 150 PHE A HB2  1  
ATOM 2413   H HB3  . PHE A 1 150 ? -7.937  -6.465  4.591   1.00 0.00 ? 150 PHE A HB3  1  
ATOM 2414   H HD1  . PHE A 1 150 ? -9.635  -8.287  3.990   1.00 0.00 ? 150 PHE A HD1  1  
ATOM 2415   H HD2  . PHE A 1 150 ? -7.437  -6.095  1.076   1.00 0.00 ? 150 PHE A HD2  1  
ATOM 2416   H HE1  . PHE A 1 150 ? -10.078 -10.047 2.336   1.00 0.00 ? 150 PHE A HE1  1  
ATOM 2417   H HE2  . PHE A 1 150 ? -7.875  -7.852  -0.580  1.00 0.00 ? 150 PHE A HE2  1  
ATOM 2418   H HZ   . PHE A 1 150 ? -9.198  -9.832  0.046   1.00 0.00 ? 150 PHE A HZ   1  
ATOM 2419   N N    . VAL A 1 151 ? -9.670  -4.471  6.270   1.00 0.00 ? 151 VAL A N    1  
ATOM 2420   C CA   . VAL A 1 151 ? -9.441  -3.676  7.473   1.00 0.00 ? 151 VAL A CA   1  
ATOM 2421   C C    . VAL A 1 151 ? -8.573  -4.433  8.474   1.00 0.00 ? 151 VAL A C    1  
ATOM 2422   O O    . VAL A 1 151 ? -8.151  -5.563  8.215   1.00 0.00 ? 151 VAL A O    1  
ATOM 2423   C CB   . VAL A 1 151 ? -10.764 -3.255  8.151   1.00 0.00 ? 151 VAL A CB   1  
ATOM 2424   C CG1  . VAL A 1 151 ? -11.544 -2.300  7.260   1.00 0.00 ? 151 VAL A CG1  1  
ATOM 2425   C CG2  . VAL A 1 151 ? -11.603 -4.478  8.501   1.00 0.00 ? 151 VAL A CG2  1  
ATOM 2426   H H    . VAL A 1 151 ? -10.257 -5.254  6.317   1.00 0.00 ? 151 VAL A H    1  
ATOM 2427   H HA   . VAL A 1 151 ? -8.911  -2.772  7.173   1.00 0.00 ? 151 VAL A HA   1  
ATOM 2428   H HB   . VAL A 1 151 ? -10.521 -2.734  9.077   1.00 0.00 ? 151 VAL A HB   1  
ATOM 2429   H HG11 . VAL A 1 151 ? -12.462 -1.993  7.762   1.00 0.00 ? 151 VAL A HG11 1  
ATOM 2430   H HG12 . VAL A 1 151 ? -10.936 -1.420  7.051   1.00 0.00 ? 151 VAL A HG12 1  
ATOM 2431   H HG13 . VAL A 1 151 ? -11.794 -2.799  6.324   1.00 0.00 ? 151 VAL A HG13 1  
ATOM 2432   H HG21 . VAL A 1 151 ? -11.034 -5.129  9.165   1.00 0.00 ? 151 VAL A HG21 1  
ATOM 2433   H HG22 . VAL A 1 151 ? -12.520 -4.165  9.000   1.00 0.00 ? 151 VAL A HG22 1  
ATOM 2434   H HG23 . VAL A 1 151 ? -11.853 -5.019  7.588   1.00 0.00 ? 151 VAL A HG23 1  
ATOM 2435   N N    . SER A 1 152 ? -8.302  -3.798  9.605   1.00 0.00 ? 152 SER A N    1  
ATOM 2436   C CA   . SER A 1 152 ? -7.480  -4.398  10.647  1.00 0.00 ? 152 SER A CA   1  
ATOM 2437   C C    . SER A 1 152 ? -8.315  -5.314  11.538  1.00 0.00 ? 152 SER A C    1  
ATOM 2438   O O    . SER A 1 152 ? -8.869  -4.871  12.549  1.00 0.00 ? 152 SER A O    1  
ATOM 2439   C CB   . SER A 1 152 ? -6.813  -3.309  11.491  1.00 0.00 ? 152 SER A CB   1  
ATOM 2440   O OG   . SER A 1 152 ? -6.447  -2.196  10.690  1.00 0.00 ? 152 SER A OG   1  
ATOM 2441   H H    . SER A 1 152 ? -8.664  -2.891  9.742   1.00 0.00 ? 152 SER A H    1  
ATOM 2442   H HA   . SER A 1 152 ? -6.703  -4.994  10.168  1.00 0.00 ? 152 SER A HA   1  
ATOM 2443   H HB2  . SER A 1 152 ? -7.510  -2.978  12.262  1.00 0.00 ? 152 SER A HB2  1  
ATOM 2444   H HB3  . SER A 1 152 ? -5.919  -3.718  11.960  1.00 0.00 ? 152 SER A HB3  1  
ATOM 2445   H HG   . SER A 1 152 ? -7.248  -1.817  10.289  1.00 0.00 ? 152 SER A HG   1  
ATOM 2446   N N    . SER A 1 153 ? -8.410  -6.583  11.144  1.00 0.00 ? 153 SER A N    1  
ATOM 2447   C CA   . SER A 1 153 ? -9.170  -7.584  11.893  1.00 0.00 ? 153 SER A CA   1  
ATOM 2448   C C    . SER A 1 153 ? -10.649 -7.190  12.046  1.00 0.00 ? 153 SER A C    1  
ATOM 2449   O O    . SER A 1 153 ? -11.093 -6.907  13.180  1.00 0.00 ? 153 SER A O    1  
ATOM 2450   C CB   . SER A 1 153 ? -8.515  -7.856  13.252  1.00 0.00 ? 153 SER A CB   1  
ATOM 2451   O OG   . SER A 1 153 ? -7.163  -8.265  13.090  1.00 0.00 ? 153 SER A OG   1  
ATOM 2452   O OXT  . SER A 1 153 ? -11.363 -7.164  11.025  1.00 0.00 ? 153 SER A OXT  1  
ATOM 2453   H H    . SER A 1 153 ? -7.958  -6.856  10.318  1.00 0.00 ? 153 SER A H    1  
ATOM 2454   H HA   . SER A 1 153 ? -9.137  -8.511  11.320  1.00 0.00 ? 153 SER A HA   1  
ATOM 2455   H HB2  . SER A 1 153 ? -8.543  -6.946  13.851  1.00 0.00 ? 153 SER A HB2  1  
ATOM 2456   H HB3  . SER A 1 153 ? -9.066  -8.645  13.764  1.00 0.00 ? 153 SER A HB3  1  
ATOM 2457   H HG   . SER A 1 153 ? -6.683  -7.598  12.568  1.00 0.00 ? 153 SER A HG   1  
ATOM 2458   N N    . ASP B 2 1   ? -3.063  -8.045  15.032  1.00 0.00 ? 1   ASP B N    1  
ATOM 2459   C CA   . ASP B 2 1   ? -3.262  -8.601  13.673  1.00 0.00 ? 1   ASP B CA   1  
ATOM 2460   C C    . ASP B 2 1   ? -2.399  -9.842  13.471  1.00 0.00 ? 1   ASP B C    1  
ATOM 2461   O O    . ASP B 2 1   ? -1.884  -10.412 14.431  1.00 0.00 ? 1   ASP B O    1  
ATOM 2462   C CB   . ASP B 2 1   ? -2.964  -7.553  12.596  1.00 0.00 ? 1   ASP B CB   1  
ATOM 2463   C CG   . ASP B 2 1   ? -4.013  -6.460  12.534  1.00 0.00 ? 1   ASP B CG   1  
ATOM 2464   O OD1  . ASP B 2 1   ? -3.724  -5.331  12.989  1.00 0.00 ? 1   ASP B OD1  1  
ATOM 2465   O OD2  . ASP B 2 1   ? -5.128  -6.729  12.049  1.00 0.00 ? 1   ASP B OD2  1  
ATOM 2466   H H1   . ASP B 2 1   ? -2.062  -7.819  15.182  1.00 0.00 ? 1   ASP B H1   1  
ATOM 2467   H H2   . ASP B 2 1   ? -3.354  -8.742  15.751  1.00 0.00 ? 1   ASP B H2   1  
ATOM 2468   H H3   . ASP B 2 1   ? -3.623  -7.182  15.155  1.00 0.00 ? 1   ASP B H3   1  
ATOM 2469   H HA   . ASP B 2 1   ? -4.308  -8.893  13.581  1.00 0.00 ? 1   ASP B HA   1  
ATOM 2470   H HB2  . ASP B 2 1   ? -1.997  -7.098  12.808  1.00 0.00 ? 1   ASP B HB2  1  
ATOM 2471   H HB3  . ASP B 2 1   ? -2.921  -8.050  11.627  1.00 0.00 ? 1   ASP B HB3  1  
ATOM 2472   H HD2  . ASP B 2 1   ? -5.742  -5.991  12.046  1.00 0.00 ? 1   ASP B HD2  1  
ATOM 2473   N N    . ILE B 2 2   ? -2.223  -10.251 12.220  1.00 0.00 ? 2   ILE B N    1  
ATOM 2474   C CA   . ILE B 2 2   ? -1.430  -11.436 11.918  1.00 0.00 ? 2   ILE B CA   1  
ATOM 2475   C C    . ILE B 2 2   ? 0.065   -11.117 11.891  1.00 0.00 ? 2   ILE B C    1  
ATOM 2476   O O    . ILE B 2 2   ? 0.587   -10.622 10.887  1.00 0.00 ? 2   ILE B O    1  
ATOM 2477   C CB   . ILE B 2 2   ? -1.845  -12.083 10.582  1.00 0.00 ? 2   ILE B CB   1  
ATOM 2478   C CG1  . ILE B 2 2   ? -3.372  -12.113 10.456  1.00 0.00 ? 2   ILE B CG1  1  
ATOM 2479   C CG2  . ILE B 2 2   ? -1.281  -13.494 10.482  1.00 0.00 ? 2   ILE B CG2  1  
ATOM 2480   C CD1  . ILE B 2 2   ? -3.866  -12.485 9.075   1.00 0.00 ? 2   ILE B CD1  1  
ATOM 2481   H H    . ILE B 2 2   ? -2.609  -9.732  11.486  1.00 0.00 ? 2   ILE B H    1  
ATOM 2482   H HA   . ILE B 2 2   ? -1.609  -12.160 12.713  1.00 0.00 ? 2   ILE B HA   1  
ATOM 2483   H HB   . ILE B 2 2   ? -1.440  -11.486 9.765   1.00 0.00 ? 2   ILE B HB   1  
ATOM 2484   H HG12 . ILE B 2 2   ? -3.762  -12.841 11.167  1.00 0.00 ? 2   ILE B HG12 1  
ATOM 2485   H HG13 . ILE B 2 2   ? -3.757  -11.123 10.701  1.00 0.00 ? 2   ILE B HG13 1  
ATOM 2486   H HG21 . ILE B 2 2   ? -1.564  -13.936 9.527   1.00 0.00 ? 2   ILE B HG21 1  
ATOM 2487   H HG22 . ILE B 2 2   ? -0.194  -13.455 10.554  1.00 0.00 ? 2   ILE B HG22 1  
ATOM 2488   H HG23 . ILE B 2 2   ? -1.677  -14.102 11.295  1.00 0.00 ? 2   ILE B HG23 1  
ATOM 2489   H HD11 . ILE B 2 2   ? -3.497  -13.478 8.817   1.00 0.00 ? 2   ILE B HD11 1  
ATOM 2490   H HD12 . ILE B 2 2   ? -4.955  -12.491 9.047   1.00 0.00 ? 2   ILE B HD12 1  
ATOM 2491   H HD13 . ILE B 2 2   ? -3.494  -11.760 8.352   1.00 0.00 ? 2   ILE B HD13 1  
ATOM 2492   N N    . GLN B 2 3   ? 0.738   -11.397 12.999  1.00 0.00 ? 3   GLN B N    1  
ATOM 2493   C CA   . GLN B 2 3   ? 2.170   -11.155 13.119  1.00 0.00 ? 3   GLN B CA   1  
ATOM 2494   C C    . GLN B 2 3   ? 2.976   -12.302 12.515  1.00 0.00 ? 3   GLN B C    1  
ATOM 2495   O O    . GLN B 2 3   ? 2.431   -13.366 12.211  1.00 0.00 ? 3   GLN B O    1  
ATOM 2496   C CB   . GLN B 2 3   ? 2.560   -10.977 14.590  1.00 0.00 ? 3   GLN B CB   1  
ATOM 2497   C CG   . GLN B 2 3   ? 2.058   -9.692  15.226  1.00 0.00 ? 3   GLN B CG   1  
ATOM 2498   C CD   . GLN B 2 3   ? 2.449   -9.582  16.687  1.00 0.00 ? 3   GLN B CD   1  
ATOM 2499   O OE1  . GLN B 2 3   ? 3.468   -10.127 17.116  1.00 0.00 ? 3   GLN B OE1  1  
ATOM 2500   N NE2  . GLN B 2 3   ? 1.644   -8.873  17.462  1.00 0.00 ? 3   GLN B NE2  1  
ATOM 2501   H H    . GLN B 2 3   ? 0.255   -11.775 13.763  1.00 0.00 ? 3   GLN B H    1  
ATOM 2502   H HA   . GLN B 2 3   ? 2.408   -10.238 12.579  1.00 0.00 ? 3   GLN B HA   1  
ATOM 2503   H HB2  . GLN B 2 3   ? 2.153   -11.816 15.154  1.00 0.00 ? 3   GLN B HB2  1  
ATOM 2504   H HB3  . GLN B 2 3   ? 3.648   -10.987 14.657  1.00 0.00 ? 3   GLN B HB3  1  
ATOM 2505   H HG2  . GLN B 2 3   ? 2.478   -8.844  14.685  1.00 0.00 ? 3   GLN B HG2  1  
ATOM 2506   H HG3  . GLN B 2 3   ? 0.971   -9.663  15.149  1.00 0.00 ? 3   GLN B HG3  1  
ATOM 2507   H HE21 . GLN B 2 3   ? 0.852   -8.461  17.053  1.00 0.00 ? 3   GLN B HE21 1  
ATOM 2508   H HE22 . GLN B 2 3   ? 1.869   -8.786  18.412  1.00 0.00 ? 3   GLN B HE22 1  
ATOM 2509   N N    . MET B 2 4   ? 4.276   -12.078 12.354  1.00 0.00 ? 4   MET B N    1  
ATOM 2510   C CA   . MET B 2 4   ? 5.175   -13.079 11.790  1.00 0.00 ? 4   MET B CA   1  
ATOM 2511   C C    . MET B 2 4   ? 6.332   -13.338 12.747  1.00 0.00 ? 4   MET B C    1  
ATOM 2512   O O    . MET B 2 4   ? 6.703   -12.463 13.529  1.00 0.00 ? 4   MET B O    1  
ATOM 2513   C CB   . MET B 2 4   ? 5.729   -12.612 10.438  1.00 0.00 ? 4   MET B CB   1  
ATOM 2514   C CG   . MET B 2 4   ? 4.675   -12.257 9.400   1.00 0.00 ? 4   MET B CG   1  
ATOM 2515   S SD   . MET B 2 4   ? 3.658   -13.664 8.911   1.00 0.00 ? 4   MET B SD   1  
ATOM 2516   C CE   . MET B 2 4   ? 4.880   -14.720 8.139   1.00 0.00 ? 4   MET B CE   1  
ATOM 2517   H H    . MET B 2 4   ? 4.647   -11.218 12.637  1.00 0.00 ? 4   MET B H    1  
ATOM 2518   H HA   . MET B 2 4   ? 4.618   -14.004 11.643  1.00 0.00 ? 4   MET B HA   1  
ATOM 2519   H HB2  . MET B 2 4   ? 6.344   -11.729 10.611  1.00 0.00 ? 4   MET B HB2  1  
ATOM 2520   H HB3  . MET B 2 4   ? 6.348   -13.411 10.032  1.00 0.00 ? 4   MET B HB3  1  
ATOM 2521   H HG2  . MET B 2 4   ? 4.027   -11.483 9.810   1.00 0.00 ? 4   MET B HG2  1  
ATOM 2522   H HG3  . MET B 2 4   ? 5.174   -11.862 8.515   1.00 0.00 ? 4   MET B HG3  1  
ATOM 2523   H HE1  . MET B 2 4   ? 5.652   -14.973 8.867   1.00 0.00 ? 4   MET B HE1  1  
ATOM 2524   H HE2  . MET B 2 4   ? 4.409   -15.636 7.782   1.00 0.00 ? 4   MET B HE2  1  
ATOM 2525   H HE3  . MET B 2 4   ? 5.332   -14.196 7.297   1.00 0.00 ? 4   MET B HE3  1  
ATOM 2526   N N    . THR B 2 5   ? 6.894   -14.539 12.689  1.00 0.00 ? 5   THR B N    1  
ATOM 2527   C CA   . THR B 2 5   ? 8.009   -14.909 13.558  1.00 0.00 ? 5   THR B CA   1  
ATOM 2528   C C    . THR B 2 5   ? 9.021   -15.768 12.800  1.00 0.00 ? 5   THR B C    1  
ATOM 2529   O O    . THR B 2 5   ? 8.699   -16.864 12.346  1.00 0.00 ? 5   THR B O    1  
ATOM 2530   C CB   . THR B 2 5   ? 7.510   -15.682 14.794  1.00 0.00 ? 5   THR B CB   1  
ATOM 2531   O OG1  . THR B 2 5   ? 6.078   -15.775 14.744  1.00 0.00 ? 5   THR B OG1  1  
ATOM 2532   C CG2  . THR B 2 5   ? 7.924   -14.968 16.071  1.00 0.00 ? 5   THR B CG2  1  
ATOM 2533   H H    . THR B 2 5   ? 6.556   -15.198 12.036  1.00 0.00 ? 5   THR B H    1  
ATOM 2534   H HA   . THR B 2 5   ? 8.501   -13.995 13.891  1.00 0.00 ? 5   THR B HA   1  
ATOM 2535   H HB   . THR B 2 5   ? 7.940   -16.684 14.788  1.00 0.00 ? 5   THR B HB   1  
ATOM 2536   H HG1  . THR B 2 5   ? 5.769   -15.401 13.910  1.00 0.00 ? 5   THR B HG1  1  
ATOM 2537   H HG21 . THR B 2 5   ? 7.496   -13.966 16.082  1.00 0.00 ? 5   THR B HG21 1  
ATOM 2538   H HG22 . THR B 2 5   ? 7.565   -15.525 16.937  1.00 0.00 ? 5   THR B HG22 1  
ATOM 2539   H HG23 . THR B 2 5   ? 9.011   -14.899 16.112  1.00 0.00 ? 5   THR B HG23 1  
ATOM 2540   N N    . GLN B 2 6   ? 10.237  -15.261 12.651  1.00 0.00 ? 6   GLN B N    1  
ATOM 2541   C CA   . GLN B 2 6   ? 11.286  -15.984 11.940  1.00 0.00 ? 6   GLN B CA   1  
ATOM 2542   C C    . GLN B 2 6   ? 12.336  -16.554 12.890  1.00 0.00 ? 6   GLN B C    1  
ATOM 2543   O O    . GLN B 2 6   ? 12.530  -16.057 14.004  1.00 0.00 ? 6   GLN B O    1  
ATOM 2544   C CB   . GLN B 2 6   ? 11.963  -15.092 10.896  1.00 0.00 ? 6   GLN B CB   1  
ATOM 2545   C CG   . GLN B 2 6   ? 11.023  -14.564 9.827   1.00 0.00 ? 6   GLN B CG   1  
ATOM 2546   C CD   . GLN B 2 6   ? 11.742  -13.859 8.690   1.00 0.00 ? 6   GLN B CD   1  
ATOM 2547   O OE1  . GLN B 2 6   ? 11.227  -12.896 8.122   1.00 0.00 ? 6   GLN B OE1  1  
ATOM 2548   N NE2  . GLN B 2 6   ? 12.931  -14.326 8.344   1.00 0.00 ? 6   GLN B NE2  1  
ATOM 2549   H H    . GLN B 2 6   ? 10.432  -14.368 13.018  1.00 0.00 ? 6   GLN B H    1  
ATOM 2550   H HA   . GLN B 2 6   ? 10.813  -16.817 11.420  1.00 0.00 ? 6   GLN B HA   1  
ATOM 2551   H HB2  . GLN B 2 6   ? 12.408  -14.240 11.410  1.00 0.00 ? 6   GLN B HB2  1  
ATOM 2552   H HB3  . GLN B 2 6   ? 12.746  -15.671 10.407  1.00 0.00 ? 6   GLN B HB3  1  
ATOM 2553   H HG2  . GLN B 2 6   ? 10.460  -15.402 9.415   1.00 0.00 ? 6   GLN B HG2  1  
ATOM 2554   H HG3  . GLN B 2 6   ? 10.331  -13.861 10.291  1.00 0.00 ? 6   GLN B HG3  1  
ATOM 2555   H HE21 . GLN B 2 6   ? 13.294  -15.097 8.834   1.00 0.00 ? 6   GLN B HE21 1  
ATOM 2556   H HE22 . GLN B 2 6   ? 13.407  -13.883 7.603   1.00 0.00 ? 6   GLN B HE22 1  
ATOM 2557   N N    . SER B 2 7   ? 12.995  -17.610 12.433  1.00 0.00 ? 7   SER B N    1  
ATOM 2558   C CA   . SER B 2 7   ? 14.044  -18.269 13.194  1.00 0.00 ? 7   SER B CA   1  
ATOM 2559   C C    . SER B 2 7   ? 15.018  -18.949 12.234  1.00 0.00 ? 7   SER B C    1  
ATOM 2560   O O    . SER B 2 7   ? 14.608  -19.749 11.390  1.00 0.00 ? 7   SER B O    1  
ATOM 2561   C CB   . SER B 2 7   ? 13.438  -19.306 14.150  1.00 0.00 ? 7   SER B CB   1  
ATOM 2562   O OG   . SER B 2 7   ? 14.422  -19.844 15.020  1.00 0.00 ? 7   SER B OG   1  
ATOM 2563   H H    . SER B 2 7   ? 12.749  -17.974 11.553  1.00 0.00 ? 7   SER B H    1  
ATOM 2564   H HA   . SER B 2 7   ? 14.580  -17.520 13.778  1.00 0.00 ? 7   SER B HA   1  
ATOM 2565   H HB2  . SER B 2 7   ? 12.661  -18.828 14.746  1.00 0.00 ? 7   SER B HB2  1  
ATOM 2566   H HB3  . SER B 2 7   ? 13.002  -20.115 13.565  1.00 0.00 ? 7   SER B HB3  1  
ATOM 2567   H HG   . SER B 2 7   ? 13.995  -20.406 15.678  1.00 0.00 ? 7   SER B HG   1  
ATOM 2568   N N    . PRO B 2 8   ? 16.318  -18.632 12.335  1.00 0.00 ? 8   PRO B N    1  
ATOM 2569   C CA   . PRO B 2 8   ? 16.840  -17.677 13.310  1.00 0.00 ? 8   PRO B CA   1  
ATOM 2570   C C    . PRO B 2 8   ? 16.891  -16.258 12.750  1.00 0.00 ? 8   PRO B C    1  
ATOM 2571   O O    . PRO B 2 8   ? 16.261  -15.957 11.736  1.00 0.00 ? 8   PRO B O    1  
ATOM 2572   C CB   . PRO B 2 8   ? 18.260  -18.197 13.519  1.00 0.00 ? 8   PRO B CB   1  
ATOM 2573   C CG   . PRO B 2 8   ? 18.657  -18.739 12.184  1.00 0.00 ? 8   PRO B CG   1  
ATOM 2574   C CD   . PRO B 2 8   ? 17.391  -19.197 11.502  1.00 0.00 ? 8   PRO B CD   1  
ATOM 2575   H HA   . PRO B 2 8   ? 16.265  -17.693 14.236  1.00 0.00 ? 8   PRO B HA   1  
ATOM 2576   H HB2  . PRO B 2 8   ? 18.935  -17.411 13.858  1.00 0.00 ? 8   PRO B HB2  1  
ATOM 2577   H HB3  . PRO B 2 8   ? 18.233  -19.018 14.235  1.00 0.00 ? 8   PRO B HB3  1  
ATOM 2578   H HG2  . PRO B 2 8   ? 19.085  -17.924 11.600  1.00 0.00 ? 8   PRO B HG2  1  
ATOM 2579   H HG3  . PRO B 2 8   ? 19.370  -19.557 12.285  1.00 0.00 ? 8   PRO B HG3  1  
ATOM 2580   H HD2  . PRO B 2 8   ? 17.343  -18.833 10.475  1.00 0.00 ? 8   PRO B HD2  1  
ATOM 2581   H HD3  . PRO B 2 8   ? 17.329  -20.285 11.521  1.00 0.00 ? 8   PRO B HD3  1  
ATOM 2582   N N    . SER B 2 9   ? 17.641  -15.395 13.417  1.00 0.00 ? 9   SER B N    1  
ATOM 2583   C CA   . SER B 2 9   ? 17.791  -14.017 12.985  1.00 0.00 ? 9   SER B CA   1  
ATOM 2584   C C    . SER B 2 9   ? 19.051  -13.882 12.127  1.00 0.00 ? 9   SER B C    1  
ATOM 2585   O O    . SER B 2 9   ? 19.098  -13.096 11.178  1.00 0.00 ? 9   SER B O    1  
ATOM 2586   C CB   . SER B 2 9   ? 17.873  -13.101 14.206  1.00 0.00 ? 9   SER B CB   1  
ATOM 2587   O OG   . SER B 2 9   ? 16.966  -13.520 15.221  1.00 0.00 ? 9   SER B OG   1  
ATOM 2588   H H    . SER B 2 9   ? 18.103  -15.690 14.232  1.00 0.00 ? 9   SER B H    1  
ATOM 2589   H HA   . SER B 2 9   ? 16.923  -13.736 12.388  1.00 0.00 ? 9   SER B HA   1  
ATOM 2590   H HB2  . SER B 2 9   ? 18.888  -13.126 14.603  1.00 0.00 ? 9   SER B HB2  1  
ATOM 2591   H HB3  . SER B 2 9   ? 17.626  -12.083 13.906  1.00 0.00 ? 9   SER B HB3  1  
ATOM 2592   H HG   . SER B 2 9   ? 16.538  -12.743 15.607  1.00 0.00 ? 9   SER B HG   1  
ATOM 2593   N N    . SER B 2 10  ? 20.067  -14.661 12.468  1.00 0.00 ? 10  SER B N    1  
ATOM 2594   C CA   . SER B 2 10  ? 21.330  -14.665 11.744  1.00 0.00 ? 10  SER B CA   1  
ATOM 2595   C C    . SER B 2 10  ? 22.034  -16.004 11.949  1.00 0.00 ? 10  SER B C    1  
ATOM 2596   O O    . SER B 2 10  ? 21.940  -16.599 13.025  1.00 0.00 ? 10  SER B O    1  
ATOM 2597   C CB   . SER B 2 10  ? 22.224  -13.507 12.203  1.00 0.00 ? 10  SER B CB   1  
ATOM 2598   O OG   . SER B 2 10  ? 21.580  -12.259 11.994  1.00 0.00 ? 10  SER B OG   1  
ATOM 2599   H H    . SER B 2 10  ? 19.970  -15.256 13.244  1.00 0.00 ? 10  SER B H    1  
ATOM 2600   H HA   . SER B 2 10  ? 21.119  -14.538 10.682  1.00 0.00 ? 10  SER B HA   1  
ATOM 2601   H HB2  . SER B 2 10  ? 22.441  -13.623 13.265  1.00 0.00 ? 10  SER B HB2  1  
ATOM 2602   H HB3  . SER B 2 10  ? 23.155  -13.528 11.637  1.00 0.00 ? 10  SER B HB3  1  
ATOM 2603   H HG   . SER B 2 10  ? 20.711  -12.415 11.601  1.00 0.00 ? 10  SER B HG   1  
ATOM 2604   N N    . LEU B 2 11  ? 22.716  -16.483 10.919  1.00 0.00 ? 11  LEU B N    1  
ATOM 2605   C CA   . LEU B 2 11  ? 23.414  -17.761 10.995  1.00 0.00 ? 11  LEU B CA   1  
ATOM 2606   C C    . LEU B 2 11  ? 24.615  -17.788 10.060  1.00 0.00 ? 11  LEU B C    1  
ATOM 2607   O O    . LEU B 2 11  ? 24.650  -17.073 9.059   1.00 0.00 ? 11  LEU B O    1  
ATOM 2608   C CB   . LEU B 2 11  ? 22.461  -18.920 10.655  1.00 0.00 ? 11  LEU B CB   1  
ATOM 2609   C CG   . LEU B 2 11  ? 21.966  -19.004 9.204   1.00 0.00 ? 11  LEU B CG   1  
ATOM 2610   C CD1  . LEU B 2 11  ? 21.593  -20.433 8.850   1.00 0.00 ? 11  LEU B CD1  1  
ATOM 2611   C CD2  . LEU B 2 11  ? 20.775  -18.084 8.984   1.00 0.00 ? 11  LEU B CD2  1  
ATOM 2612   H H    . LEU B 2 11  ? 22.755  -15.966 10.081  1.00 0.00 ? 11  LEU B H    1  
ATOM 2613   H HA   . LEU B 2 11  ? 23.769  -17.892 12.018  1.00 0.00 ? 11  LEU B HA   1  
ATOM 2614   H HB2  . LEU B 2 11  ? 22.981  -19.852 10.880  1.00 0.00 ? 11  LEU B HB2  1  
ATOM 2615   H HB3  . LEU B 2 11  ? 21.586  -18.828 11.298  1.00 0.00 ? 11  LEU B HB3  1  
ATOM 2616   H HG   . LEU B 2 11  ? 22.774  -18.684 8.546   1.00 0.00 ? 11  LEU B HG   1  
ATOM 2617   H HD11 . LEU B 2 11  ? 21.263  -20.483 7.812   1.00 0.00 ? 11  LEU B HD11 1  
ATOM 2618   H HD12 . LEU B 2 11  ? 22.461  -21.078 8.984   1.00 0.00 ? 11  LEU B HD12 1  
ATOM 2619   H HD13 . LEU B 2 11  ? 20.786  -20.769 9.501   1.00 0.00 ? 11  LEU B HD13 1  
ATOM 2620   H HD21 . LEU B 2 11  ? 21.062  -17.058 9.216   1.00 0.00 ? 11  LEU B HD21 1  
ATOM 2621   H HD22 . LEU B 2 11  ? 20.450  -18.140 7.945   1.00 0.00 ? 11  LEU B HD22 1  
ATOM 2622   H HD23 . LEU B 2 11  ? 19.956  -18.389 9.635   1.00 0.00 ? 11  LEU B HD23 1  
ATOM 2623   N N    . SER B 2 12  ? 25.594  -18.613 10.394  1.00 0.00 ? 12  SER B N    1  
ATOM 2624   C CA   . SER B 2 12  ? 26.795  -18.747 9.587   1.00 0.00 ? 12  SER B CA   1  
ATOM 2625   C C    . SER B 2 12  ? 26.904  -20.167 9.040   1.00 0.00 ? 12  SER B C    1  
ATOM 2626   O O    . SER B 2 12  ? 26.790  -21.139 9.789   1.00 0.00 ? 12  SER B O    1  
ATOM 2627   C CB   . SER B 2 12  ? 28.034  -18.397 10.411  1.00 0.00 ? 12  SER B CB   1  
ATOM 2628   O OG   . SER B 2 12  ? 28.070  -17.012 10.718  1.00 0.00 ? 12  SER B OG   1  
ATOM 2629   H H    . SER B 2 12  ? 25.506  -19.154 11.205  1.00 0.00 ? 12  SER B H    1  
ATOM 2630   H HA   . SER B 2 12  ? 26.726  -18.054 8.748   1.00 0.00 ? 12  SER B HA   1  
ATOM 2631   H HB2  . SER B 2 12  ? 28.017  -18.966 11.340  1.00 0.00 ? 12  SER B HB2  1  
ATOM 2632   H HB3  . SER B 2 12  ? 28.926  -18.657 9.841   1.00 0.00 ? 12  SER B HB3  1  
ATOM 2633   H HG   . SER B 2 12  ? 28.608  -16.550 10.052  1.00 0.00 ? 12  SER B HG   1  
ATOM 2634   N N    . ALA B 2 13  ? 27.102  -20.282 7.736   1.00 0.00 ? 13  ALA B N    1  
ATOM 2635   C CA   . ALA B 2 13  ? 27.224  -21.582 7.097   1.00 0.00 ? 13  ALA B CA   1  
ATOM 2636   C C    . ALA B 2 13  ? 28.365  -21.571 6.089   1.00 0.00 ? 13  ALA B C    1  
ATOM 2637   O O    . ALA B 2 13  ? 28.918  -20.511 5.784   1.00 0.00 ? 13  ALA B O    1  
ATOM 2638   C CB   . ALA B 2 13  ? 25.914  -21.975 6.432   1.00 0.00 ? 13  ALA B CB   1  
ATOM 2639   H H    . ALA B 2 13  ? 27.175  -19.470 7.188   1.00 0.00 ? 13  ALA B H    1  
ATOM 2640   H HA   . ALA B 2 13  ? 27.452  -22.320 7.867   1.00 0.00 ? 13  ALA B HA   1  
ATOM 2641   H HB1  . ALA B 2 13  ? 26.011  -22.962 5.980   1.00 0.00 ? 13  ALA B HB1  1  
ATOM 2642   H HB2  . ALA B 2 13  ? 25.120  -21.996 7.178   1.00 0.00 ? 13  ALA B HB2  1  
ATOM 2643   H HB3  . ALA B 2 13  ? 25.668  -21.246 5.659   1.00 0.00 ? 13  ALA B HB3  1  
ATOM 2644   N N    . SER B 2 14  ? 28.716  -22.742 5.578   1.00 0.00 ? 14  SER B N    1  
ATOM 2645   C CA   . SER B 2 14  ? 29.798  -22.861 4.613   1.00 0.00 ? 14  SER B CA   1  
ATOM 2646   C C    . SER B 2 14  ? 29.267  -22.859 3.180   1.00 0.00 ? 14  SER B C    1  
ATOM 2647   O O    . SER B 2 14  ? 28.068  -23.015 2.950   1.00 0.00 ? 14  SER B O    1  
ATOM 2648   C CB   . SER B 2 14  ? 30.590  -24.141 4.881   1.00 0.00 ? 14  SER B CB   1  
ATOM 2649   O OG   . SER B 2 14  ? 30.820  -24.307 6.271   1.00 0.00 ? 14  SER B OG   1  
ATOM 2650   H H    . SER B 2 14  ? 28.237  -23.551 5.861   1.00 0.00 ? 14  SER B H    1  
ATOM 2651   H HA   . SER B 2 14  ? 30.462  -22.006 4.736   1.00 0.00 ? 14  SER B HA   1  
ATOM 2652   H HB2  . SER B 2 14  ? 30.026  -24.996 4.508   1.00 0.00 ? 14  SER B HB2  1  
ATOM 2653   H HB3  . SER B 2 14  ? 31.548  -24.084 4.365   1.00 0.00 ? 14  SER B HB3  1  
ATOM 2654   H HG   . SER B 2 14  ? 30.601  -25.213 6.523   1.00 0.00 ? 14  SER B HG   1  
ATOM 2655   N N    . VAL B 2 15  ? 30.169  -22.684 2.221   1.00 0.00 ? 15  VAL B N    1  
ATOM 2656   C CA   . VAL B 2 15  ? 29.798  -22.669 0.814   1.00 0.00 ? 15  VAL B CA   1  
ATOM 2657   C C    . VAL B 2 15  ? 29.356  -24.061 0.379   1.00 0.00 ? 15  VAL B C    1  
ATOM 2658   O O    . VAL B 2 15  ? 30.154  -25.000 0.371   1.00 0.00 ? 15  VAL B O    1  
ATOM 2659   C CB   . VAL B 2 15  ? 30.969  -22.204 -0.077  1.00 0.00 ? 15  VAL B CB   1  
ATOM 2660   C CG1  . VAL B 2 15  ? 30.538  -22.115 -1.533  1.00 0.00 ? 15  VAL B CG1  1  
ATOM 2661   C CG2  . VAL B 2 15  ? 31.506  -20.866 0.403   1.00 0.00 ? 15  VAL B CG2  1  
ATOM 2662   H H    . VAL B 2 15  ? 31.108  -22.569 2.466   1.00 0.00 ? 15  VAL B H    1  
ATOM 2663   H HA   . VAL B 2 15  ? 28.966  -21.976 0.686   1.00 0.00 ? 15  VAL B HA   1  
ATOM 2664   H HB   . VAL B 2 15  ? 31.769  -22.941 -0.002  1.00 0.00 ? 15  VAL B HB   1  
ATOM 2665   H HG11 . VAL B 2 15  ? 31.382  -21.806 -2.150  1.00 0.00 ? 15  VAL B HG11 1  
ATOM 2666   H HG12 . VAL B 2 15  ? 30.184  -23.090 -1.867  1.00 0.00 ? 15  VAL B HG12 1  
ATOM 2667   H HG13 . VAL B 2 15  ? 29.734  -21.385 -1.629  1.00 0.00 ? 15  VAL B HG13 1  
ATOM 2668   H HG21 . VAL B 2 15  ? 31.837  -20.959 1.437   1.00 0.00 ? 15  VAL B HG21 1  
ATOM 2669   H HG22 . VAL B 2 15  ? 32.347  -20.561 -0.220  1.00 0.00 ? 15  VAL B HG22 1  
ATOM 2670   H HG23 . VAL B 2 15  ? 30.718  -20.116 0.340   1.00 0.00 ? 15  VAL B HG23 1  
ATOM 2671   N N    . GLY B 2 16  ? 28.083  -24.187 0.045   1.00 0.00 ? 16  GLY B N    1  
ATOM 2672   C CA   . GLY B 2 16  ? 27.550  -25.466 -0.373  1.00 0.00 ? 16  GLY B CA   1  
ATOM 2673   C C    . GLY B 2 16  ? 26.696  -26.086 0.713   1.00 0.00 ? 16  GLY B C    1  
ATOM 2674   O O    . GLY B 2 16  ? 26.187  -27.200 0.562   1.00 0.00 ? 16  GLY B O    1  
ATOM 2675   H H    . GLY B 2 16  ? 27.487  -23.406 0.089   1.00 0.00 ? 16  GLY B H    1  
ATOM 2676   H HA2  . GLY B 2 16  ? 26.942  -25.323 -1.266  1.00 0.00 ? 16  GLY B HA2  1  
ATOM 2677   H HA3  . GLY B 2 16  ? 28.376  -26.138 -0.603  1.00 0.00 ? 16  GLY B HA3  1  
ATOM 2678   N N    . ASP B 2 17  ? 26.535  -25.359 1.812   1.00 0.00 ? 17  ASP B N    1  
ATOM 2679   C CA   . ASP B 2 17  ? 25.743  -25.830 2.941   1.00 0.00 ? 17  ASP B CA   1  
ATOM 2680   C C    . ASP B 2 17  ? 24.253  -25.729 2.642   1.00 0.00 ? 17  ASP B C    1  
ATOM 2681   O O    . ASP B 2 17  ? 23.835  -24.944 1.790   1.00 0.00 ? 17  ASP B O    1  
ATOM 2682   C CB   . ASP B 2 17  ? 26.066  -25.018 4.197   1.00 0.00 ? 17  ASP B CB   1  
ATOM 2683   C CG   . ASP B 2 17  ? 26.321  -25.887 5.409   1.00 0.00 ? 17  ASP B CG   1  
ATOM 2684   O OD1  . ASP B 2 17  ? 25.863  -27.048 5.424   1.00 0.00 ? 17  ASP B OD1  1  
ATOM 2685   O OD2  . ASP B 2 17  ? 26.998  -25.419 6.349   1.00 0.00 ? 17  ASP B OD2  1  
ATOM 2686   H H    . ASP B 2 17  ? 26.967  -24.479 1.868   1.00 0.00 ? 17  ASP B H    1  
ATOM 2687   H HA   . ASP B 2 17  ? 25.994  -26.875 3.123   1.00 0.00 ? 17  ASP B HA   1  
ATOM 2688   H HB2  . ASP B 2 17  ? 26.955  -24.417 4.005   1.00 0.00 ? 17  ASP B HB2  1  
ATOM 2689   H HB3  . ASP B 2 17  ? 25.227  -24.358 4.412   1.00 0.00 ? 17  ASP B HB3  1  
ATOM 2690   H HD2  . ASP B 2 17  ? 27.124  -26.025 7.082   1.00 0.00 ? 17  ASP B HD2  1  
ATOM 2691   N N    . ARG B 2 18  ? 23.464  -26.509 3.365   1.00 0.00 ? 18  ARG B N    1  
ATOM 2692   C CA   . ARG B 2 18  ? 22.018  -26.515 3.184   1.00 0.00 ? 18  ARG B CA   1  
ATOM 2693   C C    . ARG B 2 18  ? 21.363  -25.634 4.242   1.00 0.00 ? 18  ARG B C    1  
ATOM 2694   O O    . ARG B 2 18  ? 20.991  -26.105 5.322   1.00 0.00 ? 18  ARG B O    1  
ATOM 2695   C CB   . ARG B 2 18  ? 21.473  -27.947 3.246   1.00 0.00 ? 18  ARG B CB   1  
ATOM 2696   C CG   . ARG B 2 18  ? 20.094  -28.116 2.625   1.00 0.00 ? 18  ARG B CG   1  
ATOM 2697   C CD   . ARG B 2 18  ? 19.824  -29.569 2.266   1.00 0.00 ? 18  ARG B CD   1  
ATOM 2698   N NE   . ARG B 2 18  ? 18.556  -29.732 1.553   1.00 0.00 ? 18  ARG B NE   1  
ATOM 2699   C CZ   . ARG B 2 18  ? 18.449  -29.908 0.230   1.00 0.00 ? 18  ARG B CZ   1  
ATOM 2700   N NH1  . ARG B 2 18  ? 19.536  -29.983 -0.533  1.00 0.00 ? 18  ARG B NH1  1  
ATOM 2701   N NH2  . ARG B 2 18  ? 17.250  -30.021 -0.327  1.00 0.00 ? 18  ARG B NH2  1  
ATOM 2702   H H    . ARG B 2 18  ? 23.861  -27.075 4.057   1.00 0.00 ? 18  ARG B H    1  
ATOM 2703   H HA   . ARG B 2 18  ? 21.791  -26.103 2.201   1.00 0.00 ? 18  ARG B HA   1  
ATOM 2704   H HB2  . ARG B 2 18  ? 22.168  -28.601 2.719   1.00 0.00 ? 18  ARG B HB2  1  
ATOM 2705   H HB3  . ARG B 2 18  ? 21.415  -28.246 4.293   1.00 0.00 ? 18  ARG B HB3  1  
ATOM 2706   H HG2  . ARG B 2 18  ? 19.340  -27.780 3.338   1.00 0.00 ? 18  ARG B HG2  1  
ATOM 2707   H HG3  . ARG B 2 18  ? 20.034  -27.510 1.721   1.00 0.00 ? 18  ARG B HG3  1  
ATOM 2708   H HD2  . ARG B 2 18  ? 20.634  -29.933 1.634   1.00 0.00 ? 18  ARG B HD2  1  
ATOM 2709   H HD3  . ARG B 2 18  ? 19.792  -30.159 3.182   1.00 0.00 ? 18  ARG B HD3  1  
ATOM 2710   H HE   . ARG B 2 18  ? 17.734  -29.711 2.093   1.00 0.00 ? 18  ARG B HE   1  
ATOM 2711   H HH11 . ARG B 2 18  ? 20.450  -29.905 -0.125  1.00 0.00 ? 18  ARG B HH11 1  
ATOM 2712   H HH12 . ARG B 2 18  ? 19.447  -30.130 -1.523  1.00 0.00 ? 18  ARG B HH12 1  
ATOM 2713   H HH21 . ARG B 2 18  ? 16.421  -29.977 0.240   1.00 0.00 ? 18  ARG B HH21 1  
ATOM 2714   H HH22 . ARG B 2 18  ? 17.164  -30.146 -1.322  1.00 0.00 ? 18  ARG B HH22 1  
ATOM 2715   N N    . VAL B 2 19  ? 21.247  -24.352 3.931   1.00 0.00 ? 19  VAL B N    1  
ATOM 2716   C CA   . VAL B 2 19  ? 20.663  -23.379 4.846   1.00 0.00 ? 19  VAL B CA   1  
ATOM 2717   C C    . VAL B 2 19  ? 19.152  -23.545 4.951   1.00 0.00 ? 19  VAL B C    1  
ATOM 2718   O O    . VAL B 2 19  ? 18.465  -23.724 3.945   1.00 0.00 ? 19  VAL B O    1  
ATOM 2719   C CB   . VAL B 2 19  ? 20.996  -21.935 4.410   1.00 0.00 ? 19  VAL B CB   1  
ATOM 2720   C CG1  . VAL B 2 19  ? 20.420  -20.919 5.387   1.00 0.00 ? 19  VAL B CG1  1  
ATOM 2721   C CG2  . VAL B 2 19  ? 22.500  -21.755 4.281   1.00 0.00 ? 19  VAL B CG2  1  
ATOM 2722   H H    . VAL B 2 19  ? 21.561  -24.049 3.051   1.00 0.00 ? 19  VAL B H    1  
ATOM 2723   H HA   . VAL B 2 19  ? 21.097  -23.549 5.832   1.00 0.00 ? 19  VAL B HA   1  
ATOM 2724   H HB   . VAL B 2 19  ? 20.545  -21.761 3.433   1.00 0.00 ? 19  VAL B HB   1  
ATOM 2725   H HG11 . VAL B 2 19  ? 20.648  -19.909 5.050   1.00 0.00 ? 19  VAL B HG11 1  
ATOM 2726   H HG12 . VAL B 2 19  ? 19.338  -21.044 5.444   1.00 0.00 ? 19  VAL B HG12 1  
ATOM 2727   H HG13 . VAL B 2 19  ? 20.856  -21.078 6.374   1.00 0.00 ? 19  VAL B HG13 1  
ATOM 2728   H HG21 . VAL B 2 19  ? 22.890  -22.468 3.554   1.00 0.00 ? 19  VAL B HG21 1  
ATOM 2729   H HG22 . VAL B 2 19  ? 22.724  -20.742 3.949   1.00 0.00 ? 19  VAL B HG22 1  
ATOM 2730   H HG23 . VAL B 2 19  ? 22.971  -21.931 5.249   1.00 0.00 ? 19  VAL B HG23 1  
ATOM 2731   N N    . THR B 2 20  ? 18.644  -23.491 6.175   1.00 0.00 ? 20  THR B N    1  
ATOM 2732   C CA   . THR B 2 20  ? 17.220  -23.628 6.424   1.00 0.00 ? 20  THR B CA   1  
ATOM 2733   C C    . THR B 2 20  ? 16.717  -22.440 7.247   1.00 0.00 ? 20  THR B C    1  
ATOM 2734   O O    . THR B 2 20  ? 17.285  -22.117 8.289   1.00 0.00 ? 20  THR B O    1  
ATOM 2735   C CB   . THR B 2 20  ? 16.928  -24.939 7.179   1.00 0.00 ? 20  THR B CB   1  
ATOM 2736   O OG1  . THR B 2 20  ? 18.077  -25.799 7.101   1.00 0.00 ? 20  THR B OG1  1  
ATOM 2737   C CG2  . THR B 2 20  ? 15.737  -25.652 6.559   1.00 0.00 ? 20  THR B CG2  1  
ATOM 2738   H H    . THR B 2 20  ? 19.244  -23.343 6.936   1.00 0.00 ? 20  THR B H    1  
ATOM 2739   H HA   . THR B 2 20  ? 16.698  -23.647 5.467   1.00 0.00 ? 20  THR B HA   1  
ATOM 2740   H HB   . THR B 2 20  ? 16.712  -24.713 8.222   1.00 0.00 ? 20  THR B HB   1  
ATOM 2741   H HG1  . THR B 2 20  ? 18.684  -25.461 6.432   1.00 0.00 ? 20  THR B HG1  1  
ATOM 2742   H HG21 . THR B 2 20  ? 15.954  -25.881 5.516   1.00 0.00 ? 20  THR B HG21 1  
ATOM 2743   H HG22 . THR B 2 20  ? 15.540  -26.577 7.100   1.00 0.00 ? 20  THR B HG22 1  
ATOM 2744   H HG23 . THR B 2 20  ? 14.860  -25.007 6.614   1.00 0.00 ? 20  THR B HG23 1  
ATOM 2745   N N    . ILE B 2 21  ? 15.671  -21.785 6.761   1.00 0.00 ? 21  ILE B N    1  
ATOM 2746   C CA   . ILE B 2 21  ? 15.097  -20.628 7.447   1.00 0.00 ? 21  ILE B CA   1  
ATOM 2747   C C    . ILE B 2 21  ? 13.643  -20.906 7.815   1.00 0.00 ? 21  ILE B C    1  
ATOM 2748   O O    . ILE B 2 21  ? 12.820  -21.178 6.943   1.00 0.00 ? 21  ILE B O    1  
ATOM 2749   C CB   . ILE B 2 21  ? 15.169  -19.366 6.559   1.00 0.00 ? 21  ILE B CB   1  
ATOM 2750   C CG1  . ILE B 2 21  ? 16.625  -19.064 6.184   1.00 0.00 ? 21  ILE B CG1  1  
ATOM 2751   C CG2  . ILE B 2 21  ? 14.536  -18.174 7.263   1.00 0.00 ? 21  ILE B CG2  1  
ATOM 2752   C CD1  . ILE B 2 21  ? 16.780  -18.016 5.104   1.00 0.00 ? 21  ILE B CD1  1  
ATOM 2753   H H    . ILE B 2 21  ? 15.260  -22.090 5.921   1.00 0.00 ? 21  ILE B H    1  
ATOM 2754   H HA   . ILE B 2 21  ? 15.667  -20.450 8.359   1.00 0.00 ? 21  ILE B HA   1  
ATOM 2755   H HB   . ILE B 2 21  ? 14.611  -19.558 5.643   1.00 0.00 ? 21  ILE B HB   1  
ATOM 2756   H HG12 . ILE B 2 21  ? 17.143  -18.714 7.077   1.00 0.00 ? 21  ILE B HG12 1  
ATOM 2757   H HG13 . ILE B 2 21  ? 17.087  -19.987 5.833   1.00 0.00 ? 21  ILE B HG13 1  
ATOM 2758   H HG21 . ILE B 2 21  ? 14.577  -17.298 6.615   1.00 0.00 ? 21  ILE B HG21 1  
ATOM 2759   H HG22 . ILE B 2 21  ? 13.497  -18.402 7.498   1.00 0.00 ? 21  ILE B HG22 1  
ATOM 2760   H HG23 . ILE B 2 21  ? 15.080  -17.967 8.185   1.00 0.00 ? 21  ILE B HG23 1  
ATOM 2761   H HD11 . ILE B 2 21  ? 16.331  -17.082 5.441   1.00 0.00 ? 21  ILE B HD11 1  
ATOM 2762   H HD12 . ILE B 2 21  ? 17.834  -17.846 4.883   1.00 0.00 ? 21  ILE B HD12 1  
ATOM 2763   H HD13 . ILE B 2 21  ? 16.277  -18.355 4.198   1.00 0.00 ? 21  ILE B HD13 1  
ATOM 2764   N N    . THR B 2 22  ? 13.331  -20.838 9.101   1.00 0.00 ? 22  THR B N    1  
ATOM 2765   C CA   . THR B 2 22  ? 11.981  -21.101 9.577   1.00 0.00 ? 22  THR B CA   1  
ATOM 2766   C C    . THR B 2 22  ? 11.165  -19.815 9.722   1.00 0.00 ? 22  THR B C    1  
ATOM 2767   O O    . THR B 2 22  ? 11.651  -18.811 10.248  1.00 0.00 ? 22  THR B O    1  
ATOM 2768   C CB   . THR B 2 22  ? 12.015  -21.841 10.930  1.00 0.00 ? 22  THR B CB   1  
ATOM 2769   O OG1  . THR B 2 22  ? 13.015  -22.869 10.878  1.00 0.00 ? 22  THR B OG1  1  
ATOM 2770   C CG2  . THR B 2 22  ? 10.664  -22.477 11.235  1.00 0.00 ? 22  THR B CG2  1  
ATOM 2771   H H    . THR B 2 22  ? 14.027  -20.602 9.754   1.00 0.00 ? 22  THR B H    1  
ATOM 2772   H HA   . THR B 2 22  ? 11.488  -21.741 8.845   1.00 0.00 ? 22  THR B HA   1  
ATOM 2773   H HB   . THR B 2 22  ? 12.263  -21.132 11.719  1.00 0.00 ? 22  THR B HB   1  
ATOM 2774   H HG1  . THR B 2 22  ? 13.789  -22.588 11.377  1.00 0.00 ? 22  THR B HG1  1  
ATOM 2775   H HG21 . THR B 2 22  ? 10.414  -23.189 10.449  1.00 0.00 ? 22  THR B HG21 1  
ATOM 2776   H HG22 . THR B 2 22  ? 10.708  -22.995 12.192  1.00 0.00 ? 22  THR B HG22 1  
ATOM 2777   H HG23 . THR B 2 22  ? 9.900   -21.700 11.278  1.00 0.00 ? 22  THR B HG23 1  
ATOM 2778   N N    . CYS B 2 23  ? 9.925   -19.854 9.244   1.00 0.00 ? 23  CYS B N    1  
ATOM 2779   C CA   . CYS B 2 23  ? 9.022   -18.713 9.327   1.00 0.00 ? 23  CYS B CA   1  
ATOM 2780   C C    . CYS B 2 23  ? 7.656   -19.172 9.833   1.00 0.00 ? 23  CYS B C    1  
ATOM 2781   O O    . CYS B 2 23  ? 7.077   -20.122 9.306   1.00 0.00 ? 23  CYS B O    1  
ATOM 2782   C CB   . CYS B 2 23  ? 8.893   -18.023 7.962   1.00 0.00 ? 23  CYS B CB   1  
ATOM 2783   S SG   . CYS B 2 23  ? 7.729   -16.618 7.910   1.00 0.00 ? 23  CYS B SG   1  
ATOM 2784   H H    . CYS B 2 23  ? 9.602   -20.683 8.821   1.00 0.00 ? 23  CYS B H    1  
ATOM 2785   H HA   . CYS B 2 23  ? 9.435   -17.998 10.038  1.00 0.00 ? 23  CYS B HA   1  
ATOM 2786   H HB2  . CYS B 2 23  ? 9.881   -17.659 7.679   1.00 0.00 ? 23  CYS B HB2  1  
ATOM 2787   H HB3  . CYS B 2 23  ? 8.558   -18.770 7.242   1.00 0.00 ? 23  CYS B HB3  1  
ATOM 2788   H HG   . CYS B 2 23  ? 7.891   -16.306 6.621   1.00 0.00 ? 23  CYS B HG   1  
ATOM 2789   N N    . ARG B 2 24  ? 7.154   -18.505 10.861  1.00 0.00 ? 24  ARG B N    1  
ATOM 2790   C CA   . ARG B 2 24  ? 5.866   -18.848 11.449  1.00 0.00 ? 24  ARG B CA   1  
ATOM 2791   C C    . ARG B 2 24  ? 4.935   -17.643 11.411  1.00 0.00 ? 24  ARG B C    1  
ATOM 2792   O O    . ARG B 2 24  ? 5.383   -16.496 11.488  1.00 0.00 ? 24  ARG B O    1  
ATOM 2793   C CB   . ARG B 2 24  ? 6.052   -19.320 12.895  1.00 0.00 ? 24  ARG B CB   1  
ATOM 2794   C CG   . ARG B 2 24  ? 4.799   -19.912 13.524  1.00 0.00 ? 24  ARG B CG   1  
ATOM 2795   C CD   . ARG B 2 24  ? 4.807   -19.754 15.036  1.00 0.00 ? 24  ARG B CD   1  
ATOM 2796   N NE   . ARG B 2 24  ? 4.870   -18.349 15.434  1.00 0.00 ? 24  ARG B NE   1  
ATOM 2797   C CZ   . ARG B 2 24  ? 4.012   -17.770 16.273  1.00 0.00 ? 24  ARG B CZ   1  
ATOM 2798   N NH1  . ARG B 2 24  ? 3.018   -18.467 16.806  1.00 0.00 ? 24  ARG B NH1  1  
ATOM 2799   N NH2  . ARG B 2 24  ? 4.151   -16.488 16.578  1.00 0.00 ? 24  ARG B NH2  1  
ATOM 2800   H H    . ARG B 2 24  ? 7.661   -17.749 11.236  1.00 0.00 ? 24  ARG B H    1  
ATOM 2801   H HA   . ARG B 2 24  ? 5.422   -19.657 10.868  1.00 0.00 ? 24  ARG B HA   1  
ATOM 2802   H HB2  . ARG B 2 24  ? 6.833   -20.081 12.909  1.00 0.00 ? 24  ARG B HB2  1  
ATOM 2803   H HB3  . ARG B 2 24  ? 6.366   -18.467 13.496  1.00 0.00 ? 24  ARG B HB3  1  
ATOM 2804   H HG2  . ARG B 2 24  ? 3.925   -19.402 13.119  1.00 0.00 ? 24  ARG B HG2  1  
ATOM 2805   H HG3  . ARG B 2 24  ? 4.747   -20.973 13.280  1.00 0.00 ? 24  ARG B HG3  1  
ATOM 2806   H HD2  . ARG B 2 24  ? 3.898   -20.197 15.443  1.00 0.00 ? 24  ARG B HD2  1  
ATOM 2807   H HD3  . ARG B 2 24  ? 5.673   -20.276 15.442  1.00 0.00 ? 24  ARG B HD3  1  
ATOM 2808   H HE   . ARG B 2 24  ? 5.597   -17.804 15.052  1.00 0.00 ? 24  ARG B HE   1  
ATOM 2809   H HH11 . ARG B 2 24  ? 2.904   -19.439 16.585  1.00 0.00 ? 24  ARG B HH11 1  
ATOM 2810   H HH12 . ARG B 2 24  ? 2.374   -18.022 17.434  1.00 0.00 ? 24  ARG B HH12 1  
ATOM 2811   H HH21 . ARG B 2 24  ? 4.902   -15.955 16.177  1.00 0.00 ? 24  ARG B HH21 1  
ATOM 2812   H HH22 . ARG B 2 24  ? 3.509   -16.048 17.214  1.00 0.00 ? 24  ARG B HH22 1  
ATOM 2813   N N    . THR B 2 25  ? 3.643   -17.906 11.294  1.00 0.00 ? 25  THR B N    1  
ATOM 2814   C CA   . THR B 2 25  ? 2.643   -16.851 11.241  1.00 0.00 ? 25  THR B CA   1  
ATOM 2815   C C    . THR B 2 25  ? 1.672   -16.966 12.419  1.00 0.00 ? 25  THR B C    1  
ATOM 2816   O O    . THR B 2 25  ? 1.507   -18.044 12.990  1.00 0.00 ? 25  THR B O    1  
ATOM 2817   C CB   . THR B 2 25  ? 1.878   -16.873 9.890   1.00 0.00 ? 25  THR B CB   1  
ATOM 2818   O OG1  . THR B 2 25  ? 0.570   -16.298 10.023  1.00 0.00 ? 25  THR B OG1  1  
ATOM 2819   C CG2  . THR B 2 25  ? 1.756   -18.290 9.345   1.00 0.00 ? 25  THR B CG2  1  
ATOM 2820   H H    . THR B 2 25  ? 3.350   -18.842 11.247  1.00 0.00 ? 25  THR B H    1  
ATOM 2821   H HA   . THR B 2 25  ? 3.162   -15.895 11.319  1.00 0.00 ? 25  THR B HA   1  
ATOM 2822   H HB   . THR B 2 25  ? 2.441   -16.277 9.173   1.00 0.00 ? 25  THR B HB   1  
ATOM 2823   H HG1  . THR B 2 25  ? -0.091  -16.931 9.706   1.00 0.00 ? 25  THR B HG1  1  
ATOM 2824   H HG21 . THR B 2 25  ? 1.195   -18.902 10.051  1.00 0.00 ? 25  THR B HG21 1  
ATOM 2825   H HG22 . THR B 2 25  ? 1.237   -18.279 8.387   1.00 0.00 ? 25  THR B HG22 1  
ATOM 2826   H HG23 . THR B 2 25  ? 2.752   -18.711 9.210   1.00 0.00 ? 25  THR B HG23 1  
ATOM 2827   N N    . SER B 2 26  ? 1.051   -15.848 12.789  1.00 0.00 ? 26  SER B N    1  
ATOM 2828   C CA   . SER B 2 26  ? 0.096   -15.819 13.894  1.00 0.00 ? 26  SER B CA   1  
ATOM 2829   C C    . SER B 2 26  ? -1.275  -16.327 13.446  1.00 0.00 ? 26  SER B C    1  
ATOM 2830   O O    . SER B 2 26  ? -2.197  -16.466 14.254  1.00 0.00 ? 26  SER B O    1  
ATOM 2831   C CB   . SER B 2 26  ? -0.021  -14.393 14.448  1.00 0.00 ? 26  SER B CB   1  
ATOM 2832   O OG   . SER B 2 26  ? -0.935  -14.319 15.530  1.00 0.00 ? 26  SER B OG   1  
ATOM 2833   H H    . SER B 2 26  ? 1.247   -15.013 12.306  1.00 0.00 ? 26  SER B H    1  
ATOM 2834   H HA   . SER B 2 26  ? 0.466   -16.471 14.684  1.00 0.00 ? 26  SER B HA   1  
ATOM 2835   H HB2  . SER B 2 26  ? 0.960   -14.066 14.793  1.00 0.00 ? 26  SER B HB2  1  
ATOM 2836   H HB3  . SER B 2 26  ? -0.365  -13.732 13.652  1.00 0.00 ? 26  SER B HB3  1  
ATOM 2837   H HG   . SER B 2 26  ? -1.473  -15.123 15.550  1.00 0.00 ? 26  SER B HG   1  
ATOM 2838   N N    . GLY B 2 27  ? -1.407  -16.595 12.155  1.00 0.00 ? 27  GLY B N    1  
ATOM 2839   C CA   . GLY B 2 27  ? -2.658  -17.087 11.620  1.00 0.00 ? 27  GLY B CA   1  
ATOM 2840   C C    . GLY B 2 27  ? -2.433  -18.187 10.610  1.00 0.00 ? 27  GLY B C    1  
ATOM 2841   O O    . GLY B 2 27  ? -1.492  -18.117 9.817   1.00 0.00 ? 27  GLY B O    1  
ATOM 2842   H H    . GLY B 2 27  ? -0.638  -16.463 11.556  1.00 0.00 ? 27  GLY B H    1  
ATOM 2843   H HA2  . GLY B 2 27  ? -3.265  -17.474 12.438  1.00 0.00 ? 27  GLY B HA2  1  
ATOM 2844   H HA3  . GLY B 2 27  ? -3.185  -16.264 11.138  1.00 0.00 ? 27  GLY B HA3  1  
ATOM 2845   N N    . ASN B 2 28  ? -3.279  -19.207 10.643  1.00 0.00 ? 28  ASN B N    1  
ATOM 2846   C CA   . ASN B 2 28  ? -3.168  -20.331 9.719   1.00 0.00 ? 28  ASN B CA   1  
ATOM 2847   C C    . ASN B 2 28  ? -3.570  -19.916 8.304   1.00 0.00 ? 28  ASN B C    1  
ATOM 2848   O O    . ASN B 2 28  ? -4.724  -20.059 7.904   1.00 0.00 ? 28  ASN B O    1  
ATOM 2849   C CB   . ASN B 2 28  ? -4.022  -21.509 10.209  1.00 0.00 ? 28  ASN B CB   1  
ATOM 2850   C CG   . ASN B 2 28  ? -3.827  -22.786 9.407   1.00 0.00 ? 28  ASN B CG   1  
ATOM 2851   O OD1  . ASN B 2 28  ? -4.644  -23.131 8.553   1.00 0.00 ? 28  ASN B OD1  1  
ATOM 2852   N ND2  . ASN B 2 28  ? -2.752  -23.505 9.684   1.00 0.00 ? 28  ASN B ND2  1  
ATOM 2853   H H    . ASN B 2 28  ? -3.997  -19.210 11.311  1.00 0.00 ? 28  ASN B H    1  
ATOM 2854   H HA   . ASN B 2 28  ? -2.126  -20.650 9.697   1.00 0.00 ? 28  ASN B HA   1  
ATOM 2855   H HB2  . ASN B 2 28  ? -3.764  -21.712 11.248  1.00 0.00 ? 28  ASN B HB2  1  
ATOM 2856   H HB3  . ASN B 2 28  ? -5.071  -21.223 10.149  1.00 0.00 ? 28  ASN B HB3  1  
ATOM 2857   H HD21 . ASN B 2 28  ? -2.138  -23.179 10.386  1.00 0.00 ? 28  ASN B HD21 1  
ATOM 2858   H HD22 . ASN B 2 28  ? -2.612  -24.339 9.188   1.00 0.00 ? 28  ASN B HD22 1  
ATOM 2859   N N    . ILE B 2 29  ? -2.607  -19.375 7.563   1.00 0.00 ? 29  ILE B N    1  
ATOM 2860   C CA   . ILE B 2 29  ? -2.840  -18.934 6.192   1.00 0.00 ? 29  ILE B CA   1  
ATOM 2861   C C    . ILE B 2 29  ? -2.939  -20.132 5.256   1.00 0.00 ? 29  ILE B C    1  
ATOM 2862   O O    . ILE B 2 29  ? -3.495  -20.034 4.161   1.00 0.00 ? 29  ILE B O    1  
ATOM 2863   C CB   . ILE B 2 29  ? -1.735  -17.975 5.704   1.00 0.00 ? 29  ILE B CB   1  
ATOM 2864   C CG1  . ILE B 2 29  ? -0.349  -18.565 5.981   1.00 0.00 ? 29  ILE B CG1  1  
ATOM 2865   C CG2  . ILE B 2 29  ? -1.884  -16.613 6.371   1.00 0.00 ? 29  ILE B CG2  1  
ATOM 2866   C CD1  . ILE B 2 29  ? 0.797   -17.686 5.531   1.00 0.00 ? 29  ILE B CD1  1  
ATOM 2867   H H    . ILE B 2 29  ? -1.717  -19.257 7.956   1.00 0.00 ? 29  ILE B H    1  
ATOM 2868   H HA   . ILE B 2 29  ? -3.790  -18.400 6.171   1.00 0.00 ? 29  ILE B HA   1  
ATOM 2869   H HB   . ILE B 2 29  ? -1.844  -17.844 4.627   1.00 0.00 ? 29  ILE B HB   1  
ATOM 2870   H HG12 . ILE B 2 29  ? -0.254  -18.728 7.055   1.00 0.00 ? 29  ILE B HG12 1  
ATOM 2871   H HG13 . ILE B 2 29  ? -0.273  -19.520 5.461   1.00 0.00 ? 29  ILE B HG13 1  
ATOM 2872   H HG21 . ILE B 2 29  ? -1.113  -15.937 6.002   1.00 0.00 ? 29  ILE B HG21 1  
ATOM 2873   H HG22 . ILE B 2 29  ? -2.867  -16.202 6.140   1.00 0.00 ? 29  ILE B HG22 1  
ATOM 2874   H HG23 . ILE B 2 29  ? -1.782  -16.725 7.450   1.00 0.00 ? 29  ILE B HG23 1  
ATOM 2875   H HD11 . ILE B 2 29  ? 0.742   -16.729 6.048   1.00 0.00 ? 29  ILE B HD11 1  
ATOM 2876   H HD12 . ILE B 2 29  ? 1.754   -18.158 5.755   1.00 0.00 ? 29  ILE B HD12 1  
ATOM 2877   H HD13 . ILE B 2 29  ? 0.724   -17.523 4.455   1.00 0.00 ? 29  ILE B HD13 1  
ATOM 2878   N N    . HIS B 2 30  ? -2.379  -21.255 5.703   1.00 0.00 ? 30  HIS B N    1  
ATOM 2879   C CA   . HIS B 2 30  ? -2.401  -22.514 4.958   1.00 0.00 ? 30  HIS B CA   1  
ATOM 2880   C C    . HIS B 2 30  ? -1.422  -22.553 3.781   1.00 0.00 ? 30  HIS B C    1  
ATOM 2881   O O    . HIS B 2 30  ? -0.571  -23.438 3.718   1.00 0.00 ? 30  HIS B O    1  
ATOM 2882   C CB   . HIS B 2 30  ? -3.825  -22.899 4.521   1.00 0.00 ? 30  HIS B CB   1  
ATOM 2883   C CG   . HIS B 2 30  ? -3.956  -24.282 3.957   1.00 0.00 ? 30  HIS B CG   1  
ATOM 2884   N ND1  . HIS B 2 30  ? -4.255  -24.535 2.633   1.00 0.00 ? 30  HIS B ND1  1  
ATOM 2885   C CD2  . HIS B 2 30  ? -3.843  -25.494 4.550   1.00 0.00 ? 30  HIS B CD2  1  
ATOM 2886   C CE1  . HIS B 2 30  ? -4.320  -25.839 2.440   1.00 0.00 ? 30  HIS B CE1  1  
ATOM 2887   N NE2  . HIS B 2 30  ? -4.073  -26.442 3.584   1.00 0.00 ? 30  HIS B NE2  1  
ATOM 2888   H H    . HIS B 2 30  ? -1.921  -21.232 6.573   1.00 0.00 ? 30  HIS B H    1  
ATOM 2889   H HA   . HIS B 2 30  ? -2.071  -23.281 5.659   1.00 0.00 ? 30  HIS B HA   1  
ATOM 2890   H HB2  . HIS B 2 30  ? -4.482  -22.819 5.387   1.00 0.00 ? 30  HIS B HB2  1  
ATOM 2891   H HB3  . HIS B 2 30  ? -4.153  -22.188 3.762   1.00 0.00 ? 30  HIS B HB3  1  
ATOM 2892   H HD1  . HIS B 2 30  ? -4.408  -23.856 1.934   1.00 0.00 ? 30  HIS B HD1  1  
ATOM 2893   H HD2  . HIS B 2 30  ? -3.615  -25.680 5.589   1.00 0.00 ? 30  HIS B HD2  1  
ATOM 2894   H HE1  . HIS B 2 30  ? -4.537  -26.329 1.502   1.00 0.00 ? 30  HIS B HE1  1  
ATOM 2895   H HE2  . HIS B 2 30  ? -4.135  -27.412 3.740   1.00 0.00 ? 30  HIS B HE2  1  
ATOM 2896   N N    . ASN B 2 31  ? -1.526  -21.596 2.865   1.00 0.00 ? 31  ASN B N    1  
ATOM 2897   C CA   . ASN B 2 31  ? -0.657  -21.583 1.686   1.00 0.00 ? 31  ASN B CA   1  
ATOM 2898   C C    . ASN B 2 31  ? -0.503  -20.196 1.065   1.00 0.00 ? 31  ASN B C    1  
ATOM 2899   O O    . ASN B 2 31  ? -0.621  -20.039 -0.151  1.00 0.00 ? 31  ASN B O    1  
ATOM 2900   C CB   . ASN B 2 31  ? -1.184  -22.566 0.624   1.00 0.00 ? 31  ASN B CB   1  
ATOM 2901   C CG   . ASN B 2 31  ? -2.622  -22.291 0.199   1.00 0.00 ? 31  ASN B CG   1  
ATOM 2902   O OD1  . ASN B 2 31  ? -3.488  -21.985 1.023   1.00 0.00 ? 31  ASN B OD1  1  
ATOM 2903   N ND2  . ASN B 2 31  ? -2.889  -22.396 -1.093  1.00 0.00 ? 31  ASN B ND2  1  
ATOM 2904   H H    . ASN B 2 31  ? -2.201  -20.889 2.979   1.00 0.00 ? 31  ASN B H    1  
ATOM 2905   H HA   . ASN B 2 31  ? 0.330   -21.917 2.005   1.00 0.00 ? 31  ASN B HA   1  
ATOM 2906   H HB2  . ASN B 2 31  ? -0.543  -22.501 -0.255  1.00 0.00 ? 31  ASN B HB2  1  
ATOM 2907   H HB3  . ASN B 2 31  ? -1.132  -23.576 1.031   1.00 0.00 ? 31  ASN B HB3  1  
ATOM 2908   H HD21 . ASN B 2 31  ? -2.160  -22.639 -1.702  1.00 0.00 ? 31  ASN B HD21 1  
ATOM 2909   H HD22 . ASN B 2 31  ? -3.807  -22.222 -1.390  1.00 0.00 ? 31  ASN B HD22 1  
ATOM 2910   N N    . TYR B 2 32  ? -0.204  -19.187 1.880   1.00 0.00 ? 32  TYR B N    1  
ATOM 2911   C CA   . TYR B 2 32  ? -0.038  -17.827 1.371   1.00 0.00 ? 32  TYR B CA   1  
ATOM 2912   C C    . TYR B 2 32  ? 1.225   -17.179 1.937   1.00 0.00 ? 32  TYR B C    1  
ATOM 2913   O O    . TYR B 2 32  ? 1.158   -16.146 2.605   1.00 0.00 ? 32  TYR B O    1  
ATOM 2914   C CB   . TYR B 2 32  ? -1.267  -16.961 1.675   1.00 0.00 ? 32  TYR B CB   1  
ATOM 2915   C CG   . TYR B 2 32  ? -2.549  -17.471 1.054   1.00 0.00 ? 32  TYR B CG   1  
ATOM 2916   C CD1  . TYR B 2 32  ? -2.682  -17.584 -0.324  1.00 0.00 ? 32  TYR B CD1  1  
ATOM 2917   C CD2  . TYR B 2 32  ? -3.623  -17.845 1.847   1.00 0.00 ? 32  TYR B CD2  1  
ATOM 2918   C CE1  . TYR B 2 32  ? -3.850  -18.057 -0.894  1.00 0.00 ? 32  TYR B CE1  1  
ATOM 2919   C CE2  . TYR B 2 32  ? -4.794  -18.317 1.289   1.00 0.00 ? 32  TYR B CE2  1  
ATOM 2920   C CZ   . TYR B 2 32  ? -4.903  -18.423 -0.082  1.00 0.00 ? 32  TYR B CZ   1  
ATOM 2921   O OH   . TYR B 2 32  ? -6.067  -18.899 -0.639  1.00 0.00 ? 32  TYR B OH   1  
ATOM 2922   H H    . TYR B 2 32  ? -0.066  -19.360 2.836   1.00 0.00 ? 32  TYR B H    1  
ATOM 2923   H HA   . TYR B 2 32  ? 0.070   -17.891 0.288   1.00 0.00 ? 32  TYR B HA   1  
ATOM 2924   H HB2  . TYR B 2 32  ? -1.400  -16.916 2.756   1.00 0.00 ? 32  TYR B HB2  1  
ATOM 2925   H HB3  . TYR B 2 32  ? -1.081  -15.953 1.303   1.00 0.00 ? 32  TYR B HB3  1  
ATOM 2926   H HD1  . TYR B 2 32  ? -1.859  -17.298 -0.962  1.00 0.00 ? 32  TYR B HD1  1  
ATOM 2927   H HD2  . TYR B 2 32  ? -3.542  -17.765 2.921   1.00 0.00 ? 32  TYR B HD2  1  
ATOM 2928   H HE1  . TYR B 2 32  ? -3.937  -18.140 -1.967  1.00 0.00 ? 32  TYR B HE1  1  
ATOM 2929   H HE2  . TYR B 2 32  ? -5.620  -18.602 1.922   1.00 0.00 ? 32  TYR B HE2  1  
ATOM 2930   H HH   . TYR B 2 32  ? -5.860  -19.386 -1.441  1.00 0.00 ? 32  TYR B HH   1  
ATOM 2931   N N    . LEU B 2 33  ? 2.371   -17.797 1.670   1.00 0.00 ? 33  LEU B N    1  
ATOM 2932   C CA   . LEU B 2 33  ? 3.649   -17.297 2.157   1.00 0.00 ? 33  LEU B CA   1  
ATOM 2933   C C    . LEU B 2 33  ? 4.540   -16.836 1.002   1.00 0.00 ? 33  LEU B C    1  
ATOM 2934   O O    . LEU B 2 33  ? 4.558   -17.450 -0.065  1.00 0.00 ? 33  LEU B O    1  
ATOM 2935   C CB   . LEU B 2 33  ? 4.355   -18.409 2.943   1.00 0.00 ? 33  LEU B CB   1  
ATOM 2936   C CG   . LEU B 2 33  ? 5.163   -17.999 4.182   1.00 0.00 ? 33  LEU B CG   1  
ATOM 2937   C CD1  . LEU B 2 33  ? 6.493   -17.376 3.798   1.00 0.00 ? 33  LEU B CD1  1  
ATOM 2938   C CD2  . LEU B 2 33  ? 4.360   -17.072 5.082   1.00 0.00 ? 33  LEU B CD2  1  
ATOM 2939   H H    . LEU B 2 33  ? 2.358   -18.617 1.135   1.00 0.00 ? 33  LEU B H    1  
ATOM 2940   H HA   . LEU B 2 33  ? 3.465   -16.451 2.820   1.00 0.00 ? 33  LEU B HA   1  
ATOM 2941   H HB2  . LEU B 2 33  ? 3.591   -19.114 3.270   1.00 0.00 ? 33  LEU B HB2  1  
ATOM 2942   H HB3  . LEU B 2 33  ? 5.040   -18.909 2.258   1.00 0.00 ? 33  LEU B HB3  1  
ATOM 2943   H HG   . LEU B 2 33  ? 5.376   -18.905 4.749   1.00 0.00 ? 33  LEU B HG   1  
ATOM 2944   H HD11 . LEU B 2 33  ? 7.063   -17.126 4.694   1.00 0.00 ? 33  LEU B HD11 1  
ATOM 2945   H HD12 . LEU B 2 33  ? 7.063   -18.083 3.196   1.00 0.00 ? 33  LEU B HD12 1  
ATOM 2946   H HD13 . LEU B 2 33  ? 6.315   -16.469 3.221   1.00 0.00 ? 33  LEU B HD13 1  
ATOM 2947   H HD21 . LEU B 2 33  ? 3.436   -17.567 5.378   1.00 0.00 ? 33  LEU B HD21 1  
ATOM 2948   H HD22 . LEU B 2 33  ? 4.937   -16.824 5.973   1.00 0.00 ? 33  LEU B HD22 1  
ATOM 2949   H HD23 . LEU B 2 33  ? 4.124   -16.156 4.539   1.00 0.00 ? 33  LEU B HD23 1  
ATOM 2950   N N    . THR B 2 34  ? 5.262   -15.751 1.222   1.00 0.00 ? 34  THR B N    1  
ATOM 2951   C CA   . THR B 2 34  ? 6.167   -15.205 0.222   1.00 0.00 ? 34  THR B CA   1  
ATOM 2952   C C    . THR B 2 34  ? 7.581   -15.070 0.802   1.00 0.00 ? 34  THR B C    1  
ATOM 2953   O O    . THR B 2 34  ? 7.748   -14.837 2.000   1.00 0.00 ? 34  THR B O    1  
ATOM 2954   C CB   . THR B 2 34  ? 5.675   -13.822 -0.247  1.00 0.00 ? 34  THR B CB   1  
ATOM 2955   O OG1  . THR B 2 34  ? 4.396   -13.545 0.346   1.00 0.00 ? 34  THR B OG1  1  
ATOM 2956   C CG2  . THR B 2 34  ? 5.536   -13.796 -1.759  1.00 0.00 ? 34  THR B CG2  1  
ATOM 2957   H H    . THR B 2 34  ? 5.171   -15.285 2.081   1.00 0.00 ? 34  THR B H    1  
ATOM 2958   H HA   . THR B 2 34  ? 6.194   -15.882 -0.632  1.00 0.00 ? 34  THR B HA   1  
ATOM 2959   H HB   . THR B 2 34  ? 6.392   -13.062 0.063   1.00 0.00 ? 34  THR B HB   1  
ATOM 2960   H HG1  . THR B 2 34  ? 4.293   -12.588 0.454   1.00 0.00 ? 34  THR B HG1  1  
ATOM 2961   H HG21 . THR B 2 34  ? 4.818   -14.554 -2.071  1.00 0.00 ? 34  THR B HG21 1  
ATOM 2962   H HG22 . THR B 2 34  ? 5.188   -12.813 -2.079  1.00 0.00 ? 34  THR B HG22 1  
ATOM 2963   H HG23 . THR B 2 34  ? 6.504   -14.003 -2.216  1.00 0.00 ? 34  THR B HG23 1  
ATOM 2964   N N    . TRP B 2 35  ? 8.591   -15.241 -0.045  1.00 0.00 ? 35  TRP B N    1  
ATOM 2965   C CA   . TRP B 2 35  ? 9.986   -15.135 0.379   1.00 0.00 ? 35  TRP B CA   1  
ATOM 2966   C C    . TRP B 2 35  ? 10.729  -14.134 -0.500  1.00 0.00 ? 35  TRP B C    1  
ATOM 2967   O O    . TRP B 2 35  ? 10.690  -14.231 -1.733  1.00 0.00 ? 35  TRP B O    1  
ATOM 2968   C CB   . TRP B 2 35  ? 10.682  -16.496 0.292   1.00 0.00 ? 35  TRP B CB   1  
ATOM 2969   C CG   . TRP B 2 35  ? 10.264  -17.469 1.351   1.00 0.00 ? 35  TRP B CG   1  
ATOM 2970   C CD1  . TRP B 2 35  ? 9.369   -18.489 1.220   1.00 0.00 ? 35  TRP B CD1  1  
ATOM 2971   C CD2  . TRP B 2 35  ? 10.733  -17.520 2.705   1.00 0.00 ? 35  TRP B CD2  1  
ATOM 2972   N NE1  . TRP B 2 35  ? 9.250   -19.173 2.405   1.00 0.00 ? 35  TRP B NE1  1  
ATOM 2973   C CE2  . TRP B 2 35  ? 10.076  -18.597 3.333   1.00 0.00 ? 35  TRP B CE2  1  
ATOM 2974   C CE3  . TRP B 2 35  ? 11.645  -16.760 3.448   1.00 0.00 ? 35  TRP B CE3  1  
ATOM 2975   C CZ2  . TRP B 2 35  ? 10.301  -18.933 4.665   1.00 0.00 ? 35  TRP B CZ2  1  
ATOM 2976   C CZ3  . TRP B 2 35  ? 11.867  -17.094 4.769   1.00 0.00 ? 35  TRP B CZ3  1  
ATOM 2977   C CH2  . TRP B 2 35  ? 11.200  -18.171 5.364   1.00 0.00 ? 35  TRP B CH2  1  
ATOM 2978   H H    . TRP B 2 35  ? 8.395   -15.440 -0.990  1.00 0.00 ? 35  TRP B H    1  
ATOM 2979   H HA   . TRP B 2 35  ? 10.009  -14.790 1.413   1.00 0.00 ? 35  TRP B HA   1  
ATOM 2980   H HB2  . TRP B 2 35  ? 10.466  -16.933 -0.683  1.00 0.00 ? 35  TRP B HB2  1  
ATOM 2981   H HB3  . TRP B 2 35  ? 11.758  -16.340 0.370   1.00 0.00 ? 35  TRP B HB3  1  
ATOM 2982   H HD1  . TRP B 2 35  ? 8.830   -18.724 0.314   1.00 0.00 ? 35  TRP B HD1  1  
ATOM 2983   H HE1  . TRP B 2 35  ? 8.666   -19.947 2.560   1.00 0.00 ? 35  TRP B HE1  1  
ATOM 2984   H HE3  . TRP B 2 35  ? 12.164  -15.928 2.996   1.00 0.00 ? 35  TRP B HE3  1  
ATOM 2985   H HZ2  . TRP B 2 35  ? 9.787   -19.762 5.129   1.00 0.00 ? 35  TRP B HZ2  1  
ATOM 2986   H HZ3  . TRP B 2 35  ? 12.567  -16.515 5.353   1.00 0.00 ? 35  TRP B HZ3  1  
ATOM 2987   H HH2  . TRP B 2 35  ? 11.398  -18.407 6.400   1.00 0.00 ? 35  TRP B HH2  1  
ATOM 2988   N N    . TYR B 2 36  ? 11.419  -13.186 0.122   1.00 0.00 ? 36  TYR B N    1  
ATOM 2989   C CA   . TYR B 2 36  ? 12.150  -12.170 -0.615  1.00 0.00 ? 36  TYR B CA   1  
ATOM 2990   C C    . TYR B 2 36  ? 13.613  -12.129 -0.192  1.00 0.00 ? 36  TYR B C    1  
ATOM 2991   O O    . TYR B 2 36  ? 13.959  -12.528 0.921   1.00 0.00 ? 36  TYR B O    1  
ATOM 2992   C CB   . TYR B 2 36  ? 11.518  -10.795 -0.377  1.00 0.00 ? 36  TYR B CB   1  
ATOM 2993   C CG   . TYR B 2 36  ? 10.167  -10.613 -1.029  1.00 0.00 ? 36  TYR B CG   1  
ATOM 2994   C CD1  . TYR B 2 36  ? 8.995   -10.958 -0.365  1.00 0.00 ? 36  TYR B CD1  1  
ATOM 2995   C CD2  . TYR B 2 36  ? 10.065  -10.093 -2.307  1.00 0.00 ? 36  TYR B CD2  1  
ATOM 2996   C CE1  . TYR B 2 36  ? 7.760   -10.789 -0.964  1.00 0.00 ? 36  TYR B CE1  1  
ATOM 2997   C CE2  . TYR B 2 36  ? 8.839   -9.920  -2.912  1.00 0.00 ? 36  TYR B CE2  1  
ATOM 2998   C CZ   . TYR B 2 36  ? 7.689   -10.269 -2.238  1.00 0.00 ? 36  TYR B CZ   1  
ATOM 2999   O OH   . TYR B 2 36  ? 6.465   -10.096 -2.846  1.00 0.00 ? 36  TYR B OH   1  
ATOM 3000   H H    . TYR B 2 36  ? 11.455  -13.159 1.102   1.00 0.00 ? 36  TYR B H    1  
ATOM 3001   H HA   . TYR B 2 36  ? 12.096  -12.408 -1.678  1.00 0.00 ? 36  TYR B HA   1  
ATOM 3002   H HB2  . TYR B 2 36  ? 11.405  -10.648 0.697   1.00 0.00 ? 36  TYR B HB2  1  
ATOM 3003   H HB3  . TYR B 2 36  ? 12.193  -10.033 -0.765  1.00 0.00 ? 36  TYR B HB3  1  
ATOM 3004   H HD1  . TYR B 2 36  ? 9.050   -11.365 0.634   1.00 0.00 ? 36  TYR B HD1  1  
ATOM 3005   H HD2  . TYR B 2 36  ? 10.962  -9.817  -2.841  1.00 0.00 ? 36  TYR B HD2  1  
ATOM 3006   H HE1  . TYR B 2 36  ? 6.858   -11.064 -0.437  1.00 0.00 ? 36  TYR B HE1  1  
ATOM 3007   H HE2  . TYR B 2 36  ? 8.780   -9.513  -3.910  1.00 0.00 ? 36  TYR B HE2  1  
ATOM 3008   H HH   . TYR B 2 36  ? 6.576   -10.180 -3.805  1.00 0.00 ? 36  TYR B HH   1  
ATOM 3009   N N    . GLN B 2 37  ? 14.464  -11.642 -1.084  1.00 0.00 ? 37  GLN B N    1  
ATOM 3010   C CA   . GLN B 2 37  ? 15.889  -11.519 -0.809  1.00 0.00 ? 37  GLN B CA   1  
ATOM 3011   C C    . GLN B 2 37  ? 16.336  -10.089 -1.084  1.00 0.00 ? 37  GLN B C    1  
ATOM 3012   O O    . GLN B 2 37  ? 16.197  -9.595  -2.203  1.00 0.00 ? 37  GLN B O    1  
ATOM 3013   C CB   . GLN B 2 37  ? 16.698  -12.491 -1.679  1.00 0.00 ? 37  GLN B CB   1  
ATOM 3014   C CG   . GLN B 2 37  ? 18.209  -12.378 -1.512  1.00 0.00 ? 37  GLN B CG   1  
ATOM 3015   C CD   . GLN B 2 37  ? 18.981  -13.085 -2.611  1.00 0.00 ? 37  GLN B CD   1  
ATOM 3016   O OE1  . GLN B 2 37  ? 19.222  -12.519 -3.677  1.00 0.00 ? 37  GLN B OE1  1  
ATOM 3017   N NE2  . GLN B 2 37  ? 19.399  -14.315 -2.351  1.00 0.00 ? 37  GLN B NE2  1  
ATOM 3018   H H    . GLN B 2 37  ? 14.126  -11.345 -1.960  1.00 0.00 ? 37  GLN B H    1  
ATOM 3019   H HA   . GLN B 2 37  ? 16.065  -11.754 0.241   1.00 0.00 ? 37  GLN B HA   1  
ATOM 3020   H HB2  . GLN B 2 37  ? 16.402  -13.508 -1.419  1.00 0.00 ? 37  GLN B HB2  1  
ATOM 3021   H HB3  . GLN B 2 37  ? 16.454  -12.297 -2.723  1.00 0.00 ? 37  GLN B HB3  1  
ATOM 3022   H HG2  . GLN B 2 37  ? 18.483  -11.323 -1.519  1.00 0.00 ? 37  GLN B HG2  1  
ATOM 3023   H HG3  . GLN B 2 37  ? 18.488  -12.815 -0.554  1.00 0.00 ? 37  GLN B HG3  1  
ATOM 3024   H HE21 . GLN B 2 37  ? 19.195  -14.702 -1.468  1.00 0.00 ? 37  GLN B HE21 1  
ATOM 3025   H HE22 . GLN B 2 37  ? 19.899  -14.790 -3.045  1.00 0.00 ? 37  GLN B HE22 1  
ATOM 3026   N N    . GLN B 2 38  ? 16.845  -9.422  -0.065  1.00 0.00 ? 38  GLN B N    1  
ATOM 3027   C CA   . GLN B 2 38  ? 17.308  -8.052  -0.207  1.00 0.00 ? 38  GLN B CA   1  
ATOM 3028   C C    . GLN B 2 38  ? 18.834  -8.001  -0.137  1.00 0.00 ? 38  GLN B C    1  
ATOM 3029   O O    . GLN B 2 38  ? 19.429  -8.326  0.885   1.00 0.00 ? 38  GLN B O    1  
ATOM 3030   C CB   . GLN B 2 38  ? 16.672  -7.168  0.870   1.00 0.00 ? 38  GLN B CB   1  
ATOM 3031   C CG   . GLN B 2 38  ? 17.089  -5.704  0.833   1.00 0.00 ? 38  GLN B CG   1  
ATOM 3032   C CD   . GLN B 2 38  ? 16.381  -4.868  1.884   1.00 0.00 ? 38  GLN B CD   1  
ATOM 3033   O OE1  . GLN B 2 38  ? 16.026  -5.356  2.958   1.00 0.00 ? 38  GLN B OE1  1  
ATOM 3034   N NE2  . GLN B 2 38  ? 16.172  -3.598  1.585   1.00 0.00 ? 38  GLN B NE2  1  
ATOM 3035   H H    . GLN B 2 38  ? 16.915  -9.860  0.811   1.00 0.00 ? 38  GLN B H    1  
ATOM 3036   H HA   . GLN B 2 38  ? 16.996  -7.683  -1.184  1.00 0.00 ? 38  GLN B HA   1  
ATOM 3037   H HB2  . GLN B 2 38  ? 15.590  -7.213  0.749   1.00 0.00 ? 38  GLN B HB2  1  
ATOM 3038   H HB3  . GLN B 2 38  ? 16.946  -7.572  1.845   1.00 0.00 ? 38  GLN B HB3  1  
ATOM 3039   H HG2  . GLN B 2 38  ? 18.164  -5.641  1.001   1.00 0.00 ? 38  GLN B HG2  1  
ATOM 3040   H HG3  . GLN B 2 38  ? 16.856  -5.299  -0.152  1.00 0.00 ? 38  GLN B HG3  1  
ATOM 3041   H HE21 . GLN B 2 38  ? 16.482  -3.266  0.717   1.00 0.00 ? 38  GLN B HE21 1  
ATOM 3042   H HE22 . GLN B 2 38  ? 15.704  -3.040  2.246   1.00 0.00 ? 38  GLN B HE22 1  
ATOM 3043   N N    . LYS B 2 39  ? 19.459  -7.610  -1.237  1.00 0.00 ? 39  LYS B N    1  
ATOM 3044   C CA   . LYS B 2 39  ? 20.915  -7.527  -1.290  1.00 0.00 ? 39  LYS B CA   1  
ATOM 3045   C C    . LYS B 2 39  ? 21.391  -6.216  -0.665  1.00 0.00 ? 39  LYS B C    1  
ATOM 3046   O O    . LYS B 2 39  ? 20.733  -5.184  -0.803  1.00 0.00 ? 39  LYS B O    1  
ATOM 3047   C CB   . LYS B 2 39  ? 21.412  -7.646  -2.736  1.00 0.00 ? 39  LYS B CB   1  
ATOM 3048   C CG   . LYS B 2 39  ? 21.099  -8.980  -3.404  1.00 0.00 ? 39  LYS B CG   1  
ATOM 3049   C CD   . LYS B 2 39  ? 22.354  -9.824  -3.584  1.00 0.00 ? 39  LYS B CD   1  
ATOM 3050   C CE   . LYS B 2 39  ? 22.096  -11.032 -4.478  1.00 0.00 ? 39  LYS B CE   1  
ATOM 3051   N NZ   . LYS B 2 39  ? 23.335  -11.825 -4.707  1.00 0.00 ? 39  LYS B NZ   1  
ATOM 3052   H H    . LYS B 2 39  ? 18.942  -7.341  -2.020  1.00 0.00 ? 39  LYS B H    1  
ATOM 3053   H HA   . LYS B 2 39  ? 21.327  -8.357  -0.714  1.00 0.00 ? 39  LYS B HA   1  
ATOM 3054   H HB2  . LYS B 2 39  ? 20.946  -6.854  -3.322  1.00 0.00 ? 39  LYS B HB2  1  
ATOM 3055   H HB3  . LYS B 2 39  ? 22.493  -7.510  -2.736  1.00 0.00 ? 39  LYS B HB3  1  
ATOM 3056   H HG2  . LYS B 2 39  ? 20.390  -9.529  -2.784  1.00 0.00 ? 39  LYS B HG2  1  
ATOM 3057   H HG3  . LYS B 2 39  ? 20.656  -8.791  -4.382  1.00 0.00 ? 39  LYS B HG3  1  
ATOM 3058   H HD2  . LYS B 2 39  ? 23.131  -9.209  -4.038  1.00 0.00 ? 39  LYS B HD2  1  
ATOM 3059   H HD3  . LYS B 2 39  ? 22.689  -10.172 -2.608  1.00 0.00 ? 39  LYS B HD3  1  
ATOM 3060   H HE2  . LYS B 2 39  ? 21.350  -11.670 -4.004  1.00 0.00 ? 39  LYS B HE2  1  
ATOM 3061   H HE3  . LYS B 2 39  ? 21.714  -10.687 -5.439  1.00 0.00 ? 39  LYS B HE3  1  
ATOM 3062   H HZ1  . LYS B 2 39  ? 24.095  -11.208 -5.057  1.00 0.00 ? 39  LYS B HZ1  1  
ATOM 3063   H HZ2  . LYS B 2 39  ? 23.164  -12.581 -5.406  1.00 0.00 ? 39  LYS B HZ2  1  
ATOM 3064   H HZ3  . LYS B 2 39  ? 23.649  -12.266 -3.815  1.00 0.00 ? 39  LYS B HZ3  1  
ATOM 3065   N N    . PRO B 2 40  ? 22.533  -6.246  0.042   1.00 0.00 ? 40  PRO B N    1  
ATOM 3066   C CA   . PRO B 2 40  ? 23.097  -5.059  0.702   1.00 0.00 ? 40  PRO B CA   1  
ATOM 3067   C C    . PRO B 2 40  ? 23.323  -3.891  -0.264  1.00 0.00 ? 40  PRO B C    1  
ATOM 3068   O O    . PRO B 2 40  ? 24.259  -3.901  -1.067  1.00 0.00 ? 40  PRO B O    1  
ATOM 3069   C CB   . PRO B 2 40  ? 24.436  -5.560  1.255   1.00 0.00 ? 40  PRO B CB   1  
ATOM 3070   C CG   . PRO B 2 40  ? 24.256  -7.031  1.398   1.00 0.00 ? 40  PRO B CG   1  
ATOM 3071   C CD   . PRO B 2 40  ? 23.361  -7.445  0.266   1.00 0.00 ? 40  PRO B CD   1  
ATOM 3072   H HA   . PRO B 2 40  ? 22.446  -4.731  1.512   1.00 0.00 ? 40  PRO B HA   1  
ATOM 3073   H HB2  . PRO B 2 40  ? 25.267  -5.314  0.594   1.00 0.00 ? 40  PRO B HB2  1  
ATOM 3074   H HB3  . PRO B 2 40  ? 24.590  -5.130  2.245   1.00 0.00 ? 40  PRO B HB3  1  
ATOM 3075   H HG2  . PRO B 2 40  ? 25.225  -7.512  1.266   1.00 0.00 ? 40  PRO B HG2  1  
ATOM 3076   H HG3  . PRO B 2 40  ? 23.824  -7.291  2.364   1.00 0.00 ? 40  PRO B HG3  1  
ATOM 3077   H HD2  . PRO B 2 40  ? 23.938  -7.716  -0.618  1.00 0.00 ? 40  PRO B HD2  1  
ATOM 3078   H HD3  . PRO B 2 40  ? 22.724  -8.275  0.573   1.00 0.00 ? 40  PRO B HD3  1  
ATOM 3079   N N    . GLY B 2 41  ? 22.445  -2.897  -0.189  1.00 0.00 ? 41  GLY B N    1  
ATOM 3080   C CA   . GLY B 2 41  ? 22.561  -1.731  -1.043  1.00 0.00 ? 41  GLY B CA   1  
ATOM 3081   C C    . GLY B 2 41  ? 21.839  -1.900  -2.364  1.00 0.00 ? 41  GLY B C    1  
ATOM 3082   O O    . GLY B 2 41  ? 22.017  -1.102  -3.287  1.00 0.00 ? 41  GLY B O    1  
ATOM 3083   H H    . GLY B 2 41  ? 21.704  -2.963  0.449   1.00 0.00 ? 41  GLY B H    1  
ATOM 3084   H HA2  . GLY B 2 41  ? 22.138  -0.872  -0.521  1.00 0.00 ? 41  GLY B HA2  1  
ATOM 3085   H HA3  . GLY B 2 41  ? 23.616  -1.547  -1.242  1.00 0.00 ? 41  GLY B HA3  1  
ATOM 3086   N N    . LYS B 2 42  ? 21.027  -2.939  -2.461  1.00 0.00 ? 42  LYS B N    1  
ATOM 3087   C CA   . LYS B 2 42  ? 20.279  -3.208  -3.677  1.00 0.00 ? 42  LYS B CA   1  
ATOM 3088   C C    . LYS B 2 42  ? 18.798  -3.375  -3.380  1.00 0.00 ? 42  LYS B C    1  
ATOM 3089   O O    . LYS B 2 42  ? 18.379  -3.381  -2.222  1.00 0.00 ? 42  LYS B O    1  
ATOM 3090   C CB   . LYS B 2 42  ? 20.809  -4.459  -4.376  1.00 0.00 ? 42  LYS B CB   1  
ATOM 3091   C CG   . LYS B 2 42  ? 22.124  -4.266  -5.110  1.00 0.00 ? 42  LYS B CG   1  
ATOM 3092   C CD   . LYS B 2 42  ? 22.404  -5.450  -6.015  1.00 0.00 ? 42  LYS B CD   1  
ATOM 3093   C CE   . LYS B 2 42  ? 23.648  -5.240  -6.860  1.00 0.00 ? 42  LYS B CE   1  
ATOM 3094   N NZ   . LYS B 2 42  ? 23.787  -6.304  -7.892  1.00 0.00 ? 42  LYS B NZ   1  
ATOM 3095   H H    . LYS B 2 42  ? 20.920  -3.542  -1.690  1.00 0.00 ? 42  LYS B H    1  
ATOM 3096   H HA   . LYS B 2 42  ? 20.404  -2.357  -4.346  1.00 0.00 ? 42  LYS B HA   1  
ATOM 3097   H HB2  . LYS B 2 42  ? 20.951  -5.234  -3.623  1.00 0.00 ? 42  LYS B HB2  1  
ATOM 3098   H HB3  . LYS B 2 42  ? 20.062  -4.786  -5.099  1.00 0.00 ? 42  LYS B HB3  1  
ATOM 3099   H HG2  . LYS B 2 42  ? 22.070  -3.359  -5.712  1.00 0.00 ? 42  LYS B HG2  1  
ATOM 3100   H HG3  . LYS B 2 42  ? 22.931  -4.172  -4.383  1.00 0.00 ? 42  LYS B HG3  1  
ATOM 3101   H HD2  . LYS B 2 42  ? 22.544  -6.339  -5.399  1.00 0.00 ? 42  LYS B HD2  1  
ATOM 3102   H HD3  . LYS B 2 42  ? 21.550  -5.597  -6.676  1.00 0.00 ? 42  LYS B HD3  1  
ATOM 3103   H HE2  . LYS B 2 42  ? 23.583  -4.270  -7.355  1.00 0.00 ? 42  LYS B HE2  1  
ATOM 3104   H HE3  . LYS B 2 42  ? 24.525  -5.253  -6.214  1.00 0.00 ? 42  LYS B HE3  1  
ATOM 3105   H HZ1  . LYS B 2 42  ? 23.033  -6.214  -8.603  1.00 0.00 ? 42  LYS B HZ1  1  
ATOM 3106   H HZ2  . LYS B 2 42  ? 23.724  -7.243  -7.450  1.00 0.00 ? 42  LYS B HZ2  1  
ATOM 3107   H HZ3  . LYS B 2 42  ? 24.703  -6.224  -8.367  1.00 0.00 ? 42  LYS B HZ3  1  
ATOM 3108   N N    . ALA B 2 43  ? 18.015  -3.513  -4.437  1.00 0.00 ? 43  ALA B N    1  
ATOM 3109   C CA   . ALA B 2 43  ? 16.579  -3.688  -4.312  1.00 0.00 ? 43  ALA B CA   1  
ATOM 3110   C C    . ALA B 2 43  ? 16.258  -5.149  -4.021  1.00 0.00 ? 43  ALA B C    1  
ATOM 3111   O O    . ALA B 2 43  ? 16.966  -6.045  -4.486  1.00 0.00 ? 43  ALA B O    1  
ATOM 3112   C CB   . ALA B 2 43  ? 15.896  -3.249  -5.598  1.00 0.00 ? 43  ALA B CB   1  
ATOM 3113   H H    . ALA B 2 43  ? 18.416  -3.507  -5.328  1.00 0.00 ? 43  ALA B H    1  
ATOM 3114   H HA   . ALA B 2 43  ? 16.218  -3.073  -3.489  1.00 0.00 ? 43  ALA B HA   1  
ATOM 3115   H HB1  . ALA B 2 43  ? 14.817  -3.368  -5.497  1.00 0.00 ? 43  ALA B HB1  1  
ATOM 3116   H HB2  . ALA B 2 43  ? 16.129  -2.202  -5.793  1.00 0.00 ? 43  ALA B HB2  1  
ATOM 3117   H HB3  . ALA B 2 43  ? 16.252  -3.861  -6.427  1.00 0.00 ? 43  ALA B HB3  1  
ATOM 3118   N N    . PRO B 2 44  ? 15.206  -5.405  -3.231  1.00 0.00 ? 44  PRO B N    1  
ATOM 3119   C CA   . PRO B 2 44  ? 14.784  -6.766  -2.890  1.00 0.00 ? 44  PRO B CA   1  
ATOM 3120   C C    . PRO B 2 44  ? 14.246  -7.501  -4.118  1.00 0.00 ? 44  PRO B C    1  
ATOM 3121   O O    . PRO B 2 44  ? 13.719  -6.880  -5.044  1.00 0.00 ? 44  PRO B O    1  
ATOM 3122   C CB   . PRO B 2 44  ? 13.655  -6.557  -1.869  1.00 0.00 ? 44  PRO B CB   1  
ATOM 3123   C CG   . PRO B 2 44  ? 13.788  -5.139  -1.424  1.00 0.00 ? 44  PRO B CG   1  
ATOM 3124   C CD   . PRO B 2 44  ? 14.356  -4.392  -2.592  1.00 0.00 ? 44  PRO B CD   1  
ATOM 3125   H HA   . PRO B 2 44  ? 15.606  -7.331  -2.451  1.00 0.00 ? 44  PRO B HA   1  
ATOM 3126   H HB2  . PRO B 2 44  ? 12.676  -6.753  -2.306  1.00 0.00 ? 44  PRO B HB2  1  
ATOM 3127   H HB3  . PRO B 2 44  ? 13.833  -7.208  -1.013  1.00 0.00 ? 44  PRO B HB3  1  
ATOM 3128   H HG2  . PRO B 2 44  ? 12.792  -4.749  -1.215  1.00 0.00 ? 44  PRO B HG2  1  
ATOM 3129   H HG3  . PRO B 2 44  ? 14.428  -5.054  -0.545  1.00 0.00 ? 44  PRO B HG3  1  
ATOM 3130   H HD2  . PRO B 2 44  ? 13.571  -4.033  -3.257  1.00 0.00 ? 44  PRO B HD2  1  
ATOM 3131   H HD3  . PRO B 2 44  ? 14.971  -3.560  -2.248  1.00 0.00 ? 44  PRO B HD3  1  
ATOM 3132   N N    . GLN B 2 45  ? 14.385  -8.818  -4.123  1.00 0.00 ? 45  GLN B N    1  
ATOM 3133   C CA   . GLN B 2 45  ? 13.909  -9.630  -5.234  1.00 0.00 ? 45  GLN B CA   1  
ATOM 3134   C C    . GLN B 2 45  ? 13.023  -10.761 -4.728  1.00 0.00 ? 45  GLN B C    1  
ATOM 3135   O O    . GLN B 2 45  ? 13.227  -11.276 -3.625  1.00 0.00 ? 45  GLN B O    1  
ATOM 3136   C CB   . GLN B 2 45  ? 15.084  -10.206 -6.031  1.00 0.00 ? 45  GLN B CB   1  
ATOM 3137   C CG   . GLN B 2 45  ? 15.295  -9.549  -7.386  1.00 0.00 ? 45  GLN B CG   1  
ATOM 3138   C CD   . GLN B 2 45  ? 16.294  -8.412  -7.338  1.00 0.00 ? 45  GLN B CD   1  
ATOM 3139   O OE1  . GLN B 2 45  ? 17.487  -8.607  -7.570  1.00 0.00 ? 45  GLN B OE1  1  
ATOM 3140   N NE2  . GLN B 2 45  ? 15.821  -7.217  -7.023  1.00 0.00 ? 45  GLN B NE2  1  
ATOM 3141   H H    . GLN B 2 45  ? 14.807  -9.264  -3.355  1.00 0.00 ? 45  GLN B H    1  
ATOM 3142   H HA   . GLN B 2 45  ? 13.321  -8.994  -5.895  1.00 0.00 ? 45  GLN B HA   1  
ATOM 3143   H HB2  . GLN B 2 45  ? 15.993  -10.077 -5.443  1.00 0.00 ? 45  GLN B HB2  1  
ATOM 3144   H HB3  . GLN B 2 45  ? 14.902  -11.268 -6.191  1.00 0.00 ? 45  GLN B HB3  1  
ATOM 3145   H HG2  . GLN B 2 45  ? 15.655  -10.301 -8.087  1.00 0.00 ? 45  GLN B HG2  1  
ATOM 3146   H HG3  . GLN B 2 45  ? 14.339  -9.159  -7.738  1.00 0.00 ? 45  GLN B HG3  1  
ATOM 3147   H HE21 . GLN B 2 45  ? 14.860  -7.132  -6.835  1.00 0.00 ? 45  GLN B HE21 1  
ATOM 3148   H HE22 . GLN B 2 45  ? 16.447  -6.466  -6.982  1.00 0.00 ? 45  GLN B HE22 1  
ATOM 3149   N N    . LEU B 2 46  ? 12.034  -11.130 -5.533  1.00 0.00 ? 46  LEU B N    1  
ATOM 3150   C CA   . LEU B 2 46  ? 11.116  -12.206 -5.187  1.00 0.00 ? 46  LEU B CA   1  
ATOM 3151   C C    . LEU B 2 46  ? 11.706  -13.549 -5.587  1.00 0.00 ? 46  LEU B C    1  
ATOM 3152   O O    . LEU B 2 46  ? 11.867  -13.833 -6.772  1.00 0.00 ? 46  LEU B O    1  
ATOM 3153   C CB   . LEU B 2 46  ? 9.766   -11.998 -5.883  1.00 0.00 ? 46  LEU B CB   1  
ATOM 3154   C CG   . LEU B 2 46  ? 8.732   -13.116 -5.718  1.00 0.00 ? 46  LEU B CG   1  
ATOM 3155   C CD1  . LEU B 2 46  ? 8.308   -13.251 -4.267  1.00 0.00 ? 46  LEU B CD1  1  
ATOM 3156   C CD2  . LEU B 2 46  ? 7.527   -12.871 -6.611  1.00 0.00 ? 46  LEU B CD2  1  
ATOM 3157   H H    . LEU B 2 46  ? 11.922  -10.660 -6.386  1.00 0.00 ? 46  LEU B H    1  
ATOM 3158   H HA   . LEU B 2 46  ? 10.961  -12.196 -4.108  1.00 0.00 ? 46  LEU B HA   1  
ATOM 3159   H HB2  . LEU B 2 46  ? 9.328   -11.081 -5.489  1.00 0.00 ? 46  LEU B HB2  1  
ATOM 3160   H HB3  . LEU B 2 46  ? 9.958   -11.879 -6.949  1.00 0.00 ? 46  LEU B HB3  1  
ATOM 3161   H HG   . LEU B 2 46  ? 9.195   -14.054 -6.023  1.00 0.00 ? 46  LEU B HG   1  
ATOM 3162   H HD11 . LEU B 2 46  ? 7.591   -14.066 -4.164  1.00 0.00 ? 46  LEU B HD11 1  
ATOM 3163   H HD12 . LEU B 2 46  ? 9.183   -13.460 -3.652  1.00 0.00 ? 46  LEU B HD12 1  
ATOM 3164   H HD13 . LEU B 2 46  ? 7.845   -12.321 -3.937  1.00 0.00 ? 46  LEU B HD13 1  
ATOM 3165   H HD21 . LEU B 2 46  ? 7.852   -12.812 -7.650  1.00 0.00 ? 46  LEU B HD21 1  
ATOM 3166   H HD22 . LEU B 2 46  ? 6.813   -13.688 -6.503  1.00 0.00 ? 46  LEU B HD22 1  
ATOM 3167   H HD23 . LEU B 2 46  ? 7.049   -11.934 -6.326  1.00 0.00 ? 46  LEU B HD23 1  
ATOM 3168   N N    . LEU B 2 47  ? 12.045  -14.362 -4.598  1.00 0.00 ? 47  LEU B N    1  
ATOM 3169   C CA   . LEU B 2 47  ? 12.616  -15.673 -4.864  1.00 0.00 ? 47  LEU B CA   1  
ATOM 3170   C C    . LEU B 2 47  ? 11.544  -16.757 -4.867  1.00 0.00 ? 47  LEU B C    1  
ATOM 3171   O O    . LEU B 2 47  ? 11.473  -17.575 -5.787  1.00 0.00 ? 47  LEU B O    1  
ATOM 3172   C CB   . LEU B 2 47  ? 13.690  -16.023 -3.829  1.00 0.00 ? 47  LEU B CB   1  
ATOM 3173   C CG   . LEU B 2 47  ? 14.916  -15.113 -3.760  1.00 0.00 ? 47  LEU B CG   1  
ATOM 3174   C CD1  . LEU B 2 47  ? 15.930  -15.680 -2.782  1.00 0.00 ? 47  LEU B CD1  1  
ATOM 3175   C CD2  . LEU B 2 47  ? 15.543  -14.933 -5.134  1.00 0.00 ? 47  LEU B CD2  1  
ATOM 3176   H H    . LEU B 2 47  ? 11.927  -14.067 -3.671  1.00 0.00 ? 47  LEU B H    1  
ATOM 3177   H HA   . LEU B 2 47  ? 13.081  -15.643 -5.849  1.00 0.00 ? 47  LEU B HA   1  
ATOM 3178   H HB2  . LEU B 2 47  ? 13.216  -16.009 -2.847  1.00 0.00 ? 47  LEU B HB2  1  
ATOM 3179   H HB3  . LEU B 2 47  ? 14.041  -17.031 -4.049  1.00 0.00 ? 47  LEU B HB3  1  
ATOM 3180   H HG   . LEU B 2 47  ? 14.598  -14.135 -3.400  1.00 0.00 ? 47  LEU B HG   1  
ATOM 3181   H HD11 . LEU B 2 47  ? 16.792  -15.015 -2.718  1.00 0.00 ? 47  LEU B HD11 1  
ATOM 3182   H HD12 . LEU B 2 47  ? 15.471  -15.772 -1.798  1.00 0.00 ? 47  LEU B HD12 1  
ATOM 3183   H HD13 . LEU B 2 47  ? 16.255  -16.662 -3.125  1.00 0.00 ? 47  LEU B HD13 1  
ATOM 3184   H HD21 . LEU B 2 47  ? 14.807  -14.503 -5.814  1.00 0.00 ? 47  LEU B HD21 1  
ATOM 3185   H HD22 . LEU B 2 47  ? 16.403  -14.267 -5.065  1.00 0.00 ? 47  LEU B HD22 1  
ATOM 3186   H HD23 . LEU B 2 47  ? 15.866  -15.902 -5.514  1.00 0.00 ? 47  LEU B HD23 1  
ATOM 3187   N N    . ILE B 2 48  ? 10.700  -16.743 -3.842  1.00 0.00 ? 48  ILE B N    1  
ATOM 3188   C CA   . ILE B 2 48  ? 9.644   -17.740 -3.705  1.00 0.00 ? 48  ILE B CA   1  
ATOM 3189   C C    . ILE B 2 48  ? 8.308   -17.059 -3.428  1.00 0.00 ? 48  ILE B C    1  
ATOM 3190   O O    . ILE B 2 48  ? 8.232   -16.123 -2.632  1.00 0.00 ? 48  ILE B O    1  
ATOM 3191   C CB   . ILE B 2 48  ? 9.946   -18.732 -2.552  1.00 0.00 ? 48  ILE B CB   1  
ATOM 3192   C CG1  . ILE B 2 48  ? 11.321  -19.387 -2.723  1.00 0.00 ? 48  ILE B CG1  1  
ATOM 3193   C CG2  . ILE B 2 48  ? 8.856   -19.793 -2.437  1.00 0.00 ? 48  ILE B CG2  1  
ATOM 3194   C CD1  . ILE B 2 48  ? 11.418  -20.338 -3.898  1.00 0.00 ? 48  ILE B CD1  1  
ATOM 3195   H H    . ILE B 2 48  ? 10.758  -16.019 -3.183  1.00 0.00 ? 48  ILE B H    1  
ATOM 3196   H HA   . ILE B 2 48  ? 9.575   -18.296 -4.640  1.00 0.00 ? 48  ILE B HA   1  
ATOM 3197   H HB   . ILE B 2 48  ? 9.960   -18.165 -1.622  1.00 0.00 ? 48  ILE B HB   1  
ATOM 3198   H HG12 . ILE B 2 48  ? 12.060  -18.598 -2.860  1.00 0.00 ? 48  ILE B HG12 1  
ATOM 3199   H HG13 . ILE B 2 48  ? 11.548  -19.944 -1.814  1.00 0.00 ? 48  ILE B HG13 1  
ATOM 3200   H HG21 . ILE B 2 48  ? 9.070   -20.458 -1.600  1.00 0.00 ? 48  ILE B HG21 1  
ATOM 3201   H HG22 . ILE B 2 48  ? 7.895   -19.307 -2.274  1.00 0.00 ? 48  ILE B HG22 1  
ATOM 3202   H HG23 . ILE B 2 48  ? 8.819   -20.374 -3.358  1.00 0.00 ? 48  ILE B HG23 1  
ATOM 3203   H HD11 . ILE B 2 48  ? 11.203  -19.796 -4.818  1.00 0.00 ? 48  ILE B HD11 1  
ATOM 3204   H HD12 . ILE B 2 48  ? 12.418  -20.768 -3.964  1.00 0.00 ? 48  ILE B HD12 1  
ATOM 3205   H HD13 . ILE B 2 48  ? 10.693  -21.142 -3.771  1.00 0.00 ? 48  ILE B HD13 1  
ATOM 3206   N N    . TYR B 2 49  ? 7.265   -17.534 -4.084  1.00 0.00 ? 49  TYR B N    1  
ATOM 3207   C CA   . TYR B 2 49  ? 5.927   -16.990 -3.905  1.00 0.00 ? 49  TYR B CA   1  
ATOM 3208   C C    . TYR B 2 49  ? 4.921   -18.127 -3.859  1.00 0.00 ? 49  TYR B C    1  
ATOM 3209   O O    . TYR B 2 49  ? 5.238   -19.247 -4.258  1.00 0.00 ? 49  TYR B O    1  
ATOM 3210   C CB   . TYR B 2 49  ? 5.570   -15.994 -5.020  1.00 0.00 ? 49  TYR B CB   1  
ATOM 3211   C CG   . TYR B 2 49  ? 5.679   -16.557 -6.421  1.00 0.00 ? 49  TYR B CG   1  
ATOM 3212   C CD1  . TYR B 2 49  ? 4.599   -17.188 -7.029  1.00 0.00 ? 49  TYR B CD1  1  
ATOM 3213   C CD2  . TYR B 2 49  ? 6.864   -16.461 -7.132  1.00 0.00 ? 49  TYR B CD2  1  
ATOM 3214   C CE1  . TYR B 2 49  ? 4.702   -17.707 -8.304  1.00 0.00 ? 49  TYR B CE1  1  
ATOM 3215   C CE2  . TYR B 2 49  ? 6.974   -16.979 -8.405  1.00 0.00 ? 49  TYR B CE2  1  
ATOM 3216   C CZ   . TYR B 2 49  ? 5.894   -17.600 -8.987  1.00 0.00 ? 49  TYR B CZ   1  
ATOM 3217   O OH   . TYR B 2 49  ? 6.013   -18.124 -10.254 1.00 0.00 ? 49  TYR B OH   1  
ATOM 3218   H H    . TYR B 2 49  ? 7.390   -18.301 -4.690  1.00 0.00 ? 49  TYR B H    1  
ATOM 3219   H HA   . TYR B 2 49  ? 5.899   -16.460 -2.953  1.00 0.00 ? 49  TYR B HA   1  
ATOM 3220   H HB2  . TYR B 2 49  ? 4.546   -15.656 -4.864  1.00 0.00 ? 49  TYR B HB2  1  
ATOM 3221   H HB3  . TYR B 2 49  ? 6.237   -15.136 -4.942  1.00 0.00 ? 49  TYR B HB3  1  
ATOM 3222   H HD1  . TYR B 2 49  ? 3.664   -17.273 -6.495  1.00 0.00 ? 49  TYR B HD1  1  
ATOM 3223   H HD2  . TYR B 2 49  ? 7.716   -15.973 -6.682  1.00 0.00 ? 49  TYR B HD2  1  
ATOM 3224   H HE1  . TYR B 2 49  ? 3.854   -18.194 -8.763  1.00 0.00 ? 49  TYR B HE1  1  
ATOM 3225   H HE2  . TYR B 2 49  ? 7.906   -16.896 -8.944  1.00 0.00 ? 49  TYR B HE2  1  
ATOM 3226   H HH   . TYR B 2 49  ? 6.799   -18.693 -10.291 1.00 0.00 ? 49  TYR B HH   1  
ATOM 3227   N N    . ASN B 2 50  ? 3.724   -17.844 -3.355  1.00 0.00 ? 50  ASN B N    1  
ATOM 3228   C CA   . ASN B 2 50  ? 2.664   -18.848 -3.260  1.00 0.00 ? 50  ASN B CA   1  
ATOM 3229   C C    . ASN B 2 50  ? 3.116   -20.061 -2.446  1.00 0.00 ? 50  ASN B C    1  
ATOM 3230   O O    . ASN B 2 50  ? 2.752   -21.200 -2.749  1.00 0.00 ? 50  ASN B O    1  
ATOM 3231   C CB   . ASN B 2 50  ? 2.183   -19.273 -4.652  1.00 0.00 ? 50  ASN B CB   1  
ATOM 3232   C CG   . ASN B 2 50  ? 0.728   -19.703 -4.668  1.00 0.00 ? 50  ASN B CG   1  
ATOM 3233   O OD1  . ASN B 2 50  ? -0.172  -18.883 -4.846  1.00 0.00 ? 50  ASN B OD1  1  
ATOM 3234   N ND2  . ASN B 2 50  ? 0.485   -20.991 -4.487  1.00 0.00 ? 50  ASN B ND2  1  
ATOM 3235   H H    . ASN B 2 50  ? 3.547   -16.937 -3.035  1.00 0.00 ? 50  ASN B H    1  
ATOM 3236   H HA   . ASN B 2 50  ? 1.822   -18.391 -2.740  1.00 0.00 ? 50  ASN B HA   1  
ATOM 3237   H HB2  . ASN B 2 50  ? 2.307   -18.432 -5.335  1.00 0.00 ? 50  ASN B HB2  1  
ATOM 3238   H HB3  . ASN B 2 50  ? 2.796   -20.106 -4.995  1.00 0.00 ? 50  ASN B HB3  1  
ATOM 3239   H HD21 . ASN B 2 50  ? 1.250   -21.590 -4.353  1.00 0.00 ? 50  ASN B HD21 1  
ATOM 3240   H HD22 . ASN B 2 50  ? -0.448  -21.291 -4.486  1.00 0.00 ? 50  ASN B HD22 1  
ATOM 3241   N N    . ALA B 2 51  ? 3.932   -19.793 -1.423  1.00 0.00 ? 51  ALA B N    1  
ATOM 3242   C CA   . ALA B 2 51  ? 4.452   -20.819 -0.516  1.00 0.00 ? 51  ALA B CA   1  
ATOM 3243   C C    . ALA B 2 51  ? 5.506   -21.744 -1.132  1.00 0.00 ? 51  ALA B C    1  
ATOM 3244   O O    . ALA B 2 51  ? 6.595   -21.884 -0.584  1.00 0.00 ? 51  ALA B O    1  
ATOM 3245   C CB   . ALA B 2 51  ? 3.332   -21.612 0.145   1.00 0.00 ? 51  ALA B CB   1  
ATOM 3246   H H    . ALA B 2 51  ? 4.198   -18.859 -1.268  1.00 0.00 ? 51  ALA B H    1  
ATOM 3247   H HA   . ALA B 2 51  ? 4.958   -20.274 0.280   1.00 0.00 ? 51  ALA B HA   1  
ATOM 3248   H HB1  . ALA B 2 51  ? 3.737   -22.311 0.877   1.00 0.00 ? 51  ALA B HB1  1  
ATOM 3249   H HB2  . ALA B 2 51  ? 2.652   -20.924 0.648   1.00 0.00 ? 51  ALA B HB2  1  
ATOM 3250   H HB3  . ALA B 2 51  ? 2.787   -22.169 -0.616  1.00 0.00 ? 51  ALA B HB3  1  
ATOM 3251   N N    . LYS B 2 52  ? 5.197   -22.363 -2.267  1.00 0.00 ? 52  LYS B N    1  
ATOM 3252   C CA   . LYS B 2 52  ? 6.131   -23.302 -2.881  1.00 0.00 ? 52  LYS B CA   1  
ATOM 3253   C C    . LYS B 2 52  ? 6.358   -23.065 -4.368  1.00 0.00 ? 52  LYS B C    1  
ATOM 3254   O O    . LYS B 2 52  ? 6.704   -23.999 -5.090  1.00 0.00 ? 52  LYS B O    1  
ATOM 3255   C CB   . LYS B 2 52  ? 5.631   -24.736 -2.681  1.00 0.00 ? 52  LYS B CB   1  
ATOM 3256   C CG   . LYS B 2 52  ? 6.229   -25.454 -1.487  1.00 0.00 ? 52  LYS B CG   1  
ATOM 3257   C CD   . LYS B 2 52  ? 6.044   -26.956 -1.609  1.00 0.00 ? 52  LYS B CD   1  
ATOM 3258   C CE   . LYS B 2 52  ? 6.934   -27.709 -0.634  1.00 0.00 ? 52  LYS B CE   1  
ATOM 3259   N NZ   . LYS B 2 52  ? 8.378   -27.559 -0.960  1.00 0.00 ? 52  LYS B NZ   1  
ATOM 3260   H H    . LYS B 2 52  ? 4.327   -22.187 -2.694  1.00 0.00 ? 52  LYS B H    1  
ATOM 3261   H HA   . LYS B 2 52  ? 7.089   -23.192 -2.372  1.00 0.00 ? 52  LYS B HA   1  
ATOM 3262   H HB2  . LYS B 2 52  ? 4.549   -24.703 -2.551  1.00 0.00 ? 52  LYS B HB2  1  
ATOM 3263   H HB3  . LYS B 2 52  ? 5.872   -25.308 -3.577  1.00 0.00 ? 52  LYS B HB3  1  
ATOM 3264   H HG2  . LYS B 2 52  ? 7.294   -25.229 -1.432  1.00 0.00 ? 52  LYS B HG2  1  
ATOM 3265   H HG3  . LYS B 2 52  ? 5.737   -25.107 -0.578  1.00 0.00 ? 52  LYS B HG3  1  
ATOM 3266   H HD2  . LYS B 2 52  ? 5.003   -27.203 -1.401  1.00 0.00 ? 52  LYS B HD2  1  
ATOM 3267   H HD3  . LYS B 2 52  ? 6.294   -27.262 -2.625  1.00 0.00 ? 52  LYS B HD3  1  
ATOM 3268   H HE2  . LYS B 2 52  ? 6.758   -27.325 0.371   1.00 0.00 ? 52  LYS B HE2  1  
ATOM 3269   H HE3  . LYS B 2 52  ? 6.673   -28.767 -0.664  1.00 0.00 ? 52  LYS B HE3  1  
ATOM 3270   H HZ1  . LYS B 2 52  ? 8.962   -27.816 -0.133  1.00 0.00 ? 52  LYS B HZ1  1  
ATOM 3271   H HZ2  . LYS B 2 52  ? 8.589   -26.572 -1.220  1.00 0.00 ? 52  LYS B HZ2  1  
ATOM 3272   H HZ3  . LYS B 2 52  ? 8.635   -28.178 -1.753  1.00 0.00 ? 52  LYS B HZ3  1  
ATOM 3273   N N    . THR B 2 53  ? 6.181   -21.847 -4.845  1.00 0.00 ? 53  THR B N    1  
ATOM 3274   C CA   . THR B 2 53  ? 6.386   -21.583 -6.259  1.00 0.00 ? 53  THR B CA   1  
ATOM 3275   C C    . THR B 2 53  ? 7.584   -20.666 -6.514  1.00 0.00 ? 53  THR B C    1  
ATOM 3276   O O    . THR B 2 53  ? 7.609   -19.518 -6.069  1.00 0.00 ? 53  THR B O    1  
ATOM 3277   C CB   . THR B 2 53  ? 5.126   -21.006 -6.928  1.00 0.00 ? 53  THR B CB   1  
ATOM 3278   O OG1  . THR B 2 53  ? 3.960   -21.643 -6.384  1.00 0.00 ? 53  THR B OG1  1  
ATOM 3279   C CG2  . THR B 2 53  ? 5.171   -21.263 -8.425  1.00 0.00 ? 53  THR B CG2  1  
ATOM 3280   H H    . THR B 2 53  ? 5.902   -21.111 -4.254  1.00 0.00 ? 53  THR B H    1  
ATOM 3281   H HA   . THR B 2 53  ? 6.600   -22.542 -6.731  1.00 0.00 ? 53  THR B HA   1  
ATOM 3282   H HB   . THR B 2 53  ? 5.078   -19.933 -6.743  1.00 0.00 ? 53  THR B HB   1  
ATOM 3283   H HG1  . THR B 2 53  ? 3.199   -21.440 -6.939  1.00 0.00 ? 53  THR B HG1  1  
ATOM 3284   H HG21 . THR B 2 53  ? 5.217   -22.336 -8.608  1.00 0.00 ? 53  THR B HG21 1  
ATOM 3285   H HG22 . THR B 2 53  ? 4.276   -20.853 -8.894  1.00 0.00 ? 53  THR B HG22 1  
ATOM 3286   H HG23 . THR B 2 53  ? 6.053   -20.783 -8.849  1.00 0.00 ? 53  THR B HG23 1  
ATOM 3287   N N    . LEU B 2 54  ? 8.588   -21.203 -7.205  1.00 0.00 ? 54  LEU B N    1  
ATOM 3288   C CA   . LEU B 2 54  ? 9.791   -20.446 -7.544  1.00 0.00 ? 54  LEU B CA   1  
ATOM 3289   C C    . LEU B 2 54  ? 9.488   -19.381 -8.596  1.00 0.00 ? 54  LEU B C    1  
ATOM 3290   O O    . LEU B 2 54  ? 8.597   -19.556 -9.436  1.00 0.00 ? 54  LEU B O    1  
ATOM 3291   C CB   . LEU B 2 54  ? 10.874  -21.383 -8.095  1.00 0.00 ? 54  LEU B CB   1  
ATOM 3292   C CG   . LEU B 2 54  ? 11.663  -22.214 -7.079  1.00 0.00 ? 54  LEU B CG   1  
ATOM 3293   C CD1  . LEU B 2 54  ? 10.837  -23.384 -6.569  1.00 0.00 ? 54  LEU B CD1  1  
ATOM 3294   C CD2  . LEU B 2 54  ? 12.965  -22.706 -7.696  1.00 0.00 ? 54  LEU B CD2  1  
ATOM 3295   H H    . LEU B 2 54  ? 8.532   -22.144 -7.464  1.00 0.00 ? 54  LEU B H    1  
ATOM 3296   H HA   . LEU B 2 54  ? 10.163  -19.961 -6.641  1.00 0.00 ? 54  LEU B HA   1  
ATOM 3297   H HB2  . LEU B 2 54  ? 10.388  -22.078 -8.780  1.00 0.00 ? 54  LEU B HB2  1  
ATOM 3298   H HB3  . LEU B 2 54  ? 11.589  -20.771 -8.644  1.00 0.00 ? 54  LEU B HB3  1  
ATOM 3299   H HG   . LEU B 2 54  ? 11.906  -21.575 -6.231  1.00 0.00 ? 54  LEU B HG   1  
ATOM 3300   H HD11 . LEU B 2 54  ? 11.408  -23.950 -5.833  1.00 0.00 ? 54  LEU B HD11 1  
ATOM 3301   H HD12 . LEU B 2 54  ? 9.925   -23.008 -6.106  1.00 0.00 ? 54  LEU B HD12 1  
ATOM 3302   H HD13 . LEU B 2 54  ? 10.579  -24.036 -7.404  1.00 0.00 ? 54  LEU B HD13 1  
ATOM 3303   H HD21 . LEU B 2 54  ? 13.555  -21.851 -8.025  1.00 0.00 ? 54  LEU B HD21 1  
ATOM 3304   H HD22 . LEU B 2 54  ? 13.531  -23.274 -6.958  1.00 0.00 ? 54  LEU B HD22 1  
ATOM 3305   H HD23 . LEU B 2 54  ? 12.742  -23.345 -8.550  1.00 0.00 ? 54  LEU B HD23 1  
ATOM 3306   N N    . ALA B 2 55  ? 10.225  -18.278 -8.542  1.00 0.00 ? 55  ALA B N    1  
ATOM 3307   C CA   . ALA B 2 55  ? 10.052  -17.195 -9.499  1.00 0.00 ? 55  ALA B CA   1  
ATOM 3308   C C    . ALA B 2 55  ? 10.813  -17.487 -10.789 1.00 0.00 ? 55  ALA B C    1  
ATOM 3309   O O    . ALA B 2 55  ? 11.813  -18.207 -10.782 1.00 0.00 ? 55  ALA B O    1  
ATOM 3310   C CB   . ALA B 2 55  ? 10.477  -15.864 -8.903  1.00 0.00 ? 55  ALA B CB   1  
ATOM 3311   H H    . ALA B 2 55  ? 10.892  -18.186 -7.827  1.00 0.00 ? 55  ALA B H    1  
ATOM 3312   H HA   . ALA B 2 55  ? 8.990   -17.131 -9.740  1.00 0.00 ? 55  ALA B HA   1  
ATOM 3313   H HB1  . ALA B 2 55  ? 10.308  -15.062 -9.622  1.00 0.00 ? 55  ALA B HB1  1  
ATOM 3314   H HB2  . ALA B 2 55  ? 9.895   -15.668 -8.002  1.00 0.00 ? 55  ALA B HB2  1  
ATOM 3315   H HB3  . ALA B 2 55  ? 11.536  -15.903 -8.650  1.00 0.00 ? 55  ALA B HB3  1  
ATOM 3316   N N    . ASP B 2 56  ? 10.341  -16.915 -11.889 1.00 0.00 ? 56  ASP B N    1  
ATOM 3317   C CA   . ASP B 2 56  ? 10.958  -17.129 -13.193 1.00 0.00 ? 56  ASP B CA   1  
ATOM 3318   C C    . ASP B 2 56  ? 12.283  -16.390 -13.316 1.00 0.00 ? 56  ASP B C    1  
ATOM 3319   O O    . ASP B 2 56  ? 12.318  -15.168 -13.464 1.00 0.00 ? 56  ASP B O    1  
ATOM 3320   C CB   . ASP B 2 56  ? 10.015  -16.707 -14.319 1.00 0.00 ? 56  ASP B CB   1  
ATOM 3321   C CG   . ASP B 2 56  ? 8.857   -17.663 -14.491 1.00 0.00 ? 56  ASP B CG   1  
ATOM 3322   O OD1  . ASP B 2 56  ? 9.053   -18.737 -15.101 1.00 0.00 ? 56  ASP B OD1  1  
ATOM 3323   O OD2  . ASP B 2 56  ? 7.746   -17.344 -14.021 1.00 0.00 ? 56  ASP B OD2  1  
ATOM 3324   H H    . ASP B 2 56  ? 9.561   -16.324 -11.822 1.00 0.00 ? 56  ASP B H    1  
ATOM 3325   H HA   . ASP B 2 56  ? 11.155  -18.196 -13.294 1.00 0.00 ? 56  ASP B HA   1  
ATOM 3326   H HB2  . ASP B 2 56  ? 9.622   -15.715 -14.094 1.00 0.00 ? 56  ASP B HB2  1  
ATOM 3327   H HB3  . ASP B 2 56  ? 10.578  -16.666 -15.251 1.00 0.00 ? 56  ASP B HB3  1  
ATOM 3328   H HD2  . ASP B 2 56  ? 7.057   -17.997 -14.167 1.00 0.00 ? 56  ASP B HD2  1  
ATOM 3329   N N    . GLY B 2 57  ? 13.370  -17.142 -13.256 1.00 0.00 ? 57  GLY B N    1  
ATOM 3330   C CA   . GLY B 2 57  ? 14.689  -16.558 -13.367 1.00 0.00 ? 57  GLY B CA   1  
ATOM 3331   C C    . GLY B 2 57  ? 15.499  -16.747 -12.104 1.00 0.00 ? 57  GLY B C    1  
ATOM 3332   O O    . GLY B 2 57  ? 16.710  -16.522 -12.094 1.00 0.00 ? 57  GLY B O    1  
ATOM 3333   H H    . GLY B 2 57  ? 13.274  -18.112 -13.131 1.00 0.00 ? 57  GLY B H    1  
ATOM 3334   H HA2  . GLY B 2 57  ? 15.214  -17.030 -14.197 1.00 0.00 ? 57  GLY B HA2  1  
ATOM 3335   H HA3  . GLY B 2 57  ? 14.587  -15.491 -13.565 1.00 0.00 ? 57  GLY B HA3  1  
ATOM 3336   N N    . VAL B 2 58  ? 14.825  -17.166 -11.041 1.00 0.00 ? 58  VAL B N    1  
ATOM 3337   C CA   . VAL B 2 58  ? 15.467  -17.388 -9.753  1.00 0.00 ? 58  VAL B CA   1  
ATOM 3338   C C    . VAL B 2 58  ? 16.284  -18.681 -9.763  1.00 0.00 ? 58  VAL B C    1  
ATOM 3339   O O    . VAL B 2 58  ? 15.832  -19.703 -10.291 1.00 0.00 ? 58  VAL B O    1  
ATOM 3340   C CB   . VAL B 2 58  ? 14.415  -17.417 -8.618  1.00 0.00 ? 58  VAL B CB   1  
ATOM 3341   C CG1  . VAL B 2 58  ? 14.976  -18.013 -7.333  1.00 0.00 ? 58  VAL B CG1  1  
ATOM 3342   C CG2  . VAL B 2 58  ? 13.896  -16.012 -8.361  1.00 0.00 ? 58  VAL B CG2  1  
ATOM 3343   H H    . VAL B 2 58  ? 13.859  -17.336 -11.126 1.00 0.00 ? 58  VAL B H    1  
ATOM 3344   H HA   . VAL B 2 58  ? 16.147  -16.556 -9.569  1.00 0.00 ? 58  VAL B HA   1  
ATOM 3345   H HB   . VAL B 2 58  ? 13.582  -18.040 -8.943  1.00 0.00 ? 58  VAL B HB   1  
ATOM 3346   H HG11 . VAL B 2 58  ? 14.206  -18.034 -6.562  1.00 0.00 ? 58  VAL B HG11 1  
ATOM 3347   H HG12 . VAL B 2 58  ? 15.320  -19.029 -7.525  1.00 0.00 ? 58  VAL B HG12 1  
ATOM 3348   H HG13 . VAL B 2 58  ? 15.814  -17.406 -6.988  1.00 0.00 ? 58  VAL B HG13 1  
ATOM 3349   H HG21 . VAL B 2 58  ? 13.463  -15.613 -9.278  1.00 0.00 ? 58  VAL B HG21 1  
ATOM 3350   H HG22 . VAL B 2 58  ? 13.133  -16.039 -7.583  1.00 0.00 ? 58  VAL B HG22 1  
ATOM 3351   H HG23 . VAL B 2 58  ? 14.719  -15.374 -8.040  1.00 0.00 ? 58  VAL B HG23 1  
ATOM 3352   N N    . PRO B 2 59  ? 17.516  -18.632 -9.211  1.00 0.00 ? 59  PRO B N    1  
ATOM 3353   C CA   . PRO B 2 59  ? 18.410  -19.795 -9.133  1.00 0.00 ? 59  PRO B CA   1  
ATOM 3354   C C    . PRO B 2 59  ? 17.700  -21.024 -8.570  1.00 0.00 ? 59  PRO B C    1  
ATOM 3355   O O    . PRO B 2 59  ? 16.860  -20.917 -7.675  1.00 0.00 ? 59  PRO B O    1  
ATOM 3356   C CB   . PRO B 2 59  ? 19.502  -19.329 -8.171  1.00 0.00 ? 59  PRO B CB   1  
ATOM 3357   C CG   . PRO B 2 59  ? 19.555  -17.855 -8.370  1.00 0.00 ? 59  PRO B CG   1  
ATOM 3358   C CD   . PRO B 2 59  ? 18.139  -17.424 -8.635  1.00 0.00 ? 59  PRO B CD   1  
ATOM 3359   H HA   . PRO B 2 59  ? 18.828  -20.030 -10.112 1.00 0.00 ? 59  PRO B HA   1  
ATOM 3360   H HB2  . PRO B 2 59  ? 19.277  -19.595 -7.138  1.00 0.00 ? 59  PRO B HB2  1  
ATOM 3361   H HB3  . PRO B 2 59  ? 20.454  -19.760 -8.481  1.00 0.00 ? 59  PRO B HB3  1  
ATOM 3362   H HG2  . PRO B 2 59  ? 19.889  -17.394 -7.441  1.00 0.00 ? 59  PRO B HG2  1  
ATOM 3363   H HG3  . PRO B 2 59  ? 20.215  -17.585 -9.194  1.00 0.00 ? 59  PRO B HG3  1  
ATOM 3364   H HD2  . PRO B 2 59  ? 17.643  -17.108 -7.718  1.00 0.00 ? 59  PRO B HD2  1  
ATOM 3365   H HD3  . PRO B 2 59  ? 18.122  -16.621 -9.372  1.00 0.00 ? 59  PRO B HD3  1  
ATOM 3366   N N    . SER B 2 60  ? 18.073  -22.193 -9.066  1.00 0.00 ? 60  SER B N    1  
ATOM 3367   C CA   . SER B 2 60  ? 17.448  -23.438 -8.646  1.00 0.00 ? 60  SER B CA   1  
ATOM 3368   C C    . SER B 2 60  ? 17.847  -23.854 -7.228  1.00 0.00 ? 60  SER B C    1  
ATOM 3369   O O    . SER B 2 60  ? 17.229  -24.740 -6.642  1.00 0.00 ? 60  SER B O    1  
ATOM 3370   C CB   . SER B 2 60  ? 17.772  -24.546 -9.647  1.00 0.00 ? 60  SER B CB   1  
ATOM 3371   O OG   . SER B 2 60  ? 17.758  -24.038 -10.975 1.00 0.00 ? 60  SER B OG   1  
ATOM 3372   H H    . SER B 2 60  ? 18.807  -22.227 -9.718  1.00 0.00 ? 60  SER B H    1  
ATOM 3373   H HA   . SER B 2 60  ? 16.369  -23.281 -8.652  1.00 0.00 ? 60  SER B HA   1  
ATOM 3374   H HB2  . SER B 2 60  ? 18.761  -24.948 -9.429  1.00 0.00 ? 60  SER B HB2  1  
ATOM 3375   H HB3  . SER B 2 60  ? 17.029  -25.338 -9.559  1.00 0.00 ? 60  SER B HB3  1  
ATOM 3376   H HG   . SER B 2 60  ? 17.006  -23.437 -11.080 1.00 0.00 ? 60  SER B HG   1  
ATOM 3377   N N    . ARG B 2 61  ? 18.879  -23.223 -6.678  1.00 0.00 ? 61  ARG B N    1  
ATOM 3378   C CA   . ARG B 2 61  ? 19.330  -23.548 -5.327  1.00 0.00 ? 61  ARG B CA   1  
ATOM 3379   C C    . ARG B 2 61  ? 18.387  -23.000 -4.258  1.00 0.00 ? 61  ARG B C    1  
ATOM 3380   O O    . ARG B 2 61  ? 18.561  -23.270 -3.071  1.00 0.00 ? 61  ARG B O    1  
ATOM 3381   C CB   . ARG B 2 61  ? 20.762  -23.062 -5.082  1.00 0.00 ? 61  ARG B CB   1  
ATOM 3382   C CG   . ARG B 2 61  ? 20.922  -21.553 -4.986  1.00 0.00 ? 61  ARG B CG   1  
ATOM 3383   C CD   . ARG B 2 61  ? 22.389  -21.175 -4.870  1.00 0.00 ? 61  ARG B CD   1  
ATOM 3384   N NE   . ARG B 2 61  ? 22.589  -19.732 -4.807  1.00 0.00 ? 61  ARG B NE   1  
ATOM 3385   C CZ   . ARG B 2 61  ? 22.777  -18.956 -5.874  1.00 0.00 ? 61  ARG B CZ   1  
ATOM 3386   N NH1  . ARG B 2 61  ? 22.815  -19.490 -7.091  1.00 0.00 ? 61  ARG B NH1  1  
ATOM 3387   N NH2  . ARG B 2 61  ? 22.935  -17.649 -5.717  1.00 0.00 ? 61  ARG B NH2  1  
ATOM 3388   H H    . ARG B 2 61  ? 19.367  -22.547 -7.201  1.00 0.00 ? 61  ARG B H    1  
ATOM 3389   H HA   . ARG B 2 61  ? 19.330  -24.635 -5.242  1.00 0.00 ? 61  ARG B HA   1  
ATOM 3390   H HB2  . ARG B 2 61  ? 21.111  -23.500 -4.147  1.00 0.00 ? 61  ARG B HB2  1  
ATOM 3391   H HB3  . ARG B 2 61  ? 21.384  -23.417 -5.904  1.00 0.00 ? 61  ARG B HB3  1  
ATOM 3392   H HG2  . ARG B 2 61  ? 20.503  -21.091 -5.881  1.00 0.00 ? 61  ARG B HG2  1  
ATOM 3393   H HG3  . ARG B 2 61  ? 20.388  -21.191 -4.107  1.00 0.00 ? 61  ARG B HG3  1  
ATOM 3394   H HD2  . ARG B 2 61  ? 22.798  -21.625 -3.966  1.00 0.00 ? 61  ARG B HD2  1  
ATOM 3395   H HD3  . ARG B 2 61  ? 22.923  -21.565 -5.737  1.00 0.00 ? 61  ARG B HD3  1  
ATOM 3396   H HE   . ARG B 2 61  ? 22.589  -19.313 -3.906  1.00 0.00 ? 61  ARG B HE   1  
ATOM 3397   H HH11 . ARG B 2 61  ? 22.706  -20.479 -7.212  1.00 0.00 ? 61  ARG B HH11 1  
ATOM 3398   H HH12 . ARG B 2 61  ? 22.950  -18.904 -7.893  1.00 0.00 ? 61  ARG B HH12 1  
ATOM 3399   H HH21 . ARG B 2 61  ? 22.912  -17.246 -4.783  1.00 0.00 ? 61  ARG B HH21 1  
ATOM 3400   H HH22 . ARG B 2 61  ? 23.083  -17.052 -6.512  1.00 0.00 ? 61  ARG B HH22 1  
ATOM 3401   N N    . PHE B 2 62  ? 17.386  -22.240 -4.679  1.00 0.00 ? 62  PHE B N    1  
ATOM 3402   C CA   . PHE B 2 62  ? 16.425  -21.669 -3.750  1.00 0.00 ? 62  PHE B CA   1  
ATOM 3403   C C    . PHE B 2 62  ? 15.117  -22.441 -3.789  1.00 0.00 ? 62  PHE B C    1  
ATOM 3404   O O    . PHE B 2 62  ? 14.421  -22.450 -4.799  1.00 0.00 ? 62  PHE B O    1  
ATOM 3405   C CB   . PHE B 2 62  ? 16.172  -20.190 -4.064  1.00 0.00 ? 62  PHE B CB   1  
ATOM 3406   C CG   . PHE B 2 62  ? 17.364  -19.303 -3.843  1.00 0.00 ? 62  PHE B CG   1  
ATOM 3407   C CD1  . PHE B 2 62  ? 17.899  -19.141 -2.576  1.00 0.00 ? 62  PHE B CD1  1  
ATOM 3408   C CD2  . PHE B 2 62  ? 17.947  -18.630 -4.902  1.00 0.00 ? 62  PHE B CD2  1  
ATOM 3409   C CE1  . PHE B 2 62  ? 18.993  -18.321 -2.370  1.00 0.00 ? 62  PHE B CE1  1  
ATOM 3410   C CE2  . PHE B 2 62  ? 19.040  -17.810 -4.705  1.00 0.00 ? 62  PHE B CE2  1  
ATOM 3411   C CZ   . PHE B 2 62  ? 19.564  -17.656 -3.436  1.00 0.00 ? 62  PHE B CZ   1  
ATOM 3412   H H    . PHE B 2 62  ? 17.268  -22.090 -5.643  1.00 0.00 ? 62  PHE B H    1  
ATOM 3413   H HA   . PHE B 2 62  ? 16.841  -21.741 -2.745  1.00 0.00 ? 62  PHE B HA   1  
ATOM 3414   H HB2  . PHE B 2 62  ? 15.869  -20.106 -5.108  1.00 0.00 ? 62  PHE B HB2  1  
ATOM 3415   H HB3  . PHE B 2 62  ? 15.357  -19.837 -3.433  1.00 0.00 ? 62  PHE B HB3  1  
ATOM 3416   H HD1  . PHE B 2 62  ? 17.455  -19.659 -1.739  1.00 0.00 ? 62  PHE B HD1  1  
ATOM 3417   H HD2  . PHE B 2 62  ? 17.541  -18.747 -5.896  1.00 0.00 ? 62  PHE B HD2  1  
ATOM 3418   H HE1  . PHE B 2 62  ? 19.401  -18.202 -1.377  1.00 0.00 ? 62  PHE B HE1  1  
ATOM 3419   H HE2  . PHE B 2 62  ? 19.485  -17.290 -5.541  1.00 0.00 ? 62  PHE B HE2  1  
ATOM 3420   H HZ   . PHE B 2 62  ? 20.419  -17.014 -3.279  1.00 0.00 ? 62  PHE B HZ   1  
ATOM 3421   N N    . SER B 2 63  ? 14.796  -23.109 -2.695  1.00 0.00 ? 63  SER B N    1  
ATOM 3422   C CA   . SER B 2 63  ? 13.569  -23.882 -2.608  1.00 0.00 ? 63  SER B CA   1  
ATOM 3423   C C    . SER B 2 63  ? 12.753  -23.454 -1.394  1.00 0.00 ? 63  SER B C    1  
ATOM 3424   O O    . SER B 2 63  ? 13.309  -23.095 -0.355  1.00 0.00 ? 63  SER B O    1  
ATOM 3425   C CB   . SER B 2 63  ? 13.895  -25.374 -2.536  1.00 0.00 ? 63  SER B CB   1  
ATOM 3426   O OG   . SER B 2 63  ? 14.781  -25.747 -3.581  1.00 0.00 ? 63  SER B OG   1  
ATOM 3427   H H    . SER B 2 63  ? 15.398  -23.083 -1.917  1.00 0.00 ? 63  SER B H    1  
ATOM 3428   H HA   . SER B 2 63  ? 12.980  -23.697 -3.507  1.00 0.00 ? 63  SER B HA   1  
ATOM 3429   H HB2  . SER B 2 63  ? 14.363  -25.591 -1.576  1.00 0.00 ? 63  SER B HB2  1  
ATOM 3430   H HB3  . SER B 2 63  ? 12.972  -25.946 -2.628  1.00 0.00 ? 63  SER B HB3  1  
ATOM 3431   H HG   . SER B 2 63  ? 15.096  -24.954 -4.027  1.00 0.00 ? 63  SER B HG   1  
ATOM 3432   N N    . GLY B 2 64  ? 11.437  -23.490 -1.529  1.00 0.00 ? 64  GLY B N    1  
ATOM 3433   C CA   . GLY B 2 64  ? 10.570  -23.101 -0.438  1.00 0.00 ? 64  GLY B CA   1  
ATOM 3434   C C    . GLY B 2 64  ? 9.657   -24.233 -0.022  1.00 0.00 ? 64  GLY B C    1  
ATOM 3435   O O    . GLY B 2 64  ? 9.162   -24.974 -0.870  1.00 0.00 ? 64  GLY B O    1  
ATOM 3436   H H    . GLY B 2 64  ? 11.047  -23.798 -2.376  1.00 0.00 ? 64  GLY B H    1  
ATOM 3437   H HA2  . GLY B 2 64  ? 11.184  -22.809 0.414   1.00 0.00 ? 64  GLY B HA2  1  
ATOM 3438   H HA3  . GLY B 2 64  ? 9.963   -22.253 -0.753  1.00 0.00 ? 64  GLY B HA3  1  
ATOM 3439   N N    . SER B 2 65  ? 9.449   -24.379 1.278   1.00 0.00 ? 65  SER B N    1  
ATOM 3440   C CA   . SER B 2 65  ? 8.587   -25.425 1.808   1.00 0.00 ? 65  SER B CA   1  
ATOM 3441   C C    . SER B 2 65  ? 7.741   -24.900 2.962   1.00 0.00 ? 65  SER B C    1  
ATOM 3442   O O    . SER B 2 65  ? 7.923   -23.770 3.417   1.00 0.00 ? 65  SER B O    1  
ATOM 3443   C CB   . SER B 2 65  ? 9.423   -26.621 2.279   1.00 0.00 ? 65  SER B CB   1  
ATOM 3444   O OG   . SER B 2 65  ? 10.066  -27.257 1.187   1.00 0.00 ? 65  SER B OG   1  
ATOM 3445   H H    . SER B 2 65  ? 9.891   -23.764 1.909   1.00 0.00 ? 65  SER B H    1  
ATOM 3446   H HA   . SER B 2 65  ? 7.923   -25.757 1.010   1.00 0.00 ? 65  SER B HA   1  
ATOM 3447   H HB2  . SER B 2 65  ? 10.179  -26.273 2.983   1.00 0.00 ? 65  SER B HB2  1  
ATOM 3448   H HB3  . SER B 2 65  ? 8.769   -27.340 2.774   1.00 0.00 ? 65  SER B HB3  1  
ATOM 3449   H HG   . SER B 2 65  ? 10.959  -27.515 1.449   1.00 0.00 ? 65  SER B HG   1  
ATOM 3450   N N    . GLY B 2 66  ? 6.810   -25.721 3.424   1.00 0.00 ? 66  GLY B N    1  
ATOM 3451   C CA   . GLY B 2 66  ? 5.960   -25.332 4.524   1.00 0.00 ? 66  GLY B CA   1  
ATOM 3452   C C    . GLY B 2 66  ? 4.500   -25.316 4.136   1.00 0.00 ? 66  GLY B C    1  
ATOM 3453   O O    . GLY B 2 66  ? 4.164   -25.190 2.956   1.00 0.00 ? 66  GLY B O    1  
ATOM 3454   H H    . GLY B 2 66  ? 6.676   -26.592 2.990   1.00 0.00 ? 66  GLY B H    1  
ATOM 3455   H HA2  . GLY B 2 66  ? 6.100   -26.039 5.343   1.00 0.00 ? 66  GLY B HA2  1  
ATOM 3456   H HA3  . GLY B 2 66  ? 6.248   -24.335 4.856   1.00 0.00 ? 66  GLY B HA3  1  
ATOM 3457   N N    . SER B 2 67  ? 3.640   -25.453 5.128   1.00 0.00 ? 67  SER B N    1  
ATOM 3458   C CA   . SER B 2 67  ? 2.205   -25.450 4.914   1.00 0.00 ? 67  SER B CA   1  
ATOM 3459   C C    . SER B 2 67  ? 1.471   -25.219 6.231   1.00 0.00 ? 67  SER B C    1  
ATOM 3460   O O    . SER B 2 67  ? 1.906   -25.685 7.289   1.00 0.00 ? 67  SER B O    1  
ATOM 3461   C CB   . SER B 2 67  ? 1.739   -26.756 4.256   1.00 0.00 ? 67  SER B CB   1  
ATOM 3462   O OG   . SER B 2 67  ? 2.729   -27.770 4.353   1.00 0.00 ? 67  SER B OG   1  
ATOM 3463   H H    . SER B 2 67  ? 3.984   -25.541 6.043   1.00 0.00 ? 67  SER B H    1  
ATOM 3464   H HA   . SER B 2 67  ? 1.968   -24.627 4.240   1.00 0.00 ? 67  SER B HA   1  
ATOM 3465   H HB2  . SER B 2 67  ? 0.831   -27.099 4.753   1.00 0.00 ? 67  SER B HB2  1  
ATOM 3466   H HB3  . SER B 2 67  ? 1.528   -26.567 3.203   1.00 0.00 ? 67  SER B HB3  1  
ATOM 3467   H HG   . SER B 2 67  ? 3.401   -27.494 4.992   1.00 0.00 ? 67  SER B HG   1  
ATOM 3468   N N    . GLY B 2 68  ? 0.387   -24.464 6.169   1.00 0.00 ? 68  GLY B N    1  
ATOM 3469   C CA   . GLY B 2 68  ? -0.393  -24.191 7.357   1.00 0.00 ? 68  GLY B CA   1  
ATOM 3470   C C    . GLY B 2 68  ? 0.062   -22.940 8.074   1.00 0.00 ? 68  GLY B C    1  
ATOM 3471   O O    . GLY B 2 68  ? -0.102  -21.831 7.564   1.00 0.00 ? 68  GLY B O    1  
ATOM 3472   H H    . GLY B 2 68  ? 0.132   -24.060 5.309   1.00 0.00 ? 68  GLY B H    1  
ATOM 3473   H HA2  . GLY B 2 68  ? -1.438  -24.070 7.069   1.00 0.00 ? 68  GLY B HA2  1  
ATOM 3474   H HA3  . GLY B 2 68  ? -0.303  -25.038 8.037   1.00 0.00 ? 68  GLY B HA3  1  
ATOM 3475   N N    . THR B 2 69  ? 0.616   -23.119 9.265   1.00 0.00 ? 69  THR B N    1  
ATOM 3476   C CA   . THR B 2 69  ? 1.096   -22.002 10.069  1.00 0.00 ? 69  THR B CA   1  
ATOM 3477   C C    . THR B 2 69  ? 2.616   -22.039 10.224  1.00 0.00 ? 69  THR B C    1  
ATOM 3478   O O    . THR B 2 69  ? 3.191   -21.262 10.986  1.00 0.00 ? 69  THR B O    1  
ATOM 3479   C CB   . THR B 2 69  ? 0.450   -22.023 11.467  1.00 0.00 ? 69  THR B CB   1  
ATOM 3480   O OG1  . THR B 2 69  ? -0.709  -22.872 11.444  1.00 0.00 ? 69  THR B OG1  1  
ATOM 3481   C CG2  . THR B 2 69  ? 0.037   -20.620 11.880  1.00 0.00 ? 69  THR B CG2  1  
ATOM 3482   H H    . THR B 2 69  ? 0.680   -24.027 9.627   1.00 0.00 ? 69  THR B H    1  
ATOM 3483   H HA   . THR B 2 69  ? 0.817   -21.076 9.566   1.00 0.00 ? 69  THR B HA   1  
ATOM 3484   H HB   . THR B 2 69  ? 1.169   -22.412 12.188  1.00 0.00 ? 69  THR B HB   1  
ATOM 3485   H HG1  . THR B 2 69  ? -1.077  -22.929 12.335  1.00 0.00 ? 69  THR B HG1  1  
ATOM 3486   H HG21 . THR B 2 69  ? -0.684  -20.229 11.163  1.00 0.00 ? 69  THR B HG21 1  
ATOM 3487   H HG22 . THR B 2 69  ? -0.417  -20.648 12.871  1.00 0.00 ? 69  THR B HG22 1  
ATOM 3488   H HG23 . THR B 2 69  ? 0.915   -19.975 11.902  1.00 0.00 ? 69  THR B HG23 1  
ATOM 3489   N N    . GLN B 2 70  ? 3.263   -22.931 9.485   1.00 0.00 ? 70  GLN B N    1  
ATOM 3490   C CA   . GLN B 2 70  ? 4.712   -23.068 9.554   1.00 0.00 ? 70  GLN B CA   1  
ATOM 3491   C C    . GLN B 2 70  ? 5.314   -23.278 8.177   1.00 0.00 ? 70  GLN B C    1  
ATOM 3492   O O    . GLN B 2 70  ? 4.952   -24.213 7.464   1.00 0.00 ? 70  GLN B O    1  
ATOM 3493   C CB   . GLN B 2 70  ? 5.120   -24.200 10.496  1.00 0.00 ? 70  GLN B CB   1  
ATOM 3494   C CG   . GLN B 2 70  ? 5.680   -23.715 11.822  1.00 0.00 ? 70  GLN B CG   1  
ATOM 3495   C CD   . GLN B 2 70  ? 6.267   -24.832 12.658  1.00 0.00 ? 70  GLN B CD   1  
ATOM 3496   O OE1  . GLN B 2 70  ? 5.571   -25.461 13.455  1.00 0.00 ? 70  GLN B OE1  1  
ATOM 3497   N NE2  . GLN B 2 70  ? 7.553   -25.086 12.487  1.00 0.00 ? 70  GLN B NE2  1  
ATOM 3498   H H    . GLN B 2 70  ? 2.758   -23.482 8.854   1.00 0.00 ? 70  GLN B H    1  
ATOM 3499   H HA   . GLN B 2 70  ? 5.109   -22.136 9.957   1.00 0.00 ? 70  GLN B HA   1  
ATOM 3500   H HB2  . GLN B 2 70  ? 4.243   -24.815 10.697  1.00 0.00 ? 70  GLN B HB2  1  
ATOM 3501   H HB3  . GLN B 2 70  ? 5.881   -24.803 10.001  1.00 0.00 ? 70  GLN B HB3  1  
ATOM 3502   H HG2  . GLN B 2 70  ? 6.460   -22.980 11.624  1.00 0.00 ? 70  GLN B HG2  1  
ATOM 3503   H HG3  . GLN B 2 70  ? 4.877   -23.241 12.387  1.00 0.00 ? 70  GLN B HG3  1  
ATOM 3504   H HE21 . GLN B 2 70  ? 8.048   -24.550 11.835  1.00 0.00 ? 70  GLN B HE21 1  
ATOM 3505   H HE22 . GLN B 2 70  ? 7.962   -25.799 13.027  1.00 0.00 ? 70  GLN B HE22 1  
ATOM 3506   N N    . PHE B 2 71  ? 6.218   -22.386 7.805   1.00 0.00 ? 71  PHE B N    1  
ATOM 3507   C CA   . PHE B 2 71  ? 6.888   -22.455 6.517   1.00 0.00 ? 71  PHE B CA   1  
