data_2KJD
# 
_entry.id   2KJD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2KJD         pdb_00002kjd 10.2210/pdb2kjd/pdb 
RCSB  RCSB101192   ?            ?                   
WWPDB D_1000101192 ?            ?                   
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2JXO PDB 'NMR structure of canonical PDZ domain (150-240)'   
unspecified 2OZF PDB 'X-ray structure of canonical PDZ domain (150-239)' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KJD 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-27 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bhattacharya, S.' 1 
'Cowburn, D.'      2 
'Bu, Z.'           3 
# 
_citation.id                        primary 
_citation.title                     'A dynamic intramolecular conformational switch autoregulates the scaffolding protein NHERF1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bhattacharya, S.' 1 ? 
primary 'Dai, Z.'          2 ? 
primary 'Li, J.'           3 ? 
primary 'Baxter, S.'       4 ? 
primary 'Callaway, D.J.E.' 5 ? 
primary 'Cowburn, D.'      6 ? 
primary 'Bu, Z.'           7 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Sodium/hydrogen exchange regulatory cofactor NHE-RF1' 
_entity.formula_weight             14100.970 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Extended PDZ2 domain: UNP residues 150-270' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;NHERF-1, Ezrin-radixin-moesin-binding phosphoprotein 50, EBP50, Regulatory cofactor of Na(+)/H(+) exchanger, Sodium-hydrogen exchanger regulatory factor 1, Solute carrier family 9 isoform A3 regulatory factor 1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAG
GDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAG
GDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ILE n 
1 3   ASP n 
1 4   PRO n 
1 5   PHE n 
1 6   THR n 
1 7   MET n 
1 8   LEU n 
1 9   ARG n 
1 10  PRO n 
1 11  ARG n 
1 12  LEU n 
1 13  CYS n 
1 14  THR n 
1 15  MET n 
1 16  LYS n 
1 17  LYS n 
1 18  GLY n 
1 19  PRO n 
1 20  SER n 
1 21  GLY n 
1 22  TYR n 
1 23  GLY n 
1 24  PHE n 
1 25  ASN n 
1 26  LEU n 
1 27  HIS n 
1 28  SER n 
1 29  ASP n 
1 30  LYS n 
1 31  SER n 
1 32  LYS n 
1 33  PRO n 
1 34  GLY n 
1 35  GLN n 
1 36  PHE n 
1 37  ILE n 
1 38  ARG n 
1 39  SER n 
1 40  VAL n 
1 41  ASP n 
1 42  PRO n 
1 43  ASP n 
1 44  SER n 
1 45  PRO n 
1 46  ALA n 
1 47  GLU n 
1 48  ALA n 
1 49  SER n 
1 50  GLY n 
1 51  LEU n 
1 52  ARG n 
1 53  ALA n 
1 54  GLN n 
1 55  ASP n 
1 56  ARG n 
1 57  ILE n 
1 58  VAL n 
1 59  GLU n 
1 60  VAL n 
1 61  ASN n 
1 62  GLY n 
1 63  VAL n 
1 64  CYS n 
1 65  MET n 
1 66  GLU n 
1 67  GLY n 
1 68  LYS n 
1 69  GLN n 
1 70  HIS n 
1 71  GLY n 
1 72  ASP n 
1 73  VAL n 
1 74  VAL n 
1 75  SER n 
1 76  ALA n 
1 77  ILE n 
1 78  ARG n 
1 79  ALA n 
1 80  GLY n 
1 81  GLY n 
1 82  ASP n 
1 83  GLU n 
1 84  THR n 
1 85  LYS n 
1 86  LEU n 
1 87  LEU n 
1 88  VAL n 
1 89  VAL n 
1 90  ASP n 
1 91  ARG n 
1 92  GLU n 
1 93  THR n 
1 94  ASP n 
1 95  GLU n 
1 96  PHE n 
1 97  PHE n 
1 98  LYS n 
1 99  LYS n 
1 100 CYS n 
1 101 ARG n 
1 102 VAL n 
1 103 ILE n 
1 104 PRO n 
1 105 SER n 
1 106 GLN n 
1 107 GLU n 
1 108 HIS n 
1 109 LEU n 
1 110 ASN n 
1 111 GLY n 
1 112 PRO n 
1 113 LEU n 
1 114 PRO n 
1 115 VAL n 
1 116 PRO n 
1 117 PHE n 
1 118 THR n 
1 119 ASN n 
1 120 GLY n 
1 121 GLU n 
1 122 ILE n 
1 123 GLN n 
1 124 LYS n 
1 125 GLU n 
1 126 ASN n 
1 127 SER n 
1 128 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SLC9A3R1, NHERF, NHERF1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET151/D-TOPO 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NHRF1_HUMAN 
_struct_ref.pdbx_db_accession          O14745 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLL
VVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSR
;
_struct_ref.pdbx_align_begin           150 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KJD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 128 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O14745 
_struct_ref_seq.db_align_beg                  150 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  270 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       128 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KJD GLY A 1 ? UNP O14745 ? ? 'expression tag' 1 1 
1 2KJD ILE A 2 ? UNP O14745 ? ? 'expression tag' 2 2 
1 2KJD ASP A 3 ? UNP O14745 ? ? 'expression tag' 3 3 
1 2KJD PRO A 4 ? UNP O14745 ? ? 'expression tag' 4 4 
1 2KJD PHE A 5 ? UNP O14745 ? ? 'expression tag' 5 5 
1 2KJD THR A 6 ? UNP O14745 ? ? 'expression tag' 6 6 
1 2KJD MET A 7 ? UNP O14745 ? ? 'expression tag' 7 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC'  
1 2 1 '2D 1H-13C HSQC'  
1 3 1 '3D HNCACB'       
1 4 1 '3D HCCH-TOCSY'   
1 5 1 '3D H(CCO)NH'     
1 6 1 '3D 1H-15N NOESY' 
1 7 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.150 
_pdbx_nmr_exptl_sample_conditions.pH                  7.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
'550 uM [U-100% 13C; U-100% 15N] PDZ2-270-1, 20 mM HEPES-2, 0.5 mM DTT-3, 0.1 mM PMSF-4, 150 mM sodium chloride-5, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker AVANCE 1 'Bruker Avance' 
900 Bruker AVANCE 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2KJD 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            500 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KJD 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KJD 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Guntert, Mumenthaler and Wuthrich' 'structure solution'         CYANA   1.3 1 
;Linge, O'Donoghue and Nilges
;
refinement                   ARIA    2.2 2 
'Keller and Wuthrich'               'data analysis'              CARA    1.5 3 
'Bruker Biospin'                    collection                   TopSpin 2.1 4 
'Bruker Biospin'                    processing                   TopSpin 2.1 5 
'Cornilescu, Delaglio and Bax'      'dihedral angle calculation' TALOS   ?   6 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KJD 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KJD 
_struct.title                     'Solution structure of extended PDZ2 domain from NHERF1 (150-270)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KJD 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;PDZ domain, PROTEIN, Acetylation, Cell projection, Disease mutation, Membrane, Phosphoprotein, Polymorphism, Wnt signaling pathway, SIGNALING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 44  ? GLY A 50  ? SER A 44  GLY A 50  1 ? 7  
HELX_P HELX_P2 2 GLN A 69  ? ALA A 79  ? GLN A 69  ALA A 79  1 ? 11 
HELX_P HELX_P3 3 ASP A 90  ? ARG A 101 ? ASP A 90  ARG A 101 1 ? 12 
HELX_P HELX_P4 4 SER A 105 ? ASN A 110 ? SER A 105 ASN A 110 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 11 ? LYS A 16 ? ARG A 11 LYS A 16 
A 2 GLU A 83 ? VAL A 89 ? GLU A 83 VAL A 89 
A 3 ARG A 56 ? VAL A 60 ? ARG A 56 VAL A 60 
A 4 VAL A 63 ? CYS A 64 ? VAL A 63 CYS A 64 
B 1 PHE A 24 ? SER A 28 ? PHE A 24 SER A 28 
B 2 GLN A 35 ? VAL A 40 ? GLN A 35 VAL A 40 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 13 ? N CYS A 13 O LEU A 86 ? O LEU A 86 
A 2 3 O LEU A 87 ? O LEU A 87 N VAL A 58 ? N VAL A 58 
A 3 4 N VAL A 60 ? N VAL A 60 O VAL A 63 ? O VAL A 63 
B 1 2 N ASN A 25 ? N ASN A 25 O SER A 39 ? O SER A 39 
# 
_atom_sites.entry_id                    2KJD 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -13.978 -12.758 6.588   1.00 11.87 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -14.805 -13.942 6.252   1.00 11.28 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -14.297 -14.665 5.023   1.00 10.17 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -13.177 -14.421 4.567   1.00 9.93  ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -14.012 -12.064 5.809   1.00 12.05 ? 1   GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1   ? -12.987 -13.044 6.738   1.00 12.06 ? 1   GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1   ? -14.335 -12.309 7.455   1.00 12.09 ? 1   GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1   ? -14.793 -14.624 7.088   1.00 11.56 ? 1   GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1   ? -15.820 -13.619 6.075   1.00 11.57 ? 1   GLY A HA3  1  
ATOM 10    N N    . ILE A 1 2   ? -15.122 -15.546 4.478   1.00 9.64  ? 2   ILE A N    1  
ATOM 11    C CA   . ILE A 1 2   ? -14.763 -16.306 3.287   1.00 8.69  ? 2   ILE A CA   1  
ATOM 12    C C    . ILE A 1 2   ? -15.284 -15.583 2.042   1.00 7.70  ? 2   ILE A C    1  
ATOM 13    O O    . ILE A 1 2   ? -16.001 -16.146 1.215   1.00 7.79  ? 2   ILE A O    1  
ATOM 14    C CB   . ILE A 1 2   ? -15.324 -17.751 3.346   1.00 9.07  ? 2   ILE A CB   1  
ATOM 15    C CG1  . ILE A 1 2   ? -15.022 -18.386 4.709   1.00 9.41  ? 2   ILE A CG1  1  
ATOM 16    C CG2  . ILE A 1 2   ? -14.736 -18.608 2.231   1.00 9.20  ? 2   ILE A CG2  1  
ATOM 17    C CD1  . ILE A 1 2   ? -13.543 -18.468 5.038   1.00 9.86  ? 2   ILE A CD1  1  
ATOM 18    H H    . ILE A 1 2   ? -16.010 -15.687 4.886   1.00 10.00 ? 2   ILE A H    1  
ATOM 19    H HA   . ILE A 1 2   ? -13.684 -16.356 3.237   1.00 8.63  ? 2   ILE A HA   1  
ATOM 20    H HB   . ILE A 1 2   ? -16.394 -17.705 3.208   1.00 9.29  ? 2   ILE A HB   1  
ATOM 21    H HG12 . ILE A 1 2   ? -15.497 -17.802 5.484   1.00 9.55  ? 2   ILE A HG12 1  
ATOM 22    H HG13 . ILE A 1 2   ? -15.422 -19.389 4.727   1.00 9.48  ? 2   ILE A HG13 1  
ATOM 23    H HG21 . ILE A 1 2   ? -13.660 -18.648 2.336   1.00 9.37  ? 2   ILE A HG21 1  
ATOM 24    H HG22 . ILE A 1 2   ? -14.987 -18.174 1.274   1.00 9.31  ? 2   ILE A HG22 1  
ATOM 25    H HG23 . ILE A 1 2   ? -15.142 -19.608 2.291   1.00 9.29  ? 2   ILE A HG23 1  
ATOM 26    H HD11 . ILE A 1 2   ? -13.036 -19.037 4.273   1.00 9.83  ? 2   ILE A HD11 1  
ATOM 27    H HD12 . ILE A 1 2   ? -13.413 -18.956 5.993   1.00 10.30 ? 2   ILE A HD12 1  
ATOM 28    H HD13 . ILE A 1 2   ? -13.127 -17.472 5.080   1.00 9.99  ? 2   ILE A HD13 1  
ATOM 29    N N    . ASP A 1 3   ? -14.936 -14.310 1.941   1.00 6.96  ? 3   ASP A N    1  
ATOM 30    C CA   . ASP A 1 3   ? -15.341 -13.486 0.810   1.00 6.18  ? 3   ASP A CA   1  
ATOM 31    C C    . ASP A 1 3   ? -14.259 -13.517 -0.264  1.00 5.44  ? 3   ASP A C    1  
ATOM 32    O O    . ASP A 1 3   ? -13.081 -13.324 0.031   1.00 5.15  ? 3   ASP A O    1  
ATOM 33    C CB   . ASP A 1 3   ? -15.585 -12.045 1.271   1.00 6.00  ? 3   ASP A CB   1  
ATOM 34    C CG   . ASP A 1 3   ? -16.171 -11.174 0.178   1.00 6.08  ? 3   ASP A CG   1  
ATOM 35    O OD1  . ASP A 1 3   ? -15.410 -10.695 -0.684  1.00 6.03  ? 3   ASP A OD1  1  
ATOM 36    O OD2  . ASP A 1 3   ? -17.405 -10.971 0.178   1.00 6.51  ? 3   ASP A OD2  1  
ATOM 37    H H    . ASP A 1 3   ? -14.381 -13.914 2.644   1.00 7.10  ? 3   ASP A H    1  
ATOM 38    H HA   . ASP A 1 3   ? -16.256 -13.893 0.406   1.00 6.61  ? 3   ASP A HA   1  
ATOM 39    H HB2  . ASP A 1 3   ? -16.271 -12.052 2.106   1.00 6.26  ? 3   ASP A HB2  1  
ATOM 40    H HB3  . ASP A 1 3   ? -14.647 -11.612 1.588   1.00 5.95  ? 3   ASP A HB3  1  
ATOM 41    N N    . PRO A 1 4   ? -14.638 -13.771 -1.524  1.00 5.55  ? 4   PRO A N    1  
ATOM 42    C CA   . PRO A 1 4   ? -13.680 -13.894 -2.631  1.00 5.42  ? 4   PRO A CA   1  
ATOM 43    C C    . PRO A 1 4   ? -12.916 -12.600 -2.919  1.00 4.78  ? 4   PRO A C    1  
ATOM 44    O O    . PRO A 1 4   ? -11.914 -12.612 -3.639  1.00 4.92  ? 4   PRO A O    1  
ATOM 45    C CB   . PRO A 1 4   ? -14.557 -14.270 -3.831  1.00 6.21  ? 4   PRO A CB   1  
ATOM 46    C CG   . PRO A 1 4   ? -15.928 -13.820 -3.463  1.00 6.65  ? 4   PRO A CG   1  
ATOM 47    C CD   . PRO A 1 4   ? -16.025 -13.971 -1.972  1.00 6.29  ? 4   PRO A CD   1  
ATOM 48    H HA   . PRO A 1 4   ? -12.970 -14.687 -2.445  1.00 5.67  ? 4   PRO A HA   1  
ATOM 49    H HB2  . PRO A 1 4   ? -14.198 -13.761 -4.713  1.00 6.22  ? 4   PRO A HB2  1  
ATOM 50    H HB3  . PRO A 1 4   ? -14.521 -15.338 -3.985  1.00 6.74  ? 4   PRO A HB3  1  
ATOM 51    H HG2  . PRO A 1 4   ? -16.064 -12.784 -3.745  1.00 6.90  ? 4   PRO A HG2  1  
ATOM 52    H HG3  . PRO A 1 4   ? -16.664 -14.441 -3.953  1.00 7.27  ? 4   PRO A HG3  1  
ATOM 53    H HD2  . PRO A 1 4   ? -16.677 -13.217 -1.558  1.00 6.29  ? 4   PRO A HD2  1  
ATOM 54    H HD3  . PRO A 1 4   ? -16.375 -14.959 -1.715  1.00 6.88  ? 4   PRO A HD3  1  
ATOM 55    N N    . PHE A 1 5   ? -13.379 -11.487 -2.359  1.00 4.52  ? 5   PHE A N    1  
ATOM 56    C CA   . PHE A 1 5   ? -12.749 -10.196 -2.604  1.00 4.35  ? 5   PHE A CA   1  
ATOM 57    C C    . PHE A 1 5   ? -12.096 -9.638  -1.339  1.00 3.69  ? 5   PHE A C    1  
ATOM 58    O O    . PHE A 1 5   ? -11.564 -8.533  -1.349  1.00 3.93  ? 5   PHE A O    1  
ATOM 59    C CB   . PHE A 1 5   ? -13.775 -9.192  -3.142  1.00 5.29  ? 5   PHE A CB   1  
ATOM 60    C CG   . PHE A 1 5   ? -14.430 -9.624  -4.422  1.00 6.13  ? 5   PHE A CG   1  
ATOM 61    C CD1  . PHE A 1 5   ? -13.758 -9.519  -5.629  1.00 6.78  ? 5   PHE A CD1  1  
ATOM 62    C CD2  . PHE A 1 5   ? -15.715 -10.143 -4.419  1.00 6.53  ? 5   PHE A CD2  1  
ATOM 63    C CE1  . PHE A 1 5   ? -14.356 -9.918  -6.808  1.00 7.72  ? 5   PHE A CE1  1  
ATOM 64    C CE2  . PHE A 1 5   ? -16.317 -10.545 -5.596  1.00 7.42  ? 5   PHE A CE2  1  
ATOM 65    C CZ   . PHE A 1 5   ? -15.637 -10.435 -6.793  1.00 7.99  ? 5   PHE A CZ   1  
ATOM 66    H H    . PHE A 1 5   ? -14.170 -11.532 -1.771  1.00 4.77  ? 5   PHE A H    1  
ATOM 67    H HA   . PHE A 1 5   ? -11.983 -10.344 -3.351  1.00 4.48  ? 5   PHE A HA   1  
ATOM 68    H HB2  . PHE A 1 5   ? -14.553 -9.055  -2.406  1.00 5.51  ? 5   PHE A HB2  1  
ATOM 69    H HB3  . PHE A 1 5   ? -13.286 -8.246  -3.322  1.00 5.50  ? 5   PHE A HB3  1  
ATOM 70    H HD1  . PHE A 1 5   ? -12.758 -9.115  -5.643  1.00 6.71  ? 5   PHE A HD1  1  
ATOM 71    H HD2  . PHE A 1 5   ? -16.249 -10.229 -3.485  1.00 6.31  ? 5   PHE A HD2  1  
ATOM 72    H HE1  . PHE A 1 5   ? -13.819 -9.831  -7.741  1.00 8.37  ? 5   PHE A HE1  1  
ATOM 73    H HE2  . PHE A 1 5   ? -17.319 -10.948 -5.578  1.00 7.82  ? 5   PHE A HE2  1  
ATOM 74    H HZ   . PHE A 1 5   ? -16.106 -10.751 -7.714  1.00 8.77  ? 5   PHE A HZ   1  
ATOM 75    N N    . THR A 1 6   ? -12.106 -10.410 -0.256  1.00 3.31  ? 6   THR A N    1  
ATOM 76    C CA   . THR A 1 6   ? -11.532 -9.942  1.006   1.00 3.02  ? 6   THR A CA   1  
ATOM 77    C C    . THR A 1 6   ? -10.004 -10.024 0.976   1.00 2.13  ? 6   THR A C    1  
ATOM 78    O O    . THR A 1 6   ? -9.332  -9.670  1.945   1.00 2.37  ? 6   THR A O    1  
ATOM 79    C CB   . THR A 1 6   ? -12.073 -10.742 2.214   1.00 3.65  ? 6   THR A CB   1  
ATOM 80    O OG1  . THR A 1 6   ? -11.782 -10.049 3.432   1.00 4.26  ? 6   THR A OG1  1  
ATOM 81    C CG2  . THR A 1 6   ? -11.465 -12.135 2.281   1.00 4.04  ? 6   THR A CG2  1  
ATOM 82    H H    . THR A 1 6   ? -12.513 -11.301 -0.300  1.00 3.60  ? 6   THR A H    1  
ATOM 83    H HA   . THR A 1 6   ? -11.819 -8.908  1.132   1.00 3.50  ? 6   THR A HA   1  
ATOM 84    H HB   . THR A 1 6   ? -13.146 -10.836 2.112   1.00 3.99  ? 6   THR A HB   1  
ATOM 85    H HG1  . THR A 1 6   ? -10.883 -9.700  3.392   1.00 4.39  ? 6   THR A HG1  1  
ATOM 86    H HG21 . THR A 1 6   ? -11.707 -12.677 1.379   1.00 4.31  ? 6   THR A HG21 1  
ATOM 87    H HG22 . THR A 1 6   ? -11.864 -12.661 3.136   1.00 4.49  ? 6   THR A HG22 1  
ATOM 88    H HG23 . THR A 1 6   ? -10.392 -12.055 2.376   1.00 4.15  ? 6   THR A HG23 1  
ATOM 89    N N    . MET A 1 7   ? -9.464  -10.483 -0.148  1.00 1.53  ? 7   MET A N    1  
ATOM 90    C CA   . MET A 1 7   ? -8.022  -10.598 -0.320  1.00 1.05  ? 7   MET A CA   1  
ATOM 91    C C    . MET A 1 7   ? -7.445  -9.307  -0.890  1.00 0.83  ? 7   MET A C    1  
ATOM 92    O O    . MET A 1 7   ? -6.236  -9.182  -1.069  1.00 1.39  ? 7   MET A O    1  
ATOM 93    C CB   . MET A 1 7   ? -7.684  -11.775 -1.238  1.00 1.50  ? 7   MET A CB   1  
ATOM 94    C CG   . MET A 1 7   ? -8.279  -11.660 -2.633  1.00 2.32  ? 7   MET A CG   1  
ATOM 95    S SD   . MET A 1 7   ? -7.842  -13.053 -3.693  1.00 3.29  ? 7   MET A SD   1  
ATOM 96    C CE   . MET A 1 7   ? -8.540  -14.421 -2.765  1.00 3.84  ? 7   MET A CE   1  
ATOM 97    H H    . MET A 1 7   ? -10.055 -10.747 -0.883  1.00 1.86  ? 7   MET A H    1  
ATOM 98    H HA   . MET A 1 7   ? -7.586  -10.773 0.651   1.00 1.34  ? 7   MET A HA   1  
ATOM 99    H HB2  . MET A 1 7   ? -6.610  -11.844 -1.333  1.00 1.93  ? 7   MET A HB2  1  
ATOM 100   H HB3  . MET A 1 7   ? -8.053  -12.684 -0.787  1.00 1.78  ? 7   MET A HB3  1  
ATOM 101   H HG2  . MET A 1 7   ? -9.355  -11.617 -2.548  1.00 2.59  ? 7   MET A HG2  1  
ATOM 102   H HG3  . MET A 1 7   ? -7.918  -10.751 -3.090  1.00 2.65  ? 7   MET A HG3  1  
ATOM 103   H HE1  . MET A 1 7   ? -8.068  -14.477 -1.795  1.00 4.06  ? 7   MET A HE1  1  
ATOM 104   H HE2  . MET A 1 7   ? -8.372  -15.343 -3.301  1.00 4.06  ? 7   MET A HE2  1  
ATOM 105   H HE3  . MET A 1 7   ? -9.602  -14.266 -2.640  1.00 4.32  ? 7   MET A HE3  1  
ATOM 106   N N    . LEU A 1 8   ? -8.323  -8.349  -1.159  1.00 0.80  ? 8   LEU A N    1  
ATOM 107   C CA   . LEU A 1 8   ? -7.916  -7.059  -1.698  1.00 0.56  ? 8   LEU A CA   1  
ATOM 108   C C    . LEU A 1 8   ? -7.516  -6.122  -0.566  1.00 0.48  ? 8   LEU A C    1  
ATOM 109   O O    . LEU A 1 8   ? -8.092  -5.047  -0.395  1.00 0.47  ? 8   LEU A O    1  
ATOM 110   C CB   . LEU A 1 8   ? -9.058  -6.444  -2.507  1.00 0.47  ? 8   LEU A CB   1  
ATOM 111   C CG   . LEU A 1 8   ? -9.603  -7.324  -3.631  1.00 0.56  ? 8   LEU A CG   1  
ATOM 112   C CD1  . LEU A 1 8   ? -10.863 -6.710  -4.213  1.00 0.61  ? 8   LEU A CD1  1  
ATOM 113   C CD2  . LEU A 1 8   ? -8.553  -7.520  -4.713  1.00 0.72  ? 8   LEU A CD2  1  
ATOM 114   H H    . LEU A 1 8   ? -9.271  -8.510  -0.982  1.00 1.36  ? 8   LEU A H    1  
ATOM 115   H HA   . LEU A 1 8   ? -7.066  -7.217  -2.346  1.00 0.70  ? 8   LEU A HA   1  
ATOM 116   H HB2  . LEU A 1 8   ? -9.869  -6.216  -1.830  1.00 0.54  ? 8   LEU A HB2  1  
ATOM 117   H HB3  . LEU A 1 8   ? -8.706  -5.522  -2.943  1.00 0.53  ? 8   LEU A HB3  1  
ATOM 118   H HG   . LEU A 1 8   ? -9.857  -8.293  -3.230  1.00 0.64  ? 8   LEU A HG   1  
ATOM 119   H HD11 . LEU A 1 8   ? -10.636 -5.731  -4.609  1.00 1.21  ? 8   LEU A HD11 1  
ATOM 120   H HD12 . LEU A 1 8   ? -11.608 -6.620  -3.435  1.00 0.99  ? 8   LEU A HD12 1  
ATOM 121   H HD13 . LEU A 1 8   ? -11.239 -7.342  -5.005  1.00 1.34  ? 8   LEU A HD13 1  
ATOM 122   H HD21 . LEU A 1 8   ? -8.962  -8.131  -5.503  1.00 1.31  ? 8   LEU A HD21 1  
ATOM 123   H HD22 . LEU A 1 8   ? -7.689  -8.009  -4.290  1.00 1.24  ? 8   LEU A HD22 1  
ATOM 124   H HD23 . LEU A 1 8   ? -8.264  -6.559  -5.113  1.00 1.27  ? 8   LEU A HD23 1  
ATOM 125   N N    . ARG A 1 9   ? -6.523  -6.536  0.199   1.00 0.52  ? 9   ARG A N    1  
ATOM 126   C CA   . ARG A 1 9   ? -6.103  -5.798  1.375   1.00 0.51  ? 9   ARG A CA   1  
ATOM 127   C C    . ARG A 1 9   ? -4.597  -5.574  1.352   1.00 0.43  ? 9   ARG A C    1  
ATOM 128   O O    . ARG A 1 9   ? -3.849  -6.392  0.816   1.00 0.47  ? 9   ARG A O    1  
ATOM 129   C CB   . ARG A 1 9   ? -6.525  -6.542  2.646   1.00 0.69  ? 9   ARG A CB   1  
ATOM 130   C CG   . ARG A 1 9   ? -6.122  -8.006  2.672   1.00 1.15  ? 9   ARG A CG   1  
ATOM 131   C CD   . ARG A 1 9   ? -6.590  -8.679  3.949   1.00 1.21  ? 9   ARG A CD   1  
ATOM 132   N NE   . ARG A 1 9   ? -6.294  -10.110 3.958   1.00 1.84  ? 9   ARG A NE   1  
ATOM 133   C CZ   . ARG A 1 9   ? -5.581  -10.717 4.904   1.00 2.23  ? 9   ARG A CZ   1  
ATOM 134   N NH1  . ARG A 1 9   ? -5.061  -10.017 5.906   1.00 2.21  ? 9   ARG A NH1  1  
ATOM 135   N NH2  . ARG A 1 9   ? -5.385  -12.025 4.844   1.00 3.09  ? 9   ARG A NH2  1  
ATOM 136   H H    . ARG A 1 9   ? -6.038  -7.352  -0.051  1.00 0.60  ? 9   ARG A H    1  
ATOM 137   H HA   . ARG A 1 9   ? -6.595  -4.839  1.353   1.00 0.51  ? 9   ARG A HA   1  
ATOM 138   H HB2  . ARG A 1 9   ? -6.077  -6.055  3.497   1.00 1.21  ? 9   ARG A HB2  1  
ATOM 139   H HB3  . ARG A 1 9   ? -7.601  -6.488  2.738   1.00 1.12  ? 9   ARG A HB3  1  
ATOM 140   H HG2  . ARG A 1 9   ? -6.568  -8.508  1.826   1.00 1.62  ? 9   ARG A HG2  1  
ATOM 141   H HG3  . ARG A 1 9   ? -5.047  -8.076  2.610   1.00 1.68  ? 9   ARG A HG3  1  
ATOM 142   H HD2  . ARG A 1 9   ? -6.095  -8.215  4.789   1.00 1.50  ? 9   ARG A HD2  1  
ATOM 143   H HD3  . ARG A 1 9   ? -7.657  -8.543  4.041   1.00 1.36  ? 9   ARG A HD3  1  
ATOM 144   H HE   . ARG A 1 9   ? -6.661  -10.652 3.222   1.00 2.36  ? 9   ARG A HE   1  
ATOM 145   H HH11 . ARG A 1 9   ? -5.205  -9.021  5.959   1.00 1.99  ? 9   ARG A HH11 1  
ATOM 146   H HH12 . ARG A 1 9   ? -4.514  -10.478 6.617   1.00 2.76  ? 9   ARG A HH12 1  
ATOM 147   H HH21 . ARG A 1 9   ? -5.772  -12.557 4.080   1.00 3.51  ? 9   ARG A HH21 1  
ATOM 148   H HH22 . ARG A 1 9   ? -4.857  -12.492 5.564   1.00 3.49  ? 9   ARG A HH22 1  
ATOM 149   N N    . PRO A 1 10  ? -4.143  -4.451  1.934   1.00 0.36  ? 10  PRO A N    1  
ATOM 150   C CA   . PRO A 1 10  ? -2.730  -4.064  1.917   1.00 0.30  ? 10  PRO A CA   1  
ATOM 151   C C    . PRO A 1 10  ? -1.865  -4.962  2.794   1.00 0.28  ? 10  PRO A C    1  
ATOM 152   O O    . PRO A 1 10  ? -2.366  -5.824  3.519   1.00 0.38  ? 10  PRO A O    1  
ATOM 153   C CB   . PRO A 1 10  ? -2.748  -2.638  2.476   1.00 0.29  ? 10  PRO A CB   1  
ATOM 154   C CG   . PRO A 1 10  ? -3.965  -2.580  3.329   1.00 0.47  ? 10  PRO A CG   1  
ATOM 155   C CD   . PRO A 1 10  ? -4.974  -3.476  2.667   1.00 0.40  ? 10  PRO A CD   1  
ATOM 156   H HA   . PRO A 1 10  ? -2.334  -4.053  0.913   1.00 0.33  ? 10  PRO A HA   1  
ATOM 157   H HB2  . PRO A 1 10  ? -1.850  -2.464  3.054   1.00 0.37  ? 10  PRO A HB2  1  
ATOM 158   H HB3  . PRO A 1 10  ? -2.803  -1.929  1.666   1.00 0.38  ? 10  PRO A HB3  1  
ATOM 159   H HG2  . PRO A 1 10  ? -3.737  -2.941  4.320   1.00 0.70  ? 10  PRO A HG2  1  
ATOM 160   H HG3  . PRO A 1 10  ? -4.335  -1.567  3.373   1.00 0.81  ? 10  PRO A HG3  1  
ATOM 161   H HD2  . PRO A 1 10  ? -5.584  -3.971  3.410   1.00 0.50  ? 10  PRO A HD2  1  
ATOM 162   H HD3  . PRO A 1 10  ? -5.594  -2.912  1.986   1.00 0.57  ? 10  PRO A HD3  1  
ATOM 163   N N    . ARG A 1 11  ? -0.563  -4.740  2.737   1.00 0.29  ? 11  ARG A N    1  
ATOM 164   C CA   . ARG A 1 11  ? 0.376   -5.495  3.549   1.00 0.34  ? 11  ARG A CA   1  
ATOM 165   C C    . ARG A 1 11  ? 1.381   -4.553  4.191   1.00 0.27  ? 11  ARG A C    1  
ATOM 166   O O    . ARG A 1 11  ? 1.815   -3.581  3.569   1.00 0.27  ? 11  ARG A O    1  
ATOM 167   C CB   . ARG A 1 11  ? 1.093   -6.546  2.696   1.00 0.49  ? 11  ARG A CB   1  
ATOM 168   C CG   . ARG A 1 11  ? 1.882   -5.959  1.539   1.00 0.63  ? 11  ARG A CG   1  
ATOM 169   C CD   . ARG A 1 11  ? 2.312   -7.032  0.552   1.00 1.00  ? 11  ARG A CD   1  
ATOM 170   N NE   . ARG A 1 11  ? 1.162   -7.754  0.012   1.00 1.22  ? 11  ARG A NE   1  
ATOM 171   C CZ   . ARG A 1 11  ? 0.544   -7.427  -1.123  1.00 1.59  ? 11  ARG A CZ   1  
ATOM 172   N NH1  . ARG A 1 11  ? 0.977   -6.406  -1.856  1.00 1.95  ? 11  ARG A NH1  1  
ATOM 173   N NH2  . ARG A 1 11  ? -0.516  -8.114  -1.525  1.00 2.37  ? 11  ARG A NH2  1  
ATOM 174   H H    . ARG A 1 11  ? -0.224  -4.045  2.132   1.00 0.33  ? 11  ARG A H    1  
ATOM 175   H HA   . ARG A 1 11  ? -0.183  -5.994  4.326   1.00 0.40  ? 11  ARG A HA   1  
ATOM 176   H HB2  . ARG A 1 11  ? 1.775   -7.099  3.325   1.00 0.63  ? 11  ARG A HB2  1  
ATOM 177   H HB3  . ARG A 1 11  ? 0.357   -7.227  2.292   1.00 0.78  ? 11  ARG A HB3  1  
ATOM 178   H HG2  . ARG A 1 11  ? 1.265   -5.238  1.026   1.00 0.94  ? 11  ARG A HG2  1  
ATOM 179   H HG3  . ARG A 1 11  ? 2.761   -5.469  1.932   1.00 0.71  ? 11  ARG A HG3  1  
ATOM 180   H HD2  . ARG A 1 11  ? 2.847   -6.563  -0.262  1.00 1.68  ? 11  ARG A HD2  1  
ATOM 181   H HD3  . ARG A 1 11  ? 2.962   -7.730  1.057   1.00 1.50  ? 11  ARG A HD3  1  
ATOM 182   H HE   . ARG A 1 11  ? 0.826   -8.519  0.533   1.00 1.83  ? 11  ARG A HE   1  
ATOM 183   H HH11 . ARG A 1 11  ? 1.770   -5.871  -1.569  1.00 2.06  ? 11  ARG A HH11 1  
ATOM 184   H HH12 . ARG A 1 11  ? 0.507   -6.166  -2.715  1.00 2.55  ? 11  ARG A HH12 1  
ATOM 185   H HH21 . ARG A 1 11  ? -0.861  -8.883  -0.984  1.00 2.82  ? 11  ARG A HH21 1  
ATOM 186   H HH22 . ARG A 1 11  ? -0.990  -7.851  -2.379  1.00 2.79  ? 11  ARG A HH22 1  
ATOM 187   N N    . LEU A 1 12  ? 1.726   -4.822  5.443   1.00 0.29  ? 12  LEU A N    1  
ATOM 188   C CA   . LEU A 1 12  ? 2.710   -4.014  6.138   1.00 0.26  ? 12  LEU A CA   1  
ATOM 189   C C    . LEU A 1 12  ? 4.077   -4.663  6.017   1.00 0.25  ? 12  LEU A C    1  
ATOM 190   O O    . LEU A 1 12  ? 4.337   -5.714  6.602   1.00 0.32  ? 12  LEU A O    1  
ATOM 191   C CB   . LEU A 1 12  ? 2.331   -3.842  7.613   1.00 0.34  ? 12  LEU A CB   1  
ATOM 192   C CG   . LEU A 1 12  ? 3.233   -2.898  8.414   1.00 0.60  ? 12  LEU A CG   1  
ATOM 193   C CD1  . LEU A 1 12  ? 3.190   -1.491  7.830   1.00 1.32  ? 12  LEU A CD1  1  
ATOM 194   C CD2  . LEU A 1 12  ? 2.816   -2.879  9.878   1.00 1.28  ? 12  LEU A CD2  1  
ATOM 195   H H    . LEU A 1 12  ? 1.319   -5.584  5.902   1.00 0.35  ? 12  LEU A H    1  
ATOM 196   H HA   . LEU A 1 12  ? 2.740   -3.045  5.664   1.00 0.24  ? 12  LEU A HA   1  
ATOM 197   H HB2  . LEU A 1 12  ? 1.319   -3.466  7.661   1.00 0.72  ? 12  LEU A HB2  1  
ATOM 198   H HB3  . LEU A 1 12  ? 2.357   -4.814  8.084   1.00 0.66  ? 12  LEU A HB3  1  
ATOM 199   H HG   . LEU A 1 12  ? 4.253   -3.252  8.362   1.00 1.58  ? 12  LEU A HG   1  
ATOM 200   H HD11 . LEU A 1 12  ? 2.179   -1.112  7.878   1.00 1.80  ? 12  LEU A HD11 1  
ATOM 201   H HD12 . LEU A 1 12  ? 3.512   -1.520  6.799   1.00 1.95  ? 12  LEU A HD12 1  
ATOM 202   H HD13 . LEU A 1 12  ? 3.845   -0.845  8.394   1.00 1.91  ? 12  LEU A HD13 1  
ATOM 203   H HD21 . LEU A 1 12  ? 2.861   -3.881  10.277  1.00 1.90  ? 12  LEU A HD21 1  
ATOM 204   H HD22 . LEU A 1 12  ? 1.807   -2.503  9.960   1.00 1.96  ? 12  LEU A HD22 1  
ATOM 205   H HD23 . LEU A 1 12  ? 3.484   -2.237  10.435  1.00 1.71  ? 12  LEU A HD23 1  
ATOM 206   N N    . CYS A 1 13  ? 4.944   -4.032  5.255   1.00 0.23  ? 13  CYS A N    1  
ATOM 207   C CA   . CYS A 1 13  ? 6.266   -4.559  5.011   1.00 0.25  ? 13  CYS A CA   1  
ATOM 208   C C    . CYS A 1 13  ? 7.233   -4.049  6.069   1.00 0.22  ? 13  CYS A C    1  
ATOM 209   O O    . CYS A 1 13  ? 7.477   -2.850  6.171   1.00 0.24  ? 13  CYS A O    1  
ATOM 210   C CB   . CYS A 1 13  ? 6.732   -4.133  3.618   1.00 0.29  ? 13  CYS A CB   1  
ATOM 211   S SG   . CYS A 1 13  ? 5.470   -4.319  2.336   1.00 0.40  ? 13  CYS A SG   1  
ATOM 212   H H    . CYS A 1 13  ? 4.686   -3.178  4.836   1.00 0.23  ? 13  CYS A H    1  
ATOM 213   H HA   . CYS A 1 13  ? 6.216   -5.636  5.060   1.00 0.28  ? 13  CYS A HA   1  
ATOM 214   H HB2  . CYS A 1 13  ? 7.024   -3.093  3.644   1.00 0.31  ? 13  CYS A HB2  1  
ATOM 215   H HB3  . CYS A 1 13  ? 7.583   -4.733  3.331   1.00 0.31  ? 13  CYS A HB3  1  
ATOM 216   H HG   . CYS A 1 13  ? 5.784   -5.374  1.596   1.00 1.17  ? 13  CYS A HG   1  
ATOM 217   N N    . THR A 1 14  ? 7.774   -4.954  6.862   1.00 0.23  ? 14  THR A N    1  
ATOM 218   C CA   . THR A 1 14  ? 8.734   -4.578  7.881   1.00 0.24  ? 14  THR A CA   1  
ATOM 219   C C    . THR A 1 14  ? 10.121  -5.032  7.461   1.00 0.22  ? 14  THR A C    1  
ATOM 220   O O    . THR A 1 14  ? 10.363  -6.226  7.281   1.00 0.25  ? 14  THR A O    1  
ATOM 221   C CB   . THR A 1 14  ? 8.365   -5.205  9.237   1.00 0.31  ? 14  THR A CB   1  
ATOM 222   O OG1  . THR A 1 14  ? 6.990   -4.916  9.537   1.00 0.35  ? 14  THR A OG1  1  
ATOM 223   C CG2  . THR A 1 14  ? 9.255   -4.668  10.348  1.00 0.35  ? 14  THR A CG2  1  
ATOM 224   H H    . THR A 1 14  ? 7.534   -5.898  6.752   1.00 0.26  ? 14  THR A H    1  
ATOM 225   H HA   . THR A 1 14  ? 8.722   -3.501  7.981   1.00 0.23  ? 14  THR A HA   1  
ATOM 226   H HB   . THR A 1 14  ? 8.496   -6.275  9.171   1.00 0.33  ? 14  THR A HB   1  
ATOM 227   H HG1  . THR A 1 14  ? 6.475   -4.932  8.723   1.00 0.65  ? 14  THR A HG1  1  
ATOM 228   H HG21 . THR A 1 14  ? 9.146   -3.596  10.410  1.00 1.01  ? 14  THR A HG21 1  
ATOM 229   H HG22 . THR A 1 14  ? 10.286  -4.913  10.136  1.00 1.13  ? 14  THR A HG22 1  
ATOM 230   H HG23 . THR A 1 14  ? 8.964   -5.115  11.288  1.00 1.10  ? 14  THR A HG23 1  
ATOM 231   N N    . MET A 1 15  ? 11.028  -4.085  7.301   1.00 0.20  ? 15  MET A N    1  
ATOM 232   C CA   . MET A 1 15  ? 12.352  -4.395  6.797   1.00 0.19  ? 15  MET A CA   1  
ATOM 233   C C    . MET A 1 15  ? 13.428  -3.647  7.576   1.00 0.21  ? 15  MET A C    1  
ATOM 234   O O    . MET A 1 15  ? 13.307  -2.449  7.829   1.00 0.21  ? 15  MET A O    1  
ATOM 235   C CB   . MET A 1 15  ? 12.444  -4.043  5.306   1.00 0.21  ? 15  MET A CB   1  
ATOM 236   C CG   . MET A 1 15  ? 12.132  -2.586  5.012   1.00 0.24  ? 15  MET A CG   1  
ATOM 237   S SD   . MET A 1 15  ? 12.343  -2.148  3.276   1.00 0.88  ? 15  MET A SD   1  
ATOM 238   C CE   . MET A 1 15  ? 10.865  -2.863  2.569   1.00 0.28  ? 15  MET A CE   1  
ATOM 239   H H    . MET A 1 15  ? 10.803  -3.156  7.528   1.00 0.21  ? 15  MET A H    1  
ATOM 240   H HA   . MET A 1 15  ? 12.512  -5.455  6.915   1.00 0.22  ? 15  MET A HA   1  
ATOM 241   H HB2  . MET A 1 15  ? 13.448  -4.251  4.961   1.00 0.26  ? 15  MET A HB2  1  
ATOM 242   H HB3  . MET A 1 15  ? 11.749  -4.657  4.756   1.00 0.23  ? 15  MET A HB3  1  
ATOM 243   H HG2  . MET A 1 15  ? 11.107  -2.392  5.291   1.00 0.48  ? 15  MET A HG2  1  
ATOM 244   H HG3  . MET A 1 15  ? 12.782  -1.971  5.607   1.00 0.46  ? 15  MET A HG3  1  
ATOM 245   H HE1  . MET A 1 15  ? 9.994   -2.388  2.997   1.00 1.04  ? 15  MET A HE1  1  
ATOM 246   H HE2  . MET A 1 15  ? 10.840  -3.921  2.786   1.00 1.08  ? 15  MET A HE2  1  
ATOM 247   H HE3  . MET A 1 15  ? 10.868  -2.714  1.500   1.00 1.03  ? 15  MET A HE3  1  
ATOM 248   N N    . LYS A 1 16  ? 14.464  -4.371  7.959   1.00 0.29  ? 16  LYS A N    1  
ATOM 249   C CA   . LYS A 1 16  ? 15.620  -3.790  8.617   1.00 0.37  ? 16  LYS A CA   1  
ATOM 250   C C    . LYS A 1 16  ? 16.761  -3.689  7.627   1.00 0.40  ? 16  LYS A C    1  
ATOM 251   O O    . LYS A 1 16  ? 16.878  -4.512  6.721   1.00 0.48  ? 16  LYS A O    1  
ATOM 252   C CB   . LYS A 1 16  ? 16.048  -4.646  9.817   1.00 0.50  ? 16  LYS A CB   1  
ATOM 253   C CG   . LYS A 1 16  ? 17.222  -4.062  10.592  1.00 0.90  ? 16  LYS A CG   1  
ATOM 254   C CD   . LYS A 1 16  ? 17.661  -4.966  11.734  1.00 1.09  ? 16  LYS A CD   1  
ATOM 255   C CE   . LYS A 1 16  ? 18.824  -4.352  12.502  1.00 1.96  ? 16  LYS A CE   1  
ATOM 256   N NZ   . LYS A 1 16  ? 19.269  -5.206  13.634  1.00 2.58  ? 16  LYS A NZ   1  
ATOM 257   H H    . LYS A 1 16  ? 14.447  -5.338  7.799   1.00 0.34  ? 16  LYS A H    1  
ATOM 258   H HA   . LYS A 1 16  ? 15.360  -2.798  8.956   1.00 0.41  ? 16  LYS A HA   1  
ATOM 259   H HB2  . LYS A 1 16  ? 15.211  -4.742  10.491  1.00 0.99  ? 16  LYS A HB2  1  
ATOM 260   H HB3  . LYS A 1 16  ? 16.329  -5.627  9.464   1.00 1.07  ? 16  LYS A HB3  1  
ATOM 261   H HG2  . LYS A 1 16  ? 18.052  -3.928  9.914   1.00 1.53  ? 16  LYS A HG2  1  
ATOM 262   H HG3  . LYS A 1 16  ? 16.929  -3.103  10.996  1.00 1.46  ? 16  LYS A HG3  1  
ATOM 263   H HD2  . LYS A 1 16  ? 16.830  -5.109  12.409  1.00 1.54  ? 16  LYS A HD2  1  
ATOM 264   H HD3  . LYS A 1 16  ? 17.971  -5.921  11.330  1.00 1.45  ? 16  LYS A HD3  1  
ATOM 265   H HE2  . LYS A 1 16  ? 19.651  -4.213  11.823  1.00 2.45  ? 16  LYS A HE2  1  
ATOM 266   H HE3  . LYS A 1 16  ? 18.514  -3.392  12.888  1.00 2.53  ? 16  LYS A HE3  1  
ATOM 267   H HZ1  . LYS A 1 16  ? 18.496  -5.312  14.330  1.00 2.80  ? 16  LYS A HZ1  1  
ATOM 268   H HZ2  . LYS A 1 16  ? 20.090  -4.776  14.111  1.00 3.11  ? 16  LYS A HZ2  1  
ATOM 269   H HZ3  . LYS A 1 16  ? 19.540  -6.151  13.288  1.00 3.02  ? 16  LYS A HZ3  1  
ATOM 270   N N    . LYS A 1 17  ? 17.575  -2.659  7.787   1.00 0.41  ? 17  LYS A N    1  
ATOM 271   C CA   . LYS A 1 17  ? 18.754  -2.481  6.955   1.00 0.50  ? 17  LYS A CA   1  
ATOM 272   C C    . LYS A 1 17  ? 19.669  -3.695  7.049   1.00 0.60  ? 17  LYS A C    1  
ATOM 273   O O    . LYS A 1 17  ? 20.290  -3.943  8.084   1.00 0.67  ? 17  LYS A O    1  
ATOM 274   C CB   . LYS A 1 17  ? 19.504  -1.217  7.366   1.00 0.51  ? 17  LYS A CB   1  
ATOM 275   C CG   . LYS A 1 17  ? 19.350  -0.084  6.373   1.00 0.52  ? 17  LYS A CG   1  
ATOM 276   C CD   . LYS A 1 17  ? 20.136  1.145   6.789   1.00 0.53  ? 17  LYS A CD   1  
ATOM 277   C CE   . LYS A 1 17  ? 19.506  1.849   7.974   1.00 0.62  ? 17  LYS A CE   1  
ATOM 278   N NZ   . LYS A 1 17  ? 20.371  2.950   8.467   1.00 0.92  ? 17  LYS A NZ   1  
ATOM 279   H H    . LYS A 1 17  ? 17.373  -1.994  8.492   1.00 0.41  ? 17  LYS A H    1  
ATOM 280   H HA   . LYS A 1 17  ? 18.421  -2.377  5.932   1.00 0.52  ? 17  LYS A HA   1  
ATOM 281   H HB2  . LYS A 1 17  ? 19.126  -0.884  8.320   1.00 0.68  ? 17  LYS A HB2  1  
ATOM 282   H HB3  . LYS A 1 17  ? 20.551  -1.445  7.463   1.00 0.68  ? 17  LYS A HB3  1  
ATOM 283   H HG2  . LYS A 1 17  ? 19.706  -0.418  5.409   1.00 0.67  ? 17  LYS A HG2  1  
ATOM 284   H HG3  . LYS A 1 17  ? 18.304  0.173   6.300   1.00 0.68  ? 17  LYS A HG3  1  
ATOM 285   H HD2  . LYS A 1 17  ? 21.140  0.846   7.057   1.00 0.91  ? 17  LYS A HD2  1  
ATOM 286   H HD3  . LYS A 1 17  ? 20.175  1.830   5.960   1.00 0.79  ? 17  LYS A HD3  1  
ATOM 287   H HE2  . LYS A 1 17  ? 18.554  2.261   7.667   1.00 0.85  ? 17  LYS A HE2  1  
ATOM 288   H HE3  . LYS A 1 17  ? 19.350  1.134   8.765   1.00 0.95  ? 17  LYS A HE3  1  
ATOM 289   H HZ1  . LYS A 1 17  ? 20.495  3.669   7.722   1.00 1.50  ? 17  LYS A HZ1  1  
ATOM 290   H HZ2  . LYS A 1 17  ? 21.310  2.574   8.729   1.00 1.28  ? 17  LYS A HZ2  1  
ATOM 291   H HZ3  . LYS A 1 17  ? 19.946  3.401   9.307   1.00 1.39  ? 17  LYS A HZ3  1  
ATOM 292   N N    . GLY A 1 18  ? 19.735  -4.441  5.949   1.00 0.68  ? 18  GLY A N    1  
ATOM 293   C CA   . GLY A 1 18  ? 20.456  -5.700  5.926   1.00 0.85  ? 18  GLY A CA   1  
ATOM 294   C C    . GLY A 1 18  ? 21.958  -5.530  5.819   1.00 1.05  ? 18  GLY A C    1  
ATOM 295   O O    . GLY A 1 18  ? 22.639  -5.388  6.831   1.00 1.28  ? 18  GLY A O    1  
ATOM 296   H H    . GLY A 1 18  ? 19.280  -4.127  5.138   1.00 0.68  ? 18  GLY A H    1  
ATOM 297   H HA2  . GLY A 1 18  ? 20.236  -6.241  6.828   1.00 0.90  ? 18  GLY A HA2  1  
ATOM 298   H HA3  . GLY A 1 18  ? 20.112  -6.279  5.082   1.00 0.94  ? 18  GLY A HA3  1  
ATOM 299   N N    . PRO A 1 19  ? 22.505  -5.571  4.597   1.00 1.24  ? 19  PRO A N    1  
ATOM 300   C CA   . PRO A 1 19  ? 23.941  -5.398  4.364   1.00 1.57  ? 19  PRO A CA   1  
ATOM 301   C C    . PRO A 1 19  ? 24.437  -4.035  4.841   1.00 1.57  ? 19  PRO A C    1  
ATOM 302   O O    . PRO A 1 19  ? 25.118  -3.928  5.860   1.00 2.23  ? 19  PRO A O    1  
ATOM 303   C CB   . PRO A 1 19  ? 24.092  -5.520  2.842   1.00 1.91  ? 19  PRO A CB   1  
ATOM 304   C CG   . PRO A 1 19  ? 22.839  -6.177  2.367   1.00 1.86  ? 19  PRO A CG   1  
ATOM 305   C CD   . PRO A 1 19  ? 21.763  -5.816  3.354   1.00 1.40  ? 19  PRO A CD   1  
ATOM 306   H HA   . PRO A 1 19  ? 24.514  -6.177  4.848   1.00 1.77  ? 19  PRO A HA   1  