ATOM 3508   C C    . PHE B 2 71  ? 8.398   -22.470 6.717   1.00 0.00 ? 71  PHE B C    1  
ATOM 3509   O O    . PHE B 2 71  ? 8.894   -22.073 7.773   1.00 0.00 ? 71  PHE B O    1  
ATOM 3510   C CB   . PHE B 2 71  ? 6.464   -21.281 5.632   1.00 0.00 ? 71  PHE B CB   1  
ATOM 3511   C CG   . PHE B 2 71  ? 5.004   -21.295 5.275   1.00 0.00 ? 71  PHE B CG   1  
ATOM 3512   C CD1  . PHE B 2 71  ? 4.058   -20.773 6.143   1.00 0.00 ? 71  PHE B CD1  1  
ATOM 3513   C CD2  . PHE B 2 71  ? 4.575   -21.836 4.076   1.00 0.00 ? 71  PHE B CD2  1  
ATOM 3514   C CE1  . PHE B 2 71  ? 2.715   -20.788 5.823   1.00 0.00 ? 71  PHE B CE1  1  
ATOM 3515   C CE2  . PHE B 2 71  ? 3.233   -21.856 3.746   1.00 0.00 ? 71  PHE B CE2  1  
ATOM 3516   C CZ   . PHE B 2 71  ? 2.300   -21.331 4.621   1.00 0.00 ? 71  PHE B CZ   1  
ATOM 3517   H H    . PHE B 2 71  ? 6.446   -21.651 8.419   1.00 0.00 ? 71  PHE B H    1  
ATOM 3518   H HA   . PHE B 2 71  ? 6.594   -23.382 6.024   1.00 0.00 ? 71  PHE B HA   1  
ATOM 3519   H HB2  . PHE B 2 71  ? 6.685   -20.352 6.157   1.00 0.00 ? 71  PHE B HB2  1  
ATOM 3520   H HB3  . PHE B 2 71  ? 7.048   -21.310 4.711   1.00 0.00 ? 71  PHE B HB3  1  
ATOM 3521   H HD1  . PHE B 2 71  ? 4.376   -20.349 7.084   1.00 0.00 ? 71  PHE B HD1  1  
ATOM 3522   H HD2  . PHE B 2 71  ? 5.299   -22.247 3.388   1.00 0.00 ? 71  PHE B HD2  1  
ATOM 3523   H HE1  . PHE B 2 71  ? 1.990   -20.377 6.510   1.00 0.00 ? 71  PHE B HE1  1  
ATOM 3524   H HE2  . PHE B 2 71  ? 2.913   -22.281 2.806   1.00 0.00 ? 71  PHE B HE2  1  
ATOM 3525   H HZ   . PHE B 2 71  ? 1.250   -21.346 4.367   1.00 0.00 ? 71  PHE B HZ   1  
ATOM 3526   N N    . THR B 2 72  ? 9.126   -22.937 5.718   1.00 0.00 ? 72  THR B N    1  
ATOM 3527   C CA   . THR B 2 72  ? 10.573  -23.022 5.810   1.00 0.00 ? 72  THR B CA   1  
ATOM 3528   C C    . THR B 2 72  ? 11.232  -22.812 4.448   1.00 0.00 ? 72  THR B C    1  
ATOM 3529   O O    . THR B 2 72  ? 10.767  -23.330 3.434   1.00 0.00 ? 72  THR B O    1  
ATOM 3530   C CB   . THR B 2 72  ? 10.992  -24.407 6.350   1.00 0.00 ? 72  THR B CB   1  
ATOM 3531   O OG1  . THR B 2 72  ? 10.060  -24.831 7.351   1.00 0.00 ? 72  THR B OG1  1  
ATOM 3532   C CG2  . THR B 2 72  ? 12.382  -24.357 6.961   1.00 0.00 ? 72  THR B CG2  1  
ATOM 3533   H H    . THR B 2 72  ? 8.679   -23.230 4.888   1.00 0.00 ? 72  THR B H    1  
ATOM 3534   H HA   . THR B 2 72  ? 10.921  -22.250 6.496   1.00 0.00 ? 72  THR B HA   1  
ATOM 3535   H HB   . THR B 2 72  ? 10.990  -25.123 5.528   1.00 0.00 ? 72  THR B HB   1  
ATOM 3536   H HG1  . THR B 2 72  ? 9.696   -24.056 7.795   1.00 0.00 ? 72  THR B HG1  1  
ATOM 3537   H HG21 . THR B 2 72  ? 12.389  -23.644 7.786   1.00 0.00 ? 72  THR B HG21 1  
ATOM 3538   H HG22 . THR B 2 72  ? 12.660  -25.343 7.333   1.00 0.00 ? 72  THR B HG22 1  
ATOM 3539   H HG23 . THR B 2 72  ? 13.099  -24.042 6.203   1.00 0.00 ? 72  THR B HG23 1  
ATOM 3540   N N    . LEU B 2 73  ? 12.316  -22.052 4.429   1.00 0.00 ? 73  LEU B N    1  
ATOM 3541   C CA   . LEU B 2 73  ? 13.054  -21.801 3.203   1.00 0.00 ? 73  LEU B CA   1  
ATOM 3542   C C    . LEU B 2 73  ? 14.276  -22.706 3.210   1.00 0.00 ? 73  LEU B C    1  
ATOM 3543   O O    . LEU B 2 73  ? 14.895  -22.901 4.259   1.00 0.00 ? 73  LEU B O    1  
ATOM 3544   C CB   . LEU B 2 73  ? 13.486  -20.333 3.119   1.00 0.00 ? 73  LEU B CB   1  
ATOM 3545   C CG   . LEU B 2 73  ? 14.144  -19.895 1.807   1.00 0.00 ? 73  LEU B CG   1  
ATOM 3546   C CD1  . LEU B 2 73  ? 13.152  -19.949 0.657   1.00 0.00 ? 73  LEU B CD1  1  
ATOM 3547   C CD2  . LEU B 2 73  ? 14.736  -18.501 1.942   1.00 0.00 ? 73  LEU B CD2  1  
ATOM 3548   H H    . LEU B 2 73  ? 12.652  -21.669 5.272   1.00 0.00 ? 73  LEU B H    1  
ATOM 3549   H HA   . LEU B 2 73  ? 12.425  -22.038 2.345   1.00 0.00 ? 73  LEU B HA   1  
ATOM 3550   H HB2  . LEU B 2 73  ? 12.599  -19.717 3.269   1.00 0.00 ? 73  LEU B HB2  1  
ATOM 3551   H HB3  . LEU B 2 73  ? 14.196  -20.149 3.926   1.00 0.00 ? 73  LEU B HB3  1  
ATOM 3552   H HG   . LEU B 2 73  ? 14.956  -20.588 1.587   1.00 0.00 ? 73  LEU B HG   1  
ATOM 3553   H HD11 . LEU B 2 73  ? 13.643  -19.658 -0.271  1.00 0.00 ? 73  LEU B HD11 1  
ATOM 3554   H HD12 . LEU B 2 73  ? 12.767  -20.964 0.559   1.00 0.00 ? 73  LEU B HD12 1  
ATOM 3555   H HD13 . LEU B 2 73  ? 12.327  -19.266 0.858   1.00 0.00 ? 73  LEU B HD13 1  
ATOM 3556   H HD21 . LEU B 2 73  ? 15.468  -18.495 2.750   1.00 0.00 ? 73  LEU B HD21 1  
ATOM 3557   H HD22 . LEU B 2 73  ? 15.224  -18.214 1.011   1.00 0.00 ? 73  LEU B HD22 1  
ATOM 3558   H HD23 . LEU B 2 73  ? 13.941  -17.790 2.167   1.00 0.00 ? 73  LEU B HD23 1  
ATOM 3559   N N    . THR B 2 74  ? 14.616  -23.275 2.068   1.00 0.00 ? 74  THR B N    1  
ATOM 3560   C CA   . THR B 2 74  ? 15.750  -24.172 1.997   1.00 0.00 ? 74  THR B CA   1  
ATOM 3561   C C    . THR B 2 74  ? 16.688  -23.836 0.842   1.00 0.00 ? 74  THR B C    1  
ATOM 3562   O O    . THR B 2 74  ? 16.286  -23.814 -0.324  1.00 0.00 ? 74  THR B O    1  
ATOM 3563   C CB   . THR B 2 74  ? 15.279  -25.630 1.872   1.00 0.00 ? 74  THR B CB   1  
ATOM 3564   O OG1  . THR B 2 74  ? 14.236  -25.865 2.829   1.00 0.00 ? 74  THR B OG1  1  
ATOM 3565   C CG2  . THR B 2 74  ? 16.428  -26.587 2.145   1.00 0.00 ? 74  THR B CG2  1  
ATOM 3566   H H    . THR B 2 74  ? 14.094  -23.087 1.253   1.00 0.00 ? 74  THR B H    1  
ATOM 3567   H HA   . THR B 2 74  ? 16.309  -24.070 2.927   1.00 0.00 ? 74  THR B HA   1  
ATOM 3568   H HB   . THR B 2 74  ? 14.898  -25.802 0.866   1.00 0.00 ? 74  THR B HB   1  
ATOM 3569   H HG1  . THR B 2 74  ? 14.170  -25.105 3.420   1.00 0.00 ? 74  THR B HG1  1  
ATOM 3570   H HG21 . THR B 2 74  ? 16.809  -26.419 3.153   1.00 0.00 ? 74  THR B HG21 1  
ATOM 3571   H HG22 . THR B 2 74  ? 16.079  -27.616 2.057   1.00 0.00 ? 74  THR B HG22 1  
ATOM 3572   H HG23 . THR B 2 74  ? 17.225  -26.412 1.422   1.00 0.00 ? 74  THR B HG23 1  
ATOM 3573   N N    . ILE B 2 75  ? 17.937  -23.554 1.181   1.00 0.00 ? 75  ILE B N    1  
ATOM 3574   C CA   . ILE B 2 75  ? 18.949  -23.251 0.186   1.00 0.00 ? 75  ILE B CA   1  
ATOM 3575   C C    . ILE B 2 75  ? 19.795  -24.500 -0.046  1.00 0.00 ? 75  ILE B C    1  
ATOM 3576   O O    . ILE B 2 75  ? 20.592  -24.883 0.811   1.00 0.00 ? 75  ILE B O    1  
ATOM 3577   C CB   . ILE B 2 75  ? 19.856  -22.080 0.624   1.00 0.00 ? 75  ILE B CB   1  
ATOM 3578   C CG1  . ILE B 2 75  ? 19.002  -20.870 1.020   1.00 0.00 ? 75  ILE B CG1  1  
ATOM 3579   C CG2  . ILE B 2 75  ? 20.822  -21.711 -0.495  1.00 0.00 ? 75  ILE B CG2  1  
ATOM 3580   C CD1  . ILE B 2 75  ? 19.795  -19.710 1.584   1.00 0.00 ? 75  ILE B CD1  1  
ATOM 3581   H H    . ILE B 2 75  ? 18.188  -23.552 2.133   1.00 0.00 ? 75  ILE B H    1  
ATOM 3582   H HA   . ILE B 2 75  ? 18.451  -22.976 -0.744  1.00 0.00 ? 75  ILE B HA   1  
ATOM 3583   H HB   . ILE B 2 75  ? 20.435  -22.395 1.492   1.00 0.00 ? 75  ILE B HB   1  
ATOM 3584   H HG12 . ILE B 2 75  ? 18.469  -20.522 0.135   1.00 0.00 ? 75  ILE B HG12 1  
ATOM 3585   H HG13 . ILE B 2 75  ? 18.282  -21.190 1.774   1.00 0.00 ? 75  ILE B HG13 1  
ATOM 3586   H HG21 . ILE B 2 75  ? 21.468  -20.896 -0.169  1.00 0.00 ? 75  ILE B HG21 1  
ATOM 3587   H HG22 . ILE B 2 75  ? 21.432  -22.578 -0.749  1.00 0.00 ? 75  ILE B HG22 1  
ATOM 3588   H HG23 . ILE B 2 75  ? 20.257  -21.395 -1.373  1.00 0.00 ? 75  ILE B HG23 1  
ATOM 3589   H HD11 . ILE B 2 75  ? 20.514  -19.370 0.838   1.00 0.00 ? 75  ILE B HD11 1  
ATOM 3590   H HD12 . ILE B 2 75  ? 19.134  -18.883 1.844   1.00 0.00 ? 75  ILE B HD12 1  
ATOM 3591   H HD13 . ILE B 2 75  ? 20.325  -20.037 2.478   1.00 0.00 ? 75  ILE B HD13 1  
ATOM 3592   N N    . SER B 2 76  ? 19.577  -25.141 -1.192  1.00 0.00 ? 76  SER B N    1  
ATOM 3593   C CA   . SER B 2 76  ? 20.288  -26.364 -1.560  1.00 0.00 ? 76  SER B CA   1  
ATOM 3594   C C    . SER B 2 76  ? 21.808  -26.229 -1.428  1.00 0.00 ? 76  SER B C    1  
ATOM 3595   O O    . SER B 2 76  ? 22.483  -27.160 -0.982  1.00 0.00 ? 76  SER B O    1  
ATOM 3596   C CB   . SER B 2 76  ? 19.906  -26.795 -2.976  1.00 0.00 ? 76  SER B CB   1  
ATOM 3597   O OG   . SER B 2 76  ? 18.503  -26.682 -3.173  1.00 0.00 ? 76  SER B OG   1  
ATOM 3598   H H    . SER B 2 76  ? 18.898  -24.792 -1.812  1.00 0.00 ? 76  SER B H    1  
ATOM 3599   H HA   . SER B 2 76  ? 19.966  -27.146 -0.872  1.00 0.00 ? 76  SER B HA   1  
ATOM 3600   H HB2  . SER B 2 76  ? 20.420  -26.158 -3.695  1.00 0.00 ? 76  SER B HB2  1  
ATOM 3601   H HB3  . SER B 2 76  ? 20.206  -27.831 -3.129  1.00 0.00 ? 76  SER B HB3  1  
ATOM 3602   H HG   . SER B 2 76  ? 18.331  -26.399 -4.077  1.00 0.00 ? 76  SER B HG   1  
ATOM 3603   N N    . SER B 2 77  ? 22.346  -25.085 -1.815  1.00 0.00 ? 77  SER B N    1  
ATOM 3604   C CA   . SER B 2 77  ? 23.779  -24.849 -1.726  1.00 0.00 ? 77  SER B CA   1  
ATOM 3605   C C    . SER B 2 77  ? 24.052  -23.361 -1.563  1.00 0.00 ? 77  SER B C    1  
ATOM 3606   O O    . SER B 2 77  ? 23.924  -22.591 -2.512  1.00 0.00 ? 77  SER B O    1  
ATOM 3607   C CB   . SER B 2 77  ? 24.494  -25.399 -2.963  1.00 0.00 ? 77  SER B CB   1  
ATOM 3608   O OG   . SER B 2 77  ? 24.270  -26.794 -3.097  1.00 0.00 ? 77  SER B OG   1  
ATOM 3609   H H    . SER B 2 77  ? 21.776  -24.365 -2.156  1.00 0.00 ? 77  SER B H    1  
ATOM 3610   H HA   . SER B 2 77  ? 24.160  -25.371 -0.848  1.00 0.00 ? 77  SER B HA   1  
ATOM 3611   H HB2  . SER B 2 77  ? 24.116  -24.890 -3.850  1.00 0.00 ? 77  SER B HB2  1  
ATOM 3612   H HB3  . SER B 2 77  ? 25.564  -25.217 -2.868  1.00 0.00 ? 77  SER B HB3  1  
ATOM 3613   H HG   . SER B 2 77  ? 23.767  -27.108 -2.333  1.00 0.00 ? 77  SER B HG   1  
ATOM 3614   N N    . LEU B 2 78  ? 24.404  -22.965 -0.348  1.00 0.00 ? 78  LEU B N    1  
ATOM 3615   C CA   . LEU B 2 78  ? 24.681  -21.566 -0.043  1.00 0.00 ? 78  LEU B CA   1  
ATOM 3616   C C    . LEU B 2 78  ? 25.937  -21.061 -0.741  1.00 0.00 ? 78  LEU B C    1  
ATOM 3617   O O    . LEU B 2 78  ? 27.023  -21.623 -0.574  1.00 0.00 ? 78  LEU B O    1  
ATOM 3618   C CB   . LEU B 2 78  ? 24.817  -21.372 1.466   1.00 0.00 ? 78  LEU B CB   1  
ATOM 3619   C CG   . LEU B 2 78  ? 25.211  -19.968 1.928   1.00 0.00 ? 78  LEU B CG   1  
ATOM 3620   C CD1  . LEU B 2 78  ? 24.035  -19.012 1.814   1.00 0.00 ? 78  LEU B CD1  1  
ATOM 3621   C CD2  . LEU B 2 78  ? 25.754  -20.000 3.347   1.00 0.00 ? 78  LEU B CD2  1  
ATOM 3622   H H    . LEU B 2 78  ? 24.475  -23.632 0.367   1.00 0.00 ? 78  LEU B H    1  
ATOM 3623   H HA   . LEU B 2 78  ? 23.835  -20.975 -0.394  1.00 0.00 ? 78  LEU B HA   1  
ATOM 3624   H HB2  . LEU B 2 78  ? 23.857  -21.615 1.922   1.00 0.00 ? 78  LEU B HB2  1  
ATOM 3625   H HB3  . LEU B 2 78  ? 25.576  -22.066 1.825   1.00 0.00 ? 78  LEU B HB3  1  
ATOM 3626   H HG   . LEU B 2 78  ? 26.004  -19.606 1.272   1.00 0.00 ? 78  LEU B HG   1  
ATOM 3627   H HD11 . LEU B 2 78  ? 24.339  -18.011 2.121   1.00 0.00 ? 78  LEU B HD11 1  
ATOM 3628   H HD12 . LEU B 2 78  ? 23.690  -18.984 0.780   1.00 0.00 ? 78  LEU B HD12 1  
ATOM 3629   H HD13 . LEU B 2 78  ? 23.225  -19.357 2.457   1.00 0.00 ? 78  LEU B HD13 1  
ATOM 3630   H HD21 . LEU B 2 78  ? 26.616  -20.665 3.390   1.00 0.00 ? 78  LEU B HD21 1  
ATOM 3631   H HD22 . LEU B 2 78  ? 26.056  -18.998 3.651   1.00 0.00 ? 78  LEU B HD22 1  
ATOM 3632   H HD23 . LEU B 2 78  ? 24.980  -20.364 4.022   1.00 0.00 ? 78  LEU B HD23 1  
ATOM 3633   N N    . GLN B 2 79  ? 25.779  -20.010 -1.531  1.00 0.00 ? 79  GLN B N    1  
ATOM 3634   C CA   . GLN B 2 79  ? 26.892  -19.400 -2.239  1.00 0.00 ? 79  GLN B CA   1  
ATOM 3635   C C    . GLN B 2 79  ? 27.259  -18.065 -1.584  1.00 0.00 ? 79  GLN B C    1  
ATOM 3636   O O    . GLN B 2 79  ? 26.427  -17.450 -0.922  1.00 0.00 ? 79  GLN B O    1  
ATOM 3637   C CB   . GLN B 2 79  ? 26.538  -19.201 -3.716  1.00 0.00 ? 79  GLN B CB   1  
ATOM 3638   C CG   . GLN B 2 79  ? 26.550  -20.490 -4.524  1.00 0.00 ? 79  GLN B CG   1  
ATOM 3639   C CD   . GLN B 2 79  ? 26.107  -20.308 -5.966  1.00 0.00 ? 79  GLN B CD   1  
ATOM 3640   O OE1  . GLN B 2 79  ? 25.568  -21.229 -6.580  1.00 0.00 ? 79  GLN B OE1  1  
ATOM 3641   N NE2  . GLN B 2 79  ? 26.338  -19.125 -6.522  1.00 0.00 ? 79  GLN B NE2  1  
ATOM 3642   H H    . GLN B 2 79  ? 24.872  -19.630 -1.651  1.00 0.00 ? 79  GLN B H    1  
ATOM 3643   H HA   . GLN B 2 79  ? 27.751  -20.068 -2.175  1.00 0.00 ? 79  GLN B HA   1  
ATOM 3644   H HB2  . GLN B 2 79  ? 25.540  -18.766 -3.776  1.00 0.00 ? 79  GLN B HB2  1  
ATOM 3645   H HB3  . GLN B 2 79  ? 27.261  -18.513 -4.155  1.00 0.00 ? 79  GLN B HB3  1  
ATOM 3646   H HG2  . GLN B 2 79  ? 27.563  -20.891 -4.521  1.00 0.00 ? 79  GLN B HG2  1  
ATOM 3647   H HG3  . GLN B 2 79  ? 25.880  -21.205 -4.044  1.00 0.00 ? 79  GLN B HG3  1  
ATOM 3648   H HE21 . GLN B 2 79  ? 26.777  -18.439 -5.980  1.00 0.00 ? 79  GLN B HE21 1  
ATOM 3649   H HE22 . GLN B 2 79  ? 26.055  -18.986 -7.451  1.00 0.00 ? 79  GLN B HE22 1  
ATOM 3650   N N    . PRO B 2 80  ? 28.512  -17.600 -1.756  1.00 0.00 ? 80  PRO B N    1  
ATOM 3651   C CA   . PRO B 2 80  ? 28.988  -16.333 -1.169  1.00 0.00 ? 80  PRO B CA   1  
ATOM 3652   C C    . PRO B 2 80  ? 28.165  -15.112 -1.597  1.00 0.00 ? 80  PRO B C    1  
ATOM 3653   O O    . PRO B 2 80  ? 28.184  -14.075 -0.934  1.00 0.00 ? 80  PRO B O    1  
ATOM 3654   C CB   . PRO B 2 80  ? 30.425  -16.212 -1.690  1.00 0.00 ? 80  PRO B CB   1  
ATOM 3655   C CG   . PRO B 2 80  ? 30.824  -17.606 -2.028  1.00 0.00 ? 80  PRO B CG   1  
ATOM 3656   C CD   . PRO B 2 80  ? 29.575  -18.281 -2.513  1.00 0.00 ? 80  PRO B CD   1  
ATOM 3657   H HA   . PRO B 2 80  ? 28.981  -16.399 -0.081  1.00 0.00 ? 80  PRO B HA   1  
ATOM 3658   H HB2  . PRO B 2 80  ? 30.488  -15.550 -2.554  1.00 0.00 ? 80  PRO B HB2  1  
ATOM 3659   H HB3  . PRO B 2 80  ? 31.062  -15.853 -0.882  1.00 0.00 ? 80  PRO B HB3  1  
ATOM 3660   H HG2  . PRO B 2 80  ? 31.540  -17.571 -2.848  1.00 0.00 ? 80  PRO B HG2  1  
ATOM 3661   H HG3  . PRO B 2 80  ? 31.248  -18.122 -1.166  1.00 0.00 ? 80  PRO B HG3  1  
ATOM 3662   H HD2  . PRO B 2 80  ? 29.452  -18.160 -3.590  1.00 0.00 ? 80  PRO B HD2  1  
ATOM 3663   H HD3  . PRO B 2 80  ? 29.591  -19.338 -2.250  1.00 0.00 ? 80  PRO B HD3  1  
ATOM 3664   N N    . GLU B 2 81  ? 27.440  -15.239 -2.701  1.00 0.00 ? 81  GLU B N    1  
ATOM 3665   C CA   . GLU B 2 81  ? 26.622  -14.141 -3.201  1.00 0.00 ? 81  GLU B CA   1  
ATOM 3666   C C    . GLU B 2 81  ? 25.234  -14.153 -2.570  1.00 0.00 ? 81  GLU B C    1  
ATOM 3667   O O    . GLU B 2 81  ? 24.452  -13.219 -2.748  1.00 0.00 ? 81  GLU B O    1  
ATOM 3668   C CB   . GLU B 2 81  ? 26.505  -14.204 -4.726  1.00 0.00 ? 81  GLU B CB   1  
ATOM 3669   C CG   . GLU B 2 81  ? 25.729  -15.407 -5.242  1.00 0.00 ? 81  GLU B CG   1  
ATOM 3670   C CD   . GLU B 2 81  ? 24.714  -15.035 -6.306  1.00 0.00 ? 81  GLU B CD   1  
ATOM 3671   O OE1  . GLU B 2 81  ? 24.047  -13.987 -6.166  1.00 0.00 ? 81  GLU B OE1  1  
ATOM 3672   O OE2  . GLU B 2 81  ? 24.567  -15.804 -7.280  1.00 0.00 ? 81  GLU B OE2  1  
ATOM 3673   H H    . GLU B 2 81  ? 27.450  -16.089 -3.185  1.00 0.00 ? 81  GLU B H    1  
ATOM 3674   H HA   . GLU B 2 81  ? 27.114  -13.206 -2.933  1.00 0.00 ? 81  GLU B HA   1  
ATOM 3675   H HB2  . GLU B 2 81  ? 26.002  -13.300 -5.068  1.00 0.00 ? 81  GLU B HB2  1  
ATOM 3676   H HB3  . GLU B 2 81  ? 27.511  -14.241 -5.145  1.00 0.00 ? 81  GLU B HB3  1  
ATOM 3677   H HG2  . GLU B 2 81  ? 26.433  -16.123 -5.665  1.00 0.00 ? 81  GLU B HG2  1  
ATOM 3678   H HG3  . GLU B 2 81  ? 25.204  -15.870 -4.406  1.00 0.00 ? 81  GLU B HG3  1  
ATOM 3679   H HE2  . GLU B 2 81  ? 23.906  -15.512 -7.912  1.00 0.00 ? 81  GLU B HE2  1  
ATOM 3680   N N    . ASP B 2 82  ? 24.939  -15.199 -1.806  1.00 0.00 ? 82  ASP B N    1  
ATOM 3681   C CA   . ASP B 2 82  ? 23.633  -15.333 -1.164  1.00 0.00 ? 82  ASP B CA   1  
ATOM 3682   C C    . ASP B 2 82  ? 23.562  -14.542 0.132   1.00 0.00 ? 82  ASP B C    1  
ATOM 3683   O O    . ASP B 2 82  ? 22.577  -14.629 0.869   1.00 0.00 ? 82  ASP B O    1  
ATOM 3684   C CB   . ASP B 2 82  ? 23.288  -16.802 -0.913  1.00 0.00 ? 82  ASP B CB   1  
ATOM 3685   C CG   . ASP B 2 82  ? 23.128  -17.593 -2.195  1.00 0.00 ? 82  ASP B CG   1  
ATOM 3686   O OD1  . ASP B 2 82  ? 22.716  -17.004 -3.215  1.00 0.00 ? 82  ASP B OD1  1  
ATOM 3687   O OD2  . ASP B 2 82  ? 23.421  -18.808 -2.193  1.00 0.00 ? 82  ASP B OD2  1  
ATOM 3688   H H    . ASP B 2 82  ? 25.616  -15.897 -1.664  1.00 0.00 ? 82  ASP B H    1  
ATOM 3689   H HA   . ASP B 2 82  ? 22.889  -14.925 -1.849  1.00 0.00 ? 82  ASP B HA   1  
ATOM 3690   H HB2  . ASP B 2 82  ? 24.084  -17.253 -0.321  1.00 0.00 ? 82  ASP B HB2  1  
ATOM 3691   H HB3  . ASP B 2 82  ? 22.354  -16.852 -0.354  1.00 0.00 ? 82  ASP B HB3  1  
ATOM 3692   H HD2  . ASP B 2 82  ? 23.298  -19.244 -3.040  1.00 0.00 ? 82  ASP B HD2  1  
ATOM 3693   N N    . PHE B 2 83  ? 24.618  -13.788 0.416   1.00 0.00 ? 83  PHE B N    1  
ATOM 3694   C CA   . PHE B 2 83  ? 24.672  -12.957 1.610   1.00 0.00 ? 83  PHE B CA   1  
ATOM 3695   C C    . PHE B 2 83  ? 23.622  -11.855 1.510   1.00 0.00 ? 83  PHE B C    1  
ATOM 3696   O O    . PHE B 2 83  ? 23.769  -10.921 0.717   1.00 0.00 ? 83  PHE B O    1  
ATOM 3697   C CB   . PHE B 2 83  ? 26.071  -12.341 1.755   1.00 0.00 ? 83  PHE B CB   1  
ATOM 3698   C CG   . PHE B 2 83  ? 26.343  -11.718 3.098   1.00 0.00 ? 83  PHE B CG   1  
ATOM 3699   C CD1  . PHE B 2 83  ? 25.947  -10.417 3.370   1.00 0.00 ? 83  PHE B CD1  1  
ATOM 3700   C CD2  . PHE B 2 83  ? 26.999  -12.433 4.086   1.00 0.00 ? 83  PHE B CD2  1  
ATOM 3701   C CE1  . PHE B 2 83  ? 26.199  -9.843  4.601   1.00 0.00 ? 83  PHE B CE1  1  
ATOM 3702   C CE2  . PHE B 2 83  ? 27.256  -11.864 5.317   1.00 0.00 ? 83  PHE B CE2  1  
ATOM 3703   C CZ   . PHE B 2 83  ? 26.855  -10.568 5.576   1.00 0.00 ? 83  PHE B CZ   1  
ATOM 3704   H H    . PHE B 2 83  ? 25.380  -13.794 -0.197  1.00 0.00 ? 83  PHE B H    1  
ATOM 3705   H HA   . PHE B 2 83  ? 24.463  -13.575 2.484   1.00 0.00 ? 83  PHE B HA   1  
ATOM 3706   H HB2  . PHE B 2 83  ? 26.810  -13.123 1.583   1.00 0.00 ? 83  PHE B HB2  1  
ATOM 3707   H HB3  . PHE B 2 83  ? 26.189  -11.573 0.990   1.00 0.00 ? 83  PHE B HB3  1  
ATOM 3708   H HD1  . PHE B 2 83  ? 25.435  -9.845  2.610   1.00 0.00 ? 83  PHE B HD1  1  
ATOM 3709   H HD2  . PHE B 2 83  ? 27.313  -13.447 3.890   1.00 0.00 ? 83  PHE B HD2  1  
ATOM 3710   H HE1  . PHE B 2 83  ? 25.882  -8.830  4.800   1.00 0.00 ? 83  PHE B HE1  1  
ATOM 3711   H HE2  . PHE B 2 83  ? 27.770  -12.432 6.078   1.00 0.00 ? 83  PHE B HE2  1  
ATOM 3712   H HZ   . PHE B 2 83  ? 27.055  -10.122 6.540   1.00 0.00 ? 83  PHE B HZ   1  
ATOM 3713   N N    . ALA B 2 84  ? 22.580  -11.958 2.326   1.00 0.00 ? 84  ALA B N    1  
ATOM 3714   C CA   . ALA B 2 84  ? 21.490  -10.994 2.309   1.00 0.00 ? 84  ALA B CA   1  
ATOM 3715   C C    . ALA B 2 84  ? 20.552  -11.248 3.481   1.00 0.00 ? 84  ALA B C    1  
ATOM 3716   O O    . ALA B 2 84  ? 20.801  -12.130 4.307   1.00 0.00 ? 84  ALA B O    1  
ATOM 3717   C CB   . ALA B 2 84  ? 20.716  -11.114 1.001   1.00 0.00 ? 84  ALA B CB   1  
ATOM 3718   H H    . ALA B 2 84  ? 22.562  -12.679 2.986   1.00 0.00 ? 84  ALA B H    1  
ATOM 3719   H HA   . ALA B 2 84  ? 21.905  -9.989  2.391   1.00 0.00 ? 84  ALA B HA   1  
ATOM 3720   H HB1  . ALA B 2 84  ? 19.908  -10.382 0.986   1.00 0.00 ? 84  ALA B HB1  1  
ATOM 3721   H HB2  . ALA B 2 84  ? 21.388  -10.930 0.163   1.00 0.00 ? 84  ALA B HB2  1  
ATOM 3722   H HB3  . ALA B 2 84  ? 20.297  -12.117 0.918   1.00 0.00 ? 84  ALA B HB3  1  
ATOM 3723   N N    . ASN B 2 85  ? 19.473  -10.481 3.543   1.00 0.00 ? 85  ASN B N    1  
ATOM 3724   C CA   . ASN B 2 85  ? 18.480  -10.632 4.598   1.00 0.00 ? 85  ASN B CA   1  
ATOM 3725   C C    . ASN B 2 85  ? 17.196  -11.220 4.030   1.00 0.00 ? 85  ASN B C    1  
ATOM 3726   O O    . ASN B 2 85  ? 16.626  -10.706 3.065   1.00 0.00 ? 85  ASN B O    1  
ATOM 3727   C CB   . ASN B 2 85  ? 18.212  -9.317  5.352   1.00 0.00 ? 85  ASN B CB   1  
ATOM 3728   C CG   . ASN B 2 85  ? 17.776  -8.170  4.459   1.00 0.00 ? 85  ASN B CG   1  
ATOM 3729   O OD1  . ASN B 2 85  ? 18.202  -8.066  3.318   1.00 0.00 ? 85  ASN B OD1  1  
ATOM 3730   N ND2  . ASN B 2 85  ? 16.933  -7.290  4.980   1.00 0.00 ? 85  ASN B ND2  1  
ATOM 3731   H H    . ASN B 2 85  ? 19.326  -9.803  2.845   1.00 0.00 ? 85  ASN B H    1  
ATOM 3732   H HA   . ASN B 2 85  ? 18.881  -11.343 5.320   1.00 0.00 ? 85  ASN B HA   1  
ATOM 3733   H HB2  . ASN B 2 85  ? 17.429  -9.497  6.088   1.00 0.00 ? 85  ASN B HB2  1  
ATOM 3734   H HB3  . ASN B 2 85  ? 19.127  -9.022  5.866   1.00 0.00 ? 85  ASN B HB3  1  
ATOM 3735   H HD21 . ASN B 2 85  ? 16.638  -7.418  5.905   1.00 0.00 ? 85  ASN B HD21 1  
ATOM 3736   H HD22 . ASN B 2 85  ? 16.636  -6.545  4.410   1.00 0.00 ? 85  ASN B HD22 1  
ATOM 3737   N N    . TYR B 2 86  ? 16.765  -12.317 4.621   1.00 0.00 ? 86  TYR B N    1  
ATOM 3738   C CA   . TYR B 2 86  ? 15.568  -13.008 4.174   1.00 0.00 ? 86  TYR B CA   1  
ATOM 3739   C C    . TYR B 2 86  ? 14.373  -12.720 5.072   1.00 0.00 ? 86  TYR B C    1  
ATOM 3740   O O    . TYR B 2 86  ? 14.370  -13.056 6.256   1.00 0.00 ? 86  TYR B O    1  
ATOM 3741   C CB   . TYR B 2 86  ? 15.825  -14.511 4.050   1.00 0.00 ? 86  TYR B CB   1  
ATOM 3742   C CG   . TYR B 2 86  ? 16.847  -14.851 2.985   1.00 0.00 ? 86  TYR B CG   1  
ATOM 3743   C CD1  . TYR B 2 86  ? 18.209  -14.794 3.256   1.00 0.00 ? 86  TYR B CD1  1  
ATOM 3744   C CD2  . TYR B 2 86  ? 16.448  -15.215 1.706   1.00 0.00 ? 86  TYR B CD2  1  
ATOM 3745   C CE1  . TYR B 2 86  ? 19.144  -15.087 2.283   1.00 0.00 ? 86  TYR B CE1  1  
ATOM 3746   C CE2  . TYR B 2 86  ? 17.377  -15.515 0.729   1.00 0.00 ? 86  TYR B CE2  1  
ATOM 3747   C CZ   . TYR B 2 86  ? 18.723  -15.447 1.022   1.00 0.00 ? 86  TYR B CZ   1  
ATOM 3748   O OH   . TYR B 2 86  ? 19.649  -15.735 0.048   1.00 0.00 ? 86  TYR B OH   1  
ATOM 3749   H H    . TYR B 2 86  ? 17.278  -12.665 5.385   1.00 0.00 ? 86  TYR B H    1  
ATOM 3750   H HA   . TYR B 2 86  ? 15.329  -12.631 3.179   1.00 0.00 ? 86  TYR B HA   1  
ATOM 3751   H HB2  . TYR B 2 86  ? 16.181  -14.886 5.009   1.00 0.00 ? 86  TYR B HB2  1  
ATOM 3752   H HB3  . TYR B 2 86  ? 14.887  -15.008 3.806   1.00 0.00 ? 86  TYR B HB3  1  
ATOM 3753   H HD1  . TYR B 2 86  ? 18.542  -14.517 4.245   1.00 0.00 ? 86  TYR B HD1  1  
ATOM 3754   H HD2  . TYR B 2 86  ? 15.395  -15.266 1.472   1.00 0.00 ? 86  TYR B HD2  1  
ATOM 3755   H HE1  . TYR B 2 86  ? 20.199  -15.035 2.509   1.00 0.00 ? 86  TYR B HE1  1  
ATOM 3756   H HE2  . TYR B 2 86  ? 17.050  -15.800 -0.261  1.00 0.00 ? 86  TYR B HE2  1  
ATOM 3757   H HH   . TYR B 2 86  ? 20.500  -15.927 0.462   1.00 0.00 ? 86  TYR B HH   1  
ATOM 3758   N N    . TYR B 2 87  ? 13.366  -12.091 4.490   1.00 0.00 ? 87  TYR B N    1  
ATOM 3759   C CA   . TYR B 2 87  ? 12.150  -11.735 5.204   1.00 0.00 ? 87  TYR B CA   1  
ATOM 3760   C C    . TYR B 2 87  ? 10.959  -12.395 4.533   1.00 0.00 ? 87  TYR B C    1  
ATOM 3761   O O    . TYR B 2 87  ? 10.736  -12.180 3.339   1.00 0.00 ? 87  TYR B O    1  
ATOM 3762   C CB   . TYR B 2 87  ? 11.935  -10.222 5.101   1.00 0.00 ? 87  TYR B CB   1  
ATOM 3763   C CG   . TYR B 2 87  ? 12.620  -9.380  6.148   1.00 0.00 ? 87  TYR B CG   1  
ATOM 3764   C CD1  . TYR B 2 87  ? 13.970  -9.071  6.053   1.00 0.00 ? 87  TYR B CD1  1  
ATOM 3765   C CD2  . TYR B 2 87  ? 11.906  -8.874  7.223   1.00 0.00 ? 87  TYR B CD2  1  
ATOM 3766   C CE1  . TYR B 2 87  ? 14.589  -8.282  7.006   1.00 0.00 ? 87  TYR B CE1  1  
ATOM 3767   C CE2  . TYR B 2 87  ? 12.514  -8.084  8.176   1.00 0.00 ? 87  TYR B CE2  1  
ATOM 3768   C CZ   . TYR B 2 87  ? 13.855  -7.792  8.065   1.00 0.00 ? 87  TYR B CZ   1  
ATOM 3769   O OH   . TYR B 2 87  ? 14.462  -7.006  9.017   1.00 0.00 ? 87  TYR B OH   1  
ATOM 3770   H H    . TYR B 2 87  ? 13.438  -11.865 3.536   1.00 0.00 ? 87  TYR B H    1  
ATOM 3771   H HA   . TYR B 2 87  ? 12.224  -12.044 6.246   1.00 0.00 ? 87  TYR B HA   1  
ATOM 3772   H HB2  . TYR B 2 87  ? 12.292  -9.897  4.124   1.00 0.00 ? 87  TYR B HB2  1  
ATOM 3773   H HB3  . TYR B 2 87  ? 10.864  -10.029 5.165   1.00 0.00 ? 87  TYR B HB3  1  
ATOM 3774   H HD1  . TYR B 2 87  ? 14.545  -9.451  5.222   1.00 0.00 ? 87  TYR B HD1  1  
ATOM 3775   H HD2  . TYR B 2 87  ? 10.854  -9.102  7.316   1.00 0.00 ? 87  TYR B HD2  1  
ATOM 3776   H HE1  . TYR B 2 87  ? 15.641  -8.053  6.920   1.00 0.00 ? 87  TYR B HE1  1  
ATOM 3777   H HE2  . TYR B 2 87  ? 11.942  -7.696  9.005   1.00 0.00 ? 87  TYR B HE2  1  
ATOM 3778   H HH   . TYR B 2 87  ? 14.272  -7.365  9.893   1.00 0.00 ? 87  TYR B HH   1  
ATOM 3779   N N    . CYS B 2 88  ? 10.210  -13.223 5.253   1.00 0.00 ? 88  CYS B N    1  
ATOM 3780   C CA   . CYS B 2 88  ? 9.028   -13.834 4.671   1.00 0.00 ? 88  CYS B CA   1  
ATOM 3781   C C    . CYS B 2 88  ? 7.874   -12.832 4.667   1.00 0.00 ? 88  CYS B C    1  
ATOM 3782   O O    . CYS B 2 88  ? 8.058   -11.669 5.031   1.00 0.00 ? 88  CYS B O    1  
ATOM 3783   C CB   . CYS B 2 88  ? 8.649   -15.123 5.414   1.00 0.00 ? 88  CYS B CB   1  
ATOM 3784   S SG   . CYS B 2 88  ? 8.841   -15.055 7.227   1.00 0.00 ? 88  CYS B SG   1  
ATOM 3785   H H    . CYS B 2 88  ? 10.456  -13.486 6.163   1.00 0.00 ? 88  CYS B H    1  
ATOM 3786   H HA   . CYS B 2 88  ? 9.257   -14.096 3.638   1.00 0.00 ? 88  CYS B HA   1  
ATOM 3787   H HB2  . CYS B 2 88  ? 7.605   -15.342 5.189   1.00 0.00 ? 88  CYS B HB2  1  
ATOM 3788   H HB3  . CYS B 2 88  ? 9.281   -15.925 5.032   1.00 0.00 ? 88  CYS B HB3  1  
ATOM 3789   H HG   . CYS B 2 88  ? 8.434   -16.300 7.491   1.00 0.00 ? 88  CYS B HG   1  
ATOM 3790   N N    . GLN B 2 89  ? 6.680   -13.289 4.314   1.00 0.00 ? 89  GLN B N    1  
ATOM 3791   C CA   . GLN B 2 89  ? 5.522   -12.408 4.234   1.00 0.00 ? 89  GLN B CA   1  
ATOM 3792   C C    . GLN B 2 89  ? 4.257   -13.203 3.951   1.00 0.00 ? 89  GLN B C    1  
ATOM 3793   O O    . GLN B 2 89  ? 4.318   -14.317 3.433   1.00 0.00 ? 89  GLN B O    1  
ATOM 3794   C CB   . GLN B 2 89  ? 5.723   -11.363 3.128   1.00 0.00 ? 89  GLN B CB   1  
ATOM 3795   C CG   . GLN B 2 89  ? 4.707   -10.230 3.142   1.00 0.00 ? 89  GLN B CG   1  
ATOM 3796   C CD   . GLN B 2 89  ? 4.113   -9.959  1.774   1.00 0.00 ? 89  GLN B CD   1  
ATOM 3797   O OE1  . GLN B 2 89  ? 4.003   -10.860 0.943   1.00 0.00 ? 89  GLN B OE1  1  
ATOM 3798   N NE2  . GLN B 2 89  ? 3.721   -8.716  1.534   1.00 0.00 ? 89  GLN B NE2  1  
ATOM 3799   H H    . GLN B 2 89  ? 6.569   -14.253 4.171   1.00 0.00 ? 89  GLN B H    1  
ATOM 3800   H HA   . GLN B 2 89  ? 5.411   -11.895 5.190   1.00 0.00 ? 89  GLN B HA   1  
ATOM 3801   H HB2  . GLN B 2 89  ? 6.717   -10.931 3.243   1.00 0.00 ? 89  GLN B HB2  1  
ATOM 3802   H HB3  . GLN B 2 89  ? 5.656   -11.869 2.165   1.00 0.00 ? 89  GLN B HB3  1  
ATOM 3803   H HG2  . GLN B 2 89  ? 3.900   -10.492 3.828   1.00 0.00 ? 89  GLN B HG2  1  
ATOM 3804   H HG3  . GLN B 2 89  ? 5.198   -9.324  3.497   1.00 0.00 ? 89  GLN B HG3  1  
ATOM 3805   H HE21 . GLN B 2 89  ? 3.833   -8.049  2.242   1.00 0.00 ? 89  GLN B HE21 1  
ATOM 3806   H HE22 . GLN B 2 89  ? 3.335   -8.516  0.656   1.00 0.00 ? 89  GLN B HE22 1  
ATOM 3807   N N    . HIS B 2 90  ? 3.120   -12.639 4.327   1.00 0.00 ? 90  HIS B N    1  
ATOM 3808   C CA   . HIS B 2 90  ? 1.830   -13.271 4.088   1.00 0.00 ? 90  HIS B CA   1  
ATOM 3809   C C    . HIS B 2 90  ? 0.953   -12.381 3.215   1.00 0.00 ? 90  HIS B C    1  
ATOM 3810   O O    . HIS B 2 90  ? 0.947   -11.160 3.376   1.00 0.00 ? 90  HIS B O    1  
ATOM 3811   C CB   . HIS B 2 90  ? 1.114   -13.640 5.398   1.00 0.00 ? 90  HIS B CB   1  
ATOM 3812   C CG   . HIS B 2 90  ? 0.994   -12.534 6.411   1.00 0.00 ? 90  HIS B CG   1  
ATOM 3813   N ND1  . HIS B 2 90  ? 0.981   -11.192 6.084   1.00 0.00 ? 90  HIS B ND1  1  
ATOM 3814   C CD2  . HIS B 2 90  ? 0.877   -12.586 7.757   1.00 0.00 ? 90  HIS B CD2  1  
ATOM 3815   C CE1  . HIS B 2 90  ? 0.866   -10.475 7.186   1.00 0.00 ? 90  HIS B CE1  1  
ATOM 3816   N NE2  . HIS B 2 90  ? 0.800   -11.297 8.214   1.00 0.00 ? 90  HIS B NE2  1  
ATOM 3817   H H    . HIS B 2 90  ? 3.151   -11.773 4.781   1.00 0.00 ? 90  HIS B H    1  
ATOM 3818   H HA   . HIS B 2 90  ? 2.016   -14.196 3.543   1.00 0.00 ? 90  HIS B HA   1  
ATOM 3819   H HB2  . HIS B 2 90  ? 0.109   -13.980 5.150   1.00 0.00 ? 90  HIS B HB2  1  
ATOM 3820   H HB3  . HIS B 2 90  ? 1.661   -14.461 5.861   1.00 0.00 ? 90  HIS B HB3  1  
ATOM 3821   H HD1  . HIS B 2 90  ? 1.040   -10.822 5.170   1.00 0.00 ? 90  HIS B HD1  1  
ATOM 3822   H HD2  . HIS B 2 90  ? 0.850   -13.481 8.361   1.00 0.00 ? 90  HIS B HD2  1  
ATOM 3823   H HE1  . HIS B 2 90  ? 0.832   -9.397  7.237   1.00 0.00 ? 90  HIS B HE1  1  
ATOM 3824   H HE2  . HIS B 2 90  ? 0.851   -11.026 9.162   1.00 0.00 ? 90  HIS B HE2  1  
ATOM 3825   N N    . PHE B 2 91  ? 0.192   -13.000 2.328   1.00 0.00 ? 91  PHE B N    1  
ATOM 3826   C CA   . PHE B 2 91  ? -0.679  -12.256 1.423   1.00 0.00 ? 91  PHE B CA   1  
ATOM 3827   C C    . PHE B 2 91  ? -2.127  -12.733 1.498   1.00 0.00 ? 91  PHE B C    1  
ATOM 3828   O O    . PHE B 2 91  ? -2.817  -12.853 0.489   1.00 0.00 ? 91  PHE B O    1  
ATOM 3829   C CB   . PHE B 2 91  ? -0.144  -12.224 -0.018  1.00 0.00 ? 91  PHE B CB   1  
ATOM 3830   C CG   . PHE B 2 91  ? 0.133   -13.566 -0.645  1.00 0.00 ? 91  PHE B CG   1  
ATOM 3831   C CD1  . PHE B 2 91  ? 1.350   -14.199 -0.453  1.00 0.00 ? 91  PHE B CD1  1  
ATOM 3832   C CD2  . PHE B 2 91  ? -0.818  -14.184 -1.442  1.00 0.00 ? 91  PHE B CD2  1  
ATOM 3833   C CE1  . PHE B 2 91  ? 1.612   -15.423 -1.038  1.00 0.00 ? 91  PHE B CE1  1  
ATOM 3834   C CE2  . PHE B 2 91  ? -0.562  -15.407 -2.031  1.00 0.00 ? 91  PHE B CE2  1  
ATOM 3835   C CZ   . PHE B 2 91  ? 0.654   -16.027 -1.828  1.00 0.00 ? 91  PHE B CZ   1  
ATOM 3836   H H    . PHE B 2 91  ? 0.187   -13.983 2.321   1.00 0.00 ? 91  PHE B H    1  
ATOM 3837   H HA   . PHE B 2 91  ? -0.673  -11.225 1.776   1.00 0.00 ? 91  PHE B HA   1  
ATOM 3838   H HB2  . PHE B 2 91  ? -0.876  -11.707 -0.638  1.00 0.00 ? 91  PHE B HB2  1  
ATOM 3839   H HB3  . PHE B 2 91  ? 0.783   -11.652 -0.021  1.00 0.00 ? 91  PHE B HB3  1  
ATOM 3840   H HD1  . PHE B 2 91  ? 2.103   -13.730 0.162   1.00 0.00 ? 91  PHE B HD1  1  
ATOM 3841   H HD2  . PHE B 2 91  ? -1.772  -13.704 -1.604  1.00 0.00 ? 91  PHE B HD2  1  
ATOM 3842   H HE1  . PHE B 2 91  ? 2.564   -15.906 -0.877  1.00 0.00 ? 91  PHE B HE1  1  
ATOM 3843   H HE2  . PHE B 2 91  ? -1.313  -15.877 -2.649  1.00 0.00 ? 91  PHE B HE2  1  
ATOM 3844   H HZ   . PHE B 2 91  ? 0.856   -16.984 -2.287  1.00 0.00 ? 91  PHE B HZ   1  
ATOM 3845   N N    . TRP B 2 92  ? -2.578  -12.989 2.717   1.00 0.00 ? 92  TRP B N    1  
ATOM 3846   C CA   . TRP B 2 92  ? -3.941  -13.448 2.943   1.00 0.00 ? 92  TRP B CA   1  
ATOM 3847   C C    . TRP B 2 92  ? -4.832  -12.325 3.473   1.00 0.00 ? 92  TRP B C    1  
ATOM 3848   O O    . TRP B 2 92  ? -5.976  -12.174 3.048   1.00 0.00 ? 92  TRP B O    1  
ATOM 3849   C CB   . TRP B 2 92  ? -3.965  -14.650 3.893   1.00 0.00 ? 92  TRP B CB   1  
ATOM 3850   C CG   . TRP B 2 92  ? -5.350  -15.132 4.209   1.00 0.00 ? 92  TRP B CG   1  
ATOM 3851   C CD1  . TRP B 2 92  ? -6.272  -15.610 3.324   1.00 0.00 ? 92  TRP B CD1  1  
ATOM 3852   C CD2  . TRP B 2 92  ? -5.970  -15.179 5.499   1.00 0.00 ? 92  TRP B CD2  1  
ATOM 3853   N NE1  . TRP B 2 92  ? -7.430  -15.945 3.982   1.00 0.00 ? 92  TRP B NE1  1  
ATOM 3854   C CE2  . TRP B 2 92  ? -7.270  -15.691 5.319   1.00 0.00 ? 92  TRP B CE2  1  
ATOM 3855   C CE3  . TRP B 2 92  ? -5.552  -14.837 6.788   1.00 0.00 ? 92  TRP B CE3  1  
ATOM 3856   C CZ2  . TRP B 2 92  ? -8.153  -15.867 6.380   1.00 0.00 ? 92  TRP B CZ2  1  
ATOM 3857   C CZ3  . TRP B 2 92  ? -6.430  -15.015 7.839   1.00 0.00 ? 92  TRP B CZ3  1  
ATOM 3858   C CH2  . TRP B 2 92  ? -7.716  -15.526 7.629   1.00 0.00 ? 92  TRP B CH2  1  
ATOM 3859   H H    . TRP B 2 92  ? -1.976  -12.858 3.473   1.00 0.00 ? 92  TRP B H    1  
ATOM 3860   H HA   . TRP B 2 92  ? -4.343  -13.770 1.982   1.00 0.00 ? 92  TRP B HA   1  
ATOM 3861   H HB2  . TRP B 2 92  ? -3.407  -15.467 3.437   1.00 0.00 ? 92  TRP B HB2  1  
ATOM 3862   H HB3  . TRP B 2 92  ? -3.471  -14.371 4.823   1.00 0.00 ? 92  TRP B HB3  1  
ATOM 3863   H HD1  . TRP B 2 92  ? -6.114  -15.710 2.261   1.00 0.00 ? 92  TRP B HD1  1  
ATOM 3864   H HE1  . TRP B 2 92  ? -8.240  -16.306 3.560   1.00 0.00 ? 92  TRP B HE1  1  
ATOM 3865   H HE3  . TRP B 2 92  ? -4.562  -14.441 6.959   1.00 0.00 ? 92  TRP B HE3  1  
ATOM 3866   H HZ2  . TRP B 2 92  ? -9.147  -16.260 6.223   1.00 0.00 ? 92  TRP B HZ2  1  
ATOM 3867   H HZ3  . TRP B 2 92  ? -6.120  -14.754 8.840   1.00 0.00 ? 92  TRP B HZ3  1  
ATOM 3868   H HH2  . TRP B 2 92  ? -8.378  -15.653 8.473   1.00 0.00 ? 92  TRP B HH2  1  
ATOM 3869   N N    . SER B 2 93  ? -4.301  -11.527 4.387   1.00 0.00 ? 93  SER B N    1  
ATOM 3870   C CA   . SER B 2 93  ? -5.050  -10.431 4.982   1.00 0.00 ? 93  SER B CA   1  
ATOM 3871   C C    . SER B 2 93  ? -4.079  -9.428  5.600   1.00 0.00 ? 93  SER B C    1  
ATOM 3872   O O    . SER B 2 93  ? -2.861  -9.567  5.446   1.00 0.00 ? 93  SER B O    1  
ATOM 3873   C CB   . SER B 2 93  ? -6.027  -10.957 6.045   1.00 0.00 ? 93  SER B CB   1  
ATOM 3874   O OG   . SER B 2 93  ? -7.109  -11.662 5.453   1.00 0.00 ? 93  SER B OG   1  
ATOM 3875   H H    . SER B 2 93  ? -3.370  -11.641 4.648   1.00 0.00 ? 93  SER B H    1  
ATOM 3876   H HA   . SER B 2 93  ? -5.621  -9.933  4.199   1.00 0.00 ? 93  SER B HA   1  
ATOM 3877   H HB2  . SER B 2 93  ? -5.493  -11.627 6.718   1.00 0.00 ? 93  SER B HB2  1  
ATOM 3878   H HB3  . SER B 2 93  ? -6.423  -10.113 6.611   1.00 0.00 ? 93  SER B HB3  1  
ATOM 3879   H HG   . SER B 2 93  ? -6.898  -11.861 4.527   1.00 0.00 ? 93  SER B HG   1  
ATOM 3880   N N    . LEU B 2 94  ? -4.618  -8.435  6.299   1.00 0.00 ? 94  LEU B N    1  
ATOM 3881   C CA   . LEU B 2 94  ? -3.809  -7.401  6.939   1.00 0.00 ? 94  LEU B CA   1  
ATOM 3882   C C    . LEU B 2 94  ? -2.865  -7.990  7.987   1.00 0.00 ? 94  LEU B C    1  
ATOM 3883   O O    . LEU B 2 94  ? -3.092  -9.088  8.496   1.00 0.00 ? 94  LEU B O    1  
ATOM 3884   C CB   . LEU B 2 94  ? -4.712  -6.335  7.573   1.00 0.00 ? 94  LEU B CB   1  
ATOM 3885   C CG   . LEU B 2 94  ? -4.551  -4.913  7.026   1.00 0.00 ? 94  LEU B CG   1  
ATOM 3886   C CD1  . LEU B 2 94  ? -5.248  -4.765  5.682   1.00 0.00 ? 94  LEU B CD1  1  
ATOM 3887   C CD2  . LEU B 2 94  ? -5.064  -3.889  8.023   1.00 0.00 ? 94  LEU B CD2  1  
ATOM 3888   H H    . LEU B 2 94  ? -5.590  -8.398  6.392   1.00 0.00 ? 94  LEU B H    1  
ATOM 3889   H HA   . LEU B 2 94  ? -3.205  -6.924  6.167   1.00 0.00 ? 94  LEU B HA   1  
ATOM 3890   H HB2  . LEU B 2 94  ? -5.747  -6.638  7.418   1.00 0.00 ? 94  LEU B HB2  1  
ATOM 3891   H HB3  . LEU B 2 94  ? -4.497  -6.308  8.641   1.00 0.00 ? 94  LEU B HB3  1  
ATOM 3892   H HG   . LEU B 2 94  ? -3.488  -4.730  6.873   1.00 0.00 ? 94  LEU B HG   1  
ATOM 3893   H HD11 . LEU B 2 94  ? -5.100  -3.756  5.296   1.00 0.00 ? 94  LEU B HD11 1  
ATOM 3894   H HD12 . LEU B 2 94  ? -4.834  -5.485  4.978   1.00 0.00 ? 94  LEU B HD12 1  
ATOM 3895   H HD13 . LEU B 2 94  ? -6.316  -4.950  5.806   1.00 0.00 ? 94  LEU B HD13 1  
ATOM 3896   H HD21 . LEU B 2 94  ? -4.520  -3.995  8.962   1.00 0.00 ? 94  LEU B HD21 1  
ATOM 3897   H HD22 . LEU B 2 94  ? -4.915  -2.882  7.632   1.00 0.00 ? 94  LEU B HD22 1  
ATOM 3898   H HD23 . LEU B 2 94  ? -6.127  -4.054  8.198   1.00 0.00 ? 94  LEU B HD23 1  
ATOM 3899   N N    . PRO B 2 95  ? -1.782  -7.267  8.325   1.00 0.00 ? 95  PRO B N    1  
ATOM 3900   C CA   . PRO B 2 95  ? -1.467  -5.964  7.747   1.00 0.00 ? 95  PRO B CA   1  
ATOM 3901   C C    . PRO B 2 95  ? -0.501  -6.057  6.567   1.00 0.00 ? 95  PRO B C    1  
ATOM 3902   O O    . PRO B 2 95  ? 0.046   -5.047  6.126   1.00 0.00 ? 95  PRO B O    1  
ATOM 3903   C CB   . PRO B 2 95  ? -0.802  -5.244  8.921   1.00 0.00 ? 95  PRO B CB   1  
ATOM 3904   C CG   . PRO B 2 95  ? -0.202  -6.325  9.770   1.00 0.00 ? 95  PRO B CG   1  
ATOM 3905   C CD   . PRO B 2 95  ? -0.793  -7.647  9.336   1.00 0.00 ? 95  PRO B CD   1  
ATOM 3906   H HA   . PRO B 2 95  ? -2.374  -5.448  7.433   1.00 0.00 ? 95  PRO B HA   1  
ATOM 3907   H HB2  . PRO B 2 95  ? -0.047  -4.535  8.581   1.00 0.00 ? 95  PRO B HB2  1  
ATOM 3908   H HB3  . PRO B 2 95  ? -1.573  -4.738  9.501   1.00 0.00 ? 95  PRO B HB3  1  
ATOM 3909   H HG2  . PRO B 2 95  ? 0.869   -6.353  9.571   1.00 0.00 ? 95  PRO B HG2  1  
ATOM 3910   H HG3  . PRO B 2 95  ? -0.393  -6.143  10.828  1.00 0.00 ? 95  PRO B HG3  1  
ATOM 3911   H HD2  . PRO B 2 95  ? -0.026  -8.306  8.927   1.00 0.00 ? 95  PRO B HD2  1  
ATOM 3912   H HD3  . PRO B 2 95  ? -1.297  -8.126  10.175  1.00 0.00 ? 95  PRO B HD3  1  
ATOM 3913   N N    . PHE B 2 96  ? -0.290  -7.281  6.074   1.00 0.00 ? 96  PHE B N    1  
ATOM 3914   C CA   . PHE B 2 96  ? 0.609   -7.526  4.942   1.00 0.00 ? 96  PHE B CA   1  
ATOM 3915   C C    . PHE B 2 96  ? 2.040   -7.115  5.289   1.00 0.00 ? 96  PHE B C    1  
ATOM 3916   O O    . PHE B 2 96  ? 2.718   -6.449  4.510   1.00 0.00 ? 96  PHE B O    1  
ATOM 3917   C CB   . PHE B 2 96  ? 0.128   -6.803  3.676   1.00 0.00 ? 96  PHE B CB   1  
ATOM 3918   C CG   . PHE B 2 96  ? -1.212  -7.262  3.171   1.00 0.00 ? 96  PHE B CG   1  
ATOM 3919   C CD1  . PHE B 2 96  ? -1.340  -8.467  2.497   1.00 0.00 ? 96  PHE B CD1  1  
ATOM 3920   C CD2  . PHE B 2 96  ? -2.342  -6.485  3.362   1.00 0.00 ? 96  PHE B CD2  1  
ATOM 3921   C CE1  . PHE B 2 96  ? -2.570  -8.886  2.025   1.00 0.00 ? 96  PHE B CE1  1  
ATOM 3922   C CE2  . PHE B 2 96  ? -3.575  -6.897  2.893   1.00 0.00 ? 96  PHE B CE2  1  
ATOM 3923   C CZ   . PHE B 2 96  ? -3.689  -8.100  2.224   1.00 0.00 ? 96  PHE B CZ   1  
ATOM 3924   H H    . PHE B 2 96  ? -0.727  -8.043  6.501   1.00 0.00 ? 96  PHE B H    1  
ATOM 3925   H HA   . PHE B 2 96  ? 0.602   -8.597  4.740   1.00 0.00 ? 96  PHE B HA   1  
ATOM 3926   H HB2  . PHE B 2 96  ? 0.067   -5.736  3.890   1.00 0.00 ? 96  PHE B HB2  1  
ATOM 3927   H HB3  . PHE B 2 96  ? 0.865   -6.961  2.888   1.00 0.00 ? 96  PHE B HB3  1  
ATOM 3928   H HD1  . PHE B 2 96  ? -0.469  -9.085  2.339   1.00 0.00 ? 96  PHE B HD1  1  
ATOM 3929   H HD2  . PHE B 2 96  ? -2.259  -5.543  3.884   1.00 0.00 ? 96  PHE B HD2  1  
ATOM 3930   H HE1  . PHE B 2 96  ? -2.656  -9.826  1.501   1.00 0.00 ? 96  PHE B HE1  1  
ATOM 3931   H HE2  . PHE B 2 96  ? -4.447  -6.280  3.050   1.00 0.00 ? 96  PHE B HE2  1  
ATOM 3932   H HZ   . PHE B 2 96  ? -4.651  -8.426  1.856   1.00 0.00 ? 96  PHE B HZ   1  
ATOM 3933   N N    . THR B 2 97  ? 2.502   -7.543  6.455   1.00 0.00 ? 97  THR B N    1  
ATOM 3934   C CA   . THR B 2 97  ? 3.833   -7.204  6.919   1.00 0.00 ? 97  THR B CA   1  
ATOM 3935   C C    . THR B 2 97  ? 4.791   -8.382  6.765   1.00 0.00 ? 97  THR B C    1  
ATOM 3936   O O    . THR B 2 97  ? 4.365   -9.510  6.491   1.00 0.00 ? 97  THR B O    1  
ATOM 3937   C CB   . THR B 2 97  ? 3.790   -6.788  8.400   1.00 0.00 ? 97  THR B CB   1  
ATOM 3938   O OG1  . THR B 2 97  ? 2.771   -7.545  9.074   1.00 0.00 ? 97  THR B OG1  1  
ATOM 3939   C CG2  . THR B 2 97  ? 3.484   -5.304  8.526   1.00 0.00 ? 97  THR B CG2  1  
ATOM 3940   H H    . THR B 2 97  ? 1.949   -8.122  7.012   1.00 0.00 ? 97  THR B H    1  
ATOM 3941   H HA   . THR B 2 97  ? 4.203   -6.368  6.325   1.00 0.00 ? 97  THR B HA   1  
ATOM 3942   H HB   . THR B 2 97  ? 4.757   -6.994  8.858   1.00 0.00 ? 97  THR B HB   1  
ATOM 3943   H HG1  . THR B 2 97  ? 2.959   -7.560  10.017  1.00 0.00 ? 97  THR B HG1  1  
ATOM 3944   H HG21 . THR B 2 97  ? 2.517   -5.093  8.070   1.00 0.00 ? 97  THR B HG21 1  
ATOM 3945   H HG22 . THR B 2 97  ? 3.457   -5.023  9.579   1.00 0.00 ? 97  THR B HG22 1  
ATOM 3946   H HG23 . THR B 2 97  ? 4.259   -4.730  8.018   1.00 0.00 ? 97  THR B HG23 1  
ATOM 3947   N N    . PHE B 2 98  ? 6.076   -8.107  6.947   1.00 0.00 ? 98  PHE B N    1  
ATOM 3948   C CA   . PHE B 2 98  ? 7.118   -9.119  6.838   1.00 0.00 ? 98  PHE B CA   1  
ATOM 3949   C C    . PHE B 2 98  ? 7.543   -9.590  8.230   1.00 0.00 ? 98  PHE B C    1  
ATOM 3950   O O    . PHE B 2 98  ? 7.045   -9.086  9.238   1.00 0.00 ? 98  PHE B O    1  
ATOM 3951   C CB   . PHE B 2 98  ? 8.326   -8.549  6.081   1.00 0.00 ? 98  PHE B CB   1  
ATOM 3952   C CG   . PHE B 2 98  ? 8.103   -8.346  4.602   1.00 0.00 ? 98  PHE B CG   1  
ATOM 3953   C CD1  . PHE B 2 98  ? 7.094   -7.514  4.140   1.00 0.00 ? 98  PHE B CD1  1  
ATOM 3954   C CD2  . PHE B 2 98  ? 8.909   -8.984  3.675   1.00 0.00 ? 98  PHE B CD2  1  
ATOM 3955   C CE1  . PHE B 2 98  ? 6.894   -7.325  2.785   1.00 0.00 ? 98  PHE B CE1  1  
ATOM 3956   C CE2  . PHE B 2 98  ? 8.714   -8.800  2.321   1.00 0.00 ? 98  PHE B CE2  1  
ATOM 3957   C CZ   . PHE B 2 98  ? 7.705   -7.970  1.874   1.00 0.00 ? 98  PHE B CZ   1  
ATOM 3958   H H    . PHE B 2 98  ? 6.333   -7.188  7.160   1.00 0.00 ? 98  PHE B H    1  
ATOM 3959   H HA   . PHE B 2 98  ? 6.723   -9.969  6.282   1.00 0.00 ? 98  PHE B HA   1  
ATOM 3960   H HB2  . PHE B 2 98  ? 8.585   -7.587  6.523   1.00 0.00 ? 98  PHE B HB2  1  
ATOM 3961   H HB3  . PHE B 2 98  ? 9.166   -9.231  6.210   1.00 0.00 ? 98  PHE B HB3  1  
ATOM 3962   H HD1  . PHE B 2 98  ? 6.455   -7.007  4.848   1.00 0.00 ? 98  PHE B HD1  1  
ATOM 3963   H HD2  . PHE B 2 98  ? 9.701   -9.635  4.016   1.00 0.00 ? 98  PHE B HD2  1  
ATOM 3964   H HE1  . PHE B 2 98  ? 6.104   -6.674  2.440   1.00 0.00 ? 98  PHE B HE1  1  
ATOM 3965   H HE2  . PHE B 2 98  ? 9.351   -9.305  1.610   1.00 0.00 ? 98  PHE B HE2  1  
ATOM 3966   H HZ   . PHE B 2 98  ? 7.551   -7.826  0.815   1.00 0.00 ? 98  PHE B HZ   1  
ATOM 3967   N N    . GLY B 2 99  ? 8.460   -10.552 8.282   1.00 0.00 ? 99  GLY B N    1  
ATOM 3968   C CA   . GLY B 2 99  ? 8.930   -11.081 9.556   1.00 0.00 ? 99  GLY B CA   1  
ATOM 3969   C C    . GLY B 2 99  ? 10.019  -10.243 10.212  1.00 0.00 ? 99  GLY B C    1  
ATOM 3970   O O    . GLY B 2 99  ? 10.056  -9.022  10.059  1.00 0.00 ? 99  GLY B O    1  
ATOM 3971   H H    . GLY B 2 99  ? 8.805   -10.924 7.441   1.00 0.00 ? 99  GLY B H    1  
ATOM 3972   H HA2  . GLY B 2 99  ? 8.082   -11.137 10.238  1.00 0.00 ? 99  GLY B HA2  1  
ATOM 3973   H HA3  . GLY B 2 99  ? 9.323   -12.084 9.386   1.00 0.00 ? 99  GLY B HA3  1  
ATOM 3974   N N    . GLN B 2 100 ? 10.896  -10.903 10.969  1.00 0.00 ? 100 GLN B N    1  
ATOM 3975   C CA   . GLN B 2 100 ? 11.994  -10.225 11.660  1.00 0.00 ? 100 GLN B CA   1  
ATOM 3976   C C    . GLN B 2 100 ? 13.236  -10.165 10.781  1.00 0.00 ? 100 GLN B C    1  
ATOM 3977   O O    . GLN B 2 100 ? 14.084  -9.282  10.939  1.00 0.00 ? 100 GLN B O    1  
ATOM 3978   C CB   . GLN B 2 100 ? 12.337  -10.940 12.974  1.00 0.00 ? 100 GLN B CB   1  
ATOM 3979   C CG   . GLN B 2 100 ? 11.317  -10.763 14.092  1.00 0.00 ? 100 GLN B CG   1  
ATOM 3980   C CD   . GLN B 2 100 ? 10.036  -11.536 13.851  1.00 0.00 ? 100 GLN B CD   1  
ATOM 3981   O OE1  . GLN B 2 100 ? 10.031  -12.550 13.154  1.00 0.00 ? 100 GLN B OE1  1  
ATOM 3982   N NE2  . GLN B 2 100 ? 8.947   -11.071 14.435  1.00 0.00 ? 100 GLN B NE2  1  
ATOM 3983   H H    . GLN B 2 100 ? 10.794  -11.872 11.077  1.00 0.00 ? 100 GLN B H    1  
ATOM 3984   H HA   . GLN B 2 100 ? 11.676  -9.208  11.888  1.00 0.00 ? 100 GLN B HA   1  
ATOM 3985   H HB2  . GLN B 2 100 ? 12.428  -12.006 12.765  1.00 0.00 ? 100 GLN B HB2  1  
ATOM 3986   H HB3  . GLN B 2 100 ? 13.294  -10.556 13.328  1.00 0.00 ? 100 GLN B HB3  1  
ATOM 3987   H HG2  . GLN B 2 100 ? 11.760  -11.106 15.027  1.00 0.00 ? 100 GLN B HG2  1  
ATOM 3988   H HG3  . GLN B 2 100 ? 11.074  -9.704  14.177  1.00 0.00 ? 100 GLN B HG3  1  
ATOM 3989   H HE21 . GLN B 2 100 ? 9.025   -10.262 14.989  1.00 0.00 ? 100 GLN B HE21 1  
ATOM 3990   H HE22 . GLN B 2 100 ? 8.101   -11.557 14.295  1.00 0.00 ? 100 GLN B HE22 1  
ATOM 3991   N N    . GLY B 2 101 ? 13.328  -11.095 9.843   1.00 0.00 ? 101 GLY B N    1  
ATOM 3992   C CA   . GLY B 2 101 ? 14.467  -11.137 8.956   1.00 0.00 ? 101 GLY B CA   1  
ATOM 3993   C C    . GLY B 2 101 ? 15.532  -12.117 9.403   1.00 0.00 ? 101 GLY B C    1  
ATOM 3994   O O    . GLY B 2 101 ? 15.898  -12.163 10.576  1.00 0.00 ? 101 GLY B O    1  
ATOM 3995   H H    . GLY B 2 101 ? 12.603  -11.741 9.737   1.00 0.00 ? 101 GLY B H    1  
ATOM 3996   H HA2  . GLY B 2 101 ? 14.122  -11.426 7.963   1.00 0.00 ? 101 GLY B HA2  1  
ATOM 3997   H HA3  . GLY B 2 101 ? 14.907  -10.141 8.909   1.00 0.00 ? 101 GLY B HA3  1  
ATOM 3998   N N    . THR B 2 102 ? 16.019  -12.896 8.456   1.00 0.00 ? 102 THR B N    1  
ATOM 3999   C CA   . THR B 2 102 ? 17.055  -13.872 8.716   1.00 0.00 ? 102 THR B CA   1  
ATOM 4000   C C    . THR B 2 102 ? 18.265  -13.556 7.843   1.00 0.00 ? 102 THR B C    1  
ATOM 4001   O O    . THR B 2 102 ? 18.156  -13.485 6.620   1.00 0.00 ? 102 THR B O    1  
ATOM 4002   C CB   . THR B 2 102 ? 16.557  -15.301 8.421   1.00 0.00 ? 102 THR B CB   1  
ATOM 4003   O OG1  . THR B 2 102 ? 15.368  -15.559 9.183   1.00 0.00 ? 102 THR B OG1  1  
ATOM 4004   C CG2  . THR B 2 102 ? 17.618  -16.326 8.784   1.00 0.00 ? 102 THR B CG2  1  
ATOM 4005   H H    . THR B 2 102 ? 15.673  -12.807 7.542   1.00 0.00 ? 102 THR B H    1  
ATOM 4006   H HA   . THR B 2 102 ? 17.343  -13.810 9.766   1.00 0.00 ? 102 THR B HA   1  
ATOM 4007   H HB   . THR B 2 102 ? 16.328  -15.385 7.358   1.00 0.00 ? 102 THR B HB   1  
ATOM 4008   H HG1  . THR B 2 102 ? 15.602  -15.656 10.119  1.00 0.00 ? 102 THR B HG1  1  
ATOM 4009   H HG21 . THR B 2 102 ? 17.850  -16.248 9.846   1.00 0.00 ? 102 THR B HG21 1  
ATOM 4010   H HG22 . THR B 2 102 ? 17.252  -17.330 8.566   1.00 0.00 ? 102 THR B HG22 1  
ATOM 4011   H HG23 . THR B 2 102 ? 18.520  -16.137 8.201   1.00 0.00 ? 102 THR B HG23 1  
ATOM 4012   N N    . LYS B 2 103 ? 19.407  -13.347 8.473   1.00 0.00 ? 103 LYS B N    1  
ATOM 4013   C CA   . LYS B 2 103 ? 20.626  -13.021 7.750   1.00 0.00 ? 103 LYS B CA   1  
ATOM 4014   C C    . LYS B 2 103 ? 21.542  -14.229 7.675   1.00 0.00 ? 103 LYS B C    1  
ATOM 4015   O O    . LYS B 2 103 ? 21.853  -14.848 8.694   1.00 0.00 ? 103 LYS B O    1  
ATOM 4016   C CB   . LYS B 2 103 ? 21.348  -11.847 8.413   1.00 0.00 ? 103 LYS B CB   1  
ATOM 4017   C CG   . LYS B 2 103 ? 20.510  -10.583 8.504   1.00 0.00 ? 103 LYS B CG   1  
ATOM 4018   C CD   . LYS B 2 103 ? 21.185  -9.534  9.370   1.00 0.00 ? 103 LYS B CD   1  
ATOM 4019   C CE   . LYS B 2 103 ? 20.263  -8.352  9.622   1.00 0.00 ? 103 LYS B CE   1  
ATOM 4020   N NZ   . LYS B 2 103 ? 20.828  -7.406  10.619  1.00 0.00 ? 103 LYS B NZ   1  
ATOM 4021   H H    . LYS B 2 103 ? 19.436  -13.443 9.451   1.00 0.00 ? 103 LYS B H    1  
ATOM 4022   H HA   . LYS B 2 103 ? 20.353  -12.730 6.735   1.00 0.00 ? 103 LYS B HA   1  
ATOM 4023   H HB2  . LYS B 2 103 ? 21.631  -12.145 9.423   1.00 0.00 ? 103 LYS B HB2  1  
ATOM 4024   H HB3  . LYS B 2 103 ? 22.245  -11.624 7.835   1.00 0.00 ? 103 LYS B HB3  1  
ATOM 4025   H HG2  . LYS B 2 103 ? 20.369  -10.178 7.502   1.00 0.00 ? 103 LYS B HG2  1  
ATOM 4026   H HG3  . LYS B 2 103 ? 19.540  -10.829 8.936   1.00 0.00 ? 103 LYS B HG3  1  
ATOM 4027   H HD2  . LYS B 2 103 ? 21.457  -9.983  10.326  1.00 0.00 ? 103 LYS B HD2  1  
ATOM 4028   H HD3  . LYS B 2 103 ? 22.085  -9.182  8.866   1.00 0.00 ? 103 LYS B HD3  1  
ATOM 4029   H HE2  . LYS B 2 103 ? 20.103  -7.822  8.683   1.00 0.00 ? 103 LYS B HE2  1  
ATOM 4030   H HE3  . LYS B 2 103 ? 19.306  -8.723  9.992   1.00 0.00 ? 103 LYS B HE3  1  
ATOM 4031   H HZ1  . LYS B 2 103 ? 21.118  -7.916  11.476  1.00 0.00 ? 103 LYS B HZ1  1  
ATOM 4032   H HZ2  . LYS B 2 103 ? 20.117  -6.692  10.876  1.00 0.00 ? 103 LYS B HZ2  1  
ATOM 4033   H HZ3  . LYS B 2 103 ? 21.656  -6.921  10.222  1.00 0.00 ? 103 LYS B HZ3  1  
ATOM 4034   N N    . VAL B 2 104 ? 21.973  -14.559 6.470   1.00 0.00 ? 104 VAL B N    1  
ATOM 4035   C CA   . VAL B 2 104 ? 22.853  -15.698 6.264   1.00 0.00 ? 104 VAL B CA   1  
ATOM 4036   C C    . VAL B 2 104 ? 24.270  -15.224 5.968   1.00 0.00 ? 104 VAL B C    1  
ATOM 4037   O O    . VAL B 2 104 ? 24.514  -14.540 4.976   1.00 0.00 ? 104 VAL B O    1  
ATOM 4038   C CB   . VAL B 2 104 ? 22.366  -16.614 5.118   1.00 0.00 ? 104 VAL B CB   1  
ATOM 4039   C CG1  . VAL B 2 104 ? 23.129  -17.928 5.133   1.00 0.00 ? 104 VAL B CG1  1  
ATOM 4040   C CG2  . VAL B 2 104 ? 20.865  -16.862 5.217   1.00 0.00 ? 104 VAL B CG2  1  
ATOM 4041   H H    . VAL B 2 104 ? 21.704  -14.012 5.701   1.00 0.00 ? 104 VAL B H    1  
ATOM 4042   H HA   . VAL B 2 104 ? 22.866  -16.281 7.185   1.00 0.00 ? 104 VAL B HA   1  
ATOM 4043   H HB   . VAL B 2 104 ? 22.566  -16.112 4.171   1.00 0.00 ? 104 VAL B HB   1  
ATOM 4044   H HG11 . VAL B 2 104 ? 22.796  -18.556 4.308   1.00 0.00 ? 104 VAL B HG11 1  
ATOM 4045   H HG12 . VAL B 2 104 ? 24.196  -17.728 5.029   1.00 0.00 ? 104 VAL B HG12 1  
ATOM 4046   H HG13 . VAL B 2 104 ? 22.946  -18.443 6.077   1.00 0.00 ? 104 VAL B HG13 1  
ATOM 4047   H HG21 . VAL B 2 104 ? 20.337  -15.910 5.175   1.00 0.00 ? 104 VAL B HG21 1  
ATOM 4048   H HG22 . VAL B 2 104 ? 20.539  -17.493 4.389   1.00 0.00 ? 104 VAL B HG22 1  
ATOM 4049   H HG23 . VAL B 2 104 ? 20.641  -17.361 6.160   1.00 0.00 ? 104 VAL B HG23 1  
ATOM 4050   N N    . GLU B 2 105 ? 25.193  -15.575 6.847   1.00 0.00 ? 105 GLU B N    1  
ATOM 4051   C CA   . GLU B 2 105 ? 26.585  -15.195 6.696   1.00 0.00 ? 105 GLU B CA   1  
ATOM 4052   C C    . GLU B 2 105 ? 27.413  -16.392 6.244   1.00 0.00 ? 105 GLU B C    1  
ATOM 4053   O O    . GLU B 2 105 ? 27.353  -17.466 6.846   1.00 0.00 ? 105 GLU B O    1  
ATOM 4054   C CB   . GLU B 2 105 ? 27.130  -14.658 8.023   1.00 0.00 ? 105 GLU B CB   1  
ATOM 4055   C CG   . GLU B 2 105 ? 28.558  -14.140 7.949   1.00 0.00 ? 105 GLU B CG   1  
ATOM 4056   C CD   . GLU B 2 105 ? 29.329  -14.386 9.226   1.00 0.00 ? 105 GLU B CD   1  
ATOM 4057   O OE1  . GLU B 2 105 ? 29.861  -15.505 9.398   1.00 0.00 ? 105 GLU B OE1  1  
ATOM 4058   O OE2  . GLU B 2 105 ? 29.413  -13.468 10.067  1.00 0.00 ? 105 GLU B OE2  1  
ATOM 4059   H H    . GLU B 2 105 ? 24.930  -16.123 7.622   1.00 0.00 ? 105 GLU B H    1  
ATOM 4060   H HA   . GLU B 2 105 ? 26.653  -14.410 5.942   1.00 0.00 ? 105 GLU B HA   1  
ATOM 4061   H HB2  . GLU B 2 105 ? 26.487  -13.842 8.351   1.00 0.00 ? 105 GLU B HB2  1  
ATOM 4062   H HB3  . GLU B 2 105 ? 27.097  -15.464 8.757   1.00 0.00 ? 105 GLU B HB3  1  
ATOM 4063   H HG2  . GLU B 2 105 ? 29.071  -14.640 7.127   1.00 0.00 ? 105 GLU B HG2  1  
ATOM 4064   H HG3  . GLU B 2 105 ? 28.532  -13.067 7.756   1.00 0.00 ? 105 GLU B HG3  1  
ATOM 4065   H HE2  . GLU B 2 105 ? 29.918  -13.696 10.851  1.00 0.00 ? 105 GLU B HE2  1  
ATOM 4066   N N    . ILE B 2 106 ? 28.183  -16.206 5.185   1.00 0.00 ? 106 ILE B N    1  
ATOM 4067   C CA   . ILE B 2 106 ? 29.027  -17.269 4.671   1.00 0.00 ? 106 ILE B CA   1  
ATOM 4068   C C    . ILE B 2 106 ? 30.336  -17.295 5.452   1.00 0.00 ? 106 ILE B C    1  
ATOM 4069   O O    . ILE B 2 106 ? 31.166  -16.392 5.324   1.00 0.00 ? 106 ILE B O    1  
ATOM 4070   C CB   . ILE B 2 106 ? 29.319  -17.107 3.160   1.00 0.00 ? 106 ILE B CB   1  
ATOM 4071   C CG1  . ILE B 2 106 ? 28.018  -17.146 2.349   1.00 0.00 ? 106 ILE B CG1  1  
ATOM 4072   C CG2  . ILE B 2 106 ? 30.272  -18.191 2.677   1.00 0.00 ? 106 ILE B CG2  1  
ATOM 4073   C CD1  . ILE B 2 106 ? 27.363  -15.793 2.163   1.00 0.00 ? 106 ILE B CD1  1  
ATOM 4074   H H    . ILE B 2 106 ? 28.193  -15.333 4.746   1.00 0.00 ? 106 ILE B H    1  
ATOM 4075   H HA   . ILE B 2 106 ? 28.509  -18.216 4.820   1.00 0.00 ? 106 ILE B HA   1  
ATOM 4076   H HB   . ILE B 2 106 ? 29.793  -16.138 3.004   1.00 0.00 ? 106 ILE B HB   1  
ATOM 4077   H HG12 . ILE B 2 106 ? 28.240  -17.557 1.364   1.00 0.00 ? 106 ILE B HG12 1  
ATOM 4078   H HG13 . ILE B 2 106 ? 27.313  -17.798 2.864   1.00 0.00 ? 106 ILE B HG13 1  
ATOM 4079   H HG21 . ILE B 2 106 ? 30.486  -18.050 1.618   1.00 0.00 ? 106 ILE B HG21 1  
ATOM 4080   H HG22 . ILE B 2 106 ? 31.201  -18.134 3.244   1.00 0.00 ? 106 ILE B HG22 1  
ATOM 4081   H HG23 . ILE B 2 106 ? 29.814  -19.169 2.827   1.00 0.00 ? 106 ILE B HG23 1  
ATOM 4082   H HD11 . ILE B 2 106 ? 28.052  -15.129 1.640   1.00 0.00 ? 106 ILE B HD11 1  
ATOM 4083   H HD12 . ILE B 2 106 ? 26.447  -15.887 1.579   1.00 0.00 ? 106 ILE B HD12 1  
ATOM 4084   H HD13 . ILE B 2 106 ? 27.123  -15.372 3.139   1.00 0.00 ? 106 ILE B HD13 1  
ATOM 4085   N N    . LYS B 2 107 ? 30.506  -18.319 6.274   1.00 0.00 ? 107 LYS B N    1  
ATOM 4086   C CA   . LYS B 2 107 ? 31.706  -18.452 7.084   1.00 0.00 ? 107 LYS B CA   1  
ATOM 4087   C C    . LYS B 2 107 ? 32.834  -19.080 6.279   1.00 0.00 ? 107 LYS B C    1  
ATOM 4088   O O    . LYS B 2 107 ? 32.911  -20.301 6.141   1.00 0.00 ? 107 LYS B O    1  
ATOM 4089   C CB   . LYS B 2 107 ? 31.423  -19.270 8.347   1.00 0.00 ? 107 LYS B CB   1  
ATOM 4090   C CG   . LYS B 2 107 ? 32.600  -19.372 9.310   1.00 0.00 ? 107 LYS B CG   1  
ATOM 4091   C CD   . LYS B 2 107 ? 32.280  -18.729 10.651  1.00 0.00 ? 107 LYS B CD   1  
ATOM 4092   C CE   . LYS B 2 107 ? 32.342  -17.214 10.568  1.00 0.00 ? 107 LYS B CE   1  
ATOM 4093   N NZ   . LYS B 2 107 ? 31.319  -16.564 11.425  1.00 0.00 ? 107 LYS B NZ   1  
ATOM 4094   H H    . LYS B 2 107 ? 29.810  -19.016 6.329   1.00 0.00 ? 107 LYS B H    1  
ATOM 4095   H HA   . LYS B 2 107 ? 32.019  -17.453 7.388   1.00 0.00 ? 107 LYS B HA   1  
ATOM 4096   H HB2  . LYS B 2 107 ? 30.591  -18.803 8.875   1.00 0.00 ? 107 LYS B HB2  1  
ATOM 4097   H HB3  . LYS B 2 107 ? 31.142  -20.278 8.044   1.00 0.00 ? 107 LYS B HB3  1  
ATOM 4098   H HG2  . LYS B 2 107 ? 32.836  -20.424 9.469   1.00 0.00 ? 107 LYS B HG2  1  
ATOM 4099   H HG3  . LYS B 2 107 ? 33.461  -18.869 8.871   1.00 0.00 ? 107 LYS B HG3  1  
ATOM 4100   H HD2  . LYS B 2 107 ? 31.277  -19.026 10.957  1.00 0.00 ? 107 LYS B HD2  1  
ATOM 4101   H HD3  . LYS B 2 107 ? 33.003  -19.073 11.391  1.00 0.00 ? 107 LYS B HD3  1  
ATOM 4102   H HE2  . LYS B 2 107 ? 33.331  -16.884 10.887  1.00 0.00 ? 107 LYS B HE2  1  
ATOM 4103   H HE3  . LYS B 2 107 ? 32.179  -16.911 9.534   1.00 0.00 ? 107 LYS B HE3  1  
ATOM 4104   H HZ1  . LYS B 2 107 ? 31.770  -15.878 12.065  1.00 0.00 ? 107 LYS B HZ1  1  
ATOM 4105   H HZ2  . LYS B 2 107 ? 30.819  -17.275 11.996  1.00 0.00 ? 107 LYS B HZ2  1  
ATOM 4106   H HZ3  . LYS B 2 107 ? 30.624  -16.060 10.831  1.00 0.00 ? 107 LYS B HZ3  1  
ATOM 4107   N N    . ARG B 2 108 ? 33.692  -18.237 5.728   1.00 0.00 ? 108 ARG B N    1  
ATOM 4108   C CA   . ARG B 2 108 ? 34.825  -18.694 4.946   1.00 0.00 ? 108 ARG B CA   1  
ATOM 4109   C C    . ARG B 2 108 ? 36.104  -18.540 5.762   1.00 0.00 ? 108 ARG B C    1  
ATOM 4110   O O    . ARG B 2 108 ? 36.297  -17.528 6.435   1.00 0.00 ? 108 ARG B O    1  
ATOM 4111   C CB   . ARG B 2 108 ? 34.928  -17.884 3.648   1.00 0.00 ? 108 ARG B CB   1  
ATOM 4112   C CG   . ARG B 2 108 ? 36.040  -18.326 2.708   1.00 0.00 ? 108 ARG B CG   1  
ATOM 4113   C CD   . ARG B 2 108 ? 35.523  -19.252 1.615   1.00 0.00 ? 108 ARG B CD   1  
ATOM 4114   N NE   . ARG B 2 108 ? 35.140  -20.569 2.128   1.00 0.00 ? 108 ARG B NE   1  
ATOM 4115   C CZ   . ARG B 2 108 ? 34.988  -21.651 1.365   1.00 0.00 ? 108 ARG B CZ   1  
ATOM 4116   N NH1  . ARG B 2 108 ? 35.198  -21.581 0.054   1.00 0.00 ? 108 ARG B NH1  1  
ATOM 4117   N NH2  . ARG B 2 108 ? 34.635  -22.804 1.922   1.00 0.00 ? 108 ARG B NH2  1  
ATOM 4118   H H    . ARG B 2 108 ? 33.562  -17.271 5.860   1.00 0.00 ? 108 ARG B H    1  
ATOM 4119   H HA   . ARG B 2 108 ? 34.682  -19.746 4.698   1.00 0.00 ? 108 ARG B HA   1  
ATOM 4120   H HB2  . ARG B 2 108 ? 33.980  -17.971 3.117   1.00 0.00 ? 108 ARG B HB2  1  
ATOM 4121   H HB3  . ARG B 2 108 ? 35.102  -16.841 3.913   1.00 0.00 ? 108 ARG B HB3  1  
ATOM 4122   H HG2  . ARG B 2 108 ? 36.481  -17.444 2.244   1.00 0.00 ? 108 ARG B HG2  1  
ATOM 4123   H HG3  . ARG B 2 108 ? 36.801  -18.853 3.285   1.00 0.00 ? 108 ARG B HG3  1  
ATOM 4124   H HD2  . ARG B 2 108 ? 34.653  -18.791 1.148   1.00 0.00 ? 108 ARG B HD2  1  
ATOM 4125   H HD3  . ARG B 2 108 ? 36.305  -19.381 0.866   1.00 0.00 ? 108 ARG B HD3  1  
ATOM 4126   H HE   . ARG B 2 108 ? 34.991  -20.653 3.097   1.00 0.00 ? 108 ARG B HE   1  
ATOM 4127   H HH11 . ARG B 2 108 ? 35.475  -20.712 -0.370  1.00 0.00 ? 108 ARG B HH11 1  
ATOM 4128   H HH12 . ARG B 2 108 ? 35.089  -22.397 -0.523  1.00 0.00 ? 108 ARG B HH12 1  
ATOM 4129   H HH21 . ARG B 2 108 ? 34.487  -22.861 2.915   1.00 0.00 ? 108 ARG B HH21 1  
ATOM 4130   H HH22 . ARG B 2 108 ? 34.512  -23.623 1.353   1.00 0.00 ? 108 ARG B HH22 1  
ATOM 4131   N N    . THR B 2 109 ? 36.959  -19.552 5.724   1.00 0.00 ? 109 THR B N    1  
ATOM 4132   C CA   . THR B 2 109 ? 38.215  -19.520 6.456   1.00 0.00 ? 109 THR B CA   1  
ATOM 4133   C C    . THR B 2 109 ? 39.133  -18.442 5.885   1.00 0.00 ? 109 THR B C    1  
ATOM 4134   O O    . THR B 2 109 ? 39.710  -17.643 6.626   1.00 0.00 ? 109 THR B O    1  
ATOM 4135   C CB   . THR B 2 109 ? 38.911  -20.890 6.375   1.00 0.00 ? 109 THR B CB   1  
ATOM 4136   O OG1  . THR B 2 109 ? 38.000  -21.837 5.788   1.00 0.00 ? 109 THR B OG1  1  
ATOM 4137   C CG2  . THR B 2 109 ? 39.306  -21.373 7.763   1.00 0.00 ? 109 THR B CG2  1  
ATOM 4138   H H    . THR B 2 109 ? 36.741  -20.348 5.195   1.00 0.00 ? 109 THR B H    1  
ATOM 4139   H HA   . THR B 2 109 ? 38.006  -19.291 7.501   1.00 0.00 ? 109 THR B HA   1  
ATOM 4140   H HB   . THR B 2 109 ? 39.804  -20.806 5.755   1.00 0.00 ? 109 THR B HB   1  
ATOM 4141   H HG1  . THR B 2 109 ? 37.498  -22.272 6.489   1.00 0.00 ? 109 THR B HG1  1  
ATOM 4142   H HG21 . THR B 2 109 ? 38.414  -21.460 8.383   1.00 0.00 ? 109 THR B HG21 1  
ATOM 4143   H HG22 . THR B 2 109 ? 39.792  -22.345 7.689   1.00 0.00 ? 109 THR B HG22 1  
ATOM 4144   H HG23 . THR B 2 109 ? 39.993  -20.657 8.213   1.00 0.00 ? 109 THR B HG23 1  
ATOM 4145   N N    . GLY B 2 110 ? 39.242  -18.414 4.563   1.00 0.00 ? 110 GLY B N    1  
ATOM 4146   C CA   . GLY B 2 110 ? 40.080  -17.431 3.906   1.00 0.00 ? 110 GLY B CA   1  
ATOM 4147   C C    . GLY B 2 110 ? 40.711  -17.989 2.650   1.00 0.00 ? 110 GLY B C    1  
ATOM 4148   O O    . GLY B 2 110 ? 41.633  -18.801 2.722   1.00 0.00 ? 110 GLY B O    1  
ATOM 4149   H H    . GLY B 2 110 ? 38.755  -19.075 4.028   1.00 0.00 ? 110 GLY B H    1  
ATOM 4150   H HA2  . GLY B 2 110 ? 39.472  -16.566 3.644   1.00 0.00 ? 110 GLY B HA2  1  
ATOM 4151   H HA3  . GLY B 2 110 ? 40.869  -17.123 4.592   1.00 0.00 ? 110 GLY B HA3  1  
ATOM 4152   N N    . GLY B 2 111 ? 40.220  -17.555 1.500   1.00 0.00 ? 111 GLY B N    1  
ATOM 4153   C CA   . GLY B 2 111 ? 40.747  -18.041 0.239   1.00 0.00 ? 111 GLY B CA   1  
ATOM 4154   C C    . GLY B 2 111 ? 41.337  -16.935 -0.607  1.00 0.00 ? 111 GLY B C    1  
ATOM 4155   O O    . GLY B 2 111 ? 41.399  -17.045 -1.831  1.00 0.00 ? 111 GLY B O    1  
ATOM 4156   H H    . GLY B 2 111 ? 39.501  -16.886 1.503   1.00 0.00 ? 111 GLY B H    1  
ATOM 4157   H HA2  . GLY B 2 111 ? 41.524  -18.777 0.445   1.00 0.00 ? 111 GLY B HA2  1  
ATOM 4158   H HA3  . GLY B 2 111 ? 39.939  -18.515 -0.317  1.00 0.00 ? 111 GLY B HA3  1  
ATOM 4159   N N    . GLY B 2 112 ? 41.772  -15.866 0.046   1.00 0.00 ? 112 GLY B N    1  
ATOM 4160   C CA   . GLY B 2 112 ? 42.353  -14.747 -0.663  1.00 0.00 ? 112 GLY B CA   1  
ATOM 4161   C C    . GLY B 2 112 ? 41.304  -13.884 -1.323  1.00 0.00 ? 112 GLY B C    1  
ATOM 4162   O O    . GLY B 2 112 ? 40.642  -13.080 -0.664  1.00 0.00 ? 112 GLY B O    1  
ATOM 4163   H H    . GLY B 2 112 ? 41.698  -15.837 1.023   1.00 0.00 ? 112 GLY B H    1  
ATOM 4164   H HA2  . GLY B 2 112 ? 42.917  -14.138 0.044   1.00 0.00 ? 112 GLY B HA2  1  
ATOM 4165   H HA3  . GLY B 2 112 ? 43.029  -15.129 -1.428  1.00 0.00 ? 112 GLY B HA3  1  
ATOM 4166   N N    . GLY B 2 113 ? 41.139  -14.055 -2.626  1.00 0.00 ? 113 GLY B N    1  
ATOM 4167   C CA   . GLY B 2 113 ? 40.159  -13.279 -3.356  1.00 0.00 ? 113 GLY B CA   1  
ATOM 4168   C C    . GLY B 2 113 ? 38.835  -14.007 -3.469  1.00 0.00 ? 113 GLY B C    1  
ATOM 4169   O O    . GLY B 2 113 ? 38.415  -14.377 -4.562  1.00 0.00 ? 113 GLY B O    1  
ATOM 4170   H H    . GLY B 2 113 ? 41.686  -14.722 -3.097  1.00 0.00 ? 113 GLY B H    1  
ATOM 4171   H HA2  . GLY B 2 113 ? 39.999  -12.334 -2.838  1.00 0.00 ? 113 GLY B HA2  1  
ATOM 4172   H HA3  . GLY B 2 113 ? 40.540  -13.082 -4.358  1.00 0.00 ? 113 GLY B HA3  1  
ATOM 4173   N N    . SER B 2 114 ? 38.185  -14.225 -2.338  1.00 0.00 ? 114 SER B N    1  
ATOM 4174   C CA   . SER B 2 114 ? 36.903  -14.913 -2.316  1.00 0.00 ? 114 SER B CA   1  
ATOM 4175   C C    . SER B 2 114 ? 35.750  -13.914 -2.312  1.00 0.00 ? 114 SER B C    1  
ATOM 4176   O O    . SER B 2 114 ? 35.528  -13.210 -1.326  1.00 0.00 ? 114 SER B O    1  
ATOM 4177   C CB   . SER B 2 114 ? 36.815  -15.832 -1.095  1.00 0.00 ? 114 SER B CB   1  
ATOM 4178   O OG   . SER B 2 114 ? 37.888  -16.759 -1.078  1.00 0.00 ? 114 SER B OG   1  
ATOM 4179   H H    . SER B 2 114 ? 38.577  -13.916 -1.494  1.00 0.00 ? 114 SER B H    1  
ATOM 4180   H HA   . SER B 2 114 ? 36.829  -15.524 -3.216  1.00 0.00 ? 114 SER B HA   1  
ATOM 4181   H HB2  . SER B 2 114 ? 36.854  -15.226 -0.190  1.00 0.00 ? 114 SER B HB2  1  
ATOM 4182   H HB3  . SER B 2 114 ? 35.873  -16.378 -1.127  1.00 0.00 ? 114 SER B HB3  1  
ATOM 4183   H HG   . SER B 2 114 ? 38.418  -16.650 -1.878  1.00 0.00 ? 114 SER B HG   1  
ATOM 4184   N N    . GLY B 2 115 ? 35.029  -13.848 -3.423  1.00 0.00 ? 115 GLY B N    1  
ATOM 4185   C CA   . GLY B 2 115 ? 33.909  -12.936 -3.530  1.00 0.00 ? 115 GLY B CA   1  
ATOM 4186   C C    . GLY B 2 115 ? 32.993  -13.295 -4.683  1.00 0.00 ? 115 GLY B C    1  
ATOM 4187   O O    . GLY B 2 115 ? 32.021  -14.034 -4.508  1.00 0.00 ? 115 GLY B O    1  
ATOM 4188   H H    . GLY B 2 115 ? 35.261  -14.424 -4.183  1.00 0.00 ? 115 GLY B H    1  
ATOM 4189   H HA2  . GLY B 2 115 ? 33.337  -12.969 -2.602  1.00 0.00 ? 115 GLY B HA2  1  
ATOM 4190   H HA3  . GLY B 2 115 ? 34.289  -11.926 -3.684  1.00 0.00 ? 115 GLY B HA3  1  
ATOM 4191   N N    . GLY B 2 116 ? 33.314  -12.791 -5.864  1.00 0.00 ? 116 GLY B N    1  
ATOM 4192   C CA   . GLY B 2 116 ? 32.508  -13.066 -7.035  1.00 0.00 ? 116 GLY B CA   1  
ATOM 4193   C C    . GLY B 2 116 ? 32.596  -11.953 -8.058  1.00 0.00 ? 116 GLY B C    1  
ATOM 4194   O O    . GLY B 2 116 ? 33.520  -11.136 -8.019  1.00 0.00 ? 116 GLY B O    1  
ATOM 4195   H H    . GLY B 2 116 ? 34.111  -12.221 -5.944  1.00 0.00 ? 116 GLY B H    1  
ATOM 4196   H HA2  . GLY B 2 116 ? 32.854  -13.993 -7.492  1.00 0.00 ? 116 GLY B HA2  1  
ATOM 4197   H HA3  . GLY B 2 116 ? 31.468  -13.180 -6.728  1.00 0.00 ? 116 GLY B HA3  1  
ATOM 4198   N N    . GLY B 2 117 ? 31.636  -11.914 -8.972  1.00 0.00 ? 117 GLY B N    1  
ATOM 4199   C CA   . GLY B 2 117 ? 31.629  -10.892 -10.000 1.00 0.00 ? 117 GLY B CA   1  
ATOM 4200   C C    . GLY B 2 117 ? 30.469  -9.930  -9.846  1.00 0.00 ? 117 GLY B C    1  
ATOM 4201   O O    . GLY B 2 117 ? 30.056  -9.620  -8.726  1.00 0.00 ? 117 GLY B O    1  
ATOM 4202   H H    . GLY B 2 117 ? 30.919  -12.580 -8.942  1.00 0.00 ? 117 GLY B H    1  
ATOM 4203   H HA2  . GLY B 2 117 ? 32.562  -10.331 -9.943  1.00 0.00 ? 117 GLY B HA2  1  
ATOM 4204   H HA3  . GLY B 2 117 ? 31.558  -11.375 -10.975 1.00 0.00 ? 117 GLY B HA3  1  
ATOM 4205   N N    . GLY B 2 118 ? 29.941  -9.459  -10.968 1.00 0.00 ? 118 GLY B N    1  
ATOM 4206   C CA   . GLY B 2 118 ? 28.830  -8.529  -10.936 1.00 0.00 ? 118 GLY B CA   1  
ATOM 4207   C C    . GLY B 2 118 ? 27.522  -9.186  -11.328 1.00 0.00 ? 118 GLY B C    1  
ATOM 4208   O O    . GLY B 2 118 ? 27.414  -10.412 -11.337 1.00 0.00 ? 118 GLY B O    1  
ATOM 4209   H H    . GLY B 2 118 ? 30.305  -9.751  -11.833 1.00 0.00 ? 118 GLY B H    1  
ATOM 4210   H HA2  . GLY B 2 118 ? 28.734  -8.131  -9.926  1.00 0.00 ? 118 GLY B HA2  1  
ATOM 4211   H HA3  . GLY B 2 118 ? 29.035  -7.713  -11.628 1.00 0.00 ? 118 GLY B HA3  1  
ATOM 4212   N N    . SER B 2 119 ? 26.528  -8.371  -11.651 1.00 0.00 ? 119 SER B N    1  
ATOM 4213   C CA   . SER B 2 119 ? 25.220  -8.875  -12.044 1.00 0.00 ? 119 SER B CA   1  
ATOM 4214   C C    . SER B 2 119 ? 24.863  -8.399  -13.450 1.00 0.00 ? 119 SER B C    1  
ATOM 4215   O O    . SER B 2 119 ? 25.265  -7.309  -13.862 1.00 0.00 ? 119 SER B O    1  
ATOM 4216   C CB   . SER B 2 119 ? 24.159  -8.402  -11.046 1.00 0.00 ? 119 SER B CB   1  
ATOM 4217   O OG   . SER B 2 119 ? 24.643  -8.487  -9.715  1.00 0.00 ? 119 SER B OG   1  
ATOM 4218   H H    . SER B 2 119 ? 26.681  -7.401  -11.637 1.00 0.00 ? 119 SER B H    1  
ATOM 4219   H HA   . SER B 2 119 ? 25.249  -9.964  -12.038 1.00 0.00 ? 119 SER B HA   1  
ATOM 4220   H HB2  . SER B 2 119 ? 23.899  -7.367  -11.265 1.00 0.00 ? 119 SER B HB2  1  
ATOM 4221   H HB3  . SER B 2 119 ? 23.273  -9.028  -11.144 1.00 0.00 ? 119 SER B HB3  1  
ATOM 4222   H HG   . SER B 2 119 ? 25.590  -8.667  -9.733  1.00 0.00 ? 119 SER B HG   1  
ATOM 4223   N N    . GLY B 2 120 ? 24.116  -9.217  -14.183 1.00 0.00 ? 120 GLY B N    1  
ATOM 4224   C CA   . GLY B 2 120 ? 23.720  -8.851  -15.529 1.00 0.00 ? 120 GLY B CA   1  
ATOM 4225   C C    . GLY B 2 120 ? 24.115  -9.896  -16.550 1.00 0.00 ? 120 GLY B C    1  
ATOM 4226   O O    . GLY B 2 120 ? 24.803  -10.868 -16.222 1.00 0.00 ? 120 GLY B O    1  
ATOM 4227   H H    . GLY B 2 120 ? 23.834  -10.081 -13.811 1.00 0.00 ? 120 GLY B H    1  
ATOM 4228   H HA2  . GLY B 2 120 ? 22.638  -8.727  -15.554 1.00 0.00 ? 120 GLY B HA2  1  
ATOM 4229   H HA3  . GLY B 2 120 ? 24.197  -7.907  -15.790 1.00 0.00 ? 120 GLY B HA3  1  
ATOM 4230   N N    . GLY B 2 121 ? 23.677  -9.698  -17.782 1.00 0.00 ? 121 GLY B N    1  
ATOM 4231   C CA   . GLY B 2 121 ? 23.987  -10.620 -18.852 1.00 0.00 ? 121 GLY B CA   1  
ATOM 4232   C C    . GLY B 2 121 ? 23.960  -9.929  -20.201 1.00 0.00 ? 121 GLY B C    1  
ATOM 4233   O O    . GLY B 2 121 ? 24.043  -8.701  -20.277 1.00 0.00 ? 121 GLY B O    1  
ATOM 4234   H H    . GLY B 2 121 ? 23.131  -8.901  -17.976 1.00 0.00 ? 121 GLY B H    1  
ATOM 4235   H HA2  . GLY B 2 121 ? 24.981  -11.036 -18.685 1.00 0.00 ? 121 GLY B HA2  1  
ATOM 4236   H HA3  . GLY B 2 121 ? 23.254  -11.426 -18.850 1.00 0.00 ? 121 GLY B HA3  1  
ATOM 4237   N N    . GLY B 2 122 ? 23.831  -10.711 -21.261 1.00 0.00 ? 122 GLY B N    1  
ATOM 4238   C CA   . GLY B 2 122 ? 23.799  -10.158 -22.600 1.00 0.00 ? 122 GLY B CA   1  
ATOM 4239   C C    . GLY B 2 122 ? 22.534  -9.374  -22.883 1.00 0.00 ? 122 GLY B C    1  
ATOM 4240   O O    . GLY B 2 122 ? 21.447  -9.946  -22.997 1.00 0.00 ? 122 GLY B O    1  
ATOM 4241   H H    . GLY B 2 122 ? 23.750  -11.681 -21.134 1.00 0.00 ? 122 GLY B H    1  
ATOM 4242   H HA2  . GLY B 2 122 ? 24.656  -9.496  -22.723 1.00 0.00 ? 122 GLY B HA2  1  
ATOM 4243   H HA3  . GLY B 2 122 ? 23.870  -10.977 -23.317 1.00 0.00 ? 122 GLY B HA3  1  
ATOM 4244   N N    . GLY B 2 123 ? 22.672  -8.059  -22.984 1.00 0.00 ? 123 GLY B N    1  
ATOM 4245   C CA   . GLY B 2 123 ? 21.534  -7.210  -23.264 1.00 0.00 ? 123 GLY B CA   1  
ATOM 4246   C C    . GLY B 2 123 ? 21.124  -6.376  -22.069 1.00 0.00 ? 123 GLY B C    1  
ATOM 4247   O O    . GLY B 2 123 ? 20.234  -5.532  -22.171 1.00 0.00 ? 123 GLY B O    1  
ATOM 4248   H H    . GLY B 2 123 ? 23.560  -7.658  -22.857 1.00 0.00 ? 123 GLY B H    1  
ATOM 4249   H HA2  . GLY B 2 123 ? 21.789  -6.542  -24.087 1.00 0.00 ? 123 GLY B HA2  1  
ATOM 4250   H HA3  . GLY B 2 123 ? 20.693  -7.838  -23.558 1.00 0.00 ? 123 GLY B HA3  1  
ATOM 4251   N N    . SER B 2 124 ? 21.770  -6.609  -20.935 1.00 0.00 ? 124 SER B N    1  
ATOM 4252   C CA   . SER B 2 124 ? 21.463  -5.873  -19.720 1.00 0.00 ? 124 SER B CA   1  
ATOM 4253   C C    . SER B 2 124 ? 21.822  -4.397  -19.858 1.00 0.00 ? 124 SER B C    1  
ATOM 4254   O O    . SER B 2 124 ? 22.985  -4.041  -20.057 1.00 0.00 ? 124 SER B O    1  
ATOM 4255   C CB   . SER B 2 124 ? 22.177  -6.500  -18.525 1.00 0.00 ? 124 SER B CB   1  
ATOM 4256   O OG   . SER B 2 124 ? 21.753  -7.841  -18.343 1.00 0.00 ? 124 SER B OG   1  
ATOM 4257   H H    . SER B 2 124 ? 22.476  -7.290  -20.914 1.00 0.00 ? 124 SER B H    1  
ATOM 4258   H HA   . SER B 2 124 ? 20.389  -5.944  -19.549 1.00 0.00 ? 124 SER B HA   1  
ATOM 4259   H HB2  . SER B 2 124 ? 23.253  -6.485  -18.701 1.00 0.00 ? 124 SER B HB2  1  
ATOM 4260   H HB3  . SER B 2 124 ? 21.947  -5.926  -17.627 1.00 0.00 ? 124 SER B HB3  1  
ATOM 4261   H HG   . SER B 2 124 ? 20.791  -7.884  -18.434 1.00 0.00 ? 124 SER B HG   1  
ATOM 4262   N N    . GLY B 2 125 ? 20.805  -3.547  -19.770 1.00 0.00 ? 125 GLY B N    1  
ATOM 4263   C CA   . GLY B 2 125 ? 21.006  -2.113  -19.887 1.00 0.00 ? 125 GLY B CA   1  
ATOM 4264   C C    . GLY B 2 125 ? 21.326  -1.672  -21.303 1.00 0.00 ? 125 GLY B C    1  
ATOM 4265   O O    . GLY B 2 125 ? 21.653  -0.509  -21.536 1.00 0.00 ? 125 GLY B O    1  
ATOM 4266   H H    . GLY B 2 125 ? 19.900  -3.903  -19.600 1.00 0.00 ? 125 GLY B H    1  
ATOM 4267   H HA2  . GLY B 2 125 ? 20.097  -1.607  -19.562 1.00 0.00 ? 125 GLY B HA2  1  
ATOM 4268   H HA3  . GLY B 2 125 ? 21.832  -1.825  -19.237 1.00 0.00 ? 125 GLY B HA3  1  
ATOM 4269   N N    . GLY B 2 126 ? 21.219  -2.592  -22.252 1.00 0.00 ? 126 GLY B N    1  
ATOM 4270   C CA   . GLY B 2 126 ? 21.519  -2.266  -23.631 1.00 0.00 ? 126 GLY B CA   1  
ATOM 4271   C C    . GLY B 2 126 ? 20.522  -2.861  -24.601 1.00 0.00 ? 126 GLY B C    1  
ATOM 4272   O O    . GLY B 2 126 ? 19.336  -2.525  -24.568 1.00 0.00 ? 126 GLY B O    1  
ATOM 4273   H H    . GLY B 2 126 ? 20.928  -3.499  -22.014 1.00 0.00 ? 126 GLY B H    1  
ATOM 4274   H HA2  . GLY B 2 126 ? 21.511  -1.181  -23.742 1.00 0.00 ? 126 GLY B HA2  1  
ATOM 4275   H HA3  . GLY B 2 126 ? 22.512  -2.646  -23.872 1.00 0.00 ? 126 GLY B HA3  1  
ATOM 4276   N N    . GLY B 2 127 ? 21.004  -3.754  -25.458 1.00 0.00 ? 127 GLY B N    1  
ATOM 4277   C CA   . GLY B 2 127 ? 20.146  -4.384  -26.442 1.00 0.00 ? 127 GLY B CA   1  
ATOM 4278   C C    . GLY B 2 127 ? 19.308  -5.495  -25.851 1.00 0.00 ? 127 GLY B C    1  
ATOM 4279   O O    . GLY B 2 127 ? 19.652  -6.671  -25.970 1.00 0.00 ? 127 GLY B O    1  
ATOM 4280   H H    . GLY B 2 127 ? 21.955  -3.993  -25.421 1.00 0.00 ? 127 GLY B H    1  
ATOM 4281   H HA2  . GLY B 2 127 ? 19.482  -3.629  -26.862 1.00 0.00 ? 127 GLY B HA2  1  
ATOM 4282   H HA3  . GLY B 2 127 ? 20.769  -4.798  -27.235 1.00 0.00 ? 127 GLY B HA3  1  
ATOM 4283   N N    . GLY B 2 128 ? 18.216  -5.121  -25.205 1.00 0.00 ? 128 GLY B N    1  
ATOM 4284   C CA   . GLY B 2 128 ? 17.334  -6.093  -24.603 1.00 0.00 ? 128 GLY B CA   1  
ATOM 4285   C C    . GLY B 2 128 ? 16.313  -5.433  -23.706 1.00 0.00 ? 128 GLY B C    1  
ATOM 4286   O O    . GLY B 2 128 ? 16.409  -4.235  -23.427 1.00 0.00 ? 128 GLY B O    1  
ATOM 4287   H H    . GLY B 2 128 ? 18.010  -4.162  -25.123 1.00 0.00 ? 128 GLY B H    1  
ATOM 4288   H HA2  . GLY B 2 128 ? 16.814  -6.637  -25.391 1.00 0.00 ? 128 GLY B HA2  1  
ATOM 4289   H HA3  . GLY B 2 128 ? 17.926  -6.791  -24.012 1.00 0.00 ? 128 GLY B HA3  1  
ATOM 4290   N N    . SER B 2 129 ? 15.336  -6.202  -23.256 1.00 0.00 ? 129 SER B N    1  
ATOM 4291   C CA   . SER B 2 129 ? 14.296  -5.679  -22.384 1.00 0.00 ? 129 SER B CA   1  
ATOM 4292   C C    . SER B 2 129 ? 14.829  -5.509  -20.964 1.00 0.00 ? 129 SER B C    1  
ATOM 4293   O O    . SER B 2 129 ? 15.550  -6.369  -20.456 1.00 0.00 ? 129 SER B O    1  
ATOM 4294   C CB   . SER B 2 129 ? 13.085  -6.612  -22.402 1.00 0.00 ? 129 SER B CB   1  
ATOM 4295   O OG   . SER B 2 129 ? 12.778  -7.004  -23.733 1.00 0.00 ? 129 SER B OG   1  
ATOM 4296   H H    . SER B 2 129 ? 15.314  -7.151  -23.512 1.00 0.00 ? 129 SER B H    1  
ATOM 4297   H HA   . SER B 2 129 ? 13.989  -4.703  -22.760 1.00 0.00 ? 129 SER B HA   1  
ATOM 4298   H HB2  . SER B 2 129 ? 13.307  -7.499  -21.809 1.00 0.00 ? 129 SER B HB2  1  
ATOM 4299   H HB3  . SER B 2 129 ? 12.227  -6.093  -21.975 1.00 0.00 ? 129 SER B HB3  1  
ATOM 4300   H HG   . SER B 2 129 ? 13.344  -6.517  -24.351 1.00 0.00 ? 129 SER B HG   1  
ATOM 4301   N N    . GLU B 2 130 ? 14.493  -4.389  -20.337 1.00 0.00 ? 130 GLU B N    1  
ATOM 4302   C CA   . GLU B 2 130 ? 14.944  -4.114  -18.984 1.00 0.00 ? 130 GLU B CA   1  
ATOM 4303   C C    . GLU B 2 130 ? 13.849  -3.430  -18.177 1.00 0.00 ? 130 GLU B C    1  
ATOM 4304   O O    . GLU B 2 130 ? 13.464  -2.299  -18.472 1.00 0.00 ? 130 GLU B O    1  
ATOM 4305   C CB   . GLU B 2 130 ? 16.193  -3.229  -19.017 1.00 0.00 ? 130 GLU B CB   1  
ATOM 4306   C CG   . GLU B 2 130 ? 17.071  -3.348  -17.783 1.00 0.00 ? 130 GLU B CG   1  
ATOM 4307   C CD   . GLU B 2 130 ? 17.787  -4.681  -17.711 1.00 0.00 ? 130 GLU B CD   1  
ATOM 4308   O OE1  . GLU B 2 130 ? 18.877  -4.806  -18.303 1.00 0.00 ? 130 GLU B OE1  1  
ATOM 4309   O OE2  . GLU B 2 130 ? 17.267  -5.609  -17.061 1.00 0.00 ? 130 GLU B OE2  1  
ATOM 4310   H H    . GLU B 2 130 ? 13.934  -3.728  -20.798 1.00 0.00 ? 130 GLU B H    1  
ATOM 4311   H HA   . GLU B 2 130 ? 15.196  -5.059  -18.504 1.00 0.00 ? 130 GLU B HA   1  
ATOM 4312   H HB2  . GLU B 2 130 ? 16.786  -3.507  -19.888 1.00 0.00 ? 130 GLU B HB2  1  
ATOM 4313   H HB3  . GLU B 2 130 ? 15.874  -2.190  -19.111 1.00 0.00 ? 130 GLU B HB3  1  
ATOM 4314   H HG2  . GLU B 2 130 ? 17.814  -2.551  -17.803 1.00 0.00 ? 130 GLU B HG2  1  
ATOM 4315   H HG3  . GLU B 2 130 ? 16.448  -3.236  -16.896 1.00 0.00 ? 130 GLU B HG3  1  
ATOM 4316   H HE2  . GLU B 2 130 ? 17.778  -6.422  -17.059 1.00 0.00 ? 130 GLU B HE2  1  
ATOM 4317   N N    . VAL B 2 131 ? 13.337  -4.129  -17.175 1.00 0.00 ? 131 VAL B N    1  
ATOM 4318   C CA   . VAL B 2 131 ? 12.297  -3.584  -16.313 1.00 0.00 ? 131 VAL B CA   1  
ATOM 4319   C C    . VAL B 2 131 ? 12.951  -2.784  -15.199 1.00 0.00 ? 131 VAL B C    1  
ATOM 4320   O O    . VAL B 2 131 ? 13.781  -3.314  -14.458 1.00 0.00 ? 131 VAL B O    1  
ATOM 4321   C CB   . VAL B 2 131 ? 11.436  -4.704  -15.693 1.00 0.00 ? 131 VAL B CB   1  
ATOM 4322   C CG1  . VAL B 2 131 ? 10.316  -4.118  -14.844 1.00 0.00 ? 131 VAL B CG1  1  
ATOM 4323   C CG2  . VAL B 2 131 ? 10.872  -5.610  -16.775 1.00 0.00 ? 131 VAL B CG2  1  
ATOM 4324   H H    . VAL B 2 131 ? 13.678  -5.028  -17.000 1.00 0.00 ? 131 VAL B H    1  
ATOM 4325   H HA   . VAL B 2 131 ? 11.656  -2.930  -16.905 1.00 0.00 ? 131 VAL B HA   1  
ATOM 4326   H HB   . VAL B 2 131 ? 12.074  -5.305  -15.045 1.00 0.00 ? 131 VAL B HB   1  
ATOM 4327   H HG11 . VAL B 2 131 ? 9.733   -4.922  -14.394 1.00 0.00 ? 131 VAL B HG11 1  
ATOM 4328   H HG12 . VAL B 2 131 ? 10.746  -3.499  -14.056 1.00 0.00 ? 131 VAL B HG12 1  
ATOM 4329   H HG13 . VAL B 2 131 ? 9.667   -3.508  -15.471 1.00 0.00 ? 131 VAL B HG13 1  
ATOM 4330   H HG21 . VAL B 2 131 ? 11.692  -6.043  -17.348 1.00 0.00 ? 131 VAL B HG21 1  
ATOM 4331   H HG22 . VAL B 2 131 ? 10.287  -6.410  -16.320 1.00 0.00 ? 131 VAL B HG22 1  
ATOM 4332   H HG23 . VAL B 2 131 ? 10.233  -5.028  -17.439 1.00 0.00 ? 131 VAL B HG23 1  
ATOM 4333   N N    . GLN B 2 132 ? 12.595  -1.511  -15.073 1.00 0.00 ? 132 GLN B N    1  
ATOM 4334   C CA   . GLN B 2 132 ? 13.192  -0.669  -14.051 1.00 0.00 ? 132 GLN B CA   1  
ATOM 4335   C C    . GLN B 2 132 ? 12.194  0.309   -13.435 1.00 0.00 ? 132 GLN B C    1  
ATOM 4336   O O    . GLN B 2 132 ? 11.342  0.872   -14.129 1.00 0.00 ? 132 GLN B O    1  
ATOM 4337   C CB   . GLN B 2 132 ? 14.389  0.093   -14.623 1.00 0.00 ? 132 GLN B CB   1  
ATOM 4338   C CG   . GLN B 2 132 ? 14.095  0.819   -15.927 1.00 0.00 ? 132 GLN B CG   1  
ATOM 4339   C CD   . GLN B 2 132 ? 15.268  1.631   -16.428 1.00 0.00 ? 132 GLN B CD   1  
ATOM 4340   O OE1  . GLN B 2 132 ? 16.081  2.126   -15.645 1.00 0.00 ? 132 GLN B OE1  1  
ATOM 4341   N NE2  . GLN B 2 132 ? 15.363  1.789   -17.739 1.00 0.00 ? 132 GLN B NE2  1  
ATOM 4342   H H    . GLN B 2 132 ? 11.923  -1.128  -15.685 1.00 0.00 ? 132 GLN B H    1  
ATOM 4343   H HA   . GLN B 2 132 ? 13.552  -1.323  -13.257 1.00 0.00 ? 132 GLN B HA   1  
ATOM 4344   H HB2  . GLN B 2 132 ? 14.711  0.829   -13.886 1.00 0.00 ? 132 GLN B HB2  1  
ATOM 4345   H HB3  . GLN B 2 132 ? 15.195  -0.619  -14.801 1.00 0.00 ? 132 GLN B HB3  1  
ATOM 4346   H HG2  . GLN B 2 132 ? 13.832  0.082   -16.685 1.00 0.00 ? 132 GLN B HG2  1  
ATOM 4347   H HG3  . GLN B 2 132 ? 13.249  1.489   -15.769 1.00 0.00 ? 132 GLN B HG3  1  
ATOM 4348   H HE21 . GLN B 2 132 ? 14.675  1.377   -18.309 1.00 0.00 ? 132 GLN B HE21 1  
ATOM 4349   H HE22 . GLN B 2 132 ? 16.112  2.314   -18.088 1.00 0.00 ? 132 GLN B HE22 1  
ATOM 4350   N N    . LEU B 2 133 ? 12.302  0.481   -12.124 1.00 0.00 ? 133 LEU B N    1  
ATOM 4351   C CA   . LEU B 2 133 ? 11.458  1.404   -11.378 1.00 0.00 ? 133 LEU B CA   1  
ATOM 4352   C C    . LEU B 2 133 ? 12.346  2.389   -10.626 1.00 0.00 ? 133 LEU B C    1  
ATOM 4353   O O    . LEU B 2 133 ? 13.159  1.982   -9.796  1.00 0.00 ? 133 LEU B O    1  
ATOM 4354   C CB   . LEU B 2 133 ? 10.580  0.645   -10.378 1.00 0.00 ? 133 LEU B CB   1  
ATOM 4355   C CG   . LEU B 2 133 ? 9.434   -0.187  -10.960 1.00 0.00 ? 133 LEU B CG   1  
ATOM 4356   C CD1  . LEU B 2 133 ? 8.708   -0.936  -9.853  1.00 0.00 ? 133 LEU B CD1  1  
ATOM 4357   C CD2  . LEU B 2 133 ? 8.464   0.699   -11.722 1.00 0.00 ? 133 LEU B CD2  1  
ATOM 4358   H H    . LEU B 2 133 ? 12.978  -0.037  -11.633 1.00 0.00 ? 133 LEU B H    1  
ATOM 4359   H HA   . LEU B 2 133 ? 10.820  1.948   -12.076 1.00 0.00 ? 133 LEU B HA   1  
ATOM 4360   H HB2  . LEU B 2 133 ? 11.226  -0.030  -9.817  1.00 0.00 ? 133 LEU B HB2  1  
ATOM 4361   H HB3  . LEU B 2 133 ? 10.144  1.378   -9.699  1.00 0.00 ? 133 LEU B HB3  1  
ATOM 4362   H HG   . LEU B 2 133 ? 9.854   -0.916  -11.654 1.00 0.00 ? 133 LEU B HG   1  
ATOM 4363   H HD11 . LEU B 2 133 ? 7.907   -1.540  -10.280 1.00 0.00 ? 133 LEU B HD11 1  
ATOM 4364   H HD12 . LEU B 2 133 ? 9.412   -1.586  -9.333  1.00 0.00 ? 133 LEU B HD12 1  
ATOM 4365   H HD13 . LEU B 2 133 ? 8.285   -0.220  -9.148  1.00 0.00 ? 133 LEU B HD13 1  
ATOM 4366   H HD21 . LEU B 2 133 ? 8.995   1.209   -12.525 1.00 0.00 ? 133 LEU B HD21 1  
ATOM 4367   H HD22 . LEU B 2 133 ? 7.665   0.091   -12.146 1.00 0.00 ? 133 LEU B HD22 1  
ATOM 4368   H HD23 . LEU B 2 133 ? 8.036   1.436   -11.043 1.00 0.00 ? 133 LEU B HD23 1  
ATOM 4369   N N    . VAL B 2 134 ? 12.212  3.671   -10.930 1.00 0.00 ? 134 VAL B N    1  
ATOM 4370   C CA   . VAL B 2 134 ? 13.031  4.691   -10.279 1.00 0.00 ? 134 VAL B CA   1  
ATOM 4371   C C    . VAL B 2 134 ? 12.171  5.717   -9.549  1.00 0.00 ? 134 VAL B C    1  
ATOM 4372   O O    . VAL B 2 134 ? 11.512  6.555   -10.176 1.00 0.00 ? 134 VAL B O    1  
ATOM 4373   C CB   . VAL B 2 134 ? 13.957  5.415   -11.280 1.00 0.00 ? 134 VAL B CB   1  
ATOM 4374   C CG1  . VAL B 2 134 ? 14.863  6.405   -10.555 1.00 0.00 ? 134 VAL B CG1  1  
ATOM 4375   C CG2  . VAL B 2 134 ? 14.787  4.419   -12.076 1.00 0.00 ? 134 VAL B CG2  1  
ATOM 4376   H H    . VAL B 2 134 ? 11.546  3.943   -11.600 1.00 0.00 ? 134 VAL B H    1  
ATOM 4377   H HA   . VAL B 2 134 ? 13.657  4.185   -9.543  1.00 0.00 ? 134 VAL B HA   1  
ATOM 4378   H HB   . VAL B 2 134 ? 13.333  5.972   -11.978 1.00 0.00 ? 134 VAL B HB   1  
ATOM 4379   H HG11 . VAL B 2 134 ? 15.493  6.927   -11.276 1.00 0.00 ? 134 VAL B HG11 1  
ATOM 4380   H HG12 . VAL B 2 134 ? 14.251  7.131   -10.019 1.00 0.00 ? 134 VAL B HG12 1  
ATOM 4381   H HG13 . VAL B 2 134 ? 15.494  5.868   -9.847  1.00 0.00 ? 134 VAL B HG13 1  
ATOM 4382   H HG21 . VAL B 2 134 ? 14.122  3.741   -12.611 1.00 0.00 ? 134 VAL B HG21 1  
ATOM 4383   H HG22 . VAL B 2 134 ? 15.416  4.948   -12.792 1.00 0.00 ? 134 VAL B HG22 1  
ATOM 4384   H HG23 . VAL B 2 134 ? 15.417  3.847   -11.394 1.00 0.00 ? 134 VAL B HG23 1  
ATOM 4385   N N    . GLU B 2 135 ? 12.154  5.625   -8.229  1.00 0.00 ? 135 GLU B N    1  
ATOM 4386   C CA   . GLU B 2 135 ? 11.396  6.549   -7.402  1.00 0.00 ? 135 GLU B CA   1  
ATOM 4387   C C    . GLU B 2 135 ? 12.210  7.808   -7.106  1.00 0.00 ? 135 GLU B C    1  
ATOM 4388   O O    . GLU B 2 135 ? 13.441  7.790   -7.129  1.00 0.00 ? 135 GLU B O    1  
ATOM 4389   C CB   . GLU B 2 135 ? 10.979  5.874   -6.092  1.00 0.00 ? 135 GLU B CB   1  
ATOM 4390   C CG   . GLU B 2 135 ? 10.471  4.450   -6.255  1.00 0.00 ? 135 GLU B CG   1  
ATOM 4391   C CD   . GLU B 2 135 ? 11.555  3.409   -6.046  1.00 0.00 ? 135 GLU B CD   1  
ATOM 4392   O OE1  . GLU B 2 135 ? 12.660  3.566   -6.608  1.00 0.00 ? 135 GLU B OE1  1  
ATOM 4393   O OE2  . GLU B 2 135 ? 11.305  2.427   -5.320  1.00 0.00 ? 135 GLU B OE2  1  
ATOM 4394   H H    . GLU B 2 135 ? 12.635  4.880   -7.791  1.00 0.00 ? 135 GLU B H    1  
ATOM 4395   H HA   . GLU B 2 135 ? 10.497  6.836   -7.947  1.00 0.00 ? 135 GLU B HA   1  
ATOM 4396   H HB2  . GLU B 2 135 ? 11.843  5.855   -5.428  1.00 0.00 ? 135 GLU B HB2  1  
ATOM 4397   H HB3  . GLU B 2 135 ? 10.186  6.469   -5.639  1.00 0.00 ? 135 GLU B HB3  1  
ATOM 4398   H HG2  . GLU B 2 135 ? 9.678   4.277   -5.528  1.00 0.00 ? 135 GLU B HG2  1  
ATOM 4399   H HG3  . GLU B 2 135 ? 10.067  4.336   -7.260  1.00 0.00 ? 135 GLU B HG3  1  
ATOM 4400   H HE2  . GLU B 2 135 ? 12.034  1.809   -5.233  1.00 0.00 ? 135 GLU B HE2  1  
ATOM 4401   N N    . SER B 2 136 ? 11.511  8.907   -6.855  1.00 0.00 ? 136 SER B N    1  
ATOM 4402   C CA   . SER B 2 136 ? 12.140  10.183  -6.547  1.00 0.00 ? 136 SER B CA   1  
ATOM 4403   C C    . SER B 2 136 ? 11.179  11.055  -5.741  1.00 0.00 ? 136 SER B C    1  
ATOM 4404   O O    . SER B 2 136 ? 9.993   10.732  -5.623  1.00 0.00 ? 136 SER B O    1  
ATOM 4405   C CB   . SER B 2 136 ? 12.541  10.903  -7.840  1.00 0.00 ? 136 SER B CB   1  
ATOM 4406   O OG   . SER B 2 136 ? 13.408  10.098  -8.623  1.00 0.00 ? 136 SER B OG   1  
ATOM 4407   H H    . SER B 2 136 ? 10.529  8.863   -6.891  1.00 0.00 ? 136 SER B H    1  
ATOM 4408   H HA   . SER B 2 136 ? 13.035  9.999   -5.954  1.00 0.00 ? 136 SER B HA   1  
ATOM 4409   H HB2  . SER B 2 136 ? 11.644  11.125  -8.418  1.00 0.00 ? 136 SER B HB2  1  
ATOM 4410   H HB3  . SER B 2 136 ? 13.050  11.833  -7.588  1.00 0.00 ? 136 SER B HB3  1  
ATOM 4411   H HG   . SER B 2 136 ? 13.530  9.242   -8.186  1.00 0.00 ? 136 SER B HG   1  
ATOM 4412   N N    . GLY B 2 137 ? 11.689  12.152  -5.186  1.00 0.00 ? 137 GLY B N    1  
ATOM 4413   C CA   . GLY B 2 137 ? 10.851  13.046  -4.408  1.00 0.00 ? 137 GLY B CA   1  
ATOM 4414   C C    . GLY B 2 137 ? 11.178  13.036  -2.928  1.00 0.00 ? 137 GLY B C    1  
ATOM 4415   O O    . GLY B 2 137 ? 10.742  13.918  -2.190  1.00 0.00 ? 137 GLY B O    1  
ATOM 4416   H H    . GLY B 2 137 ? 12.636  12.367  -5.322  1.00 0.00 ? 137 GLY B H    1  
ATOM 4417   H HA2  . GLY B 2 137 ? 10.982  14.060  -4.786  1.00 0.00 ? 137 GLY B HA2  1  
ATOM 4418   H HA3  . GLY B 2 137 ? 9.811   12.745  -4.536  1.00 0.00 ? 137 GLY B HA3  1  
ATOM 4419   N N    . GLY B 2 138 ? 11.943  12.038  -2.493  1.00 0.00 ? 138 GLY B N    1  
ATOM 4420   C CA   . GLY B 2 138 ? 12.315  11.931  -1.092  1.00 0.00 ? 138 GLY B CA   1  
ATOM 4421   C C    . GLY B 2 138 ? 13.156  13.096  -0.604  1.00 0.00 ? 138 GLY B C    1  
ATOM 4422   O O    . GLY B 2 138 ? 13.808  13.781  -1.398  1.00 0.00 ? 138 GLY B O    1  
ATOM 4423   H H    . GLY B 2 138 ? 12.248  11.357  -3.123  1.00 0.00 ? 138 GLY B H    1  
ATOM 4424   H HA2  . GLY B 2 138 ? 11.404  11.886  -0.494  1.00 0.00 ? 138 GLY B HA2  1  
ATOM 4425   H HA3  . GLY B 2 138 ? 12.882  11.010  -0.953  1.00 0.00 ? 138 GLY B HA3  1  
ATOM 4426   N N    . GLY B 2 139 ? 13.166  13.303  0.706   1.00 0.00 ? 139 GLY B N    1  
ATOM 4427   C CA   . GLY B 2 139 ? 13.915  14.393  1.290   1.00 0.00 ? 139 GLY B CA   1  
ATOM 4428   C C    . GLY B 2 139 ? 13.559  14.608  2.745   1.00 0.00 ? 139 GLY B C    1  
ATOM 4429   O O    . GLY B 2 139 ? 12.899  13.764  3.360   1.00 0.00 ? 139 GLY B O    1  
ATOM 4430   H H    . GLY B 2 139 ? 12.687  12.682  1.292   1.00 0.00 ? 139 GLY B H    1  
ATOM 4431   H HA2  . GLY B 2 139 ? 14.979  14.169  1.216   1.00 0.00 ? 139 GLY B HA2  1  
ATOM 4432   H HA3  . GLY B 2 139 ? 13.700  15.306  0.735   1.00 0.00 ? 139 GLY B HA3  1  
ATOM 4433   N N    . LEU B 2 140 ? 13.998  15.734  3.295   1.00 0.00 ? 140 LEU B N    1  
ATOM 4434   C CA   . LEU B 2 140 ? 13.724  16.069  4.686   1.00 0.00 ? 140 LEU B CA   1  
ATOM 4435   C C    . LEU B 2 140 ? 12.599  17.093  4.769   1.00 0.00 ? 140 LEU B C    1  
ATOM 4436   O O    . LEU B 2 140 ? 12.704  18.190  4.217   1.00 0.00 ? 140 LEU B O    1  
ATOM 4437   C CB   . LEU B 2 140 ? 14.987  16.618  5.360   1.00 0.00 ? 140 LEU B CB   1  
ATOM 4438   C CG   . LEU B 2 140 ? 14.856  17.018  6.833   1.00 0.00 ? 140 LEU B CG   1  
ATOM 4439   C CD1  . LEU B 2 140 ? 14.819  15.791  7.728   1.00 0.00 ? 140 LEU B CD1  1  
ATOM 4440   C CD2  . LEU B 2 140 ? 15.986  17.947  7.243   1.00 0.00 ? 140 LEU B CD2  1  
ATOM 4441   H H    . LEU B 2 140 ? 14.522  16.360  2.748   1.00 0.00 ? 140 LEU B H    1  
ATOM 4442   H HA   . LEU B 2 140 ? 13.414  15.162  5.206   1.00 0.00 ? 140 LEU B HA   1  
ATOM 4443   H HB2  . LEU B 2 140 ? 15.759  15.852  5.292   1.00 0.00 ? 140 LEU B HB2  1  
ATOM 4444   H HB3  . LEU B 2 140 ? 15.302  17.501  4.804   1.00 0.00 ? 140 LEU B HB3  1  
ATOM 4445   H HG   . LEU B 2 140 ? 13.915  17.554  6.956   1.00 0.00 ? 140 LEU B HG   1  
ATOM 4446   H HD11 . LEU B 2 140 ? 14.700  16.093  8.768   1.00 0.00 ? 140 LEU B HD11 1  
ATOM 4447   H HD12 . LEU B 2 140 ? 13.980  15.157  7.438   1.00 0.00 ? 140 LEU B HD12 1  
ATOM 4448   H HD13 . LEU B 2 140 ? 15.750  15.235  7.618   1.00 0.00 ? 140 LEU B HD13 1  
ATOM 4449   H HD21 . LEU B 2 140 ? 15.972  18.835  6.611   1.00 0.00 ? 140 LEU B HD21 1  
ATOM 4450   H HD22 . LEU B 2 140 ? 15.863  18.244  8.285   1.00 0.00 ? 140 LEU B HD22 1  
ATOM 4451   H HD23 . LEU B 2 140 ? 16.939  17.432  7.124   1.00 0.00 ? 140 LEU B HD23 1  
ATOM 4452   N N    . VAL B 2 141 ? 11.531  16.738  5.463   1.00 0.00 ? 141 VAL B N    1  
ATOM 4453   C CA   . VAL B 2 141 ? 10.391  17.628  5.613   1.00 0.00 ? 141 VAL B CA   1  
ATOM 4454   C C    . VAL B 2 141 ? 10.020  17.775  7.087   1.00 0.00 ? 141 VAL B C    1  
ATOM 4455   O O    . VAL B 2 141 ? 10.324  16.903  7.902   1.00 0.00 ? 141 VAL B O    1  
ATOM 4456   C CB   . VAL B 2 141 ? 9.175   17.139  4.783   1.00 0.00 ? 141 VAL B CB   1  
ATOM 4457   C CG1  . VAL B 2 141 ? 8.546   15.891  5.384   1.00 0.00 ? 141 VAL B CG1  1  
ATOM 4458   C CG2  . VAL B 2 141 ? 8.141   18.240  4.595   1.00 0.00 ? 141 VAL B CG2  1  
ATOM 4459   H H    . VAL B 2 141 ? 11.510  15.855  5.899   1.00 0.00 ? 141 VAL B H    1  
ATOM 4460   H HA   . VAL B 2 141 ? 10.683  18.609  5.236   1.00 0.00 ? 141 VAL B HA   1  
ATOM 4461   H HB   . VAL B 2 141 ? 9.546   16.870  3.794   1.00 0.00 ? 141 VAL B HB   1  
ATOM 4462   H HG11 . VAL B 2 141 ? 7.722   15.547  4.759   1.00 0.00 ? 141 VAL B HG11 1  
ATOM 4463   H HG12 . VAL B 2 141 ? 9.298   15.105  5.452   1.00 0.00 ? 141 VAL B HG12 1  
ATOM 4464   H HG13 . VAL B 2 141 ? 8.169   16.121  6.381   1.00 0.00 ? 141 VAL B HG13 1  
ATOM 4465   H HG21 . VAL B 2 141 ? 8.610   19.097  4.111   1.00 0.00 ? 141 VAL B HG21 1  
ATOM 4466   H HG22 . VAL B 2 141 ? 7.319   17.882  3.974   1.00 0.00 ? 141 VAL B HG22 1  
ATOM 4467   H HG23 . VAL B 2 141 ? 7.752   18.541  5.568   1.00 0.00 ? 141 VAL B HG23 1  
ATOM 4468   N N    . GLN B 2 142 ? 9.396   18.892  7.427   1.00 0.00 ? 142 GLN B N    1  
ATOM 4469   C CA   . GLN B 2 142 ? 8.982   19.156  8.796   1.00 0.00 ? 142 GLN B CA   1  
ATOM 4470   C C    . GLN B 2 142 ? 7.716   18.365  9.117   1.00 0.00 ? 142 GLN B C    1  
ATOM 4471   O O    . GLN B 2 142 ? 6.850   18.200  8.254   1.00 0.00 ? 142 GLN B O    1  
ATOM 4472   C CB   . GLN B 2 142 ? 8.730   20.656  8.981   1.00 0.00 ? 142 GLN B CB   1  
ATOM 4473   C CG   . GLN B 2 142 ? 9.333   21.240  10.247  1.00 0.00 ? 142 GLN B CG   1  
ATOM 4474   C CD   . GLN B 2 142 ? 10.202  22.452  9.973   1.00 0.00 ? 142 GLN B CD   1  
ATOM 4475   O OE1  . GLN B 2 142 ? 11.403  22.331  9.747   1.00 0.00 ? 142 GLN B OE1  1  
ATOM 4476   N NE2  . GLN B 2 142 ? 9.604   23.633  9.997   1.00 0.00 ? 142 GLN B NE2  1  
ATOM 4477   H H    . GLN B 2 142 ? 9.203   19.558  6.735   1.00 0.00 ? 142 GLN B H    1  
ATOM 4478   H HA   . GLN B 2 142 ? 9.778   18.843  9.472   1.00 0.00 ? 142 GLN B HA   1  
ATOM 4479   H HB2  . GLN B 2 142 ? 9.157   21.181  8.126   1.00 0.00 ? 142 GLN B HB2  1  
ATOM 4480   H HB3  . GLN B 2 142 ? 7.653   20.821  9.008   1.00 0.00 ? 142 GLN B HB3  1  
ATOM 4481   H HG2  . GLN B 2 142 ? 8.525   21.534  10.917  1.00 0.00 ? 142 GLN B HG2  1  
ATOM 4482   H HG3  . GLN B 2 142 ? 9.940   20.476  10.731  1.00 0.00 ? 142 GLN B HG3  1  
ATOM 4483   H HE21 . GLN B 2 142 ? 8.640   23.663  10.190  1.00 0.00 ? 142 GLN B HE21 1  
ATOM 4484   H HE22 . GLN B 2 142 ? 10.147  24.430  9.831   1.00 0.00 ? 142 GLN B HE22 1  
ATOM 4485   N N    . PRO B 2 143 ? 7.599   17.852  10.355  1.00 0.00 ? 143 PRO B N    1  
ATOM 4486   C CA   . PRO B 2 143 ? 6.430   17.076  10.792  1.00 0.00 ? 143 PRO B CA   1  
ATOM 4487   C C    . PRO B 2 143 ? 5.125   17.811  10.502  1.00 0.00 ? 143 PRO B C    1  
ATOM 4488   O O    . PRO B 2 143 ? 5.037   19.030  10.659  1.00 0.00 ? 143 PRO B O    1  
ATOM 4489   C CB   . PRO B 2 143 ? 6.641   16.939  12.302  1.00 0.00 ? 143 PRO B CB   1  
ATOM 4490   C CG   . PRO B 2 143 ? 8.117   17.017  12.474  1.00 0.00 ? 143 PRO B CG   1  
ATOM 4491   C CD   . PRO B 2 143 ? 8.603   17.980  11.426  1.00 0.00 ? 143 PRO B CD   1  
ATOM 4492   H HA   . PRO B 2 143 ? 6.412   16.098  10.313  1.00 0.00 ? 143 PRO B HA   1  
ATOM 4493   H HB2  . PRO B 2 143 ? 6.122   17.719  12.859  1.00 0.00 ? 143 PRO B HB2  1  
ATOM 4494   H HB3  . PRO B 2 143 ? 6.303   15.951  12.617  1.00 0.00 ? 143 PRO B HB3  1  
ATOM 4495   H HG2  . PRO B 2 143 ? 8.327   17.440  13.456  1.00 0.00 ? 143 PRO B HG2  1  
ATOM 4496   H HG3  . PRO B 2 143 ? 8.586   16.039  12.366  1.00 0.00 ? 143 PRO B HG3  1  
ATOM 4497   H HD2  . PRO B 2 143 ? 8.656   18.996  11.817  1.00 0.00 ? 143 PRO B HD2  1  
ATOM 4498   H HD3  . PRO B 2 143 ? 9.577   17.666  11.051  1.00 0.00 ? 143 PRO B HD3  1  
ATOM 4499   N N    . GLY B 2 144 ? 4.112   17.062  10.085  1.00 0.00 ? 144 GLY B N    1  
ATOM 4500   C CA   . GLY B 2 144 ? 2.834   17.660  9.756   1.00 0.00 ? 144 GLY B CA   1  
ATOM 4501   C C    . GLY B 2 144 ? 2.802   18.188  8.337   1.00 0.00 ? 144 GLY B C    1  
ATOM 4502   O O    . GLY B 2 144 ? 1.756   18.614  7.847   1.00 0.00 ? 144 GLY B O    1  
ATOM 4503   H H    . GLY B 2 144 ? 4.221   16.086  10.036  1.00 0.00 ? 144 GLY B H    1  
ATOM 4504   H HA2  . GLY B 2 144 ? 2.054   16.908  9.870   1.00 0.00 ? 144 GLY B HA2  1  
ATOM 4505   H HA3  . GLY B 2 144 ? 2.644   18.484  10.443  1.00 0.00 ? 144 GLY B HA3  1  
ATOM 4506   N N    . GLY B 2 145 ? 3.952   18.158  7.677   1.00 0.00 ? 145 GLY B N    1  
ATOM 4507   C CA   . GLY B 2 145 ? 4.041   18.631  6.314   1.00 0.00 ? 145 GLY B CA   1  
ATOM 4508   C C    . GLY B 2 145 ? 3.540   17.606  5.317   1.00 0.00 ? 145 GLY B C    1  
ATOM 4509   O O    . GLY B 2 145 ? 2.910   16.614  5.693   1.00 0.00 ? 145 GLY B O    1  
ATOM 4510   H H    . GLY B 2 145 ? 4.753   17.815  8.124   1.00 0.00 ? 145 GLY B H    1  
ATOM 4511   H HA2  . GLY B 2 145 ? 3.443   19.537  6.217   1.00 0.00 ? 145 GLY B HA2  1  
ATOM 4512   H HA3  . GLY B 2 145 ? 5.082   18.861  6.089   1.00 0.00 ? 145 GLY B HA3  1  
ATOM 4513   N N    . SER B 2 146 ? 3.813   17.843  4.046   1.00 0.00 ? 146 SER B N    1  
ATOM 4514   C CA   . SER B 2 146 ? 3.386   16.943  2.990   1.00 0.00 ? 146 SER B CA   1  
ATOM 4515   C C    . SER B 2 146 ? 4.499   16.731  1.969   1.00 0.00 ? 146 SER B C    1  
ATOM 4516   O O    . SER B 2 146 ? 5.368   17.588  1.797   1.00 0.00 ? 146 SER B O    1  
ATOM 4517   C CB   . SER B 2 146 ? 2.146   17.510  2.295   1.00 0.00 ? 146 SER B CB   1  
ATOM 4518   O OG   . SER B 2 146 ? 1.211   17.992  3.246   1.00 0.00 ? 146 SER B OG   1  
ATOM 4519   H H    . SER B 2 146 ? 4.322   18.648  3.808   1.00 0.00 ? 146 SER B H    1  
ATOM 4520   H HA   . SER B 2 146 ? 3.132   15.981  3.436   1.00 0.00 ? 146 SER B HA   1  
ATOM 4521   H HB2  . SER B 2 146 ? 2.446   18.330  1.642   1.00 0.00 ? 146 SER B HB2  1  
ATOM 4522   H HB3  . SER B 2 146 ? 1.678   16.725  1.702   1.00 0.00 ? 146 SER B HB3  1  
ATOM 4523   H HG   . SER B 2 146 ? 1.446   17.653  4.120   1.00 0.00 ? 146 SER B HG   1  
ATOM 4524   N N    . LEU B 2 147 ? 4.461   15.589  1.302   1.00 0.00 ? 147 LEU B N    1  
ATOM 4525   C CA   . LEU B 2 147 ? 5.450   15.246  0.287   1.00 0.00 ? 147 LEU B CA   1  
ATOM 4526   C C    . LEU B 2 147 ? 4.818   14.390  -0.797  1.00 0.00 ? 147 LEU B C    1  
ATOM 4527   O O    . LEU B 2 147 ? 3.954   13.558  -0.518  1.00 0.00 ? 147 LEU B O    1  
ATOM 4528   C CB   . LEU B 2 147 ? 6.643   14.503  0.907   1.00 0.00 ? 147 LEU B CB   1  
ATOM 4529   C CG   . LEU B 2 147 ? 7.860   15.356  1.270   1.00 0.00 ? 147 LEU B CG   1  
ATOM 4530   C CD1  . LEU B 2 147 ? 8.976   14.478  1.817   1.00 0.00 ? 147 LEU B CD1  1  
ATOM 4531   C CD2  . LEU B 2 147 ? 8.342   16.152  0.067   1.00 0.00 ? 147 LEU B CD2  1  
ATOM 4532   H H    . LEU B 2 147 ? 3.736   14.953  1.490   1.00 0.00 ? 147 LEU B H    1  
ATOM 4533   H HA   . LEU B 2 147 ? 5.813   16.171  -0.162  1.00 0.00 ? 147 LEU B HA   1  
ATOM 4534   H HB2  . LEU B 2 147 ? 6.294   14.017  1.819   1.00 0.00 ? 147 LEU B HB2  1  
ATOM 4535   H HB3  . LEU B 2 147 ? 6.969   13.746  0.194   1.00 0.00 ? 147 LEU B HB3  1  
ATOM 4536   H HG   . LEU B 2 147 ? 7.565   16.060  2.049   1.00 0.00 ? 147 LEU B HG   1  
ATOM 4537   H HD11 . LEU B 2 147 ? 9.829   15.096  2.095   1.00 0.00 ? 147 LEU B HD11 1  
ATOM 4538   H HD12 . LEU B 2 147 ? 8.617   13.941  2.695   1.00 0.00 ? 147 LEU B HD12 1  
ATOM 4539   H HD13 . LEU B 2 147 ? 9.281   13.762  1.054   1.00 0.00 ? 147 LEU B HD13 1  
ATOM 4540   H HD21 . LEU B 2 147 ? 7.536   16.793  -0.290  1.00 0.00 ? 147 LEU B HD21 1  
ATOM 4541   H HD22 . LEU B 2 147 ? 9.195   16.769  0.349   1.00 0.00 ? 147 LEU B HD22 1  
ATOM 4542   H HD23 . LEU B 2 147 ? 8.640   15.466  -0.726  1.00 0.00 ? 147 LEU B HD23 1  
ATOM 4543   N N    . ARG B 2 148 ? 5.214   14.625  -2.033  1.00 0.00 ? 148 ARG B N    1  
ATOM 4544   C CA   . ARG B 2 148 ? 4.696   13.866  -3.156  1.00 0.00 ? 148 ARG B CA   1  
ATOM 4545   C C    . ARG B 2 148 ? 5.789   12.990  -3.759  1.00 0.00 ? 148 ARG B C    1  
ATOM 4546   O O    . ARG B 2 148 ? 6.703   13.488  -4.422  1.00 0.00 ? 148 ARG B O    1  
ATOM 4547   C CB   . ARG B 2 148 ? 4.127   14.806  -4.220  1.00 0.00 ? 148 ARG B CB   1  
ATOM 4548   C CG   . ARG B 2 148 ? 3.740   14.111  -5.517  1.00 0.00 ? 148 ARG B CG   1  
ATOM 4549   C CD   . ARG B 2 148 ? 3.735   15.081  -6.687  1.00 0.00 ? 148 ARG B CD   1  
ATOM 4550   N NE   . ARG B 2 148 ? 4.966   15.873  -6.750  1.00 0.00 ? 148 ARG B NE   1  
ATOM 4551   C CZ   . ARG B 2 148 ? 5.859   15.800  -7.740  1.00 0.00 ? 148 ARG B CZ   1  
ATOM 4552   N NH1  . ARG B 2 148 ? 5.677   14.953  -8.747  1.00 0.00 ? 148 ARG B NH1  1  
ATOM 4553   N NH2  . ARG B 2 148 ? 6.938   16.569  -7.721  1.00 0.00 ? 148 ARG B NH2  1  
ATOM 4554   H H    . ARG B 2 148 ? 5.866   15.341  -2.200  1.00 0.00 ? 148 ARG B H    1  
ATOM 4555   H HA   . ARG B 2 148 ? 3.893   13.223  -2.795  1.00 0.00 ? 148 ARG B HA   1  
ATOM 4556   H HB2  . ARG B 2 148 ? 3.239   15.289  -3.811  1.00 0.00 ? 148 ARG B HB2  1  
ATOM 4557   H HB3  . ARG B 2 148 ? 4.880   15.561  -4.447  1.00 0.00 ? 148 ARG B HB3  1  
ATOM 4558   H HG2  . ARG B 2 148 ? 4.456   13.314  -5.720  1.00 0.00 ? 148 ARG B HG2  1  
ATOM 4559   H HG3  . ARG B 2 148 ? 2.743   13.684  -5.407  1.00 0.00 ? 148 ARG B HG3  1  
ATOM 4560   H HD2  . ARG B 2 148 ? 3.631   14.517  -7.614  1.00 0.00 ? 148 ARG B HD2  1  
ATOM 4561   H HD3  . ARG B 2 148 ? 2.886   15.757  -6.583  1.00 0.00 ? 148 ARG B HD3  1  
ATOM 4562   H HE   . ARG B 2 148 ? 5.130   16.504  -6.011  1.00 0.00 ? 148 ARG B HE   1  
ATOM 4563   H HH11 . ARG B 2 148 ? 4.870   14.361  -8.769  1.00 0.00 ? 148 ARG B HH11 1  
ATOM 4564   H HH12 . ARG B 2 148 ? 6.346   14.904  -9.492  1.00 0.00 ? 148 ARG B HH12 1  
ATOM 4565   H HH21 . ARG B 2 148 ? 7.088   17.210  -6.964  1.00 0.00 ? 148 ARG B HH21 1  
ATOM 4566   H HH22 . ARG B 2 148 ? 7.610   16.513  -8.464  1.00 0.00 ? 148 ARG B HH22 1  
ATOM 4567   N N    . LEU B 2 149 ? 5.699   11.693  -3.522  1.00 0.00 ? 149 LEU B N    1  
ATOM 4568   C CA   . LEU B 2 149 ? 6.674   10.758  -4.060  1.00 0.00 ? 149 LEU B CA   1  
ATOM 4569   C C    . LEU B 2 149 ? 6.254   10.318  -5.455  1.00 0.00 ? 149 LEU B C    1  
ATOM 4570   O O    . LEU B 2 149 ? 5.069   10.125  -5.720  1.00 0.00 ? 149 LEU B O    1  
ATOM 4571   C CB   . LEU B 2 149 ? 6.827   9.540   -3.146  1.00 0.00 ? 149 LEU B CB   1  
ATOM 4572   C CG   . LEU B 2 149 ? 7.420   9.804   -1.761  1.00 0.00 ? 149 LEU B CG   1  
ATOM 4573   C CD1  . LEU B 2 149 ? 7.596   8.498   -1.003  1.00 0.00 ? 149 LEU B CD1  1  
ATOM 4574   C CD2  . LEU B 2 149 ? 8.745   10.539  -1.873  1.00 0.00 ? 149 LEU B CD2  1  
ATOM 4575   H H    . LEU B 2 149 ? 4.954   11.355  -2.979  1.00 0.00 ? 149 LEU B H    1  
ATOM 4576   H HA   . LEU B 2 149 ? 7.637   11.265  -4.126  1.00 0.00 ? 149 LEU B HA   1  
ATOM 4577   H HB2  . LEU B 2 149 ? 5.838   9.103   -3.006  1.00 0.00 ? 149 LEU B HB2  1  
ATOM 4578   H HB3  . LEU B 2 149 ? 7.472   8.823   -3.653  1.00 0.00 ? 149 LEU B HB3  1  
ATOM 4579   H HG   . LEU B 2 149 ? 6.725   10.434  -1.205  1.00 0.00 ? 149 LEU B HG   1  
ATOM 4580   H HD11 . LEU B 2 149 ? 7.998   8.699   -0.010  1.00 0.00 ? 149 LEU B HD11 1  
ATOM 4581   H HD12 . LEU B 2 149 ? 6.630   8.001   -0.908  1.00 0.00 ? 149 LEU B HD12 1  
ATOM 4582   H HD13 . LEU B 2 149 ? 8.285   7.853   -1.548  1.00 0.00 ? 149 LEU B HD13 1  
ATOM 4583   H HD21 . LEU B 2 149 ? 8.592   11.483  -2.396  1.00 0.00 ? 149 LEU B HD21 1  
ATOM 4584   H HD22 . LEU B 2 149 ? 9.143   10.738  -0.878  1.00 0.00 ? 149 LEU B HD22 1  
ATOM 4585   H HD23 . LEU B 2 149 ? 9.453   9.926   -2.430  1.00 0.00 ? 149 LEU B HD23 1  
ATOM 4586   N N    . SER B 2 150 ? 7.218   10.184  -6.349  1.00 0.00 ? 150 SER B N    1  
ATOM 4587   C CA   . SER B 2 150 ? 6.930   9.768   -7.712  1.00 0.00 ? 150 SER B CA   1  
ATOM 4588   C C    . SER B 2 150 ? 7.805   8.590   -8.123  1.00 0.00 ? 150 SER B C    1  
ATOM 4589   O O    . SER B 2 150 ? 9.005   8.578   -7.864  1.00 0.00 ? 150 SER B O    1  
ATOM 4590   C CB   . SER B 2 150 ? 7.117   10.942  -8.674  1.00 0.00 ? 150 SER B CB   1  
ATOM 4591   O OG   . SER B 2 150 ? 6.466   12.101  -8.180  1.00 0.00 ? 150 SER B OG   1  
ATOM 4592   H H    . SER B 2 150 ? 8.149   10.365  -6.088  1.00 0.00 ? 150 SER B H    1  
ATOM 4593   H HA   . SER B 2 150 ? 5.888   9.451   -7.755  1.00 0.00 ? 150 SER B HA   1  
ATOM 4594   H HB2  . SER B 2 150 ? 8.182   11.149  -8.783  1.00 0.00 ? 150 SER B HB2  1  
ATOM 4595   H HB3  . SER B 2 150 ? 6.696   10.681  -9.644  1.00 0.00 ? 150 SER B HB3  1  
ATOM 4596   H HG   . SER B 2 150 ? 6.359   12.021  -7.225  1.00 0.00 ? 150 SER B HG   1  
ATOM 4597   N N    . CYS B 2 151 ? 7.193   7.599   -8.747  1.00 0.00 ? 151 CYS B N    1  
ATOM 4598   C CA   . CYS B 2 151 ? 7.913   6.414   -9.199  1.00 0.00 ? 151 CYS B CA   1  
ATOM 4599   C C    . CYS B 2 151 ? 7.790   6.272   -10.710 1.00 0.00 ? 151 CYS B C    1  
ATOM 4600   O O    . CYS B 2 151 ? 6.683   6.217   -11.242 1.00 0.00 ? 151 CYS B O    1  
ATOM 4601   C CB   . CYS B 2 151 ? 7.362   5.165   -8.504  1.00 0.00 ? 151 CYS B CB   1  
ATOM 4602   S SG   . CYS B 2 151 ? 7.977   3.583   -9.169  1.00 0.00 ? 151 CYS B SG   1  