ATOM 307   H HB2  . PRO A 1 19  ? 24.209  -4.536  2.413   1.00 2.10  ? 19  PRO A HB2  1  
ATOM 308   H HB3  . PRO A 1 19  ? 24.959  -6.122  2.614   1.00 2.19  ? 19  PRO A HB3  1  
ATOM 309   H HG2  . PRO A 1 19  ? 22.581  -5.810  1.384   1.00 2.16  ? 19  PRO A HG2  1  
ATOM 310   H HG3  . PRO A 1 19  ? 22.978  -7.248  2.340   1.00 2.10  ? 19  PRO A HG3  1  
ATOM 311   H HD2  . PRO A 1 19  ? 21.238  -4.928  3.042   1.00 1.45  ? 19  PRO A HD2  1  
ATOM 312   H HD3  . PRO A 1 19  ? 21.074  -6.639  3.477   1.00 1.43  ? 19  PRO A HD3  1  
ATOM 313   N N    . SER A 1 20  ? 24.086  -2.994  4.105   1.00 1.40  ? 20  SER A N    1  
ATOM 314   C CA   . SER A 1 20  ? 24.426  -1.633  4.486   1.00 1.65  ? 20  SER A CA   1  
ATOM 315   C C    . SER A 1 20  ? 23.317  -0.685  4.052   1.00 1.43  ? 20  SER A C    1  
ATOM 316   O O    . SER A 1 20  ? 23.516  0.522   3.921   1.00 1.93  ? 20  SER A O    1  
ATOM 317   C CB   . SER A 1 20  ? 25.758  -1.222  3.853   1.00 2.14  ? 20  SER A CB   1  
ATOM 318   O OG   . SER A 1 20  ? 26.799  -2.104  4.243   1.00 2.87  ? 20  SER A OG   1  
ATOM 319   H H    . SER A 1 20  ? 23.594  -3.144  3.265   1.00 1.61  ? 20  SER A H    1  
ATOM 320   H HA   . SER A 1 20  ? 24.517  -1.600  5.564   1.00 1.88  ? 20  SER A HA   1  
ATOM 321   H HB2  . SER A 1 20  ? 25.665  -1.251  2.776   1.00 2.20  ? 20  SER A HB2  1  
ATOM 322   H HB3  . SER A 1 20  ? 26.012  -0.220  4.165   1.00 2.54  ? 20  SER A HB3  1  
ATOM 323   H HG   . SER A 1 20  ? 26.477  -2.687  4.944   1.00 3.28  ? 20  SER A HG   1  
ATOM 324   N N    . GLY A 1 21  ? 22.143  -1.255  3.828   1.00 1.04  ? 21  GLY A N    1  
ATOM 325   C CA   . GLY A 1 21  ? 21.014  -0.490  3.361   1.00 0.94  ? 21  GLY A CA   1  
ATOM 326   C C    . GLY A 1 21  ? 19.835  -1.383  3.055   1.00 0.97  ? 21  GLY A C    1  
ATOM 327   O O    . GLY A 1 21  ? 19.737  -2.493  3.583   1.00 1.93  ? 21  GLY A O    1  
ATOM 328   H H    . GLY A 1 21  ? 22.041  -2.218  3.979   1.00 1.21  ? 21  GLY A H    1  
ATOM 329   H HA2  . GLY A 1 21  ? 20.733  0.226   4.119   1.00 0.97  ? 21  GLY A HA2  1  
ATOM 330   H HA3  . GLY A 1 21  ? 21.294  0.039   2.462   1.00 1.07  ? 21  GLY A HA3  1  
ATOM 331   N N    . TYR A 1 22  ? 18.945  -0.905  2.204   1.00 0.74  ? 22  TYR A N    1  
ATOM 332   C CA   . TYR A 1 22  ? 17.784  -1.679  1.793   1.00 0.70  ? 22  TYR A CA   1  
ATOM 333   C C    . TYR A 1 22  ? 17.919  -2.048  0.320   1.00 0.89  ? 22  TYR A C    1  
ATOM 334   O O    . TYR A 1 22  ? 18.775  -1.504  -0.378  1.00 1.82  ? 22  TYR A O    1  
ATOM 335   C CB   . TYR A 1 22  ? 16.498  -0.884  2.033   1.00 0.64  ? 22  TYR A CB   1  
ATOM 336   C CG   . TYR A 1 22  ? 16.312  -0.435  3.468   1.00 0.50  ? 22  TYR A CG   1  
ATOM 337   C CD1  . TYR A 1 22  ? 15.839  -1.310  4.439   1.00 0.47  ? 22  TYR A CD1  1  
ATOM 338   C CD2  . TYR A 1 22  ? 16.606  0.870   3.850   1.00 0.55  ? 22  TYR A CD2  1  
ATOM 339   C CE1  . TYR A 1 22  ? 15.665  -0.897  5.747   1.00 0.46  ? 22  TYR A CE1  1  
ATOM 340   C CE2  . TYR A 1 22  ? 16.435  1.289   5.154   1.00 0.54  ? 22  TYR A CE2  1  
ATOM 341   C CZ   . TYR A 1 22  ? 15.965  0.402   6.097   1.00 0.46  ? 22  TYR A CZ   1  
ATOM 342   O OH   . TYR A 1 22  ? 15.798  0.815   7.397   1.00 0.59  ? 22  TYR A OH   1  
ATOM 343   H H    . TYR A 1 22  ? 19.078  -0.006  1.828   1.00 1.40  ? 22  TYR A H    1  
ATOM 344   H HA   . TYR A 1 22  ? 17.760  -2.583  2.383   1.00 0.72  ? 22  TYR A HA   1  
ATOM 345   H HB2  . TYR A 1 22  ? 16.507  0.000   1.411   1.00 0.75  ? 22  TYR A HB2  1  
ATOM 346   H HB3  . TYR A 1 22  ? 15.649  -1.496  1.765   1.00 0.71  ? 22  TYR A HB3  1  
ATOM 347   H HD1  . TYR A 1 22  ? 15.609  -2.329  4.166   1.00 0.58  ? 22  TYR A HD1  1  
ATOM 348   H HD2  . TYR A 1 22  ? 16.973  1.564   3.109   1.00 0.70  ? 22  TYR A HD2  1  
ATOM 349   H HE1  . TYR A 1 22  ? 15.296  -1.590  6.487   1.00 0.57  ? 22  TYR A HE1  1  
ATOM 350   H HE2  . TYR A 1 22  ? 16.673  2.305   5.433   1.00 0.68  ? 22  TYR A HE2  1  
ATOM 351   H HH   . TYR A 1 22  ? 16.130  0.135   7.997   1.00 1.17  ? 22  TYR A HH   1  
ATOM 352   N N    . GLY A 1 23  ? 17.077  -2.951  -0.163  1.00 0.43  ? 23  GLY A N    1  
ATOM 353   C CA   . GLY A 1 23  ? 17.223  -3.425  -1.526  1.00 0.42  ? 23  GLY A CA   1  
ATOM 354   C C    . GLY A 1 23  ? 15.971  -3.244  -2.354  1.00 0.39  ? 23  GLY A C    1  
ATOM 355   O O    . GLY A 1 23  ? 15.298  -4.213  -2.705  1.00 0.39  ? 23  GLY A O    1  
ATOM 356   H H    . GLY A 1 23  ? 16.353  -3.292  0.401   1.00 0.96  ? 23  GLY A H    1  
ATOM 357   H HA2  . GLY A 1 23  ? 18.030  -2.886  -1.999  1.00 0.44  ? 23  GLY A HA2  1  
ATOM 358   H HA3  . GLY A 1 23  ? 17.474  -4.475  -1.503  1.00 0.48  ? 23  GLY A HA3  1  
ATOM 359   N N    . PHE A 1 24  ? 15.664  -2.000  -2.673  1.00 0.37  ? 24  PHE A N    1  
ATOM 360   C CA   . PHE A 1 24  ? 14.535  -1.688  -3.531  1.00 0.36  ? 24  PHE A CA   1  
ATOM 361   C C    . PHE A 1 24  ? 14.748  -0.343  -4.201  1.00 0.38  ? 24  PHE A C    1  
ATOM 362   O O    . PHE A 1 24  ? 15.594  0.447   -3.774  1.00 0.40  ? 24  PHE A O    1  
ATOM 363   C CB   . PHE A 1 24  ? 13.221  -1.686  -2.742  1.00 0.34  ? 24  PHE A CB   1  
ATOM 364   C CG   . PHE A 1 24  ? 13.165  -0.674  -1.629  1.00 0.32  ? 24  PHE A CG   1  
ATOM 365   C CD1  . PHE A 1 24  ? 12.686  0.605   -1.860  1.00 0.34  ? 24  PHE A CD1  1  
ATOM 366   C CD2  . PHE A 1 24  ? 13.577  -1.008  -0.350  1.00 0.33  ? 24  PHE A CD2  1  
ATOM 367   C CE1  . PHE A 1 24  ? 12.621  1.532   -0.839  1.00 0.36  ? 24  PHE A CE1  1  
ATOM 368   C CE2  . PHE A 1 24  ? 13.516  -0.083  0.676   1.00 0.35  ? 24  PHE A CE2  1  
ATOM 369   C CZ   . PHE A 1 24  ? 13.036  1.187   0.431   1.00 0.36  ? 24  PHE A CZ   1  
ATOM 370   H H    . PHE A 1 24  ? 16.218  -1.267  -2.331  1.00 0.39  ? 24  PHE A H    1  
ATOM 371   H HA   . PHE A 1 24  ? 14.482  -2.447  -4.298  1.00 0.37  ? 24  PHE A HA   1  
ATOM 372   H HB2  . PHE A 1 24  ? 12.407  -1.473  -3.417  1.00 0.35  ? 24  PHE A HB2  1  
ATOM 373   H HB3  . PHE A 1 24  ? 13.072  -2.666  -2.309  1.00 0.34  ? 24  PHE A HB3  1  
ATOM 374   H HD1  . PHE A 1 24  ? 12.362  0.878   -2.852  1.00 0.37  ? 24  PHE A HD1  1  
ATOM 375   H HD2  . PHE A 1 24  ? 13.954  -2.002  -0.155  1.00 0.35  ? 24  PHE A HD2  1  
ATOM 376   H HE1  . PHE A 1 24  ? 12.247  2.527   -1.034  1.00 0.40  ? 24  PHE A HE1  1  
ATOM 377   H HE2  . PHE A 1 24  ? 13.842  -0.355  1.670   1.00 0.38  ? 24  PHE A HE2  1  
ATOM 378   H HZ   . PHE A 1 24  ? 12.987  1.911   1.233   1.00 0.39  ? 24  PHE A HZ   1  
ATOM 379   N N    . ASN A 1 25  ? 13.991  -0.093  -5.250  1.00 0.43  ? 25  ASN A N    1  
ATOM 380   C CA   . ASN A 1 25  ? 14.049  1.175   -5.948  1.00 0.46  ? 25  ASN A CA   1  
ATOM 381   C C    . ASN A 1 25  ? 12.644  1.740   -6.103  1.00 0.42  ? 25  ASN A C    1  
ATOM 382   O O    . ASN A 1 25  ? 11.729  1.041   -6.550  1.00 0.39  ? 25  ASN A O    1  
ATOM 383   C CB   . ASN A 1 25  ? 14.715  1.000   -7.318  1.00 0.51  ? 25  ASN A CB   1  
ATOM 384   C CG   . ASN A 1 25  ? 14.914  2.315   -8.052  1.00 1.23  ? 25  ASN A CG   1  
ATOM 385   O OD1  . ASN A 1 25  ? 14.079  2.725   -8.855  1.00 2.18  ? 25  ASN A OD1  1  
ATOM 386   N ND2  . ASN A 1 25  ? 16.023  2.983   -7.781  1.00 1.65  ? 25  ASN A ND2  1  
ATOM 387   H H    . ASN A 1 25  ? 13.376  -0.788  -5.575  1.00 0.48  ? 25  ASN A H    1  
ATOM 388   H HA   . ASN A 1 25  ? 14.638  1.857   -5.352  1.00 0.53  ? 25  ASN A HA   1  
ATOM 389   H HB2  . ASN A 1 25  ? 15.681  0.536   -7.184  1.00 1.01  ? 25  ASN A HB2  1  
ATOM 390   H HB3  . ASN A 1 25  ? 14.096  0.359   -7.929  1.00 0.91  ? 25  ASN A HB3  1  
ATOM 391   H HD21 . ASN A 1 25  ? 16.649  2.600   -7.128  1.00 1.88  ? 25  ASN A HD21 1  
ATOM 392   H HD22 . ASN A 1 25  ? 16.171  3.846   -8.238  1.00 2.23  ? 25  ASN A HD22 1  
ATOM 393   N N    . LEU A 1 26  ? 12.474  2.995   -5.727  1.00 0.50  ? 26  LEU A N    1  
ATOM 394   C CA   . LEU A 1 26  ? 11.175  3.645   -5.801  1.00 0.52  ? 26  LEU A CA   1  
ATOM 395   C C    . LEU A 1 26  ? 11.107  4.511   -7.044  1.00 0.55  ? 26  LEU A C    1  
ATOM 396   O O    . LEU A 1 26  ? 12.105  5.104   -7.444  1.00 0.73  ? 26  LEU A O    1  
ATOM 397   C CB   . LEU A 1 26  ? 10.942  4.527   -4.570  1.00 0.69  ? 26  LEU A CB   1  
ATOM 398   C CG   . LEU A 1 26  ? 10.949  3.802   -3.223  1.00 0.87  ? 26  LEU A CG   1  
ATOM 399   C CD1  . LEU A 1 26  ? 10.826  4.799   -2.081  1.00 1.52  ? 26  LEU A CD1  1  
ATOM 400   C CD2  . LEU A 1 26  ? 9.819   2.788   -3.164  1.00 1.48  ? 26  LEU A CD2  1  
ATOM 401   H H    . LEU A 1 26  ? 13.247  3.508   -5.392  1.00 0.61  ? 26  LEU A H    1  
ATOM 402   H HA   . LEU A 1 26  ? 10.411  2.885   -5.849  1.00 0.49  ? 26  LEU A HA   1  
ATOM 403   H HB2  . LEU A 1 26  ? 11.711  5.284   -4.548  1.00 1.10  ? 26  LEU A HB2  1  
ATOM 404   H HB3  . LEU A 1 26  ? 9.985   5.016   -4.682  1.00 1.29  ? 26  LEU A HB3  1  
ATOM 405   H HG   . LEU A 1 26  ? 11.885  3.273   -3.107  1.00 1.73  ? 26  LEU A HG   1  
ATOM 406   H HD11 . LEU A 1 26  ? 9.914   5.367   -2.193  1.00 2.08  ? 26  LEU A HD11 1  
ATOM 407   H HD12 . LEU A 1 26  ? 11.672  5.470   -2.097  1.00 2.11  ? 26  LEU A HD12 1  
ATOM 408   H HD13 . LEU A 1 26  ? 10.807  4.269   -1.139  1.00 1.96  ? 26  LEU A HD13 1  
ATOM 409   H HD21 . LEU A 1 26  ? 9.862   2.255   -2.226  1.00 2.11  ? 26  LEU A HD21 1  
ATOM 410   H HD22 . LEU A 1 26  ? 9.920   2.089   -3.980  1.00 1.96  ? 26  LEU A HD22 1  
ATOM 411   H HD23 . LEU A 1 26  ? 8.873   3.302   -3.244  1.00 1.94  ? 26  LEU A HD23 1  
ATOM 412   N N    . HIS A 1 27  ? 9.943   4.577   -7.668  1.00 0.56  ? 27  HIS A N    1  
ATOM 413   C CA   . HIS A 1 27  ? 9.780   5.456   -8.806  1.00 0.67  ? 27  HIS A CA   1  
ATOM 414   C C    . HIS A 1 27  ? 8.664   6.453   -8.542  1.00 0.68  ? 27  HIS A C    1  
ATOM 415   O O    . HIS A 1 27  ? 7.575   6.083   -8.095  1.00 0.95  ? 27  HIS A O    1  
ATOM 416   C CB   . HIS A 1 27  ? 9.557   4.667   -10.110 1.00 1.23  ? 27  HIS A CB   1  
ATOM 417   C CG   . HIS A 1 27  ? 8.137   4.333   -10.467 1.00 0.70  ? 27  HIS A CG   1  
ATOM 418   N ND1  . HIS A 1 27  ? 7.370   5.118   -11.303 1.00 0.97  ? 27  HIS A ND1  1  
ATOM 419   C CD2  . HIS A 1 27  ? 7.364   3.272   -10.142 1.00 0.81  ? 27  HIS A CD2  1  
ATOM 420   C CE1  . HIS A 1 27  ? 6.190   4.557   -11.474 1.00 1.30  ? 27  HIS A CE1  1  
ATOM 421   N NE2  . HIS A 1 27  ? 6.159   3.434   -10.782 1.00 1.34  ? 27  HIS A NE2  1  
ATOM 422   H H    . HIS A 1 27  ? 9.188   4.030   -7.357  1.00 0.64  ? 27  HIS A H    1  
ATOM 423   H HA   . HIS A 1 27  ? 10.702  6.013   -8.901  1.00 0.83  ? 27  HIS A HA   1  
ATOM 424   H HB2  . HIS A 1 27  ? 9.959   5.239   -10.924 1.00 1.96  ? 27  HIS A HB2  1  
ATOM 425   H HB3  . HIS A 1 27  ? 10.100  3.737   -10.038 1.00 2.02  ? 27  HIS A HB3  1  
ATOM 426   H HD1  . HIS A 1 27  ? 7.658   5.962   -11.734 1.00 1.24  ? 27  HIS A HD1  1  
ATOM 427   H HD2  . HIS A 1 27  ? 7.644   2.447   -9.501  1.00 0.91  ? 27  HIS A HD2  1  
ATOM 428   H HE1  . HIS A 1 27  ? 5.385   4.948   -12.078 1.00 1.74  ? 27  HIS A HE1  1  
ATOM 429   H HE2  . HIS A 1 27  ? 5.465   2.733   -10.879 1.00 1.74  ? 27  HIS A HE2  1  
ATOM 430   N N    . SER A 1 28  ? 8.965   7.716   -8.777  1.00 0.75  ? 28  SER A N    1  
ATOM 431   C CA   . SER A 1 28  ? 7.999   8.782   -8.587  1.00 1.14  ? 28  SER A CA   1  
ATOM 432   C C    . SER A 1 28  ? 7.296   9.063   -9.905  1.00 1.03  ? 28  SER A C    1  
ATOM 433   O O    . SER A 1 28  ? 7.945   9.314   -10.923 1.00 1.34  ? 28  SER A O    1  
ATOM 434   C CB   . SER A 1 28  ? 8.712   10.032  -8.072  1.00 1.74  ? 28  SER A CB   1  
ATOM 435   O OG   . SER A 1 28  ? 9.561   9.706   -6.980  1.00 2.30  ? 28  SER A OG   1  
ATOM 436   H H    . SER A 1 28  ? 9.868   7.942   -9.091  1.00 0.74  ? 28  SER A H    1  
ATOM 437   H HA   . SER A 1 28  ? 7.273   8.455   -7.859  1.00 1.51  ? 28  SER A HA   1  
ATOM 438   H HB2  . SER A 1 28  ? 9.309   10.460  -8.862  1.00 2.11  ? 28  SER A HB2  1  
ATOM 439   H HB3  . SER A 1 28  ? 7.980   10.753  -7.739  1.00 2.17  ? 28  SER A HB3  1  
ATOM 440   H HG   . SER A 1 28  ? 10.197  9.028   -7.265  1.00 2.75  ? 28  SER A HG   1  
ATOM 441   N N    . ASP A 1 29  ? 5.977   9.000   -9.895  1.00 1.23  ? 29  ASP A N    1  
ATOM 442   C CA   . ASP A 1 29  ? 5.207   9.160   -11.117 1.00 1.54  ? 29  ASP A CA   1  
ATOM 443   C C    . ASP A 1 29  ? 4.947   10.638  -11.376 1.00 1.63  ? 29  ASP A C    1  
ATOM 444   O O    . ASP A 1 29  ? 4.780   11.425  -10.439 1.00 1.73  ? 29  ASP A O    1  
ATOM 445   C CB   . ASP A 1 29  ? 3.892   8.386   -11.020 1.00 2.09  ? 29  ASP A CB   1  
ATOM 446   C CG   . ASP A 1 29  ? 3.152   8.327   -12.338 1.00 2.87  ? 29  ASP A CG   1  
ATOM 447   O OD1  . ASP A 1 29  ? 2.457   9.303   -12.677 1.00 3.48  ? 29  ASP A OD1  1  
ATOM 448   O OD2  . ASP A 1 29  ? 3.248   7.296   -13.034 1.00 3.19  ? 29  ASP A OD2  1  
ATOM 449   H H    . ASP A 1 29  ? 5.505   8.859   -9.045  1.00 1.49  ? 29  ASP A H    1  
ATOM 450   H HA   . ASP A 1 29  ? 5.792   8.761   -11.933 1.00 1.59  ? 29  ASP A HA   1  
ATOM 451   H HB2  . ASP A 1 29  ? 4.101   7.375   -10.701 1.00 2.22  ? 29  ASP A HB2  1  
ATOM 452   H HB3  . ASP A 1 29  ? 3.256   8.863   -10.290 1.00 2.29  ? 29  ASP A HB3  1  
ATOM 453   N N    . LYS A 1 30  ? 4.928   11.016  -12.646 1.00 1.90  ? 30  LYS A N    1  
ATOM 454   C CA   . LYS A 1 30  ? 4.862   12.419  -13.024 1.00 2.10  ? 30  LYS A CA   1  
ATOM 455   C C    . LYS A 1 30  ? 3.413   12.876  -13.192 1.00 2.35  ? 30  LYS A C    1  
ATOM 456   O O    . LYS A 1 30  ? 3.150   14.055  -13.441 1.00 2.78  ? 30  LYS A O    1  
ATOM 457   C CB   . LYS A 1 30  ? 5.636   12.636  -14.326 1.00 2.29  ? 30  LYS A CB   1  
ATOM 458   C CG   . LYS A 1 30  ? 6.233   14.027  -14.455 1.00 2.65  ? 30  LYS A CG   1  
ATOM 459   C CD   . LYS A 1 30  ? 7.288   14.269  -13.387 1.00 3.12  ? 30  LYS A CD   1  
ATOM 460   C CE   . LYS A 1 30  ? 7.813   15.695  -13.429 1.00 3.99  ? 30  LYS A CE   1  
ATOM 461   N NZ   . LYS A 1 30  ? 8.824   15.943  -12.370 1.00 4.54  ? 30  LYS A NZ   1  
ATOM 462   H H    . LYS A 1 30  ? 4.951   10.332  -13.346 1.00 2.13  ? 30  LYS A H    1  
ATOM 463   H HA   . LYS A 1 30  ? 5.325   12.999  -12.240 1.00 2.09  ? 30  LYS A HA   1  
ATOM 464   H HB2  . LYS A 1 30  ? 6.441   11.917  -14.379 1.00 2.49  ? 30  LYS A HB2  1  
ATOM 465   H HB3  . LYS A 1 30  ? 4.967   12.476  -15.159 1.00 2.60  ? 30  LYS A HB3  1  
ATOM 466   H HG2  . LYS A 1 30  ? 6.689   14.125  -15.428 1.00 2.99  ? 30  LYS A HG2  1  
ATOM 467   H HG3  . LYS A 1 30  ? 5.446   14.757  -14.344 1.00 2.97  ? 30  LYS A HG3  1  
ATOM 468   H HD2  . LYS A 1 30  ? 6.856   14.082  -12.416 1.00 3.37  ? 30  LYS A HD2  1  
ATOM 469   H HD3  . LYS A 1 30  ? 8.112   13.588  -13.553 1.00 3.23  ? 30  LYS A HD3  1  
ATOM 470   H HE2  . LYS A 1 30  ? 8.267   15.870  -14.392 1.00 4.39  ? 30  LYS A HE2  1  
ATOM 471   H HE3  . LYS A 1 30  ? 6.984   16.375  -13.292 1.00 4.35  ? 30  LYS A HE3  1  
ATOM 472   H HZ1  . LYS A 1 30  ? 9.693   15.404  -12.565 1.00 4.89  ? 30  LYS A HZ1  1  
ATOM 473   H HZ2  . LYS A 1 30  ? 8.454   15.648  -11.440 1.00 4.83  ? 30  LYS A HZ2  1  
ATOM 474   H HZ3  . LYS A 1 30  ? 9.059   16.960  -12.330 1.00 4.73  ? 30  LYS A HZ3  1  
ATOM 475   N N    . SER A 1 31  ? 2.482   11.939  -13.067 1.00 2.29  ? 31  SER A N    1  
ATOM 476   C CA   . SER A 1 31  ? 1.065   12.238  -13.199 1.00 2.61  ? 31  SER A CA   1  
ATOM 477   C C    . SER A 1 31  ? 0.333   11.975  -11.885 1.00 2.43  ? 31  SER A C    1  
ATOM 478   O O    . SER A 1 31  ? -0.437  12.811  -11.405 1.00 2.50  ? 31  SER A O    1  
ATOM 479   C CB   . SER A 1 31  ? 0.452   11.386  -14.313 1.00 2.93  ? 31  SER A CB   1  
ATOM 480   O OG   . SER A 1 31  ? 1.153   11.553  -15.536 1.00 3.49  ? 31  SER A OG   1  
ATOM 481   H H    . SER A 1 31  ? 2.756   11.010  -12.877 1.00 2.20  ? 31  SER A H    1  
ATOM 482   H HA   . SER A 1 31  ? 0.963   13.281  -13.454 1.00 2.83  ? 31  SER A HA   1  
ATOM 483   H HB2  . SER A 1 31  ? 0.493   10.345  -14.030 1.00 3.18  ? 31  SER A HB2  1  
ATOM 484   H HB3  . SER A 1 31  ? -0.578  11.677  -14.461 1.00 2.98  ? 31  SER A HB3  1  
ATOM 485   H HG   . SER A 1 31  ? 1.413   12.483  -15.631 1.00 3.79  ? 31  SER A HG   1  
ATOM 486   N N    . LYS A 1 32  ? 0.574   10.805  -11.310 1.00 2.27  ? 32  LYS A N    1  
ATOM 487   C CA   . LYS A 1 32  ? -0.059  10.418  -10.058 1.00 2.14  ? 32  LYS A CA   1  
ATOM 488   C C    . LYS A 1 32  ? 0.955   10.442  -8.916  1.00 1.84  ? 32  LYS A C    1  
ATOM 489   O O    . LYS A 1 32  ? 2.067   9.934   -9.051  1.00 1.68  ? 32  LYS A O    1  
ATOM 490   C CB   . LYS A 1 32  ? -0.705  9.031   -10.195 1.00 2.21  ? 32  LYS A CB   1  
ATOM 491   C CG   . LYS A 1 32  ? 0.231   7.953   -10.717 1.00 2.25  ? 32  LYS A CG   1  
ATOM 492   C CD   . LYS A 1 32  ? -0.500  6.640   -10.951 1.00 2.41  ? 32  LYS A CD   1  
ATOM 493   C CE   . LYS A 1 32  ? 0.403   5.593   -11.586 1.00 2.93  ? 32  LYS A CE   1  
ATOM 494   N NZ   . LYS A 1 32  ? 0.905   6.017   -12.919 1.00 3.00  ? 32  LYS A NZ   1  
ATOM 495   H H    . LYS A 1 32  ? 1.208   10.182  -11.740 1.00 2.30  ? 32  LYS A H    1  
ATOM 496   H HA   . LYS A 1 32  ? -0.833  11.142  -9.845  1.00 2.30  ? 32  LYS A HA   1  
ATOM 497   H HB2  . LYS A 1 32  ? -1.069  8.720   -9.226  1.00 2.38  ? 32  LYS A HB2  1  
ATOM 498   H HB3  . LYS A 1 32  ? -1.543  9.106   -10.873 1.00 2.55  ? 32  LYS A HB3  1  
ATOM 499   H HG2  . LYS A 1 32  ? 0.664   8.285   -11.651 1.00 2.42  ? 32  LYS A HG2  1  