ATOM 4603   H H    . CYS B 2 151 ? 6.225   7.662   -8.905  1.00 0.00 ? 151 CYS B H    1  
ATOM 4604   H HA   . CYS B 2 151 ? 8.966   6.526   -8.940  1.00 0.00 ? 151 CYS B HA   1  
ATOM 4605   H HB2  . CYS B 2 151 ? 7.634   5.222   -7.450  1.00 0.00 ? 151 CYS B HB2  1  
ATOM 4606   H HB3  . CYS B 2 151 ? 6.277   5.180   -8.603  1.00 0.00 ? 151 CYS B HB3  1  
ATOM 4607   H HG   . CYS B 2 151 ? 7.302   2.775   -8.347  1.00 0.00 ? 151 CYS B HG   1  
ATOM 4608   N N    . ALA B 2 152 ? 8.923   6.247   -11.401 1.00 0.00 ? 152 ALA B N    1  
ATOM 4609   C CA   . ALA B 2 152 ? 8.934   6.111   -12.849 1.00 0.00 ? 152 ALA B CA   1  
ATOM 4610   C C    . ALA B 2 152 ? 8.972   4.640   -13.244 1.00 0.00 ? 152 ALA B C    1  
ATOM 4611   O O    . ALA B 2 152 ? 9.849   3.895   -12.803 1.00 0.00 ? 152 ALA B O    1  
ATOM 4612   C CB   . ALA B 2 152 ? 10.121  6.854   -13.444 1.00 0.00 ? 152 ALA B CB   1  
ATOM 4613   H H    . ALA B 2 152 ? 9.780   6.316   -10.921 1.00 0.00 ? 152 ALA B H    1  
ATOM 4614   H HA   . ALA B 2 152 ? 8.017   6.552   -13.242 1.00 0.00 ? 152 ALA B HA   1  
ATOM 4615   H HB1  . ALA B 2 152 ? 10.104  6.766   -14.530 1.00 0.00 ? 152 ALA B HB1  1  
ATOM 4616   H HB2  . ALA B 2 152 ? 10.065  7.907   -13.166 1.00 0.00 ? 152 ALA B HB2  1  
ATOM 4617   H HB3  . ALA B 2 152 ? 11.046  6.425   -13.060 1.00 0.00 ? 152 ALA B HB3  1  
ATOM 4618   N N    . ALA B 2 153 ? 8.029   4.227   -14.077 1.00 0.00 ? 153 ALA B N    1  
ATOM 4619   C CA   . ALA B 2 153 ? 7.948   2.842   -14.522 1.00 0.00 ? 153 ALA B CA   1  
ATOM 4620   C C    . ALA B 2 153 ? 8.388   2.704   -15.972 1.00 0.00 ? 153 ALA B C    1  
ATOM 4621   O O    . ALA B 2 153 ? 7.960   3.471   -16.835 1.00 0.00 ? 153 ALA B O    1  
ATOM 4622   C CB   . ALA B 2 153 ? 6.524   2.324   -14.357 1.00 0.00 ? 153 ALA B CB   1  
ATOM 4623   H H    . ALA B 2 153 ? 7.364   4.872   -14.411 1.00 0.00 ? 153 ALA B H    1  
ATOM 4624   H HA   . ALA B 2 153 ? 8.612   2.244   -13.899 1.00 0.00 ? 153 ALA B HA   1  
ATOM 4625   H HB1  . ALA B 2 153 ? 6.474   1.280   -14.664 1.00 0.00 ? 153 ALA B HB1  1  
ATOM 4626   H HB2  . ALA B 2 153 ? 6.226   2.408   -13.311 1.00 0.00 ? 153 ALA B HB2  1  
ATOM 4627   H HB3  . ALA B 2 153 ? 5.849   2.916   -14.975 1.00 0.00 ? 153 ALA B HB3  1  
ATOM 4628   N N    . SER B 2 154 ? 9.254   1.731   -16.235 1.00 0.00 ? 154 SER B N    1  
ATOM 4629   C CA   . SER B 2 154 ? 9.745   1.498   -17.587 1.00 0.00 ? 154 SER B CA   1  
ATOM 4630   C C    . SER B 2 154 ? 10.111  0.034   -17.807 1.00 0.00 ? 154 SER B C    1  
ATOM 4631   O O    . SER B 2 154 ? 10.406  -0.692  -16.853 1.00 0.00 ? 154 SER B O    1  
ATOM 4632   C CB   . SER B 2 154 ? 10.947  2.410   -17.877 1.00 0.00 ? 154 SER B CB   1  
ATOM 4633   O OG   . SER B 2 154 ? 11.624  2.756   -16.679 1.00 0.00 ? 154 SER B OG   1  
ATOM 4634   H H    . SER B 2 154 ? 9.578   1.161   -15.503 1.00 0.00 ? 154 SER B H    1  
ATOM 4635   H HA   . SER B 2 154 ? 8.945   1.755   -18.282 1.00 0.00 ? 154 SER B HA   1  
ATOM 4636   H HB2  . SER B 2 154 ? 11.639  1.888   -18.538 1.00 0.00 ? 154 SER B HB2  1  
ATOM 4637   H HB3  . SER B 2 154 ? 10.596  3.320   -18.363 1.00 0.00 ? 154 SER B HB3  1  
ATOM 4638   H HG   . SER B 2 154 ? 11.096  2.472   -15.925 1.00 0.00 ? 154 SER B HG   1  
ATOM 4639   N N    . GLY B 2 155 ? 10.087  -0.387  -19.068 1.00 0.00 ? 155 GLY B N    1  
ATOM 4640   C CA   . GLY B 2 155 ? 10.428  -1.755  -19.417 1.00 0.00 ? 155 GLY B CA   1  
ATOM 4641   C C    . GLY B 2 155 ? 9.278   -2.744  -19.312 1.00 0.00 ? 155 GLY B C    1  
ATOM 4642   O O    . GLY B 2 155 ? 9.491   -3.950  -19.440 1.00 0.00 ? 155 GLY B O    1  
ATOM 4643   H H    . GLY B 2 155 ? 9.875   0.261   -19.780 1.00 0.00 ? 155 GLY B H    1  
ATOM 4644   H HA2  . GLY B 2 155 ? 10.791  -1.763  -20.444 1.00 0.00 ? 155 GLY B HA2  1  
ATOM 4645   H HA3  . GLY B 2 155 ? 11.224  -2.087  -18.750 1.00 0.00 ? 155 GLY B HA3  1  
ATOM 4646   N N    . PHE B 2 156 ? 8.056   -2.260  -19.104 1.00 0.00 ? 156 PHE B N    1  
ATOM 4647   C CA   . PHE B 2 156 ? 6.909   -3.158  -18.981 1.00 0.00 ? 156 PHE B CA   1  
ATOM 4648   C C    . PHE B 2 156 ? 5.582   -2.451  -19.250 1.00 0.00 ? 156 PHE B C    1  
ATOM 4649   O O    . PHE B 2 156 ? 5.553   -1.254  -19.531 1.00 0.00 ? 156 PHE B O    1  
ATOM 4650   C CB   . PHE B 2 156 ? 6.893   -3.849  -17.608 1.00 0.00 ? 156 PHE B CB   1  
ATOM 4651   C CG   . PHE B 2 156 ? 6.631   -2.933  -16.442 1.00 0.00 ? 156 PHE B CG   1  
ATOM 4652   C CD1  . PHE B 2 156 ? 7.603   -2.053  -15.993 1.00 0.00 ? 156 PHE B CD1  1  
ATOM 4653   C CD2  . PHE B 2 156 ? 5.411   -2.962  -15.788 1.00 0.00 ? 156 PHE B CD2  1  
ATOM 4654   C CE1  . PHE B 2 156 ? 7.363   -1.220  -14.919 1.00 0.00 ? 156 PHE B CE1  1  
ATOM 4655   C CE2  . PHE B 2 156 ? 5.162   -2.129  -14.714 1.00 0.00 ? 156 PHE B CE2  1  
ATOM 4656   C CZ   . PHE B 2 156 ? 6.138   -1.258  -14.279 1.00 0.00 ? 156 PHE B CZ   1  
ATOM 4657   H H    . PHE B 2 156 ? 7.918   -1.289  -19.044 1.00 0.00 ? 156 PHE B H    1  
ATOM 4658   H HA   . PHE B 2 156 ? 7.027   -3.932  -19.740 1.00 0.00 ? 156 PHE B HA   1  
ATOM 4659   H HB2  . PHE B 2 156 ? 6.119   -4.616  -17.621 1.00 0.00 ? 156 PHE B HB2  1  
ATOM 4660   H HB3  . PHE B 2 156 ? 7.860   -4.329  -17.455 1.00 0.00 ? 156 PHE B HB3  1  
ATOM 4661   H HD1  . PHE B 2 156 ? 8.561   -2.018  -16.491 1.00 0.00 ? 156 PHE B HD1  1  
ATOM 4662   H HD2  . PHE B 2 156 ? 4.643   -3.645  -16.122 1.00 0.00 ? 156 PHE B HD2  1  
ATOM 4663   H HE1  . PHE B 2 156 ? 8.131   -0.540  -14.579 1.00 0.00 ? 156 PHE B HE1  1  
ATOM 4664   H HE2  . PHE B 2 156 ? 4.204   -2.161  -14.216 1.00 0.00 ? 156 PHE B HE2  1  
ATOM 4665   H HZ   . PHE B 2 156 ? 5.947   -0.607  -13.439 1.00 0.00 ? 156 PHE B HZ   1  
ATOM 4666   N N    . ASP B 2 157 ? 4.493   -3.213  -19.168 1.00 0.00 ? 157 ASP B N    1  
ATOM 4667   C CA   . ASP B 2 157 ? 3.147   -2.687  -19.389 1.00 0.00 ? 157 ASP B CA   1  
ATOM 4668   C C    . ASP B 2 157 ? 2.681   -1.889  -18.179 1.00 0.00 ? 157 ASP B C    1  
ATOM 4669   O O    . ASP B 2 157 ? 2.688   -2.397  -17.060 1.00 0.00 ? 157 ASP B O    1  
ATOM 4670   C CB   . ASP B 2 157 ? 2.168   -3.839  -19.634 1.00 0.00 ? 157 ASP B CB   1  
ATOM 4671   C CG   . ASP B 2 157 ? 2.084   -4.257  -21.086 1.00 0.00 ? 157 ASP B CG   1  
ATOM 4672   O OD1  . ASP B 2 157 ? 2.274   -5.462  -21.374 1.00 0.00 ? 157 ASP B OD1  1  
ATOM 4673   O OD2  . ASP B 2 157 ? 1.811   -3.393  -21.942 1.00 0.00 ? 157 ASP B OD2  1  
ATOM 4674   H H    . ASP B 2 157 ? 4.598   -4.162  -18.953 1.00 0.00 ? 157 ASP B H    1  
ATOM 4675   H HA   . ASP B 2 157 ? 3.163   -2.037  -20.263 1.00 0.00 ? 157 ASP B HA   1  
ATOM 4676   H HB2  . ASP B 2 157 ? 2.487   -4.697  -19.043 1.00 0.00 ? 157 ASP B HB2  1  
ATOM 4677   H HB3  . ASP B 2 157 ? 1.176   -3.526  -19.306 1.00 0.00 ? 157 ASP B HB3  1  
ATOM 4678   H HD2  . ASP B 2 157 ? 1.770   -3.730  -22.840 1.00 0.00 ? 157 ASP B HD2  1  
ATOM 4679   N N    . PHE B 2 158 ? 2.250   -0.657  -18.411 1.00 0.00 ? 158 PHE B N    1  
ATOM 4680   C CA   . PHE B 2 158 ? 1.793   0.211   -17.330 1.00 0.00 ? 158 PHE B CA   1  
ATOM 4681   C C    . PHE B 2 158 ? 0.286   0.086   -17.097 1.00 0.00 ? 158 PHE B C    1  
ATOM 4682   O O    . PHE B 2 158 ? -0.195  0.276   -15.978 1.00 0.00 ? 158 PHE B O    1  
ATOM 4683   C CB   . PHE B 2 158 ? 2.163   1.670   -17.624 1.00 0.00 ? 158 PHE B CB   1  
ATOM 4684   C CG   . PHE B 2 158 ? 1.978   2.599   -16.453 1.00 0.00 ? 158 PHE B CG   1  
ATOM 4685   C CD1  . PHE B 2 158 ? 2.911   2.639   -15.430 1.00 0.00 ? 158 PHE B CD1  1  
ATOM 4686   C CD2  . PHE B 2 158 ? 0.871   3.430   -16.377 1.00 0.00 ? 158 PHE B CD2  1  
ATOM 4687   C CE1  . PHE B 2 158 ? 2.745   3.488   -14.353 1.00 0.00 ? 158 PHE B CE1  1  
ATOM 4688   C CE2  . PHE B 2 158 ? 0.700   4.281   -15.302 1.00 0.00 ? 158 PHE B CE2  1  
ATOM 4689   C CZ   . PHE B 2 158 ? 1.637   4.311   -14.290 1.00 0.00 ? 158 PHE B CZ   1  
ATOM 4690   H H    . PHE B 2 158 ? 2.230   -0.325  -19.334 1.00 0.00 ? 158 PHE B H    1  
ATOM 4691   H HA   . PHE B 2 158 ? 2.304   -0.096  -16.418 1.00 0.00 ? 158 PHE B HA   1  
ATOM 4692   H HB2  . PHE B 2 158 ? 3.208   1.706   -17.931 1.00 0.00 ? 158 PHE B HB2  1  
ATOM 4693   H HB3  . PHE B 2 158 ? 1.543   2.025   -18.448 1.00 0.00 ? 158 PHE B HB3  1  
ATOM 4694   H HD1  . PHE B 2 158 ? 3.780   1.999   -15.475 1.00 0.00 ? 158 PHE B HD1  1  
ATOM 4695   H HD2  . PHE B 2 158 ? 0.134   3.411   -17.166 1.00 0.00 ? 158 PHE B HD2  1  
ATOM 4696   H HE1  . PHE B 2 158 ? 3.479   3.509   -13.561 1.00 0.00 ? 158 PHE B HE1  1  
ATOM 4697   H HE2  . PHE B 2 158 ? -0.167  4.924   -15.255 1.00 0.00 ? 158 PHE B HE2  1  
ATOM 4698   H HZ   . PHE B 2 158 ? 1.503   4.975   -13.449 1.00 0.00 ? 158 PHE B HZ   1  
ATOM 4699   N N    . SER B 2 159 ? -0.457  -0.233  -18.152 1.00 0.00 ? 159 SER B N    1  
ATOM 4700   C CA   . SER B 2 159 ? -1.909  -0.362  -18.052 1.00 0.00 ? 159 SER B CA   1  
ATOM 4701   C C    . SER B 2 159 ? -2.346  -1.817  -17.909 1.00 0.00 ? 159 SER B C    1  
ATOM 4702   O O    . SER B 2 159 ? -3.530  -2.104  -17.739 1.00 0.00 ? 159 SER B O    1  
ATOM 4703   C CB   . SER B 2 159 ? -2.583  0.272   -19.270 1.00 0.00 ? 159 SER B CB   1  
ATOM 4704   O OG   . SER B 2 159 ? -2.001  1.531   -19.573 1.00 0.00 ? 159 SER B OG   1  
ATOM 4705   H H    . SER B 2 159 ? -0.022  -0.368  -19.022 1.00 0.00 ? 159 SER B H    1  
ATOM 4706   H HA   . SER B 2 159 ? -2.230  0.177   -17.162 1.00 0.00 ? 159 SER B HA   1  
ATOM 4707   H HB2  . SER B 2 159 ? -2.466  -0.390  -20.128 1.00 0.00 ? 159 SER B HB2  1  
ATOM 4708   H HB3  . SER B 2 159 ? -3.643  0.411   -19.059 1.00 0.00 ? 159 SER B HB3  1  
ATOM 4709   H HG   . SER B 2 159 ? -1.526  1.471   -20.407 1.00 0.00 ? 159 SER B HG   1  
ATOM 4710   N N    . ARG B 2 160 ? -1.389  -2.734  -17.959 1.00 0.00 ? 160 ARG B N    1  
ATOM 4711   C CA   . ARG B 2 160 ? -1.693  -4.152  -17.846 1.00 0.00 ? 160 ARG B CA   1  
ATOM 4712   C C    . ARG B 2 160 ? -1.196  -4.712  -16.513 1.00 0.00 ? 160 ARG B C    1  
ATOM 4713   O O    . ARG B 2 160 ? -1.683  -5.737  -16.029 1.00 0.00 ? 160 ARG B O    1  
ATOM 4714   C CB   . ARG B 2 160 ? -1.077  -4.907  -19.025 1.00 0.00 ? 160 ARG B CB   1  
ATOM 4715   C CG   . ARG B 2 160 ? -1.111  -6.420  -18.907 1.00 0.00 ? 160 ARG B CG   1  
ATOM 4716   C CD   . ARG B 2 160 ? -0.384  -7.076  -20.064 1.00 0.00 ? 160 ARG B CD   1  
ATOM 4717   N NE   . ARG B 2 160 ? -0.028  -8.460  -19.768 1.00 0.00 ? 160 ARG B NE   1  
ATOM 4718   C CZ   . ARG B 2 160 ? 1.169   -8.984  -20.018 1.00 0.00 ? 160 ARG B CZ   1  
ATOM 4719   N NH1  . ARG B 2 160 ? 2.126   -8.237  -20.561 1.00 0.00 ? 160 ARG B NH1  1  
ATOM 4720   N NH2  . ARG B 2 160 ? 1.416   -10.252 -19.718 1.00 0.00 ? 160 ARG B NH2  1  
ATOM 4721   H H    . ARG B 2 160 ? -0.458  -2.450  -18.060 1.00 0.00 ? 160 ARG B H    1  
ATOM 4722   H HA   . ARG B 2 160 ? -2.776  -4.274  -17.886 1.00 0.00 ? 160 ARG B HA   1  
ATOM 4723   H HB2  . ARG B 2 160 ? -1.619  -4.626  -19.928 1.00 0.00 ? 160 ARG B HB2  1  
ATOM 4724   H HB3  . ARG B 2 160 ? -0.035  -4.598  -19.117 1.00 0.00 ? 160 ARG B HB3  1  
ATOM 4725   H HG2  . ARG B 2 160 ? -0.632  -6.714  -17.973 1.00 0.00 ? 160 ARG B HG2  1  
ATOM 4726   H HG3  . ARG B 2 160 ? -2.149  -6.753  -18.904 1.00 0.00 ? 160 ARG B HG3  1  
ATOM 4727   H HD2  . ARG B 2 160 ? -1.028  -7.057  -20.943 1.00 0.00 ? 160 ARG B HD2  1  
ATOM 4728   H HD3  . ARG B 2 160 ? 0.526   -6.514  -20.275 1.00 0.00 ? 160 ARG B HD3  1  
ATOM 4729   H HE   . ARG B 2 160 ? -0.722  -9.028  -19.361 1.00 0.00 ? 160 ARG B HE   1  
ATOM 4730   H HH11 . ARG B 2 160 ? 1.954   -7.269  -20.785 1.00 0.00 ? 160 ARG B HH11 1  
ATOM 4731   H HH12 . ARG B 2 160 ? 3.023   -8.641  -20.759 1.00 0.00 ? 160 ARG B HH12 1  
ATOM 4732   H HH21 . ARG B 2 160 ? 0.701   -10.824 -19.302 1.00 0.00 ? 160 ARG B HH21 1  
ATOM 4733   H HH22 . ARG B 2 160 ? 2.322   -10.646 -19.903 1.00 0.00 ? 160 ARG B HH22 1  
ATOM 4734   N N    . TYR B 2 161 ? -0.243  -4.016  -15.913 1.00 0.00 ? 161 TYR B N    1  
ATOM 4735   C CA   . TYR B 2 161 ? 0.324   -4.441  -14.647 1.00 0.00 ? 161 TYR B CA   1  
ATOM 4736   C C    . TYR B 2 161 ? -0.125  -3.523  -13.524 1.00 0.00 ? 161 TYR B C    1  
ATOM 4737   O O    . TYR B 2 161 ? -0.152  -2.303  -13.682 1.00 0.00 ? 161 TYR B O    1  
ATOM 4738   C CB   . TYR B 2 161 ? 1.853   -4.470  -14.712 1.00 0.00 ? 161 TYR B CB   1  
ATOM 4739   C CG   . TYR B 2 161 ? 2.426   -5.726  -15.328 1.00 0.00 ? 161 TYR B CG   1  
ATOM 4740   C CD1  . TYR B 2 161 ? 2.532   -5.864  -16.705 1.00 0.00 ? 161 TYR B CD1  1  
ATOM 4741   C CD2  . TYR B 2 161 ? 2.865   -6.774  -14.530 1.00 0.00 ? 161 TYR B CD2  1  
ATOM 4742   C CE1  . TYR B 2 161 ? 3.059   -7.009  -17.271 1.00 0.00 ? 161 TYR B CE1  1  
ATOM 4743   C CE2  . TYR B 2 161 ? 3.394   -7.922  -15.086 1.00 0.00 ? 161 TYR B CE2  1  
ATOM 4744   C CZ   . TYR B 2 161 ? 3.489   -8.034  -16.457 1.00 0.00 ? 161 TYR B CZ   1  
ATOM 4745   O OH   . TYR B 2 161 ? 4.017   -9.176  -17.014 1.00 0.00 ? 161 TYR B OH   1  
ATOM 4746   H H    . TYR B 2 161 ? 0.059   -3.177  -16.316 1.00 0.00 ? 161 TYR B H    1  
ATOM 4747   H HA   . TYR B 2 161 ? -0.033  -5.450  -14.437 1.00 0.00 ? 161 TYR B HA   1  
ATOM 4748   H HB2  . TYR B 2 161 ? 2.189   -3.615  -15.298 1.00 0.00 ? 161 TYR B HB2  1  
ATOM 4749   H HB3  . TYR B 2 161 ? 2.243   -4.375  -13.699 1.00 0.00 ? 161 TYR B HB3  1  
ATOM 4750   H HD1  . TYR B 2 161 ? 2.198   -5.062  -17.346 1.00 0.00 ? 161 TYR B HD1  1  
ATOM 4751   H HD2  . TYR B 2 161 ? 2.792   -6.689  -13.455 1.00 0.00 ? 161 TYR B HD2  1  
ATOM 4752   H HE1  . TYR B 2 161 ? 3.134   -7.100  -18.345 1.00 0.00 ? 161 TYR B HE1  1  
ATOM 4753   H HE2  . TYR B 2 161 ? 3.731   -8.728  -14.450 1.00 0.00 ? 161 TYR B HE2  1  
ATOM 4754   H HH   . TYR B 2 161 ? 3.593   -9.950  -16.627 1.00 0.00 ? 161 TYR B HH   1  
ATOM 4755   N N    . ASP B 2 162 ? -0.478  -4.112  -12.396 1.00 0.00 ? 162 ASP B N    1  
ATOM 4756   C CA   . ASP B 2 162 ? -0.914  -3.341  -11.245 1.00 0.00 ? 162 ASP B CA   1  
ATOM 4757   C C    . ASP B 2 162 ? 0.259   -3.177  -10.288 1.00 0.00 ? 162 ASP B C    1  
ATOM 4758   O O    . ASP B 2 162 ? 1.213   -3.960  -10.335 1.00 0.00 ? 162 ASP B O    1  
ATOM 4759   C CB   . ASP B 2 162 ? -2.092  -4.027  -10.552 1.00 0.00 ? 162 ASP B CB   1  
ATOM 4760   C CG   . ASP B 2 162 ? -3.051  -3.033  -9.933  1.00 0.00 ? 162 ASP B CG   1  
ATOM 4761   O OD1  . ASP B 2 162 ? -2.712  -2.458  -8.886  1.00 0.00 ? 162 ASP B OD1  1  
ATOM 4762   O OD2  . ASP B 2 162 ? -4.152  -2.825  -10.494 1.00 0.00 ? 162 ASP B OD2  1  
ATOM 4763   H H    . ASP B 2 162 ? -0.435  -5.086  -12.325 1.00 0.00 ? 162 ASP B H    1  
ATOM 4764   H HA   . ASP B 2 162 ? -1.235  -2.356  -11.583 1.00 0.00 ? 162 ASP B HA   1  
ATOM 4765   H HB2  . ASP B 2 162 ? -2.631  -4.626  -11.286 1.00 0.00 ? 162 ASP B HB2  1  
ATOM 4766   H HB3  . ASP B 2 162 ? -1.708  -4.680  -9.769  1.00 0.00 ? 162 ASP B HB3  1  
ATOM 4767   H HD2  . ASP B 2 162 ? -4.707  -2.184  -10.044 1.00 0.00 ? 162 ASP B HD2  1  
ATOM 4768   N N    . MET B 2 163 ? 0.204   -2.175  -9.423  1.00 0.00 ? 163 MET B N    1  
ATOM 4769   C CA   . MET B 2 163 ? 1.297   -1.921  -8.496  1.00 0.00 ? 163 MET B CA   1  
ATOM 4770   C C    . MET B 2 163 ? 0.798   -1.501  -7.117  1.00 0.00 ? 163 MET B C    1  
ATOM 4771   O O    . MET B 2 163 ? -0.394  -1.260  -6.925  1.00 0.00 ? 163 MET B O    1  
ATOM 4772   C CB   . MET B 2 163 ? 2.257   -0.870  -9.068  1.00 0.00 ? 163 MET B CB   1  
ATOM 4773   C CG   . MET B 2 163 ? 1.576   0.343   -9.685  1.00 0.00 ? 163 MET B CG   1  
ATOM 4774   S SD   . MET B 2 163 ? 1.254   0.154   -11.453 1.00 0.00 ? 163 MET B SD   1  
ATOM 4775   C CE   . MET B 2 163 ? 2.923   0.002   -12.086 1.00 0.00 ? 163 MET B CE   1  
ATOM 4776   H H    . MET B 2 163 ? -0.593  -1.597  -9.397  1.00 0.00 ? 163 MET B H    1  
ATOM 4777   H HA   . MET B 2 163 ? 1.850   -2.853  -8.379  1.00 0.00 ? 163 MET B HA   1  
ATOM 4778   H HB2  . MET B 2 163 ? 2.902   -0.524  -8.261  1.00 0.00 ? 163 MET B HB2  1  
ATOM 4779   H HB3  . MET B 2 163 ? 2.863   -1.347  -9.838  1.00 0.00 ? 163 MET B HB3  1  
ATOM 4780   H HG2  . MET B 2 163 ? 0.628   0.511   -9.174  1.00 0.00 ? 163 MET B HG2  1  
ATOM 4781   H HG3  . MET B 2 163 ? 2.212   1.216   -9.537  1.00 0.00 ? 163 MET B HG3  1  
ATOM 4782   H HE1  . MET B 2 163 ? 3.404   -0.865  -11.633 1.00 0.00 ? 163 MET B HE1  1  
ATOM 4783   H HE2  . MET B 2 163 ? 2.900   -0.122  -13.168 1.00 0.00 ? 163 MET B HE2  1  
ATOM 4784   H HE3  . MET B 2 163 ? 3.488   0.901   -11.838 1.00 0.00 ? 163 MET B HE3  1  
ATOM 4785   N N    . SER B 2 164 ? 1.718   -1.411  -6.163  1.00 0.00 ? 164 SER B N    1  
ATOM 4786   C CA   . SER B 2 164 ? 1.391   -1.030  -4.797  1.00 0.00 ? 164 SER B CA   1  
ATOM 4787   C C    . SER B 2 164 ? 2.565   -0.269  -4.181  1.00 0.00 ? 164 SER B C    1  
ATOM 4788   O O    . SER B 2 164 ? 3.583   -0.052  -4.840  1.00 0.00 ? 164 SER B O    1  
ATOM 4789   C CB   . SER B 2 164 ? 1.097   -2.280  -3.960  1.00 0.00 ? 164 SER B CB   1  
ATOM 4790   O OG   . SER B 2 164 ? 0.097   -3.083  -4.556  1.00 0.00 ? 164 SER B OG   1  
ATOM 4791   H H    . SER B 2 164 ? 2.665   -1.583  -6.381  1.00 0.00 ? 164 SER B H    1  
ATOM 4792   H HA   . SER B 2 164 ? 0.510   -0.389  -4.807  1.00 0.00 ? 164 SER B HA   1  
ATOM 4793   H HB2  . SER B 2 164 ? 2.012   -2.866  -3.865  1.00 0.00 ? 164 SER B HB2  1  
ATOM 4794   H HB3  . SER B 2 164 ? 0.759   -1.972  -2.970  1.00 0.00 ? 164 SER B HB3  1  
ATOM 4795   H HG   . SER B 2 164 ? 0.474   -3.557  -5.309  1.00 0.00 ? 164 SER B HG   1  
ATOM 4796   N N    . TRP B 2 165 ? 2.424   0.136   -2.926  1.00 0.00 ? 165 TRP B N    1  
ATOM 4797   C CA   . TRP B 2 165 ? 3.481   0.863   -2.236  1.00 0.00 ? 165 TRP B CA   1  
ATOM 4798   C C    . TRP B 2 165 ? 3.839   0.187   -0.916  1.00 0.00 ? 165 TRP B C    1  
ATOM 4799   O O    . TRP B 2 165 ? 2.954   -0.177  -0.136  1.00 0.00 ? 165 TRP B O    1  
ATOM 4800   C CB   . TRP B 2 165 ? 3.067   2.317   -1.990  1.00 0.00 ? 165 TRP B CB   1  
ATOM 4801   C CG   . TRP B 2 165 ? 3.122   3.172   -3.219  1.00 0.00 ? 165 TRP B CG   1  
ATOM 4802   C CD1  . TRP B 2 165 ? 2.111   3.398   -4.106  1.00 0.00 ? 165 TRP B CD1  1  
ATOM 4803   C CD2  . TRP B 2 165 ? 4.251   3.914   -3.697  1.00 0.00 ? 165 TRP B CD2  1  
ATOM 4804   N NE1  . TRP B 2 165 ? 2.538   4.235   -5.108  1.00 0.00 ? 165 TRP B NE1  1  
ATOM 4805   C CE2  . TRP B 2 165 ? 3.849   4.566   -4.880  1.00 0.00 ? 165 TRP B CE2  1  
ATOM 4806   C CE3  . TRP B 2 165 ? 5.561   4.092   -3.241  1.00 0.00 ? 165 TRP B CE3  1  
ATOM 4807   C CZ2  . TRP B 2 165 ? 4.710   5.381   -5.612  1.00 0.00 ? 165 TRP B CZ2  1  
ATOM 4808   C CZ3  . TRP B 2 165 ? 6.413   4.901   -3.968  1.00 0.00 ? 165 TRP B CZ3  1  
ATOM 4809   C CH2  . TRP B 2 165 ? 5.984   5.535   -5.139  1.00 0.00 ? 165 TRP B CH2  1  
ATOM 4810   H H    . TRP B 2 165 ? 1.585   -0.056  -2.448  1.00 0.00 ? 165 TRP B H    1  
ATOM 4811   H HA   . TRP B 2 165 ? 4.364   0.860   -2.875  1.00 0.00 ? 165 TRP B HA   1  
ATOM 4812   H HB2  . TRP B 2 165 ? 2.048   2.329   -1.603  1.00 0.00 ? 165 TRP B HB2  1  
ATOM 4813   H HB3  . TRP B 2 165 ? 3.728   2.746   -1.237  1.00 0.00 ? 165 TRP B HB3  1  
ATOM 4814   H HD1  . TRP B 2 165 ? 1.118   2.979   -4.032  1.00 0.00 ? 165 TRP B HD1  1  
ATOM 4815   H HE1  . TRP B 2 165 ? 1.996   4.543   -5.862  1.00 0.00 ? 165 TRP B HE1  1  
ATOM 4816   H HE3  . TRP B 2 165 ? 5.900   3.606   -2.338  1.00 0.00 ? 165 TRP B HE3  1  
ATOM 4817   H HZ2  . TRP B 2 165 ? 4.383   5.871   -6.517  1.00 0.00 ? 165 TRP B HZ2  1  
ATOM 4818   H HZ3  . TRP B 2 165 ? 7.427   5.046   -3.626  1.00 0.00 ? 165 TRP B HZ3  1  
ATOM 4819   H HH2  . TRP B 2 165 ? 6.675   6.161   -5.684  1.00 0.00 ? 165 TRP B HH2  1  
ATOM 4820   N N    . VAL B 2 166 ? 5.135   0.009   -0.678  1.00 0.00 ? 166 VAL B N    1  
ATOM 4821   C CA   . VAL B 2 166 ? 5.622   -0.621  0.546   1.00 0.00 ? 166 VAL B CA   1  
ATOM 4822   C C    . VAL B 2 166 ? 6.794   0.188   1.099   1.00 0.00 ? 166 VAL B C    1  
ATOM 4823   O O    . VAL B 2 166 ? 7.595   0.724   0.333   1.00 0.00 ? 166 VAL B O    1  
ATOM 4824   C CB   . VAL B 2 166 ? 6.088   -2.077  0.293   1.00 0.00 ? 166 VAL B CB   1  
ATOM 4825   C CG1  . VAL B 2 166 ? 6.490   -2.759  1.593   1.00 0.00 ? 166 VAL B CG1  1  
ATOM 4826   C CG2  . VAL B 2 166 ? 5.010   -2.881  -0.419  1.00 0.00 ? 166 VAL B CG2  1  
ATOM 4827   H H    . VAL B 2 166 ? 5.790   0.321   -1.342  1.00 0.00 ? 166 VAL B H    1  
ATOM 4828   H HA   . VAL B 2 166 ? 4.814   -0.632  1.278   1.00 0.00 ? 166 VAL B HA   1  
ATOM 4829   H HB   . VAL B 2 166 ? 6.964   -2.040  -0.354  1.00 0.00 ? 166 VAL B HB   1  
ATOM 4830   H HG11 . VAL B 2 166 ? 6.841   -3.771  1.389   1.00 0.00 ? 166 VAL B HG11 1  
ATOM 4831   H HG12 . VAL B 2 166 ? 7.289   -2.190  2.068   1.00 0.00 ? 166 VAL B HG12 1  
ATOM 4832   H HG13 . VAL B 2 166 ? 5.629   -2.804  2.260   1.00 0.00 ? 166 VAL B HG13 1  
ATOM 4833   H HG21 . VAL B 2 166 ? 4.763   -2.399  -1.364  1.00 0.00 ? 166 VAL B HG21 1  
ATOM 4834   H HG22 . VAL B 2 166 ? 5.368   -3.893  -0.613  1.00 0.00 ? 166 VAL B HG22 1  
ATOM 4835   H HG23 . VAL B 2 166 ? 4.120   -2.928  0.209   1.00 0.00 ? 166 VAL B HG23 1  
ATOM 4836   N N    . ARG B 2 167 ? 6.889   0.292   2.418   1.00 0.00 ? 167 ARG B N    1  
ATOM 4837   C CA   . ARG B 2 167 ? 7.971   1.049   3.033   1.00 0.00 ? 167 ARG B CA   1  
ATOM 4838   C C    . ARG B 2 167 ? 8.765   0.206   4.024   1.00 0.00 ? 167 ARG B C    1  
ATOM 4839   O O    . ARG B 2 167 ? 8.226   -0.694  4.669   1.00 0.00 ? 167 ARG B O    1  
ATOM 4840   C CB   . ARG B 2 167 ? 7.453   2.330   3.696   1.00 0.00 ? 167 ARG B CB   1  
ATOM 4841   C CG   . ARG B 2 167 ? 6.687   2.121   4.995   1.00 0.00 ? 167 ARG B CG   1  
ATOM 4842   C CD   . ARG B 2 167 ? 6.215   3.449   5.565   1.00 0.00 ? 167 ARG B CD   1  
ATOM 4843   N NE   . ARG B 2 167 ? 5.575   3.299   6.868   1.00 0.00 ? 167 ARG B NE   1  
ATOM 4844   C CZ   . ARG B 2 167 ? 4.879   4.258   7.477   1.00 0.00 ? 167 ARG B CZ   1  
ATOM 4845   N NH1  . ARG B 2 167 ? 4.717   5.445   6.903   1.00 0.00 ? 167 ARG B NH1  1  
ATOM 4846   N NH2  . ARG B 2 167 ? 4.349   4.024   8.668   1.00 0.00 ? 167 ARG B NH2  1  
ATOM 4847   H H    . ARG B 2 167 ? 6.226   -0.162  2.992   1.00 0.00 ? 167 ARG B H    1  
ATOM 4848   H HA   . ARG B 2 167 ? 8.651   1.343   2.233   1.00 0.00 ? 167 ARG B HA   1  
ATOM 4849   H HB2  . ARG B 2 167 ? 8.309   2.971   3.909   1.00 0.00 ? 167 ARG B HB2  1  
ATOM 4850   H HB3  . ARG B 2 167 ? 6.791   2.832   2.991   1.00 0.00 ? 167 ARG B HB3  1  
ATOM 4851   H HG2  . ARG B 2 167 ? 5.820   1.488   4.800   1.00 0.00 ? 167 ARG B HG2  1  
ATOM 4852   H HG3  . ARG B 2 167 ? 7.338   1.632   5.719   1.00 0.00 ? 167 ARG B HG3  1  
ATOM 4853   H HD2  . ARG B 2 167 ? 7.074   4.112   5.671   1.00 0.00 ? 167 ARG B HD2  1  
ATOM 4854   H HD3  . ARG B 2 167 ? 5.501   3.896   4.873   1.00 0.00 ? 167 ARG B HD3  1  
ATOM 4855   H HE   . ARG B 2 167 ? 5.672   2.424   7.327   1.00 0.00 ? 167 ARG B HE   1  
ATOM 4856   H HH11 . ARG B 2 167 ? 5.120   5.635   6.002   1.00 0.00 ? 167 ARG B HH11 1  
ATOM 4857   H HH12 . ARG B 2 167 ? 4.180   6.171   7.371   1.00 0.00 ? 167 ARG B HH12 1  
ATOM 4858   H HH21 . ARG B 2 167 ? 4.473   3.124   9.104   1.00 0.00 ? 167 ARG B HH21 1  
ATOM 4859   H HH22 . ARG B 2 167 ? 3.831   4.739   9.138   1.00 0.00 ? 167 ARG B HH22 1  
ATOM 4860   N N    . GLN B 2 168 ? 10.048  0.503   4.132   1.00 0.00 ? 168 GLN B N    1  
ATOM 4861   C CA   . GLN B 2 168 ? 10.930  -0.211  5.039   1.00 0.00 ? 168 GLN B CA   1  
ATOM 4862   C C    . GLN B 2 168 ? 11.855  0.770   5.748   1.00 0.00 ? 168 GLN B C    1  
ATOM 4863   O O    . GLN B 2 168 ? 12.691  1.415   5.119   1.00 0.00 ? 168 GLN B O    1  
ATOM 4864   C CB   . GLN B 2 168 ? 11.763  -1.247  4.277   1.00 0.00 ? 168 GLN B CB   1  
ATOM 4865   C CG   . GLN B 2 168 ? 12.748  -2.016  5.146   1.00 0.00 ? 168 GLN B CG   1  
ATOM 4866   C CD   . GLN B 2 168 ? 13.804  -2.743  4.337   1.00 0.00 ? 168 GLN B CD   1  
ATOM 4867   O OE1  . GLN B 2 168 ? 14.204  -2.292  3.265   1.00 0.00 ? 168 GLN B OE1  1  
ATOM 4868   N NE2  . GLN B 2 168 ? 14.270  -3.870  4.851   1.00 0.00 ? 168 GLN B NE2  1  
ATOM 4869   H H    . GLN B 2 168 ? 10.417  1.232   3.582   1.00 0.00 ? 168 GLN B H    1  
ATOM 4870   H HA   . GLN B 2 168 ? 10.321  -0.725  5.782   1.00 0.00 ? 168 GLN B HA   1  
ATOM 4871   H HB2  . GLN B 2 168 ? 11.082  -1.963  3.818   1.00 0.00 ? 168 GLN B HB2  1  
ATOM 4872   H HB3  . GLN B 2 168 ? 12.325  -0.730  3.500   1.00 0.00 ? 168 GLN B HB3  1  
ATOM 4873   H HG2  . GLN B 2 168 ? 13.244  -1.314  5.817   1.00 0.00 ? 168 GLN B HG2  1  
ATOM 4874   H HG3  . GLN B 2 168 ? 12.195  -2.747  5.737   1.00 0.00 ? 168 GLN B HG3  1  
ATOM 4875   H HE21 . GLN B 2 168 ? 13.915  -4.164  5.717   1.00 0.00 ? 168 GLN B HE21 1  
ATOM 4876   H HE22 . GLN B 2 168 ? 14.946  -4.370  4.338   1.00 0.00 ? 168 GLN B HE22 1  
ATOM 4877   N N    . ALA B 2 169 ? 11.665  0.921   7.047   1.00 0.00 ? 169 ALA B N    1  
ATOM 4878   C CA   . ALA B 2 169 ? 12.503  1.809   7.836   1.00 0.00 ? 169 ALA B CA   1  
ATOM 4879   C C    . ALA B 2 169 ? 13.873  1.176   8.057   1.00 0.00 ? 169 ALA B C    1  
ATOM 4880   O O    . ALA B 2 169 ? 13.985  -0.047  8.116   1.00 0.00 ? 169 ALA B O    1  
ATOM 4881   C CB   . ALA B 2 169 ? 11.837  2.120   9.167   1.00 0.00 ? 169 ALA B CB   1  
ATOM 4882   H H    . ALA B 2 169 ? 10.932  0.443   7.480   1.00 0.00 ? 169 ALA B H    1  
ATOM 4883   H HA   . ALA B 2 169 ? 12.633  2.740   7.285   1.00 0.00 ? 169 ALA B HA   1  
ATOM 4884   H HB1  . ALA B 2 169 ? 12.464  2.803   9.741   1.00 0.00 ? 169 ALA B HB1  1  
ATOM 4885   H HB2  . ALA B 2 169 ? 10.867  2.583   8.988   1.00 0.00 ? 169 ALA B HB2  1  
ATOM 4886   H HB3  . ALA B 2 169 ? 11.700  1.196   9.729   1.00 0.00 ? 169 ALA B HB3  1  
ATOM 4887   N N    . PRO B 2 170 ? 14.936  1.995   8.140   1.00 0.00 ? 170 PRO B N    1  
ATOM 4888   C CA   . PRO B 2 170 ? 16.296  1.498   8.371   1.00 0.00 ? 170 PRO B CA   1  
ATOM 4889   C C    . PRO B 2 170 ? 16.353  0.682   9.657   1.00 0.00 ? 170 PRO B C    1  
ATOM 4890   O O    . PRO B 2 170 ? 16.140  1.214   10.751  1.00 0.00 ? 170 PRO B O    1  
ATOM 4891   C CB   . PRO B 2 170 ? 17.127  2.777   8.517   1.00 0.00 ? 170 PRO B CB   1  
ATOM 4892   C CG   . PRO B 2 170 ? 16.347  3.814   7.788   1.00 0.00 ? 170 PRO B CG   1  
ATOM 4893   C CD   . PRO B 2 170 ? 14.902  3.461   7.996   1.00 0.00 ? 170 PRO B CD   1  
ATOM 4894   H HA   . PRO B 2 170 ? 16.647  0.897   7.532   1.00 0.00 ? 170 PRO B HA   1  
ATOM 4895   H HB2  . PRO B 2 170 ? 17.283  3.043   9.562   1.00 0.00 ? 170 PRO B HB2  1  
ATOM 4896   H HB3  . PRO B 2 170 ? 18.081  2.636   8.008   1.00 0.00 ? 170 PRO B HB3  1  
ATOM 4897   H HG2  . PRO B 2 170 ? 16.538  4.780   8.256   1.00 0.00 ? 170 PRO B HG2  1  
ATOM 4898   H HG3  . PRO B 2 170 ? 16.604  3.840   6.729   1.00 0.00 ? 170 PRO B HG3  1  
ATOM 4899   H HD2  . PRO B 2 170 ? 14.497  3.950   8.882   1.00 0.00 ? 170 PRO B HD2  1  
ATOM 4900   H HD3  . PRO B 2 170 ? 14.318  3.728   7.115   1.00 0.00 ? 170 PRO B HD3  1  
ATOM 4901   N N    . GLY B 2 171 ? 16.625  -0.609  9.522   1.00 0.00 ? 171 GLY B N    1  
ATOM 4902   C CA   . GLY B 2 171 ? 16.674  -1.478  10.676  1.00 0.00 ? 171 GLY B CA   1  
ATOM 4903   C C    . GLY B 2 171 ? 15.278  -1.873  11.111  1.00 0.00 ? 171 GLY B C    1  
ATOM 4904   O O    . GLY B 2 171 ? 14.946  -1.835  12.297  1.00 0.00 ? 171 GLY B O    1  
ATOM 4905   H H    . GLY B 2 171 ? 16.795  -0.975  8.629   1.00 0.00 ? 171 GLY B H    1  
ATOM 4906   H HA2  . GLY B 2 171 ? 17.238  -2.376  10.424  1.00 0.00 ? 171 GLY B HA2  1  
ATOM 4907   H HA3  . GLY B 2 171 ? 17.171  -0.959  11.495  1.00 0.00 ? 171 GLY B HA3  1  
ATOM 4908   N N    . LYS B 2 172 ? 14.451  -2.229  10.139  1.00 0.00 ? 172 LYS B N    1  
ATOM 4909   C CA   . LYS B 2 172 ? 13.076  -2.621  10.396  1.00 0.00 ? 172 LYS B CA   1  
ATOM 4910   C C    . LYS B 2 172 ? 12.566  -3.481  9.243   1.00 0.00 ? 172 LYS B C    1  
ATOM 4911   O O    . LYS B 2 172 ? 13.244  -3.634  8.222   1.00 0.00 ? 172 LYS B O    1  
ATOM 4912   C CB   . LYS B 2 172 ? 12.197  -1.369  10.534  1.00 0.00 ? 172 LYS B CB   1  
ATOM 4913   C CG   . LYS B 2 172 ? 10.870  -1.593  11.243  1.00 0.00 ? 172 LYS B CG   1  
ATOM 4914   C CD   . LYS B 2 172 ? 9.913   -0.440  10.993  1.00 0.00 ? 172 LYS B CD   1  
ATOM 4915   C CE   . LYS B 2 172 ? 8.697   -0.520  11.900  1.00 0.00 ? 172 LYS B CE   1  
ATOM 4916   N NZ   . LYS B 2 172 ? 7.712   0.549   11.600  1.00 0.00 ? 172 LYS B NZ   1  
ATOM 4917   H H    . LYS B 2 172 ? 14.776  -2.229  9.213   1.00 0.00 ? 172 LYS B H    1  
ATOM 4918   H HA   . LYS B 2 172 ? 13.034  -3.194  11.322  1.00 0.00 ? 172 LYS B HA   1  
ATOM 4919   H HB2  . LYS B 2 172 ? 12.759  -0.621  11.094  1.00 0.00 ? 172 LYS B HB2  1  
ATOM 4920   H HB3  . LYS B 2 172 ? 11.987  -0.991  9.533   1.00 0.00 ? 172 LYS B HB3  1  
ATOM 4921   H HG2  . LYS B 2 172 ? 10.420  -2.515  10.874  1.00 0.00 ? 172 LYS B HG2  1  
ATOM 4922   H HG3  . LYS B 2 172 ? 11.049  -1.680  12.315  1.00 0.00 ? 172 LYS B HG3  1  
ATOM 4923   H HD2  . LYS B 2 172 ? 10.434  0.500   11.179  1.00 0.00 ? 172 LYS B HD2  1  
ATOM 4924   H HD3  . LYS B 2 172 ? 9.583   -0.472  9.954   1.00 0.00 ? 172 LYS B HD3  1  
ATOM 4925   H HE2  . LYS B 2 172 ? 8.218   -1.490  11.766  1.00 0.00 ? 172 LYS B HE2  1  
ATOM 4926   H HE3  . LYS B 2 172 ? 9.021   -0.421  12.936  1.00 0.00 ? 172 LYS B HE3  1  
ATOM 4927   H HZ1  . LYS B 2 172 ? 7.154   0.297   10.753  1.00 0.00 ? 172 LYS B HZ1  1  
ATOM 4928   H HZ2  . LYS B 2 172 ? 8.200   1.451   11.428  1.00 0.00 ? 172 LYS B HZ2  1  
ATOM 4929   H HZ3  . LYS B 2 172 ? 7.060   0.670   12.401  1.00 0.00 ? 172 LYS B HZ3  1  
ATOM 4930   N N    . ARG B 2 173 ? 11.381  -4.048  9.413   1.00 0.00 ? 173 ARG B N    1  
ATOM 4931   C CA   . ARG B 2 173 ? 10.775  -4.876  8.382   1.00 0.00 ? 173 ARG B CA   1  
ATOM 4932   C C    . ARG B 2 173 ? 10.060  -4.001  7.359   1.00 0.00 ? 173 ARG B C    1  
ATOM 4933   O O    . ARG B 2 173 ? 10.078  -2.774  7.456   1.00 0.00 ? 173 ARG B O    1  
ATOM 4934   C CB   . ARG B 2 173 ? 9.786   -5.863  9.006   1.00 0.00 ? 173 ARG B CB   1  
ATOM 4935   C CG   . ARG B 2 173 ? 8.634   -5.203  9.749   1.00 0.00 ? 173 ARG B CG   1  
ATOM 4936   C CD   . ARG B 2 173 ? 7.899   -6.204  10.622  1.00 0.00 ? 173 ARG B CD   1  
ATOM 4937   N NE   . ARG B 2 173 ? 8.820   -6.960  11.470  1.00 0.00 ? 173 ARG B NE   1  
ATOM 4938   C CZ   . ARG B 2 173 ? 9.122   -6.627  12.723  1.00 0.00 ? 173 ARG B CZ   1  
ATOM 4939   N NH1  . ARG B 2 173 ? 8.570   -5.553  13.278  1.00 0.00 ? 173 ARG B NH1  1  
ATOM 4940   N NH2  . ARG B 2 173 ? 9.976   -7.366  13.420  1.00 0.00 ? 173 ARG B NH2  1  
ATOM 4941   H H    . ARG B 2 173 ? 10.900  -3.902  10.252  1.00 0.00 ? 173 ARG B H    1  
ATOM 4942   H HA   . ARG B 2 173 ? 11.563  -5.437  7.879   1.00 0.00 ? 173 ARG B HA   1  
ATOM 4943   H HB2  . ARG B 2 173 ? 9.370   -6.480  8.209   1.00 0.00 ? 173 ARG B HB2  1  
ATOM 4944   H HB3  . ARG B 2 173 ? 10.329  -6.494  9.708   1.00 0.00 ? 173 ARG B HB3  1  
ATOM 4945   H HG2  . ARG B 2 173 ? 9.028   -4.405  10.377  1.00 0.00 ? 173 ARG B HG2  1  
ATOM 4946   H HG3  . ARG B 2 173 ? 7.936   -4.784  9.024   1.00 0.00 ? 173 ARG B HG3  1  
ATOM 4947   H HD2  . ARG B 2 173 ? 7.192   -5.670  11.256  1.00 0.00 ? 173 ARG B HD2  1  
ATOM 4948   H HD3  . ARG B 2 173 ? 7.354   -6.899  9.984   1.00 0.00 ? 173 ARG B HD3  1  
ATOM 4949   H HE   . ARG B 2 173 ? 9.240   -7.763  11.074  1.00 0.00 ? 173 ARG B HE   1  
ATOM 4950   H HH11 . ARG B 2 173 ? 7.923   -4.988  12.758  1.00 0.00 ? 173 ARG B HH11 1  
ATOM 4951   H HH12 . ARG B 2 173 ? 8.799   -5.304  14.224  1.00 0.00 ? 173 ARG B HH12 1  
ATOM 4952   H HH21 . ARG B 2 173 ? 10.394  -8.174  13.010  1.00 0.00 ? 173 ARG B HH21 1  
ATOM 4953   H HH22 . ARG B 2 173 ? 10.206  -7.114  14.368  1.00 0.00 ? 173 ARG B HH22 1  
ATOM 4954   N N    . LEU B 2 174 ? 9.419   -4.638  6.398   1.00 0.00 ? 174 LEU B N    1  
ATOM 4955   C CA   . LEU B 2 174 ? 8.697   -3.917  5.365   1.00 0.00 ? 174 LEU B CA   1  
ATOM 4956   C C    . LEU B 2 174 ? 7.203   -3.896  5.676   1.00 0.00 ? 174 LEU B C    1  
ATOM 4957   O O    . LEU B 2 174 ? 6.605   -4.938  5.960   1.00 0.00 ? 174 LEU B O    1  
ATOM 4958   C CB   . LEU B 2 174 ? 8.958   -4.529  3.984   1.00 0.00 ? 174 LEU B CB   1  
ATOM 4959   C CG   . LEU B 2 174 ? 10.422  -4.578  3.526   1.00 0.00 ? 174 LEU B CG   1  
ATOM 4960   C CD1  . LEU B 2 174 ? 11.082  -5.884  3.947   1.00 0.00 ? 174 LEU B CD1  1  
ATOM 4961   C CD2  . LEU B 2 174 ? 10.522  -4.384  2.023   1.00 0.00 ? 174 LEU B CD2  1  
ATOM 4962   H H    . LEU B 2 174 ? 9.416   -5.616  6.394   1.00 0.00 ? 174 LEU B H    1  
ATOM 4963   H HA   . LEU B 2 174 ? 9.059   -2.889  5.355   1.00 0.00 ? 174 LEU B HA   1  
ATOM 4964   H HB2  . LEU B 2 174 ? 8.580   -5.551  3.997   1.00 0.00 ? 174 LEU B HB2  1  
ATOM 4965   H HB3  . LEU B 2 174 ? 8.400   -3.945  3.251   1.00 0.00 ? 174 LEU B HB3  1  
ATOM 4966   H HG   . LEU B 2 174 ? 10.954  -3.759  4.010   1.00 0.00 ? 174 LEU B HG   1  
ATOM 4967   H HD11 . LEU B 2 174 ? 12.127  -5.890  3.636   1.00 0.00 ? 174 LEU B HD11 1  
ATOM 4968   H HD12 . LEU B 2 174 ? 11.028  -5.985  5.031   1.00 0.00 ? 174 LEU B HD12 1  
ATOM 4969   H HD13 . LEU B 2 174 ? 10.562  -6.720  3.478   1.00 0.00 ? 174 LEU B HD13 1  
ATOM 4970   H HD21 . LEU B 2 174 ? 10.075  -3.428  1.750   1.00 0.00 ? 174 LEU B HD21 1  
ATOM 4971   H HD22 . LEU B 2 174 ? 11.569  -4.393  1.717   1.00 0.00 ? 174 LEU B HD22 1  
ATOM 4972   H HD23 . LEU B 2 174 ? 9.992   -5.190  1.517   1.00 0.00 ? 174 LEU B HD23 1  
ATOM 4973   N N    . GLU B 2 175 ? 6.621   -2.707  5.658   1.00 0.00 ? 175 GLU B N    1  
ATOM 4974   C CA   . GLU B 2 175 ? 5.202   -2.541  5.929   1.00 0.00 ? 175 GLU B CA   1  
ATOM 4975   C C    . GLU B 2 175 ? 4.471   -1.967  4.719   1.00 0.00 ? 175 GLU B C    1  
ATOM 4976   O O    . GLU B 2 175 ? 4.992   -1.090  4.021   1.00 0.00 ? 175 GLU B O    1  
ATOM 4977   C CB   . GLU B 2 175 ? 4.965   -1.686  7.180   1.00 0.00 ? 175 GLU B CB   1  
ATOM 4978   C CG   . GLU B 2 175 ? 5.996   -0.591  7.409   1.00 0.00 ? 175 GLU B CG   1  
ATOM 4979   C CD   . GLU B 2 175 ? 5.797   0.139   8.723   1.00 0.00 ? 175 GLU B CD   1  
ATOM 4980   O OE1  . GLU B 2 175 ? 5.427   1.327   8.698   1.00 0.00 ? 175 GLU B OE1  1  
ATOM 4981   O OE2  . GLU B 2 175 ? 6.014   -0.474  9.790   1.00 0.00 ? 175 GLU B OE2  1  
ATOM 4982   H H    . GLU B 2 175 ? 7.171   -1.913  5.460   1.00 0.00 ? 175 GLU B H    1  
ATOM 4983   H HA   . GLU B 2 175 ? 4.791   -3.531  6.126   1.00 0.00 ? 175 GLU B HA   1  
ATOM 4984   H HB2  . GLU B 2 175 ? 3.986   -1.216  7.090   1.00 0.00 ? 175 GLU B HB2  1  
ATOM 4985   H HB3  . GLU B 2 175 ? 4.973   -2.345  8.048   1.00 0.00 ? 175 GLU B HB3  1  
ATOM 4986   H HG2  . GLU B 2 175 ? 6.990   -1.040  7.406   1.00 0.00 ? 175 GLU B HG2  1  
ATOM 4987   H HG3  . GLU B 2 175 ? 5.927   0.130   6.594   1.00 0.00 ? 175 GLU B HG3  1  
ATOM 4988   H HE2  . GLU B 2 175 ? 5.868   0.050   10.581  1.00 0.00 ? 175 GLU B HE2  1  
ATOM 4989   N N    . TRP B 2 176 ? 3.272   -2.481  4.471   1.00 0.00 ? 176 TRP B N    1  
ATOM 4990   C CA   . TRP B 2 176 ? 2.453   -2.050  3.345   1.00 0.00 ? 176 TRP B CA   1  
ATOM 4991   C C    . TRP B 2 176 ? 1.990   -0.605  3.530   1.00 0.00 ? 176 TRP B C    1  
ATOM 4992   O O    . TRP B 2 176 ? 1.652   -0.191  4.638   1.00 0.00 ? 176 TRP B O    1  
ATOM 4993   C CB   . TRP B 2 176 ? 1.250   -2.988  3.205   1.00 0.00 ? 176 TRP B CB   1  
ATOM 4994   C CG   . TRP B 2 176 ? 0.611   -2.977  1.852   1.00 0.00 ? 176 TRP B CG   1  
ATOM 4995   C CD1  . TRP B 2 176 ? 1.243   -2.983  0.642   1.00 0.00 ? 176 TRP B CD1  1  
ATOM 4996   C CD2  . TRP B 2 176 ? -0.792  -2.970  1.575   1.00 0.00 ? 176 TRP B CD2  1  
ATOM 4997   N NE1  . TRP B 2 176 ? 0.317   -2.976  -0.371  1.00 0.00 ? 176 TRP B NE1  1  
ATOM 4998   C CE2  . TRP B 2 176 ? -0.941  -2.969  0.177   1.00 0.00 ? 176 TRP B CE2  1  
ATOM 4999   C CE3  . TRP B 2 176 ? -1.936  -2.965  2.377   1.00 0.00 ? 176 TRP B CE3  1  
ATOM 5000   C CZ2  . TRP B 2 176 ? -2.189  -2.965  -0.438  1.00 0.00 ? 176 TRP B CZ2  1  
ATOM 5001   C CZ3  . TRP B 2 176 ? -3.173  -2.959  1.765   1.00 0.00 ? 176 TRP B CZ3  1  
ATOM 5002   C CH2  . TRP B 2 176 ? -3.290  -2.959  0.372   1.00 0.00 ? 176 TRP B CH2  1  
ATOM 5003   H H    . TRP B 2 176 ? 2.921   -3.169  5.071   1.00 0.00 ? 176 TRP B H    1  
ATOM 5004   H HA   . TRP B 2 176 ? 3.052   -2.110  2.437   1.00 0.00 ? 176 TRP B HA   1  
ATOM 5005   H HB2  . TRP B 2 176 ? 1.577   -4.004  3.423   1.00 0.00 ? 176 TRP B HB2  1  
ATOM 5006   H HB3  . TRP B 2 176 ? 0.500   -2.700  3.943   1.00 0.00 ? 176 TRP B HB3  1  
ATOM 5007   H HD1  . TRP B 2 176 ? 2.313   -2.991  0.503   1.00 0.00 ? 176 TRP B HD1  1  
ATOM 5008   H HE1  . TRP B 2 176 ? 0.520   -2.978  -1.331  1.00 0.00 ? 176 TRP B HE1  1  
ATOM 5009   H HE3  . TRP B 2 176 ? -1.853  -2.965  3.454   1.00 0.00 ? 176 TRP B HE3  1  
ATOM 5010   H HZ2  . TRP B 2 176 ? -2.284  -2.965  -1.513  1.00 0.00 ? 176 TRP B HZ2  1  
ATOM 5011   H HZ3  . TRP B 2 176 ? -4.066  -2.955  2.373   1.00 0.00 ? 176 TRP B HZ3  1  
ATOM 5012   H HH2  . TRP B 2 176 ? -4.273  -2.955  -0.076  1.00 0.00 ? 176 TRP B HH2  1  
ATOM 5013   N N    . VAL B 2 177 ? 1.982   0.158   2.441   1.00 0.00 ? 177 VAL B N    1  
ATOM 5014   C CA   . VAL B 2 177 ? 1.578   1.558   2.494   1.00 0.00 ? 177 VAL B CA   1  
ATOM 5015   C C    . VAL B 2 177 ? 0.247   1.805   1.789   1.00 0.00 ? 177 VAL B C    1  
ATOM 5016   O O    . VAL B 2 177 ? -0.603  2.526   2.310   1.00 0.00 ? 177 VAL B O    1  
ATOM 5017   C CB   . VAL B 2 177 ? 2.653   2.486   1.883   1.00 0.00 ? 177 VAL B CB   1  
ATOM 5018   C CG1  . VAL B 2 177 ? 2.242   3.948   1.999   1.00 0.00 ? 177 VAL B CG1  1  
ATOM 5019   C CG2  . VAL B 2 177 ? 3.997   2.260   2.551   1.00 0.00 ? 177 VAL B CG2  1  
ATOM 5020   H H    . VAL B 2 177 ? 2.257   -0.228  1.581   1.00 0.00 ? 177 VAL B H    1  
ATOM 5021   H HA   . VAL B 2 177 ? 1.459   1.820   3.545   1.00 0.00 ? 177 VAL B HA   1  
ATOM 5022   H HB   . VAL B 2 177 ? 2.752   2.243   0.825   1.00 0.00 ? 177 VAL B HB   1  
ATOM 5023   H HG11 . VAL B 2 177 ? 3.001   4.583   1.543   1.00 0.00 ? 177 VAL B HG11 1  
ATOM 5024   H HG12 . VAL B 2 177 ? 1.291   4.098   1.487   1.00 0.00 ? 177 VAL B HG12 1  
ATOM 5025   H HG13 . VAL B 2 177 ? 2.134   4.211   3.051   1.00 0.00 ? 177 VAL B HG13 1  
ATOM 5026   H HG21 . VAL B 2 177 ? 4.291   1.217   2.430   1.00 0.00 ? 177 VAL B HG21 1  
ATOM 5027   H HG22 . VAL B 2 177 ? 4.750   2.903   2.094   1.00 0.00 ? 177 VAL B HG22 1  
ATOM 5028   H HG23 . VAL B 2 177 ? 3.918   2.495   3.612   1.00 0.00 ? 177 VAL B HG23 1  
ATOM 5029   N N    . ALA B 2 178 ? 0.049   1.179   0.628   1.00 0.00 ? 178 ALA B N    1  
ATOM 5030   C CA   . ALA B 2 178 ? -1.177  1.378   -0.145  1.00 0.00 ? 178 ALA B CA   1  
ATOM 5031   C C    . ALA B 2 178 ? -1.182  0.547   -1.424  1.00 0.00 ? 178 ALA B C    1  
ATOM 5032   O O    . ALA B 2 178 ? -0.168  -0.047  -1.798  1.00 0.00 ? 178 ALA B O    1  
ATOM 5033   C CB   . ALA B 2 178 ? -1.351  2.849   -0.504  1.00 0.00 ? 178 ALA B CB   1  
ATOM 5034   H H    . ALA B 2 178 ? 0.698   0.516   0.319   1.00 0.00 ? 178 ALA B H    1  
ATOM 5035   H HA   . ALA B 2 178 ? -2.019  1.067   0.473   1.00 0.00 ? 178 ALA B HA   1  
ATOM 5036   H HB1  . ALA B 2 178 ? -2.283  2.991   -1.052  1.00 0.00 ? 178 ALA B HB1  1  
ATOM 5037   H HB2  . ALA B 2 178 ? -1.375  3.444   0.409   1.00 0.00 ? 178 ALA B HB2  1  
ATOM 5038   H HB3  . ALA B 2 178 ? -0.516  3.172   -1.126  1.00 0.00 ? 178 ALA B HB3  1  
ATOM 5039   N N    . TYR B 2 179 ? -2.333  0.531   -2.086  1.00 0.00 ? 179 TYR B N    1  
ATOM 5040   C CA   . TYR B 2 179 ? -2.521  -0.192  -3.337  1.00 0.00 ? 179 TYR B CA   1  
ATOM 5041   C C    . TYR B 2 179 ? -3.036  0.788   -4.388  1.00 0.00 ? 179 TYR B C    1  
ATOM 5042   O O    . TYR B 2 179 ? -3.959  1.561   -4.117  1.00 0.00 ? 179 TYR B O    1  
ATOM 5043   C CB   . TYR B 2 179 ? -3.529  -1.332  -3.130  1.00 0.00 ? 179 TYR B CB   1  
ATOM 5044   C CG   . TYR B 2 179 ? -3.976  -2.041  -4.394  1.00 0.00 ? 179 TYR B CG   1  
ATOM 5045   C CD1  . TYR B 2 179 ? -3.287  -3.147  -4.880  1.00 0.00 ? 179 TYR B CD1  1  
ATOM 5046   C CD2  . TYR B 2 179 ? -5.096  -1.610  -5.095  1.00 0.00 ? 179 TYR B CD2  1  
ATOM 5047   C CE1  . TYR B 2 179 ? -3.701  -3.797  -6.028  1.00 0.00 ? 179 TYR B CE1  1  
ATOM 5048   C CE2  . TYR B 2 179 ? -5.515  -2.254  -6.240  1.00 0.00 ? 179 TYR B CE2  1  
ATOM 5049   C CZ   . TYR B 2 179 ? -4.815  -3.345  -6.703  1.00 0.00 ? 179 TYR B CZ   1  
ATOM 5050   O OH   . TYR B 2 179 ? -5.232  -3.984  -7.849  1.00 0.00 ? 179 TYR B OH   1  
ATOM 5051   H H    . TYR B 2 179 ? -3.091  1.035   -1.719  1.00 0.00 ? 179 TYR B H    1  
ATOM 5052   H HA   . TYR B 2 179 ? -1.569  -0.610  -3.663  1.00 0.00 ? 179 TYR B HA   1  
ATOM 5053   H HB2  . TYR B 2 179 ? -3.077  -2.070  -2.468  1.00 0.00 ? 179 TYR B HB2  1  
ATOM 5054   H HB3  . TYR B 2 179 ? -4.413  -0.920  -2.642  1.00 0.00 ? 179 TYR B HB3  1  
ATOM 5055   H HD1  . TYR B 2 179 ? -2.415  -3.503  -4.352  1.00 0.00 ? 179 TYR B HD1  1  
ATOM 5056   H HD2  . TYR B 2 179 ? -5.649  -0.754  -4.736  1.00 0.00 ? 179 TYR B HD2  1  
ATOM 5057   H HE1  . TYR B 2 179 ? -3.155  -4.654  -6.394  1.00 0.00 ? 179 TYR B HE1  1  
ATOM 5058   H HE2  . TYR B 2 179 ? -6.387  -1.904  -6.771  1.00 0.00 ? 179 TYR B HE2  1  
ATOM 5059   H HH   . TYR B 2 179 ? -4.814  -3.564  -8.616  1.00 0.00 ? 179 TYR B HH   1  
ATOM 5060   N N    . ILE B 2 180 ? -2.453  0.762   -5.577  1.00 0.00 ? 180 ILE B N    1  
ATOM 5061   C CA   . ILE B 2 180 ? -2.862  1.669   -6.639  1.00 0.00 ? 180 ILE B CA   1  
ATOM 5062   C C    . ILE B 2 180 ? -3.359  0.904   -7.867  1.00 0.00 ? 180 ILE B C    1  
ATOM 5063   O O    . ILE B 2 180 ? -2.583  0.537   -8.755  1.00 0.00 ? 180 ILE B O    1  
ATOM 5064   C CB   . ILE B 2 180 ? -1.751  2.686   -6.994  1.00 0.00 ? 180 ILE B CB   1  
ATOM 5065   C CG1  . ILE B 2 180 ? -2.125  3.544   -8.202  1.00 0.00 ? 180 ILE B CG1  1  
ATOM 5066   C CG2  . ILE B 2 180 ? -0.404  2.006   -7.186  1.00 0.00 ? 180 ILE B CG2  1  
ATOM 5067   C CD1  . ILE B 2 180 ? -1.198  4.720   -8.406  1.00 0.00 ? 180 ILE B CD1  1  
ATOM 5068   H H    . ILE B 2 180 ? -1.741  0.103   -5.755  1.00 0.00 ? 180 ILE B H    1  
ATOM 5069   H HA   . ILE B 2 180 ? -3.707  2.242   -6.255  1.00 0.00 ? 180 ILE B HA   1  
ATOM 5070   H HB   . ILE B 2 180 ? -1.651  3.359   -6.143  1.00 0.00 ? 180 ILE B HB   1  
ATOM 5071   H HG12 . ILE B 2 180 ? -2.093  2.920   -9.095  1.00 0.00 ? 180 ILE B HG12 1  
ATOM 5072   H HG13 . ILE B 2 180 ? -3.137  3.923   -8.059  1.00 0.00 ? 180 ILE B HG13 1  
ATOM 5073   H HG21 . ILE B 2 180 ? 0.368   2.749   -7.387  1.00 0.00 ? 180 ILE B HG21 1  
ATOM 5074   H HG22 . ILE B 2 180 ? -0.145  1.456   -6.282  1.00 0.00 ? 180 ILE B HG22 1  
ATOM 5075   H HG23 . ILE B 2 180 ? -0.464  1.316   -8.027  1.00 0.00 ? 180 ILE B HG23 1  
ATOM 5076   H HD11 . ILE B 2 180 ? -0.182  4.356   -8.557  1.00 0.00 ? 180 ILE B HD11 1  
ATOM 5077   H HD12 . ILE B 2 180 ? -1.504  5.299   -9.277  1.00 0.00 ? 180 ILE B HD12 1  
ATOM 5078   H HD13 . ILE B 2 180 ? -1.227  5.359   -7.523  1.00 0.00 ? 180 ILE B HD13 1  
ATOM 5079   N N    . SER B 2 181 ? -4.667  0.686   -7.902  1.00 0.00 ? 181 SER B N    1  
ATOM 5080   C CA   . SER B 2 181 ? -5.310  -0.054  -8.975  1.00 0.00 ? 181 SER B CA   1  
ATOM 5081   C C    . SER B 2 181 ? -5.039  0.537   -10.354 1.00 0.00 ? 181 SER B C    1  
ATOM 5082   O O    . SER B 2 181 ? -4.953  1.757   -10.526 1.00 0.00 ? 181 SER B O    1  
ATOM 5083   C CB   . SER B 2 181 ? -6.816  -0.145  -8.719  1.00 0.00 ? 181 SER B CB   1  
ATOM 5084   O OG   . SER B 2 181 ? -7.278  0.969   -7.966  1.00 0.00 ? 181 SER B OG   1  
ATOM 5085   H H    . SER B 2 181 ? -5.226  1.046   -7.184  1.00 0.00 ? 181 SER B H    1  
ATOM 5086   H HA   . SER B 2 181 ? -4.902  -1.065  -8.963  1.00 0.00 ? 181 SER B HA   1  
ATOM 5087   H HB2  . SER B 2 181 ? -7.338  -0.168  -9.676  1.00 0.00 ? 181 SER B HB2  1  
ATOM 5088   H HB3  . SER B 2 181 ? -7.029  -1.060  -8.166  1.00 0.00 ? 181 SER B HB3  1  
ATOM 5089   H HG   . SER B 2 181 ? -7.531  0.674   -7.080  1.00 0.00 ? 181 SER B HG   1  
ATOM 5090   N N    . SER B 2 182 ? -4.890  -0.347  -11.329 1.00 0.00 ? 182 SER B N    1  
ATOM 5091   C CA   . SER B 2 182 ? -4.645  0.045   -12.707 1.00 0.00 ? 182 SER B CA   1  
ATOM 5092   C C    . SER B 2 182 ? -5.914  0.611   -13.345 1.00 0.00 ? 182 SER B C    1  
ATOM 5093   O O    . SER B 2 182 ? -5.855  1.347   -14.329 1.00 0.00 ? 182 SER B O    1  
ATOM 5094   C CB   . SER B 2 182 ? -4.136  -1.162  -13.498 1.00 0.00 ? 182 SER B CB   1  
ATOM 5095   O OG   . SER B 2 182 ? -4.788  -2.353  -13.078 1.00 0.00 ? 182 SER B OG   1  
ATOM 5096   H H    . SER B 2 182 ? -4.911  -1.309  -11.102 1.00 0.00 ? 182 SER B H    1  
ATOM 5097   H HA   . SER B 2 182 ? -3.877  0.819   -12.715 1.00 0.00 ? 182 SER B HA   1  
ATOM 5098   H HB2  . SER B 2 182 ? -4.333  -1.003  -14.559 1.00 0.00 ? 182 SER B HB2  1  
ATOM 5099   H HB3  . SER B 2 182 ? -3.063  -1.268  -13.339 1.00 0.00 ? 182 SER B HB3  1  
ATOM 5100   H HG   . SER B 2 182 ? -4.434  -2.629  -12.214 1.00 0.00 ? 182 SER B HG   1  
ATOM 5101   N N    . GLY B 2 183 ? -7.056  0.269   -12.759 1.00 0.00 ? 183 GLY B N    1  
ATOM 5102   C CA   . GLY B 2 183 ? -8.327  0.741   -13.266 1.00 0.00 ? 183 GLY B CA   1  
ATOM 5103   C C    . GLY B 2 183 ? -8.671  2.118   -12.742 1.00 0.00 ? 183 GLY B C    1  
ATOM 5104   O O    . GLY B 2 183 ? -8.965  3.032   -13.514 1.00 0.00 ? 183 GLY B O    1  
ATOM 5105   H H    . GLY B 2 183 ? -7.029  -0.299  -11.966 1.00 0.00 ? 183 GLY B H    1  
ATOM 5106   H HA2  . GLY B 2 183 ? -8.278  0.780   -14.355 1.00 0.00 ? 183 GLY B HA2  1  
ATOM 5107   H HA3  . GLY B 2 183 ? -9.108  0.043   -12.965 1.00 0.00 ? 183 GLY B HA3  1  
ATOM 5108   N N    . GLY B 2 184 ? -8.623  2.272   -11.427 1.00 0.00 ? 184 GLY B N    1  
ATOM 5109   C CA   . GLY B 2 184 ? -8.930  3.553   -10.822 1.00 0.00 ? 184 GLY B CA   1  
ATOM 5110   C C    . GLY B 2 184 ? -10.266 3.544   -10.105 1.00 0.00 ? 184 GLY B C    1  
ATOM 5111   O O    . GLY B 2 184 ? -11.218 4.204   -10.533 1.00 0.00 ? 184 GLY B O    1  
ATOM 5112   H H    . GLY B 2 184 ? -8.381  1.509   -10.862 1.00 0.00 ? 184 GLY B H    1  
ATOM 5113   H HA2  . GLY B 2 184 ? -8.148  3.798   -10.104 1.00 0.00 ? 184 GLY B HA2  1  
ATOM 5114   H HA3  . GLY B 2 184 ? -8.955  4.313   -11.603 1.00 0.00 ? 184 GLY B HA3  1  
ATOM 5115   N N    . GLY B 2 185 ? -10.338 2.780   -9.025  1.00 0.00 ? 185 GLY B N    1  
ATOM 5116   C CA   . GLY B 2 185 ? -11.558 2.697   -8.249  1.00 0.00 ? 185 GLY B CA   1  
ATOM 5117   C C    . GLY B 2 185 ? -11.310 2.053   -6.904  1.00 0.00 ? 185 GLY B C    1  
ATOM 5118   O O    . GLY B 2 185 ? -11.342 2.726   -5.869  1.00 0.00 ? 185 GLY B O    1  
ATOM 5119   H H    . GLY B 2 185 ? -9.553  2.255   -8.754  1.00 0.00 ? 185 GLY B H    1  
ATOM 5120   H HA2  . GLY B 2 185 ? -11.950 3.702   -8.095  1.00 0.00 ? 185 GLY B HA2  1  
ATOM 5121   H HA3  . GLY B 2 185 ? -12.289 2.104   -8.798  1.00 0.00 ? 185 GLY B HA3  1  
ATOM 5122   N N    . SER B 2 186 ? -11.071 0.746   -6.925  1.00 0.00 ? 186 SER B N    1  
ATOM 5123   C CA   . SER B 2 186 ? -10.791 -0.015  -5.716  1.00 0.00 ? 186 SER B CA   1  
ATOM 5124   C C    . SER B 2 186 ? -9.557  0.539   -5.007  1.00 0.00 ? 186 SER B C    1  
ATOM 5125   O O    . SER B 2 186 ? -8.425  0.360   -5.464  1.00 0.00 ? 186 SER B O    1  
ATOM 5126   C CB   . SER B 2 186 ? -10.611 -1.490  -6.072  1.00 0.00 ? 186 SER B CB   1  
ATOM 5127   O OG   . SER B 2 186 ? -11.615 -1.898  -6.989  1.00 0.00 ? 186 SER B OG   1  
ATOM 5128   H H    . SER B 2 186 ? -11.123 0.274   -7.782  1.00 0.00 ? 186 SER B H    1  
ATOM 5129   H HA   . SER B 2 186 ? -11.645 0.078   -5.044  1.00 0.00 ? 186 SER B HA   1  
ATOM 5130   H HB2  . SER B 2 186 ? -9.630  -1.634  -6.526  1.00 0.00 ? 186 SER B HB2  1  
ATOM 5131   H HB3  . SER B 2 186 ? -10.684 -2.091  -5.166  1.00 0.00 ? 186 SER B HB3  1  
ATOM 5132   H HG   . SER B 2 186 ? -11.354 -2.727  -7.414  1.00 0.00 ? 186 SER B HG   1  
ATOM 5133   N N    . THR B 2 187 ? -9.794  1.232   -3.907  1.00 0.00 ? 187 THR B N    1  
ATOM 5134   C CA   . THR B 2 187 ? -8.730  1.846   -3.135  1.00 0.00 ? 187 THR B CA   1  
ATOM 5135   C C    . THR B 2 187 ? -8.497  1.097   -1.826  1.00 0.00 ? 187 THR B C    1  
ATOM 5136   O O    . THR B 2 187 ? -9.234  1.279   -0.857  1.00 0.00 ? 187 THR B O    1  
ATOM 5137   C CB   . THR B 2 187 ? -9.098  3.306   -2.822  1.00 0.00 ? 187 THR B CB   1  
ATOM 5138   O OG1  . THR B 2 187 ? -10.459 3.538   -3.232  1.00 0.00 ? 187 THR B OG1  1  
ATOM 5139   C CG2  . THR B 2 187 ? -8.181  4.262   -3.570  1.00 0.00 ? 187 THR B CG2  1  
ATOM 5140   H H    . THR B 2 187 ? -10.718 1.338   -3.604  1.00 0.00 ? 187 THR B H    1  
ATOM 5141   H HA   . THR B 2 187 ? -7.814  1.824   -3.725  1.00 0.00 ? 187 THR B HA   1  
ATOM 5142   H HB   . THR B 2 187 ? -9.002  3.480   -1.750  1.00 0.00 ? 187 THR B HB   1  
ATOM 5143   H HG1  . THR B 2 187 ? -10.524 3.442   -4.194  1.00 0.00 ? 187 THR B HG1  1  
ATOM 5144   H HG21 . THR B 2 187 ? -8.277  4.092   -4.642  1.00 0.00 ? 187 THR B HG21 1  
ATOM 5145   H HG22 . THR B 2 187 ? -8.457  5.291   -3.341  1.00 0.00 ? 187 THR B HG22 1  
ATOM 5146   H HG23 . THR B 2 187 ? -7.149  4.088   -3.265  1.00 0.00 ? 187 THR B HG23 1  
ATOM 5147   N N    . TYR B 2 188 ? -7.482  0.244   -1.807  1.00 0.00 ? 188 TYR B N    1  
ATOM 5148   C CA   . TYR B 2 188 ? -7.152  -0.526  -0.616  1.00 0.00 ? 188 TYR B CA   1  
ATOM 5149   C C    . TYR B 2 188 ? -6.316  0.314   0.342   1.00 0.00 ? 188 TYR B C    1  
ATOM 5150   O O    . TYR B 2 188 ? -5.178  0.671   0.031   1.00 0.00 ? 188 TYR B O    1  
ATOM 5151   C CB   . TYR B 2 188 ? -6.375  -1.792  -0.994  1.00 0.00 ? 188 TYR B CB   1  
ATOM 5152   C CG   . TYR B 2 188 ? -7.166  -2.830  -1.765  1.00 0.00 ? 188 TYR B CG   1  
ATOM 5153   C CD1  . TYR B 2 188 ? -7.610  -2.583  -3.059  1.00 0.00 ? 188 TYR B CD1  1  
ATOM 5154   C CD2  . TYR B 2 188 ? -7.457  -4.065  -1.199  1.00 0.00 ? 188 TYR B CD2  1  
ATOM 5155   C CE1  . TYR B 2 188 ? -8.323  -3.533  -3.765  1.00 0.00 ? 188 TYR B CE1  1  
ATOM 5156   C CE2  . TYR B 2 188 ? -8.168  -5.022  -1.900  1.00 0.00 ? 188 TYR B CE2  1  
ATOM 5157   C CZ   . TYR B 2 188 ? -8.599  -4.751  -3.181  1.00 0.00 ? 188 TYR B CZ   1  
ATOM 5158   O OH   . TYR B 2 188 ? -9.307  -5.701  -3.880  1.00 0.00 ? 188 TYR B OH   1  
ATOM 5159   H H    . TYR B 2 188 ? -6.939  0.121   -2.611  1.00 0.00 ? 188 TYR B H    1  
ATOM 5160   H HA   . TYR B 2 188 ? -8.080  -0.815  -0.121  1.00 0.00 ? 188 TYR B HA   1  
ATOM 5161   H HB2  . TYR B 2 188 ? -5.519  -1.497  -1.602  1.00 0.00 ? 188 TYR B HB2  1  
ATOM 5162   H HB3  . TYR B 2 188 ? -6.010  -2.254  -0.077  1.00 0.00 ? 188 TYR B HB3  1  
ATOM 5163   H HD1  . TYR B 2 188 ? -7.393  -1.632  -3.521  1.00 0.00 ? 188 TYR B HD1  1  
ATOM 5164   H HD2  . TYR B 2 188 ? -7.124  -4.281  -0.195  1.00 0.00 ? 188 TYR B HD2  1  
ATOM 5165   H HE1  . TYR B 2 188 ? -8.662  -3.322  -4.768  1.00 0.00 ? 188 TYR B HE1  1  
ATOM 5166   H HE2  . TYR B 2 188 ? -8.385  -5.977  -1.446  1.00 0.00 ? 188 TYR B HE2  1  
ATOM 5167   H HH   . TYR B 2 188 ? -8.859  -5.893  -4.710  1.00 0.00 ? 188 TYR B HH   1  
ATOM 5168   N N    . PHE B 2 189 ? -6.887  0.635   1.494   1.00 0.00 ? 189 PHE B N    1  
ATOM 5169   C CA   . PHE B 2 189 ? -6.196  1.435   2.495   1.00 0.00 ? 189 PHE B CA   1  
ATOM 5170   C C    . PHE B 2 189 ? -6.458  0.906   3.900   1.00 0.00 ? 189 PHE B C    1  
ATOM 5171   O O    . PHE B 2 189 ? -7.585  0.987   4.395   1.00 0.00 ? 189 PHE B O    1  
ATOM 5172   C CB   . PHE B 2 189 ? -6.644  2.896   2.416   1.00 0.00 ? 189 PHE B CB   1  
ATOM 5173   C CG   . PHE B 2 189 ? -5.815  3.749   1.499   1.00 0.00 ? 189 PHE B CG   1  
ATOM 5174   C CD1  . PHE B 2 189 ? -4.547  4.161   1.875   1.00 0.00 ? 189 PHE B CD1  1  
ATOM 5175   C CD2  . PHE B 2 189 ? -6.306  4.145   0.266   1.00 0.00 ? 189 PHE B CD2  1  
ATOM 5176   C CE1  . PHE B 2 189 ? -3.784  4.950   1.039   1.00 0.00 ? 189 PHE B CE1  1  
ATOM 5177   C CE2  . PHE B 2 189 ? -5.547  4.933   -0.574  1.00 0.00 ? 189 PHE B CE2  1  
ATOM 5178   C CZ   . PHE B 2 189 ? -4.284  5.337   -0.187  1.00 0.00 ? 189 PHE B CZ   1  
ATOM 5179   H H    . PHE B 2 189 ? -7.799  0.327   1.680   1.00 0.00 ? 189 PHE B H    1  
ATOM 5180   H HA   . PHE B 2 189 ? -5.126  1.383   2.294   1.00 0.00 ? 189 PHE B HA   1  
ATOM 5181   H HB2  . PHE B 2 189 ? -7.677  2.921   2.069   1.00 0.00 ? 189 PHE B HB2  1  
ATOM 5182   H HB3  . PHE B 2 189 ? -6.602  3.325   3.417   1.00 0.00 ? 189 PHE B HB3  1  
ATOM 5183   H HD1  . PHE B 2 189 ? -4.151  3.860   2.834   1.00 0.00 ? 189 PHE B HD1  1  
ATOM 5184   H HD2  . PHE B 2 189 ? -7.293  3.833   -0.041  1.00 0.00 ? 189 PHE B HD2  1  
ATOM 5185   H HE1  . PHE B 2 189 ? -2.797  5.265   1.344   1.00 0.00 ? 189 PHE B HE1  1  
ATOM 5186   H HE2  . PHE B 2 189 ? -5.940  5.234   -1.534  1.00 0.00 ? 189 PHE B HE2  1  
ATOM 5187   H HZ   . PHE B 2 189 ? -3.689  5.955   -0.843  1.00 0.00 ? 189 PHE B HZ   1  
ATOM 5188   N N    . PRO B 2 190 ? -5.430  0.337   4.549   1.00 0.00 ? 190 PRO B N    1  
ATOM 5189   C CA   . PRO B 2 190 ? -5.548  -0.182  5.918   1.00 0.00 ? 190 PRO B CA   1  
ATOM 5190   C C    . PRO B 2 190 ? -5.900  0.946   6.885   1.00 0.00 ? 190 PRO B C    1  
ATOM 5191   O O    . PRO B 2 190 ? -5.533  2.097   6.653   1.00 0.00 ? 190 PRO B O    1  
ATOM 5192   C CB   . PRO B 2 190 ? -4.141  -0.708  6.227   1.00 0.00 ? 190 PRO B CB   1  
ATOM 5193   C CG   . PRO B 2 190 ? -3.504  -0.911  4.896   1.00 0.00 ? 190 PRO B CG   1  
ATOM 5194   C CD   . PRO B 2 190 ? -4.082  0.141   3.997   1.00 0.00 ? 190 PRO B CD   1  
ATOM 5195   H HA   . PRO B 2 190 ? -6.289  -0.979  5.981   1.00 0.00 ? 190 PRO B HA   1  
ATOM 5196   H HB2  . PRO B 2 190 ? -3.575  -0.010  6.844   1.00 0.00 ? 190 PRO B HB2  1  
ATOM 5197   H HB3  . PRO B 2 190 ? -4.229  -1.676  6.721   1.00 0.00 ? 190 PRO B HB3  1  
ATOM 5198   H HG2  . PRO B 2 190 ? -2.434  -0.731  4.996   1.00 0.00 ? 190 PRO B HG2  1  
ATOM 5199   H HG3  . PRO B 2 190 ? -3.693  -1.913  4.511   1.00 0.00 ? 190 PRO B HG3  1  
ATOM 5200   H HD2  . PRO B 2 190 ? -3.490  1.056   4.023   1.00 0.00 ? 190 PRO B HD2  1  
ATOM 5201   H HD3  . PRO B 2 190 ? -4.156  -0.234  2.976   1.00 0.00 ? 190 PRO B HD3  1  
ATOM 5202   N N    . ASP B 2 191 ? -6.591  0.616   7.974   1.00 0.00 ? 191 ASP B N    1  
ATOM 5203   C CA   . ASP B 2 191 ? -7.000  1.620   8.967   1.00 0.00 ? 191 ASP B CA   1  
ATOM 5204   C C    . ASP B 2 191 ? -5.808  2.405   9.504   1.00 0.00 ? 191 ASP B C    1  
ATOM 5205   O O    . ASP B 2 191 ? -5.939  3.573   9.877   1.00 0.00 ? 191 ASP B O    1  
ATOM 5206   C CB   . ASP B 2 191 ? -7.751  0.971   10.134  1.00 0.00 ? 191 ASP B CB   1  
ATOM 5207   C CG   . ASP B 2 191 ? -8.885  0.071   9.691   1.00 0.00 ? 191 ASP B CG   1  
ATOM 5208   O OD1  . ASP B 2 191 ? -9.935  0.593   9.259   1.00 0.00 ? 191 ASP B OD1  1  
ATOM 5209   O OD2  . ASP B 2 191 ? -8.721  -1.164  9.771   1.00 0.00 ? 191 ASP B OD2  1  
ATOM 5210   H H    . ASP B 2 191 ? -6.841  -0.322  8.114   1.00 0.00 ? 191 ASP B H    1  
ATOM 5211   H HA   . ASP B 2 191 ? -7.675  2.318   8.471   1.00 0.00 ? 191 ASP B HA   1  
ATOM 5212   H HB2  . ASP B 2 191 ? -7.045  0.379   10.715  1.00 0.00 ? 191 ASP B HB2  1  
ATOM 5213   H HB3  . ASP B 2 191 ? -8.161  1.760   10.765  1.00 0.00 ? 191 ASP B HB3  1  
ATOM 5214   H HD2  . ASP B 2 191 ? -9.475  -1.677  9.473   1.00 0.00 ? 191 ASP B HD2  1  
ATOM 5215   N N    . THR B 2 192 ? -4.654  1.758   9.535   1.00 0.00 ? 192 THR B N    1  
ATOM 5216   C CA   . THR B 2 192 ? -3.429  2.366   10.026  1.00 0.00 ? 192 THR B CA   1  
ATOM 5217   C C    . THR B 2 192 ? -3.003  3.583   9.201   1.00 0.00 ? 192 THR B C    1  
ATOM 5218   O O    . THR B 2 192 ? -2.718  4.648   9.751   1.00 0.00 ? 192 THR B O    1  
ATOM 5219   C CB   . THR B 2 192 ? -2.299  1.324   10.021  1.00 0.00 ? 192 THR B CB   1  
ATOM 5220   O OG1  . THR B 2 192 ? -2.798  0.113   9.427   1.00 0.00 ? 192 THR B OG1  1  
ATOM 5221   C CG2  . THR B 2 192 ? -1.829  1.029   11.438  1.00 0.00 ? 192 THR B CG2  1  
ATOM 5222   H H    . THR B 2 192 ? -4.623  0.826   9.232   1.00 0.00 ? 192 THR B H    1  
ATOM 5223   H HA   . THR B 2 192 ? -3.602  2.691   11.052  1.00 0.00 ? 192 THR B HA   1  
ATOM 5224   H HB   . THR B 2 192 ? -1.461  1.702   9.436   1.00 0.00 ? 192 THR B HB   1  
ATOM 5225   H HG1  . THR B 2 192 ? -2.733  -0.610  10.065  1.00 0.00 ? 192 THR B HG1  1  
ATOM 5226   H HG21 . THR B 2 192 ? -2.665  0.647   12.025  1.00 0.00 ? 192 THR B HG21 1  
ATOM 5227   H HG22 . THR B 2 192 ? -1.033  0.285   11.415  1.00 0.00 ? 192 THR B HG22 1  
ATOM 5228   H HG23 . THR B 2 192 ? -1.454  1.946   11.893  1.00 0.00 ? 192 THR B HG23 1  
ATOM 5229   N N    . VAL B 2 193 ? -2.968  3.436   7.881   1.00 0.00 ? 193 VAL B N    1  
ATOM 5230   C CA   . VAL B 2 193 ? -2.555  4.530   7.004   1.00 0.00 ? 193 VAL B CA   1  
ATOM 5231   C C    . VAL B 2 193 ? -3.739  5.254   6.364   1.00 0.00 ? 193 VAL B C    1  
ATOM 5232   O O    . VAL B 2 193 ? -3.555  6.216   5.615   1.00 0.00 ? 193 VAL B O    1  
ATOM 5233   C CB   . VAL B 2 193 ? -1.586  4.047   5.907   1.00 0.00 ? 193 VAL B CB   1  
ATOM 5234   C CG1  . VAL B 2 193 ? -0.301  3.521   6.527   1.00 0.00 ? 193 VAL B CG1  1  
ATOM 5235   C CG2  . VAL B 2 193 ? -2.240  2.980   5.045   1.00 0.00 ? 193 VAL B CG2  1  
ATOM 5236   H H    . VAL B 2 193 ? -3.213  2.571   7.488   1.00 0.00 ? 193 VAL B H    1  
ATOM 5237   H HA   . VAL B 2 193 ? -2.023  5.250   7.625   1.00 0.00 ? 193 VAL B HA   1  
ATOM 5238   H HB   . VAL B 2 193 ? -1.337  4.896   5.270   1.00 0.00 ? 193 VAL B HB   1  
ATOM 5239   H HG11 . VAL B 2 193 ? 0.384   3.203   5.741   1.00 0.00 ? 193 VAL B HG11 1  
ATOM 5240   H HG12 . VAL B 2 193 ? 0.167   4.310   7.116   1.00 0.00 ? 193 VAL B HG12 1  
ATOM 5241   H HG13 . VAL B 2 193 ? -0.530  2.673   7.172   1.00 0.00 ? 193 VAL B HG13 1  
ATOM 5242   H HG21 . VAL B 2 193 ? -3.143  3.386   4.589   1.00 0.00 ? 193 VAL B HG21 1  
ATOM 5243   H HG22 . VAL B 2 193 ? -1.551  2.664   4.262   1.00 0.00 ? 193 VAL B HG22 1  
ATOM 5244   H HG23 . VAL B 2 193 ? -2.501  2.123   5.665   1.00 0.00 ? 193 VAL B HG23 1  
ATOM 5245   N N    . LYS B 2 194 ? -4.946  4.779   6.660   1.00 0.00 ? 194 LYS B N    1  
ATOM 5246   C CA   . LYS B 2 194 ? -6.178  5.366   6.135   1.00 0.00 ? 194 LYS B CA   1  
ATOM 5247   C C    . LYS B 2 194 ? -6.214  6.883   6.334   1.00 0.00 ? 194 LYS B C    1  
ATOM 5248   O O    . LYS B 2 194 ? -6.107  7.373   7.458   1.00 0.00 ? 194 LYS B O    1  
ATOM 5249   C CB   . LYS B 2 194 ? -7.391  4.721   6.822   1.00 0.00 ? 194 LYS B CB   1  
ATOM 5250   C CG   . LYS B 2 194 ? -8.740  5.058   6.197   1.00 0.00 ? 194 LYS B CG   1  
ATOM 5251   C CD   . LYS B 2 194 ? -9.902  4.607   7.080   1.00 0.00 ? 194 LYS B CD   1  
ATOM 5252   C CE   . LYS B 2 194 ? -9.945  3.093   7.246   1.00 0.00 ? 194 LYS B CE   1  
ATOM 5253   N NZ   . LYS B 2 194 ? -11.089 2.645   8.089   1.00 0.00 ? 194 LYS B NZ   1  
ATOM 5254   H H    . LYS B 2 194 ? -5.013  3.980   7.227   1.00 0.00 ? 194 LYS B H    1  
ATOM 5255   H HA   . LYS B 2 194 ? -6.227  5.156   5.066   1.00 0.00 ? 194 LYS B HA   1  
ATOM 5256   H HB2  . LYS B 2 194 ? -7.264  3.639   6.787   1.00 0.00 ? 194 LYS B HB2  1  
ATOM 5257   H HB3  . LYS B 2 194 ? -7.408  5.051   7.860   1.00 0.00 ? 194 LYS B HB3  1  
ATOM 5258   H HG2  . LYS B 2 194 ? -8.802  6.136   6.054   1.00 0.00 ? 194 LYS B HG2  1  
ATOM 5259   H HG3  . LYS B 2 194 ? -8.816  4.558   5.231   1.00 0.00 ? 194 LYS B HG3  1  
ATOM 5260   H HD2  . LYS B 2 194 ? -9.794  5.065   8.064   1.00 0.00 ? 194 LYS B HD2  1  
ATOM 5261   H HD3  . LYS B 2 194 ? -10.836 4.937   6.627   1.00 0.00 ? 194 LYS B HD3  1  
ATOM 5262   H HE2  . LYS B 2 194 ? -10.034 2.635   6.261   1.00 0.00 ? 194 LYS B HE2  1  
ATOM 5263   H HE3  . LYS B 2 194 ? -9.015  2.765   7.712   1.00 0.00 ? 194 LYS B HE3  1  
ATOM 5264   H HZ1  . LYS B 2 194 ? -11.334 3.375   8.794   1.00 0.00 ? 194 LYS B HZ1  1  
ATOM 5265   H HZ2  . LYS B 2 194 ? -10.835 1.763   8.597   1.00 0.00 ? 194 LYS B HZ2  1  
ATOM 5266   H HZ3  . LYS B 2 194 ? -11.921 2.462   7.498   1.00 0.00 ? 194 LYS B HZ3  1  
ATOM 5267   N N    . GLY B 2 195 ? -6.337  7.614   5.230   1.00 0.00 ? 195 GLY B N    1  
ATOM 5268   C CA   . GLY B 2 195 ? -6.411  9.064   5.290   1.00 0.00 ? 195 GLY B CA   1  
ATOM 5269   C C    . GLY B 2 195 ? -5.066  9.767   5.227   1.00 0.00 ? 195 GLY B C    1  
ATOM 5270   O O    . GLY B 2 195 ? -4.987  10.917  4.794   1.00 0.00 ? 195 GLY B O    1  
ATOM 5271   H H    . GLY B 2 195 ? -6.391  7.163   4.363   1.00 0.00 ? 195 GLY B H    1  
ATOM 5272   H HA2  . GLY B 2 195 ? -7.017  9.409   4.452   1.00 0.00 ? 195 GLY B HA2  1  
ATOM 5273   H HA3  . GLY B 2 195 ? -6.898  9.342   6.225   1.00 0.00 ? 195 GLY B HA3  1  
ATOM 5274   N N    . ARG B 2 196 ? -4.010  9.089   5.651   1.00 0.00 ? 196 ARG B N    1  
ATOM 5275   C CA   . ARG B 2 196 ? -2.676  9.681   5.657   1.00 0.00 ? 196 ARG B CA   1  
ATOM 5276   C C    . ARG B 2 196 ? -2.077  9.743   4.256   1.00 0.00 ? 196 ARG B C    1  
ATOM 5277   O O    . ARG B 2 196 ? -1.361  10.686  3.915   1.00 0.00 ? 196 ARG B O    1  
ATOM 5278   C CB   . ARG B 2 196 ? -1.752  8.893   6.585   1.00 0.00 ? 196 ARG B CB   1  
ATOM 5279   C CG   . ARG B 2 196 ? -0.577  9.691   7.127   1.00 0.00 ? 196 ARG B CG   1  
ATOM 5280   C CD   . ARG B 2 196 ? 0.357   8.811   7.941   1.00 0.00 ? 196 ARG B CD   1  
ATOM 5281   N NE   . ARG B 2 196 ? -0.376  7.901   8.820   1.00 0.00 ? 196 ARG B NE   1  
ATOM 5282   C CZ   . ARG B 2 196 ? 0.162   7.279   9.868   1.00 0.00 ? 196 ARG B CZ   1  
ATOM 5283   N NH1  . ARG B 2 196 ? 1.435   7.476   10.192  1.00 0.00 ? 196 ARG B NH1  1  
ATOM 5284   N NH2  . ARG B 2 196 ? -0.573  6.444   10.589  1.00 0.00 ? 196 ARG B NH2  1  
ATOM 5285   H H    . ARG B 2 196 ? -4.124  8.169   5.973   1.00 0.00 ? 196 ARG B H    1  
ATOM 5286   H HA   . ARG B 2 196 ? -2.762  10.699  6.037   1.00 0.00 ? 196 ARG B HA   1  
ATOM 5287   H HB2  . ARG B 2 196 ? -2.341  8.535   7.430   1.00 0.00 ? 196 ARG B HB2  1  
ATOM 5288   H HB3  . ARG B 2 196 ? -1.358  8.041   6.030   1.00 0.00 ? 196 ARG B HB3  1  
ATOM 5289   H HG2  . ARG B 2 196 ? -0.023  10.121  6.292   1.00 0.00 ? 196 ARG B HG2  1  
ATOM 5290   H HG3  . ARG B 2 196 ? -0.954  10.492  7.763   1.00 0.00 ? 196 ARG B HG3  1  
ATOM 5291   H HD2  . ARG B 2 196 ? 0.973   8.224   7.259   1.00 0.00 ? 196 ARG B HD2  1  
ATOM 5292   H HD3  . ARG B 2 196 ? 1.002   9.446   8.548   1.00 0.00 ? 196 ARG B HD3  1  
ATOM 5293   H HE   . ARG B 2 196 ? -1.322  7.740   8.610   1.00 0.00 ? 196 ARG B HE   1  
ATOM 5294   H HH11 . ARG B 2 196 ? 2.015   8.096   9.640   1.00 0.00 ? 196 ARG B HH11 1  
ATOM 5295   H HH12 . ARG B 2 196 ? 1.827   7.016   10.998  1.00 0.00 ? 196 ARG B HH12 1  
ATOM 5296   H HH21 . ARG B 2 196 ? -1.534  6.272   10.349  1.00 0.00 ? 196 ARG B HH21 1  
ATOM 5297   H HH22 . ARG B 2 196 ? -0.173  5.981   11.386  1.00 0.00 ? 196 ARG B HH22 1  
ATOM 5298   N N    . PHE B 2 197 ? -2.360  8.732   3.449   1.00 0.00 ? 197 PHE B N    1  
ATOM 5299   C CA   . PHE B 2 197 ? -1.829  8.679   2.098   1.00 0.00 ? 197 PHE B CA   1  
ATOM 5300   C C    . PHE B 2 197 ? -2.929  8.646   1.046   1.00 0.00 ? 197 PHE B C    1  
ATOM 5301   O O    . PHE B 2 197 ? -4.081  8.308   1.333   1.00 0.00 ? 197 PHE B O    1  
ATOM 5302   C CB   . PHE B 2 197 ? -0.905  7.464   1.928   1.00 0.00 ? 197 PHE B CB   1  
ATOM 5303   C CG   . PHE B 2 197 ? 0.217   7.396   2.927   1.00 0.00 ? 197 PHE B CG   1  
ATOM 5304   C CD1  . PHE B 2 197 ? 1.363   8.156   2.760   1.00 0.00 ? 197 PHE B CD1  1  
ATOM 5305   C CD2  . PHE B 2 197 ? 0.125   6.572   4.036   1.00 0.00 ? 197 PHE B CD2  1  
ATOM 5306   C CE1  . PHE B 2 197 ? 2.394   8.096   3.677   1.00 0.00 ? 197 PHE B CE1  1  
ATOM 5307   C CE2  . PHE B 2 197 ? 1.152   6.506   4.957   1.00 0.00 ? 197 PHE B CE2  1  
ATOM 5308   C CZ   . PHE B 2 197 ? 2.287   7.269   4.778   1.00 0.00 ? 197 PHE B CZ   1  
ATOM 5309   H H    . PHE B 2 197 ? -2.923  8.000   3.774   1.00 0.00 ? 197 PHE B H    1  
ATOM 5310   H HA   . PHE B 2 197 ? -1.238  9.582   1.941   1.00 0.00 ? 197 PHE B HA   1  
ATOM 5311   H HB2  . PHE B 2 197 ? -1.506  6.559   2.023   1.00 0.00 ? 197 PHE B HB2  1  
ATOM 5312   H HB3  . PHE B 2 197 ? -0.475  7.494   0.927   1.00 0.00 ? 197 PHE B HB3  1  
ATOM 5313   H HD1  . PHE B 2 197 ? 1.451   8.805   1.901   1.00 0.00 ? 197 PHE B HD1  1  
ATOM 5314   H HD2  . PHE B 2 197 ? -0.761  5.972   4.182   1.00 0.00 ? 197 PHE B HD2  1  
ATOM 5315   H HE1  . PHE B 2 197 ? 3.282   8.693   3.534   1.00 0.00 ? 197 PHE B HE1  1  
ATOM 5316   H HE2  . PHE B 2 197 ? 1.067   5.858   5.817   1.00 0.00 ? 197 PHE B HE2  1  
ATOM 5317   H HZ   . PHE B 2 197 ? 3.091   7.219   5.497   1.00 0.00 ? 197 PHE B HZ   1  
ATOM 5318   N N    . THR B 2 198 ? -2.563  9.036   -0.165  1.00 0.00 ? 198 THR B N    1  
ATOM 5319   C CA   . THR B 2 198 ? -3.468  9.035   -1.307  1.00 0.00 ? 198 THR B CA   1  
ATOM 5320   C C    . THR B 2 198 ? -2.652  8.747   -2.566  1.00 0.00 ? 198 THR B C    1  
ATOM 5321   O O    . THR B 2 198 ? -1.601  9.352   -2.776  1.00 0.00 ? 198 THR B O    1  
ATOM 5322   C CB   . THR B 2 198 ? -4.202  10.387  -1.451  1.00 0.00 ? 198 THR B CB   1  
ATOM 5323   O OG1  . THR B 2 198 ? -4.927  10.667  -0.243  1.00 0.00 ? 198 THR B OG1  1  
ATOM 5324   C CG2  . THR B 2 198 ? -5.181  10.349  -2.619  1.00 0.00 ? 198 THR B CG2  1  
ATOM 5325   H H    . THR B 2 198 ? -1.642  9.355   -0.299  1.00 0.00 ? 198 THR B H    1  
ATOM 5326   H HA   . THR B 2 198 ? -4.209  8.248   -1.169  1.00 0.00 ? 198 THR B HA   1  
ATOM 5327   H HB   . THR B 2 198 ? -3.468  11.174  -1.625  1.00 0.00 ? 198 THR B HB   1  
ATOM 5328   H HG1  . THR B 2 198 ? -4.710  9.997   0.420   1.00 0.00 ? 198 THR B HG1  1  
ATOM 5329   H HG21 . THR B 2 198 ? -5.919  9.564   -2.447  1.00 0.00 ? 198 THR B HG21 1  
ATOM 5330   H HG22 . THR B 2 198 ? -5.689  11.309  -2.707  1.00 0.00 ? 198 THR B HG22 1  
ATOM 5331   H HG23 . THR B 2 198 ? -4.638  10.141  -3.541  1.00 0.00 ? 198 THR B HG23 1  
ATOM 5332   N N    . ILE B 2 199 ? -3.114  7.815   -3.386  1.00 0.00 ? 199 ILE B N    1  
ATOM 5333   C CA   . ILE B 2 199 ? -2.384  7.448   -4.592  1.00 0.00 ? 199 ILE B CA   1  
ATOM 5334   C C    . ILE B 2 199 ? -3.027  7.984   -5.866  1.00 0.00 ? 199 ILE B C    1  
ATOM 5335   O O    . ILE B 2 199 ? -4.231  8.232   -5.921  1.00 0.00 ? 199 ILE B O    1  
ATOM 5336   C CB   . ILE B 2 199 ? -2.179  5.916   -4.724  1.00 0.00 ? 199 ILE B CB   1  
ATOM 5337   C CG1  . ILE B 2 199 ? -3.487  5.189   -5.084  1.00 0.00 ? 199 ILE B CG1  1  
ATOM 5338   C CG2  . ILE B 2 199 ? -1.548  5.334   -3.468  1.00 0.00 ? 199 ILE B CG2  1  
ATOM 5339   C CD1  . ILE B 2 199 ? -4.467  5.027   -3.941  1.00 0.00 ? 199 ILE B CD1  1  
ATOM 5340   H H    . ILE B 2 199 ? -3.965  7.374   -3.186  1.00 0.00 ? 199 ILE B H    1  
ATOM 5341   H HA   . ILE B 2 199 ? -1.398  7.905   -4.505  1.00 0.00 ? 199 ILE B HA   1  
ATOM 5342   H HB   . ILE B 2 199 ? -1.481  5.753   -5.545  1.00 0.00 ? 199 ILE B HB   1  
ATOM 5343   H HG12 . ILE B 2 199 ? -3.981  5.753   -5.875  1.00 0.00 ? 199 ILE B HG12 1  
ATOM 5344   H HG13 . ILE B 2 199 ? -3.231  4.195   -5.452  1.00 0.00 ? 199 ILE B HG13 1  
ATOM 5345   H HG21 . ILE B 2 199 ? -1.371  4.266   -3.599  1.00 0.00 ? 199 ILE B HG21 1  
ATOM 5346   H HG22 . ILE B 2 199 ? -0.599  5.834   -3.275  1.00 0.00 ? 199 ILE B HG22 1  
ATOM 5347   H HG23 . ILE B 2 199 ? -2.218  5.487   -2.622  1.00 0.00 ? 199 ILE B HG23 1  
ATOM 5348   H HD11 . ILE B 2 199 ? -4.745  6.012   -3.565  1.00 0.00 ? 199 ILE B HD11 1  
ATOM 5349   H HD12 . ILE B 2 199 ? -5.365  4.506   -4.271  1.00 0.00 ? 199 ILE B HD12 1  
ATOM 5350   H HD13 . ILE B 2 199 ? -3.996  4.453   -3.143  1.00 0.00 ? 199 ILE B HD13 1  
ATOM 5351   N N    . SER B 2 200 ? -2.195  8.188   -6.873  1.00 0.00 ? 200 SER B N    1  
ATOM 5352   C CA   . SER B 2 200 ? -2.630  8.660   -8.177  1.00 0.00 ? 200 SER B CA   1  
ATOM 5353   C C    . SER B 2 200 ? -1.682  8.097   -9.232  1.00 0.00 ? 200 SER B C    1  
ATOM 5354   O O    . SER B 2 200 ? -0.499  7.902   -8.958  1.00 0.00 ? 200 SER B O    1  
ATOM 5355   C CB   . SER B 2 200 ? -2.623  10.189  -8.214  1.00 0.00 ? 200 SER B CB   1  
ATOM 5356   O OG   . SER B 2 200 ? -3.495  10.722  -7.227  1.00 0.00 ? 200 SER B OG   1  
ATOM 5357   H H    . SER B 2 200 ? -1.234  8.037   -6.729  1.00 0.00 ? 200 SER B H    1  
ATOM 5358   H HA   . SER B 2 200 ? -3.642  8.304   -8.371  1.00 0.00 ? 200 SER B HA   1  
ATOM 5359   H HB2  . SER B 2 200 ? -1.611  10.547  -8.026  1.00 0.00 ? 200 SER B HB2  1  
ATOM 5360   H HB3  . SER B 2 200 ? -2.951  10.524  -9.198  1.00 0.00 ? 200 SER B HB3  1  
ATOM 5361   H HG   . SER B 2 200 ? -3.894  9.995   -6.730  1.00 0.00 ? 200 SER B HG   1  
ATOM 5362   N N    . ARG B 2 201 ? -2.186  7.816   -10.425 1.00 0.00 ? 201 ARG B N    1  
ATOM 5363   C CA   . ARG B 2 201 ? -1.339  7.261   -11.475 1.00 0.00 ? 201 ARG B CA   1  
ATOM 5364   C C    . ARG B 2 201 ? -1.471  8.030   -12.777 1.00 0.00 ? 201 ARG B C    1  
ATOM 5365   O O    . ARG B 2 201 ? -2.553  8.501   -13.128 1.00 0.00 ? 201 ARG B O    1  
ATOM 5366   C CB   . ARG B 2 201 ? -1.606  5.763   -11.703 1.00 0.00 ? 201 ARG B CB   1  
ATOM 5367   C CG   . ARG B 2 201 ? -3.016  5.423   -12.161 1.00 0.00 ? 201 ARG B CG   1  
ATOM 5368   C CD   . ARG B 2 201 ? -3.061  4.075   -12.874 1.00 0.00 ? 201 ARG B CD   1  
ATOM 5369   N NE   . ARG B 2 201 ? -2.758  2.953   -11.978 1.00 0.00 ? 201 ARG B NE   1  
ATOM 5370   C CZ   . ARG B 2 201 ? -1.887  1.980   -12.264 1.00 0.00 ? 201 ARG B CZ   1  
ATOM 5371   N NH1  . ARG B 2 201 ? -1.254  1.965   -13.436 1.00 0.00 ? 201 ARG B NH1  1  
ATOM 5372   N NH2  . ARG B 2 201 ? -1.672  1.003   -11.388 1.00 0.00 ? 201 ARG B NH2  1  
ATOM 5373   H H    . ARG B 2 201 ? -3.128  8.012   -10.614 1.00 0.00 ? 201 ARG B H    1  
ATOM 5374   H HA   . ARG B 2 201 ? -0.308  7.362   -11.137 1.00 0.00 ? 201 ARG B HA   1  
ATOM 5375   H HB2  . ARG B 2 201 ? -0.908  5.407   -12.461 1.00 0.00 ? 201 ARG B HB2  1  
ATOM 5376   H HB3  . ARG B 2 201 ? -1.420  5.241   -10.764 1.00 0.00 ? 201 ARG B HB3  1  
ATOM 5377   H HG2  . ARG B 2 201 ? -3.672  5.385   -11.291 1.00 0.00 ? 201 ARG B HG2  1  
ATOM 5378   H HG3  . ARG B 2 201 ? -3.363  6.197   -12.845 1.00 0.00 ? 201 ARG B HG3  1  
ATOM 5379   H HD2  . ARG B 2 201 ? -4.059  3.931   -13.290 1.00 0.00 ? 201 ARG B HD2  1  
ATOM 5380   H HD3  . ARG B 2 201 ? -2.333  4.083   -13.685 1.00 0.00 ? 201 ARG B HD3  1  
ATOM 5381   H HE   . ARG B 2 201 ? -3.240  2.921   -11.117 1.00 0.00 ? 201 ARG B HE   1  
ATOM 5382   H HH11 . ARG B 2 201 ? -1.427  2.682   -14.111 1.00 0.00 ? 201 ARG B HH11 1  
ATOM 5383   H HH12 . ARG B 2 201 ? -0.602  1.229   -13.650 1.00 0.00 ? 201 ARG B HH12 1  
ATOM 5384   H HH21 . ARG B 2 201 ? -2.167  0.986   -10.509 1.00 0.00 ? 201 ARG B HH21 1  
ATOM 5385   H HH22 . ARG B 2 201 ? -1.005  0.280   -11.593 1.00 0.00 ? 201 ARG B HH22 1  
ATOM 5386   N N    . ASP B 2 202 ? -0.354  8.173   -13.474 1.00 0.00 ? 202 ASP B N    1  
ATOM 5387   C CA   . ASP B 2 202 ? -0.330  8.865   -14.751 1.00 0.00 ? 202 ASP B CA   1  
ATOM 5388   C C    . ASP B 2 202 ? 0.141   7.903   -15.832 1.00 0.00 ? 202 ASP B C    1  
ATOM 5389   O O    . ASP B 2 202 ? 1.301   7.491   -15.843 1.00 0.00 ? 202 ASP B O    1  
ATOM 5390   C CB   . ASP B 2 202 ? 0.595   10.079  -14.689 1.00 0.00 ? 202 ASP B CB   1  
ATOM 5391   C CG   . ASP B 2 202 ? 0.313   11.061  -15.803 1.00 0.00 ? 202 ASP B CG   1  
ATOM 5392   O OD1  . ASP B 2 202 ? -0.137  12.186  -15.504 1.00 0.00 ? 202 ASP B OD1  1  
ATOM 5393   O OD2  . ASP B 2 202 ? 0.523   10.705  -16.980 1.00 0.00 ? 202 ASP B OD2  1  
ATOM 5394   H H    . ASP B 2 202 ? 0.487   7.808   -13.115 1.00 0.00 ? 202 ASP B H    1  
ATOM 5395   H HA   . ASP B 2 202 ? -1.339  9.203   -14.987 1.00 0.00 ? 202 ASP B HA   1  
ATOM 5396   H HB2  . ASP B 2 202 ? 0.456   10.581  -13.732 1.00 0.00 ? 202 ASP B HB2  1  
ATOM 5397   H HB3  . ASP B 2 202 ? 1.628   9.741   -14.770 1.00 0.00 ? 202 ASP B HB3  1  
ATOM 5398   H HD2  . ASP B 2 202 ? 0.317   11.376  -17.635 1.00 0.00 ? 202 ASP B HD2  1  
ATOM 5399   N N    . ASN B 2 203 ? -0.762  7.543   -16.734 1.00 0.00 ? 203 ASN B N    1  
ATOM 5400   C CA   . ASN B 2 203 ? -0.445  6.600   -17.805 1.00 0.00 ? 203 ASN B CA   1  
ATOM 5401   C C    . ASN B 2 203 ? 0.215   7.275   -18.998 1.00 0.00 ? 203 ASN B C    1  
ATOM 5402   O O    . ASN B 2 203 ? 0.606   6.607   -19.954 1.00 0.00 ? 203 ASN B O    1  
ATOM 5403   C CB   . ASN B 2 203 ? -1.691  5.826   -18.250 1.00 0.00 ? 203 ASN B CB   1  
ATOM 5404   C CG   . ASN B 2 203 ? -2.736  6.712   -18.903 1.00 0.00 ? 203 ASN B CG   1  
ATOM 5405   O OD1  . ASN B 2 203 ? -2.694  6.966   -20.105 1.00 0.00 ? 203 ASN B OD1  1  
ATOM 5406   N ND2  . ASN B 2 203 ? -3.694  7.175   -18.115 1.00 0.00 ? 203 ASN B ND2  1  
ATOM 5407   H H    . ASN B 2 203 ? -1.666  7.920   -16.686 1.00 0.00 ? 203 ASN B H    1  
ATOM 5408   H HA   . ASN B 2 203 ? 0.266   5.880   -17.399 1.00 0.00 ? 203 ASN B HA   1  
ATOM 5409   H HB2  . ASN B 2 203 ? -1.389  5.060   -18.963 1.00 0.00 ? 203 ASN B HB2  1  
ATOM 5410   H HB3  . ASN B 2 203 ? -2.136  5.349   -17.377 1.00 0.00 ? 203 ASN B HB3  1  
ATOM 5411   H HD21 . ASN B 2 203 ? -3.678  6.922   -17.170 1.00 0.00 ? 203 ASN B HD21 1  
ATOM 5412   H HD22 . ASN B 2 203 ? -4.380  7.755   -18.511 1.00 0.00 ? 203 ASN B HD22 1  
ATOM 5413   N N    . ALA B 2 204 ? 0.331   8.591   -18.950 1.00 0.00 ? 204 ALA B N    1  
ATOM 5414   C CA   . ALA B 2 204 ? 0.956   9.333   -20.033 1.00 0.00 ? 204 ALA B CA   1  
ATOM 5415   C C    . ALA B 2 204 ? 2.439   9.500   -19.754 1.00 0.00 ? 204 ALA B C    1  
ATOM 5416   O O    . ALA B 2 204 ? 3.273   9.398   -20.653 1.00 0.00 ? 204 ALA B O    1  
ATOM 5417   C CB   . ALA B 2 204 ? 0.288   10.689  -20.206 1.00 0.00 ? 204 ALA B CB   1  
ATOM 5418   H H    . ALA B 2 204 ? -0.008  9.079   -18.166 1.00 0.00 ? 204 ALA B H    1  
ATOM 5419   H HA   . ALA B 2 204 ? 0.835   8.766   -20.956 1.00 0.00 ? 204 ALA B HA   1  
ATOM 5420   H HB1  . ALA B 2 204 ? 0.754   11.225  -21.033 1.00 0.00 ? 204 ALA B HB1  1  
ATOM 5421   H HB2  . ALA B 2 204 ? -0.771  10.547  -20.418 1.00 0.00 ? 204 ALA B HB2  1  
ATOM 5422   H HB3  . ALA B 2 204 ? 0.401   11.268  -19.289 1.00 0.00 ? 204 ALA B HB3  1  
ATOM 5423   N N    . LYS B 2 205 ? 2.757   9.749   -18.495 1.00 0.00 ? 205 LYS B N    1  
ATOM 5424   C CA   . LYS B 2 205 ? 4.135   9.936   -18.076 1.00 0.00 ? 205 LYS B CA   1  
ATOM 5425   C C    . LYS B 2 205 ? 4.722   8.662   -17.484 1.00 0.00 ? 205 LYS B C    1  
ATOM 5426   O O    . LYS B 2 205 ? 5.885   8.649   -17.079 1.00 0.00 ? 205 LYS B O    1  
ATOM 5427   C CB   . LYS B 2 205 ? 4.225   11.069  -17.055 1.00 0.00 ? 205 LYS B CB   1  
ATOM 5428   C CG   . LYS B 2 205 ? 3.692   12.397  -17.559 1.00 0.00 ? 205 LYS B CG   1  
ATOM 5429   C CD   . LYS B 2 205 ? 3.447   13.363  -16.414 1.00 0.00 ? 205 LYS B CD   1  
ATOM 5430   C CE   . LYS B 2 205 ? 2.955   14.707  -16.923 1.00 0.00 ? 205 LYS B CE   1  
ATOM 5431   N NZ   . LYS B 2 205 ? 3.993   15.411  -17.718 1.00 0.00 ? 205 LYS B NZ   1  
ATOM 5432   H H    . LYS B 2 205 ? 2.033   9.838   -17.833 1.00 0.00 ? 205 LYS B H    1  
ATOM 5433   H HA   . LYS B 2 205 ? 4.722   10.210  -18.953 1.00 0.00 ? 205 LYS B HA   1  
ATOM 5434   H HB2  . LYS B 2 205 ? 3.652   10.782  -16.173 1.00 0.00 ? 205 LYS B HB2  1  
ATOM 5435   H HB3  . LYS B 2 205 ? 5.272   11.202  -16.781 1.00 0.00 ? 205 LYS B HB3  1  
ATOM 5436   H HG2  . LYS B 2 205 ? 4.418   12.835  -18.243 1.00 0.00 ? 205 LYS B HG2  1  
ATOM 5437   H HG3  . LYS B 2 205 ? 2.753   12.226  -18.086 1.00 0.00 ? 205 LYS B HG3  1  
ATOM 5438   H HD2  . LYS B 2 205 ? 2.696   12.940  -15.746 1.00 0.00 ? 205 LYS B HD2  1  
ATOM 5439   H HD3  . LYS B 2 205 ? 4.378   13.510  -15.867 1.00 0.00 ? 205 LYS B HD3  1  
ATOM 5440   H HE2  . LYS B 2 205 ? 2.077   14.548  -17.549 1.00 0.00 ? 205 LYS B HE2  1  
ATOM 5441   H HE3  . LYS B 2 205 ? 2.680   15.329  -16.071 1.00 0.00 ? 205 LYS B HE3  1  
ATOM 5442   H HZ1  . LYS B 2 205 ? 4.256   14.842  -18.545 1.00 0.00 ? 205 LYS B HZ1  1  
ATOM 5443   H HZ2  . LYS B 2 205 ? 4.840   15.574  -17.137 1.00 0.00 ? 205 LYS B HZ2  1  
ATOM 5444   H HZ3  . LYS B 2 205 ? 3.632   16.329  -18.047 1.00 0.00 ? 205 LYS B HZ3  1  
ATOM 5445   N N    . ASN B 2 206 ? 3.915   7.597   -17.436 1.00 0.00 ? 206 ASN B N    1  
ATOM 5446   C CA   . ASN B 2 206 ? 4.345   6.309   -16.883 1.00 0.00 ? 206 ASN B CA   1  
ATOM 5447   C C    . ASN B 2 206 ? 4.928   6.469   -15.483 1.00 0.00 ? 206 ASN B C    1  
ATOM 5448   O O    . ASN B 2 206 ? 6.020   5.977   -15.188 1.00 0.00 ? 206 ASN B O    1  
ATOM 5449   C CB   . ASN B 2 206 ? 5.357   5.604   -17.797 1.00 0.00 ? 206 ASN B CB   1  
ATOM 5450   C CG   . ASN B 2 206 ? 4.753   5.080   -19.087 1.00 0.00 ? 206 ASN B CG   1  
ATOM 5451   O OD1  . ASN B 2 206 ? 3.542   4.880   -19.191 1.00 0.00 ? 206 ASN B OD1  1  
ATOM 5452   N ND2  . ASN B 2 206 ? 5.599   4.844   -20.078 1.00 0.00 ? 206 ASN B ND2  1  
ATOM 5453   H H    . ASN B 2 206 ? 3.006   7.665   -17.794 1.00 0.00 ? 206 ASN B H    1  
ATOM 5454   H HA   . ASN B 2 206 ? 3.462   5.674   -16.810 1.00 0.00 ? 206 ASN B HA   1  
ATOM 5455   H HB2  . ASN B 2 206 ? 6.147   6.312   -18.048 1.00 0.00 ? 206 ASN B HB2  1  
ATOM 5456   H HB3  . ASN B 2 206 ? 5.788   4.764   -17.252 1.00 0.00 ? 206 ASN B HB3  1  
ATOM 5457   H HD21 . ASN B 2 206 ? 6.554   5.020   -19.923 1.00 0.00 ? 206 ASN B HD21 1  
ATOM 5458   H HD22 . ASN B 2 206 ? 5.244   4.499   -20.921 1.00 0.00 ? 206 ASN B HD22 1  
ATOM 5459   N N    . THR B 2 207 ? 4.200   7.152   -14.618 1.00 0.00 ? 207 THR B N    1  
ATOM 5460   C CA   . THR B 2 207 ? 4.675   7.383   -13.270 1.00 0.00 ? 207 THR B CA   1  
ATOM 5461   C C    . THR B 2 207 ? 3.543   7.322   -12.242 1.00 0.00 ? 207 THR B C    1  
ATOM 5462   O O    . THR B 2 207 ? 2.373   7.557   -12.562 1.00 0.00 ? 207 THR B O    1  
ATOM 5463   C CB   . THR B 2 207 ? 5.432   8.730   -13.177 1.00 0.00 ? 207 THR B CB   1  
ATOM 5464   O OG1  . THR B 2 207 ? 6.241   8.773   -11.994 1.00 0.00 ? 207 THR B OG1  1  
ATOM 5465   C CG2  . THR B 2 207 ? 4.476   9.912   -13.189 1.00 0.00 ? 207 THR B CG2  1  
ATOM 5466   H H    . THR B 2 207 ? 3.321   7.492   -14.888 1.00 0.00 ? 207 THR B H    1  
ATOM 5467   H HA   . THR B 2 207 ? 5.380   6.586   -13.033 1.00 0.00 ? 207 THR B HA   1  
ATOM 5468   H HB   . THR B 2 207 ? 6.088   8.811   -14.044 1.00 0.00 ? 207 THR B HB   1  
ATOM 5469   H HG1  . THR B 2 207 ? 6.537   7.877   -11.781 1.00 0.00 ? 207 THR B HG1  1  
ATOM 5470   H HG21 . THR B 2 207 ? 3.811   9.848   -12.328 1.00 0.00 ? 207 THR B HG21 1  
ATOM 5471   H HG22 . THR B 2 207 ? 5.035   10.847  -13.143 1.00 0.00 ? 207 THR B HG22 1  
ATOM 5472   H HG23 . THR B 2 207 ? 3.887   9.891   -14.106 1.00 0.00 ? 207 THR B HG23 1  
ATOM 5473   N N    . LEU B 2 208 ? 3.905   6.967   -11.017 1.00 0.00 ? 208 LEU B N    1  
ATOM 5474   C CA   . LEU B 2 208 ? 2.955   6.878   -9.920  1.00 0.00 ? 208 LEU B CA   1  
ATOM 5475   C C    . LEU B 2 208 ? 3.174   8.044   -8.964  1.00 0.00 ? 208 LEU B C    1  
ATOM 5476   O O    . LEU B 2 208 ? 4.315   8.388   -8.652  1.00 0.00 ? 208 LEU B O    1  
ATOM 5477   C CB   . LEU B 2 208 ? 3.149   5.562   -9.166  1.00 0.00 ? 208 LEU B CB   1  
ATOM 5478   C CG   . LEU B 2 208 ? 3.170   4.291   -10.015 1.00 0.00 ? 208 LEU B CG   1  
ATOM 5479   C CD1  . LEU B 2 208 ? 3.688   3.116   -9.203  1.00 0.00 ? 208 LEU B CD1  1  
ATOM 5480   C CD2  . LEU B 2 208 ? 1.788   3.995   -10.572 1.00 0.00 ? 208 LEU B CD2  1  
ATOM 5481   H H    . LEU B 2 208 ? 4.847   6.737   -10.848 1.00 0.00 ? 208 LEU B H    1  
ATOM 5482   H HA   . LEU B 2 208 ? 1.942   6.920   -10.320 1.00 0.00 ? 208 LEU B HA   1  
ATOM 5483   H HB2  . LEU B 2 208 ? 4.098   5.621   -8.633  1.00 0.00 ? 208 LEU B HB2  1  
ATOM 5484   H HB3  . LEU B 2 208 ? 2.334   5.468   -8.448  1.00 0.00 ? 208 LEU B HB3  1  
ATOM 5485   H HG   . LEU B 2 208 ? 3.849   4.451   -10.853 1.00 0.00 ? 208 LEU B HG   1  
ATOM 5486   H HD11 . LEU B 2 208 ? 3.720   2.222   -9.825  1.00 0.00 ? 208 LEU B HD11 1  
ATOM 5487   H HD12 . LEU B 2 208 ? 4.691   3.340   -8.840  1.00 0.00 ? 208 LEU B HD12 1  
ATOM 5488   H HD13 . LEU B 2 208 ? 3.026   2.942   -8.354  1.00 0.00 ? 208 LEU B HD13 1  
ATOM 5489   H HD21 . LEU B 2 208 ? 1.453   4.840   -11.174 1.00 0.00 ? 208 LEU B HD21 1  
ATOM 5490   H HD22 . LEU B 2 208 ? 1.824   3.100   -11.194 1.00 0.00 ? 208 LEU B HD22 1  
ATOM 5491   H HD23 . LEU B 2 208 ? 1.092   3.836   -9.749  1.00 0.00 ? 208 LEU B HD23 1  
ATOM 5492   N N    . TYR B 2 209 ? 2.089   8.643   -8.506  1.00 0.00 ? 209 TYR B N    1  
ATOM 5493   C CA   . TYR B 2 209 ? 2.162   9.771   -7.588  1.00 0.00 ? 209 TYR B CA   1  
ATOM 5494   C C    . TYR B 2 209 ? 1.603   9.389   -6.223  1.00 0.00 ? 209 TYR B C    1  
ATOM 5495   O O    . TYR B 2 209 ? 0.431   9.029   -6.104  1.00 0.00 ? 209 TYR B O    1  
ATOM 5496   C CB   . TYR B 2 209 ? 1.365   10.959  -8.135  1.00 0.00 ? 209 TYR B CB   1  
ATOM 5497   C CG   . TYR B 2 209 ? 1.944   11.605  -9.374  1.00 0.00 ? 209 TYR B CG   1  
ATOM 5498   C CD1  . TYR B 2 209 ? 3.089   12.386  -9.303  1.00 0.00 ? 209 TYR B CD1  1  
ATOM 5499   C CD2  . TYR B 2 209 ? 1.333   11.450  -10.612 1.00 0.00 ? 209 TYR B CD2  1  
ATOM 5500   C CE1  . TYR B 2 209 ? 3.611   12.992  -10.430 1.00 0.00 ? 209 TYR B CE1  1  
ATOM 5501   C CE2  . TYR B 2 209 ? 1.847   12.057  -11.745 1.00 0.00 ? 209 TYR B CE2  1  
ATOM 5502   C CZ   . TYR B 2 209 ? 2.985   12.825  -11.647 1.00 0.00 ? 209 TYR B CZ   1  
ATOM 5503   O OH   . TYR B 2 209 ? 3.495   13.439  -12.769 1.00 0.00 ? 209 TYR B OH   1  
ATOM 5504   H H    . TYR B 2 209 ? 1.205   8.313   -8.784  1.00 0.00 ? 209 TYR B H    1  
ATOM 5505   H HA   . TYR B 2 209 ? 3.207   10.062  -7.478  1.00 0.00 ? 209 TYR B HA   1  
ATOM 5506   H HB2  . TYR B 2 209 ? 0.358   10.615  -8.369  1.00 0.00 ? 209 TYR B HB2  1  
ATOM 5507   H HB3  . TYR B 2 209 ? 1.304   11.716  -7.353  1.00 0.00 ? 209 TYR B HB3  1  
ATOM 5508   H HD1  . TYR B 2 209 ? 3.581   12.523  -8.351  1.00 0.00 ? 209 TYR B HD1  1  
ATOM 5509   H HD2  . TYR B 2 209 ? 0.441   10.846  -10.692 1.00 0.00 ? 209 TYR B HD2  1  
ATOM 5510   H HE1  . TYR B 2 209 ? 4.505   13.594  -10.358 1.00 0.00 ? 209 TYR B HE1  1  
ATOM 5511   H HE2  . TYR B 2 209 ? 1.358   11.929  -12.699 1.00 0.00 ? 209 TYR B HE2  1  
ATOM 5512   H HH   . TYR B 2 209 ? 4.450   13.545  -12.671 1.00 0.00 ? 209 TYR B HH   1  
ATOM 5513   N N    . LEU B 2 210 ? 2.444   9.443   -5.203  1.00 0.00 ? 210 LEU B N    1  
ATOM 5514   C CA   . LEU B 2 210 ? 2.021   9.129   -3.849  1.00 0.00 ? 210 LEU B CA   1  
ATOM 5515   C C    . LEU B 2 210 ? 1.957   10.403  -3.017  1.00 0.00 ? 210 LEU B C    1  
ATOM 5516   O O    . LEU B 2 210 ? 2.989   10.992  -2.685  1.00 0.00 ? 210 LEU B O    1  
ATOM 5517   C CB   . LEU B 2 210 ? 2.982   8.122   -3.204  1.00 0.00 ? 210 LEU B CB   1  
ATOM 5518   C CG   . LEU B 2 210 ? 2.672   7.712   -1.760  1.00 0.00 ? 210 LEU B CG   1  
ATOM 5519   C CD1  . LEU B 2 210 ? 1.374   6.924   -1.682  1.00 0.00 ? 210 LEU B CD1  1  
ATOM 5520   C CD2  . LEU B 2 210 ? 3.822   6.916   -1.168  1.00 0.00 ? 210 LEU B CD2  1  
ATOM 5521   H H    . LEU B 2 210 ? 3.385   9.688   -5.360  1.00 0.00 ? 210 LEU B H    1  
ATOM 5522   H HA   . LEU B 2 210 ? 1.026   8.685   -3.890  1.00 0.00 ? 210 LEU B HA   1  
ATOM 5523   H HB2  . LEU B 2 210 ? 2.973   7.218   -3.814  1.00 0.00 ? 210 LEU B HB2  1  
ATOM 5524   H HB3  . LEU B 2 210 ? 3.979   8.560   -3.217  1.00 0.00 ? 210 LEU B HB3  1  
ATOM 5525   H HG   . LEU B 2 210 ? 2.550   8.620   -1.170  1.00 0.00 ? 210 LEU B HG   1  
ATOM 5526   H HD11 . LEU B 2 210 ? 1.158   6.665   -0.646  1.00 0.00 ? 210 LEU B HD11 1  
ATOM 5527   H HD12 . LEU B 2 210 ? 0.559   7.530   -2.079  1.00 0.00 ? 210 LEU B HD12 1  
ATOM 5528   H HD13 . LEU B 2 210 ? 1.469   6.011   -2.270  1.00 0.00 ? 210 LEU B HD13 1  
ATOM 5529   H HD21 . LEU B 2 210 ? 4.732   7.515   -1.202  1.00 0.00 ? 210 LEU B HD21 1  
ATOM 5530   H HD22 . LEU B 2 210 ? 3.600   6.657   -0.133  1.00 0.00 ? 210 LEU B HD22 1  
ATOM 5531   H HD23 . LEU B 2 210 ? 3.966   6.003   -1.746  1.00 0.00 ? 210 LEU B HD23 1  
ATOM 5532   N N    . GLN B 2 211 ? 0.746   10.830  -2.698  1.00 0.00 ? 211 GLN B N    1  
ATOM 5533   C CA   . GLN B 2 211 ? 0.543   12.030  -1.908  1.00 0.00 ? 211 GLN B CA   1  
ATOM 5534   C C    . GLN B 2 211 ? 0.551   11.697  -0.423  1.00 0.00 ? 211 GLN B C    1  
ATOM 5535   O O    . GLN B 2 211 ? -0.303  10.953  0.062   1.00 0.00 ? 211 GLN B O    1  
ATOM 5536   C CB   . GLN B 2 211 ? -0.768  12.717  -2.301  1.00 0.00 ? 211 GLN B CB   1  
ATOM 5537   C CG   . GLN B 2 211 ? -0.922  14.128  -1.753  1.00 0.00 ? 211 GLN B CG   1  
ATOM 5538   C CD   . GLN B 2 211 ? 0.201   15.052  -2.184  1.00 0.00 ? 211 GLN B CD   1  
ATOM 5539   O OE1  . GLN B 2 211 ? 0.796   14.877  -3.248  1.00 0.00 ? 211 GLN B OE1  1  
ATOM 5540   N NE2  . GLN B 2 211 ? 0.492   16.050  -1.363  1.00 0.00 ? 211 GLN B NE2  1  
ATOM 5541   H H    . GLN B 2 211 ? -0.038  10.313  -2.993  1.00 0.00 ? 211 GLN B H    1  
ATOM 5542   H HA   . GLN B 2 211 ? 1.365   12.716  -2.112  1.00 0.00 ? 211 GLN B HA   1  
ATOM 5543   H HB2  . GLN B 2 211 ? -0.815  12.766  -3.389  1.00 0.00 ? 211 GLN B HB2  1  
ATOM 5544   H HB3  . GLN B 2 211 ? -1.595  12.113  -1.928  1.00 0.00 ? 211 GLN B HB3  1  
ATOM 5545   H HG2  . GLN B 2 211 ? -1.868  14.539  -2.107  1.00 0.00 ? 211 GLN B HG2  1  
ATOM 5546   H HG3  . GLN B 2 211 ? -0.937  14.080  -0.664  1.00 0.00 ? 211 GLN B HG3  1  
ATOM 5547   H HE21 . GLN B 2 211 ? -0.028  16.138  -0.536  1.00 0.00 ? 211 GLN B HE21 1  
ATOM 5548   H HE22 . GLN B 2 211 ? 1.220   16.662  -1.613  1.00 0.00 ? 211 GLN B HE22 1  
ATOM 5549   N N    . MET B 2 212 ? 1.528   12.237  0.286   1.00 0.00 ? 212 MET B N    1  
ATOM 5550   C CA   . MET B 2 212 ? 1.664   12.002  1.714   1.00 0.00 ? 212 MET B CA   1  
ATOM 5551   C C    . MET B 2 212 ? 1.323   13.270  2.490   1.00 0.00 ? 212 MET B C    1  
ATOM 5552   O O    . MET B 2 212 ? 2.045   14.264  2.409   1.00 0.00 ? 212 MET B O    1  
ATOM 5553   C CB   . MET B 2 212 ? 3.102   11.580  2.037   1.00 0.00 ? 212 MET B CB   1  
ATOM 5554   C CG   . MET B 2 212 ? 3.657   10.490  1.133   1.00 0.00 ? 212 MET B CG   1  
ATOM 5555   S SD   . MET B 2 212 ? 5.452   10.339  1.241   1.00 0.00 ? 212 MET B SD   1  
ATOM 5556   C CE   . MET B 2 212 ? 5.654   9.763   2.923   1.00 0.00 ? 212 MET B CE   1  
ATOM 5557   H H    . MET B 2 212 ? 2.187   12.810  -0.167  1.00 0.00 ? 212 MET B H    1  
ATOM 5558   H HA   . MET B 2 212 ? 0.981   11.205  2.009   1.00 0.00 ? 212 MET B HA   1  
ATOM 5559   H HB2  . MET B 2 212 ? 3.743   12.457  1.946   1.00 0.00 ? 212 MET B HB2  1  
ATOM 5560   H HB3  . MET B 2 212 ? 3.127   11.216  3.064   1.00 0.00 ? 212 MET B HB3  1  
ATOM 5561   H HG2  . MET B 2 212 ? 3.208   9.538   1.413   1.00 0.00 ? 212 MET B HG2  1  
ATOM 5562   H HG3  . MET B 2 212 ? 3.386   10.715  0.102   1.00 0.00 ? 212 MET B HG3  1  
ATOM 5563   H HE1  . MET B 2 212 ? 5.130   8.815   3.046   1.00 0.00 ? 212 MET B HE1  1  
ATOM 5564   H HE2  . MET B 2 212 ? 6.712   9.620   3.145   1.00 0.00 ? 212 MET B HE2  1  
ATOM 5565   H HE3  . MET B 2 212 ? 5.239   10.500  3.610   1.00 0.00 ? 212 MET B HE3  1  
ATOM 5566   N N    . ASN B 2 213 ? 0.219   13.240  3.221   1.00 0.00 ? 213 ASN B N    1  
ATOM 5567   C CA   . ASN B 2 213 ? -0.209  14.392  4.010   1.00 0.00 ? 213 ASN B CA   1  
ATOM 5568   C C    . ASN B 2 213 ? -0.217  14.060  5.495   1.00 0.00 ? 213 ASN B C    1  
ATOM 5569   O O    . ASN B 2 213 ? -0.330  12.892  5.872   1.00 0.00 ? 213 ASN B O    1  
ATOM 5570   C CB   . ASN B 2 213 ? -1.590  14.902  3.570   1.00 0.00 ? 213 ASN B CB   1  
ATOM 5571   C CG   . ASN B 2 213 ? -2.615  13.797  3.382   1.00 0.00 ? 213 ASN B CG   1  
ATOM 5572   O OD1  . ASN B 2 213 ? -2.820  13.317  2.265   1.00 0.00 ? 213 ASN B OD1  1  
ATOM 5573   N ND2  . ASN B 2 213 ? -3.271  13.392  4.463   1.00 0.00 ? 213 ASN B ND2  1  
ATOM 5574   H H    . ASN B 2 213 ? -0.324  12.419  3.239   1.00 0.00 ? 213 ASN B H    1  
ATOM 5575   H HA   . ASN B 2 213 ? 0.513   15.191  3.845   1.00 0.00 ? 213 ASN B HA   1  
ATOM 5576   H HB2  . ASN B 2 213 ? -1.960  15.593  4.327   1.00 0.00 ? 213 ASN B HB2  1  
ATOM 5577   H HB3  . ASN B 2 213 ? -1.477  15.433  2.625   1.00 0.00 ? 213 ASN B HB3  1  
ATOM 5578   H HD21 . ASN B 2 213 ? -3.067  13.823  5.321   1.00 0.00 ? 213 ASN B HD21 1  
ATOM 5579   H HD22 . ASN B 2 213 ? -3.929  12.667  4.364   1.00 0.00 ? 213 ASN B HD22 1  
ATOM 5580   N N    . SER B 2 214 ? -0.110  15.098  6.328   1.00 0.00 ? 214 SER B N    1  
ATOM 5581   C CA   . SER B 2 214 ? -0.098  14.951  7.783   1.00 0.00 ? 214 SER B CA   1  
ATOM 5582   C C    . SER B 2 214 ? 0.863   13.849  8.238   1.00 0.00 ? 214 SER B C    1  
ATOM 5583   O O    . SER B 2 214 ? 0.491   12.948  8.996   1.00 0.00 ? 214 SER B O    1  
ATOM 5584   C CB   . SER B 2 214 ? -1.515  14.734  8.336   1.00 0.00 ? 214 SER B CB   1  
ATOM 5585   O OG   . SER B 2 214 ? -2.205  13.710  7.636   1.00 0.00 ? 214 SER B OG   1  
ATOM 5586   H H    . SER B 2 214 ? -0.041  16.000  5.948   1.00 0.00 ? 214 SER B H    1  
ATOM 5587   H HA   . SER B 2 214 ? 0.270   15.891  8.195   1.00 0.00 ? 214 SER B HA   1  
ATOM 5588   H HB2  . SER B 2 214 ? -1.444  14.455  9.387   1.00 0.00 ? 214 SER B HB2  1  
ATOM 5589   H HB3  . SER B 2 214 ? -2.076  15.663  8.243   1.00 0.00 ? 214 SER B HB3  1  
ATOM 5590   H HG   . SER B 2 214 ? -1.568  13.181  7.134   1.00 0.00 ? 214 SER B HG   1  
ATOM 5591   N N    . LEU B 2 215 ? 2.102   13.936  7.766   1.00 0.00 ? 215 LEU B N    1  
ATOM 5592   C CA   . LEU B 2 215 ? 3.127   12.951  8.090   1.00 0.00 ? 215 LEU B CA   1  
ATOM 5593   C C    . LEU B 2 215 ? 3.541   13.015  9.555   1.00 0.00 ? 215 LEU B C    1  
ATOM 5594   O O    . LEU B 2 215 ? 3.663   14.098  10.140  1.00 0.00 ? 215 LEU B O    1  
ATOM 5595   C CB   . LEU B 2 215 ? 4.350   13.129  7.185   1.00 0.00 ? 215 LEU B CB   1  
ATOM 5596   C CG   . LEU B 2 215 ? 4.145   12.787  5.709   1.00 0.00 ? 215 LEU B CG   1  
ATOM 5597   C CD1  . LEU B 2 215 ? 5.420   13.041  4.918   1.00 0.00 ? 215 LEU B CD1  1  
ATOM 5598   C CD2  . LEU B 2 215 ? 3.693   11.343  5.555   1.00 0.00 ? 215 LEU B CD2  1  
ATOM 5599   H H    . LEU B 2 215 ? 2.335   14.691  7.186   1.00 0.00 ? 215 LEU B H    1  
ATOM 5600   H HA   . LEU B 2 215 ? 2.706   11.964  7.902   1.00 0.00 ? 215 LEU B HA   1  
ATOM 5601   H HB2  . LEU B 2 215 ? 4.662   14.172  7.246   1.00 0.00 ? 215 LEU B HB2  1  
ATOM 5602   H HB3  . LEU B 2 215 ? 5.145   12.489  7.568   1.00 0.00 ? 215 LEU B HB3  1  
ATOM 5603   H HG   . LEU B 2 215 ? 3.362   13.434  5.312   1.00 0.00 ? 215 LEU B HG   1  
ATOM 5604   H HD11 . LEU B 2 215 ? 5.253   12.814  3.865   1.00 0.00 ? 215 LEU B HD11 1  
ATOM 5605   H HD12 . LEU B 2 215 ? 5.707   14.088  5.020   1.00 0.00 ? 215 LEU B HD12 1  
ATOM 5606   H HD13 . LEU B 2 215 ? 6.217   12.406  5.303   1.00 0.00 ? 215 LEU B HD13 1  
ATOM 5607   H HD21 . LEU B 2 215 ? 2.765   11.193  6.106   1.00 0.00 ? 215 LEU B HD21 1  
ATOM 5608   H HD22 . LEU B 2 215 ? 3.528   11.118  4.502   1.00 0.00 ? 215 LEU B HD22 1  
ATOM 5609   H HD23 . LEU B 2 215 ? 4.462   10.679  5.951   1.00 0.00 ? 215 LEU B HD23 1  
ATOM 5610   N N    . ARG B 2 216 ? 3.754   11.846  10.138  1.00 0.00 ? 216 ARG B N    1  
ATOM 5611   C CA   . ARG B 2 216 ? 4.159   11.736  11.528  1.00 0.00 ? 216 ARG B CA   1  
ATOM 5612   C C    . ARG B 2 216 ? 5.598   11.242  11.603  1.00 0.00 ? 216 ARG B C    1  
ATOM 5613   O O    . ARG B 2 216 ? 6.178   10.867  10.587  1.00 0.00 ? 216 ARG B O    1  
ATOM 5614   C CB   . ARG B 2 216 ? 3.231   10.764  12.261  1.00 0.00 ? 216 ARG B CB   1  
ATOM 5615   C CG   . ARG B 2 216 ? 1.753   11.078  12.091  1.00 0.00 ? 216 ARG B CG   1  
ATOM 5616   C CD   . ARG B 2 216 ? 0.885   9.959   12.637  1.00 0.00 ? 216 ARG B CD   1  
ATOM 5617   N NE   . ARG B 2 216 ? -0.497  10.069  12.170  1.00 0.00 ? 216 ARG B NE   1  
ATOM 5618   C CZ   . ARG B 2 216 ? -1.443  9.164   12.415  1.00 0.00 ? 216 ARG B CZ   1  
ATOM 5619   N NH1  . ARG B 2 216 ? -1.160  8.080   13.130  1.00 0.00 ? 216 ARG B NH1  1  
ATOM 5620   N NH2  . ARG B 2 216 ? -2.667  9.336   11.926  1.00 0.00 ? 216 ARG B NH2  1  
ATOM 5621   H H    . ARG B 2 216 ? 3.640   11.017  9.611   1.00 0.00 ? 216 ARG B H    1  
ATOM 5622   H HA   . ARG B 2 216 ? 4.091   12.717  11.997  1.00 0.00 ? 216 ARG B HA   1  
ATOM 5623   H HB2  . ARG B 2 216 ? 3.415   9.760   11.880  1.00 0.00 ? 216 ARG B HB2  1  
ATOM 5624   H HB3  . ARG B 2 216 ? 3.469   10.799  13.324  1.00 0.00 ? 216 ARG B HB3  1  
ATOM 5625   H HG2  . ARG B 2 216 ? 1.523   11.999  12.626  1.00 0.00 ? 216 ARG B HG2  1  
ATOM 5626   H HG3  . ARG B 2 216 ? 1.538   11.209  11.031  1.00 0.00 ? 216 ARG B HG3  1  
ATOM 5627   H HD2  . ARG B 2 216 ? 1.293   9.003   12.312  1.00 0.00 ? 216 ARG B HD2  1  
ATOM 5628   H HD3  . ARG B 2 216 ? 0.895   10.002  13.726  1.00 0.00 ? 216 ARG B HD3  1  
ATOM 5629   H HE   . ARG B 2 216 ? -0.727  10.859  11.630  1.00 0.00 ? 216 ARG B HE   1  
ATOM 5630   H HH11 . ARG B 2 216 ? -0.234  7.937   13.483  1.00 0.00 ? 216 ARG B HH11 1  
ATOM 5631   H HH12 . ARG B 2 216 ? -1.872  7.398   13.320  1.00 0.00 ? 216 ARG B HH12 1  
ATOM 5632   H HH21 . ARG B 2 216 ? -2.878  10.143  11.369  1.00 0.00 ? 216 ARG B HH21 1  
ATOM 5633   H HH22 . ARG B 2 216 ? -3.383  8.657   12.109  1.00 0.00 ? 216 ARG B HH22 1  
ATOM 5634   N N    . ALA B 2 217 ? 6.166   11.228  12.802  1.00 0.00 ? 217 ALA B N    1  
ATOM 5635   C CA   . ALA B 2 217 ? 7.543   10.777  12.988  1.00 0.00 ? 217 ALA B CA   1  
ATOM 5636   C C    . ALA B 2 217 ? 7.663   9.283   12.710  1.00 0.00 ? 217 ALA B C    1  
ATOM 5637   O O    . ALA B 2 217 ? 8.723   8.790   12.319  1.00 0.00 ? 217 ALA B O    1  
ATOM 5638   C CB   . ALA B 2 217 ? 8.028   11.102  14.390  1.00 0.00 ? 217 ALA B CB   1  
ATOM 5639   H H    . ALA B 2 217 ? 5.649   11.522  13.582  1.00 0.00 ? 217 ALA B H    1  
ATOM 5640   H HA   . ALA B 2 217 ? 8.173   11.310  12.276  1.00 0.00 ? 217 ALA B HA   1  
ATOM 5641   H HB1  . ALA B 2 217 ? 9.065   10.786  14.505  1.00 0.00 ? 217 ALA B HB1  1  
ATOM 5642   H HB2  . ALA B 2 217 ? 7.956   12.176  14.558  1.00 0.00 ? 217 ALA B HB2  1  
ATOM 5643   H HB3  . ALA B 2 217 ? 7.408   10.578  15.118  1.00 0.00 ? 217 ALA B HB3  1  
ATOM 5644   N N    . GLU B 2 218 ? 6.562   8.574   12.910  1.00 0.00 ? 218 GLU B N    1  
ATOM 5645   C CA   . GLU B 2 218 ? 6.514   7.136   12.679  1.00 0.00 ? 218 GLU B CA   1  
ATOM 5646   C C    . GLU B 2 218 ? 6.494   6.807   11.187  1.00 0.00 ? 218 GLU B C    1  
ATOM 5647   O O    . GLU B 2 218 ? 6.548   5.641   10.802  1.00 0.00 ? 218 GLU B O    1  
ATOM 5648   C CB   . GLU B 2 218 ? 5.280   6.539   13.351  1.00 0.00 ? 218 GLU B CB   1  
ATOM 5649   C CG   . GLU B 2 218 ? 3.969   7.134   12.865  1.00 0.00 ? 218 GLU B CG   1  
ATOM 5650   C CD   . GLU B 2 218 ? 2.759   6.422   13.430  1.00 0.00 ? 218 GLU B CD   1  
ATOM 5651   O OE1  . GLU B 2 218 ? 1.688   6.460   12.790  1.00 0.00 ? 218 GLU B OE1  1  
ATOM 5652   O OE2  . GLU B 2 218 ? 2.868   5.827   14.522  1.00 0.00 ? 218 GLU B OE2  1  
ATOM 5653   H H    . GLU B 2 218 ? 5.762   9.034   13.245  1.00 0.00 ? 218 GLU B H    1  
ATOM 5654   H HA   . GLU B 2 218 ? 7.405   6.689   13.121  1.00 0.00 ? 218 GLU B HA   1  
ATOM 5655   H HB2  . GLU B 2 218 ? 5.265   5.467   13.153  1.00 0.00 ? 218 GLU B HB2  1  
ATOM 5656   H HB3  . GLU B 2 218 ? 5.357   6.708   14.425  1.00 0.00 ? 218 GLU B HB3  1  
ATOM 5657   H HG2  . GLU B 2 218 ? 3.929   8.182   13.164  1.00 0.00 ? 218 GLU B HG2  1  
ATOM 5658   H HG3  . GLU B 2 218 ? 3.937   7.070   11.778  1.00 0.00 ? 218 GLU B HG3  1  
ATOM 5659   H HE2  . GLU B 2 218 ? 2.061   5.400   14.820  1.00 0.00 ? 218 GLU B HE2  1  
ATOM 5660   N N    . ASP B 2 219 ? 6.413   7.839   10.351  1.00 0.00 ? 219 ASP B N    1  
ATOM 5661   C CA   . ASP B 2 219 ? 6.373   7.652   8.908   1.00 0.00 ? 219 ASP B CA   1  
ATOM 5662   C C    . ASP B 2 219 ? 7.769   7.682   8.303   1.00 0.00 ? 219 ASP B C    1  
ATOM 5663   O O    . ASP B 2 219 ? 7.939   7.456   7.103   1.00 0.00 ? 219 ASP B O    1  
ATOM 5664   C CB   . ASP B 2 219 ? 5.475   8.704   8.248   1.00 0.00 ? 219 ASP B CB   1  
ATOM 5665   C CG   . ASP B 2 219 ? 4.005   8.473   8.532   1.00 0.00 ? 219 ASP B CG   1  
ATOM 5666   O OD1  . ASP B 2 219 ? 3.469   7.436   8.093   1.00 0.00 ? 219 ASP B OD1  1  
ATOM 5667   O OD2  . ASP B 2 219 ? 3.379   9.321   9.202   1.00 0.00 ? 219 ASP B OD2  1  
ATOM 5668   H H    . ASP B 2 219 ? 6.373   8.751   10.707  1.00 0.00 ? 219 ASP B H    1  
ATOM 5669   H HA   . ASP B 2 219 ? 5.943   6.670   8.714   1.00 0.00 ? 219 ASP B HA   1  
ATOM 5670   H HB2  . ASP B 2 219 ? 5.754   9.689   8.622   1.00 0.00 ? 219 ASP B HB2  1  
ATOM 5671   H HB3  . ASP B 2 219 ? 5.632   8.672   7.169   1.00 0.00 ? 219 ASP B HB3  1  
ATOM 5672   H HD2  . ASP B 2 219 ? 2.454   9.107   9.344   1.00 0.00 ? 219 ASP B HD2  1  
ATOM 5673   N N    . THR B 2 220 ? 8.763   7.981   9.136   1.00 0.00 ? 220 THR B N    1  
ATOM 5674   C CA   . THR B 2 220 ? 10.152  8.019   8.694   1.00 0.00 ? 220 THR B CA   1  
ATOM 5675   C C    . THR B 2 220 ? 10.598  6.625   8.258   1.00 0.00 ? 220 THR B C    1  
ATOM 5676   O O    . THR B 2 220 ? 10.667  5.705   9.079   1.00 0.00 ? 220 THR B O    1  
ATOM 5677   C CB   . THR B 2 220 ? 11.080  8.507   9.823   1.00 0.00 ? 220 THR B CB   1  
ATOM 5678   O OG1  . THR B 2 220 ? 10.523  9.679   10.427  1.00 0.00 ? 220 THR B OG1  1  
ATOM 5679   C CG2  . THR B 2 220 ? 12.460  8.836   9.274   1.00 0.00 ? 220 THR B CG2  1  
ATOM 5680   H H    . THR B 2 220 ? 8.557   8.199   10.067  1.00 0.00 ? 220 THR B H    1  
ATOM 5681   H HA   . THR B 2 220 ? 10.229  8.703   7.849   1.00 0.00 ? 220 THR B HA   1  
ATOM 5682   H HB   . THR B 2 220 ? 11.171  7.723   10.574  1.00 0.00 ? 220 THR B HB   1  
ATOM 5683   H HG1  . THR B 2 220 ? 10.062  9.433   11.240  1.00 0.00 ? 220 THR B HG1  1  
ATOM 5684   H HG21 . THR B 2 220 ? 12.374  9.622   8.524   1.00 0.00 ? 220 THR B HG21 1  
ATOM 5685   H HG22 . THR B 2 220 ? 13.107  9.177   10.083  1.00 0.00 ? 220 THR B HG22 1  
ATOM 5686   H HG23 . THR B 2 220 ? 12.891  7.945   8.819   1.00 0.00 ? 220 THR B HG23 1  
ATOM 5687   N N    . ALA B 2 221 ? 10.927  6.490   6.975   1.00 0.00 ? 221 ALA B N    1  
ATOM 5688   C CA   . ALA B 2 221 ? 11.340  5.209   6.415   1.00 0.00 ? 221 ALA B CA   1  
ATOM 5689   C C    . ALA B 2 221 ? 11.697  5.358   4.943   1.00 0.00 ? 221 ALA B C    1  
ATOM 5690   O O    . ALA B 2 221 ? 11.685  6.464   4.397   1.00 0.00 ? 221 ALA B O    1  
ATOM 5691   C CB   . ALA B 2 221 ? 10.211  4.194   6.551   1.00 0.00 ? 221 ALA B CB   1  
ATOM 5692   H H    . ALA B 2 221 ? 10.925  7.286   6.400   1.00 0.00 ? 221 ALA B H    1  
ATOM 5693   H HA   . ALA B 2 221 ? 12.213  4.852   6.961   1.00 0.00 ? 221 ALA B HA   1  
ATOM 5694   H HB1  . ALA B 2 221 ? 10.529  3.233   6.146   1.00 0.00 ? 221 ALA B HB1  1  
ATOM 5695   H HB2  . ALA B 2 221 ? 9.954   4.076   7.603   1.00 0.00 ? 221 ALA B HB2  1  
ATOM 5696   H HB3  . ALA B 2 221 ? 9.338   4.546   6.001   1.00 0.00 ? 221 ALA B HB3  1  
ATOM 5697   N N    . VAL B 2 222 ? 12.023  4.237   4.313   1.00 0.00 ? 222 VAL B N    1  