ATOM 500   H HG3  . LYS A 1 32  ? 1.016   7.793   -9.994  1.00 2.49  ? 32  LYS A HG3  1  
ATOM 501   H HD2  . LYS A 1 32  ? -0.853  6.266   -10.002 1.00 2.64  ? 32  LYS A HD2  1  
ATOM 502   H HD3  . LYS A 1 32  ? -1.342  6.820   -11.604 1.00 2.50  ? 32  LYS A HD3  1  
ATOM 503   H HE2  . LYS A 1 32  ? 1.246   5.423   -10.933 1.00 3.27  ? 32  LYS A HE2  1  
ATOM 504   H HE3  . LYS A 1 32  ? -0.155  4.675   -11.695 1.00 3.51  ? 32  LYS A HE3  1  
ATOM 505   H HZ1  . LYS A 1 32  ? 1.250   5.189   -13.451 1.00 3.05  ? 32  LYS A HZ1  1  
ATOM 506   H HZ2  . LYS A 1 32  ? 1.694   6.693   -12.811 1.00 3.40  ? 32  LYS A HZ2  1  
ATOM 507   H HZ3  . LYS A 1 32  ? 0.142   6.476   -13.466 1.00 3.29  ? 32  LYS A HZ3  1  
ATOM 508   N N    . PRO A 1 33  ? 0.588   11.058  -7.782  1.00 1.87  ? 33  PRO A N    1  
ATOM 509   C CA   . PRO A 1 33  ? 1.494   11.229  -6.645  1.00 1.71  ? 33  PRO A CA   1  
ATOM 510   C C    . PRO A 1 33  ? 1.707   9.944   -5.853  1.00 1.40  ? 33  PRO A C    1  
ATOM 511   O O    . PRO A 1 33  ? 0.851   9.053   -5.837  1.00 1.40  ? 33  PRO A O    1  
ATOM 512   C CB   . PRO A 1 33  ? 0.782   12.270  -5.786  1.00 1.97  ? 33  PRO A CB   1  
ATOM 513   C CG   . PRO A 1 33  ? -0.662  12.065  -6.075  1.00 2.24  ? 33  PRO A CG   1  
ATOM 514   C CD   . PRO A 1 33  ? -0.743  11.641  -7.518  1.00 2.19  ? 33  PRO A CD   1  
ATOM 515   H HA   . PRO A 1 33  ? 2.451   11.617  -6.960  1.00 1.77  ? 33  PRO A HA   1  
ATOM 516   H HB2  . PRO A 1 33  ? 1.008   12.098  -4.744  1.00 1.85  ? 33  PRO A HB2  1  
ATOM 517   H HB3  . PRO A 1 33  ? 1.106   13.260  -6.073  1.00 2.24  ? 33  PRO A HB3  1  
ATOM 518   H HG2  . PRO A 1 33  ? -1.053  11.289  -5.434  1.00 2.37  ? 33  PRO A HG2  1  
ATOM 519   H HG3  . PRO A 1 33  ? -1.202  12.987  -5.923  1.00 2.55  ? 33  PRO A HG3  1  
ATOM 520   H HD2  . PRO A 1 33  ? -1.518  10.901  -7.650  1.00 2.33  ? 33  PRO A HD2  1  
ATOM 521   H HD3  . PRO A 1 33  ? -0.924  12.496  -8.153  1.00 2.38  ? 33  PRO A HD3  1  
ATOM 522   N N    . GLY A 1 34  ? 2.851   9.863   -5.195  1.00 1.29  ? 34  GLY A N    1  
ATOM 523   C CA   . GLY A 1 34  ? 3.167   8.708   -4.392  1.00 1.05  ? 34  GLY A CA   1  
ATOM 524   C C    . GLY A 1 34  ? 4.317   7.916   -4.964  1.00 0.85  ? 34  GLY A C    1  
ATOM 525   O O    . GLY A 1 34  ? 4.639   8.037   -6.147  1.00 0.88  ? 34  GLY A O    1  
ATOM 526   H H    . GLY A 1 34  ? 3.495   10.600  -5.263  1.00 1.47  ? 34  GLY A H    1  
ATOM 527   H HA2  . GLY A 1 34  ? 3.435   9.037   -3.399  1.00 1.11  ? 34  GLY A HA2  1  
ATOM 528   H HA3  . GLY A 1 34  ? 2.299   8.071   -4.328  1.00 1.10  ? 34  GLY A HA3  1  
ATOM 529   N N    . GLN A 1 35  ? 4.943   7.112   -4.124  1.00 0.74  ? 35  GLN A N    1  
ATOM 530   C CA   . GLN A 1 35  ? 6.085   6.324   -4.546  1.00 0.59  ? 35  GLN A CA   1  
ATOM 531   C C    . GLN A 1 35  ? 5.635   4.915   -4.890  1.00 0.52  ? 35  GLN A C    1  
ATOM 532   O O    . GLN A 1 35  ? 4.952   4.271   -4.097  1.00 0.58  ? 35  GLN A O    1  
ATOM 533   C CB   . GLN A 1 35  ? 7.155   6.276   -3.444  1.00 0.58  ? 35  GLN A CB   1  
ATOM 534   C CG   . GLN A 1 35  ? 7.438   7.614   -2.757  1.00 0.82  ? 35  GLN A CG   1  
ATOM 535   C CD   . GLN A 1 35  ? 7.471   8.817   -3.694  1.00 0.75  ? 35  GLN A CD   1  
ATOM 536   O OE1  . GLN A 1 35  ? 7.172   9.933   -3.283  1.00 1.50  ? 35  GLN A OE1  1  
ATOM 537   N NE2  . GLN A 1 35  ? 7.817   8.609   -4.951  1.00 0.78  ? 35  GLN A NE2  1  
ATOM 538   H H    . GLN A 1 35  ? 4.624   7.042   -3.202  1.00 0.85  ? 35  GLN A H    1  
ATOM 539   H HA   . GLN A 1 35  ? 6.506   6.785   -5.428  1.00 0.60  ? 35  GLN A HA   1  
ATOM 540   H HB2  . GLN A 1 35  ? 6.830   5.580   -2.685  1.00 0.76  ? 35  GLN A HB2  1  
ATOM 541   H HB3  . GLN A 1 35  ? 8.077   5.914   -3.869  1.00 0.65  ? 35  GLN A HB3  1  
ATOM 542   H HG2  . GLN A 1 35  ? 6.671   7.786   -2.017  1.00 1.35  ? 35  GLN A HG2  1  
ATOM 543   H HG3  . GLN A 1 35  ? 8.395   7.542   -2.260  1.00 1.50  ? 35  GLN A HG3  1  
ATOM 544   H HE21 . GLN A 1 35  ? 8.040   7.700   -5.228  1.00 1.10  ? 35  GLN A HE21 1  
ATOM 545   H HE22 . GLN A 1 35  ? 7.812   9.377   -5.562  1.00 1.07  ? 35  GLN A HE22 1  
ATOM 546   N N    . PHE A 1 36  ? 6.001   4.438   -6.068  1.00 0.47  ? 36  PHE A N    1  
ATOM 547   C CA   . PHE A 1 36  ? 5.631   3.093   -6.478  1.00 0.43  ? 36  PHE A CA   1  
ATOM 548   C C    . PHE A 1 36  ? 6.877   2.230   -6.550  1.00 0.39  ? 36  PHE A C    1  
ATOM 549   O O    . PHE A 1 36  ? 7.946   2.718   -6.930  1.00 0.45  ? 36  PHE A O    1  
ATOM 550   C CB   . PHE A 1 36  ? 4.931   3.109   -7.841  1.00 0.48  ? 36  PHE A CB   1  
ATOM 551   C CG   . PHE A 1 36  ? 3.670   3.933   -7.888  1.00 0.58  ? 36  PHE A CG   1  
ATOM 552   C CD1  . PHE A 1 36  ? 3.728   5.306   -8.070  1.00 0.70  ? 36  PHE A CD1  1  
ATOM 553   C CD2  . PHE A 1 36  ? 2.430   3.330   -7.762  1.00 0.68  ? 36  PHE A CD2  1  
ATOM 554   C CE1  . PHE A 1 36  ? 2.572   6.062   -8.123  1.00 0.83  ? 36  PHE A CE1  1  
ATOM 555   C CE2  . PHE A 1 36  ? 1.270   4.080   -7.813  1.00 0.81  ? 36  PHE A CE2  1  
ATOM 556   C CZ   . PHE A 1 36  ? 1.342   5.447   -7.994  1.00 0.87  ? 36  PHE A CZ   1  
ATOM 557   H H    . PHE A 1 36  ? 6.542   4.995   -6.677  1.00 0.51  ? 36  PHE A H    1  
ATOM 558   H HA   . PHE A 1 36  ? 4.960   2.684   -5.736  1.00 0.42  ? 36  PHE A HA   1  
ATOM 559   H HB2  . PHE A 1 36  ? 5.612   3.509   -8.578  1.00 0.50  ? 36  PHE A HB2  1  
ATOM 560   H HB3  . PHE A 1 36  ? 4.675   2.096   -8.115  1.00 0.48  ? 36  PHE A HB3  1  
ATOM 561   H HD1  . PHE A 1 36  ? 4.689   5.786   -8.171  1.00 0.74  ? 36  PHE A HD1  1  
ATOM 562   H HD2  . PHE A 1 36  ? 2.372   2.260   -7.620  1.00 0.72  ? 36  PHE A HD2  1  
ATOM 563   H HE1  . PHE A 1 36  ? 2.631   7.131   -8.264  1.00 0.95  ? 36  PHE A HE1  1  
ATOM 564   H HE2  . PHE A 1 36  ? 0.309   3.598   -7.711  1.00 0.93  ? 36  PHE A HE2  1  
ATOM 565   H HZ   . PHE A 1 36  ? 0.438   6.035   -8.034  1.00 0.99  ? 36  PHE A HZ   1  
ATOM 566   N N    . ILE A 1 37  ? 6.751   0.962   -6.176  1.00 0.36  ? 37  ILE A N    1  
ATOM 567   C CA   . ILE A 1 37  ? 7.878   0.047   -6.234  1.00 0.33  ? 37  ILE A CA   1  
ATOM 568   C C    . ILE A 1 37  ? 8.241   -0.218  -7.687  1.00 0.33  ? 37  ILE A C    1  
ATOM 569   O O    . ILE A 1 37  ? 7.519   -0.910  -8.404  1.00 0.38  ? 37  ILE A O    1  
ATOM 570   C CB   . ILE A 1 37  ? 7.599   -1.309  -5.535  1.00 0.34  ? 37  ILE A CB   1  
ATOM 571   C CG1  . ILE A 1 37  ? 7.148   -1.125  -4.080  1.00 0.39  ? 37  ILE A CG1  1  
ATOM 572   C CG2  . ILE A 1 37  ? 8.835   -2.197  -5.585  1.00 0.33  ? 37  ILE A CG2  1  
ATOM 573   C CD1  . ILE A 1 37  ? 7.915   -0.058  -3.334  1.00 0.38  ? 37  ILE A CD1  1  
ATOM 574   H H    . ILE A 1 37  ? 5.877   0.636   -5.852  1.00 0.41  ? 37  ILE A H    1  
ATOM 575   H HA   . ILE A 1 37  ? 8.718   0.520   -5.743  1.00 0.33  ? 37  ILE A HA   1  
ATOM 576   H HB   . ILE A 1 37  ? 6.815   -1.808  -6.083  1.00 0.37  ? 37  ILE A HB   1  
ATOM 577   H HG12 . ILE A 1 37  ? 6.102   -0.869  -4.051  1.00 0.47  ? 37  ILE A HG12 1  
ATOM 578   H HG13 . ILE A 1 37  ? 7.292   -2.059  -3.552  1.00 0.44  ? 37  ILE A HG13 1  
ATOM 579   H HG21 . ILE A 1 37  ? 9.122   -2.353  -6.614  1.00 1.05  ? 37  ILE A HG21 1  
ATOM 580   H HG22 . ILE A 1 37  ? 8.611   -3.148  -5.126  1.00 1.00  ? 37  ILE A HG22 1  
ATOM 581   H HG23 . ILE A 1 37  ? 9.645   -1.721  -5.052  1.00 1.04  ? 37  ILE A HG23 1  
ATOM 582   H HD11 . ILE A 1 37  ? 7.567   -0.010  -2.314  1.00 1.09  ? 37  ILE A HD11 1  
ATOM 583   H HD12 . ILE A 1 37  ? 7.758   0.897   -3.814  1.00 1.12  ? 37  ILE A HD12 1  
ATOM 584   H HD13 . ILE A 1 37  ? 8.967   -0.299  -3.345  1.00 1.05  ? 37  ILE A HD13 1  
ATOM 585   N N    . ARG A 1 38  ? 9.350   0.357   -8.117  1.00 0.34  ? 38  ARG A N    1  
ATOM 586   C CA   . ARG A 1 38  ? 9.819   0.182   -9.478  1.00 0.41  ? 38  ARG A CA   1  
ATOM 587   C C    . ARG A 1 38  ? 10.431  -1.199  -9.638  1.00 0.40  ? 38  ARG A C    1  
ATOM 588   O O    . ARG A 1 38  ? 10.115  -1.928  -10.580 1.00 0.49  ? 38  ARG A O    1  
ATOM 589   C CB   . ARG A 1 38  ? 10.845  1.260   -9.819  1.00 0.50  ? 38  ARG A CB   1  
ATOM 590   C CG   . ARG A 1 38  ? 11.469  1.092   -11.191 1.00 0.67  ? 38  ARG A CG   1  
ATOM 591   C CD   . ARG A 1 38  ? 12.508  2.161   -11.452 1.00 1.24  ? 38  ARG A CD   1  
ATOM 592   N NE   . ARG A 1 38  ? 13.327  1.852   -12.619 1.00 1.56  ? 38  ARG A NE   1  
ATOM 593   C CZ   . ARG A 1 38  ? 14.653  1.964   -12.645 1.00 2.17  ? 38  ARG A CZ   1  
ATOM 594   N NH1  . ARG A 1 38  ? 15.307  2.379   -11.565 1.00 2.83  ? 38  ARG A NH1  1  
ATOM 595   N NH2  . ARG A 1 38  ? 15.319  1.652   -13.748 1.00 2.62  ? 38  ARG A NH2  1  
ATOM 596   H H    . ARG A 1 38  ? 9.876   0.909   -7.496  1.00 0.35  ? 38  ARG A H    1  
ATOM 597   H HA   . ARG A 1 38  ? 8.975   0.273   -10.141 1.00 0.46  ? 38  ARG A HA   1  
ATOM 598   H HB2  . ARG A 1 38  ? 10.361  2.224   -9.782  1.00 0.58  ? 38  ARG A HB2  1  
ATOM 599   H HB3  . ARG A 1 38  ? 11.636  1.235   -9.083  1.00 0.52  ? 38  ARG A HB3  1  
ATOM 600   H HG2  . ARG A 1 38  ? 11.939  0.120   -11.248 1.00 1.18  ? 38  ARG A HG2  1  
ATOM 601   H HG3  . ARG A 1 38  ? 10.694  1.164   -11.939 1.00 1.34  ? 38  ARG A HG3  1  
ATOM 602   H HD2  . ARG A 1 38  ? 12.004  3.101   -11.617 1.00 1.95  ? 38  ARG A HD2  1  
ATOM 603   H HD3  . ARG A 1 38  ? 13.147  2.243   -10.586 1.00 1.74  ? 38  ARG A HD3  1  
ATOM 604   H HE   . ARG A 1 38  ? 12.862  1.537   -13.429 1.00 1.83  ? 38  ARG A HE   1  
ATOM 605   H HH11 . ARG A 1 38  ? 14.801  2.613   -10.728 1.00 2.92  ? 38  ARG A HH11 1  
ATOM 606   H HH12 . ARG A 1 38  ? 16.314  2.450   -11.573 1.00 3.48  ? 38  ARG A HH12 1  
ATOM 607   H HH21 . ARG A 1 38  ? 14.820  1.327   -14.561 1.00 2.77  ? 38  ARG A HH21 1  
ATOM 608   H HH22 . ARG A 1 38  ? 16.322  1.745   -13.784 1.00 3.10  ? 38  ARG A HH22 1  
ATOM 609   N N    . SER A 1 39  ? 11.294  -1.548  -8.698  1.00 0.36  ? 39  SER A N    1  
ATOM 610   C CA   . SER A 1 39  ? 11.959  -2.834  -8.698  1.00 0.40  ? 39  SER A CA   1  
ATOM 611   C C    . SER A 1 39  ? 12.472  -3.154  -7.300  1.00 0.32  ? 39  SER A C    1  
ATOM 612   O O    . SER A 1 39  ? 12.881  -2.258  -6.559  1.00 0.37  ? 39  SER A O    1  
ATOM 613   C CB   . SER A 1 39  ? 13.106  -2.834  -9.715  1.00 0.54  ? 39  SER A CB   1  
ATOM 614   O OG   . SER A 1 39  ? 13.919  -1.680  -9.574  1.00 1.26  ? 39  SER A OG   1  
ATOM 615   H H    . SER A 1 39  ? 11.497  -0.913  -7.975  1.00 0.35  ? 39  SER A H    1  
ATOM 616   H HA   . SER A 1 39  ? 11.235  -3.582  -8.982  1.00 0.44  ? 39  SER A HA   1  
ATOM 617   H HB2  . SER A 1 39  ? 13.719  -3.708  -9.561  1.00 1.11  ? 39  SER A HB2  1  
ATOM 618   H HB3  . SER A 1 39  ? 12.697  -2.851  -10.714 1.00 1.13  ? 39  SER A HB3  1  
ATOM 619   H HG   . SER A 1 39  ? 14.495  -1.597  -10.354 1.00 1.82  ? 39  SER A HG   1  
ATOM 620   N N    . VAL A 1 40  ? 12.411  -4.421  -6.933  1.00 0.36  ? 40  VAL A N    1  
ATOM 621   C CA   . VAL A 1 40  ? 12.879  -4.869  -5.633  1.00 0.30  ? 40  VAL A CA   1  
ATOM 622   C C    . VAL A 1 40  ? 13.928  -5.961  -5.812  1.00 0.31  ? 40  VAL A C    1  
ATOM 623   O O    . VAL A 1 40  ? 13.862  -6.745  -6.762  1.00 0.37  ? 40  VAL A O    1  
ATOM 624   C CB   . VAL A 1 40  ? 11.702  -5.381  -4.764  1.00 0.33  ? 40  VAL A CB   1  
ATOM 625   C CG1  . VAL A 1 40  ? 10.989  -6.544  -5.435  1.00 0.37  ? 40  VAL A CG1  1  
ATOM 626   C CG2  . VAL A 1 40  ? 12.177  -5.777  -3.374  1.00 0.32  ? 40  VAL A CG2  1  
ATOM 627   H H    . VAL A 1 40  ? 12.050  -5.083  -7.558  1.00 0.49  ? 40  VAL A H    1  
ATOM 628   H HA   . VAL A 1 40  ? 13.332  -4.024  -5.133  1.00 0.31  ? 40  VAL A HA   1  
ATOM 629   H HB   . VAL A 1 40  ? 10.990  -4.575  -4.656  1.00 0.38  ? 40  VAL A HB   1  
ATOM 630   H HG11 . VAL A 1 40  ? 10.198  -6.902  -4.790  1.00 1.03  ? 40  VAL A HG11 1  
ATOM 631   H HG12 . VAL A 1 40  ? 11.693  -7.343  -5.617  1.00 1.05  ? 40  VAL A HG12 1  
ATOM 632   H HG13 . VAL A 1 40  ? 10.568  -6.214  -6.373  1.00 1.11  ? 40  VAL A HG13 1  
ATOM 633   H HG21 . VAL A 1 40  ? 12.874  -6.599  -3.452  1.00 1.08  ? 40  VAL A HG21 1  
ATOM 634   H HG22 . VAL A 1 40  ? 11.331  -6.077  -2.778  1.00 1.09  ? 40  VAL A HG22 1  
ATOM 635   H HG23 . VAL A 1 40  ? 12.665  -4.934  -2.908  1.00 1.02  ? 40  VAL A HG23 1  
ATOM 636   N N    . ASP A 1 41  ? 14.916  -5.988  -4.930  1.00 0.35  ? 41  ASP A N    1  
ATOM 637   C CA   . ASP A 1 41  ? 15.946  -7.011  -4.984  1.00 0.45  ? 41  ASP A CA   1  
ATOM 638   C C    . ASP A 1 41  ? 15.490  -8.227  -4.193  1.00 0.48  ? 41  ASP A C    1  
ATOM 639   O O    . ASP A 1 41  ? 15.180  -8.120  -3.006  1.00 0.51  ? 41  ASP A O    1  
ATOM 640   C CB   . ASP A 1 41  ? 17.269  -6.485  -4.424  1.00 0.54  ? 41  ASP A CB   1  
ATOM 641   C CG   . ASP A 1 41  ? 18.437  -7.397  -4.756  1.00 1.27  ? 41  ASP A CG   1  
ATOM 642   O OD1  . ASP A 1 41  ? 18.533  -8.494  -4.168  1.00 2.28  ? 41  ASP A OD1  1  
ATOM 643   O OD2  . ASP A 1 41  ? 19.263  -7.014  -5.612  1.00 1.32  ? 41  ASP A OD2  1  
ATOM 644   H H    . ASP A 1 41  ? 14.946  -5.315  -4.215  1.00 0.39  ? 41  ASP A H    1  
ATOM 645   H HA   . ASP A 1 41  ? 16.084  -7.292  -6.017  1.00 0.52  ? 41  ASP A HA   1  
ATOM 646   H HB2  . ASP A 1 41  ? 17.469  -5.509  -4.840  1.00 0.79  ? 41  ASP A HB2  1  
ATOM 647   H HB3  . ASP A 1 41  ? 17.191  -6.406  -3.350  1.00 1.00  ? 41  ASP A HB3  1  
ATOM 648   N N    . PRO A 1 42  ? 15.423  -9.391  -4.852  1.00 0.58  ? 42  PRO A N    1  
ATOM 649   C CA   . PRO A 1 42  ? 14.947  -10.634 -4.235  1.00 0.69  ? 42  PRO A CA   1  
ATOM 650   C C    . PRO A 1 42  ? 15.808  -11.096 -3.067  1.00 0.69  ? 42  PRO A C    1  
ATOM 651   O O    . PRO A 1 42  ? 15.349  -11.850 -2.209  1.00 1.17  ? 42  PRO A O    1  
ATOM 652   C CB   . PRO A 1 42  ? 15.012  -11.663 -5.369  1.00 0.84  ? 42  PRO A CB   1  
ATOM 653   C CG   . PRO A 1 42  ? 15.102  -10.864 -6.625  1.00 0.93  ? 42  PRO A CG   1  
ATOM 654   C CD   . PRO A 1 42  ? 15.793  -9.582  -6.260  1.00 0.69  ? 42  PRO A CD   1  
ATOM 655   H HA   . PRO A 1 42  ? 13.928  -10.536 -3.895  1.00 0.75  ? 42  PRO A HA   1  
ATOM 656   H HB2  . PRO A 1 42  ? 15.883  -12.288 -5.239  1.00 0.99  ? 42  PRO A HB2  1  
ATOM 657   H HB3  . PRO A 1 42  ? 14.122  -12.272 -5.354  1.00 0.96  ? 42  PRO A HB3  1  
ATOM 658   H HG2  . PRO A 1 42  ? 15.677  -11.403 -7.361  1.00 1.27  ? 42  PRO A HG2  1  
ATOM 659   H HG3  . PRO A 1 42  ? 14.108  -10.659 -6.999  1.00 1.17  ? 42  PRO A HG3  1  
ATOM 660   H HD2  . PRO A 1 42  ? 16.863  -9.681  -6.366  1.00 0.79  ? 42  PRO A HD2  1  
ATOM 661   H HD3  . PRO A 1 42  ? 15.425  -8.770  -6.867  1.00 0.77  ? 42  PRO A HD3  1  
ATOM 662   N N    . ASP A 1 43  ? 17.052  -10.652 -3.036  1.00 0.75  ? 43  ASP A N    1  
ATOM 663   C CA   . ASP A 1 43  ? 17.959  -11.025 -1.964  1.00 0.87  ? 43  ASP A CA   1  
ATOM 664   C C    . ASP A 1 43  ? 18.139  -9.845  -1.020  1.00 0.70  ? 43  ASP A C    1  
ATOM 665   O O    . ASP A 1 43  ? 19.258  -9.436  -0.699  1.00 0.86  ? 43  ASP A O    1  
ATOM 666   C CB   . ASP A 1 43  ? 19.308  -11.478 -2.533  1.00 1.14  ? 43  ASP A CB   1  
ATOM 667   C CG   . ASP A 1 43  ? 20.221  -12.095 -1.485  1.00 1.69  ? 43  ASP A CG   1  
ATOM 668   O OD1  . ASP A 1 43  ? 19.713  -12.665 -0.496  1.00 1.92  ? 43  ASP A OD1  1  
ATOM 669   O OD2  . ASP A 1 43  ? 21.458  -12.026 -1.655  1.00 2.40  ? 43  ASP A OD2  1  
ATOM 670   H H    . ASP A 1 43  ? 17.367  -10.043 -3.742  1.00 1.09  ? 43  ASP A H    1  
ATOM 671   H HA   . ASP A 1 43  ? 17.510  -11.843 -1.417  1.00 1.00  ? 43  ASP A HA   1  
ATOM 672   H HB2  . ASP A 1 43  ? 19.133  -12.213 -3.305  1.00 1.42  ? 43  ASP A HB2  1  
ATOM 673   H HB3  . ASP A 1 43  ? 19.812  -10.625 -2.964  1.00 1.58  ? 43  ASP A HB3  1  
ATOM 674   N N    . SER A 1 44  ? 17.019  -9.280  -0.595  1.00 0.57  ? 44  SER A N    1  
ATOM 675   C CA   . SER A 1 44  ? 17.040  -8.165  0.334   1.00 0.48  ? 44  SER A CA   1  
ATOM 676   C C    . SER A 1 44  ? 15.844  -8.249  1.279   1.00 0.40  ? 44  SER A C    1  
ATOM 677   O O    . SER A 1 44  ? 14.868  -8.950  0.993   1.00 0.39  ? 44  SER A O    1  
ATOM 678   C CB   . SER A 1 44  ? 17.011  -6.842  -0.434  1.00 0.47  ? 44  SER A CB   1  
ATOM 679   O OG   . SER A 1 44  ? 15.721  -6.585  -0.963  1.00 0.46  ? 44  SER A OG   1  
ATOM 680   H H    . SER A 1 44  ? 16.154  -9.621  -0.922  1.00 0.68  ? 44  SER A H    1  
ATOM 681   H HA   . SER A 1 44  ? 17.951  -8.223  0.911   1.00 0.55  ? 44  SER A HA   1  
ATOM 682   H HB2  . SER A 1 44  ? 17.281  -6.034  0.231   1.00 0.50  ? 44  SER A HB2  1  
ATOM 683   H HB3  . SER A 1 44  ? 17.716  -6.889  -1.248  1.00 0.51  ? 44  SER A HB3  1  
ATOM 684   H HG   . SER A 1 44  ? 15.601  -7.099  -1.779  1.00 0.41  ? 44  SER A HG   1  
ATOM 685   N N    . PRO A 1 45  ? 15.903  -7.530  2.418   1.00 0.43  ? 45  PRO A N    1  
ATOM 686   C CA   . PRO A 1 45  ? 14.801  -7.473  3.387   1.00 0.45  ? 45  PRO A CA   1  
ATOM 687   C C    . PRO A 1 45  ? 13.523  -6.894  2.783   1.00 0.38  ? 45  PRO A C    1  
ATOM 688   O O    . PRO A 1 45  ? 12.434  -7.092  3.313   1.00 0.39  ? 45  PRO A O    1  
ATOM 689   C CB   . PRO A 1 45  ? 15.331  -6.551  4.494   1.00 0.57  ? 45  PRO A CB   1  
ATOM 690   C CG   . PRO A 1 45  ? 16.457  -5.801  3.872   1.00 0.65  ? 45  PRO A CG   1  
ATOM 691   C CD   . PRO A 1 45  ? 17.060  -6.733  2.865   1.00 0.52  ? 45  PRO A CD   1  
ATOM 692   H HA   . PRO A 1 45  ? 14.588  -8.448  3.800   1.00 0.48  ? 45  PRO A HA   1  
ATOM 693   H HB2  . PRO A 1 45  ? 14.546  -5.882  4.816   1.00 0.68  ? 45  PRO A HB2  1  