ATOM 5698   C CA   . VAL B 2 222 ? 12.349  4.219   2.900   1.00 0.00 ? 222 VAL B CA   1  
ATOM 5699   C C    . VAL B 2 222 ? 11.126  3.711   2.143   1.00 0.00 ? 222 VAL B C    1  
ATOM 5700   O O    . VAL B 2 222 ? 10.480  2.756   2.571   1.00 0.00 ? 222 VAL B O    1  
ATOM 5701   C CB   . VAL B 2 222 ? 13.561  3.308   2.605   1.00 0.00 ? 222 VAL B CB   1  
ATOM 5702   C CG1  . VAL B 2 222 ? 14.027  3.481   1.167   1.00 0.00 ? 222 VAL B CG1  1  
ATOM 5703   C CG2  . VAL B 2 222 ? 14.700  3.603   3.569   1.00 0.00 ? 222 VAL B CG2  1  
ATOM 5704   H H    . VAL B 2 222 ? 12.039  3.391   4.812   1.00 0.00 ? 222 VAL B H    1  
ATOM 5705   H HA   . VAL B 2 222 ? 12.583  5.233   2.577   1.00 0.00 ? 222 VAL B HA   1  
ATOM 5706   H HB   . VAL B 2 222 ? 13.252  2.272   2.744   1.00 0.00 ? 222 VAL B HB   1  
ATOM 5707   H HG11 . VAL B 2 222 ? 14.868  2.817   0.969   1.00 0.00 ? 222 VAL B HG11 1  
ATOM 5708   H HG12 . VAL B 2 222 ? 13.208  3.238   0.489   1.00 0.00 ? 222 VAL B HG12 1  
ATOM 5709   H HG13 . VAL B 2 222 ? 14.337  4.513   1.007   1.00 0.00 ? 222 VAL B HG13 1  
ATOM 5710   H HG21 . VAL B 2 222 ? 14.358  3.447   4.593   1.00 0.00 ? 222 VAL B HG21 1  
ATOM 5711   H HG22 . VAL B 2 222 ? 15.539  2.939   3.363   1.00 0.00 ? 222 VAL B HG22 1  
ATOM 5712   H HG23 . VAL B 2 222 ? 15.020  4.638   3.447   1.00 0.00 ? 222 VAL B HG23 1  
ATOM 5713   N N    . TYR B 2 223 ? 10.809  4.349   1.035   1.00 0.00 ? 223 TYR B N    1  
ATOM 5714   C CA   . TYR B 2 223 ? 9.644   3.966   0.248   1.00 0.00 ? 223 TYR B CA   1  
ATOM 5715   C C    . TYR B 2 223 ? 10.049  3.310   -1.063  1.00 0.00 ? 223 TYR B C    1  
ATOM 5716   O O    . TYR B 2 223 ? 10.690  3.935   -1.903  1.00 0.00 ? 223 TYR B O    1  
ATOM 5717   C CB   . TYR B 2 223 ? 8.713   5.162   0.029   1.00 0.00 ? 223 TYR B CB   1  
ATOM 5718   C CG   . TYR B 2 223 ? 7.985   5.586   1.288   1.00 0.00 ? 223 TYR B CG   1  
ATOM 5719   C CD1  . TYR B 2 223 ? 8.661   6.214   2.327   1.00 0.00 ? 223 TYR B CD1  1  
ATOM 5720   C CD2  . TYR B 2 223 ? 6.626   5.347   1.443   1.00 0.00 ? 223 TYR B CD2  1  
ATOM 5721   C CE1  . TYR B 2 223 ? 8.009   6.589   3.485   1.00 0.00 ? 223 TYR B CE1  1  
ATOM 5722   C CE2  . TYR B 2 223 ? 5.963   5.723   2.597   1.00 0.00 ? 223 TYR B CE2  1  
ATOM 5723   C CZ   . TYR B 2 223 ? 6.660   6.341   3.616   1.00 0.00 ? 223 TYR B CZ   1  
ATOM 5724   O OH   . TYR B 2 223 ? 6.007   6.710   4.770   1.00 0.00 ? 223 TYR B OH   1  
ATOM 5725   H H    . TYR B 2 223 ? 11.400  5.070   0.726   1.00 0.00 ? 223 TYR B H    1  
ATOM 5726   H HA   . TYR B 2 223 ? 9.093   3.224   0.827   1.00 0.00 ? 223 TYR B HA   1  
ATOM 5727   H HB2  . TYR B 2 223 ? 9.303   6.003   -0.335  1.00 0.00 ? 223 TYR B HB2  1  
ATOM 5728   H HB3  . TYR B 2 223 ? 7.975   4.897   -0.729  1.00 0.00 ? 223 TYR B HB3  1  
ATOM 5729   H HD1  . TYR B 2 223 ? 9.718   6.413   2.227   1.00 0.00 ? 223 TYR B HD1  1  
ATOM 5730   H HD2  . TYR B 2 223 ? 6.078   4.860   0.650   1.00 0.00 ? 223 TYR B HD2  1  
ATOM 5731   H HE1  . TYR B 2 223 ? 8.553   7.073   4.283   1.00 0.00 ? 223 TYR B HE1  1  
ATOM 5732   H HE2  . TYR B 2 223 ? 4.905   5.533   2.701   1.00 0.00 ? 223 TYR B HE2  1  
ATOM 5733   H HH   . TYR B 2 223 ? 6.557   7.332   5.267   1.00 0.00 ? 223 TYR B HH   1  
ATOM 5734   N N    . TYR B 2 224 ? 9.672   2.045   -1.220  1.00 0.00 ? 224 TYR B N    1  
ATOM 5735   C CA   . TYR B 2 224 ? 10.012  1.284   -2.415  1.00 0.00 ? 224 TYR B CA   1  
ATOM 5736   C C    . TYR B 2 224 ? 8.803   1.101   -3.322  1.00 0.00 ? 224 TYR B C    1  
ATOM 5737   O O    . TYR B 2 224 ? 7.681   0.892   -2.852  1.00 0.00 ? 224 TYR B O    1  
ATOM 5738   C CB   . TYR B 2 224 ? 10.539  -0.107  -2.038  1.00 0.00 ? 224 TYR B CB   1  
ATOM 5739   C CG   . TYR B 2 224 ? 11.727  -0.131  -1.101  1.00 0.00 ? 224 TYR B CG   1  
ATOM 5740   C CD1  . TYR B 2 224 ? 11.555  -0.042  0.273   1.00 0.00 ? 224 TYR B CD1  1  
ATOM 5741   C CD2  . TYR B 2 224 ? 13.021  -0.271  -1.591  1.00 0.00 ? 224 TYR B CD2  1  
ATOM 5742   C CE1  . TYR B 2 224 ? 12.634  -0.091  1.134   1.00 0.00 ? 224 TYR B CE1  1  
ATOM 5743   C CE2  . TYR B 2 224 ? 14.108  -0.317  -0.736  1.00 0.00 ? 224 TYR B CE2  1  
ATOM 5744   C CZ   . TYR B 2 224 ? 13.907  -0.228  0.624   1.00 0.00 ? 224 TYR B CZ   1  
ATOM 5745   O OH   . TYR B 2 224 ? 14.983  -0.287  1.483   1.00 0.00 ? 224 TYR B OH   1  
ATOM 5746   H H    . TYR B 2 224 ? 9.132   1.615   -0.521  1.00 0.00 ? 224 TYR B H    1  
ATOM 5747   H HA   . TYR B 2 224 ? 10.787  1.826   -2.957  1.00 0.00 ? 224 TYR B HA   1  
ATOM 5748   H HB2  . TYR B 2 224 ? 9.727   -0.659  -1.566  1.00 0.00 ? 224 TYR B HB2  1  
ATOM 5749   H HB3  . TYR B 2 224 ? 10.824  -0.620  -2.956  1.00 0.00 ? 224 TYR B HB3  1  
ATOM 5750   H HD1  . TYR B 2 224 ? 10.559  0.067   0.677   1.00 0.00 ? 224 TYR B HD1  1  
ATOM 5751   H HD2  . TYR B 2 224 ? 13.180  -0.346  -2.656  1.00 0.00 ? 224 TYR B HD2  1  
ATOM 5752   H HE1  . TYR B 2 224 ? 12.481  -0.022  2.201   1.00 0.00 ? 224 TYR B HE1  1  
ATOM 5753   H HE2  . TYR B 2 224 ? 15.107  -0.422  -1.133  1.00 0.00 ? 224 TYR B HE2  1  
ATOM 5754   H HH   . TYR B 2 224 ? 14.765  -0.864  2.226   1.00 0.00 ? 224 TYR B HH   1  
ATOM 5755   N N    . CYS B 2 225 ? 9.042   1.186   -4.619  1.00 0.00 ? 225 CYS B N    1  
ATOM 5756   C CA   . CYS B 2 225 ? 7.998   0.985   -5.605  1.00 0.00 ? 225 CYS B CA   1  
ATOM 5757   C C    . CYS B 2 225 ? 7.752   -0.513  -5.753  1.00 0.00 ? 225 CYS B C    1  
ATOM 5758   O O    . CYS B 2 225 ? 8.677   -1.271  -6.046  1.00 0.00 ? 225 CYS B O    1  
ATOM 5759   C CB   . CYS B 2 225 ? 8.438   1.574   -6.948  1.00 0.00 ? 225 CYS B CB   1  
ATOM 5760   S SG   . CYS B 2 225 ? 7.082   2.186   -8.000  1.00 0.00 ? 225 CYS B SG   1  
ATOM 5761   H H    . CYS B 2 225 ? 9.955   1.416   -4.925  1.00 0.00 ? 225 CYS B H    1  
ATOM 5762   H HA   . CYS B 2 225 ? 7.083   1.477   -5.273  1.00 0.00 ? 225 CYS B HA   1  
ATOM 5763   H HB2  . CYS B 2 225 ? 9.113   2.405   -6.742  1.00 0.00 ? 225 CYS B HB2  1  
ATOM 5764   H HB3  . CYS B 2 225 ? 8.972   0.796   -7.494  1.00 0.00 ? 225 CYS B HB3  1  
ATOM 5765   H HG   . CYS B 2 225 ? 7.831   2.598   -9.026  1.00 0.00 ? 225 CYS B HG   1  
ATOM 5766   N N    . ALA B 2 226 ? 6.518   -0.943  -5.531  1.00 0.00 ? 226 ALA B N    1  
ATOM 5767   C CA   . ALA B 2 226 ? 6.177   -2.354  -5.629  1.00 0.00 ? 226 ALA B CA   1  
ATOM 5768   C C    . ALA B 2 226 ? 5.268   -2.619  -6.823  1.00 0.00 ? 226 ALA B C    1  
ATOM 5769   O O    . ALA B 2 226 ? 4.373   -1.830  -7.115  1.00 0.00 ? 226 ALA B O    1  
ATOM 5770   C CB   . ALA B 2 226 ? 5.527   -2.828  -4.340  1.00 0.00 ? 226 ALA B CB   1  
ATOM 5771   H H    . ALA B 2 226 ? 5.820   -0.290  -5.299  1.00 0.00 ? 226 ALA B H    1  
ATOM 5772   H HA   . ALA B 2 226 ? 7.101   -2.914  -5.774  1.00 0.00 ? 226 ALA B HA   1  
ATOM 5773   H HB1  . ALA B 2 226 ? 5.305   -3.893  -4.408  1.00 0.00 ? 226 ALA B HB1  1  
ATOM 5774   H HB2  . ALA B 2 226 ? 6.207   -2.653  -3.506  1.00 0.00 ? 226 ALA B HB2  1  
ATOM 5775   H HB3  . ALA B 2 226 ? 4.602   -2.276  -4.176  1.00 0.00 ? 226 ALA B HB3  1  
ATOM 5776   N N    . ARG B 2 227 ? 5.498   -3.734  -7.503  1.00 0.00 ? 227 ARG B N    1  
ATOM 5777   C CA   . ARG B 2 227 ? 4.708   -4.098  -8.673  1.00 0.00 ? 227 ARG B CA   1  
ATOM 5778   C C    . ARG B 2 227 ? 4.222   -5.540  -8.575  1.00 0.00 ? 227 ARG B C    1  
ATOM 5779   O O    . ARG B 2 227 ? 4.935   -6.403  -8.063  1.00 0.00 ? 227 ARG B O    1  
ATOM 5780   C CB   . ARG B 2 227 ? 5.564   -3.933  -9.933  1.00 0.00 ? 227 ARG B CB   1  
ATOM 5781   C CG   . ARG B 2 227 ? 4.880   -4.360  -11.222 1.00 0.00 ? 227 ARG B CG   1  
ATOM 5782   C CD   . ARG B 2 227 ? 5.896   -4.656  -12.311 1.00 0.00 ? 227 ARG B CD   1  
ATOM 5783   N NE   . ARG B 2 227 ? 6.276   -6.069  -12.356 1.00 0.00 ? 227 ARG B NE   1  
ATOM 5784   C CZ   . ARG B 2 227 ? 6.738   -6.679  -13.446 1.00 0.00 ? 227 ARG B CZ   1  
ATOM 5785   N NH1  . ARG B 2 227 ? 6.892   -5.999  -14.577 1.00 0.00 ? 227 ARG B NH1  1  
ATOM 5786   N NH2  . ARG B 2 227 ? 7.045   -7.965  -13.404 1.00 0.00 ? 227 ARG B NH2  1  
ATOM 5787   H H    . ARG B 2 227 ? 6.220   -4.333  -7.212  1.00 0.00 ? 227 ARG B H    1  
ATOM 5788   H HA   . ARG B 2 227 ? 3.845   -3.435  -8.734  1.00 0.00 ? 227 ARG B HA   1  
ATOM 5789   H HB2  . ARG B 2 227 ? 5.835   -2.881  -10.025 1.00 0.00 ? 227 ARG B HB2  1  
ATOM 5790   H HB3  . ARG B 2 227 ? 6.466   -4.532  -9.812  1.00 0.00 ? 227 ARG B HB3  1  
ATOM 5791   H HG2  . ARG B 2 227 ? 4.292   -5.258  -11.031 1.00 0.00 ? 227 ARG B HG2  1  
ATOM 5792   H HG3  . ARG B 2 227 ? 4.222   -3.559  -11.558 1.00 0.00 ? 227 ARG B HG3  1  
ATOM 5793   H HD2  . ARG B 2 227 ? 5.469   -4.377  -13.274 1.00 0.00 ? 227 ARG B HD2  1  
ATOM 5794   H HD3  . ARG B 2 227 ? 6.789   -4.058  -12.129 1.00 0.00 ? 227 ARG B HD3  1  
ATOM 5795   H HE   . ARG B 2 227 ? 6.177   -6.598  -11.518 1.00 0.00 ? 227 ARG B HE   1  
ATOM 5796   H HH11 . ARG B 2 227 ? 6.663   -5.026  -14.612 1.00 0.00 ? 227 ARG B HH11 1  
ATOM 5797   H HH12 . ARG B 2 227 ? 7.233   -6.459  -15.398 1.00 0.00 ? 227 ARG B HH12 1  
ATOM 5798   H HH21 . ARG B 2 227 ? 6.927   -8.490  -12.537 1.00 0.00 ? 227 ARG B HH21 1  
ATOM 5799   H HH22 . ARG B 2 227 ? 7.392   -8.431  -14.213 1.00 0.00 ? 227 ARG B HH22 1  
ATOM 5800   N N    . GLN B 2 228 ? 3.003   -5.792  -9.056  1.00 0.00 ? 228 GLN B N    1  
ATOM 5801   C CA   . GLN B 2 228 ? 2.433   -7.134  -9.045  1.00 0.00 ? 228 GLN B CA   1  
ATOM 5802   C C    . GLN B 2 228 ? 2.693   -7.818  -10.390 1.00 0.00 ? 228 GLN B C    1  
ATOM 5803   O O    . GLN B 2 228 ? 3.613   -7.432  -11.112 1.00 0.00 ? 228 GLN B O    1  
ATOM 5804   C CB   . GLN B 2 228 ? 0.922   -7.076  -8.772  1.00 0.00 ? 228 GLN B CB   1  
ATOM 5805   C CG   . GLN B 2 228 ? 0.539   -6.752  -7.333  1.00 0.00 ? 228 GLN B CG   1  
ATOM 5806   C CD   . GLN B 2 228 ? 0.453   -5.263  -7.060  1.00 0.00 ? 228 GLN B CD   1  
ATOM 5807   O OE1  . GLN B 2 228 ? 1.423   -4.639  -6.631  1.00 0.00 ? 228 GLN B OE1  1  
ATOM 5808   N NE2  . GLN B 2 228 ? -0.710  -4.682  -7.304  1.00 0.00 ? 228 GLN B NE2  1  
ATOM 5809   H H    . GLN B 2 228 ? 2.462   -5.061  -9.428  1.00 0.00 ? 228 GLN B H    1  
ATOM 5810   H HA   . GLN B 2 228 ? 2.912   -7.711  -8.253  1.00 0.00 ? 228 GLN B HA   1  
ATOM 5811   H HB2  . GLN B 2 228 ? 0.491   -6.311  -9.417  1.00 0.00 ? 228 GLN B HB2  1  
ATOM 5812   H HB3  . GLN B 2 228 ? 0.496   -8.047  -9.025  1.00 0.00 ? 228 GLN B HB3  1  
ATOM 5813   H HG2  . GLN B 2 228 ? -0.431  -7.201  -7.122  1.00 0.00 ? 228 GLN B HG2  1  
ATOM 5814   H HG3  . GLN B 2 228 ? 1.287   -7.185  -6.669  1.00 0.00 ? 228 GLN B HG3  1  
ATOM 5815   H HE21 . GLN B 2 228 ? -1.443  -5.235  -7.643  1.00 0.00 ? 228 GLN B HE21 1  
ATOM 5816   H HE22 . GLN B 2 228 ? -0.791  -3.717  -7.143  1.00 0.00 ? 228 GLN B HE22 1  
ATOM 5817   N N    . ASN B 2 229 ? 1.849   -8.791  -10.749 1.00 0.00 ? 229 ASN B N    1  
ATOM 5818   C CA   . ASN B 2 229 ? 2.009   -9.530  -12.011 1.00 0.00 ? 229 ASN B CA   1  
ATOM 5819   C C    . ASN B 2 229 ? 0.901   -10.563 -12.229 1.00 0.00 ? 229 ASN B C    1  
ATOM 5820   O O    . ASN B 2 229 ? 0.841   -11.212 -13.275 1.00 0.00 ? 229 ASN B O    1  
ATOM 5821   C CB   . ASN B 2 229 ? 3.387   -10.212 -12.115 1.00 0.00 ? 229 ASN B CB   1  
ATOM 5822   C CG   . ASN B 2 229 ? 3.622   -11.317 -11.092 1.00 0.00 ? 229 ASN B CG   1  
ATOM 5823   O OD1  . ASN B 2 229 ? 2.693   -11.967 -10.614 1.00 0.00 ? 229 ASN B OD1  1  
ATOM 5824   N ND2  . ASN B 2 229 ? 4.878   -11.544 -10.758 1.00 0.00 ? 229 ASN B ND2  1  
ATOM 5825   H H    . ASN B 2 229 ? 1.073   -8.972  -10.190 1.00 0.00 ? 229 ASN B H    1  
ATOM 5826   H HA   . ASN B 2 229 ? 1.941   -8.799  -12.817 1.00 0.00 ? 229 ASN B HA   1  
ATOM 5827   H HB2  . ASN B 2 229 ? 3.481   -10.642 -13.112 1.00 0.00 ? 229 ASN B HB2  1  
ATOM 5828   H HB3  . ASN B 2 229 ? 4.156   -9.451  -11.979 1.00 0.00 ? 229 ASN B HB3  1  
ATOM 5829   H HD21 . ASN B 2 229 ? 5.583   -10.990 -11.187 1.00 0.00 ? 229 ASN B HD21 1  
ATOM 5830   H HD22 . ASN B 2 229 ? 5.065   -12.234 -10.091 1.00 0.00 ? 229 ASN B HD22 1  
ATOM 5831   N N    . LYS B 2 230 ? 0.018   -10.700 -11.250 1.00 0.00 ? 230 LYS B N    1  
ATOM 5832   C CA   . LYS B 2 230 ? -1.066  -11.672 -11.318 1.00 0.00 ? 230 LYS B CA   1  
ATOM 5833   C C    . LYS B 2 230 ? -2.325  -11.067 -10.713 1.00 0.00 ? 230 LYS B C    1  
ATOM 5834   O O    . LYS B 2 230 ? -2.485  -9.849  -10.702 1.00 0.00 ? 230 LYS B O    1  
ATOM 5835   C CB   . LYS B 2 230 ? -0.680  -12.933 -10.534 1.00 0.00 ? 230 LYS B CB   1  
ATOM 5836   C CG   . LYS B 2 230 ? -0.580  -14.199 -11.372 1.00 0.00 ? 230 LYS B CG   1  
ATOM 5837   C CD   . LYS B 2 230 ? 0.726   -14.257 -12.148 1.00 0.00 ? 230 LYS B CD   1  
ATOM 5838   C CE   . LYS B 2 230 ? 0.868   -15.579 -12.882 1.00 0.00 ? 230 LYS B CE   1  
ATOM 5839   N NZ   . LYS B 2 230 ? 2.171   -15.698 -13.586 1.00 0.00 ? 230 LYS B NZ   1  
ATOM 5840   H H    . LYS B 2 230 ? 0.060   -10.099 -10.483 1.00 0.00 ? 230 LYS B H    1  
ATOM 5841   H HA   . LYS B 2 230 ? -1.250  -11.935 -12.359 1.00 0.00 ? 230 LYS B HA   1  
ATOM 5842   H HB2  . LYS B 2 230 ? 0.289   -12.758 -10.067 1.00 0.00 ? 230 LYS B HB2  1  
ATOM 5843   H HB3  . LYS B 2 230 ? -1.431  -13.096 -9.762  1.00 0.00 ? 230 LYS B HB3  1  
ATOM 5844   H HG2  . LYS B 2 230 ? -0.638  -15.065 -10.712 1.00 0.00 ? 230 LYS B HG2  1  
ATOM 5845   H HG3  . LYS B 2 230 ? -1.411  -14.223 -12.076 1.00 0.00 ? 230 LYS B HG3  1  
ATOM 5846   H HD2  . LYS B 2 230 ? 0.746   -13.443 -12.873 1.00 0.00 ? 230 LYS B HD2  1  
ATOM 5847   H HD3  . LYS B 2 230 ? 1.558   -14.145 -11.453 1.00 0.00 ? 230 LYS B HD3  1  
ATOM 5848   H HE2  . LYS B 2 230 ? 0.783   -16.393 -12.162 1.00 0.00 ? 230 LYS B HE2  1  
ATOM 5849   H HE3  . LYS B 2 230 ? 0.065   -15.663 -13.614 1.00 0.00 ? 230 LYS B HE3  1  
ATOM 5850   H HZ1  . LYS B 2 230 ? 2.299   -16.670 -13.935 1.00 0.00 ? 230 LYS B HZ1  1  
ATOM 5851   H HZ2  . LYS B 2 230 ? 2.952   -15.471 -12.939 1.00 0.00 ? 230 LYS B HZ2  1  
ATOM 5852   H HZ3  . LYS B 2 230 ? 2.204   -15.046 -14.394 1.00 0.00 ? 230 LYS B HZ3  1  
ATOM 5853   N N    . LYS B 2 231 ? -3.205  -11.911 -10.188 1.00 0.00 ? 231 LYS B N    1  
ATOM 5854   C CA   . LYS B 2 231 ? -4.435  -11.437 -9.572  1.00 0.00 ? 231 LYS B CA   1  
ATOM 5855   C C    . LYS B 2 231 ? -4.287  -11.462 -8.050  1.00 0.00 ? 231 LYS B C    1  
ATOM 5856   O O    . LYS B 2 231 ? -5.163  -11.016 -7.315  1.00 0.00 ? 231 LYS B O    1  
ATOM 5857   C CB   . LYS B 2 231 ? -5.631  -12.291 -10.016 1.00 0.00 ? 231 LYS B CB   1  
ATOM 5858   C CG   . LYS B 2 231 ? -6.985  -11.694 -9.655  1.00 0.00 ? 231 LYS B CG   1  
ATOM 5859   C CD   . LYS B 2 231 ? -8.138  -12.625 -10.003 1.00 0.00 ? 231 LYS B CD   1  
ATOM 5860   C CE   . LYS B 2 231 ? -9.435  -12.137 -9.371  1.00 0.00 ? 231 LYS B CE   1  
ATOM 5861   N NZ   . LYS B 2 231 ? -10.614 -12.959 -9.762  1.00 0.00 ? 231 LYS B NZ   1  
ATOM 5862   H H    . LYS B 2 231 ? -3.021  -12.873 -10.190 1.00 0.00 ? 231 LYS B H    1  
ATOM 5863   H HA   . LYS B 2 231 ? -4.607  -10.409 -9.890  1.00 0.00 ? 231 LYS B HA   1  
ATOM 5864   H HB2  . LYS B 2 231 ? -5.585  -12.407 -11.099 1.00 0.00 ? 231 LYS B HB2  1  
ATOM 5865   H HB3  . LYS B 2 231 ? -5.549  -13.269 -9.542  1.00 0.00 ? 231 LYS B HB3  1  
ATOM 5866   H HG2  . LYS B 2 231 ? -7.006  -11.496 -8.584  1.00 0.00 ? 231 LYS B HG2  1  
ATOM 5867   H HG3  . LYS B 2 231 ? -7.113  -10.759 -10.201 1.00 0.00 ? 231 LYS B HG3  1  
ATOM 5868   H HD2  . LYS B 2 231 ? -8.258  -12.656 -11.086 1.00 0.00 ? 231 LYS B HD2  1  
ATOM 5869   H HD3  . LYS B 2 231 ? -7.914  -13.625 -9.633  1.00 0.00 ? 231 LYS B HD3  1  
ATOM 5870   H HE2  . LYS B 2 231 ? -9.330  -12.171 -8.286  1.00 0.00 ? 231 LYS B HE2  1  
ATOM 5871   H HE3  . LYS B 2 231 ? -9.610  -11.106 -9.681  1.00 0.00 ? 231 LYS B HE3  1  
ATOM 5872   H HZ1  . LYS B 2 231 ? -10.914 -12.719 -10.726 1.00 0.00 ? 231 LYS B HZ1  1  
ATOM 5873   H HZ2  . LYS B 2 231 ? -11.410 -12.772 -9.106  1.00 0.00 ? 231 LYS B HZ2  1  
ATOM 5874   H HZ3  . LYS B 2 231 ? -10.379 -13.975 -9.725  1.00 0.00 ? 231 LYS B HZ3  1  
ATOM 5875   N N    . LEU B 2 232 ? -3.163  -11.994 -7.587  1.00 0.00 ? 232 LEU B N    1  
ATOM 5876   C CA   . LEU B 2 232 ? -2.887  -12.076 -6.161  1.00 0.00 ? 232 LEU B CA   1  
ATOM 5877   C C    . LEU B 2 232 ? -2.013  -10.910 -5.719  1.00 0.00 ? 232 LEU B C    1  
ATOM 5878   O O    . LEU B 2 232 ? -1.286  -10.326 -6.525  1.00 0.00 ? 232 LEU B O    1  
ATOM 5879   C CB   . LEU B 2 232 ? -2.235  -13.414 -5.802  1.00 0.00 ? 232 LEU B CB   1  
ATOM 5880   C CG   . LEU B 2 232 ? -3.169  -14.628 -5.776  1.00 0.00 ? 232 LEU B CG   1  
ATOM 5881   C CD1  . LEU B 2 232 ? -2.397  -15.896 -5.447  1.00 0.00 ? 232 LEU B CD1  1  
ATOM 5882   C CD2  . LEU B 2 232 ? -4.298  -14.415 -4.781  1.00 0.00 ? 232 LEU B CD2  1  
ATOM 5883   H H    . LEU B 2 232 ? -2.498  -12.329 -8.221  1.00 0.00 ? 232 LEU B H    1  
ATOM 5884   H HA   . LEU B 2 232 ? -3.837  -12.010 -5.631  1.00 0.00 ? 232 LEU B HA   1  
ATOM 5885   H HB2  . LEU B 2 232 ? -1.451  -13.610 -6.533  1.00 0.00 ? 232 LEU B HB2  1  
ATOM 5886   H HB3  . LEU B 2 232 ? -1.791  -13.314 -4.811  1.00 0.00 ? 232 LEU B HB3  1  
ATOM 5887   H HG   . LEU B 2 232 ? -3.606  -14.743 -6.768  1.00 0.00 ? 232 LEU B HG   1  
ATOM 5888   H HD11 . LEU B 2 232 ? -3.070  -16.753 -5.456  1.00 0.00 ? 232 LEU B HD11 1  
ATOM 5889   H HD12 . LEU B 2 232 ? -1.613  -16.045 -6.190  1.00 0.00 ? 232 LEU B HD12 1  
ATOM 5890   H HD13 . LEU B 2 232 ? -1.947  -15.800 -4.459  1.00 0.00 ? 232 LEU B HD13 1  
ATOM 5891   H HD21 . LEU B 2 232 ? -4.857  -13.519 -5.053  1.00 0.00 ? 232 LEU B HD21 1  
ATOM 5892   H HD22 . LEU B 2 232 ? -4.968  -15.275 -4.791  1.00 0.00 ? 232 LEU B HD22 1  
ATOM 5893   H HD23 . LEU B 2 232 ? -3.882  -14.293 -3.781  1.00 0.00 ? 232 LEU B HD23 1  
ATOM 5894   N N    . THR B 2 233 ? -2.077  -10.588 -4.438  1.00 0.00 ? 233 THR B N    1  
ATOM 5895   C CA   . THR B 2 233 ? -1.315  -9.482  -3.889  1.00 0.00 ? 233 THR B CA   1  
ATOM 5896   C C    . THR B 2 233 ? 0.126   -9.870  -3.543  1.00 0.00 ? 233 THR B C    1  
ATOM 5897   O O    . THR B 2 233 ? 0.439   -10.213 -2.404  1.00 0.00 ? 233 THR B O    1  
ATOM 5898   C CB   . THR B 2 233 ? -2.026  -8.830  -2.675  1.00 0.00 ? 233 THR B CB   1  
ATOM 5899   O OG1  . THR B 2 233 ? -1.124  -7.968  -1.968  1.00 0.00 ? 233 THR B OG1  1  
ATOM 5900   C CG2  . THR B 2 233 ? -2.585  -9.882  -1.724  1.00 0.00 ? 233 THR B CG2  1  
ATOM 5901   H H    . THR B 2 233 ? -2.647  -11.114 -3.842  1.00 0.00 ? 233 THR B H    1  
ATOM 5902   H HA   . THR B 2 233 ? -1.262  -8.726  -4.672  1.00 0.00 ? 233 THR B HA   1  
ATOM 5903   H HB   . THR B 2 233 ? -2.855  -8.229  -3.049  1.00 0.00 ? 233 THR B HB   1  
ATOM 5904   H HG1  . THR B 2 233 ? -0.352  -8.477  -1.689  1.00 0.00 ? 233 THR B HG1  1  
ATOM 5905   H HG21 . THR B 2 233 ? -1.768  -10.493 -1.341  1.00 0.00 ? 233 THR B HG21 1  
ATOM 5906   H HG22 . THR B 2 233 ? -3.095  -9.399  -0.891  1.00 0.00 ? 233 THR B HG22 1  
ATOM 5907   H HG23 . THR B 2 233 ? -3.292  -10.515 -2.260  1.00 0.00 ? 233 THR B HG23 1  
ATOM 5908   N N    . TRP B 2 234 ? 0.996   -9.823  -4.540  1.00 0.00 ? 234 TRP B N    1  
ATOM 5909   C CA   . TRP B 2 234 ? 2.405   -10.131 -4.344  1.00 0.00 ? 234 TRP B CA   1  
ATOM 5910   C C    . TRP B 2 234 ? 3.262   -9.226  -5.219  1.00 0.00 ? 234 TRP B C    1  
ATOM 5911   O O    . TRP B 2 234 ? 2.820   -8.788  -6.279  1.00 0.00 ? 234 TRP B O    1  
ATOM 5912   C CB   . TRP B 2 234 ? 2.737   -11.621 -4.535  1.00 0.00 ? 234 TRP B CB   1  
ATOM 5913   C CG   . TRP B 2 234 ? 2.380   -12.225 -5.867  1.00 0.00 ? 234 TRP B CG   1  
ATOM 5914   C CD1  . TRP B 2 234 ? 2.446   -11.638 -7.097  1.00 0.00 ? 234 TRP B CD1  1  
ATOM 5915   C CD2  . TRP B 2 234 ? 1.921   -13.564 -6.092  1.00 0.00 ? 234 TRP B CD2  1  
ATOM 5916   N NE1  . TRP B 2 234 ? 2.051   -12.522 -8.067  1.00 0.00 ? 234 TRP B NE1  1  
ATOM 5917   C CE2  . TRP B 2 234 ? 1.725   -13.712 -7.477  1.00 0.00 ? 234 TRP B CE2  1  
ATOM 5918   C CE3  . TRP B 2 234 ? 1.658   -14.650 -5.254  1.00 0.00 ? 234 TRP B CE3  1  
ATOM 5919   C CZ2  . TRP B 2 234 ? 1.277   -14.903 -8.045  1.00 0.00 ? 234 TRP B CZ2  1  
ATOM 5920   C CZ3  . TRP B 2 234 ? 1.215   -15.830 -5.818  1.00 0.00 ? 234 TRP B CZ3  1  
ATOM 5921   C CH2  . TRP B 2 234 ? 1.029   -15.948 -7.202  1.00 0.00 ? 234 TRP B CH2  1  
ATOM 5922   H H    . TRP B 2 234 ? 0.693   -9.545  -5.431  1.00 0.00 ? 234 TRP B H    1  
ATOM 5923   H HA   . TRP B 2 234 ? 2.637   -9.891  -3.307  1.00 0.00 ? 234 TRP B HA   1  
ATOM 5924   H HB2  . TRP B 2 234 ? 3.809   -11.748 -4.387  1.00 0.00 ? 234 TRP B HB2  1  
ATOM 5925   H HB3  . TRP B 2 234 ? 2.213   -12.183 -3.762  1.00 0.00 ? 234 TRP B HB3  1  
ATOM 5926   H HD1  . TRP B 2 234 ? 2.763   -10.622 -7.279  1.00 0.00 ? 234 TRP B HD1  1  
ATOM 5927   H HE1  . TRP B 2 234 ? 2.017   -12.331 -9.034  1.00 0.00 ? 234 TRP B HE1  1  
ATOM 5928   H HE3  . TRP B 2 234 ? 1.798   -14.568 -4.186  1.00 0.00 ? 234 TRP B HE3  1  
ATOM 5929   H HZ2  . TRP B 2 234 ? 1.131   -14.995 -9.111  1.00 0.00 ? 234 TRP B HZ2  1  
ATOM 5930   H HZ3  . TRP B 2 234 ? 1.010   -16.678 -5.181  1.00 0.00 ? 234 TRP B HZ3  1  
ATOM 5931   H HH2  . TRP B 2 234 ? 0.681   -16.885 -7.611  1.00 0.00 ? 234 TRP B HH2  1  
ATOM 5932   N N    . PHE B 2 235 ? 4.466   -8.933  -4.770  1.00 0.00 ? 235 PHE B N    1  
ATOM 5933   C CA   . PHE B 2 235 ? 5.356   -8.052  -5.512  1.00 0.00 ? 235 PHE B CA   1  
ATOM 5934   C C    . PHE B 2 235 ? 6.517   -8.838  -6.098  1.00 0.00 ? 235 PHE B C    1  
ATOM 5935   O O    . PHE B 2 235 ? 7.167   -9.611  -5.398  1.00 0.00 ? 235 PHE B O    1  
ATOM 5936   C CB   . PHE B 2 235 ? 5.869   -6.942  -4.592  1.00 0.00 ? 235 PHE B CB   1  
ATOM 5937   C CG   . PHE B 2 235 ? 4.852   -6.504  -3.575  1.00 0.00 ? 235 PHE B CG   1  
ATOM 5938   C CD1  . PHE B 2 235 ? 3.733   -5.782  -3.961  1.00 0.00 ? 235 PHE B CD1  1  
ATOM 5939   C CD2  . PHE B 2 235 ? 5.008   -6.825  -2.237  1.00 0.00 ? 235 PHE B CD2  1  
ATOM 5940   C CE1  . PHE B 2 235 ? 2.791   -5.387  -3.030  1.00 0.00 ? 235 PHE B CE1  1  
ATOM 5941   C CE2  . PHE B 2 235 ? 4.070   -6.433  -1.301  1.00 0.00 ? 235 PHE B CE2  1  
ATOM 5942   C CZ   . PHE B 2 235 ? 2.961   -5.713  -1.698  1.00 0.00 ? 235 PHE B CZ   1  
ATOM 5943   H H    . PHE B 2 235 ? 4.775   -9.326  -3.926  1.00 0.00 ? 235 PHE B H    1  
ATOM 5944   H HA   . PHE B 2 235 ? 4.794   -7.598  -6.328  1.00 0.00 ? 235 PHE B HA   1  
ATOM 5945   H HB2  . PHE B 2 235 ? 6.755   -7.303  -4.068  1.00 0.00 ? 235 PHE B HB2  1  
ATOM 5946   H HB3  . PHE B 2 235 ? 6.148   -6.083  -5.201  1.00 0.00 ? 235 PHE B HB3  1  
ATOM 5947   H HD1  . PHE B 2 235 ? 3.596   -5.524  -5.001  1.00 0.00 ? 235 PHE B HD1  1  
ATOM 5948   H HD2  . PHE B 2 235 ? 5.874   -7.388  -1.922  1.00 0.00 ? 235 PHE B HD2  1  
ATOM 5949   H HE1  . PHE B 2 235 ? 1.924   -4.824  -3.342  1.00 0.00 ? 235 PHE B HE1  1  
ATOM 5950   H HE2  . PHE B 2 235 ? 4.205   -6.688  -0.260  1.00 0.00 ? 235 PHE B HE2  1  
ATOM 5951   H HZ   . PHE B 2 235 ? 2.226   -5.406  -0.969  1.00 0.00 ? 235 PHE B HZ   1  
ATOM 5952   N N    . ASP B 2 236 ? 6.765   -8.657  -7.386  1.00 0.00 ? 236 ASP B N    1  
ATOM 5953   C CA   . ASP B 2 236 ? 7.850   -9.370  -8.055  1.00 0.00 ? 236 ASP B CA   1  
ATOM 5954   C C    . ASP B 2 236 ? 9.017   -8.461  -8.414  1.00 0.00 ? 236 ASP B C    1  
ATOM 5955   O O    . ASP B 2 236 ? 10.105  -8.936  -8.742  1.00 0.00 ? 236 ASP B O    1  
ATOM 5956   C CB   . ASP B 2 236 ? 7.345   -10.120 -9.290  1.00 0.00 ? 236 ASP B CB   1  
ATOM 5957   C CG   . ASP B 2 236 ? 6.936   -9.226  -10.451 1.00 0.00 ? 236 ASP B CG   1  
ATOM 5958   O OD1  . ASP B 2 236 ? 6.757   -8.003  -10.258 1.00 0.00 ? 236 ASP B OD1  1  
ATOM 5959   O OD2  . ASP B 2 236 ? 6.768   -9.758  -11.565 1.00 0.00 ? 236 ASP B OD2  1  
ATOM 5960   H H    . ASP B 2 236 ? 6.194   -8.045  -7.908  1.00 0.00 ? 236 ASP B H    1  
ATOM 5961   H HA   . ASP B 2 236 ? 8.222   -10.112 -7.349  1.00 0.00 ? 236 ASP B HA   1  
ATOM 5962   H HB2  . ASP B 2 236 ? 8.139   -10.784 -9.634  1.00 0.00 ? 236 ASP B HB2  1  
ATOM 5963   H HB3  . ASP B 2 236 ? 6.481   -10.716 -8.997  1.00 0.00 ? 236 ASP B HB3  1  
ATOM 5964   H HD2  . ASP B 2 236 ? 6.505   -9.145  -12.255 1.00 0.00 ? 236 ASP B HD2  1  
ATOM 5965   N N    . TYR B 2 237 ? 8.800   -7.160  -8.332  1.00 0.00 ? 237 TYR B N    1  
ATOM 5966   C CA   . TYR B 2 237 ? 9.839   -6.202  -8.655  1.00 0.00 ? 237 TYR B CA   1  
ATOM 5967   C C    . TYR B 2 237 ? 9.758   -5.007  -7.722  1.00 0.00 ? 237 TYR B C    1  
ATOM 5968   O O    . TYR B 2 237 ? 8.690   -4.413  -7.543  1.00 0.00 ? 237 TYR B O    1  
ATOM 5969   C CB   . TYR B 2 237 ? 9.746   -5.752  -10.113 1.00 0.00 ? 237 TYR B CB   1  
ATOM 5970   C CG   . TYR B 2 237 ? 10.946  -4.954  -10.575 1.00 0.00 ? 237 TYR B CG   1  
ATOM 5971   C CD1  . TYR B 2 237 ? 12.093  -5.589  -11.035 1.00 0.00 ? 237 TYR B CD1  1  
ATOM 5972   C CD2  . TYR B 2 237 ? 10.939  -3.567  -10.540 1.00 0.00 ? 237 TYR B CD2  1  
ATOM 5973   C CE1  . TYR B 2 237 ? 13.197  -4.864  -11.445 1.00 0.00 ? 237 TYR B CE1  1  
ATOM 5974   C CE2  . TYR B 2 237 ? 12.034  -2.833  -10.950 1.00 0.00 ? 237 TYR B CE2  1  
ATOM 5975   C CZ   . TYR B 2 237 ? 13.160  -3.486  -11.400 1.00 0.00 ? 237 TYR B CZ   1  
ATOM 5976   O OH   . TYR B 2 237 ? 14.253  -2.757  -11.811 1.00 0.00 ? 237 TYR B OH   1  
ATOM 5977   H H    . TYR B 2 237 ? 7.933   -6.830  -8.020  1.00 0.00 ? 237 TYR B H    1  
ATOM 5978   H HA   . TYR B 2 237 ? 10.803  -6.689  -8.509  1.00 0.00 ? 237 TYR B HA   1  
ATOM 5979   H HB2  . TYR B 2 237 ? 9.650   -6.635  -10.745 1.00 0.00 ? 237 TYR B HB2  1  
ATOM 5980   H HB3  . TYR B 2 237 ? 8.853   -5.138  -10.233 1.00 0.00 ? 237 TYR B HB3  1  
ATOM 5981   H HD1  . TYR B 2 237 ? 12.124  -6.668  -11.072 1.00 0.00 ? 237 TYR B HD1  1  
ATOM 5982   H HD2  . TYR B 2 237 ? 10.059  -3.051  -10.184 1.00 0.00 ? 237 TYR B HD2  1  
ATOM 5983   H HE1  . TYR B 2 237 ? 14.081  -5.374  -11.799 1.00 0.00 ? 237 TYR B HE1  1  
ATOM 5984   H HE2  . TYR B 2 237 ? 12.008  -1.754  -10.918 1.00 0.00 ? 237 TYR B HE2  1  
ATOM 5985   H HH   . TYR B 2 237 ? 14.462  -2.990  -12.726 1.00 0.00 ? 237 TYR B HH   1  
ATOM 5986   N N    . TRP B 2 238 ? 10.883  -4.681  -7.110  1.00 0.00 ? 238 TRP B N    1  
ATOM 5987   C CA   . TRP B 2 238 ? 10.961  -3.559  -6.191  1.00 0.00 ? 238 TRP B CA   1  
ATOM 5988   C C    . TRP B 2 238 ? 11.872  -2.473  -6.746  1.00 0.00 ? 238 TRP B C    1  
ATOM 5989   O O    . TRP B 2 238 ? 12.870  -2.768  -7.405  1.00 0.00 ? 238 TRP B O    1  
ATOM 5990   C CB   . TRP B 2 238 ? 11.498  -4.022  -4.834  1.00 0.00 ? 238 TRP B CB   1  
ATOM 5991   C CG   . TRP B 2 238 ? 10.642  -5.041  -4.151  1.00 0.00 ? 238 TRP B CG   1  
ATOM 5992   C CD1  . TRP B 2 238 ? 10.476  -6.347  -4.510  1.00 0.00 ? 238 TRP B CD1  1  
ATOM 5993   C CD2  . TRP B 2 238 ? 9.843   -4.842  -2.981  1.00 0.00 ? 238 TRP B CD2  1  
ATOM 5994   N NE1  . TRP B 2 238 ? 9.615   -6.970  -3.643  1.00 0.00 ? 238 TRP B NE1  1  
ATOM 5995   C CE2  . TRP B 2 238 ? 9.215   -6.069  -2.692  1.00 0.00 ? 238 TRP B CE2  1  
ATOM 5996   C CE3  . TRP B 2 238 ? 9.598   -3.746  -2.151  1.00 0.00 ? 238 TRP B CE3  1  
ATOM 5997   C CZ2  . TRP B 2 238 ? 8.359   -6.229  -1.609  1.00 0.00 ? 238 TRP B CZ2  1  
ATOM 5998   C CZ3  . TRP B 2 238 ? 8.748   -3.907  -1.077  1.00 0.00 ? 238 TRP B CZ3  1  
ATOM 5999   C CH2  . TRP B 2 238 ? 8.139   -5.140  -0.814  1.00 0.00 ? 238 TRP B CH2  1  
ATOM 6000   H H    . TRP B 2 238 ? 11.681  -5.225  -7.269  1.00 0.00 ? 238 TRP B H    1  
ATOM 6001   H HA   . TRP B 2 238 ? 9.960   -3.150  -6.057  1.00 0.00 ? 238 TRP B HA   1  
ATOM 6002   H HB2  . TRP B 2 238 ? 12.491  -4.447  -4.981  1.00 0.00 ? 238 TRP B HB2  1  
ATOM 6003   H HB3  . TRP B 2 238 ? 11.588  -3.152  -4.182  1.00 0.00 ? 238 TRP B HB3  1  
ATOM 6004   H HD1  . TRP B 2 238 ? 10.953  -6.822  -5.355  1.00 0.00 ? 238 TRP B HD1  1  
ATOM 6005   H HE1  . TRP B 2 238 ? 9.335   -7.907  -3.695  1.00 0.00 ? 238 TRP B HE1  1  
ATOM 6006   H HE3  . TRP B 2 238 ? 10.065  -2.791  -2.346  1.00 0.00 ? 238 TRP B HE3  1  
ATOM 6007   H HZ2  . TRP B 2 238 ? 7.885   -7.178  -1.404  1.00 0.00 ? 238 TRP B HZ2  1  
ATOM 6008   H HZ3  . TRP B 2 238 ? 8.548   -3.067  -0.428  1.00 0.00 ? 238 TRP B HZ3  1  
ATOM 6009   H HH2  . TRP B 2 238 ? 7.480   -5.232  0.037   1.00 0.00 ? 238 TRP B HH2  1  
ATOM 6010   N N    . GLY B 2 239 ? 11.500  -1.223  -6.501  1.00 0.00 ? 239 GLY B N    1  
ATOM 6011   C CA   . GLY B 2 239 ? 12.304  -0.102  -6.950  1.00 0.00 ? 239 GLY B CA   1  
ATOM 6012   C C    . GLY B 2 239 ? 13.550  0.081   -6.100  1.00 0.00 ? 239 GLY B C    1  
ATOM 6013   O O    . GLY B 2 239 ? 13.915  -0.810  -5.331  1.00 0.00 ? 239 GLY B O    1  
ATOM 6014   H H    . GLY B 2 239 ? 10.649  -1.060  -6.039  1.00 0.00 ? 239 GLY B H    1  
ATOM 6015   H HA2  . GLY B 2 239 ? 12.604  -0.275  -7.984  1.00 0.00 ? 239 GLY B HA2  1  
ATOM 6016   H HA3  . GLY B 2 239 ? 11.704  0.807   -6.896  1.00 0.00 ? 239 GLY B HA3  1  
ATOM 6017   N N    . GLN B 2 240 ? 14.193  1.233   -6.215  1.00 0.00 ? 240 GLN B N    1  
ATOM 6018   C CA   . GLN B 2 240 ? 15.411  1.499   -5.462  1.00 0.00 ? 240 GLN B CA   1  
ATOM 6019   C C    . GLN B 2 240 ? 15.080  1.988   -4.057  1.00 0.00 ? 240 GLN B C    1  
ATOM 6020   O O    . GLN B 2 240 ? 15.827  1.744   -3.108  1.00 0.00 ? 240 GLN B O    1  
ATOM 6021   C CB   . GLN B 2 240 ? 16.271  2.537   -6.189  1.00 0.00 ? 240 GLN B CB   1  
ATOM 6022   C CG   . GLN B 2 240 ? 17.653  2.729   -5.586  1.00 0.00 ? 240 GLN B CG   1  
ATOM 6023   C CD   . GLN B 2 240 ? 18.449  3.810   -6.285  1.00 0.00 ? 240 GLN B CD   1  
ATOM 6024   O OE1  . GLN B 2 240 ? 18.290  4.044   -7.483  1.00 0.00 ? 240 GLN B OE1  1  
ATOM 6025   N NE2  . GLN B 2 240 ? 19.319  4.478   -5.548  1.00 0.00 ? 240 GLN B NE2  1  
ATOM 6026   H H    . GLN B 2 240 ? 13.825  1.942   -6.795  1.00 0.00 ? 240 GLN B H    1  
ATOM 6027   H HA   . GLN B 2 240 ? 15.976  0.570   -5.384  1.00 0.00 ? 240 GLN B HA   1  
ATOM 6028   H HB2  . GLN B 2 240 ? 16.390  2.218   -7.224  1.00 0.00 ? 240 GLN B HB2  1  
ATOM 6029   H HB3  . GLN B 2 240 ? 15.749  3.493   -6.161  1.00 0.00 ? 240 GLN B HB3  1  
ATOM 6030   H HG2  . GLN B 2 240 ? 17.543  3.000   -4.536  1.00 0.00 ? 240 GLN B HG2  1  
ATOM 6031   H HG3  . GLN B 2 240 ? 18.200  1.789   -5.659  1.00 0.00 ? 240 GLN B HG3  1  
ATOM 6032   H HE21 . GLN B 2 240 ? 19.403  4.239   -4.600  1.00 0.00 ? 240 GLN B HE21 1  
ATOM 6033   H HE22 . GLN B 2 240 ? 19.842  5.188   -5.976  1.00 0.00 ? 240 GLN B HE22 1  
ATOM 6034   N N    . GLY B 2 241 ? 13.945  2.656   -3.931  1.00 0.00 ? 241 GLY B N    1  
ATOM 6035   C CA   . GLY B 2 241 ? 13.538  3.177   -2.648  1.00 0.00 ? 241 GLY B CA   1  
ATOM 6036   C C    . GLY B 2 241 ? 13.967  4.610   -2.430  1.00 0.00 ? 241 GLY B C    1  
ATOM 6037   O O    . GLY B 2 241 ? 15.111  4.978   -2.692  1.00 0.00 ? 241 GLY B O    1  
ATOM 6038   H H    . GLY B 2 241 ? 13.370  2.783   -4.720  1.00 0.00 ? 241 GLY B H    1  
ATOM 6039   H HA2  . GLY B 2 241 ? 12.451  3.125   -2.582  1.00 0.00 ? 241 GLY B HA2  1  
ATOM 6040   H HA3  . GLY B 2 241 ? 13.977  2.559   -1.866  1.00 0.00 ? 241 GLY B HA3  1  
ATOM 6041   N N    . THR B 2 242 ? 13.041  5.429   -1.950  1.00 0.00 ? 242 THR B N    1  
ATOM 6042   C CA   . THR B 2 242 ? 13.325  6.827   -1.677  1.00 0.00 ? 242 THR B CA   1  
ATOM 6043   C C    . THR B 2 242 ? 13.272  7.091   -0.174  1.00 0.00 ? 242 THR B C    1  
ATOM 6044   O O    . THR B 2 242 ? 12.310  6.708   0.497   1.00 0.00 ? 242 THR B O    1  
ATOM 6045   C CB   . THR B 2 242 ? 12.320  7.751   -2.389  1.00 0.00 ? 242 THR B CB   1  
ATOM 6046   O OG1  . THR B 2 242 ? 11.474  6.960   -3.229  1.00 0.00 ? 242 THR B OG1  1  
ATOM 6047   C CG2  . THR B 2 242 ? 13.053  8.778   -3.237  1.00 0.00 ? 242 THR B CG2  1  
ATOM 6048   H H    . THR B 2 242 ? 12.141  5.074   -1.771  1.00 0.00 ? 242 THR B H    1  
ATOM 6049   H HA   . THR B 2 242 ? 14.327  7.052   -2.042  1.00 0.00 ? 242 THR B HA   1  
ATOM 6050   H HB   . THR B 2 242 ? 11.714  8.266   -1.644  1.00 0.00 ? 242 THR B HB   1  
ATOM 6051   H HG1  . THR B 2 242 ? 11.888  6.105   -3.391  1.00 0.00 ? 242 THR B HG1  1  
ATOM 6052   H HG21 . THR B 2 242 ? 13.659  8.266   -3.985  1.00 0.00 ? 242 THR B HG21 1  
ATOM 6053   H HG22 . THR B 2 242 ? 12.331  9.424   -3.737  1.00 0.00 ? 242 THR B HG22 1  
ATOM 6054   H HG23 . THR B 2 242 ? 13.698  9.382   -2.599  1.00 0.00 ? 242 THR B HG23 1  
ATOM 6055   N N    . LEU B 2 243 ? 14.314  7.719   0.353   1.00 0.00 ? 243 LEU B N    1  
ATOM 6056   C CA   . LEU B 2 243 ? 14.384  8.028   1.775   1.00 0.00 ? 243 LEU B CA   1  
ATOM 6057   C C    . LEU B 2 243 ? 13.594  9.281   2.127   1.00 0.00 ? 243 LEU B C    1  
ATOM 6058   O O    . LEU B 2 243 ? 13.804  10.348  1.549   1.00 0.00 ? 243 LEU B O    1  
ATOM 6059   C CB   . LEU B 2 243 ? 15.841  8.182   2.223   1.00 0.00 ? 243 LEU B CB   1  
ATOM 6060   C CG   . LEU B 2 243 ? 16.065  8.483   3.709   1.00 0.00 ? 243 LEU B CG   1  
ATOM 6061   C CD1  . LEU B 2 243 ? 15.672  7.291   4.569   1.00 0.00 ? 243 LEU B CD1  1  
ATOM 6062   C CD2  . LEU B 2 243 ? 17.510  8.881   3.963   1.00 0.00 ? 243 LEU B CD2  1  
ATOM 6063   H H    . LEU B 2 243 ? 15.067  7.966   -0.224  1.00 0.00 ? 243 LEU B H    1  
ATOM 6064   H HA   . LEU B 2 243 ? 13.947  7.189   2.317   1.00 0.00 ? 243 LEU B HA   1  
ATOM 6065   H HB2  . LEU B 2 243 ? 16.360  7.252   1.990   1.00 0.00 ? 243 LEU B HB2  1  
ATOM 6066   H HB3  . LEU B 2 243 ? 16.280  8.997   1.648   1.00 0.00 ? 243 LEU B HB3  1  
ATOM 6067   H HG   . LEU B 2 243 ? 15.429  9.324   3.985   1.00 0.00 ? 243 LEU B HG   1  
ATOM 6068   H HD11 . LEU B 2 243 ? 15.814  7.531   5.623   1.00 0.00 ? 243 LEU B HD11 1  
ATOM 6069   H HD12 . LEU B 2 243 ? 14.624  7.048   4.393   1.00 0.00 ? 243 LEU B HD12 1  
ATOM 6070   H HD13 . LEU B 2 243 ? 16.292  6.435   4.307   1.00 0.00 ? 243 LEU B HD13 1  
ATOM 6071   H HD21 . LEU B 2 243 ? 17.755  9.756   3.361   1.00 0.00 ? 243 LEU B HD21 1  
ATOM 6072   H HD22 . LEU B 2 243 ? 17.649  9.119   5.018   1.00 0.00 ? 243 LEU B HD22 1  
ATOM 6073   H HD23 . LEU B 2 243 ? 18.167  8.056   3.689   1.00 0.00 ? 243 LEU B HD23 1  
ATOM 6074   N N    . VAL B 2 244 ? 12.685  9.136   3.077   1.00 0.00 ? 244 VAL B N    1  
ATOM 6075   C CA   . VAL B 2 244 ? 11.870  10.246  3.547   1.00 0.00 ? 244 VAL B CA   1  
ATOM 6076   C C    . VAL B 2 244 ? 12.137  10.444  5.034   1.00 0.00 ? 244 VAL B C    1  
ATOM 6077   O O    . VAL B 2 244 ? 11.992  9.509   5.821   1.00 0.00 ? 244 VAL B O    1  
ATOM 6078   C CB   . VAL B 2 244 ? 10.364  9.982   3.326   1.00 0.00 ? 244 VAL B CB   1  
ATOM 6079   C CG1  . VAL B 2 244 ? 9.532   11.150  3.837   1.00 0.00 ? 244 VAL B CG1  1  
ATOM 6080   C CG2  . VAL B 2 244 ? 10.078  9.729   1.851   1.00 0.00 ? 244 VAL B CG2  1  
ATOM 6081   H H    . VAL B 2 244 ? 12.561  8.250   3.483   1.00 0.00 ? 244 VAL B H    1  
ATOM 6082   H HA   . VAL B 2 244 ? 12.154  11.147  3.003   1.00 0.00 ? 244 VAL B HA   1  
ATOM 6083   H HB   . VAL B 2 244 ? 10.085  9.091   3.888   1.00 0.00 ? 244 VAL B HB   1  
ATOM 6084   H HG11 . VAL B 2 244 ? 8.472   10.939  3.692   1.00 0.00 ? 244 VAL B HG11 1  
ATOM 6085   H HG12 . VAL B 2 244 ? 9.729   11.298  4.899   1.00 0.00 ? 244 VAL B HG12 1  
ATOM 6086   H HG13 . VAL B 2 244 ? 9.799   12.053  3.288   1.00 0.00 ? 244 VAL B HG13 1  
ATOM 6087   H HG21 . VAL B 2 244 ? 10.660  8.873   1.511   1.00 0.00 ? 244 VAL B HG21 1  
ATOM 6088   H HG22 . VAL B 2 244 ? 9.017   9.523   1.712   1.00 0.00 ? 244 VAL B HG22 1  
ATOM 6089   H HG23 . VAL B 2 244 ? 10.355  10.610  1.272   1.00 0.00 ? 244 VAL B HG23 1  
ATOM 6090   N N    . THR B 2 245 ? 12.547  11.645  5.418   1.00 0.00 ? 245 THR B N    1  
ATOM 6091   C CA   . THR B 2 245 ? 12.852  11.930  6.811   1.00 0.00 ? 245 THR B CA   1  
ATOM 6092   C C    . THR B 2 245 ? 12.064  13.136  7.312   1.00 0.00 ? 245 THR B C    1  
ATOM 6093   O O    . THR B 2 245 ? 12.100  14.206  6.703   1.00 0.00 ? 245 THR B O    1  
ATOM 6094   C CB   . THR B 2 245 ? 14.357  12.215  6.987   1.00 0.00 ? 245 THR B CB   1  
ATOM 6095   O OG1  . THR B 2 245 ? 15.071  11.711  5.848   1.00 0.00 ? 245 THR B OG1  1  
ATOM 6096   C CG2  . THR B 2 245 ? 14.884  11.543  8.245   1.00 0.00 ? 245 THR B CG2  1  
ATOM 6097   H H    . THR B 2 245 ? 12.635  12.371  4.757   1.00 0.00 ? 245 THR B H    1  
ATOM 6098   H HA   . THR B 2 245 ? 12.583  11.058  7.407   1.00 0.00 ? 245 THR B HA   1  
ATOM 6099   H HB   . THR B 2 245 ? 14.510  13.291  7.064   1.00 0.00 ? 245 THR B HB   1  
ATOM 6100   H HG1  . THR B 2 245 ? 14.527  11.056  5.399   1.00 0.00 ? 245 THR B HG1  1  
ATOM 6101   H HG21 . THR B 2 245 ? 14.734  10.466  8.171   1.00 0.00 ? 245 THR B HG21 1  
ATOM 6102   H HG22 . THR B 2 245 ? 15.948  11.754  8.357   1.00 0.00 ? 245 THR B HG22 1  
ATOM 6103   H HG23 . THR B 2 245 ? 14.347  11.927  9.113   1.00 0.00 ? 245 THR B HG23 1  
ATOM 6104   N N    . VAL B 2 246 ? 11.335  12.953  8.405   1.00 0.00 ? 246 VAL B N    1  
ATOM 6105   C CA   . VAL B 2 246 ? 10.565  14.036  8.996   1.00 0.00 ? 246 VAL B CA   1  
ATOM 6106   C C    . VAL B 2 246 ? 11.244  14.545  10.267  1.00 0.00 ? 246 VAL B C    1  
ATOM 6107   O O    . VAL B 2 246 ? 11.362  13.828  11.260  1.00 0.00 ? 246 VAL B O    1  
ATOM 6108   C CB   . VAL B 2 246 ? 9.093   13.649  9.281   1.00 0.00 ? 246 VAL B CB   1  
ATOM 6109   C CG1  . VAL B 2 246 ? 8.326   13.469  7.979   1.00 0.00 ? 246 VAL B CG1  1  
ATOM 6110   C CG2  . VAL B 2 246 ? 9.009   12.386  10.120  1.00 0.00 ? 246 VAL B CG2  1  
ATOM 6111   H H    . VAL B 2 246 ? 11.302  12.066  8.817   1.00 0.00 ? 246 VAL B H    1  
ATOM 6112   H HA   . VAL B 2 246 ? 10.553  14.852  8.273   1.00 0.00 ? 246 VAL B HA   1  
ATOM 6113   H HB   . VAL B 2 246 ? 8.631   14.462  9.841   1.00 0.00 ? 246 VAL B HB   1  
ATOM 6114   H HG11 . VAL B 2 246 ? 7.287   13.222  8.194   1.00 0.00 ? 246 VAL B HG11 1  
ATOM 6115   H HG12 . VAL B 2 246 ? 8.367   14.394  7.404   1.00 0.00 ? 246 VAL B HG12 1  
ATOM 6116   H HG13 . VAL B 2 246 ? 8.777   12.662  7.402   1.00 0.00 ? 246 VAL B HG13 1  
ATOM 6117   H HG21 . VAL B 2 246 ? 9.536   12.541  11.061  1.00 0.00 ? 246 VAL B HG21 1  
ATOM 6118   H HG22 . VAL B 2 246 ? 7.966   12.145  10.326  1.00 0.00 ? 246 VAL B HG22 1  
ATOM 6119   H HG23 . VAL B 2 246 ? 9.469   11.560  9.577   1.00 0.00 ? 246 VAL B HG23 1  
ATOM 6120   N N    . SER B 2 247 ? 11.722  15.776  10.218  1.00 0.00 ? 247 SER B N    1  
ATOM 6121   C CA   . SER B 2 247 ? 12.397  16.394  11.352  1.00 0.00 ? 247 SER B CA   1  
ATOM 6122   C C    . SER B 2 247 ? 12.238  17.907  11.258  1.00 0.00 ? 247 SER B C    1  
ATOM 6123   O O    . SER B 2 247 ? 11.628  18.407  10.314  1.00 0.00 ? 247 SER B O    1  
ATOM 6124   C CB   . SER B 2 247 ? 13.882  16.008  11.363  1.00 0.00 ? 247 SER B CB   1  
ATOM 6125   O OG   . SER B 2 247 ? 14.045  14.598  11.407  1.00 0.00 ? 247 SER B OG   1  
ATOM 6126   H H    . SER B 2 247 ? 11.611  16.304  9.394   1.00 0.00 ? 247 SER B H    1  
ATOM 6127   H HA   . SER B 2 247 ? 11.935  16.043  12.275  1.00 0.00 ? 247 SER B HA   1  
ATOM 6128   H HB2  . SER B 2 247 ? 14.356  16.392  10.460  1.00 0.00 ? 247 SER B HB2  1  
ATOM 6129   H HB3  . SER B 2 247 ? 14.358  16.448  12.239  1.00 0.00 ? 247 SER B HB3  1  
ATOM 6130   H HG   . SER B 2 247 ? 13.175  14.182  11.506  1.00 0.00 ? 247 SER B HG   1  
ATOM 6131   N N    . SER B 2 248 ? 12.787  18.635  12.213  1.00 0.00 ? 248 SER B N    1  
ATOM 6132   C CA   . SER B 2 248 ? 12.677  20.082  12.207  1.00 0.00 ? 248 SER B CA   1  
ATOM 6133   C C    . SER B 2 248 ? 13.963  20.711  11.689  1.00 0.00 ? 248 SER B C    1  
ATOM 6134   O O    . SER B 2 248 ? 15.061  20.227  11.970  1.00 0.00 ? 248 SER B O    1  
ATOM 6135   C CB   . SER B 2 248 ? 12.366  20.601  13.616  1.00 0.00 ? 248 SER B CB   1  
ATOM 6136   O OG   . SER B 2 248 ? 12.158  22.004  13.615  1.00 0.00 ? 248 SER B OG   1  
ATOM 6137   H H    . SER B 2 248 ? 13.311  18.203  12.923  1.00 0.00 ? 248 SER B H    1  
ATOM 6138   H HA   . SER B 2 248 ? 11.859  20.362  11.544  1.00 0.00 ? 248 SER B HA   1  
ATOM 6139   H HB2  . SER B 2 248 ? 11.466  20.109  13.985  1.00 0.00 ? 248 SER B HB2  1  
ATOM 6140   H HB3  . SER B 2 248 ? 13.204  20.368  14.274  1.00 0.00 ? 248 SER B HB3  1  
ATOM 6141   H HG   . SER B 2 248 ? 11.327  22.202  14.068  1.00 0.00 ? 248 SER B HG   1  
ATOM 6142   N N    . HIS B 2 249 ? 13.820  21.782  10.920  1.00 0.00 ? 249 HIS B N    1  
ATOM 6143   C CA   . HIS B 2 249 ? 14.968  22.493  10.373  1.00 0.00 ? 249 HIS B CA   1  
ATOM 6144   C C    . HIS B 2 249 ? 15.571  23.405  11.434  1.00 0.00 ? 249 HIS B C    1  
ATOM 6145   O O    . HIS B 2 249 ? 16.621  24.013  11.228  1.00 0.00 ? 249 HIS B O    1  
ATOM 6146   C CB   . HIS B 2 249 ? 14.561  23.313  9.143   1.00 0.00 ? 249 HIS B CB   1  
ATOM 6147   C CG   . HIS B 2 249 ? 14.832  22.631  7.836   1.00 0.00 ? 249 HIS B CG   1  
ATOM 6148   N ND1  . HIS B 2 249 ? 15.510  23.236  6.802   1.00 0.00 ? 249 HIS B ND1  1  
ATOM 6149   C CD2  . HIS B 2 249 ? 14.512  21.388  7.394   1.00 0.00 ? 249 HIS B CD2  1  
ATOM 6150   C CE1  . HIS B 2 249 ? 15.595  22.402  5.785   1.00 0.00 ? 249 HIS B CE1  1  
ATOM 6151   N NE2  . HIS B 2 249 ? 14.999  21.273  6.114   1.00 0.00 ? 249 HIS B NE2  1  
ATOM 6152   H H    . HIS B 2 249 ? 12.913  22.099  10.707  1.00 0.00 ? 249 HIS B H    1  
ATOM 6153   H HA   . HIS B 2 249 ? 15.717  21.760  10.071  1.00 0.00 ? 249 HIS B HA   1  
ATOM 6154   H HB2  . HIS B 2 249 ? 13.493  23.524  9.207   1.00 0.00 ? 249 HIS B HB2  1  
ATOM 6155   H HB3  . HIS B 2 249 ? 15.108  24.255  9.160   1.00 0.00 ? 249 HIS B HB3  1  
ATOM 6156   H HD1  . HIS B 2 249 ? 15.862  24.151  6.805   1.00 0.00 ? 249 HIS B HD1  1  
ATOM 6157   H HD2  . HIS B 2 249 ? 13.974  20.632  7.946   1.00 0.00 ? 249 HIS B HD2  1  
ATOM 6158   H HE1  . HIS B 2 249 ? 16.074  22.609  4.839   1.00 0.00 ? 249 HIS B HE1  1  
ATOM 6159   H HE2  . HIS B 2 249 ? 14.761  20.561  5.478   1.00 0.00 ? 249 HIS B HE2  1  
ATOM 6160   N N    . HIS B 2 250 ? 14.892  23.491  12.573  1.00 0.00 ? 250 HIS B N    1  
ATOM 6161   C CA   . HIS B 2 250 ? 15.344  24.323  13.680  1.00 0.00 ? 250 HIS B CA   1  
ATOM 6162   C C    . HIS B 2 250 ? 16.446  23.619  14.458  1.00 0.00 ? 250 HIS B C    1  
ATOM 6163   O O    . HIS B 2 250 ? 16.201  22.633  15.156  1.00 0.00 ? 250 HIS B O    1  
ATOM 6164   C CB   . HIS B 2 250 ? 14.179  24.678  14.610  1.00 0.00 ? 250 HIS B CB   1  
ATOM 6165   C CG   . HIS B 2 250 ? 13.289  25.759  14.083  1.00 0.00 ? 250 HIS B CG   1  
ATOM 6166   N ND1  . HIS B 2 250 ? 11.980  25.542  13.701  1.00 0.00 ? 250 HIS B ND1  1  
ATOM 6167   C CD2  . HIS B 2 250 ? 13.524  27.077  13.878  1.00 0.00 ? 250 HIS B CD2  1  
ATOM 6168   C CE1  . HIS B 2 250 ? 11.453  26.678  13.284  1.00 0.00 ? 250 HIS B CE1  1  
ATOM 6169   N NE2  . HIS B 2 250 ? 12.368  27.621  13.384  1.00 0.00 ? 250 HIS B NE2  1  
ATOM 6170   H H    . HIS B 2 250 ? 14.072  22.963  12.679  1.00 0.00 ? 250 HIS B H    1  
ATOM 6171   H HA   . HIS B 2 250 ? 15.748  25.247  13.266  1.00 0.00 ? 250 HIS B HA   1  
ATOM 6172   H HB2  . HIS B 2 250 ? 13.578  23.783  14.770  1.00 0.00 ? 250 HIS B HB2  1  
ATOM 6173   H HB3  . HIS B 2 250 ? 14.588  25.003  15.567  1.00 0.00 ? 250 HIS B HB3  1  
ATOM 6174   H HD1  . HIS B 2 250 ? 11.504  24.681  13.734  1.00 0.00 ? 250 HIS B HD1  1  
ATOM 6175   H HD2  . HIS B 2 250 ? 14.449  27.600  14.069  1.00 0.00 ? 250 HIS B HD2  1  
ATOM 6176   H HE1  . HIS B 2 250 ? 10.444  26.812  12.923  1.00 0.00 ? 250 HIS B HE1  1  
ATOM 6177   H HE2  . HIS B 2 250 ? 12.215  28.579  13.214  1.00 0.00 ? 250 HIS B HE2  1  
ATOM 6178   N N    . HIS B 2 251 ? 17.657  24.128  14.332  1.00 0.00 ? 251 HIS B N    1  
ATOM 6179   C CA   . HIS B 2 251 ? 18.801  23.548  15.012  1.00 0.00 ? 251 HIS B CA   1  
ATOM 6180   C C    . HIS B 2 251 ? 19.792  24.633  15.397  1.00 0.00 ? 251 HIS B C    1  
ATOM 6181   O O    . HIS B 2 251 ? 19.815  25.705  14.792  1.00 0.00 ? 251 HIS B O    1  
ATOM 6182   C CB   . HIS B 2 251 ? 19.484  22.486  14.135  1.00 0.00 ? 251 HIS B CB   1  
ATOM 6183   C CG   . HIS B 2 251 ? 20.250  23.037  12.966  1.00 0.00 ? 251 HIS B CG   1  
ATOM 6184   N ND1  . HIS B 2 251 ? 21.590  23.354  13.026  1.00 0.00 ? 251 HIS B ND1  1  
ATOM 6185   C CD2  . HIS B 2 251 ? 19.854  23.331  11.705  1.00 0.00 ? 251 HIS B CD2  1  
ATOM 6186   C CE1  . HIS B 2 251 ? 21.981  23.823  11.856  1.00 0.00 ? 251 HIS B CE1  1  
ATOM 6187   N NE2  . HIS B 2 251 ? 20.949  23.818  11.035  1.00 0.00 ? 251 HIS B NE2  1  
ATOM 6188   H H    . HIS B 2 251 ? 17.783  24.933  13.781  1.00 0.00 ? 251 HIS B H    1  
ATOM 6189   H HA   . HIS B 2 251 ? 18.445  23.065  15.922  1.00 0.00 ? 251 HIS B HA   1  
ATOM 6190   H HB2  . HIS B 2 251 ? 20.175  21.918  14.759  1.00 0.00 ? 251 HIS B HB2  1  
ATOM 6191   H HB3  . HIS B 2 251 ? 18.718  21.811  13.754  1.00 0.00 ? 251 HIS B HB3  1  
ATOM 6192   H HD1  . HIS B 2 251 ? 22.174  23.248  13.815  1.00 0.00 ? 251 HIS B HD1  1  
ATOM 6193   H HD2  . HIS B 2 251 ? 18.861  23.206  11.301  1.00 0.00 ? 251 HIS B HD2  1  
ATOM 6194   H HE1  . HIS B 2 251 ? 22.980  24.154  11.611  1.00 0.00 ? 251 HIS B HE1  1  
ATOM 6195   H HE2  . HIS B 2 251 ? 21.008  23.931  10.061  1.00 0.00 ? 251 HIS B HE2  1  
ATOM 6196   N N    . HIS B 2 252 ? 20.608  24.349  16.395  1.00 0.00 ? 252 HIS B N    1  
ATOM 6197   C CA   . HIS B 2 252 ? 21.610  25.295  16.852  1.00 0.00 ? 252 HIS B CA   1  
ATOM 6198   C C    . HIS B 2 252 ? 22.956  24.916  16.265  1.00 0.00 ? 252 HIS B C    1  
ATOM 6199   O O    . HIS B 2 252 ? 23.052  23.965  15.485  1.00 0.00 ? 252 HIS B O    1  
ATOM 6200   C CB   . HIS B 2 252 ? 21.695  25.292  18.382  1.00 0.00 ? 252 HIS B CB   1  
ATOM 6201   C CG   . HIS B 2 252 ? 20.375  25.461  19.065  1.00 0.00 ? 252 HIS B CG   1  
ATOM 6202   N ND1  . HIS B 2 252 ? 19.704  24.417  19.662  1.00 0.00 ? 252 HIS B ND1  1  
ATOM 6203   C CD2  . HIS B 2 252 ? 19.594  26.553  19.234  1.00 0.00 ? 252 HIS B CD2  1  
ATOM 6204   C CE1  . HIS B 2 252 ? 18.569  24.857  20.166  1.00 0.00 ? 252 HIS B CE1  1  
ATOM 6205   N NE2  . HIS B 2 252 ? 18.476  26.150  19.922  1.00 0.00 ? 252 HIS B NE2  1  
ATOM 6206   H H    . HIS B 2 252 ? 20.546  23.471  16.833  1.00 0.00 ? 252 HIS B H    1  
ATOM 6207   H HA   . HIS B 2 252 ? 21.335  26.294  16.513  1.00 0.00 ? 252 HIS B HA   1  
ATOM 6208   H HB2  . HIS B 2 252 ? 22.131  24.346  18.702  1.00 0.00 ? 252 HIS B HB2  1  
ATOM 6209   H HB3  . HIS B 2 252 ? 22.350  26.106  18.692  1.00 0.00 ? 252 HIS B HB3  1  
ATOM 6210   H HD1  . HIS B 2 252 ? 20.020  23.485  19.713  1.00 0.00 ? 252 HIS B HD1  1  
ATOM 6211   H HD2  . HIS B 2 252 ? 19.810  27.554  18.892  1.00 0.00 ? 252 HIS B HD2  1  
ATOM 6212   H HE1  . HIS B 2 252 ? 17.838  24.260  20.690  1.00 0.00 ? 252 HIS B HE1  1  
ATOM 6213   H HE2  . HIS B 2 252 ? 17.657  26.685  20.034  1.00 0.00 ? 252 HIS B HE2  1  
ATOM 6214   N N    . HIS B 2 253 ? 23.987  25.661  16.620  1.00 0.00 ? 253 HIS B N    1  
ATOM 6215   C CA   . HIS B 2 253 ? 25.321  25.373  16.131  1.00 0.00 ? 253 HIS B CA   1  
ATOM 6216   C C    . HIS B 2 253 ? 26.025  24.392  17.063  1.00 0.00 ? 253 HIS B C    1  
ATOM 6217   O O    . HIS B 2 253 ? 25.950  24.516  18.290  1.00 0.00 ? 253 HIS B O    1  
ATOM 6218   C CB   . HIS B 2 253 ? 26.136  26.660  15.996  1.00 0.00 ? 253 HIS B CB   1  
ATOM 6219   C CG   . HIS B 2 253 ? 27.325  26.529  15.097  1.00 0.00 ? 253 HIS B CG   1  
ATOM 6220   N ND1  . HIS B 2 253 ? 28.471  25.852  15.451  1.00 0.00 ? 253 HIS B ND1  1  
ATOM 6221   C CD2  . HIS B 2 253 ? 27.540  26.993  13.845  1.00 0.00 ? 253 HIS B CD2  1  
ATOM 6222   C CE1  . HIS B 2 253 ? 29.337  25.910  14.459  1.00 0.00 ? 253 HIS B CE1  1  
ATOM 6223   N NE2  . HIS B 2 253 ? 28.798  26.596  13.471  1.00 0.00 ? 253 HIS B NE2  1  
ATOM 6224   H H    . HIS B 2 253 ? 23.848  26.425  17.216  1.00 0.00 ? 253 HIS B H    1  
ATOM 6225   H HA   . HIS B 2 253 ? 25.233  24.915  15.146  1.00 0.00 ? 253 HIS B HA   1  
ATOM 6226   H HB2  . HIS B 2 253 ? 25.487  27.441  15.600  1.00 0.00 ? 253 HIS B HB2  1  
ATOM 6227   H HB3  . HIS B 2 253 ? 26.481  26.956  16.986  1.00 0.00 ? 253 HIS B HB3  1  
ATOM 6228   H HD1  . HIS B 2 253 ? 28.623  25.378  16.308  1.00 0.00 ? 253 HIS B HD1  1  
ATOM 6229   H HD2  . HIS B 2 253 ? 26.847  27.570  13.249  1.00 0.00 ? 253 HIS B HD2  1  
ATOM 6230   H HE1  . HIS B 2 253 ? 30.323  25.469  14.456  1.00 0.00 ? 253 HIS B HE1  1  
ATOM 6231   H HE2  . HIS B 2 253 ? 29.295  26.953  12.702  1.00 0.00 ? 253 HIS B HE2  1  
ATOM 6232   N N    . HIS B 2 254 ? 26.693  23.412  16.475  1.00 0.00 ? 254 HIS B N    1  
ATOM 6233   C CA   . HIS B 2 254 ? 27.419  22.410  17.241  1.00 0.00 ? 254 HIS B CA   1  
ATOM 6234   C C    . HIS B 2 254 ? 28.685  23.027  17.822  1.00 0.00 ? 254 HIS B C    1  
ATOM 6235   O O    . HIS B 2 254 ? 28.997  24.185  17.469  1.00 0.00 ? 254 HIS B O    1  
ATOM 6236   C CB   . HIS B 2 254 ? 27.772  21.212  16.351  1.00 0.00 ? 254 HIS B CB   1  
ATOM 6237   C CG   . HIS B 2 254 ? 28.197  19.988  17.109  1.00 0.00 ? 254 HIS B CG   1  
ATOM 6238   N ND1  . HIS B 2 254 ? 29.432  19.395  16.958  1.00 0.00 ? 254 HIS B ND1  1  
ATOM 6239   C CD2  . HIS B 2 254 ? 27.536  19.241  18.026  1.00 0.00 ? 254 HIS B CD2  1  
ATOM 6240   C CE1  . HIS B 2 254 ? 29.508  18.341  17.748  1.00 0.00 ? 254 HIS B CE1  1  
ATOM 6241   N NE2  . HIS B 2 254 ? 28.373  18.223  18.408  1.00 0.00 ? 254 HIS B NE2  1  
ATOM 6242   O OXT  . HIS B 2 254 ? 29.365  22.359  18.625  1.00 0.00 ? 254 HIS B OXT  1  
ATOM 6243   H H    . HIS B 2 254 ? 26.701  23.359  15.496  1.00 0.00 ? 254 HIS B H    1  
ATOM 6244   H HA   . HIS B 2 254 ? 26.784  22.067  18.058  1.00 0.00 ? 254 HIS B HA   1  
ATOM 6245   H HB2  . HIS B 2 254 ? 26.898  20.959  15.751  1.00 0.00 ? 254 HIS B HB2  1  
ATOM 6246   H HB3  . HIS B 2 254 ? 28.585  21.504  15.686  1.00 0.00 ? 254 HIS B HB3  1  
ATOM 6247   H HD1  . HIS B 2 254 ? 30.148  19.700  16.356  1.00 0.00 ? 254 HIS B HD1  1  
ATOM 6248   H HD2  . HIS B 2 254 ? 26.534  19.414  18.389  1.00 0.00 ? 254 HIS B HD2  1  
ATOM 6249   H HE1  . HIS B 2 254 ? 30.360  17.683  17.839  1.00 0.00 ? 254 HIS B HE1  1  
ATOM 6250   H HE2  . HIS B 2 254 ? 28.092  17.416  18.894  1.00 0.00 ? 254 HIS B HE2  1  
ATOM 6251   N N    . ALA A 1 1   ? -6.150  -21.110 12.620  1.00 0.00 ? 1   ALA A N    2  
ATOM 6252   C CA   . ALA A 1 1   ? -7.560  -21.431 12.307  1.00 0.00 ? 1   ALA A CA   2  
ATOM 6253   C C    . ALA A 1 1   ? -7.672  -22.014 10.905  1.00 0.00 ? 1   ALA A C    2  
ATOM 6254   O O    . ALA A 1 1   ? -7.105  -21.468 9.957   1.00 0.00 ? 1   ALA A O    2  
ATOM 6255   C CB   . ALA A 1 1   ? -8.428  -20.186 12.440  1.00 0.00 ? 1   ALA A CB   2  
ATOM 6256   H H1   . ALA A 1 1   ? -5.545  -21.931 12.418  1.00 0.00 ? 1   ALA A H1   2  
ATOM 6257   H H2   . ALA A 1 1   ? -6.054  -20.863 13.623  1.00 0.00 ? 1   ALA A H2   2  
ATOM 6258   H H3   . ALA A 1 1   ? -5.828  -20.307 12.044  1.00 0.00 ? 1   ALA A H3   2  
ATOM 6259   H HA   . ALA A 1 1   ? -7.909  -22.176 13.022  1.00 0.00 ? 1   ALA A HA   2  
ATOM 6260   H HB1  . ALA A 1 1   ? -8.348  -19.795 13.454  1.00 0.00 ? 1   ALA A HB1  2  
ATOM 6261   H HB2  . ALA A 1 1   ? -8.090  -19.431 11.731  1.00 0.00 ? 1   ALA A HB2  2  
ATOM 6262   H HB3  . ALA A 1 1   ? -9.467  -20.441 12.231  1.00 0.00 ? 1   ALA A HB3  2  
ATOM 6263   N N    . PRO A 1 2   ? -8.384  -23.146 10.759  1.00 0.00 ? 2   PRO A N    2  
ATOM 6264   C CA   . PRO A 1 2   ? -8.572  -23.803 9.462   1.00 0.00 ? 2   PRO A CA   2  
ATOM 6265   C C    . PRO A 1 2   ? -9.509  -23.004 8.563   1.00 0.00 ? 2   PRO A C    2  
ATOM 6266   O O    . PRO A 1 2   ? -9.410  -23.057 7.338   1.00 0.00 ? 2   PRO A O    2  
ATOM 6267   C CB   . PRO A 1 2   ? -9.213  -25.154 9.820   1.00 0.00 ? 2   PRO A CB   2  
ATOM 6268   C CG   . PRO A 1 2   ? -9.065  -25.285 11.301  1.00 0.00 ? 2   PRO A CG   2  
ATOM 6269   C CD   . PRO A 1 2   ? -9.040  -23.888 11.845  1.00 0.00 ? 2   PRO A CD   2  
ATOM 6270   H HA   . PRO A 1 2   ? -7.617  -23.950 8.959   1.00 0.00 ? 2   PRO A HA   2  
ATOM 6271   H HB2  . PRO A 1 2   ? -10.258 -25.197 9.514   1.00 0.00 ? 2   PRO A HB2  2  
ATOM 6272   H HB3  . PRO A 1 2   ? -8.639  -25.949 9.344   1.00 0.00 ? 2   PRO A HB3  2  
ATOM 6273   H HG2  . PRO A 1 2   ? -9.949  -25.790 11.690  1.00 0.00 ? 2   PRO A HG2  2  
ATOM 6274   H HG3  . PRO A 1 2   ? -8.160  -25.831 11.565  1.00 0.00 ? 2   PRO A HG3  2  
ATOM 6275   H HD2  . PRO A 1 2   ? -10.045 -23.519 12.050  1.00 0.00 ? 2   PRO A HD2  2  
ATOM 6276   H HD3  . PRO A 1 2   ? -8.427  -23.841 12.746  1.00 0.00 ? 2   PRO A HD3  2  
ATOM 6277   N N    . VAL A 1 3   ? -10.416 -22.262 9.184   1.00 0.00 ? 3   VAL A N    2  
ATOM 6278   C CA   . VAL A 1 3   ? -11.368 -21.446 8.449   1.00 0.00 ? 3   VAL A CA   2  
ATOM 6279   C C    . VAL A 1 3   ? -10.843 -20.016 8.324   1.00 0.00 ? 3   VAL A C    2  
ATOM 6280   O O    . VAL A 1 3   ? -10.568 -19.348 9.321   1.00 0.00 ? 3   VAL A O    2  
ATOM 6281   C CB   . VAL A 1 3   ? -12.777 -21.466 9.094   1.00 0.00 ? 3   VAL A CB   2  
ATOM 6282   C CG1  . VAL A 1 3   ? -12.723 -21.098 10.571  1.00 0.00 ? 3   VAL A CG1  2  
ATOM 6283   C CG2  . VAL A 1 3   ? -13.744 -20.564 8.338   1.00 0.00 ? 3   VAL A CG2  2  
ATOM 6284   H H    . VAL A 1 3   ? -10.426 -22.241 10.163  1.00 0.00 ? 3   VAL A H    2  
ATOM 6285   H HA   . VAL A 1 3   ? -11.455 -21.864 7.447   1.00 0.00 ? 3   VAL A HA   2  
ATOM 6286   H HB   . VAL A 1 3   ? -13.155 -22.486 9.023   1.00 0.00 ? 3   VAL A HB   2  
ATOM 6287   H HG11 . VAL A 1 3   ? -13.720 -21.154 11.008  1.00 0.00 ? 3   VAL A HG11 2  
ATOM 6288   H HG12 . VAL A 1 3   ? -12.062 -21.791 11.093  1.00 0.00 ? 3   VAL A HG12 2  
ATOM 6289   H HG13 . VAL A 1 3   ? -12.341 -20.082 10.677  1.00 0.00 ? 3   VAL A HG13 2  
ATOM 6290   H HG21 . VAL A 1 3   ? -13.799 -20.884 7.298   1.00 0.00 ? 3   VAL A HG21 2  
ATOM 6291   H HG22 . VAL A 1 3   ? -14.736 -20.622 8.786   1.00 0.00 ? 3   VAL A HG22 2  
ATOM 6292   H HG23 . VAL A 1 3   ? -13.388 -19.535 8.384   1.00 0.00 ? 3   VAL A HG23 2  
ATOM 6293   N N    . ARG A 1 4   ? -10.677 -19.569 7.091   1.00 0.00 ? 4   ARG A N    2  
ATOM 6294   C CA   . ARG A 1 4   ? -10.177 -18.232 6.834   1.00 0.00 ? 4   ARG A CA   2  
ATOM 6295   C C    . ARG A 1 4   ? -11.321 -17.256 6.586   1.00 0.00 ? 4   ARG A C    2  
ATOM 6296   O O    . ARG A 1 4   ? -12.299 -17.581 5.905   1.00 0.00 ? 4   ARG A O    2  
ATOM 6297   C CB   . ARG A 1 4   ? -9.195  -18.235 5.661   1.00 0.00 ? 4   ARG A CB   2  
ATOM 6298   C CG   . ARG A 1 4   ? -7.801  -18.726 6.027   1.00 0.00 ? 4   ARG A CG   2  
ATOM 6299   C CD   . ARG A 1 4   ? -6.865  -18.695 4.828   1.00 0.00 ? 4   ARG A CD   2  
ATOM 6300   N NE   . ARG A 1 4   ? -7.057  -19.851 3.949   1.00 0.00 ? 4   ARG A NE   2  
ATOM 6301   C CZ   . ARG A 1 4   ? -6.740  -19.867 2.652   1.00 0.00 ? 4   ARG A CZ   2  
ATOM 6302   N NH1  . ARG A 1 4   ? -6.221  -18.786 2.078   1.00 0.00 ? 4   ARG A NH1  2  
ATOM 6303   N NH2  . ARG A 1 4   ? -6.944  -20.967 1.928   1.00 0.00 ? 4   ARG A NH2  2  
ATOM 6304   H H    . ARG A 1 4   ? -10.891 -20.157 6.339   1.00 0.00 ? 4   ARG A H    2  
ATOM 6305   H HA   . ARG A 1 4   ? -9.640  -17.901 7.723   1.00 0.00 ? 4   ARG A HA   2  
ATOM 6306   H HB2  . ARG A 1 4   ? -9.594  -18.884 4.881   1.00 0.00 ? 4   ARG A HB2  2  
ATOM 6307   H HB3  . ARG A 1 4   ? -9.111  -17.218 5.280   1.00 0.00 ? 4   ARG A HB3  2  
ATOM 6308   H HG2  . ARG A 1 4   ? -7.394  -18.085 6.809   1.00 0.00 ? 4   ARG A HG2  2  
ATOM 6309   H HG3  . ARG A 1 4   ? -7.871  -19.749 6.395   1.00 0.00 ? 4   ARG A HG3  2  
ATOM 6310   H HD2  . ARG A 1 4   ? -7.051  -17.785 4.259   1.00 0.00 ? 4   ARG A HD2  2  
ATOM 6311   H HD3  . ARG A 1 4   ? -5.835  -18.691 5.184   1.00 0.00 ? 4   ARG A HD3  2  
ATOM 6312   H HE   . ARG A 1 4   ? -7.437  -20.662 4.355   1.00 0.00 ? 4   ARG A HE   2  
ATOM 6313   H HH11 . ARG A 1 4   ? -6.067  -17.956 2.616   1.00 0.00 ? 4   ARG A HH11 2  
ATOM 6314   H HH12 . ARG A 1 4   ? -5.977  -18.799 1.104   1.00 0.00 ? 4   ARG A HH12 2  
ATOM 6315   H HH21 . ARG A 1 4   ? -7.336  -21.787 2.351   1.00 0.00 ? 4   ARG A HH21 2  
ATOM 6316   H HH22 . ARG A 1 4   ? -6.717  -20.982 0.947   1.00 0.00 ? 4   ARG A HH22 2  
ATOM 6317   N N    . SER A 1 5   ? -11.204 -16.071 7.160   1.00 0.00 ? 5   SER A N    2  
ATOM 6318   C CA   . SER A 1 5   ? -12.213 -15.032 7.015   1.00 0.00 ? 5   SER A CA   2  
ATOM 6319   C C    . SER A 1 5   ? -11.563 -13.663 7.162   1.00 0.00 ? 5   SER A C    2  
ATOM 6320   O O    . SER A 1 5   ? -10.611 -13.508 7.924   1.00 0.00 ? 5   SER A O    2  
ATOM 6321   C CB   . SER A 1 5   ? -13.319 -15.207 8.063   1.00 0.00 ? 5   SER A CB   2  
ATOM 6322   O OG   . SER A 1 5   ? -13.967 -16.459 7.916   1.00 0.00 ? 5   SER A OG   2  
ATOM 6323   H H    . SER A 1 5   ? -10.407 -15.880 7.699   1.00 0.00 ? 5   SER A H    2  
ATOM 6324   H HA   . SER A 1 5   ? -12.654 -15.110 6.021   1.00 0.00 ? 5   SER A HA   2  
ATOM 6325   H HB2  . SER A 1 5   ? -12.879 -15.149 9.058   1.00 0.00 ? 5   SER A HB2  2  
ATOM 6326   H HB3  . SER A 1 5   ? -14.053 -14.410 7.942   1.00 0.00 ? 5   SER A HB3  2  
ATOM 6327   H HG   . SER A 1 5   ? -13.458 -17.012 7.312   1.00 0.00 ? 5   SER A HG   2  
ATOM 6328   N N    . LEU A 1 6   ? -12.069 -12.682 6.433   1.00 0.00 ? 6   LEU A N    2  
ATOM 6329   C CA   . LEU A 1 6   ? -11.522 -11.336 6.488   1.00 0.00 ? 6   LEU A CA   2  
ATOM 6330   C C    . LEU A 1 6   ? -12.633 -10.306 6.647   1.00 0.00 ? 6   LEU A C    2  
ATOM 6331   O O    . LEU A 1 6   ? -13.801 -10.608 6.414   1.00 0.00 ? 6   LEU A O    2  
ATOM 6332   C CB   . LEU A 1 6   ? -10.697 -11.046 5.229   1.00 0.00 ? 6   LEU A CB   2  
ATOM 6333   C CG   . LEU A 1 6   ? -11.331 -11.461 3.897   1.00 0.00 ? 6   LEU A CG   2  
ATOM 6334   C CD1  . LEU A 1 6   ? -11.606 -10.245 3.027   1.00 0.00 ? 6   LEU A CD1  2  
ATOM 6335   C CD2  . LEU A 1 6   ? -10.448 -12.461 3.167   1.00 0.00 ? 6   LEU A CD2  2  
ATOM 6336   H H    . LEU A 1 6   ? -12.834 -12.866 5.844   1.00 0.00 ? 6   LEU A H    2  
ATOM 6337   H HA   . LEU A 1 6   ? -10.864 -11.270 7.355   1.00 0.00 ? 6   LEU A HA   2  
ATOM 6338   H HB2  . LEU A 1 6   ? -10.513 -9.973  5.190   1.00 0.00 ? 6   LEU A HB2  2  
ATOM 6339   H HB3  . LEU A 1 6   ? -9.747  -11.574 5.325   1.00 0.00 ? 6   LEU A HB3  2  
ATOM 6340   H HG   . LEU A 1 6   ? -12.283 -11.946 4.112   1.00 0.00 ? 6   LEU A HG   2  
ATOM 6341   H HD11 . LEU A 1 6   ? -12.081 -10.554 2.096   1.00 0.00 ? 6   LEU A HD11 2  
ATOM 6342   H HD12 . LEU A 1 6   ? -12.268 -9.562  3.559   1.00 0.00 ? 6   LEU A HD12 2  
ATOM 6343   H HD13 . LEU A 1 6   ? -10.667 -9.739  2.803   1.00 0.00 ? 6   LEU A HD13 2  
ATOM 6344   H HD21 . LEU A 1 6   ? -10.294 -13.337 3.797   1.00 0.00 ? 6   LEU A HD21 2  
ATOM 6345   H HD22 . LEU A 1 6   ? -10.925 -12.767 2.235   1.00 0.00 ? 6   LEU A HD22 2  
ATOM 6346   H HD23 . LEU A 1 6   ? -9.485  -12.000 2.944   1.00 0.00 ? 6   LEU A HD23 2  
ATOM 6347   N N    . ASN A 1 7   ? -12.264 -9.097  7.044   1.00 0.00 ? 7   ASN A N    2  
ATOM 6348   C CA   . ASN A 1 7   ? -13.231 -8.019  7.224   1.00 0.00 ? 7   ASN A CA   2  
ATOM 6349   C C    . ASN A 1 7   ? -13.035 -6.985  6.129   1.00 0.00 ? 7   ASN A C    2  
ATOM 6350   O O    . ASN A 1 7   ? -11.906 -6.575  5.851   1.00 0.00 ? 7   ASN A O    2  
ATOM 6351   C CB   . ASN A 1 7   ? -13.072 -7.364  8.602   1.00 0.00 ? 7   ASN A CB   2  
ATOM 6352   C CG   . ASN A 1 7   ? -14.163 -7.769  9.577   1.00 0.00 ? 7   ASN A CG   2  
ATOM 6353   O OD1  . ASN A 1 7   ? -15.244 -8.196  9.179   1.00 0.00 ? 7   ASN A OD1  2  
ATOM 6354   N ND2  . ASN A 1 7   ? -13.895 -7.624  10.867  1.00 0.00 ? 7   ASN A ND2  2  
ATOM 6355   H H    . ASN A 1 7   ? -11.315 -8.912  7.193   1.00 0.00 ? 7   ASN A H    2  
ATOM 6356   H HA   . ASN A 1 7   ? -14.236 -8.434  7.148   1.00 0.00 ? 7   ASN A HA   2  
ATOM 6357   H HB2  . ASN A 1 7   ? -12.107 -7.653  9.017   1.00 0.00 ? 7   ASN A HB2  2  
ATOM 6358   H HB3  . ASN A 1 7   ? -13.100 -6.281  8.479   1.00 0.00 ? 7   ASN A HB3  2  
ATOM 6359   H HD21 . ASN A 1 7   ? -13.013 -7.265  11.129  1.00 0.00 ? 7   ASN A HD21 2  
ATOM 6360   H HD22 . ASN A 1 7   ? -14.584 -7.878  11.511  1.00 0.00 ? 7   ASN A HD22 2  
ATOM 6361   N N    . CYS A 1 8   ? -14.124 -6.558  5.508   1.00 0.00 ? 8   CYS A N    2  
ATOM 6362   C CA   . CYS A 1 8   ? -14.036 -5.590  4.431   1.00 0.00 ? 8   CYS A CA   2  
ATOM 6363   C C    . CYS A 1 8   ? -15.147 -4.548  4.496   1.00 0.00 ? 8   CYS A C    2  
ATOM 6364   O O    . CYS A 1 8   ? -16.158 -4.733  5.180   1.00 0.00 ? 8   CYS A O    2  
ATOM 6365   C CB   . CYS A 1 8   ? -14.066 -6.312  3.081   1.00 0.00 ? 8   CYS A CB   2  
ATOM 6366   S SG   . CYS A 1 8   ? -15.303 -7.630  2.966   1.00 0.00 ? 8   CYS A SG   2  
ATOM 6367   H H    . CYS A 1 8   ? -15.006 -6.898  5.780   1.00 0.00 ? 8   CYS A H    2  
ATOM 6368   H HA   . CYS A 1 8   ? -13.082 -5.073  4.526   1.00 0.00 ? 8   CYS A HA   2  
ATOM 6369   H HB2  . CYS A 1 8   ? -14.277 -5.572  2.309   1.00 0.00 ? 8   CYS A HB2  2  
ATOM 6370   H HB3  . CYS A 1 8   ? -13.081 -6.747  2.911   1.00 0.00 ? 8   CYS A HB3  2  
ATOM 6371   H HG   . CYS A 1 8   ? -15.621 -8.002  4.199   1.00 0.00 ? 8   CYS A HG   2  
ATOM 6372   N N    . THR A 1 9   ? -14.935 -3.447  3.789   1.00 0.00 ? 9   THR A N    2  
ATOM 6373   C CA   . THR A 1 9   ? -15.900 -2.363  3.722   1.00 0.00 ? 9   THR A CA   2  
ATOM 6374   C C    . THR A 1 9   ? -16.380 -2.208  2.281   1.00 0.00 ? 9   THR A C    2  
ATOM 6375   O O    . THR A 1 9   ? -15.568 -2.105  1.357   1.00 0.00 ? 9   THR A O    2  
ATOM 6376   C CB   . THR A 1 9   ? -15.271 -1.042  4.195   1.00 0.00 ? 9   THR A CB   2  
ATOM 6377   O OG1  . THR A 1 9   ? -13.880 -1.031  3.844   1.00 0.00 ? 9   THR A OG1  2  
ATOM 6378   C CG2  . THR A 1 9   ? -15.407 -0.902  5.702   1.00 0.00 ? 9   THR A CG2  2  
ATOM 6379   H H    . THR A 1 9   ? -14.095 -3.362  3.289   1.00 0.00 ? 9   THR A H    2  
ATOM 6380   H HA   . THR A 1 9   ? -16.748 -2.603  4.363   1.00 0.00 ? 9   THR A HA   2  
ATOM 6381   H HB   . THR A 1 9   ? -15.776 -0.208  3.708   1.00 0.00 ? 9   THR A HB   2  
ATOM 6382   H HG1  . THR A 1 9   ? -13.420 -1.719  4.338   1.00 0.00 ? 9   THR A HG1  2  
ATOM 6383   H HG21 . THR A 1 9   ? -14.900 -1.734  6.191   1.00 0.00 ? 9   THR A HG21 2  
ATOM 6384   H HG22 . THR A 1 9   ? -14.957 0.037   6.026   1.00 0.00 ? 9   THR A HG22 2  
ATOM 6385   H HG23 . THR A 1 9   ? -16.463 -0.909  5.974   1.00 0.00 ? 9   THR A HG23 2  
ATOM 6386   N N    . LEU A 1 10  ? -17.691 -2.201  2.091   1.00 0.00 ? 10  LEU A N    2  
ATOM 6387   C CA   . LEU A 1 10  ? -18.261 -2.098  0.758   1.00 0.00 ? 10  LEU A CA   2  
ATOM 6388   C C    . LEU A 1 10  ? -18.617 -0.666  0.372   1.00 0.00 ? 10  LEU A C    2  
ATOM 6389   O O    . LEU A 1 10  ? -19.429 -0.012  1.029   1.00 0.00 ? 10  LEU A O    2  
ATOM 6390   C CB   . LEU A 1 10  ? -19.481 -3.012  0.615   1.00 0.00 ? 10  LEU A CB   2  
ATOM 6391   C CG   . LEU A 1 10  ? -19.245 -4.504  0.879   1.00 0.00 ? 10  LEU A CG   2  
ATOM 6392   C CD1  . LEU A 1 10  ? -20.514 -5.305  0.624   1.00 0.00 ? 10  LEU A CD1  2  
ATOM 6393   C CD2  . LEU A 1 10  ? -18.099 -5.029  0.026   1.00 0.00 ? 10  LEU A CD2  2  
ATOM 6394   H H    . LEU A 1 10  ? -18.288 -2.262  2.862   1.00 0.00 ? 10  LEU A H    2  
ATOM 6395   H HA   . LEU A 1 10  ? -17.500 -2.446  0.058   1.00 0.00 ? 10  LEU A HA   2  
ATOM 6396   H HB2  . LEU A 1 10  ? -20.239 -2.666  1.318   1.00 0.00 ? 10  LEU A HB2  2  
ATOM 6397   H HB3  . LEU A 1 10  ? -19.856 -2.910  -0.403  1.00 0.00 ? 10  LEU A HB3  2  
ATOM 6398   H HG   . LEU A 1 10  ? -18.971 -4.625  1.927   1.00 0.00 ? 10  LEU A HG   2  
ATOM 6399   H HD11 . LEU A 1 10  ? -20.337 -6.359  0.838   1.00 0.00 ? 10  LEU A HD11 2  
ATOM 6400   H HD12 . LEU A 1 10  ? -21.311 -4.934  1.268   1.00 0.00 ? 10  LEU A HD12 2  
ATOM 6401   H HD13 . LEU A 1 10  ? -20.808 -5.194  -0.420  1.00 0.00 ? 10  LEU A HD13 2  
ATOM 6402   H HD21 . LEU A 1 10  ? -17.194 -4.463  0.248   1.00 0.00 ? 10  LEU A HD21 2  
ATOM 6403   H HD22 . LEU A 1 10  ? -17.927 -6.083  0.243   1.00 0.00 ? 10  LEU A HD22 2  
ATOM 6404   H HD23 . LEU A 1 10  ? -18.350 -4.914  -1.028  1.00 0.00 ? 10  LEU A HD23 2  
ATOM 6405   N N    . ARG A 1 11  ? -17.980 -0.187  -0.689  1.00 0.00 ? 11  ARG A N    2  
ATOM 6406   C CA   . ARG A 1 11  ? -18.230 1.147   -1.223  1.00 0.00 ? 11  ARG A CA   2  
ATOM 6407   C C    . ARG A 1 11  ? -18.546 1.008   -2.705  1.00 0.00 ? 11  ARG A C    2  
ATOM 6408   O O    . ARG A 1 11  ? -17.778 0.381   -3.441  1.00 0.00 ? 11  ARG A O    2  
ATOM 6409   C CB   . ARG A 1 11  ? -16.996 2.046   -1.072  1.00 0.00 ? 11  ARG A CB   2  
ATOM 6410   C CG   . ARG A 1 11  ? -16.600 2.380   0.354   1.00 0.00 ? 11  ARG A CG   2  
ATOM 6411   C CD   . ARG A 1 11  ? -15.492 3.422   0.373   1.00 0.00 ? 11  ARG A CD   2  
ATOM 6412   N NE   . ARG A 1 11  ? -14.314 2.992   -0.387  1.00 0.00 ? 11  ARG A NE   2  
ATOM 6413   C CZ   . ARG A 1 11  ? -13.555 3.808   -1.127  1.00 0.00 ? 11  ARG A CZ   2  
ATOM 6414   N NH1  . ARG A 1 11  ? -13.872 5.091   -1.252  1.00 0.00 ? 11  ARG A NH1  2  
ATOM 6415   N NH2  . ARG A 1 11  ? -12.485 3.333   -1.758  1.00 0.00 ? 11  ARG A NH2  2  
ATOM 6416   H H    . ARG A 1 11  ? -17.316 -0.754  -1.135  1.00 0.00 ? 11  ARG A H    2  
ATOM 6417   H HA   . ARG A 1 11  ? -19.074 1.596   -0.700  1.00 0.00 ? 11  ARG A HA   2  
ATOM 6418   H HB2  . ARG A 1 11  ? -16.154 1.543   -1.546  1.00 0.00 ? 11  ARG A HB2  2  
ATOM 6419   H HB3  . ARG A 1 11  ? -17.199 2.983   -1.592  1.00 0.00 ? 11  ARG A HB3  2  
ATOM 6420   H HG2  . ARG A 1 11  ? -17.468 2.770   0.884   1.00 0.00 ? 11  ARG A HG2  2  
ATOM 6421   H HG3  . ARG A 1 11  ? -16.249 1.474   0.849   1.00 0.00 ? 11  ARG A HG3  2  
ATOM 6422   H HD2  . ARG A 1 11  ? -15.871 4.348   -0.060  1.00 0.00 ? 11  ARG A HD2  2  
ATOM 6423   H HD3  . ARG A 1 11  ? -15.197 3.605   1.406   1.00 0.00 ? 11  ARG A HD3  2  
ATOM 6424   H HE   . ARG A 1 11  ? -14.070 2.040   -0.332  1.00 0.00 ? 11  ARG A HE   2  
ATOM 6425   H HH11 . ARG A 1 11  ? -14.686 5.459   -0.799  1.00 0.00 ? 11  ARG A HH11 2  
ATOM 6426   H HH12 . ARG A 1 11  ? -13.295 5.702   -1.804  1.00 0.00 ? 11  ARG A HH12 2  
ATOM 6427   H HH21 . ARG A 1 11  ? -12.242 2.357   -1.682  1.00 0.00 ? 11  ARG A HH21 2  
ATOM 6428   H HH22 . ARG A 1 11  ? -11.913 3.943   -2.311  1.00 0.00 ? 11  ARG A HH22 2  
ATOM 6429   N N    . ASP A 1 12  ? -19.667 1.556   -3.141  1.00 0.00 ? 12  ASP A N    2  
ATOM 6430   C CA   . ASP A 1 12  ? -20.043 1.463   -4.548  1.00 0.00 ? 12  ASP A CA   2  
ATOM 6431   C C    . ASP A 1 12  ? -19.320 2.493   -5.411  1.00 0.00 ? 12  ASP A C    2  
ATOM 6432   O O    . ASP A 1 12  ? -18.513 3.285   -4.914  1.00 0.00 ? 12  ASP A O    2  
ATOM 6433   C CB   . ASP A 1 12  ? -21.565 1.480   -4.773  1.00 0.00 ? 12  ASP A CB   2  
ATOM 6434   C CG   . ASP A 1 12  ? -22.268 2.759   -4.354  1.00 0.00 ? 12  ASP A CG   2  
ATOM 6435   O OD1  . ASP A 1 12  ? -21.649 3.842   -4.394  1.00 0.00 ? 12  ASP A OD1  2  
ATOM 6436   O OD2  . ASP A 1 12  ? -23.468 2.683   -4.007  1.00 0.00 ? 12  ASP A OD2  2  
ATOM 6437   H H    . ASP A 1 12  ? -20.252 2.033   -2.512  1.00 0.00 ? 12  ASP A H    2  
ATOM 6438   H HA   . ASP A 1 12  ? -19.698 0.485   -4.882  1.00 0.00 ? 12  ASP A HA   2  
ATOM 6439   H HB2  . ASP A 1 12  ? -21.752 1.324   -5.836  1.00 0.00 ? 12  ASP A HB2  2  
ATOM 6440   H HB3  . ASP A 1 12  ? -22.000 0.655   -4.209  1.00 0.00 ? 12  ASP A HB3  2  
ATOM 6441   H HD2  . ASP A 1 12  ? -23.857 3.526   -3.761  1.00 0.00 ? 12  ASP A HD2  2  
ATOM 6442   N N    . SER A 1 13  ? -19.618 2.483   -6.703  1.00 0.00 ? 13  SER A N    2  
ATOM 6443   C CA   . SER A 1 13  ? -18.992 3.387   -7.657  1.00 0.00 ? 13  SER A CA   2  
ATOM 6444   C C    . SER A 1 13  ? -19.419 4.845   -7.456  1.00 0.00 ? 13  SER A C    2  
ATOM 6445   O O    . SER A 1 13  ? -18.837 5.758   -8.045  1.00 0.00 ? 13  SER A O    2  
ATOM 6446   C CB   . SER A 1 13  ? -19.325 2.922   -9.073  1.00 0.00 ? 13  SER A CB   2  
ATOM 6447   O OG   . SER A 1 13  ? -20.116 1.743   -9.028  1.00 0.00 ? 13  SER A OG   2  
ATOM 6448   H H    . SER A 1 13  ? -20.283 1.838   -7.034  1.00 0.00 ? 13  SER A H    2  
ATOM 6449   H HA   . SER A 1 13  ? -17.912 3.330   -7.517  1.00 0.00 ? 13  SER A HA   2  
ATOM 6450   H HB2  . SER A 1 13  ? -19.878 3.706   -9.589  1.00 0.00 ? 13  SER A HB2  2  
ATOM 6451   H HB3  . SER A 1 13  ? -18.401 2.714   -9.611  1.00 0.00 ? 13  SER A HB3  2  
ATOM 6452   H HG   . SER A 1 13  ? -19.587 0.983   -9.324  1.00 0.00 ? 13  SER A HG   2  
ATOM 6453   N N    . GLN A 1 14  ? -20.431 5.063   -6.621  1.00 0.00 ? 14  GLN A N    2  
ATOM 6454   C CA   . GLN A 1 14  ? -20.919 6.408   -6.354  1.00 0.00 ? 14  GLN A CA   2  
ATOM 6455   C C    . GLN A 1 14  ? -20.414 6.924   -5.013  1.00 0.00 ? 14  GLN A C    2  
ATOM 6456   O O    . GLN A 1 14  ? -20.924 7.914   -4.492  1.00 0.00 ? 14  GLN A O    2  
ATOM 6457   C CB   . GLN A 1 14  ? -22.448 6.455   -6.407  1.00 0.00 ? 14  GLN A CB   2  
ATOM 6458   C CG   . GLN A 1 14  ? -23.004 7.114   -7.661  1.00 0.00 ? 14  GLN A CG   2  
ATOM 6459   C CD   . GLN A 1 14  ? -22.685 8.596   -7.737  1.00 0.00 ? 14  GLN A CD   2  
ATOM 6460   O OE1  . GLN A 1 14  ? -22.597 9.279   -6.719  1.00 0.00 ? 14  GLN A OE1  2  
ATOM 6461   N NE2  . GLN A 1 14  ? -22.507 9.104   -8.945  1.00 0.00 ? 14  GLN A NE2  2  
ATOM 6462   H H    . GLN A 1 14  ? -20.856 4.302   -6.165  1.00 0.00 ? 14  GLN A H    2  
ATOM 6463   H HA   . GLN A 1 14  ? -20.532 7.061   -7.136  1.00 0.00 ? 14  GLN A HA   2  
ATOM 6464   H HB2  . GLN A 1 14  ? -22.824 5.433   -6.362  1.00 0.00 ? 14  GLN A HB2  2  
ATOM 6465   H HB3  . GLN A 1 14  ? -22.804 7.012   -5.540  1.00 0.00 ? 14  GLN A HB3  2  
ATOM 6466   H HG2  . GLN A 1 14  ? -22.578 6.619   -8.534  1.00 0.00 ? 14  GLN A HG2  2  
ATOM 6467   H HG3  . GLN A 1 14  ? -24.087 6.988   -7.670  1.00 0.00 ? 14  GLN A HG3  2  
ATOM 6468   H HE21 . GLN A 1 14  ? -22.590 8.502   -9.720  1.00 0.00 ? 14  GLN A HE21 2  
ATOM 6469   H HE22 . GLN A 1 14  ? -22.303 10.060  -9.024  1.00 0.00 ? 14  GLN A HE22 2  
ATOM 6470   N N    . GLN A 1 15  ? -19.415 6.239   -4.459  1.00 0.00 ? 15  GLN A N    2  
ATOM 6471   C CA   . GLN A 1 15  ? -18.811 6.623   -3.181  1.00 0.00 ? 15  GLN A CA   2  
ATOM 6472   C C    . GLN A 1 15  ? -19.784 6.471   -2.013  1.00 0.00 ? 15  GLN A C    2  
ATOM 6473   O O    . GLN A 1 15  ? -19.699 7.195   -1.016  1.00 0.00 ? 15  GLN A O    2  
ATOM 6474   C CB   . GLN A 1 15  ? -18.239 8.045   -3.233  1.00 0.00 ? 15  GLN A CB   2  
ATOM 6475   C CG   . GLN A 1 15  ? -16.889 8.154   -3.925  1.00 0.00 ? 15  GLN A CG   2  
ATOM 6476   C CD   . GLN A 1 15  ? -15.737 7.685   -3.053  1.00 0.00 ? 15  GLN A CD   2  
ATOM 6477   O OE1  . GLN A 1 15  ? -15.897 6.814   -2.197  1.00 0.00 ? 15  GLN A OE1  2  
ATOM 6478   N NE2  . GLN A 1 15  ? -14.563 8.264   -3.262  1.00 0.00 ? 15  GLN A NE2  2  
ATOM 6479   H H    . GLN A 1 15  ? -19.080 5.439   -4.918  1.00 0.00 ? 15  GLN A H    2  
ATOM 6480   H HA   . GLN A 1 15  ? -17.980 5.941   -3.005  1.00 0.00 ? 15  GLN A HA   2  
ATOM 6481   H HB2  . GLN A 1 15  ? -18.947 8.679   -3.767  1.00 0.00 ? 15  GLN A HB2  2  
ATOM 6482   H HB3  . GLN A 1 15  ? -18.127 8.406   -2.210  1.00 0.00 ? 15  GLN A HB3  2  
ATOM 6483   H HG2  . GLN A 1 15  ? -16.910 7.546   -4.830  1.00 0.00 ? 15  GLN A HG2  2  
ATOM 6484   H HG3  . GLN A 1 15  ? -16.719 9.196   -4.197  1.00 0.00 ? 15  GLN A HG3  2  
ATOM 6485   H HE21 . GLN A 1 15  ? -14.501 8.955   -3.958  1.00 0.00 ? 15  GLN A HE21 2  
ATOM 6486   H HE22 . GLN A 1 15  ? -13.802 7.978   -2.717  1.00 0.00 ? 15  GLN A HE22 2  
ATOM 6487   N N    . LYS A 1 16  ? -20.709 5.532   -2.137  1.00 0.00 ? 16  LYS A N    2  
ATOM 6488   C CA   . LYS A 1 16  ? -21.675 5.286   -1.081  1.00 0.00 ? 16  LYS A CA   2  
ATOM 6489   C C    . LYS A 1 16  ? -21.265 4.064   -0.278  1.00 0.00 ? 16  LYS A C    2  
ATOM 6490   O O    . LYS A 1 16  ? -20.727 3.102   -0.828  1.00 0.00 ? 16  LYS A O    2  
ATOM 6491   C CB   . LYS A 1 16  ? -23.084 5.099   -1.646  1.00 0.00 ? 16  LYS A CB   2  
ATOM 6492   C CG   . LYS A 1 16  ? -23.556 6.230   -2.545  1.00 0.00 ? 16  LYS A CG   2  
ATOM 6493   C CD   . LYS A 1 16  ? -25.075 6.319   -2.583  1.00 0.00 ? 16  LYS A CD   2  
ATOM 6494   C CE   . LYS A 1 16  ? -25.709 5.006   -3.017  1.00 0.00 ? 16  LYS A CE   2  
ATOM 6495   N NZ   . LYS A 1 16  ? -25.241 4.572   -4.359  1.00 0.00 ? 16  LYS A NZ   2  
ATOM 6496   H H    . LYS A 1 16  ? -20.743 4.989   -2.957  1.00 0.00 ? 16  LYS A H    2  
ATOM 6497   H HA   . LYS A 1 16  ? -21.683 6.153   -0.420  1.00 0.00 ? 16  LYS A HA   2  
ATOM 6498   H HB2  . LYS A 1 16  ? -23.099 4.175   -2.225  1.00 0.00 ? 16  LYS A HB2  2  
ATOM 6499   H HB3  . LYS A 1 16  ? -23.778 5.015   -0.810  1.00 0.00 ? 16  LYS A HB3  2  
ATOM 6500   H HG2  . LYS A 1 16  ? -23.157 7.172   -2.168  1.00 0.00 ? 16  LYS A HG2  2  
ATOM 6501   H HG3  . LYS A 1 16  ? -23.186 6.057   -3.555  1.00 0.00 ? 16  LYS A HG3  2  
ATOM 6502   H HD2  . LYS A 1 16  ? -25.439 6.574   -1.588  1.00 0.00 ? 16  LYS A HD2  2  
ATOM 6503   H HD3  . LYS A 1 16  ? -25.365 7.099   -3.287  1.00 0.00 ? 16  LYS A HD3  2  
ATOM 6504   H HE2  . LYS A 1 16  ? -25.456 4.235   -2.290  1.00 0.00 ? 16  LYS A HE2  2  
ATOM 6505   H HE3  . LYS A 1 16  ? -26.792 5.130   -3.045  1.00 0.00 ? 16  LYS A HE3  2  
ATOM 6506   H HZ1  . LYS A 1 16  ? -24.491 3.846   -4.262  1.00 0.00 ? 16  LYS A HZ1  2  
ATOM 6507   H HZ2  . LYS A 1 16  ? -24.860 5.381   -4.886  1.00 0.00 ? 16  LYS A HZ2  2  
ATOM 6508   H HZ3  . LYS A 1 16  ? -26.035 4.164   -4.897  1.00 0.00 ? 16  LYS A HZ3  2  
ATOM 6509   N N    . SER A 1 17  ? -21.512 4.108   1.019   1.00 0.00 ? 17  SER A N    2  
ATOM 6510   C CA   . SER A 1 17  ? -21.170 3.006   1.895   1.00 0.00 ? 17  SER A CA   2  
ATOM 6511   C C    . SER A 1 17  ? -22.428 2.439   2.539   1.00 0.00 ? 17  SER A C    2  
ATOM 6512   O O    . SER A 1 17  ? -23.460 3.112   2.598   1.00 0.00 ? 17  SER A O    2  
ATOM 6513   C CB   . SER A 1 17  ? -20.182 3.473   2.961   1.00 0.00 ? 17  SER A CB   2  
ATOM 6514   O OG   . SER A 1 17  ? -19.124 4.203   2.365   1.00 0.00 ? 17  SER A OG   2  
ATOM 6515   H H    . SER A 1 17  ? -21.965 4.892   1.400   1.00 0.00 ? 17  SER A H    2  
ATOM 6516   H HA   . SER A 1 17  ? -20.698 2.223   1.301   1.00 0.00 ? 17  SER A HA   2  
ATOM 6517   H HB2  . SER A 1 17  ? -20.701 4.112   3.676   1.00 0.00 ? 17  SER A HB2  2  
ATOM 6518   H HB3  . SER A 1 17  ? -19.773 2.606   3.478   1.00 0.00 ? 17  SER A HB3  2  
ATOM 6519   H HG   . SER A 1 17  ? -19.370 4.440   1.465   1.00 0.00 ? 17  SER A HG   2  
ATOM 6520   N N    . LEU A 1 18  ? -22.339 1.206   3.017   1.00 0.00 ? 18  LEU A N    2  
ATOM 6521   C CA   . LEU A 1 18  ? -23.476 0.550   3.643   1.00 0.00 ? 18  LEU A CA   2  
ATOM 6522   C C    . LEU A 1 18  ? -23.484 0.769   5.149   1.00 0.00 ? 18  LEU A C    2  
ATOM 6523   O O    . LEU A 1 18  ? -22.475 0.551   5.824   1.00 0.00 ? 18  LEU A O    2  
ATOM 6524   C CB   . LEU A 1 18  ? -23.477 -0.949  3.330   1.00 0.00 ? 18  LEU A CB   2  
ATOM 6525   C CG   . LEU A 1 18  ? -23.288 -1.341  1.862   1.00 0.00 ? 18  LEU A CG   2  
ATOM 6526   C CD1  . LEU A 1 18  ? -23.385 -2.850  1.695   1.00 0.00 ? 18  LEU A CD1  2  
ATOM 6527   C CD2  . LEU A 1 18  ? -24.300 -0.635  0.973   1.00 0.00 ? 18  LEU A CD2  2  
ATOM 6528   H H    . LEU A 1 18  ? -21.486 0.729   2.953   1.00 0.00 ? 18  LEU A H    2  
ATOM 6529   H HA   . LEU A 1 18  ? -24.385 0.987   3.229   1.00 0.00 ? 18  LEU A HA   2  
ATOM 6530   H HB2  . LEU A 1 18  ? -22.670 -1.407  3.902   1.00 0.00 ? 18  LEU A HB2  2  
ATOM 6531   H HB3  . LEU A 1 18  ? -24.433 -1.356  3.661   1.00 0.00 ? 18  LEU A HB3  2  
ATOM 6532   H HG   . LEU A 1 18  ? -22.290 -1.028  1.553   1.00 0.00 ? 18  LEU A HG   2  
ATOM 6533   H HD11 . LEU A 1 18  ? -23.223 -3.119  0.651   1.00 0.00 ? 18  LEU A HD11 2  
ATOM 6534   H HD12 . LEU A 1 18  ? -22.629 -3.333  2.314   1.00 0.00 ? 18  LEU A HD12 2  
ATOM 6535   H HD13 . LEU A 1 18  ? -24.375 -3.186  2.004   1.00 0.00 ? 18  LEU A HD13 2  
ATOM 6536   H HD21 . LEU A 1 18  ? -24.190 0.443   1.085   1.00 0.00 ? 18  LEU A HD21 2  
ATOM 6537   H HD22 . LEU A 1 18  ? -24.134 -0.908  -0.069  1.00 0.00 ? 18  LEU A HD22 2  
ATOM 6538   H HD23 . LEU A 1 18  ? -25.308 -0.930  1.267   1.00 0.00 ? 18  LEU A HD23 2  
ATOM 6539   N N    . VAL A 1 19  ? -24.621 1.212   5.664   1.00 0.00 ? 19  VAL A N    2  
ATOM 6540   C CA   . VAL A 1 19  ? -24.783 1.456   7.091   1.00 0.00 ? 19  VAL A CA   2  
ATOM 6541   C C    . VAL A 1 19  ? -26.043 0.766   7.610   1.00 0.00 ? 19  VAL A C    2  
ATOM 6542   O O    . VAL A 1 19  ? -27.063 0.710   6.920   1.00 0.00 ? 19  VAL A O    2  
ATOM 6543   C CB   . VAL A 1 19  ? -24.846 2.965   7.423   1.00 0.00 ? 19  VAL A CB   2  
ATOM 6544   C CG1  . VAL A 1 19  ? -23.476 3.608   7.278   1.00 0.00 ? 19  VAL A CG1  2  
ATOM 6545   C CG2  . VAL A 1 19  ? -25.866 3.676   6.545   1.00 0.00 ? 19  VAL A CG2  2  
ATOM 6546   H H    . VAL A 1 19  ? -25.383 1.382   5.061   1.00 0.00 ? 19  VAL A H    2  
ATOM 6547   H HA   . VAL A 1 19  ? -23.919 1.030   7.602   1.00 0.00 ? 19  VAL A HA   2  
ATOM 6548   H HB   . VAL A 1 19  ? -25.161 3.070   8.461   1.00 0.00 ? 19  VAL A HB   2  
ATOM 6549   H HG11 . VAL A 1 19  ? -23.533 4.664   7.541   1.00 0.00 ? 19  VAL A HG11 2  
ATOM 6550   H HG12 . VAL A 1 19  ? -22.769 3.109   7.940   1.00 0.00 ? 19  VAL A HG12 2  
ATOM 6551   H HG13 . VAL A 1 19  ? -23.138 3.511   6.246   1.00 0.00 ? 19  VAL A HG13 2  
ATOM 6552   H HG21 . VAL A 1 19  ? -26.847 3.222   6.691   1.00 0.00 ? 19  VAL A HG21 2  
ATOM 6553   H HG22 . VAL A 1 19  ? -25.913 4.731   6.812   1.00 0.00 ? 19  VAL A HG22 2  
ATOM 6554   H HG23 . VAL A 1 19  ? -25.573 3.580   5.500   1.00 0.00 ? 19  VAL A HG23 2  
ATOM 6555   N N    . MET A 1 20  ? -25.965 0.229   8.819   1.00 0.00 ? 20  MET A N    2  
ATOM 6556   C CA   . MET A 1 20  ? -27.099 -0.461  9.423   1.00 0.00 ? 20  MET A CA   2  
ATOM 6557   C C    . MET A 1 20  ? -28.143 0.542   9.895   1.00 0.00 ? 20  MET A C    2  
ATOM 6558   O O    . MET A 1 20  ? -27.838 1.452   10.666  1.00 0.00 ? 20  MET A O    2  
ATOM 6559   C CB   . MET A 1 20  ? -26.641 -1.331  10.597  1.00 0.00 ? 20  MET A CB   2  
ATOM 6560   C CG   . MET A 1 20  ? -25.902 -2.596  10.192  1.00 0.00 ? 20  MET A CG   2  
ATOM 6561   S SD   . MET A 1 20  ? -26.979 -3.828  9.433   1.00 0.00 ? 20  MET A SD   2  
ATOM 6562   C CE   . MET A 1 20  ? -28.040 -4.255  10.812  1.00 0.00 ? 20  MET A CE   2  
ATOM 6563   H H    . MET A 1 20  ? -25.130 0.305   9.325   1.00 0.00 ? 20  MET A H    2  
ATOM 6564   H HA   . MET A 1 20  ? -27.549 -1.105  8.667   1.00 0.00 ? 20  MET A HA   2  
ATOM 6565   H HB2  . MET A 1 20  ? -25.979 -0.736  11.226  1.00 0.00 ? 20  MET A HB2  2  
ATOM 6566   H HB3  . MET A 1 20  ? -27.522 -1.621  11.170  1.00 0.00 ? 20  MET A HB3  2  
ATOM 6567   H HG2  . MET A 1 20  ? -25.117 -2.332  9.483   1.00 0.00 ? 20  MET A HG2  2  
ATOM 6568   H HG3  . MET A 1 20  ? -25.440 -3.032  11.078  1.00 0.00 ? 20  MET A HG3  2  
ATOM 6569   H HE1  . MET A 1 20  ? -28.569 -3.365  11.152  1.00 0.00 ? 20  MET A HE1  2  
ATOM 6570   H HE2  . MET A 1 20  ? -28.765 -5.009  10.505  1.00 0.00 ? 20  MET A HE2  2  
ATOM 6571   H HE3  . MET A 1 20  ? -27.433 -4.651  11.627  1.00 0.00 ? 20  MET A HE3  2  
ATOM 6572   N N    . SER A 1 21  ? -29.366 0.392   9.412   1.00 0.00 ? 21  SER A N    2  
ATOM 6573   C CA   . SER A 1 21  ? -30.451 1.281   9.794   1.00 0.00 ? 21  SER A CA   2  
ATOM 6574   C C    . SER A 1 21  ? -31.182 0.712   11.006  1.00 0.00 ? 21  SER A C    2  
ATOM 6575   O O    . SER A 1 21  ? -31.109 1.259   12.109  1.00 0.00 ? 21  SER A O    2  
ATOM 6576   C CB   . SER A 1 21  ? -31.418 1.461   8.624   1.00 0.00 ? 21  SER A CB   2  
ATOM 6577   O OG   . SER A 1 21  ? -32.225 2.611   8.794   1.00 0.00 ? 21  SER A OG   2  
ATOM 6578   H H    . SER A 1 21  ? -29.547 -0.338  8.778   1.00 0.00 ? 21  SER A H    2  
ATOM 6579   H HA   . SER A 1 21  ? -30.032 2.253   10.057  1.00 0.00 ? 21  SER A HA   2  
ATOM 6580   H HB2  . SER A 1 21  ? -30.846 1.564   7.702   1.00 0.00 ? 21  SER A HB2  2  
ATOM 6581   H HB3  . SER A 1 21  ? -32.062 0.584   8.556   1.00 0.00 ? 21  SER A HB3  2  
ATOM 6582   H HG   . SER A 1 21  ? -33.157 2.352   8.789   1.00 0.00 ? 21  SER A HG   2  
ATOM 6583   N N    . GLY A 1 22  ? -31.894 -0.383  10.791  1.00 0.00 ? 22  GLY A N    2  
ATOM 6584   C CA   . GLY A 1 22  ? -32.608 -1.022  11.870  1.00 0.00 ? 22  GLY A CA   2  
ATOM 6585   C C    . GLY A 1 22  ? -31.940 -2.317  12.267  1.00 0.00 ? 22  GLY A C    2  
ATOM 6586   O O    . GLY A 1 22  ? -30.764 -2.518  11.962  1.00 0.00 ? 22  GLY A O    2  
ATOM 6587   H H    . GLY A 1 22  ? -31.952 -0.753  9.889   1.00 0.00 ? 22  GLY A H    2  
ATOM 6588   H HA2  . GLY A 1 22  ? -32.630 -0.352  12.730  1.00 0.00 ? 22  GLY A HA2  2  
ATOM 6589   H HA3  . GLY A 1 22  ? -33.629 -1.230  11.549  1.00 0.00 ? 22  GLY A HA3  2  
ATOM 6590   N N    . PRO A 1 23  ? -32.658 -3.221  12.940  1.00 0.00 ? 23  PRO A N    2  
ATOM 6591   C CA   . PRO A 1 23  ? -32.097 -4.504  13.364  1.00 0.00 ? 23  PRO A CA   2  
ATOM 6592   C C    . PRO A 1 23  ? -31.755 -5.408  12.178  1.00 0.00 ? 23  PRO A C    2  
ATOM 6593   O O    . PRO A 1 23  ? -30.795 -6.173  12.229  1.00 0.00 ? 23  PRO A O    2  
ATOM 6594   C CB   . PRO A 1 23  ? -33.216 -5.124  14.208  1.00 0.00 ? 23  PRO A CB   2  
ATOM 6595   C CG   . PRO A 1 23  ? -34.461 -4.457  13.736  1.00 0.00 ? 23  PRO A CG   2  
ATOM 6596   C CD   . PRO A 1 23  ? -34.064 -3.062  13.352  1.00 0.00 ? 23  PRO A CD   2  
ATOM 6597   H HA   . PRO A 1 23  ? -31.203 -4.350  13.967  1.00 0.00 ? 23  PRO A HA   2  
ATOM 6598   H HB2  . PRO A 1 23  ? -33.263 -6.206  14.086  1.00 0.00 ? 23  PRO A HB2  2  
ATOM 6599   H HB3  . PRO A 1 23  ? -33.054 -4.860  15.253  1.00 0.00 ? 23  PRO A HB3  2  
ATOM 6600   H HG2  . PRO A 1 23  ? -34.811 -4.975  12.843  1.00 0.00 ? 23  PRO A HG2  2  
ATOM 6601   H HG3  . PRO A 1 23  ? -35.231 -4.455  14.508  1.00 0.00 ? 23  PRO A HG3  2  
ATOM 6602   H HD2  . PRO A 1 23  ? -34.688 -2.679  12.544  1.00 0.00 ? 23  PRO A HD2  2  
ATOM 6603   H HD3  . PRO A 1 23  ? -34.118 -2.402  14.218  1.00 0.00 ? 23  PRO A HD3  2  
ATOM 6604   N N    . TYR A 1 24  ? -32.538 -5.310  11.105  1.00 0.00 ? 24  TYR A N    2  
ATOM 6605   C CA   . TYR A 1 24  ? -32.307 -6.132  9.923   1.00 0.00 ? 24  TYR A CA   2  
ATOM 6606   C C    . TYR A 1 24  ? -32.433 -5.323  8.633   1.00 0.00 ? 24  TYR A C    2  
ATOM 6607   O O    . TYR A 1 24  ? -33.026 -5.788  7.658   1.00 0.00 ? 24  TYR A O    2  
ATOM 6608   C CB   . TYR A 1 24  ? -33.281 -7.320  9.888   1.00 0.00 ? 24  TYR A CB   2  
ATOM 6609   C CG   . TYR A 1 24  ? -33.295 -8.163  11.145  1.00 0.00 ? 24  TYR A CG   2  
ATOM 6610   C CD1  . TYR A 1 24  ? -32.237 -9.007  11.459  1.00 0.00 ? 24  TYR A CD1  2  
ATOM 6611   C CD2  . TYR A 1 24  ? -34.370 -8.112  12.020  1.00 0.00 ? 24  TYR A CD2  2  
ATOM 6612   C CE1  . TYR A 1 24  ? -32.251 -9.774  12.608  1.00 0.00 ? 24  TYR A CE1  2  
ATOM 6613   C CE2  . TYR A 1 24  ? -34.392 -8.874  13.170  1.00 0.00 ? 24  TYR A CE2  2  
ATOM 6614   C CZ   . TYR A 1 24  ? -33.332 -9.703  13.461  1.00 0.00 ? 24  TYR A CZ   2  
ATOM 6615   O OH   . TYR A 1 24  ? -33.354 -10.460 14.613  1.00 0.00 ? 24  TYR A OH   2  
ATOM 6616   H H    . TYR A 1 24  ? -33.285 -4.676  11.111  1.00 0.00 ? 24  TYR A H    2  
ATOM 6617   H HA   . TYR A 1 24  ? -31.291 -6.522  9.983   1.00 0.00 ? 24  TYR A HA   2  
ATOM 6618   H HB2  . TYR A 1 24  ? -34.287 -6.934  9.723   1.00 0.00 ? 24  TYR A HB2  2  
ATOM 6619   H HB3  . TYR A 1 24  ? -33.010 -7.961  9.049   1.00 0.00 ? 24  TYR A HB3  2  
ATOM 6620   H HD1  . TYR A 1 24  ? -31.388 -9.065  10.793  1.00 0.00 ? 24  TYR A HD1  2  
ATOM 6621   H HD2  . TYR A 1 24  ? -35.206 -7.465  11.797  1.00 0.00 ? 24  TYR A HD2  2  
ATOM 6622   H HE1  . TYR A 1 24  ? -31.420 -10.425 12.837  1.00 0.00 ? 24  TYR A HE1  2  
ATOM 6623   H HE2  . TYR A 1 24  ? -35.237 -8.821  13.839  1.00 0.00 ? 24  TYR A HE2  2  
ATOM 6624   H HH   . TYR A 1 24  ? -32.555 -10.274 15.130  1.00 0.00 ? 24  TYR A HH   2  
ATOM 6625   N N    . GLU A 1 25  ? -31.891 -4.111  8.623   1.00 0.00 ? 25  GLU A N    2  
ATOM 6626   C CA   . GLU A 1 25  ? -31.950 -3.271  7.428   1.00 0.00 ? 25  GLU A CA   2  
ATOM 6627   C C    . GLU A 1 25  ? -30.644 -2.514  7.206   1.00 0.00 ? 25  GLU A C    2  
ATOM 6628   O O    . GLU A 1 25  ? -30.034 -2.016  8.152   1.00 0.00 ? 25  GLU A O    2  
ATOM 6629   C CB   . GLU A 1 25  ? -33.134 -2.301  7.479   1.00 0.00 ? 25  GLU A CB   2  
ATOM 6630   C CG   . GLU A 1 25  ? -33.437 -1.644  6.139   1.00 0.00 ? 25  GLU A CG   2  
ATOM 6631   C CD   . GLU A 1 25  ? -34.669 -0.766  6.171   1.00 0.00 ? 25  GLU A CD   2  
ATOM 6632   O OE1  . GLU A 1 25  ? -35.793 -1.310  6.108   1.00 0.00 ? 25  GLU A OE1  2  
ATOM 6633   O OE2  . GLU A 1 25  ? -34.522 0.468   6.260   1.00 0.00 ? 25  GLU A OE2  2  
ATOM 6634   H H    . GLU A 1 25  ? -31.442 -3.774  9.428   1.00 0.00 ? 25  GLU A H    2  
ATOM 6635   H HA   . GLU A 1 25  ? -32.100 -3.933  6.575   1.00 0.00 ? 25  GLU A HA   2  
ATOM 6636   H HB2  . GLU A 1 25  ? -34.018 -2.851  7.802   1.00 0.00 ? 25  GLU A HB2  2  
ATOM 6637   H HB3  . GLU A 1 25  ? -32.908 -1.518  8.203   1.00 0.00 ? 25  GLU A HB3  2  
ATOM 6638   H HG2  . GLU A 1 25  ? -32.582 -1.033  5.851   1.00 0.00 ? 25  GLU A HG2  2  
ATOM 6639   H HG3  . GLU A 1 25  ? -33.587 -2.426  5.395   1.00 0.00 ? 25  GLU A HG3  2  
ATOM 6640   H HE2  . GLU A 1 25  ? -35.345 0.961   6.274   1.00 0.00 ? 25  GLU A HE2  2  
ATOM 6641   N N    . LEU A 1 26  ? -30.242 -2.417  5.945   1.00 0.00 ? 26  LEU A N    2  
ATOM 6642   C CA   . LEU A 1 26  ? -29.016 -1.729  5.569   1.00 0.00 ? 26  LEU A CA   2  
ATOM 6643   C C    . LEU A 1 26  ? -29.321 -0.642  4.545   1.00 0.00 ? 26  LEU A C    2  
ATOM 6644   O O    . LEU A 1 26  ? -30.111 -0.855  3.624   1.00 0.00 ? 26  LEU A O    2  
ATOM 6645   C CB   . LEU A 1 26  ? -28.014 -2.725  4.976   1.00 0.00 ? 26  LEU A CB   2  
ATOM 6646   C CG   . LEU A 1 26  ? -27.044 -3.388  5.955   1.00 0.00 ? 26  LEU A CG   2  
ATOM 6647   C CD1  . LEU A 1 26  ? -26.606 -4.747  5.430   1.00 0.00 ? 26  LEU A CD1  2  
ATOM 6648   C CD2  . LEU A 1 26  ? -25.833 -2.498  6.185   1.00 0.00 ? 26  LEU A CD2  2  
ATOM 6649   H H    . LEU A 1 26  ? -30.806 -2.800  5.239   1.00 0.00 ? 26  LEU A H    2  
ATOM 6650   H HA   . LEU A 1 26  ? -28.582 -1.273  6.458   1.00 0.00 ? 26  LEU A HA   2  
ATOM 6651   H HB2  . LEU A 1 26  ? -28.583 -3.516  4.488   1.00 0.00 ? 26  LEU A HB2  2  
ATOM 6652   H HB3  . LEU A 1 26  ? -27.421 -2.193  4.232   1.00 0.00 ? 26  LEU A HB3  2  
ATOM 6653   H HG   . LEU A 1 26  ? -27.555 -3.531  6.907   1.00 0.00 ? 26  LEU A HG   2  
ATOM 6654   H HD11 . LEU A 1 26  ? -25.929 -5.217  6.143   1.00 0.00 ? 26  LEU A HD11 2  
ATOM 6655   H HD12 . LEU A 1 26  ? -27.482 -5.381  5.292   1.00 0.00 ? 26  LEU A HD12 2  
ATOM 6656   H HD13 . LEU A 1 26  ? -26.095 -4.620  4.476   1.00 0.00 ? 26  LEU A HD13 2  
ATOM 6657   H HD21 . LEU A 1 26  ? -26.160 -1.537  6.582   1.00 0.00 ? 26  LEU A HD21 2  
ATOM 6658   H HD22 . LEU A 1 26  ? -25.157 -2.972  6.898   1.00 0.00 ? 26  LEU A HD22 2  
ATOM 6659   H HD23 . LEU A 1 26  ? -25.311 -2.343  5.241   1.00 0.00 ? 26  LEU A HD23 2  
ATOM 6660   N N    . LYS A 1 27  ? -28.705 0.517   4.716   1.00 0.00 ? 27  LYS A N    2  
ATOM 6661   C CA   . LYS A 1 27  ? -28.904 1.634   3.801   1.00 0.00 ? 27  LYS A CA   2  
ATOM 6662   C C    . LYS A 1 27  ? -27.581 2.036   3.167   1.00 0.00 ? 27  LYS A C    2  
ATOM 6663   O O    . LYS A 1 27  ? -26.512 1.719   3.692   1.00 0.00 ? 27  LYS A O    2  
ATOM 6664   C CB   . LYS A 1 27  ? -29.478 2.843   4.542   1.00 0.00 ? 27  LYS A CB   2  
ATOM 6665   C CG   . LYS A 1 27  ? -30.836 2.619   5.185   1.00 0.00 ? 27  LYS A CG   2  
ATOM 6666   C CD   . LYS A 1 27  ? -31.367 3.911   5.787   1.00 0.00 ? 27  LYS A CD   2  
ATOM 6667   C CE   . LYS A 1 27  ? -30.408 4.480   6.824   1.00 0.00 ? 27  LYS A CE   2  
ATOM 6668   N NZ   . LYS A 1 27  ? -30.794 5.850   7.250   1.00 0.00 ? 27  LYS A NZ   2  
ATOM 6669   H H    . LYS A 1 27  ? -28.086 0.626   5.476   1.00 0.00 ? 27  LYS A H    2  
ATOM 6670   H HA   . LYS A 1 27  ? -29.600 1.328   3.021   1.00 0.00 ? 27  LYS A HA   2  
ATOM 6671   H HB2  . LYS A 1 27  ? -28.775 3.124   5.326   1.00 0.00 ? 27  LYS A HB2  2  
ATOM 6672   H HB3  . LYS A 1 27  ? -29.573 3.662   3.829   1.00 0.00 ? 27  LYS A HB3  2  
ATOM 6673   H HG2  . LYS A 1 27  ? -31.536 2.264   4.428   1.00 0.00 ? 27  LYS A HG2  2  
ATOM 6674   H HG3  . LYS A 1 27  ? -30.740 1.871   5.971   1.00 0.00 ? 27  LYS A HG3  2  
ATOM 6675   H HD2  . LYS A 1 27  ? -31.503 4.643   4.991   1.00 0.00 ? 27  LYS A HD2  2  
ATOM 6676   H HD3  . LYS A 1 27  ? -32.326 3.710   6.265   1.00 0.00 ? 27  LYS A HD3  2  
ATOM 6677   H HE2  . LYS A 1 27  ? -30.403 3.828   7.697   1.00 0.00 ? 27  LYS A HE2  2  
ATOM 6678   H HE3  . LYS A 1 27  ? -29.405 4.513   6.396   1.00 0.00 ? 27  LYS A HE3  2  
ATOM 6679   H HZ1  . LYS A 1 27  ? -30.099 6.225   7.926   1.00 0.00 ? 27  LYS A HZ1  2  
ATOM 6680   H HZ2  . LYS A 1 27  ? -31.729 5.833   7.705   1.00 0.00 ? 27  LYS A HZ2  2  
ATOM 6681   H HZ3  . LYS A 1 27  ? -30.837 6.487   6.425   1.00 0.00 ? 27  LYS A HZ3  2  
ATOM 6682   N N    . ALA A 1 28  ? -27.655 2.726   2.041   1.00 0.00 ? 28  ALA A N    2  
ATOM 6683   C CA   . ALA A 1 28  ? -26.464 3.184   1.343   1.00 0.00 ? 28  ALA A CA   2  
ATOM 6684   C C    . ALA A 1 28  ? -26.465 4.708   1.229   1.00 0.00 ? 28  ALA A C    2  
ATOM 6685   O O    . ALA A 1 28  ? -27.443 5.302   0.766   1.00 0.00 ? 28  ALA A O    2  
ATOM 6686   C CB   . ALA A 1 28  ? -26.378 2.544   -0.035  1.00 0.00 ? 28  ALA A CB   2  
ATOM 6687   H H    . ALA A 1 28  ? -28.540 2.926   1.660   1.00 0.00 ? 28  ALA A H    2  
ATOM 6688   H HA   . ALA A 1 28  ? -25.591 2.881   1.921   1.00 0.00 ? 28  ALA A HA   2  
ATOM 6689   H HB1  . ALA A 1 28  ? -25.470 2.874   -0.539  1.00 0.00 ? 28  ALA A HB1  2  
ATOM 6690   H HB2  . ALA A 1 28  ? -26.360 1.459   0.070   1.00 0.00 ? 28  ALA A HB2  2  
ATOM 6691   H HB3  . ALA A 1 28  ? -27.246 2.837   -0.625  1.00 0.00 ? 28  ALA A HB3  2  
ATOM 6692   N N    . LEU A 1 29  ? -25.376 5.331   1.658   1.00 0.00 ? 29  LEU A N    2  
ATOM 6693   C CA   . LEU A 1 29  ? -25.250 6.787   1.596   1.00 0.00 ? 29  LEU A CA   2  
ATOM 6694   C C    . LEU A 1 29  ? -23.795 7.206   1.397   1.00 0.00 ? 29  LEU A C    2  
ATOM 6695   O O    . LEU A 1 29  ? -22.877 6.426   1.653   1.00 0.00 ? 29  LEU A O    2  
ATOM 6696   C CB   . LEU A 1 29  ? -25.862 7.454   2.837   1.00 0.00 ? 29  LEU A CB   2  
ATOM 6697   C CG   . LEU A 1 29  ? -25.589 6.785   4.191   1.00 0.00 ? 29  LEU A CG   2  
ATOM 6698   C CD1  . LEU A 1 29  ? -24.233 7.199   4.744   1.00 0.00 ? 29  LEU A CD1  2  
ATOM 6699   C CD2  . LEU A 1 29  ? -26.699 7.108   5.181   1.00 0.00 ? 29  LEU A CD2  2  
ATOM 6700   H H    . LEU A 1 29  ? -24.624 4.812   2.021   1.00 0.00 ? 29  LEU A H    2  
ATOM 6701   H HA   . LEU A 1 29  ? -25.815 7.126   0.728   1.00 0.00 ? 29  LEU A HA   2  
ATOM 6702   H HB2  . LEU A 1 29  ? -25.475 8.471   2.889   1.00 0.00 ? 29  LEU A HB2  2  
ATOM 6703   H HB3  . LEU A 1 29  ? -26.942 7.483   2.696   1.00 0.00 ? 29  LEU A HB3  2  
ATOM 6704   H HG   . LEU A 1 29  ? -25.575 5.706   4.038   1.00 0.00 ? 29  LEU A HG   2  
ATOM 6705   H HD11 . LEU A 1 29  ? -24.048 6.694   5.693   1.00 0.00 ? 29  LEU A HD11 2  
ATOM 6706   H HD12 . LEU A 1 29  ? -23.453 6.926   4.033   1.00 0.00 ? 29  LEU A HD12 2  
ATOM 6707   H HD13 . LEU A 1 29  ? -24.219 8.278   4.901   1.00 0.00 ? 29  LEU A HD13 2  
ATOM 6708   H HD21 . LEU A 1 29  ? -27.653 6.770   4.778   1.00 0.00 ? 29  LEU A HD21 2  
ATOM 6709   H HD22 . LEU A 1 29  ? -26.508 6.604   6.128   1.00 0.00 ? 29  LEU A HD22 2  
ATOM 6710   H HD23 . LEU A 1 29  ? -26.735 8.185   5.346   1.00 0.00 ? 29  LEU A HD23 2  
ATOM 6711   N N    . HIS A 1 30  ? -23.600 8.428   0.913   1.00 0.00 ? 30  HIS A N    2  
ATOM 6712   C CA   . HIS A 1 30  ? -22.262 8.964   0.671   1.00 0.00 ? 30  HIS A CA   2  
ATOM 6713   C C    . HIS A 1 30  ? -21.471 9.097   1.968   1.00 0.00 ? 30  HIS A C    2  
ATOM 6714   O O    . HIS A 1 30  ? -21.971 9.624   2.963   1.00 0.00 ? 30  HIS A O    2  
ATOM 6715   C CB   . HIS A 1 30  ? -22.331 10.318  -0.034  1.00 0.00 ? 30  HIS A CB   2  
ATOM 6716   C CG   . HIS A 1 30  ? -22.445 10.231  -1.525  1.00 0.00 ? 30  HIS A CG   2  
ATOM 6717   N ND1  . HIS A 1 30  ? -23.614 9.905   -2.180  1.00 0.00 ? 30  HIS A ND1  2  
ATOM 6718   C CD2  . HIS A 1 30  ? -21.524 10.444  -2.494  1.00 0.00 ? 30  HIS A CD2  2  
ATOM 6719   C CE1  . HIS A 1 30  ? -23.404 9.920   -3.482  1.00 0.00 ? 30  HIS A CE1  2  
ATOM 6720   N NE2  . HIS A 1 30  ? -22.146 10.245  -3.701  1.00 0.00 ? 30  HIS A NE2  2  
ATOM 6721   H H    . HIS A 1 30  ? -24.389 8.979   0.704   1.00 0.00 ? 30  HIS A H    2  
ATOM 6722   H HA   . HIS A 1 30  ? -21.737 8.265   0.020   1.00 0.00 ? 30  HIS A HA   2  
ATOM 6723   H HB2  . HIS A 1 30  ? -23.196 10.860  0.346   1.00 0.00 ? 30  HIS A HB2  2  
ATOM 6724   H HB3  . HIS A 1 30  ? -21.428 10.879  0.209   1.00 0.00 ? 30  HIS A HB3  2  
ATOM 6725   H HD1  . HIS A 1 30  ? -24.482 9.697   -1.749  1.00 0.00 ? 30  HIS A HD1  2  
ATOM 6726   H HD2  . HIS A 1 30  ? -20.490 10.720  -2.344  1.00 0.00 ? 30  HIS A HD2  2  
ATOM 6727   H HE1  . HIS A 1 30  ? -24.140 9.703   -4.242  1.00 0.00 ? 30  HIS A HE1  2  
ATOM 6728   H HE2  . HIS A 1 30  ? -21.680 10.132  -4.561  1.00 0.00 ? 30  HIS A HE2  2  
ATOM 6729   N N    . LEU A 1 31  ? -20.237 8.617   1.948   1.00 0.00 ? 31  LEU A N    2  
ATOM 6730   C CA   . LEU A 1 31  ? -19.372 8.683   3.116   1.00 0.00 ? 31  LEU A CA   2  
ATOM 6731   C C    . LEU A 1 31  ? -18.344 9.794   2.941   1.00 0.00 ? 31  LEU A C    2  
ATOM 6732   O O    . LEU A 1 31  ? -17.378 9.648   2.191   1.00 0.00 ? 31  LEU A O    2  
ATOM 6733   C CB   . LEU A 1 31  ? -18.670 7.339   3.334   1.00 0.00 ? 31  LEU A CB   2  
ATOM 6734   C CG   . LEU A 1 31  ? -18.011 7.126   4.699   1.00 0.00 ? 31  LEU A CG   2  
ATOM 6735   C CD1  . LEU A 1 31  ? -19.057 7.113   5.804   1.00 0.00 ? 31  LEU A CD1  2  
ATOM 6736   C CD2  . LEU A 1 31  ? -17.210 5.834   4.706   1.00 0.00 ? 31  LEU A CD2  2  
ATOM 6737   H H    . LEU A 1 31  ? -19.894 8.210   1.124   1.00 0.00 ? 31  LEU A H    2  
ATOM 6738   H HA   . LEU A 1 31  ? -19.984 8.904   3.991   1.00 0.00 ? 31  LEU A HA   2  
ATOM 6739   H HB2  . LEU A 1 31  ? -19.411 6.552   3.198   1.00 0.00 ? 31  LEU A HB2  2  
ATOM 6740   H HB3  . LEU A 1 31  ? -17.894 7.244   2.574   1.00 0.00 ? 31  LEU A HB3  2  
ATOM 6741   H HG   . LEU A 1 31  ? -17.327 7.955   4.884   1.00 0.00 ? 31  LEU A HG   2  
ATOM 6742   H HD11 . LEU A 1 31  ? -18.572 6.981   6.771   1.00 0.00 ? 31  LEU A HD11 2  
ATOM 6743   H HD12 . LEU A 1 31  ? -19.601 8.058   5.799   1.00 0.00 ? 31  LEU A HD12 2  
ATOM 6744   H HD13 . LEU A 1 31  ? -19.754 6.293   5.634   1.00 0.00 ? 31  LEU A HD13 2  
ATOM 6745   H HD21 . LEU A 1 31  ? -16.450 5.875   3.926   1.00 0.00 ? 31  LEU A HD21 2  
ATOM 6746   H HD22 . LEU A 1 31  ? -16.728 5.704   5.675   1.00 0.00 ? 31  LEU A HD22 2  
ATOM 6747   H HD23 . LEU A 1 31  ? -17.878 4.993   4.518   1.00 0.00 ? 31  LEU A HD23 2  
ATOM 6748   N N    . GLN A 1 32  ? -18.566 10.911  3.623   1.00 0.00 ? 32  GLN A N    2  
ATOM 6749   C CA   . GLN A 1 32  ? -17.670 12.057  3.533   1.00 0.00 ? 32  GLN A CA   2  
ATOM 6750   C C    . GLN A 1 32  ? -17.406 12.645  4.913   1.00 0.00 ? 32  GLN A C    2  
ATOM 6751   O O    . GLN A 1 32  ? -18.002 12.215  5.904   1.00 0.00 ? 32  GLN A O    2  
ATOM 6752   C CB   . GLN A 1 32  ? -18.270 13.134  2.621   1.00 0.00 ? 32  GLN A CB   2  
ATOM 6753   C CG   . GLN A 1 32  ? -18.517 12.680  1.191   1.00 0.00 ? 32  GLN A CG   2  
ATOM 6754   C CD   . GLN A 1 32  ? -19.325 13.673  0.380   1.00 0.00 ? 32  GLN A CD   2  
ATOM 6755   O OE1  . GLN A 1 32  ? -20.086 13.288  -0.512  1.00 0.00 ? 32  GLN A OE1  2  
ATOM 6756   N NE2  . GLN A 1 32  ? -19.168 14.953  0.674   1.00 0.00 ? 32  GLN A NE2  2  
ATOM 6757   H H    . GLN A 1 32  ? -19.344 10.962  4.216   1.00 0.00 ? 32  GLN A H    2  
ATOM 6758   H HA   . GLN A 1 32  ? -16.725 11.722  3.107   1.00 0.00 ? 32  GLN A HA   2  
ATOM 6759   H HB2  . GLN A 1 32  ? -19.222 13.451  3.047   1.00 0.00 ? 32  GLN A HB2  2  
ATOM 6760   H HB3  . GLN A 1 32  ? -17.583 13.981  2.596   1.00 0.00 ? 32  GLN A HB3  2  
ATOM 6761   H HG2  . GLN A 1 32  ? -17.554 12.533  0.701   1.00 0.00 ? 32  GLN A HG2  2  
ATOM 6762   H HG3  . GLN A 1 32  ? -19.054 11.732  1.216   1.00 0.00 ? 32  GLN A HG3  2  
ATOM 6763   H HE21 . GLN A 1 32  ? -18.544 15.191  1.392   1.00 0.00 ? 32  GLN A HE21 2  
ATOM 6764   H HE22 . GLN A 1 32  ? -19.679 15.613  0.157   1.00 0.00 ? 32  GLN A HE22 2  
ATOM 6765   N N    . GLY A 1 33  ? -16.519 13.629  4.966   1.00 0.00 ? 33  GLY A N    2  
ATOM 6766   C CA   . GLY A 1 33  ? -16.189 14.278  6.220   1.00 0.00 ? 33  GLY A CA   2  
ATOM 6767   C C    . GLY A 1 33  ? -15.301 13.431  7.107   1.00 0.00 ? 33  GLY A C    2  
ATOM 6768   O O    . GLY A 1 33  ? -14.618 12.523  6.634   1.00 0.00 ? 33  GLY A O    2  
ATOM 6769   H H    . GLY A 1 33  ? -16.084 13.927  4.141   1.00 0.00 ? 33  GLY A H    2  
ATOM 6770   H HA2  . GLY A 1 33  ? -15.674 15.214  6.003   1.00 0.00 ? 33  GLY A HA2  2  
ATOM 6771   H HA3  . GLY A 1 33  ? -17.115 14.491  6.755   1.00 0.00 ? 33  GLY A HA3  2  
ATOM 6772   N N    . GLN A 1 34  ? -15.316 13.730  8.400   1.00 0.00 ? 34  GLN A N    2  
ATOM 6773   C CA   . GLN A 1 34  ? -14.511 12.997  9.368   1.00 0.00 ? 34  GLN A CA   2  
ATOM 6774   C C    . GLN A 1 34  ? -15.309 11.835  9.950   1.00 0.00 ? 34  GLN A C    2  
ATOM 6775   O O    . GLN A 1 34  ? -14.787 11.021  10.713  1.00 0.00 ? 34  GLN A O    2  
ATOM 6776   C CB   . GLN A 1 34  ? -14.029 13.928  10.486  1.00 0.00 ? 34  GLN A CB   2  
ATOM 6777   C CG   . GLN A 1 34  ? -12.831 13.413  11.275  1.00 0.00 ? 34  GLN A CG   2  
ATOM 6778   C CD   . GLN A 1 34  ? -11.674 12.993  10.385  1.00 0.00 ? 34  GLN A CD   2  
ATOM 6779   O OE1  . GLN A 1 34  ? -10.848 13.815  9.992   1.00 0.00 ? 34  GLN A OE1  2  
ATOM 6780   N NE2  . GLN A 1 34  ? -11.599 11.707  10.078  1.00 0.00 ? 34  GLN A NE2  2  
ATOM 6781   H H    . GLN A 1 34  ? -15.889 14.466  8.713   1.00 0.00 ? 34  GLN A H    2  
ATOM 6782   H HA   . GLN A 1 34  ? -13.638 12.595  8.853   1.00 0.00 ? 34  GLN A HA   2  
ATOM 6783   H HB2  . GLN A 1 34  ? -13.754 14.883  10.038  1.00 0.00 ? 34  GLN A HB2  2  
ATOM 6784   H HB3  . GLN A 1 34  ? -14.854 14.078  11.182  1.00 0.00 ? 34  GLN A HB3  2  
ATOM 6785   H HG2  . GLN A 1 34  ? -12.487 14.202  11.944  1.00 0.00 ? 34  GLN A HG2  2  
ATOM 6786   H HG3  . GLN A 1 34  ? -13.146 12.553  11.866  1.00 0.00 ? 34  GLN A HG3  2  
ATOM 6787   H HE21 . GLN A 1 34  ? -12.283 11.104  10.440  1.00 0.00 ? 34  GLN A HE21 2  
ATOM 6788   H HE22 . GLN A 1 34  ? -10.867 11.411  9.497   1.00 0.00 ? 34  GLN A HE22 2  
ATOM 6789   N N    . ASP A 1 35  ? -16.578 11.754  9.572   1.00 0.00 ? 35  ASP A N    2  
ATOM 6790   C CA   . ASP A 1 35  ? -17.458 10.688  10.050  1.00 0.00 ? 35  ASP A CA   2  
ATOM 6791   C C    . ASP A 1 35  ? -17.316 9.439   9.188   1.00 0.00 ? 35  ASP A C    2  
ATOM 6792   O O    . ASP A 1 35  ? -18.202 8.590   9.156   1.00 0.00 ? 35  ASP A O    2  