ATOM 694   H HB3  . PRO A 1 45  ? 15.669  -7.146  5.329   1.00 0.68  ? 45  PRO A HB3  1  
ATOM 695   H HG2  . PRO A 1 45  ? 16.083  -4.911  3.384   1.00 0.81  ? 45  PRO A HG2  1  
ATOM 696   H HG3  . PRO A 1 45  ? 17.184  -5.540  4.625   1.00 0.87  ? 45  PRO A HG3  1  
ATOM 697   H HD2  . PRO A 1 45  ? 17.488  -6.178  2.044   1.00 0.56  ? 45  PRO A HD2  1  
ATOM 698   H HD3  . PRO A 1 45  ? 17.805  -7.362  3.330   1.00 0.60  ? 45  PRO A HD3  1  
ATOM 699   N N    . ALA A 1 46  ? 13.661  -6.195  1.662   1.00 0.35  ? 46  ALA A N    1  
ATOM 700   C CA   . ALA A 1 46  ? 12.525  -5.558  1.014   1.00 0.33  ? 46  ALA A CA   1  
ATOM 701   C C    . ALA A 1 46  ? 11.567  -6.603  0.450   1.00 0.30  ? 46  ALA A C    1  
ATOM 702   O O    . ALA A 1 46  ? 10.372  -6.590  0.747   1.00 0.31  ? 46  ALA A O    1  
ATOM 703   C CB   . ALA A 1 46  ? 13.004  -4.621  -0.083  1.00 0.36  ? 46  ALA A CB   1  
ATOM 704   H H    . ALA A 1 46  ? 14.548  -6.118  1.256   1.00 0.37  ? 46  ALA A H    1  
ATOM 705   H HA   . ALA A 1 46  ? 12.004  -4.971  1.757   1.00 0.35  ? 46  ALA A HA   1  
ATOM 706   H HB1  . ALA A 1 46  ? 13.515  -5.192  -0.845  1.00 1.17  ? 46  ALA A HB1  1  
ATOM 707   H HB2  . ALA A 1 46  ? 13.682  -3.893  0.337   1.00 0.96  ? 46  ALA A HB2  1  
ATOM 708   H HB3  . ALA A 1 46  ? 12.156  -4.115  -0.519  1.00 1.10  ? 46  ALA A HB3  1  
ATOM 709   N N    . GLU A 1 47  ? 12.099  -7.524  -0.338  1.00 0.31  ? 47  GLU A N    1  
ATOM 710   C CA   . GLU A 1 47  ? 11.291  -8.592  -0.911  1.00 0.33  ? 47  GLU A CA   1  
ATOM 711   C C    . GLU A 1 47  ? 10.755  -9.492  0.202   1.00 0.34  ? 47  GLU A C    1  
ATOM 712   O O    . GLU A 1 47  ? 9.602   -9.922  0.171   1.00 0.40  ? 47  GLU A O    1  
ATOM 713   C CB   . GLU A 1 47  ? 12.117  -9.396  -1.924  1.00 0.40  ? 47  GLU A CB   1  
ATOM 714   C CG   . GLU A 1 47  ? 11.380  -10.583 -2.534  1.00 0.53  ? 47  GLU A CG   1  
ATOM 715   C CD   . GLU A 1 47  ? 10.175  -10.177 -3.365  1.00 1.12  ? 47  GLU A CD   1  
ATOM 716   O OE1  . GLU A 1 47  ? 9.100   -9.930  -2.783  1.00 2.01  ? 47  GLU A OE1  1  
ATOM 717   O OE2  . GLU A 1 47  ? 10.292  -10.122 -4.609  1.00 1.51  ? 47  GLU A OE2  1  
ATOM 718   H H    . GLU A 1 47  ? 13.058  -7.487  -0.540  1.00 0.33  ? 47  GLU A H    1  
ATOM 719   H HA   . GLU A 1 47  ? 10.455  -8.136  -1.421  1.00 0.36  ? 47  GLU A HA   1  
ATOM 720   H HB2  . GLU A 1 47  ? 12.412  -8.737  -2.727  1.00 0.44  ? 47  GLU A HB2  1  
ATOM 721   H HB3  . GLU A 1 47  ? 13.006  -9.764  -1.434  1.00 0.42  ? 47  GLU A HB3  1  
ATOM 722   H HG2  . GLU A 1 47  ? 12.063  -11.127 -3.169  1.00 1.14  ? 47  GLU A HG2  1  
ATOM 723   H HG3  . GLU A 1 47  ? 11.044  -11.227 -1.735  1.00 1.17  ? 47  GLU A HG3  1  
ATOM 724   N N    . ALA A 1 48  ? 11.587  -9.736  1.212   1.00 0.34  ? 48  ALA A N    1  
ATOM 725   C CA   . ALA A 1 48  ? 11.190  -10.552 2.355   1.00 0.38  ? 48  ALA A CA   1  
ATOM 726   C C    . ALA A 1 48  ? 10.036  -9.906  3.122   1.00 0.37  ? 48  ALA A C    1  
ATOM 727   O O    . ALA A 1 48  ? 9.115   -10.592 3.571   1.00 0.47  ? 48  ALA A O    1  
ATOM 728   C CB   . ALA A 1 48  ? 12.378  -10.783 3.278   1.00 0.44  ? 48  ALA A CB   1  
ATOM 729   H H    . ALA A 1 48  ? 12.495  -9.364  1.184   1.00 0.34  ? 48  ALA A H    1  
ATOM 730   H HA   . ALA A 1 48  ? 10.863  -11.510 1.980   1.00 0.42  ? 48  ALA A HA   1  
ATOM 731   H HB1  . ALA A 1 48  ? 12.092  -11.456 4.071   1.00 1.15  ? 48  ALA A HB1  1  
ATOM 732   H HB2  . ALA A 1 48  ? 12.694  -9.842  3.701   1.00 0.97  ? 48  ALA A HB2  1  
ATOM 733   H HB3  . ALA A 1 48  ? 13.192  -11.216 2.714   1.00 1.06  ? 48  ALA A HB3  1  
ATOM 734   N N    . SER A 1 49  ? 10.087  -8.584  3.258   1.00 0.31  ? 49  SER A N    1  
ATOM 735   C CA   . SER A 1 49  ? 9.061   -7.848  3.986   1.00 0.32  ? 49  SER A CA   1  
ATOM 736   C C    . SER A 1 49  ? 7.743   -7.826  3.206   1.00 0.35  ? 49  SER A C    1  
ATOM 737   O O    . SER A 1 49  ? 6.676   -7.596  3.776   1.00 0.40  ? 49  SER A O    1  
ATOM 738   C CB   . SER A 1 49  ? 9.541   -6.420  4.274   1.00 0.32  ? 49  SER A CB   1  
ATOM 739   O OG   . SER A 1 49  ? 9.649   -5.658  3.088   1.00 0.31  ? 49  SER A OG   1  
ATOM 740   H H    . SER A 1 49  ? 10.847  -8.093  2.876   1.00 0.29  ? 49  SER A H    1  
ATOM 741   H HA   . SER A 1 49  ? 8.899   -8.357  4.925   1.00 0.36  ? 49  SER A HA   1  
ATOM 742   H HB2  . SER A 1 49  ? 8.848   -5.927  4.940   1.00 0.35  ? 49  SER A HB2  1  
ATOM 743   H HB3  . SER A 1 49  ? 10.512  -6.463  4.745   1.00 0.36  ? 49  SER A HB3  1  
ATOM 744   H HG   . SER A 1 49  ? 9.948   -6.224  2.365   1.00 0.29  ? 49  SER A HG   1  
ATOM 745   N N    . GLY A 1 50  ? 7.828   -8.077  1.901   1.00 0.36  ? 50  GLY A N    1  
ATOM 746   C CA   . GLY A 1 50  ? 6.638   -8.131  1.072   1.00 0.43  ? 50  GLY A CA   1  
ATOM 747   C C    . GLY A 1 50  ? 6.476   -6.905  0.196   1.00 0.43  ? 50  GLY A C    1  
ATOM 748   O O    . GLY A 1 50  ? 5.365   -6.409  0.015   1.00 0.62  ? 50  GLY A O    1  
ATOM 749   H H    . GLY A 1 50  ? 8.709   -8.236  1.501   1.00 0.34  ? 50  GLY A H    1  
ATOM 750   H HA2  . GLY A 1 50  ? 6.695   -9.005  0.440   1.00 0.49  ? 50  GLY A HA2  1  
ATOM 751   H HA3  . GLY A 1 50  ? 5.772   -8.221  1.712   1.00 0.45  ? 50  GLY A HA3  1  
ATOM 752   N N    . LEU A 1 51  ? 7.577   -6.409  -0.342  1.00 0.41  ? 51  LEU A N    1  
ATOM 753   C CA   . LEU A 1 51  ? 7.543   -5.239  -1.208  1.00 0.40  ? 51  LEU A CA   1  
ATOM 754   C C    . LEU A 1 51  ? 7.360   -5.671  -2.656  1.00 0.48  ? 51  LEU A C    1  
ATOM 755   O O    . LEU A 1 51  ? 8.323   -6.011  -3.345  1.00 0.65  ? 51  LEU A O    1  
ATOM 756   C CB   . LEU A 1 51  ? 8.829   -4.434  -1.045  1.00 0.38  ? 51  LEU A CB   1  
ATOM 757   C CG   . LEU A 1 51  ? 8.716   -2.961  -1.421  1.00 0.35  ? 51  LEU A CG   1  
ATOM 758   C CD1  . LEU A 1 51  ? 7.671   -2.278  -0.550  1.00 0.38  ? 51  LEU A CD1  1  
ATOM 759   C CD2  . LEU A 1 51  ? 10.062  -2.273  -1.282  1.00 0.37  ? 51  LEU A CD2  1  
ATOM 760   H H    . LEU A 1 51  ? 8.439   -6.841  -0.160  1.00 0.54  ? 51  LEU A H    1  
ATOM 761   H HA   . LEU A 1 51  ? 6.701   -4.621  -0.922  1.00 0.41  ? 51  LEU A HA   1  
ATOM 762   H HB2  . LEU A 1 51  ? 9.142   -4.500  -0.013  1.00 0.42  ? 51  LEU A HB2  1  
ATOM 763   H HB3  . LEU A 1 51  ? 9.591   -4.883  -1.665  1.00 0.48  ? 51  LEU A HB3  1  
ATOM 764   H HG   . LEU A 1 51  ? 8.400   -2.879  -2.451  1.00 0.42  ? 51  LEU A HG   1  
ATOM 765   H HD11 . LEU A 1 51  ? 6.699   -2.706  -0.751  1.00 1.04  ? 51  LEU A HD11 1  
ATOM 766   H HD12 . LEU A 1 51  ? 7.651   -1.222  -0.771  1.00 1.12  ? 51  LEU A HD12 1  
ATOM 767   H HD13 . LEU A 1 51  ? 7.918   -2.424  0.491   1.00 1.10  ? 51  LEU A HD13 1  
ATOM 768   H HD21 . LEU A 1 51  ? 10.779  -2.746  -1.938  1.00 1.03  ? 51  LEU A HD21 1  
ATOM 769   H HD22 . LEU A 1 51  ? 10.404  -2.351  -0.261  1.00 1.05  ? 51  LEU A HD22 1  
ATOM 770   H HD23 . LEU A 1 51  ? 9.963   -1.231  -1.549  1.00 1.08  ? 51  LEU A HD23 1  
ATOM 771   N N    . ARG A 1 52  ? 6.115   -5.667  -3.105  1.00 0.53  ? 52  ARG A N    1  
ATOM 772   C CA   . ARG A 1 52  ? 5.776   -6.122  -4.445  1.00 0.65  ? 52  ARG A CA   1  
ATOM 773   C C    . ARG A 1 52  ? 5.950   -4.989  -5.446  1.00 0.55  ? 52  ARG A C    1  
ATOM 774   O O    . ARG A 1 52  ? 5.730   -3.822  -5.123  1.00 0.61  ? 52  ARG A O    1  
ATOM 775   C CB   . ARG A 1 52  ? 4.334   -6.631  -4.471  1.00 0.86  ? 52  ARG A CB   1  
ATOM 776   C CG   . ARG A 1 52  ? 3.971   -7.431  -5.715  1.00 1.23  ? 52  ARG A CG   1  
ATOM 777   C CD   . ARG A 1 52  ? 4.646   -8.798  -5.728  1.00 2.05  ? 52  ARG A CD   1  
ATOM 778   N NE   . ARG A 1 52  ? 6.022   -8.749  -6.227  1.00 2.59  ? 52  ARG A NE   1  
ATOM 779   C CZ   . ARG A 1 52  ? 7.094   -9.084  -5.506  1.00 3.57  ? 52  ARG A CZ   1  
ATOM 780   N NH1  . ARG A 1 52  ? 6.967   -9.418  -4.230  1.00 4.13  ? 52  ARG A NH1  1  
ATOM 781   N NH2  . ARG A 1 52  ? 8.296   -9.085  -6.066  1.00 4.38  ? 52  ARG A NH2  1  
ATOM 782   H H    . ARG A 1 52  ? 5.401   -5.334  -2.521  1.00 0.62  ? 52  ARG A H    1  
ATOM 783   H HA   . ARG A 1 52  ? 6.445   -6.928  -4.706  1.00 0.74  ? 52  ARG A HA   1  
ATOM 784   H HB2  . ARG A 1 52  ? 4.178   -7.263  -3.609  1.00 1.11  ? 52  ARG A HB2  1  
ATOM 785   H HB3  . ARG A 1 52  ? 3.668   -5.784  -4.407  1.00 1.35  ? 52  ARG A HB3  1  
ATOM 786   H HG2  . ARG A 1 52  ? 2.901   -7.571  -5.741  1.00 1.80  ? 52  ARG A HG2  1  
ATOM 787   H HG3  . ARG A 1 52  ? 4.284   -6.878  -6.588  1.00 1.46  ? 52  ARG A HG3  1  
ATOM 788   H HD2  . ARG A 1 52  ? 4.656   -9.187  -4.722  1.00 2.55  ? 52  ARG A HD2  1  
ATOM 789   H HD3  . ARG A 1 52  ? 4.070   -9.460  -6.359  1.00 2.57  ? 52  ARG A HD3  1  
ATOM 790   H HE   . ARG A 1 52  ? 6.147   -8.485  -7.172  1.00 2.68  ? 52  ARG A HE   1  
ATOM 791   H HH11 . ARG A 1 52  ? 6.066   -9.427  -3.798  1.00 3.93  ? 52  ARG A HH11 1  
ATOM 792   H HH12 . ARG A 1 52  ? 7.789   -9.657  -3.684  1.00 4.99  ? 52  ARG A HH12 1  
ATOM 793   H HH21 . ARG A 1 52  ? 8.406   -8.835  -7.028  1.00 4.42  ? 52  ARG A HH21 1  
ATOM 794   H HH22 . ARG A 1 52  ? 9.110   -9.349  -5.519  1.00 5.17  ? 52  ARG A HH22 1  
ATOM 795   N N    . ALA A 1 53  ? 6.357   -5.336  -6.657  1.00 0.53  ? 53  ALA A N    1  
ATOM 796   C CA   . ALA A 1 53  ? 6.579   -4.349  -7.699  1.00 0.54  ? 53  ALA A CA   1  
ATOM 797   C C    . ALA A 1 53  ? 5.258   -3.772  -8.189  1.00 0.61  ? 53  ALA A C    1  
ATOM 798   O O    . ALA A 1 53  ? 4.264   -4.494  -8.287  1.00 1.44  ? 53  ALA A O    1  
ATOM 799   C CB   . ALA A 1 53  ? 7.353   -4.964  -8.854  1.00 0.68  ? 53  ALA A CB   1  
ATOM 800   H H    . ALA A 1 53  ? 6.499   -6.282  -6.857  1.00 0.60  ? 53  ALA A H    1  
ATOM 801   H HA   . ALA A 1 53  ? 7.175   -3.551  -7.279  1.00 0.52  ? 53  ALA A HA   1  
ATOM 802   H HB1  . ALA A 1 53  ? 6.766   -5.751  -9.302  1.00 1.00  ? 53  ALA A HB1  1  
ATOM 803   H HB2  . ALA A 1 53  ? 8.284   -5.372  -8.489  1.00 1.18  ? 53  ALA A HB2  1  
ATOM 804   H HB3  . ALA A 1 53  ? 7.559   -4.204  -9.594  1.00 1.17  ? 53  ALA A HB3  1  
ATOM 805   N N    . GLN A 1 54  ? 5.272   -2.469  -8.490  1.00 0.65  ? 54  GLN A N    1  
ATOM 806   C CA   . GLN A 1 54  ? 4.099   -1.728  -8.976  1.00 0.74  ? 54  GLN A CA   1  
ATOM 807   C C    . GLN A 1 54  ? 3.146   -1.361  -7.838  1.00 0.59  ? 54  GLN A C    1  
ATOM 808   O O    . GLN A 1 54  ? 2.115   -0.722  -8.068  1.00 0.67  ? 54  GLN A O    1  
ATOM 809   C CB   . GLN A 1 54  ? 3.348   -2.488  -10.082 1.00 0.99  ? 54  GLN A CB   1  
ATOM 810   C CG   . GLN A 1 54  ? 3.986   -2.392  -11.464 1.00 1.46  ? 54  GLN A CG   1  
ATOM 811   C CD   . GLN A 1 54  ? 5.386   -2.976  -11.530 1.00 2.34  ? 54  GLN A CD   1  
ATOM 812   O OE1  . GLN A 1 54  ? 5.567   -4.165  -11.794 1.00 2.99  ? 54  GLN A OE1  1  
ATOM 813   N NE2  . GLN A 1 54  ? 6.386   -2.139  -11.307 1.00 3.06  ? 54  GLN A NE2  1  
ATOM 814   H H    . GLN A 1 54  ? 6.118   -1.978  -8.381  1.00 1.26  ? 54  GLN A H    1  
ATOM 815   H HA   . GLN A 1 54  ? 4.471   -0.804  -9.398  1.00 0.86  ? 54  GLN A HA   1  
ATOM 816   H HB2  . GLN A 1 54  ? 3.299   -3.531  -9.808  1.00 1.00  ? 54  GLN A HB2  1  
ATOM 817   H HB3  . GLN A 1 54  ? 2.343   -2.098  -10.148 1.00 1.09  ? 54  GLN A HB3  1  
ATOM 818   H HG2  . GLN A 1 54  ? 3.363   -2.924  -12.168 1.00 1.69  ? 54  GLN A HG2  1  
ATOM 819   H HG3  . GLN A 1 54  ? 4.034   -1.351  -11.748 1.00 1.84  ? 54  GLN A HG3  1  
ATOM 820   H HE21 . GLN A 1 54  ? 6.172   -1.201  -11.114 1.00 3.14  ? 54  GLN A HE21 1  
ATOM 821   H HE22 . GLN A 1 54  ? 7.300   -2.488  -11.347 1.00 3.80  ? 54  GLN A HE22 1  
ATOM 822   N N    . ASP A 1 55  ? 3.497   -1.748  -6.618  1.00 0.47  ? 55  ASP A N    1  
ATOM 823   C CA   . ASP A 1 55  ? 2.720   -1.375  -5.443  1.00 0.45  ? 55  ASP A CA   1  
ATOM 824   C C    . ASP A 1 55  ? 3.100   0.033   -5.005  1.00 0.39  ? 55  ASP A C    1  
ATOM 825   O O    . ASP A 1 55  ? 4.231   0.474   -5.222  1.00 0.48  ? 55  ASP A O    1  
ATOM 826   C CB   . ASP A 1 55  ? 2.961   -2.362  -4.294  1.00 0.50  ? 55  ASP A CB   1  
ATOM 827   C CG   . ASP A 1 55  ? 2.310   -3.719  -4.505  1.00 0.67  ? 55  ASP A CG   1  
ATOM 828   O OD1  . ASP A 1 55  ? 2.213   -4.172  -5.667  1.00 1.02  ? 55  ASP A OD1  1  
ATOM 829   O OD2  . ASP A 1 55  ? 1.894   -4.339  -3.501  1.00 1.01  ? 55  ASP A OD2  1  
ATOM 830   H H    . ASP A 1 55  ? 4.291   -2.307  -6.501  1.00 0.46  ? 55  ASP A H    1  
ATOM 831   H HA   . ASP A 1 55  ? 1.675   -1.390  -5.713  1.00 0.52  ? 55  ASP A HA   1  
ATOM 832   H HB2  . ASP A 1 55  ? 4.024   -2.513  -4.177  1.00 0.55  ? 55  ASP A HB2  1  
ATOM 833   H HB3  . ASP A 1 55  ? 2.566   -1.936  -3.387  1.00 0.57  ? 55  ASP A HB3  1  
ATOM 834   N N    . ARG A 1 56  ? 2.163   0.748   -4.402  1.00 0.38  ? 56  ARG A N    1  
ATOM 835   C CA   . ARG A 1 56  ? 2.417   2.123   -3.983  1.00 0.42  ? 56  ARG A CA   1  
ATOM 836   C C    . ARG A 1 56  ? 2.619   2.219   -2.479  1.00 0.39  ? 56  ARG A C    1  
ATOM 837   O O    . ARG A 1 56  ? 1.960   1.520   -1.709  1.00 0.39  ? 56  ARG A O    1  
ATOM 838   C CB   . ARG A 1 56  ? 1.260   3.040   -4.384  1.00 0.56  ? 56  ARG A CB   1  
ATOM 839   C CG   . ARG A 1 56  ? 1.564   4.520   -4.165  1.00 0.78  ? 56  ARG A CG   1  
ATOM 840   C CD   . ARG A 1 56  ? 0.334   5.396   -4.339  1.00 0.79  ? 56  ARG A CD   1  
ATOM 841   N NE   . ARG A 1 56  ? -0.578  5.307   -3.197  1.00 0.89  ? 56  ARG A NE   1  
ATOM 842   C CZ   . ARG A 1 56  ? -1.729  4.646   -3.214  1.00 0.91  ? 56  ARG A CZ   1  
ATOM 843   N NH1  . ARG A 1 56  ? -2.091  3.963   -4.288  1.00 1.51  ? 56  ARG A NH1  1  
ATOM 844   N NH2  . ARG A 1 56  ? -2.519  4.671   -2.152  1.00 1.57  ? 56  ARG A NH2  1  
ATOM 845   H H    . ARG A 1 56  ? 1.287   0.343   -4.237  1.00 0.45  ? 56  ARG A H    1  
ATOM 846   H HA   . ARG A 1 56  ? 3.317   2.459   -4.476  1.00 0.43  ? 56  ARG A HA   1  
ATOM 847   H HB2  . ARG A 1 56  ? 1.041   2.887   -5.430  1.00 0.70  ? 56  ARG A HB2  1  
ATOM 848   H HB3  . ARG A 1 56  ? 0.391   2.782   -3.798  1.00 0.54  ? 56  ARG A HB3  1  
ATOM 849   H HG2  . ARG A 1 56  ? 1.943   4.650   -3.163  1.00 1.15  ? 56  ARG A HG2  1  
ATOM 850   H HG3  . ARG A 1 56  ? 2.318   4.829   -4.876  1.00 1.24  ? 56  ARG A HG3  1  
ATOM 851   H HD2  . ARG A 1 56  ? 0.651   6.422   -4.452  1.00 1.55  ? 56  ARG A HD2  1  
ATOM 852   H HD3  . ARG A 1 56  ? -0.192  5.084   -5.231  1.00 1.33  ? 56  ARG A HD3  1  
ATOM 853   H HE   . ARG A 1 56  ? -0.324  5.791   -2.372  1.00 1.71  ? 56  ARG A HE   1  
ATOM 854   H HH11 . ARG A 1 56  ? -1.499  3.939   -5.093  1.00 1.92  ? 56  ARG A HH11 1  
ATOM 855   H HH12 . ARG A 1 56  ? -2.971  3.453   -4.296  1.00 2.03  ? 56  ARG A HH12 1  
ATOM 856   H HH21 . ARG A 1 56  ? -2.239  5.199   -1.330  1.00 2.26  ? 56  ARG A HH21 1  
ATOM 857   H HH22 . ARG A 1 56  ? -3.390  4.178   -2.156  1.00 1.73  ? 56  ARG A HH22 1  
ATOM 858   N N    . ILE A 1 57  ? 3.534   3.093   -2.078  1.00 0.40  ? 57  ILE A N    1  
ATOM 859   C CA   . ILE A 1 57  ? 3.752   3.409   -0.674  1.00 0.38  ? 57  ILE A CA   1  
ATOM 860   C C    . ILE A 1 57  ? 2.595   4.256   -0.155  1.00 0.38  ? 57  ILE A C    1  
ATOM 861   O O    . ILE A 1 57  ? 2.295   5.314   -0.711  1.00 0.49  ? 57  ILE A O    1  
ATOM 862   C CB   . ILE A 1 57  ? 5.073   4.191   -0.476  1.00 0.46  ? 57  ILE A CB   1  
ATOM 863   C CG1  . ILE A 1 57  ? 6.249   3.466   -1.141  1.00 0.53  ? 57  ILE A CG1  1  
ATOM 864   C CG2  . ILE A 1 57  ? 5.360   4.416   1.003   1.00 0.45  ? 57  ILE A CG2  1  
ATOM 865   C CD1  . ILE A 1 57  ? 6.544   2.102   -0.558  1.00 0.68  ? 57  ILE A CD1  1  
ATOM 866   H H    . ILE A 1 57  ? 4.085   3.547   -2.756  1.00 0.45  ? 57  ILE A H    1  
ATOM 867   H HA   . ILE A 1 57  ? 3.800   2.487   -0.113  1.00 0.35  ? 57  ILE A HA   1  
ATOM 868   H HB   . ILE A 1 57  ? 4.956   5.159   -0.940  1.00 0.52  ? 57  ILE A HB   1  
ATOM 869   H HG12 . ILE A 1 57  ? 6.033   3.334   -2.190  1.00 1.01  ? 57  ILE A HG12 1  
ATOM 870   H HG13 . ILE A 1 57  ? 7.138   4.072   -1.036  1.00 0.84  ? 57  ILE A HG13 1  
ATOM 871   H HG21 . ILE A 1 57  ? 5.438   3.461   1.504   1.00 1.02  ? 57  ILE A HG21 1  
ATOM 872   H HG22 . ILE A 1 57  ? 4.559   4.990   1.444   1.00 1.06  ? 57  ILE A HG22 1  
ATOM 873   H HG23 . ILE A 1 57  ? 6.291   4.954   1.109   1.00 1.21  ? 57  ILE A HG23 1  
ATOM 874   H HD11 . ILE A 1 57  ? 7.394   1.671   -1.066  1.00 1.25  ? 57  ILE A HD11 1  
ATOM 875   H HD12 . ILE A 1 57  ? 5.684   1.462   -0.686  1.00 1.30  ? 57  ILE A HD12 1  
ATOM 876   H HD13 . ILE A 1 57  ? 6.766   2.203   0.494   1.00 1.37  ? 57  ILE A HD13 1  
ATOM 877   N N    . VAL A 1 58  ? 1.951   3.789   0.901   1.00 0.29  ? 58  VAL A N    1  
ATOM 878   C CA   . VAL A 1 58  ? 0.832   4.503   1.499   1.00 0.32  ? 58  VAL A CA   1  
ATOM 879   C C    . VAL A 1 58  ? 1.222   5.019   2.876   1.00 0.30  ? 58  VAL A C    1  
ATOM 880   O O    . VAL A 1 58  ? 1.014   6.187   3.207   1.00 0.37  ? 58  VAL A O    1  
ATOM 881   C CB   . VAL A 1 58  ? -0.410  3.594   1.633   1.00 0.37  ? 58  VAL A CB   1  
ATOM 882   C CG1  . VAL A 1 58  ? -1.598  4.381   2.166   1.00 0.87  ? 58  VAL A CG1  1  
ATOM 883   C CG2  . VAL A 1 58  ? -0.750  2.948   0.299   1.00 0.62  ? 58  VAL A CG2  1  
ATOM 884   H H    . VAL A 1 58  ? 2.235   2.930   1.291   1.00 0.27  ? 58  VAL A H    1  
ATOM 885   H HA   . VAL A 1 58  ? 0.583   5.338   0.861   1.00 0.38  ? 58  VAL A HA   1  
ATOM 886   H HB   . VAL A 1 58  ? -0.181  2.810   2.341   1.00 0.66  ? 58  VAL A HB   1  
ATOM 887   H HG11 . VAL A 1 58  ? -1.350  4.802   3.129   1.00 1.32  ? 58  VAL A HG11 1  
ATOM 888   H HG12 . VAL A 1 58  ? -2.448  3.723   2.268   1.00 1.56  ? 58  VAL A HG12 1  
ATOM 889   H HG13 . VAL A 1 58  ? -1.839  5.177   1.476   1.00 1.41  ? 58  VAL A HG13 1  
ATOM 890   H HG21 . VAL A 1 58  ? -0.930  3.718   -0.438  1.00 1.24  ? 58  VAL A HG21 1  
ATOM 891   H HG22 . VAL A 1 58  ? -1.636  2.339   0.407   1.00 1.25  ? 58  VAL A HG22 1  
ATOM 892   H HG23 . VAL A 1 58  ? 0.074   2.329   -0.022  1.00 1.22  ? 58  VAL A HG23 1  
ATOM 893   N N    . GLU A 1 59  ? 1.803   4.134   3.670   1.00 0.24  ? 59  GLU A N    1  
ATOM 894   C CA   . GLU A 1 59  ? 2.289   4.487   4.994   1.00 0.25  ? 59  GLU A CA   1  
ATOM 895   C C    . GLU A 1 59  ? 3.751   4.103   5.131   1.00 0.22  ? 59  GLU A C    1  
ATOM 896   O O    . GLU A 1 59  ? 4.199   3.114   4.549   1.00 0.23  ? 59  GLU A O    1  
ATOM 897   C CB   . GLU A 1 59  ? 1.478   3.795   6.096   1.00 0.29  ? 59  GLU A CB   1  
ATOM 898   C CG   . GLU A 1 59  ? 0.160   4.471   6.421   1.00 0.40  ? 59  GLU A CG   1  
ATOM 899   C CD   . GLU A 1 59  ? -0.485  3.892   7.666   1.00 0.44  ? 59  GLU A CD   1  
ATOM 900   O OE1  . GLU A 1 59  ? 0.022   4.151   8.779   1.00 0.89  ? 59  GLU A OE1  1  
ATOM 901   O OE2  . GLU A 1 59  ? -1.493  3.172   7.542   1.00 0.43  ? 59  GLU A OE2  1  
ATOM 902   H H    . GLU A 1 59  ? 1.920   3.216   3.349   1.00 0.24  ? 59  GLU A H    1  
ATOM 903   H HA   . GLU A 1 59  ? 2.198   5.556   5.109   1.00 0.27  ? 59  GLU A HA   1  
ATOM 904   H HB2  . GLU A 1 59  ? 1.267   2.784   5.785   1.00 0.26  ? 59  GLU A HB2  1  
ATOM 905   H HB3  . GLU A 1 59  ? 2.069   3.763   6.999   1.00 0.37  ? 59  GLU A HB3  1  
ATOM 906   H HG2  . GLU A 1 59  ? 0.337   5.524   6.579   1.00 0.55  ? 59  GLU A HG2  1  
ATOM 907   H HG3  . GLU A 1 59  ? -0.515  4.341   5.587   1.00 0.44  ? 59  GLU A HG3  1  
ATOM 908   N N    . VAL A 1 60  ? 4.487   4.894   5.884   1.00 0.22  ? 60  VAL A N    1  
ATOM 909   C CA   . VAL A 1 60  ? 5.861   4.577   6.214   1.00 0.21  ? 60  VAL A CA   1  
ATOM 910   C C    . VAL A 1 60  ? 6.119   4.863   7.688   1.00 0.22  ? 60  VAL A C    1  
ATOM 911   O O    . VAL A 1 60  ? 5.905   5.979   8.164   1.00 0.27  ? 60  VAL A O    1  
ATOM 912   C CB   . VAL A 1 60  ? 6.866   5.346   5.322   1.00 0.23  ? 60  VAL A CB   1  
ATOM 913   C CG1  . VAL A 1 60  ? 6.545   6.828   5.285   1.00 0.54  ? 60  VAL A CG1  1  
ATOM 914   C CG2  . VAL A 1 60  ? 8.292   5.122   5.800   1.00 0.66  ? 60  VAL A CG2  1  
ATOM 915   H H    . VAL A 1 60  ? 4.094   5.732   6.227   1.00 0.25  ? 60  VAL A H    1  
ATOM 916   H HA   . VAL A 1 60  ? 6.001   3.518   6.040   1.00 0.22  ? 60  VAL A HA   1  
ATOM 917   H HB   . VAL A 1 60  ? 6.786   4.960   4.315   1.00 0.52  ? 60  VAL A HB   1  
ATOM 918   H HG11 . VAL A 1 60  ? 5.544   6.968   4.904   1.00 1.16  ? 60  VAL A HG11 1  
ATOM 919   H HG12 . VAL A 1 60  ? 7.251   7.334   4.642   1.00 1.03  ? 60  VAL A HG12 1  
ATOM 920   H HG13 . VAL A 1 60  ? 6.609   7.234   6.283   1.00 1.01  ? 60  VAL A HG13 1  
ATOM 921   H HG21 . VAL A 1 60  ? 8.514   4.065   5.786   1.00 1.23  ? 60  VAL A HG21 1  
ATOM 922   H HG22 . VAL A 1 60  ? 8.398   5.499   6.806   1.00 1.29  ? 60  VAL A HG22 1  
ATOM 923   H HG23 . VAL A 1 60  ? 8.977   5.642   5.147   1.00 1.22  ? 60  VAL A HG23 1  
ATOM 924   N N    . ASN A 1 61  ? 6.515   3.821   8.414   1.00 0.25  ? 61  ASN A N    1  
ATOM 925   C CA   . ASN A 1 61  ? 6.809   3.911   9.845   1.00 0.30  ? 61  ASN A CA   1  
ATOM 926   C C    . ASN A 1 61  ? 5.565   4.320   10.636  1.00 0.36  ? 61  ASN A C    1  
ATOM 927   O O    . ASN A 1 61  ? 5.660   4.842   11.748  1.00 0.47  ? 61  ASN A O    1  
ATOM 928   C CB   . ASN A 1 61  ? 7.961   4.893   10.108  1.00 0.39  ? 61  ASN A CB   1  
ATOM 929   C CG   . ASN A 1 61  ? 9.248   4.473   9.419   1.00 0.53  ? 61  ASN A CG   1  
ATOM 930   O OD1  . ASN A 1 61  ? 9.504   3.283   9.228   1.00 1.17  ? 61  ASN A OD1  1  
ATOM 931   N ND2  . ASN A 1 61  ? 10.065  5.444   9.034   1.00 0.61  ? 61  ASN A ND2  1  
ATOM 932   H H    . ASN A 1 61  ? 6.617   2.952   7.963   1.00 0.27  ? 61  ASN A H    1  
ATOM 933   H HA   . ASN A 1 61  ? 7.110   2.929   10.176  1.00 0.40  ? 61  ASN A HA   1  
ATOM 934   H HB2  . ASN A 1 61  ? 7.682   5.871   9.740   1.00 0.67  ? 61  ASN A HB2  1  
ATOM 935   H HB3  . ASN A 1 61  ? 8.143   4.950   11.169  1.00 0.55  ? 61  ASN A HB3  1  
ATOM 936   H HD21 . ASN A 1 61  ? 9.800   6.372   9.210   1.00 0.97  ? 61  ASN A HD21 1  
ATOM 937   H HD22 . ASN A 1 61  ? 10.901  5.198   8.586   1.00 0.74  ? 61  ASN A HD22 1  
ATOM 938   N N    . GLY A 1 62  ? 4.400   4.065   10.055  1.00 0.37  ? 62  GLY A N    1  
ATOM 939   C CA   . GLY A 1 62  ? 3.153   4.381   10.719  1.00 0.50  ? 62  GLY A CA   1  
ATOM 940   C C    . GLY A 1 62  ? 2.640   5.763   10.368  1.00 0.51  ? 62  GLY A C    1  
ATOM 941   O O    . GLY A 1 62  ? 1.704   6.261   10.992  1.00 0.66  ? 62  GLY A O    1  
ATOM 942   H H    . GLY A 1 62  ? 4.387   3.659   9.164   1.00 0.34  ? 62  GLY A H    1  
ATOM 943   H HA2  . GLY A 1 62  ? 2.410   3.651   10.432  1.00 0.55  ? 62  GLY A HA2  1  
ATOM 944   H HA3  . GLY A 1 62  ? 3.302   4.328   11.788  1.00 0.58  ? 62  GLY A HA3  1  
ATOM 945   N N    . VAL A 1 63  ? 3.266   6.399   9.388   1.00 0.42  ? 63  VAL A N    1  
ATOM 946   C CA   . VAL A 1 63  ? 2.820   7.705   8.928   1.00 0.50  ? 63  VAL A CA   1  
ATOM 947   C C    . VAL A 1 63  ? 2.306   7.618   7.500   1.00 0.43  ? 63  VAL A C    1  
ATOM 948   O O    . VAL A 1 63  ? 2.985   7.102   6.611   1.00 0.39  ? 63  VAL A O    1  
ATOM 949   C CB   . VAL A 1 63  ? 3.946   8.758   9.002   1.00 0.61  ? 63  VAL A CB   1  
ATOM 950   C CG1  . VAL A 1 63  ? 3.419   10.134  8.620   1.00 0.98  ? 63  VAL A CG1  1  
ATOM 951   C CG2  . VAL A 1 63  ? 4.573   8.788   10.390  1.00 1.17  ? 63  VAL A CG2  1  
ATOM 952   H H    . VAL A 1 63  ? 4.052   5.985   8.969   1.00 0.36  ? 63  VAL A H    1  
ATOM 953   H HA   . VAL A 1 63  ? 2.006   8.023   9.564   1.00 0.62  ? 63  VAL A HA   1  
ATOM 954   H HB   . VAL A 1 63  ? 4.712   8.485   8.290   1.00 1.15  ? 63  VAL A HB   1  
ATOM 955   H HG11 . VAL A 1 63  ? 4.222   10.853  8.666   1.00 1.65  ? 63  VAL A HG11 1  
ATOM 956   H HG12 . VAL A 1 63  ? 2.636   10.424  9.307   1.00 1.44  ? 63  VAL A HG12 1  
ATOM 957   H HG13 . VAL A 1 63  ? 3.020   10.101  7.616   1.00 1.53  ? 63  VAL A HG13 1  
ATOM 958   H HG21 . VAL A 1 63  ? 5.361   9.526   10.415  1.00 1.72  ? 63  VAL A HG21 1  
ATOM 959   H HG22 . VAL A 1 63  ? 4.982   7.815   10.620  1.00 1.75  ? 63  VAL A HG22 1  
ATOM 960   H HG23 . VAL A 1 63  ? 3.818   9.042   11.120  1.00 1.64  ? 63  VAL A HG23 1  
ATOM 961   N N    . CYS A 1 64  ? 1.103   8.122   7.291   1.00 0.49  ? 64  CYS A N    1  
ATOM 962   C CA   . CYS A 1 64  ? 0.468   8.084   5.992   1.00 0.49  ? 64  CYS A CA   1  
ATOM 963   C C    . CYS A 1 64  ? 1.047   9.157   5.070   1.00 0.47  ? 64  CYS A C    1  
ATOM 964   O O    . CYS A 1 64  ? 1.139   10.332  5.437   1.00 0.51  ? 64  CYS A O    1  
ATOM 965   C CB   . CYS A 1 64  ? -1.035  8.255   6.173   1.00 0.59  ? 64  CYS A CB   1  
ATOM 966   S SG   . CYS A 1 64  ? -1.502  9.627   7.256   1.00 1.68  ? 64  CYS A SG   1  
ATOM 967   H H    . CYS A 1 64  ? 0.626   8.540   8.037   1.00 0.57  ? 64  CYS A H    1  
ATOM 968   H HA   . CYS A 1 64  ? 0.659   7.113   5.558   1.00 0.51  ? 64  CYS A HA   1  
ATOM 969   H HB2  . CYS A 1 64  ? -1.492  8.425   5.215   1.00 1.19  ? 64  CYS A HB2  1  
ATOM 970   H HB3  . CYS A 1 64  ? -1.434  7.351   6.606   1.00 1.14  ? 64  CYS A HB3  1  
ATOM 971   H HG   . CYS A 1 64  ? -2.310  9.141   8.194   1.00 2.36  ? 64  CYS A HG   1  
ATOM 972   N N    . MET A 1 65  ? 1.443   8.750   3.872   1.00 0.48  ? 65  MET A N    1  
ATOM 973   C CA   . MET A 1 65  ? 2.125   9.648   2.952   1.00 0.53  ? 65  MET A CA   1  
ATOM 974   C C    . MET A 1 65  ? 1.330   9.873   1.674   1.00 0.61  ? 65  MET A C    1  
ATOM 975   O O    . MET A 1 65  ? 1.899   10.180  0.624   1.00 0.81  ? 65  MET A O    1  
ATOM 976   C CB   . MET A 1 65  ? 3.519   9.116   2.625   1.00 0.61  ? 65  MET A CB   1  
ATOM 977   C CG   . MET A 1 65  ? 4.475   9.181   3.803   1.00 0.63  ? 65  MET A CG   1  
ATOM 978   S SD   . MET A 1 65  ? 4.611   10.844  4.491   1.00 0.61  ? 65  MET A SD   1  
ATOM 979   C CE   . MET A 1 65  ? 5.774   10.572  5.824   1.00 0.74  ? 65  MET A CE   1  
ATOM 980   H H    . MET A 1 65  ? 1.272   7.815   3.597   1.00 0.50  ? 65  MET A H    1  
ATOM 981   H HA   . MET A 1 65  ? 2.234   10.596  3.455   1.00 0.54  ? 65  MET A HA   1  
ATOM 982   H HB2  . MET A 1 65  ? 3.434   8.085   2.313   1.00 0.69  ? 65  MET A HB2  1  
ATOM 983   H HB3  . MET A 1 65  ? 3.936   9.698   1.816   1.00 0.65  ? 65  MET A HB3  1  
ATOM 984   H HG2  . MET A 1 65  ? 4.120   8.515   4.575   1.00 0.66  ? 65  MET A HG2  1  
ATOM 985   H HG3  . MET A 1 65  ? 5.453   8.861   3.476   1.00 0.74  ? 65  MET A HG3  1  
ATOM 986   H HE1  . MET A 1 65  ? 5.951   11.502  6.344   1.00 1.42  ? 65  MET A HE1  1  
ATOM 987   H HE2  . MET A 1 65  ? 6.707   10.202  5.421   1.00 1.16  ? 65  MET A HE2  1  
ATOM 988   H HE3  . MET A 1 65  ? 5.367   9.846   6.512   1.00 1.11  ? 65  MET A HE3  1  
ATOM 989   N N    . GLU A 1 66  ? 0.017   9.738   1.768   1.00 0.83  ? 66  GLU A N    1  
ATOM 990   C CA   . GLU A 1 66  ? -0.860  10.055  0.650   1.00 1.01  ? 66  GLU A CA   1  
ATOM 991   C C    . GLU A 1 66  ? -0.863  11.558  0.391   1.00 1.08  ? 66  GLU A C    1  
ATOM 992   O O    . GLU A 1 66  ? -1.297  12.343  1.240   1.00 1.86  ? 66  GLU A O    1  
ATOM 993   C CB   . GLU A 1 66  ? -2.283  9.570   0.925   1.00 1.29  ? 66  GLU A CB   1  
ATOM 994   C CG   . GLU A 1 66  ? -2.429  8.060   0.863   1.00 2.19  ? 66  GLU A CG   1  
ATOM 995   C CD   . GLU A 1 66  ? -2.070  7.500   -0.499  1.00 3.03  ? 66  GLU A CD   1  
ATOM 996   O OE1  . GLU A 1 66  ? -2.497  8.085   -1.520  1.00 3.33  ? 66  GLU A OE1  1  
ATOM 997   O OE2  . GLU A 1 66  ? -1.376  6.465   -0.558  1.00 3.75  ? 66  GLU A OE2  1  
ATOM 998   H H    . GLU A 1 66  ? -0.372  9.416   2.605   1.00 1.03  ? 66  GLU A H    1  
ATOM 999   H HA   . GLU A 1 66  ? -0.477  9.551   -0.225  1.00 1.16  ? 66  GLU A HA   1  
ATOM 1000  H HB2  . GLU A 1 66  ? -2.579  9.898   1.909   1.00 1.44  ? 66  GLU A HB2  1  
ATOM 1001  H HB3  . GLU A 1 66  ? -2.947  10.006  0.194   1.00 1.69  ? 66  GLU A HB3  1  
ATOM 1002  H HG2  . GLU A 1 66  ? -1.776  7.619   1.599   1.00 2.66  ? 66  GLU A HG2  1  
ATOM 1003  H HG3  . GLU A 1 66  ? -3.453  7.799   1.086   1.00 2.52  ? 66  GLU A HG3  1  
ATOM 1004  N N    . GLY A 1 67  ? -0.358  11.950  -0.771  1.00 1.21  ? 67  GLY A N    1  
ATOM 1005  C CA   . GLY A 1 67  ? -0.312  13.355  -1.126  1.00 1.36  ? 67  GLY A CA   1  
ATOM 1006  C C    . GLY A 1 67  ? 1.005   14.017  -0.753  1.00 1.24  ? 67  GLY A C    1  
ATOM 1007  O O    . GLY A 1 67  ? 1.139   15.235  -0.854  1.00 1.47  ? 67  GLY A O    1  
ATOM 1008  H H    . GLY A 1 67  ? -0.027  11.273  -1.403  1.00 1.78  ? 67  GLY A H    1  
ATOM 1009  H HA2  . GLY A 1 67  ? -0.458  13.450  -2.192  1.00 1.51  ? 67  GLY A HA2  1  
ATOM 1010  H HA3  . GLY A 1 67  ? -1.115  13.867  -0.617  1.00 1.54  ? 67  GLY A HA3  1  
ATOM 1011  N N    . LYS A 1 68  ? 1.971   13.218  -0.316  1.00 0.97  ? 68  LYS A N    1  
ATOM 1012  C CA   . LYS A 1 68  ? 3.288   13.736  0.049   1.00 0.87  ? 68  LYS A CA   1  
ATOM 1013  C C    . LYS A 1 68  ? 4.230   13.675  -1.151  1.00 0.90  ? 68  LYS A C    1  
ATOM 1014  O O    . LYS A 1 68  ? 3.928   13.023  -2.150  1.00 1.06  ? 68  LYS A O    1  
ATOM 1015  C CB   . LYS A 1 68  ? 3.870   12.929  1.210   1.00 0.73  ? 68  LYS A CB   1  
ATOM 1016  C CG   . LYS A 1 68  ? 2.937   12.826  2.406   1.00 1.24  ? 68  LYS A CG   1  
ATOM 1017  C CD   . LYS A 1 68  ? 2.691   14.173  3.061   1.00 2.01  ? 68  LYS A CD   1  
ATOM 1018  C CE   . LYS A 1 68  ? 1.657   14.067  4.173   1.00 2.81  ? 68  LYS A CE   1  
ATOM 1019  N NZ   . LYS A 1 68  ? 2.080   13.138  5.257   1.00 3.36  ? 68  LYS A NZ   1  
ATOM 1020  H H    . LYS A 1 68  ? 1.799   12.254  -0.237  1.00 0.95  ? 68  LYS A H    1  
ATOM 1021  H HA   . LYS A 1 68  ? 3.171   14.765  0.354   1.00 0.97  ? 68  LYS A HA   1  
ATOM 1022  H HB2  . LYS A 1 68  ? 4.093   11.932  0.863   1.00 0.95  ? 68  LYS A HB2  1  
ATOM 1023  H HB3  . LYS A 1 68  ? 4.788   13.399  1.536   1.00 0.87  ? 68  LYS A HB3  1  
ATOM 1024  H HG2  . LYS A 1 68  ? 1.994   12.423  2.073   1.00 1.54  ? 68  LYS A HG2  1  
ATOM 1025  H HG3  . LYS A 1 68  ? 3.377   12.158  3.132   1.00 1.43  ? 68  LYS A HG3  1  
ATOM 1026  H HD2  . LYS A 1 68  ? 3.618   14.534  3.481   1.00 2.15  ? 68  LYS A HD2  1  
ATOM 1027  H HD3  . LYS A 1 68  ? 2.336   14.866  2.314   1.00 2.21  ? 68  LYS A HD3  1  
ATOM 1028  H HE2  . LYS A 1 68  ? 1.503   15.049  4.596   1.00 3.07  ? 68  LYS A HE2  1  
ATOM 1029  H HE3  . LYS A 1 68  ? 0.732   13.712  3.746   1.00 3.16  ? 68  LYS A HE3  1  
ATOM 1030  H HZ1  . LYS A 1 68  ? 2.966   13.473  5.698   1.00 3.73  ? 68  LYS A HZ1  1  
ATOM 1031  H HZ2  . LYS A 1 68  ? 2.236   12.183  4.877   1.00 3.59  ? 68  LYS A HZ2  1  
ATOM 1032  H HZ3  . LYS A 1 68  ? 1.342   13.087  5.995   1.00 3.71  ? 68  LYS A HZ3  1  
ATOM 1033  N N    . GLN A 1 69  ? 5.368   14.352  -1.046  1.00 0.87  ? 69  GLN A N    1  
ATOM 1034  C CA   . GLN A 1 69  ? 6.325   14.411  -2.145  1.00 0.93  ? 69  GLN A CA   1  
ATOM 1035  C C    . GLN A 1 69  ? 7.420   13.363  -1.975  1.00 0.81  ? 69  GLN A C    1  
ATOM 1036  O O    . GLN A 1 69  ? 7.477   12.680  -0.948  1.00 0.74  ? 69  GLN A O    1  
ATOM 1037  C CB   . GLN A 1 69  ? 6.970   15.793  -2.231  1.00 1.07  ? 69  GLN A CB   1  
ATOM 1038  C CG   . GLN A 1 69  ? 5.983   16.939  -2.361  1.00 1.33  ? 69  GLN A CG   1  
ATOM 1039  C CD   . GLN A 1 69  ? 6.679   18.278  -2.495  1.00 2.12  ? 69  GLN A CD   1  
ATOM 1040  O OE1  . GLN A 1 69  ? 6.964   18.734  -3.603  1.00 2.64  ? 69  GLN A OE1  1  
ATOM 1041  N NE2  . GLN A 1 69  ? 6.974   18.908  -1.370  1.00 2.89  ? 69  GLN A NE2  1  
ATOM 1042  H H    . GLN A 1 69  ? 5.574   14.818  -0.209  1.00 0.90  ? 69  GLN A H    1  
ATOM 1043  H HA   . GLN A 1 69  ? 5.791   14.214  -3.062  1.00 1.04  ? 69  GLN A HA   1  
ATOM 1044  H HB2  . GLN A 1 69  ? 7.559   15.955  -1.340  1.00 1.06  ? 69  GLN A HB2  1  
ATOM 1045  H HB3  . GLN A 1 69  ? 7.626   15.812  -3.090  1.00 1.25  ? 69  GLN A HB3  1  
ATOM 1046  H HG2  . GLN A 1 69  ? 5.372   16.778  -3.236  1.00 1.71  ? 69  GLN A HG2  1  
ATOM 1047  H HG3  . GLN A 1 69  ? 5.357   16.961  -1.482  1.00 1.61  ? 69  GLN A HG3  1  
ATOM 1048  H HE21 . GLN A 1 69  ? 6.732   18.479  -0.520  1.00 2.96  ? 69  GLN A HE21 1  
ATOM 1049  H HE22 . GLN A 1 69  ? 7.429   19.777  -1.429  1.00 3.61  ? 69  GLN A HE22 1  
ATOM 1050  N N    . HIS A 1 70  ? 8.304   13.259  -2.964  1.00 0.84  ? 70  HIS A N    1  
ATOM 1051  C CA   . HIS A 1 70  ? 9.385   12.275  -2.934  1.00 0.79  ? 70  HIS A CA   1  
ATOM 1052  C C    . HIS A 1 70  ? 10.271  12.480  -1.709  1.00 0.70  ? 70  HIS A C    1  
ATOM 1053  O O    . HIS A 1 70  ? 10.619  11.523  -1.015  1.00 0.65  ? 70  HIS A O    1  
ATOM 1054  C CB   . HIS A 1 70  ? 10.224  12.387  -4.217  1.00 0.88  ? 70  HIS A CB   1  
ATOM 1055  C CG   . HIS A 1 70  ? 11.403  11.457  -4.289  1.00 0.90  ? 70  HIS A CG   1  
ATOM 1056  N ND1  . HIS A 1 70  ? 11.415  10.322  -5.065  1.00 1.42  ? 70  HIS A ND1  1  
ATOM 1057  C CD2  . HIS A 1 70  ? 12.621  11.512  -3.695  1.00 1.37  ? 70  HIS A CD2  1  
ATOM 1058  C CE1  . HIS A 1 70  ? 12.582  9.718   -4.946  1.00 1.31  ? 70  HIS A CE1  1  
ATOM 1059  N NE2  . HIS A 1 70  ? 13.332  10.421  -4.123  1.00 1.13  ? 70  HIS A NE2  1  
ATOM 1060  H H    . HIS A 1 70  ? 8.230   13.862  -3.737  1.00 0.93  ? 70  HIS A H    1  
ATOM 1061  H HA   . HIS A 1 70  ? 8.941   11.293  -2.887  1.00 0.78  ? 70  HIS A HA   1  
ATOM 1062  H HB2  . HIS A 1 70  ? 9.593   12.174  -5.066  1.00 0.96  ? 70  HIS A HB2  1  
ATOM 1063  H HB3  . HIS A 1 70  ? 10.597  13.398  -4.303  1.00 0.92  ? 70  HIS A HB3  1  
ATOM 1064  H HD1  . HIS A 1 70  ? 10.678  10.015  -5.645  1.00 2.13  ? 70  HIS A HD1  1  
ATOM 1065  H HD2  . HIS A 1 70  ? 12.970  12.279  -3.016  1.00 2.20  ? 70  HIS A HD2  1  
ATOM 1066  H HE1  . HIS A 1 70  ? 12.873  8.804   -5.442  1.00 1.85  ? 70  HIS A HE1  1  
ATOM 1067  H HE2  . HIS A 1 70  ? 14.216  10.137  -3.778  1.00 1.45  ? 70  HIS A HE2  1  
ATOM 1068  N N    . GLY A 1 71  ? 10.603  13.736  -1.434  1.00 0.72  ? 71  GLY A N    1  
ATOM 1069  C CA   . GLY A 1 71  ? 11.488  14.047  -0.331  1.00 0.69  ? 71  GLY A CA   1  
ATOM 1070  C C    . GLY A 1 71  ? 10.873  13.703  1.007   1.00 0.62  ? 71  GLY A C    1  
ATOM 1071  O O    . GLY A 1 71  ? 11.551  13.184  1.892   1.00 0.62  ? 71  GLY A O    1  
ATOM 1072  H H    . GLY A 1 71  ? 10.233  14.461  -1.979  1.00 0.78  ? 71  GLY A H    1  
ATOM 1073  H HA2  . GLY A 1 71  ? 12.406  13.491  -0.448  1.00 0.70  ? 71  GLY A HA2  1  
ATOM 1074  H HA3  . GLY A 1 71  ? 11.714  15.103  -0.351  1.00 0.75  ? 71  GLY A HA3  1  
ATOM 1075  N N    . ASP A 1 72  ? 9.581   13.969  1.135   1.00 0.61  ? 72  ASP A N    1  
ATOM 1076  C CA   . ASP A 1 72  ? 8.858   13.733  2.381   1.00 0.58  ? 72  ASP A CA   1  
ATOM 1077  C C    . ASP A 1 72  ? 8.853   12.255  2.742   1.00 0.49  ? 72  ASP A C    1  
ATOM 1078  O O    . ASP A 1 72  ? 9.145   11.881  3.881   1.00 0.44  ? 72  ASP A O    1  
ATOM 1079  C CB   . ASP A 1 72  ? 7.418   14.240  2.262   1.00 0.68  ? 72  ASP A CB   1  
ATOM 1080  C CG   . ASP A 1 72  ? 7.344   15.741  2.091   1.00 1.16  ? 72  ASP A CG   1  
ATOM 1081  O OD1  . ASP A 1 72  ? 7.602   16.233  0.969   1.00 2.03  ? 72  ASP A OD1  1  