ATOM 6793   C CB   . ASP A 1 35  ? -18.919 11.147  10.078  1.00 0.00 ? 35  ASP A CB   2  
ATOM 6794   C CG   . ASP A 1 35  ? -19.447 11.339  11.487  1.00 0.00 ? 35  ASP A CG   2  
ATOM 6795   O OD1  . ASP A 1 35  ? -19.421 12.487  11.982  1.00 0.00 ? 35  ASP A OD1  2  
ATOM 6796   O OD2  . ASP A 1 35  ? -19.890 10.348  12.110  1.00 0.00 ? 35  ASP A OD2  2  
ATOM 6797   H H    . ASP A 1 35  ? -16.936 12.430  8.953   1.00 0.00 ? 35  ASP A H    2  
ATOM 6798   H HA   . ASP A 1 35  ? -17.159 10.439  11.068  1.00 0.00 ? 35  ASP A HA   2  
ATOM 6799   H HB2  . ASP A 1 35  ? -18.999 12.093  9.543   1.00 0.00 ? 35  ASP A HB2  2  
ATOM 6800   H HB3  . ASP A 1 35  ? -19.530 10.398  9.576   1.00 0.00 ? 35  ASP A HB3  2  
ATOM 6801   H HD2  . ASP A 1 35  ? -20.206 10.546  12.995  1.00 0.00 ? 35  ASP A HD2  2  
ATOM 6802   N N    . MET A 1 36  ? -16.180 9.336   8.503   1.00 0.00 ? 36  MET A N    2  
ATOM 6803   C CA   . MET A 1 36  ? -15.887 8.202   7.629   1.00 0.00 ? 36  MET A CA   2  
ATOM 6804   C C    . MET A 1 36  ? -15.843 6.895   8.421   1.00 0.00 ? 36  MET A C    2  
ATOM 6805   O O    . MET A 1 36  ? -16.153 5.829   7.897   1.00 0.00 ? 36  MET A O    2  
ATOM 6806   C CB   . MET A 1 36  ? -14.544 8.426   6.920   1.00 0.00 ? 36  MET A CB   2  
ATOM 6807   C CG   . MET A 1 36  ? -14.109 7.290   6.003   1.00 0.00 ? 36  MET A CG   2  
ATOM 6808   S SD   . MET A 1 36  ? -12.427 7.490   5.379   1.00 0.00 ? 36  MET A SD   2  
ATOM 6809   C CE   . MET A 1 36  ? -12.599 8.982   4.403   1.00 0.00 ? 36  MET A CE   2  
ATOM 6810   H H    . MET A 1 36  ? -15.520 10.056  8.578   1.00 0.00 ? 36  MET A H    2  
ATOM 6811   H HA   . MET A 1 36  ? -16.675 8.130   6.879   1.00 0.00 ? 36  MET A HA   2  
ATOM 6812   H HB2  . MET A 1 36  ? -14.622 9.334   6.322   1.00 0.00 ? 36  MET A HB2  2  
ATOM 6813   H HB3  . MET A 1 36  ? -13.776 8.558   7.682   1.00 0.00 ? 36  MET A HB3  2  
ATOM 6814   H HG2  . MET A 1 36  ? -14.169 6.351   6.554   1.00 0.00 ? 36  MET A HG2  2  
ATOM 6815   H HG3  . MET A 1 36  ? -14.794 7.241   5.156   1.00 0.00 ? 36  MET A HG3  2  
ATOM 6816   H HE1  . MET A 1 36  ? -12.926 9.799   5.046   1.00 0.00 ? 36  MET A HE1  2  
ATOM 6817   H HE2  . MET A 1 36  ? -11.643 9.242   3.948   1.00 0.00 ? 36  MET A HE2  2  
ATOM 6818   H HE3  . MET A 1 36  ? -13.338 8.818   3.619   1.00 0.00 ? 36  MET A HE3  2  
ATOM 6819   N N    . GLU A 1 37  ? -15.492 6.995   9.696   1.00 0.00 ? 37  GLU A N    2  
ATOM 6820   C CA   . GLU A 1 37  ? -15.389 5.818   10.557  1.00 0.00 ? 37  GLU A CA   2  
ATOM 6821   C C    . GLU A 1 37  ? -16.739 5.362   11.110  1.00 0.00 ? 37  GLU A C    2  
ATOM 6822   O O    . GLU A 1 37  ? -16.802 4.647   12.110  1.00 0.00 ? 37  GLU A O    2  
ATOM 6823   C CB   . GLU A 1 37  ? -14.362 6.028   11.668  1.00 0.00 ? 37  GLU A CB   2  
ATOM 6824   C CG   . GLU A 1 37  ? -12.932 5.822   11.200  1.00 0.00 ? 37  GLU A CG   2  
ATOM 6825   C CD   . GLU A 1 37  ? -12.790 4.585   10.339  1.00 0.00 ? 37  GLU A CD   2  
ATOM 6826   O OE1  . GLU A 1 37  ? -12.568 4.724   9.120   1.00 0.00 ? 37  GLU A OE1  2  
ATOM 6827   O OE2  . GLU A 1 37  ? -12.921 3.468   10.875  1.00 0.00 ? 37  GLU A OE2  2  
ATOM 6828   H H    . GLU A 1 37  ? -15.306 7.878   10.071  1.00 0.00 ? 37  GLU A H    2  
ATOM 6829   H HA   . GLU A 1 37  ? -15.017 5.009   9.929   1.00 0.00 ? 37  GLU A HA   2  
ATOM 6830   H HB2  . GLU A 1 37  ? -14.461 7.046   12.045  1.00 0.00 ? 37  GLU A HB2  2  
ATOM 6831   H HB3  . GLU A 1 37  ? -14.570 5.322   12.472  1.00 0.00 ? 37  GLU A HB3  2  
ATOM 6832   H HG2  . GLU A 1 37  ? -12.621 6.692   10.622  1.00 0.00 ? 37  GLU A HG2  2  
ATOM 6833   H HG3  . GLU A 1 37  ? -12.286 5.722   12.072  1.00 0.00 ? 37  GLU A HG3  2  
ATOM 6834   H HE2  . GLU A 1 37  ? -12.824 2.729   10.270  1.00 0.00 ? 37  GLU A HE2  2  
ATOM 6835   N N    . GLN A 1 38  ? -17.810 5.766   10.442  1.00 0.00 ? 38  GLN A N    2  
ATOM 6836   C CA   . GLN A 1 38  ? -19.157 5.382   10.841  1.00 0.00 ? 38  GLN A CA   2  
ATOM 6837   C C    . GLN A 1 38  ? -19.627 4.216   9.976   1.00 0.00 ? 38  GLN A C    2  
ATOM 6838   O O    . GLN A 1 38  ? -20.771 3.770   10.069  1.00 0.00 ? 38  GLN A O    2  
ATOM 6839   C CB   . GLN A 1 38  ? -20.113 6.565   10.666  1.00 0.00 ? 38  GLN A CB   2  
ATOM 6840   C CG   . GLN A 1 38  ? -20.986 6.846   11.875  1.00 0.00 ? 38  GLN A CG   2  
ATOM 6841   C CD   . GLN A 1 38  ? -22.239 7.615   11.513  1.00 0.00 ? 38  GLN A CD   2  
ATOM 6842   O OE1  . GLN A 1 38  ? -23.281 7.024   11.239  1.00 0.00 ? 38  GLN A OE1  2  
ATOM 6843   N NE2  . GLN A 1 38  ? -22.146 8.934   11.496  1.00 0.00 ? 38  GLN A NE2  2  
ATOM 6844   H H    . GLN A 1 38  ? -17.693 6.344   9.657   1.00 0.00 ? 38  GLN A H    2  
ATOM 6845   H HA   . GLN A 1 38  ? -19.148 5.078   11.888  1.00 0.00 ? 38  GLN A HA   2  
ATOM 6846   H HB2  . GLN A 1 38  ? -19.520 7.455   10.459  1.00 0.00 ? 38  GLN A HB2  2  
ATOM 6847   H HB3  . GLN A 1 38  ? -20.763 6.356   9.817   1.00 0.00 ? 38  GLN A HB3  2  
ATOM 6848   H HG2  . GLN A 1 38  ? -21.274 5.898   12.330  1.00 0.00 ? 38  GLN A HG2  2  
ATOM 6849   H HG3  . GLN A 1 38  ? -20.411 7.430   12.595  1.00 0.00 ? 38  GLN A HG3  2  
ATOM 6850   H HE21 . GLN A 1 38  ? -21.276 9.347   11.716  1.00 0.00 ? 38  GLN A HE21 2  
ATOM 6851   H HE22 . GLN A 1 38  ? -22.946 9.449   11.265  1.00 0.00 ? 38  GLN A HE22 2  
ATOM 6852   N N    . GLN A 1 39  ? -18.720 3.740   9.131   1.00 0.00 ? 39  GLN A N    2  
ATOM 6853   C CA   . GLN A 1 39  ? -18.994 2.641   8.219   1.00 0.00 ? 39  GLN A CA   2  
ATOM 6854   C C    . GLN A 1 39  ? -19.118 1.307   8.951   1.00 0.00 ? 39  GLN A C    2  
ATOM 6855   O O    . GLN A 1 39  ? -18.678 1.165   10.096  1.00 0.00 ? 39  GLN A O    2  
ATOM 6856   C CB   . GLN A 1 39  ? -17.901 2.558   7.149   1.00 0.00 ? 39  GLN A CB   2  
ATOM 6857   C CG   . GLN A 1 39  ? -16.482 2.544   7.706   1.00 0.00 ? 39  GLN A CG   2  
ATOM 6858   C CD   . GLN A 1 39  ? -15.428 2.825   6.649   1.00 0.00 ? 39  GLN A CD   2  
ATOM 6859   O OE1  . GLN A 1 39  ? -15.585 2.463   5.484   1.00 0.00 ? 39  GLN A OE1  2  
ATOM 6860   N NE2  . GLN A 1 39  ? -14.346 3.479   7.048   1.00 0.00 ? 39  GLN A NE2  2  
ATOM 6861   H H    . GLN A 1 39  ? -17.828 4.141   9.127   1.00 0.00 ? 39  GLN A H    2  
ATOM 6862   H HA   . GLN A 1 39  ? -19.944 2.846   7.725   1.00 0.00 ? 39  GLN A HA   2  
ATOM 6863   H HB2  . GLN A 1 39  ? -18.051 1.643   6.576   1.00 0.00 ? 39  GLN A HB2  2  
ATOM 6864   H HB3  . GLN A 1 39  ? -18.001 3.420   6.490   1.00 0.00 ? 39  GLN A HB3  2  
ATOM 6865   H HG2  . GLN A 1 39  ? -16.406 3.303   8.485   1.00 0.00 ? 39  GLN A HG2  2  
ATOM 6866   H HG3  . GLN A 1 39  ? -16.287 1.564   8.141   1.00 0.00 ? 39  GLN A HG3  2  
ATOM 6867   H HE21 . GLN A 1 39  ? -14.281 3.742   7.994   1.00 0.00 ? 39  GLN A HE21 2  
ATOM 6868   H HE22 . GLN A 1 39  ? -13.664 3.689   6.382   1.00 0.00 ? 39  GLN A HE22 2  
ATOM 6869   N N    . VAL A 1 40  ? -19.721 0.339   8.278   1.00 0.00 ? 40  VAL A N    2  
ATOM 6870   C CA   . VAL A 1 40  ? -19.903 -0.994  8.839   1.00 0.00 ? 40  VAL A CA   2  
ATOM 6871   C C    . VAL A 1 40  ? -18.926 -1.957  8.175   1.00 0.00 ? 40  VAL A C    2  
ATOM 6872   O O    . VAL A 1 40  ? -18.650 -1.840  6.979   1.00 0.00 ? 40  VAL A O    2  
ATOM 6873   C CB   . VAL A 1 40  ? -21.346 -1.506  8.638   1.00 0.00 ? 40  VAL A CB   2  
ATOM 6874   C CG1  . VAL A 1 40  ? -21.560 -2.840  9.343   1.00 0.00 ? 40  VAL A CG1  2  
ATOM 6875   C CG2  . VAL A 1 40  ? -22.352 -0.477  9.129   1.00 0.00 ? 40  VAL A CG2  2  
ATOM 6876   H H    . VAL A 1 40  ? -20.037 0.519   7.368   1.00 0.00 ? 40  VAL A H    2  
ATOM 6877   H HA   . VAL A 1 40  ? -19.693 -0.952  9.908   1.00 0.00 ? 40  VAL A HA   2  
ATOM 6878   H HB   . VAL A 1 40  ? -21.506 -1.657  7.571   1.00 0.00 ? 40  VAL A HB   2  
ATOM 6879   H HG11 . VAL A 1 40  ? -22.576 -3.193  9.169   1.00 0.00 ? 40  VAL A HG11 2  
ATOM 6880   H HG12 . VAL A 1 40  ? -20.852 -3.572  8.955   1.00 0.00 ? 40  VAL A HG12 2  
ATOM 6881   H HG13 . VAL A 1 40  ? -21.400 -2.713  10.414  1.00 0.00 ? 40  VAL A HG13 2  
ATOM 6882   H HG21 . VAL A 1 40  ? -22.206 0.458   8.588   1.00 0.00 ? 40  VAL A HG21 2  
ATOM 6883   H HG22 . VAL A 1 40  ? -23.366 -0.839  8.956   1.00 0.00 ? 40  VAL A HG22 2  
ATOM 6884   H HG23 . VAL A 1 40  ? -22.205 -0.307  10.195  1.00 0.00 ? 40  VAL A HG23 2  
ATOM 6885   N N    . VAL A 1 41  ? -18.404 -2.900  8.943   1.00 0.00 ? 41  VAL A N    2  
ATOM 6886   C CA   . VAL A 1 41  ? -17.455 -3.867  8.414   1.00 0.00 ? 41  VAL A CA   2  
ATOM 6887   C C    . VAL A 1 41  ? -18.115 -5.232  8.277   1.00 0.00 ? 41  VAL A C    2  
ATOM 6888   O O    . VAL A 1 41  ? -18.727 -5.736  9.224   1.00 0.00 ? 41  VAL A O    2  
ATOM 6889   C CB   . VAL A 1 41  ? -16.185 -3.976  9.285   1.00 0.00 ? 41  VAL A CB   2  
ATOM 6890   C CG1  . VAL A 1 41  ? -15.235 -2.832  8.973   1.00 0.00 ? 41  VAL A CG1  2  
ATOM 6891   C CG2  . VAL A 1 41  ? -16.540 -3.978  10.764  1.00 0.00 ? 41  VAL A CG2  2  
ATOM 6892   H H    . VAL A 1 41  ? -18.695 -2.987  9.879   1.00 0.00 ? 41  VAL A H    2  
ATOM 6893   H HA   . VAL A 1 41  ? -17.155 -3.528  7.422   1.00 0.00 ? 41  VAL A HA   2  
ATOM 6894   H HB   . VAL A 1 41  ? -15.685 -4.915  9.050   1.00 0.00 ? 41  VAL A HB   2  
ATOM 6895   H HG11 . VAL A 1 41  ? -14.333 -2.928  9.577   1.00 0.00 ? 41  VAL A HG11 2  
ATOM 6896   H HG12 . VAL A 1 41  ? -14.968 -2.860  7.916   1.00 0.00 ? 41  VAL A HG12 2  
ATOM 6897   H HG13 . VAL A 1 41  ? -15.723 -1.884  9.199   1.00 0.00 ? 41  VAL A HG13 2  
ATOM 6898   H HG21 . VAL A 1 41  ? -17.202 -4.817  10.976  1.00 0.00 ? 41  VAL A HG21 2  
ATOM 6899   H HG22 . VAL A 1 41  ? -15.634 -4.072  11.361  1.00 0.00 ? 41  VAL A HG22 2  
ATOM 6900   H HG23 . VAL A 1 41  ? -17.045 -3.045  11.016  1.00 0.00 ? 41  VAL A HG23 2  
ATOM 6901   N N    . PHE A 1 42  ? -18.009 -5.814  7.094   1.00 0.00 ? 42  PHE A N    2  
ATOM 6902   C CA   . PHE A 1 42  ? -18.610 -7.108  6.827   1.00 0.00 ? 42  PHE A CA   2  
ATOM 6903   C C    . PHE A 1 42  ? -17.556 -8.202  6.774   1.00 0.00 ? 42  PHE A C    2  
ATOM 6904   O O    . PHE A 1 42  ? -16.513 -8.052  6.129   1.00 0.00 ? 42  PHE A O    2  
ATOM 6905   C CB   . PHE A 1 42  ? -19.407 -7.065  5.519   1.00 0.00 ? 42  PHE A CB   2  
ATOM 6906   C CG   . PHE A 1 42  ? -20.468 -5.999  5.499   1.00 0.00 ? 42  PHE A CG   2  
ATOM 6907   C CD1  . PHE A 1 42  ? -21.652 -6.168  6.198   1.00 0.00 ? 42  PHE A CD1  2  
ATOM 6908   C CD2  . PHE A 1 42  ? -20.276 -4.827  4.787   1.00 0.00 ? 42  PHE A CD2  2  
ATOM 6909   C CE1  . PHE A 1 42  ? -22.625 -5.185  6.187   1.00 0.00 ? 42  PHE A CE1  2  
ATOM 6910   C CE2  . PHE A 1 42  ? -21.244 -3.842  4.771   1.00 0.00 ? 42  PHE A CE2  2  
ATOM 6911   C CZ   . PHE A 1 42  ? -22.421 -4.022  5.472   1.00 0.00 ? 42  PHE A CZ   2  
ATOM 6912   H H    . PHE A 1 42  ? -17.506 -5.364  6.380   1.00 0.00 ? 42  PHE A H    2  
ATOM 6913   H HA   . PHE A 1 42  ? -19.297 -7.335  7.641   1.00 0.00 ? 42  PHE A HA   2  
ATOM 6914   H HB2  . PHE A 1 42  ? -18.716 -6.884  4.696   1.00 0.00 ? 42  PHE A HB2  2  
ATOM 6915   H HB3  . PHE A 1 42  ? -19.884 -8.034  5.370   1.00 0.00 ? 42  PHE A HB3  2  
ATOM 6916   H HD1  . PHE A 1 42  ? -21.817 -7.077  6.758   1.00 0.00 ? 42  PHE A HD1  2  
ATOM 6917   H HD2  . PHE A 1 42  ? -19.358 -4.681  4.237   1.00 0.00 ? 42  PHE A HD2  2  
ATOM 6918   H HE1  . PHE A 1 42  ? -23.544 -5.328  6.737   1.00 0.00 ? 42  PHE A HE1  2  
ATOM 6919   H HE2  . PHE A 1 42  ? -21.082 -2.932  4.211   1.00 0.00 ? 42  PHE A HE2  2  
ATOM 6920   H HZ   . PHE A 1 42  ? -23.180 -3.254  5.460   1.00 0.00 ? 42  PHE A HZ   2  
ATOM 6921   N N    . SER A 1 43  ? -17.833 -9.296  7.463   1.00 0.00 ? 43  SER A N    2  
ATOM 6922   C CA   . SER A 1 43  ? -16.924 -10.422 7.509   1.00 0.00 ? 43  SER A CA   2  
ATOM 6923   C C    . SER A 1 43  ? -17.190 -11.375 6.350   1.00 0.00 ? 43  SER A C    2  
ATOM 6924   O O    . SER A 1 43  ? -18.319 -11.824 6.145   1.00 0.00 ? 43  SER A O    2  
ATOM 6925   C CB   . SER A 1 43  ? -17.061 -11.145 8.848   1.00 0.00 ? 43  SER A CB   2  
ATOM 6926   O OG   . SER A 1 43  ? -16.896 -10.236 9.926   1.00 0.00 ? 43  SER A OG   2  
ATOM 6927   H H    . SER A 1 43  ? -18.687 -9.353  7.947   1.00 0.00 ? 43  SER A H    2  
ATOM 6928   H HA   . SER A 1 43  ? -15.905 -10.045 7.421   1.00 0.00 ? 43  SER A HA   2  
ATOM 6929   H HB2  . SER A 1 43  ? -18.051 -11.599 8.910   1.00 0.00 ? 43  SER A HB2  2  
ATOM 6930   H HB3  . SER A 1 43  ? -16.300 -11.922 8.915   1.00 0.00 ? 43  SER A HB3  2  
ATOM 6931   H HG   . SER A 1 43  ? -16.436 -9.443  9.608   1.00 0.00 ? 43  SER A HG   2  
ATOM 6932   N N    . MET A 1 44  ? -16.146 -11.664 5.589   1.00 0.00 ? 44  MET A N    2  
ATOM 6933   C CA   . MET A 1 44  ? -16.248 -12.561 4.449   1.00 0.00 ? 44  MET A CA   2  
ATOM 6934   C C    . MET A 1 44  ? -15.628 -13.911 4.785   1.00 0.00 ? 44  MET A C    2  
ATOM 6935   O O    . MET A 1 44  ? -14.410 -14.019 4.944   1.00 0.00 ? 44  MET A O    2  
ATOM 6936   C CB   . MET A 1 44  ? -15.555 -11.951 3.226   1.00 0.00 ? 44  MET A CB   2  
ATOM 6937   C CG   . MET A 1 44  ? -15.631 -12.815 1.976   1.00 0.00 ? 44  MET A CG   2  
ATOM 6938   S SD   . MET A 1 44  ? -14.811 -12.077 0.550   1.00 0.00 ? 44  MET A SD   2  
ATOM 6939   C CE   . MET A 1 44  ? -15.786 -10.590 0.333   1.00 0.00 ? 44  MET A CE   2  
ATOM 6940   H H    . MET A 1 44  ? -15.269 -11.277 5.816   1.00 0.00 ? 44  MET A H    2  
ATOM 6941   H HA   . MET A 1 44  ? -17.303 -12.708 4.217   1.00 0.00 ? 44  MET A HA   2  
ATOM 6942   H HB2  . MET A 1 44  ? -16.025 -10.991 3.008   1.00 0.00 ? 44  MET A HB2  2  
ATOM 6943   H HB3  . MET A 1 44  ? -14.504 -11.794 3.470   1.00 0.00 ? 44  MET A HB3  2  
ATOM 6944   H HG2  . MET A 1 44  ? -15.165 -13.778 2.187   1.00 0.00 ? 44  MET A HG2  2  
ATOM 6945   H HG3  . MET A 1 44  ? -16.680 -12.982 1.728   1.00 0.00 ? 44  MET A HG3  2  
ATOM 6946   H HE1  . MET A 1 44  ? -15.726 -9.982  1.236   1.00 0.00 ? 44  MET A HE1  2  
ATOM 6947   H HE2  . MET A 1 44  ? -15.407 -10.017 -0.513  1.00 0.00 ? 44  MET A HE2  2  
ATOM 6948   H HE3  . MET A 1 44  ? -16.825 -10.862 0.147   1.00 0.00 ? 44  MET A HE3  2  
ATOM 6949   N N    . SER A 1 45  ? -16.468 -14.924 4.911   1.00 0.00 ? 45  SER A N    2  
ATOM 6950   C CA   . SER A 1 45  ? -16.007 -16.265 5.231   1.00 0.00 ? 45  SER A CA   2  
ATOM 6951   C C    . SER A 1 45  ? -15.907 -17.115 3.970   1.00 0.00 ? 45  SER A C    2  
ATOM 6952   O O    . SER A 1 45  ? -16.683 -16.935 3.032   1.00 0.00 ? 45  SER A O    2  
ATOM 6953   C CB   . SER A 1 45  ? -16.976 -16.911 6.223   1.00 0.00 ? 45  SER A CB   2  
ATOM 6954   O OG   . SER A 1 45  ? -17.531 -15.934 7.089   1.00 0.00 ? 45  SER A OG   2  
ATOM 6955   H H    . SER A 1 45  ? -17.430 -14.767 4.792   1.00 0.00 ? 45  SER A H    2  
ATOM 6956   H HA   . SER A 1 45  ? -15.020 -16.197 5.690   1.00 0.00 ? 45  SER A HA   2  
ATOM 6957   H HB2  . SER A 1 45  ? -17.780 -17.398 5.671   1.00 0.00 ? 45  SER A HB2  2  
ATOM 6958   H HB3  . SER A 1 45  ? -16.441 -17.652 6.816   1.00 0.00 ? 45  SER A HB3  2  
ATOM 6959   H HG   . SER A 1 45  ? -16.829 -15.538 7.613   1.00 0.00 ? 45  SER A HG   2  
ATOM 6960   N N    . PHE A 1 46  ? -14.943 -18.027 3.945   1.00 0.00 ? 46  PHE A N    2  
ATOM 6961   C CA   . PHE A 1 46  ? -14.753 -18.904 2.799   1.00 0.00 ? 46  PHE A CA   2  
ATOM 6962   C C    . PHE A 1 46  ? -15.542 -20.193 2.987   1.00 0.00 ? 46  PHE A C    2  
ATOM 6963   O O    . PHE A 1 46  ? -15.287 -20.955 3.921   1.00 0.00 ? 46  PHE A O    2  
ATOM 6964   C CB   . PHE A 1 46  ? -13.271 -19.226 2.597   1.00 0.00 ? 46  PHE A CB   2  
ATOM 6965   C CG   . PHE A 1 46  ? -12.443 -18.061 2.128   1.00 0.00 ? 46  PHE A CG   2  
ATOM 6966   C CD1  . PHE A 1 46  ? -12.939 -17.168 1.192   1.00 0.00 ? 46  PHE A CD1  2  
ATOM 6967   C CD2  . PHE A 1 46  ? -11.166 -17.864 2.621   1.00 0.00 ? 46  PHE A CD2  2  
ATOM 6968   C CE1  . PHE A 1 46  ? -12.176 -16.101 0.757   1.00 0.00 ? 46  PHE A CE1  2  
ATOM 6969   C CE2  . PHE A 1 46  ? -10.397 -16.801 2.191   1.00 0.00 ? 46  PHE A CE2  2  
ATOM 6970   C CZ   . PHE A 1 46  ? -10.902 -15.917 1.257   1.00 0.00 ? 46  PHE A CZ   2  
ATOM 6971   H H    . PHE A 1 46  ? -14.352 -18.119 4.721   1.00 0.00 ? 46  PHE A H    2  
ATOM 6972   H HA   . PHE A 1 46  ? -15.122 -18.393 1.910   1.00 0.00 ? 46  PHE A HA   2  
ATOM 6973   H HB2  . PHE A 1 46  ? -12.863 -19.578 3.545   1.00 0.00 ? 46  PHE A HB2  2  
ATOM 6974   H HB3  . PHE A 1 46  ? -13.189 -20.026 1.862   1.00 0.00 ? 46  PHE A HB3  2  
ATOM 6975   H HD1  . PHE A 1 46  ? -13.934 -17.308 0.797   1.00 0.00 ? 46  PHE A HD1  2  
ATOM 6976   H HD2  . PHE A 1 46  ? -10.765 -18.550 3.352   1.00 0.00 ? 46  PHE A HD2  2  
ATOM 6977   H HE1  . PHE A 1 46  ? -12.576 -15.411 0.028   1.00 0.00 ? 46  PHE A HE1  2  
ATOM 6978   H HE2  . PHE A 1 46  ? -9.401  -16.660 2.585   1.00 0.00 ? 46  PHE A HE2  2  
ATOM 6979   H HZ   . PHE A 1 46  ? -10.303 -15.084 0.920   1.00 0.00 ? 46  PHE A HZ   2  
ATOM 6980   N N    . VAL A 1 47  ? -16.502 -20.431 2.106   1.00 0.00 ? 47  VAL A N    2  
ATOM 6981   C CA   . VAL A 1 47  ? -17.325 -21.627 2.190   1.00 0.00 ? 47  VAL A CA   2  
ATOM 6982   C C    . VAL A 1 47  ? -16.979 -22.618 1.082   1.00 0.00 ? 47  VAL A C    2  
ATOM 6983   O O    . VAL A 1 47  ? -16.312 -22.273 0.107   1.00 0.00 ? 47  VAL A O    2  
ATOM 6984   C CB   . VAL A 1 47  ? -18.837 -21.313 2.173   1.00 0.00 ? 47  VAL A CB   2  
ATOM 6985   C CG1  . VAL A 1 47  ? -19.209 -20.409 3.338   1.00 0.00 ? 47  VAL A CG1  2  
ATOM 6986   C CG2  . VAL A 1 47  ? -19.258 -20.688 0.852   1.00 0.00 ? 47  VAL A CG2  2  
ATOM 6987   H H    . VAL A 1 47  ? -16.651 -19.796 1.371   1.00 0.00 ? 47  VAL A H    2  
ATOM 6988   H HA   . VAL A 1 47  ? -17.099 -22.103 3.145   1.00 0.00 ? 47  VAL A HA   2  
ATOM 6989   H HB   . VAL A 1 47  ? -19.378 -22.253 2.288   1.00 0.00 ? 47  VAL A HB   2  
ATOM 6990   H HG11 . VAL A 1 47  ? -20.282 -20.219 3.331   1.00 0.00 ? 47  VAL A HG11 2  
ATOM 6991   H HG12 . VAL A 1 47  ? -18.934 -20.893 4.275   1.00 0.00 ? 47  VAL A HG12 2  
ATOM 6992   H HG13 . VAL A 1 47  ? -18.674 -19.463 3.247   1.00 0.00 ? 47  VAL A HG13 2  
ATOM 6993   H HG21 . VAL A 1 47  ? -19.014 -21.369 0.036   1.00 0.00 ? 47  VAL A HG21 2  
ATOM 6994   H HG22 . VAL A 1 47  ? -20.331 -20.499 0.854   1.00 0.00 ? 47  VAL A HG22 2  
ATOM 6995   H HG23 . VAL A 1 47  ? -18.726 -19.747 0.711   1.00 0.00 ? 47  VAL A HG23 2  
ATOM 6996   N N    . GLN A 1 48  ? -17.434 -23.850 1.238   1.00 0.00 ? 48  GLN A N    2  
ATOM 6997   C CA   . GLN A 1 48  ? -17.164 -24.885 0.256   1.00 0.00 ? 48  GLN A CA   2  
ATOM 6998   C C    . GLN A 1 48  ? -18.211 -24.879 -0.852  1.00 0.00 ? 48  GLN A C    2  
ATOM 6999   O O    . GLN A 1 48  ? -19.331 -25.355 -0.661  1.00 0.00 ? 48  GLN A O    2  
ATOM 7000   C CB   . GLN A 1 48  ? -17.110 -26.261 0.923   1.00 0.00 ? 48  GLN A CB   2  
ATOM 7001   C CG   . GLN A 1 48  ? -16.302 -27.292 0.150   1.00 0.00 ? 48  GLN A CG   2  
ATOM 7002   C CD   . GLN A 1 48  ? -14.888 -26.820 -0.124  1.00 0.00 ? 48  GLN A CD   2  
ATOM 7003   O OE1  . GLN A 1 48  ? -14.001 -26.965 0.718   1.00 0.00 ? 48  GLN A OE1  2  
ATOM 7004   N NE2  . GLN A 1 48  ? -14.664 -26.266 -1.305  1.00 0.00 ? 48  GLN A NE2  2  
ATOM 7005   H H    . GLN A 1 48  ? -17.967 -24.065 2.032   1.00 0.00 ? 48  GLN A H    2  
ATOM 7006   H HA   . GLN A 1 48  ? -16.191 -24.680 -0.189  1.00 0.00 ? 48  GLN A HA   2  
ATOM 7007   H HB2  . GLN A 1 48  ? -16.662 -26.145 1.910   1.00 0.00 ? 48  GLN A HB2  2  
ATOM 7008   H HB3  . GLN A 1 48  ? -18.129 -26.632 1.026   1.00 0.00 ? 48  GLN A HB3  2  
ATOM 7009   H HG2  . GLN A 1 48  ? -16.260 -28.214 0.730   1.00 0.00 ? 48  GLN A HG2  2  
ATOM 7010   H HG3  . GLN A 1 48  ? -16.798 -27.488 -0.800  1.00 0.00 ? 48  GLN A HG3  2  
ATOM 7011   H HE21 . GLN A 1 48  ? -15.410 -26.195 -1.936  1.00 0.00 ? 48  GLN A HE21 2  
ATOM 7012   H HE22 . GLN A 1 48  ? -13.762 -25.926 -1.494  1.00 0.00 ? 48  GLN A HE22 2  
ATOM 7013   N N    . GLY A 1 49  ? -17.843 -24.329 -1.997  1.00 0.00 ? 49  GLY A N    2  
ATOM 7014   C CA   . GLY A 1 49  ? -18.749 -24.279 -3.123  1.00 0.00 ? 49  GLY A CA   2  
ATOM 7015   C C    . GLY A 1 49  ? -18.009 -24.207 -4.441  1.00 0.00 ? 49  GLY A C    2  
ATOM 7016   O O    . GLY A 1 49  ? -16.944 -24.806 -4.590  1.00 0.00 ? 49  GLY A O    2  
ATOM 7017   H H    . GLY A 1 49  ? -16.949 -23.939 -2.082  1.00 0.00 ? 49  GLY A H    2  
ATOM 7018   H HA2  . GLY A 1 49  ? -19.371 -25.175 -3.115  1.00 0.00 ? 49  GLY A HA2  2  
ATOM 7019   H HA3  . GLY A 1 49  ? -19.385 -23.399 -3.026  1.00 0.00 ? 49  GLY A HA3  2  
ATOM 7020   N N    . GLU A 1 50  ? -18.561 -23.456 -5.385  1.00 0.00 ? 50  GLU A N    2  
ATOM 7021   C CA   . GLU A 1 50  ? -17.960 -23.300 -6.706  1.00 0.00 ? 50  GLU A CA   2  
ATOM 7022   C C    . GLU A 1 50  ? -16.728 -22.397 -6.640  1.00 0.00 ? 50  GLU A C    2  
ATOM 7023   O O    . GLU A 1 50  ? -16.846 -21.172 -6.651  1.00 0.00 ? 50  GLU A O    2  
ATOM 7024   C CB   . GLU A 1 50  ? -18.993 -22.713 -7.676  1.00 0.00 ? 50  GLU A CB   2  
ATOM 7025   C CG   . GLU A 1 50  ? -18.582 -22.756 -9.140  1.00 0.00 ? 50  GLU A CG   2  
ATOM 7026   C CD   . GLU A 1 50  ? -18.426 -24.170 -9.656  1.00 0.00 ? 50  GLU A CD   2  
ATOM 7027   O OE1  . GLU A 1 50  ? -19.382 -24.964 -9.530  1.00 0.00 ? 50  GLU A OE1  2  
ATOM 7028   O OE2  . GLU A 1 50  ? -17.346 -24.498 -10.186 1.00 0.00 ? 50  GLU A OE2  2  
ATOM 7029   H H    . GLU A 1 50  ? -19.398 -22.988 -5.189  1.00 0.00 ? 50  GLU A H    2  
ATOM 7030   H HA   . GLU A 1 50  ? -17.656 -24.282 -7.067  1.00 0.00 ? 50  GLU A HA   2  
ATOM 7031   H HB2  . GLU A 1 50  ? -19.920 -23.275 -7.567  1.00 0.00 ? 50  GLU A HB2  2  
ATOM 7032   H HB3  . GLU A 1 50  ? -19.165 -21.672 -7.402  1.00 0.00 ? 50  GLU A HB3  2  
ATOM 7033   H HG2  . GLU A 1 50  ? -19.343 -22.248 -9.733  1.00 0.00 ? 50  GLU A HG2  2  
ATOM 7034   H HG3  . GLU A 1 50  ? -17.632 -22.234 -9.253  1.00 0.00 ? 50  GLU A HG3  2  
ATOM 7035   H HE2  . GLU A 1 50  ? -17.317 -25.409 -10.489 1.00 0.00 ? 50  GLU A HE2  2  
ATOM 7036   N N    . GLU A 1 51  ? -15.552 -23.010 -6.555  1.00 0.00 ? 51  GLU A N    2  
ATOM 7037   C CA   . GLU A 1 51  ? -14.301 -22.261 -6.492  1.00 0.00 ? 51  GLU A CA   2  
ATOM 7038   C C    . GLU A 1 51  ? -13.662 -22.170 -7.873  1.00 0.00 ? 51  GLU A C    2  
ATOM 7039   O O    . GLU A 1 51  ? -13.757 -23.103 -8.675  1.00 0.00 ? 51  GLU A O    2  
ATOM 7040   C CB   . GLU A 1 51  ? -13.327 -22.917 -5.505  1.00 0.00 ? 51  GLU A CB   2  
ATOM 7041   C CG   . GLU A 1 51  ? -12.233 -21.985 -5.004  1.00 0.00 ? 51  GLU A CG   2  
ATOM 7042   C CD   . GLU A 1 51  ? -10.968 -22.718 -4.600  1.00 0.00 ? 51  GLU A CD   2  
ATOM 7043   O OE1  . GLU A 1 51  ? -9.901  -22.436 -5.184  1.00 0.00 ? 51  GLU A OE1  2  
ATOM 7044   O OE2  . GLU A 1 51  ? -11.035 -23.582 -3.702  1.00 0.00 ? 51  GLU A OE2  2  
ATOM 7045   H H    . GLU A 1 51  ? -15.525 -23.992 -6.533  1.00 0.00 ? 51  GLU A H    2  
ATOM 7046   H HA   . GLU A 1 51  ? -14.522 -21.253 -6.142  1.00 0.00 ? 51  GLU A HA   2  
ATOM 7047   H HB2  . GLU A 1 51  ? -13.895 -23.272 -4.646  1.00 0.00 ? 51  GLU A HB2  2  
ATOM 7048   H HB3  . GLU A 1 51  ? -12.854 -23.764 -6.002  1.00 0.00 ? 51  GLU A HB3  2  
ATOM 7049   H HG2  . GLU A 1 51  ? -11.987 -21.278 -5.797  1.00 0.00 ? 51  GLU A HG2  2  
ATOM 7050   H HG3  . GLU A 1 51  ? -12.610 -21.437 -4.140  1.00 0.00 ? 51  GLU A HG3  2  
ATOM 7051   H HE2  . GLU A 1 51  ? -10.197 -24.005 -3.500  1.00 0.00 ? 51  GLU A HE2  2  
ATOM 7052   N N    . SER A 1 52  ? -13.004 -21.055 -8.150  1.00 0.00 ? 52  SER A N    2  
ATOM 7053   C CA   . SER A 1 52  ? -12.358 -20.855 -9.438  1.00 0.00 ? 52  SER A CA   2  
ATOM 7054   C C    . SER A 1 52  ? -11.199 -19.864 -9.322  1.00 0.00 ? 52  SER A C    2  
ATOM 7055   O O    . SER A 1 52  ? -10.604 -19.719 -8.252  1.00 0.00 ? 52  SER A O    2  
ATOM 7056   C CB   . SER A 1 52  ? -13.380 -20.390 -10.476 1.00 0.00 ? 52  SER A CB   2  
ATOM 7057   O OG   . SER A 1 52  ? -14.099 -19.269 -10.004 1.00 0.00 ? 52  SER A OG   2  
ATOM 7058   H H    . SER A 1 52  ? -12.937 -20.354 -7.468  1.00 0.00 ? 52  SER A H    2  
ATOM 7059   H HA   . SER A 1 52  ? -11.953 -21.813 -9.764  1.00 0.00 ? 52  SER A HA   2  
ATOM 7060   H HB2  . SER A 1 52  ? -12.858 -20.119 -11.395 1.00 0.00 ? 52  SER A HB2  2  
ATOM 7061   H HB3  . SER A 1 52  ? -14.077 -21.202 -10.680 1.00 0.00 ? 52  SER A HB3  2  
ATOM 7062   H HG   . SER A 1 52  ? -14.469 -19.468 -9.132  1.00 0.00 ? 52  SER A HG   2  
ATOM 7063   N N    . ASN A 1 53  ? -10.892 -19.181 -10.418 1.00 0.00 ? 53  ASN A N    2  
ATOM 7064   C CA   . ASN A 1 53  ? -9.802  -18.214 -10.444 1.00 0.00 ? 53  ASN A CA   2  
ATOM 7065   C C    . ASN A 1 53  ? -10.286 -16.819 -10.067 1.00 0.00 ? 53  ASN A C    2  
ATOM 7066   O O    . ASN A 1 53  ? -9.482  -15.922 -9.812  1.00 0.00 ? 53  ASN A O    2  
ATOM 7067   C CB   . ASN A 1 53  ? -9.138  -18.176 -11.825 1.00 0.00 ? 53  ASN A CB   2  
ATOM 7068   C CG   . ASN A 1 53  ? -8.360  -19.437 -12.160 1.00 0.00 ? 53  ASN A CG   2  
ATOM 7069   O OD1  . ASN A 1 53  ? -8.350  -19.880 -13.308 1.00 0.00 ? 53  ASN A OD1  2  
ATOM 7070   N ND2  . ASN A 1 53  ? -7.696  -20.015 -11.172 1.00 0.00 ? 53  ASN A ND2  2  
ATOM 7071   H H    . ASN A 1 53  ? -11.420 -19.325 -11.236 1.00 0.00 ? 53  ASN A H    2  
ATOM 7072   H HA   . ASN A 1 53  ? -9.057  -18.529 -9.712  1.00 0.00 ? 53  ASN A HA   2  
ATOM 7073   H HB2  . ASN A 1 53  ? -9.914  -18.037 -12.577 1.00 0.00 ? 53  ASN A HB2  2  
ATOM 7074   H HB3  . ASN A 1 53  ? -8.452  -17.329 -11.856 1.00 0.00 ? 53  ASN A HB3  2  
ATOM 7075   H HD21 . ASN A 1 53  ? -7.739  -19.609 -10.282 1.00 0.00 ? 53  ASN A HD21 2  
ATOM 7076   H HD22 . ASN A 1 53  ? -7.184  -20.827 -11.374 1.00 0.00 ? 53  ASN A HD22 2  
ATOM 7077   N N    . ASP A 1 54  ? -11.601 -16.639 -10.046 1.00 0.00 ? 54  ASP A N    2  
ATOM 7078   C CA   . ASP A 1 54  ? -12.189 -15.347 -9.697  1.00 0.00 ? 54  ASP A CA   2  
ATOM 7079   C C    . ASP A 1 54  ? -13.494 -15.507 -8.925  1.00 0.00 ? 54  ASP A C    2  
ATOM 7080   O O    . ASP A 1 54  ? -13.747 -14.777 -7.966  1.00 0.00 ? 54  ASP A O    2  
ATOM 7081   C CB   . ASP A 1 54  ? -12.372 -14.449 -10.931 1.00 0.00 ? 54  ASP A CB   2  
ATOM 7082   C CG   . ASP A 1 54  ? -13.691 -14.644 -11.651 1.00 0.00 ? 54  ASP A CG   2  
ATOM 7083   O OD1  . ASP A 1 54  ? -13.850 -15.670 -12.349 1.00 0.00 ? 54  ASP A OD1  2  
ATOM 7084   O OD2  . ASP A 1 54  ? -14.561 -13.754 -11.553 1.00 0.00 ? 54  ASP A OD2  2  
ATOM 7085   H H    . ASP A 1 54  ? -12.190 -17.391 -10.267 1.00 0.00 ? 54  ASP A H    2  
ATOM 7086   H HA   . ASP A 1 54  ? -11.481 -14.847 -9.036  1.00 0.00 ? 54  ASP A HA   2  
ATOM 7087   H HB2  . ASP A 1 54  ? -12.306 -13.409 -10.611 1.00 0.00 ? 54  ASP A HB2  2  
ATOM 7088   H HB3  . ASP A 1 54  ? -11.564 -14.660 -11.632 1.00 0.00 ? 54  ASP A HB3  2  
ATOM 7089   H HD2  . ASP A 1 54  ? -15.367 -13.937 -12.041 1.00 0.00 ? 54  ASP A HD2  2  
ATOM 7090   N N    . LYS A 1 55  ? -14.301 -16.485 -9.315  1.00 0.00 ? 55  LYS A N    2  
ATOM 7091   C CA   . LYS A 1 55  ? -15.569 -16.730 -8.652  1.00 0.00 ? 55  LYS A CA   2  
ATOM 7092   C C    . LYS A 1 55  ? -15.335 -17.577 -7.414  1.00 0.00 ? 55  LYS A C    2  
ATOM 7093   O O    . LYS A 1 55  ? -15.074 -18.778 -7.507  1.00 0.00 ? 55  LYS A O    2  
ATOM 7094   C CB   . LYS A 1 55  ? -16.556 -17.427 -9.591  1.00 0.00 ? 55  LYS A CB   2  
ATOM 7095   C CG   . LYS A 1 55  ? -17.731 -16.564 -10.011 1.00 0.00 ? 55  LYS A CG   2  
ATOM 7096   C CD   . LYS A 1 55  ? -18.857 -17.412 -10.579 1.00 0.00 ? 55  LYS A CD   2  
ATOM 7097   C CE   . LYS A 1 55  ? -20.119 -16.589 -10.772 1.00 0.00 ? 55  LYS A CE   2  
ATOM 7098   N NZ   . LYS A 1 55  ? -21.348 -17.394 -10.550 1.00 0.00 ? 55  LYS A NZ   2  
ATOM 7099   H H    . LYS A 1 55  ? -14.022 -17.085 -10.039 1.00 0.00 ? 55  LYS A H    2  
ATOM 7100   H HA   . LYS A 1 55  ? -15.994 -15.772 -8.351  1.00 0.00 ? 55  LYS A HA   2  
ATOM 7101   H HB2  . LYS A 1 55  ? -16.017 -17.731 -10.488 1.00 0.00 ? 55  LYS A HB2  2  
ATOM 7102   H HB3  . LYS A 1 55  ? -16.945 -18.310 -9.083  1.00 0.00 ? 55  LYS A HB3  2  
ATOM 7103   H HG2  . LYS A 1 55  ? -18.100 -16.018 -9.144  1.00 0.00 ? 55  LYS A HG2  2  
ATOM 7104   H HG3  . LYS A 1 55  ? -17.400 -15.858 -10.772 1.00 0.00 ? 55  LYS A HG3  2  
ATOM 7105   H HD2  . LYS A 1 55  ? -18.546 -17.817 -11.542 1.00 0.00 ? 55  LYS A HD2  2  
ATOM 7106   H HD3  . LYS A 1 55  ? -19.068 -18.230 -9.891  1.00 0.00 ? 55  LYS A HD3  2  
ATOM 7107   H HE2  . LYS A 1 55  ? -20.110 -15.757 -10.067 1.00 0.00 ? 55  LYS A HE2  2  
ATOM 7108   H HE3  . LYS A 1 55  ? -20.133 -16.196 -11.789 1.00 0.00 ? 55  LYS A HE3  2  
ATOM 7109   H HZ1  . LYS A 1 55  ? -21.245 -17.978 -9.691  1.00 0.00 ? 55  LYS A HZ1  2  
ATOM 7110   H HZ2  . LYS A 1 55  ? -21.521 -18.021 -11.361 1.00 0.00 ? 55  LYS A HZ2  2  
ATOM 7111   H HZ3  . LYS A 1 55  ? -22.175 -16.763 -10.430 1.00 0.00 ? 55  LYS A HZ3  2  
ATOM 7112   N N    . ILE A 1 56  ? -15.400 -16.944 -6.257  1.00 0.00 ? 56  ILE A N    2  
ATOM 7113   C CA   . ILE A 1 56  ? -15.179 -17.636 -4.997  1.00 0.00 ? 56  ILE A CA   2  
ATOM 7114   C C    . ILE A 1 56  ? -16.449 -17.632 -4.153  1.00 0.00 ? 56  ILE A C    2  
ATOM 7115   O O    . ILE A 1 56  ? -17.083 -16.589 -3.985  1.00 0.00 ? 56  ILE A O    2  
ATOM 7116   C CB   . ILE A 1 56  ? -14.028 -16.978 -4.193  1.00 0.00 ? 56  ILE A CB   2  
ATOM 7117   C CG1  . ILE A 1 56  ? -12.749 -16.893 -5.037  1.00 0.00 ? 56  ILE A CG1  2  
ATOM 7118   C CG2  . ILE A 1 56  ? -13.763 -17.726 -2.891  1.00 0.00 ? 56  ILE A CG2  2  
ATOM 7119   C CD1  . ILE A 1 56  ? -12.185 -18.237 -5.452  1.00 0.00 ? 56  ILE A CD1  2  
ATOM 7120   H H    . ILE A 1 56  ? -15.602 -15.984 -6.250  1.00 0.00 ? 56  ILE A H    2  
ATOM 7121   H HA   . ILE A 1 56  ? -14.906 -18.668 -5.218  1.00 0.00 ? 56  ILE A HA   2  
ATOM 7122   H HB   . ILE A 1 56  ? -14.333 -15.963 -3.940  1.00 0.00 ? 56  ILE A HB   2  
ATOM 7123   H HG12 . ILE A 1 56  ? -12.972 -16.324 -5.939  1.00 0.00 ? 56  ILE A HG12 2  
ATOM 7124   H HG13 . ILE A 1 56  ? -11.990 -16.370 -4.456  1.00 0.00 ? 56  ILE A HG13 2  
ATOM 7125   H HG21 . ILE A 1 56  ? -12.972 -17.229 -2.330  1.00 0.00 ? 56  ILE A HG21 2  
ATOM 7126   H HG22 . ILE A 1 56  ? -14.674 -17.742 -2.292  1.00 0.00 ? 56  ILE A HG22 2  
ATOM 7127   H HG23 . ILE A 1 56  ? -13.458 -18.748 -3.116  1.00 0.00 ? 56  ILE A HG23 2  
ATOM 7128   H HD11 . ILE A 1 56  ? -12.928 -18.772 -6.043  1.00 0.00 ? 56  ILE A HD11 2  
ATOM 7129   H HD12 . ILE A 1 56  ? -11.281 -18.108 -6.048  1.00 0.00 ? 56  ILE A HD12 2  
ATOM 7130   H HD13 . ILE A 1 56  ? -11.944 -18.817 -4.561  1.00 0.00 ? 56  ILE A HD13 2  
ATOM 7131   N N    . PRO A 1 57  ? -16.851 -18.804 -3.641  1.00 0.00 ? 57  PRO A N    2  
ATOM 7132   C CA   . PRO A 1 57  ? -18.036 -18.928 -2.794  1.00 0.00 ? 57  PRO A CA   2  
ATOM 7133   C C    . PRO A 1 57  ? -17.731 -18.408 -1.394  1.00 0.00 ? 57  PRO A C    2  
ATOM 7134   O O    . PRO A 1 57  ? -16.917 -18.979 -0.666  1.00 0.00 ? 57  PRO A O    2  
ATOM 7135   C CB   . PRO A 1 57  ? -18.294 -20.435 -2.768  1.00 0.00 ? 57  PRO A CB   2  
ATOM 7136   C CG   . PRO A 1 57  ? -16.954 -21.052 -2.980  1.00 0.00 ? 57  PRO A CG   2  
ATOM 7137   C CD   . PRO A 1 57  ? -16.176 -20.099 -3.845  1.00 0.00 ? 57  PRO A CD   2  
ATOM 7138   H HA   . PRO A 1 57  ? -18.888 -18.393 -3.215  1.00 0.00 ? 57  PRO A HA   2  
ATOM 7139   H HB2  . PRO A 1 57  ? -18.744 -20.754 -1.828  1.00 0.00 ? 57  PRO A HB2  2  
ATOM 7140   H HB3  . PRO A 1 57  ? -18.934 -20.696 -3.611  1.00 0.00 ? 57  PRO A HB3  2  
ATOM 7141   H HG2  . PRO A 1 57  ? -16.455 -21.124 -2.014  1.00 0.00 ? 57  PRO A HG2  2  
ATOM 7142   H HG3  . PRO A 1 57  ? -17.037 -22.034 -3.446  1.00 0.00 ? 57  PRO A HG3  2  
ATOM 7143   H HD2  . PRO A 1 57  ? -15.128 -20.062 -3.546  1.00 0.00 ? 57  PRO A HD2  2  
ATOM 7144   H HD3  . PRO A 1 57  ? -16.262 -20.390 -4.892  1.00 0.00 ? 57  PRO A HD3  2  
ATOM 7145   N N    . VAL A 1 58  ? -18.368 -17.313 -1.023  1.00 0.00 ? 58  VAL A N    2  
ATOM 7146   C CA   . VAL A 1 58  ? -18.128 -16.708 0.273   1.00 0.00 ? 58  VAL A CA   2  
ATOM 7147   C C    . VAL A 1 58  ? -19.425 -16.398 1.003   1.00 0.00 ? 58  VAL A C    2  
ATOM 7148   O O    . VAL A 1 58  ? -20.497 -16.339 0.401   1.00 0.00 ? 58  VAL A O    2  
ATOM 7149   C CB   . VAL A 1 58  ? -17.309 -15.404 0.141   1.00 0.00 ? 58  VAL A CB   2  
ATOM 7150   C CG1  . VAL A 1 58  ? -15.911 -15.694 -0.384  1.00 0.00 ? 58  VAL A CG1  2  
ATOM 7151   C CG2  . VAL A 1 58  ? -18.023 -14.406 -0.760  1.00 0.00 ? 58  VAL A CG2  2  
ATOM 7152   H H    . VAL A 1 58  ? -19.029 -16.906 -1.630  1.00 0.00 ? 58  VAL A H    2  
ATOM 7153   H HA   . VAL A 1 58  ? -17.557 -17.419 0.870   1.00 0.00 ? 58  VAL A HA   2  
ATOM 7154   H HB   . VAL A 1 58  ? -17.214 -14.961 1.132   1.00 0.00 ? 58  VAL A HB   2  
ATOM 7155   H HG11 . VAL A 1 58  ? -15.340 -14.768 -0.448  1.00 0.00 ? 58  VAL A HG11 2  
ATOM 7156   H HG12 . VAL A 1 58  ? -15.406 -16.384 0.292   1.00 0.00 ? 58  VAL A HG12 2  
ATOM 7157   H HG13 . VAL A 1 58  ? -15.982 -16.144 -1.375  1.00 0.00 ? 58  VAL A HG13 2  
ATOM 7158   H HG21 . VAL A 1 58  ? -19.008 -14.186 -0.348  1.00 0.00 ? 58  VAL A HG21 2  
ATOM 7159   H HG22 . VAL A 1 58  ? -17.444 -13.484 -0.823  1.00 0.00 ? 58  VAL A HG22 2  
ATOM 7160   H HG23 . VAL A 1 58  ? -18.133 -14.831 -1.757  1.00 0.00 ? 58  VAL A HG23 2  
ATOM 7161   N N    . ALA A 1 59  ? -19.310 -16.217 2.307   1.00 0.00 ? 59  ALA A N    2  
ATOM 7162   C CA   . ALA A 1 59  ? -20.444 -15.878 3.147   1.00 0.00 ? 59  ALA A CA   2  
ATOM 7163   C C    . ALA A 1 59  ? -20.273 -14.448 3.631   1.00 0.00 ? 59  ALA A C    2  
ATOM 7164   O O    . ALA A 1 59  ? -19.145 -13.969 3.759   1.00 0.00 ? 59  ALA A O    2  
ATOM 7165   C CB   . ALA A 1 59  ? -20.535 -16.829 4.329   1.00 0.00 ? 59  ALA A CB   2  
ATOM 7166   H H    . ALA A 1 59  ? -18.423 -16.315 2.721   1.00 0.00 ? 59  ALA A H    2  
ATOM 7167   H HA   . ALA A 1 59  ? -21.360 -15.955 2.561   1.00 0.00 ? 59  ALA A HA   2  
ATOM 7168   H HB1  . ALA A 1 59  ? -21.392 -16.564 4.947   1.00 0.00 ? 59  ALA A HB1  2  
ATOM 7169   H HB2  . ALA A 1 59  ? -20.652 -17.850 3.966   1.00 0.00 ? 59  ALA A HB2  2  
ATOM 7170   H HB3  . ALA A 1 59  ? -19.623 -16.758 4.923   1.00 0.00 ? 59  ALA A HB3  2  
ATOM 7171   N N    . LEU A 1 60  ? -21.377 -13.773 3.904   1.00 0.00 ? 60  LEU A N    2  
ATOM 7172   C CA   . LEU A 1 60  ? -21.319 -12.391 4.354   1.00 0.00 ? 60  LEU A CA   2  
ATOM 7173   C C    . LEU A 1 60  ? -22.096 -12.182 5.646   1.00 0.00 ? 60  LEU A C    2  
ATOM 7174   O O    . LEU A 1 60  ? -23.328 -12.234 5.662   1.00 0.00 ? 60  LEU A O    2  
ATOM 7175   C CB   . LEU A 1 60  ? -21.820 -11.441 3.265   1.00 0.00 ? 60  LEU A CB   2  
ATOM 7176   C CG   . LEU A 1 60  ? -20.915 -11.278 2.039   1.00 0.00 ? 60  LEU A CG   2  
ATOM 7177   C CD1  . LEU A 1 60  ? -21.587 -10.403 0.988   1.00 0.00 ? 60  LEU A CD1  2  
ATOM 7178   C CD2  . LEU A 1 60  ? -19.566 -10.695 2.436   1.00 0.00 ? 60  LEU A CD2  2  
ATOM 7179   H H    . LEU A 1 60  ? -22.245 -14.221 3.829   1.00 0.00 ? 60  LEU A H    2  
ATOM 7180   H HA   . LEU A 1 60  ? -20.273 -12.155 4.551   1.00 0.00 ? 60  LEU A HA   2  
ATOM 7181   H HB2  . LEU A 1 60  ? -22.785 -11.812 2.918   1.00 0.00 ? 60  LEU A HB2  2  
ATOM 7182   H HB3  . LEU A 1 60  ? -21.950 -10.457 3.716   1.00 0.00 ? 60  LEU A HB3  2  
ATOM 7183   H HG   . LEU A 1 60  ? -20.746 -12.264 1.606   1.00 0.00 ? 60  LEU A HG   2  
ATOM 7184   H HD11 . LEU A 1 60  ? -20.943 -10.315 0.113   1.00 0.00 ? 60  LEU A HD11 2  
ATOM 7185   H HD12 . LEU A 1 60  ? -22.535 -10.854 0.694   1.00 0.00 ? 60  LEU A HD12 2  
ATOM 7186   H HD13 . LEU A 1 60  ? -21.769 -9.412  1.404   1.00 0.00 ? 60  LEU A HD13 2  
ATOM 7187   H HD21 . LEU A 1 60  ? -19.089 -11.350 3.166   1.00 0.00 ? 60  LEU A HD21 2  
ATOM 7188   H HD22 . LEU A 1 60  ? -18.926 -10.608 1.558   1.00 0.00 ? 60  LEU A HD22 2  
ATOM 7189   H HD23 . LEU A 1 60  ? -19.713 -9.709  2.876   1.00 0.00 ? 60  LEU A HD23 2  
ATOM 7190   N N    . GLY A 1 61  ? -21.364 -11.959 6.727   1.00 0.00 ? 61  GLY A N    2  
ATOM 7191   C CA   . GLY A 1 61  ? -21.984 -11.736 8.013   1.00 0.00 ? 61  GLY A CA   2  
ATOM 7192   C C    . GLY A 1 61  ? -21.473 -10.468 8.658   1.00 0.00 ? 61  GLY A C    2  
ATOM 7193   O O    . GLY A 1 61  ? -20.554 -9.828  8.140   1.00 0.00 ? 61  GLY A O    2  
ATOM 7194   H H    . GLY A 1 61  ? -20.384 -11.944 6.658   1.00 0.00 ? 61  GLY A H    2  
ATOM 7195   H HA2  . GLY A 1 61  ? -23.063 -11.657 7.879   1.00 0.00 ? 61  GLY A HA2  2  
ATOM 7196   H HA3  . GLY A 1 61  ? -21.763 -12.580 8.666   1.00 0.00 ? 61  GLY A HA3  2  
ATOM 7197   N N    . LEU A 1 62  ? -22.061 -10.100 9.782   1.00 0.00 ? 62  LEU A N    2  
ATOM 7198   C CA   . LEU A 1 62  ? -21.660 -8.897  10.494  1.00 0.00 ? 62  LEU A CA   2  
ATOM 7199   C C    . LEU A 1 62  ? -20.581 -9.202  11.528  1.00 0.00 ? 62  LEU A C    2  
ATOM 7200   O O    . LEU A 1 62  ? -20.584 -10.268 12.146  1.00 0.00 ? 62  LEU A O    2  
ATOM 7201   C CB   . LEU A 1 62  ? -22.866 -8.225  11.157  1.00 0.00 ? 62  LEU A CB   2  
ATOM 7202   C CG   . LEU A 1 62  ? -23.622 -7.195  10.309  1.00 0.00 ? 62  LEU A CG   2  
ATOM 7203   C CD1  . LEU A 1 62  ? -24.355 -7.865  9.156   1.00 0.00 ? 62  LEU A CD1  2  
ATOM 7204   C CD2  . LEU A 1 62  ? -24.591 -6.400  11.170  1.00 0.00 ? 62  LEU A CD2  2  
ATOM 7205   H H    . LEU A 1 62  ? -22.784 -10.654 10.147  1.00 0.00 ? 62  LEU A H    2  
ATOM 7206   H HA   . LEU A 1 62  ? -21.243 -8.202  9.764   1.00 0.00 ? 62  LEU A HA   2  
ATOM 7207   H HB2  . LEU A 1 62  ? -23.571 -9.008  11.435  1.00 0.00 ? 62  LEU A HB2  2  
ATOM 7208   H HB3  . LEU A 1 62  ? -22.512 -7.719  12.055  1.00 0.00 ? 62  LEU A HB3  2  
ATOM 7209   H HG   . LEU A 1 62  ? -22.894 -6.502  9.889   1.00 0.00 ? 62  LEU A HG   2  
ATOM 7210   H HD11 . LEU A 1 62  ? -24.865 -7.115  8.553   1.00 0.00 ? 62  LEU A HD11 2  
ATOM 7211   H HD12 . LEU A 1 62  ? -23.637 -8.400  8.534   1.00 0.00 ? 62  LEU A HD12 2  
ATOM 7212   H HD13 . LEU A 1 62  ? -25.087 -8.568  9.552   1.00 0.00 ? 62  LEU A HD13 2  
ATOM 7213   H HD21 . LEU A 1 62  ? -24.041 -5.901  11.967  1.00 0.00 ? 62  LEU A HD21 2  
ATOM 7214   H HD22 . LEU A 1 62  ? -25.102 -5.654  10.561  1.00 0.00 ? 62  LEU A HD22 2  
ATOM 7215   H HD23 . LEU A 1 62  ? -25.328 -7.076  11.605  1.00 0.00 ? 62  LEU A HD23 2  
ATOM 7216   N N    . LYS A 1 63  ? -19.659 -8.259  11.700  1.00 0.00 ? 63  LYS A N    2  
ATOM 7217   C CA   . LYS A 1 63  ? -18.566 -8.402  12.656  1.00 0.00 ? 63  LYS A CA   2  
ATOM 7218   C C    . LYS A 1 63  ? -19.098 -8.683  14.063  1.00 0.00 ? 63  LYS A C    2  
ATOM 7219   O O    . LYS A 1 63  ? -19.865 -7.890  14.612  1.00 0.00 ? 63  LYS A O    2  
ATOM 7220   C CB   . LYS A 1 63  ? -17.693 -7.138  12.649  1.00 0.00 ? 63  LYS A CB   2  
ATOM 7221   C CG   . LYS A 1 63  ? -16.465 -7.207  13.546  1.00 0.00 ? 63  LYS A CG   2  
ATOM 7222   C CD   . LYS A 1 63  ? -15.629 -5.939  13.447  1.00 0.00 ? 63  LYS A CD   2  
ATOM 7223   C CE   . LYS A 1 63  ? -14.794 -5.707  14.699  1.00 0.00 ? 63  LYS A CE   2  
ATOM 7224   N NZ   . LYS A 1 63  ? -13.836 -6.813  14.952  1.00 0.00 ? 63  LYS A NZ   2  
ATOM 7225   H H    . LYS A 1 63  ? -19.716 -7.442  11.165  1.00 0.00 ? 63  LYS A H    2  
ATOM 7226   H HA   . LYS A 1 63  ? -17.952 -9.248  12.347  1.00 0.00 ? 63  LYS A HA   2  
ATOM 7227   H HB2  . LYS A 1 63  ? -17.357 -6.964  11.627  1.00 0.00 ? 63  LYS A HB2  2  
ATOM 7228   H HB3  . LYS A 1 63  ? -18.307 -6.300  12.978  1.00 0.00 ? 63  LYS A HB3  2  
ATOM 7229   H HG2  . LYS A 1 63  ? -16.788 -7.338  14.579  1.00 0.00 ? 63  LYS A HG2  2  
ATOM 7230   H HG3  . LYS A 1 63  ? -15.854 -8.059  13.246  1.00 0.00 ? 63  LYS A HG3  2  
ATOM 7231   H HD2  . LYS A 1 63  ? -14.962 -6.024  12.589  1.00 0.00 ? 63  LYS A HD2  2  
ATOM 7232   H HD3  . LYS A 1 63  ? -16.296 -5.089  13.306  1.00 0.00 ? 63  LYS A HD3  2  
ATOM 7233   H HE2  . LYS A 1 63  ? -14.236 -4.778  14.582  1.00 0.00 ? 63  LYS A HE2  2  
ATOM 7234   H HE3  . LYS A 1 63  ? -15.462 -5.618  15.556  1.00 0.00 ? 63  LYS A HE3  2  
ATOM 7235   H HZ1  . LYS A 1 63  ? -14.354 -7.691  15.181  1.00 0.00 ? 63  LYS A HZ1  2  
ATOM 7236   H HZ2  . LYS A 1 63  ? -13.219 -6.573  15.756  1.00 0.00 ? 63  LYS A HZ2  2  
ATOM 7237   H HZ3  . LYS A 1 63  ? -13.242 -6.972  14.108  1.00 0.00 ? 63  LYS A HZ3  2  
ATOM 7238   N N    . GLU A 1 64  ? -18.681 -9.826  14.621  1.00 0.00 ? 64  GLU A N    2  
ATOM 7239   C CA   . GLU A 1 64  ? -19.087 -10.278 15.963  1.00 0.00 ? 64  GLU A CA   2  
ATOM 7240   C C    . GLU A 1 64  ? -20.597 -10.215 16.215  1.00 0.00 ? 64  GLU A C    2  
ATOM 7241   O O    . GLU A 1 64  ? -21.047 -9.960  17.335  1.00 0.00 ? 64  GLU A O    2  
ATOM 7242   C CB   . GLU A 1 64  ? -18.263 -9.665  17.108  1.00 0.00 ? 64  GLU A CB   2  
ATOM 7243   C CG   . GLU A 1 64  ? -17.999 -8.172  17.003  1.00 0.00 ? 64  GLU A CG   2  
ATOM 7244   C CD   . GLU A 1 64  ? -16.524 -7.852  16.880  1.00 0.00 ? 64  GLU A CD   2  
ATOM 7245   O OE1  . GLU A 1 64  ? -16.085 -6.840  17.458  1.00 0.00 ? 64  GLU A OE1  2  
ATOM 7246   O OE2  . GLU A 1 64  ? -15.790 -8.611  16.204  1.00 0.00 ? 64  GLU A OE2  2  
ATOM 7247   H H    . GLU A 1 64  ? -18.073 -10.394 14.108  1.00 0.00 ? 64  GLU A H    2  
ATOM 7248   H HA   . GLU A 1 64  ? -18.842 -11.340 15.975  1.00 0.00 ? 64  GLU A HA   2  
ATOM 7249   H HB2  . GLU A 1 64  ? -18.799 -9.845  18.040  1.00 0.00 ? 64  GLU A HB2  2  
ATOM 7250   H HB3  . GLU A 1 64  ? -17.300 -10.174 17.139  1.00 0.00 ? 64  GLU A HB3  2  
ATOM 7251   H HG2  . GLU A 1 64  ? -18.516 -7.785  16.125  1.00 0.00 ? 64  GLU A HG2  2  
ATOM 7252   H HG3  . GLU A 1 64  ? -18.391 -7.682  17.894  1.00 0.00 ? 64  GLU A HG3  2  
ATOM 7253   H HE2  . GLU A 1 64  ? -14.869 -8.344  16.172  1.00 0.00 ? 64  GLU A HE2  2  
ATOM 7254   N N    . LYS A 1 65  ? -21.369 -10.465 15.167  1.00 0.00 ? 65  LYS A N    2  
ATOM 7255   C CA   . LYS A 1 65  ? -22.822 -10.458 15.250  1.00 0.00 ? 65  LYS A CA   2  
ATOM 7256   C C    . LYS A 1 65  ? -23.377 -11.677 14.520  1.00 0.00 ? 65  LYS A C    2  
ATOM 7257   O O    . LYS A 1 65  ? -22.818 -12.111 13.513  1.00 0.00 ? 65  LYS A O    2  
ATOM 7258   C CB   . LYS A 1 65  ? -23.392 -9.167  14.653  1.00 0.00 ? 65  LYS A CB   2  
ATOM 7259   C CG   . LYS A 1 65  ? -23.163 -7.928  15.510  1.00 0.00 ? 65  LYS A CG   2  
ATOM 7260   C CD   . LYS A 1 65  ? -23.269 -6.654  14.688  1.00 0.00 ? 65  LYS A CD   2  
ATOM 7261   C CE   . LYS A 1 65  ? -23.195 -5.413  15.565  1.00 0.00 ? 65  LYS A CE   2  
ATOM 7262   N NZ   . LYS A 1 65  ? -24.476 -5.152  16.275  1.00 0.00 ? 65  LYS A NZ   2  
ATOM 7263   H H    . LYS A 1 65  ? -20.947 -10.661 14.302  1.00 0.00 ? 65  LYS A H    2  
ATOM 7264   H HA   . LYS A 1 65  ? -23.111 -10.513 16.299  1.00 0.00 ? 65  LYS A HA   2  
ATOM 7265   H HB2  . LYS A 1 65  ? -22.923 -9.003  13.683  1.00 0.00 ? 65  LYS A HB2  2  
ATOM 7266   H HB3  . LYS A 1 65  ? -24.466 -9.297  14.520  1.00 0.00 ? 65  LYS A HB3  2  
ATOM 7267   H HG2  . LYS A 1 65  ? -23.911 -7.902  16.302  1.00 0.00 ? 65  LYS A HG2  2  
ATOM 7268   H HG3  . LYS A 1 65  ? -22.168 -7.982  15.952  1.00 0.00 ? 65  LYS A HG3  2  
ATOM 7269   H HD2  . LYS A 1 65  ? -22.451 -6.628  13.968  1.00 0.00 ? 65  LYS A HD2  2  
ATOM 7270   H HD3  . LYS A 1 65  ? -24.221 -6.655  14.156  1.00 0.00 ? 65  LYS A HD3  2  
ATOM 7271   H HE2  . LYS A 1 65  ? -22.404 -5.549  16.303  1.00 0.00 ? 65  LYS A HE2  2  
ATOM 7272   H HE3  . LYS A 1 65  ? -22.957 -4.552  14.939  1.00 0.00 ? 65  LYS A HE3  2  
ATOM 7273   H HZ1  . LYS A 1 65  ? -24.598 -4.131  16.437  1.00 0.00 ? 65  LYS A HZ1  2  
ATOM 7274   H HZ2  . LYS A 1 65  ? -24.486 -5.641  17.191  1.00 0.00 ? 65  LYS A HZ2  2  
ATOM 7275   H HZ3  . LYS A 1 65  ? -25.278 -5.496  15.709  1.00 0.00 ? 65  LYS A HZ3  2  
ATOM 7276   N N    . ASN A 1 66  ? -24.481 -12.219 15.016  1.00 0.00 ? 66  ASN A N    2  
ATOM 7277   C CA   . ASN A 1 66  ? -25.089 -13.404 14.414  1.00 0.00 ? 66  ASN A CA   2  
ATOM 7278   C C    . ASN A 1 66  ? -26.018 -13.052 13.252  1.00 0.00 ? 66  ASN A C    2  
ATOM 7279   O O    . ASN A 1 66  ? -26.916 -13.822 12.907  1.00 0.00 ? 66  ASN A O    2  
ATOM 7280   C CB   . ASN A 1 66  ? -25.818 -14.255 15.466  1.00 0.00 ? 66  ASN A CB   2  
ATOM 7281   C CG   . ASN A 1 66  ? -27.119 -13.645 15.966  1.00 0.00 ? 66  ASN A CG   2  
ATOM 7282   O OD1  . ASN A 1 66  ? -27.242 -12.429 16.102  1.00 0.00 ? 66  ASN A OD1  2  
ATOM 7283   N ND2  . ASN A 1 66  ? -28.102 -14.491 16.238  1.00 0.00 ? 66  ASN A ND2  2  
ATOM 7284   H H    . ASN A 1 66  ? -24.901 -11.811 15.803  1.00 0.00 ? 66  ASN A H    2  
ATOM 7285   H HA   . ASN A 1 66  ? -24.277 -14.008 14.009  1.00 0.00 ? 66  ASN A HA   2  
ATOM 7286   H HB2  . ASN A 1 66  ? -26.040 -15.228 15.027  1.00 0.00 ? 66  ASN A HB2  2  
ATOM 7287   H HB3  . ASN A 1 66  ? -25.153 -14.390 16.319  1.00 0.00 ? 66  ASN A HB3  2  
ATOM 7288   H HD21 . ASN A 1 66  ? -27.937 -15.454 16.098  1.00 0.00 ? 66  ASN A HD21 2  
ATOM 7289   H HD22 . ASN A 1 66  ? -28.947 -14.128 16.571  1.00 0.00 ? 66  ASN A HD22 2  
ATOM 7290   N N    . LEU A 1 67  ? -25.784 -11.901 12.636  1.00 0.00 ? 67  LEU A N    2  
ATOM 7291   C CA   . LEU A 1 67  ? -26.595 -11.457 11.516  1.00 0.00 ? 67  LEU A CA   2  
ATOM 7292   C C    . LEU A 1 67  ? -25.876 -11.746 10.206  1.00 0.00 ? 67  LEU A C    2  
ATOM 7293   O O    . LEU A 1 67  ? -24.757 -11.276 9.985   1.00 0.00 ? 67  LEU A O    2  
ATOM 7294   C CB   . LEU A 1 67  ? -26.901 -9.960  11.629  1.00 0.00 ? 67  LEU A CB   2  
ATOM 7295   C CG   . LEU A 1 67  ? -27.571 -9.499  12.928  1.00 0.00 ? 67  LEU A CG   2  
ATOM 7296   C CD1  . LEU A 1 67  ? -27.880 -8.010  12.873  1.00 0.00 ? 67  LEU A CD1  2  
ATOM 7297   C CD2  . LEU A 1 67  ? -28.836 -10.301 13.200  1.00 0.00 ? 67  LEU A CD2  2  
ATOM 7298   H H    . LEU A 1 67  ? -25.028 -11.351 12.930  1.00 0.00 ? 67  LEU A H    2  
ATOM 7299   H HA   . LEU A 1 67  ? -27.536 -12.007 11.530  1.00 0.00 ? 67  LEU A HA   2  
ATOM 7300   H HB2  . LEU A 1 67  ? -25.959 -9.421  11.532  1.00 0.00 ? 67  LEU A HB2  2  
ATOM 7301   H HB3  . LEU A 1 67  ? -27.560 -9.693  10.803  1.00 0.00 ? 67  LEU A HB3  2  
ATOM 7302   H HG   . LEU A 1 67  ? -26.876 -9.673  13.750  1.00 0.00 ? 67  LEU A HG   2  
ATOM 7303   H HD11 . LEU A 1 67  ? -28.333 -7.691  13.812  1.00 0.00 ? 67  LEU A HD11 2  
ATOM 7304   H HD12 . LEU A 1 67  ? -26.956 -7.454  12.711  1.00 0.00 ? 67  LEU A HD12 2  
ATOM 7305   H HD13 . LEU A 1 67  ? -28.571 -7.813  12.053  1.00 0.00 ? 67  LEU A HD13 2  
ATOM 7306   H HD21 . LEU A 1 67  ? -28.586 -11.360 13.266  1.00 0.00 ? 67  LEU A HD21 2  
ATOM 7307   H HD22 . LEU A 1 67  ? -29.286 -9.977  14.138  1.00 0.00 ? 67  LEU A HD22 2  
ATOM 7308   H HD23 . LEU A 1 67  ? -29.545 -10.145 12.387  1.00 0.00 ? 67  LEU A HD23 2  
ATOM 7309   N N    . TYR A 1 68  ? -26.510 -12.533 9.351   1.00 0.00 ? 68  TYR A N    2  
ATOM 7310   C CA   . TYR A 1 68  ? -25.930 -12.890 8.064   1.00 0.00 ? 68  TYR A CA   2  
ATOM 7311   C C    . TYR A 1 68  ? -26.861 -12.511 6.926   1.00 0.00 ? 68  TYR A C    2  
ATOM 7312   O O    . TYR A 1 68  ? -28.085 -12.517 7.088   1.00 0.00 ? 68  TYR A O    2  
ATOM 7313   C CB   . TYR A 1 68  ? -25.623 -14.391 8.011   1.00 0.00 ? 68  TYR A CB   2  
ATOM 7314   C CG   . TYR A 1 68  ? -24.269 -14.761 8.570   1.00 0.00 ? 68  TYR A CG   2  
ATOM 7315   C CD1  . TYR A 1 68  ? -24.031 -14.749 9.937   1.00 0.00 ? 68  TYR A CD1  2  
ATOM 7316   C CD2  . TYR A 1 68  ? -23.227 -15.123 7.726   1.00 0.00 ? 68  TYR A CD2  2  
ATOM 7317   C CE1  . TYR A 1 68  ? -22.794 -15.085 10.449  1.00 0.00 ? 68  TYR A CE1  2  
ATOM 7318   C CE2  . TYR A 1 68  ? -21.986 -15.460 8.228   1.00 0.00 ? 68  TYR A CE2  2  
ATOM 7319   C CZ   . TYR A 1 68  ? -21.776 -15.440 9.590   1.00 0.00 ? 68  TYR A CZ   2  
ATOM 7320   O OH   . TYR A 1 68  ? -20.545 -15.777 10.095  1.00 0.00 ? 68  TYR A OH   2  
ATOM 7321   H H    . TYR A 1 68  ? -27.397 -12.885 9.593   1.00 0.00 ? 68  TYR A H    2  
ATOM 7322   H HA   . TYR A 1 68  ? -24.996 -12.340 7.947   1.00 0.00 ? 68  TYR A HA   2  
ATOM 7323   H HB2  . TYR A 1 68  ? -26.388 -14.920 8.579   1.00 0.00 ? 68  TYR A HB2  2  
ATOM 7324   H HB3  . TYR A 1 68  ? -25.670 -14.717 6.972   1.00 0.00 ? 68  TYR A HB3  2  
ATOM 7325   H HD1  . TYR A 1 68  ? -24.827 -14.473 10.612  1.00 0.00 ? 68  TYR A HD1  2  
ATOM 7326   H HD2  . TYR A 1 68  ? -23.390 -15.141 6.658   1.00 0.00 ? 68  TYR A HD2  2  
ATOM 7327   H HE1  . TYR A 1 68  ? -22.624 -15.069 11.515  1.00 0.00 ? 68  TYR A HE1  2  
ATOM 7328   H HE2  . TYR A 1 68  ? -21.186 -15.738 7.559   1.00 0.00 ? 68  TYR A HE2  2  
ATOM 7329   H HH   . TYR A 1 68  ? -20.640 -16.062 11.007  1.00 0.00 ? 68  TYR A HH   2  
ATOM 7330   N N    . LEU A 1 69  ? -26.277 -12.161 5.787   1.00 0.00 ? 69  LEU A N    2  
ATOM 7331   C CA   . LEU A 1 69  ? -27.053 -11.792 4.610   1.00 0.00 ? 69  LEU A CA   2  
ATOM 7332   C C    . LEU A 1 69  ? -27.688 -13.035 3.998   1.00 0.00 ? 69  LEU A C    2  
ATOM 7333   O O    . LEU A 1 69  ? -26.989 -13.957 3.584   1.00 0.00 ? 69  LEU A O    2  
ATOM 7334   C CB   . LEU A 1 69  ? -26.173 -11.079 3.581   1.00 0.00 ? 69  LEU A CB   2  
ATOM 7335   C CG   . LEU A 1 69  ? -25.742 -9.651  3.929   1.00 0.00 ? 69  LEU A CG   2  
ATOM 7336   C CD1  . LEU A 1 69  ? -24.793 -9.102  2.872   1.00 0.00 ? 69  LEU A CD1  2  
ATOM 7337   C CD2  . LEU A 1 69  ? -26.957 -8.746  4.078   1.00 0.00 ? 69  LEU A CD2  2  
ATOM 7338   H H    . LEU A 1 69  ? -25.295 -12.152 5.741   1.00 0.00 ? 69  LEU A H    2  
ATOM 7339   H HA   . LEU A 1 69  ? -27.845 -11.110 4.920   1.00 0.00 ? 69  LEU A HA   2  
ATOM 7340   H HB2  . LEU A 1 69  ? -25.270 -11.675 3.446   1.00 0.00 ? 69  LEU A HB2  2  
ATOM 7341   H HB3  . LEU A 1 69  ? -26.725 -11.040 2.642   1.00 0.00 ? 69  LEU A HB3  2  
ATOM 7342   H HG   . LEU A 1 69  ? -25.215 -9.676  4.883   1.00 0.00 ? 69  LEU A HG   2  
ATOM 7343   H HD11 . LEU A 1 69  ? -24.478 -8.094  3.145   1.00 0.00 ? 69  LEU A HD11 2  
ATOM 7344   H HD12 . LEU A 1 69  ? -23.917 -9.747  2.802   1.00 0.00 ? 69  LEU A HD12 2  
ATOM 7345   H HD13 . LEU A 1 69  ? -25.301 -9.073  1.909   1.00 0.00 ? 69  LEU A HD13 2  
ATOM 7346   H HD21 . LEU A 1 69  ? -27.609 -9.140  4.858   1.00 0.00 ? 69  LEU A HD21 2  
ATOM 7347   H HD22 . LEU A 1 69  ? -26.637 -7.740  4.348   1.00 0.00 ? 69  LEU A HD22 2  
ATOM 7348   H HD23 . LEU A 1 69  ? -27.500 -8.711  3.133   1.00 0.00 ? 69  LEU A HD23 2  
ATOM 7349   N N    . SER A 1 70  ? -29.009 -13.056 3.962   1.00 0.00 ? 70  SER A N    2  
ATOM 7350   C CA   . SER A 1 70  ? -29.743 -14.191 3.431   1.00 0.00 ? 70  SER A CA   2  
ATOM 7351   C C    . SER A 1 70  ? -30.468 -13.830 2.137   1.00 0.00 ? 70  SER A C    2  
ATOM 7352   O O    . SER A 1 70  ? -31.110 -12.782 2.045   1.00 0.00 ? 70  SER A O    2  
ATOM 7353   C CB   . SER A 1 70  ? -30.753 -14.671 4.479   1.00 0.00 ? 70  SER A CB   2  
ATOM 7354   O OG   . SER A 1 70  ? -31.337 -15.913 4.123   1.00 0.00 ? 70  SER A OG   2  
ATOM 7355   H H    . SER A 1 70  ? -29.510 -12.281 4.306   1.00 0.00 ? 70  SER A H    2  
ATOM 7356   H HA   . SER A 1 70  ? -29.037 -14.996 3.223   1.00 0.00 ? 70  SER A HA   2  
ATOM 7357   H HB2  . SER A 1 70  ? -30.242 -14.784 5.435   1.00 0.00 ? 70  SER A HB2  2  
ATOM 7358   H HB3  . SER A 1 70  ? -31.543 -13.926 4.575   1.00 0.00 ? 70  SER A HB3  2  
ATOM 7359   H HG   . SER A 1 70  ? -31.643 -16.366 4.928   1.00 0.00 ? 70  SER A HG   2  
ATOM 7360   N N    . CYS A 1 71  ? -30.347 -14.697 1.142   1.00 0.00 ? 71  CYS A N    2  
ATOM 7361   C CA   . CYS A 1 71  ? -31.004 -14.493 -0.140  1.00 0.00 ? 71  CYS A CA   2  
ATOM 7362   C C    . CYS A 1 71  ? -32.162 -15.472 -0.265  1.00 0.00 ? 71  CYS A C    2  
ATOM 7363   O O    . CYS A 1 71  ? -31.950 -16.683 -0.341  1.00 0.00 ? 71  CYS A O    2  
ATOM 7364   C CB   . CYS A 1 71  ? -30.018 -14.698 -1.295  1.00 0.00 ? 71  CYS A CB   2  
ATOM 7365   S SG   . CYS A 1 71  ? -28.294 -14.934 -0.800  1.00 0.00 ? 71  CYS A SG   2  
ATOM 7366   H H    . CYS A 1 71  ? -29.792 -15.497 1.272   1.00 0.00 ? 71  CYS A H    2  
ATOM 7367   H HA   . CYS A 1 71  ? -31.388 -13.474 -0.180  1.00 0.00 ? 71  CYS A HA   2  
ATOM 7368   H HB2  . CYS A 1 71  ? -30.337 -15.579 -1.852  1.00 0.00 ? 71  CYS A HB2  2  
ATOM 7369   H HB3  . CYS A 1 71  ? -30.072 -13.820 -1.938  1.00 0.00 ? 71  CYS A HB3  2  
ATOM 7370   H HG   . CYS A 1 71  ? -28.280 -15.496 0.406   1.00 0.00 ? 71  CYS A HG   2  
ATOM 7371   N N    . VAL A 1 72  ? -33.382 -14.955 -0.289  1.00 0.00 ? 72  VAL A N    2  
ATOM 7372   C CA   . VAL A 1 72  ? -34.565 -15.805 -0.376  1.00 0.00 ? 72  VAL A CA   2  
ATOM 7373   C C    . VAL A 1 72  ? -35.622 -15.193 -1.285  1.00 0.00 ? 72  VAL A C    2  
ATOM 7374   O O    . VAL A 1 72  ? -35.506 -14.043 -1.704  1.00 0.00 ? 72  VAL A O    2  
ATOM 7375   C CB   . VAL A 1 72  ? -35.190 -16.059 1.017   1.00 0.00 ? 72  VAL A CB   2  
ATOM 7376   C CG1  . VAL A 1 72  ? -34.355 -17.044 1.821   1.00 0.00 ? 72  VAL A CG1  2  
ATOM 7377   C CG2  . VAL A 1 72  ? -35.357 -14.753 1.779   1.00 0.00 ? 72  VAL A CG2  2  
ATOM 7378   H H    . VAL A 1 72  ? -33.493 -13.977 -0.281  1.00 0.00 ? 72  VAL A H    2  
ATOM 7379   H HA   . VAL A 1 72  ? -34.257 -16.762 -0.796  1.00 0.00 ? 72  VAL A HA   2  
ATOM 7380   H HB   . VAL A 1 72  ? -36.178 -16.495 0.870   1.00 0.00 ? 72  VAL A HB   2  
ATOM 7381   H HG11 . VAL A 1 72  ? -34.825 -17.228 2.787   1.00 0.00 ? 72  VAL A HG11 2  
ATOM 7382   H HG12 . VAL A 1 72  ? -34.277 -17.984 1.273   1.00 0.00 ? 72  VAL A HG12 2  
ATOM 7383   H HG13 . VAL A 1 72  ? -33.358 -16.631 1.977   1.00 0.00 ? 72  VAL A HG13 2  
ATOM 7384   H HG21 . VAL A 1 72  ? -35.987 -14.076 1.203   1.00 0.00 ? 72  VAL A HG21 2  
ATOM 7385   H HG22 . VAL A 1 72  ? -35.822 -14.945 2.746   1.00 0.00 ? 72  VAL A HG22 2  
ATOM 7386   H HG23 . VAL A 1 72  ? -34.379 -14.296 1.934   1.00 0.00 ? 72  VAL A HG23 2  
ATOM 7387   N N    . LEU A 1 73  ? -36.646 -15.974 -1.585  1.00 0.00 ? 73  LEU A N    2  
ATOM 7388   C CA   . LEU A 1 73  ? -37.740 -15.523 -2.429  1.00 0.00 ? 73  LEU A CA   2  
ATOM 7389   C C    . LEU A 1 73  ? -38.858 -14.988 -1.553  1.00 0.00 ? 73  LEU A C    2  
ATOM 7390   O O    . LEU A 1 73  ? -39.396 -15.720 -0.715  1.00 0.00 ? 73  LEU A O    2  
ATOM 7391   C CB   . LEU A 1 73  ? -38.272 -16.688 -3.270  1.00 0.00 ? 73  LEU A CB   2  
ATOM 7392   C CG   . LEU A 1 73  ? -37.572 -16.946 -4.602  1.00 0.00 ? 73  LEU A CG   2  
ATOM 7393   C CD1  . LEU A 1 73  ? -37.884 -18.347 -5.101  1.00 0.00 ? 73  LEU A CD1  2  
ATOM 7394   C CD2  . LEU A 1 73  ? -38.002 -15.913 -5.632  1.00 0.00 ? 73  LEU A CD2  2  
ATOM 7395   H H    . LEU A 1 73  ? -36.677 -16.882 -1.216  1.00 0.00 ? 73  LEU A H    2  
ATOM 7396   H HA   . LEU A 1 73  ? -37.383 -14.734 -3.090  1.00 0.00 ? 73  LEU A HA   2  
ATOM 7397   H HB2  . LEU A 1 73  ? -38.185 -17.595 -2.670  1.00 0.00 ? 73  LEU A HB2  2  
ATOM 7398   H HB3  . LEU A 1 73  ? -39.323 -16.491 -3.480  1.00 0.00 ? 73  LEU A HB3  2  
ATOM 7399   H HG   . LEU A 1 73  ? -36.496 -16.861 -4.453  1.00 0.00 ? 73  LEU A HG   2  
ATOM 7400   H HD11 . LEU A 1 73  ? -37.368 -18.526 -6.044  1.00 0.00 ? 73  LEU A HD11 2  
ATOM 7401   H HD12 . LEU A 1 73  ? -37.551 -19.076 -4.363  1.00 0.00 ? 73  LEU A HD12 2  
ATOM 7402   H HD13 . LEU A 1 73  ? -38.959 -18.447 -5.252  1.00 0.00 ? 73  LEU A HD13 2  
ATOM 7403   H HD21 . LEU A 1 73  ? -37.754 -14.915 -5.270  1.00 0.00 ? 73  LEU A HD21 2  
ATOM 7404   H HD22 . LEU A 1 73  ? -37.485 -16.095 -6.574  1.00 0.00 ? 73  LEU A HD22 2  
ATOM 7405   H HD23 . LEU A 1 73  ? -39.078 -15.985 -5.790  1.00 0.00 ? 73  LEU A HD23 2  
ATOM 7406   N N    . LYS A 1 74  ? -39.205 -13.723 -1.725  1.00 0.00 ? 74  LYS A N    2  
ATOM 7407   C CA   . LYS A 1 74  ? -40.260 -13.107 -0.947  1.00 0.00 ? 74  LYS A CA   2  
ATOM 7408   C C    . LYS A 1 74  ? -41.236 -12.437 -1.897  1.00 0.00 ? 74  LYS A C    2  
ATOM 7409   O O    . LYS A 1 74  ? -40.838 -11.588 -2.696  1.00 0.00 ? 74  LYS A O    2  
ATOM 7410   C CB   . LYS A 1 74  ? -39.681 -12.036 -0.023  1.00 0.00 ? 74  LYS A CB   2  
ATOM 7411   C CG   . LYS A 1 74  ? -38.707 -12.542 1.022   1.00 0.00 ? 74  LYS A CG   2  
ATOM 7412   C CD   . LYS A 1 74  ? -38.128 -11.382 1.813   1.00 0.00 ? 74  LYS A CD   2  
ATOM 7413   C CE   . LYS A 1 74  ? -37.296 -11.867 2.984   1.00 0.00 ? 74  LYS A CE   2  
ATOM 7414   N NZ   . LYS A 1 74  ? -38.106 -12.646 3.958   1.00 0.00 ? 74  LYS A NZ   2  
ATOM 7415   H H    . LYS A 1 74  ? -38.773 -13.168 -2.416  1.00 0.00 ? 74  LYS A H    2  
ATOM 7416   H HA   . LYS A 1 74  ? -40.771 -13.867 -0.356  1.00 0.00 ? 74  LYS A HA   2  
ATOM 7417   H HB2  . LYS A 1 74  ? -39.163 -11.303 -0.640  1.00 0.00 ? 74  LYS A HB2  2  
ATOM 7418   H HB3  . LYS A 1 74  ? -40.510 -11.554 0.495   1.00 0.00 ? 74  LYS A HB3  2  
ATOM 7419   H HG2  . LYS A 1 74  ? -39.228 -13.216 1.702   1.00 0.00 ? 74  LYS A HG2  2  
ATOM 7420   H HG3  . LYS A 1 74  ? -37.897 -13.079 0.528   1.00 0.00 ? 74  LYS A HG3  2  
ATOM 7421   H HD2  . LYS A 1 74  ? -37.499 -10.783 1.155   1.00 0.00 ? 74  LYS A HD2  2  
ATOM 7422   H HD3  . LYS A 1 74  ? -38.946 -10.768 2.191   1.00 0.00 ? 74  LYS A HD3  2  
ATOM 7423   H HE2  . LYS A 1 74  ? -36.491 -12.498 2.608   1.00 0.00 ? 74  LYS A HE2  2  
ATOM 7424   H HE3  . LYS A 1 74  ? -36.866 -11.004 3.493   1.00 0.00 ? 74  LYS A HE3  2  
ATOM 7425   H HZ1  . LYS A 1 74  ? -39.076 -12.270 4.006   1.00 0.00 ? 74  LYS A HZ1  2  
ATOM 7426   H HZ2  . LYS A 1 74  ? -37.679 -12.590 4.906   1.00 0.00 ? 74  LYS A HZ2  2  
ATOM 7427   H HZ3  . LYS A 1 74  ? -38.150 -13.643 3.669   1.00 0.00 ? 74  LYS A HZ3  2  
ATOM 7428   N N    . ASP A 1 75  ? -42.498 -12.832 -1.822  1.00 0.00 ? 75  ASP A N    2  
ATOM 7429   C CA   . ASP A 1 75  ? -43.537 -12.261 -2.673  1.00 0.00 ? 75  ASP A CA   2  
ATOM 7430   C C    . ASP A 1 75  ? -43.217 -12.458 -4.152  1.00 0.00 ? 75  ASP A C    2  
ATOM 7431   O O    . ASP A 1 75  ? -43.245 -11.511 -4.939  1.00 0.00 ? 75  ASP A O    2  
ATOM 7432   C CB   . ASP A 1 75  ? -43.740 -10.776 -2.357  1.00 0.00 ? 75  ASP A CB   2  
ATOM 7433   C CG   . ASP A 1 75  ? -45.198 -10.379 -2.347  1.00 0.00 ? 75  ASP A CG   2  
ATOM 7434   O OD1  . ASP A 1 75  ? -45.680 -9.840  -3.365  1.00 0.00 ? 75  ASP A OD1  2  
ATOM 7435   O OD2  . ASP A 1 75  ? -45.868 -10.603 -1.316  1.00 0.00 ? 75  ASP A OD2  2  
ATOM 7436   H H    . ASP A 1 75  ? -42.742 -13.527 -1.176  1.00 0.00 ? 75  ASP A H    2  
ATOM 7437   H HA   . ASP A 1 75  ? -44.468 -12.784 -2.456  1.00 0.00 ? 75  ASP A HA   2  
ATOM 7438   H HB2  . ASP A 1 75  ? -43.313 -10.564 -1.377  1.00 0.00 ? 75  ASP A HB2  2  
ATOM 7439   H HB3  . ASP A 1 75  ? -43.221 -10.183 -3.110  1.00 0.00 ? 75  ASP A HB3  2  
ATOM 7440   H HD2  . ASP A 1 75  ? -46.785 -10.325 -1.377  1.00 0.00 ? 75  ASP A HD2  2  
ATOM 7441   N N    . ASP A 1 76  ? -42.902 -13.703 -4.513  1.00 0.00 ? 76  ASP A N    2  
ATOM 7442   C CA   . ASP A 1 76  ? -42.580 -14.071 -5.894  1.00 0.00 ? 76  ASP A CA   2  
ATOM 7443   C C    . ASP A 1 76  ? -41.357 -13.346 -6.448  1.00 0.00 ? 76  ASP A C    2  
ATOM 7444   O O    . ASP A 1 76  ? -41.180 -13.272 -7.663  1.00 0.00 ? 76  ASP A O    2  
ATOM 7445   C CB   . ASP A 1 76  ? -43.782 -13.847 -6.821  1.00 0.00 ? 76  ASP A CB   2  
ATOM 7446   C CG   . ASP A 1 76  ? -44.674 -15.065 -6.942  1.00 0.00 ? 76  ASP A CG   2  
ATOM 7447   O OD1  . ASP A 1 76  ? -45.343 -15.420 -5.949  1.00 0.00 ? 76  ASP A OD1  2  
ATOM 7448   O OD2  . ASP A 1 76  ? -44.724 -15.665 -8.036  1.00 0.00 ? 76  ASP A OD2  2  
ATOM 7449   H H    . ASP A 1 76  ? -42.922 -14.412 -3.836  1.00 0.00 ? 76  ASP A H    2  
ATOM 7450   H HA   . ASP A 1 76  ? -42.354 -15.138 -5.892  1.00 0.00 ? 76  ASP A HA   2  
ATOM 7451   H HB2  . ASP A 1 76  ? -44.374 -13.020 -6.430  1.00 0.00 ? 76  ASP A HB2  2  
ATOM 7452   H HB3  . ASP A 1 76  ? -43.413 -13.587 -7.813  1.00 0.00 ? 76  ASP A HB3  2  
ATOM 7453   H HD2  . ASP A 1 76  ? -45.312 -16.424 -8.042  1.00 0.00 ? 76  ASP A HD2  2  
ATOM 7454   N N    . LYS A 1 77  ? -40.512 -12.805 -5.581  1.00 0.00 ? 77  LYS A N    2  
ATOM 7455   C CA   . LYS A 1 77  ? -39.326 -12.093 -6.041  1.00 0.00 ? 77  LYS A CA   2  
ATOM 7456   C C    . LYS A 1 77  ? -38.131 -12.330 -5.117  1.00 0.00 ? 77  LYS A C    2  
ATOM 7457   O O    . LYS A 1 77  ? -38.274 -12.337 -3.896  1.00 0.00 ? 77  LYS A O    2  
ATOM 7458   C CB   . LYS A 1 77  ? -39.630 -10.593 -6.145  1.00 0.00 ? 77  LYS A CB   2  
ATOM 7459   C CG   . LYS A 1 77  ? -38.990 -9.898  -7.342  1.00 0.00 ? 77  LYS A CG   2  
ATOM 7460   C CD   . LYS A 1 77  ? -39.445 -10.500 -8.668  1.00 0.00 ? 77  LYS A CD   2  
ATOM 7461   C CE   . LYS A 1 77  ? -40.822 -9.996  -9.092  1.00 0.00 ? 77  LYS A CE   2  
ATOM 7462   N NZ   . LYS A 1 77  ? -41.929 -10.721 -8.413  1.00 0.00 ? 77  LYS A NZ   2  
ATOM 7463   H H    . LYS A 1 77  ? -40.696 -12.864 -4.618  1.00 0.00 ? 77  LYS A H    2  
ATOM 7464   H HA   . LYS A 1 77  ? -39.070 -12.465 -7.033  1.00 0.00 ? 77  LYS A HA   2  
ATOM 7465   H HB2  . LYS A 1 77  ? -40.710 -10.469 -6.218  1.00 0.00 ? 77  LYS A HB2  2  
ATOM 7466   H HB3  . LYS A 1 77  ? -39.269 -10.108 -5.238  1.00 0.00 ? 77  LYS A HB3  2  
ATOM 7467   H HG2  . LYS A 1 77  ? -39.263 -8.843  -7.323  1.00 0.00 ? 77  LYS A HG2  2  
ATOM 7468   H HG3  . LYS A 1 77  ? -37.907 -9.995  -7.266  1.00 0.00 ? 77  LYS A HG3  2  
ATOM 7469   H HD2  . LYS A 1 77  ? -38.722 -10.236 -9.440  1.00 0.00 ? 77  LYS A HD2  2  
ATOM 7470   H HD3  . LYS A 1 77  ? -39.486 -11.585 -8.565  1.00 0.00 ? 77  LYS A HD3  2  
ATOM 7471   H HE2  . LYS A 1 77  ? -40.897 -8.935  -8.851  1.00 0.00 ? 77  LYS A HE2  2  
ATOM 7472   H HE3  . LYS A 1 77  ? -40.926 -10.126 -10.170 1.00 0.00 ? 77  LYS A HE3  2  
ATOM 7473   H HZ1  . LYS A 1 77  ? -42.807 -10.630 -8.961  1.00 0.00 ? 77  LYS A HZ1  2  
ATOM 7474   H HZ2  . LYS A 1 77  ? -42.086 -10.328 -7.461  1.00 0.00 ? 77  LYS A HZ2  2  
ATOM 7475   H HZ3  . LYS A 1 77  ? -41.696 -11.734 -8.325  1.00 0.00 ? 77  LYS A HZ3  2  
ATOM 7476   N N    . PRO A 1 78  ? -36.940 -12.567 -5.688  1.00 0.00 ? 78  PRO A N    2  
ATOM 7477   C CA   . PRO A 1 78  ? -35.716 -12.784 -4.906  1.00 0.00 ? 78  PRO A CA   2  
ATOM 7478   C C    . PRO A 1 78  ? -35.315 -11.511 -4.167  1.00 0.00 ? 78  PRO A C    2  
ATOM 7479   O O    . PRO A 1 78  ? -35.100 -10.467 -4.782  1.00 0.00 ? 78  PRO A O    2  
ATOM 7480   C CB   . PRO A 1 78  ? -34.661 -13.133 -5.965  1.00 0.00 ? 78  PRO A CB   2  
ATOM 7481   C CG   . PRO A 1 78  ? -35.437 -13.491 -7.185  1.00 0.00 ? 78  PRO A CG   2  
ATOM 7482   C CD   . PRO A 1 78  ? -36.685 -12.659 -7.132  1.00 0.00 ? 78  PRO A CD   2  
ATOM 7483   H HA   . PRO A 1 78  ? -35.842 -13.601 -4.197  1.00 0.00 ? 78  PRO A HA   2  
ATOM 7484   H HB2  . PRO A 1 78  ? -33.982 -12.301 -6.148  1.00 0.00 ? 78  PRO A HB2  2  
ATOM 7485   H HB3  . PRO A 1 78  ? -34.112 -14.014 -5.633  1.00 0.00 ? 78  PRO A HB3  2  
ATOM 7486   H HG2  . PRO A 1 78  ? -34.860 -13.196 -8.060  1.00 0.00 ? 78  PRO A HG2  2  
ATOM 7487   H HG3  . PRO A 1 78  ? -35.668 -14.556 -7.215  1.00 0.00 ? 78  PRO A HG3  2  
ATOM 7488   H HD2  . PRO A 1 78  ? -36.532 -11.680 -7.588  1.00 0.00 ? 78  PRO A HD2  2  
ATOM 7489   H HD3  . PRO A 1 78  ? -37.509 -13.179 -7.619  1.00 0.00 ? 78  PRO A HD3  2  
ATOM 7490   N N    . THR A 1 79  ? -35.218 -11.597 -2.851  1.00 0.00 ? 79  THR A N    2  
ATOM 7491   C CA   . THR A 1 79  ? -34.866 -10.444 -2.040  1.00 0.00 ? 79  THR A CA   2  
ATOM 7492   C C    . THR A 1 79  ? -33.759 -10.781 -1.047  1.00 0.00 ? 79  THR A C    2  
ATOM 7493   O O    . THR A 1 79  ? -33.531 -11.948 -0.724  1.00 0.00 ? 79  THR A O    2  
ATOM 7494   C CB   . THR A 1 79  ? -36.091 -9.920  -1.268  1.00 0.00 ? 79  THR A CB   2  
ATOM 7495   O OG1  . THR A 1 79  ? -37.288 -10.429 -1.870  1.00 0.00 ? 79  THR A OG1  2  
ATOM 7496   C CG2  . THR A 1 79  ? -36.126 -8.399  -1.290  1.00 0.00 ? 79  THR A CG2  2  
ATOM 7497   H H    . THR A 1 79  ? -35.361 -12.467 -2.411  1.00 0.00 ? 79  THR A H    2  
ATOM 7498   H HA   . THR A 1 79  ? -34.510 -9.659  -2.707  1.00 0.00 ? 79  THR A HA   2  
ATOM 7499   H HB   . THR A 1 79  ? -36.033 -10.261 -0.235  1.00 0.00 ? 79  THR A HB   2  
ATOM 7500   H HG1  . THR A 1 79  ? -37.082 -10.778 -2.746  1.00 0.00 ? 79  THR A HG1  2  
ATOM 7501   H HG21 . THR A 1 79  ? -36.185 -8.053  -2.322  1.00 0.00 ? 79  THR A HG21 2  
ATOM 7502   H HG22 . THR A 1 79  ? -36.996 -8.043  -0.738  1.00 0.00 ? 79  THR A HG22 2  
ATOM 7503   H HG23 . THR A 1 79  ? -35.219 -8.009  -0.827  1.00 0.00 ? 79  THR A HG23 2  
ATOM 7504   N N    . LEU A 1 80  ? -33.081 -9.748  -0.574  1.00 0.00 ? 80  LEU A N    2  
ATOM 7505   C CA   . LEU A 1 80  ? -32.004 -9.902  0.390   1.00 0.00 ? 80  LEU A CA   2  
ATOM 7506   C C    . LEU A 1 80  ? -32.508 -9.484  1.768   1.00 0.00 ? 80  LEU A C    2  
ATOM 7507   O O    . LEU A 1 80  ? -33.363 -8.605  1.874   1.00 0.00 ? 80  LEU A O    2  
ATOM 7508   C CB   . LEU A 1 80  ? -30.815 -9.028  -0.020  1.00 0.00 ? 80  LEU A CB   2  
ATOM 7509   C CG   . LEU A 1 80  ? -29.540 -9.171  0.817   1.00 0.00 ? 80  LEU A CG   2  
ATOM 7510   C CD1  . LEU A 1 80  ? -28.897 -10.532 0.591   1.00 0.00 ? 80  LEU A CD1  2  
ATOM 7511   C CD2  . LEU A 1 80  ? -28.560 -8.052  0.496   1.00 0.00 ? 80  LEU A CD2  2  
ATOM 7512   H H    . LEU A 1 80  ? -33.321 -8.847  -0.870  1.00 0.00 ? 80  LEU A H    2  
ATOM 7513   H HA   . LEU A 1 80  ? -31.692 -10.946 0.418   1.00 0.00 ? 80  LEU A HA   2  
ATOM 7514   H HB2  . LEU A 1 80  ? -30.563 -9.274  -1.051  1.00 0.00 ? 80  LEU A HB2  2  
ATOM 7515   H HB3  . LEU A 1 80  ? -31.134 -7.987  0.038   1.00 0.00 ? 80  LEU A HB3  2  
ATOM 7516   H HG   . LEU A 1 80  ? -29.812 -9.094  1.869   1.00 0.00 ? 80  LEU A HG   2  
ATOM 7517   H HD11 . LEU A 1 80  ? -28.005 -10.628 1.210   1.00 0.00 ? 80  LEU A HD11 2  
ATOM 7518   H HD12 . LEU A 1 80  ? -29.606 -11.316 0.857   1.00 0.00 ? 80  LEU A HD12 2  
ATOM 7519   H HD13 . LEU A 1 80  ? -28.621 -10.633 -0.458  1.00 0.00 ? 80  LEU A HD13 2  
ATOM 7520   H HD21 . LEU A 1 80  ? -29.032 -7.090  0.695   1.00 0.00 ? 80  LEU A HD21 2  
ATOM 7521   H HD22 . LEU A 1 80  ? -27.669 -8.152  1.115   1.00 0.00 ? 80  LEU A HD22 2  
ATOM 7522   H HD23 . LEU A 1 80  ? -28.277 -8.108  -0.555  1.00 0.00 ? 80  LEU A HD23 2  
ATOM 7523   N N    . GLN A 1 81  ? -31.995 -10.118 2.813   1.00 0.00 ? 81  GLN A N    2  
ATOM 7524   C CA   . GLN A 1 81  ? -32.409 -9.804  4.175   1.00 0.00 ? 81  GLN A CA   2  
ATOM 7525   C C    . GLN A 1 81  ? -31.336 -10.209 5.174   1.00 0.00 ? 81  GLN A C    2  
ATOM 7526   O O    . GLN A 1 81  ? -30.346 -10.842 4.810   1.00 0.00 ? 81  GLN A O    2  
ATOM 7527   C CB   . GLN A 1 81  ? -33.725 -10.515 4.515   1.00 0.00 ? 81  GLN A CB   2  
ATOM 7528   C CG   . GLN A 1 81  ? -33.681 -12.023 4.314   1.00 0.00 ? 81  GLN A CG   2  
ATOM 7529   C CD   . GLN A 1 81  ? -34.633 -12.772 5.228   1.00 0.00 ? 81  GLN A CD   2  
ATOM 7530   O OE1  . GLN A 1 81  ? -35.685 -12.258 5.613   1.00 0.00 ? 81  GLN A OE1  2  
ATOM 7531   N NE2  . GLN A 1 81  ? -34.273 -13.997 5.573   1.00 0.00 ? 81  GLN A NE2  2  
ATOM 7532   H H    . GLN A 1 81  ? -31.315 -10.815 2.667   1.00 0.00 ? 81  GLN A H    2  
ATOM 7533   H HA   . GLN A 1 81  ? -32.565 -8.727  4.245   1.00 0.00 ? 81  GLN A HA   2  
ATOM 7534   H HB2  . GLN A 1 81  ? -33.964 -10.315 5.559   1.00 0.00 ? 81  GLN A HB2  2  
ATOM 7535   H HB3  . GLN A 1 81  ? -34.510 -10.107 3.878   1.00 0.00 ? 81  GLN A HB3  2  
ATOM 7536   H HG2  . GLN A 1 81  ? -33.944 -12.245 3.280   1.00 0.00 ? 81  GLN A HG2  2  
ATOM 7537   H HG3  . GLN A 1 81  ? -32.667 -12.371 4.509   1.00 0.00 ? 81  GLN A HG3  2  
ATOM 7538   H HE21 . GLN A 1 81  ? -33.425 -14.348 5.224   1.00 0.00 ? 81  GLN A HE21 2  
ATOM 7539   H HE22 . GLN A 1 81  ? -34.863 -14.504 6.168   1.00 0.00 ? 81  GLN A HE22 2  
ATOM 7540   N N    . LEU A 1 82  ? -31.542 -9.839  6.428   1.00 0.00 ? 82  LEU A N    2  
ATOM 7541   C CA   . LEU A 1 82  ? -30.613 -10.179 7.493   1.00 0.00 ? 82  LEU A CA   2  
ATOM 7542   C C    . LEU A 1 82  ? -31.214 -11.288 8.342   1.00 0.00 ? 82  LEU A C    2  
ATOM 7543   O O    . LEU A 1 82  ? -32.308 -11.134 8.889   1.00 0.00 ? 82  LEU A O    2  
ATOM 7544   C CB   . LEU A 1 82  ? -30.317 -8.955  8.369   1.00 0.00 ? 82  LEU A CB   2  
ATOM 7545   C CG   . LEU A 1 82  ? -29.174 -8.038  7.923   1.00 0.00 ? 82  LEU A CG   2  
ATOM 7546   C CD1  . LEU A 1 82  ? -27.887 -8.827  7.729   1.00 0.00 ? 82  LEU A CD1  2  
ATOM 7547   C CD2  . LEU A 1 82  ? -29.543 -7.265  6.664   1.00 0.00 ? 82  LEU A CD2  2  
ATOM 7548   H H    . LEU A 1 82  ? -32.352 -9.335  6.650   1.00 0.00 ? 82  LEU A H    2  
ATOM 7549   H HA   . LEU A 1 82  ? -29.681 -10.530 7.050   1.00 0.00 ? 82  LEU A HA   2  
ATOM 7550   H HB2  . LEU A 1 82  ? -31.225 -8.352  8.409   1.00 0.00 ? 82  LEU A HB2  2  
ATOM 7551   H HB3  . LEU A 1 82  ? -30.077 -9.317  9.369   1.00 0.00 ? 82  LEU A HB3  2  
ATOM 7552   H HG   . LEU A 1 82  ? -29.001 -7.312  8.718   1.00 0.00 ? 82  LEU A HG   2  
ATOM 7553   H HD11 . LEU A 1 82  ? -27.077 -8.155  7.445   1.00 0.00 ? 82  LEU A HD11 2  
ATOM 7554   H HD12 . LEU A 1 82  ? -27.628 -9.331  8.660   1.00 0.00 ? 82  LEU A HD12 2  
ATOM 7555   H HD13 . LEU A 1 82  ? -28.033 -9.568  6.943   1.00 0.00 ? 82  LEU A HD13 2  
ATOM 7556   H HD21 . LEU A 1 82  ? -30.443 -6.678  6.851   1.00 0.00 ? 82  LEU A HD21 2  
ATOM 7557   H HD22 . LEU A 1 82  ? -28.729 -6.596  6.384   1.00 0.00 ? 82  LEU A HD22 2  
ATOM 7558   H HD23 . LEU A 1 82  ? -29.729 -7.966  5.850   1.00 0.00 ? 82  LEU A HD23 2  
ATOM 7559   N N    . GLU A 1 83  ? -30.517 -12.404 8.441   1.00 0.00 ? 83  GLU A N    2  
ATOM 7560   C CA   . GLU A 1 83  ? -31.006 -13.533 9.219   1.00 0.00 ? 83  GLU A CA   2  
ATOM 7561   C C    . GLU A 1 83  ? -30.187 -13.742 10.484  1.00 0.00 ? 83  GLU A C    2  
ATOM 7562   O O    . GLU A 1 83  ? -28.956 -13.785 10.436  1.00 0.00 ? 83  GLU A O    2  
ATOM 7563   C CB   . GLU A 1 83  ? -30.994 -14.811 8.375   1.00 0.00 ? 83  GLU A CB   2  
ATOM 7564   C CG   . GLU A 1 83  ? -32.373 -15.399 8.124   1.00 0.00 ? 83  GLU A CG   2  
ATOM 7565   C CD   . GLU A 1 83  ? -32.321 -16.820 7.598   1.00 0.00 ? 83  GLU A CD   2  
ATOM 7566   O OE1  . GLU A 1 83  ? -32.393 -17.766 8.414   1.00 0.00 ? 83  GLU A OE1  2  
ATOM 7567   O OE2  . GLU A 1 83  ? -32.222 -17.004 6.367   1.00 0.00 ? 83  GLU A OE2  2  
ATOM 7568   H H    . GLU A 1 83  ? -29.647 -12.474 7.981   1.00 0.00 ? 83  GLU A H    2  
ATOM 7569   H HA   . GLU A 1 83  ? -32.035 -13.319 9.508   1.00 0.00 ? 83  GLU A HA   2  
ATOM 7570   H HB2  . GLU A 1 83  ? -30.538 -14.581 7.412   1.00 0.00 ? 83  GLU A HB2  2  
ATOM 7571   H HB3  . GLU A 1 83  ? -30.392 -15.557 8.893   1.00 0.00 ? 83  GLU A HB3  2  
ATOM 7572   H HG2  . GLU A 1 83  ? -32.930 -15.395 9.061   1.00 0.00 ? 83  GLU A HG2  2  
ATOM 7573   H HG3  . GLU A 1 83  ? -32.891 -14.776 7.396   1.00 0.00 ? 83  GLU A HG3  2  
ATOM 7574   H HE2  . GLU A 1 83  ? -32.199 -17.928 6.107   1.00 0.00 ? 83  GLU A HE2  2  
ATOM 7575   N N    . SER A 1 84  ? -30.880 -13.852 11.610  1.00 0.00 ? 84  SER A N    2  
ATOM 7576   C CA   . SER A 1 84  ? -30.239 -14.086 12.892  1.00 0.00 ? 84  SER A CA   2  
ATOM 7577   C C    . SER A 1 84  ? -29.998 -15.583 13.061  1.00 0.00 ? 84  SER A C    2  
ATOM 7578   O O    . SER A 1 84  ? -30.910 -16.339 13.401  1.00 0.00 ? 84  SER A O    2  
ATOM 7579   C CB   . SER A 1 84  ? -31.135 -13.555 14.009  1.00 0.00 ? 84  SER A CB   2  
ATOM 7580   O OG   . SER A 1 84  ? -32.470 -13.403 13.548  1.00 0.00 ? 84  SER A OG   2  
ATOM 7581   H H    . SER A 1 84  ? -31.856 -13.767 11.582  1.00 0.00 ? 84  SER A H    2  
ATOM 7582   H HA   . SER A 1 84  ? -29.283 -13.563 12.920  1.00 0.00 ? 84  SER A HA   2  
ATOM 7583   H HB2  . SER A 1 84  ? -31.122 -14.256 14.843  1.00 0.00 ? 84  SER A HB2  2  
ATOM 7584   H HB3  . SER A 1 84  ? -30.759 -12.588 14.341  1.00 0.00 ? 84  SER A HB3  2  
ATOM 7585   H HG   . SER A 1 84  ? -33.050 -13.240 14.299  1.00 0.00 ? 84  SER A HG   2  
ATOM 7586   N N    . VAL A 1 85  ? -28.774 -16.007 12.812  1.00 0.00 ? 85  VAL A N    2  
ATOM 7587   C CA   . VAL A 1 85  ? -28.420 -17.417 12.885  1.00 0.00 ? 85  VAL A CA   2  
ATOM 7588   C C    . VAL A 1 85  ? -27.883 -17.835 14.253  1.00 0.00 ? 85  VAL A C    2  
ATOM 7589   O O    . VAL A 1 85  ? -27.590 -16.996 15.105  1.00 0.00 ? 85  VAL A O    2  
ATOM 7590   C CB   . VAL A 1 85  ? -27.392 -17.787 11.798  1.00 0.00 ? 85  VAL A CB   2  
ATOM 7591   C CG1  . VAL A 1 85  ? -28.015 -17.669 10.415  1.00 0.00 ? 85  VAL A CG1  2  
ATOM 7592   C CG2  . VAL A 1 85  ? -26.160 -16.900 11.905  1.00 0.00 ? 85  VAL A CG2  2  
ATOM 7593   H H    . VAL A 1 85  ? -28.080 -15.349 12.577  1.00 0.00 ? 85  VAL A H    2  
ATOM 7594   H HA   . VAL A 1 85  ? -29.331 -17.986 12.698  1.00 0.00 ? 85  VAL A HA   2  
ATOM 7595   H HB   . VAL A 1 85  ? -27.085 -18.822 11.951  1.00 0.00 ? 85  VAL A HB   2  
ATOM 7596   H HG11 . VAL A 1 85  ? -27.285 -17.952 9.657   1.00 0.00 ? 85  VAL A HG11 2  
ATOM 7597   H HG12 . VAL A 1 85  ? -28.879 -18.331 10.349  1.00 0.00 ? 85  VAL A HG12 2  
ATOM 7598   H HG13 . VAL A 1 85  ? -28.331 -16.640 10.247  1.00 0.00 ? 85  VAL A HG13 2  
ATOM 7599   H HG21 . VAL A 1 85  ? -25.714 -17.017 12.892  1.00 0.00 ? 85  VAL A HG21 2  
ATOM 7600   H HG22 . VAL A 1 85  ? -25.434 -17.184 11.143  1.00 0.00 ? 85  VAL A HG22 2  
ATOM 7601   H HG23 . VAL A 1 85  ? -26.449 -15.859 11.758  1.00 0.00 ? 85  VAL A HG23 2  
ATOM 7602   N N    . ASP A 1 86  ? -27.800 -19.150 14.445  1.00 0.00 ? 86  ASP A N    2  
ATOM 7603   C CA   . ASP A 1 86  ? -27.288 -19.745 15.681  1.00 0.00 ? 86  ASP A CA   2  
ATOM 7604   C C    . ASP A 1 86  ? -25.875 -19.242 15.981  1.00 0.00 ? 86  ASP A C    2  
ATOM 7605   O O    . ASP A 1 86  ? -24.946 -19.487 15.215  1.00 0.00 ? 86  ASP A O    2  
ATOM 7606   C CB   . ASP A 1 86  ? -27.278 -21.272 15.549  1.00 0.00 ? 86  ASP A CB   2  
ATOM 7607   C CG   . ASP A 1 86  ? -27.108 -21.998 16.871  1.00 0.00 ? 86  ASP A CG   2  
ATOM 7608   O OD1  . ASP A 1 86  ? -27.801 -23.018 17.085  1.00 0.00 ? 86  ASP A OD1  2  
ATOM 7609   O OD2  . ASP A 1 86  ? -26.283 -21.566 17.697  1.00 0.00 ? 86  ASP A OD2  2  
ATOM 7610   H H    . ASP A 1 86  ? -28.133 -19.738 13.734  1.00 0.00 ? 86  ASP A H    2  
ATOM 7611   H HA   . ASP A 1 86  ? -27.945 -19.463 16.504  1.00 0.00 ? 86  ASP A HA   2  
ATOM 7612   H HB2  . ASP A 1 86  ? -28.220 -21.586 15.101  1.00 0.00 ? 86  ASP A HB2  2  
ATOM 7613   H HB3  . ASP A 1 86  ? -26.456 -21.556 14.892  1.00 0.00 ? 86  ASP A HB3  2  
ATOM 7614   H HD2  . ASP A 1 86  ? -26.231 -22.078 18.508  1.00 0.00 ? 86  ASP A HD2  2  
ATOM 7615   N N    . PRO A 1 87  ? -25.696 -18.548 17.113  1.00 0.00 ? 87  PRO A N    2  
ATOM 7616   C CA   . PRO A 1 87  ? -24.396 -17.984 17.503  1.00 0.00 ? 87  PRO A CA   2  
ATOM 7617   C C    . PRO A 1 87  ? -23.335 -19.041 17.825  1.00 0.00 ? 87  PRO A C    2  
ATOM 7618   O O    . PRO A 1 87  ? -22.138 -18.757 17.778  1.00 0.00 ? 87  PRO A O    2  
ATOM 7619   C CB   . PRO A 1 87  ? -24.727 -17.161 18.752  1.00 0.00 ? 87  PRO A CB   2  
ATOM 7620   C CG   . PRO A 1 87  ? -25.969 -17.778 19.295  1.00 0.00 ? 87  PRO A CG   2  
ATOM 7621   C CD   . PRO A 1 87  ? -26.747 -18.256 18.103  1.00 0.00 ? 87  PRO A CD   2  
ATOM 7622   H HA   . PRO A 1 87  ? -24.017 -17.338 16.711  1.00 0.00 ? 87  PRO A HA   2  
ATOM 7623   H HB2  . PRO A 1 87  ? -23.913 -17.180 19.476  1.00 0.00 ? 87  PRO A HB2  2  
ATOM 7624   H HB3  . PRO A 1 87  ? -24.950 -16.138 18.448  1.00 0.00 ? 87  PRO A HB3  2  
ATOM 7625   H HG2  . PRO A 1 87  ? -25.688 -18.644 19.895  1.00 0.00 ? 87  PRO A HG2  2  
ATOM 7626   H HG3  . PRO A 1 87  ? -26.543 -17.067 19.888  1.00 0.00 ? 87  PRO A HG3  2  
ATOM 7627   H HD2  . PRO A 1 87  ? -27.340 -19.139 18.344  1.00 0.00 ? 87  PRO A HD2  2  
ATOM 7628   H HD3  . PRO A 1 87  ? -27.390 -17.459 17.729  1.00 0.00 ? 87  PRO A HD3  2  
ATOM 7629   N N    . LYS A 1 88  ? -23.762 -20.259 18.139  1.00 0.00 ? 88  LYS A N    2  
ATOM 7630   C CA   . LYS A 1 88  ? -22.820 -21.320 18.481  1.00 0.00 ? 88  LYS A CA   2  
ATOM 7631   C C    . LYS A 1 88  ? -22.621 -22.298 17.325  1.00 0.00 ? 88  LYS A C    2  
ATOM 7632   O O    . LYS A 1 88  ? -21.664 -23.074 17.316  1.00 0.00 ? 88  LYS A O    2  
ATOM 7633   C CB   . LYS A 1 88  ? -23.266 -22.063 19.744  1.00 0.00 ? 88  LYS A CB   2  
ATOM 7634   C CG   . LYS A 1 88  ? -24.415 -23.031 19.519  1.00 0.00 ? 88  LYS A CG   2  
ATOM 7635   C CD   . LYS A 1 88  ? -25.063 -23.442 20.826  1.00 0.00 ? 88  LYS A CD   2  
ATOM 7636   C CE   . LYS A 1 88  ? -26.447 -24.020 20.588  1.00 0.00 ? 88  LYS A CE   2  
ATOM 7637   N NZ   . LYS A 1 88  ? -27.337 -23.050 19.894  1.00 0.00 ? 88  LYS A NZ   2  
ATOM 7638   H H    . LYS A 1 88  ? -24.730 -20.451 18.133  1.00 0.00 ? 88  LYS A H    2  
ATOM 7639   H HA   . LYS A 1 88  ? -21.859 -20.849 18.689  1.00 0.00 ? 88  LYS A HA   2  
ATOM 7640   H HB2  . LYS A 1 88  ? -22.415 -22.625 20.129  1.00 0.00 ? 88  LYS A HB2  2  
ATOM 7641   H HB3  . LYS A 1 88  ? -23.578 -21.325 20.483  1.00 0.00 ? 88  LYS A HB3  2  
ATOM 7642   H HG2  . LYS A 1 88  ? -25.164 -22.550 18.889  1.00 0.00 ? 88  LYS A HG2  2  
ATOM 7643   H HG3  . LYS A 1 88  ? -24.035 -23.920 19.017  1.00 0.00 ? 88  LYS A HG3  2  
ATOM 7644   H HD2  . LYS A 1 88  ? -24.441 -24.195 21.312  1.00 0.00 ? 88  LYS A HD2  2  
ATOM 7645   H HD3  . LYS A 1 88  ? -25.148 -22.569 21.473  1.00 0.00 ? 88  LYS A HD3  2  
ATOM 7646   H HE2  . LYS A 1 88  ? -26.356 -24.918 19.976  1.00 0.00 ? 88  LYS A HE2  2  
ATOM 7647   H HE3  . LYS A 1 88  ? -26.891 -24.284 21.547  1.00 0.00 ? 88  LYS A HE3  2  
ATOM 7648   H HZ1  . LYS A 1 88  ? -27.557 -22.252 20.521  1.00 0.00 ? 88  LYS A HZ1  2  
ATOM 7649   H HZ2  . LYS A 1 88  ? -28.227 -23.512 19.621  1.00 0.00 ? 88  LYS A HZ2  2  
ATOM 7650   H HZ3  . LYS A 1 88  ? -26.876 -22.681 19.031  1.00 0.00 ? 88  LYS A HZ3  2  
ATOM 7651   N N    . ASN A 1 89  ? -23.520 -22.262 16.353  1.00 0.00 ? 89  ASN A N    2  
ATOM 7652   C CA   . ASN A 1 89  ? -23.428 -23.158 15.200  1.00 0.00 ? 89  ASN A CA   2  
ATOM 7653   C C    . ASN A 1 89  ? -22.958 -22.408 13.964  1.00 0.00 ? 89  ASN A C    2  
ATOM 7654   O O    . ASN A 1 89  ? -22.881 -22.969 12.871  1.00 0.00 ? 89  ASN A O    2  
ATOM 7655   C CB   . ASN A 1 89  ? -24.766 -23.853 14.928  1.00 0.00 ? 89  ASN A CB   2  
ATOM 7656   C CG   . ASN A 1 89  ? -24.918 -25.156 15.690  1.00 0.00 ? 89  ASN A CG   2  
ATOM 7657   O OD1  . ASN A 1 89  ? -24.098 -26.067 15.558  1.00 0.00 ? 89  ASN A OD1  2  
ATOM 7658   N ND2  . ASN A 1 89  ? -25.964 -25.251 16.498  1.00 0.00 ? 89  ASN A ND2  2  
ATOM 7659   H H    . ASN A 1 89  ? -24.265 -21.622 16.408  1.00 0.00 ? 89  ASN A H    2  
ATOM 7660   H HA   . ASN A 1 89  ? -22.690 -23.925 15.433  1.00 0.00 ? 89  ASN A HA   2  
ATOM 7661   H HB2  . ASN A 1 89  ? -25.574 -23.181 15.219  1.00 0.00 ? 89  ASN A HB2  2  
ATOM 7662   H HB3  . ASN A 1 89  ? -24.841 -24.062 13.861  1.00 0.00 ? 89  ASN A HB3  2  
ATOM 7663   H HD21 . ASN A 1 89  ? -26.580 -24.484 16.558  1.00 0.00 ? 89  ASN A HD21 2  
ATOM 7664   H HD22 . ASN A 1 89  ? -26.078 -26.080 17.008  1.00 0.00 ? 89  ASN A HD22 2  
ATOM 7665   N N    . TYR A 1 90  ? -22.642 -21.138 14.146  1.00 0.00 ? 90  TYR A N    2  
ATOM 7666   C CA   . TYR A 1 90  ? -22.180 -20.296 13.056  1.00 0.00 ? 90  TYR A CA   2  
ATOM 7667   C C    . TYR A 1 90  ? -20.957 -19.502 13.499  1.00 0.00 ? 90  TYR A C    2  
ATOM 7668   O O    . TYR A 1 90  ? -20.820 -19.171 14.679  1.00 0.00 ? 90  TYR A O    2  
ATOM 7669   C CB   . TYR A 1 90  ? -23.285 -19.341 12.592  1.00 0.00 ? 90  TYR A CB   2  
ATOM 7670   C CG   . TYR A 1 90  ? -24.373 -19.987 11.759  1.00 0.00 ? 90  TYR A CG   2  
ATOM 7671   C CD1  . TYR A 1 90  ? -25.387 -20.725 12.354  1.00 0.00 ? 90  TYR A CD1  2  
ATOM 7672   C CD2  . TYR A 1 90  ? -24.393 -19.844 10.379  1.00 0.00 ? 90  TYR A CD2  2  
ATOM 7673   C CE1  . TYR A 1 90  ? -26.389 -21.302 11.600  1.00 0.00 ? 90  TYR A CE1  2  
ATOM 7674   C CE2  . TYR A 1 90  ? -25.391 -20.420 9.614   1.00 0.00 ? 90  TYR A CE2  2  
ATOM 7675   C CZ   . TYR A 1 90  ? -26.387 -21.149 10.229  1.00 0.00 ? 90  TYR A CZ   2  
ATOM 7676   O OH   . TYR A 1 90  ? -27.392 -21.719 9.477   1.00 0.00 ? 90  TYR A OH   2  
ATOM 7677   H H    . TYR A 1 90  ? -22.697 -20.757 15.047  1.00 0.00 ? 90  TYR A H    2  
ATOM 7678   H HA   . TYR A 1 90  ? -21.900 -20.938 12.220  1.00 0.00 ? 90  TYR A HA   2  
ATOM 7679   H HB2  . TYR A 1 90  ? -23.747 -18.898 13.474  1.00 0.00 ? 90  TYR A HB2  2  
ATOM 7680   H HB3  . TYR A 1 90  ? -22.827 -18.548 12.001  1.00 0.00 ? 90  TYR A HB3  2  
ATOM 7681   H HD1  . TYR A 1 90  ? -25.393 -20.849 13.427  1.00 0.00 ? 90  TYR A HD1  2  
ATOM 7682   H HD2  . TYR A 1 90  ? -23.614 -19.274 9.893   1.00 0.00 ? 90  TYR A HD2  2  
ATOM 7683   H HE1  . TYR A 1 90  ? -27.171 -21.872 12.081  1.00 0.00 ? 90  TYR A HE1  2  
ATOM 7684   H HE2  . TYR A 1 90  ? -25.390 -20.299 8.540   1.00 0.00 ? 90  TYR A HE2  2  
ATOM 7685   H HH   . TYR A 1 90  ? -27.062 -21.900 8.575   1.00 0.00 ? 90  TYR A HH   2  
ATOM 7686   N N    . PRO A 1 91  ? -20.036 -19.208 12.568  1.00 0.00 ? 91  PRO A N    2  
ATOM 7687   C CA   . PRO A 1 91  ? -20.155 -19.626 11.169  1.00 0.00 ? 91  PRO A CA   2  
ATOM 7688   C C    . PRO A 1 91  ? -19.714 -21.074 10.972  1.00 0.00 ? 91  PRO A C    2  
ATOM 7689   O O    . PRO A 1 91  ? -19.251 -21.728 11.908  1.00 0.00 ? 91  PRO A O    2  
ATOM 7690   C CB   . PRO A 1 91  ? -19.191 -18.683 10.450  1.00 0.00 ? 91  PRO A CB   2  
ATOM 7691   C CG   . PRO A 1 91  ? -18.130 -18.404 11.458  1.00 0.00 ? 91  PRO A CG   2  
ATOM 7692   C CD   . PRO A 1 91  ? -18.805 -18.433 12.807  1.00 0.00 ? 91  PRO A CD   2  
ATOM 7693   H HA   . PRO A 1 91  ? -21.175 -19.499 10.805  1.00 0.00 ? 91  PRO A HA   2  
ATOM 7694   H HB2  . PRO A 1 91  ? -18.785 -19.129 9.542   1.00 0.00 ? 91  PRO A HB2  2  
ATOM 7695   H HB3  . PRO A 1 91  ? -19.712 -17.752 10.223  1.00 0.00 ? 91  PRO A HB3  2  
ATOM 7696   H HG2  . PRO A 1 91  ? -17.402 -19.214 11.421  1.00 0.00 ? 91  PRO A HG2  2  
ATOM 7697   H HG3  . PRO A 1 91  ? -17.649 -17.443 11.275  1.00 0.00 ? 91  PRO A HG3  2  
ATOM 7698   H HD2  . PRO A 1 91  ? -18.168 -18.903 13.556  1.00 0.00 ? 91  PRO A HD2  2  
ATOM 7699   H HD3  . PRO A 1 91  ? -19.069 -17.421 13.114  1.00 0.00 ? 91  PRO A HD3  2  
ATOM 7700   N N    . LYS A 1 92  ? -19.864 -21.568 9.758   1.00 0.00 ? 92  LYS A N    2  
ATOM 7701   C CA   . LYS A 1 92  ? -19.474 -22.928 9.435   1.00 0.00 ? 92  LYS A CA   2  
ATOM 7702   C C    . LYS A 1 92  ? -18.881 -22.976 8.036   1.00 0.00 ? 92  LYS A C    2  
ATOM 7703   O O    . LYS A 1 92  ? -19.155 -22.103 7.214   1.00 0.00 ? 92  LYS A O    2  
ATOM 7704   C CB   . LYS A 1 92  ? -20.661 -23.894 9.569   1.00 0.00 ? 92  LYS A CB   2  
ATOM 7705   C CG   . LYS A 1 92  ? -21.950 -23.407 8.929   1.00 0.00 ? 92  LYS A CG   2  
ATOM 7706   C CD   . LYS A 1 92  ? -23.029 -24.475 8.988   1.00 0.00 ? 92  LYS A CD   2  
ATOM 7707   C CE   . LYS A 1 92  ? -24.316 -23.999 8.334   1.00 0.00 ? 92  LYS A CE   2  
ATOM 7708   N NZ   . LYS A 1 92  ? -25.225 -25.128 8.009   1.00 0.00 ? 92  LYS A NZ   2  
ATOM 7709   H H    . LYS A 1 92  ? -20.231 -20.997 9.049   1.00 0.00 ? 92  LYS A H    2  
ATOM 7710   H HA   . LYS A 1 92  ? -18.706 -23.237 10.144  1.00 0.00 ? 92  LYS A HA   2  
ATOM 7711   H HB2  . LYS A 1 92  ? -20.385 -24.838 9.101   1.00 0.00 ? 92  LYS A HB2  2  
ATOM 7712   H HB3  . LYS A 1 92  ? -20.849 -24.056 10.631  1.00 0.00 ? 92  LYS A HB3  2  
ATOM 7713   H HG2  . LYS A 1 92  ? -22.297 -22.520 9.459   1.00 0.00 ? 92  LYS A HG2  2  
ATOM 7714   H HG3  . LYS A 1 92  ? -21.756 -23.154 7.886   1.00 0.00 ? 92  LYS A HG3  2  
ATOM 7715   H HD2  . LYS A 1 92  ? -22.676 -25.366 8.469   1.00 0.00 ? 92  LYS A HD2  2  
ATOM 7716   H HD3  . LYS A 1 92  ? -23.231 -24.718 10.031  1.00 0.00 ? 92  LYS A HD3  2  
ATOM 7717   H HE2  . LYS A 1 92  ? -24.828 -23.318 9.014   1.00 0.00 ? 92  LYS A HE2  2  
ATOM 7718   H HE3  . LYS A 1 92  ? -24.070 -23.468 7.414   1.00 0.00 ? 92  LYS A HE3  2  
ATOM 7719   H HZ1  . LYS A 1 92  ? -24.790 -25.748 7.297   1.00 0.00 ? 92  LYS A HZ1  2  
ATOM 7720   H HZ2  . LYS A 1 92  ? -26.131 -24.766 7.631   1.00 0.00 ? 92  LYS A HZ2  2  
ATOM 7721   H HZ3  . LYS A 1 92  ? -25.421 -25.687 8.861   1.00 0.00 ? 92  LYS A HZ3  2  
ATOM 7722   N N    . LYS A 1 93  ? -18.059 -23.987 7.775   1.00 0.00 ? 93  LYS A N    2  
ATOM 7723   C CA   . LYS A 1 93  ? -17.414 -24.135 6.476   1.00 0.00 ? 93  LYS A CA   2  
ATOM 7724   C C    . LYS A 1 93  ? -18.449 -24.322 5.365   1.00 0.00 ? 93  LYS A C    2  
ATOM 7725   O O    . LYS A 1 93  ? -18.310 -23.775 4.273   1.00 0.00 ? 93  LYS A O    2  
ATOM 7726   C CB   . LYS A 1 93  ? -16.412 -25.290 6.501   1.00 0.00 ? 93  LYS A CB   2  
ATOM 7727   C CG   . LYS A 1 93  ? -15.442 -25.294 5.331   1.00 0.00 ? 93  LYS A CG   2  
ATOM 7728   C CD   . LYS A 1 93  ? -14.257 -26.209 5.594   1.00 0.00 ? 93  LYS A CD   2  
ATOM 7729   C CE   . LYS A 1 93  ? -13.455 -26.443 4.325   1.00 0.00 ? 93  LYS A CE   2  
ATOM 7730   N NZ   . LYS A 1 93  ? -14.168 -27.350 3.389   1.00 0.00 ? 93  LYS A NZ   2  
ATOM 7731   H H    . LYS A 1 93  ? -17.883 -24.647 8.474   1.00 0.00 ? 93  LYS A H    2  
ATOM 7732   H HA   . LYS A 1 93  ? -16.864 -23.216 6.271   1.00 0.00 ? 93  LYS A HA   2  
ATOM 7733   H HB2  . LYS A 1 93  ? -15.835 -25.223 7.423   1.00 0.00 ? 93  LYS A HB2  2  
ATOM 7734   H HB3  . LYS A 1 93  ? -16.969 -26.227 6.487   1.00 0.00 ? 93  LYS A HB3  2  
ATOM 7735   H HG2  . LYS A 1 93  ? -15.965 -25.639 4.438   1.00 0.00 ? 93  LYS A HG2  2  
ATOM 7736   H HG3  . LYS A 1 93  ? -15.078 -24.280 5.169   1.00 0.00 ? 93  LYS A HG3  2  
ATOM 7737   H HD2  . LYS A 1 93  ? -13.612 -25.750 6.343   1.00 0.00 ? 93  LYS A HD2  2  
ATOM 7738   H HD3  . LYS A 1 93  ? -14.622 -27.167 5.966   1.00 0.00 ? 93  LYS A HD3  2  
ATOM 7739   H HE2  . LYS A 1 93  ? -13.283 -25.487 3.832   1.00 0.00 ? 93  LYS A HE2  2  
ATOM 7740   H HE3  . LYS A 1 93  ? -12.496 -26.888 4.589   1.00 0.00 ? 93  LYS A HE3  2  
ATOM 7741   H HZ1  . LYS A 1 93  ? -13.937 -27.107 2.401   1.00 0.00 ? 93  LYS A HZ1  2  
ATOM 7742   H HZ2  . LYS A 1 93  ? -15.196 -27.265 3.523   1.00 0.00 ? 93  LYS A HZ2  2  
ATOM 7743   H HZ3  . LYS A 1 93  ? -13.889 -28.338 3.563   1.00 0.00 ? 93  LYS A HZ3  2  
ATOM 7744   N N    . LYS A 1 94  ? -19.475 -25.113 5.635   1.00 0.00 ? 94  LYS A N    2  
ATOM 7745   C CA   . LYS A 1 94  ? -20.532 -25.328 4.666   1.00 0.00 ? 94  LYS A CA   2  
ATOM 7746   C C    . LYS A 1 94  ? -21.809 -24.640 5.136   1.00 0.00 ? 94  LYS A C    2  
ATOM 7747   O O    . LYS A 1 94  ? -22.577 -25.202 5.917   1.00 0.00 ? 94  LYS A O    2  
ATOM 7748   C CB   . LYS A 1 94  ? -20.773 -26.827 4.474   1.00 0.00 ? 94  LYS A CB   2  
ATOM 7749   C CG   . LYS A 1 94  ? -21.657 -27.167 3.288   1.00 0.00 ? 94  LYS A CG   2  
ATOM 7750   C CD   . LYS A 1 94  ? -20.992 -26.783 1.976   1.00 0.00 ? 94  LYS A CD   2  
ATOM 7751   C CE   . LYS A 1 94  ? -21.818 -27.239 0.784   1.00 0.00 ? 94  LYS A CE   2  
ATOM 7752   N NZ   . LYS A 1 94  ? -21.956 -28.719 0.737   1.00 0.00 ? 94  LYS A NZ   2  
ATOM 7753   H H    . LYS A 1 94  ? -19.511 -25.598 6.483   1.00 0.00 ? 94  LYS A H    2  
ATOM 7754   H HA   . LYS A 1 94  ? -20.228 -24.896 3.713   1.00 0.00 ? 94  LYS A HA   2  
ATOM 7755   H HB2  . LYS A 1 94  ? -19.807 -27.312 4.332   1.00 0.00 ? 94  LYS A HB2  2  
ATOM 7756   H HB3  . LYS A 1 94  ? -21.246 -27.216 5.376   1.00 0.00 ? 94  LYS A HB3  2  
ATOM 7757   H HG2  . LYS A 1 94  ? -21.852 -28.240 3.286   1.00 0.00 ? 94  LYS A HG2  2  
ATOM 7758   H HG3  . LYS A 1 94  ? -22.599 -26.627 3.380   1.00 0.00 ? 94  LYS A HG3  2  
ATOM 7759   H HD2  . LYS A 1 94  ? -20.882 -25.699 1.937   1.00 0.00 ? 94  LYS A HD2  2  
ATOM 7760   H HD3  . LYS A 1 94  ? -20.009 -27.250 1.926   1.00 0.00 ? 94  LYS A HD3  2  
ATOM 7761   H HE2  . LYS A 1 94  ? -22.811 -26.794 0.851   1.00 0.00 ? 94  LYS A HE2  2  
ATOM 7762   H HE3  . LYS A 1 94  ? -21.334 -26.900 -0.132  1.00 0.00 ? 94  LYS A HE3  2  
ATOM 7763   H HZ1  . LYS A 1 94  ? -21.058 -29.174 0.993   1.00 0.00 ? 94  LYS A HZ1  2  
ATOM 7764   H HZ2  . LYS A 1 94  ? -22.228 -29.022 -0.221  1.00 0.00 ? 94  LYS A HZ2  2  
ATOM 7765   H HZ3  . LYS A 1 94  ? -22.691 -29.030 1.403   1.00 0.00 ? 94  LYS A HZ3  2  
ATOM 7766   N N    . MET A 1 95  ? -22.016 -23.415 4.679   1.00 0.00 ? 95  MET A N    2  
ATOM 7767   C CA   . MET A 1 95  ? -23.197 -22.647 5.057   1.00 0.00 ? 95  MET A CA   2  
ATOM 7768   C C    . MET A 1 95  ? -24.359 -22.977 4.133   1.00 0.00 ? 95  MET A C    2  
ATOM 7769   O O    . MET A 1 95  ? -24.172 -23.631 3.106   1.00 0.00 ? 95  MET A O    2  
ATOM 7770   C CB   . MET A 1 95  ? -22.897 -21.145 4.984   1.00 0.00 ? 95  MET A CB   2  
ATOM 7771   C CG   . MET A 1 95  ? -21.779 -20.683 5.904   1.00 0.00 ? 95  MET A CG   2  
ATOM 7772   S SD   . MET A 1 95  ? -22.373 -20.143 7.516   1.00 0.00 ? 95  MET A SD   2  
ATOM 7773   C CE   . MET A 1 95  ? -23.306 -18.686 7.049   1.00 0.00 ? 95  MET A CE   2  
ATOM 7774   H H    . MET A 1 95  ? -21.369 -23.022 4.060   1.00 0.00 ? 95  MET A H    2  
ATOM 7775   H HA   . MET A 1 95  ? -23.470 -22.905 6.080   1.00 0.00 ? 95  MET A HA   2  
ATOM 7776   H HB2  . MET A 1 95  ? -22.618 -20.902 3.959   1.00 0.00 ? 95  MET A HB2  2  
ATOM 7777   H HB3  . MET A 1 95  ? -23.804 -20.603 5.252   1.00 0.00 ? 95  MET A HB3  2  
ATOM 7778   H HG2  . MET A 1 95  ? -21.079 -21.506 6.046   1.00 0.00 ? 95  MET A HG2  2  
ATOM 7779   H HG3  . MET A 1 95  ? -21.252 -19.855 5.429   1.00 0.00 ? 95  MET A HG3  2  
ATOM 7780   H HE1  . MET A 1 95  ? -24.101 -18.971 6.359   1.00 0.00 ? 95  MET A HE1  2  
ATOM 7781   H HE2  . MET A 1 95  ? -23.744 -18.227 7.935   1.00 0.00 ? 95  MET A HE2  2  
ATOM 7782   H HE3  . MET A 1 95  ? -22.642 -17.971 6.563   1.00 0.00 ? 95  MET A HE3  2  
ATOM 7783   N N    . GLU A 1 96  ? -25.557 -22.534 4.503   1.00 0.00 ? 96  GLU A N    2  
ATOM 7784   C CA   . GLU A 1 96  ? -26.741 -22.767 3.690   1.00 0.00 ? 96  GLU A CA   2  
ATOM 7785   C C    . GLU A 1 96  ? -26.588 -22.050 2.356   1.00 0.00 ? 96  GLU A C    2  
ATOM 7786   O O    . GLU A 1 96  ? -25.961 -20.994 2.289   1.00 0.00 ? 96  GLU A O    2  
ATOM 7787   C CB   . GLU A 1 96  ? -27.992 -22.243 4.402   1.00 0.00 ? 96  GLU A CB   2  
ATOM 7788   C CG   . GLU A 1 96  ? -28.569 -23.175 5.456   1.00 0.00 ? 96  GLU A CG   2  
ATOM 7789   C CD   . GLU A 1 96  ? -27.654 -23.384 6.646   1.00 0.00 ? 96  GLU A CD   2  
ATOM 7790   O OE1  . GLU A 1 96  ? -27.690 -24.485 7.236   1.00 0.00 ? 96  GLU A OE1  2  
ATOM 7791   O OE2  . GLU A 1 96  ? -26.890 -22.460 6.992   1.00 0.00 ? 96  GLU A OE2  2  
ATOM 7792   H H    . GLU A 1 96  ? -25.653 -22.034 5.345   1.00 0.00 ? 96  GLU A H    2  
ATOM 7793   H HA   . GLU A 1 96  ? -26.849 -23.838 3.517   1.00 0.00 ? 96  GLU A HA   2  
ATOM 7794   H HB2  . GLU A 1 96  ? -27.736 -21.301 4.888   1.00 0.00 ? 96  GLU A HB2  2  
ATOM 7795   H HB3  . GLU A 1 96  ? -28.761 -22.065 3.650   1.00 0.00 ? 96  GLU A HB3  2  
ATOM 7796   H HG2  . GLU A 1 96  ? -29.509 -22.755 5.813   1.00 0.00 ? 96  GLU A HG2  2  
ATOM 7797   H HG3  . GLU A 1 96  ? -28.762 -24.143 4.994   1.00 0.00 ? 96  GLU A HG3  2  
ATOM 7798   H HE2  . GLU A 1 96  ? -26.339 -22.667 7.750   1.00 0.00 ? 96  GLU A HE2  2  
ATOM 7799   N N    . LYS A 1 97  ? -27.179 -22.607 1.304   1.00 0.00 ? 97  LYS A N    2  
ATOM 7800   C CA   . LYS A 1 97  ? -27.085 -22.011 -0.030  1.00 0.00 ? 97  LYS A CA   2  
ATOM 7801   C C    . LYS A 1 97  ? -27.659 -20.593 -0.057  1.00 0.00 ? 97  LYS A C    2  
ATOM 7802   O O    . LYS A 1 97  ? -27.285 -19.775 -0.894  1.00 0.00 ? 97  LYS A O    2  
ATOM 7803   C CB   . LYS A 1 97  ? -27.770 -22.896 -1.079  1.00 0.00 ? 97  LYS A CB   2  
ATOM 7804   C CG   . LYS A 1 97  ? -27.495 -22.475 -2.516  1.00 0.00 ? 97  LYS A CG   2  
ATOM 7805   C CD   . LYS A 1 97  ? -28.029 -23.491 -3.511  1.00 0.00 ? 97  LYS A CD   2  
ATOM 7806   C CE   . LYS A 1 97  ? -27.941 -22.961 -4.934  1.00 0.00 ? 97  LYS A CE   2  
ATOM 7807   N NZ   . LYS A 1 97  ? -28.390 -23.962 -5.934  1.00 0.00 ? 97  LYS A NZ   2  
ATOM 7808   H H    . LYS A 1 97  ? -27.691 -23.437 1.423   1.00 0.00 ? 97  LYS A H    2  
ATOM 7809   H HA   . LYS A 1 97  ? -26.028 -21.947 -0.286  1.00 0.00 ? 97  LYS A HA   2  
ATOM 7810   H HB2  . LYS A 1 97  ? -27.417 -23.919 -0.948  1.00 0.00 ? 97  LYS A HB2  2  
ATOM 7811   H HB3  . LYS A 1 97  ? -28.846 -22.859 -0.911  1.00 0.00 ? 97  LYS A HB3  2  
ATOM 7812   H HG2  . LYS A 1 97  ? -27.976 -21.514 -2.700  1.00 0.00 ? 97  LYS A HG2  2  
ATOM 7813   H HG3  . LYS A 1 97  ? -26.419 -22.376 -2.656  1.00 0.00 ? 97  LYS A HG3  2  
ATOM 7814   H HD2  . LYS A 1 97  ? -27.442 -24.407 -3.436  1.00 0.00 ? 97  LYS A HD2  2  
ATOM 7815   H HD3  . LYS A 1 97  ? -29.071 -23.708 -3.275  1.00 0.00 ? 97  LYS A HD3  2  
ATOM 7816   H HE2  . LYS A 1 97  ? -28.569 -22.073 -5.019  1.00 0.00 ? 97  LYS A HE2  2  
ATOM 7817   H HE3  . LYS A 1 97  ? -26.907 -22.690 -5.146  1.00 0.00 ? 97  LYS A HE3  2  
ATOM 7818   H HZ1  . LYS A 1 97  ? -28.581 -23.496 -6.843  1.00 0.00 ? 97  LYS A HZ1  2  
ATOM 7819   H HZ2  . LYS A 1 97  ? -29.258 -24.432 -5.609  1.00 0.00 ? 97  LYS A HZ2  2  
ATOM 7820   H HZ3  . LYS A 1 97  ? -27.653 -24.682 -6.077  1.00 0.00 ? 97  LYS A HZ3  2  
ATOM 7821   N N    . ARG A 1 98  ? -28.550 -20.305 0.885   1.00 0.00 ? 98  ARG A N    2  
ATOM 7822   C CA   . ARG A 1 98  ? -29.165 -18.985 0.973   1.00 0.00 ? 98  ARG A CA   2  
ATOM 7823   C C    . ARG A 1 98  ? -28.209 -17.951 1.581   1.00 0.00 ? 98  ARG A C    2  
ATOM 7824   O O    . ARG A 1 98  ? -28.505 -16.757 1.597   1.00 0.00 ? 98  ARG A O    2  
ATOM 7825   C CB   . ARG A 1 98  ? -30.492 -19.040 1.746   1.00 0.00 ? 98  ARG A CB   2  
ATOM 7826   C CG   . ARG A 1 98  ? -30.362 -19.303 3.239   1.00 0.00 ? 98  ARG A CG   2  
ATOM 7827   C CD   . ARG A 1 98  ? -31.711 -19.660 3.849   1.00 0.00 ? 98  ARG A CD   2  
ATOM 7828   N NE   . ARG A 1 98  ? -31.739 -19.456 5.299   1.00 0.00 ? 98  ARG A NE   2  
ATOM 7829   C CZ   . ARG A 1 98  ? -31.648 -20.436 6.202   1.00 0.00 ? 98  ARG A CZ   2  
ATOM 7830   N NH1  . ARG A 1 98  ? -31.541 -21.700 5.815   1.00 0.00 ? 98  ARG A NH1  2  
ATOM 7831   N NH2  . ARG A 1 98  ? -31.687 -20.147 7.494   1.00 0.00 ? 98  ARG A NH2  2  
ATOM 7832   H H    . ARG A 1 98  ? -28.794 -20.996 1.532   1.00 0.00 ? 98  ARG A H    2  
ATOM 7833   H HA   . ARG A 1 98  ? -29.390 -18.665 -0.044  1.00 0.00 ? 98  ARG A HA   2  
ATOM 7834   H HB2  . ARG A 1 98  ? -30.999 -18.085 1.614   1.00 0.00 ? 98  ARG A HB2  2  
ATOM 7835   H HB3  . ARG A 1 98  ? -31.099 -19.837 1.315   1.00 0.00 ? 98  ARG A HB3  2  
ATOM 7836   H HG2  . ARG A 1 98  ? -29.669 -20.130 3.396   1.00 0.00 ? 98  ARG A HG2  2  
ATOM 7837   H HG3  . ARG A 1 98  ? -29.976 -18.408 3.726   1.00 0.00 ? 98  ARG A HG3  2  
ATOM 7838   H HD2  . ARG A 1 98  ? -32.480 -19.037 3.392   1.00 0.00 ? 98  ARG A HD2  2  
ATOM 7839   H HD3  . ARG A 1 98  ? -31.926 -20.708 3.638   1.00 0.00 ? 98  ARG A HD3  2  
ATOM 7840   H HE   . ARG A 1 98  ? -31.839 -18.519 5.623   1.00 0.00 ? 98  ARG A HE   2  
ATOM 7841   H HH11 . ARG A 1 98  ? -31.532 -21.934 4.842   1.00 0.00 ? 98  ARG A HH11 2  
ATOM 7842   H HH12 . ARG A 1 98  ? -31.469 -22.430 6.501   1.00 0.00 ? 98  ARG A HH12 2  
ATOM 7843   H HH21 . ARG A 1 98  ? -31.790 -19.188 7.798   1.00 0.00 ? 98  ARG A HH21 2  
ATOM 7844   H HH22 . ARG A 1 98  ? -31.612 -20.878 8.180   1.00 0.00 ? 98  ARG A HH22 2  
ATOM 7845   N N    . PHE A 1 99  ? -27.064 -18.423 2.072   1.00 0.00 ? 99  PHE A N    2  
ATOM 7846   C CA   . PHE A 1 99  ? -26.057 -17.549 2.673   1.00 0.00 ? 99  PHE A CA   2  
ATOM 7847   C C    . PHE A 1 99  ? -24.765 -17.588 1.861   1.00 0.00 ? 99  PHE A C    2  
ATOM 7848   O O    . PHE A 1 99  ? -23.761 -16.987 2.243   1.00 0.00 ? 99  PHE A O    2  
ATOM 7849   C CB   . PHE A 1 99  ? -25.734 -18.009 4.102   1.00 0.00 ? 99  PHE A CB   2  
ATOM 7850   C CG   . PHE A 1 99  ? -26.870 -17.916 5.079   1.00 0.00 ? 99  PHE A CG   2  
ATOM 7851   C CD1  . PHE A 1 99  ? -27.453 -16.696 5.376   1.00 0.00 ? 99  PHE A CD1  2  
ATOM 7852   C CD2  . PHE A 1 99  ? -27.345 -19.050 5.714   1.00 0.00 ? 99  PHE A CD2  2  
ATOM 7853   C CE1  . PHE A 1 99  ? -28.490 -16.610 6.284   1.00 0.00 ? 99  PHE A CE1  2  
ATOM 7854   C CE2  . PHE A 1 99  ? -28.379 -18.972 6.626   1.00 0.00 ? 99  PHE A CE2  2  
ATOM 7855   C CZ   . PHE A 1 99  ? -28.953 -17.749 6.910   1.00 0.00 ? 99  PHE A CZ   2  
ATOM 7856   H H    . PHE A 1 99  ? -26.887 -19.388 2.028   1.00 0.00 ? 99  PHE A H    2  
ATOM 7857   H HA   . PHE A 1 99  ? -26.442 -16.530 2.697   1.00 0.00 ? 99  PHE A HA   2  
ATOM 7858   H HB2  . PHE A 1 99  ? -25.409 -19.049 4.058   1.00 0.00 ? 99  PHE A HB2  2  
ATOM 7859   H HB3  . PHE A 1 99  ? -24.912 -17.401 4.478   1.00 0.00 ? 99  PHE A HB3  2  
ATOM 7860   H HD1  . PHE A 1 99  ? -27.092 -15.800 4.891   1.00 0.00 ? 99  PHE A HD1  2  
ATOM 7861   H HD2  . PHE A 1 99  ? -26.900 -20.010 5.493   1.00 0.00 ? 99  PHE A HD2  2  
ATOM 7862   H HE1  . PHE A 1 99  ? -28.937 -15.652 6.504   1.00 0.00 ? 99  PHE A HE1  2  
ATOM 7863   H HE2  . PHE A 1 99  ? -28.739 -19.866 7.115   1.00 0.00 ? 99  PHE A HE2  2  
ATOM 7864   H HZ   . PHE A 1 99  ? -29.764 -17.684 7.621   1.00 0.00 ? 99  PHE A HZ   2  
ATOM 7865   N N    . VAL A 1 100 ? -24.792 -18.302 0.744   1.00 0.00 ? 100 VAL A N    2  
ATOM 7866   C CA   . VAL A 1 100 ? -23.614 -18.435 -0.099  1.00 0.00 ? 100 VAL A CA   2  
ATOM 7867   C C    . VAL A 1 100 ? -23.649 -17.458 -1.266  1.00 0.00 ? 100 VAL A C    2  
ATOM 7868   O O    . VAL A 1 100 ? -24.545 -17.508 -2.112  1.00 0.00 ? 100 VAL A O    2  
ATOM 7869   C CB   . VAL A 1 100 ? -23.443 -19.878 -0.630  1.00 0.00 ? 100 VAL A CB   2  
ATOM 7870   C CG1  . VAL A 1 100 ? -22.260 -19.973 -1.583  1.00 0.00 ? 100 VAL A CG1  2  
ATOM 7871   C CG2  . VAL A 1 100 ? -23.271 -20.855 0.524   1.00 0.00 ? 100 VAL A CG2  2  
ATOM 7872   H H    . VAL A 1 100 ? -25.626 -18.733 0.470   1.00 0.00 ? 100 VAL A H    2  
ATOM 7873   H HA   . VAL A 1 100 ? -22.745 -18.197 0.516   1.00 0.00 ? 100 VAL A HA   2  
ATOM 7874   H HB   . VAL A 1 100 ? -24.346 -20.149 -1.177  1.00 0.00 ? 100 VAL A HB   2  
ATOM 7875   H HG11 . VAL A 1 100 ? -22.169 -20.991 -1.962  1.00 0.00 ? 100 VAL A HG11 2  
ATOM 7876   H HG12 . VAL A 1 100 ? -22.412 -19.289 -2.418  1.00 0.00 ? 100 VAL A HG12 2  
ATOM 7877   H HG13 . VAL A 1 100 ? -21.346 -19.702 -1.054  1.00 0.00 ? 100 VAL A HG13 2  
ATOM 7878   H HG21 . VAL A 1 100 ? -24.140 -20.797 1.180   1.00 0.00 ? 100 VAL A HG21 2  
ATOM 7879   H HG22 . VAL A 1 100 ? -23.176 -21.869 0.138   1.00 0.00 ? 100 VAL A HG22 2  
ATOM 7880   H HG23 . VAL A 1 100 ? -22.374 -20.596 1.087   1.00 0.00 ? 100 VAL A HG23 2  
ATOM 7881   N N    . PHE A 1 101 ? -22.673 -16.567 -1.301  1.00 0.00 ? 101 PHE A N    2  
ATOM 7882   C CA   . PHE A 1 101 ? -22.567 -15.586 -2.363  1.00 0.00 ? 101 PHE A CA   2  
ATOM 7883   C C    . PHE A 1 101 ? -21.381 -15.923 -3.254  1.00 0.00 ? 101 PHE A C    2  
ATOM 7884   O O    . PHE A 1 101 ? -20.373 -16.458 -2.788  1.00 0.00 ? 101 PHE A O    2  
ATOM 7885   C CB   . PHE A 1 101 ? -22.383 -14.181 -1.782  1.00 0.00 ? 101 PHE A CB   2  
ATOM 7886   C CG   . PHE A 1 101 ? -23.589 -13.646 -1.069  1.00 0.00 ? 101 PHE A CG   2  
ATOM 7887   C CD1  . PHE A 1 101 ? -24.624 -13.061 -1.778  1.00 0.00 ? 101 PHE A CD1  2  