ATOM 1082  O OD2  . ASP A 1 72  ? 7.026   16.436  3.076   1.00 1.47  ? 72  ASP A OD2  1  
ATOM 1083  H H    . ASP A 1 72  ? 9.096   14.342  0.370   1.00 0.65  ? 72  ASP A H    1  
ATOM 1084  H HA   . ASP A 1 72  ? 9.360   14.280  3.164   1.00 0.61  ? 72  ASP A HA   1  
ATOM 1085  H HB2  . ASP A 1 72  ? 6.948   13.776  1.407   1.00 1.25  ? 72  ASP A HB2  1  
ATOM 1086  H HB3  . ASP A 1 72  ? 6.873   13.970  3.156   1.00 0.87  ? 72  ASP A HB3  1  
ATOM 1087  N N    . VAL A 1 73  ? 8.539   11.416  1.764   1.00 0.50  ? 73  VAL A N    1  
ATOM 1088  C CA   . VAL A 1 73  ? 8.461   9.980   1.989   1.00 0.45  ? 73  VAL A CA   1  
ATOM 1089  C C    . VAL A 1 73  ? 9.845   9.392   2.250   1.00 0.44  ? 73  VAL A C    1  
ATOM 1090  O O    . VAL A 1 73  ? 10.042  8.651   3.213   1.00 0.43  ? 73  VAL A O    1  
ATOM 1091  C CB   . VAL A 1 73  ? 7.818   9.256   0.785   1.00 0.51  ? 73  VAL A CB   1  
ATOM 1092  C CG1  . VAL A 1 73  ? 7.687   7.763   1.053   1.00 1.08  ? 73  VAL A CG1  1  
ATOM 1093  C CG2  . VAL A 1 73  ? 6.460   9.858   0.458   1.00 0.97  ? 73  VAL A CG2  1  
ATOM 1094  H H    . VAL A 1 73  ? 8.348   11.773  0.869   1.00 0.56  ? 73  VAL A H    1  
ATOM 1095  H HA   . VAL A 1 73  ? 7.840   9.812   2.857   1.00 0.44  ? 73  VAL A HA   1  
ATOM 1096  H HB   . VAL A 1 73  ? 8.460   9.388   -0.073  1.00 0.92  ? 73  VAL A HB   1  
ATOM 1097  H HG11 . VAL A 1 73  ? 7.243   7.279   0.194   1.00 1.67  ? 73  VAL A HG11 1  
ATOM 1098  H HG12 . VAL A 1 73  ? 7.060   7.604   1.918   1.00 1.48  ? 73  VAL A HG12 1  
ATOM 1099  H HG13 . VAL A 1 73  ? 8.666   7.343   1.236   1.00 1.71  ? 73  VAL A HG13 1  
ATOM 1100  H HG21 . VAL A 1 73  ? 6.031   9.337   -0.385  1.00 1.47  ? 73  VAL A HG21 1  
ATOM 1101  H HG22 . VAL A 1 73  ? 6.577   10.903  0.214   1.00 1.57  ? 73  VAL A HG22 1  
ATOM 1102  H HG23 . VAL A 1 73  ? 5.806   9.760   1.314   1.00 1.50  ? 73  VAL A HG23 1  
ATOM 1103  N N    . VAL A 1 74  ? 10.811  9.754   1.410   1.00 0.49  ? 74  VAL A N    1  
ATOM 1104  C CA   . VAL A 1 74  ? 12.164  9.218   1.529   1.00 0.53  ? 74  VAL A CA   1  
ATOM 1105  C C    . VAL A 1 74  ? 12.816  9.652   2.839   1.00 0.51  ? 74  VAL A C    1  
ATOM 1106  O O    . VAL A 1 74  ? 13.455  8.847   3.518   1.00 0.52  ? 74  VAL A O    1  
ATOM 1107  C CB   . VAL A 1 74  ? 13.049  9.638   0.333   1.00 0.64  ? 74  VAL A CB   1  
ATOM 1108  C CG1  . VAL A 1 74  ? 14.496  9.215   0.540   1.00 0.72  ? 74  VAL A CG1  1  
ATOM 1109  C CG2  . VAL A 1 74  ? 12.508  9.041   -0.957  1.00 0.70  ? 74  VAL A CG2  1  
ATOM 1110  H H    . VAL A 1 74  ? 10.609  10.396  0.694   1.00 0.52  ? 74  VAL A H    1  
ATOM 1111  H HA   . VAL A 1 74  ? 12.088  8.140   1.527   1.00 0.55  ? 74  VAL A HA   1  
ATOM 1112  H HB   . VAL A 1 74  ? 13.020  10.714  0.245   1.00 0.66  ? 74  VAL A HB   1  
ATOM 1113  H HG11 . VAL A 1 74  ? 15.088  9.533   -0.306  1.00 1.19  ? 74  VAL A HG11 1  
ATOM 1114  H HG12 . VAL A 1 74  ? 14.548  8.140   0.632   1.00 1.34  ? 74  VAL A HG12 1  
ATOM 1115  H HG13 . VAL A 1 74  ? 14.879  9.673   1.440   1.00 1.20  ? 74  VAL A HG13 1  
ATOM 1116  H HG21 . VAL A 1 74  ? 12.473  7.965   -0.868  1.00 1.37  ? 74  VAL A HG21 1  
ATOM 1117  H HG22 . VAL A 1 74  ? 13.154  9.314   -1.778  1.00 1.03  ? 74  VAL A HG22 1  
ATOM 1118  H HG23 . VAL A 1 74  ? 11.514  9.422   -1.136  1.00 1.19  ? 74  VAL A HG23 1  
ATOM 1119  N N    . SER A 1 75  ? 12.628  10.914  3.209   1.00 0.51  ? 75  SER A N    1  
ATOM 1120  C CA   . SER A 1 75  ? 13.206  11.431  4.439   1.00 0.52  ? 75  SER A CA   1  
ATOM 1121  C C    . SER A 1 75  ? 12.609  10.704  5.642   1.00 0.47  ? 75  SER A C    1  
ATOM 1122  O O    . SER A 1 75  ? 13.302  10.429  6.621   1.00 0.51  ? 75  SER A O    1  
ATOM 1123  C CB   . SER A 1 75  ? 12.976  12.943  4.548   1.00 0.58  ? 75  SER A CB   1  
ATOM 1124  O OG   . SER A 1 75  ? 13.855  13.528  5.494   1.00 0.66  ? 75  SER A OG   1  
ATOM 1125  H H    . SER A 1 75  ? 12.090  11.511  2.640   1.00 0.52  ? 75  SER A H    1  
ATOM 1126  H HA   . SER A 1 75  ? 14.268  11.238  4.411   1.00 0.57  ? 75  SER A HA   1  
ATOM 1127  H HB2  . SER A 1 75  ? 13.151  13.400  3.584   1.00 0.61  ? 75  SER A HB2  1  
ATOM 1128  H HB3  . SER A 1 75  ? 11.959  13.130  4.855   1.00 0.57  ? 75  SER A HB3  1  
ATOM 1129  H HG   . SER A 1 75  ? 13.546  14.421  5.709   1.00 1.12  ? 75  SER A HG   1  
ATOM 1130  N N    . ALA A 1 76  ? 11.326  10.369  5.548   1.00 0.42  ? 76  ALA A N    1  
ATOM 1131  C CA   . ALA A 1 76  ? 10.646  9.642   6.609   1.00 0.39  ? 76  ALA A CA   1  
ATOM 1132  C C    . ALA A 1 76  ? 11.224  8.240   6.766   1.00 0.37  ? 76  ALA A C    1  
ATOM 1133  O O    . ALA A 1 76  ? 11.408  7.759   7.882   1.00 0.39  ? 76  ALA A O    1  
ATOM 1134  C CB   . ALA A 1 76  ? 9.156   9.566   6.333   1.00 0.39  ? 76  ALA A CB   1  
ATOM 1135  H H    . ALA A 1 76  ? 10.824  10.617  4.741   1.00 0.42  ? 76  ALA A H    1  
ATOM 1136  H HA   . ALA A 1 76  ? 10.790  10.185  7.532   1.00 0.42  ? 76  ALA A HA   1  
ATOM 1137  H HB1  . ALA A 1 76  ? 8.661   9.089   7.164   1.00 1.09  ? 76  ALA A HB1  1  
ATOM 1138  H HB2  . ALA A 1 76  ? 8.986   8.993   5.435   1.00 1.06  ? 76  ALA A HB2  1  
ATOM 1139  H HB3  . ALA A 1 76  ? 8.762   10.564  6.204   1.00 1.06  ? 76  ALA A HB3  1  
ATOM 1140  N N    . ILE A 1 77  ? 11.507  7.591   5.637   1.00 0.37  ? 77  ILE A N    1  
ATOM 1141  C CA   . ILE A 1 77  ? 12.113  6.263   5.639   1.00 0.39  ? 77  ILE A CA   1  
ATOM 1142  C C    . ILE A 1 77  ? 13.475  6.302   6.322   1.00 0.41  ? 77  ILE A C    1  
ATOM 1143  O O    . ILE A 1 77  ? 13.780  5.468   7.175   1.00 0.44  ? 77  ILE A O    1  
ATOM 1144  C CB   . ILE A 1 77  ? 12.286  5.730   4.200   1.00 0.45  ? 77  ILE A CB   1  
ATOM 1145  C CG1  . ILE A 1 77  ? 10.932  5.678   3.490   1.00 0.53  ? 77  ILE A CG1  1  
ATOM 1146  C CG2  . ILE A 1 77  ? 12.937  4.350   4.208   1.00 0.50  ? 77  ILE A CG2  1  
ATOM 1147  C CD1  . ILE A 1 77  ? 11.035  5.432   2.003   1.00 0.69  ? 77  ILE A CD1  1  
ATOM 1148  H H    . ILE A 1 77  ? 11.293  8.013   4.774   1.00 0.38  ? 77  ILE A H    1  
ATOM 1149  H HA   . ILE A 1 77  ? 11.462  5.592   6.180   1.00 0.40  ? 77  ILE A HA   1  
ATOM 1150  H HB   . ILE A 1 77  ? 12.936  6.404   3.667   1.00 0.50  ? 77  ILE A HB   1  
ATOM 1151  H HG12 . ILE A 1 77  ? 10.339  4.881   3.916   1.00 0.98  ? 77  ILE A HG12 1  
ATOM 1152  H HG13 . ILE A 1 77  ? 10.420  6.619   3.639   1.00 1.00  ? 77  ILE A HG13 1  
ATOM 1153  H HG21 . ILE A 1 77  ? 13.081  4.014   3.192   1.00 1.07  ? 77  ILE A HG21 1  
ATOM 1154  H HG22 . ILE A 1 77  ? 12.297  3.652   4.730   1.00 1.16  ? 77  ILE A HG22 1  
ATOM 1155  H HG23 . ILE A 1 77  ? 13.893  4.404   4.708   1.00 1.05  ? 77  ILE A HG23 1  
ATOM 1156  H HD11 . ILE A 1 77  ? 11.598  6.234   1.548   1.00 1.20  ? 77  ILE A HD11 1  
ATOM 1157  H HD12 . ILE A 1 77  ? 10.043  5.399   1.575   1.00 1.34  ? 77  ILE A HD12 1  
ATOM 1158  H HD13 . ILE A 1 77  ? 11.537  4.492   1.826   1.00 1.35  ? 77  ILE A HD13 1  
ATOM 1159  N N    . ARG A 1 78  ? 14.276  7.300   5.967   1.00 0.43  ? 78  ARG A N    1  
ATOM 1160  C CA   . ARG A 1 78  ? 15.614  7.443   6.523   1.00 0.50  ? 78  ARG A CA   1  
ATOM 1161  C C    . ARG A 1 78  ? 15.550  7.801   8.005   1.00 0.50  ? 78  ARG A C    1  
ATOM 1162  O O    . ARG A 1 78  ? 16.449  7.461   8.780   1.00 0.56  ? 78  ARG A O    1  
ATOM 1163  C CB   . ARG A 1 78  ? 16.396  8.511   5.759   1.00 0.58  ? 78  ARG A CB   1  
ATOM 1164  C CG   . ARG A 1 78  ? 16.451  8.267   4.260   1.00 0.66  ? 78  ARG A CG   1  
ATOM 1165  C CD   . ARG A 1 78  ? 17.317  9.298   3.558   1.00 0.89  ? 78  ARG A CD   1  
ATOM 1166  N NE   . ARG A 1 78  ? 18.729  9.154   3.906   1.00 1.59  ? 78  ARG A NE   1  
ATOM 1167  C CZ   . ARG A 1 78  ? 19.526  10.171  4.231   1.00 2.11  ? 78  ARG A CZ   1  
ATOM 1168  N NH1  . ARG A 1 78  ? 19.033  11.402  4.333   1.00 2.12  ? 78  ARG A NH1  1  
ATOM 1169  N NH2  . ARG A 1 78  ? 20.813  9.956   4.471   1.00 3.09  ? 78  ARG A NH2  1  
ATOM 1170  H H    . ARG A 1 78  ? 13.959  7.954   5.304   1.00 0.42  ? 78  ARG A H    1  
ATOM 1171  H HA   . ARG A 1 78  ? 16.118  6.494   6.418   1.00 0.54  ? 78  ARG A HA   1  
ATOM 1172  H HB2  . ARG A 1 78  ? 15.930  9.471   5.930   1.00 0.60  ? 78  ARG A HB2  1  
ATOM 1173  H HB3  . ARG A 1 78  ? 17.409  8.540   6.135   1.00 0.65  ? 78  ARG A HB3  1  
ATOM 1174  H HG2  . ARG A 1 78  ? 16.861  7.285   4.080   1.00 0.78  ? 78  ARG A HG2  1  
ATOM 1175  H HG3  . ARG A 1 78  ? 15.448  8.320   3.862   1.00 0.83  ? 78  ARG A HG3  1  
ATOM 1176  H HD2  . ARG A 1 78  ? 17.204  9.175   2.492   1.00 1.36  ? 78  ARG A HD2  1  
ATOM 1177  H HD3  . ARG A 1 78  ? 16.983  10.284  3.845   1.00 1.38  ? 78  ARG A HD3  1  
ATOM 1178  H HE   . ARG A 1 78  ? 19.109  8.243   3.873   1.00 2.12  ? 78  ARG A HE   1  
ATOM 1179  H HH11 . ARG A 1 78  ? 18.056  11.572  4.175   1.00 1.97  ? 78  ARG A HH11 1  
ATOM 1180  H HH12 . ARG A 1 78  ? 19.641  12.172  4.552   1.00 2.67  ? 78  ARG A HH12 1  
ATOM 1181  H HH21 . ARG A 1 78  ? 21.192  9.025   4.403   1.00 3.55  ? 78  ARG A HH21 1  
ATOM 1182  H HH22 . ARG A 1 78  ? 21.417  10.722  4.725   1.00 3.52  ? 78  ARG A HH22 1  
ATOM 1183  N N    . ALA A 1 79  ? 14.472  8.468   8.399   1.00 0.47  ? 79  ALA A N    1  
ATOM 1184  C CA   . ALA A 1 79  ? 14.277  8.864   9.786   1.00 0.51  ? 79  ALA A CA   1  
ATOM 1185  C C    . ALA A 1 79  ? 13.642  7.736   10.591  1.00 0.43  ? 79  ALA A C    1  
ATOM 1186  O O    . ALA A 1 79  ? 13.234  7.930   11.737  1.00 0.46  ? 79  ALA A O    1  
ATOM 1187  C CB   . ALA A 1 79  ? 13.424  10.122  9.863   1.00 0.65  ? 79  ALA A CB   1  
ATOM 1188  H H    . ALA A 1 79  ? 13.788  8.705   7.736   1.00 0.45  ? 79  ALA A H    1  
ATOM 1189  H HA   . ALA A 1 79  ? 15.246  9.090   10.206  1.00 0.60  ? 79  ALA A HA   1  
ATOM 1190  H HB1  . ALA A 1 79  ? 12.447  9.917   9.448   1.00 1.28  ? 79  ALA A HB1  1  
ATOM 1191  H HB2  . ALA A 1 79  ? 13.897  10.914  9.300   1.00 1.20  ? 79  ALA A HB2  1  
ATOM 1192  H HB3  . ALA A 1 79  ? 13.320  10.424  10.894  1.00 1.18  ? 79  ALA A HB3  1  
ATOM 1193  N N    . GLY A 1 80  ? 13.548  6.561   9.980   1.00 0.41  ? 80  GLY A N    1  
ATOM 1194  C CA   . GLY A 1 80  ? 13.035  5.401   10.677  1.00 0.42  ? 80  GLY A CA   1  
ATOM 1195  C C    . GLY A 1 80  ? 14.110  4.717   11.495  1.00 0.46  ? 80  GLY A C    1  
ATOM 1196  O O    . GLY A 1 80  ? 13.815  3.985   12.440  1.00 0.60  ? 80  GLY A O    1  
ATOM 1197  H H    . GLY A 1 80  ? 13.826  6.484   9.040   1.00 0.46  ? 80  GLY A H    1  
ATOM 1198  H HA2  . GLY A 1 80  ? 12.237  5.713   11.335  1.00 0.51  ? 80  GLY A HA2  1  
ATOM 1199  H HA3  . GLY A 1 80  ? 12.643  4.701   9.954   1.00 0.43  ? 80  GLY A HA3  1  
ATOM 1200  N N    . GLY A 1 81  ? 15.360  4.966   11.136  1.00 0.49  ? 81  GLY A N    1  
ATOM 1201  C CA   . GLY A 1 81  ? 16.467  4.376   11.854  1.00 0.63  ? 81  GLY A CA   1  
ATOM 1202  C C    . GLY A 1 81  ? 17.069  3.208   11.106  1.00 0.64  ? 81  GLY A C    1  
ATOM 1203  O O    . GLY A 1 81  ? 17.371  3.312   9.915   1.00 1.10  ? 81  GLY A O    1  
ATOM 1204  H H    . GLY A 1 81  ? 15.532  5.552   10.372  1.00 0.51  ? 81  GLY A H    1  
ATOM 1205  H HA2  . GLY A 1 81  ? 17.228  5.127   12.005  1.00 0.75  ? 81  GLY A HA2  1  
ATOM 1206  H HA3  . GLY A 1 81  ? 16.115  4.032   12.816  1.00 0.70  ? 81  GLY A HA3  1  
ATOM 1207  N N    . ASP A 1 82  ? 17.229  2.092   11.798  1.00 0.43  ? 82  ASP A N    1  
ATOM 1208  C CA   . ASP A 1 82  ? 17.841  0.900   11.220  1.00 0.44  ? 82  ASP A CA   1  
ATOM 1209  C C    . ASP A 1 82  ? 16.839  0.124   10.377  1.00 0.39  ? 82  ASP A C    1  
ATOM 1210  O O    . ASP A 1 82  ? 17.218  -0.610  9.469   1.00 0.55  ? 82  ASP A O    1  
ATOM 1211  C CB   . ASP A 1 82  ? 18.399  -0.001  12.330  1.00 0.55  ? 82  ASP A CB   1  
ATOM 1212  C CG   . ASP A 1 82  ? 17.316  -0.556  13.243  1.00 1.41  ? 82  ASP A CG   1  
ATOM 1213  O OD1  . ASP A 1 82  ? 16.602  0.244   13.888  1.00 1.97  ? 82  ASP A OD1  1  
ATOM 1214  O OD2  . ASP A 1 82  ? 17.189  -1.794  13.342  1.00 2.12  ? 82  ASP A OD2  1  
ATOM 1215  H H    . ASP A 1 82  ? 16.923  2.063   12.729  1.00 0.64  ? 82  ASP A H    1  
ATOM 1216  H HA   . ASP A 1 82  ? 18.656  1.218   10.582  1.00 0.51  ? 82  ASP A HA   1  
ATOM 1217  H HB2  . ASP A 1 82  ? 18.921  -0.832  11.881  1.00 0.96  ? 82  ASP A HB2  1  
ATOM 1218  H HB3  . ASP A 1 82  ? 19.092  0.569   12.931  1.00 0.95  ? 82  ASP A HB3  1  
ATOM 1219  N N    . GLU A 1 83  ? 15.563  0.302   10.663  1.00 0.38  ? 83  GLU A N    1  
ATOM 1220  C CA   . GLU A 1 83  ? 14.517  -0.409  9.946   1.00 0.39  ? 83  GLU A CA   1  
ATOM 1221  C C    . GLU A 1 83  ? 13.352  0.513   9.638   1.00 0.38  ? 83  GLU A C    1  
ATOM 1222  O O    . GLU A 1 83  ? 13.212  1.579   10.241  1.00 0.53  ? 83  GLU A O    1  
ATOM 1223  C CB   . GLU A 1 83  ? 14.035  -1.610  10.757  1.00 0.47  ? 83  GLU A CB   1  
ATOM 1224  C CG   . GLU A 1 83  ? 13.943  -1.324  12.237  1.00 0.86  ? 83  GLU A CG   1  
ATOM 1225  C CD   . GLU A 1 83  ? 13.010  -2.263  12.967  1.00 1.62  ? 83  GLU A CD   1  
ATOM 1226  O OE1  . GLU A 1 83  ? 13.144  -3.494  12.801  1.00 2.11  ? 83  GLU A OE1  1  
ATOM 1227  O OE2  . GLU A 1 83  ? 12.164  -1.773  13.741  1.00 2.00  ? 83  GLU A OE2  1  
ATOM 1228  H H    . GLU A 1 83  ? 15.309  0.937   11.365  1.00 0.49  ? 83  GLU A H    1  
ATOM 1229  H HA   . GLU A 1 83  ? 14.935  -0.762  9.015   1.00 0.42  ? 83  GLU A HA   1  
ATOM 1230  H HB2  . GLU A 1 83  ? 13.056  -1.899  10.405  1.00 0.89  ? 83  GLU A HB2  1  
ATOM 1231  H HB3  . GLU A 1 83  ? 14.720  -2.430  10.611  1.00 0.82  ? 83  GLU A HB3  1  
ATOM 1232  H HG2  . GLU A 1 83  ? 14.929  -1.422  12.668  1.00 1.20  ? 83  GLU A HG2  1  
ATOM 1233  H HG3  . GLU A 1 83  ? 13.599  -0.314  12.367  1.00 1.09  ? 83  GLU A HG3  1  
ATOM 1234  N N    . THR A 1 84  ? 12.520  0.095   8.703   1.00 0.27  ? 84  THR A N    1  
ATOM 1235  C CA   . THR A 1 84  ? 11.380  0.880   8.290   1.00 0.26  ? 84  THR A CA   1  
ATOM 1236  C C    . THR A 1 84  ? 10.202  -0.034  7.972   1.00 0.22  ? 84  THR A C    1  
ATOM 1237  O O    . THR A 1 84  ? 10.386  -1.191  7.578   1.00 0.21  ? 84  THR A O    1  
ATOM 1238  C CB   . THR A 1 84  ? 11.722  1.764   7.067   1.00 0.30  ? 84  THR A CB   1  
ATOM 1239  O OG1  . THR A 1 84  ? 10.626  2.640   6.767   1.00 0.32  ? 84  THR A OG1  1  
ATOM 1240  C CG2  . THR A 1 84  ? 12.050  0.912   5.846   1.00 0.30  ? 84  THR A CG2  1  
ATOM 1241  H H    . THR A 1 84  ? 12.678  -0.778  8.276   1.00 0.23  ? 84  THR A H    1  
ATOM 1242  H HA   . THR A 1 84  ? 11.107  1.528   9.112   1.00 0.30  ? 84  THR A HA   1  
ATOM 1243  H HB   . THR A 1 84  ? 12.589  2.361   7.309   1.00 0.36  ? 84  THR A HB   1  
ATOM 1244  H HG1  . THR A 1 84  ? 10.278  3.008   7.588   1.00 0.60  ? 84  THR A HG1  1  
ATOM 1245  H HG21 . THR A 1 84  ? 11.187  0.319   5.580   1.00 1.03  ? 84  THR A HG21 1  
ATOM 1246  H HG22 . THR A 1 84  ? 12.879  0.258   6.075   1.00 1.05  ? 84  THR A HG22 1  
ATOM 1247  H HG23 . THR A 1 84  ? 12.315  1.554   5.018   1.00 1.09  ? 84  THR A HG23 1  
ATOM 1248  N N    . LYS A 1 85  ? 8.996   0.468   8.197   1.00 0.24  ? 85  LYS A N    1  
ATOM 1249  C CA   . LYS A 1 85  ? 7.787   -0.278  7.890   1.00 0.23  ? 85  LYS A CA   1  
ATOM 1250  C C    . LYS A 1 85  ? 7.010   0.427   6.791   1.00 0.23  ? 85  LYS A C    1  
ATOM 1251  O O    . LYS A 1 85  ? 6.556   1.556   6.967   1.00 0.26  ? 85  LYS A O    1  
ATOM 1252  C CB   . LYS A 1 85  ? 6.916   -0.420  9.140   1.00 0.28  ? 85  LYS A CB   1  
ATOM 1253  C CG   . LYS A 1 85  ? 7.595   -1.170  10.273  1.00 0.37  ? 85  LYS A CG   1  
ATOM 1254  C CD   . LYS A 1 85  ? 6.764   -1.121  11.542  1.00 0.50  ? 85  LYS A CD   1  
ATOM 1255  C CE   . LYS A 1 85  ? 7.450   -1.847  12.687  1.00 0.78  ? 85  LYS A CE   1  
ATOM 1256  N NZ   . LYS A 1 85  ? 6.698   -1.710  13.963  1.00 1.63  ? 85  LYS A NZ   1  
ATOM 1257  H H    . LYS A 1 85  ? 8.919   1.371   8.570   1.00 0.27  ? 85  LYS A H    1  
ATOM 1258  H HA   . LYS A 1 85  ? 8.073   -1.261  7.544   1.00 0.22  ? 85  LYS A HA   1  
ATOM 1259  H HB2  . LYS A 1 85  ? 6.653   0.565   9.496   1.00 0.34  ? 85  LYS A HB2  1  
ATOM 1260  H HB3  . LYS A 1 85  ? 6.013   -0.950  8.877   1.00 0.36  ? 85  LYS A HB3  1  
ATOM 1261  H HG2  . LYS A 1 85  ? 7.729   -2.202  9.981   1.00 0.55  ? 85  LYS A HG2  1  
ATOM 1262  H HG3  . LYS A 1 85  ? 8.559   -0.721  10.465  1.00 0.55  ? 85  LYS A HG3  1  
ATOM 1263  H HD2  . LYS A 1 85  ? 6.614   -0.090  11.820  1.00 0.71  ? 85  LYS A HD2  1  
ATOM 1264  H HD3  . LYS A 1 85  ? 5.809   -1.587  11.351  1.00 0.72  ? 85  LYS A HD3  1  
ATOM 1265  H HE2  . LYS A 1 85  ? 7.528   -2.894  12.437  1.00 1.42  ? 85  LYS A HE2  1  
ATOM 1266  H HE3  . LYS A 1 85  ? 8.442   -1.435  12.817  1.00 1.22  ? 85  LYS A HE3  1  
ATOM 1267  H HZ1  . LYS A 1 85  ? 5.741   -2.112  13.865  1.00 2.25  ? 85  LYS A HZ1  1  
ATOM 1268  H HZ2  . LYS A 1 85  ? 6.614   -0.702  14.223  1.00 1.97  ? 85  LYS A HZ2  1  
ATOM 1269  H HZ3  . LYS A 1 85  ? 7.200   -2.210  14.730  1.00 2.17  ? 85  LYS A HZ3  1  
ATOM 1270  N N    . LEU A 1 86  ? 6.855   -0.246  5.668   1.00 0.22  ? 86  LEU A N    1  
ATOM 1271  C CA   . LEU A 1 86  ? 6.181   0.328   4.515   1.00 0.22  ? 86  LEU A CA   1  
ATOM 1272  C C    . LEU A 1 86  ? 4.827   -0.336  4.306   1.00 0.22  ? 86  LEU A C    1  
ATOM 1273  O O    . LEU A 1 86  ? 4.703   -1.552  4.395   1.00 0.27  ? 86  LEU A O    1  
ATOM 1274  C CB   . LEU A 1 86  ? 7.038   0.163   3.256   1.00 0.24  ? 86  LEU A CB   1  
ATOM 1275  C CG   . LEU A 1 86  ? 8.381   0.899   3.275   1.00 0.25  ? 86  LEU A CG   1  