ATOM 7888   C CD2  . PHE A 1 101 ? -23.684 -13.722 0.311   1.00 0.00 ? 101 PHE A CD2  2  
ATOM 7889   C CE1  . PHE A 1 101 ? -25.734 -12.562 -1.126  1.00 0.00 ? 101 PHE A CE1  2  
ATOM 7890   C CE2  . PHE A 1 101 ? -24.790 -13.225 0.970   1.00 0.00 ? 101 PHE A CE2  2  
ATOM 7891   C CZ   . PHE A 1 101 ? -25.817 -12.644 0.251   1.00 0.00 ? 101 PHE A CZ   2  
ATOM 7892   H H    . PHE A 1 101 ? -21.990 -16.561 -0.590  1.00 0.00 ? 101 PHE A H    2  
ATOM 7893   H HA   . PHE A 1 101 ? -23.481 -15.609 -2.956  1.00 0.00 ? 101 PHE A HA   2  
ATOM 7894   H HB2  . PHE A 1 101 ? -21.550 -14.205 -1.079  1.00 0.00 ? 101 PHE A HB2  2  
ATOM 7895   H HB3  . PHE A 1 101 ? -22.134 -13.501 -2.596  1.00 0.00 ? 101 PHE A HB3  2  
ATOM 7896   H HD1  . PHE A 1 101 ? -24.564 -12.995 -2.854  1.00 0.00 ? 101 PHE A HD1  2  
ATOM 7897   H HD2  . PHE A 1 101 ? -22.883 -14.175 0.878   1.00 0.00 ? 101 PHE A HD2  2  
ATOM 7898   H HE1  . PHE A 1 101 ? -26.534 -12.107 -1.690  1.00 0.00 ? 101 PHE A HE1  2  
ATOM 7899   H HE2  . PHE A 1 101 ? -24.854 -13.291 2.046   1.00 0.00 ? 101 PHE A HE2  2  
ATOM 7900   H HZ   . PHE A 1 101 ? -26.683 -12.253 0.765   1.00 0.00 ? 101 PHE A HZ   2  
ATOM 7901   N N    . ASN A 1 102 ? -21.507 -15.622 -4.529  1.00 0.00 ? 102 ASN A N    2  
ATOM 7902   C CA   . ASN A 1 102 ? -20.444 -15.881 -5.477  1.00 0.00 ? 102 ASN A CA   2  
ATOM 7903   C C    . ASN A 1 102 ? -19.724 -14.581 -5.793  1.00 0.00 ? 102 ASN A C    2  
ATOM 7904   O O    . ASN A 1 102 ? -20.206 -13.765 -6.579  1.00 0.00 ? 102 ASN A O    2  
ATOM 7905   C CB   . ASN A 1 102 ? -20.989 -16.510 -6.758  1.00 0.00 ? 102 ASN A CB   2  
ATOM 7906   C CG   . ASN A 1 102 ? -20.265 -17.787 -7.157  1.00 0.00 ? 102 ASN A CG   2  
ATOM 7907   O OD1  . ASN A 1 102 ? -20.699 -18.496 -8.063  1.00 0.00 ? 102 ASN A OD1  2  
ATOM 7908   N ND2  . ASN A 1 102 ? -19.164 -18.096 -6.484  1.00 0.00 ? 102 ASN A ND2  2  
ATOM 7909   H H    . ASN A 1 102 ? -22.339 -15.197 -4.842  1.00 0.00 ? 102 ASN A H    2  
ATOM 7910   H HA   . ASN A 1 102 ? -19.737 -16.575 -5.023  1.00 0.00 ? 102 ASN A HA   2  
ATOM 7911   H HB2  . ASN A 1 102 ? -22.044 -16.740 -6.610  1.00 0.00 ? 102 ASN A HB2  2  
ATOM 7912   H HB3  . ASN A 1 102 ? -20.890 -15.788 -7.569  1.00 0.00 ? 102 ASN A HB3  2  
ATOM 7913   H HD21 . ASN A 1 102 ? -18.872 -17.495 -5.767  1.00 0.00 ? 102 ASN A HD21 2  
ATOM 7914   H HD22 . ASN A 1 102 ? -18.688 -18.921 -6.731  1.00 0.00 ? 102 ASN A HD22 2  
ATOM 7915   N N    . LYS A 1 103 ? -18.589 -14.383 -5.149  1.00 0.00 ? 103 LYS A N    2  
ATOM 7916   C CA   . LYS A 1 103 ? -17.796 -13.181 -5.348  1.00 0.00 ? 103 LYS A CA   2  
ATOM 7917   C C    . LYS A 1 103 ? -17.111 -13.217 -6.707  1.00 0.00 ? 103 LYS A C    2  
ATOM 7918   O O    . LYS A 1 103 ? -16.151 -13.963 -6.902  1.00 0.00 ? 103 LYS A O    2  
ATOM 7919   C CB   . LYS A 1 103 ? -16.755 -13.031 -4.236  1.00 0.00 ? 103 LYS A CB   2  
ATOM 7920   C CG   . LYS A 1 103 ? -15.777 -11.882 -4.442  1.00 0.00 ? 103 LYS A CG   2  
ATOM 7921   C CD   . LYS A 1 103 ? -14.614 -11.952 -3.462  1.00 0.00 ? 103 LYS A CD   2  
ATOM 7922   C CE   . LYS A 1 103 ? -13.854 -13.268 -3.575  1.00 0.00 ? 103 LYS A CE   2  
ATOM 7923   N NZ   . LYS A 1 103 ? -13.324 -13.497 -4.946  1.00 0.00 ? 103 LYS A NZ   2  
ATOM 7924   H H    . LYS A 1 103 ? -18.276 -15.076 -4.524  1.00 0.00 ? 103 LYS A H    2  
ATOM 7925   H HA   . LYS A 1 103 ? -18.464 -12.321 -5.316  1.00 0.00 ? 103 LYS A HA   2  
ATOM 7926   H HB2  . LYS A 1 103 ? -17.282 -12.866 -3.296  1.00 0.00 ? 103 LYS A HB2  2  
ATOM 7927   H HB3  . LYS A 1 103 ? -16.185 -13.958 -4.175  1.00 0.00 ? 103 LYS A HB3  2  
ATOM 7928   H HG2  . LYS A 1 103 ? -15.386 -11.930 -5.459  1.00 0.00 ? 103 LYS A HG2  2  
ATOM 7929   H HG3  . LYS A 1 103 ? -16.304 -10.939 -4.299  1.00 0.00 ? 103 LYS A HG3  2  
ATOM 7930   H HD2  . LYS A 1 103 ? -13.928 -11.130 -3.669  1.00 0.00 ? 103 LYS A HD2  2  
ATOM 7931   H HD3  . LYS A 1 103 ? -15.001 -11.854 -2.448  1.00 0.00 ? 103 LYS A HD3  2  
ATOM 7932   H HE2  . LYS A 1 103 ? -13.020 -13.254 -2.873  1.00 0.00 ? 103 LYS A HE2  2  
ATOM 7933   H HE3  . LYS A 1 103 ? -14.526 -14.085 -3.316  1.00 0.00 ? 103 LYS A HE3  2  
ATOM 7934   H HZ1  . LYS A 1 103 ? -14.089 -13.428 -5.647  1.00 0.00 ? 103 LYS A HZ1  2  
ATOM 7935   H HZ2  . LYS A 1 103 ? -12.892 -14.438 -5.013  1.00 0.00 ? 103 LYS A HZ2  2  
ATOM 7936   H HZ3  . LYS A 1 103 ? -12.593 -12.780 -5.175  1.00 0.00 ? 103 LYS A HZ3  2  
ATOM 7937   N N    . ILE A 1 104 ? -17.628 -12.430 -7.642  1.00 0.00 ? 104 ILE A N    2  
ATOM 7938   C CA   . ILE A 1 104 ? -17.067 -12.355 -8.983  1.00 0.00 ? 104 ILE A CA   2  
ATOM 7939   C C    . ILE A 1 104 ? -16.017 -11.255 -9.036  1.00 0.00 ? 104 ILE A C    2  
ATOM 7940   O O    . ILE A 1 104 ? -16.194 -10.190 -8.442  1.00 0.00 ? 104 ILE A O    2  
ATOM 7941   C CB   . ILE A 1 104 ? -18.160 -12.059 -10.036 1.00 0.00 ? 104 ILE A CB   2  
ATOM 7942   C CG1  . ILE A 1 104 ? -19.334 -13.028 -9.866  1.00 0.00 ? 104 ILE A CG1  2  
ATOM 7943   C CG2  . ILE A 1 104 ? -17.590 -12.154 -11.445 1.00 0.00 ? 104 ILE A CG2  2  
ATOM 7944   C CD1  . ILE A 1 104 ? -20.484 -12.772 -10.813 1.00 0.00 ? 104 ILE A CD1  2  
ATOM 7945   H H    . ILE A 1 104 ? -18.405 -11.872 -7.419  1.00 0.00 ? 104 ILE A H    2  
ATOM 7946   H HA   . ILE A 1 104 ? -16.599 -13.312 -9.218  1.00 0.00 ? 104 ILE A HA   2  
ATOM 7947   H HB   . ILE A 1 104 ? -18.525 -11.044 -9.879  1.00 0.00 ? 104 ILE A HB   2  
ATOM 7948   H HG12 . ILE A 1 104 ? -18.969 -14.041 -10.035 1.00 0.00 ? 104 ILE A HG12 2  
ATOM 7949   H HG13 . ILE A 1 104 ? -19.705 -12.941 -8.845  1.00 0.00 ? 104 ILE A HG13 2  
ATOM 7950   H HG21 . ILE A 1 104 ? -18.367 -11.924 -12.174 1.00 0.00 ? 104 ILE A HG21 2  
ATOM 7951   H HG22 . ILE A 1 104 ? -16.771 -11.442 -11.553 1.00 0.00 ? 104 ILE A HG22 2  
ATOM 7952   H HG23 . ILE A 1 104 ? -17.218 -13.164 -11.619 1.00 0.00 ? 104 ILE A HG23 2  
ATOM 7953   H HD11 . ILE A 1 104 ? -20.131 -12.863 -11.840 1.00 0.00 ? 104 ILE A HD11 2  
ATOM 7954   H HD12 . ILE A 1 104 ? -21.285 -13.491 -10.646 1.00 0.00 ? 104 ILE A HD12 2  
ATOM 7955   H HD13 . ILE A 1 104 ? -20.868 -11.765 -10.649 1.00 0.00 ? 104 ILE A HD13 2  
ATOM 7956   N N    . GLU A 1 105 ? -14.931 -11.511 -9.748  1.00 0.00 ? 105 GLU A N    2  
ATOM 7957   C CA   . GLU A 1 105 ? -13.855 -10.542 -9.867  1.00 0.00 ? 105 GLU A CA   2  
ATOM 7958   C C    . GLU A 1 105 ? -13.600 -10.208 -11.327 1.00 0.00 ? 105 GLU A C    2  
ATOM 7959   O O    . GLU A 1 105 ? -12.661 -10.719 -11.940 1.00 0.00 ? 105 GLU A O    2  
ATOM 7960   C CB   . GLU A 1 105 ? -12.589 -11.074 -9.197  1.00 0.00 ? 105 GLU A CB   2  
ATOM 7961   C CG   . GLU A 1 105 ? -12.807 -11.495 -7.755  1.00 0.00 ? 105 GLU A CG   2  
ATOM 7962   C CD   . GLU A 1 105 ? -11.609 -12.190 -7.151  1.00 0.00 ? 105 GLU A CD   2  
ATOM 7963   O OE1  . GLU A 1 105 ? -10.890 -12.890 -7.887  1.00 0.00 ? 105 GLU A OE1  2  
ATOM 7964   O OE2  . GLU A 1 105 ? -11.409 -12.067 -5.925  1.00 0.00 ? 105 GLU A OE2  2  
ATOM 7965   H H    . GLU A 1 105 ? -14.860 -12.368 -10.235 1.00 0.00 ? 105 GLU A H    2  
ATOM 7966   H HA   . GLU A 1 105 ? -14.158 -9.630  -9.353  1.00 0.00 ? 105 GLU A HA   2  
ATOM 7967   H HB2  . GLU A 1 105 ? -12.235 -11.937 -9.760  1.00 0.00 ? 105 GLU A HB2  2  
ATOM 7968   H HB3  . GLU A 1 105 ? -11.831 -10.291 -9.217  1.00 0.00 ? 105 GLU A HB3  2  
ATOM 7969   H HG2  . GLU A 1 105 ? -13.029 -10.607 -7.163  1.00 0.00 ? 105 GLU A HG2  2  
ATOM 7970   H HG3  . GLU A 1 105 ? -13.659 -12.174 -7.716  1.00 0.00 ? 105 GLU A HG3  2  
ATOM 7971   H HE2  . GLU A 1 105 ? -10.638 -12.542 -5.605  1.00 0.00 ? 105 GLU A HE2  2  
ATOM 7972   N N    . ILE A 1 106 ? -14.476 -9.381  -11.889 1.00 0.00 ? 106 ILE A N    2  
ATOM 7973   C CA   . ILE A 1 106 ? -14.376 -8.962  -13.287 1.00 0.00 ? 106 ILE A CA   2  
ATOM 7974   C C    . ILE A 1 106 ? -13.044 -8.266  -13.600 1.00 0.00 ? 106 ILE A C    2  
ATOM 7975   O O    . ILE A 1 106 ? -12.072 -8.914  -13.990 1.00 0.00 ? 106 ILE A O    2  
ATOM 7976   C CB   . ILE A 1 106 ? -15.574 -8.079  -13.716 1.00 0.00 ? 106 ILE A CB   2  
ATOM 7977   C CG1  . ILE A 1 106 ? -15.957 -7.095  -12.602 1.00 0.00 ? 106 ILE A CG1  2  
ATOM 7978   C CG2  . ILE A 1 106 ? -16.763 -8.952  -14.088 1.00 0.00 ? 106 ILE A CG2  2  
ATOM 7979   C CD1  . ILE A 1 106 ? -16.917 -6.009  -13.041 1.00 0.00 ? 106 ILE A CD1  2  
ATOM 7980   H H    . ILE A 1 106 ? -15.233 -9.060  -11.355 1.00 0.00 ? 106 ILE A H    2  
ATOM 7981   H HA   . ILE A 1 106 ? -14.413 -9.872  -13.887 1.00 0.00 ? 106 ILE A HA   2  
ATOM 7982   H HB   . ILE A 1 106 ? -15.279 -7.505  -14.594 1.00 0.00 ? 106 ILE A HB   2  
ATOM 7983   H HG12 . ILE A 1 106 ? -16.424 -7.658  -11.794 1.00 0.00 ? 106 ILE A HG12 2  
ATOM 7984   H HG13 . ILE A 1 106 ? -15.047 -6.620  -12.236 1.00 0.00 ? 106 ILE A HG13 2  
ATOM 7985   H HG21 . ILE A 1 106 ? -17.593 -8.324  -14.412 1.00 0.00 ? 106 ILE A HG21 2  
ATOM 7986   H HG22 . ILE A 1 106 ? -16.480 -9.625  -14.898 1.00 0.00 ? 106 ILE A HG22 2  
ATOM 7987   H HG23 . ILE A 1 106 ? -17.069 -9.537  -13.220 1.00 0.00 ? 106 ILE A HG23 2  
ATOM 7988   H HD11 . ILE A 1 106 ? -17.838 -6.466  -13.402 1.00 0.00 ? 106 ILE A HD11 2  
ATOM 7989   H HD12 . ILE A 1 106 ? -17.151 -5.345  -12.208 1.00 0.00 ? 106 ILE A HD12 2  
ATOM 7990   H HD13 . ILE A 1 106 ? -16.461 -5.428  -13.842 1.00 0.00 ? 106 ILE A HD13 2  
ATOM 7991   N N    . ASN A 1 107 ? -12.998 -6.956  -13.432 1.00 0.00 ? 107 ASN A N    2  
ATOM 7992   C CA   . ASN A 1 107 ? -11.781 -6.201  -13.695 1.00 0.00 ? 107 ASN A CA   2  
ATOM 7993   C C    . ASN A 1 107 ? -11.077 -5.845  -12.389 1.00 0.00 ? 107 ASN A C    2  
ATOM 7994   O O    . ASN A 1 107 ? -10.342 -6.662  -11.835 1.00 0.00 ? 107 ASN A O    2  
ATOM 7995   C CB   . ASN A 1 107 ? -12.043 -4.968  -14.581 1.00 0.00 ? 107 ASN A CB   2  
ATOM 7996   C CG   . ASN A 1 107 ? -13.318 -4.209  -14.232 1.00 0.00 ? 107 ASN A CG   2  
ATOM 7997   O OD1  . ASN A 1 107 ? -13.681 -4.079  -13.063 1.00 0.00 ? 107 ASN A OD1  2  
ATOM 7998   N ND2  . ASN A 1 107 ? -14.009 -3.715  -15.247 1.00 0.00 ? 107 ASN A ND2  2  
ATOM 7999   H H    . ASN A 1 107 ? -13.797 -6.483  -13.120 1.00 0.00 ? 107 ASN A H    2  
ATOM 8000   H HA   . ASN A 1 107 ? -11.113 -6.857  -14.253 1.00 0.00 ? 107 ASN A HA   2  
ATOM 8001   H HB2  . ASN A 1 107 ? -11.199 -4.287  -14.479 1.00 0.00 ? 107 ASN A HB2  2  
ATOM 8002   H HB3  . ASN A 1 107 ? -12.114 -5.298  -15.617 1.00 0.00 ? 107 ASN A HB3  2  
ATOM 8003   H HD21 . ASN A 1 107 ? -13.671 -3.864  -16.158 1.00 0.00 ? 107 ASN A HD21 2  
ATOM 8004   H HD22 . ASN A 1 107 ? -14.830 -3.214  -15.049 1.00 0.00 ? 107 ASN A HD22 2  
ATOM 8005   N N    . ASN A 1 108 ? -11.304 -4.641  -11.889 1.00 0.00 ? 108 ASN A N    2  
ATOM 8006   C CA   . ASN A 1 108 ? -10.701 -4.207  -10.637 1.00 0.00 ? 108 ASN A CA   2  
ATOM 8007   C C    . ASN A 1 108 ? -11.773 -4.031  -9.569  1.00 0.00 ? 108 ASN A C    2  
ATOM 8008   O O    . ASN A 1 108 ? -11.474 -3.813  -8.395  1.00 0.00 ? 108 ASN A O    2  
ATOM 8009   C CB   . ASN A 1 108 ? -9.887  -2.917  -10.828 1.00 0.00 ? 108 ASN A CB   2  
ATOM 8010   C CG   . ASN A 1 108 ? -10.673 -1.800  -11.489 1.00 0.00 ? 108 ASN A CG   2  
ATOM 8011   O OD1  . ASN A 1 108 ? -10.803 -1.752  -12.712 1.00 0.00 ? 108 ASN A OD1  2  
ATOM 8012   N ND2  . ASN A 1 108 ? -11.187 -0.882  -10.689 1.00 0.00 ? 108 ASN A ND2  2  
ATOM 8013   H H    . ASN A 1 108 ? -11.882 -4.018  -12.381 1.00 0.00 ? 108 ASN A H    2  
ATOM 8014   H HA   . ASN A 1 108 ? -10.017 -4.988  -10.306 1.00 0.00 ? 108 ASN A HA   2  
ATOM 8015   H HB2  . ASN A 1 108 ? -9.549  -2.573  -9.851  1.00 0.00 ? 108 ASN A HB2  2  
ATOM 8016   H HB3  . ASN A 1 108 ? -9.019  -3.143  -11.448 1.00 0.00 ? 108 ASN A HB3  2  
ATOM 8017   H HD21 . ASN A 1 108 ? -11.035 -0.971  -9.716  1.00 0.00 ? 108 ASN A HD21 2  
ATOM 8018   H HD22 . ASN A 1 108 ? -11.703 -0.155  -11.093 1.00 0.00 ? 108 ASN A HD22 2  
ATOM 8019   N N    . LYS A 1 109 ? -13.027 -4.115  -9.994  1.00 0.00 ? 109 LYS A N    2  
ATOM 8020   C CA   . LYS A 1 109 ? -14.158 -3.994  -9.084  1.00 0.00 ? 109 LYS A CA   2  
ATOM 8021   C C    . LYS A 1 109 ? -14.734 -5.380  -8.829  1.00 0.00 ? 109 LYS A C    2  
ATOM 8022   O O    . LYS A 1 109 ? -14.693 -6.243  -9.707  1.00 0.00 ? 109 LYS A O    2  
ATOM 8023   C CB   . LYS A 1 109 ? -15.234 -3.075  -9.673  1.00 0.00 ? 109 LYS A CB   2  
ATOM 8024   C CG   . LYS A 1 109 ? -14.716 -1.725  -10.151 1.00 0.00 ? 109 LYS A CG   2  
ATOM 8025   C CD   . LYS A 1 109 ? -14.103 -0.915  -9.017  1.00 0.00 ? 109 LYS A CD   2  
ATOM 8026   C CE   . LYS A 1 109 ? -15.166 -0.351  -8.088  1.00 0.00 ? 109 LYS A CE   2  
ATOM 8027   N NZ   . LYS A 1 109 ? -16.092 0.573   -8.790  1.00 0.00 ? 109 LYS A NZ   2  
ATOM 8028   H H    . LYS A 1 109 ? -13.195 -4.267  -10.947 1.00 0.00 ? 109 LYS A H    2  
ATOM 8029   H HA   . LYS A 1 109 ? -13.811 -3.570  -8.142  1.00 0.00 ? 109 LYS A HA   2  
ATOM 8030   H HB2  . LYS A 1 109 ? -15.691 -3.585  -10.522 1.00 0.00 ? 109 LYS A HB2  2  
ATOM 8031   H HB3  . LYS A 1 109 ? -15.989 -2.898  -8.907  1.00 0.00 ? 109 LYS A HB3  2  
ATOM 8032   H HG2  . LYS A 1 109 ? -13.957 -1.891  -10.916 1.00 0.00 ? 109 LYS A HG2  2  
ATOM 8033   H HG3  . LYS A 1 109 ? -15.545 -1.161  -10.578 1.00 0.00 ? 109 LYS A HG3  2  
ATOM 8034   H HD2  . LYS A 1 109 ? -13.438 -1.560  -8.442  1.00 0.00 ? 109 LYS A HD2  2  
ATOM 8035   H HD3  . LYS A 1 109 ? -13.531 -0.090  -9.441  1.00 0.00 ? 109 LYS A HD3  2  
ATOM 8036   H HE2  . LYS A 1 109 ? -15.742 -1.176  -7.669  1.00 0.00 ? 109 LYS A HE2  2  
ATOM 8037   H HE3  . LYS A 1 109 ? -14.676 0.191   -7.279  1.00 0.00 ? 109 LYS A HE3  2  
ATOM 8038   H HZ1  . LYS A 1 109 ? -15.645 0.951   -9.649  1.00 0.00 ? 109 LYS A HZ1  2  
ATOM 8039   H HZ2  . LYS A 1 109 ? -16.354 1.361   -8.170  1.00 0.00 ? 109 LYS A HZ2  2  
ATOM 8040   H HZ3  . LYS A 1 109 ? -16.967 0.064   -9.067  1.00 0.00 ? 109 LYS A HZ3  2  
ATOM 8041   N N    . LEU A 1 110 ? -15.267 -5.600  -7.635  1.00 0.00 ? 110 LEU A N    2  
ATOM 8042   C CA   . LEU A 1 110 ? -15.827 -6.897  -7.291  1.00 0.00 ? 110 LEU A CA   2  
ATOM 8043   C C    . LEU A 1 110 ? -17.346 -6.841  -7.231  1.00 0.00 ? 110 LEU A C    2  
ATOM 8044   O O    . LEU A 1 110 ? -17.922 -5.853  -6.775  1.00 0.00 ? 110 LEU A O    2  
ATOM 8045   C CB   . LEU A 1 110 ? -15.272 -7.386  -5.950  1.00 0.00 ? 110 LEU A CB   2  
ATOM 8046   C CG   . LEU A 1 110 ? -13.748 -7.396  -5.798  1.00 0.00 ? 110 LEU A CG   2  
ATOM 8047   C CD1  . LEU A 1 110 ? -13.350 -8.073  -4.498  1.00 0.00 ? 110 LEU A CD1  2  
ATOM 8048   C CD2  . LEU A 1 110 ? -13.085 -8.083  -6.980  1.00 0.00 ? 110 LEU A CD2  2  
ATOM 8049   H H    . LEU A 1 110 ? -15.294 -4.876  -6.976  1.00 0.00 ? 110 LEU A H    2  
ATOM 8050   H HA   . LEU A 1 110 ? -15.538 -7.607  -8.066  1.00 0.00 ? 110 LEU A HA   2  
ATOM 8051   H HB2  . LEU A 1 110 ? -15.677 -6.741  -5.170  1.00 0.00 ? 110 LEU A HB2  2  
ATOM 8052   H HB3  . LEU A 1 110 ? -15.626 -8.406  -5.798  1.00 0.00 ? 110 LEU A HB3  2  
ATOM 8053   H HG   . LEU A 1 110 ? -13.401 -6.363  -5.767  1.00 0.00 ? 110 LEU A HG   2  
ATOM 8054   H HD11 . LEU A 1 110 ? -12.265 -8.053  -4.388  1.00 0.00 ? 110 LEU A HD11 2  
ATOM 8055   H HD12 . LEU A 1 110 ? -13.808 -7.547  -3.660  1.00 0.00 ? 110 LEU A HD12 2  
ATOM 8056   H HD13 . LEU A 1 110 ? -13.693 -9.108  -4.508  1.00 0.00 ? 110 LEU A HD13 2  
ATOM 8057   H HD21 . LEU A 1 110 ? -13.359 -7.567  -7.900  1.00 0.00 ? 110 LEU A HD21 2  
ATOM 8058   H HD22 . LEU A 1 110 ? -12.001 -8.061  -6.864  1.00 0.00 ? 110 LEU A HD22 2  
ATOM 8059   H HD23 . LEU A 1 110 ? -13.420 -9.119  -7.031  1.00 0.00 ? 110 LEU A HD23 2  
ATOM 8060   N N    . GLU A 1 111 ? -17.981 -7.905  -7.700  1.00 0.00 ? 111 GLU A N    2  
ATOM 8061   C CA   . GLU A 1 111 ? -19.433 -8.001  -7.696  1.00 0.00 ? 111 GLU A CA   2  
ATOM 8062   C C    . GLU A 1 111 ? -19.862 -9.185  -6.838  1.00 0.00 ? 111 GLU A C    2  
ATOM 8063   O O    . GLU A 1 111 ? -19.166 -10.204 -6.781  1.00 0.00 ? 111 GLU A O    2  
ATOM 8064   C CB   . GLU A 1 111 ? -19.971 -8.141  -9.121  1.00 0.00 ? 111 GLU A CB   2  
ATOM 8065   C CG   . GLU A 1 111 ? -19.724 -6.915  -9.991  1.00 0.00 ? 111 GLU A CG   2  
ATOM 8066   C CD   . GLU A 1 111 ? -20.333 -7.041  -11.373 1.00 0.00 ? 111 GLU A CD   2  
ATOM 8067   O OE1  . GLU A 1 111 ? -21.196 -6.211  -11.735 1.00 0.00 ? 111 GLU A OE1  2  
ATOM 8068   O OE2  . GLU A 1 111 ? -19.946 -7.967  -12.116 1.00 0.00 ? 111 GLU A OE2  2  
ATOM 8069   H H    . GLU A 1 111 ? -17.458 -8.655  -8.056  1.00 0.00 ? 111 GLU A H    2  
ATOM 8070   H HA   . GLU A 1 111 ? -19.840 -7.088  -7.262  1.00 0.00 ? 111 GLU A HA   2  
ATOM 8071   H HB2  . GLU A 1 111 ? -19.488 -8.998  -9.589  1.00 0.00 ? 111 GLU A HB2  2  
ATOM 8072   H HB3  . GLU A 1 111 ? -21.046 -8.314  -9.068  1.00 0.00 ? 111 GLU A HB3  2  
ATOM 8073   H HG2  . GLU A 1 111 ? -20.156 -6.044  -9.497  1.00 0.00 ? 111 GLU A HG2  2  
ATOM 8074   H HG3  . GLU A 1 111 ? -18.649 -6.772  -10.095 1.00 0.00 ? 111 GLU A HG3  2  
ATOM 8075   H HE2  . GLU A 1 111 ? -20.371 -7.986  -12.977 1.00 0.00 ? 111 GLU A HE2  2  
ATOM 8076   N N    . PHE A 1 112 ? -20.996 -9.058  -6.167  1.00 0.00 ? 112 PHE A N    2  
ATOM 8077   C CA   . PHE A 1 112 ? -21.479 -10.117 -5.297  1.00 0.00 ? 112 PHE A CA   2  
ATOM 8078   C C    . PHE A 1 112 ? -22.784 -10.705 -5.817  1.00 0.00 ? 112 PHE A C    2  
ATOM 8079   O O    . PHE A 1 112 ? -23.843 -10.080 -5.726  1.00 0.00 ? 112 PHE A O    2  
ATOM 8080   C CB   . PHE A 1 112 ? -21.645 -9.605  -3.865  1.00 0.00 ? 112 PHE A CB   2  
ATOM 8081   C CG   . PHE A 1 112 ? -20.394 -8.992  -3.302  1.00 0.00 ? 112 PHE A CG   2  
ATOM 8082   C CD1  . PHE A 1 112 ? -19.413 -9.786  -2.732  1.00 0.00 ? 112 PHE A CD1  2  
ATOM 8083   C CD2  . PHE A 1 112 ? -20.195 -7.621  -3.352  1.00 0.00 ? 112 PHE A CD2  2  
ATOM 8084   C CE1  . PHE A 1 112 ? -18.256 -9.228  -2.222  1.00 0.00 ? 112 PHE A CE1  2  
ATOM 8085   C CE2  . PHE A 1 112 ? -19.042 -7.057  -2.843  1.00 0.00 ? 112 PHE A CE2  2  
ATOM 8086   C CZ   . PHE A 1 112 ? -18.071 -7.862  -2.278  1.00 0.00 ? 112 PHE A CZ   2  
ATOM 8087   H H    . PHE A 1 112 ? -21.531 -8.244  -6.274  1.00 0.00 ? 112 PHE A H    2  
ATOM 8088   H HA   . PHE A 1 112 ? -20.731 -10.910 -5.289  1.00 0.00 ? 112 PHE A HA   2  
ATOM 8089   H HB2  . PHE A 1 112 ? -22.437 -8.856  -3.852  1.00 0.00 ? 112 PHE A HB2  2  
ATOM 8090   H HB3  . PHE A 1 112 ? -21.942 -10.439 -3.228  1.00 0.00 ? 112 PHE A HB3  2  
ATOM 8091   H HD1  . PHE A 1 112 ? -19.554 -10.855 -2.685  1.00 0.00 ? 112 PHE A HD1  2  
ATOM 8092   H HD2  . PHE A 1 112 ? -20.950 -6.988  -3.793  1.00 0.00 ? 112 PHE A HD2  2  
ATOM 8093   H HE1  . PHE A 1 112 ? -17.499 -9.860  -1.781  1.00 0.00 ? 112 PHE A HE1  2  
ATOM 8094   H HE2  . PHE A 1 112 ? -18.900 -5.987  -2.887  1.00 0.00 ? 112 PHE A HE2  2  
ATOM 8095   H HZ   . PHE A 1 112 ? -17.168 -7.422  -1.880  1.00 0.00 ? 112 PHE A HZ   2  
ATOM 8096   N N    . GLU A 1 113 ? -22.692 -11.903 -6.368  1.00 0.00 ? 113 GLU A N    2  
ATOM 8097   C CA   . GLU A 1 113 ? -23.847 -12.599 -6.914  1.00 0.00 ? 113 GLU A CA   2  
ATOM 8098   C C    . GLU A 1 113 ? -24.338 -13.642 -5.921  1.00 0.00 ? 113 GLU A C    2  
ATOM 8099   O O    . GLU A 1 113 ? -23.579 -14.095 -5.071  1.00 0.00 ? 113 GLU A O    2  
ATOM 8100   C CB   . GLU A 1 113 ? -23.444 -13.285 -8.223  1.00 0.00 ? 113 GLU A CB   2  
ATOM 8101   C CG   . GLU A 1 113 ? -24.561 -14.042 -8.923  1.00 0.00 ? 113 GLU A CG   2  
ATOM 8102   C CD   . GLU A 1 113 ? -24.081 -14.751 -10.169 1.00 0.00 ? 113 GLU A CD   2  
ATOM 8103   O OE1  . GLU A 1 113 ? -24.687 -14.553 -11.243 1.00 0.00 ? 113 GLU A OE1  2  
ATOM 8104   O OE2  . GLU A 1 113 ? -23.085 -15.497 -10.088 1.00 0.00 ? 113 GLU A OE2  2  
ATOM 8105   H H    . GLU A 1 113 ? -21.815 -12.342 -6.404  1.00 0.00 ? 113 GLU A H    2  
ATOM 8106   H HA   . GLU A 1 113 ? -24.644 -11.880 -7.110  1.00 0.00 ? 113 GLU A HA   2  
ATOM 8107   H HB2  . GLU A 1 113 ? -23.075 -12.520 -8.906  1.00 0.00 ? 113 GLU A HB2  2  
ATOM 8108   H HB3  . GLU A 1 113 ? -22.644 -13.991 -8.002  1.00 0.00 ? 113 GLU A HB3  2  
ATOM 8109   H HG2  . GLU A 1 113 ? -24.971 -14.781 -8.234  1.00 0.00 ? 113 GLU A HG2  2  
ATOM 8110   H HG3  . GLU A 1 113 ? -25.345 -13.337 -9.199  1.00 0.00 ? 113 GLU A HG3  2  
ATOM 8111   H HE2  . GLU A 1 113 ? -22.834 -15.910 -10.918 1.00 0.00 ? 113 GLU A HE2  2  
ATOM 8112   N N    . SER A 1 114 ? -25.603 -14.004 -6.013  1.00 0.00 ? 114 SER A N    2  
ATOM 8113   C CA   . SER A 1 114 ? -26.159 -15.015 -5.136  1.00 0.00 ? 114 SER A CA   2  
ATOM 8114   C C    . SER A 1 114 ? -26.061 -16.377 -5.816  1.00 0.00 ? 114 SER A C    2  
ATOM 8115   O O    . SER A 1 114 ? -26.426 -16.517 -6.978  1.00 0.00 ? 114 SER A O    2  
ATOM 8116   C CB   . SER A 1 114 ? -27.622 -14.692 -4.810  1.00 0.00 ? 114 SER A CB   2  
ATOM 8117   O OG   . SER A 1 114 ? -28.177 -15.649 -3.921  1.00 0.00 ? 114 SER A OG   2  
ATOM 8118   H H    . SER A 1 114 ? -26.179 -13.585 -6.692  1.00 0.00 ? 114 SER A H    2  
ATOM 8119   H HA   . SER A 1 114 ? -25.586 -15.035 -4.209  1.00 0.00 ? 114 SER A HA   2  
ATOM 8120   H HB2  . SER A 1 114 ? -27.673 -13.707 -4.347  1.00 0.00 ? 114 SER A HB2  2  
ATOM 8121   H HB3  . SER A 1 114 ? -28.200 -14.690 -5.734  1.00 0.00 ? 114 SER A HB3  2  
ATOM 8122   H HG   . SER A 1 114 ? -28.087 -15.333 -3.014  1.00 0.00 ? 114 SER A HG   2  
ATOM 8123   N N    . ALA A 1 115 ? -25.544 -17.373 -5.103  1.00 0.00 ? 115 ALA A N    2  
ATOM 8124   C CA   . ALA A 1 115 ? -25.425 -18.713 -5.663  1.00 0.00 ? 115 ALA A CA   2  
ATOM 8125   C C    . ALA A 1 115 ? -26.814 -19.297 -5.876  1.00 0.00 ? 115 ALA A C    2  
ATOM 8126   O O    . ALA A 1 115 ? -27.049 -20.068 -6.804  1.00 0.00 ? 115 ALA A O    2  
ATOM 8127   C CB   . ALA A 1 115 ? -24.605 -19.607 -4.745  1.00 0.00 ? 115 ALA A CB   2  
ATOM 8128   H H    . ALA A 1 115 ? -25.228 -17.200 -4.187  1.00 0.00 ? 115 ALA A H    2  
ATOM 8129   H HA   . ALA A 1 115 ? -24.919 -18.645 -6.626  1.00 0.00 ? 115 ALA A HA   2  
ATOM 8130   H HB1  . ALA A 1 115 ? -24.513 -20.600 -5.186  1.00 0.00 ? 115 ALA A HB1  2  
ATOM 8131   H HB2  . ALA A 1 115 ? -23.612 -19.177 -4.612  1.00 0.00 ? 115 ALA A HB2  2  
ATOM 8132   H HB3  . ALA A 1 115 ? -25.100 -19.685 -3.777  1.00 0.00 ? 115 ALA A HB3  2  
ATOM 8133   N N    . GLN A 1 116 ? -27.722 -18.923 -4.983  1.00 0.00 ? 116 GLN A N    2  
ATOM 8134   C CA   . GLN A 1 116 ? -29.104 -19.368 -5.045  1.00 0.00 ? 116 GLN A CA   2  
ATOM 8135   C C    . GLN A 1 116 ? -29.818 -18.764 -6.254  1.00 0.00 ? 116 GLN A C    2  
ATOM 8136   O O    . GLN A 1 116 ? -30.629 -19.427 -6.903  1.00 0.00 ? 116 GLN A O    2  
ATOM 8137   C CB   . GLN A 1 116 ? -29.827 -18.988 -3.747  1.00 0.00 ? 116 GLN A CB   2  
ATOM 8138   C CG   . GLN A 1 116 ? -31.303 -19.356 -3.699  1.00 0.00 ? 116 GLN A CG   2  
ATOM 8139   C CD   . GLN A 1 116 ? -31.547 -20.848 -3.581  1.00 0.00 ? 116 GLN A CD   2  
ATOM 8140   O OE1  . GLN A 1 116 ? -30.792 -21.665 -4.108  1.00 0.00 ? 116 GLN A OE1  2  
ATOM 8141   N NE2  . GLN A 1 116 ? -32.608 -21.216 -2.885  1.00 0.00 ? 116 GLN A NE2  2  
ATOM 8142   H H    . GLN A 1 116 ? -27.435 -18.354 -4.240  1.00 0.00 ? 116 GLN A H    2  
ATOM 8143   H HA   . GLN A 1 116 ? -29.112 -20.453 -5.145  1.00 0.00 ? 116 GLN A HA   2  
ATOM 8144   H HB2  . GLN A 1 116 ? -29.327 -19.493 -2.921  1.00 0.00 ? 116 GLN A HB2  2  
ATOM 8145   H HB3  . GLN A 1 116 ? -29.744 -17.909 -3.617  1.00 0.00 ? 116 GLN A HB3  2  
ATOM 8146   H HG2  . GLN A 1 116 ? -31.757 -18.861 -2.841  1.00 0.00 ? 116 GLN A HG2  2  
ATOM 8147   H HG3  . GLN A 1 116 ? -31.779 -18.998 -4.612  1.00 0.00 ? 116 GLN A HG3  2  
ATOM 8148   H HE21 . GLN A 1 116 ? -33.168 -20.516 -2.491  1.00 0.00 ? 116 GLN A HE21 2  
ATOM 8149   H HE22 . GLN A 1 116 ? -32.793 -22.175 -2.792  1.00 0.00 ? 116 GLN A HE22 2  
ATOM 8150   N N    . PHE A 1 117 ? -29.496 -17.514 -6.567  1.00 0.00 ? 117 PHE A N    2  
ATOM 8151   C CA   . PHE A 1 117 ? -30.122 -16.825 -7.689  1.00 0.00 ? 117 PHE A CA   2  
ATOM 8152   C C    . PHE A 1 117 ? -29.084 -16.308 -8.683  1.00 0.00 ? 117 PHE A C    2  
ATOM 8153   O O    . PHE A 1 117 ? -28.514 -15.233 -8.495  1.00 0.00 ? 117 PHE A O    2  
ATOM 8154   C CB   . PHE A 1 117 ? -30.987 -15.665 -7.190  1.00 0.00 ? 117 PHE A CB   2  
ATOM 8155   C CG   . PHE A 1 117 ? -32.035 -16.064 -6.193  1.00 0.00 ? 117 PHE A CG   2  
ATOM 8156   C CD1  . PHE A 1 117 ? -33.141 -16.798 -6.585  1.00 0.00 ? 117 PHE A CD1  2  
ATOM 8157   C CD2  . PHE A 1 117 ? -31.916 -15.699 -4.861  1.00 0.00 ? 117 PHE A CD2  2  
ATOM 8158   C CE1  . PHE A 1 117 ? -34.109 -17.161 -5.670  1.00 0.00 ? 117 PHE A CE1  2  
ATOM 8159   C CE2  . PHE A 1 117 ? -32.881 -16.059 -3.939  1.00 0.00 ? 117 PHE A CE2  2  
ATOM 8160   C CZ   . PHE A 1 117 ? -33.979 -16.791 -4.344  1.00 0.00 ? 117 PHE A CZ   2  
ATOM 8161   H H    . PHE A 1 117 ? -28.811 -17.048 -6.043  1.00 0.00 ? 117 PHE A H    2  
ATOM 8162   H HA   . PHE A 1 117 ? -30.765 -17.539 -8.205  1.00 0.00 ? 117 PHE A HA   2  
ATOM 8163   H HB2  . PHE A 1 117 ? -30.336 -14.924 -6.728  1.00 0.00 ? 117 PHE A HB2  2  
ATOM 8164   H HB3  . PHE A 1 117 ? -31.483 -15.210 -8.048  1.00 0.00 ? 117 PHE A HB3  2  
ATOM 8165   H HD1  . PHE A 1 117 ? -33.248 -17.090 -7.620  1.00 0.00 ? 117 PHE A HD1  2  
ATOM 8166   H HD2  . PHE A 1 117 ? -31.059 -15.126 -4.540  1.00 0.00 ? 117 PHE A HD2  2  
ATOM 8167   H HE1  . PHE A 1 117 ? -34.968 -17.733 -5.989  1.00 0.00 ? 117 PHE A HE1  2  
ATOM 8168   H HE2  . PHE A 1 117 ? -32.775 -15.769 -2.904  1.00 0.00 ? 117 PHE A HE2  2  
ATOM 8169   H HZ   . PHE A 1 117 ? -34.735 -17.074 -3.627  1.00 0.00 ? 117 PHE A HZ   2  
ATOM 8170   N N    . PRO A 1 118 ? -28.825 -17.072 -9.755  1.00 0.00 ? 118 PRO A N    2  
ATOM 8171   C CA   . PRO A 1 118 ? -27.857 -16.686 -10.787 1.00 0.00 ? 118 PRO A CA   2  
ATOM 8172   C C    . PRO A 1 118 ? -28.291 -15.412 -11.510 1.00 0.00 ? 118 PRO A C    2  
ATOM 8173   O O    . PRO A 1 118 ? -29.475 -15.231 -11.802 1.00 0.00 ? 118 PRO A O    2  
ATOM 8174   C CB   . PRO A 1 118 ? -27.870 -17.872 -11.760 1.00 0.00 ? 118 PRO A CB   2  
ATOM 8175   C CG   . PRO A 1 118 ? -28.462 -18.998 -10.985 1.00 0.00 ? 118 PRO A CG   2  
ATOM 8176   C CD   . PRO A 1 118 ? -29.447 -18.372 -10.045 1.00 0.00 ? 118 PRO A CD   2  
ATOM 8177   H HA   . PRO A 1 118 ? -26.865 -16.546 -10.358 1.00 0.00 ? 118 PRO A HA   2  
ATOM 8178   H HB2  . PRO A 1 118 ? -28.447 -17.651 -12.659 1.00 0.00 ? 118 PRO A HB2  2  
ATOM 8179   H HB3  . PRO A 1 118 ? -26.842 -18.127 -12.014 1.00 0.00 ? 118 PRO A HB3  2  
ATOM 8180   H HG2  . PRO A 1 118 ? -29.004 -19.645 -11.675 1.00 0.00 ? 118 PRO A HG2  2  
ATOM 8181   H HG3  . PRO A 1 118 ? -27.698 -19.561 -10.448 1.00 0.00 ? 118 PRO A HG3  2  
ATOM 8182   H HD2  . PRO A 1 118 ? -30.428 -18.265 -10.507 1.00 0.00 ? 118 PRO A HD2  2  
ATOM 8183   H HD3  . PRO A 1 118 ? -29.521 -18.956 -9.128  1.00 0.00 ? 118 PRO A HD3  2  
ATOM 8184   N N    . ASN A 1 119 ? -27.322 -14.537 -11.780 1.00 0.00 ? 119 ASN A N    2  
ATOM 8185   C CA   . ASN A 1 119 ? -27.563 -13.261 -12.462 1.00 0.00 ? 119 ASN A CA   2  
ATOM 8186   C C    . ASN A 1 119 ? -28.191 -12.217 -11.540 1.00 0.00 ? 119 ASN A C    2  
ATOM 8187   O O    . ASN A 1 119 ? -28.536 -11.115 -11.972 1.00 0.00 ? 119 ASN A O    2  
ATOM 8188   C CB   . ASN A 1 119 ? -28.337 -13.410 -13.780 1.00 0.00 ? 119 ASN A CB   2  
ATOM 8189   C CG   . ASN A 1 119 ? -27.465 -13.874 -14.938 1.00 0.00 ? 119 ASN A CG   2  
ATOM 8190   O OD1  . ASN A 1 119 ? -27.937 -14.553 -15.849 1.00 0.00 ? 119 ASN A OD1  2  
ATOM 8191   N ND2  . ASN A 1 119 ? -26.189 -13.514 -14.916 1.00 0.00 ? 119 ASN A ND2  2  
ATOM 8192   H H    . ASN A 1 119 ? -26.396 -14.754 -11.507 1.00 0.00 ? 119 ASN A H    2  
ATOM 8193   H HA   . ASN A 1 119 ? -26.578 -12.879 -12.731 1.00 0.00 ? 119 ASN A HA   2  
ATOM 8194   H HB2  . ASN A 1 119 ? -29.137 -14.137 -13.633 1.00 0.00 ? 119 ASN A HB2  2  
ATOM 8195   H HB3  . ASN A 1 119 ? -28.773 -12.445 -14.040 1.00 0.00 ? 119 ASN A HB3  2  
ATOM 8196   H HD21 . ASN A 1 119 ? -25.871 -12.973 -14.162 1.00 0.00 ? 119 ASN A HD21 2  
ATOM 8197   H HD22 . ASN A 1 119 ? -25.612 -13.803 -15.657 1.00 0.00 ? 119 ASN A HD22 2  
ATOM 8198   N N    . TRP A 1 120 ? -28.330 -12.575 -10.270 1.00 0.00 ? 120 TRP A N    2  
ATOM 8199   C CA   . TRP A 1 120 ? -28.873 -11.673 -9.268  1.00 0.00 ? 120 TRP A CA   2  
ATOM 8200   C C    . TRP A 1 120 ? -27.736 -11.223 -8.359  1.00 0.00 ? 120 TRP A C    2  
ATOM 8201   O O    . TRP A 1 120 ? -27.198 -12.015 -7.579  1.00 0.00 ? 120 TRP A O    2  
ATOM 8202   C CB   . TRP A 1 120 ? -29.975 -12.354 -8.449  1.00 0.00 ? 120 TRP A CB   2  
ATOM 8203   C CG   . TRP A 1 120 ? -31.279 -12.502 -9.178  1.00 0.00 ? 120 TRP A CG   2  
ATOM 8204   C CD1  . TRP A 1 120 ? -31.655 -13.537 -9.984  1.00 0.00 ? 120 TRP A CD1  2  
ATOM 8205   C CD2  . TRP A 1 120 ? -32.380 -11.586 -9.162  1.00 0.00 ? 120 TRP A CD2  2  
ATOM 8206   N NE1  . TRP A 1 120 ? -32.922 -13.323 -10.470 1.00 0.00 ? 120 TRP A NE1  2  
ATOM 8207   C CE2  . TRP A 1 120 ? -33.389 -12.131 -9.982  1.00 0.00 ? 120 TRP A CE2  2  
ATOM 8208   C CE3  . TRP A 1 120 ? -32.614 -10.358 -8.536  1.00 0.00 ? 120 TRP A CE3  2  
ATOM 8209   C CZ2  . TRP A 1 120 ? -34.608 -11.491 -10.190 1.00 0.00 ? 120 TRP A CZ2  2  
ATOM 8210   C CZ3  . TRP A 1 120 ? -33.825 -9.725  -8.743  1.00 0.00 ? 120 TRP A CZ3  2  
ATOM 8211   C CH2  . TRP A 1 120 ? -34.807 -10.292 -9.564  1.00 0.00 ? 120 TRP A CH2  2  
ATOM 8212   H H    . TRP A 1 120 ? -28.053 -13.475 -9.996  1.00 0.00 ? 120 TRP A H    2  
ATOM 8213   H HA   . TRP A 1 120 ? -29.298 -10.803 -9.769  1.00 0.00 ? 120 TRP A HA   2  
ATOM 8214   H HB2  . TRP A 1 120 ? -29.628 -13.345 -8.158  1.00 0.00 ? 120 TRP A HB2  2  
ATOM 8215   H HB3  . TRP A 1 120 ? -30.148 -11.769 -7.546  1.00 0.00 ? 120 TRP A HB3  2  
ATOM 8216   H HD1  . TRP A 1 120 ? -31.045 -14.399 -10.208 1.00 0.00 ? 120 TRP A HD1  2  
ATOM 8217   H HE1  . TRP A 1 120 ? -33.415 -13.928 -11.068 1.00 0.00 ? 120 TRP A HE1  2  
ATOM 8218   H HE3  . TRP A 1 120 ? -31.863 -9.913  -7.901  1.00 0.00 ? 120 TRP A HE3  2  
ATOM 8219   H HZ2  . TRP A 1 120 ? -35.368 -11.925 -10.822 1.00 0.00 ? 120 TRP A HZ2  2  
ATOM 8220   H HZ3  . TRP A 1 120 ? -34.017 -8.776  -8.264  1.00 0.00 ? 120 TRP A HZ3  2  
ATOM 8221   H HH2  . TRP A 1 120 ? -35.742 -9.770  -9.705  1.00 0.00 ? 120 TRP A HH2  2  
ATOM 8222   N N    . TYR A 1 121 ? -27.364 -9.960  -8.472  1.00 0.00 ? 121 TYR A N    2  
ATOM 8223   C CA   . TYR A 1 121 ? -26.267 -9.412  -7.694  1.00 0.00 ? 121 TYR A CA   2  
ATOM 8224   C C    . TYR A 1 121 ? -26.769 -8.380  -6.700  1.00 0.00 ? 121 TYR A C    2  
ATOM 8225   O O    . TYR A 1 121 ? -27.832 -7.788  -6.889  1.00 0.00 ? 121 TYR A O    2  
ATOM 8226   C CB   . TYR A 1 121 ? -25.245 -8.749  -8.629  1.00 0.00 ? 121 TYR A CB   2  
ATOM 8227   C CG   . TYR A 1 121 ? -24.910 -9.553  -9.869  1.00 0.00 ? 121 TYR A CG   2  
ATOM 8228   C CD1  . TYR A 1 121 ? -25.699 -9.470  -11.012 1.00 0.00 ? 121 TYR A CD1  2  
ATOM 8229   C CD2  . TYR A 1 121 ? -23.812 -10.397 -9.895  1.00 0.00 ? 121 TYR A CD2  2  
ATOM 8230   C CE1  . TYR A 1 121 ? -25.401 -10.210 -12.141 1.00 0.00 ? 121 TYR A CE1  2  
ATOM 8231   C CE2  . TYR A 1 121 ? -23.506 -11.135 -11.021 1.00 0.00 ? 121 TYR A CE2  2  
ATOM 8232   C CZ   . TYR A 1 121 ? -24.303 -11.041 -12.138 1.00 0.00 ? 121 TYR A CZ   2  
ATOM 8233   O OH   . TYR A 1 121 ? -24.004 -11.785 -13.258 1.00 0.00 ? 121 TYR A OH   2  
ATOM 8234   H H    . TYR A 1 121 ? -27.856 -9.370  -9.087  1.00 0.00 ? 121 TYR A H    2  
ATOM 8235   H HA   . TYR A 1 121 ? -25.784 -10.225 -7.152  1.00 0.00 ? 121 TYR A HA   2  
ATOM 8236   H HB2  . TYR A 1 121 ? -25.642 -7.784  -8.944  1.00 0.00 ? 121 TYR A HB2  2  
ATOM 8237   H HB3  . TYR A 1 121 ? -24.324 -8.583  -8.069  1.00 0.00 ? 121 TYR A HB3  2  
ATOM 8238   H HD1  . TYR A 1 121 ? -26.559 -8.817  -11.017 1.00 0.00 ? 121 TYR A HD1  2  
ATOM 8239   H HD2  . TYR A 1 121 ? -23.184 -10.479 -9.020  1.00 0.00 ? 121 TYR A HD2  2  
ATOM 8240   H HE1  . TYR A 1 121 ? -26.025 -10.136 -13.019 1.00 0.00 ? 121 TYR A HE1  2  
ATOM 8241   H HE2  . TYR A 1 121 ? -22.643 -11.785 -11.024 1.00 0.00 ? 121 TYR A HE2  2  
ATOM 8242   H HH   . TYR A 1 121 ? -23.768 -12.683 -12.989 1.00 0.00 ? 121 TYR A HH   2  
ATOM 8243   N N    . ILE A 1 122 ? -26.009 -8.179  -5.635  1.00 0.00 ? 122 ILE A N    2  
ATOM 8244   C CA   . ILE A 1 122 ? -26.358 -7.185  -4.635  1.00 0.00 ? 122 ILE A CA   2  
ATOM 8245   C C    . ILE A 1 122 ? -26.210 -5.815  -5.283  1.00 0.00 ? 122 ILE A C    2  
ATOM 8246   O O    . ILE A 1 122 ? -25.134 -5.473  -5.767  1.00 0.00 ? 122 ILE A O    2  
ATOM 8247   C CB   . ILE A 1 122 ? -25.432 -7.282  -3.403  1.00 0.00 ? 122 ILE A CB   2  
ATOM 8248   C CG1  . ILE A 1 122 ? -25.593 -8.645  -2.723  1.00 0.00 ? 122 ILE A CG1  2  
ATOM 8249   C CG2  . ILE A 1 122 ? -25.722 -6.155  -2.423  1.00 0.00 ? 122 ILE A CG2  2  
ATOM 8250   C CD1  . ILE A 1 122 ? -24.647 -8.872  -1.562  1.00 0.00 ? 122 ILE A CD1  2  
ATOM 8251   H H    . ILE A 1 122 ? -25.188 -8.708  -5.524  1.00 0.00 ? 122 ILE A H    2  
ATOM 8252   H HA   . ILE A 1 122 ? -27.390 -7.336  -4.318  1.00 0.00 ? 122 ILE A HA   2  
ATOM 8253   H HB   . ILE A 1 122 ? -24.400 -7.185  -3.741  1.00 0.00 ? 122 ILE A HB   2  
ATOM 8254   H HG12 . ILE A 1 122 ? -26.615 -8.724  -2.352  1.00 0.00 ? 122 ILE A HG12 2  
ATOM 8255   H HG13 . ILE A 1 122 ? -25.415 -9.422  -3.467  1.00 0.00 ? 122 ILE A HG13 2  
ATOM 8256   H HG21 . ILE A 1 122 ? -25.046 -6.226  -1.570  1.00 0.00 ? 122 ILE A HG21 2  
ATOM 8257   H HG22 . ILE A 1 122 ? -25.578 -5.196  -2.920  1.00 0.00 ? 122 ILE A HG22 2  
ATOM 8258   H HG23 . ILE A 1 122 ? -26.752 -6.233  -2.076  1.00 0.00 ? 122 ILE A HG23 2  
ATOM 8259   H HD11 . ILE A 1 122 ? -24.818 -8.108  -0.804  1.00 0.00 ? 122 ILE A HD11 2  
ATOM 8260   H HD12 . ILE A 1 122 ? -24.811 -9.855  -1.120  1.00 0.00 ? 122 ILE A HD12 2  
ATOM 8261   H HD13 . ILE A 1 122 ? -23.619 -8.808  -1.917  1.00 0.00 ? 122 ILE A HD13 2  
ATOM 8262   N N    . SER A 1 123 ? -27.288 -5.052  -5.324  1.00 0.00 ? 123 SER A N    2  
ATOM 8263   C CA   . SER A 1 123 ? -27.251 -3.751  -5.962  1.00 0.00 ? 123 SER A CA   2  
ATOM 8264   C C    . SER A 1 123 ? -27.681 -2.631  -5.029  1.00 0.00 ? 123 SER A C    2  
ATOM 8265   O O    . SER A 1 123 ? -28.401 -2.855  -4.052  1.00 0.00 ? 123 SER A O    2  
ATOM 8266   C CB   . SER A 1 123 ? -28.148 -3.763  -7.201  1.00 0.00 ? 123 SER A CB   2  
ATOM 8267   O OG   . SER A 1 123 ? -28.053 -5.004  -7.876  1.00 0.00 ? 123 SER A OG   2  
ATOM 8268   H H    . SER A 1 123 ? -28.122 -5.360  -4.905  1.00 0.00 ? 123 SER A H    2  
ATOM 8269   H HA   . SER A 1 123 ? -26.225 -3.559  -6.275  1.00 0.00 ? 123 SER A HA   2  
ATOM 8270   H HB2  . SER A 1 123 ? -29.181 -3.599  -6.896  1.00 0.00 ? 123 SER A HB2  2  
ATOM 8271   H HB3  . SER A 1 123 ? -27.837 -2.965  -7.875  1.00 0.00 ? 123 SER A HB3  2  
ATOM 8272   H HG   . SER A 1 123 ? -27.480 -5.595  -7.375  1.00 0.00 ? 123 SER A HG   2  
ATOM 8273   N N    . THR A 1 124 ? -27.238 -1.424  -5.351  1.00 0.00 ? 124 THR A N    2  
ATOM 8274   C CA   . THR A 1 124 ? -27.580 -0.242  -4.588  1.00 0.00 ? 124 THR A CA   2  
ATOM 8275   C C    . THR A 1 124 ? -28.170 0.785   -5.547  1.00 0.00 ? 124 THR A C    2  
ATOM 8276   O O    . THR A 1 124 ? -27.867 0.766   -6.745  1.00 0.00 ? 124 THR A O    2  
ATOM 8277   C CB   . THR A 1 124 ? -26.343 0.363   -3.891  1.00 0.00 ? 124 THR A CB   2  
ATOM 8278   O OG1  . THR A 1 124 ? -25.233 0.398   -4.801  1.00 0.00 ? 124 THR A OG1  2  
ATOM 8279   C CG2  . THR A 1 124 ? -25.968 -0.454  -2.664  1.00 0.00 ? 124 THR A CG2  2  
ATOM 8280   H H    . THR A 1 124 ? -26.675 -1.312  -6.146  1.00 0.00 ? 124 THR A H    2  
ATOM 8281   H HA   . THR A 1 124 ? -28.319 -0.507  -3.833  1.00 0.00 ? 124 THR A HA   2  
ATOM 8282   H HB   . THR A 1 124 ? -26.578 1.381   -3.579  1.00 0.00 ? 124 THR A HB   2  
ATOM 8283   H HG1  . THR A 1 124 ? -24.503 0.895   -4.402  1.00 0.00 ? 124 THR A HG1  2  
ATOM 8284   H HG21 . THR A 1 124 ? -25.731 -1.474  -2.966  1.00 0.00 ? 124 THR A HG21 2  
ATOM 8285   H HG22 . THR A 1 124 ? -25.100 -0.010  -2.176  1.00 0.00 ? 124 THR A HG22 2  
ATOM 8286   H HG23 . THR A 1 124 ? -26.806 -0.467  -1.967  1.00 0.00 ? 124 THR A HG23 2  
ATOM 8287   N N    . SER A 1 125 ? -29.012 1.667   -5.037  1.00 0.00 ? 125 SER A N    2  
ATOM 8288   C CA   . SER A 1 125 ? -29.634 2.676   -5.871  1.00 0.00 ? 125 SER A CA   2  
ATOM 8289   C C    . SER A 1 125 ? -28.726 3.890   -6.022  1.00 0.00 ? 125 SER A C    2  
ATOM 8290   O O    . SER A 1 125 ? -27.808 4.097   -5.224  1.00 0.00 ? 125 SER A O    2  
ATOM 8291   C CB   . SER A 1 125 ? -30.981 3.083   -5.282  1.00 0.00 ? 125 SER A CB   2  
ATOM 8292   O OG   . SER A 1 125 ? -31.779 1.942   -5.036  1.00 0.00 ? 125 SER A OG   2  
ATOM 8293   H H    . SER A 1 125 ? -29.217 1.645   -4.080  1.00 0.00 ? 125 SER A H    2  
ATOM 8294   H HA   . SER A 1 125 ? -29.803 2.247   -6.859  1.00 0.00 ? 125 SER A HA   2  
ATOM 8295   H HB2  . SER A 1 125 ? -30.816 3.614   -4.344  1.00 0.00 ? 125 SER A HB2  2  
ATOM 8296   H HB3  . SER A 1 125 ? -31.497 3.736   -5.985  1.00 0.00 ? 125 SER A HB3  2  
ATOM 8297   H HG   . SER A 1 125 ? -31.696 1.330   -5.776  1.00 0.00 ? 125 SER A HG   2  
ATOM 8298   N N    . GLN A 1 126 ? -28.970 4.673   -7.064  1.00 0.00 ? 126 GLN A N    2  
ATOM 8299   C CA   . GLN A 1 126 ? -28.190 5.876   -7.323  1.00 0.00 ? 126 GLN A CA   2  
ATOM 8300   C C    . GLN A 1 126 ? -28.521 6.943   -6.287  1.00 0.00 ? 126 GLN A C    2  
ATOM 8301   O O    . GLN A 1 126 ? -27.672 7.757   -5.918  1.00 0.00 ? 126 GLN A O    2  
ATOM 8302   C CB   . GLN A 1 126 ? -28.499 6.415   -8.724  1.00 0.00 ? 126 GLN A CB   2  
ATOM 8303   C CG   . GLN A 1 126 ? -28.083 5.499   -9.864  1.00 0.00 ? 126 GLN A CG   2  
ATOM 8304   C CD   . GLN A 1 126 ? -26.578 5.381   -10.004 1.00 0.00 ? 126 GLN A CD   2  
ATOM 8305   O OE1  . GLN A 1 126 ? -25.832 6.285   -9.624  1.00 0.00 ? 126 GLN A OE1  2  
ATOM 8306   N NE2  . GLN A 1 126 ? -26.123 4.268   -10.557 1.00 0.00 ? 126 GLN A NE2  2  
ATOM 8307   H H    . GLN A 1 126 ? -29.693 4.429   -7.685  1.00 0.00 ? 126 GLN A H    2  
ATOM 8308   H HA   . GLN A 1 126 ? -27.131 5.629   -7.260  1.00 0.00 ? 126 GLN A HA   2  
ATOM 8309   H HB2  . GLN A 1 126 ? -29.574 6.579   -8.795  1.00 0.00 ? 126 GLN A HB2  2  
ATOM 8310   H HB3  . GLN A 1 126 ? -27.977 7.365   -8.844  1.00 0.00 ? 126 GLN A HB3  2  
ATOM 8311   H HG2  . GLN A 1 126 ? -28.496 4.507   -9.684  1.00 0.00 ? 126 GLN A HG2  2  
ATOM 8312   H HG3  . GLN A 1 126 ? -28.490 5.894   -10.795 1.00 0.00 ? 126 GLN A HG3  2  
ATOM 8313   H HE21 . GLN A 1 126 ? -26.779 3.589   -10.842 1.00 0.00 ? 126 GLN A HE21 2  
ATOM 8314   H HE22 . GLN A 1 126 ? -25.156 4.165   -10.664 1.00 0.00 ? 126 GLN A HE22 2  
ATOM 8315   N N    . ALA A 1 127 ? -29.765 6.922   -5.818  1.00 0.00 ? 127 ALA A N    2  
ATOM 8316   C CA   . ALA A 1 127 ? -30.236 7.879   -4.826  1.00 0.00 ? 127 ALA A CA   2  
ATOM 8317   C C    . ALA A 1 127 ? -29.578 7.661   -3.465  1.00 0.00 ? 127 ALA A C    2  
ATOM 8318   O O    . ALA A 1 127 ? -28.918 6.644   -3.230  1.00 0.00 ? 127 ALA A O    2  
ATOM 8319   C CB   . ALA A 1 127 ? -31.748 7.810   -4.703  1.00 0.00 ? 127 ALA A CB   2  
ATOM 8320   H H    . ALA A 1 127 ? -30.387 6.242   -6.158  1.00 0.00 ? 127 ALA A H    2  
ATOM 8321   H HA   . ALA A 1 127 ? -29.967 8.877   -5.173  1.00 0.00 ? 127 ALA A HA   2  
ATOM 8322   H HB1  . ALA A 1 127 ? -32.097 8.555   -3.989  1.00 0.00 ? 127 ALA A HB1  2  
ATOM 8323   H HB2  . ALA A 1 127 ? -32.199 8.003   -5.676  1.00 0.00 ? 127 ALA A HB2  2  
ATOM 8324   H HB3  . ALA A 1 127 ? -32.038 6.817   -4.359  1.00 0.00 ? 127 ALA A HB3  2  
ATOM 8325   N N    . GLU A 1 128 ? -29.781 8.617   -2.573  1.00 0.00 ? 128 GLU A N    2  
ATOM 8326   C CA   . GLU A 1 128 ? -29.209 8.564   -1.237  1.00 0.00 ? 128 GLU A CA   2  
ATOM 8327   C C    . GLU A 1 128 ? -30.228 8.065   -0.222  1.00 0.00 ? 128 GLU A C    2  
ATOM 8328   O O    . GLU A 1 128 ? -31.430 8.299   -0.373  1.00 0.00 ? 128 GLU A O    2  
ATOM 8329   C CB   . GLU A 1 128 ? -28.734 9.959   -0.831  1.00 0.00 ? 128 GLU A CB   2  
ATOM 8330   C CG   . GLU A 1 128 ? -27.661 9.964   0.239   1.00 0.00 ? 128 GLU A CG   2  
ATOM 8331   C CD   . GLU A 1 128 ? -26.271 9.877   -0.346  1.00 0.00 ? 128 GLU A CD   2  
ATOM 8332   O OE1  . GLU A 1 128 ? -26.064 9.102   -1.300  1.00 0.00 ? 128 GLU A OE1  2  
ATOM 8333   O OE2  . GLU A 1 128 ? -25.373 10.583  0.144   1.00 0.00 ? 128 GLU A OE2  2  
ATOM 8334   H H    . GLU A 1 128 ? -30.342 9.385   -2.819  1.00 0.00 ? 128 GLU A H    2  
ATOM 8335   H HA   . GLU A 1 128 ? -28.357 7.884   -1.248  1.00 0.00 ? 128 GLU A HA   2  
ATOM 8336   H HB2  . GLU A 1 128 ? -28.337 10.456  -1.716  1.00 0.00 ? 128 GLU A HB2  2  
ATOM 8337   H HB3  . GLU A 1 128 ? -29.593 10.516  -0.456  1.00 0.00 ? 128 GLU A HB3  2  
ATOM 8338   H HG2  . GLU A 1 128 ? -27.743 10.885  0.816   1.00 0.00 ? 128 GLU A HG2  2  
ATOM 8339   H HG3  . GLU A 1 128 ? -27.819 9.112   0.901   1.00 0.00 ? 128 GLU A HG3  2  
ATOM 8340   H HE2  . GLU A 1 128 ? -24.516 10.477  -0.276  1.00 0.00 ? 128 GLU A HE2  2  
ATOM 8341   N N    . ASN A 1 129 ? -29.734 7.366   0.800   1.00 0.00 ? 129 ASN A N    2  
ATOM 8342   C CA   . ASN A 1 129 ? -30.570 6.838   1.882   1.00 0.00 ? 129 ASN A CA   2  
ATOM 8343   C C    . ASN A 1 129 ? -31.491 5.719   1.398   1.00 0.00 ? 129 ASN A C    2  
ATOM 8344   O O    . ASN A 1 129 ? -32.587 5.524   1.927   1.00 0.00 ? 129 ASN A O    2  
ATOM 8345   C CB   . ASN A 1 129 ? -31.372 7.948   2.571   1.00 0.00 ? 129 ASN A CB   2  
ATOM 8346   C CG   . ASN A 1 129 ? -31.685 7.625   4.019   1.00 0.00 ? 129 ASN A CG   2  
ATOM 8347   O OD1  . ASN A 1 129 ? -30.872 7.028   4.727   1.00 0.00 ? 129 ASN A OD1  2  
ATOM 8348   N ND2  . ASN A 1 129 ? -32.868 8.014   4.468   1.00 0.00 ? 129 ASN A ND2  2  
ATOM 8349   H H    . ASN A 1 129 ? -28.771 7.174   0.814   1.00 0.00 ? 129 ASN A H    2  
ATOM 8350   H HA   . ASN A 1 129 ? -29.897 6.410   2.625   1.00 0.00 ? 129 ASN A HA   2  
ATOM 8351   H HB2  . ASN A 1 129 ? -30.794 8.872   2.535   1.00 0.00 ? 129 ASN A HB2  2  
ATOM 8352   H HB3  . ASN A 1 129 ? -32.309 8.089   2.034   1.00 0.00 ? 129 ASN A HB3  2  
ATOM 8353   H HD21 . ASN A 1 129 ? -33.469 8.480   3.847   1.00 0.00 ? 129 ASN A HD21 2  
ATOM 8354   H HD22 . ASN A 1 129 ? -33.095 7.823   5.403   1.00 0.00 ? 129 ASN A HD22 2  
ATOM 8355   N N    . MET A 1 130 ? -31.037 4.987   0.396   1.00 0.00 ? 130 MET A N    2  
ATOM 8356   C CA   . MET A 1 130 ? -31.809 3.885   -0.156  1.00 0.00 ? 130 MET A CA   2  
ATOM 8357   C C    . MET A 1 130 ? -31.292 2.560   0.385   1.00 0.00 ? 130 MET A C    2  
ATOM 8358   O O    . MET A 1 130 ? -30.087 2.399   0.589   1.00 0.00 ? 130 MET A O    2  
ATOM 8359   C CB   . MET A 1 130 ? -31.745 3.892   -1.684  1.00 0.00 ? 130 MET A CB   2  
ATOM 8360   C CG   . MET A 1 130 ? -32.761 4.808   -2.350  1.00 0.00 ? 130 MET A CG   2  
ATOM 8361   S SD   . MET A 1 130 ? -34.461 4.225   -2.164  1.00 0.00 ? 130 MET A SD   2  
ATOM 8362   C CE   . MET A 1 130 ? -34.395 2.681   -3.071  1.00 0.00 ? 130 MET A CE   2  
ATOM 8363   H H    . MET A 1 130 ? -30.156 5.192   0.014   1.00 0.00 ? 130 MET A H    2  
ATOM 8364   H HA   . MET A 1 130 ? -32.849 4.007   0.148   1.00 0.00 ? 130 MET A HA   2  
ATOM 8365   H HB2  . MET A 1 130 ? -30.747 4.214   -1.982  1.00 0.00 ? 130 MET A HB2  2  
ATOM 8366   H HB3  . MET A 1 130 ? -31.919 2.875   -2.037  1.00 0.00 ? 130 MET A HB3  2  
ATOM 8367   H HG2  . MET A 1 130 ? -32.681 5.802   -1.909  1.00 0.00 ? 130 MET A HG2  2  
ATOM 8368   H HG3  . MET A 1 130 ? -32.529 4.878   -3.413  1.00 0.00 ? 130 MET A HG3  2  
ATOM 8369   H HE1  . MET A 1 130 ? -33.656 2.023   -2.614  1.00 0.00 ? 130 MET A HE1  2  
ATOM 8370   H HE2  . MET A 1 130 ? -35.370 2.195   -3.051  1.00 0.00 ? 130 MET A HE2  2  
ATOM 8371   H HE3  . MET A 1 130 ? -34.113 2.880   -4.105  1.00 0.00 ? 130 MET A HE3  2  
ATOM 8372   N N    . PRO A 1 131 ? -32.200 1.609   0.653   1.00 0.00 ? 131 PRO A N    2  
ATOM 8373   C CA   . PRO A 1 131 ? -31.840 0.284   1.164   1.00 0.00 ? 131 PRO A CA   2  
ATOM 8374   C C    . PRO A 1 131 ? -31.105 -0.552  0.119   1.00 0.00 ? 131 PRO A C    2  
ATOM 8375   O O    . PRO A 1 131 ? -31.079 -0.207  -1.067  1.00 0.00 ? 131 PRO A O    2  
ATOM 8376   C CB   . PRO A 1 131 ? -33.195 -0.364  1.498   1.00 0.00 ? 131 PRO A CB   2  
ATOM 8377   C CG   . PRO A 1 131 ? -34.181 0.754   1.483   1.00 0.00 ? 131 PRO A CG   2  
ATOM 8378   C CD   . PRO A 1 131 ? -33.652 1.753   0.497   1.00 0.00 ? 131 PRO A CD   2  
ATOM 8379   H HA   . PRO A 1 131 ? -31.224 0.372   2.059   1.00 0.00 ? 131 PRO A HA   2  
ATOM 8380   H HB2  . PRO A 1 131 ? -33.456 -1.143  0.781   1.00 0.00 ? 131 PRO A HB2  2  
ATOM 8381   H HB3  . PRO A 1 131 ? -33.147 -0.770  2.508   1.00 0.00 ? 131 PRO A HB3  2  
ATOM 8382   H HG2  . PRO A 1 131 ? -35.131 0.370   1.111   1.00 0.00 ? 131 PRO A HG2  2  
ATOM 8383   H HG3  . PRO A 1 131 ? -34.304 1.195   2.472   1.00 0.00 ? 131 PRO A HG3  2  
ATOM 8384   H HD2  . PRO A 1 131 ? -33.984 1.528   -0.517  1.00 0.00 ? 131 PRO A HD2  2  
ATOM 8385   H HD3  . PRO A 1 131 ? -33.954 2.761   0.780   1.00 0.00 ? 131 PRO A HD3  2  
ATOM 8386   N N    . VAL A 1 132 ? -30.519 -1.654  0.563   1.00 0.00 ? 132 VAL A N    2  
ATOM 8387   C CA   . VAL A 1 132 ? -29.784 -2.545  -0.322  1.00 0.00 ? 132 VAL A CA   2  
ATOM 8388   C C    . VAL A 1 132 ? -30.665 -3.733  -0.696  1.00 0.00 ? 132 VAL A C    2  
ATOM 8389   O O    . VAL A 1 132 ? -31.309 -4.327  0.171   1.00 0.00 ? 132 VAL A O    2  
ATOM 8390   C CB   . VAL A 1 132 ? -28.496 -3.064  0.352   1.00 0.00 ? 132 VAL A CB   2  
ATOM 8391   C CG1  . VAL A 1 132 ? -27.591 -3.737  -0.667  1.00 0.00 ? 132 VAL A CG1  2  
ATOM 8392   C CG2  . VAL A 1 132 ? -27.762 -1.934  1.056   1.00 0.00 ? 132 VAL A CG2  2  
ATOM 8393   H H    . VAL A 1 132 ? -30.599 -1.883  1.513   1.00 0.00 ? 132 VAL A H    2  
ATOM 8394   H HA   . VAL A 1 132 ? -29.516 -1.996  -1.225  1.00 0.00 ? 132 VAL A HA   2  
ATOM 8395   H HB   . VAL A 1 132 ? -28.778 -3.805  1.100   1.00 0.00 ? 132 VAL A HB   2  
ATOM 8396   H HG11 . VAL A 1 132 ? -26.698 -4.119  -0.172  1.00 0.00 ? 132 VAL A HG11 2  
ATOM 8397   H HG12 . VAL A 1 132 ? -28.126 -4.564  -1.136  1.00 0.00 ? 132 VAL A HG12 2  
ATOM 8398   H HG13 . VAL A 1 132 ? -27.301 -3.013  -1.428  1.00 0.00 ? 132 VAL A HG13 2  
ATOM 8399   H HG21 . VAL A 1 132 ? -28.418 -1.486  1.802   1.00 0.00 ? 132 VAL A HG21 2  
ATOM 8400   H HG22 . VAL A 1 132 ? -26.869 -2.321  1.545   1.00 0.00 ? 132 VAL A HG22 2  
ATOM 8401   H HG23 . VAL A 1 132 ? -27.475 -1.178  0.325   1.00 0.00 ? 132 VAL A HG23 2  
ATOM 8402   N N    . PHE A 1 133 ? -30.694 -4.079  -1.977  1.00 0.00 ? 133 PHE A N    2  
ATOM 8403   C CA   . PHE A 1 133 ? -31.514 -5.189  -2.441  1.00 0.00 ? 133 PHE A CA   2  
ATOM 8404   C C    . PHE A 1 133 ? -30.803 -6.008  -3.510  1.00 0.00 ? 133 PHE A C    2  
ATOM 8405   O O    . PHE A 1 133 ? -29.673 -5.706  -3.894  1.00 0.00 ? 133 PHE A O    2  
ATOM 8406   C CB   . PHE A 1 133 ? -32.864 -4.683  -2.967  1.00 0.00 ? 133 PHE A CB   2  
ATOM 8407   C CG   . PHE A 1 133 ? -32.765 -3.537  -3.939  1.00 0.00 ? 133 PHE A CG   2  
ATOM 8408   C CD1  . PHE A 1 133 ? -32.506 -3.763  -5.281  1.00 0.00 ? 133 PHE A CD1  2  
ATOM 8409   C CD2  . PHE A 1 133 ? -32.937 -2.232  -3.507  1.00 0.00 ? 133 PHE A CD2  2  
ATOM 8410   C CE1  . PHE A 1 133 ? -32.418 -2.713  -6.174  1.00 0.00 ? 133 PHE A CE1  2  
ATOM 8411   C CE2  . PHE A 1 133 ? -32.852 -1.176  -4.392  1.00 0.00 ? 133 PHE A CE2  2  
ATOM 8412   C CZ   . PHE A 1 133 ? -32.592 -1.415  -5.729  1.00 0.00 ? 133 PHE A CZ   2  
ATOM 8413   H H    . PHE A 1 133 ? -30.145 -3.585  -2.625  1.00 0.00 ? 133 PHE A H    2  
ATOM 8414   H HA   . PHE A 1 133 ? -31.704 -5.840  -1.587  1.00 0.00 ? 133 PHE A HA   2  
ATOM 8415   H HB2  . PHE A 1 133 ? -33.372 -5.510  -3.463  1.00 0.00 ? 133 PHE A HB2  2  
ATOM 8416   H HB3  . PHE A 1 133 ? -33.466 -4.361  -2.117  1.00 0.00 ? 133 PHE A HB3  2  
ATOM 8417   H HD1  . PHE A 1 133 ? -32.370 -4.775  -5.635  1.00 0.00 ? 133 PHE A HD1  2  
ATOM 8418   H HD2  . PHE A 1 133 ? -33.140 -2.038  -2.464  1.00 0.00 ? 133 PHE A HD2  2  
ATOM 8419   H HE1  . PHE A 1 133 ? -32.215 -2.904  -7.217  1.00 0.00 ? 133 PHE A HE1  2  
ATOM 8420   H HE2  . PHE A 1 133 ? -32.987 -0.164  -4.041  1.00 0.00 ? 133 PHE A HE2  2  
ATOM 8421   H HZ   . PHE A 1 133 ? -32.524 -0.591  -6.423  1.00 0.00 ? 133 PHE A HZ   2  
ATOM 8422   N N    . LEU A 1 134 ? -31.479 -7.045  -3.983  1.00 0.00 ? 134 LEU A N    2  
ATOM 8423   C CA   . LEU A 1 134 ? -30.938 -7.918  -5.011  1.00 0.00 ? 134 LEU A CA   2  
ATOM 8424   C C    . LEU A 1 134 ? -31.452 -7.460  -6.370  1.00 0.00 ? 134 LEU A C    2  
ATOM 8425   O O    . LEU A 1 134 ? -32.658 -7.292  -6.553  1.00 0.00 ? 134 LEU A O    2  
ATOM 8426   C CB   . LEU A 1 134 ? -31.377 -9.361  -4.742  1.00 0.00 ? 134 LEU A CB   2  
ATOM 8427   C CG   . LEU A 1 134 ? -30.474 -10.469 -5.287  1.00 0.00 ? 134 LEU A CG   2  
ATOM 8428   C CD1  . LEU A 1 134 ? -29.089 -10.390 -4.662  1.00 0.00 ? 134 LEU A CD1  2  
ATOM 8429   C CD2  . LEU A 1 134 ? -31.097 -11.832 -5.033  1.00 0.00 ? 134 LEU A CD2  2  
ATOM 8430   H H    . LEU A 1 134 ? -32.380 -7.219  -3.642  1.00 0.00 ? 134 LEU A H    2  
ATOM 8431   H HA   . LEU A 1 134 ? -29.849 -7.863  -4.996  1.00 0.00 ? 134 LEU A HA   2  
ATOM 8432   H HB2  . LEU A 1 134 ? -31.442 -9.490  -3.661  1.00 0.00 ? 134 LEU A HB2  2  
ATOM 8433   H HB3  . LEU A 1 134 ? -32.365 -9.493  -5.183  1.00 0.00 ? 134 LEU A HB3  2  
ATOM 8434   H HG   . LEU A 1 134 ? -30.372 -10.332 -6.363  1.00 0.00 ? 134 LEU A HG   2  
ATOM 8435   H HD11 . LEU A 1 134 ? -28.452 -11.173 -5.074  1.00 0.00 ? 134 LEU A HD11 2  
ATOM 8436   H HD12 . LEU A 1 134 ? -28.650 -9.416  -4.877  1.00 0.00 ? 134 LEU A HD12 2  
ATOM 8437   H HD13 . LEU A 1 134 ? -29.171 -10.521 -3.583  1.00 0.00 ? 134 LEU A HD13 2  
ATOM 8438   H HD21 . LEU A 1 134 ? -32.075 -11.878 -5.511  1.00 0.00 ? 134 LEU A HD21 2  
ATOM 8439   H HD22 . LEU A 1 134 ? -30.457 -12.613 -5.445  1.00 0.00 ? 134 LEU A HD22 2  
ATOM 8440   H HD23 . LEU A 1 134 ? -31.209 -11.985 -3.960  1.00 0.00 ? 134 LEU A HD23 2  
ATOM 8441   N N    . GLY A 1 135 ? -30.545 -7.242  -7.307  1.00 0.00 ? 135 GLY A N    2  
ATOM 8442   C CA   . GLY A 1 135 ? -30.940 -6.794  -8.623  1.00 0.00 ? 135 GLY A CA   2  
ATOM 8443   C C    . GLY A 1 135 ? -30.478 -7.726  -9.717  1.00 0.00 ? 135 GLY A C    2  
ATOM 8444   O O    . GLY A 1 135 ? -29.427 -8.358  -9.606  1.00 0.00 ? 135 GLY A O    2  
ATOM 8445   H H    . GLY A 1 135 ? -29.592 -7.393  -7.110  1.00 0.00 ? 135 GLY A H    2  
ATOM 8446   H HA2  . GLY A 1 135 ? -32.027 -6.727  -8.656  1.00 0.00 ? 135 GLY A HA2  2  
ATOM 8447   H HA3  . GLY A 1 135 ? -30.512 -5.808  -8.799  1.00 0.00 ? 135 GLY A HA3  2  
ATOM 8448   N N    . GLY A 1 136 ? -31.255 -7.805  -10.784 1.00 0.00 ? 136 GLY A N    2  
ATOM 8449   C CA   . GLY A 1 136 ? -30.912 -8.665  -11.895 1.00 0.00 ? 136 GLY A CA   2  
ATOM 8450   C C    . GLY A 1 136 ? -30.559 -7.855  -13.122 1.00 0.00 ? 136 GLY A C    2  
ATOM 8451   O O    . GLY A 1 136 ? -30.700 -8.323  -14.253 1.00 0.00 ? 136 GLY A O    2  
ATOM 8452   H H    . GLY A 1 136 ? -32.075 -7.258  -10.824 1.00 0.00 ? 136 GLY A H    2  
ATOM 8453   H HA2  . GLY A 1 136 ? -30.058 -9.283  -11.617 1.00 0.00 ? 136 GLY A HA2  2  
ATOM 8454   H HA3  . GLY A 1 136 ? -31.763 -9.308  -12.123 1.00 0.00 ? 136 GLY A HA3  2  
ATOM 8455   N N    . THR A 1 137 ? -30.134 -6.621  -12.894 1.00 0.00 ? 137 THR A N    2  
ATOM 8456   C CA   . THR A 1 137 ? -29.758 -5.725  -13.975 1.00 0.00 ? 137 THR A CA   2  
ATOM 8457   C C    . THR A 1 137 ? -28.296 -5.289  -13.872 1.00 0.00 ? 137 THR A C    2  
ATOM 8458   O O    . THR A 1 137 ? -27.999 -4.131  -13.564 1.00 0.00 ? 137 THR A O    2  
ATOM 8459   C CB   . THR A 1 137 ? -30.668 -4.483  -13.998 1.00 0.00 ? 137 THR A CB   2  
ATOM 8460   O OG1  . THR A 1 137 ? -31.382 -4.394  -12.756 1.00 0.00 ? 137 THR A OG1  2  
ATOM 8461   C CG2  . THR A 1 137 ? -31.664 -4.574  -15.143 1.00 0.00 ? 137 THR A CG2  2  
ATOM 8462   H H    . THR A 1 137 ? -30.106 -6.294  -11.973 1.00 0.00 ? 137 THR A H    2  
ATOM 8463   H HA   . THR A 1 137 ? -29.889 -6.265  -14.913 1.00 0.00 ? 137 THR A HA   2  
ATOM 8464   H HB   . THR A 1 137 ? -30.054 -3.592  -14.127 1.00 0.00 ? 137 THR A HB   2  
ATOM 8465   H HG1  . THR A 1 137 ? -31.104 -3.591  -12.281 1.00 0.00 ? 137 THR A HG1  2  
ATOM 8466   H HG21 . THR A 1 137 ? -32.282 -5.463  -15.017 1.00 0.00 ? 137 THR A HG21 2  
ATOM 8467   H HG22 . THR A 1 137 ? -32.300 -3.688  -15.149 1.00 0.00 ? 137 THR A HG22 2  
ATOM 8468   H HG23 . THR A 1 137 ? -31.125 -4.637  -16.088 1.00 0.00 ? 137 THR A HG23 2  
ATOM 8469   N N    . LYS A 1 138 ? -27.386 -6.222  -14.120 1.00 0.00 ? 138 LYS A N    2  
ATOM 8470   C CA   . LYS A 1 138 ? -25.961 -5.926  -14.070 1.00 0.00 ? 138 LYS A CA   2  
ATOM 8471   C C    . LYS A 1 138 ? -25.581 -4.999  -15.218 1.00 0.00 ? 138 LYS A C    2  
ATOM 8472   O O    . LYS A 1 138 ? -25.922 -5.255  -16.376 1.00 0.00 ? 138 LYS A O    2  
ATOM 8473   C CB   . LYS A 1 138 ? -25.134 -7.213  -14.136 1.00 0.00 ? 138 LYS A CB   2  
ATOM 8474   C CG   . LYS A 1 138 ? -23.646 -6.982  -14.357 1.00 0.00 ? 138 LYS A CG   2  
ATOM 8475   C CD   . LYS A 1 138 ? -22.880 -8.290  -14.458 1.00 0.00 ? 138 LYS A CD   2  
ATOM 8476   C CE   . LYS A 1 138 ? -21.517 -8.081  -15.099 1.00 0.00 ? 138 LYS A CE   2  
ATOM 8477   N NZ   . LYS A 1 138 ? -20.739 -7.012  -14.420 1.00 0.00 ? 138 LYS A NZ   2  
ATOM 8478   H H    . LYS A 1 138 ? -27.680 -7.131  -14.349 1.00 0.00 ? 138 LYS A H    2  
ATOM 8479   H HA   . LYS A 1 138 ? -25.747 -5.423  -13.126 1.00 0.00 ? 138 LYS A HA   2  
ATOM 8480   H HB2  . LYS A 1 138 ? -25.261 -7.751  -13.196 1.00 0.00 ? 138 LYS A HB2  2  
ATOM 8481   H HB3  . LYS A 1 138 ? -25.512 -7.822  -14.957 1.00 0.00 ? 138 LYS A HB3  2  
ATOM 8482   H HG2  . LYS A 1 138 ? -23.510 -6.421  -15.282 1.00 0.00 ? 138 LYS A HG2  2  
ATOM 8483   H HG3  . LYS A 1 138 ? -23.251 -6.405  -13.521 1.00 0.00 ? 138 LYS A HG3  2  
ATOM 8484   H HD2  . LYS A 1 138 ? -22.743 -8.700  -13.457 1.00 0.00 ? 138 LYS A HD2  2  
ATOM 8485   H HD3  . LYS A 1 138 ? -23.454 -8.992  -15.063 1.00 0.00 ? 138 LYS A HD3  2  
ATOM 8486   H HE2  . LYS A 1 138 ? -20.956 -9.014  -15.047 1.00 0.00 ? 138 LYS A HE2  2  
ATOM 8487   H HE3  . LYS A 1 138 ? -21.658 -7.805  -16.144 1.00 0.00 ? 138 LYS A HE3  2  
ATOM 8488   H HZ1  . LYS A 1 138 ? -21.318 -6.156  -14.313 1.00 0.00 ? 138 LYS A HZ1  2  
ATOM 8489   H HZ2  . LYS A 1 138 ? -19.891 -6.780  -14.971 1.00 0.00 ? 138 LYS A HZ2  2  
ATOM 8490   H HZ3  . LYS A 1 138 ? -20.444 -7.333  -13.467 1.00 0.00 ? 138 LYS A HZ3  2  
ATOM 8491   N N    . GLY A 1 139 ? -24.883 -3.923  -14.897 1.00 0.00 ? 139 GLY A N    2  
ATOM 8492   C CA   . GLY A 1 139 ? -24.478 -2.976  -15.916 1.00 0.00 ? 139 GLY A CA   2  
ATOM 8493   C C    . GLY A 1 139 ? -25.597 -2.020  -16.270 1.00 0.00 ? 139 GLY A C    2  
ATOM 8494   O O    . GLY A 1 139 ? -25.563 -1.361  -17.307 1.00 0.00 ? 139 GLY A O    2  
ATOM 8495   H H    . GLY A 1 139 ? -24.639 -3.768  -13.959 1.00 0.00 ? 139 GLY A H    2  
ATOM 8496   H HA2  . GLY A 1 139 ? -23.627 -2.403  -15.548 1.00 0.00 ? 139 GLY A HA2  2  
ATOM 8497   H HA3  . GLY A 1 139 ? -24.185 -3.524  -16.811 1.00 0.00 ? 139 GLY A HA3  2  
ATOM 8498   N N    . GLY A 1 140 ? -26.603 -1.963  -15.412 1.00 0.00 ? 140 GLY A N    2  
ATOM 8499   C CA   . GLY A 1 140 ? -27.719 -1.075  -15.642 1.00 0.00 ? 140 GLY A CA   2  
ATOM 8500   C C    . GLY A 1 140 ? -27.661 0.124   -14.724 1.00 0.00 ? 140 GLY A C    2  
ATOM 8501   O O    . GLY A 1 140 ? -26.578 0.597   -14.382 1.00 0.00 ? 140 GLY A O    2  
ATOM 8502   H H    . GLY A 1 140 ? -26.585 -2.528  -14.610 1.00 0.00 ? 140 GLY A H    2  
ATOM 8503   H HA2  . GLY A 1 140 ? -27.694 -0.733  -16.677 1.00 0.00 ? 140 GLY A HA2  2  
ATOM 8504   H HA3  . GLY A 1 140 ? -28.648 -1.616  -15.463 1.00 0.00 ? 140 GLY A HA3  2  
ATOM 8505   N N    . GLN A 1 141 ? -28.822 0.614   -14.321 1.00 0.00 ? 141 GLN A N    2  
ATOM 8506   C CA   . GLN A 1 141 ? -28.893 1.760   -13.427 1.00 0.00 ? 141 GLN A CA   2  
ATOM 8507   C C    . GLN A 1 141 ? -28.479 1.337   -12.021 1.00 0.00 ? 141 GLN A C    2  
ATOM 8508   O O    . GLN A 1 141 ? -27.889 2.111   -11.262 1.00 0.00 ? 141 GLN A O    2  
ATOM 8509   C CB   . GLN A 1 141 ? -30.312 2.342   -13.408 1.00 0.00 ? 141 GLN A CB   2  
ATOM 8510   C CG   . GLN A 1 141 ? -30.897 2.638   -14.787 1.00 0.00 ? 141 GLN A CG   2  
ATOM 8511   C CD   . GLN A 1 141 ? -31.440 1.400   -15.477 1.00 0.00 ? 141 GLN A CD   2  
ATOM 8512   O OE1  . GLN A 1 141 ? -31.879 0.455   -14.823 1.00 0.00 ? 141 GLN A OE1  2  
ATOM 8513   N NE2  . GLN A 1 141 ? -31.412 1.392   -16.801 1.00 0.00 ? 141 GLN A NE2  2  
ATOM 8514   H H    . GLN A 1 141 ? -29.653 0.199   -14.636 1.00 0.00 ? 141 GLN A H    2  
ATOM 8515   H HA   . GLN A 1 141 ? -28.205 2.526   -13.784 1.00 0.00 ? 141 GLN A HA   2  
ATOM 8516   H HB2  . GLN A 1 141 ? -30.966 1.626   -12.909 1.00 0.00 ? 141 GLN A HB2  2  
ATOM 8517   H HB3  . GLN A 1 141 ? -30.291 3.272   -12.841 1.00 0.00 ? 141 GLN A HB3  2  
ATOM 8518   H HG2  . GLN A 1 141 ? -31.707 3.359   -14.675 1.00 0.00 ? 141 GLN A HG2  2  
ATOM 8519   H HG3  . GLN A 1 141 ? -30.115 3.071   -15.411 1.00 0.00 ? 141 GLN A HG3  2  
ATOM 8520   H HE21 . GLN A 1 141 ? -31.047 2.180   -17.265 1.00 0.00 ? 141 GLN A HE21 2  
ATOM 8521   H HE22 . GLN A 1 141 ? -31.758 0.601   -17.269 1.00 0.00 ? 141 GLN A HE22 2  
ATOM 8522   N N    . ASP A 1 142 ? -28.803 0.097   -11.686 1.00 0.00 ? 142 ASP A N    2  
ATOM 8523   C CA   . ASP A 1 142 ? -28.470 -0.463  -10.387 1.00 0.00 ? 142 ASP A CA   2  
ATOM 8524   C C    . ASP A 1 142 ? -26.983 -0.777  -10.317 1.00 0.00 ? 142 ASP A C    2  
ATOM 8525   O O    . ASP A 1 142 ? -26.425 -1.397  -11.226 1.00 0.00 ? 142 ASP A O    2  
ATOM 8526   C CB   . ASP A 1 142 ? -29.282 -1.735  -10.126 1.00 0.00 ? 142 ASP A CB   2  
ATOM 8527   C CG   . ASP A 1 142 ? -30.761 -1.563  -10.408 1.00 0.00 ? 142 ASP A CG   2  
ATOM 8528   O OD1  . ASP A 1 142 ? -31.445 -0.863  -9.631  1.00 0.00 ? 142 ASP A OD1  2  
ATOM 8529   O OD2  . ASP A 1 142 ? -31.245 -2.122  -11.416 1.00 0.00 ? 142 ASP A OD2  2  
ATOM 8530   H H    . ASP A 1 142 ? -29.302 -0.446  -12.329 1.00 0.00 ? 142 ASP A H    2  
ATOM 8531   H HA   . ASP A 1 142 ? -28.713 0.272   -9.620  1.00 0.00 ? 142 ASP A HA   2  
ATOM 8532   H HB2  . ASP A 1 142 ? -28.897 -2.532  -10.763 1.00 0.00 ? 142 ASP A HB2  2  
ATOM 8533   H HB3  . ASP A 1 142 ? -29.158 -2.020  -9.082  1.00 0.00 ? 142 ASP A HB3  2  
ATOM 8534   H HD2  . ASP A 1 142 ? -32.185 -1.969  -11.535 1.00 0.00 ? 142 ASP A HD2  2  
ATOM 8535   N N    . ILE A 1 143 ? -26.337 -0.317  -9.257  1.00 0.00 ? 143 ILE A N    2  
ATOM 8536   C CA   . ILE A 1 143 ? -24.912 -0.553  -9.066  1.00 0.00 ? 143 ILE A CA   2  
ATOM 8537   C C    . ILE A 1 143 ? -24.657 -1.973  -8.568  1.00 0.00 ? 143 ILE A C    2  
ATOM 8538   O O    . ILE A 1 143 ? -25.162 -2.372  -7.521  1.00 0.00 ? 143 ILE A O    2  
ATOM 8539   C CB   . ILE A 1 143 ? -24.302 0.462   -8.080  1.00 0.00 ? 143 ILE A CB   2  
ATOM 8540   C CG1  . ILE A 1 143 ? -24.601 1.890   -8.546  1.00 0.00 ? 143 ILE A CG1  2  
ATOM 8541   C CG2  . ILE A 1 143 ? -22.801 0.247   -7.957  1.00 0.00 ? 143 ILE A CG2  2  
ATOM 8542   C CD1  . ILE A 1 143 ? -24.223 2.959   -7.544  1.00 0.00 ? 143 ILE A CD1  2  
ATOM 8543   H H    . ILE A 1 143 ? -26.825 0.215   -8.593  1.00 0.00 ? 143 ILE A H    2  
ATOM 8544   H HA   . ILE A 1 143 ? -24.420 -0.432  -10.032 1.00 0.00 ? 143 ILE A HA   2  
ATOM 8545   H HB   . ILE A 1 143 ? -24.756 0.312   -7.101  1.00 0.00 ? 143 ILE A HB   2  
ATOM 8546   H HG12 . ILE A 1 143 ? -24.047 2.074   -9.467  1.00 0.00 ? 143 ILE A HG12 2  
ATOM 8547   H HG13 . ILE A 1 143 ? -25.670 1.970   -8.744  1.00 0.00 ? 143 ILE A HG13 2  
ATOM 8548   H HG21 . ILE A 1 143 ? -22.385 0.960   -7.245  1.00 0.00 ? 143 ILE A HG21 2  
ATOM 8549   H HG22 . ILE A 1 143 ? -22.608 -0.767  -7.608  1.00 0.00 ? 143 ILE A HG22 2  
ATOM 8550   H HG23 . ILE A 1 143 ? -22.333 0.392   -8.930  1.00 0.00 ? 143 ILE A HG23 2  
ATOM 8551   H HD11 . ILE A 1 143 ? -23.154 2.900   -7.341  1.00 0.00 ? 143 ILE A HD11 2  
ATOM 8552   H HD12 . ILE A 1 143 ? -24.458 3.950   -7.932  1.00 0.00 ? 143 ILE A HD12 2  
ATOM 8553   H HD13 . ILE A 1 143 ? -24.778 2.797   -6.619  1.00 0.00 ? 143 ILE A HD13 2  
ATOM 8554   N N    . THR A 1 144 ? -23.879 -2.726  -9.331  1.00 0.00 ? 144 THR A N    2  
ATOM 8555   C CA   . THR A 1 144 ? -23.569 -4.105  -8.976  1.00 0.00 ? 144 THR A CA   2  
ATOM 8556   C C    . THR A 1 144 ? -22.113 -4.280  -8.554  1.00 0.00 ? 144 THR A C    2  
ATOM 8557   O O    . THR A 1 144 ? -21.752 -5.290  -7.946  1.00 0.00 ? 144 THR A O    2  
ATOM 8558   C CB   . THR A 1 144 ? -23.888 -5.071  -10.133 1.00 0.00 ? 144 THR A CB   2  
ATOM 8559   O OG1  . THR A 1 144 ? -23.299 -4.585  -11.350 1.00 0.00 ? 144 THR A OG1  2  
ATOM 8560   C CG2  . THR A 1 144 ? -25.391 -5.206  -10.321 1.00 0.00 ? 144 THR A CG2  2  
ATOM 8561   H H    . THR A 1 144 ? -23.505 -2.335  -10.148 1.00 0.00 ? 144 THR A H    2  
ATOM 8562   H HA   . THR A 1 144 ? -24.201 -4.371  -8.128  1.00 0.00 ? 144 THR A HA   2  
ATOM 8563   H HB   . THR A 1 144 ? -23.470 -6.051  -9.901  1.00 0.00 ? 144 THR A HB   2  
ATOM 8564   H HG1  . THR A 1 144 ? -22.468 -5.069  -11.514 1.00 0.00 ? 144 THR A HG1  2  
ATOM 8565   H HG21 . THR A 1 144 ? -25.816 -4.230  -10.555 1.00 0.00 ? 144 THR A HG21 2  
ATOM 8566   H HG22 . THR A 1 144 ? -25.601 -5.897  -11.137 1.00 0.00 ? 144 THR A HG22 2  
ATOM 8567   H HG23 . THR A 1 144 ? -25.838 -5.586  -9.402  1.00 0.00 ? 144 THR A HG23 2  
ATOM 8568   N N    . ASP A 1 145 ? -21.281 -3.292  -8.869  1.00 0.00 ? 145 ASP A N    2  
ATOM 8569   C CA   . ASP A 1 145 ? -19.863 -3.352  -8.533  1.00 0.00 ? 145 ASP A CA   2  
ATOM 8570   C C    . ASP A 1 145 ? -19.559 -2.625  -7.229  1.00 0.00 ? 145 ASP A C    2  
ATOM 8571   O O    . ASP A 1 145 ? -20.166 -1.601  -6.915  1.00 0.00 ? 145 ASP A O    2  
ATOM 8572   C CB   . ASP A 1 145 ? -18.990 -2.814  -9.676  1.00 0.00 ? 145 ASP A CB   2  
ATOM 8573   C CG   . ASP A 1 145 ? -19.156 -1.324  -9.918  1.00 0.00 ? 145 ASP A CG   2  
ATOM 8574   O OD1  . ASP A 1 145 ? -20.060 -0.936  -10.689 1.00 0.00 ? 145 ASP A OD1  2  
ATOM 8575   O OD2  . ASP A 1 145 ? -18.370 -0.532  -9.354  1.00 0.00 ? 145 ASP A OD2  2  
ATOM 8576   H H    . ASP A 1 145 ? -21.629 -2.501  -9.327  1.00 0.00 ? 145 ASP A H    2  
ATOM 8577   H HA   . ASP A 1 145 ? -19.611 -4.403  -8.391  1.00 0.00 ? 145 ASP A HA   2  
ATOM 8578   H HB2  . ASP A 1 145 ? -17.946 -3.012  -9.435  1.00 0.00 ? 145 ASP A HB2  2  
ATOM 8579   H HB3  . ASP A 1 145 ? -19.254 -3.345  -10.591 1.00 0.00 ? 145 ASP A HB3  2  
ATOM 8580   H HD2  . ASP A 1 145 ? -18.530 0.392   -9.557  1.00 0.00 ? 145 ASP A HD2  2  
ATOM 8581   N N    . PHE A 1 146 ? -18.604 -3.161  -6.478  1.00 0.00 ? 146 PHE A N    2  
ATOM 8582   C CA   . PHE A 1 146 ? -18.205 -2.585  -5.200  1.00 0.00 ? 146 PHE A CA   2  
ATOM 8583   C C    . PHE A 1 146 ? -16.692 -2.683  -5.017  1.00 0.00 ? 146 PHE A C    2  
ATOM 8584   O O    . PHE A 1 146 ? -15.968 -3.141  -5.908  1.00 0.00 ? 146 PHE A O    2  
ATOM 8585   C CB   . PHE A 1 146 ? -18.899 -3.309  -4.036  1.00 0.00 ? 146 PHE A CB   2  
ATOM 8586   C CG   . PHE A 1 146 ? -20.398 -3.202  -4.028  1.00 0.00 ? 146 PHE A CG   2  
ATOM 8587   C CD1  . PHE A 1 146 ? -21.026 -2.072  -3.531  1.00 0.00 ? 146 PHE A CD1  2  
ATOM 8588   C CD2  . PHE A 1 146 ? -21.180 -4.236  -4.516  1.00 0.00 ? 146 PHE A CD2  2  
ATOM 8589   C CE1  . PHE A 1 146 ? -22.404 -1.977  -3.522  1.00 0.00 ? 146 PHE A CE1  2  
ATOM 8590   C CE2  . PHE A 1 146 ? -22.557 -4.147  -4.509  1.00 0.00 ? 146 PHE A CE2  2  
ATOM 8591   C CZ   . PHE A 1 146 ? -23.172 -3.015  -4.012  1.00 0.00 ? 146 PHE A CZ   2  
ATOM 8592   H H    . PHE A 1 146 ? -18.139 -3.965  -6.804  1.00 0.00 ? 146 PHE A H    2  
ATOM 8593   H HA   . PHE A 1 146 ? -18.497 -1.535  -5.189  1.00 0.00 ? 146 PHE A HA   2  
ATOM 8594   H HB2  . PHE A 1 146 ? -18.632 -4.365  -4.082  1.00 0.00 ? 146 PHE A HB2  2  
ATOM 8595   H HB3  . PHE A 1 146 ? -18.522 -2.894  -3.101  1.00 0.00 ? 146 PHE A HB3  2  
ATOM 8596   H HD1  . PHE A 1 146 ? -20.432 -1.257  -3.146  1.00 0.00 ? 146 PHE A HD1  2  
ATOM 8597   H HD2  . PHE A 1 146 ? -20.705 -5.123  -4.908  1.00 0.00 ? 146 PHE A HD2  2  
ATOM 8598   H HE1  . PHE A 1 146 ? -22.882 -1.090  -3.132  1.00 0.00 ? 146 PHE A HE1  2  
ATOM 8599   H HE2  . PHE A 1 146 ? -23.154 -4.962  -4.893  1.00 0.00 ? 146 PHE A HE2  2  
ATOM 8600   H HZ   . PHE A 1 146 ? -24.250 -2.942  -4.007  1.00 0.00 ? 146 PHE A HZ   2  
ATOM 8601   N N    . THR A 1 147 ? -16.227 -2.248  -3.858  1.00 0.00 ? 147 THR A N    2  
ATOM 8602   C CA   . THR A 1 147 ? -14.816 -2.293  -3.516  1.00 0.00 ? 147 THR A CA   2  
ATOM 8603   C C    . THR A 1 147 ? -14.634 -3.174  -2.286  1.00 0.00 ? 147 THR A C    2  
ATOM 8604   O O    . THR A 1 147 ? -15.589 -3.398  -1.542  1.00 0.00 ? 147 THR A O    2  
ATOM 8605   C CB   . THR A 1 147 ? -14.282 -0.883  -3.213  1.00 0.00 ? 147 THR A CB   2  
ATOM 8606   O OG1  . THR A 1 147 ? -15.271 -0.151  -2.476  1.00 0.00 ? 147 THR A OG1  2  
ATOM 8607   C CG2  . THR A 1 147 ? -13.961 -0.140  -4.501  1.00 0.00 ? 147 THR A CG2  2  
ATOM 8608   H H    . THR A 1 147 ? -16.860 -1.892  -3.202  1.00 0.00 ? 147 THR A H    2  
ATOM 8609   H HA   . THR A 1 147 ? -14.259 -2.715  -4.354  1.00 0.00 ? 147 THR A HA   2  
ATOM 8610   H HB   . THR A 1 147 ? -13.375 -0.967  -2.614  1.00 0.00 ? 147 THR A HB   2  
ATOM 8611   H HG1  . THR A 1 147 ? -15.978 0.123   -3.076  1.00 0.00 ? 147 THR A HG1  2  
ATOM 8612   H HG21 . THR A 1 147 ? -14.865 -0.052  -5.104  1.00 0.00 ? 147 THR A HG21 2  
ATOM 8613   H HG22 . THR A 1 147 ? -13.582 0.855   -4.269  1.00 0.00 ? 147 THR A HG22 2  
ATOM 8614   H HG23 . THR A 1 147 ? -13.205 -0.693  -5.059  1.00 0.00 ? 147 THR A HG23 2  
ATOM 8615   N N    . MET A 1 148 ? -13.425 -3.668  -2.065  1.00 0.00 ? 148 MET A N    2  
ATOM 8616   C CA   . MET A 1 148 ? -13.164 -4.532  -0.920  1.00 0.00 ? 148 MET A CA   2  
ATOM 8617   C C    . MET A 1 148 ? -11.984 -4.028  -0.086  1.00 0.00 ? 148 MET A C    2  
ATOM 8618   O O    . MET A 1 148 ? -10.917 -4.641  -0.068  1.00 0.00 ? 148 MET A O    2  
ATOM 8619   C CB   . MET A 1 148 ? -12.927 -5.977  -1.381  1.00 0.00 ? 148 MET A CB   2  
ATOM 8620   C CG   . MET A 1 148 ? -13.077 -7.023  -0.285  1.00 0.00 ? 148 MET A CG   2  
ATOM 8621   S SD   . MET A 1 148 ? -13.016 -8.715  -0.914  1.00 0.00 ? 148 MET A SD   2  
ATOM 8622   C CE   . MET A 1 148 ? -11.301 -8.839  -1.411  1.00 0.00 ? 148 MET A CE   2  
ATOM 8623   H H    . MET A 1 148 ? -12.691 -3.452  -2.686  1.00 0.00 ? 148 MET A H    2  
ATOM 8624   H HA   . MET A 1 148 ? -14.052 -4.520  -0.287  1.00 0.00 ? 148 MET A HA   2  
ATOM 8625   H HB2  . MET A 1 148 ? -13.644 -6.204  -2.169  1.00 0.00 ? 148 MET A HB2  2  
ATOM 8626   H HB3  . MET A 1 148 ? -11.915 -6.045  -1.779  1.00 0.00 ? 148 MET A HB3  2  
ATOM 8627   H HG2  . MET A 1 148 ? -12.274 -6.889  0.440   1.00 0.00 ? 148 MET A HG2  2  
ATOM 8628   H HG3  . MET A 1 148 ? -14.032 -6.871  0.219   1.00 0.00 ? 148 MET A HG3  2  
ATOM 8629   H HE1  . MET A 1 148 ? -10.660 -8.673  -0.545  1.00 0.00 ? 148 MET A HE1  2  
ATOM 8630   H HE2  . MET A 1 148 ? -11.102 -9.829  -1.822  1.00 0.00 ? 148 MET A HE2  2  
ATOM 8631   H HE3  . MET A 1 148 ? -11.088 -8.085  -2.170  1.00 0.00 ? 148 MET A HE3  2  
ATOM 8632   N N    . GLN A 1 149 ? -12.174 -2.892  0.579   1.00 0.00 ? 149 GLN A N    2  
ATOM 8633   C CA   . GLN A 1 149 ? -11.129 -2.316  1.428   1.00 0.00 ? 149 GLN A CA   2  
ATOM 8634   C C    . GLN A 1 149 ? -10.951 -3.150  2.692   1.00 0.00 ? 149 GLN A C    2  
ATOM 8635   O O    . GLN A 1 149 ? -11.926 -3.440  3.393   1.00 0.00 ? 149 GLN A O    2  
ATOM 8636   C CB   . GLN A 1 149 ? -11.477 -0.877  1.830   1.00 0.00 ? 149 GLN A CB   2  
ATOM 8637   C CG   . GLN A 1 149 ? -11.293 0.165   0.739   1.00 0.00 ? 149 GLN A CG   2  
ATOM 8638   C CD   . GLN A 1 149 ? -12.443 0.212   -0.247  1.00 0.00 ? 149 GLN A CD   2  
ATOM 8639   O OE1  . GLN A 1 149 ? -12.263 0.588   -1.403  1.00 0.00 ? 149 GLN A OE1  2  
ATOM 8640   N NE2  . GLN A 1 149 ? -13.637 -0.152  0.199   1.00 0.00 ? 149 GLN A NE2  2  
ATOM 8641   H H    . GLN A 1 149 ? -13.025 -2.416  0.486   1.00 0.00 ? 149 GLN A H    2  
ATOM 8642   H HA   . GLN A 1 149 ? -10.194 -2.311  0.868   1.00 0.00 ? 149 GLN A HA   2  
ATOM 8643   H HB2  . GLN A 1 149 ? -12.522 -0.857  2.141   1.00 0.00 ? 149 GLN A HB2  2  
ATOM 8644   H HB3  . GLN A 1 149 ? -10.842 -0.599  2.671   1.00 0.00 ? 149 GLN A HB3  2  
ATOM 8645   H HG2  . GLN A 1 149 ? -11.197 1.144   1.208   1.00 0.00 ? 149 GLN A HG2  2  
ATOM 8646   H HG3  . GLN A 1 149 ? -10.377 -0.063  0.194   1.00 0.00 ? 149 GLN A HG3  2  
ATOM 8647   H HE21 . GLN A 1 149 ? -13.720 -0.430  1.139   1.00 0.00 ? 149 GLN A HE21 2  
ATOM 8648   H HE22 . GLN A 1 149 ? -14.391 -0.142  -0.433  1.00 0.00 ? 149 GLN A HE22 2  
ATOM 8649   N N    . PHE A 1 150 ? -9.717  -3.534  2.982   1.00 0.00 ? 150 PHE A N    2  
ATOM 8650   C CA   . PHE A 1 150 ? -9.425  -4.327  4.165   1.00 0.00 ? 150 PHE A CA   2  
ATOM 8651   C C    . PHE A 1 150 ? -9.143  -3.423  5.356   1.00 0.00 ? 150 PHE A C    2  
ATOM 8652   O O    . PHE A 1 150 ? -8.438  -2.417  5.228   1.00 0.00 ? 150 PHE A O    2  
ATOM 8653   C CB   . PHE A 1 150 ? -8.209  -5.227  3.921   1.00 0.00 ? 150 PHE A CB   2  
ATOM 8654   C CG   . PHE A 1 150 ? -8.299  -6.087  2.694   1.00 0.00 ? 150 PHE A CG   2  
ATOM 8655   C CD1  . PHE A 1 150 ? -9.008  -7.274  2.716   1.00 0.00 ? 150 PHE A CD1  2  
ATOM 8656   C CD2  . PHE A 1 150 ? -7.665  -5.709  1.522   1.00 0.00 ? 150 PHE A CD2  2  
ATOM 8657   C CE1  . PHE A 1 150 ? -9.086  -8.071  1.588   1.00 0.00 ? 150 PHE A CE1  2  
ATOM 8658   C CE2  . PHE A 1 150 ? -7.736  -6.499  0.391   1.00 0.00 ? 150 PHE A CE2  2  
ATOM 8659   C CZ   . PHE A 1 150 ? -8.449  -7.683  0.424   1.00 0.00 ? 150 PHE A CZ   2  
ATOM 8660   H H    . PHE A 1 150 ? -8.977  -3.280  2.391   1.00 0.00 ? 150 PHE A H    2  
ATOM 8661   H HA   . PHE A 1 150 ? -10.291 -4.951  4.387   1.00 0.00 ? 150 PHE A HA   2  
ATOM 8662   H HB2  . PHE A 1 150 ? -7.327  -4.594  3.831   1.00 0.00 ? 150 PHE A HB2  2  
ATOM 8663   H HB3  . PHE A 1 150 ? -8.085  -5.878  4.787   1.00 0.00 ? 150 PHE A HB3  2  
ATOM 8664   H HD1  . PHE A 1 150 ? -9.506  -7.582  3.623   1.00 0.00 ? 150 PHE A HD1  2  
ATOM 8665   H HD2  . PHE A 1 150 ? -7.107  -4.784  1.492   1.00 0.00 ? 150 PHE A HD2  2  
ATOM 8666   H HE1  . PHE A 1 150 ? -9.644  -8.996  1.617   1.00 0.00 ? 150 PHE A HE1  2  
ATOM 8667   H HE2  . PHE A 1 150 ? -7.237  -6.192  -0.516  1.00 0.00 ? 150 PHE A HE2  2  
ATOM 8668   H HZ   . PHE A 1 150 ? -8.508  -8.303  -0.458  1.00 0.00 ? 150 PHE A HZ   2  
ATOM 8669   N N    . VAL A 1 151 ? -9.701  -3.775  6.500   1.00 0.00 ? 151 VAL A N    2  
ATOM 8670   C CA   . VAL A 1 151 ? -9.489  -3.016  7.725   1.00 0.00 ? 151 VAL A CA   2  
ATOM 8671   C C    . VAL A 1 151 ? -8.632  -3.820  8.694   1.00 0.00 ? 151 VAL A C    2  
ATOM 8672   O O    . VAL A 1 151 ? -8.327  -4.987  8.435   1.00 0.00 ? 151 VAL A O    2  
ATOM 8673   C CB   . VAL A 1 151 ? -10.817 -2.626  8.409   1.00 0.00 ? 151 VAL A CB   2  
ATOM 8674   C CG1  . VAL A 1 151 ? -11.567 -1.600  7.577   1.00 0.00 ? 151 VAL A CG1  2  
ATOM 8675   C CG2  . VAL A 1 151 ? -11.677 -3.857  8.663   1.00 0.00 ? 151 VAL A CG2  2  
ATOM 8676   H H    . VAL A 1 151 ? -10.268 -4.573  6.530   1.00 0.00 ? 151 VAL A H    2  
ATOM 8677   H HA   . VAL A 1 151 ? -8.958  -2.100  7.464   1.00 0.00 ? 151 VAL A HA   2  
ATOM 8678   H HB   . VAL A 1 151 ? -10.582 -2.174  9.373   1.00 0.00 ? 151 VAL A HB   2  
ATOM 8679   H HG11 . VAL A 1 151 ? -12.489 -1.316  8.084   1.00 0.00 ? 151 VAL A HG11 2  
ATOM 8680   H HG12 . VAL A 1 151 ? -10.942 -0.717  7.440   1.00 0.00 ? 151 VAL A HG12 2  
ATOM 8681   H HG13 . VAL A 1 151 ? -11.808 -2.029  6.604   1.00 0.00 ? 151 VAL A HG13 2  
ATOM 8682   H HG21 . VAL A 1 151 ? -11.128 -4.560  9.289   1.00 0.00 ? 151 VAL A HG21 2  
ATOM 8683   H HG22 . VAL A 1 151 ? -12.598 -3.566  9.168   1.00 0.00 ? 151 VAL A HG22 2  
ATOM 8684   H HG23 . VAL A 1 151 ? -11.921 -4.330  7.712   1.00 0.00 ? 151 VAL A HG23 2  
ATOM 8685   N N    . SER A 1 152 ? -8.260  -3.210  9.810   1.00 0.00 ? 152 SER A N    2  
ATOM 8686   C CA   . SER A 1 152 ? -7.428  -3.879  10.799  1.00 0.00 ? 152 SER A CA   2  
ATOM 8687   C C    . SER A 1 152 ? -8.260  -4.670  11.818  1.00 0.00 ? 152 SER A C    2  
ATOM 8688   O O    . SER A 1 152 ? -8.272  -4.349  13.009  1.00 0.00 ? 152 SER A O    2  
ATOM 8689   C CB   . SER A 1 152 ? -6.484  -2.889  11.488  1.00 0.00 ? 152 SER A CB   2  
ATOM 8690   O OG   . SER A 1 152 ? -7.072  -1.599  11.586  1.00 0.00 ? 152 SER A OG   2  
ATOM 8691   H H    . SER A 1 152 ? -8.556  -2.287  9.976   1.00 0.00 ? 152 SER A H    2  
ATOM 8692   H HA   . SER A 1 152 ? -6.810  -4.598  10.261  1.00 0.00 ? 152 SER A HA   2  
ATOM 8693   H HB2  . SER A 1 152 ? -6.257  -3.252  12.490  1.00 0.00 ? 152 SER A HB2  2  
ATOM 8694   H HB3  . SER A 1 152 ? -5.563  -2.815  10.910  1.00 0.00 ? 152 SER A HB3  2  
ATOM 8695   H HG   . SER A 1 152 ? -7.344  -1.295  10.704  1.00 0.00 ? 152 SER A HG   2  
ATOM 8696   N N    . SER A 1 153 ? -8.956  -5.697  11.321  1.00 0.00 ? 153 SER A N    2  
ATOM 8697   C CA   . SER A 1 153 ? -9.784  -6.582  12.148  1.00 0.00 ? 153 SER A CA   2  
ATOM 8698   C C    . SER A 1 153 ? -11.053 -5.912  12.689  1.00 0.00 ? 153 SER A C    2  
ATOM 8699   O O    . SER A 1 153 ? -10.981 -4.756  13.158  1.00 0.00 ? 153 SER A O    2  
ATOM 8700   C CB   . SER A 1 153 ? -8.968  -7.239  13.266  1.00 0.00 ? 153 SER A CB   2  
ATOM 8701   O OG   . SER A 1 153 ? -7.821  -7.893  12.739  1.00 0.00 ? 153 SER A OG   2  
ATOM 8702   O OXT  . SER A 1 153 ? -12.122 -6.562  12.659  1.00 0.00 ? 153 SER A OXT  2  
ATOM 8703   H H    . SER A 1 153 ? -8.921  -5.860  10.356  1.00 0.00 ? 153 SER A H    2  
ATOM 8704   H HA   . SER A 1 153 ? -10.116 -7.384  11.489  1.00 0.00 ? 153 SER A HA   2  
ATOM 8705   H HB2  . SER A 1 153 ? -8.649  -6.473  13.973  1.00 0.00 ? 153 SER A HB2  2  
ATOM 8706   H HB3  . SER A 1 153 ? -9.591  -7.971  13.779  1.00 0.00 ? 153 SER A HB3  2  
ATOM 8707   H HG   . SER A 1 153 ? -7.463  -7.372  12.008  1.00 0.00 ? 153 SER A HG   2  
ATOM 8708   N N    . ASP B 2 1   ? -3.558  -9.754  13.931  1.00 0.00 ? 1   ASP B N    2  
ATOM 8709   C CA   . ASP B 2 1   ? -3.113  -9.918  12.532  1.00 0.00 ? 1   ASP B CA   2  
ATOM 8710   C C    . ASP B 2 1   ? -2.386  -11.239 12.358  1.00 0.00 ? 1   ASP B C    2  
ATOM 8711   O O    . ASP B 2 1   ? -1.969  -11.860 13.336  1.00 0.00 ? 1   ASP B O    2  
ATOM 8712   C CB   . ASP B 2 1   ? -2.178  -8.773  12.131  1.00 0.00 ? 1   ASP B CB   2  
ATOM 8713   C CG   . ASP B 2 1   ? -2.873  -7.432  12.096  1.00 0.00 ? 1   ASP B CG   2  
ATOM 8714   O OD1  . ASP B 2 1   ? -3.273  -6.934  13.170  1.00 0.00 ? 1   ASP B OD1  2  
ATOM 8715   O OD2  . ASP B 2 1   ? -3.025  -6.864  10.997  1.00 0.00 ? 1   ASP B OD2  2  
ATOM 8716   H H1   . ASP B 2 1   ? -2.790  -10.015 14.583  1.00 0.00 ? 1   ASP B H1   2  
ATOM 8717   H H2   . ASP B 2 1   ? -4.379  -10.363 14.121  1.00 0.00 ? 1   ASP B H2   2  
ATOM 8718   H H3   . ASP B 2 1   ? -3.824  -8.765  14.106  1.00 0.00 ? 1   ASP B H3   2  
ATOM 8719   H HA   . ASP B 2 1   ? -3.989  -9.904  11.884  1.00 0.00 ? 1   ASP B HA   2  
ATOM 8720   H HB2  . ASP B 2 1   ? -1.359  -8.723  12.849  1.00 0.00 ? 1   ASP B HB2  2  
ATOM 8721   H HB3  . ASP B 2 1   ? -1.775  -8.983  11.140  1.00 0.00 ? 1   ASP B HB3  2  
ATOM 8722   H HD2  . ASP B 2 1   ? -3.473  -6.017  11.050  1.00 0.00 ? 1   ASP B HD2  2  
ATOM 8723   N N    . ILE B 2 2   ? -2.244  -11.674 11.112  1.00 0.00 ? 2   ILE B N    2  
ATOM 8724   C CA   . ILE B 2 2   ? -1.537  -12.914 10.815  1.00 0.00 ? 2   ILE B CA   2  
ATOM 8725   C C    . ILE B 2 2   ? -0.034  -12.664 10.881  1.00 0.00 ? 2   ILE B C    2  
ATOM 8726   O O    . ILE B 2 2   ? 0.575   -12.188 9.916   1.00 0.00 ? 2   ILE B O    2  
ATOM 8727   C CB   . ILE B 2 2   ? -1.920  -13.491 9.433   1.00 0.00 ? 2   ILE B CB   2  
ATOM 8728   C CG1  . ILE B 2 2   ? -2.278  -12.367 8.452   1.00 0.00 ? 2   ILE B CG1  2  
ATOM 8729   C CG2  . ILE B 2 2   ? -3.069  -14.482 9.569   1.00 0.00 ? 2   ILE B CG2  2  
ATOM 8730   C CD1  . ILE B 2 2   ? -2.553  -12.838 7.041   1.00 0.00 ? 2   ILE B CD1  2  
ATOM 8731   H H    . ILE B 2 2   ? -2.621  -11.149 10.377  1.00 0.00 ? 2   ILE B H    2  
ATOM 8732   H HA   . ILE B 2 2   ? -1.805  -13.647 11.576  1.00 0.00 ? 2   ILE B HA   2  
ATOM 8733   H HB   . ILE B 2 2   ? -1.057  -14.025 9.036   1.00 0.00 ? 2   ILE B HB   2  
ATOM 8734   H HG12 . ILE B 2 2   ? -3.169  -11.860 8.823   1.00 0.00 ? 2   ILE B HG12 2  
ATOM 8735   H HG13 . ILE B 2 2   ? -1.446  -11.663 8.421   1.00 0.00 ? 2   ILE B HG13 2  
ATOM 8736   H HG21 . ILE B 2 2   ? -3.312  -14.902 8.593   1.00 0.00 ? 2   ILE B HG21 2  
ATOM 8737   H HG22 . ILE B 2 2   ? -2.777  -15.285 10.246  1.00 0.00 ? 2   ILE B HG22 2  
ATOM 8738   H HG23 . ILE B 2 2   ? -3.944  -13.969 9.970   1.00 0.00 ? 2   ILE B HG23 2  
ATOM 8739   H HD11 . ILE B 2 2   ? -3.389  -13.537 7.051   1.00 0.00 ? 2   ILE B HD11 2  
ATOM 8740   H HD12 . ILE B 2 2   ? -2.801  -11.996 6.396   1.00 0.00 ? 2   ILE B HD12 2  
ATOM 8741   H HD13 . ILE B 2 2   ? -1.667  -13.338 6.649   1.00 0.00 ? 2   ILE B HD13 2  
ATOM 8742   N N    . GLN B 2 3   ? 0.548   -12.961 12.034  1.00 0.00 ? 3   GLN B N    2  
ATOM 8743   C CA   . GLN B 2 3   ? 1.970   -12.747 12.260  1.00 0.00 ? 3   GLN B CA   2  
ATOM 8744   C C    . GLN B 2 3   ? 2.834   -13.774 11.545  1.00 0.00 ? 3   GLN B C    2  
ATOM 8745   O O    . GLN B 2 3   ? 2.366   -14.848 11.161  1.00 0.00 ? 3   GLN B O    2  
ATOM 8746   C CB   . GLN B 2 3   ? 2.288   -12.754 13.757  1.00 0.00 ? 3   GLN B CB   2  
ATOM 8747   C CG   . GLN B 2 3   ? 1.579   -11.667 14.546  1.00 0.00 ? 3   GLN B CG   2  
ATOM 8748   C CD   . GLN B 2 3   ? 2.030   -11.610 15.991  1.00 0.00 ? 3   GLN B CD   2  
ATOM 8749   O OE1  . GLN B 2 3   ? 3.186   -11.890 16.307  1.00 0.00 ? 3   GLN B OE1  2  
ATOM 8750   N NE2  . GLN B 2 3   ? 1.120   -11.244 16.878  1.00 0.00 ? 3   GLN B NE2  2  
ATOM 8751   H H    . GLN B 2 3   ? 0.003   -13.338 12.758  1.00 0.00 ? 3   GLN B H    2  
ATOM 8752   H HA   . GLN B 2 3   ? 2.219   -11.763 11.863  1.00 0.00 ? 3   GLN B HA   2  
ATOM 8753   H HB2  . GLN B 2 3   ? 1.993   -13.721 14.165  1.00 0.00 ? 3   GLN B HB2  2  
ATOM 8754   H HB3  . GLN B 2 3   ? 3.363   -12.620 13.879  1.00 0.00 ? 3   GLN B HB3  2  
ATOM 8755   H HG2  . GLN B 2 3   ? 1.782   -10.704 14.078  1.00 0.00 ? 3   GLN B HG2  2  
ATOM 8756   H HG3  . GLN B 2 3   ? 0.507   -11.859 14.521  1.00 0.00 ? 3   GLN B HG3  2  
ATOM 8757   H HE21 . GLN B 2 3   ? 0.214   -11.032 16.553  1.00 0.00 ? 3   GLN B HE21 2  
ATOM 8758   H HE22 . GLN B 2 3   ? 1.380   -11.209 17.824  1.00 0.00 ? 3   GLN B HE22 2  
ATOM 8759   N N    . MET B 2 4   ? 4.100   -13.427 11.372  1.00 0.00 ? 4   MET B N    2  
ATOM 8760   C CA   . MET B 2 4   ? 5.064   -14.298 10.719  1.00 0.00 ? 4   MET B CA   2  
ATOM 8761   C C    . MET B 2 4   ? 6.206   -14.581 11.681  1.00 0.00 ? 4   MET B C    2  
ATOM 8762   O O    . MET B 2 4   ? 6.562   -13.728 12.489  1.00 0.00 ? 4   MET B O    2  
ATOM 8763   C CB   . MET B 2 4   ? 5.622   -13.632 9.455   1.00 0.00 ? 4   MET B CB   2  
ATOM 8764   C CG   . MET B 2 4   ? 4.583   -13.320 8.389   1.00 0.00 ? 4   MET B CG   2  
ATOM 8765   S SD   . MET B 2 4   ? 3.718   -14.790 7.803   1.00 0.00 ? 4   MET B SD   2  
ATOM 8766   C CE   . MET B 2 4   ? 5.081   -15.765 7.176   1.00 0.00 ? 4   MET B CE   2  
ATOM 8767   H H    . MET B 2 4   ? 4.403   -12.556 11.701  1.00 0.00 ? 4   MET B H    2  
ATOM 8768   H HA   . MET B 2 4   ? 4.575   -15.233 10.447  1.00 0.00 ? 4   MET B HA   2  
ATOM 8769   H HB2  . MET B 2 4   ? 6.100   -12.697 9.747   1.00 0.00 ? 4   MET B HB2  2  
ATOM 8770   H HB3  . MET B 2 4   ? 6.365   -14.300 9.020   1.00 0.00 ? 4   MET B HB3  2  
ATOM 8771   H HG2  . MET B 2 4   ? 3.853   -12.625 8.801   1.00 0.00 ? 4   MET B HG2  2  
ATOM 8772   H HG3  . MET B 2 4   ? 5.080   -12.845 7.542   1.00 0.00 ? 4   MET B HG3  2  
ATOM 8773   H HE1  . MET B 2 4   ? 5.784   -15.967 7.984   1.00 0.00 ? 4   MET B HE1  2  
ATOM 8774   H HE2  . MET B 2 4   ? 4.711   -16.710 6.777   1.00 0.00 ? 4   MET B HE2  2  
ATOM 8775   H HE3  . MET B 2 4   ? 5.587   -15.213 6.384   1.00 0.00 ? 4   MET B HE3  2  
ATOM 8776   N N    . THR B 2 5   ? 6.759   -15.781 11.615  1.00 0.00 ? 5   THR B N    2  
ATOM 8777   C CA   . THR B 2 5   ? 7.868   -16.156 12.481  1.00 0.00 ? 5   THR B CA   2  
ATOM 8778   C C    . THR B 2 5   ? 8.932   -16.906 11.688  1.00 0.00 ? 5   THR B C    2  
ATOM 8779   O O    . THR B 2 5   ? 8.686   -18.007 11.197  1.00 0.00 ? 5   THR B O    2  
ATOM 8780   C CB   . THR B 2 5   ? 7.387   -17.036 13.652  1.00 0.00 ? 5   THR B CB   2  
ATOM 8781   O OG1  . THR B 2 5   ? 5.953   -17.103 13.628  1.00 0.00 ? 5   THR B OG1  2  
ATOM 8782   C CG2  . THR B 2 5   ? 7.835   -16.443 14.979  1.00 0.00 ? 5   THR B CG2  2  
ATOM 8783   H H    . THR B 2 5   ? 6.412   -16.436 10.967  1.00 0.00 ? 5   THR B H    2  
ATOM 8784   H HA   . THR B 2 5   ? 8.307   -15.245 12.887  1.00 0.00 ? 5   THR B HA   2  
ATOM 8785   H HB   . THR B 2 5   ? 7.803   -18.038 13.545  1.00 0.00 ? 5   THR B HB   2  
ATOM 8786   H HG1  . THR B 2 5   ? 5.625   -16.546 12.911  1.00 0.00 ? 5   THR B HG1  2  
ATOM 8787   H HG21 . THR B 2 5   ? 7.417   -15.442 15.089  1.00 0.00 ? 5   THR B HG21 2  
ATOM 8788   H HG22 . THR B 2 5   ? 7.486   -17.073 15.798  1.00 0.00 ? 5   THR B HG22 2  
ATOM 8789   H HG23 . THR B 2 5   ? 8.923   -16.388 15.003  1.00 0.00 ? 5   THR B HG23 2  
ATOM 8790   N N    . GLN B 2 6   ? 10.101  -16.301 11.547  1.00 0.00 ? 6   GLN B N    2  
ATOM 8791   C CA   . GLN B 2 6   ? 11.196  -16.917 10.807  1.00 0.00 ? 6   GLN B CA   2  
ATOM 8792   C C    . GLN B 2 6   ? 12.256  -17.504 11.726  1.00 0.00 ? 6   GLN B C    2  
ATOM 8793   O O    . GLN B 2 6   ? 12.554  -16.952 12.787  1.00 0.00 ? 6   GLN B O    2  
ATOM 8794   C CB   . GLN B 2 6   ? 11.834  -15.907 9.854   1.00 0.00 ? 6   GLN B CB   2  
ATOM 8795   C CG   . GLN B 2 6   ? 11.159  -15.837 8.500   1.00 0.00 ? 6   GLN B CG   2  
ATOM 8796   C CD   . GLN B 2 6   ? 11.745  -14.764 7.612   1.00 0.00 ? 6   GLN B CD   2  
ATOM 8797   O OE1  . GLN B 2 6   ? 11.238  -13.645 7.550   1.00 0.00 ? 6   GLN B OE1  2  
ATOM 8798   N NE2  . GLN B 2 6   ? 12.830  -15.088 6.935   1.00 0.00 ? 6   GLN B NE2  2  
ATOM 8799   H H    . GLN B 2 6   ? 10.233  -15.409 11.943  1.00 0.00 ? 6   GLN B H    2  
ATOM 8800   H HA   . GLN B 2 6   ? 10.776  -17.729 10.214  1.00 0.00 ? 6   GLN B HA   2  
ATOM 8801   H HB2  . GLN B 2 6   ? 11.786  -14.920 10.315  1.00 0.00 ? 6   GLN B HB2  2  
ATOM 8802   H HB3  . GLN B 2 6   ? 12.877  -16.187 9.704   1.00 0.00 ? 6   GLN B HB3  2  
ATOM 8803   H HG2  . GLN B 2 6   ? 11.268  -16.800 8.003   1.00 0.00 ? 6   GLN B HG2  2  
ATOM 8804   H HG3  . GLN B 2 6   ? 10.099  -15.628 8.648   1.00 0.00 ? 6   GLN B HG3  2  
ATOM 8805   H HE21 . GLN B 2 6   ? 13.196  -15.994 7.046   1.00 0.00 ? 6   GLN B HE21 2  
ATOM 8806   H HE22 . GLN B 2 6   ? 13.232  -14.408 6.349   1.00 0.00 ? 6   GLN B HE22 2  
ATOM 8807   N N    . SER B 2 7   ? 12.816  -18.630 11.310  1.00 0.00 ? 7   SER B N    2  
ATOM 8808   C CA   . SER B 2 7   ? 13.856  -19.304 12.071  1.00 0.00 ? 7   SER B CA   2  
ATOM 8809   C C    . SER B 2 7   ? 14.843  -19.984 11.128  1.00 0.00 ? 7   SER B C    2  
ATOM 8810   O O    . SER B 2 7   ? 14.446  -20.737 10.234  1.00 0.00 ? 7   SER B O    2  
ATOM 8811   C CB   . SER B 2 7   ? 13.260  -20.326 13.044  1.00 0.00 ? 7   SER B CB   2  
ATOM 8812   O OG   . SER B 2 7   ? 13.427  -19.908 14.389  1.00 0.00 ? 7   SER B OG   2  
ATOM 8813   H H    . SER B 2 7   ? 12.524  -19.020 10.456  1.00 0.00 ? 7   SER B H    2  
ATOM 8814   H HA   . SER B 2 7   ? 14.393  -18.552 12.650  1.00 0.00 ? 7   SER B HA   2  
ATOM 8815   H HB2  . SER B 2 7   ? 12.195  -20.437 12.836  1.00 0.00 ? 7   SER B HB2  2  
ATOM 8816   H HB3  . SER B 2 7   ? 13.759  -21.284 12.905  1.00 0.00 ? 7   SER B HB3  2  
ATOM 8817   H HG   . SER B 2 7   ? 12.850  -19.156 14.563  1.00 0.00 ? 7   SER B HG   2  
ATOM 8818   N N    . PRO B 2 8   ? 16.141  -19.709 11.303  1.00 0.00 ? 8   PRO B N    2  
ATOM 8819   C CA   . PRO B 2 8   ? 16.625  -18.795 12.335  1.00 0.00 ? 8   PRO B CA   2  
ATOM 8820   C C    . PRO B 2 8   ? 16.685  -17.356 11.827  1.00 0.00 ? 8   PRO B C    2  
ATOM 8821   O O    . PRO B 2 8   ? 16.394  -17.086 10.661  1.00 0.00 ? 8   PRO B O    2  
ATOM 8822   C CB   . PRO B 2 8   ? 18.035  -19.322 12.592  1.00 0.00 ? 8   PRO B CB   2  
ATOM 8823   C CG   . PRO B 2 8   ? 18.484  -19.863 11.276  1.00 0.00 ? 8   PRO B CG   2  
ATOM 8824   C CD   . PRO B 2 8   ? 17.246  -20.277 10.516  1.00 0.00 ? 8   PRO B CD   2  
ATOM 8825   H HA   . PRO B 2 8   ? 16.011  -18.846 13.234  1.00 0.00 ? 8   PRO B HA   2  
ATOM 8826   H HB2  . PRO B 2 8   ? 18.700  -18.539 12.958  1.00 0.00 ? 8   PRO B HB2  2  
ATOM 8827   H HB3  . PRO B 2 8   ? 17.978  -20.144 13.306  1.00 0.00 ? 8   PRO B HB3  2  
ATOM 8828   H HG2  . PRO B 2 8   ? 18.968  -19.056 10.725  1.00 0.00 ? 8   PRO B HG2  2  
ATOM 8829   H HG3  . PRO B 2 8   ? 19.165  -20.704 11.406  1.00 0.00 ? 8   PRO B HG3  2  
ATOM 8830   H HD2  . PRO B 2 8   ? 17.261  -19.888 9.498   1.00 0.00 ? 8   PRO B HD2  2  
ATOM 8831   H HD3  . PRO B 2 8   ? 17.160  -21.363 10.506  1.00 0.00 ? 8   PRO B HD3  2  
ATOM 8832   N N    . SER B 2 9   ? 17.042  -16.434 12.708  1.00 0.00 ? 9   SER B N    2  
ATOM 8833   C CA   . SER B 2 9   ? 17.152  -15.034 12.337  1.00 0.00 ? 9   SER B CA   2  
ATOM 8834   C C    . SER B 2 9   ? 18.454  -14.801 11.570  1.00 0.00 ? 9   SER B C    2  
ATOM 8835   O O    . SER B 2 9   ? 18.528  -13.961 10.673  1.00 0.00 ? 9   SER B O    2  
ATOM 8836   C CB   . SER B 2 9   ? 17.097  -14.163 13.591  1.00 0.00 ? 9   SER B CB   2  
ATOM 8837   O OG   . SER B 2 9   ? 16.108  -14.647 14.489  1.00 0.00 ? 9   SER B OG   2  
ATOM 8838   H H    . SER B 2 9   ? 17.225  -16.699 13.637  1.00 0.00 ? 9   SER B H    2  
ATOM 8839   H HA   . SER B 2 9   ? 16.313  -14.774 11.692  1.00 0.00 ? 9   SER B HA   2  
ATOM 8840   H HB2  . SER B 2 9   ? 18.069  -14.182 14.084  1.00 0.00 ? 9   SER B HB2  2  
ATOM 8841   H HB3  . SER B 2 9   ? 16.853  -13.139 13.307  1.00 0.00 ? 9   SER B HB3  2  
ATOM 8842   H HG   . SER B 2 9   ? 15.335  -14.929 13.987  1.00 0.00 ? 9   SER B HG   2  
ATOM 8843   N N    . SER B 2 10  ? 19.479  -15.558 11.930  1.00 0.00 ? 10  SER B N    2  
ATOM 8844   C CA   . SER B 2 10  ? 20.778  -15.463 11.281  1.00 0.00 ? 10  SER B CA   2  
ATOM 8845   C C    . SER B 2 10  ? 21.495  -16.807 11.375  1.00 0.00 ? 10  SER B C    2  
ATOM 8846   O O    . SER B 2 10  ? 21.491  -17.443 12.429  1.00 0.00 ? 10  SER B O    2  
ATOM 8847   C CB   . SER B 2 10  ? 21.622  -14.360 11.930  1.00 0.00 ? 10  SER B CB   2  
ATOM 8848   O OG   . SER B 2 10  ? 20.908  -13.135 11.964  1.00 0.00 ? 10  SER B OG   2  
ATOM 8849   H H    . SER B 2 10  ? 19.364  -16.204 12.660  1.00 0.00 ? 10  SER B H    2  
ATOM 8850   H HA   . SER B 2 10  ? 20.626  -15.216 10.230  1.00 0.00 ? 10  SER B HA   2  
ATOM 8851   H HB2  . SER B 2 10  ? 21.874  -14.655 12.948  1.00 0.00 ? 10  SER B HB2  2  
ATOM 8852   H HB3  . SER B 2 10  ? 22.537  -14.225 11.353  1.00 0.00 ? 10  SER B HB3  2  
ATOM 8853   H HG   . SER B 2 10  ? 20.084  -13.233 11.468  1.00 0.00 ? 10  SER B HG   2  
ATOM 8854   N N    . LEU B 2 11  ? 22.078  -17.248 10.271  1.00 0.00 ? 11  LEU B N    2  
ATOM 8855   C CA   . LEU B 2 11  ? 22.789  -18.517 10.240  1.00 0.00 ? 11  LEU B CA   2  
ATOM 8856   C C    . LEU B 2 11  ? 24.027  -18.413 9.363   1.00 0.00 ? 11  LEU B C    2  
ATOM 8857   O O    . LEU B 2 11  ? 24.047  -17.659 8.391   1.00 0.00 ? 11  LEU B O    2  
ATOM 8858   C CB   . LEU B 2 11  ? 21.879  -19.643 9.735   1.00 0.00 ? 11  LEU B CB   2  
ATOM 8859   C CG   . LEU B 2 11  ? 21.631  -19.697 8.224   1.00 0.00 ? 11  LEU B CG   2  
ATOM 8860   C CD1  . LEU B 2 11  ? 22.101  -21.028 7.652   1.00 0.00 ? 11  LEU B CD1  2  
ATOM 8861   C CD2  . LEU B 2 11  ? 20.161  -19.470 7.909   1.00 0.00 ? 11  LEU B CD2  2  
ATOM 8862   H H    . LEU B 2 11  ? 22.042  -16.699 9.452   1.00 0.00 ? 11  LEU B H    2  
ATOM 8863   H HA   . LEU B 2 11  ? 23.102  -18.755 11.257  1.00 0.00 ? 11  LEU B HA   2  
ATOM 8864   H HB2  . LEU B 2 11  ? 22.329  -20.590 10.031  1.00 0.00 ? 11  LEU B HB2  2  
ATOM 8865   H HB3  . LEU B 2 11  ? 20.912  -19.531 10.226  1.00 0.00 ? 11  LEU B HB3  2  
ATOM 8866   H HG   . LEU B 2 11  ? 22.207  -18.900 7.754   1.00 0.00 ? 11  LEU B HG   2  
ATOM 8867   H HD11 . LEU B 2 11  ? 21.940  -21.045 6.574   1.00 0.00 ? 11  LEU B HD11 2  
ATOM 8868   H HD12 . LEU B 2 11  ? 23.163  -21.157 7.861   1.00 0.00 ? 11  LEU B HD12 2  
ATOM 8869   H HD13 . LEU B 2 11  ? 21.538  -21.840 8.113   1.00 0.00 ? 11  LEU B HD13 2  
ATOM 8870   H HD21 . LEU B 2 11  ? 19.853  -18.500 8.301   1.00 0.00 ? 11  LEU B HD21 2  
ATOM 8871   H HD22 . LEU B 2 11  ? 20.006  -19.489 6.830   1.00 0.00 ? 11  LEU B HD22 2  
ATOM 8872   H HD23 . LEU B 2 11  ? 19.565  -20.256 8.373   1.00 0.00 ? 11  LEU B HD23 2  
ATOM 8873   N N    . SER B 2 12  ? 25.055  -19.162 9.715   1.00 0.00 ? 12  SER B N    2  
ATOM 8874   C CA   . SER B 2 12  ? 26.289  -19.159 8.953   1.00 0.00 ? 12  SER B CA   2  
ATOM 8875   C C    . SER B 2 12  ? 26.591  -20.546 8.405   1.00 0.00 ? 12  SER B C    2  
ATOM 8876   O O    . SER B 2 12  ? 26.543  -21.538 9.136   1.00 0.00 ? 12  SER B O    2  
ATOM 8877   C CB   . SER B 2 12  ? 27.443  -18.669 9.824   1.00 0.00 ? 12  SER B CB   2  
ATOM 8878   O OG   . SER B 2 12  ? 27.151  -17.402 10.391  1.00 0.00 ? 12  SER B OG   2  
ATOM 8879   H H    . SER B 2 12  ? 24.988  -19.725 10.513  1.00 0.00 ? 12  SER B H    2  
ATOM 8880   H HA   . SER B 2 12  ? 26.172  -18.472 8.115   1.00 0.00 ? 12  SER B HA   2  
ATOM 8881   H HB2  . SER B 2 12  ? 27.613  -19.387 10.626  1.00 0.00 ? 12  SER B HB2  2  
ATOM 8882   H HB3  . SER B 2 12  ? 28.341  -18.587 9.213   1.00 0.00 ? 12  SER B HB3  2  
ATOM 8883   H HG   . SER B 2 12  ? 27.753  -16.738 10.009  1.00 0.00 ? 12  SER B HG   2  
ATOM 8884   N N    . ALA B 2 13  ? 26.894  -20.607 7.118   1.00 0.00 ? 13  ALA B N    2  
ATOM 8885   C CA   . ALA B 2 13  ? 27.207  -21.864 6.459   1.00 0.00 ? 13  ALA B CA   2  
ATOM 8886   C C    . ALA B 2 13  ? 28.393  -21.673 5.520   1.00 0.00 ? 13  ALA B C    2  
ATOM 8887   O O    . ALA B 2 13  ? 28.859  -20.552 5.331   1.00 0.00 ? 13  ALA B O    2  
ATOM 8888   C CB   . ALA B 2 13  ? 25.994  -22.383 5.700   1.00 0.00 ? 13  ALA B CB   2  
ATOM 8889   H H    . ALA B 2 13  ? 26.925  -19.773 6.594   1.00 0.00 ? 13  ALA B H    2  
ATOM 8890   H HA   . ALA B 2 13  ? 27.478  -22.596 7.220   1.00 0.00 ? 13  ALA B HA   2  
ATOM 8891   H HB1  . ALA B 2 13  ? 26.236  -23.335 5.228   1.00 0.00 ? 13  ALA B HB1  2  
ATOM 8892   H HB2  . ALA B 2 13  ? 25.166  -22.524 6.394   1.00 0.00 ? 13  ALA B HB2  2  
ATOM 8893   H HB3  . ALA B 2 13  ? 25.709  -21.661 4.935   1.00 0.00 ? 13  ALA B HB3  2  
ATOM 8894   N N    . SER B 2 14  ? 28.879  -22.757 4.938   1.00 0.00 ? 14  SER B N    2  
ATOM 8895   C CA   . SER B 2 14  ? 30.012  -22.679 4.031   1.00 0.00 ? 14  SER B CA   2  
ATOM 8896   C C    . SER B 2 14  ? 29.548  -22.733 2.578   1.00 0.00 ? 14  SER B C    2  
ATOM 8897   O O    . SER B 2 14  ? 28.374  -23.003 2.303   1.00 0.00 ? 14  SER B O    2  
ATOM 8898   C CB   . SER B 2 14  ? 30.994  -23.813 4.334   1.00 0.00 ? 14  SER B CB   2  
ATOM 8899   O OG   . SER B 2 14  ? 31.142  -23.983 5.738   1.00 0.00 ? 14  SER B OG   2  
ATOM 8900   H H    . SER B 2 14  ? 28.462  -23.631 5.112   1.00 0.00 ? 14  SER B H    2  
ATOM 8901   H HA   . SER B 2 14  ? 30.519  -21.728 4.195   1.00 0.00 ? 14  SER B HA   2  
ATOM 8902   H HB2  . SER B 2 14  ? 30.617  -24.740 3.900   1.00 0.00 ? 14  SER B HB2  2  
ATOM 8903   H HB3  . SER B 2 14  ? 31.963  -23.575 3.898   1.00 0.00 ? 14  SER B HB3  2  
ATOM 8904   H HG   . SER B 2 14  ? 30.303  -24.281 6.113   1.00 0.00 ? 14  SER B HG   2  
ATOM 8905   N N    . VAL B 2 15  ? 30.462  -22.469 1.654   1.00 0.00 ? 15  VAL B N    2  
ATOM 8906   C CA   . VAL B 2 15  ? 30.139  -22.491 0.233   1.00 0.00 ? 15  VAL B CA   2  
ATOM 8907   C C    . VAL B 2 15  ? 29.837  -23.917 -0.215  1.00 0.00 ? 15  VAL B C    2  
ATOM 8908   O O    . VAL B 2 15  ? 30.689  -24.800 -0.129  1.00 0.00 ? 15  VAL B O    2  
ATOM 8909   C CB   . VAL B 2 15  ? 31.285  -21.911 -0.623  1.00 0.00 ? 15  VAL B CB   2  
ATOM 8910   C CG1  . VAL B 2 15  ? 30.885  -21.849 -2.089  1.00 0.00 ? 15  VAL B CG1  2  
ATOM 8911   C CG2  . VAL B 2 15  ? 31.680  -20.530 -0.121  1.00 0.00 ? 15  VAL B CG2  2  
ATOM 8912   H H    . VAL B 2 15  ? 31.382  -22.262 1.932   1.00 0.00 ? 15  VAL B H    2  
ATOM 8913   H HA   . VAL B 2 15  ? 29.250  -21.880 0.079   1.00 0.00 ? 15  VAL B HA   2  
ATOM 8914   H HB   . VAL B 2 15  ? 32.148  -22.569 -0.531  1.00 0.00 ? 15  VAL B HB   2  
ATOM 8915   H HG11 . VAL B 2 15  ? 31.712  -21.456 -2.682  1.00 0.00 ? 15  VAL B HG11 2  
ATOM 8916   H HG12 . VAL B 2 15  ? 30.633  -22.850 -2.439  1.00 0.00 ? 15  VAL B HG12 2  
ATOM 8917   H HG13 . VAL B 2 15  ? 30.019  -21.196 -2.202  1.00 0.00 ? 15  VAL B HG13 2  
ATOM 8918   H HG21 . VAL B 2 15  ? 31.991  -20.599 0.921   1.00 0.00 ? 15  VAL B HG21 2  
ATOM 8919   H HG22 . VAL B 2 15  ? 32.504  -20.141 -0.720  1.00 0.00 ? 15  VAL B HG22 2  
ATOM 8920   H HG23 . VAL B 2 15  ? 30.826  -19.857 -0.201  1.00 0.00 ? 15  VAL B HG23 2  
ATOM 8921   N N    . GLY B 2 16  ? 28.617  -24.135 -0.680  1.00 0.00 ? 16  GLY B N    2  
ATOM 8922   C CA   . GLY B 2 16  ? 28.219  -25.456 -1.122  1.00 0.00 ? 16  GLY B CA   2  
ATOM 8923   C C    . GLY B 2 16  ? 27.378  -26.174 -0.088  1.00 0.00 ? 16  GLY B C    2  
ATOM 8924   O O    . GLY B 2 16  ? 26.984  -27.330 -0.281  1.00 0.00 ? 16  GLY B O    2  
ATOM 8925   H H    . GLY B 2 16  ? 27.981  -23.387 -0.733  1.00 0.00 ? 16  GLY B H    2  
ATOM 8926   H HA2  . GLY B 2 16  ? 27.641  -25.360 -2.041  1.00 0.00 ? 16  GLY B HA2  2  
ATOM 8927   H HA3  . GLY B 2 16  ? 29.114  -26.046 -1.319  1.00 0.00 ? 16  GLY B HA3  2  
ATOM 8928   N N    . ASP B 2 17  ? 27.111  -25.493 1.019   1.00 0.00 ? 17  ASP B N    2  
ATOM 8929   C CA   . ASP B 2 17  ? 26.307  -26.066 2.089   1.00 0.00 ? 17  ASP B CA   2  
ATOM 8930   C C    . ASP B 2 17  ? 24.822  -25.960 1.768   1.00 0.00 ? 17  ASP B C    2  
ATOM 8931   O O    . ASP B 2 17  ? 24.425  -25.213 0.869   1.00 0.00 ? 17  ASP B O    2  
ATOM 8932   C CB   . ASP B 2 17  ? 26.599  -25.382 3.427   1.00 0.00 ? 17  ASP B CB   2  
ATOM 8933   C CG   . ASP B 2 17  ? 27.516  -26.196 4.318   1.00 0.00 ? 17  ASP B CG   2  
ATOM 8934   O OD1  . ASP B 2 17  ? 27.553  -27.436 4.170   1.00 0.00 ? 17  ASP B OD1  2  
ATOM 8935   O OD2  . ASP B 2 17  ? 28.202  -25.603 5.177   1.00 0.00 ? 17  ASP B OD2  2  
ATOM 8936   H H    . ASP B 2 17  ? 27.465  -24.583 1.118   1.00 0.00 ? 17  ASP B H    2  
ATOM 8937   H HA   . ASP B 2 17  ? 26.568  -27.121 2.178   1.00 0.00 ? 17  ASP B HA   2  
ATOM 8938   H HB2  . ASP B 2 17  ? 27.069  -24.418 3.232   1.00 0.00 ? 17  ASP B HB2  2  
ATOM 8939   H HB3  . ASP B 2 17  ? 25.657  -25.223 3.951   1.00 0.00 ? 17  ASP B HB3  2  
ATOM 8940   H HD2  . ASP B 2 17  ? 28.757  -26.181 5.706   1.00 0.00 ? 17  ASP B HD2  2  
ATOM 8941   N N    . ARG B 2 18  ? 24.020  -26.715 2.499   1.00 0.00 ? 18  ARG B N    2  
ATOM 8942   C CA   . ARG B 2 18  ? 22.576  -26.716 2.312   1.00 0.00 ? 18  ARG B CA   2  
ATOM 8943   C C    . ARG B 2 18  ? 21.935  -25.755 3.303   1.00 0.00 ? 18  ARG B C    2  
ATOM 8944   O O    . ARG B 2 18  ? 22.090  -25.907 4.515   1.00 0.00 ? 18  ARG B O    2  
ATOM 8945   C CB   . ARG B 2 18  ? 22.029  -28.132 2.504   1.00 0.00 ? 18  ARG B CB   2  
ATOM 8946   C CG   . ARG B 2 18  ? 20.563  -28.309 2.134   1.00 0.00 ? 18  ARG B CG   2  
ATOM 8947   C CD   . ARG B 2 18  ? 20.235  -29.778 1.914   1.00 0.00 ? 18  ARG B CD   2  
ATOM 8948   N NE   . ARG B 2 18  ? 18.800  -30.017 1.750   1.00 0.00 ? 18  ARG B NE   2  
ATOM 8949   C CZ   . ARG B 2 18  ? 18.187  -30.120 0.570   1.00 0.00 ? 18  ARG B CZ   2  
ATOM 8950   N NH1  . ARG B 2 18  ? 18.883  -29.990 -0.554  1.00 0.00 ? 18  ARG B NH1  2  
ATOM 8951   N NH2  . ARG B 2 18  ? 16.881  -30.366 0.512   1.00 0.00 ? 18  ARG B NH2  2  
ATOM 8952   H H    . ARG B 2 18  ? 24.411  -27.275 3.200   1.00 0.00 ? 18  ARG B H    2  
ATOM 8953   H HA   . ARG B 2 18  ? 22.350  -26.384 1.299   1.00 0.00 ? 18  ARG B HA   2  
ATOM 8954   H HB2  . ARG B 2 18  ? 22.618  -28.809 1.886   1.00 0.00 ? 18  ARG B HB2  2  
ATOM 8955   H HB3  . ARG B 2 18  ? 22.148  -28.401 3.553   1.00 0.00 ? 18  ARG B HB3  2  
ATOM 8956   H HG2  . ARG B 2 18  ? 19.942  -27.921 2.941   1.00 0.00 ? 18  ARG B HG2  2  
ATOM 8957   H HG3  . ARG B 2 18  ? 20.356  -27.755 1.218   1.00 0.00 ? 18  ARG B HG3  2  
ATOM 8958   H HD2  . ARG B 2 18  ? 20.751  -30.123 1.018   1.00 0.00 ? 18  ARG B HD2  2  
ATOM 8959   H HD3  . ARG B 2 18  ? 20.588  -30.349 2.773   1.00 0.00 ? 18  ARG B HD3  2  
ATOM 8960   H HE   . ARG B 2 18  ? 18.268  -30.123 2.572   1.00 0.00 ? 18  ARG B HE   2  
ATOM 8961   H HH11 . ARG B 2 18  ? 19.872  -29.818 -0.518  1.00 0.00 ? 18  ARG B HH11 2  
ATOM 8962   H HH12 . ARG B 2 18  ? 18.422  -30.059 -1.444  1.00 0.00 ? 18  ARG B HH12 2  
ATOM 8963   H HH21 . ARG B 2 18  ? 16.348  -30.475 1.357   1.00 0.00 ? 18  ARG B HH21 2  
ATOM 8964   H HH22 . ARG B 2 18  ? 16.420  -30.448 -0.374  1.00 0.00 ? 18  ARG B HH22 2  
ATOM 8965   N N    . VAL B 2 19  ? 21.230  -24.763 2.788   1.00 0.00 ? 19  VAL B N    2  
ATOM 8966   C CA   . VAL B 2 19  ? 20.583  -23.776 3.641   1.00 0.00 ? 19  VAL B CA   2  
ATOM 8967   C C    . VAL B 2 19  ? 19.084  -24.023 3.741   1.00 0.00 ? 19  VAL B C    2  
ATOM 8968   O O    . VAL B 2 19  ? 18.398  -24.163 2.727   1.00 0.00 ? 19  VAL B O    2  
ATOM 8969   C CB   . VAL B 2 19  ? 20.836  -22.335 3.146   1.00 0.00 ? 19  VAL B CB   2  
ATOM 8970   C CG1  . VAL B 2 19  ? 20.195  -21.316 4.079   1.00 0.00 ? 19  VAL B CG1  2  
ATOM 8971   C CG2  . VAL B 2 19  ? 22.328  -22.072 3.013   1.00 0.00 ? 19  VAL B CG2  2  
ATOM 8972   H H    . VAL B 2 19  ? 21.135  -24.694 1.814   1.00 0.00 ? 19  VAL B H    2  
ATOM 8973   H HA   . VAL B 2 19  ? 21.013  -23.873 4.638   1.00 0.00 ? 19  VAL B HA   2  
ATOM 8974   H HB   . VAL B 2 19  ? 20.381  -22.228 2.161   1.00 0.00 ? 19  VAL B HB   2  
ATOM 8975   H HG11 . VAL B 2 19  ? 20.366  -20.308 3.701   1.00 0.00 ? 19  VAL B HG11 2  
ATOM 8976   H HG12 . VAL B 2 19  ? 19.122  -21.502 4.137   1.00 0.00 ? 19  VAL B HG12 2  
ATOM 8977   H HG13 . VAL B 2 19  ? 20.633  -21.408 5.073   1.00 0.00 ? 19  VAL B HG13 2  
ATOM 8978   H HG21 . VAL B 2 19  ? 22.762  -22.790 2.316   1.00 0.00 ? 19  VAL B HG21 2  
ATOM 8979   H HG22 . VAL B 2 19  ? 22.493  -21.061 2.639   1.00 0.00 ? 19  VAL B HG22 2  
ATOM 8980   H HG23 . VAL B 2 19  ? 22.804  -22.179 3.988   1.00 0.00 ? 19  VAL B HG23 2  
ATOM 8981   N N    . THR B 2 20  ? 18.592  -24.082 4.969   1.00 0.00 ? 20  THR B N    2  
ATOM 8982   C CA   . THR B 2 20  ? 17.179  -24.296 5.228   1.00 0.00 ? 20  THR B CA   2  
ATOM 8983   C C    . THR B 2 20  ? 16.625  -23.129 6.045   1.00 0.00 ? 20  THR B C    2  
ATOM 8984   O O    . THR B 2 20  ? 17.150  -22.802 7.110   1.00 0.00 ? 20  THR B O    2  
ATOM 8985   C CB   . THR B 2 20  ? 16.956  -25.617 5.997   1.00 0.00 ? 20  THR B CB   2  
ATOM 8986   O OG1  . THR B 2 20  ? 17.427  -26.718 5.208   1.00 0.00 ? 20  THR B OG1  2  
ATOM 8987   C CG2  . THR B 2 20  ? 15.483  -25.822 6.313   1.00 0.00 ? 20  THR B CG2  2  
ATOM 8988   H H    . THR B 2 20  ? 19.201  -23.975 5.731   1.00 0.00 ? 20  THR B H    2  
ATOM 8989   H HA   . THR B 2 20  ? 16.652  -24.349 4.275   1.00 0.00 ? 20  THR B HA   2  
ATOM 8990   H HB   . THR B 2 20  ? 17.517  -25.580 6.931   1.00 0.00 ? 20  THR B HB   2  
ATOM 8991   H HG1  . THR B 2 20  ? 18.391  -26.775 5.279   1.00 0.00 ? 20  THR B HG1  2  
ATOM 8992   H HG21 . THR B 2 20  ? 14.916  -25.862 5.383   1.00 0.00 ? 20  THR B HG21 2  
ATOM 8993   H HG22 . THR B 2 20  ? 15.348  -26.755 6.859   1.00 0.00 ? 20  THR B HG22 2  
ATOM 8994   H HG23 . THR B 2 20  ? 15.124  -24.992 6.921   1.00 0.00 ? 20  THR B HG23 2  
ATOM 8995   N N    . ILE B 2 21  ? 15.576  -22.498 5.537   1.00 0.00 ? 21  ILE B N    2  
ATOM 8996   C CA   . ILE B 2 21  ? 14.955  -21.368 6.218   1.00 0.00 ? 21  ILE B CA   2  
ATOM 8997   C C    . ILE B 2 21  ? 13.490  -21.684 6.489   1.00 0.00 ? 21  ILE B C    2  
ATOM 8998   O O    . ILE B 2 21  ? 12.721  -21.909 5.557   1.00 0.00 ? 21  ILE B O    2  
ATOM 8999   C CB   . ILE B 2 21  ? 15.049  -20.084 5.368   1.00 0.00 ? 21  ILE B CB   2  
ATOM 9000   C CG1  . ILE B 2 21  ? 16.510  -19.769 5.038   1.00 0.00 ? 21  ILE B CG1  2  
ATOM 9001   C CG2  . ILE B 2 21  ? 14.398  -18.913 6.090   1.00 0.00 ? 21  ILE B CG2  2  
ATOM 9002   C CD1  . ILE B 2 21  ? 16.687  -18.704 3.980   1.00 0.00 ? 21  ILE B CD1  2  
ATOM 9003   H H    . ILE B 2 21  ? 15.191  -22.812 4.688   1.00 0.00 ? 21  ILE B H    2  
ATOM 9004   H HA   . ILE B 2 21  ? 15.470  -21.204 7.164   1.00 0.00 ? 21  ILE B HA   2  
ATOM 9005   H HB   . ILE B 2 21  ? 14.513  -20.251 4.433   1.00 0.00 ? 21  ILE B HB   2  
ATOM 9006   H HG12 . ILE B 2 21  ? 17.003  -19.431 5.950   1.00 0.00 ? 21  ILE B HG12 2  
ATOM 9007   H HG13 . ILE B 2 21  ? 16.987  -20.684 4.685   1.00 0.00 ? 21  ILE B HG13 2  
ATOM 9008   H HG21 . ILE B 2 21  ? 14.453  -18.019 5.468   1.00 0.00 ? 21  ILE B HG21 2  
ATOM 9009   H HG22 . ILE B 2 21  ? 13.353  -19.148 6.293   1.00 0.00 ? 21  ILE B HG22 2  
ATOM 9010   H HG23 . ILE B 2 21  ? 14.918  -18.732 7.030   1.00 0.00 ? 21  ILE B HG23 2  
ATOM 9011   H HD11 . ILE B 2 21  ? 16.222  -17.779 4.320   1.00 0.00 ? 21  ILE B HD11 2  
ATOM 9012   H HD12 . ILE B 2 21  ? 17.745  -18.523 3.790   1.00 0.00 ? 21  ILE B HD12 2  
ATOM 9013   H HD13 . ILE B 2 21  ? 16.210  -19.032 3.056   1.00 0.00 ? 21  ILE B HD13 2  
ATOM 9014   N N    . THR B 2 22  ? 13.109  -21.708 7.757   1.00 0.00 ? 22  THR B N    2  
ATOM 9015   C CA   . THR B 2 22  ? 11.739  -22.016 8.127   1.00 0.00 ? 22  THR B CA   2  
ATOM 9016   C C    . THR B 2 22  ? 10.921  -20.749 8.386   1.00 0.00 ? 22  THR B C    2  
ATOM 9017   O O    . THR B 2 22  ? 11.437  -19.748 8.894   1.00 0.00 ? 22  THR B O    2  
ATOM 9018   C CB   . THR B 2 22  ? 11.674  -23.002 9.323   1.00 0.00 ? 22  THR B CB   2  
ATOM 9019   O OG1  . THR B 2 22  ? 10.732  -24.045 9.045   1.00 0.00 ? 22  THR B OG1  2  
ATOM 9020   C CG2  . THR B 2 22  ? 11.297  -22.314 10.628  1.00 0.00 ? 22  THR B CG2  2  
ATOM 9021   H H    . THR B 2 22  ? 13.763  -21.499 8.463   1.00 0.00 ? 22  THR B H    2  
ATOM 9022   H HA   . THR B 2 22  ? 11.289  -22.520 7.271   1.00 0.00 ? 22  THR B HA   2  
ATOM 9023   H HB   . THR B 2 22  ? 12.660  -23.448 9.447   1.00 0.00 ? 22  THR B HB   2  
ATOM 9024   H HG1  . THR B 2 22  ? 11.170  -24.898 9.126   1.00 0.00 ? 22  THR B HG1  2  
ATOM 9025   H HG21 . THR B 2 22  ? 10.311  -21.861 10.525  1.00 0.00 ? 22  THR B HG21 2  
ATOM 9026   H HG22 . THR B 2 22  ? 11.277  -23.036 11.444  1.00 0.00 ? 22  THR B HG22 2  
ATOM 9027   H HG23 . THR B 2 22  ? 12.031  -21.539 10.852  1.00 0.00 ? 22  THR B HG23 2  
ATOM 9028   N N    . CYS B 2 23  ? 9.650   -20.801 8.016   1.00 0.00 ? 23  CYS B N    2  
ATOM 9029   C CA   . CYS B 2 23  ? 8.744   -19.681 8.201   1.00 0.00 ? 23  CYS B CA   2  
ATOM 9030   C C    . CYS B 2 23  ? 7.395   -20.189 8.703   1.00 0.00 ? 23  CYS B C    2  
ATOM 9031   O O    . CYS B 2 23  ? 6.833   -21.139 8.153   1.00 0.00 ? 23  CYS B O    2  
ATOM 9032   C CB   . CYS B 2 23  ? 8.578   -18.911 6.886   1.00 0.00 ? 23  CYS B CB   2  
ATOM 9033   S SG   . CYS B 2 23  ? 8.256   -17.126 7.088   1.00 0.00 ? 23  CYS B SG   2  
ATOM 9034   H H    . CYS B 2 23  ? 9.307   -21.631 7.610   1.00 0.00 ? 23  CYS B H    2  
ATOM 9035   H HA   . CYS B 2 23  ? 9.167   -19.009 8.948   1.00 0.00 ? 23  CYS B HA   2  
ATOM 9036   H HB2  . CYS B 2 23  ? 9.494   -19.032 6.309   1.00 0.00 ? 23  CYS B HB2  2  
ATOM 9037   H HB3  . CYS B 2 23  ? 7.742   -19.352 6.343   1.00 0.00 ? 23  CYS B HB3  2  
ATOM 9038   H HG   . CYS B 2 23  ? 8.173   -16.819 5.790   1.00 0.00 ? 23  CYS B HG   2  
ATOM 9039   N N    . ARG B 2 24  ? 6.888   -19.560 9.753   1.00 0.00 ? 24  ARG B N    2  
ATOM 9040   C CA   . ARG B 2 24  ? 5.617   -19.946 10.347  1.00 0.00 ? 24  ARG B CA   2  
ATOM 9041   C C    . ARG B 2 24  ? 4.655   -18.766 10.369  1.00 0.00 ? 24  ARG B C    2  
ATOM 9042   O O    . ARG B 2 24  ? 5.083   -17.610 10.415  1.00 0.00 ? 24  ARG B O    2  
ATOM 9043   C CB   . ARG B 2 24  ? 5.855   -20.448 11.779  1.00 0.00 ? 24  ARG B CB   2  
ATOM 9044   C CG   . ARG B 2 24  ? 4.621   -21.021 12.460  1.00 0.00 ? 24  ARG B CG   2  
ATOM 9045   C CD   . ARG B 2 24  ? 4.764   -20.995 13.975  1.00 0.00 ? 24  ARG B CD   2  
ATOM 9046   N NE   . ARG B 2 24  ? 4.846   -19.629 14.499  1.00 0.00 ? 24  ARG B NE   2  
ATOM 9047   C CZ   . ARG B 2 24  ? 4.238   -19.221 15.613  1.00 0.00 ? 24  ARG B CZ   2  
ATOM 9048   N NH1  . ARG B 2 24  ? 3.478   -20.063 16.303  1.00 0.00 ? 24  ARG B NH1  2  
ATOM 9049   N NH2  . ARG B 2 24  ? 4.382   -17.967 16.021  1.00 0.00 ? 24  ARG B NH2  2  
ATOM 9050   H H    . ARG B 2 24  ? 7.378   -18.798 10.133  1.00 0.00 ? 24  ARG B H    2  
ATOM 9051   H HA   . ARG B 2 24  ? 5.180   -20.750 9.753   1.00 0.00 ? 24  ARG B HA   2  
ATOM 9052   H HB2  . ARG B 2 24  ? 6.618   -21.226 11.745  1.00 0.00 ? 24  ARG B HB2  2  
ATOM 9053   H HB3  . ARG B 2 24  ? 6.216   -19.611 12.377  1.00 0.00 ? 24  ARG B HB3  2  
ATOM 9054   H HG2  . ARG B 2 24  ? 3.751   -20.429 12.174  1.00 0.00 ? 24  ARG B HG2  2  
ATOM 9055   H HG3  . ARG B 2 24  ? 4.482   -22.052 12.134  1.00 0.00 ? 24  ARG B HG3  2  
ATOM 9056   H HD2  . ARG B 2 24  ? 3.901   -21.491 14.419  1.00 0.00 ? 24  ARG B HD2  2  
ATOM 9057   H HD3  . ARG B 2 24  ? 5.670   -21.533 14.253  1.00 0.00 ? 24  ARG B HD3  2  
ATOM 9058   H HE   . ARG B 2 24  ? 5.394   -18.982 13.995  1.00 0.00 ? 24  ARG B HE   2  
ATOM 9059   H HH11 . ARG B 2 24  ? 3.358   -21.010 15.988  1.00 0.00 ? 24  ARG B HH11 2  
ATOM 9060   H HH12 . ARG B 2 24  ? 3.023   -19.762 17.145  1.00 0.00 ? 24  ARG B HH12 2  
ATOM 9061   H HH21 . ARG B 2 24  ? 4.947   -17.327 15.491  1.00 0.00 ? 24  ARG B HH21 2  
ATOM 9062   H HH22 . ARG B 2 24  ? 3.935   -17.652 16.864  1.00 0.00 ? 24  ARG B HH22 2  
ATOM 9063   N N    . THR B 2 25  ? 3.362   -19.056 10.326  1.00 0.00 ? 25  THR B N    2  
ATOM 9064   C CA   . THR B 2 25  ? 2.341   -18.016 10.347  1.00 0.00 ? 25  THR B CA   2  
ATOM 9065   C C    . THR B 2 25  ? 1.131   -18.482 11.164  1.00 0.00 ? 25  THR B C    2  
ATOM 9066   O O    . THR B 2 25  ? 1.172   -19.546 11.786  1.00 0.00 ? 25  THR B O    2  
ATOM 9067   C CB   . THR B 2 25  ? 1.914   -17.602 8.917   1.00 0.00 ? 25  THR B CB   2  
ATOM 9068   O OG1  . THR B 2 25  ? 1.176   -16.370 8.959   1.00 0.00 ? 25  THR B OG1  2  
ATOM 9069   C CG2  . THR B 2 25  ? 1.079   -18.686 8.245   1.00 0.00 ? 25  THR B CG2  2  
ATOM 9070   H H    . THR B 2 25  ? 3.081   -19.993 10.284  1.00 0.00 ? 25  THR B H    2  
ATOM 9071   H HA   . THR B 2 25  ? 2.767   -17.141 10.837  1.00 0.00 ? 25  THR B HA   2  
ATOM 9072   H HB   . THR B 2 25  ? 2.815   -17.446 8.324   1.00 0.00 ? 25  THR B HB   2  
ATOM 9073   H HG1  . THR B 2 25  ? 1.756   -15.663 9.272   1.00 0.00 ? 25  THR B HG1  2  
ATOM 9074   H HG21 . THR B 2 25  ? 0.173   -18.857 8.826   1.00 0.00 ? 25  THR B HG21 2  
ATOM 9075   H HG22 . THR B 2 25  ? 0.807   -18.376 7.236   1.00 0.00 ? 25  THR B HG22 2  
ATOM 9076   H HG23 . THR B 2 25  ? 1.658   -19.608 8.194   1.00 0.00 ? 25  THR B HG23 2  
ATOM 9077   N N    . SER B 2 26  ? 0.074   -17.679 11.171  1.00 0.00 ? 26  SER B N    2  
ATOM 9078   C CA   . SER B 2 26  ? -1.141  -18.003 11.906  1.00 0.00 ? 26  SER B CA   2  
ATOM 9079   C C    . SER B 2 26  ? -2.113  -18.794 11.021  1.00 0.00 ? 26  SER B C    2  
ATOM 9080   O O    . SER B 2 26  ? -1.712  -19.788 10.424  1.00 0.00 ? 26  SER B O    2  
ATOM 9081   C CB   . SER B 2 26  ? -1.785  -16.710 12.411  1.00 0.00 ? 26  SER B CB   2  
ATOM 9082   O OG   . SER B 2 26  ? -0.835  -15.902 13.089  1.00 0.00 ? 26  SER B OG   2  
ATOM 9083   H H    . SER B 2 26  ? 0.108   -16.848 10.649  1.00 0.00 ? 26  SER B H    2  
ATOM 9084   H HA   . SER B 2 26  ? -0.875  -18.619 12.765  1.00 0.00 ? 26  SER B HA   2  
ATOM 9085   H HB2  . SER B 2 26  ? -2.185  -16.155 11.562  1.00 0.00 ? 26  SER B HB2  2  
ATOM 9086   H HB3  . SER B 2 26  ? -2.595  -16.959 13.097  1.00 0.00 ? 26  SER B HB3  2  
ATOM 9087   H HG   . SER B 2 26  ? -0.025  -16.407 13.227  1.00 0.00 ? 26  SER B HG   2  
ATOM 9088   N N    . GLY B 2 27  ? -3.393  -18.381 11.011  1.00 0.00 ? 27  GLY B N    2  
ATOM 9089   C CA   . GLY B 2 27  ? -4.435  -19.015 10.190  1.00 0.00 ? 27  GLY B CA   2  
ATOM 9090   C C    . GLY B 2 27  ? -3.926  -19.737 8.952   1.00 0.00 ? 27  GLY B C    2  
ATOM 9091   O O    . GLY B 2 27  ? -3.267  -19.139 8.102   1.00 0.00 ? 27  GLY B O    2  
ATOM 9092   H H    . GLY B 2 27  ? -3.652  -17.672 11.634  1.00 0.00 ? 27  GLY B H    2  
ATOM 9093   H HA2  . GLY B 2 27  ? -4.962  -19.738 10.812  1.00 0.00 ? 27  GLY B HA2  2  
ATOM 9094   H HA3  . GLY B 2 27  ? -5.131  -18.241 9.869   1.00 0.00 ? 27  GLY B HA3  2  
ATOM 9095   N N    . ASN B 2 28  ? -4.249  -21.027 8.870   1.00 0.00 ? 28  ASN B N    2  
ATOM 9096   C CA   . ASN B 2 28  ? -3.826  -21.886 7.767   1.00 0.00 ? 28  ASN B CA   2  
ATOM 9097   C C    . ASN B 2 28  ? -4.211  -21.310 6.409   1.00 0.00 ? 28  ASN B C    2  
ATOM 9098   O O    . ASN B 2 28  ? -5.363  -21.405 5.978   1.00 0.00 ? 28  ASN B O    2  
ATOM 9099   C CB   . ASN B 2 28  ? -4.412  -23.293 7.944   1.00 0.00 ? 28  ASN B CB   2  
ATOM 9100   C CG   . ASN B 2 28  ? -3.804  -24.325 7.010   1.00 0.00 ? 28  ASN B CG   2  
ATOM 9101   O OD1  . ASN B 2 28  ? -3.476  -24.034 5.860   1.00 0.00 ? 28  ASN B OD1  2  
ATOM 9102   N ND2  . ASN B 2 28  ? -3.652  -25.547 7.497   1.00 0.00 ? 28  ASN B ND2  2  
ATOM 9103   H H    . ASN B 2 28  ? -4.801  -21.415 9.578   1.00 0.00 ? 28  ASN B H    2  
ATOM 9104   H HA   . ASN B 2 28  ? -2.739  -21.962 7.802   1.00 0.00 ? 28  ASN B HA   2  
ATOM 9105   H HB2  . ASN B 2 28  ? -4.240  -23.612 8.972   1.00 0.00 ? 28  ASN B HB2  2  
ATOM 9106   H HB3  . ASN B 2 28  ? -5.484  -23.248 7.757   1.00 0.00 ? 28  ASN B HB3  2  
ATOM 9107   H HD21 . ASN B 2 28  ? -3.938  -25.721 8.423   1.00 0.00 ? 28  ASN B HD21 2  
ATOM 9108   H HD22 . ASN B 2 28  ? -3.264  -26.232 6.912   1.00 0.00 ? 28  ASN B HD22 2  
ATOM 9109   N N    . ILE B 2 29  ? -3.231  -20.719 5.737   1.00 0.00 ? 29  ILE B N    2  
ATOM 9110   C CA   . ILE B 2 29  ? -3.442  -20.124 4.428   1.00 0.00 ? 29  ILE B CA   2  
ATOM 9111   C C    . ILE B 2 29  ? -3.279  -21.150 3.311   1.00 0.00 ? 29  ILE B C    2  
ATOM 9112   O O    . ILE B 2 29  ? -3.504  -20.839 2.144   1.00 0.00 ? 29  ILE B O    2  
ATOM 9113   C CB   . ILE B 2 29  ? -2.498  -18.929 4.177   1.00 0.00 ? 29  ILE B CB   2  
ATOM 9114   C CG1  . ILE B 2 29  ? -1.056  -19.292 4.555   1.00 0.00 ? 29  ILE B CG1  2  
ATOM 9115   C CG2  . ILE B 2 29  ? -2.972  -17.706 4.951   1.00 0.00 ? 29  ILE B CG2  2  
ATOM 9116   C CD1  . ILE B 2 29  ? -0.039  -18.227 4.202   1.00 0.00 ? 29  ILE B CD1  2  
ATOM 9117   H H    . ILE B 2 29  ? -2.340  -20.670 6.145   1.00 0.00 ? 29  ILE B H    2  
ATOM 9118   H HA   . ILE B 2 29  ? -4.468  -19.754 4.401   1.00 0.00 ? 29  ILE B HA   2  
ATOM 9119   H HB   . ILE B 2 29  ? -2.522  -18.690 3.114   1.00 0.00 ? 29  ILE B HB   2  
ATOM 9120   H HG12 . ILE B 2 29  ? -1.016  -19.460 5.631   1.00 0.00 ? 29  ILE B HG12 2  
ATOM 9121   H HG13 . ILE B 2 29  ? -0.786  -20.210 4.034   1.00 0.00 ? 29  ILE B HG13 2  
ATOM 9122   H HG21 . ILE B 2 29  ? -2.312  -16.862 4.747   1.00 0.00 ? 29  ILE B HG21 2  
ATOM 9123   H HG22 . ILE B 2 29  ? -3.987  -17.453 4.644   1.00 0.00 ? 29  ILE B HG22 2  
ATOM 9124   H HG23 . ILE B 2 29  ? -2.960  -17.925 6.019   1.00 0.00 ? 29  ILE B HG23 2  
ATOM 9125   H HD11 . ILE B 2 29  ? -0.289  -17.303 4.723   1.00 0.00 ? 29  ILE B HD11 2  
ATOM 9126   H HD12 . ILE B 2 29  ? 0.963   -18.542 4.495   1.00 0.00 ? 29  ILE B HD12 2  
ATOM 9127   H HD13 . ILE B 2 29  ? -0.058  -18.055 3.126   1.00 0.00 ? 29  ILE B HD13 2  
ATOM 9128   N N    . HIS B 2 30  ? -2.890  -22.369 3.681   1.00 0.00 ? 30  HIS B N    2  
ATOM 9129   C CA   . HIS B 2 30  ? -2.698  -23.465 2.727   1.00 0.00 ? 30  HIS B CA   2  
ATOM 9130   C C    . HIS B 2 30  ? -1.457  -23.277 1.861   1.00 0.00 ? 30  HIS B C    2  
ATOM 9131   O O    . HIS B 2 30  ? -0.421  -23.898 2.099   1.00 0.00 ? 30  HIS B O    2  
ATOM 9132   C CB   . HIS B 2 30  ? -3.936  -23.680 1.846   1.00 0.00 ? 30  HIS B CB   2  
ATOM 9133   C CG   . HIS B 2 30  ? -4.950  -24.625 2.409   1.00 0.00 ? 30  HIS B CG   2  
ATOM 9134   N ND1  . HIS B 2 30  ? -5.386  -24.578 3.717   1.00 0.00 ? 30  HIS B ND1  2  
ATOM 9135   C CD2  . HIS B 2 30  ? -5.625  -25.641 1.826   1.00 0.00 ? 30  HIS B CD2  2  
ATOM 9136   C CE1  . HIS B 2 30  ? -6.286  -25.523 3.908   1.00 0.00 ? 30  HIS B CE1  2  
ATOM 9137   N NE2  . HIS B 2 30  ? -6.450  -26.185 2.777   1.00 0.00 ? 30  HIS B NE2  2  
ATOM 9138   H H    . HIS B 2 30  ? -2.726  -22.542 4.634   1.00 0.00 ? 30  HIS B H    2  
ATOM 9139   H HA   . HIS B 2 30  ? -2.552  -24.372 3.315   1.00 0.00 ? 30  HIS B HA   2  
ATOM 9140   H HB2  . HIS B 2 30  ? -4.418  -22.714 1.691   1.00 0.00 ? 30  HIS B HB2  2  
ATOM 9141   H HB3  . HIS B 2 30  ? -3.607  -24.068 0.882   1.00 0.00 ? 30  HIS B HB3  2  
ATOM 9142   H HD1  . HIS B 2 30  ? -5.063  -23.959 4.412   1.00 0.00 ? 30  HIS B HD1  2  
ATOM 9143   H HD2  . HIS B 2 30  ? -5.532  -25.965 0.800   1.00 0.00 ? 30  HIS B HD2  2  
ATOM 9144   H HE1  . HIS B 2 30  ? -6.803  -25.723 4.835   1.00 0.00 ? 30  HIS B HE1  2  
ATOM 9145   H HE2  . HIS B 2 30  ? -6.903  -27.053 2.699   1.00 0.00 ? 30  HIS B HE2  2  
ATOM 9146   N N    . ASN B 2 31  ? -1.563  -22.406 0.868   1.00 0.00 ? 31  ASN B N    2  
ATOM 9147   C CA   . ASN B 2 31  ? -0.462  -22.158 -0.056  1.00 0.00 ? 31  ASN B CA   2  
ATOM 9148   C C    . ASN B 2 31  ? -0.503  -20.737 -0.602  1.00 0.00 ? 31  ASN B C    2  
ATOM 9149   O O    . ASN B 2 31  ? -0.820  -20.521 -1.772  1.00 0.00 ? 31  ASN B O    2  
ATOM 9150   C CB   . ASN B 2 31  ? -0.490  -23.166 -1.215  1.00 0.00 ? 31  ASN B CB   2  
ATOM 9151   C CG   . ASN B 2 31  ? -1.901  -23.550 -1.632  1.00 0.00 ? 31  ASN B CG   2  
ATOM 9152   O OD1  . ASN B 2 31  ? -2.359  -24.661 -1.363  1.00 0.00 ? 31  ASN B OD1  2  
ATOM 9153   N ND2  . ASN B 2 31  ? -2.604  -22.632 -2.280  1.00 0.00 ? 31  ASN B ND2  2  
ATOM 9154   H H    . ASN B 2 31  ? -2.399  -21.899 0.763   1.00 0.00 ? 31  ASN B H    2  
ATOM 9155   H HA   . ASN B 2 31  ? 0.471   -22.289 0.492   1.00 0.00 ? 31  ASN B HA   2  
ATOM 9156   H HB2  . ASN B 2 31  ? 0.021   -22.727 -2.072  1.00 0.00 ? 31  ASN B HB2  2  
ATOM 9157   H HB3  . ASN B 2 31  ? 0.039   -24.068 -0.907  1.00 0.00 ? 31  ASN B HB3  2  
ATOM 9158   H HD21 . ASN B 2 31  ? -2.178  -21.762 -2.460  1.00 0.00 ? 31  ASN B HD21 2  
ATOM 9159   H HD22 . ASN B 2 31  ? -3.526  -22.850 -2.539  1.00 0.00 ? 31  ASN B HD22 2  
ATOM 9160   N N    . TYR B 2 32  ? -0.202  -19.771 0.251   1.00 0.00 ? 32  TYR B N    2  
ATOM 9161   C CA   . TYR B 2 32  ? -0.191  -18.366 -0.149  1.00 0.00 ? 32  TYR B CA   2  
ATOM 9162   C C    . TYR B 2 32  ? 0.971   -17.642 0.527   1.00 0.00 ? 32  TYR B C    2  
ATOM 9163   O O    . TYR B 2 32  ? 0.787   -16.620 1.193   1.00 0.00 ? 32  TYR B O    2  
ATOM 9164   C CB   . TYR B 2 32  ? -1.525  -17.683 0.174   1.00 0.00 ? 32  TYR B CB   2  
ATOM 9165   C CG   . TYR B 2 32  ? -2.689  -18.165 -0.670  1.00 0.00 ? 32  TYR B CG   2  
ATOM 9166   C CD1  . TYR B 2 32  ? -2.860  -17.727 -1.979  1.00 0.00 ? 32  TYR B CD1  2  
ATOM 9167   C CD2  . TYR B 2 32  ? -3.616  -19.062 -0.161  1.00 0.00 ? 32  TYR B CD2  2  
ATOM 9168   C CE1  . TYR B 2 32  ? -3.920  -18.168 -2.751  1.00 0.00 ? 32  TYR B CE1  2  
ATOM 9169   C CE2  . TYR B 2 32  ? -4.677  -19.510 -0.923  1.00 0.00 ? 32  TYR B CE2  2  
ATOM 9170   C CZ   . TYR B 2 32  ? -4.825  -19.062 -2.217  1.00 0.00 ? 32  TYR B CZ   2  
ATOM 9171   O OH   . TYR B 2 32  ? -5.887  -19.506 -2.974  1.00 0.00 ? 32  TYR B OH   2  
ATOM 9172   H H    . TYR B 2 32  ? 0.030   -20.003 1.177   1.00 0.00 ? 32  TYR B H    2  
ATOM 9173   H HA   . TYR B 2 32  ? -0.042  -18.324 -1.228  1.00 0.00 ? 32  TYR B HA   2  
ATOM 9174   H HB2  . TYR B 2 32  ? -1.762  -17.864 1.223   1.00 0.00 ? 32  TYR B HB2  2  
ATOM 9175   H HB3  . TYR B 2 32  ? -1.410  -16.610 0.022   1.00 0.00 ? 32  TYR B HB3  2  
ATOM 9176   H HD1  . TYR B 2 32  ? -2.153  -17.028 -2.400  1.00 0.00 ? 32  TYR B HD1  2  
ATOM 9177   H HD2  . TYR B 2 32  ? -3.507  -19.417 0.853   1.00 0.00 ? 32  TYR B HD2  2  
ATOM 9178   H HE1  . TYR B 2 32  ? -4.038  -17.816 -3.765  1.00 0.00 ? 32  TYR B HE1  2  
ATOM 9179   H HE2  . TYR B 2 32  ? -5.387  -20.208 -0.506  1.00 0.00 ? 32  TYR B HE2  2  
ATOM 9180   H HH   . TYR B 2 32  ? -5.587  -19.709 -3.868  1.00 0.00 ? 32  TYR B HH   2  
ATOM 9181   N N    . LEU B 2 33  ? 2.168   -18.193 0.344   1.00 0.00 ? 33  LEU B N    2  
ATOM 9182   C CA   . LEU B 2 33  ? 3.381   -17.639 0.931   1.00 0.00 ? 33  LEU B CA   2  
ATOM 9183   C C    . LEU B 2 33  ? 4.374   -17.249 -0.167  1.00 0.00 ? 33  LEU B C    2  
ATOM 9184   O O    . LEU B 2 33  ? 4.537   -17.969 -1.154  1.00 0.00 ? 33  LEU B O    2  
ATOM 9185   C CB   . LEU B 2 33  ? 4.009   -18.698 1.851   1.00 0.00 ? 33  LEU B CB   2  
ATOM 9186   C CG   . LEU B 2 33  ? 4.685   -18.211 3.137   1.00 0.00 ? 33  LEU B CG   2  
ATOM 9187   C CD1  . LEU B 2 33  ? 6.031   -17.572 2.845   1.00 0.00 ? 33  LEU B CD1  2  
ATOM 9188   C CD2  . LEU B 2 33  ? 3.784   -17.267 3.914   1.00 0.00 ? 33  LEU B CD2  2  
ATOM 9189   H H    . LEU B 2 33  ? 2.239   -18.995 -0.211  1.00 0.00 ? 33  LEU B H    2  
ATOM 9190   H HA   . LEU B 2 33  ? 3.126   -16.755 1.515   1.00 0.00 ? 33  LEU B HA   2  
ATOM 9191   H HB2  . LEU B 2 33  ? 3.218   -19.389 2.141   1.00 0.00 ? 33  LEU B HB2  2  
ATOM 9192   H HB3  . LEU B 2 33  ? 4.762   -19.230 1.269   1.00 0.00 ? 33  LEU B HB3  2  
ATOM 9193   H HG   . LEU B 2 33  ? 4.865   -19.084 3.764   1.00 0.00 ? 33  LEU B HG   2  
ATOM 9194   H HD11 . LEU B 2 33  ? 6.510   -17.266 3.775   1.00 0.00 ? 33  LEU B HD11 2  
ATOM 9195   H HD12 . LEU B 2 33  ? 6.669   -18.291 2.331   1.00 0.00 ? 33  LEU B HD12 2  
ATOM 9196   H HD13 . LEU B 2 33  ? 5.885   -16.697 2.211   1.00 0.00 ? 33  LEU B HD13 2  
ATOM 9197   H HD21 . LEU B 2 33  ? 2.848   -17.772 4.149   1.00 0.00 ? 33  LEU B HD21 2  
ATOM 9198   H HD22 . LEU B 2 33  ? 4.271   -16.963 4.841   1.00 0.00 ? 33  LEU B HD22 2  
ATOM 9199   H HD23 . LEU B 2 33  ? 3.579   -16.383 3.310   1.00 0.00 ? 33  LEU B HD23 2  
ATOM 9200   N N    . THR B 2 34  ? 5.016   -16.103 0.001   1.00 0.00 ? 34  THR B N    2  
ATOM 9201   C CA   . THR B 2 34  ? 5.993   -15.619 -0.964  1.00 0.00 ? 34  THR B CA   2  
ATOM 9202   C C    . THR B 2 34  ? 7.378   -15.480 -0.325  1.00 0.00 ? 34  THR B C    2  
ATOM 9203   O O    . THR B 2 34  ? 7.495   -15.218 0.871   1.00 0.00 ? 34  THR B O    2  
ATOM 9204   C CB   . THR B 2 34  ? 5.556   -14.257 -1.540  1.00 0.00 ? 34  THR B CB   2  
ATOM 9205   O OG1  . THR B 2 34  ? 4.439   -13.758 -0.790  1.00 0.00 ? 34  THR B OG1  2  
ATOM 9206   C CG2  . THR B 2 34  ? 5.156   -14.402 -3.000  1.00 0.00 ? 34  THR B CG2  2  
ATOM 9207   H H    . THR B 2 34  ? 4.814   -15.552 0.789   1.00 0.00 ? 34  THR B H    2  
ATOM 9208   H HA   . THR B 2 34  ? 6.054   -16.340 -1.778  1.00 0.00 ? 34  THR B HA   2  
ATOM 9209   H HB   . THR B 2 34  ? 6.386   -13.554 -1.464  1.00 0.00 ? 34  THR B HB   2  
ATOM 9210   H HG1  . THR B 2 34  ? 4.396   -12.796 -0.873  1.00 0.00 ? 34  THR B HG1  2  
ATOM 9211   H HG21 . THR B 2 34  ? 4.325   -15.104 -3.080  1.00 0.00 ? 34  THR B HG21 2  
ATOM 9212   H HG22 . THR B 2 34  ? 4.851   -13.434 -3.396  1.00 0.00 ? 34  THR B HG22 2  
ATOM 9213   H HG23 . THR B 2 34  ? 6.004   -14.777 -3.573  1.00 0.00 ? 34  THR B HG23 2  
ATOM 9214   N N    . TRP B 2 35  ? 8.421   -15.683 -1.127  1.00 0.00 ? 35  TRP B N    2  
ATOM 9215   C CA   . TRP B 2 35  ? 9.801   -15.572 -0.652  1.00 0.00 ? 35  TRP B CA   2  
ATOM 9216   C C    . TRP B 2 35  ? 10.545  -14.505 -1.450  1.00 0.00 ? 35  TRP B C    2  
ATOM 9217   O O    . TRP B 2 35  ? 10.579  -14.563 -2.684  1.00 0.00 ? 35  TRP B O    2  
ATOM 9218   C CB   . TRP B 2 35  ? 10.523  -16.915 -0.783  1.00 0.00 ? 35  TRP B CB   2  
ATOM 9219   C CG   . TRP B 2 35  ? 10.046  -17.968 0.171   1.00 0.00 ? 35  TRP B CG   2  
ATOM 9220   C CD1  . TRP B 2 35  ? 9.113   -18.935 -0.072  1.00 0.00 ? 35  TRP B CD1  2  
ATOM 9221   C CD2  . TRP B 2 35  ? 10.486  -18.165 1.520   1.00 0.00 ? 35  TRP B CD2  2  
ATOM 9222   N NE1  . TRP B 2 35  ? 8.948   -19.725 1.039   1.00 0.00 ? 35  TRP B NE1  2  
ATOM 9223   C CE2  . TRP B 2 35  ? 9.776   -19.270 2.032   1.00 0.00 ? 35  TRP B CE2  2  
ATOM 9224   C CE3  . TRP B 2 35  ? 11.408  -17.514 2.346   1.00 0.00 ? 35  TRP B CE3  2  
ATOM 9225   C CZ2  . TRP B 2 35  ? 9.964   -19.741 3.329   1.00 0.00 ? 35  TRP B CZ2  2  
ATOM 9226   C CZ3  . TRP B 2 35  ? 11.591  -17.983 3.633   1.00 0.00 ? 35  TRP B CZ3  2  
ATOM 9227   C CH2  . TRP B 2 35  ? 10.873  -19.084 4.112   1.00 0.00 ? 35  TRP B CH2  2  
ATOM 9228   H H    . TRP B 2 35  ? 8.258   -15.915 -2.068  1.00 0.00 ? 35  TRP B H    2  
ATOM 9229   H HA   . TRP B 2 35  ? 9.785   -15.282 0.399   1.00 0.00 ? 35  TRP B HA   2  
ATOM 9230   H HB2  . TRP B 2 35  ? 10.386  -17.283 -1.800  1.00 0.00 ? 35  TRP B HB2  2  
ATOM 9231   H HB3  . TRP B 2 35  ? 11.588  -16.754 -0.616  1.00 0.00 ? 35  TRP B HB3  2  
ATOM 9232   H HD1  . TRP B 2 35  ? 8.582   -19.061 -1.004  1.00 0.00 ? 35  TRP B HD1  2  
ATOM 9233   H HE1  . TRP B 2 35  ? 8.336   -20.488 1.109   1.00 0.00 ? 35  TRP B HE1  2  
ATOM 9234   H HE3  . TRP B 2 35  ? 11.964  -16.662 1.986   1.00 0.00 ? 35  TRP B HE3  2  
ATOM 9235   H HZ2  . TRP B 2 35  ? 9.414   -20.592 3.702   1.00 0.00 ? 35  TRP B HZ2  2  
ATOM 9236   H HZ3  . TRP B 2 35  ? 12.302  -17.491 4.280   1.00 0.00 ? 35  TRP B HZ3  2  
ATOM 9237   H HH2  . TRP B 2 35  ? 11.040  -19.424 5.124   1.00 0.00 ? 35  TRP B HH2  2  
ATOM 9238   N N    . TYR B 2 36  ? 11.143  -13.536 -0.757  1.00 0.00 ? 36  TYR B N    2  
ATOM 9239   C CA   . TYR B 2 36  ? 11.868  -12.455 -1.418  1.00 0.00 ? 36  TYR B CA   2  
ATOM 9240   C C    . TYR B 2 36  ? 13.337  -12.455 -0.997  1.00 0.00 ? 36  TYR B C    2  
ATOM 9241   O O    . TYR B 2 36  ? 13.678  -12.938 0.086   1.00 0.00 ? 36  TYR B O    2  
ATOM 9242   C CB   . TYR B 2 36  ? 11.257  -11.101 -1.025  1.00 0.00 ? 36  TYR B CB   2  
ATOM 9243   C CG   . TYR B 2 36  ? 9.828   -10.874 -1.471  1.00 0.00 ? 36  TYR B CG   2  
ATOM 9244   C CD1  . TYR B 2 36  ? 8.788   -11.675 -1.011  1.00 0.00 ? 36  TYR B CD1  2  
ATOM 9245   C CD2  . TYR B 2 36  ? 9.516   -9.840  -2.341  1.00 0.00 ? 36  TYR B CD2  2  
ATOM 9246   C CE1  . TYR B 2 36  ? 7.486   -11.457 -1.410  1.00 0.00 ? 36  TYR B CE1  2  
ATOM 9247   C CE2  . TYR B 2 36  ? 8.217   -9.616  -2.744  1.00 0.00 ? 36  TYR B CE2  2  
ATOM 9248   C CZ   . TYR B 2 36  ? 7.206   -10.424 -2.277  1.00 0.00 ? 36  TYR B CZ   2  
ATOM 9249   O OH   . TYR B 2 36  ? 5.910   -10.199 -2.679  1.00 0.00 ? 36  TYR B OH   2  
ATOM 9250   H H    . TYR B 2 36  ? 11.112  -13.528 0.225   1.00 0.00 ? 36  TYR B H    2  
ATOM 9251   H HA   . TYR B 2 36  ? 11.798  -12.588 -2.498  1.00 0.00 ? 36  TYR B HA   2  
ATOM 9252   H HB2  . TYR B 2 36  ? 11.290  -11.017 0.061   1.00 0.00 ? 36  TYR B HB2  2  
ATOM 9253   H HB3  . TYR B 2 36  ? 11.875  -10.313 -1.456  1.00 0.00 ? 36  TYR B HB3  2  
ATOM 9254   H HD1  . TYR B 2 36  ? 9.005   -12.483 -0.328  1.00 0.00 ? 36  TYR B HD1  2  
ATOM 9255   H HD2  . TYR B 2 36  ? 10.304  -9.200  -2.709  1.00 0.00 ? 36  TYR B HD2  2  
ATOM 9256   H HE1  . TYR B 2 36  ? 6.691   -12.091 -1.045  1.00 0.00 ? 36  TYR B HE1  2  
ATOM 9257   H HE2  . TYR B 2 36  ? 7.993   -8.807  -3.424  1.00 0.00 ? 36  TYR B HE2  2  
ATOM 9258   H HH   . TYR B 2 36  ? 5.306   -10.452 -1.964  1.00 0.00 ? 36  TYR B HH   2  
ATOM 9259   N N    . GLN B 2 37  ? 14.190  -11.912 -1.854  1.00 0.00 ? 37  GLN B N    2  
ATOM 9260   C CA   . GLN B 2 37  ? 15.623  -11.825 -1.570  1.00 0.00 ? 37  GLN B CA   2  
ATOM 9261   C C    . GLN B 2 37  ? 16.161  -10.447 -1.943  1.00 0.00 ? 37  GLN B C    2  
ATOM 9262   O O    . GLN B 2 37  ? 15.983  -9.992  -3.071  1.00 0.00 ? 37  GLN B O    2  
ATOM 9263   C CB   . GLN B 2 37  ? 16.391  -12.904 -2.338  1.00 0.00 ? 37  GLN B CB   2  
ATOM 9264   C CG   . GLN B 2 37  ? 17.901  -12.849 -2.144  1.00 0.00 ? 37  GLN B CG   2  
ATOM 9265   C CD   . GLN B 2 37  ? 18.670  -13.476 -3.291  1.00 0.00 ? 37  GLN B CD   2  
ATOM 9266   O OE1  . GLN B 2 37  ? 18.952  -12.823 -4.294  1.00 0.00 ? 37  GLN B OE1  2  
ATOM 9267   N NE2  . GLN B 2 37  ? 19.037  -14.738 -3.145  1.00 0.00 ? 37  GLN B NE2  2  
ATOM 9268   H H    . GLN B 2 37  ? 13.856  -11.568 -2.710  1.00 0.00 ? 37  GLN B H    2  
ATOM 9269   H HA   . GLN B 2 37  ? 15.771  -11.983 -0.502  1.00 0.00 ? 37  GLN B HA   2  
ATOM 9270   H HB2  . GLN B 2 37  ? 16.038  -13.880 -2.004  1.00 0.00 ? 37  GLN B HB2  2  
ATOM 9271   H HB3  . GLN B 2 37  ? 16.178  -12.785 -3.401  1.00 0.00 ? 37  GLN B HB3  2  
ATOM 9272   H HG2  . GLN B 2 37  ? 18.203  -11.806 -2.051  1.00 0.00 ? 37  GLN B HG2  2  
ATOM 9273   H HG3  . GLN B 2 37  ? 18.153  -13.379 -1.225  1.00 0.00 ? 37  GLN B HG3  2  
ATOM 9274   H HE21 . GLN B 2 37  ? 18.800  -15.202 -2.308  1.00 0.00 ? 37  GLN B HE21 2  
ATOM 9275   H HE22 . GLN B 2 37  ? 19.529  -15.163 -3.876  1.00 0.00 ? 37  GLN B HE22 2  
ATOM 9276   N N    . GLN B 2 38  ? 16.800  -9.782  -0.987  1.00 0.00 ? 38  GLN B N    2  
ATOM 9277   C CA   . GLN B 2 38  ? 17.377  -8.463  -1.230  1.00 0.00 ? 38  GLN B CA   2  
ATOM 9278   C C    . GLN B 2 38  ? 18.878  -8.469  -0.981  1.00 0.00 ? 38  GLN B C    2  
ATOM 9279   O O    . GLN B 2 38  ? 19.329  -8.695  0.140   1.00 0.00 ? 38  GLN B O    2  
ATOM 9280   C CB   . GLN B 2 38  ? 16.709  -7.380  -0.375  1.00 0.00 ? 38  GLN B CB   2  
ATOM 9281   C CG   . GLN B 2 38  ? 17.387  -6.018  -0.492  1.00 0.00 ? 38  GLN B CG   2  
ATOM 9282   C CD   . GLN B 2 38  ? 16.720  -4.927  0.325   1.00 0.00 ? 38  GLN B CD   2  
ATOM 9283   O OE1  . GLN B 2 38  ? 16.132  -5.181  1.378   1.00 0.00 ? 38  GLN B OE1  2  
ATOM 9284   N NE2  . GLN B 2 38  ? 16.817  -3.694  -0.154  1.00 0.00 ? 38  GLN B NE2  2  
ATOM 9285   H H    . GLN B 2 38  ? 16.884  -10.192 -0.098  1.00 0.00 ? 38  GLN B H    2  
ATOM 9286   H HA   . GLN B 2 38  ? 17.206  -8.218  -2.279  1.00 0.00 ? 38  GLN B HA   2  
ATOM 9287   H HB2  . GLN B 2 38  ? 15.671  -7.279  -0.692  1.00 0.00 ? 38  GLN B HB2  2  
ATOM 9288   H HB3  . GLN B 2 38  ? 16.741  -7.694  0.669   1.00 0.00 ? 38  GLN B HB3  2  
ATOM 9289   H HG2  . GLN B 2 38  ? 18.419  -6.116  -0.157  1.00 0.00 ? 38  GLN B HG2  2  
ATOM 9290   H HG3  . GLN B 2 38  ? 17.377  -5.718  -1.540  1.00 0.00 ? 38  GLN B HG3  2  
ATOM 9291   H HE21 . GLN B 2 38  ? 17.307  -3.561  -0.996  1.00 0.00 ? 38  GLN B HE21 2  
ATOM 9292   H HE22 . GLN B 2 38  ? 16.399  -2.968  0.352   1.00 0.00 ? 38  GLN B HE22 2  
ATOM 9293   N N    . LYS B 2 39  ? 19.650  -8.226  -2.026  1.00 0.00 ? 39  LYS B N    2  
ATOM 9294   C CA   . LYS B 2 39  ? 21.098  -8.193  -1.902  1.00 0.00 ? 39  LYS B CA   2  
ATOM 9295   C C    . LYS B 2 39  ? 21.543  -6.811  -1.433  1.00 0.00 ? 39  LYS B C    2  
ATOM 9296   O O    . LYS B 2 39  ? 20.968  -5.801  -1.845  1.00 0.00 ? 39  LYS B O    2  
ATOM 9297   C CB   . LYS B 2 39  ? 21.765  -8.561  -3.235  1.00 0.00 ? 39  LYS B CB   2  
ATOM 9298   C CG   . LYS B 2 39  ? 21.231  -9.842  -3.860  1.00 0.00 ? 39  LYS B CG   2  
ATOM 9299   C CD   . LYS B 2 39  ? 22.258  -10.501 -4.770  1.00 0.00 ? 39  LYS B CD   2  
ATOM 9300   C CE   . LYS B 2 39  ? 21.675  -11.732 -5.450  1.00 0.00 ? 39  LYS B CE   2  
ATOM 9301   N NZ   . LYS B 2 39  ? 22.727  -12.694 -5.883  1.00 0.00 ? 39  LYS B NZ   2  
ATOM 9302   H H    . LYS B 2 39  ? 19.239  -8.058  -2.899  1.00 0.00 ? 39  LYS B H    2  
ATOM 9303   H HA   . LYS B 2 39  ? 21.397  -8.927  -1.154  1.00 0.00 ? 39  LYS B HA   2  
ATOM 9304   H HB2  . LYS B 2 39  ? 21.601  -7.743  -3.937  1.00 0.00 ? 39  LYS B HB2  2  
ATOM 9305   H HB3  . LYS B 2 39  ? 22.834  -8.682  -3.062  1.00 0.00 ? 39  LYS B HB3  2  
ATOM 9306   H HG2  . LYS B 2 39  ? 20.968  -10.539 -3.064  1.00 0.00 ? 39  LYS B HG2  2  
ATOM 9307   H HG3  . LYS B 2 39  ? 20.342  -9.606  -4.444  1.00 0.00 ? 39  LYS B HG3  2  
ATOM 9308   H HD2  . LYS B 2 39  ? 22.569  -9.786  -5.532  1.00 0.00 ? 39  LYS B HD2  2  
ATOM 9309   H HD3  . LYS B 2 39  ? 23.122  -10.797 -4.176  1.00 0.00 ? 39  LYS B HD3  2  
ATOM 9310   H HE2  . LYS B 2 39  ? 21.005  -12.234 -4.752  1.00 0.00 ? 39  LYS B HE2  2  
ATOM 9311   H HE3  . LYS B 2 39  ? 21.108  -11.414 -6.325  1.00 0.00 ? 39  LYS B HE3  2  
ATOM 9312   H HZ1  . LYS B 2 39  ? 22.292  -13.596 -6.162  1.00 0.00 ? 39  LYS B HZ1  2  
ATOM 9313   H HZ2  . LYS B 2 39  ? 23.392  -12.874 -5.097  1.00 0.00 ? 39  LYS B HZ2  2  
ATOM 9314   H HZ3  . LYS B 2 39  ? 23.258  -12.314 -6.693  1.00 0.00 ? 39  LYS B HZ3  2  
ATOM 9315   N N    . PRO B 2 40  ? 22.552  -6.748  -0.548  1.00 0.00 ? 40  PRO B N    2  
ATOM 9316   C CA   . PRO B 2 40  ? 23.067  -5.478  -0.016  1.00 0.00 ? 40  PRO B CA   2  
ATOM 9317   C C    . PRO B 2 40  ? 23.513  -4.527  -1.124  1.00 0.00 ? 40  PRO B C    2  
ATOM 9318   O O    . PRO B 2 40  ? 24.504  -4.777  -1.815  1.00 0.00 ? 40  PRO B O    2  
ATOM 9319   C CB   . PRO B 2 40  ? 24.265  -5.902  0.839   1.00 0.00 ? 40  PRO B CB   2  
ATOM 9320   C CG   . PRO B 2 40  ? 23.991  -7.323  1.189   1.00 0.00 ? 40  PRO B CG   2  
ATOM 9321   C CD   . PRO B 2 40  ? 23.269  -7.906  0.008   1.00 0.00 ? 40  PRO B CD   2  
ATOM 9322   H HA   . PRO B 2 40  ? 22.312  -4.986  0.598   1.00 0.00 ? 40  PRO B HA   2  
ATOM 9323   H HB2  . PRO B 2 40  ? 25.208  -5.789  0.303   1.00 0.00 ? 40  PRO B HB2  2  
ATOM 9324   H HB3  . PRO B 2 40  ? 24.270  -5.312  1.756   1.00 0.00 ? 40  PRO B HB3  2  
ATOM 9325   H HG2  . PRO B 2 40  ? 24.944  -7.839  1.301   1.00 0.00 ? 40  PRO B HG2  2  
ATOM 9326   H HG3  . PRO B 2 40  ? 23.398  -7.404  2.100   1.00 0.00 ? 40  PRO B HG3  2  
ATOM 9327   H HD2  . PRO B 2 40  ? 23.966  -8.339  -0.709  1.00 0.00 ? 40  PRO B HD2  2  
ATOM 9328   H HD3  . PRO B 2 40  ? 22.550  -8.656  0.338   1.00 0.00 ? 40  PRO B HD3  2  
ATOM 9329   N N    . GLY B 2 41  ? 22.768  -3.443  -1.289  1.00 0.00 ? 41  GLY B N    2  
ATOM 9330   C CA   . GLY B 2 41  ? 23.084  -2.467  -2.312  1.00 0.00 ? 41  GLY B CA   2  
ATOM 9331   C C    . GLY B 2 41  ? 22.131  -2.556  -3.485  1.00 0.00 ? 41  GLY B C    2  
ATOM 9332   O O    . GLY B 2 41  ? 22.193  -1.750  -4.413  1.00 0.00 ? 41  GLY B O    2  
ATOM 9333   H H    . GLY B 2 41  ? 21.990  -3.306  -0.710  1.00 0.00 ? 41  GLY B H    2  
ATOM 9334   H HA2  . GLY B 2 41  ? 23.021  -1.468  -1.880  1.00 0.00 ? 41  GLY B HA2  2  
ATOM 9335   H HA3  . GLY B 2 41  ? 24.100  -2.643  -2.667  1.00 0.00 ? 41  GLY B HA3  2  
ATOM 9336   N N    . LYS B 2 42  ? 21.242  -3.540  -3.440  1.00 0.00 ? 42  LYS B N    2  
ATOM 9337   C CA   . LYS B 2 42  ? 20.269  -3.746  -4.501  1.00 0.00 ? 42  LYS B CA   2  
ATOM 9338   C C    . LYS B 2 42  ? 18.851  -3.793  -3.940  1.00 0.00 ? 42  LYS B C    2  
ATOM 9339   O O    . LYS B 2 42  ? 18.627  -3.527  -2.754  1.00 0.00 ? 42  LYS B O    2  
ATOM 9340   C CB   . LYS B 2 42  ? 20.577  -5.040  -5.266  1.00 0.00 ? 42  LYS B CB   2  
ATOM 9341   C CG   . LYS B 2 42  ? 21.898  -5.023  -6.021  1.00 0.00 ? 42  LYS B CG   2  
ATOM 9342   C CD   . LYS B 2 42  ? 21.870  -4.020  -7.161  1.00 0.00 ? 42  LYS B CD   2  
ATOM 9343   C CE   . LYS B 2 42  ? 23.214  -3.942  -7.867  1.00 0.00 ? 42  LYS B CE   2  
ATOM 9344   N NZ   . LYS B 2 42  ? 23.162  -3.057  -9.060  1.00 0.00 ? 42  LYS B NZ   2  
ATOM 9345   H H    . LYS B 2 42  ? 21.234  -4.146  -2.664  1.00 0.00 ? 42  LYS B H    2  
ATOM 9346   H HA   . LYS B 2 42  ? 20.340  -2.908  -5.194  1.00 0.00 ? 42  LYS B HA   2  
ATOM 9347   H HB2  . LYS B 2 42  ? 20.604  -5.861  -4.551  1.00 0.00 ? 42  LYS B HB2  2  
ATOM 9348   H HB3  . LYS B 2 42  ? 19.776  -5.209  -5.985  1.00 0.00 ? 42  LYS B HB3  2  
ATOM 9349   H HG2  . LYS B 2 42  ? 22.698  -4.754  -5.331  1.00 0.00 ? 42  LYS B HG2  2  
ATOM 9350   H HG3  . LYS B 2 42  ? 22.087  -6.017  -6.427  1.00 0.00 ? 42  LYS B HG3  2  
ATOM 9351   H HD2  . LYS B 2 42  ? 21.109  -4.322  -7.881  1.00 0.00 ? 42  LYS B HD2  2  
ATOM 9352   H HD3  . LYS B 2 42  ? 21.622  -3.036  -6.762  1.00 0.00 ? 42  LYS B HD3  2  
ATOM 9353   H HE2  . LYS B 2 42  ? 23.958  -3.555  -7.171  1.00 0.00 ? 42  LYS B HE2  2  
ATOM 9354   H HE3  . LYS B 2 42  ? 23.506  -4.944  -8.182  1.00 0.00 ? 42  LYS B HE3  2  
ATOM 9355   H HZ1  . LYS B 2 42  ? 22.608  -3.509  -9.817  1.00 0.00 ? 42  LYS B HZ1  2  
ATOM 9356   H HZ2  . LYS B 2 42  ? 24.122  -2.868  -9.413  1.00 0.00 ? 42  LYS B HZ2  2  
ATOM 9357   H HZ3  . LYS B 2 42  ? 22.712  -2.154  -8.815  1.00 0.00 ? 42  LYS B HZ3  2  
ATOM 9358   N N    . ALA B 2 43  ? 17.903  -4.139  -4.797  1.00 0.00 ? 43  ALA B N    2  
ATOM 9359   C CA   . ALA B 2 43  ? 16.503  -4.218  -4.411  1.00 0.00 ? 43  ALA B CA   2  
ATOM 9360   C C    . ALA B 2 43  ? 16.049  -5.673  -4.331  1.00 0.00 ? 43  ALA B C    2  
ATOM 9361   O O    . ALA B 2 43  ? 16.642  -6.541  -4.967  1.00 0.00 ? 43  ALA B O    2  
ATOM 9362   C CB   . ALA B 2 43  ? 15.656  -3.452  -5.414  1.00 0.00 ? 43  ALA B CB   2  
ATOM 9363   H H    . ALA B 2 43  ? 18.152  -4.357  -5.717  1.00 0.00 ? 43  ALA B H    2  
ATOM 9364   H HA   . ALA B 2 43  ? 16.386  -3.760  -3.429  1.00 0.00 ? 43  ALA B HA   2  
ATOM 9365   H HB1  . ALA B 2 43  ? 14.609  -3.491  -5.114  1.00 0.00 ? 43  ALA B HB1  2  
ATOM 9366   H HB2  . ALA B 2 43  ? 15.985  -2.413  -5.448  1.00 0.00 ? 43  ALA B HB2  2  
ATOM 9367   H HB3  . ALA B 2 43  ? 15.767  -3.900  -6.401  1.00 0.00 ? 43  ALA B HB3  2  
ATOM 9368   N N    . PRO B 2 44  ? 15.005  -5.959  -3.532  1.00 0.00 ? 44  PRO B N    2  
ATOM 9369   C CA   . PRO B 2 44  ? 14.477  -7.319  -3.376  1.00 0.00 ? 44  PRO B CA   2  
ATOM 9370   C C    . PRO B 2 44  ? 13.828  -7.851  -4.655  1.00 0.00 ? 44  PRO B C    2  
ATOM 9371   O O    . PRO B 2 44  ? 13.167  -7.111  -5.392  1.00 0.00 ? 44  PRO B O    2  
ATOM 9372   C CB   . PRO B 2 44  ? 13.412  -7.182  -2.276  1.00 0.00 ? 44  PRO B CB   2  
ATOM 9373   C CG   . PRO B 2 44  ? 13.668  -5.859  -1.638  1.00 0.00 ? 44  PRO B CG   2  
ATOM 9374   C CD   . PRO B 2 44  ? 14.273  -4.991  -2.701  1.00 0.00 ? 44  PRO B CD   2  
ATOM 9375   H HA   . PRO B 2 44  ? 15.268  -7.999  -3.063  1.00 0.00 ? 44  PRO B HA   2  
ATOM 9376   H HB2  . PRO B 2 44  ? 12.403  -7.246  -2.683  1.00 0.00 ? 44  PRO B HB2  2  
ATOM 9377   H HB3  . PRO B 2 44  ? 13.578  -7.962  -1.533  1.00 0.00 ? 44  PRO B HB3  2  
ATOM 9378   H HG2  . PRO B 2 44  ? 12.710  -5.429  -1.346  1.00 0.00 ? 44  PRO B HG2  2  
ATOM 9379   H HG3  . PRO B 2 44  ? 14.329  -5.952  -0.777  1.00 0.00 ? 44  PRO B HG3  2  
ATOM 9380   H HD2  . PRO B 2 44  ? 13.506  -4.460  -3.266  1.00 0.00 ? 44  PRO B HD2  2  
ATOM 9381   H HD3  . PRO B 2 44  ? 14.975  -4.284  -2.257  1.00 0.00 ? 44  PRO B HD3  2  
ATOM 9382   N N    . GLN B 2 45  ? 14.026  -9.134  -4.910  1.00 0.00 ? 45  GLN B N    2  
ATOM 9383   C CA   . GLN B 2 45  ? 13.457  -9.790  -6.078  1.00 0.00 ? 45  GLN B CA   2  
ATOM 9384   C C    . GLN B 2 45  ? 12.608  -10.977 -5.637  1.00 0.00 ? 45  GLN B C    2  
ATOM 9385   O O    . GLN B 2 45  ? 12.827  -11.536 -4.557  1.00 0.00 ? 45  GLN B O    2  
ATOM 9386   C CB   . GLN B 2 45  ? 14.562  -10.264 -7.029  1.00 0.00 ? 45  GLN B CB   2  
ATOM 9387   C CG   . GLN B 2 45  ? 14.716  -9.416  -8.282  1.00 0.00 ? 45  GLN B CG   2  
ATOM 9388   C CD   . GLN B 2 45  ? 15.650  -8.236  -8.088  1.00 0.00 ? 45  GLN B CD   2  
ATOM 9389   O OE1  . GLN B 2 45  ? 16.846  -8.317  -8.373  1.00 0.00 ? 45  GLN B OE1  2  
ATOM 9390   N NE2  . GLN B 2 45  ? 15.110  -7.132  -7.601  1.00 0.00 ? 45  GLN B NE2  2  
ATOM 9391   H H    . GLN B 2 45  ? 14.563  -9.672  -4.284  1.00 0.00 ? 45  GLN B H    2  
ATOM 9392   H HA   . GLN B 2 45  ? 12.824  -9.075  -6.604  1.00 0.00 ? 45  GLN B HA   2  
ATOM 9393   H HB2  . GLN B 2 45  ? 15.508  -10.249 -6.488  1.00 0.00 ? 45  GLN B HB2  2  
ATOM 9394   H HB3  . GLN B 2 45  ? 14.334  -11.286 -7.334  1.00 0.00 ? 45  GLN B HB3  2  
ATOM 9395   H HG2  . GLN B 2 45  ? 15.110  -10.044 -9.081  1.00 0.00 ? 45  GLN B HG2  2  
ATOM 9396   H HG3  . GLN B 2 45  ? 13.735  -9.040  -8.571  1.00 0.00 ? 45  GLN B HG3  2  
ATOM 9397   H HE21 . GLN B 2 45  ? 14.151  -7.136  -7.394  1.00 0.00 ? 45  GLN B HE21 2  
ATOM 9398   H HE22 . GLN B 2 45  ? 15.693  -6.359  -7.453  1.00 0.00 ? 45  GLN B HE22 2  
ATOM 9399   N N    . LEU B 2 46  ? 11.642  -11.354 -6.465  1.00 0.00 ? 46  LEU B N    2  
ATOM 9400   C CA   . LEU B 2 46  ? 10.767  -12.481 -6.155  1.00 0.00 ? 46  LEU B CA   2  
ATOM 9401   C C    . LEU B 2 46  ? 11.366  -13.786 -6.670  1.00 0.00 ? 46  LEU B C    2  
ATOM 9402   O O    . LEU B 2 46  ? 11.448  -14.005 -7.879  1.00 0.00 ? 46  LEU B O    2  
ATOM 9403   C CB   . LEU B 2 46  ? 9.373   -12.267 -6.749  1.00 0.00 ? 46  LEU B CB   2  
ATOM 9404   C CG   . LEU B 2 46  ? 8.301   -13.289 -6.356  1.00 0.00 ? 46  LEU B CG   2  
ATOM 9405   C CD1  . LEU B 2 46  ? 8.099   -13.301 -4.849  1.00 0.00 ? 46  LEU B CD1  2  
ATOM 9406   C CD2  . LEU B 2 46  ? 6.991   -12.993 -7.069  1.00 0.00 ? 46  LEU B CD2  2  
ATOM 9407   H H    . LEU B 2 46  ? 11.515  -10.865 -7.305  1.00 0.00 ? 46  LEU B H    2  
ATOM 9408   H HA   . LEU B 2 46  ? 10.673  -12.549 -5.071  1.00 0.00 ? 46  LEU B HA   2  
ATOM 9409   H HB2  . LEU B 2 46  ? 9.026   -11.283 -6.434  1.00 0.00 ? 46  LEU B HB2  2  
ATOM 9410   H HB3  . LEU B 2 46  ? 9.469   -12.288 -7.835  1.00 0.00 ? 46  LEU B HB3  2  
ATOM 9411   H HG   . LEU B 2 46  ? 8.642   -14.278 -6.663  1.00 0.00 ? 46  LEU B HG   2  
ATOM 9412   H HD11 . LEU B 2 46  ? 7.351   -14.047 -4.582  1.00 0.00 ? 46  LEU B HD11 2  
ATOM 9413   H HD12 . LEU B 2 46  ? 9.042   -13.544 -4.359  1.00 0.00 ? 46  LEU B HD12 2  
ATOM 9414   H HD13 . LEU B 2 46  ? 7.762   -12.317 -4.521  1.00 0.00 ? 46  LEU B HD13 2  
ATOM 9415   H HD21 . LEU B 2 46  ? 7.152   -13.018 -8.147  1.00 0.00 ? 46  LEU B HD21 2  
ATOM 9416   H HD22 . LEU B 2 46  ? 6.246   -13.740 -6.798  1.00 0.00 ? 46  LEU B HD22 2  
ATOM 9417   H HD23 . LEU B 2 46  ? 6.636   -12.005 -6.777  1.00 0.00 ? 46  LEU B HD23 2  
ATOM 9418   N N    . LEU B 2 47  ? 11.790  -14.642 -5.750  1.00 0.00 ? 47  LEU B N    2  
ATOM 9419   C CA   . LEU B 2 47  ? 12.388  -15.918 -6.119  1.00 0.00 ? 47  LEU B CA   2  
ATOM 9420   C C    . LEU B 2 47  ? 11.367  -17.048 -6.125  1.00 0.00 ? 47  LEU B C    2  
ATOM 9421   O O    . LEU B 2 47  ? 11.341  -17.868 -7.045  1.00 0.00 ? 47  LEU B O    2  
ATOM 9422   C CB   . LEU B 2 47  ? 13.533  -16.277 -5.168  1.00 0.00 ? 47  LEU B CB   2  
ATOM 9423   C CG   . LEU B 2 47  ? 14.657  -15.253 -5.016  1.00 0.00 ? 47  LEU B CG   2  
ATOM 9424   C CD1  . LEU B 2 47  ? 15.766  -15.825 -4.151  1.00 0.00 ? 47  LEU B CD1  2  
ATOM 9425   C CD2  . LEU B 2 47  ? 15.201  -14.829 -6.373  1.00 0.00 ? 47  LEU B CD2  2  
ATOM 9426   H H    . LEU B 2 47  ? 11.715  -14.402 -4.802  1.00 0.00 ? 47  LEU B H    2  
ATOM 9427   H HA   . LEU B 2 47  ? 12.793  -15.816 -7.126  1.00 0.00 ? 47  LEU B HA   2  
ATOM 9428   H HB2  . LEU B 2 47  ? 13.101  -16.441 -4.181  1.00 0.00 ? 47  LEU B HB2  2  
ATOM 9429   H HB3  . LEU B 2 47  ? 13.980  -17.204 -5.528  1.00 0.00 ? 47  LEU B HB3  2  
ATOM 9430   H HG   . LEU B 2 47  ? 14.253  -14.370 -4.520  1.00 0.00 ? 47  LEU B HG   2  
ATOM 9431   H HD11 . LEU B 2 47  ? 16.555  -15.082 -4.025  1.00 0.00 ? 47  LEU B HD11 2  
ATOM 9432   H HD12 . LEU B 2 47  ? 15.363  -16.093 -3.175  1.00 0.00 ? 47  LEU B HD12 2  
ATOM 9433   H HD13 . LEU B 2 47  ? 16.179  -16.713 -4.631  1.00 0.00 ? 47  LEU B HD13 2  
ATOM 9434   H HD21 . LEU B 2 47  ? 14.395  -14.400 -6.968  1.00 0.00 ? 47  LEU B HD21 2  
ATOM 9435   H HD22 . LEU B 2 47  ? 15.988  -14.086 -6.242  1.00 0.00 ? 47  LEU B HD22 2  
ATOM 9436   H HD23 . LEU B 2 47  ? 15.609  -15.700 -6.887  1.00 0.00 ? 47  LEU B HD23 2  
ATOM 9437   N N    . ILE B 2 48  ? 10.521  -17.087 -5.101  1.00 0.00 ? 48  ILE B N    2  
ATOM 9438   C CA   . ILE B 2 48  ? 9.523   -18.139 -4.978  1.00 0.00 ? 48  ILE B CA   2  
ATOM 9439   C C    . ILE B 2 48  ? 8.134   -17.551 -4.782  1.00 0.00 ? 48  ILE B C    2  
ATOM 9440   O O    . ILE B 2 48  ? 7.940   -16.657 -3.957  1.00 0.00 ? 48  ILE B O    2  
ATOM 9441   C CB   . ILE B 2 48  ? 9.836   -19.080 -3.788  1.00 0.00 ? 48  ILE B CB   2  
ATOM 9442   C CG1  . ILE B 2 48  ? 11.229  -19.709 -3.935  1.00 0.00 ? 48  ILE B CG1  2  
ATOM 9443   C CG2  . ILE B 2 48  ? 8.769   -20.163 -3.646  1.00 0.00 ? 48  ILE B CG2  2  
ATOM 9444   C CD1  . ILE B 2 48  ? 11.359  -20.654 -5.109  1.00 0.00 ? 48  ILE B CD1  2  
ATOM 9445   H H    . ILE B 2 48  ? 10.546  -16.370 -4.433  1.00 0.00 ? 48  ILE B H    2  
ATOM 9446   H HA   . ILE B 2 48  ? 9.532   -18.723 -5.898  1.00 0.00 ? 48  ILE B HA   2  
ATOM 9447   H HB   . ILE B 2 48  ? 9.831   -18.481 -2.877  1.00 0.00 ? 48  ILE B HB   2  
ATOM 9448   H HG12 . ILE B 2 48  ? 11.956  -18.907 -4.060  1.00 0.00 ? 48  ILE B HG12 2  
ATOM 9449   H HG13 . ILE B 2 48  ? 11.452  -20.264 -3.024  1.00 0.00 ? 48  ILE B HG13 2  
ATOM 9450   H HG21 . ILE B 2 48  ? 8.992   -20.795 -2.786  1.00 0.00 ? 48  ILE B HG21 2  
ATOM 9451   H HG22 . ILE B 2 48  ? 7.795   -19.695 -3.506  1.00 0.00 ? 48  ILE B HG22 2  
ATOM 9452   H HG23 . ILE B 2 48  ? 8.753   -20.775 -4.548  1.00 0.00 ? 48  ILE B HG23 2  
ATOM 9453   H HD11 . ILE B 2 48  ? 11.148  -20.113 -6.031  1.00 0.00 ? 48  ILE B HD11 2  
ATOM 9454   H HD12 . ILE B 2 48  ? 12.367  -21.065 -5.160  1.00 0.00 ? 48  ILE B HD12 2  
ATOM 9455   H HD13 . ILE B 2 48  ? 10.646  -21.471 -4.995  1.00 0.00 ? 48  ILE B HD13 2  
ATOM 9456   N N    . TYR B 2 49  ? 7.173   -18.068 -5.532  1.00 0.00 ? 49  TYR B N    2  
ATOM 9457   C CA   . TYR B 2 49  ? 5.797   -17.610 -5.431  1.00 0.00 ? 49  TYR B CA   2  
ATOM 9458   C C    . TYR B 2 49  ? 4.865   -18.798 -5.233  1.00 0.00 ? 49  TYR B C    2  
ATOM 9459   O O    . TYR B 2 49  ? 5.183   -19.918 -5.644  1.00 0.00 ? 49  TYR B O    2  
ATOM 9460   C CB   . TYR B 2 49  ? 5.377   -16.731 -6.622  1.00 0.00 ? 49  TYR B CB   2  
ATOM 9461   C CG   . TYR B 2 49  ? 5.430   -17.390 -7.986  1.00 0.00 ? 49  TYR B CG   2  
ATOM 9462   C CD1  . TYR B 2 49  ? 6.577   -17.331 -8.765  1.00 0.00 ? 49  TYR B CD1  2  
ATOM 9463   C CD2  . TYR B 2 49  ? 4.322   -18.049 -8.505  1.00 0.00 ? 49  TYR B CD2  2  
ATOM 9464   C CE1  . TYR B 2 49  ? 6.620   -17.914 -10.017 1.00 0.00 ? 49  TYR B CE1  2  
ATOM 9465   C CE2  . TYR B 2 49  ? 4.357   -18.638 -9.757  1.00 0.00 ? 49  TYR B CE2  2  
ATOM 9466   C CZ   . TYR B 2 49  ? 5.510   -18.566 -10.509 1.00 0.00 ? 49  TYR B CZ   2  
ATOM 9467   O OH   . TYR B 2 49  ? 5.555   -19.147 -11.759 1.00 0.00 ? 49  TYR B OH   2  
ATOM 9468   H H    . TYR B 2 49  ? 7.391   -18.808 -6.148  1.00 0.00 ? 49  TYR B H    2  
ATOM 9469   H HA   . TYR B 2 49  ? 5.731   -16.990 -4.538  1.00 0.00 ? 49  TYR B HA   2  
ATOM 9470   H HB2  . TYR B 2 49  ? 4.354   -16.397 -6.449  1.00 0.00 ? 49  TYR B HB2  2  
ATOM 9471   H HB3  . TYR B 2 49  ? 6.031   -15.859 -6.644  1.00 0.00 ? 49  TYR B HB3  2  
ATOM 9472   H HD1  . TYR B 2 49  ? 7.451   -16.822 -8.386  1.00 0.00 ? 49  TYR B HD1  2  
ATOM 9473   H HD2  . TYR B 2 49  ? 3.415   -18.103 -7.921  1.00 0.00 ? 49  TYR B HD2  2  
ATOM 9474   H HE1  . TYR B 2 49  ? 7.521   -17.858 -10.609 1.00 0.00 ? 49  TYR B HE1  2  
ATOM 9475   H HE2  . TYR B 2 49  ? 3.488   -19.150 -10.142 1.00 0.00 ? 49  TYR B HE2  2  
ATOM 9476   H HH   . TYR B 2 49  ? 6.425   -19.543 -11.896 1.00 0.00 ? 49  TYR B HH   2  
ATOM 9477   N N    . ASN B 2 50  ? 3.747   -18.559 -4.554  1.00 0.00 ? 50  ASN B N    2  
ATOM 9478   C CA   . ASN B 2 50  ? 2.751   -19.602 -4.269  1.00 0.00 ? 50  ASN B CA   2  
ATOM 9479   C C    . ASN B 2 50  ? 3.300   -20.650 -3.299  1.00 0.00 ? 50  ASN B C    2  
ATOM 9480   O O    . ASN B 2 50  ? 2.654   -21.661 -3.028  1.00 0.00 ? 50  ASN B O    2  
ATOM 9481   C CB   . ASN B 2 50  ? 2.238   -20.264 -5.556  1.00 0.00 ? 50  ASN B CB   2  
ATOM 9482   C CG   . ASN B 2 50  ? 0.760   -20.611 -5.492  1.00 0.00 ? 50  ASN B CG   2  
ATOM 9483   O OD1  . ASN B 2 50  ? -0.091  -19.818 -5.885  1.00 0.00 ? 50  ASN B OD1  2  
ATOM 9484   N ND2  . ASN B 2 50  ? 0.443   -21.796 -4.992  1.00 0.00 ? 50  ASN B ND2  2  
ATOM 9485   H H    . ASN B 2 50  ? 3.579   -17.649 -4.228  1.00 0.00 ? 50  ASN B H    2  
ATOM 9486   H HA   . ASN B 2 50  ? 1.902   -19.116 -3.787  1.00 0.00 ? 50  ASN B HA   2  
ATOM 9487   H HB2  . ASN B 2 50  ? 2.401   -19.580 -6.389  1.00 0.00 ? 50  ASN B HB2  2  
ATOM 9488   H HB3  . ASN B 2 50  ? 2.804   -21.179 -5.727  1.00 0.00 ? 50  ASN B HB3  2  
ATOM 9489   H HD21 . ASN B 2 50  ? 1.170   -22.380 -4.690  1.00 0.00 ? 50  ASN B HD21 2  
ATOM 9490   H HD22 . ASN B 2 50  ? -0.505  -22.037 -4.946  1.00 0.00 ? 50  ASN B HD22 2  
ATOM 9491   N N    . ALA B 2 51  ? 4.509   -20.387 -2.799  1.00 0.00 ? 51  ALA B N    2  
ATOM 9492   C CA   . ALA B 2 51  ? 5.200   -21.253 -1.839  1.00 0.00 ? 51  ALA B CA   2  
ATOM 9493   C C    . ALA B 2 51  ? 5.537   -22.642 -2.380  1.00 0.00 ? 51  ALA B C    2  
ATOM 9494   O O    . ALA B 2 51  ? 6.003   -23.497 -1.629  1.00 0.00 ? 51  ALA B O    2  
ATOM 9495   C CB   . ALA B 2 51  ? 4.422   -21.355 -0.536  1.00 0.00 ? 51  ALA B CB   2  
ATOM 9496   H H    . ALA B 2 51  ? 4.957   -19.561 -3.080  1.00 0.00 ? 51  ALA B H    2  
ATOM 9497   H HA   . ALA B 2 51  ? 6.148   -20.765 -1.613  1.00 0.00 ? 51  ALA B HA   2  
ATOM 9498   H HB1  . ALA B 2 51  ? 4.979   -21.945 0.193   1.00 0.00 ? 51  ALA B HB1  2  
ATOM 9499   H HB2  . ALA B 2 51  ? 4.256   -20.355 -0.135  1.00 0.00 ? 51  ALA B HB2  2  
ATOM 9500   H HB3  . ALA B 2 51  ? 3.461   -21.834 -0.725  1.00 0.00 ? 51  ALA B HB3  2  
ATOM 9501   N N    . LYS B 2 52  ? 5.333   -22.871 -3.673  1.00 0.00 ? 52  LYS B N    2  
ATOM 9502   C CA   . LYS B 2 52  ? 5.613   -24.187 -4.243  1.00 0.00 ? 52  LYS B CA   2  
ATOM 9503   C C    . LYS B 2 52  ? 6.187   -24.133 -5.657  1.00 0.00 ? 52  LYS B C    2  
ATOM 9504   O O    . LYS B 2 52  ? 6.304   -25.167 -6.313  1.00 0.00 ? 52  LYS B O    2  
ATOM 9505   C CB   . LYS B 2 52  ? 4.352   -25.060 -4.224  1.00 0.00 ? 52  LYS B CB   2  
ATOM 9506   C CG   . LYS B 2 52  ? 4.016   -25.646 -2.862  1.00 0.00 ? 52  LYS B CG   2  
ATOM 9507   C CD   . LYS B 2 52  ? 2.737   -26.464 -2.913  1.00 0.00 ? 52  LYS B CD   2  
ATOM 9508   C CE   . LYS B 2 52  ? 2.422   -27.085 -1.561  1.00 0.00 ? 52  LYS B CE   2  
ATOM 9509   N NZ   . LYS B 2 52  ? 3.473   -28.043 -1.125  1.00 0.00 ? 52  LYS B NZ   2  
ATOM 9510   H H    . LYS B 2 52  ? 4.982   -22.158 -4.243  1.00 0.00 ? 52  LYS B H    2  
ATOM 9511   H HA   . LYS B 2 52  ? 6.360   -24.658 -3.604  1.00 0.00 ? 52  LYS B HA   2  
ATOM 9512   H HB2  . LYS B 2 52  ? 3.510   -24.451 -4.551  1.00 0.00 ? 52  LYS B HB2  2  
ATOM 9513   H HB3  . LYS B 2 52  ? 4.498   -25.884 -4.923  1.00 0.00 ? 52  LYS B HB3  2  
ATOM 9514   H HG2  . LYS B 2 52  ? 4.835   -26.288 -2.539  1.00 0.00 ? 52  LYS B HG2  2  
ATOM 9515   H HG3  . LYS B 2 52  ? 3.888   -24.833 -2.147  1.00 0.00 ? 52  LYS B HG3  2  
ATOM 9516   H HD2  . LYS B 2 52  ? 1.911   -25.815 -3.206  1.00 0.00 ? 52  LYS B HD2  2  
ATOM 9517   H HD3  . LYS B 2 52  ? 2.853   -27.259 -3.650  1.00 0.00 ? 52  LYS B HD3  2  
ATOM 9518   H HE2  . LYS B 2 52  ? 2.340   -26.291 -0.819  1.00 0.00 ? 52  LYS B HE2  2  
ATOM 9519   H HE3  . LYS B 2 52  ? 1.471   -27.613 -1.628  1.00 0.00 ? 52  LYS B HE3  2  
ATOM 9520   H HZ1  . LYS B 2 52  ? 4.190   -27.556 -0.549  1.00 0.00 ? 52  LYS B HZ1  2  
ATOM 9521   H HZ2  . LYS B 2 52  ? 3.938   -28.467 -1.953  1.00 0.00 ? 52  LYS B HZ2  2  
ATOM 9522   H HZ3  . LYS B 2 52  ? 3.049   -28.805 -0.557  1.00 0.00 ? 52  LYS B HZ3  2  
ATOM 9523   N N    . THR B 2 53  ? 6.552   -22.949 -6.135  1.00 0.00 ? 53  THR B N    2  
ATOM 9524   C CA   . THR B 2 53  ? 7.103   -22.839 -7.480  1.00 0.00 ? 53  THR B CA   2  
ATOM 9525   C C    . THR B 2 53  ? 8.086   -21.682 -7.635  1.00 0.00 ? 53  THR B C    2  
ATOM 9526   O O    . THR B 2 53  ? 7.870   -20.581 -7.119  1.00 0.00 ? 53  THR B O    2  
ATOM 9527   C CB   . THR B 2 53  ? 6.003   -22.768 -8.568  1.00 0.00 ? 53  THR B CB   2  
ATOM 9528   O OG1  . THR B 2 53  ? 6.575   -22.417 -9.839  1.00 0.00 ? 53  THR B OG1  2  
ATOM 9529   C CG2  . THR B 2 53  ? 4.922   -21.765 -8.199  1.00 0.00 ? 53  THR B CG2  2  
ATOM 9530   H H    . THR B 2 53  ? 6.450   -22.146 -5.586  1.00 0.00 ? 53  THR B H    2  
ATOM 9531   H HA   . THR B 2 53  ? 7.664   -23.758 -7.653  1.00 0.00 ? 53  THR B HA   2  
ATOM 9532   H HB   . THR B 2 53  ? 5.543   -23.752 -8.656  1.00 0.00 ? 53  THR B HB   2  
ATOM 9533   H HG1  . THR B 2 53  ? 7.118   -21.624 -9.743  1.00 0.00 ? 53  THR B HG1  2  
ATOM 9534   H HG21 . THR B 2 53  ? 5.365   -20.773 -8.107  1.00 0.00 ? 53  THR B HG21 2  
ATOM 9535   H HG22 . THR B 2 53  ? 4.152   -21.745 -8.970  1.00 0.00 ? 53  THR B HG22 2  
ATOM 9536   H HG23 . THR B 2 53  ? 4.472   -22.052 -7.249  1.00 0.00 ? 53  THR B HG23 2  
ATOM 9537   N N    . LEU B 2 54  ? 9.183   -21.970 -8.329  1.00 0.00 ? 54  LEU B N    2  
ATOM 9538   C CA   . LEU B 2 54  ? 10.218  -20.985 -8.613  1.00 0.00 ? 54  LEU B CA   2  
ATOM 9539   C C    . LEU B 2 54  ? 9.717   -19.975 -9.638  1.00 0.00 ? 54  LEU B C    2  
ATOM 9540   O O    . LEU B 2 54  ? 8.814   -20.276 -10.425 1.00 0.00 ? 54  LEU B O    2  
ATOM 9541   C CB   . LEU B 2 54  ? 11.466  -21.678 -9.174  1.00 0.00 ? 54  LEU B CB   2  
ATOM 9542   C CG   . LEU B 2 54  ? 12.365  -22.413 -8.177  1.00 0.00 ? 54  LEU B CG   2  
ATOM 9543   C CD1  . LEU B 2 54  ? 11.731  -23.719 -7.719  1.00 0.00 ? 54  LEU B CD1  2  
ATOM 9544   C CD2  . LEU B 2 54  ? 13.733  -22.666 -8.789  1.00 0.00 ? 54  LEU B CD2  2  
ATOM 9545   H H    . LEU B 2 54  ? 9.317   -22.893 -8.630  1.00 0.00 ? 54  LEU B H    2  
ATOM 9546   H HA   . LEU B 2 54  ? 10.475  -20.467 -7.689  1.00 0.00 ? 54  LEU B HA   2  
ATOM 9547   H HB2  . LEU B 2 54  ? 11.133  -22.405 -9.914  1.00 0.00 ? 54  LEU B HB2  2  
ATOM 9548   H HB3  . LEU B 2 54  ? 12.073  -20.915 -9.661  1.00 0.00 ? 54  LEU B HB3  2  
ATOM 9549   H HG   . LEU B 2 54  ? 12.495  -21.776 -7.302  1.00 0.00 ? 54  LEU B HG   2  
ATOM 9550   H HD11 . LEU B 2 54  ? 12.379  -24.213 -6.994  1.00 0.00 ? 54  LEU B HD11 2  
ATOM 9551   H HD12 . LEU B 2 54  ? 10.767  -23.510 -7.256  1.00 0.00 ? 54  LEU B HD12 2  
ATOM 9552   H HD13 . LEU B 2 54  ? 11.588  -24.373 -8.579  1.00 0.00 ? 54  LEU B HD13 2  
ATOM 9553   H HD21 . LEU B 2 54  ? 14.182  -21.715 -9.077  1.00 0.00 ? 54  LEU B HD21 2  
ATOM 9554   H HD22 . LEU B 2 54  ? 14.376  -23.164 -8.063  1.00 0.00 ? 54  LEU B HD22 2  
ATOM 9555   H HD23 . LEU B 2 54  ? 13.625  -23.298 -9.670  1.00 0.00 ? 54  LEU B HD23 2  
ATOM 9556   N N    . ALA B 2 55  ? 10.290  -18.780 -9.610  1.00 0.00 ? 55  ALA B N    2  
ATOM 9557   C CA   . ALA B 2 55  ? 9.916   -17.732 -10.549 1.00 0.00 ? 55  ALA B CA   2  
ATOM 9558   C C    . ALA B 2 55  ? 10.671  -17.878 -11.866 1.00 0.00 ? 55  ALA B C    2  
ATOM 9559   O O    . ALA B 2 55  ? 11.680  -18.581 -11.946 1.00 0.00 ? 55  ALA B O    2  
ATOM 9560   C CB   . ALA B 2 55  ? 10.149  -16.356 -9.945  1.00 0.00 ? 55  ALA B CB   2  
ATOM 9561   H H    . ALA B 2 55  ? 10.961  -18.589 -8.919  1.00 0.00 ? 55  ALA B H    2  
ATOM 9562   H HA   . ALA B 2 55  ? 8.851   -17.836 -10.756 1.00 0.00 ? 55  ALA B HA   2  
ATOM 9563   H HB1  . ALA B 2 55  ? 9.832   -15.583 -10.646 1.00 0.00 ? 55  ALA B HB1  2  
ATOM 9564   H HB2  . ALA B 2 55  ? 9.576   -16.263 -9.023  1.00 0.00 ? 55  ALA B HB2  2  
ATOM 9565   H HB3  . ALA B 2 55  ? 11.210  -16.231 -9.727  1.00 0.00 ? 55  ALA B HB3  2  
ATOM 9566   N N    . ASP B 2 56  ? 10.187  -17.187 -12.887 1.00 0.00 ? 56  ASP B N    2  
ATOM 9567   C CA   . ASP B 2 56  ? 10.796  -17.242 -14.209 1.00 0.00 ? 56  ASP B CA   2  
ATOM 9568   C C    . ASP B 2 56  ? 12.083  -16.425 -14.244 1.00 0.00 ? 56  ASP B C    2  
ATOM 9569   O O    . ASP B 2 56  ? 12.047  -15.193 -14.292 1.00 0.00 ? 56  ASP B O    2  
ATOM 9570   C CB   . ASP B 2 56  ? 9.825   -16.728 -15.279 1.00 0.00 ? 56  ASP B CB   2  
ATOM 9571   C CG   . ASP B 2 56  ? 8.663   -17.667 -15.543 1.00 0.00 ? 56  ASP B CG   2  
ATOM 9572   O OD1  . ASP B 2 56  ? 8.729   -18.440 -16.523 1.00 0.00 ? 56  ASP B OD1  2  
ATOM 9573   O OD2  . ASP B 2 56  ? 7.674   -17.629 -14.776 1.00 0.00 ? 56  ASP B OD2  2  
ATOM 9574   H H    . ASP B 2 56  ? 9.402   -16.616 -12.745 1.00 0.00 ? 56  ASP B H    2  
ATOM 9575   H HA   . ASP B 2 56  ? 11.037  -18.282 -14.430 1.00 0.00 ? 56  ASP B HA   2  
ATOM 9576   H HB2  . ASP B 2 56  ? 9.426   -15.768 -14.952 1.00 0.00 ? 56  ASP B HB2  2  
ATOM 9577   H HB3  . ASP B 2 56  ? 10.376  -16.590 -16.209 1.00 0.00 ? 56  ASP B HB3  2  
ATOM 9578   H HD2  . ASP B 2 56  ? 6.977   -18.248 -15.005 1.00 0.00 ? 56  ASP B HD2  2  
ATOM 9579   N N    . GLY B 2 57  ? 13.215  -17.111 -14.204 1.00 0.00 ? 57  GLY B N    2  
ATOM 9580   C CA   . GLY B 2 57  ? 14.495  -16.433 -14.238 1.00 0.00 ? 57  GLY B CA   2  
ATOM 9581   C C    . GLY B 2 57  ? 15.341  -16.743 -13.021 1.00 0.00 ? 57  GLY B C    2  
ATOM 9582   O O    . GLY B 2 57  ? 16.537  -16.442 -12.992 1.00 0.00 ? 57  GLY B O    2  
ATOM 9583   H H    . GLY B 2 57  ? 13.183  -18.089 -14.143 1.00 0.00 ? 57  GLY B H    2  
ATOM 9584   H HA2  . GLY B 2 57  ? 15.035  -16.747 -15.131 1.00 0.00 ? 57  GLY B HA2  2  
ATOM 9585   H HA3  . GLY B 2 57  ? 14.321  -15.358 -14.280 1.00 0.00 ? 57  GLY B HA3  2  
ATOM 9586   N N    . VAL B 2 58  ? 14.724  -17.355 -12.022 1.00 0.00 ? 58  VAL B N    2  
ATOM 9587   C CA   . VAL B 2 58  ? 15.415  -17.708 -10.788 1.00 0.00 ? 58  VAL B CA   2  
ATOM 9588   C C    . VAL B 2 58  ? 16.149  -19.040 -10.939 1.00 0.00 ? 58  VAL B C    2  
ATOM 9589   O O    . VAL B 2 58  ? 15.580  -20.009 -11.439 1.00 0.00 ? 58  VAL B O    2  
ATOM 9590   C CB   . VAL B 2 58  ? 14.420  -17.791 -9.607  1.00 0.00 ? 58  VAL B CB   2  
ATOM 9591   C CG1  . VAL B 2 58  ? 15.114  -18.207 -8.316  1.00 0.00 ? 58  VAL B CG1  2  
ATOM 9592   C CG2  . VAL B 2 58  ? 13.711  -16.458 -9.426  1.00 0.00 ? 58  VAL B CG2  2  
ATOM 9593   H H    . VAL B 2 58  ? 13.775  -17.582 -12.117 1.00 0.00 ? 58  VAL B H    2  
ATOM 9594   H HA   . VAL B 2 58  ? 16.147  -16.930 -10.573 1.00 0.00 ? 58  VAL B HA   2  
ATOM 9595   H HB   . VAL B 2 58  ? 13.672  -18.547 -9.846  1.00 0.00 ? 58  VAL B HB   2  
ATOM 9596   H HG11 . VAL B 2 58  ? 14.386  -18.276 -7.507  1.00 0.00 ? 58  VAL B HG11 2  
ATOM 9597   H HG12 . VAL B 2 58  ? 15.589  -19.177 -8.457  1.00 0.00 ? 58  VAL B HG12 2  
ATOM 9598   H HG13 . VAL B 2 58  ? 15.870  -17.466 -8.057  1.00 0.00 ? 58  VAL B HG13 2  
ATOM 9599   H HG21 . VAL B 2 58  ? 13.190  -16.196 -10.347 1.00 0.00 ? 58  VAL B HG21 2  
ATOM 9600   H HG22 . VAL B 2 58  ? 12.990  -16.532 -8.611  1.00 0.00 ? 58  VAL B HG22 2  
ATOM 9601   H HG23 . VAL B 2 58  ? 14.444  -15.686 -9.191  1.00 0.00 ? 58  VAL B HG23 2  
ATOM 9602   N N    . PRO B 2 59  ? 17.435  -19.088 -10.537 1.00 0.00 ? 59  PRO B N    2  
ATOM 9603   C CA   . PRO B 2 59  ? 18.249  -20.311 -10.611 1.00 0.00 ? 59  PRO B CA   2  
ATOM 9604   C C    . PRO B 2 59  ? 17.597  -21.478 -9.867  1.00 0.00 ? 59  PRO B C    2  
ATOM 9605   O O    . PRO B 2 59  ? 16.880  -21.282 -8.885  1.00 0.00 ? 59  PRO B O    2  
ATOM 9606   C CB   . PRO B 2 59  ? 19.558  -19.911 -9.928  1.00 0.00 ? 59  PRO B CB   2  
ATOM 9607   C CG   . PRO B 2 59  ? 19.623  -18.430 -10.084 1.00 0.00 ? 59  PRO B CG   2  
ATOM 9608   C CD   . PRO B 2 59  ? 18.203  -17.949 -10.002 1.00 0.00 ? 59  PRO B CD   2  
ATOM 9609   H HA   . PRO B 2 59  ? 18.426  -20.594 -11.649 1.00 0.00 ? 59  PRO B HA   2  
ATOM 9610   H HB2  . PRO B 2 59  ? 19.578  -20.211 -8.881  1.00 0.00 ? 59  PRO B HB2  2  
ATOM 9611   H HB3  . PRO B 2 59  ? 20.390  -20.356 -10.474 1.00 0.00 ? 59  PRO B HB3  2  
ATOM 9612   H HG2  . PRO B 2 59  ? 20.178  -18.019 -9.241  1.00 0.00 ? 59  PRO B HG2  2  
ATOM 9613   H HG3  . PRO B 2 59  ? 20.088  -18.146 -11.028 1.00 0.00 ? 59  PRO B HG3  2  
ATOM 9614   H HD2  . PRO B 2 59  ? 17.923  -17.712 -8.976  1.00 0.00 ? 59  PRO B HD2  2  
ATOM 9615   H HD3  . PRO B 2 59  ? 18.061  -17.080 -10.645 1.00 0.00 ? 59  PRO B HD3  2  
ATOM 9616   N N    . SER B 2 60  ? 17.892  -22.692 -10.312 1.00 0.00 ? 60  SER B N    2  
ATOM 9617   C CA   . SER B 2 60  ? 17.316  -23.897 -9.728  1.00 0.00 ? 60  SER B CA   2  
ATOM 9618   C C    . SER B 2 60  ? 17.785  -24.163 -8.294  1.00 0.00 ? 60  SER B C    2  
ATOM 9619   O O    . SER B 2 60  ? 17.185  -24.970 -7.582  1.00 0.00 ? 60  SER B O    2  
ATOM 9620   C CB   . SER B 2 60  ? 17.651  -25.092 -10.619 1.00 0.00 ? 60  SER B CB   2  
ATOM 9621   O OG   . SER B 2 60  ? 18.570  -24.714 -11.635 1.00 0.00 ? 60  SER B OG   2  
ATOM 9622   H H    . SER B 2 60  ? 18.533  -22.792 -11.049 1.00 0.00 ? 60  SER B H    2  
ATOM 9623   H HA   . SER B 2 60  ? 16.233  -23.772 -9.708  1.00 0.00 ? 60  SER B HA   2  
ATOM 9624   H HB2  . SER B 2 60  ? 18.095  -25.880 -10.010 1.00 0.00 ? 60  SER B HB2  2  
ATOM 9625   H HB3  . SER B 2 60  ? 16.737  -25.462 -11.083 1.00 0.00 ? 60  SER B HB3  2  
ATOM 9626   H HG   . SER B 2 60  ? 18.152  -24.831 -12.500 1.00 0.00 ? 60  SER B HG   2  
ATOM 9627   N N    . ARG B 2 61  ? 18.847  -23.488 -7.860  1.00 0.00 ? 61  ARG B N    2  
ATOM 9628   C CA   . ARG B 2 61  ? 19.371  -23.693 -6.511  1.00 0.00 ? 61  ARG B CA   2  
ATOM 9629   C C    . ARG B 2 61  ? 18.481  -23.092 -5.424  1.00 0.00 ? 61  ARG B C    2  
ATOM 9630   O O    . ARG B 2 61  ? 18.742  -23.273 -4.233  1.00 0.00 ? 61  ARG B O    2  
ATOM 9631   C CB   . ARG B 2 61  ? 20.830  -23.242 -6.379  1.00 0.00 ? 61  ARG B CB   2  
ATOM 9632   C CG   . ARG B 2 61  ? 21.063  -21.737 -6.359  1.00 0.00 ? 61  ARG B CG   2  
ATOM 9633   C CD   . ARG B 2 61  ? 22.554  -21.429 -6.340  1.00 0.00 ? 61  ARG B CD   2  
ATOM 9634   N NE   . ARG B 2 61  ? 22.846  -20.014 -6.111  1.00 0.00 ? 61  ARG B NE   2  
ATOM 9635   C CZ   . ARG B 2 61  ? 23.506  -19.244 -6.974  1.00 0.00 ? 61  ARG B CZ   2  
ATOM 9636   N NH1  . ARG B 2 61  ? 23.890  -19.731 -8.149  1.00 0.00 ? 61  ARG B NH1  2  
ATOM 9637   N NH2  . ARG B 2 61  ? 23.775  -17.983 -6.668  1.00 0.00 ? 61  ARG B NH2  2  
ATOM 9638   H H    . ARG B 2 61  ? 19.297  -22.858 -8.460  1.00 0.00 ? 61  ARG B H    2  
ATOM 9639   H HA   . ARG B 2 61  ? 19.366  -24.771 -6.350  1.00 0.00 ? 61  ARG B HA   2  
ATOM 9640   H HB2  . ARG B 2 61  ? 21.224  -23.654 -5.450  1.00 0.00 ? 61  ARG B HB2  2  
ATOM 9641   H HB3  . ARG B 2 61  ? 21.384  -23.654 -7.223  1.00 0.00 ? 61  ARG B HB3  2  
ATOM 9642   H HG2  . ARG B 2 61  ? 20.616  -21.293 -7.248  1.00 0.00 ? 61  ARG B HG2  2  
ATOM 9643   H HG3  . ARG B 2 61  ? 20.598  -21.313 -5.469  1.00 0.00 ? 61  ARG B HG3  2  
ATOM 9644   H HD2  . ARG B 2 61  ? 23.020  -22.013 -5.547  1.00 0.00 ? 61  ARG B HD2  2  
ATOM 9645   H HD3  . ARG B 2 61  ? 22.982  -21.722 -7.299  1.00 0.00 ? 61  ARG B HD3  2  
ATOM 9646   H HE   . ARG B 2 61  ? 22.564  -19.623 -5.245  1.00 0.00 ? 61  ARG B HE   2  
ATOM 9647   H HH11 . ARG B 2 61  ? 23.678  -20.682 -8.395  1.00 0.00 ? 61  ARG B HH11 2  
ATOM 9648   H HH12 . ARG B 2 61  ? 24.400  -19.156 -8.789  1.00 0.00 ? 61  ARG B HH12 2  
ATOM 9649   H HH21 . ARG B 2 61  ? 23.471  -17.601 -5.775  1.00 0.00 ? 61  ARG B HH21 2  
ATOM 9650   H HH22 . ARG B 2 61  ? 24.287  -17.398 -7.310  1.00 0.00 ? 61  ARG B HH22 2  
ATOM 9651   N N    . PHE B 2 62  ? 17.435  -22.384 -5.830  1.00 0.00 ? 62  PHE B N    2  
ATOM 9652   C CA   . PHE B 2 62  ? 16.506  -21.784 -4.883  1.00 0.00 ? 62  PHE B CA   2  
ATOM 9653   C C    . PHE B 2 62  ? 15.184  -22.543 -4.898  1.00 0.00 ? 62  PHE B C    2  
ATOM 9654   O O    . PHE B 2 62  ? 14.268  -22.200 -5.639  1.00 0.00 ? 62  PHE B O    2  
ATOM 9655   C CB   . PHE B 2 62  ? 16.278  -20.306 -5.209  1.00 0.00 ? 62  PHE B CB   2  
ATOM 9656   C CG   . PHE B 2 62  ? 17.497  -19.447 -5.025  1.00 0.00 ? 62  PHE B CG   2  
ATOM 9657   C CD1  . PHE B 2 62  ? 17.933  -19.104 -3.755  1.00 0.00 ? 62  PHE B CD1  2  
ATOM 9658   C CD2  . PHE B 2 62  ? 18.208  -18.983 -6.120  1.00 0.00 ? 62  PHE B CD2  2  
ATOM 9659   C CE1  . PHE B 2 62  ? 19.052  -18.314 -3.583  1.00 0.00 ? 62  PHE B CE1  2  
ATOM 9660   C CE2  . PHE B 2 62  ? 19.330  -18.193 -5.953  1.00 0.00 ? 62  PHE B CE2  2  
ATOM 9661   C CZ   . PHE B 2 62  ? 19.750  -17.858 -4.684  1.00 0.00 ? 62  PHE B CZ   2  
ATOM 9662   H H    . PHE B 2 62  ? 17.280  -22.266 -6.792  1.00 0.00 ? 62  PHE B H    2  
ATOM 9663   H HA   . PHE B 2 62  ? 16.939  -21.855 -3.885  1.00 0.00 ? 62  PHE B HA   2  
ATOM 9664   H HB2  . PHE B 2 62  ? 15.952  -20.226 -6.246  1.00 0.00 ? 62  PHE B HB2  2  
ATOM 9665   H HB3  . PHE B 2 62  ? 15.486  -19.926 -4.563  1.00 0.00 ? 62  PHE B HB3  2  
ATOM 9666   H HD1  . PHE B 2 62  ? 17.390  -19.458 -2.891  1.00 0.00 ? 62  PHE B HD1  2  
ATOM 9667   H HD2  . PHE B 2 62  ? 17.882  -19.241 -7.117  1.00 0.00 ? 62  PHE B HD2  2  
ATOM 9668   H HE1  . PHE B 2 62  ? 19.382  -18.053 -2.588  1.00 0.00 ? 62  PHE B HE1  2  
ATOM 9669   H HE2  . PHE B 2 62  ? 19.875  -17.838 -6.816  1.00 0.00 ? 62  PHE B HE2  2  
ATOM 9670   H HZ   . PHE B 2 62  ? 20.625  -17.239 -4.550  1.00 0.00 ? 62  PHE B HZ   2  
ATOM 9671   N N    . SER B 2 63  ? 15.094  -23.582 -4.081  1.00 0.00 ? 63  SER B N    2  
ATOM 9672   C CA   . SER B 2 63  ? 13.894  -24.400 -4.018  1.00 0.00 ? 63  SER B CA   2  
ATOM 9673   C C    . SER B 2 63  ? 13.005  -24.015 -2.837  1.00 0.00 ? 63  SER B C    2  
ATOM 9674   O O    . SER B 2 63  ? 13.421  -24.077 -1.679  1.00 0.00 ? 63  SER B O    2  
ATOM 9675   C CB   . SER B 2 63  ? 14.272  -25.879 -3.931  1.00 0.00 ? 63  SER B CB   2  
ATOM 9676   O OG   . SER B 2 63  ? 15.301  -26.193 -4.856  1.00 0.00 ? 63  SER B OG   2  
ATOM 9677   H H    . SER B 2 63  ? 15.851  -23.793 -3.491  1.00 0.00 ? 63  SER B H    2  
ATOM 9678   H HA   . SER B 2 63  ? 13.329  -24.240 -4.936  1.00 0.00 ? 63  SER B HA   2  
ATOM 9679   H HB2  . SER B 2 63  ? 14.621  -26.100 -2.922  1.00 0.00 ? 63  SER B HB2  2  
ATOM 9680   H HB3  . SER B 2 63  ? 13.395  -26.486 -4.153  1.00 0.00 ? 63  SER B HB3  2  
ATOM 9681   H HG   . SER B 2 63  ? 15.430  -25.449 -5.453  1.00 0.00 ? 63  SER B HG   2  
ATOM 9682   N N    . GLY B 2 64  ? 11.780  -23.618 -3.135  1.00 0.00 ? 64  GLY B N    2  
ATOM 9683   C CA   . GLY B 2 64  ? 10.847  -23.246 -2.093  1.00 0.00 ? 64  GLY B CA   2  
ATOM 9684   C C    . GLY B 2 64  ? 9.828   -24.338 -1.852  1.00 0.00 ? 64  GLY B C    2  
ATOM 9685   O O    . GLY B 2 64  ? 9.379   -24.985 -2.798  1.00 0.00 ? 64  GLY B O    2  
ATOM 9686   H H    . GLY B 2 64  ? 11.501  -23.586 -4.073  1.00 0.00 ? 64  GLY B H    2  
ATOM 9687   H HA2  . GLY B 2 64  ? 11.398  -23.064 -1.170  1.00 0.00 ? 64  GLY B HA2  2  
ATOM 9688   H HA3  . GLY B 2 64  ? 10.328  -22.334 -2.389  1.00 0.00 ? 64  GLY B HA3  2  
ATOM 9689   N N    . SER B 2 65  ? 9.480   -24.567 -0.594  1.00 0.00 ? 65  SER B N    2  
ATOM 9690   C CA   . SER B 2 65  ? 8.512   -25.594 -0.242  1.00 0.00 ? 65  SER B CA   2  
ATOM 9691   C C    . SER B 2 65  ? 7.705   -25.181 0.986   1.00 0.00 ? 65  SER B C    2  
ATOM 9692   O O    . SER B 2 65  ? 7.885   -24.086 1.524   1.00 0.00 ? 65  SER B O    2  
ATOM 9693   C CB   . SER B 2 65  ? 9.225   -26.926 0.011   1.00 0.00 ? 65  SER B CB   2  
ATOM 9694   O OG   . SER B 2 65  ? 9.957   -27.332 -1.134  1.00 0.00 ? 65  SER B OG   2  
ATOM 9695   H H    . SER B 2 65  ? 9.880   -24.028 0.124   1.00 0.00 ? 65  SER B H    2  
ATOM 9696   H HA   . SER B 2 65  ? 7.827   -25.720 -1.081  1.00 0.00 ? 65  SER B HA   2  
ATOM 9697   H HB2  . SER B 2 65  ? 9.910   -26.811 0.851   1.00 0.00 ? 65  SER B HB2  2  
ATOM 9698   H HB3  . SER B 2 65  ? 8.483   -27.689 0.249   1.00 0.00 ? 65  SER B HB3  2  
ATOM 9699   H HG   . SER B 2 65  ? 9.788   -26.708 -1.855  1.00 0.00 ? 65  SER B HG   2  
ATOM 9700   N N    . GLY B 2 66  ? 6.816   -26.059 1.419   1.00 0.00 ? 66  GLY B N    2  
ATOM 9701   C CA   . GLY B 2 66  ? 5.999   -25.775 2.573   1.00 0.00 ? 66  GLY B CA   2  
ATOM 9702   C C    . GLY B 2 66  ? 4.529   -25.921 2.262   1.00 0.00 ? 66  GLY B C    2  
ATOM 9703   O O    . GLY B 2 66  ? 4.122   -25.807 1.103   1.00 0.00 ? 66  GLY B O    2  
ATOM 9704   H H    . GLY B 2 66  ? 6.700   -26.905 0.938   1.00 0.00 ? 66  GLY B H    2  
ATOM 9705   H HA2  . GLY B 2 66  ? 6.262   -26.467 3.373   1.00 0.00 ? 66  GLY B HA2  2  
ATOM 9706   H HA3  . GLY B 2 66  ? 6.192   -24.754 2.902   1.00 0.00 ? 66  GLY B HA3  2  
ATOM 9707   N N    . SER B 2 67  ? 3.730   -26.194 3.282   1.00 0.00 ? 67  SER B N    2  
ATOM 9708   C CA   . SER B 2 67  ? 2.299   -26.351 3.099   1.00 0.00 ? 67  SER B CA   2  
ATOM 9709   C C    . SER B 2 67  ? 1.544   -26.117 4.404   1.00 0.00 ? 67  SER B C    2  
ATOM 9710   O O    . SER B 2 67  ? 1.976   -26.557 5.474   1.00 0.00 ? 67  SER B O    2  
ATOM 9711   C CB   . SER B 2 67  ? 1.989   -27.746 2.549   1.00 0.00 ? 67  SER B CB   2  
ATOM 9712   O OG   . SER B 2 67  ? 2.916   -28.705 3.038   1.00 0.00 ? 67  SER B OG   2  
ATOM 9713   H H    . SER B 2 67  ? 4.108   -26.299 4.184   1.00 0.00 ? 67  SER B H    2  
ATOM 9714   H HA   . SER B 2 67  ? 1.967   -25.610 2.372   1.00 0.00 ? 67  SER B HA   2  
ATOM 9715   H HB2  . SER B 2 67  ? 0.983   -28.035 2.856   1.00 0.00 ? 67  SER B HB2  2  
ATOM 9716   H HB3  . SER B 2 67  ? 2.044   -27.722 1.461   1.00 0.00 ? 67  SER B HB3  2  
ATOM 9717   H HG   . SER B 2 67  ? 3.699   -28.251 3.363   1.00 0.00 ? 67  SER B HG   2  
ATOM 9718   N N    . GLY B 2 68  ? 0.437   -25.397 4.317   1.00 0.00 ? 68  GLY B N    2  
ATOM 9719   C CA   . GLY B 2 68  ? -0.370  -25.133 5.490   1.00 0.00 ? 68  GLY B CA   2  
ATOM 9720   C C    . GLY B 2 68  ? 0.188   -24.009 6.332   1.00 0.00 ? 68  GLY B C    2  
ATOM 9721   O O    . GLY B 2 68  ? 0.030   -22.841 5.991   1.00 0.00 ? 68  GLY B O    2  
ATOM 9722   H H    . GLY B 2 68  ? 0.185   -25.001 3.452   1.00 0.00 ? 68  GLY B H    2  
ATOM 9723   H HA2  . GLY B 2 68  ? -1.376  -24.865 5.169   1.00 0.00 ? 68  GLY B HA2  2  
ATOM 9724   H HA3  . GLY B 2 68  ? -0.413  -26.037 6.096   1.00 0.00 ? 68  GLY B HA3  2  
ATOM 9725   N N    . THR B 2 69  ? 0.833   -24.363 7.433   1.00 0.00 ? 69  THR B N    2  
ATOM 9726   C CA   . THR B 2 69  ? 1.426   -23.376 8.325   1.00 0.00 ? 69  THR B CA   2  
ATOM 9727   C C    . THR B 2 69  ? 2.935   -23.573 8.424   1.00 0.00 ? 69  THR B C    2  
ATOM 9728   O O    . THR B 2 69  ? 3.632   -22.811 9.095   1.00 0.00 ? 69  THR B O    2  
ATOM 9729   C CB   . THR B 2 69  ? 0.818   -23.498 9.733   1.00 0.00 ? 69  THR B CB   2  
ATOM 9730   O OG1  . THR B 2 69  ? 0.181   -24.779 9.865   1.00 0.00 ? 69  THR B OG1  2  
ATOM 9731   C CG2  . THR B 2 69  ? -0.209  -22.406 9.961   1.00 0.00 ? 69  THR B CG2  2  
ATOM 9732   H H    . THR B 2 69  ? 0.889   -25.310 7.673   1.00 0.00 ? 69  THR B H    2  
ATOM 9733   H HA   . THR B 2 69  ? 1.219   -22.381 7.930   1.00 0.00 ? 69  THR B HA   2  
ATOM 9734   H HB   . THR B 2 69  ? 1.611   -23.407 10.476  1.00 0.00 ? 69  THR B HB   2  
ATOM 9735   H HG1  . THR B 2 69  ? -0.771  -24.671 9.770   1.00 0.00 ? 69  THR B HG1  2  
ATOM 9736   H HG21 . THR B 2 69  ? -1.004  -22.496 9.221   1.00 0.00 ? 69  THR B HG21 2  
ATOM 9737   H HG22 . THR B 2 69  ? -0.632  -22.503 10.961  1.00 0.00 ? 69  THR B HG22 2  
ATOM 9738   H HG23 . THR B 2 69  ? 0.270   -21.432 9.864   1.00 0.00 ? 69  THR B HG23 2  
ATOM 9739   N N    . GLN B 2 70  ? 3.432   -24.595 7.742   1.00 0.00 ? 70  GLN B N    2  
ATOM 9740   C CA   . GLN B 2 70  ? 4.852   -24.905 7.762   1.00 0.00 ? 70  GLN B CA   2  
ATOM 9741   C C    . GLN B 2 70  ? 5.484   -24.647 6.403   1.00 0.00 ? 70  GLN B C    2  
ATOM 9742   O O    . GLN B 2 70  ? 5.391   -25.479 5.503   1.00 0.00 ? 70  GLN B O    2  
ATOM 9743   C CB   . GLN B 2 70  ? 5.070   -26.365 8.169   1.00 0.00 ? 70  GLN B CB   2  
ATOM 9744   C CG   . GLN B 2 70  ? 4.601   -26.699 9.576   1.00 0.00 ? 70  GLN B CG   2  
ATOM 9745   C CD   . GLN B 2 70  ? 4.371   -28.184 9.781   1.00 0.00 ? 70  GLN B CD   2  
ATOM 9746   O OE1  . GLN B 2 70  ? 3.509   -28.587 10.562  1.00 0.00 ? 70  GLN B OE1  2  
ATOM 9747   N NE2  . GLN B 2 70  ? 5.143   -29.007 9.089   1.00 0.00 ? 70  GLN B NE2  2  
ATOM 9748   H H    . GLN B 2 70  ? 2.830   -25.146 7.196   1.00 0.00 ? 70  GLN B H    2  
ATOM 9749   H HA   . GLN B 2 70  ? 5.333   -24.261 8.499   1.00 0.00 ? 70  GLN B HA   2  
ATOM 9750   H HB2  . GLN B 2 70  ? 4.526   -26.999 7.468   1.00 0.00 ? 70  GLN B HB2  2  
ATOM 9751   H HB3  . GLN B 2 70  ? 6.136   -26.582 8.103   1.00 0.00 ? 70  GLN B HB3  2  
ATOM 9752   H HG2  . GLN B 2 70  ? 5.356   -26.361 10.285  1.00 0.00 ? 70  GLN B HG2  2  
ATOM 9753   H HG3  . GLN B 2 70  ? 3.667   -26.170 9.767   1.00 0.00 ? 70  GLN B HG3  2  
ATOM 9754   H HE21 . GLN B 2 70  ? 5.820   -28.617 8.490   1.00 0.00 ? 70  GLN B HE21 2  
ATOM 9755   H HE22 . GLN B 2 70  ? 5.005   -29.972 9.195   1.00 0.00 ? 70  GLN B HE22 2  
ATOM 9756   N N    . PHE B 2 71  ? 6.095   -23.484 6.251   1.00 0.00 ? 71  PHE B N    2  
ATOM 9757   C CA   . PHE B 2 71  ? 6.748   -23.123 5.000   1.00 0.00 ? 71  PHE B CA   2  
ATOM 9758   C C    . PHE B 2 71  ? 8.258   -23.181 5.183   1.00 0.00 ? 71  PHE B C    2  
ATOM 9759   O O    . PHE B 2 71  ? 8.766   -22.867 6.260   1.00 0.00 ? 71  PHE B O    2  
ATOM 9760   C CB   . PHE B 2 71  ? 6.302   -21.737 4.541   1.00 0.00 ? 71  PHE B CB   2  
ATOM 9761   C CG   . PHE B 2 71  ? 4.819   -21.637 4.322   1.00 0.00 ? 71  PHE B CG   2  
ATOM 9762   C CD1  . PHE B 2 71  ? 4.234   -22.184 3.192   1.00 0.00 ? 71  PHE B CD1  2  
ATOM 9763   C CD2  . PHE B 2 71  ? 4.009   -21.003 5.250   1.00 0.00 ? 71  PHE B CD2  2  
ATOM 9764   C CE1  . PHE B 2 71  ? 2.869   -22.100 2.990   1.00 0.00 ? 71  PHE B CE1  2  
ATOM 9765   C CE2  . PHE B 2 71  ? 2.645   -20.916 5.056   1.00 0.00 ? 71  PHE B CE2  2  
ATOM 9766   C CZ   . PHE B 2 71  ? 2.074   -21.465 3.924   1.00 0.00 ? 71  PHE B CZ   2  
ATOM 9767   H H    . PHE B 2 71  ? 6.110   -22.846 6.997   1.00 0.00 ? 71  PHE B H    2  
ATOM 9768   H HA   . PHE B 2 71  ? 6.461   -23.847 4.238   1.00 0.00 ? 71  PHE B HA   2  
ATOM 9769   H HB2  . PHE B 2 71  ? 6.594   -21.007 5.297   1.00 0.00 ? 71  PHE B HB2  2  
ATOM 9770   H HB3  . PHE B 2 71  ? 6.811   -21.496 3.608   1.00 0.00 ? 71  PHE B HB3  2  
ATOM 9771   H HD1  . PHE B 2 71  ? 4.852   -22.683 2.460   1.00 0.00 ? 71  PHE B HD1  2  
ATOM 9772   H HD2  . PHE B 2 71  ? 4.450   -20.571 6.137   1.00 0.00 ? 71  PHE B HD2  2  
ATOM 9773   H HE1  . PHE B 2 71  ? 2.426   -22.530 2.104   1.00 0.00 ? 71  PHE B HE1  2  
ATOM 9774   H HE2  . PHE B 2 71  ? 2.025   -20.419 5.788   1.00 0.00 ? 71  PHE B HE2  2  
ATOM 9775   H HZ   . PHE B 2 71  ? 1.007   -21.398 3.769   1.00 0.00 ? 71  PHE B HZ   2  
ATOM 9776   N N    . THR B 2 72  ? 8.978   -23.590 4.145   1.00 0.00 ? 72  THR B N    2  
ATOM 9777   C CA   . THR B 2 72  ? 10.424  -23.711 4.241   1.00 0.00 ? 72  THR B CA   2  
ATOM 9778   C C    . THR B 2 72  ? 11.118  -23.423 2.911   1.00 0.00 ? 72  THR B C    2  
ATOM 9779   O O    . THR B 2 72  ? 10.657  -23.839 1.850   1.00 0.00 ? 72  THR B O    2  
ATOM 9780   C CB   . THR B 2 72  ? 10.814  -25.136 4.696   1.00 0.00 ? 72  THR B CB   2  
ATOM 9781   O OG1  . THR B 2 72  ? 9.780   -25.677 5.532   1.00 0.00 ? 72  THR B OG1  2  
ATOM 9782   C CG2  . THR B 2 72  ? 12.118  -25.115 5.475   1.00 0.00 ? 72  THR B CG2  2  
ATOM 9783   H H    . THR B 2 72  ? 8.528   -23.809 3.297   1.00 0.00 ? 72  THR B H    2  
ATOM 9784   H HA   . THR B 2 72  ? 10.775  -22.993 4.982   1.00 0.00 ? 72  THR B HA   2  
ATOM 9785   H HB   . THR B 2 72  ? 10.934  -25.768 3.817   1.00 0.00 ? 72  THR B HB   2  
ATOM 9786   H HG1  . THR B 2 72  ? 9.412   -24.971 6.078   1.00 0.00 ? 72  THR B HG1  2  
ATOM 9787   H HG21 . THR B 2 72  ? 12.003  -24.486 6.358   1.00 0.00 ? 72  THR B HG21 2  
ATOM 9788   H HG22 . THR B 2 72  ? 12.380  -26.127 5.785   1.00 0.00 ? 72  THR B HG22 2  
ATOM 9789   H HG23 . THR B 2 72  ? 12.911  -24.714 4.844   1.00 0.00 ? 72  THR B HG23 2  
ATOM 9790   N N    . LEU B 2 73  ? 12.228  -22.708 2.980   1.00 0.00 ? 73  LEU B N    2  
ATOM 9791   C CA   . LEU B 2 73  ? 13.014  -22.390 1.800   1.00 0.00 ? 73  LEU B CA   2  
ATOM 9792   C C    . LEU B 2 73  ? 14.278  -23.231 1.853   1.00 0.00 ? 73  LEU B C    2  
ATOM 9793   O O    . LEU B 2 73  ? 14.892  -23.356 2.914   1.00 0.00 ? 73  LEU B O    2  
ATOM 9794   C CB   . LEU B 2 73  ? 13.372  -20.902 1.773   1.00 0.00 ? 73  LEU B CB   2  
ATOM 9795   C CG   . LEU B 2 73  ? 14.083  -20.402 0.511   1.00 0.00 ? 73  LEU B CG   2  
ATOM 9796   C CD1  . LEU B 2 73  ? 13.175  -20.528 -0.702  1.00 0.00 ? 73  LEU B CD1  2  
ATOM 9797   C CD2  . LEU B 2 73  ? 14.545  -18.966 0.691   1.00 0.00 ? 73  LEU B CD2  2  
ATOM 9798   H H    . LEU B 2 73  ? 12.551  -22.397 3.858   1.00 0.00 ? 73  LEU B H    2  
ATOM 9799   H HA   . LEU B 2 73  ? 12.443  -22.637 0.905   1.00 0.00 ? 73  LEU B HA   2  
ATOM 9800   H HB2  . LEU B 2 73  ? 12.448  -20.334 1.881   1.00 0.00 ? 73  LEU B HB2  2  
ATOM 9801   H HB3  . LEU B 2 73  ? 14.024  -20.701 2.623   1.00 0.00 ? 73  LEU B HB3  2  
ATOM 9802   H HG   . LEU B 2 73  ? 14.962  -21.025 0.345   1.00 0.00 ? 73  LEU B HG   2  
ATOM 9803   H HD11 . LEU B 2 73  ? 13.702  -20.190 -1.595  1.00 0.00 ? 73  LEU B HD11 2  
ATOM 9804   H HD12 . LEU B 2 73  ? 12.882  -21.570 -0.829  1.00 0.00 ? 73  LEU B HD12 2  
ATOM 9805   H HD13 . LEU B 2 73  ? 12.286  -19.915 -0.554  1.00 0.00 ? 73  LEU B HD13 2  
ATOM 9806   H HD21 . LEU B 2 73  ? 15.217  -18.906 1.547   1.00 0.00 ? 73  LEU B HD21 2  
ATOM 9807   H HD22 . LEU B 2 73  ? 15.070  -18.631 -0.205  1.00 0.00 ? 73  LEU B HD22 2  
ATOM 9808   H HD23 . LEU B 2 73  ? 13.680  -18.325 0.862   1.00 0.00 ? 73  LEU B HD23 2  
ATOM 9809   N N    . THR B 2 74  ? 14.661  -23.817 0.732   1.00 0.00 ? 74  THR B N    2  
ATOM 9810   C CA   . THR B 2 74  ? 15.839  -24.668 0.699   1.00 0.00 ? 74  THR B CA   2  
ATOM 9811   C C    . THR B 2 74  ? 16.810  -24.272 -0.407  1.00 0.00 ? 74  THR B C    2  
ATOM 9812   O O    . THR B 2 74  ? 16.453  -24.238 -1.585  1.00 0.00 ? 74  THR B O    2  
ATOM 9813   C CB   . THR B 2 74  ? 15.440  -26.144 0.520   1.00 0.00 ? 74  THR B CB   2  
ATOM 9814   O OG1  . THR B 2 74  ? 14.015  -26.268 0.657   1.00 0.00 ? 74  THR B OG1  2  
ATOM 9815   C CG2  . THR B 2 74  ? 16.124  -27.011 1.565   1.00 0.00 ? 74  THR B CG2  2  
ATOM 9816   H H    . THR B 2 74  ? 14.151  -23.670 -0.096  1.00 0.00 ? 74  THR B H    2  
ATOM 9817   H HA   . THR B 2 74  ? 16.350  -24.562 1.656   1.00 0.00 ? 74  THR B HA   2  
ATOM 9818   H HB   . THR B 2 74  ? 15.739  -26.478 -0.473  1.00 0.00 ? 74  THR B HB   2  
ATOM 9819   H HG1  . THR B 2 74  ? 13.591  -25.553 0.172   1.00 0.00 ? 74  THR B HG1  2  
ATOM 9820   H HG21 . THR B 2 74  ? 15.827  -26.681 2.561   1.00 0.00 ? 74  THR B HG21 2  
ATOM 9821   H HG22 . THR B 2 74  ? 15.834  -28.052 1.427   1.00 0.00 ? 74  THR B HG22 2  
ATOM 9822   H HG23 . THR B 2 74  ? 17.205  -26.920 1.460   1.00 0.00 ? 74  THR B HG23 2  
ATOM 9823   N N    . ILE B 2 75  ? 18.035  -23.965 -0.014  1.00 0.00 ? 75  ILE B N    2  
ATOM 9824   C CA   . ILE B 2 75  ? 19.073  -23.596 -0.959  1.00 0.00 ? 75  ILE B CA   2  
ATOM 9825   C C    . ILE B 2 75  ? 20.027  -24.774 -1.123  1.00 0.00 ? 75  ILE B C    2  
ATOM 9826   O O    . ILE B 2 75  ? 20.739  -25.138 -0.184  1.00 0.00 ? 75  ILE B O    2  
ATOM 9827   C CB   . ILE B 2 75  ? 19.860  -22.350 -0.492  1.00 0.00 ? 75  ILE B CB   2  
ATOM 9828   C CG1  . ILE B 2 75  ? 18.899  -21.191 -0.205  1.00 0.00 ? 75  ILE B CG1  2  
ATOM 9829   C CG2  . ILE B 2 75  ? 20.891  -21.943 -1.537  1.00 0.00 ? 75  ILE B CG2  2  
ATOM 9830   C CD1  . ILE B 2 75  ? 19.569  -19.959 0.367   1.00 0.00 ? 75  ILE B CD1  2  
ATOM 9831   H H    . ILE B 2 75  ? 18.250  -23.995 0.947   1.00 0.00 ? 75  ILE B H    2  
ATOM 9832   H HA   . ILE B 2 75  ? 18.607  -23.374 -1.919  1.00 0.00 ? 75  ILE B HA   2  
ATOM 9833   H HB   . ILE B 2 75  ? 20.385  -22.599 0.430   1.00 0.00 ? 75  ILE B HB   2  
ATOM 9834   H HG12 . ILE B 2 75  ? 18.411  -20.912 -1.139  1.00 0.00 ? 75  ILE B HG12 2  
ATOM 9835   H HG13 . ILE B 2 75  ? 18.151  -21.535 0.508   1.00 0.00 ? 75  ILE B HG13 2  
ATOM 9836   H HG21 . ILE B 2 75  ? 21.451  -21.077 -1.185  1.00 0.00 ? 75  ILE B HG21 2  
ATOM 9837   H HG22 . ILE B 2 75  ? 21.578  -22.772 -1.710  1.00 0.00 ? 75  ILE B HG22 2  
ATOM 9838   H HG23 . ILE B 2 75  ? 20.384  -21.692 -2.468  1.00 0.00 ? 75  ILE B HG23 2  
ATOM 9839   H HD11 . ILE B 2 75  ? 20.316  -19.595 -0.338  1.00 0.00 ? 75  ILE B HD11 2  
ATOM 9840   H HD12 . ILE B 2 75  ? 18.836  -19.173 0.548   1.00 0.00 ? 75  ILE B HD12 2  
ATOM 9841   H HD13 . ILE B 2 75  ? 20.053  -20.217 1.309   1.00 0.00 ? 75  ILE B HD13 2  
ATOM 9842   N N    . SER B 2 76  ? 19.992  -25.389 -2.301  1.00 0.00 ? 76  SER B N    2  
ATOM 9843   C CA   . SER B 2 76  ? 20.828  -26.545 -2.614  1.00 0.00 ? 76  SER B CA   2  
ATOM 9844   C C    . SER B 2 76  ? 22.315  -26.308 -2.345  1.00 0.00 ? 76  SER B C    2  
ATOM 9845   O O    . SER B 2 76  ? 22.988  -27.159 -1.763  1.00 0.00 ? 76  SER B O    2  
ATOM 9846   C CB   . SER B 2 76  ? 20.608  -26.950 -4.071  1.00 0.00 ? 76  SER B CB   2  
ATOM 9847   O OG   . SER B 2 76  ? 19.372  -26.437 -4.546  1.00 0.00 ? 76  SER B OG   2  
ATOM 9848   H H    . SER B 2 76  ? 19.355  -25.076 -2.984  1.00 0.00 ? 76  SER B H    2  
ATOM 9849   H HA   . SER B 2 76  ? 20.504  -27.367 -1.977  1.00 0.00 ? 76  SER B HA   2  
ATOM 9850   H HB2  . SER B 2 76  ? 21.420  -26.552 -4.681  1.00 0.00 ? 76  SER B HB2  2  
ATOM 9851   H HB3  . SER B 2 76  ? 20.597  -28.037 -4.144  1.00 0.00 ? 76  SER B HB3  2  
ATOM 9852   H HG   . SER B 2 76  ? 18.722  -27.147 -4.574  1.00 0.00 ? 76  SER B HG   2  
ATOM 9853   N N    . SER B 2 77  ? 22.832  -25.158 -2.752  1.00 0.00 ? 77  SER B N    2  
ATOM 9854   C CA   . SER B 2 77  ? 24.235  -24.855 -2.553  1.00 0.00 ? 77  SER B CA   2  
ATOM 9855   C C    . SER B 2 77  ? 24.419  -23.365 -2.308  1.00 0.00 ? 77  SER B C    2  
ATOM 9856   O O    . SER B 2 77  ? 24.264  -22.559 -3.223  1.00 0.00 ? 77  SER B O    2  
ATOM 9857   C CB   . SER B 2 77  ? 25.046  -25.293 -3.779  1.00 0.00 ? 77  SER B CB   2  
ATOM 9858   O OG   . SER B 2 77  ? 26.407  -24.915 -3.666  1.00 0.00 ? 77  SER B OG   2  
ATOM 9859   H H    . SER B 2 77  ? 22.266  -24.478 -3.177  1.00 0.00 ? 77  SER B H    2  
ATOM 9860   H HA   . SER B 2 77  ? 24.591  -25.403 -1.681  1.00 0.00 ? 77  SER B HA   2  
ATOM 9861   H HB2  . SER B 2 77  ? 24.987  -26.378 -3.874  1.00 0.00 ? 77  SER B HB2  2  
ATOM 9862   H HB3  . SER B 2 77  ? 24.623  -24.827 -4.669  1.00 0.00 ? 77  SER B HB3  2  
ATOM 9863   H HG   . SER B 2 77  ? 26.485  -23.963 -3.803  1.00 0.00 ? 77  SER B HG   2  
ATOM 9864   N N    . LEU B 2 78  ? 24.729  -23.010 -1.070  1.00 0.00 ? 78  LEU B N    2  
ATOM 9865   C CA   . LEU B 2 78  ? 24.936  -21.617 -0.702  1.00 0.00 ? 78  LEU B CA   2  
ATOM 9866   C C    . LEU B 2 78  ? 26.179  -21.038 -1.365  1.00 0.00 ? 78  LEU B C    2  
ATOM 9867   O O    . LEU B 2 78  ? 27.278  -21.587 -1.240  1.00 0.00 ? 78  LEU B O    2  
ATOM 9868   C CB   . LEU B 2 78  ? 25.054  -21.476 0.817   1.00 0.00 ? 78  LEU B CB   2  
ATOM 9869   C CG   . LEU B 2 78  ? 25.453  -20.089 1.335   1.00 0.00 ? 78  LEU B CG   2  
ATOM 9870   C CD1  . LEU B 2 78  ? 24.340  -19.079 1.102   1.00 0.00 ? 78  LEU B CD1  2  
ATOM 9871   C CD2  . LEU B 2 78  ? 25.836  -20.149 2.805   1.00 0.00 ? 78  LEU B CD2  2  
ATOM 9872   H H    . LEU B 2 78  ? 24.808  -23.705 -0.379  1.00 0.00 ? 78  LEU B H    2  
ATOM 9873   H HA   . LEU B 2 78  ? 24.068  -21.048 -1.038  1.00 0.00 ? 78  LEU B HA   2  
ATOM 9874   H HB2  . LEU B 2 78  ? 24.087  -21.728 1.251   1.00 0.00 ? 78  LEU B HB2  2  
ATOM 9875   H HB3  . LEU B 2 78  ? 25.804  -22.189 1.160   1.00 0.00 ? 78  LEU B HB3  2  
ATOM 9876   H HG   . LEU B 2 78  ? 26.328  -19.760 0.774   1.00 0.00 ? 78  LEU B HG   2  
ATOM 9877   H HD11 . LEU B 2 78  ? 24.652  -18.094 1.450   1.00 0.00 ? 78  LEU B HD11 2  
ATOM 9878   H HD12 . LEU B 2 78  ? 24.114  -19.030 0.036   1.00 0.00 ? 78  LEU B HD12 2  
ATOM 9879   H HD13 . LEU B 2 78  ? 23.449  -19.389 1.648   1.00 0.00 ? 78  LEU B HD13 2  
ATOM 9880   H HD21 . LEU B 2 78  ? 26.659  -20.851 2.936   1.00 0.00 ? 78  LEU B HD21 2  
ATOM 9881   H HD22 . LEU B 2 78  ? 26.145  -19.162 3.148   1.00 0.00 ? 78  LEU B HD22 2  
ATOM 9882   H HD23 . LEU B 2 78  ? 24.978  -20.482 3.389   1.00 0.00 ? 78  LEU B HD23 2  
ATOM 9883   N N    . GLN B 2 79  ? 25.994  -19.941 -2.078  1.00 0.00 ? 79  GLN B N    2  
ATOM 9884   C CA   . GLN B 2 79  ? 27.096  -19.257 -2.738  1.00 0.00 ? 79  GLN B CA   2  
ATOM 9885   C C    . GLN B 2 79  ? 27.287  -17.878 -2.115  1.00 0.00 ? 79  GLN B C    2  
ATOM 9886   O O    . GLN B 2 79  ? 26.335  -17.296 -1.599  1.00 0.00 ? 79  GLN B O    2  
ATOM 9887   C CB   . GLN B 2 79  ? 26.852  -19.161 -4.248  1.00 0.00 ? 79  GLN B CB   2  
ATOM 9888   C CG   . GLN B 2 79  ? 27.058  -20.481 -4.983  1.00 0.00 ? 79  GLN B CG   2  
ATOM 9889   C CD   . GLN B 2 79  ? 26.897  -20.368 -6.488  1.00 0.00 ? 79  GLN B CD   2  
ATOM 9890   O OE1  . GLN B 2 79  ? 26.501  -21.326 -7.156  1.00 0.00 ? 79  GLN B OE1  2  
ATOM 9891   N NE2  . GLN B 2 79  ? 27.219  -19.206 -7.038  1.00 0.00 ? 79  GLN B NE2  2  
ATOM 9892   H H    . GLN B 2 79  ? 25.082  -19.577 -2.170  1.00 0.00 ? 79  GLN B H    2  
ATOM 9893   H HA   . GLN B 2 79  ? 28.004  -19.838 -2.577  1.00 0.00 ? 79  GLN B HA   2  
ATOM 9894   H HB2  . GLN B 2 79  ? 25.826  -18.832 -4.411  1.00 0.00 ? 79  GLN B HB2  2  
ATOM 9895   H HB3  . GLN B 2 79  ? 27.540  -18.424 -4.662  1.00 0.00 ? 79  GLN B HB3  2  
ATOM 9896   H HG2  . GLN B 2 79  ? 28.063  -20.843 -4.769  1.00 0.00 ? 79  GLN B HG2  2  
ATOM 9897   H HG3  . GLN B 2 79  ? 26.330  -21.201 -4.610  1.00 0.00 ? 79  GLN B HG3  2  
ATOM 9898   H HE21 . GLN B 2 79  ? 27.544  -18.493 -6.453  1.00 0.00 ? 79  GLN B HE21 2  
ATOM 9899   H HE22 . GLN B 2 79  ? 27.107  -19.104 -8.008  1.00 0.00 ? 79  GLN B HE22 2  
ATOM 9900   N N    . PRO B 2 80  ? 28.520  -17.339 -2.141  1.00 0.00 ? 80  PRO B N    2  
ATOM 9901   C CA   . PRO B 2 80  ? 28.833  -16.021 -1.558  1.00 0.00 ? 80  PRO B CA   2  
ATOM 9902   C C    . PRO B 2 80  ? 27.990  -14.882 -2.139  1.00 0.00 ? 80  PRO B C    2  
ATOM 9903   O O    . PRO B 2 80  ? 27.865  -13.819 -1.530  1.00 0.00 ? 80  PRO B O    2  
ATOM 9904   C CB   . PRO B 2 80  ? 30.312  -15.816 -1.894  1.00 0.00 ? 80  PRO B CB   2  
ATOM 9905   C CG   . PRO B 2 80  ? 30.844  -17.190 -2.111  1.00 0.00 ? 80  PRO B CG   2  
ATOM 9906   C CD   . PRO B 2 80  ? 29.718  -17.977 -2.718  1.00 0.00 ? 80  PRO B CD   2  
ATOM 9907   H HA   . PRO B 2 80  ? 28.690  -16.049 -0.478  1.00 0.00 ? 80  PRO B HA   2  
ATOM 9908   H HB2  . PRO B 2 80  ? 30.445  -15.185 -2.773  1.00 0.00 ? 80  PRO B HB2  2  
ATOM 9909   H HB3  . PRO B 2 80  ? 30.812  -15.381 -1.029  1.00 0.00 ? 80  PRO B HB3  2  
ATOM 9910   H HG2  . PRO B 2 80  ? 31.657  -17.134 -2.835  1.00 0.00 ? 80  PRO B HG2  2  
ATOM 9911   H HG3  . PRO B 2 80  ? 31.188  -17.638 -1.178  1.00 0.00 ? 80  PRO B HG3  2  
ATOM 9912   H HD2  . PRO B 2 80  ? 29.732  -17.915 -3.806  1.00 0.00 ? 80  PRO B HD2  2  
ATOM 9913   H HD3  . PRO B 2 80  ? 29.768  -19.017 -2.396  1.00 0.00 ? 80  PRO B HD3  2  
ATOM 9914   N N    . GLU B 2 81  ? 27.413  -15.105 -3.310  1.00 0.00 ? 81  GLU B N    2  
ATOM 9915   C CA   . GLU B 2 81  ? 26.586  -14.093 -3.952  1.00 0.00 ? 81  GLU B CA   2  
ATOM 9916   C C    . GLU B 2 81  ? 25.140  -14.179 -3.480  1.00 0.00 ? 81  GLU B C    2  
ATOM 9917   O O    . GLU B 2 81  ? 24.320  -13.320 -3.808  1.00 0.00 ? 81  GLU B O    2  
ATOM 9918   C CB   . GLU B 2 81  ? 26.650  -14.222 -5.474  1.00 0.00 ? 81  GLU B CB   2  
ATOM 9919   C CG   . GLU B 2 81  ? 26.284  -15.601 -5.999  1.00 0.00 ? 81  GLU B CG   2  
ATOM 9920   C CD   . GLU B 2 81  ? 26.320  -15.674 -7.511  1.00 0.00 ? 81  GLU B CD   2  
ATOM 9921   O OE1  . GLU B 2 81  ? 25.484  -16.399 -8.094  1.00 0.00 ? 81  GLU B OE1  2  
ATOM 9922   O OE2  . GLU B 2 81  ? 27.187  -15.013 -8.120  1.00 0.00 ? 81  GLU B OE2  2  
ATOM 9923   H H    . GLU B 2 81  ? 27.537  -15.970 -3.748  1.00 0.00 ? 81  GLU B H    2  
ATOM 9924   H HA   . GLU B 2 81  ? 26.980  -13.115 -3.675  1.00 0.00 ? 81  GLU B HA   2  
ATOM 9925   H HB2  . GLU B 2 81  ? 25.962  -13.497 -5.908  1.00 0.00 ? 81  GLU B HB2  2  
ATOM 9926   H HB3  . GLU B 2 81  ? 27.667  -13.994 -5.795  1.00 0.00 ? 81  GLU B HB3  2  
ATOM 9927   H HG2  . GLU B 2 81  ? 26.988  -16.328 -5.596  1.00 0.00 ? 81  GLU B HG2  2  
ATOM 9928   H HG3  . GLU B 2 81  ? 25.278  -15.849 -5.660  1.00 0.00 ? 81  GLU B HG3  2  
ATOM 9929   H HE2  . GLU B 2 81  ? 27.153  -15.107 -9.075  1.00 0.00 ? 81  GLU B HE2  2  
ATOM 9930   N N    . ASP B 2 82  ? 24.834  -15.211 -2.707  1.00 0.00 ? 82  ASP B N    2  
ATOM 9931   C CA   . ASP B 2 82  ? 23.482  -15.412 -2.198  1.00 0.00 ? 82  ASP B CA   2  
ATOM 9932   C C    . ASP B 2 82  ? 23.297  -14.744 -0.843  1.00 0.00 ? 82  ASP B C    2  
ATOM 9933   O O    . ASP B 2 82  ? 22.260  -14.901 -0.200  1.00 0.00 ? 82  ASP B O    2  
ATOM 9934   C CB   . ASP B 2 82  ? 23.132  -16.898 -2.125  1.00 0.00 ? 82  ASP B CB   2  
ATOM 9935   C CG   . ASP B 2 82  ? 23.051  -17.547 -3.494  1.00 0.00 ? 82  ASP B CG   2  
ATOM 9936   O OD1  . ASP B 2 82  ? 22.843  -16.823 -4.492  1.00 0.00 ? 82  ASP B OD1  2  
ATOM 9937   O OD2  . ASP B 2 82  ? 23.205  -18.783 -3.579  1.00 0.00 ? 82  ASP B OD2  2  
ATOM 9938   H H    . ASP B 2 82  ? 25.532  -15.863 -2.474  1.00 0.00 ? 82  ASP B H    2  
ATOM 9939   H HA   . ASP B 2 82  ? 22.794  -14.941 -2.901  1.00 0.00 ? 82  ASP B HA   2  
ATOM 9940   H HB2  . ASP B 2 82  ? 23.896  -17.409 -1.540  1.00 0.00 ? 82  ASP B HB2  2  
ATOM 9941   H HB3  . ASP B 2 82  ? 22.168  -17.006 -1.629  1.00 0.00 ? 82  ASP B HB3  2  
ATOM 9942   H HD2  . ASP B 2 82  ? 23.144  -19.126 -4.473  1.00 0.00 ? 82  ASP B HD2  2  
ATOM 9943   N N    . PHE B 2 83  ? 24.315  -14.002 -0.414  1.00 0.00 ? 83  PHE B N    2  
ATOM 9944   C CA   . PHE B 2 83  ? 24.261  -13.280 0.850   1.00 0.00 ? 83  PHE B CA   2  
ATOM 9945   C C    . PHE B 2 83  ? 23.176  -12.218 0.750   1.00 0.00 ? 83  PHE B C    2  
ATOM 9946   O O    . PHE B 2 83  ? 23.291  -11.283 -0.047  1.00 0.00 ? 83  PHE B O    2  
ATOM 9947   C CB   . PHE B 2 83  ? 25.616  -12.622 1.131   1.00 0.00 ? 83  PHE B CB   2  
ATOM 9948   C CG   . PHE B 2 83  ? 25.764  -12.056 2.518   1.00 0.00 ? 83  PHE B CG   2  
ATOM 9949   C CD1  . PHE B 2 83  ? 25.318  -10.777 2.815   1.00 0.00 ? 83  PHE B CD1  2  
ATOM 9950   C CD2  . PHE B 2 83  ? 26.356  -12.801 3.523   1.00 0.00 ? 83  PHE B CD2  2  
ATOM 9951   C CE1  . PHE B 2 83  ? 25.458  -10.256 4.086   1.00 0.00 ? 83  PHE B CE1  2  
ATOM 9952   C CE2  . PHE B 2 83  ? 26.500  -12.286 4.797   1.00 0.00 ? 83  PHE B CE2  2  
ATOM 9953   C CZ   . PHE B 2 83  ? 26.049  -11.012 5.079   1.00 0.00 ? 83  PHE B CZ   2  
ATOM 9954   H H    . PHE B 2 83  ? 25.121  -13.938 -0.962  1.00 0.00 ? 83  PHE B H    2  
ATOM 9955   H HA   . PHE B 2 83  ? 24.022  -13.974 1.656   1.00 0.00 ? 83  PHE B HA   2  
ATOM 9956   H HB2  . PHE B 2 83  ? 26.397  -13.368 0.981   1.00 0.00 ? 83  PHE B HB2  2  
ATOM 9957   H HB3  . PHE B 2 83  ? 25.761  -11.814 0.414   1.00 0.00 ? 83  PHE B HB3  2  
ATOM 9958   H HD1  . PHE B 2 83  ? 24.855  -10.182 2.043   1.00 0.00 ? 83  PHE B HD1  2  
ATOM 9959   H HD2  . PHE B 2 83  ? 26.710  -13.799 3.309   1.00 0.00 ? 83  PHE B HD2  2  
ATOM 9960   H HE1  . PHE B 2 83  ? 25.106  -9.258  4.303   1.00 0.00 ? 83  PHE B HE1  2  
ATOM 9961   H HE2  . PHE B 2 83  ? 26.964  -12.880 5.571   1.00 0.00 ? 83  PHE B HE2  2  
ATOM 9962   H HZ   . PHE B 2 83  ? 26.158  -10.607 6.075   1.00 0.00 ? 83  PHE B HZ   2  
ATOM 9963   N N    . ALA B 2 84  ? 22.131  -12.355 1.557   1.00 0.00 ? 84  ALA B N    2  
ATOM 9964   C CA   . ALA B 2 84  ? 21.016  -11.423 1.521   1.00 0.00 ? 84  ALA B CA   2  
ATOM 9965   C C    . ALA B 2 84  ? 20.087  -11.641 2.708   1.00 0.00 ? 84  ALA B C    2  
ATOM 9966   O O    . ALA B 2 84  ? 20.342  -12.494 3.565   1.00 0.00 ? 84  ALA B O    2  
ATOM 9967   C CB   . ALA B 2 84  ? 20.238  -11.618 0.228   1.00 0.00 ? 84  ALA B CB   2  
ATOM 9968   H H    . ALA B 2 84  ? 22.126  -13.079 2.221   1.00 0.00 ? 84  ALA B H    2  
ATOM 9969   H HA   . ALA B 2 84  ? 21.406  -10.406 1.557   1.00 0.00 ? 84  ALA B HA   2  
ATOM 9970   H HB1  . ALA B 2 84  ? 19.412  -10.908 0.187   1.00 0.00 ? 84  ALA B HB1  2  
ATOM 9971   H HB2  . ALA B 2 84  ? 20.900  -11.453 -0.622  1.00 0.00 ? 84  ALA B HB2  2  
ATOM 9972   H HB3  . ALA B 2 84  ? 19.845  -12.634 0.190   1.00 0.00 ? 84  ALA B HB3  2  
ATOM 9973   N N    . ASN B 2 85  ? 19.014  -10.864 2.747   1.00 0.00 ? 85  ASN B N    2  
ATOM 9974   C CA   . ASN B 2 85  ? 18.020  -10.968 3.802   1.00 0.00 ? 85  ASN B CA   2  
ATOM 9975   C C    . ASN B 2 85  ? 16.729  -11.574 3.257   1.00 0.00 ? 85  ASN B C    2  
ATOM 9976   O O    . ASN B 2 85  ? 16.025  -10.968 2.448   1.00 0.00 ? 85  ASN B O    2  
ATOM 9977   C CB   . ASN B 2 85  ? 17.759  -9.611  4.479   1.00 0.00 ? 85  ASN B CB   2  
ATOM 9978   C CG   . ASN B 2 85  ? 17.304  -8.516  3.523   1.00 0.00 ? 85  ASN B CG   2  
ATOM 9979   O OD1  . ASN B 2 85  ? 17.725  -8.462  2.374   1.00 0.00 ? 85  ASN B OD1  2  
ATOM 9980   N ND2  . ASN B 2 85  ? 16.450  -7.621  4.002   1.00 0.00 ? 85  ASN B ND2  2  
ATOM 9981   H H    . ASN B 2 85  ? 18.878  -10.200 2.034   1.00 0.00 ? 85  ASN B H    2  
ATOM 9982   H HA   . ASN B 2 85  ? 18.415  -11.645 4.560   1.00 0.00 ? 85  ASN B HA   2  
ATOM 9983   H HB2  . ASN B 2 85  ? 16.987  -9.748  5.236   1.00 0.00 ? 85  ASN B HB2  2  
ATOM 9984   H HB3  . ASN B 2 85  ? 18.680  -9.284  4.960   1.00 0.00 ? 85  ASN B HB3  2  
ATOM 9985   H HD21 . ASN B 2 85  ? 16.160  -7.708  4.934   1.00 0.00 ? 85  ASN B HD21 2  
ATOM 9986   H HD22 . ASN B 2 85  ? 16.143  -6.907  3.401   1.00 0.00 ? 85  ASN B HD22 2  
ATOM 9987   N N    . TYR B 2 86  ? 16.446  -12.790 3.682   1.00 0.00 ? 86  TYR B N    2  
ATOM 9988   C CA   . TYR B 2 86  ? 15.250  -13.492 3.236   1.00 0.00 ? 86  TYR B CA   2  
ATOM 9989   C C    . TYR B 2 86  ? 14.052  -13.160 4.112   1.00 0.00 ? 86  TYR B C    2  
ATOM 9990   O O    . TYR B 2 86  ? 14.104  -13.316 5.331   1.00 0.00 ? 86  TYR B O    2  
ATOM 9991   C CB   . TYR B 2 86  ? 15.494  -14.997 3.175   1.00 0.00 ? 86  TYR B CB   2  
ATOM 9992   C CG   . TYR B 2 86  ? 16.459  -15.387 2.079   1.00 0.00 ? 86  TYR B CG   2  
ATOM 9993   C CD1  . TYR B 2 86  ? 17.826  -15.443 2.317   1.00 0.00 ? 86  TYR B CD1  2  
ATOM 9994   C CD2  . TYR B 2 86  ? 16.003  -15.686 0.802   1.00 0.00 ? 86  TYR B CD2  2  
ATOM 9995   C CE1  . TYR B 2 86  ? 18.712  -15.786 1.314   1.00 0.00 ? 86  TYR B CE1  2  
ATOM 9996   C CE2  . TYR B 2 86  ? 16.882  -16.032 -0.205  1.00 0.00 ? 86  TYR B CE2  2  
ATOM 9997   C CZ   . TYR B 2 86  ? 18.234  -16.080 0.057   1.00 0.00 ? 86  TYR B CZ   2  
ATOM 9998   O OH   . TYR B 2 86  ? 19.110  -16.417 -0.946  1.00 0.00 ? 86  TYR B OH   2  
ATOM 9999   H H    . TYR B 2 86  ? 17.065  -13.218 4.312   1.00 0.00 ? 86  TYR B H    2  
ATOM 10000  H HA   . TYR B 2 86  ? 15.028  -13.149 2.225   1.00 0.00 ? 86  TYR B HA   2  
ATOM 10001  H HB2  . TYR B 2 86  ? 15.896  -15.327 4.132   1.00 0.00 ? 86  TYR B HB2  2  
ATOM 10002  H HB3  . TYR B 2 86  ? 14.543  -15.501 3.002   1.00 0.00 ? 86  TYR B HB3  2  
ATOM 10003  H HD1  . TYR B 2 86  ? 18.203  -15.216 3.304   1.00 0.00 ? 86  TYR B HD1  2  
ATOM 10004  H HD2  . TYR B 2 86  ? 14.944  -15.648 0.593   1.00 0.00 ? 86  TYR B HD2  2  
ATOM 10005  H HE1  . TYR B 2 86  ? 19.773  -15.823 1.515   1.00 0.00 ? 86  TYR B HE1  2  
ATOM 10006  H HE2  . TYR B 2 86  ? 16.512  -16.264 -1.193  1.00 0.00 ? 86  TYR B HE2  2  
ATOM 10007  H HH   . TYR B 2 86  ? 19.897  -16.820 -0.566  1.00 0.00 ? 86  TYR B HH   2  
ATOM 10008  N N    . TYR B 2 87  ? 12.986  -12.690 3.484   1.00 0.00 ? 87  TYR B N    2  
ATOM 10009  C CA   . TYR B 2 87  ? 11.765  -12.318 4.190   1.00 0.00 ? 87  TYR B CA   2  
ATOM 10010  C C    . TYR B 2 87  ? 10.559  -12.946 3.509   1.00 0.00 ? 87  TYR B C    2  
ATOM 10011  O O    . TYR B 2 87  ? 10.370  -12.762 2.304   1.00 0.00 ? 87  TYR B O    2  
ATOM 10012  C CB   . TYR B 2 87  ? 11.580  -10.796 4.131   1.00 0.00 ? 87  TYR B CB   2  
ATOM 10013  C CG   . TYR B 2 87  ? 12.363  -9.993  5.144   1.00 0.00 ? 87  TYR B CG   2  
ATOM 10014  C CD1  . TYR B 2 87  ? 13.733  -9.813  5.014   1.00 0.00 ? 87  TYR B CD1  2  
ATOM 10015  C CD2  . TYR B 2 87  ? 11.723  -9.395  6.221   1.00 0.00 ? 87  TYR B CD2  2  
ATOM 10016  C CE1  . TYR B 2 87  ? 14.441  -9.065  5.932   1.00 0.00 ? 87  TYR B CE1  2  
ATOM 10017  C CE2  . TYR B 2 87  ? 12.423  -8.642  7.140   1.00 0.00 ? 87  TYR B CE2  2  
ATOM 10018  C CZ   . TYR B 2 87  ? 13.783  -8.482  6.991   1.00 0.00 ? 87  TYR B CZ   2  
ATOM 10019  O OH   . TYR B 2 87  ? 14.486  -7.736  7.905   1.00 0.00 ? 87  TYR B OH   2  
ATOM 10020  H H    . TYR B 2 87  ? 13.016  -12.590 2.507   1.00 0.00 ? 87  TYR B H    2  
ATOM 10021  H HA   . TYR B 2 87  ? 11.828  -12.650 5.227   1.00 0.00 ? 87  TYR B HA   2  
ATOM 10022  H HB2  . TYR B 2 87  ? 11.872  -10.459 3.137   1.00 0.00 ? 87  TYR B HB2  2  
ATOM 10023  H HB3  . TYR B 2 87  ? 10.521  -10.579 4.277   1.00 0.00 ? 87  TYR B HB3  2  
ATOM 10024  H HD1  . TYR B 2 87  ? 14.252  -10.265 4.182   1.00 0.00 ? 87  TYR B HD1  2  
ATOM 10025  H HD2  . TYR B 2 87  ? 10.657  -9.523  6.341   1.00 0.00 ? 87  TYR B HD2  2  
ATOM 10026  H HE1  . TYR B 2 87  ? 15.508  -8.937  5.820   1.00 0.00 ? 87  TYR B HE1  2  
ATOM 10027  H HE2  . TYR B 2 87  ? 11.909  -8.181  7.970   1.00 0.00 ? 87  TYR B HE2  2  
ATOM 10028  H HH   . TYR B 2 87  ? 14.404  -8.141  8.777   1.00 0.00 ? 87  TYR B HH   2  
ATOM 10029  N N    . CYS B 2 88  ? 9.765   -13.716 4.244   1.00 0.00 ? 88  CYS B N    2  
ATOM 10030  C CA   . CYS B 2 88  ? 8.563   -14.308 3.674   1.00 0.00 ? 88  CYS B CA   2  
ATOM 10031  C C    . CYS B 2 88  ? 7.462   -13.255 3.553   1.00 0.00 ? 88  CYS B C    2  
ATOM 10032  O O    . CYS B 2 88  ? 7.675   -12.086 3.868   1.00 0.00 ? 88  CYS B O    2  
ATOM 10033  C CB   . CYS B 2 88  ? 8.063   -15.454 4.560   1.00 0.00 ? 88  CYS B CB   2  
ATOM 10034  S SG   . CYS B 2 88  ? 9.331   -16.248 5.599   1.00 0.00 ? 88  CYS B SG   2  
ATOM 10035  H H    . CYS B 2 88  ? 10.003  -13.971 5.160   1.00 0.00 ? 88  CYS B H    2  
ATOM 10036  H HA   . CYS B 2 88  ? 8.800   -14.696 2.683   1.00 0.00 ? 88  CYS B HA   2  
ATOM 10037  H HB2  . CYS B 2 88  ? 7.289   -15.053 5.214   1.00 0.00 ? 88  CYS B HB2  2  
ATOM 10038  H HB3  . CYS B 2 88  ? 7.633   -16.213 3.907   1.00 0.00 ? 88  CYS B HB3  2  
ATOM 10039  H HG   . CYS B 2 88  ? 8.537   -17.148 6.187   1.00 0.00 ? 88  CYS B HG   2  
ATOM 10040  N N    . GLN B 2 89  ? 6.275   -13.694 3.155   1.00 0.00 ? 89  GLN B N    2  
ATOM 10041  C CA   . GLN B 2 89  ? 5.135   -12.801 2.981   1.00 0.00 ? 89  GLN B CA   2  
ATOM 10042  C C    . GLN B 2 89  ? 3.877   -13.604 2.699   1.00 0.00 ? 89  GLN B C    2  
ATOM 10043  O O    . GLN B 2 89  ? 3.947   -14.698 2.148   1.00 0.00 ? 89  GLN B O    2  
ATOM 10044  C CB   . GLN B 2 89  ? 5.383   -11.813 1.836   1.00 0.00 ? 89  GLN B CB   2  
ATOM 10045  C CG   . GLN B 2 89  ? 4.348   -10.703 1.744   1.00 0.00 ? 89  GLN B CG   2  
ATOM 10046  C CD   . GLN B 2 89  ? 4.148   -10.201 0.327   1.00 0.00 ? 89  GLN B CD   2  
ATOM 10047  O OE1  . GLN B 2 89  ? 4.304   -10.946 -0.640  1.00 0.00 ? 89  GLN B OE1  2  
ATOM 10048  N NE2  . GLN B 2 89  ? 3.798   -8.931  0.194   1.00 0.00 ? 89  GLN B NE2  2  
ATOM 10049  H H    . GLN B 2 89  ? 6.154   -14.659 3.027   1.00 0.00 ? 89  GLN B H    2  
ATOM 10050  H HA   . GLN B 2 89  ? 4.996   -12.238 3.904   1.00 0.00 ? 89  GLN B HA   2  
ATOM 10051  H HB2  . GLN B 2 89  ? 6.362   -11.357 1.981   1.00 0.00 ? 89  GLN B HB2  2  
ATOM 10052  H HB3  . GLN B 2 89  ? 5.376   -12.368 0.898   1.00 0.00 ? 89  GLN B HB3  2  
ATOM 10053  H HG2  . GLN B 2 89  ? 3.396   -11.080 2.118   1.00 0.00 ? 89  GLN B HG2  2  
ATOM 10054  H HG3  . GLN B 2 89  ? 4.673   -9.870  2.367   1.00 0.00 ? 89  GLN B HG3  2  
ATOM 10055  H HE21 . GLN B 2 89  ? 3.688   -8.393  1.005   1.00 0.00 ? 89  GLN B HE21 2  
ATOM 10056  H HE22 . GLN B 2 89  ? 3.660   -8.582  -0.711  1.00 0.00 ? 89  GLN B HE22 2  
ATOM 10057  N N    . HIS B 2 90  ? 2.740   -13.066 3.101   1.00 0.00 ? 90  HIS B N    2  
ATOM 10058  C CA   . HIS B 2 90  ? 1.459   -13.719 2.867   1.00 0.00 ? 90  HIS B CA   2  
ATOM 10059  C C    . HIS B 2 90  ? 0.556   -12.818 2.036   1.00 0.00 ? 90  HIS B C    2  
ATOM 10060  O O    . HIS B 2 90  ? 0.491   -11.608 2.269   1.00 0.00 ? 90  HIS B O    2  
ATOM 10061  C CB   . HIS B 2 90  ? 0.772   -14.137 4.174   1.00 0.00 ? 90  HIS B CB   2  
ATOM 10062  C CG   . HIS B 2 90  ? 0.857   -13.141 5.294   1.00 0.00 ? 90  HIS B CG   2  
ATOM 10063  N ND1  . HIS B 2 90  ? 0.725   -11.780 5.116   1.00 0.00 ? 90  HIS B ND1  2  
ATOM 10064  C CD2  . HIS B 2 90  ? 1.066   -13.325 6.619   1.00 0.00 ? 90  HIS B CD2  2  
ATOM 10065  C CE1  . HIS B 2 90  ? 0.853   -11.172 6.285   1.00 0.00 ? 90  HIS B CE1  2  
ATOM 10066  N NE2  . HIS B 2 90  ? 1.059   -12.085 7.211   1.00 0.00 ? 90  HIS B NE2  2  
ATOM 10067  H H    . HIS B 2 90  ? 2.760   -12.202 3.562   1.00 0.00 ? 90  HIS B H    2  
ATOM 10068  H HA   . HIS B 2 90  ? 1.654   -14.625 2.293   1.00 0.00 ? 90  HIS B HA   2  
ATOM 10069  H HB2  . HIS B 2 90  ? -0.281  -14.318 3.960   1.00 0.00 ? 90  HIS B HB2  2  
ATOM 10070  H HB3  . HIS B 2 90  ? 1.228   -15.067 4.514   1.00 0.00 ? 90  HIS B HB3  2  
ATOM 10071  H HD1  . HIS B 2 90  ? 0.565   -11.324 4.256   1.00 0.00 ? 90  HIS B HD1  2  
ATOM 10072  H HD2  . HIS B 2 90  ? 1.211   -14.271 7.117   1.00 0.00 ? 90  HIS B HD2  2  
ATOM 10073  H HE1  . HIS B 2 90  ? 0.799   -10.106 6.452   1.00 0.00 ? 90  HIS B HE1  2  
ATOM 10074  H HE2  . HIS B 2 90  ? 1.033   -11.921 8.186   1.00 0.00 ? 90  HIS B HE2  2  
ATOM 10075  N N    . PHE B 2 91  ? -0.167  -13.420 1.105   1.00 0.00 ? 91  PHE B N    2  
ATOM 10076  C CA   . PHE B 2 91  ? -1.049  -12.668 0.218   1.00 0.00 ? 91  PHE B CA   2  
ATOM 10077  C C    . PHE B 2 91  ? -2.501  -13.120 0.322   1.00 0.00 ? 91  PHE B C    2  
ATOM 10078  O O    . PHE B 2 91  ? -3.114  -13.532 -0.659  1.00 0.00 ? 91  PHE B O    2  
ATOM 10079  C CB   . PHE B 2 91  ? -0.547  -12.635 -1.235  1.00 0.00 ? 91  PHE B CB   2  
ATOM 10080  C CG   . PHE B 2 91  ? 0.003   -13.929 -1.771  1.00 0.00 ? 91  PHE B CG   2  
ATOM 10081  C CD1  . PHE B 2 91  ? 1.317   -14.292 -1.530  1.00 0.00 ? 91  PHE B CD1  2  
ATOM 10082  C CD2  . PHE B 2 91  ? -0.790  -14.774 -2.532  1.00 0.00 ? 91  PHE B CD2  2  
ATOM 10083  C CE1  . PHE B 2 91  ? 1.828   -15.472 -2.032  1.00 0.00 ? 91  PHE B CE1  2  
ATOM 10084  C CE2  . PHE B 2 91  ? -0.283  -15.954 -3.039  1.00 0.00 ? 91  PHE B CE2  2  
ATOM 10085  C CZ   . PHE B 2 91  ? 1.027   -16.305 -2.787  1.00 0.00 ? 91  PHE B CZ   2  
ATOM 10086  H H    . PHE B 2 91  ? -0.142  -14.401 1.066   1.00 0.00 ? 91  PHE B H    2  
ATOM 10087  H HA   . PHE B 2 91  ? -1.022  -11.638 0.574   1.00 0.00 ? 91  PHE B HA   2  
ATOM 10088  H HB2  . PHE B 2 91  ? -1.378  -12.333 -1.872  1.00 0.00 ? 91  PHE B HB2  2  
ATOM 10089  H HB3  . PHE B 2 91  ? 0.238   -11.881 -1.304  1.00 0.00 ? 91  PHE B HB3  2  
ATOM 10090  H HD1  . PHE B 2 91  ? 1.949   -13.644 -0.942  1.00 0.00 ? 91  PHE B HD1  2  
ATOM 10091  H HD2  . PHE B 2 91  ? -1.817  -14.506 -2.730  1.00 0.00 ? 91  PHE B HD2  2  
ATOM 10092  H HE1  . PHE B 2 91  ? 2.854   -15.743 -1.834  1.00 0.00 ? 91  PHE B HE1  2  
ATOM 10093  H HE2  . PHE B 2 91  ? -0.911  -16.602 -3.631  1.00 0.00 ? 91  PHE B HE2  2  
ATOM 10094  H HZ   . PHE B 2 91  ? 1.425   -17.229 -3.180  1.00 0.00 ? 91  PHE B HZ   2  
ATOM 10095  N N    . TRP B 2 92  ? -3.034  -13.050 1.535   1.00 0.00 ? 92  TRP B N    2  
ATOM 10096  C CA   . TRP B 2 92  ? -4.416  -13.436 1.784   1.00 0.00 ? 92  TRP B CA   2  
ATOM 10097  C C    . TRP B 2 92  ? -5.267  -12.249 2.241   1.00 0.00 ? 92  TRP B C    2  
ATOM 10098  O O    . TRP B 2 92  ? -6.377  -12.047 1.748   1.00 0.00 ? 92  TRP B O    2  
ATOM 10099  C CB   . TRP B 2 92  ? -4.496  -14.580 2.803   1.00 0.00 ? 92  TRP B CB   2  
ATOM 10100  C CG   . TRP B 2 92  ? -5.871  -14.777 3.374   1.00 0.00 ? 92  TRP B CG   2  
ATOM 10101  C CD1  . TRP B 2 92  ? -7.008  -15.103 2.691   1.00 0.00 ? 92  TRP B CD1  2  
ATOM 10102  C CD2  . TRP B 2 92  ? -6.256  -14.643 4.748   1.00 0.00 ? 92  TRP B CD2  2  
ATOM 10103  N NE1  . TRP B 2 92  ? -8.072  -15.178 3.551   1.00 0.00 ? 92  TRP B NE1  2  
ATOM 10104  C CE2  . TRP B 2 92  ? -7.639  -14.902 4.821   1.00 0.00 ? 92  TRP B CE2  2  
ATOM 10105  C CE3  . TRP B 2 92  ? -5.566  -14.335 5.922   1.00 0.00 ? 92  TRP B CE3  2  
ATOM 10106  C CZ2  . TRP B 2 92  ? -8.343  -14.854 6.021   1.00 0.00 ? 92  TRP B CZ2  2  
ATOM 10107  C CZ3  . TRP B 2 92  ? -6.268  -14.290 7.111   1.00 0.00 ? 92  TRP B CZ3  2  
ATOM 10108  C CH2  . TRP B 2 92  ? -7.643  -14.550 7.152   1.00 0.00 ? 92  TRP B CH2  2  
ATOM 10109  H H    . TRP B 2 92  ? -2.475  -12.745 2.274   1.00 0.00 ? 92  TRP B H    2  
ATOM 10110  H HA   . TRP B 2 92  ? -4.827  -13.797 0.842   1.00 0.00 ? 92  TRP B HA   2  
ATOM 10111  H HB2  . TRP B 2 92  ? -4.185  -15.504 2.315   1.00 0.00 ? 92  TRP B HB2  2  
ATOM 10112  H HB3  . TRP B 2 92  ? -3.804  -14.371 3.619   1.00 0.00 ? 92  TRP B HB3  2  
ATOM 10113  H HD1  . TRP B 2 92  ? -7.060  -15.276 1.626   1.00 0.00 ? 92  TRP B HD1  2  
ATOM 10114  H HE1  . TRP B 2 92  ? -8.995  -15.391 3.296   1.00 0.00 ? 92  TRP B HE1  2  
ATOM 10115  H HE3  . TRP B 2 92  ? -4.505  -14.136 5.901   1.00 0.00 ? 92  TRP B HE3  2  
ATOM 10116  H HZ2  . TRP B 2 92  ? -9.405  -15.050 6.055   1.00 0.00 ? 92  TRP B HZ2  2  
ATOM 10117  H HZ3  . TRP B 2 92  ? -5.746  -14.050 8.026   1.00 0.00 ? 92  TRP B HZ3  2  
ATOM 10118  H HH2  . TRP B 2 92  ? -8.160  -14.510 8.099   1.00 0.00 ? 92  TRP B HH2  2  
ATOM 10119  N N    . SER B 2 93  ? -4.738  -11.455 3.163   1.00 0.00 ? 93  SER B N    2  
ATOM 10120  C CA   . SER B 2 93  ? -5.460  -10.311 3.701   1.00 0.00 ? 93  SER B CA   2  
ATOM 10121  C C    . SER B 2 93  ? -4.483  -9.370  4.398   1.00 0.00 ? 93  SER B C    2  
ATOM 10122  O O    . SER B 2 93  ? -3.265  -9.575  4.332   1.00 0.00 ? 93  SER B O    2  
ATOM 10123  C CB   . SER B 2 93  ? -6.535  -10.769 4.695   1.00 0.00 ? 93  SER B CB   2  
ATOM 10124  O OG   . SER B 2 93  ? -7.645  -11.348 4.032   1.00 0.00 ? 93  SER B OG   2  
ATOM 10125  H H    . SER B 2 93  ? -3.819  -11.595 3.460   1.00 0.00 ? 93  SER B H    2  
ATOM 10126  H HA   . SER B 2 93  ? -5.941  -9.782  2.878   1.00 0.00 ? 93  SER B HA   2  
ATOM 10127  H HB2  . SER B 2 93  ? -6.102  -11.507 5.370   1.00 0.00 ? 93  SER B HB2  2  
ATOM 10128  H HB3  . SER B 2 93  ? -6.876  -9.908  5.269   1.00 0.00 ? 93  SER B HB3  2  
ATOM 10129  H HG   . SER B 2 93  ? -7.393  -11.592 3.131   1.00 0.00 ? 93  SER B HG   2  
ATOM 10130  N N    . LEU B 2 94  ? -5.018  -8.351  5.062   1.00 0.00 ? 94  LEU B N    2  
ATOM 10131  C CA   . LEU B 2 94  ? -4.203  -7.375  5.775   1.00 0.00 ? 94  LEU B CA   2  
ATOM 10132  C C    . LEU B 2 94  ? -3.374  -8.053  6.873   1.00 0.00 ? 94  LEU B C    2  
ATOM 10133  O O    . LEU B 2 94  ? -3.724  -9.134  7.351   1.00 0.00 ? 94  LEU B O    2  
ATOM 10134  C CB   . LEU B 2 94  ? -5.107  -6.290  6.381   1.00 0.00 ? 94  LEU B CB   2  
ATOM 10135  C CG   . LEU B 2 94  ? -4.629  -4.842  6.229   1.00 0.00 ? 94  LEU B CG   2  
ATOM 10136  C CD1  . LEU B 2 94  ? -4.667  -4.408  4.771   1.00 0.00 ? 94  LEU B CD1  2  
ATOM 10137  C CD2  . LEU B 2 94  ? -5.455  -3.907  7.095   1.00 0.00 ? 94  LEU B CD2  2  
ATOM 10138  H H    . LEU B 2 94  ? -5.994  -8.256  5.077   1.00 0.00 ? 94  LEU B H    2  
ATOM 10139  H HA   . LEU B 2 94  ? -3.523  -6.907  5.064   1.00 0.00 ? 94  LEU B HA   2  
ATOM 10140  H HB2  . LEU B 2 94  ? -6.085  -6.369  5.905   1.00 0.00 ? 94  LEU B HB2  2  
ATOM 10141  H HB3  . LEU B 2 94  ? -5.205  -6.498  7.447   1.00 0.00 ? 94  LEU B HB3  2  
ATOM 10142  H HG   . LEU B 2 94  ? -3.595  -4.791  6.570   1.00 0.00 ? 94  LEU B HG   2  
ATOM 10143  H HD11 . LEU B 2 94  ? -4.299  -3.386  4.678   1.00 0.00 ? 94  LEU B HD11 2  
ATOM 10144  H HD12 . LEU B 2 94  ? -4.038  -5.072  4.178   1.00 0.00 ? 94  LEU B HD12 2  
ATOM 10145  H HD13 . LEU B 2 94  ? -5.693  -4.456  4.405   1.00 0.00 ? 94  LEU B HD13 2  
ATOM 10146  H HD21 . LEU B 2 94  ? -5.382  -4.219  8.137   1.00 0.00 ? 94  LEU B HD21 2  
ATOM 10147  H HD22 . LEU B 2 94  ? -5.085  -2.886  6.998   1.00 0.00 ? 94  LEU B HD22 2  
ATOM 10148  H HD23 . LEU B 2 94  ? -6.497  -3.944  6.777   1.00 0.00 ? 94  LEU B HD23 2  
ATOM 10149  N N    . PRO B 2 95  ? -2.257  -7.434  7.285   1.00 0.00 ? 95  PRO B N    2  
ATOM 10150  C CA   . PRO B 2 95  ? -1.793  -6.161  6.745   1.00 0.00 ? 95  PRO B CA   2  
ATOM 10151  C C    . PRO B 2 95  ? -0.781  -6.326  5.615   1.00 0.00 ? 95  PRO B C    2  
ATOM 10152  O O    . PRO B 2 95  ? -0.199  -5.344  5.159   1.00 0.00 ? 95  PRO B O    2  
ATOM 10153  C CB   . PRO B 2 95  ? -1.124  -5.527  7.962   1.00 0.00 ? 95  PRO B CB   2  
ATOM 10154  C CG   . PRO B 2 95  ? -0.588  -6.681  8.751   1.00 0.00 ? 95  PRO B CG   2  
ATOM 10155  C CD   . PRO B 2 95  ? -1.375  -7.910  8.359   1.00 0.00 ? 95  PRO B CD   2  
ATOM 10156  H HA   . PRO B 2 95  ? -2.631  -5.557  6.396   1.00 0.00 ? 95  PRO B HA   2  
ATOM 10157  H HB2  . PRO B 2 95  ? -0.336  -4.832  7.673   1.00 0.00 ? 95  PRO B HB2  2  
ATOM 10158  H HB3  . PRO B 2 95  ? -1.885  -5.022  8.557   1.00 0.00 ? 95  PRO B HB3  2  
ATOM 10159  H HG2  . PRO B 2 95  ? 0.450   -6.836  8.458   1.00 0.00 ? 95  PRO B HG2  2  
ATOM 10160  H HG3  . PRO B 2 95  ? -0.664  -6.493  9.822   1.00 0.00 ? 95  PRO B HG3  2  
ATOM 10161  H HD2  . PRO B 2 95  ? -0.716  -8.708  8.019   1.00 0.00 ? 95  PRO B HD2  2  
ATOM 10162  H HD3  . PRO B 2 95  ? -1.981  -8.251  9.199   1.00 0.00 ? 95  PRO B HD3  2  
ATOM 10163  N N    . PHE B 2 96  ? -0.564  -7.573  5.184   1.00 0.00 ? 96  PHE B N    2  
ATOM 10164  C CA   . PHE B 2 96  ? 0.380   -7.874  4.103   1.00 0.00 ? 96  PHE B CA   2  
ATOM 10165  C C    . PHE B 2 96  ? 1.802   -7.531  4.534   1.00 0.00 ? 96  PHE B C    2  
ATOM 10166  O O    . PHE B 2 96  ? 2.521   -6.814  3.840   1.00 0.00 ? 96  PHE B O    2  
ATOM 10167  C CB   . PHE B 2 96  ? 0.022   -7.131  2.804   1.00 0.00 ? 96  PHE B CB   2  
ATOM 10168  C CG   . PHE B 2 96  ? -1.311  -7.497  2.212   1.00 0.00 ? 96  PHE B CG   2  
ATOM 10169  C CD1  . PHE B 2 96  ? -1.493  -8.714  1.578   1.00 0.00 ? 96  PHE B CD1  2  
ATOM 10170  C CD2  . PHE B 2 96  ? -2.380  -6.617  2.283   1.00 0.00 ? 96  PHE B CD2  2  
ATOM 10171  C CE1  . PHE B 2 96  ? -2.717  -9.047  1.025   1.00 0.00 ? 96  PHE B CE1  2  
ATOM 10172  C CE2  . PHE B 2 96  ? -3.606  -6.944  1.735   1.00 0.00 ? 96  PHE B CE2  2  
ATOM 10173  C CZ   . PHE B 2 96  ? -3.775  -8.161  1.104   1.00 0.00 ? 96  PHE B CZ   2  
ATOM 10174  H H    . PHE B 2 96  ? -1.009  -8.315  5.639   1.00 0.00 ? 96  PHE B H    2  
ATOM 10175  H HA   . PHE B 2 96  ? 0.329   -8.945  3.905   1.00 0.00 ? 96  PHE B HA   2  
ATOM 10176  H HB2  . PHE B 2 96  ? 0.022   -6.061  3.012   1.00 0.00 ? 96  PHE B HB2  2  
ATOM 10177  H HB3  . PHE B 2 96  ? 0.795   -7.343  2.065   1.00 0.00 ? 96  PHE B HB3  2  
ATOM 10178  H HD1  . PHE B 2 96  ? -0.671  -9.411  1.514   1.00 0.00 ? 96  PHE B HD1  2  
ATOM 10179  H HD2  . PHE B 2 96  ? -2.254  -5.663  2.774   1.00 0.00 ? 96  PHE B HD2  2  
ATOM 10180  H HE1  . PHE B 2 96  ? -2.846  -9.999  0.531   1.00 0.00 ? 96  PHE B HE1  2  
ATOM 10181  H HE2  . PHE B 2 96  ? -4.431  -6.249  1.799   1.00 0.00 ? 96  PHE B HE2  2  
ATOM 10182  H HZ   . PHE B 2 96  ? -4.731  -8.420  0.674   1.00 0.00 ? 96  PHE B HZ   2  
ATOM 10183  N N    . THR B 2 97  ? 2.215   -8.069  5.671   1.00 0.00 ? 97  THR B N    2  
ATOM 10184  C CA   . THR B 2 97  ? 3.536   -7.800  6.209   1.00 0.00 ? 97  THR B CA   2  
ATOM 10185  C C    . THR B 2 97  ? 4.495   -8.959  5.948   1.00 0.00 ? 97  THR B C    2  
ATOM 10186  O O    . THR B 2 97  ? 4.074   -10.067 5.596   1.00 0.00 ? 97  THR B O    2  
ATOM 10187  C CB   . THR B 2 97  ? 3.443   -7.560  7.724   1.00 0.00 ? 97  THR B CB   2  
ATOM 10188  O OG1  . THR B 2 97  ? 2.222   -8.136  8.215   1.00 0.00 ? 97  THR B OG1  2  
ATOM 10189  C CG2  . THR B 2 97  ? 3.454   -6.070  8.028   1.00 0.00 ? 97  THR B CG2  2  
ATOM 10190  H H    . THR B 2 97  ? 1.638   -8.686  6.161   1.00 0.00 ? 97  THR B H    2  
ATOM 10191  H HA   . THR B 2 97  ? 3.927   -6.903  5.729   1.00 0.00 ? 97  THR B HA   2  
ATOM 10192  H HB   . THR B 2 97  ? 4.293   -8.034  8.215   1.00 0.00 ? 97  THR B HB   2  
ATOM 10193  H HG1  . THR B 2 97  ? 1.957   -7.674  9.015   1.00 0.00 ? 97  THR B HG1  2  
ATOM 10194  H HG21 . THR B 2 97  ? 2.604   -5.594  7.539   1.00 0.00 ? 97  THR B HG21 2  
ATOM 10195  H HG22 . THR B 2 97  ? 3.386   -5.914  9.104   1.00 0.00 ? 97  THR B HG22 2  
ATOM 10196  H HG23 . THR B 2 97  ? 4.379   -5.631  7.656   1.00 0.00 ? 97  THR B HG23 2  
ATOM 10197  N N    . PHE B 2 98  ? 5.780   -8.684  6.123   1.00 0.00 ? 98  PHE B N    2  
ATOM 10198  C CA   . PHE B 2 98  ? 6.823   -9.681  5.922   1.00 0.00 ? 98  PHE B CA   2  
ATOM 10199  C C    . PHE B 2 98  ? 7.271   -10.252 7.264   1.00 0.00 ? 98  PHE B C    2  
ATOM 10200  O O    . PHE B 2 98  ? 6.761   -9.854  8.313   1.00 0.00 ? 98  PHE B O    2  
ATOM 10201  C CB   . PHE B 2 98  ? 8.016   -9.050  5.196   1.00 0.00 ? 98  PHE B CB   2  
ATOM 10202  C CG   . PHE B 2 98  ? 7.779   -8.767  3.736   1.00 0.00 ? 98  PHE B CG   2  
ATOM 10203  C CD1  . PHE B 2 98  ? 6.783   -7.892  3.331   1.00 0.00 ? 98  PHE B CD1  2  
ATOM 10204  C CD2  . PHE B 2 98  ? 8.558   -9.377  2.768   1.00 0.00 ? 98  PHE B CD2  2  
ATOM 10205  C CE1  . PHE B 2 98  ? 6.567   -7.632  1.993   1.00 0.00 ? 98  PHE B CE1  2  
ATOM 10206  C CE2  . PHE B 2 98  ? 8.348   -9.123  1.428   1.00 0.00 ? 98  PHE B CE2  2  
ATOM 10207  C CZ   . PHE B 2 98  ? 7.351   -8.248  1.040   1.00 0.00 ? 98  PHE B CZ   2  
ATOM 10208  H H    . PHE B 2 98  ? 6.036   -7.779  6.390   1.00 0.00 ? 98  PHE B H    2  
ATOM 10209  H HA   . PHE B 2 98  ? 6.423   -10.488 5.309   1.00 0.00 ? 98  PHE B HA   2  
ATOM 10210  H HB2  . PHE B 2 98  ? 8.262   -8.111  5.692   1.00 0.00 ? 98  PHE B HB2  2  
ATOM 10211  H HB3  . PHE B 2 98  ? 8.867   -9.725  5.282   1.00 0.00 ? 98  PHE B HB3  2  
ATOM 10212  H HD1  . PHE B 2 98  ? 6.167   -7.407  4.074   1.00 0.00 ? 98  PHE B HD1  2  
ATOM 10213  H HD2  . PHE B 2 98  ? 9.339   -10.061 3.065   1.00 0.00 ? 98  PHE B HD2  2  
ATOM 10214  H HE1  . PHE B 2 98  ? 5.787   -6.949  1.693   1.00 0.00 ? 98  PHE B HE1  2  
ATOM 10215  H HE2  . PHE B 2 98  ? 8.962   -9.607  0.683   1.00 0.00 ? 98  PHE B HE2  2  
ATOM 10216  H HZ   . PHE B 2 98  ? 7.186   -8.048  -0.009  1.00 0.00 ? 98  PHE B HZ   2  
ATOM 10217  N N    . GLY B 2 99  ? 8.211   -11.187 7.227   1.00 0.00 ? 99  GLY B N    2  
ATOM 10218  C CA   . GLY B 2 99  ? 8.710   -11.793 8.449   1.00 0.00 ? 99  GLY B CA   2  
ATOM 10219  C C    . GLY B 2 99  ? 9.775   -10.957 9.136   1.00 0.00 ? 99  GLY B C    2  
ATOM 10220  O O    . GLY B 2 99  ? 9.855   -9.742  8.933   1.00 0.00 ? 99  GLY B O    2  
ATOM 10221  H H    . GLY B 2 99  ? 8.557   -11.484 6.360   1.00 0.00 ? 99  GLY B H    2  
ATOM 10222  H HA2  . GLY B 2 99  ? 7.875   -11.928 9.136   1.00 0.00 ? 99  GLY B HA2  2  
ATOM 10223  H HA3  . GLY B 2 99  ? 9.136   -12.766 8.204   1.00 0.00 ? 99  GLY B HA3  2  
ATOM 10224  N N    . GLN B 2 100 ? 10.590  -11.606 9.957   1.00 0.00 ? 100 GLN B N    2  
ATOM 10225  C CA   . GLN B 2 100 ? 11.656  -10.924 10.683  1.00 0.00 ? 100 GLN B CA   2  
ATOM 10226  C C    . GLN B 2 100 ? 12.914  -10.827 9.832   1.00 0.00 ? 100 GLN B C    2  
ATOM 10227  O O    . GLN B 2 100 ? 13.717  -9.903  9.994   1.00 0.00 ? 100 GLN B O    2  
ATOM 10228  C CB   . GLN B 2 100 ? 11.980  -11.649 11.995  1.00 0.00 ? 100 GLN B CB   2  
ATOM 10229  C CG   . GLN B 2 100 ? 10.903  -11.548 13.065  1.00 0.00 ? 100 GLN B CG   2  
ATOM 10230  C CD   . GLN B 2 100 ? 9.705   -12.430 12.776  1.00 0.00 ? 100 GLN B CD   2  
ATOM 10231  O OE1  . GLN B 2 100 ? 9.827   -13.481 12.143  1.00 0.00 ? 100 GLN B OE1  2  
ATOM 10232  N NE2  . GLN B 2 100 ? 8.538   -12.011 13.237  1.00 0.00 ? 100 GLN B NE2  2  
ATOM 10233  H H    . GLN B 2 100 ? 10.473  -12.570 10.083  1.00 0.00 ? 100 GLN B H    2  
ATOM 10234  H HA   . GLN B 2 100 ? 11.314  -9.916  10.918  1.00 0.00 ? 100 GLN B HA   2  
ATOM 10235  H HB2  . GLN B 2 100 ? 12.135  -12.704 11.770  1.00 0.00 ? 100 GLN B HB2  2  
ATOM 10236  H HB3  . GLN B 2 100 ? 12.899  -11.224 12.399  1.00 0.00 ? 100 GLN B HB3  2  
ATOM 10237  H HG2  . GLN B 2 100 ? 11.332  -11.843 14.022  1.00 0.00 ? 100 GLN B HG2  2  
ATOM 10238  H HG3  . GLN B 2 100 ? 10.568  -10.512 13.126  1.00 0.00 ? 100 GLN B HG3  2  
ATOM 10239  H HE21 . GLN B 2 100 ? 8.511   -11.165 13.738  1.00 0.00 ? 100 GLN B HE21 2  
ATOM 10240  H HE22 . GLN B 2 100 ? 7.744   -12.566 13.062  1.00 0.00 ? 100 GLN B HE22 2  
ATOM 10241  N N    . GLY B 2 101 ? 13.063  -11.762 8.904   1.00 0.00 ? 101 GLY B N    2  
ATOM 10242  C CA   . GLY B 2 101 ? 14.229  -11.776 8.048   1.00 0.00 ? 101 GLY B CA   2  
ATOM 10243  C C    . GLY B 2 101 ? 15.284  -12.762 8.501   1.00 0.00 ? 101 GLY B C    2  
ATOM 10244  O O    . GLY B 2 101 ? 15.608  -12.841 9.684   1.00 0.00 ? 101 GLY B O    2  
ATOM 10245  H H    . GLY B 2 101 ? 12.356  -12.427 8.774   1.00 0.00 ? 101 GLY B H    2  
ATOM 10246  H HA2  . GLY B 2 101 ? 13.915  -12.041 7.038   1.00 0.00 ? 101 GLY B HA2  2  
ATOM 10247  H HA3  . GLY B 2 101 ? 14.666  -10.778 8.040   1.00 0.00 ? 101 GLY B HA3  2  
ATOM 10248  N N    . THR B 2 102 ? 15.804  -13.528 7.555   1.00 0.00 ? 102 THR B N    2  
ATOM 10249  C CA   . THR B 2 102 ? 16.837  -14.507 7.842   1.00 0.00 ? 102 THR B CA   2  
ATOM 10250  C C    . THR B 2 102 ? 18.133  -14.124 7.132   1.00 0.00 ? 102 THR B C    2  
ATOM 10251  O O    . THR B 2 102 ? 18.164  -13.995 5.905   1.00 0.00 ? 102 THR B O    2  
ATOM 10252  C CB   . THR B 2 102 ? 16.403  -15.920 7.396   1.00 0.00 ? 102 THR B CB   2  
ATOM 10253  O OG1  . THR B 2 102 ? 15.202  -16.293 8.088   1.00 0.00 ? 102 THR B OG1  2  
ATOM 10254  C CG2  . THR B 2 102 ? 17.491  -16.942 7.687   1.00 0.00 ? 102 THR B CG2  2  
ATOM 10255  H H    . THR B 2 102 ? 15.479  -13.435 6.635   1.00 0.00 ? 102 THR B H    2  
ATOM 10256  H HA   . THR B 2 102 ? 17.012  -14.519 8.918   1.00 0.00 ? 102 THR B HA   2  
ATOM 10257  H HB   . THR B 2 102 ? 16.209  -15.907 6.323   1.00 0.00 ? 102 THR B HB   2  
ATOM 10258  H HG1  . THR B 2 102 ? 15.409  -16.448 9.019   1.00 0.00 ? 102 THR B HG1  2  
ATOM 10259  H HG21 . THR B 2 102 ? 17.691  -16.963 8.759   1.00 0.00 ? 102 THR B HG21 2  
ATOM 10260  H HG22 . THR B 2 102 ? 17.168  -17.930 7.361   1.00 0.00 ? 102 THR B HG22 2  
ATOM 10261  H HG23 . THR B 2 102 ? 18.400  -16.665 7.154   1.00 0.00 ? 102 THR B HG23 2  
ATOM 10262  N N    . LYS B 2 103 ? 19.185  -13.911 7.911   1.00 0.00 ? 103 LYS B N    2  
ATOM 10263  C CA   . LYS B 2 103 ? 20.482  -13.545 7.365   1.00 0.00 ? 103 LYS B CA   2  
ATOM 10264  C C    . LYS B 2 103 ? 21.379  -14.767 7.230   1.00 0.00 ? 103 LYS B C    2  
ATOM 10265  O O    . LYS B 2 103 ? 21.667  -15.448 8.215   1.00 0.00 ? 103 LYS B O    2  
ATOM 10266  C CB   . LYS B 2 103 ? 21.161  -12.495 8.246   1.00 0.00 ? 103 LYS B CB   2  
ATOM 10267  C CG   . LYS B 2 103 ? 20.562  -11.102 8.139   1.00 0.00 ? 103 LYS B CG   2  
ATOM 10268  C CD   . LYS B 2 103 ? 21.485  -10.061 8.753   1.00 0.00 ? 103 LYS B CD   2  
ATOM 10269  C CE   . LYS B 2 103 ? 20.993  -8.652  8.468   1.00 0.00 ? 103 LYS B CE   2  
ATOM 10270  N NZ   . LYS B 2 103 ? 21.976  -7.617  8.891   1.00 0.00 ? 103 LYS B NZ   2  
ATOM 10271  H H    . LYS B 2 103 ? 19.083  -14.000 8.886   1.00 0.00 ? 103 LYS B H    2  
ATOM 10272  H HA   . LYS B 2 103 ? 20.325  -13.118 6.374   1.00 0.00 ? 103 LYS B HA   2  
ATOM 10273  H HB2  . LYS B 2 103 ? 21.085  -12.821 9.283   1.00 0.00 ? 103 LYS B HB2  2  
ATOM 10274  H HB3  . LYS B 2 103 ? 22.211  -12.438 7.959   1.00 0.00 ? 103 LYS B HB3  2  
ATOM 10275  H HG2  . LYS B 2 103 ? 20.404  -10.862 7.087   1.00 0.00 ? 103 LYS B HG2  2  
ATOM 10276  H HG3  . LYS B 2 103 ? 19.606  -11.084 8.662   1.00 0.00 ? 103 LYS B HG3  2  
ATOM 10277  H HD2  . LYS B 2 103 ? 21.523  -10.212 9.832   1.00 0.00 ? 103 LYS B HD2  2  
ATOM 10278  H HD3  . LYS B 2 103 ? 22.484  -10.180 8.334   1.00 0.00 ? 103 LYS B HD3  2  
ATOM 10279  H HE2  . LYS B 2 103 ? 20.813  -8.552  7.398   1.00 0.00 ? 103 LYS B HE2  2  
ATOM 10280  H HE3  . LYS B 2 103 ? 20.058  -8.490  9.005   1.00 0.00 ? 103 LYS B HE3  2  
ATOM 10281  H HZ1  . LYS B 2 103 ? 22.925  -7.853  8.535   1.00 0.00 ? 103 LYS B HZ1  2  
ATOM 10282  H HZ2  . LYS B 2 103 ? 22.012  -7.558  9.928   1.00 0.00 ? 103 LYS B HZ2  2  
ATOM 10283  H HZ3  . LYS B 2 103 ? 21.701  -6.687  8.510   1.00 0.00 ? 103 LYS B HZ3  2  
ATOM 10284  N N    . VAL B 2 104 ? 21.803  -15.048 6.008   1.00 0.00 ? 104 VAL B N    2  
ATOM 10285  C CA   . VAL B 2 104 ? 22.675  -16.183 5.742   1.00 0.00 ? 104 VAL B CA   2  
ATOM 10286  C C    . VAL B 2 104 ? 24.097  -15.692 5.497   1.00 0.00 ? 104 VAL B C    2  
ATOM 10287  O O    . VAL B 2 104 ? 24.359  -14.989 4.520   1.00 0.00 ? 104 VAL B O    2  
ATOM 10288  C CB   . VAL B 2 104 ? 22.198  -17.000 4.524   1.00 0.00 ? 104 VAL B CB   2  
ATOM 10289  C CG1  . VAL B 2 104 ? 22.935  -18.329 4.453   1.00 0.00 ? 104 VAL B CG1  2  
ATOM 10290  C CG2  . VAL B 2 104 ? 20.694  -17.223 4.578   1.00 0.00 ? 104 VAL B CG2  2  
ATOM 10291  H H    . VAL B 2 104 ? 21.526  -14.477 5.263   1.00 0.00 ? 104 VAL B H    2  
ATOM 10292  H HA   . VAL B 2 104 ? 22.669  -16.830 6.619   1.00 0.00 ? 104 VAL B HA   2  
ATOM 10293  H HB   . VAL B 2 104 ? 22.427  -16.433 3.621   1.00 0.00 ? 104 VAL B HB   2  
ATOM 10294  H HG11 . VAL B 2 104 ? 22.607  -18.886 3.576   1.00 0.00 ? 104 VAL B HG11 2  
ATOM 10295  H HG12 . VAL B 2 104 ? 24.008  -18.146 4.384   1.00 0.00 ? 104 VAL B HG12 2  
ATOM 10296  H HG13 . VAL B 2 104 ? 22.723  -18.909 5.351   1.00 0.00 ? 104 VAL B HG13 2  
ATOM 10297  H HG21 . VAL B 2 104 ? 20.186  -16.258 4.598   1.00 0.00 ? 104 VAL B HG21 2  
ATOM 10298  H HG22 . VAL B 2 104 ? 20.372  -17.782 3.700   1.00 0.00 ? 104 VAL B HG22 2  
ATOM 10299  H HG23 . VAL B 2 104 ? 20.443  -17.785 5.477   1.00 0.00 ? 104 VAL B HG23 2  
ATOM 10300  N N    . GLU B 2 105 ? 25.003  -16.049 6.394   1.00 0.00 ? 105 GLU B N    2  
ATOM 10301  C CA   . GLU B 2 105 ? 26.395  -15.637 6.285   1.00 0.00 ? 105 GLU B CA   2  
ATOM 10302  C C    . GLU B 2 105 ? 27.273  -16.774 5.778   1.00 0.00 ? 105 GLU B C    2  
ATOM 10303  O O    . GLU B 2 105 ? 27.142  -17.920 6.216   1.00 0.00 ? 105 GLU B O    2  
ATOM 10304  C CB   . GLU B 2 105 ? 26.917  -15.151 7.642   1.00 0.00 ? 105 GLU B CB   2  
ATOM 10305  C CG   . GLU B 2 105 ? 28.364  -14.679 7.614   1.00 0.00 ? 105 GLU B CG   2  
ATOM 10306  C CD   . GLU B 2 105 ? 29.040  -14.761 8.968   1.00 0.00 ? 105 GLU B CD   2  
ATOM 10307  O OE1  . GLU B 2 105 ? 29.046  -15.852 9.574   1.00 0.00 ? 105 GLU B OE1  2  
ATOM 10308  O OE2  . GLU B 2 105 ? 29.592  -13.741 9.427   1.00 0.00 ? 105 GLU B OE2  2  
ATOM 10309  H H    . GLU B 2 105 ? 24.728  -16.612 7.151   1.00 0.00 ? 105 GLU B H    2  
ATOM 10310  H HA   . GLU B 2 105 ? 26.450  -14.812 5.575   1.00 0.00 ? 105 GLU B HA   2  
ATOM 10311  H HB2  . GLU B 2 105 ? 26.292  -14.322 7.973   1.00 0.00 ? 105 GLU B HB2  2  
ATOM 10312  H HB3  . GLU B 2 105 ? 26.838  -15.973 8.354   1.00 0.00 ? 105 GLU B HB3  2  
ATOM 10313  H HG2  . GLU B 2 105 ? 28.919  -15.298 6.910   1.00 0.00 ? 105 GLU B HG2  2  
ATOM 10314  H HG3  . GLU B 2 105 ? 28.386  -13.643 7.276   1.00 0.00 ? 105 GLU B HG3  2  
ATOM 10315  H HE2  . GLU B 2 105 ? 30.005  -13.868 10.285  1.00 0.00 ? 105 GLU B HE2  2  
ATOM 10316  N N    . ILE B 2 106 ? 28.161  -16.450 4.850   1.00 0.00 ? 106 ILE B N    2  
ATOM 10317  C CA   . ILE B 2 106 ? 29.084  -17.429 4.295   1.00 0.00 ? 106 ILE B CA   2  
ATOM 10318  C C    . ILE B 2 106 ? 30.361  -17.445 5.131   1.00 0.00 ? 106 ILE B C    2  
ATOM 10319  O O    . ILE B 2 106 ? 31.066  -16.438 5.228   1.00 0.00 ? 106 ILE B O    2  
ATOM 10320  C CB   . ILE B 2 106 ? 29.429  -17.123 2.818   1.00 0.00 ? 106 ILE B CB   2  
ATOM 10321  C CG1  . ILE B 2 106 ? 28.180  -17.230 1.934   1.00 0.00 ? 106 ILE B CG1  2  
ATOM 10322  C CG2  . ILE B 2 106 ? 30.519  -18.056 2.306   1.00 0.00 ? 106 ILE B CG2  2  
ATOM 10323  C CD1  . ILE B 2 106 ? 27.405  -15.938 1.792   1.00 0.00 ? 106 ILE B CD1  2  
ATOM 10324  H H    . ILE B 2 106 ? 28.198  -15.528 4.528   1.00 0.00 ? 106 ILE B H    2  
ATOM 10325  H HA   . ILE B 2 106 ? 28.614  -18.411 4.344   1.00 0.00 ? 106 ILE B HA   2  
ATOM 10326  H HB   . ILE B 2 106 ? 29.801  -16.100 2.761   1.00 0.00 ? 106 ILE B HB   2  
ATOM 10327  H HG12 . ILE B 2 106 ? 28.492  -17.553 0.940   1.00 0.00 ? 106 ILE B HG12 2  
ATOM 10328  H HG13 . ILE B 2 106 ? 27.518  -17.979 2.368   1.00 0.00 ? 106 ILE B HG13 2  
ATOM 10329  H HG21 . ILE B 2 106 ? 30.766  -17.808 1.274   1.00 0.00 ? 106 ILE B HG21 2  
ATOM 10330  H HG22 . ILE B 2 106 ? 31.409  -17.946 2.926   1.00 0.00 ? 106 ILE B HG22 2  
ATOM 10331  H HG23 . ILE B 2 106 ? 30.167  -19.086 2.356   1.00 0.00 ? 106 ILE B HG23 2  
ATOM 10332  H HD11 . ILE B 2 106 ? 28.051  -15.178 1.350   1.00 0.00 ? 106 ILE B HD11 2  
ATOM 10333  H HD12 . ILE B 2 106 ? 26.534  -16.080 1.153   1.00 0.00 ? 106 ILE B HD12 2  
ATOM 10334  H HD13 . ILE B 2 106 ? 27.075  -15.606 2.776   1.00 0.00 ? 106 ILE B HD13 2  
ATOM 10335  N N    . LYS B 2 107 ? 30.645  -18.581 5.749   1.00 0.00 ? 107 LYS B N    2  
ATOM 10336  C CA   . LYS B 2 107 ? 31.821  -18.718 6.585   1.00 0.00 ? 107 LYS B CA   2  
ATOM 10337  C C    . LYS B 2 107 ? 33.015  -19.214 5.780   1.00 0.00 ? 107 LYS B C    2  
ATOM 10338  O O    . LYS B 2 107 ? 32.908  -20.168 5.007   1.00 0.00 ? 107 LYS B O    2  
ATOM 10339  C CB   . LYS B 2 107 ? 31.539  -19.668 7.753   1.00 0.00 ? 107 LYS B CB   2  
ATOM 10340  C CG   . LYS B 2 107 ? 32.568  -19.604 8.872   1.00 0.00 ? 107 LYS B CG   2  
ATOM 10341  C CD   . LYS B 2 107 ? 32.462  -18.301 9.648   1.00 0.00 ? 107 LYS B CD   2  
ATOM 10342  C CE   . LYS B 2 107 ? 31.264  -18.311 10.587  1.00 0.00 ? 107 LYS B CE   2  
ATOM 10343  N NZ   . LYS B 2 107 ? 30.944  -16.952 11.094  1.00 0.00 ? 107 LYS B NZ   2  
ATOM 10344  H H    . LYS B 2 107 ? 30.048  -19.356 5.634   1.00 0.00 ? 107 LYS B H    2  
ATOM 10345  H HA   . LYS B 2 107 ? 32.063  -17.735 6.990   1.00 0.00 ? 107 LYS B HA   2  
ATOM 10346  H HB2  . LYS B 2 107 ? 30.564  -19.416 8.171   1.00 0.00 ? 107 LYS B HB2  2  
ATOM 10347  H HB3  . LYS B 2 107 ? 31.517  -20.687 7.367   1.00 0.00 ? 107 LYS B HB3  2  
ATOM 10348  H HG2  . LYS B 2 107 ? 32.403  -20.438 9.554   1.00 0.00 ? 107 LYS B HG2  2  
ATOM 10349  H HG3  . LYS B 2 107 ? 33.566  -19.680 8.441   1.00 0.00 ? 107 LYS B HG3  2  
ATOM 10350  H HD2  . LYS B 2 107 ? 33.370  -18.162 10.234  1.00 0.00 ? 107 LYS B HD2  2  
ATOM 10351  H HD3  . LYS B 2 107 ? 32.353  -17.477 8.943   1.00 0.00 ? 107 LYS B HD3  2  
ATOM 10352  H HE2  . LYS B 2 107 ? 30.398  -18.701 10.051  1.00 0.00 ? 107 LYS B HE2  2  
ATOM 10353  H HE3  . LYS B 2 107 ? 31.484  -18.961 11.433  1.00 0.00 ? 107 LYS B HE3  2  
ATOM 10354  H HZ1  . LYS B 2 107 ? 30.264  -16.476 10.455  1.00 0.00 ? 107 LYS B HZ1  2  
ATOM 10355  H HZ2  . LYS B 2 107 ? 31.805  -16.377 11.155  1.00 0.00 ? 107 LYS B HZ2  2  
ATOM 10356  H HZ3  . LYS B 2 107 ? 30.521  -17.017 12.039  1.00 0.00 ? 107 LYS B HZ3  2  
ATOM 10357  N N    . ARG B 2 108 ? 34.145  -18.554 5.968   1.00 0.00 ? 108 ARG B N    2  
ATOM 10358  C CA   . ARG B 2 108 ? 35.374  -18.913 5.283   1.00 0.00 ? 108 ARG B CA   2  
ATOM 10359  C C    . ARG B 2 108 ? 36.559  -18.648 6.205   1.00 0.00 ? 108 ARG B C    2  
ATOM 10360  O O    . ARG B 2 108 ? 36.624  -17.598 6.844   1.00 0.00 ? 108 ARG B O    2  
ATOM 10361  C CB   . ARG B 2 108 ? 35.509  -18.121 3.976   1.00 0.00 ? 108 ARG B CB   2  
ATOM 10362  C CG   . ARG B 2 108 ? 36.809  -18.362 3.224   1.00 0.00 ? 108 ARG B CG   2  
ATOM 10363  C CD   . ARG B 2 108 ? 36.602  -18.310 1.720   1.00 0.00 ? 108 ARG B CD   2  
ATOM 10364  N NE   . ARG B 2 108 ? 36.002  -19.542 1.206   1.00 0.00 ? 108 ARG B NE   2  
ATOM 10365  C CZ   . ARG B 2 108 ? 36.266  -20.052 0.004   1.00 0.00 ? 108 ARG B CZ   2  
ATOM 10366  N NH1  . ARG B 2 108 ? 37.137  -19.454 -0.804  1.00 0.00 ? 108 ARG B NH1  2  
ATOM 10367  N NH2  . ARG B 2 108 ? 35.664  -21.169 -0.386  1.00 0.00 ? 108 ARG B NH2  2  
ATOM 10368  H H    . ARG B 2 108 ? 34.157  -17.799 6.593   1.00 0.00 ? 108 ARG B H    2  
ATOM 10369  H HA   . ARG B 2 108 ? 35.344  -19.977 5.044   1.00 0.00 ? 108 ARG B HA   2  
ATOM 10370  H HB2  . ARG B 2 108 ? 34.681  -18.398 3.323   1.00 0.00 ? 108 ARG B HB2  2  
ATOM 10371  H HB3  . ARG B 2 108 ? 35.445  -17.059 4.213   1.00 0.00 ? 108 ARG B HB3  2  
ATOM 10372  H HG2  . ARG B 2 108 ? 37.529  -17.596 3.509   1.00 0.00 ? 108 ARG B HG2  2  
ATOM 10373  H HG3  . ARG B 2 108 ? 37.197  -19.344 3.494   1.00 0.00 ? 108 ARG B HG3  2  
ATOM 10374  H HD2  . ARG B 2 108 ? 35.946  -17.473 1.483   1.00 0.00 ? 108 ARG B HD2  2  
ATOM 10375  H HD3  . ARG B 2 108 ? 37.566  -18.158 1.236   1.00 0.00 ? 108 ARG B HD3  2  
ATOM 10376  H HE   . ARG B 2 108 ? 35.371  -20.016 1.796   1.00 0.00 ? 108 ARG B HE   2  
ATOM 10377  H HH11 . ARG B 2 108 ? 37.607  -18.615 -0.511  1.00 0.00 ? 108 ARG B HH11 2  
ATOM 10378  H HH12 . ARG B 2 108 ? 37.336  -19.840 -1.710  1.00 0.00 ? 108 ARG B HH12 2  
ATOM 10379  H HH21 . ARG B 2 108 ? 35.012  -21.632 0.221   1.00 0.00 ? 108 ARG B HH21 2  
ATOM 10380  H HH22 . ARG B 2 108 ? 35.866  -21.563 -1.289  1.00 0.00 ? 108 ARG B HH22 2  
ATOM 10381  N N    . THR B 2 109 ? 37.469  -19.612 6.296   1.00 0.00 ? 109 THR B N    2  
ATOM 10382  C CA   . THR B 2 109 ? 38.645  -19.487 7.149   1.00 0.00 ? 109 THR B CA   2  
ATOM 10383  C C    . THR B 2 109 ? 39.536  -18.335 6.694   1.00 0.00 ? 109 THR B C    2  
ATOM 10384  O O    . THR B 2 109 ? 40.167  -17.663 7.509   1.00 0.00 ? 109 THR B O    2  
ATOM 10385  C CB   . THR B 2 109 ? 39.464  -20.790 7.150   1.00 0.00 ? 109 THR B CB   2  
ATOM 10386  O OG1  . THR B 2 109 ? 38.615  -21.875 6.745   1.00 0.00 ? 109 THR B OG1  2  
ATOM 10387  C CG2  . THR B 2 109 ? 40.015  -21.073 8.538   1.00 0.00 ? 109 THR B CG2  2  
ATOM 10388  H H    . THR B 2 109 ? 37.347  -20.437 5.779   1.00 0.00 ? 109 THR B H    2  
ATOM 10389  H HA   . THR B 2 109 ? 38.306  -19.287 8.166   1.00 0.00 ? 109 THR B HA   2  
ATOM 10390  H HB   . THR B 2 109 ? 40.292  -20.695 6.448   1.00 0.00 ? 109 THR B HB   2  
ATOM 10391  H HG1  . THR B 2 109 ? 38.811  -22.655 7.279   1.00 0.00 ? 109 THR B HG1  2  
ATOM 10392  H HG21 . THR B 2 109 ? 39.190  -21.171 9.243   1.00 0.00 ? 109 THR B HG21 2  
ATOM 10393  H HG22 . THR B 2 109 ? 40.591  -21.998 8.524   1.00 0.00 ? 109 THR B HG22 2  
ATOM 10394  H HG23 . THR B 2 109 ? 40.661  -20.250 8.846   1.00 0.00 ? 109 THR B HG23 2  
ATOM 10395  N N    . GLY B 2 110 ? 39.584  -18.111 5.394   1.00 0.00 ? 110 GLY B N    2  
ATOM 10396  C CA   . GLY B 2 110 ? 40.387  -17.036 4.871   1.00 0.00 ? 110 GLY B CA   2  
ATOM 10397  C C    . GLY B 2 110 ? 40.897  -17.325 3.483   1.00 0.00 ? 110 GLY B C    2  
ATOM 10398  O O    . GLY B 2 110 ? 40.129  -17.703 2.598   1.00 0.00 ? 110 GLY B O    2  
ATOM 10399  H H    . GLY B 2 110 ? 39.077  -18.685 4.782   1.00 0.00 ? 110 GLY B H    2  
ATOM 10400  H HA2  . GLY B 2 110 ? 39.783  -16.129 4.842   1.00 0.00 ? 110 GLY B HA2  2  
ATOM 10401  H HA3  . GLY B 2 110 ? 41.239  -16.881 5.533   1.00 0.00 ? 110 GLY B HA3  2  
ATOM 10402  N N    . GLY B 2 111 ? 42.196  -17.172 3.299   1.00 0.00 ? 111 GLY B N    2  
ATOM 10403  C CA   . GLY B 2 111 ? 42.795  -17.406 2.004   1.00 0.00 ? 111 GLY B CA   2  
ATOM 10404  C C    . GLY B 2 111 ? 43.288  -16.114 1.393   1.00 0.00 ? 111 GLY B C    2  
ATOM 10405  O O    . GLY B 2 111 ? 43.593  -16.054 0.200   1.00 0.00 ? 111 GLY B O    2  
ATOM 10406  H H    . GLY B 2 111 ? 42.761  -16.904 4.058   1.00 0.00 ? 111 GLY B H    2  
ATOM 10407  H HA2  . GLY B 2 111 ? 43.635  -18.090 2.118   1.00 0.00 ? 111 GLY B HA2  2  
ATOM 10408  H HA3  . GLY B 2 111 ? 42.052  -17.853 1.343   1.00 0.00 ? 111 GLY B HA3  2  
ATOM 10409  N N    . GLY B 2 112 ? 43.351  -15.073 2.216   1.00 0.00 ? 112 GLY B N    2  
ATOM 10410  C CA   . GLY B 2 112 ? 43.809  -13.780 1.756   1.00 0.00 ? 112 GLY B CA   2  
ATOM 10411  C C    . GLY B 2 112 ? 42.692  -12.942 1.167   1.00 0.00 ? 112 GLY B C    2  
ATOM 10412  O O    . GLY B 2 112 ? 42.399  -11.847 1.656   1.00 0.00 ? 112 GLY B O    2  
ATOM 10413  H H    . GLY B 2 112 ? 43.086  -15.189 3.152   1.00 0.00 ? 112 GLY B H    2  
ATOM 10414  H HA2  . GLY B 2 112 ? 44.243  -13.243 2.599   1.00 0.00 ? 112 GLY B HA2  2  
ATOM 10415  H HA3  . GLY B 2 112 ? 44.573  -13.931 0.993   1.00 0.00 ? 112 GLY B HA3  2  
ATOM 10416  N N    . GLY B 2 113 ? 42.058  -13.459 0.127   1.00 0.00 ? 113 GLY B N    2  
ATOM 10417  C CA   . GLY B 2 113 ? 40.983  -12.739 -0.522  1.00 0.00 ? 113 GLY B CA   2  
ATOM 10418  C C    . GLY B 2 113 ? 39.681  -13.511 -0.526  1.00 0.00 ? 113 GLY B C    2  
ATOM 10419  O O    . GLY B 2 113 ? 39.613  -14.632 -1.031  1.00 0.00 ? 113 GLY B O    2  
ATOM 10420  H H    . GLY B 2 113 ? 42.326  -14.342 -0.208  1.00 0.00 ? 113 GLY B H    2  
ATOM 10421  H HA2  . GLY B 2 113 ? 40.828  -11.796 0.003   1.00 0.00 ? 113 GLY B HA2  2  
ATOM 10422  H HA3  . GLY B 2 113 ? 41.272  -12.535 -1.553  1.00 0.00 ? 113 GLY B HA3  2  
ATOM 10423  N N    . SER B 2 114 ? 38.654  -12.918 0.055   1.00 0.00 ? 114 SER B N    2  
ATOM 10424  C CA   . SER B 2 114 ? 37.337  -13.528 0.114   1.00 0.00 ? 114 SER B CA   2  
ATOM 10425  C C    . SER B 2 114 ? 36.277  -12.462 -0.152  1.00 0.00 ? 114 SER B C    2  
ATOM 10426  O O    . SER B 2 114 ? 36.269  -11.417 0.503   1.00 0.00 ? 114 SER B O    2  
ATOM 10427  C CB   . SER B 2 114 ? 37.113  -14.180 1.482   1.00 0.00 ? 114 SER B CB   2  
ATOM 10428  O OG   . SER B 2 114 ? 38.158  -15.089 1.791   1.00 0.00 ? 114 SER B OG   2  
ATOM 10429  H H    . SER B 2 114 ? 38.782  -12.034 0.458   1.00 0.00 ? 114 SER B H    2  
ATOM 10430  H HA   . SER B 2 114 ? 37.269  -14.297 -0.656  1.00 0.00 ? 114 SER B HA   2  
ATOM 10431  H HB2  . SER B 2 114 ? 37.080  -13.403 2.246   1.00 0.00 ? 114 SER B HB2  2  
ATOM 10432  H HB3  . SER B 2 114 ? 36.166  -14.718 1.470   1.00 0.00 ? 114 SER B HB3  2  
ATOM 10433  H HG   . SER B 2 114 ? 38.620  -15.334 0.981   1.00 0.00 ? 114 SER B HG   2  
ATOM 10434  N N    . GLY B 2 115 ? 35.405  -12.712 -1.118  1.00 0.00 ? 115 GLY B N    2  
ATOM 10435  C CA   . GLY B 2 115 ? 34.376  -11.744 -1.444  1.00 0.00 ? 115 GLY B CA   2  
ATOM 10436  C C    . GLY B 2 115 ? 33.035  -12.379 -1.755  1.00 0.00 ? 115 GLY B C    2  
ATOM 10437  O O    . GLY B 2 115 ? 32.621  -13.331 -1.090  1.00 0.00 ? 115 GLY B O    2  
ATOM 10438  H H    . GLY B 2 115 ? 35.456  -13.558 -1.613  1.00 0.00 ? 115 GLY B H    2  
ATOM 10439  H HA2  . GLY B 2 115 ? 34.253  -11.070 -0.597  1.00 0.00 ? 115 GLY B HA2  2  
ATOM 10440  H HA3  . GLY B 2 115 ? 34.700  -11.174 -2.315  1.00 0.00 ? 115 GLY B HA3  2  
ATOM 10441  N N    . GLY B 2 116 ? 32.361  -11.858 -2.771  1.00 0.00 ? 116 GLY B N    2  
ATOM 10442  C CA   . GLY B 2 116 ? 31.062  -12.376 -3.142  1.00 0.00 ? 116 GLY B CA   2  
ATOM 10443  C C    . GLY B 2 116 ? 31.080  -13.109 -4.467  1.00 0.00 ? 116 GLY B C    2  
ATOM 10444  O O    . GLY B 2 116 ? 32.070  -13.752 -4.818  1.00 0.00 ? 116 GLY B O    2  
ATOM 10445  H H    . GLY B 2 116 ? 32.759  -11.124 -3.287  1.00 0.00 ? 116 GLY B H    2  
ATOM 10446  H HA2  . GLY B 2 116 ? 30.727  -13.065 -2.366  1.00 0.00 ? 116 GLY B HA2  2  
ATOM 10447  H HA3  . GLY B 2 116 ? 30.362  -11.544 -3.213  1.00 0.00 ? 116 GLY B HA3  2  
ATOM 10448  N N    . GLY B 2 117 ? 29.989  -13.005 -5.209  1.00 0.00 ? 117 GLY B N    2  
ATOM 10449  C CA   . GLY B 2 117 ? 29.894  -13.674 -6.490  1.00 0.00 ? 117 GLY B CA   2  
ATOM 10450  C C    . GLY B 2 117 ? 29.862  -12.704 -7.649  1.00 0.00 ? 117 GLY B C    2  
ATOM 10451  O O    . GLY B 2 117 ? 30.700  -11.807 -7.737  1.00 0.00 ? 117 GLY B O    2  
ATOM 10452  H H    . GLY B 2 117 ? 29.241  -12.454 -4.888  1.00 0.00 ? 117 GLY B H    2  
ATOM 10453  H HA2  . GLY B 2 117 ? 30.757  -14.331 -6.606  1.00 0.00 ? 117 GLY B HA2  2  
ATOM 10454  H HA3  . GLY B 2 117 ? 28.982  -14.271 -6.507  1.00 0.00 ? 117 GLY B HA3  2  
ATOM 10455  N N    . GLY B 2 118 ? 28.896  -12.885 -8.535  1.00 0.00 ? 118 GLY B N    2  
ATOM 10456  C CA   . GLY B 2 118 ? 28.768  -12.019 -9.687  1.00 0.00 ? 118 GLY B CA   2  
ATOM 10457  C C    . GLY B 2 118 ? 27.586  -12.414 -10.544 1.00 0.00 ? 118 GLY B C    2  
ATOM 10458  O O    . GLY B 2 118 ? 27.750  -12.873 -11.676 1.00 0.00 ? 118 GLY B O    2  
ATOM 10459  H H    . GLY B 2 118 ? 28.254  -13.626 -8.406  1.00 0.00 ? 118 GLY B H    2  
ATOM 10460  H HA2  . GLY B 2 118 ? 28.633  -10.992 -9.346  1.00 0.00 ? 118 GLY B HA2  2  
ATOM 10461  H HA3  . GLY B 2 118 ? 29.677  -12.085 -10.284 1.00 0.00 ? 118 GLY B HA3  2  
ATOM 10462  N N    . SER B 2 119 ? 26.393  -12.258 -9.994  1.00 0.00 ? 119 SER B N    2  
ATOM 10463  C CA   . SER B 2 119 ? 25.173  -12.606 -10.701 1.00 0.00 ? 119 SER B CA   2  
ATOM 10464  C C    . SER B 2 119 ? 24.627  -11.407 -11.477 1.00 0.00 ? 119 SER B C    2  
ATOM 10465  O O    . SER B 2 119 ? 24.072  -10.481 -10.884 1.00 0.00 ? 119 SER B O    2  
ATOM 10466  C CB   . SER B 2 119 ? 24.129  -13.116 -9.702  1.00 0.00 ? 119 SER B CB   2  
ATOM 10467  O OG   . SER B 2 119 ? 24.003  -12.226 -8.600  1.00 0.00 ? 119 SER B OG   2  
ATOM 10468  H H    . SER B 2 119 ? 26.330  -11.903 -9.085  1.00 0.00 ? 119 SER B H    2  
ATOM 10469  H HA   . SER B 2 119 ? 25.399  -13.403 -11.409 1.00 0.00 ? 119 SER B HA   2  
ATOM 10470  H HB2  . SER B 2 119 ? 23.165  -13.199 -10.204 1.00 0.00 ? 119 SER B HB2  2  
ATOM 10471  H HB3  . SER B 2 119 ? 24.434  -14.096 -9.336  1.00 0.00 ? 119 SER B HB3  2  
ATOM 10472  H HG   . SER B 2 119 ? 23.946  -11.321 -8.938  1.00 0.00 ? 119 SER B HG   2  
ATOM 10473  N N    . GLY B 2 120 ? 24.805  -11.418 -12.792 1.00 0.00 ? 120 GLY B N    2  
ATOM 10474  C CA   . GLY B 2 120 ? 24.311  -10.330 -13.616 1.00 0.00 ? 120 GLY B CA   2  
ATOM 10475  C C    . GLY B 2 120 ? 25.130  -10.144 -14.877 1.00 0.00 ? 120 GLY B C    2  
ATOM 10476  O O    . GLY B 2 120 ? 26.361  -10.172 -14.832 1.00 0.00 ? 120 GLY B O    2  
ATOM 10477  H H    . GLY B 2 120 ? 25.291  -12.162 -13.207 1.00 0.00 ? 120 GLY B H    2  
ATOM 10478  H HA2  . GLY B 2 120 ? 23.279  -10.543 -13.896 1.00 0.00 ? 120 GLY B HA2  2  
ATOM 10479  H HA3  . GLY B 2 120 ? 24.344  -9.408  -13.036 1.00 0.00 ? 120 GLY B HA3  2  
ATOM 10480  N N    . GLY B 2 121 ? 24.449  -9.960  -16.001 1.00 0.00 ? 121 GLY B N    2  
ATOM 10481  C CA   . GLY B 2 121 ? 25.134  -9.766  -17.262 1.00 0.00 ? 121 GLY B CA   2  
ATOM 10482  C C    . GLY B 2 121 ? 24.372  -10.352 -18.435 1.00 0.00 ? 121 GLY B C    2  
ATOM 10483  O O    . GLY B 2 121 ? 23.853  -9.616  -19.276 1.00 0.00 ? 121 GLY B O    2  
ATOM 10484  H H    . GLY B 2 121 ? 23.464  -9.951  -15.973 1.00 0.00 ? 121 GLY B H    2  
ATOM 10485  H HA2  . GLY B 2 121 ? 25.265  -8.697  -17.428 1.00 0.00 ? 121 GLY B HA2  2  
ATOM 10486  H HA3  . GLY B 2 121 ? 26.112  -10.245 -17.206 1.00 0.00 ? 121 GLY B HA3  2  
ATOM 10487  N N    . GLY B 2 122 ? 24.298  -11.676 -18.489 1.00 0.00 ? 122 GLY B N    2  
ATOM 10488  C CA   . GLY B 2 122 ? 23.604  -12.342 -19.574 1.00 0.00 ? 122 GLY B CA   2  
ATOM 10489  C C    . GLY B 2 122 ? 22.096  -12.232 -19.466 1.00 0.00 ? 122 GLY B C    2  
ATOM 10490  O O    . GLY B 2 122 ? 21.445  -13.092 -18.873 1.00 0.00 ? 122 GLY B O    2  
ATOM 10491  H H    . GLY B 2 122 ? 24.719  -12.210 -17.781 1.00 0.00 ? 122 GLY B H    2  
ATOM 10492  H HA2  . GLY B 2 122 ? 23.920  -11.893 -20.516 1.00 0.00 ? 122 GLY B HA2  2  
ATOM 10493  H HA3  . GLY B 2 122 ? 23.878  -13.397 -19.567 1.00 0.00 ? 122 GLY B HA3  2  
ATOM 10494  N N    . GLY B 2 123 ? 21.544  -11.166 -20.029 1.00 0.00 ? 123 GLY B N    2  
ATOM 10495  C CA   . GLY B 2 123 ? 20.110  -10.963 -19.996 1.00 0.00 ? 123 GLY B CA   2  
ATOM 10496  C C    . GLY B 2 123 ? 19.715  -9.899  -18.998 1.00 0.00 ? 123 GLY B C    2  
ATOM 10497  O O    . GLY B 2 123 ? 19.352  -8.786  -19.379 1.00 0.00 ? 123 GLY B O    2  
ATOM 10498  H H    . GLY B 2 123 ? 22.122  -10.498 -20.459 1.00 0.00 ? 123 GLY B H    2  
ATOM 10499  H HA2  . GLY B 2 123 ? 19.774  -10.660 -20.988 1.00 0.00 ? 123 GLY B HA2  2  
ATOM 10500  H HA3  . GLY B 2 123 ? 19.627  -11.901 -19.722 1.00 0.00 ? 123 GLY B HA3  2  
ATOM 10501  N N    . SER B 2 124 ? 19.797  -10.241 -17.722 1.00 0.00 ? 124 SER B N    2  
ATOM 10502  C CA   . SER B 2 124 ? 19.451  -9.318  -16.658 1.00 0.00 ? 124 SER B CA   2  
ATOM 10503  C C    . SER B 2 124 ? 20.711  -8.745  -16.020 1.00 0.00 ? 124 SER B C    2  
ATOM 10504  O O    . SER B 2 124 ? 21.711  -9.452  -15.854 1.00 0.00 ? 124 SER B O    2  
ATOM 10505  C CB   . SER B 2 124 ? 18.594  -10.031 -15.612 1.00 0.00 ? 124 SER B CB   2  
ATOM 10506  O OG   . SER B 2 124 ? 17.570  -10.785 -16.242 1.00 0.00 ? 124 SER B OG   2  
ATOM 10507  H H    . SER B 2 124 ? 20.103  -11.141 -17.489 1.00 0.00 ? 124 SER B H    2  
ATOM 10508  H HA   . SER B 2 124 ? 18.872  -8.498  -17.084 1.00 0.00 ? 124 SER B HA   2  
ATOM 10509  H HB2  . SER B 2 124 ? 19.224  -10.701 -15.027 1.00 0.00 ? 124 SER B HB2  2  
ATOM 10510  H HB3  . SER B 2 124 ? 18.140  -9.291  -14.953 1.00 0.00 ? 124 SER B HB3  2  
ATOM 10511  H HG   . SER B 2 124 ? 17.380  -10.400 -17.106 1.00 0.00 ? 124 SER B HG   2  
ATOM 10512  N N    . GLY B 2 125 ? 20.660  -7.469  -15.674 1.00 0.00 ? 125 GLY B N    2  
ATOM 10513  C CA   . GLY B 2 125 ? 21.800  -6.816  -15.066 1.00 0.00 ? 125 GLY B CA   2  
ATOM 10514  C C    . GLY B 2 125 ? 22.681  -6.155  -16.105 1.00 0.00 ? 125 GLY B C    2  
ATOM 10515  O O    . GLY B 2 125 ? 23.910  -6.151  -15.985 1.00 0.00 ? 125 GLY B O    2  
ATOM 10516  H H    . GLY B 2 125 ? 19.828  -6.957  -15.838 1.00 0.00 ? 125 GLY B H    2  
ATOM 10517  H HA2  . GLY B 2 125 ? 21.444  -6.057  -14.369 1.00 0.00 ? 125 GLY B HA2  2  
ATOM 10518  H HA3  . GLY B 2 125 ? 22.386  -7.558  -14.524 1.00 0.00 ? 125 GLY B HA3  2  
ATOM 10519  N N    . GLY B 2 126 ? 22.051  -5.588  -17.124 1.00 0.00 ? 126 GLY B N    2  
ATOM 10520  C CA   . GLY B 2 126 ? 22.788  -4.938  -18.185 1.00 0.00 ? 126 GLY B CA   2  
ATOM 10521  C C    . GLY B 2 126 ? 22.957  -5.842  -19.385 1.00 0.00 ? 126 GLY B C    2  
ATOM 10522  O O    . GLY B 2 126 ? 24.005  -5.840  -20.030 1.00 0.00 ? 126 GLY B O    2  
ATOM 10523  H H    . GLY B 2 126 ? 21.062  -5.603  -17.153 1.00 0.00 ? 126 GLY B H    2  
ATOM 10524  H HA2  . GLY B 2 126 ? 22.249  -4.041  -18.491 1.00 0.00 ? 126 GLY B HA2  2  
ATOM 10525  H HA3  . GLY B 2 126 ? 23.772  -4.657  -17.812 1.00 0.00 ? 126 GLY B HA3  2  
ATOM 10526  N N    . GLY B 2 127 ? 21.925  -6.618  -19.680 1.00 0.00 ? 127 GLY B N    2  
ATOM 10527  C CA   . GLY B 2 127 ? 21.979  -7.524  -20.810 1.00 0.00 ? 127 GLY B CA   2  
ATOM 10528  C C    . GLY B 2 127 ? 21.135  -7.029  -21.963 1.00 0.00 ? 127 GLY B C    2  
ATOM 10529  O O    . GLY B 2 127 ? 21.646  -6.405  -22.895 1.00 0.00 ? 127 GLY B O    2  
ATOM 10530  H H    . GLY B 2 127 ? 21.114  -6.570  -19.130 1.00 0.00 ? 127 GLY B H    2  
ATOM 10531  H HA2  . GLY B 2 127 ? 23.013  -7.615  -21.142 1.00 0.00 ? 127 GLY B HA2  2  
ATOM 10532  H HA3  . GLY B 2 127 ? 21.613  -8.502  -20.497 1.00 0.00 ? 127 GLY B HA3  2  
ATOM 10533  N N    . GLY B 2 128 ? 19.841  -7.298  -21.896 1.00 0.00 ? 128 GLY B N    2  
ATOM 10534  C CA   . GLY B 2 128 ? 18.932  -6.862  -22.938 1.00 0.00 ? 128 GLY B CA   2  
ATOM 10535  C C    . GLY B 2 128 ? 17.959  -5.842  -22.394 1.00 0.00 ? 128 GLY B C    2  
ATOM 10536  O O    . GLY B 2 128 ? 18.320  -4.682  -22.183 1.00 0.00 ? 128 GLY B O    2  
ATOM 10537  H H    . GLY B 2 128 ? 19.492  -7.791  -21.119 1.00 0.00 ? 128 GLY B H    2  
ATOM 10538  H HA2  . GLY B 2 128 ? 19.504  -6.416  -23.751 1.00 0.00 ? 128 GLY B HA2  2  
ATOM 10539  H HA3  . GLY B 2 128 ? 18.378  -7.722  -23.316 1.00 0.00 ? 128 GLY B HA3  2  
ATOM 10540  N N    . SER B 2 129 ? 16.726  -6.267  -22.168 1.00 0.00 ? 129 SER B N    2  
ATOM 10541  C CA   . SER B 2 129 ? 15.716  -5.393  -21.604 1.00 0.00 ? 129 SER B CA   2  
ATOM 10542  C C    . SER B 2 129 ? 15.948  -5.328  -20.100 1.00 0.00 ? 129 SER B C    2  
ATOM 10543  O O    . SER B 2 129 ? 16.594  -6.212  -19.539 1.00 0.00 ? 129 SER B O    2  
ATOM 10544  C CB   . SER B 2 129 ? 14.327  -5.955  -21.897 1.00 0.00 ? 129 SER B CB   2  
ATOM 10545  O OG   . SER B 2 129 ? 14.258  -6.466  -23.221 1.00 0.00 ? 129 SER B OG   2  
ATOM 10546  H H    . SER B 2 129 ? 16.489  -7.195  -22.377 1.00 0.00 ? 129 SER B H    2  
ATOM 10547  H HA   . SER B 2 129 ? 15.804  -4.397  -22.037 1.00 0.00 ? 129 SER B HA   2  
ATOM 10548  H HB2  . SER B 2 129 ? 14.110  -6.759  -21.193 1.00 0.00 ? 129 SER B HB2  2  
ATOM 10549  H HB3  . SER B 2 129 ? 13.588  -5.162  -21.782 1.00 0.00 ? 129 SER B HB3  2  
ATOM 10550  H HG   . SER B 2 129 ? 14.542  -5.783  -23.839 1.00 0.00 ? 129 SER B HG   2  
ATOM 10551  N N    . GLU B 2 130 ? 15.438  -4.301  -19.442 1.00 0.00 ? 130 GLU B N    2  
ATOM 10552  C CA   . GLU B 2 130 ? 15.638  -4.164  -18.010 1.00 0.00 ? 130 GLU B CA   2  
ATOM 10553  C C    . GLU B 2 130 ? 14.544  -3.312  -17.384 1.00 0.00 ? 130 GLU B C    2  
ATOM 10554  O O    . GLU B 2 130 ? 14.197  -2.249  -17.902 1.00 0.00 ? 130 GLU B O    2  
ATOM 10555  C CB   . GLU B 2 130 ? 17.010  -3.544  -17.728 1.00 0.00 ? 130 GLU B CB   2  
ATOM 10556  C CG   . GLU B 2 130 ? 17.691  -4.048  -16.462 1.00 0.00 ? 130 GLU B CG   2  
ATOM 10557  C CD   . GLU B 2 130 ? 18.468  -5.332  -16.683 1.00 0.00 ? 130 GLU B CD   2  
ATOM 10558  O OE1  . GLU B 2 130 ? 19.423  -5.325  -17.484 1.00 0.00 ? 130 GLU B OE1  2  
ATOM 10559  O OE2  . GLU B 2 130 ? 18.139  -6.352  -16.043 1.00 0.00 ? 130 GLU B OE2  2  
ATOM 10560  H H    . GLU B 2 130 ? 14.898  -3.635  -19.924 1.00 0.00 ? 130 GLU B H    2  
ATOM 10561  H HA   . GLU B 2 130 ? 15.604  -5.157  -17.563 1.00 0.00 ? 130 GLU B HA   2  
ATOM 10562  H HB2  . GLU B 2 130 ? 17.661  -3.762  -18.574 1.00 0.00 ? 130 GLU B HB2  2  
ATOM 10563  H HB3  . GLU B 2 130 ? 16.882  -2.465  -17.637 1.00 0.00 ? 130 GLU B HB3  2  
ATOM 10564  H HG2  . GLU B 2 130 ? 18.378  -3.281  -16.106 1.00 0.00 ? 130 GLU B HG2  2  
ATOM 10565  H HG3  . GLU B 2 130 ? 16.929  -4.228  -15.704 1.00 0.00 ? 130 GLU B HG3  2  
ATOM 10566  H HE2  . GLU B 2 130 ? 18.677  -7.125  -16.230 1.00 0.00 ? 130 GLU B HE2  2  
ATOM 10567  N N    . VAL B 2 131 ? 13.999  -3.790  -16.275 1.00 0.00 ? 131 VAL B N    2  
ATOM 10568  C CA   . VAL B 2 131 ? 12.951  -3.073  -15.564 1.00 0.00 ? 131 VAL B CA   2  
ATOM 10569  C C    . VAL B 2 131 ? 13.590  -2.194  -14.499 1.00 0.00 ? 131 VAL B C    2  
ATOM 10570  O O    . VAL B 2 131 ? 14.444  -2.657  -13.745 1.00 0.00 ? 131 VAL B O    2  
ATOM 10571  C CB   . VAL B 2 131 ? 11.964  -4.048  -14.889 1.00 0.00 ? 131 VAL B CB   2  
ATOM 10572  C CG1  . VAL B 2 131 ? 10.876  -3.293  -14.137 1.00 0.00 ? 131 VAL B CG1  2  
ATOM 10573  C CG2  . VAL B 2 131 ? 11.352  -4.985  -15.917 1.00 0.00 ? 131 VAL B CG2  2  
ATOM 10574  H H    . VAL B 2 131 ? 14.324  -4.640  -15.914 1.00 0.00 ? 131 VAL B H    2  
ATOM 10575  H HA   . VAL B 2 131 ? 12.407  -2.449  -16.273 1.00 0.00 ? 131 VAL B HA   2  
ATOM 10576  H HB   . VAL B 2 131 ? 12.520  -4.649  -14.168 1.00 0.00 ? 131 VAL B HB   2  
ATOM 10577  H HG11 . VAL B 2 131 ? 10.204  -3.999  -13.649 1.00 0.00 ? 131 VAL B HG11 2  
ATOM 10578  H HG12 . VAL B 2 131 ? 11.334  -2.652  -13.384 1.00 0.00 ? 131 VAL B HG12 2  
ATOM 10579  H HG13 . VAL B 2 131 ? 10.309  -2.681  -14.839 1.00 0.00 ? 131 VAL B HG13 2  
ATOM 10580  H HG21 . VAL B 2 131 ? 12.145  -5.539  -16.419 1.00 0.00 ? 131 VAL B HG21 2  
ATOM 10581  H HG22 . VAL B 2 131 ? 10.678  -5.685  -15.424 1.00 0.00 ? 131 VAL B HG22 2  
ATOM 10582  H HG23 . VAL B 2 131 ? 10.795  -4.402  -16.651 1.00 0.00 ? 131 VAL B HG23 2  
ATOM 10583  N N    . GLN B 2 132 ? 13.208  -0.928  -14.453 1.00 0.00 ? 132 GLN B N    2  
ATOM 10584  C CA   . GLN B 2 132 ? 13.758  -0.009  -13.469 1.00 0.00 ? 132 GLN B CA   2  
ATOM 10585  C C    . GLN B 2 132 ? 12.693  0.918   -12.897 1.00 0.00 ? 132 GLN B C    2  
ATOM 10586  O O    . GLN B 2 132 ? 11.855  1.448   -13.630 1.00 0.00 ? 132 GLN B O    2  
ATOM 10587  C CB   . GLN B 2 132 ? 14.907  0.813   -14.070 1.00 0.00 ? 132 GLN B CB   2  
ATOM 10588  C CG   . GLN B 2 132 ? 14.720  1.159   -15.540 1.00 0.00 ? 132 GLN B CG   2  
ATOM 10589  C CD   . GLN B 2 132 ? 15.237  2.538   -15.899 1.00 0.00 ? 132 GLN B CD   2  
ATOM 10590  O OE1  . GLN B 2 132 ? 15.205  3.461   -15.085 1.00 0.00 ? 132 GLN B OE1  2  
ATOM 10591  N NE2  . GLN B 2 132 ? 15.711  2.689   -17.124 1.00 0.00 ? 132 GLN B NE2  2  
ATOM 10592  H H    . GLN B 2 132 ? 12.559  -0.588  -15.111 1.00 0.00 ? 132 GLN B H    2  
ATOM 10593  H HA   . GLN B 2 132 ? 14.160  -0.606  -12.651 1.00 0.00 ? 132 GLN B HA   2  
ATOM 10594  H HB2  . GLN B 2 132 ? 14.993  1.743   -13.508 1.00 0.00 ? 132 GLN B HB2  2  
ATOM 10595  H HB3  . GLN B 2 132 ? 15.828  0.239   -13.968 1.00 0.00 ? 132 GLN B HB3  2  
ATOM 10596  H HG2  . GLN B 2 132 ? 15.251  0.421   -16.142 1.00 0.00 ? 132 GLN B HG2  2  
ATOM 10597  H HG3  . GLN B 2 132 ? 13.656  1.114   -15.775 1.00 0.00 ? 132 GLN B HG3  2  
ATOM 10598  H HE21 . GLN B 2 132 ? 15.704  1.915   -17.724 1.00 0.00 ? 132 GLN B HE21 2  
ATOM 10599  H HE22 . GLN B 2 132 ? 16.046  3.574   -17.385 1.00 0.00 ? 132 GLN B HE22 2  
ATOM 10600  N N    . LEU B 2 133 ? 12.723  1.082   -11.579 1.00 0.00 ? 133 LEU B N    2  
ATOM 10601  C CA   . LEU B 2 133 ? 11.794  1.959   -10.880 1.00 0.00 ? 133 LEU B CA   2  
ATOM 10602  C C    . LEU B 2 133 ? 12.587  3.044   -10.159 1.00 0.00 ? 133 LEU B C    2  
ATOM 10603  O O    . LEU B 2 133 ? 13.277  2.763   -9.176  1.00 0.00 ? 133 LEU B O    2  
ATOM 10604  C CB   . LEU B 2 133 ? 10.952  1.174   -9.873  1.00 0.00 ? 133 LEU B CB   2  
ATOM 10605  C CG   . LEU B 2 133 ? 9.954   0.170   -10.456 1.00 0.00 ? 133 LEU B CG   2  
ATOM 10606  C CD1  . LEU B 2 133 ? 9.263   -0.605  -9.344  1.00 0.00 ? 133 LEU B CD1  2  
ATOM 10607  C CD2  . LEU B 2 133 ? 8.933   0.876   -11.332 1.00 0.00 ? 133 LEU B CD2  2  
ATOM 10608  H H    . LEU B 2 133 ? 13.385  0.584   -11.055 1.00 0.00 ? 133 LEU B H    2  
ATOM 10609  H HA   . LEU B 2 133 ? 11.130  2.423   -11.610 1.00 0.00 ? 133 LEU B HA   2  
ATOM 10610  H HB2  . LEU B 2 133 ? 11.637  0.624   -9.227  1.00 0.00 ? 133 LEU B HB2  2  
ATOM 10611  H HB3  . LEU B 2 133 ? 10.390  1.893   -9.278  1.00 0.00 ? 133 LEU B HB3  2  
ATOM 10612  H HG   . LEU B 2 133 ? 10.504  -0.539  -11.075 1.00 0.00 ? 133 LEU B HG   2  
ATOM 10613  H HD11 . LEU B 2 133 ? 8.572   -1.330  -9.773  1.00 0.00 ? 133 LEU B HD11 2  
ATOM 10614  H HD12 . LEU B 2 133 ? 10.010  -1.127  -8.747  1.00 0.00 ? 133 LEU B HD12 2  
ATOM 10615  H HD13 . LEU B 2 133 ? 8.710   0.088   -8.709  1.00 0.00 ? 133 LEU B HD13 2  
ATOM 10616  H HD21 . LEU B 2 133 ? 9.448   1.400   -12.138 1.00 0.00 ? 133 LEU B HD21 2  
ATOM 10617  H HD22 . LEU B 2 133 ? 8.244   0.147   -11.758 1.00 0.00 ? 133 LEU B HD22 2  
ATOM 10618  H HD23 . LEU B 2 133 ? 8.374   1.594   -10.731 1.00 0.00 ? 133 LEU B HD23 2  
ATOM 10619  N N    . VAL B 2 134 ? 12.511  4.266   -10.655 1.00 0.00 ? 134 VAL B N    2  
ATOM 10620  C CA   . VAL B 2 134 ? 13.247  5.371   -10.059 1.00 0.00 ? 134 VAL B CA   2  
ATOM 10621  C C    . VAL B 2 134 ? 12.326  6.316   -9.297  1.00 0.00 ? 134 VAL B C    2  
ATOM 10622  O O    . VAL B 2 134 ? 11.662  7.167   -9.892  1.00 0.00 ? 134 VAL B O    2  
ATOM 10623  C CB   . VAL B 2 134 ? 14.030  6.175   -11.123 1.00 0.00 ? 134 VAL B CB   2  
ATOM 10624  C CG1  . VAL B 2 134 ? 14.957  7.186   -10.464 1.00 0.00 ? 134 VAL B CG1  2  
ATOM 10625  C CG2  . VAL B 2 134 ? 14.816  5.240   -12.034 1.00 0.00 ? 134 VAL B CG2  2  
ATOM 10626  H H    . VAL B 2 134 ? 11.948  4.437   -11.442 1.00 0.00 ? 134 VAL B H    2  
ATOM 10627  H HA   . VAL B 2 134 ? 13.963  4.947   -9.354  1.00 0.00 ? 134 VAL B HA   2  
ATOM 10628  H HB   . VAL B 2 134 ? 13.311  6.720   -11.734 1.00 0.00 ? 134 VAL B HB   2  
ATOM 10629  H HG11 . VAL B 2 134 ? 15.482  7.759   -11.227 1.00 0.00 ? 134 VAL B HG11 2  
ATOM 10630  H HG12 . VAL B 2 134 ? 14.370  7.864   -9.843  1.00 0.00 ? 134 VAL B HG12 2  
ATOM 10631  H HG13 . VAL B 2 134 ? 15.683  6.662   -9.842  1.00 0.00 ? 134 VAL B HG13 2  
ATOM 10632  H HG21 . VAL B 2 134 ? 14.129  4.547   -12.520 1.00 0.00 ? 134 VAL B HG21 2  
ATOM 10633  H HG22 . VAL B 2 134 ? 15.342  5.819   -12.793 1.00 0.00 ? 134 VAL B HG22 2  
ATOM 10634  H HG23 . VAL B 2 134 ? 15.539  4.679   -11.441 1.00 0.00 ? 134 VAL B HG23 2  
ATOM 10635  N N    . GLU B 2 135 ? 12.267  6.149   -7.986  1.00 0.00 ? 135 GLU B N    2  
ATOM 10636  C CA   . GLU B 2 135 ? 11.443  7.007   -7.148  1.00 0.00 ? 135 GLU B CA   2  
ATOM 10637  C C    . GLU B 2 135 ? 12.231  8.248   -6.729  1.00 0.00 ? 135 GLU B C    2  
ATOM 10638  O O    . GLU B 2 135 ? 13.460  8.207   -6.618  1.00 0.00 ? 135 GLU B O    2  
ATOM 10639  C CB   . GLU B 2 135 ? 10.952  6.253   -5.910  1.00 0.00 ? 135 GLU B CB   2  
ATOM 10640  C CG   . GLU B 2 135 ? 10.642  4.785   -6.155  1.00 0.00 ? 135 GLU B CG   2  
ATOM 10641  C CD   . GLU B 2 135 ? 11.793  3.873   -5.783  1.00 0.00 ? 135 GLU B CD   2  
ATOM 10642  O OE1  . GLU B 2 135 ? 12.951  4.186   -6.141  1.00 0.00 ? 135 GLU B OE1  2  
ATOM 10643  O OE2  . GLU B 2 135 ? 11.546  2.843   -5.126  1.00 0.00 ? 135 GLU B OE2  2  
ATOM 10644  H H    . GLU B 2 135 ? 12.760  5.400   -7.571  1.00 0.00 ? 135 GLU B H    2  
ATOM 10645  H HA   . GLU B 2 135 ? 10.575  7.321   -7.728  1.00 0.00 ? 135 GLU B HA   2  
ATOM 10646  H HB2  . GLU B 2 135 ? 11.724  6.315   -5.143  1.00 0.00 ? 135 GLU B HB2  2  
ATOM 10647  H HB3  . GLU B 2 135 ? 10.044  6.738   -5.552  1.00 0.00 ? 135 GLU B HB3  2  
ATOM 10648  H HG2  . GLU B 2 135 ? 9.771   4.508   -5.561  1.00 0.00 ? 135 GLU B HG2  2  
ATOM 10649  H HG3  . GLU B 2 135 ? 10.414  4.647   -7.212  1.00 0.00 ? 135 GLU B HG3  2  
ATOM 10650  H HE2  . GLU B 2 135 ? 12.320  2.313   -4.924  1.00 0.00 ? 135 GLU B HE2  2  
ATOM 10651  N N    . SER B 2 136 ? 11.532  9.351   -6.522  1.00 0.00 ? 136 SER B N    2  
ATOM 10652  C CA   . SER B 2 136 ? 12.153  10.606  -6.120  1.00 0.00 ? 136 SER B CA   2  
ATOM 10653  C C    . SER B 2 136 ? 11.141  11.470  -5.368  1.00 0.00 ? 136 SER B C    2  
ATOM 10654  O O    . SER B 2 136 ? 9.959   11.127  -5.307  1.00 0.00 ? 136 SER B O    2  
ATOM 10655  C CB   . SER B 2 136 ? 12.673  11.358  -7.352  1.00 0.00 ? 136 SER B CB   2  
ATOM 10656  O OG   . SER B 2 136 ? 13.562  10.550  -8.115  1.00 0.00 ? 136 SER B OG   2  
ATOM 10657  H H    . SER B 2 136 ? 10.553  9.322   -6.633  1.00 0.00 ? 136 SER B H    2  
ATOM 10658  H HA   . SER B 2 136 ? 12.992  10.387  -5.459  1.00 0.00 ? 136 SER B HA   2  
ATOM 10659  H HB2  . SER B 2 136 ? 11.827  11.642  -7.978  1.00 0.00 ? 136 SER B HB2  2  
ATOM 10660  H HB3  . SER B 2 136 ? 13.201  12.254  -7.026  1.00 0.00 ? 136 SER B HB3  2  
ATOM 10661  H HG   . SER B 2 136 ? 13.615  9.666   -7.720  1.00 0.00 ? 136 SER B HG   2  
ATOM 10662  N N    . GLY B 2 137 ? 11.600  12.592  -4.815  1.00 0.00 ? 137 GLY B N    2  
ATOM 10663  C CA   . GLY B 2 137 ? 10.708  13.474  -4.084  1.00 0.00 ? 137 GLY B CA   2  
ATOM 10664  C C    . GLY B 2 137 ? 11.021  13.573  -2.602  1.00 0.00 ? 137 GLY B C    2  
ATOM 10665  O O    . GLY B 2 137 ? 10.447  14.409  -1.903  1.00 0.00 ? 137 GLY B O    2  
ATOM 10666  H H    . GLY B 2 137 ? 12.539  12.845  -4.939  1.00 0.00 ? 137 GLY B H    2  
ATOM 10667  H HA2  . GLY B 2 137 ? 10.779  14.471  -4.518  1.00 0.00 ? 137 GLY B HA2  2  
ATOM 10668  H HA3  . GLY B 2 137 ? 9.689   13.103  -4.197  1.00 0.00 ? 137 GLY B HA3  2  
ATOM 10669  N N    . GLY B 2 138 ? 11.924  12.725  -2.117  1.00 0.00 ? 138 GLY B N    2  
ATOM 10670  C CA   . GLY B 2 138 ? 12.281  12.737  -0.705  1.00 0.00 ? 138 GLY B CA   2  
ATOM 10671  C C    . GLY B 2 138 ? 12.943  14.026  -0.251  1.00 0.00 ? 138 GLY B C    2  
ATOM 10672  O O    . GLY B 2 138 ? 13.421  14.814  -1.070  1.00 0.00 ? 138 GLY B O    2  
ATOM 10673  H H    . GLY B 2 138 ? 12.338  12.070  -2.714  1.00 0.00 ? 138 GLY B H    2  
ATOM 10674  H HA2  . GLY B 2 138 ? 11.373  12.591  -0.120  1.00 0.00 ? 138 GLY B HA2  2  
ATOM 10675  H HA3  . GLY B 2 138 ? 12.968  11.911  -0.517  1.00 0.00 ? 138 GLY B HA3  2  
ATOM 10676  N N    . GLY B 2 139 ? 12.965  14.242  1.060   1.00 0.00 ? 139 GLY B N    2  
ATOM 10677  C CA   . GLY B 2 139 ? 13.576  15.438  1.612   1.00 0.00 ? 139 GLY B CA   2  
ATOM 10678  C C    . GLY B 2 139 ? 13.203  15.651  3.068   1.00 0.00 ? 139 GLY B C    2  
ATOM 10679  O O    . GLY B 2 139 ? 12.577  14.785  3.688   1.00 0.00 ? 139 GLY B O    2  
ATOM 10680  H H    . GLY B 2 139 ? 12.564  13.581  1.662   1.00 0.00 ? 139 GLY B H    2  
ATOM 10681  H HA2  . GLY B 2 139 ? 14.659  15.346  1.536   1.00 0.00 ? 139 GLY B HA2  2  
ATOM 10682  H HA3  . GLY B 2 139 ? 13.245  16.301  1.034   1.00 0.00 ? 139 GLY B HA3  2  
ATOM 10683  N N    . LEU B 2 140 ? 13.593  16.799  3.615   1.00 0.00 ? 140 LEU B N    2  
ATOM 10684  C CA   . LEU B 2 140 ? 13.298  17.135  5.003   1.00 0.00 ? 140 LEU B CA   2  
ATOM 10685  C C    . LEU B 2 140 ? 12.089  18.066  5.084   1.00 0.00 ? 140 LEU B C    2  
ATOM 10686  O O    . LEU B 2 140 ? 12.199  19.272  4.843   1.00 0.00 ? 140 LEU B O    2  
ATOM 10687  C CB   . LEU B 2 140 ? 14.513  17.791  5.667   1.00 0.00 ? 140 LEU B CB   2  
ATOM 10688  C CG   . LEU B 2 140 ? 14.401  18.073  7.168   1.00 0.00 ? 140 LEU B CG   2  
ATOM 10689  C CD1  . LEU B 2 140 ? 14.474  16.779  7.965   1.00 0.00 ? 140 LEU B CD1  2  
ATOM 10690  C CD2  . LEU B 2 140 ? 15.478  19.046  7.617   1.00 0.00 ? 140 LEU B CD2  2  
ATOM 10691  H H    . LEU B 2 140 ? 14.105  17.434  3.073   1.00 0.00 ? 140 LEU B H    2  
ATOM 10692  H HA   . LEU B 2 140 ? 13.066  16.213  5.537   1.00 0.00 ? 140 LEU B HA   2  
ATOM 10693  H HB2  . LEU B 2 140 ? 15.369  17.134  5.516   1.00 0.00 ? 140 LEU B HB2  2  
ATOM 10694  H HB3  . LEU B 2 140 ? 14.692  18.742  5.164   1.00 0.00 ? 140 LEU B HB3  2  
ATOM 10695  H HG   . LEU B 2 140 ? 13.430  18.531  7.356   1.00 0.00 ? 140 LEU B HG   2  
ATOM 10696  H HD11 . LEU B 2 140 ? 14.367  16.993  9.029   1.00 0.00 ? 140 LEU B HD11 2  
ATOM 10697  H HD12 . LEU B 2 140 ? 13.672  16.113  7.649   1.00 0.00 ? 140 LEU B HD12 2  
ATOM 10698  H HD13 . LEU B 2 140 ? 15.437  16.299  7.788   1.00 0.00 ? 140 LEU B HD13 2  
ATOM 10699  H HD21 . LEU B 2 140 ? 15.383  19.975  7.055   1.00 0.00 ? 140 LEU B HD21 2  
ATOM 10700  H HD22 . LEU B 2 140 ? 15.368  19.256  8.681   1.00 0.00 ? 140 LEU B HD22 2  
ATOM 10701  H HD23 . LEU B 2 140 ? 16.460  18.610  7.435   1.00 0.00 ? 140 LEU B HD23 2  
ATOM 10702  N N    . VAL B 2 141 ? 10.943  17.501  5.428   1.00 0.00 ? 141 VAL B N    2  
ATOM 10703  C CA   . VAL B 2 141 ? 9.709   18.269  5.532   1.00 0.00 ? 141 VAL B CA   2  
ATOM 10704  C C    . VAL B 2 141 ? 9.334   18.466  6.997   1.00 0.00 ? 141 VAL B C    2  
ATOM 10705  O O    . VAL B 2 141 ? 9.651   17.631  7.841   1.00 0.00 ? 141 VAL B O    2  
ATOM 10706  C CB   . VAL B 2 141 ? 8.548   17.556  4.798   1.00 0.00 ? 141 VAL B CB   2  
ATOM 10707  C CG1  . VAL B 2 141 ? 7.321   18.454  4.708   1.00 0.00 ? 141 VAL B CG1  2  
ATOM 10708  C CG2  . VAL B 2 141 ? 8.987   17.114  3.408   1.00 0.00 ? 141 VAL B CG2  2  
ATOM 10709  H H    . VAL B 2 141 ? 10.928  16.540  5.637   1.00 0.00 ? 141 VAL B H    2  
ATOM 10710  H HA   . VAL B 2 141 ? 9.870   19.244  5.072   1.00 0.00 ? 141 VAL B HA   2  
ATOM 10711  H HB   . VAL B 2 141 ? 8.279   16.668  5.370   1.00 0.00 ? 141 VAL B HB   2  
ATOM 10712  H HG11 . VAL B 2 141 ? 6.510   17.925  4.208   1.00 0.00 ? 141 VAL B HG11 2  
ATOM 10713  H HG12 . VAL B 2 141 ? 7.004   18.734  5.712   1.00 0.00 ? 141 VAL B HG12 2  
ATOM 10714  H HG13 . VAL B 2 141 ? 7.570   19.351  4.142   1.00 0.00 ? 141 VAL B HG13 2  
ATOM 10715  H HG21 . VAL B 2 141 ? 9.844   16.446  3.494   1.00 0.00 ? 141 VAL B HG21 2  
ATOM 10716  H HG22 . VAL B 2 141 ? 8.169   16.591  2.912   1.00 0.00 ? 141 VAL B HG22 2  
ATOM 10717  H HG23 . VAL B 2 141 ? 9.266   17.989  2.821   1.00 0.00 ? 141 VAL B HG23 2  
ATOM 10718  N N    . GLN B 2 142 ? 8.686   19.579  7.299   1.00 0.00 ? 142 GLN B N    2  
ATOM 10719  C CA   . GLN B 2 142 ? 8.262   19.870  8.657   1.00 0.00 ? 142 GLN B CA   2  
ATOM 10720  C C    . GLN B 2 142 ? 6.950   19.142  8.952   1.00 0.00 ? 142 GLN B C    2  
ATOM 10721  O O    . GLN B 2 142 ? 6.090   19.040  8.072   1.00 0.00 ? 142 GLN B O    2  
ATOM 10722  C CB   . GLN B 2 142 ? 8.091   21.382  8.831   1.00 0.00 ? 142 GLN B CB   2  
ATOM 10723  C CG   . GLN B 2 142 ? 8.070   21.850  10.276  1.00 0.00 ? 142 GLN B CG   2  
ATOM 10724  C CD   . GLN B 2 142 ? 8.644   23.240  10.443  1.00 0.00 ? 142 GLN B CD   2  
ATOM 10725  O OE1  . GLN B 2 142 ? 9.842   23.407  10.675  1.00 0.00 ? 142 GLN B OE1  2  
ATOM 10726  N NE2  . GLN B 2 142 ? 7.798   24.247  10.326  1.00 0.00 ? 142 GLN B NE2  2  
ATOM 10727  H H    . GLN B 2 142 ? 8.493   20.229  6.591   1.00 0.00 ? 142 GLN B H    2  
ATOM 10728  H HA   . GLN B 2 142 ? 9.026   19.518  9.350   1.00 0.00 ? 142 GLN B HA   2  
ATOM 10729  H HB2  . GLN B 2 142 ? 8.919   21.878  8.324   1.00 0.00 ? 142 GLN B HB2  2  
ATOM 10730  H HB3  . GLN B 2 142 ? 7.151   21.675  8.364   1.00 0.00 ? 142 GLN B HB3  2  
ATOM 10731  H HG2  . GLN B 2 142 ? 7.039   21.852  10.630  1.00 0.00 ? 142 GLN B HG2  2  
ATOM 10732  H HG3  . GLN B 2 142 ? 8.655   21.155  10.879  1.00 0.00 ? 142 GLN B HG3  2  
ATOM 10733  H HE21 . GLN B 2 142 ? 6.854   24.043  10.140  1.00 0.00 ? 142 GLN B HE21 2  
ATOM 10734  H HE22 . GLN B 2 142 ? 8.146   25.157  10.424  1.00 0.00 ? 142 GLN B HE22 2  
ATOM 10735  N N    . PRO B 2 143 ? 6.800   18.594  10.177  1.00 0.00 ? 143 PRO B N    2  
ATOM 10736  C CA   . PRO B 2 143 ? 5.590   17.873  10.596  1.00 0.00 ? 143 PRO B CA   2  
ATOM 10737  C C    . PRO B 2 143 ? 4.315   18.637  10.255  1.00 0.00 ? 143 PRO B C    2  
ATOM 10738  O O    . PRO B 2 143 ? 4.249   19.859  10.404  1.00 0.00 ? 143 PRO B O    2  
ATOM 10739  C CB   . PRO B 2 143 ? 5.749   17.778  12.113  1.00 0.00 ? 143 PRO B CB   2  
ATOM 10740  C CG   . PRO B 2 143 ? 7.221   17.751  12.322  1.00 0.00 ? 143 PRO B CG   2  
ATOM 10741  C CD   . PRO B 2 143 ? 7.814   18.621  11.250  1.00 0.00 ? 143 PRO B CD   2  
ATOM 10742  H HA   . PRO B 2 143 ? 5.553   16.882  10.144  1.00 0.00 ? 143 PRO B HA   2  
ATOM 10743  H HB2  . PRO B 2 143 ? 5.278   18.617  12.626  1.00 0.00 ? 143 PRO B HB2  2  
ATOM 10744  H HB3  . PRO B 2 143 ? 5.328   16.832  12.454  1.00 0.00 ? 143 PRO B HB3  2  
ATOM 10745  H HG2  . PRO B 2 143 ? 7.438   18.202  13.291  1.00 0.00 ? 143 PRO B HG2  2  
ATOM 10746  H HG3  . PRO B 2 143 ? 7.613   16.735  12.273  1.00 0.00 ? 143 PRO B HG3  2  
ATOM 10747  H HD2  . PRO B 2 143 ? 7.992   19.632  11.616  1.00 0.00 ? 143 PRO B HD2  2  
ATOM 10748  H HD3  . PRO B 2 143 ? 8.742   18.182  10.882  1.00 0.00 ? 143 PRO B HD3  2  
ATOM 10749  N N    . GLY B 2 144 ? 3.302   17.910  9.802   1.00 0.00 ? 144 GLY B N    2  
ATOM 10750  C CA   . GLY B 2 144 ? 2.046   18.534  9.434   1.00 0.00 ? 144 GLY B CA   2  
ATOM 10751  C C    . GLY B 2 144 ? 2.065   19.081  8.019   1.00 0.00 ? 144 GLY B C    2  
ATOM 10752  O O    . GLY B 2 144 ? 1.043   19.547  7.513   1.00 0.00 ? 144 GLY B O    2  
ATOM 10753  H H    . GLY B 2 144 ? 3.398   16.933  9.752   1.00 0.00 ? 144 GLY B H    2  
ATOM 10754  H HA2  . GLY B 2 144 ? 1.251   17.793  9.514   1.00 0.00 ? 144 GLY B HA2  2  
ATOM 10755  H HA3  . GLY B 2 144 ? 1.847   19.353  10.125  1.00 0.00 ? 144 GLY B HA3  2  
ATOM 10756  N N    . GLY B 2 145 ? 3.231   19.037  7.384   1.00 0.00 ? 145 GLY B N    2  
ATOM 10757  C CA   . GLY B 2 145 ? 3.363   19.525  6.025   1.00 0.00 ? 145 GLY B CA   2  
ATOM 10758  C C    . GLY B 2 145 ? 2.939   18.489  5.003   1.00 0.00 ? 145 GLY B C    2  
ATOM 10759  O O    . GLY B 2 145 ? 2.357   17.461  5.352   1.00 0.00 ? 145 GLY B O    2  
ATOM 10760  H H    . GLY B 2 145 ? 4.019   18.682  7.851   1.00 0.00 ? 145 GLY B H    2  
ATOM 10761  H HA2  . GLY B 2 145 ? 2.739   20.411  5.908   1.00 0.00 ? 145 GLY B HA2  2  
ATOM 10762  H HA3  . GLY B 2 145 ? 4.404   19.791  5.846   1.00 0.00 ? 145 GLY B HA3  2  
ATOM 10763  N N    . SER B 2 146 ? 3.235   18.753  3.739   1.00 0.00 ? 146 SER B N    2  
ATOM 10764  C CA   . SER B 2 146 ? 2.865   17.840  2.669   1.00 0.00 ? 146 SER B CA   2  
ATOM 10765  C C    . SER B 2 146 ? 4.062   17.516  1.779   1.00 0.00 ? 146 SER B C    2  
ATOM 10766  O O    . SER B 2 146 ? 4.963   18.340  1.605   1.00 0.00 ? 146 SER B O    2  
ATOM 10767  C CB   . SER B 2 146 ? 1.725   18.433  1.841   1.00 0.00 ? 146 SER B CB   2  
ATOM 10768  O OG   . SER B 2 146 ? 0.660   18.844  2.685   1.00 0.00 ? 146 SER B OG   2  
ATOM 10769  H H    . SER B 2 146 ? 3.719   19.577  3.518   1.00 0.00 ? 146 SER B H    2  
ATOM 10770  H HA   . SER B 2 146 ? 2.515   16.913  3.122   1.00 0.00 ? 146 SER B HA   2  
ATOM 10771  H HB2  . SER B 2 146 ? 2.095   19.295  1.286   1.00 0.00 ? 146 SER B HB2  2  
ATOM 10772  H HB3  . SER B 2 146 ? 1.359   17.681  1.143   1.00 0.00 ? 146 SER B HB3  2  
ATOM 10773  H HG   . SER B 2 146 ? 1.017   19.300  3.452   1.00 0.00 ? 146 SER B HG   2  
ATOM 10774  N N    . LEU B 2 147 ? 4.067   16.310  1.238   1.00 0.00 ? 147 LEU B N    2  
ATOM 10775  C CA   . LEU B 2 147 ? 5.133   15.856  0.365   1.00 0.00 ? 147 LEU B CA   2  
ATOM 10776  C C    . LEU B 2 147 ? 4.566   14.946  -0.717  1.00 0.00 ? 147 LEU B C    2  
ATOM 10777  O O    . LEU B 2 147 ? 3.733   14.084  -0.439  1.00 0.00 ? 147 LEU B O    2  
ATOM 10778  C CB   . LEU B 2 147 ? 6.208   15.126  1.180   1.00 0.00 ? 147 LEU B CB   2  
ATOM 10779  C CG   . LEU B 2 147 ? 7.235   14.313  0.388   1.00 0.00 ? 147 LEU B CG   2  
ATOM 10780  C CD1  . LEU B 2 147 ? 8.647   14.641  0.838   1.00 0.00 ? 147 LEU B CD1  2  
ATOM 10781  C CD2  . LEU B 2 147 ? 6.963   12.825  0.531   1.00 0.00 ? 147 LEU B CD2  2  
ATOM 10782  H H    . LEU B 2 147 ? 3.320   15.695  1.436   1.00 0.00 ? 147 LEU B H    2  
ATOM 10783  H HA   . LEU B 2 147 ? 5.587   16.726  -0.110  1.00 0.00 ? 147 LEU B HA   2  
ATOM 10784  H HB2  . LEU B 2 147 ? 6.753   15.876  1.755   1.00 0.00 ? 147 LEU B HB2  2  
ATOM 10785  H HB3  . LEU B 2 147 ? 5.701   14.444  1.861   1.00 0.00 ? 147 LEU B HB3  2  
ATOM 10786  H HG   . LEU B 2 147 ? 7.142   14.578  -0.666  1.00 0.00 ? 147 LEU B HG   2  
ATOM 10787  H HD11 . LEU B 2 147 ? 9.366   14.070  0.250   1.00 0.00 ? 147 LEU B HD11 2  
ATOM 10788  H HD12 . LEU B 2 147 ? 8.833   15.706  0.700   1.00 0.00 ? 147 LEU B HD12 2  
ATOM 10789  H HD13 . LEU B 2 147 ? 8.760   14.386  1.892   1.00 0.00 ? 147 LEU B HD13 2  
ATOM 10790  H HD21 . LEU B 2 147 ? 5.957   12.604  0.176   1.00 0.00 ? 147 LEU B HD21 2  
ATOM 10791  H HD22 . LEU B 2 147 ? 7.686   12.258  -0.056  1.00 0.00 ? 147 LEU B HD22 2  
ATOM 10792  H HD23 . LEU B 2 147 ? 7.049   12.540  1.580   1.00 0.00 ? 147 LEU B HD23 2  
ATOM 10793  N N    . ARG B 2 148 ? 4.994   15.152  -1.951  1.00 0.00 ? 148 ARG B N    2  
ATOM 10794  C CA   . ARG B 2 148 ? 4.528   14.337  -3.057  1.00 0.00 ? 148 ARG B CA   2  
ATOM 10795  C C    . ARG B 2 148 ? 5.694   13.585  -3.690  1.00 0.00 ? 148 ARG B C    2  
ATOM 10796  O O    . ARG B 2 148 ? 6.656   14.197  -4.160  1.00 0.00 ? 148 ARG B O    2  
ATOM 10797  C CB   . ARG B 2 148 ? 3.817   15.203  -4.095  1.00 0.00 ? 148 ARG B CB   2  
ATOM 10798  C CG   . ARG B 2 148 ? 3.045   14.411  -5.140  1.00 0.00 ? 148 ARG B CG   2  
ATOM 10799  C CD   . ARG B 2 148 ? 2.864   15.209  -6.424  1.00 0.00 ? 148 ARG B CD   2  
ATOM 10800  N NE   . ARG B 2 148 ? 4.119   15.807  -6.886  1.00 0.00 ? 148 ARG B NE   2  
ATOM 10801  C CZ   . ARG B 2 148 ? 5.151   15.114  -7.372  1.00 0.00 ? 148 ARG B CZ   2  
ATOM 10802  N NH1  . ARG B 2 148 ? 5.085   13.793  -7.461  1.00 0.00 ? 148 ARG B NH1  2  
ATOM 10803  N NH2  . ARG B 2 148 ? 6.249   15.743  -7.776  1.00 0.00 ? 148 ARG B NH2  2  
ATOM 10804  H H    . ARG B 2 148 ? 5.634   15.877  -2.123  1.00 0.00 ? 148 ARG B H    2  
ATOM 10805  H HA   . ARG B 2 148 ? 3.816   13.608  -2.670  1.00 0.00 ? 148 ARG B HA   2  
ATOM 10806  H HB2  . ARG B 2 148 ? 3.117   15.857  -3.575  1.00 0.00 ? 148 ARG B HB2  2  
ATOM 10807  H HB3  . ARG B 2 148 ? 4.566   15.807  -4.608  1.00 0.00 ? 148 ARG B HB3  2  
ATOM 10808  H HG2  . ARG B 2 148 ? 3.592   13.496  -5.366  1.00 0.00 ? 148 ARG B HG2  2  
ATOM 10809  H HG3  . ARG B 2 148 ? 2.064   14.158  -4.739  1.00 0.00 ? 148 ARG B HG3  2  
ATOM 10810  H HD2  . ARG B 2 148 ? 2.483   14.546  -7.200  1.00 0.00 ? 148 ARG B HD2  2  
ATOM 10811  H HD3  . ARG B 2 148 ? 2.140   16.004  -6.245  1.00 0.00 ? 148 ARG B HD3  2  
ATOM 10812  H HE   . ARG B 2 148 ? 4.192   16.787  -6.832  1.00 0.00 ? 148 ARG B HE   2  
ATOM 10813  H HH11 . ARG B 2 148 ? 4.263   13.307  -7.167  1.00 0.00 ? 148 ARG B HH11 2  
ATOM 10814  H HH12 . ARG B 2 148 ? 5.872   13.272  -7.823  1.00 0.00 ? 148 ARG B HH12 2  
ATOM 10815  H HH21 . ARG B 2 148 ? 6.310   16.743  -7.721  1.00 0.00 ? 148 ARG B HH21 2  
ATOM 10816  H HH22 . ARG B 2 148 ? 7.029   15.218  -8.131  1.00 0.00 ? 148 ARG B HH22 2  
ATOM 10817  N N    . LEU B 2 149 ? 5.604   12.263  -3.694  1.00 0.00 ? 149 LEU B N    2  
ATOM 10818  C CA   . LEU B 2 149 ? 6.651   11.421  -4.260  1.00 0.00 ? 149 LEU B CA   2  
ATOM 10819  C C    . LEU B 2 149 ? 6.333   11.042  -5.701  1.00 0.00 ? 149 LEU B C    2  
ATOM 10820  O O    . LEU B 2 149 ? 5.166   10.979  -6.094  1.00 0.00 ? 149 LEU B O    2  
ATOM 10821  C CB   . LEU B 2 149 ? 6.825   10.147  -3.425  1.00 0.00 ? 149 LEU B CB   2  
ATOM 10822  C CG   . LEU B 2 149 ? 7.413   10.319  -2.023  1.00 0.00 ? 149 LEU B CG   2  
ATOM 10823  C CD1  . LEU B 2 149 ? 7.331   9.013   -1.250  1.00 0.00 ? 149 LEU B CD1  2  
ATOM 10824  C CD2  . LEU B 2 149 ? 8.854   10.793  -2.105  1.00 0.00 ? 149 LEU B CD2  2  
ATOM 10825  H H    . LEU B 2 149 ? 4.804   11.838  -3.308  1.00 0.00 ? 149 LEU B H    2  
ATOM 10826  H HA   . LEU B 2 149 ? 7.585   11.983  -4.244  1.00 0.00 ? 149 LEU B HA   2  
ATOM 10827  H HB2  . LEU B 2 149 ? 5.843   9.687   -3.317  1.00 0.00 ? 149 LEU B HB2  2  
ATOM 10828  H HB3  . LEU B 2 149 ? 7.482   9.477   -3.979  1.00 0.00 ? 149 LEU B HB3  2  
ATOM 10829  H HG   . LEU B 2 149 ? 6.830   11.072  -1.494  1.00 0.00 ? 149 LEU B HG   2  
ATOM 10830  H HD11 . LEU B 2 149 ? 7.736   9.151   -0.247  1.00 0.00 ? 149 LEU B HD11 2  
ATOM 10831  H HD12 . LEU B 2 149 ? 6.290   8.698   -1.179  1.00 0.00 ? 149 LEU B HD12 2  
ATOM 10832  H HD13 . LEU B 2 149 ? 7.907   8.247   -1.769  1.00 0.00 ? 149 LEU B HD13 2  
ATOM 10833  H HD21 . LEU B 2 149 ? 8.893   11.742  -2.641  1.00 0.00 ? 149 LEU B HD21 2  
ATOM 10834  H HD22 . LEU B 2 149 ? 9.255   10.930  -1.101  1.00 0.00 ? 149 LEU B HD22 2  
ATOM 10835  H HD23 . LEU B 2 149 ? 9.451   10.051  -2.635  1.00 0.00 ? 149 LEU B HD23 2  
ATOM 10836  N N    . SER B 2 150 ? 7.375   10.792  -6.480  1.00 0.00 ? 150 SER B N    2  
ATOM 10837  C CA   . SER B 2 150 ? 7.224   10.403  -7.876  1.00 0.00 ? 150 SER B CA   2  
ATOM 10838  C C    . SER B 2 150 ? 7.997   9.117   -8.135  1.00 0.00 ? 150 SER B C    2  
ATOM 10839  O O    . SER B 2 150 ? 9.099   8.944   -7.624  1.00 0.00 ? 150 SER B O    2  
ATOM 10840  C CB   . SER B 2 150 ? 7.753   11.510  -8.790  1.00 0.00 ? 150 SER B CB   2  
ATOM 10841  O OG   . SER B 2 150 ? 7.388   12.788  -8.302  1.00 0.00 ? 150 SER B OG   2  
ATOM 10842  H H    . SER B 2 150 ? 8.282   10.872  -6.105  1.00 0.00 ? 150 SER B H    2  
ATOM 10843  H HA   . SER B 2 150 ? 6.167   10.238  -8.087  1.00 0.00 ? 150 SER B HA   2  
ATOM 10844  H HB2  . SER B 2 150 ? 8.840   11.444  -8.838  1.00 0.00 ? 150 SER B HB2  2  
ATOM 10845  H HB3  . SER B 2 150 ? 7.336   11.378  -9.789  1.00 0.00 ? 150 SER B HB3  2  
ATOM 10846  H HG   . SER B 2 150 ? 8.166   13.217  -7.922  1.00 0.00 ? 150 SER B HG   2  
ATOM 10847  N N    . CYS B 2 151 ? 7.417   8.214   -8.905  1.00 0.00 ? 151 CYS B N    2  
ATOM 10848  C CA   . CYS B 2 151 ? 8.072   6.955   -9.224  1.00 0.00 ? 151 CYS B CA   2  
ATOM 10849  C C    . CYS B 2 151 ? 8.075   6.736   -10.727 1.00 0.00 ? 151 CYS B C    2  
ATOM 10850  O O    . CYS B 2 151 ? 7.020   6.563   -11.336 1.00 0.00 ? 151 CYS B O    2  
ATOM 10851  C CB   . CYS B 2 151 ? 7.372   5.791   -8.515  1.00 0.00 ? 151 CYS B CB   2  
ATOM 10852  S SG   . CYS B 2 151 ? 8.117   4.154   -8.816  1.00 0.00 ? 151 CYS B SG   2  
ATOM 10853  H H    . CYS B 2 151 ? 6.521   8.396   -9.269  1.00 0.00 ? 151 CYS B H    2  
ATOM 10854  H HA   . CYS B 2 151 ? 9.103   7.005   -8.875  1.00 0.00 ? 151 CYS B HA   2  
ATOM 10855  H HB2  . CYS B 2 151 ? 7.399   5.988   -7.443  1.00 0.00 ? 151 CYS B HB2  2  
ATOM 10856  H HB3  . CYS B 2 151 ? 6.337   5.765   -8.856  1.00 0.00 ? 151 CYS B HB3  2  
ATOM 10857  H HG   . CYS B 2 151 ? 7.271   3.440   -8.069  1.00 0.00 ? 151 CYS B HG   2  
ATOM 10858  N N    . ALA B 2 152 ? 9.253   6.783   -11.328 1.00 0.00 ? 152 ALA B N    2  
ATOM 10859  C CA   . ALA B 2 152 ? 9.385   6.582   -12.763 1.00 0.00 ? 152 ALA B CA   2  
ATOM 10860  C C    . ALA B 2 152 ? 9.476   5.095   -13.080 1.00 0.00 ? 152 ALA B C    2  
ATOM 10861  O O    . ALA B 2 152 ? 10.363  4.401   -12.581 1.00 0.00 ? 152 ALA B O    2  
ATOM 10862  C CB   . ALA B 2 152 ? 10.603  7.322   -13.294 1.00 0.00 ? 152 ALA B CB   2  
ATOM 10863  H H    . ALA B 2 152 ? 10.061  6.949   -10.791 1.00 0.00 ? 152 ALA B H    2  
ATOM 10864  H HA   . ALA B 2 152 ? 8.497   6.986   -13.248 1.00 0.00 ? 152 ALA B HA   2  
ATOM 10865  H HB1  . ALA B 2 152 ? 10.677  7.184   -14.373 1.00 0.00 ? 152 ALA B HB1  2  
ATOM 10866  H HB2  . ALA B 2 152 ? 10.507  8.385   -13.072 1.00 0.00 ? 152 ALA B HB2  2  
ATOM 10867  H HB3  . ALA B 2 152 ? 11.502  6.931   -12.817 1.00 0.00 ? 152 ALA B HB3  2  
ATOM 10868  N N    . ALA B 2 153 ? 8.551   4.614   -13.897 1.00 0.00 ? 153 ALA B N    2  
ATOM 10869  C CA   . ALA B 2 153 ? 8.520   3.209   -14.276 1.00 0.00 ? 153 ALA B CA   2  
ATOM 10870  C C    . ALA B 2 153 ? 9.045   3.031   -15.692 1.00 0.00 ? 153 ALA B C    2  
ATOM 10871  O O    . ALA B 2 153 ? 8.671   3.778   -16.596 1.00 0.00 ? 153 ALA B O    2  
ATOM 10872  C CB   . ALA B 2 153 ? 7.101   2.673   -14.168 1.00 0.00 ? 153 ALA B CB   2  
ATOM 10873  H H    . ALA B 2 153 ? 7.874   5.223   -14.267 1.00 0.00 ? 153 ALA B H    2  
ATOM 10874  H HA   . ALA B 2 153 ? 9.159   2.651   -13.593 1.00 0.00 ? 153 ALA B HA   2  
ATOM 10875  H HB1  . ALA B 2 153 ? 7.088   1.615   -14.432 1.00 0.00 ? 153 ALA B HB1  2  
ATOM 10876  H HB2  . ALA B 2 153 ? 6.745   2.795   -13.145 1.00 0.00 ? 153 ALA B HB2  2  
ATOM 10877  H HB3  . ALA B 2 153 ? 6.452   3.224   -14.848 1.00 0.00 ? 153 ALA B HB3  2  
ATOM 10878  N N    . SER B 2 154 ? 9.935   2.064   -15.879 1.00 0.00 ? 154 SER B N    2  
ATOM 10879  C CA   . SER B 2 154 ? 10.502  1.796   -17.191 1.00 0.00 ? 154 SER B CA   2  
ATOM 10880  C C    . SER B 2 154 ? 10.850  0.316   -17.352 1.00 0.00 ? 154 SER B C    2  
ATOM 10881  O O    . SER B 2 154 ? 11.068  -0.391  -16.366 1.00 0.00 ? 154 SER B O    2  
ATOM 10882  C CB   . SER B 2 154 ? 11.754  2.656   -17.408 1.00 0.00 ? 154 SER B CB   2  
ATOM 10883  O OG   . SER B 2 154 ? 11.527  4.006   -17.024 1.00 0.00 ? 154 SER B OG   2  
ATOM 10884  H H    . SER B 2 154 ? 10.230  1.527   -15.112 1.00 0.00 ? 154 SER B H    2  
ATOM 10885  H HA   . SER B 2 154 ? 9.761   2.062   -17.945 1.00 0.00 ? 154 SER B HA   2  
ATOM 10886  H HB2  . SER B 2 154 ? 12.572  2.251   -16.811 1.00 0.00 ? 154 SER B HB2  2  
ATOM 10887  H HB3  . SER B 2 154 ? 12.026  2.629   -18.463 1.00 0.00 ? 154 SER B HB3  2  
ATOM 10888  H HG   . SER B 2 154 ? 10.574  4.159   -16.949 1.00 0.00 ? 154 SER B HG   2  
ATOM 10889  N N    . GLY B 2 155 ? 10.892  -0.137  -18.600 1.00 0.00 ? 155 GLY B N    2  
ATOM 10890  C CA   . GLY B 2 155 ? 11.239  -1.517  -18.894 1.00 0.00 ? 155 GLY B CA   2  
ATOM 10891  C C    . GLY B 2 155 ? 10.082  -2.500  -18.838 1.00 0.00 ? 155 GLY B C    2  
ATOM 10892  O O    . GLY B 2 155 ? 10.300  -3.708  -18.908 1.00 0.00 ? 155 GLY B O    2  
ATOM 10893  H H    . GLY B 2 155 ? 10.716  0.490   -19.335 1.00 0.00 ? 155 GLY B H    2  
ATOM 10894  H HA2  . GLY B 2 155 ? 11.664  -1.552  -19.897 1.00 0.00 ? 155 GLY B HA2  2  
ATOM 10895  H HA3  . GLY B 2 155 ? 11.991  -1.837  -18.173 1.00 0.00 ? 155 GLY B HA3  2  
ATOM 10896  N N    . PHE B 2 156 ? 8.853   -2.007  -18.721 1.00 0.00 ? 156 PHE B N    2  
ATOM 10897  C CA   . PHE B 2 156 ? 7.696   -2.898  -18.657 1.00 0.00 ? 156 PHE B CA   2  
ATOM 10898  C C    . PHE B 2 156 ? 6.392   -2.192  -19.009 1.00 0.00 ? 156 PHE B C    2  
ATOM 10899  O O    . PHE B 2 156 ? 6.375   -0.983  -19.254 1.00 0.00 ? 156 PHE B O    2  
ATOM 10900  C CB   . PHE B 2 156 ? 7.591   -3.586  -17.286 1.00 0.00 ? 156 PHE B CB   2  
ATOM 10901  C CG   . PHE B 2 156 ? 7.228   -2.678  -16.141 1.00 0.00 ? 156 PHE B CG   2  
ATOM 10902  C CD1  . PHE B 2 156 ? 8.107   -1.703  -15.701 1.00 0.00 ? 156 PHE B CD1  2  
ATOM 10903  C CD2  . PHE B 2 156 ? 6.010   -2.811  -15.496 1.00 0.00 ? 156 PHE B CD2  2  
ATOM 10904  C CE1  . PHE B 2 156 ? 7.781   -0.878  -14.641 1.00 0.00 ? 156 PHE B CE1  2  
ATOM 10905  C CE2  . PHE B 2 156 ? 5.673   -1.988  -14.436 1.00 0.00 ? 156 PHE B CE2  2  
ATOM 10906  C CZ   . PHE B 2 156 ? 6.560   -1.020  -14.008 1.00 0.00 ? 156 PHE B CZ   2  
ATOM 10907  H H    . PHE B 2 156 ? 8.722   -1.036  -18.680 1.00 0.00 ? 156 PHE B H    2  
ATOM 10908  H HA   . PHE B 2 156 ? 7.855   -3.677  -19.403 1.00 0.00 ? 156 PHE B HA   2  
ATOM 10909  H HB2  . PHE B 2 156 ? 6.834   -4.367  -17.354 1.00 0.00 ? 156 PHE B HB2  2  
ATOM 10910  H HB3  . PHE B 2 156 ? 8.553   -4.048  -17.062 1.00 0.00 ? 156 PHE B HB3  2  
ATOM 10911  H HD1  . PHE B 2 156 ? 9.062   -1.587  -16.193 1.00 0.00 ? 156 PHE B HD1  2  
ATOM 10912  H HD2  . PHE B 2 156 ? 5.313   -3.568  -15.825 1.00 0.00 ? 156 PHE B HD2  2  
ATOM 10913  H HE1  . PHE B 2 156 ? 8.478   -0.123  -14.309 1.00 0.00 ? 156 PHE B HE1  2  
ATOM 10914  H HE2  . PHE B 2 156 ? 4.719   -2.102  -13.945 1.00 0.00 ? 156 PHE B HE2  2  
ATOM 10915  H HZ   . PHE B 2 156 ? 6.302   -0.376  -13.180 1.00 0.00 ? 156 PHE B HZ   2  
ATOM 10916  N N    . ASP B 2 157 ? 5.307   -2.965  -19.034 1.00 0.00 ? 157 ASP B N    2  
ATOM 10917  C CA   . ASP B 2 157 ? 3.977   -2.441  -19.341 1.00 0.00 ? 157 ASP B CA   2  
ATOM 10918  C C    . ASP B 2 157 ? 3.448   -1.627  -18.167 1.00 0.00 ? 157 ASP B C    2  
ATOM 10919  O O    . ASP B 2 157 ? 3.416   -2.112  -17.039 1.00 0.00 ? 157 ASP B O    2  
ATOM 10920  C CB   . ASP B 2 157 ? 3.001   -3.591  -19.621 1.00 0.00 ? 157 ASP B CB   2  
ATOM 10921  C CG   . ASP B 2 157 ? 3.297   -4.357  -20.892 1.00 0.00 ? 157 ASP B CG   2  
ATOM 10922  O OD1  . ASP B 2 157 ? 3.297   -5.609  -20.853 1.00 0.00 ? 157 ASP B OD1  2  
ATOM 10923  O OD2  . ASP B 2 157 ? 3.512   -3.720  -21.939 1.00 0.00 ? 157 ASP B OD2  2  
ATOM 10924  H H    . ASP B 2 157 ? 5.405   -3.922  -18.840 1.00 0.00 ? 157 ASP B H    2  
ATOM 10925  H HA   . ASP B 2 157 ? 4.045   -1.803  -20.222 1.00 0.00 ? 157 ASP B HA   2  
ATOM 10926  H HB2  . ASP B 2 157 ? 3.041   -4.287  -18.783 1.00 0.00 ? 157 ASP B HB2  2  
ATOM 10927  H HB3  . ASP B 2 157 ? 1.995   -3.177  -19.696 1.00 0.00 ? 157 ASP B HB3  2  
ATOM 10928  H HD2  . ASP B 2 157 ? 3.688   -4.270  -22.706 1.00 0.00 ? 157 ASP B HD2  2  
ATOM 10929  N N    . PHE B 2 158 ? 3.003   -0.411  -18.435 1.00 0.00 ? 158 PHE B N    2  
ATOM 10930  C CA   . PHE B 2 158 ? 2.497   0.454   -17.378 1.00 0.00 ? 158 PHE B CA   2  
ATOM 10931  C C    . PHE B 2 158 ? 0.998   0.264   -17.155 1.00 0.00 ? 158 PHE B C    2  
ATOM 10932  O O    . PHE B 2 158 ? 0.504   0.415   -16.036 1.00 0.00 ? 158 PHE B O    2  
ATOM 10933  C CB   . PHE B 2 158 ? 2.812   1.921   -17.690 1.00 0.00 ? 158 PHE B CB   2  
ATOM 10934  C CG   . PHE B 2 158 ? 2.577   2.860   -16.540 1.00 0.00 ? 158 PHE B CG   2  
ATOM 10935  C CD1  . PHE B 2 158 ? 3.404   2.836   -15.429 1.00 0.00 ? 158 PHE B CD1  2  
ATOM 10936  C CD2  . PHE B 2 158 ? 1.529   3.768   -16.569 1.00 0.00 ? 158 PHE B CD2  2  
ATOM 10937  C CE1  . PHE B 2 158 ? 3.193   3.699   -14.370 1.00 0.00 ? 158 PHE B CE1  2  
ATOM 10938  C CE2  . PHE B 2 158 ? 1.313   4.633   -15.513 1.00 0.00 ? 158 PHE B CE2  2  
ATOM 10939  C CZ   . PHE B 2 158 ? 2.146   4.598   -14.411 1.00 0.00 ? 158 PHE B CZ   2  
ATOM 10940  H H    . PHE B 2 158 ? 3.004   -0.090  -19.362 1.00 0.00 ? 158 PHE B H    2  
ATOM 10941  H HA   . PHE B 2 158 ? 3.011   0.185   -16.456 1.00 0.00 ? 158 PHE B HA   2  
ATOM 10942  H HB2  . PHE B 2 158 ? 3.859   1.994   -17.986 1.00 0.00 ? 158 PHE B HB2  2  
ATOM 10943  H HB3  . PHE B 2 158 ? 2.190   2.238   -18.527 1.00 0.00 ? 158 PHE B HB3  2  
ATOM 10944  H HD1  . PHE B 2 158 ? 4.223   2.134   -15.389 1.00 0.00 ? 158 PHE B HD1  2  
ATOM 10945  H HD2  . PHE B 2 158 ? 0.875   3.800   -17.428 1.00 0.00 ? 158 PHE B HD2  2  
ATOM 10946  H HE1  . PHE B 2 158 ? 3.847   3.669   -13.510 1.00 0.00 ? 158 PHE B HE1  2  
ATOM 10947  H HE2  . PHE B 2 158 ? 0.493   5.335   -15.549 1.00 0.00 ? 158 PHE B HE2  2  
ATOM 10948  H HZ   . PHE B 2 158 ? 1.979   5.273   -13.585 1.00 0.00 ? 158 PHE B HZ   2  
ATOM 10949  N N    . SER B 2 159 ? 0.280   -0.079  -18.218 1.00 0.00 ? 159 SER B N    2  
ATOM 10950  C CA   . SER B 2 159 ? -1.165  -0.269  -18.140 1.00 0.00 ? 159 SER B CA   2  
ATOM 10951  C C    . SER B 2 159 ? -1.548  -1.740  -17.976 1.00 0.00 ? 159 SER B C    2  
ATOM 10952  O O    . SER B 2 159 ? -2.727  -2.077  -17.879 1.00 0.00 ? 159 SER B O    2  
ATOM 10953  C CB   . SER B 2 159 ? -1.827  0.305   -19.395 1.00 0.00 ? 159 SER B CB   2  
ATOM 10954  O OG   . SER B 2 159 ? -1.020  1.317   -19.982 1.00 0.00 ? 159 SER B OG   2  
ATOM 10955  H H    . SER B 2 159 ? 0.729   -0.193  -19.081 1.00 0.00 ? 159 SER B H    2  
ATOM 10956  H HA   . SER B 2 159 ? -1.531  0.278   -17.271 1.00 0.00 ? 159 SER B HA   2  
ATOM 10957  H HB2  . SER B 2 159 ? -1.974  -0.497  -20.119 1.00 0.00 ? 159 SER B HB2  2  
ATOM 10958  H HB3  . SER B 2 159 ? -2.793  0.733   -19.125 1.00 0.00 ? 159 SER B HB3  2  
ATOM 10959  H HG   . SER B 2 159 ? -1.568  2.092   -20.165 1.00 0.00 ? 159 SER B HG   2  
ATOM 10960  N N    . ARG B 2 160 ? -0.549  -2.612  -17.945 1.00 0.00 ? 160 ARG B N    2  
ATOM 10961  C CA   . ARG B 2 160 ? -0.798  -4.042  -17.802 1.00 0.00 ? 160 ARG B CA   2  
ATOM 10962  C C    . ARG B 2 160 ? -0.296  -4.551  -16.453 1.00 0.00 ? 160 ARG B C    2  
ATOM 10963  O O    . ARG B 2 160 ? -0.622  -5.661  -16.032 1.00 0.00 ? 160 ARG B O    2  
ATOM 10964  C CB   . ARG B 2 160 ? -0.140  -4.811  -18.957 1.00 0.00 ? 160 ARG B CB   2  
ATOM 10965  C CG   . ARG B 2 160 ? -0.388  -6.312  -18.955 1.00 0.00 ? 160 ARG B CG   2  
ATOM 10966  C CD   . ARG B 2 160 ? 0.381   -6.995  -20.072 1.00 0.00 ? 160 ARG B CD   2  
ATOM 10967  N NE   . ARG B 2 160 ? 0.639   -8.404  -19.779 1.00 0.00 ? 160 ARG B NE   2  
ATOM 10968  C CZ   . ARG B 2 160 ? 1.844   -8.964  -19.840 1.00 0.00 ? 160 ARG B CZ   2  
ATOM 10969  N NH1  . ARG B 2 160 ? 2.897   -8.242  -20.207 1.00 0.00 ? 160 ARG B NH1  2  
ATOM 10970  N NH2  . ARG B 2 160 ? 1.994   -10.248 -19.535 1.00 0.00 ? 160 ARG B NH2  2  
ATOM 10971  H H    . ARG B 2 160 ? 0.369   -2.289  -18.023 1.00 0.00 ? 160 ARG B H    2  
ATOM 10972  H HA   . ARG B 2 160 ? -1.875  -4.206  -17.850 1.00 0.00 ? 160 ARG B HA   2  
ATOM 10973  H HB2  . ARG B 2 160 ? -0.523  -4.407  -19.894 1.00 0.00 ? 160 ARG B HB2  2  
ATOM 10974  H HB3  . ARG B 2 160 ? 0.936   -4.647  -18.903 1.00 0.00 ? 160 ARG B HB3  2  
ATOM 10975  H HG2  . ARG B 2 160 ? -0.067  -6.724  -17.998 1.00 0.00 ? 160 ARG B HG2  2  
ATOM 10976  H HG3  . ARG B 2 160 ? -1.454  -6.497  -19.091 1.00 0.00 ? 160 ARG B HG3  2  
ATOM 10977  H HD2  . ARG B 2 160 ? -0.198  -6.926  -20.993 1.00 0.00 ? 160 ARG B HD2  2  
ATOM 10978  H HD3  . ARG B 2 160 ? 1.334   -6.483  -20.209 1.00 0.00 ? 160 ARG B HD3  2  
ATOM 10979  H HE   . ARG B 2 160 ? -0.132  -8.959  -19.520 1.00 0.00 ? 160 ARG B HE   2  
ATOM 10980  H HH11 . ARG B 2 160 ? 2.789   -7.264  -20.436 1.00 0.00 ? 160 ARG B HH11 2  
ATOM 10981  H HH12 . ARG B 2 160 ? 3.805   -8.665  -20.259 1.00 0.00 ? 160 ARG B HH12 2  
ATOM 10982  H HH21 . ARG B 2 160 ? 1.199   -10.795 -19.252 1.00 0.00 ? 160 ARG B HH21 2  
ATOM 10983  H HH22 . ARG B 2 160 ? 2.896   -10.678 -19.585 1.00 0.00 ? 160 ARG B HH22 2  
ATOM 10984  N N    . TYR B 2 161 ? 0.486   -3.731  -15.767 1.00 0.00 ? 161 TYR B N    2  
ATOM 10985  C CA   . TYR B 2 161 ? 1.031   -4.113  -14.473 1.00 0.00 ? 161 TYR B CA   2  
ATOM 10986  C C    . TYR B 2 161 ? 0.524   -3.198  -13.369 1.00 0.00 ? 161 TYR B C    2  
ATOM 10987  O O    . TYR B 2 161 ? 0.505   -1.972  -13.519 1.00 0.00 ? 161 TYR B O    2  
ATOM 10988  C CB   . TYR B 2 161 ? 2.562   -4.111  -14.507 1.00 0.00 ? 161 TYR B CB   2  
ATOM 10989  C CG   . TYR B 2 161 ? 3.171   -5.297  -15.225 1.00 0.00 ? 161 TYR B CG   2  
ATOM 10990  C CD1  . TYR B 2 161 ? 3.059   -5.436  -16.602 1.00 0.00 ? 161 TYR B CD1  2  
ATOM 10991  C CD2  . TYR B 2 161 ? 3.858   -6.279  -14.524 1.00 0.00 ? 161 TYR B CD2  2  
ATOM 10992  C CE1  . TYR B 2 161 ? 3.614   -6.514  -17.260 1.00 0.00 ? 161 TYR B CE1  2  
ATOM 10993  C CE2  . TYR B 2 161 ? 4.418   -7.362  -15.174 1.00 0.00 ? 161 TYR B CE2  2  
ATOM 10994  C CZ   . TYR B 2 161 ? 4.290   -7.476  -16.541 1.00 0.00 ? 161 TYR B CZ   2  
ATOM 10995  O OH   . TYR B 2 161 ? 4.847   -8.550  -17.196 1.00 0.00 ? 161 TYR B OH   2  
ATOM 10996  H H    . TYR B 2 161 ? 0.692   -2.845  -16.130 1.00 0.00 ? 161 TYR B H    2  
ATOM 10997  H HA   . TYR B 2 161 ? 0.696   -5.127  -14.256 1.00 0.00 ? 161 TYR B HA   2  
ATOM 10998  H HB2  . TYR B 2 161 ? 2.895   -3.200  -15.004 1.00 0.00 ? 161 TYR B HB2  2  
ATOM 10999  H HB3  . TYR B 2 161 ? 2.930   -4.104  -13.481 1.00 0.00 ? 161 TYR B HB3  2  
ATOM 11000  H HD1  . TYR B 2 161 ? 2.527   -4.686  -17.169 1.00 0.00 ? 161 TYR B HD1  2  
ATOM 11001  H HD2  . TYR B 2 161 ? 3.957   -6.195  -13.452 1.00 0.00 ? 161 TYR B HD2  2  
ATOM 11002  H HE1  . TYR B 2 161 ? 3.520   -6.604  -18.332 1.00 0.00 ? 161 TYR B HE1  2  
ATOM 11003  H HE2  . TYR B 2 161 ? 4.952   -8.116  -14.614 1.00 0.00 ? 161 TYR B HE2  2  
ATOM 11004  H HH   . TYR B 2 161 ? 4.761   -9.335  -16.646 1.00 0.00 ? 161 TYR B HH   2  
ATOM 11005  N N    . ASP B 2 162 ? 0.109   -3.795  -12.264 1.00 0.00 ? 162 ASP B N    2  
ATOM 11006  C CA   . ASP B 2 162 ? -0.389  -3.036  -11.132 1.00 0.00 ? 162 ASP B CA   2  
ATOM 11007  C C    . ASP B 2 162 ? 0.762   -2.711  -10.193 1.00 0.00 ? 162 ASP B C    2  
ATOM 11008  O O    . ASP B 2 162 ? 1.716   -3.484  -10.086 1.00 0.00 ? 162 ASP B O    2  
ATOM 11009  C CB   . ASP B 2 162 ? -1.472  -3.823  -10.395 1.00 0.00 ? 162 ASP B CB   2  
ATOM 11010  C CG   . ASP B 2 162 ? -2.843  -3.192  -10.524 1.00 0.00 ? 162 ASP B CG   2  
ATOM 11011  O OD1  . ASP B 2 162 ? -3.523  -3.030  -9.494  1.00 0.00 ? 162 ASP B OD1  2  
ATOM 11012  O OD2  . ASP B 2 162 ? -3.241  -2.845  -11.655 1.00 0.00 ? 162 ASP B OD2  2  
ATOM 11013  H H    . ASP B 2 162 ? 0.149   -4.769  -12.199 1.00 0.00 ? 162 ASP B H    2  
ATOM 11014  H HA   . ASP B 2 162 ? -0.821  -2.104  -11.498 1.00 0.00 ? 162 ASP B HA   2  
ATOM 11015  H HB2  . ASP B 2 162 ? -1.512  -4.832  -10.804 1.00 0.00 ? 162 ASP B HB2  2  
ATOM 11016  H HB3  . ASP B 2 162 ? -1.210  -3.874  -9.338  1.00 0.00 ? 162 ASP B HB3  2  
ATOM 11017  H HD2  . ASP B 2 162 ? -4.116  -2.451  -11.659 1.00 0.00 ? 162 ASP B HD2  2  
ATOM 11018  N N    . MET B 2 163 ? 0.678   -1.574  -9.520  1.00 0.00 ? 163 MET B N    2  
ATOM 11019  C CA   . MET B 2 163 ? 1.737   -1.153  -8.612  1.00 0.00 ? 163 MET B CA   2  
ATOM 11020  C C    . MET B 2 163 ? 1.197   -0.937  -7.209  1.00 0.00 ? 163 MET B C    2  
ATOM 11021  O O    . MET B 2 163 ? -0.016  -0.835  -7.009  1.00 0.00 ? 163 MET B O    2  
ATOM 11022  C CB   . MET B 2 163 ? 2.377   0.147   -9.113  1.00 0.00 ? 163 MET B CB   2  
ATOM 11023  C CG   . MET B 2 163 ? 2.737   0.153   -10.591 1.00 0.00 ? 163 MET B CG   2  
ATOM 11024  S SD   . MET B 2 163 ? 4.190   -0.843  -10.969 1.00 0.00 ? 163 MET B SD   2  
ATOM 11025  C CE   . MET B 2 163 ? 5.461   0.072   -10.101 1.00 0.00 ? 163 MET B CE   2  
ATOM 11026  H H    . MET B 2 163 ? -0.114  -1.005  -9.620  1.00 0.00 ? 163 MET B H    2  
ATOM 11027  H HA   . MET B 2 163 ? 2.497   -1.934  -8.582  1.00 0.00 ? 163 MET B HA   2  
ATOM 11028  H HB2  . MET B 2 163 ? 1.677   0.963   -8.931  1.00 0.00 ? 163 MET B HB2  2  
ATOM 11029  H HB3  . MET B 2 163 ? 3.290   0.318   -8.542  1.00 0.00 ? 163 MET B HB3  2  
ATOM 11030  H HG2  . MET B 2 163 ? 1.891   -0.234  -11.158 1.00 0.00 ? 163 MET B HG2  2  
ATOM 11031  H HG3  . MET B 2 163 ? 2.926   1.180   -10.902 1.00 0.00 ? 163 MET B HG3  2  
ATOM 11032  H HE1  . MET B 2 163 ? 5.220   0.108   -9.038  1.00 0.00 ? 163 MET B HE1  2  
ATOM 11033  H HE2  . MET B 2 163 ? 6.427   -0.414  -10.235 1.00 0.00 ? 163 MET B HE2  2  
ATOM 11034  H HE3  . MET B 2 163 ? 5.511   1.087   -10.496 1.00 0.00 ? 163 MET B HE3  2  
ATOM 11035  N N    . SER B 2 164 ? 2.100   -0.861  -6.243  1.00 0.00 ? 164 SER B N    2  
ATOM 11036  C CA   . SER B 2 164 ? 1.737   -0.643  -4.851  1.00 0.00 ? 164 SER B CA   2  
ATOM 11037  C C    . SER B 2 164 ? 2.848   0.146   -4.165  1.00 0.00 ? 164 SER B C    2  
ATOM 11038  O O    . SER B 2 164 ? 3.880   0.433   -4.776  1.00 0.00 ? 164 SER B O    2  
ATOM 11039  C CB   . SER B 2 164 ? 1.536   -1.985  -4.135  1.00 0.00 ? 164 SER B CB   2  
ATOM 11040  O OG   . SER B 2 164 ? 0.678   -2.841  -4.872  1.00 0.00 ? 164 SER B OG   2  
ATOM 11041  H H    . SER B 2 164 ? 3.056   -0.946  -6.462  1.00 0.00 ? 164 SER B H    2  
ATOM 11042  H HA   . SER B 2 164 ? 0.808   -0.074  -4.810  1.00 0.00 ? 164 SER B HA   2  
ATOM 11043  H HB2  . SER B 2 164 ? 2.504   -2.472  -4.014  1.00 0.00 ? 164 SER B HB2  2  
ATOM 11044  H HB3  . SER B 2 164 ? 1.096   -1.802  -3.155  1.00 0.00 ? 164 SER B HB3  2  
ATOM 11045  H HG   . SER B 2 164 ? 1.197   -3.336  -5.521  1.00 0.00 ? 164 SER B HG   2  
ATOM 11046  N N    . TRP B 2 165 ? 2.639   0.503   -2.909  1.00 0.00 ? 165 TRP B N    2  
ATOM 11047  C CA   . TRP B 2 165 ? 3.637   1.250   -2.156  1.00 0.00 ? 165 TRP B CA   2  
ATOM 11048  C C    . TRP B 2 165 ? 3.941   0.567   -0.830  1.00 0.00 ? 165 TRP B C    2  
ATOM 11049  O O    . TRP B 2 165 ? 3.026   0.129   -0.126  1.00 0.00 ? 165 TRP B O    2  
ATOM 11050  C CB   . TRP B 2 165 ? 3.185   2.693   -1.923  1.00 0.00 ? 165 TRP B CB   2  
ATOM 11051  C CG   . TRP B 2 165 ? 3.371   3.580   -3.117  1.00 0.00 ? 165 TRP B CG   2  
ATOM 11052  C CD1  . TRP B 2 165 ? 2.432   3.906   -4.049  1.00 0.00 ? 165 TRP B CD1  2  
ATOM 11053  C CD2  . TRP B 2 165 ? 4.577   4.251   -3.509  1.00 0.00 ? 165 TRP B CD2  2  
ATOM 11054  N NE1  . TRP B 2 165 ? 2.974   4.738   -4.998  1.00 0.00 ? 165 TRP B NE1  2  
ATOM 11055  C CE2  . TRP B 2 165 ? 4.292   4.965   -4.690  1.00 0.00 ? 165 TRP B CE2  2  
ATOM 11056  C CE3  . TRP B 2 165 ? 5.870   4.319   -2.977  1.00 0.00 ? 165 TRP B CE3  2  
ATOM 11057  C CZ2  . TRP B 2 165 ? 5.249   5.735   -5.346  1.00 0.00 ? 165 TRP B CZ2  2  
ATOM 11058  C CZ3  . TRP B 2 165 ? 6.818   5.084   -3.631  1.00 0.00 ? 165 TRP B CZ3  2  
ATOM 11059  C CH2  . TRP B 2 165 ? 6.502   5.782   -4.803  1.00 0.00 ? 165 TRP B CH2  2  
ATOM 11060  H H    . TRP B 2 165 ? 1.791   0.262   -2.474  1.00 0.00 ? 165 TRP B H    2  
ATOM 11061  H HA   . TRP B 2 165 ? 4.553   1.272   -2.747  1.00 0.00 ? 165 TRP B HA   2  
ATOM 11062  H HB2  . TRP B 2 165 ? 2.129   2.689   -1.654  1.00 0.00 ? 165 TRP B HB2  2  
ATOM 11063  H HB3  . TRP B 2 165 ? 3.752   3.107   -1.089  1.00 0.00 ? 165 TRP B HB3  2  
ATOM 11064  H HD1  . TRP B 2 165 ? 1.409   3.560   -4.042  1.00 0.00 ? 165 TRP B HD1  2  
ATOM 11065  H HE1  . TRP B 2 165 ? 2.498   5.108   -5.770  1.00 0.00 ? 165 TRP B HE1  2  
ATOM 11066  H HE3  . TRP B 2 165 ? 6.122   3.784   -2.074  1.00 0.00 ? 165 TRP B HE3  2  
ATOM 11067  H HZ2  . TRP B 2 165 ? 5.010   6.275   -6.251  1.00 0.00 ? 165 TRP B HZ2  2  
ATOM 11068  H HZ3  . TRP B 2 165 ? 7.819   5.143   -3.230  1.00 0.00 ? 165 TRP B HZ3  2  
ATOM 11069  H HH2  . TRP B 2 165 ? 7.266   6.371   -5.289  1.00 0.00 ? 165 TRP B HH2  2  
ATOM 11070  N N    . VAL B 2 166 ? 5.224   0.463   -0.507  1.00 0.00 ? 166 VAL B N    2  
ATOM 11071  C CA   . VAL B 2 166 ? 5.666   -0.163  0.737   1.00 0.00 ? 166 VAL B CA   2  
ATOM 11072  C C    . VAL B 2 166 ? 6.770   0.682   1.373   1.00 0.00 ? 166 VAL B C    2  
ATOM 11073  O O    . VAL B 2 166 ? 7.622   1.230   0.669   1.00 0.00 ? 166 VAL B O    2  
ATOM 11074  C CB   . VAL B 2 166 ? 6.195   -1.601  0.498   1.00 0.00 ? 166 VAL B CB   2  
ATOM 11075  C CG1  . VAL B 2 166 ? 6.580   -2.265  1.812   1.00 0.00 ? 166 VAL B CG1  2  
ATOM 11076  C CG2  . VAL B 2 166 ? 5.170   -2.450  -0.243  1.00 0.00 ? 166 VAL B CG2  2  
ATOM 11077  H H    . VAL B 2 166 ? 5.902   0.827   -1.121  1.00 0.00 ? 166 VAL B H    2  
ATOM 11078  H HA   . VAL B 2 166 ? 4.816   -0.212  1.418   1.00 0.00 ? 166 VAL B HA   2  
ATOM 11079  H HB   . VAL B 2 166 ? 7.089   -1.532  -0.122  1.00 0.00 ? 166 VAL B HB   2  
ATOM 11080  H HG11 . VAL B 2 166 ? 6.975   -3.263  1.622   1.00 0.00 ? 166 VAL B HG11 2  
ATOM 11081  H HG12 . VAL B 2 166 ? 7.340   -1.666  2.312   1.00 0.00 ? 166 VAL B HG12 2  
ATOM 11082  H HG13 . VAL B 2 166 ? 5.700   -2.342  2.451   1.00 0.00 ? 166 VAL B HG13 2  
ATOM 11083  H HG21 . VAL B 2 166 ? 4.933   -1.980  -1.197  1.00 0.00 ? 166 VAL B HG21 2  
ATOM 11084  H HG22 . VAL B 2 166 ? 5.573   -3.447  -0.423  1.00 0.00 ? 166 VAL B HG22 2  
ATOM 11085  H HG23 . VAL B 2 166 ? 4.264   -2.530  0.357   1.00 0.00 ? 166 VAL B HG23 2  
ATOM 11086  N N    . ARG B 2 167 ? 6.751   0.801   2.695   1.00 0.00 ? 167 ARG B N    2  
ATOM 11087  C CA   . ARG B 2 167 ? 7.758   1.586   3.396   1.00 0.00 ? 167 ARG B CA   2  
ATOM 11088  C C    . ARG B 2 167 ? 8.471   0.757   4.454   1.00 0.00 ? 167 ARG B C    2  
ATOM 11089  O O    . ARG B 2 167 ? 7.920   -0.212  4.975   1.00 0.00 ? 167 ARG B O    2  
ATOM 11090  C CB   . ARG B 2 167 ? 7.151   2.849   4.020   1.00 0.00 ? 167 ARG B CB   2  
ATOM 11091  C CG   . ARG B 2 167 ? 6.234   2.604   5.212   1.00 0.00 ? 167 ARG B CG   2  
ATOM 11092  C CD   . ARG B 2 167 ? 5.668   3.912   5.743   1.00 0.00 ? 167 ARG B CD   2  
ATOM 11093  N NE   . ARG B 2 167 ? 4.743   3.712   6.857   1.00 0.00 ? 167 ARG B NE   2  
ATOM 11094  C CZ   . ARG B 2 167 ? 4.045   4.689   7.435   1.00 0.00 ? 167 ARG B CZ   2  
ATOM 11095  N NH1  . ARG B 2 167 ? 4.142   5.944   6.997   1.00 0.00 ? 167 ARG B NH1  2  
ATOM 11096  N NH2  . ARG B 2 167 ? 3.242   4.403   8.451   1.00 0.00 ? 167 ARG B NH2  2  
ATOM 11097  H H    . ARG B 2 167 ? 6.051   0.340   3.214   1.00 0.00 ? 167 ARG B H    2  
ATOM 11098  H HA   . ARG B 2 167 ? 8.499   1.900   2.660   1.00 0.00 ? 167 ARG B HA   2  
ATOM 11099  H HB2  . ARG B 2 167 ? 7.970   3.490   4.350   1.00 0.00 ? 167 ARG B HB2  2  
ATOM 11100  H HB3  . ARG B 2 167 ? 6.575   3.363   3.251   1.00 0.00 ? 167 ARG B HB3  2  
ATOM 11101  H HG2  . ARG B 2 167 ? 5.411   1.959   4.902   1.00 0.00 ? 167 ARG B HG2  2  
ATOM 11102  H HG3  . ARG B 2 167 ? 6.801   2.114   6.004   1.00 0.00 ? 167 ARG B HG3  2  
ATOM 11103  H HD2  . ARG B 2 167 ? 6.492   4.540   6.080   1.00 0.00 ? 167 ARG B HD2  2  
ATOM 11104  H HD3  . ARG B 2 167 ? 5.139   4.419   4.935   1.00 0.00 ? 167 ARG B HD3  2  
ATOM 11105  H HE   . ARG B 2 167 ? 4.636   2.790   7.199   1.00 0.00 ? 167 ARG B HE   2  
ATOM 11106  H HH11 . ARG B 2 167 ? 4.745   6.165   6.223   1.00 0.00 ? 167 ARG B HH11 2  
ATOM 11107  H HH12 . ARG B 2 167 ? 3.607   6.682   7.438   1.00 0.00 ? 167 ARG B HH12 2  
ATOM 11108  H HH21 . ARG B 2 167 ? 3.163   3.450   8.773   1.00 0.00 ? 167 ARG B HH21 2  
ATOM 11109  H HH22 . ARG B 2 167 ? 2.720   5.128   8.902   1.00 0.00 ? 167 ARG B HH22 2  
ATOM 11110  N N    . GLN B 2 168 ? 9.701   1.136   4.757   1.00 0.00 ? 168 GLN B N    2  
ATOM 11111  C CA   . GLN B 2 168 ? 10.491  0.439   5.760   1.00 0.00 ? 168 GLN B CA   2  
ATOM 11112  C C    . GLN B 2 168 ? 11.195  1.434   6.672   1.00 0.00 ? 168 GLN B C    2  
ATOM 11113  O O    . GLN B 2 168 ? 12.050  2.202   6.224   1.00 0.00 ? 168 GLN B O    2  
ATOM 11114  C CB   . GLN B 2 168 ? 11.511  -0.483  5.093   1.00 0.00 ? 168 GLN B CB   2  
ATOM 11115  C CG   . GLN B 2 168 ? 12.392  -1.245  6.070   1.00 0.00 ? 168 GLN B CG   2  
ATOM 11116  C CD   . GLN B 2 168 ? 13.414  -2.127  5.379   1.00 0.00 ? 168 GLN B CD   2  
ATOM 11117  O OE1  . GLN B 2 168 ? 13.872  -1.829  4.275   1.00 0.00 ? 168 GLN B OE1  2  
ATOM 11118  N NE2  . GLN B 2 168 ? 13.781  -3.221  6.028   1.00 0.00 ? 168 GLN B NE2  2  
ATOM 11119  H H    . GLN B 2 168 ? 10.095  1.903   4.284   1.00 0.00 ? 168 GLN B H    2  
ATOM 11120  H HA   . GLN B 2 168 ? 9.817   -0.170  6.363   1.00 0.00 ? 168 GLN B HA   2  
ATOM 11121  H HB2  . GLN B 2 168 ? 10.972  -1.207  4.483   1.00 0.00 ? 168 GLN B HB2  2  
ATOM 11122  H HB3  . GLN B 2 168 ? 12.154  0.123   4.455   1.00 0.00 ? 168 GLN B HB3  2  
ATOM 11123  H HG2  . GLN B 2 168 ? 12.920  -0.528  6.698   1.00 0.00 ? 168 GLN B HG2  2  
ATOM 11124  H HG3  . GLN B 2 168 ? 11.757  -1.872  6.696   1.00 0.00 ? 168 GLN B HG3  2  
ATOM 11125  H HE21 . GLN B 2 168 ? 13.376  -3.396  6.906   1.00 0.00 ? 168 GLN B HE21 2  
ATOM 11126  H HE22 . GLN B 2 168 ? 14.445  -3.810  5.609   1.00 0.00 ? 168 GLN B HE22 2  
ATOM 11127  N N    . ALA B 2 169 ? 10.800  1.445   7.938   1.00 0.00 ? 169 ALA B N    2  
ATOM 11128  C CA   . ALA B 2 169 ? 11.394  2.340   8.922   1.00 0.00 ? 169 ALA B CA   2  
ATOM 11129  C C    . ALA B 2 169 ? 12.764  1.813   9.337   1.00 0.00 ? 169 ALA B C    2  
ATOM 11130  O O    . ALA B 2 169 ? 13.009  0.614   9.251   1.00 0.00 ? 169 ALA B O    2  
ATOM 11131  C CB   . ALA B 2 169 ? 10.479  2.479   10.131  1.00 0.00 ? 169 ALA B CB   2  
ATOM 11132  H H    . ALA B 2 169 ? 10.079  0.843   8.213   1.00 0.00 ? 169 ALA B H    2  
ATOM 11133  H HA   . ALA B 2 169 ? 11.519  3.322   8.466   1.00 0.00 ? 169 ALA B HA   2  
ATOM 11134  H HB1  . ALA B 2 169 ? 10.925  3.165   10.851  1.00 0.00 ? 169 ALA B HB1  2  
ATOM 11135  H HB2  . ALA B 2 169 ? 9.512   2.867   9.812   1.00 0.00 ? 169 ALA B HB2  2  
ATOM 11136  H HB3  . ALA B 2 169 ? 10.344  1.503   10.597  1.00 0.00 ? 169 ALA B HB3  2  
ATOM 11137  N N    . PRO B 2 170 ? 13.671  2.699   9.780   1.00 0.00 ? 170 PRO B N    2  
ATOM 11138  C CA   . PRO B 2 170 ? 15.024  2.307   10.199  1.00 0.00 ? 170 PRO B CA   2  
ATOM 11139  C C    . PRO B 2 170 ? 15.011  1.246   11.302  1.00 0.00 ? 170 PRO B C    2  
ATOM 11140  O O    . PRO B 2 170 ? 14.690  1.534   12.459  1.00 0.00 ? 170 PRO B O    2  
ATOM 11141  C CB   . PRO B 2 170 ? 15.634  3.611   10.723  1.00 0.00 ? 170 PRO B CB   2  
ATOM 11142  C CG   . PRO B 2 170 ? 14.852  4.686   10.053  1.00 0.00 ? 170 PRO B CG   2  
ATOM 11143  C CD   . PRO B 2 170 ? 13.457  4.153   9.910   1.00 0.00 ? 170 PRO B CD   2  
ATOM 11144  H HA   . PRO B 2 170 ? 15.593  1.933   9.348   1.00 0.00 ? 170 PRO B HA   2  
ATOM 11145  H HB2  . PRO B 2 170 ? 15.573  3.679   11.809  1.00 0.00 ? 170 PRO B HB2  2  
ATOM 11146  H HB3  . PRO B 2 170 ? 16.670  3.673   10.389  1.00 0.00 ? 170 PRO B HB3  2  
ATOM 11147  H HG2  . PRO B 2 170 ? 14.825  5.554   10.713  1.00 0.00 ? 170 PRO B HG2  2  
ATOM 11148  H HG3  . PRO B 2 170 ? 15.280  4.950   9.086   1.00 0.00 ? 170 PRO B HG3  2  
ATOM 11149  H HD2  . PRO B 2 170 ? 12.846  4.402   10.777  1.00 0.00 ? 170 PRO B HD2  2  
ATOM 11150  H HD3  . PRO B 2 170 ? 12.998  4.537   8.999   1.00 0.00 ? 170 PRO B HD3  2  
ATOM 11151  N N    . GLY B 2 171 ? 15.337  0.014   10.924  1.00 0.00 ? 171 GLY B N    2  
ATOM 11152  C CA   . GLY B 2 171 ? 15.371  -1.081  11.875  1.00 0.00 ? 171 GLY B CA   2  
ATOM 11153  C C    . GLY B 2 171 ? 14.078  -1.871  11.891  1.00 0.00 ? 171 GLY B C    2  
ATOM 11154  O O    . GLY B 2 171 ? 13.989  -2.930  12.516  1.00 0.00 ? 171 GLY B O    2  
ATOM 11155  H H    . GLY B 2 171 ? 15.546  -0.156  9.979   1.00 0.00 ? 171 GLY B H    2  
ATOM 11156  H HA2  . GLY B 2 171 ? 16.188  -1.752  11.609  1.00 0.00 ? 171 GLY B HA2  2  
ATOM 11157  H HA3  . GLY B 2 171 ? 15.547  -0.675  12.871  1.00 0.00 ? 171 GLY B HA3  2  
ATOM 11158  N N    . LYS B 2 172 ? 13.079  -1.365  11.187  1.00 0.00 ? 172 LYS B N    2  
ATOM 11159  C CA   . LYS B 2 172 ? 11.776  -2.007  11.119  1.00 0.00 ? 172 LYS B CA   2  
ATOM 11160  C C    . LYS B 2 172 ? 11.669  -2.824  9.833   1.00 0.00 ? 172 LYS B C    2  
ATOM 11161  O O    . LYS B 2 172 ? 12.547  -2.756  8.969   1.00 0.00 ? 172 LYS B O    2  
ATOM 11162  C CB   . LYS B 2 172 ? 10.676  -0.934  11.174  1.00 0.00 ? 172 LYS B CB   2  
ATOM 11163  C CG   . LYS B 2 172 ? 9.262   -1.451  11.399  1.00 0.00 ? 172 LYS B CG   2  
ATOM 11164  C CD   . LYS B 2 172 ? 8.275   -0.301  11.532  1.00 0.00 ? 172 LYS B CD   2  
ATOM 11165  C CE   . LYS B 2 172 ? 6.839   -0.775  11.371  1.00 0.00 ? 172 LYS B CE   2  
ATOM 11166  N NZ   . LYS B 2 172 ? 5.860   0.292   11.715  1.00 0.00 ? 172 LYS B NZ   2  
ATOM 11167  H H    . LYS B 2 172 ? 13.229  -0.538  10.673  1.00 0.00 ? 172 LYS B H    2  
ATOM 11168  H HA   . LYS B 2 172 ? 11.663  -2.674  11.974  1.00 0.00 ? 172 LYS B HA   2  
ATOM 11169  H HB2  . LYS B 2 172 ? 10.916  -0.249  11.987  1.00 0.00 ? 172 LYS B HB2  2  
ATOM 11170  H HB3  . LYS B 2 172 ? 10.688  -0.393  10.227  1.00 0.00 ? 172 LYS B HB3  2  
ATOM 11171  H HG2  . LYS B 2 172 ? 8.972   -2.074  10.553  1.00 0.00 ? 172 LYS B HG2  2  
ATOM 11172  H HG3  . LYS B 2 172 ? 9.242   -2.045  12.312  1.00 0.00 ? 172 LYS B HG3  2  
ATOM 11173  H HD2  .