ATOM 1276  C CD1  . LEU A 1 86  ? 9.186   0.564   2.028   1.00 0.28  ? 86  LEU A CD1  1  
ATOM 1277  C CD2  . LEU A 1 86  ? 8.161   2.402   3.376   1.00 0.28  ? 86  LEU A CD2  1  
ATOM 1278  H H    . LEU A 1 86  ? 7.194   -1.168  5.613   1.00 0.22  ? 86  LEU A H    1  
ATOM 1279  H HA   . LEU A 1 86  ? 6.032   1.381   4.704   1.00 0.23  ? 86  LEU A HA   1  
ATOM 1280  H HB2  . LEU A 1 86  ? 7.233   -0.890  3.115   1.00 0.24  ? 86  LEU A HB2  1  
ATOM 1281  H HB3  . LEU A 1 86  ? 6.469   0.523   2.410   1.00 0.25  ? 86  LEU A HB3  1  
ATOM 1282  H HG   . LEU A 1 86  ? 8.950   0.582   4.138   1.00 0.26  ? 86  LEU A HG   1  
ATOM 1283  H HD11 . LEU A 1 86  ? 8.628   0.853   1.151   1.00 1.02  ? 86  LEU A HD11 1  
ATOM 1284  H HD12 . LEU A 1 86  ? 9.378   -0.500  1.998   1.00 0.97  ? 86  LEU A HD12 1  
ATOM 1285  H HD13 . LEU A 1 86  ? 10.125  1.097   2.051   1.00 1.02  ? 86  LEU A HD13 1  
ATOM 1286  H HD21 . LEU A 1 86  ? 9.117   2.904   3.395   1.00 1.04  ? 86  LEU A HD21 1  
ATOM 1287  H HD22 . LEU A 1 86  ? 7.618   2.627   4.282   1.00 1.00  ? 86  LEU A HD22 1  
ATOM 1288  H HD23 . LEU A 1 86  ? 7.593   2.740   2.521   1.00 1.03  ? 86  LEU A HD23 1  
ATOM 1289  N N    . LEU A 1 87  ? 3.817   0.468   4.042   1.00 0.20  ? 87  LEU A N    1  
ATOM 1290  C CA   . LEU A 1 87  ? 2.497   -0.049  3.728   1.00 0.21  ? 87  LEU A CA   1  
ATOM 1291  C C    . LEU A 1 87  ? 2.236   0.108   2.241   1.00 0.21  ? 87  LEU A C    1  
ATOM 1292  O O    . LEU A 1 87  ? 2.280   1.220   1.718   1.00 0.26  ? 87  LEU A O    1  
ATOM 1293  C CB   . LEU A 1 87  ? 1.425   0.696   4.520   1.00 0.27  ? 87  LEU A CB   1  
ATOM 1294  C CG   . LEU A 1 87  ? -0.008  0.242   4.248   1.00 0.39  ? 87  LEU A CG   1  
ATOM 1295  C CD1  . LEU A 1 87  ? -0.238  -1.150  4.803   1.00 0.51  ? 87  LEU A CD1  1  
ATOM 1296  C CD2  . LEU A 1 87  ? -1.001  1.225   4.835   1.00 0.45  ? 87  LEU A CD2  1  
ATOM 1297  H H    . LEU A 1 87  ? 3.961   1.440   4.060   1.00 0.20  ? 87  LEU A H    1  
ATOM 1298  H HA   . LEU A 1 87  ? 2.470   -1.097  3.987   1.00 0.23  ? 87  LEU A HA   1  
ATOM 1299  H HB2  . LEU A 1 87  ? 1.630   0.568   5.574   1.00 0.29  ? 87  LEU A HB2  1  
ATOM 1300  H HB3  . LEU A 1 87  ? 1.497   1.745   4.280   1.00 0.27  ? 87  LEU A HB3  1  
ATOM 1301  H HG   . LEU A 1 87  ? -0.165  0.203   3.179   1.00 0.63  ? 87  LEU A HG   1  
ATOM 1302  H HD11 . LEU A 1 87  ? -0.096  -1.140  5.873   1.00 1.22  ? 87  LEU A HD11 1  
ATOM 1303  H HD12 . LEU A 1 87  ? 0.464   -1.840  4.353   1.00 1.05  ? 87  LEU A HD12 1  
ATOM 1304  H HD13 . LEU A 1 87  ? -1.246  -1.465  4.578   1.00 1.12  ? 87  LEU A HD13 1  
ATOM 1305  H HD21 . LEU A 1 87  ? -2.007  0.895   4.614   1.00 1.05  ? 87  LEU A HD21 1  
ATOM 1306  H HD22 . LEU A 1 87  ? -0.838  2.201   4.401   1.00 1.12  ? 87  LEU A HD22 1  
ATOM 1307  H HD23 . LEU A 1 87  ? -0.867  1.278   5.905   1.00 1.19  ? 87  LEU A HD23 1  
ATOM 1308  N N    . VAL A 1 88  ? 1.976   -1.002  1.566   1.00 0.20  ? 88  VAL A N    1  
ATOM 1309  C CA   . VAL A 1 88  ? 1.780   -0.979  0.126   1.00 0.23  ? 88  VAL A CA   1  
ATOM 1310  C C    . VAL A 1 88  ? 0.481   -1.670  -0.274  1.00 0.24  ? 88  VAL A C    1  
ATOM 1311  O O    . VAL A 1 88  ? -0.053  -2.499  0.471   1.00 0.27  ? 88  VAL A O    1  
ATOM 1312  C CB   . VAL A 1 88  ? 2.962   -1.641  -0.617  1.00 0.28  ? 88  VAL A CB   1  
ATOM 1313  C CG1  . VAL A 1 88  ? 4.251   -0.868  -0.384  1.00 0.31  ? 88  VAL A CG1  1  
ATOM 1314  C CG2  . VAL A 1 88  ? 3.126   -3.097  -0.198  1.00 0.33  ? 88  VAL A CG2  1  
ATOM 1315  H H    . VAL A 1 88  ? 1.913   -1.857  2.047   1.00 0.20  ? 88  VAL A H    1  
ATOM 1316  H HA   . VAL A 1 88  ? 1.728   0.055   -0.182  1.00 0.26  ? 88  VAL A HA   1  
ATOM 1317  H HB   . VAL A 1 88  ? 2.748   -1.617  -1.672  1.00 0.32  ? 88  VAL A HB   1  
ATOM 1318  H HG11 . VAL A 1 88  ? 4.442   -0.800  0.676   1.00 1.05  ? 88  VAL A HG11 1  
ATOM 1319  H HG12 . VAL A 1 88  ? 4.155   0.127   -0.798  1.00 1.02  ? 88  VAL A HG12 1  
ATOM 1320  H HG13 . VAL A 1 88  ? 5.069   -1.381  -0.865  1.00 1.03  ? 88  VAL A HG13 1  
ATOM 1321  H HG21 . VAL A 1 88  ? 3.976   -3.524  -0.708  1.00 1.07  ? 88  VAL A HG21 1  
ATOM 1322  H HG22 . VAL A 1 88  ? 2.234   -3.651  -0.457  1.00 1.02  ? 88  VAL A HG22 1  
ATOM 1323  H HG23 . VAL A 1 88  ? 3.285   -3.148  0.869   1.00 1.09  ? 88  VAL A HG23 1  
ATOM 1324  N N    . VAL A 1 89  ? -0.025  -1.304  -1.445  1.00 0.24  ? 89  VAL A N    1  
ATOM 1325  C CA   . VAL A 1 89  ? -1.239  -1.899  -1.994  1.00 0.27  ? 89  VAL A CA   1  
ATOM 1326  C C    . VAL A 1 89  ? -1.013  -2.329  -3.438  1.00 0.34  ? 89  VAL A C    1  
ATOM 1327  O O    . VAL A 1 89  ? -0.358  -1.622  -4.209  1.00 0.42  ? 89  VAL A O    1  
ATOM 1328  C CB   . VAL A 1 89  ? -2.444  -0.926  -1.944  1.00 0.25  ? 89  VAL A CB   1  
ATOM 1329  C CG1  . VAL A 1 89  ? -2.926  -0.727  -0.519  1.00 0.29  ? 89  VAL A CG1  1  
ATOM 1330  C CG2  . VAL A 1 89  ? -2.093  0.413   -2.573  1.00 0.30  ? 89  VAL A CG2  1  
ATOM 1331  H H    . VAL A 1 89  ? 0.443   -0.620  -1.969  1.00 0.26  ? 89  VAL A H    1  
ATOM 1332  H HA   . VAL A 1 89  ? -1.479  -2.772  -1.402  1.00 0.32  ? 89  VAL A HA   1  
ATOM 1333  H HB   . VAL A 1 89  ? -3.251  -1.362  -2.513  1.00 0.28  ? 89  VAL A HB   1  
ATOM 1334  H HG11 . VAL A 1 89  ? -3.243  -1.675  -0.111  1.00 1.04  ? 89  VAL A HG11 1  
ATOM 1335  H HG12 . VAL A 1 89  ? -3.761  -0.039  -0.515  1.00 1.07  ? 89  VAL A HG12 1  
ATOM 1336  H HG13 . VAL A 1 89  ? -2.123  -0.325  0.081   1.00 1.01  ? 89  VAL A HG13 1  
ATOM 1337  H HG21 . VAL A 1 89  ? -1.810  0.262   -3.604  1.00 1.03  ? 89  VAL A HG21 1  
ATOM 1338  H HG22 . VAL A 1 89  ? -1.269  0.858   -2.035  1.00 1.08  ? 89  VAL A HG22 1  
ATOM 1339  H HG23 . VAL A 1 89  ? -2.950  1.067   -2.526  1.00 1.05  ? 89  VAL A HG23 1  
ATOM 1340  N N    . ASP A 1 90  ? -1.557  -3.489  -3.787  1.00 0.41  ? 90  ASP A N    1  
ATOM 1341  C CA   . ASP A 1 90  ? -1.444  -4.034  -5.140  1.00 0.51  ? 90  ASP A CA   1  
ATOM 1342  C C    . ASP A 1 90  ? -2.268  -3.218  -6.115  1.00 0.48  ? 90  ASP A C    1  
ATOM 1343  O O    . ASP A 1 90  ? -3.028  -2.341  -5.705  1.00 0.45  ? 90  ASP A O    1  
ATOM 1344  C CB   . ASP A 1 90  ? -1.952  -5.477  -5.192  1.00 0.68  ? 90  ASP A CB   1  
ATOM 1345  C CG   . ASP A 1 90  ? -1.496  -6.305  -4.022  1.00 1.20  ? 90  ASP A CG   1  
ATOM 1346  O OD1  . ASP A 1 90  ? -2.074  -6.151  -2.928  1.00 1.92  ? 90  ASP A OD1  1  
ATOM 1347  O OD2  . ASP A 1 90  ? -0.567  -7.118  -4.190  1.00 1.86  ? 90  ASP A OD2  1  
ATOM 1348  H H    . ASP A 1 90  ? -2.036  -4.011  -3.108  1.00 0.44  ? 90  ASP A H    1  
ATOM 1349  H HA   . ASP A 1 90  ? -0.406  -4.009  -5.436  1.00 0.59  ? 90  ASP A HA   1  
ATOM 1350  H HB2  . ASP A 1 90  ? -3.032  -5.472  -5.200  1.00 1.54  ? 90  ASP A HB2  1  
ATOM 1351  H HB3  . ASP A 1 90  ? -1.594  -5.942  -6.099  1.00 1.21  ? 90  ASP A HB3  1  
ATOM 1352  N N    . ARG A 1 91  ? -2.154  -3.523  -7.398  1.00 0.57  ? 91  ARG A N    1  
ATOM 1353  C CA   . ARG A 1 91  ? -2.974  -2.859  -8.398  1.00 0.61  ? 91  ARG A CA   1  
ATOM 1354  C C    . ARG A 1 91  ? -4.446  -3.160  -8.143  1.00 0.55  ? 91  ARG A C    1  
ATOM 1355  O O    . ARG A 1 91  ? -5.264  -2.251  -8.049  1.00 0.55  ? 91  ARG A O    1  
ATOM 1356  C CB   . ARG A 1 91  ? -2.592  -3.319  -9.804  1.00 0.75  ? 91  ARG A CB   1  
ATOM 1357  C CG   . ARG A 1 91  ? -3.481  -2.739  -10.895 1.00 0.82  ? 91  ARG A CG   1  
ATOM 1358  C CD   . ARG A 1 91  ? -3.254  -3.443  -12.219 1.00 1.44  ? 91  ARG A CD   1  
ATOM 1359  N NE   . ARG A 1 91  ? -4.181  -2.989  -13.256 1.00 2.25  ? 91  ARG A NE   1  
ATOM 1360  C CZ   . ARG A 1 91  ? -5.129  -3.758  -13.788 1.00 3.13  ? 91  ARG A CZ   1  
ATOM 1361  N NH1  . ARG A 1 91  ? -5.353  -4.966  -13.298 1.00 3.39  ? 91  ARG A NH1  1  
ATOM 1362  N NH2  . ARG A 1 91  ? -5.877  -3.312  -14.791 1.00 4.16  ? 91  ARG A NH2  1  
ATOM 1363  H H    . ARG A 1 91  ? -1.511  -4.210  -7.675  1.00 0.66  ? 91  ARG A H    1  
ATOM 1364  H HA   . ARG A 1 91  ? -2.813  -1.796  -8.312  1.00 0.63  ? 91  ARG A HA   1  
ATOM 1365  H HB2  . ARG A 1 91  ? -1.575  -3.019  -10.005 1.00 0.85  ? 91  ARG A HB2  1  
ATOM 1366  H HB3  . ARG A 1 91  ? -2.658  -4.397  -9.850  1.00 0.78  ? 91  ARG A HB3  1  
ATOM 1367  H HG2  . ARG A 1 91  ? -4.515  -2.857  -10.608 1.00 1.07  ? 91  ARG A HG2  1  
ATOM 1368  H HG3  . ARG A 1 91  ? -3.252  -1.689  -11.013 1.00 1.01  ? 91  ARG A HG3  1  
ATOM 1369  H HD2  . ARG A 1 91  ? -2.245  -3.243  -12.547 1.00 1.95  ? 91  ARG A HD2  1  
ATOM 1370  H HD3  . ARG A 1 91  ? -3.382  -4.507  -12.075 1.00 1.87  ? 91  ARG A HD3  1  
ATOM 1371  H HE   . ARG A 1 91  ? -4.066  -2.067  -13.595 1.00 2.59  ? 91  ARG A HE   1  
ATOM 1372  H HH11 . ARG A 1 91  ? -4.812  -5.308  -12.518 1.00 3.07  ? 91  ARG A HH11 1  
ATOM 1373  H HH12 . ARG A 1 91  ? -6.067  -5.550  -13.703 1.00 4.20  ? 91  ARG A HH12 1  
ATOM 1374  H HH21 . ARG A 1 91  ? -5.730  -2.386  -15.163 1.00 4.40  ? 91  ARG A HH21 1  
ATOM 1375  H HH22 . ARG A 1 91  ? -6.594  -3.893  -15.178 1.00 4.87  ? 91  ARG A HH22 1  
ATOM 1376  N N    . GLU A 1 92  ? -4.759  -4.442  -7.962  1.00 0.57  ? 92  GLU A N    1  
ATOM 1377  C CA   . GLU A 1 92  ? -6.136  -4.873  -7.747  1.00 0.61  ? 92  GLU A CA   1  
ATOM 1378  C C    . GLU A 1 92  ? -6.680  -4.286  -6.455  1.00 0.51  ? 92  GLU A C    1  
ATOM 1379  O O    . GLU A 1 92  ? -7.834  -3.862  -6.383  1.00 0.56  ? 92  GLU A O    1  
ATOM 1380  C CB   . GLU A 1 92  ? -6.230  -6.403  -7.709  1.00 0.74  ? 92  GLU A CB   1  
ATOM 1381  C CG   . GLU A 1 92  ? -6.337  -7.062  -9.077  1.00 1.44  ? 92  GLU A CG   1  
ATOM 1382  C CD   . GLU A 1 92  ? -5.115  -6.862  -9.952  1.00 1.98  ? 92  GLU A CD   1  
ATOM 1383  O OE1  . GLU A 1 92  ? -4.192  -7.703  -9.895  1.00 2.26  ? 92  GLU A OE1  1  
ATOM 1384  O OE2  . GLU A 1 92  ? -5.079  -5.880  -10.716 1.00 2.68  ? 92  GLU A OE2  1  
ATOM 1385  H H    . GLU A 1 92  ? -4.039  -5.116  -7.967  1.00 0.59  ? 92  GLU A H    1  
ATOM 1386  H HA   . GLU A 1 92  ? -6.730  -4.505  -8.571  1.00 0.67  ? 92  GLU A HA   1  
ATOM 1387  H HB2  . GLU A 1 92  ? -5.349  -6.791  -7.220  1.00 1.34  ? 92  GLU A HB2  1  
ATOM 1388  H HB3  . GLU A 1 92  ? -7.100  -6.682  -7.131  1.00 1.23  ? 92  GLU A HB3  1  
ATOM 1389  H HG2  . GLU A 1 92  ? -6.483  -8.121  -8.936  1.00 1.97  ? 92  GLU A HG2  1  
ATOM 1390  H HG3  . GLU A 1 92  ? -7.196  -6.650  -9.588  1.00 1.93  ? 92  GLU A HG3  1  
ATOM 1391  N N    . THR A 1 93  ? -5.827  -4.254  -5.447  1.00 0.44  ? 93  THR A N    1  
ATOM 1392  C CA   . THR A 1 93  ? -6.174  -3.714  -4.149  1.00 0.38  ? 93  THR A CA   1  
ATOM 1393  C C    . THR A 1 93  ? -6.415  -2.206  -4.228  1.00 0.33  ? 93  THR A C    1  
ATOM 1394  O O    . THR A 1 93  ? -7.404  -1.693  -3.705  1.00 0.37  ? 93  THR A O    1  
ATOM 1395  C CB   . THR A 1 93  ? -5.039  -4.006  -3.153  1.00 0.36  ? 93  THR A CB   1  
ATOM 1396  O OG1  . THR A 1 93  ? -4.724  -5.405  -3.195  1.00 0.47  ? 93  THR A OG1  1  
ATOM 1397  C CG2  . THR A 1 93  ? -5.421  -3.606  -1.739  1.00 0.36  ? 93  THR A CG2  1  
ATOM 1398  H H    . THR A 1 93  ? -4.926  -4.613  -5.579  1.00 0.45  ? 93  THR A H    1  
ATOM 1399  H HA   . THR A 1 93  ? -7.072  -4.204  -3.802  1.00 0.45  ? 93  THR A HA   1  
ATOM 1400  H HB   . THR A 1 93  ? -4.174  -3.436  -3.452  1.00 0.33  ? 93  THR A HB   1  
ATOM 1401  H HG1  . THR A 1 93  ? -3.776  -5.538  -3.023  1.00 0.82  ? 93  THR A HG1  1  
ATOM 1402  H HG21 . THR A 1 93  ? -6.315  -4.135  -1.445  1.00 1.00  ? 93  THR A HG21 1  
ATOM 1403  H HG22 . THR A 1 93  ? -5.603  -2.542  -1.704  1.00 1.04  ? 93  THR A HG22 1  
ATOM 1404  H HG23 . THR A 1 93  ? -4.613  -3.855  -1.065  1.00 1.08  ? 93  THR A HG23 1  
ATOM 1405  N N    . ASP A 1 94  ? -5.513  -1.507  -4.905  1.00 0.33  ? 94  ASP A N    1  
ATOM 1406  C CA   . ASP A 1 94  ? -5.592  -0.054  -5.016  1.00 0.39  ? 94  ASP A CA   1  
ATOM 1407  C C    . ASP A 1 94  ? -6.774  0.372   -5.879  1.00 0.43  ? 94  ASP A C    1  
ATOM 1408  O O    . ASP A 1 94  ? -7.429  1.372   -5.591  1.00 0.50  ? 94  ASP A O    1  
ATOM 1409  C CB   . ASP A 1 94  ? -4.291  0.504   -5.587  1.00 0.48  ? 94  ASP A CB   1  
ATOM 1410  C CG   . ASP A 1 94  ? -4.270  2.016   -5.610  1.00 0.71  ? 94  ASP A CG   1  
ATOM 1411  O OD1  . ASP A 1 94  ? -4.288  2.634   -4.528  1.00 0.77  ? 94  ASP A OD1  1  
ATOM 1412  O OD2  . ASP A 1 94  ? -4.197  2.594   -6.712  1.00 1.18  ? 94  ASP A OD2  1  
ATOM 1413  H H    . ASP A 1 94  ? -4.763  -1.978  -5.337  1.00 0.34  ? 94  ASP A H    1  
ATOM 1414  H HA   . ASP A 1 94  ? -5.730  0.341   -4.021  1.00 0.43  ? 94  ASP A HA   1  
ATOM 1415  H HB2  . ASP A 1 94  ? -3.462  0.160   -4.985  1.00 0.48  ? 94  ASP A HB2  1  
ATOM 1416  H HB3  . ASP A 1 94  ? -4.166  0.145   -6.599  1.00 0.53  ? 94  ASP A HB3  1  
ATOM 1417  N N    . GLU A 1 95  ? -7.054  -0.387  -6.936  1.00 0.43  ? 95  GLU A N    1  
ATOM 1418  C CA   . GLU A 1 95  ? -8.219  -0.118  -7.773  1.00 0.49  ? 95  GLU A CA   1  
ATOM 1419  C C    . GLU A 1 95  ? -9.499  -0.295  -6.959  1.00 0.45  ? 95  GLU A C    1  
ATOM 1420  O O    . GLU A 1 95  ? -10.473 0.440   -7.135  1.00 0.50  ? 95  GLU A O    1  
ATOM 1421  C CB   . GLU A 1 95  ? -8.248  -1.039  -8.998  1.00 0.60  ? 95  GLU A CB   1  
ATOM 1422  C CG   . GLU A 1 95  ? -7.061  -0.873  -9.935  1.00 0.72  ? 95  GLU A CG   1  
ATOM 1423  C CD   . GLU A 1 95  ? -6.846  0.558   -10.383 1.00 1.17  ? 95  GLU A CD   1  
ATOM 1424  O OE1  . GLU A 1 95  ? -7.609  1.041   -11.244 1.00 1.23  ? 95  GLU A OE1  1  
ATOM 1425  O OE2  . GLU A 1 95  ? -5.899  1.204   -9.890  1.00 1.94  ? 95  GLU A OE2  1  
ATOM 1426  H H    . GLU A 1 95  ? -6.459  -1.137  -7.162  1.00 0.44  ? 95  GLU A H    1  
ATOM 1427  H HA   . GLU A 1 95  ? -8.156  0.908   -8.106  1.00 0.54  ? 95  GLU A HA   1  
ATOM 1428  H HB2  . GLU A 1 95  ? -8.268  -2.065  -8.658  1.00 0.60  ? 95  GLU A HB2  1  
ATOM 1429  H HB3  . GLU A 1 95  ? -9.150  -0.842  -9.557  1.00 0.66  ? 95  GLU A HB3  1  
ATOM 1430  H HG2  . GLU A 1 95  ? -6.171  -1.210  -9.425  1.00 1.08  ? 95  GLU A HG2  1  
ATOM 1431  H HG3  . GLU A 1 95  ? -7.224  -1.488  -10.810 1.00 1.05  ? 95  GLU A HG3  1  
ATOM 1432  N N    . PHE A 1 96  ? -9.481  -1.275  -6.060  1.00 0.41  ? 96  PHE A N    1  
ATOM 1433  C CA   . PHE A 1 96  ? -10.591 -1.509  -5.146  1.00 0.41  ? 96  PHE A CA   1  
ATOM 1434  C C    . PHE A 1 96  ? -10.775 -0.308  -4.221  1.00 0.36  ? 96  PHE A C    1  
ATOM 1435  O O    . PHE A 1 96  ? -11.892 0.178   -4.028  1.00 0.40  ? 96  PHE A O    1  
ATOM 1436  C CB   . PHE A 1 96  ? -10.336 -2.784  -4.331  1.00 0.44  ? 96  PHE A CB   1  
ATOM 1437  C CG   . PHE A 1 96  ? -11.347 -3.038  -3.247  1.00 0.51  ? 96  PHE A CG   1  
ATOM 1438  C CD1  . PHE A 1 96  ? -12.580 -3.589  -3.545  1.00 0.63  ? 96  PHE A CD1  1  
ATOM 1439  C CD2  . PHE A 1 96  ? -11.056 -2.730  -1.928  1.00 0.52  ? 96  PHE A CD2  1  
ATOM 1440  C CE1  . PHE A 1 96  ? -13.509 -3.827  -2.549  1.00 0.73  ? 96  PHE A CE1  1  
ATOM 1441  C CE2  . PHE A 1 96  ? -11.979 -2.965  -0.927  1.00 0.62  ? 96  PHE A CE2  1  
ATOM 1442  C CZ   . PHE A 1 96  ? -13.207 -3.514  -1.238  1.00 0.72  ? 96  PHE A CZ   1  
ATOM 1443  H H    . PHE A 1 96  ? -8.695  -1.861  -6.010  1.00 0.41  ? 96  PHE A H    1  
ATOM 1444  H HA   . PHE A 1 96  ? -11.487 -1.638  -5.736  1.00 0.46  ? 96  PHE A HA   1  
ATOM 1445  H HB2  . PHE A 1 96  ? -10.351 -3.633  -4.998  1.00 0.49  ? 96  PHE A HB2  1  
ATOM 1446  H HB3  . PHE A 1 96  ? -9.362  -2.716  -3.869  1.00 0.41  ? 96  PHE A HB3  1  
ATOM 1447  H HD1  . PHE A 1 96  ? -12.818 -3.834  -4.572  1.00 0.67  ? 96  PHE A HD1  1  
ATOM 1448  H HD2  . PHE A 1 96  ? -10.096 -2.300  -1.685  1.00 0.48  ? 96  PHE A HD2  1  
ATOM 1449  H HE1  . PHE A 1 96  ? -14.467 -4.257  -2.796  1.00 0.83  ? 96  PHE A HE1  1  
ATOM 1450  H HE2  . PHE A 1 96  ? -11.740 -2.719  0.097   1.00 0.66  ? 96  PHE A HE2  1  
ATOM 1451  H HZ   . PHE A 1 96  ? -13.929 -3.697  -0.459  1.00 0.81  ? 96  PHE A HZ   1  
ATOM 1452  N N    . PHE A 1 97  ? -9.672  0.168   -3.659  1.00 0.32  ? 97  PHE A N    1  
ATOM 1453  C CA   . PHE A 1 97  ? -9.707  1.338   -2.792  1.00 0.32  ? 97  PHE A CA   1  
ATOM 1454  C C    . PHE A 1 97  ? -10.142 2.590   -3.560  1.00 0.39  ? 97  PHE A C    1  
ATOM 1455  O O    . PHE A 1 97  ? -10.891 3.413   -3.028  1.00 0.44  ? 97  PHE A O    1  
ATOM 1456  C CB   . PHE A 1 97  ? -8.348  1.563   -2.119  1.00 0.30  ? 97  PHE A CB   1  
ATOM 1457  C CG   . PHE A 1 97  ? -8.107  0.671   -0.931  1.00 0.29  ? 97  PHE A CG   1  
ATOM 1458  C CD1  . PHE A 1 97  ? -8.880  0.799   0.210   1.00 0.38  ? 97  PHE A CD1  1  
ATOM 1459  C CD2  . PHE A 1 97  ? -7.108  -0.290  -0.949  1.00 0.37  ? 97  PHE A CD2  1  
ATOM 1460  C CE1  . PHE A 1 97  ? -8.666  -0.010  1.310   1.00 0.41  ? 97  PHE A CE1  1  
ATOM 1461  C CE2  . PHE A 1 97  ? -6.889  -1.103  0.150   1.00 0.40  ? 97  PHE A CE2  1  
ATOM 1462  C CZ   . PHE A 1 97  ? -7.670  -0.963  1.281   1.00 0.35  ? 97  PHE A CZ   1  
ATOM 1463  H H    . PHE A 1 97  ? -8.814  -0.288  -3.823  1.00 0.30  ? 97  PHE A H    1  
ATOM 1464  H HA   . PHE A 1 97  ? -10.443 1.144   -2.024  1.00 0.34  ? 97  PHE A HA   1  
ATOM 1465  H HB2  . PHE A 1 97  ? -7.563  1.375   -2.838  1.00 0.29  ? 97  PHE A HB2  1  
ATOM 1466  H HB3  . PHE A 1 97  ? -8.284  2.587   -1.784  1.00 0.35  ? 97  PHE A HB3  1  
ATOM 1467  H HD1  . PHE A 1 97  ? -9.661  1.543   0.237   1.00 0.53  ? 97  PHE A HD1  1  
ATOM 1468  H HD2  . PHE A 1 97  ? -6.495  -0.403  -1.831  1.00 0.50  ? 97  PHE A HD2  1  
ATOM 1469  H HE1  . PHE A 1 97  ? -9.280  0.103   2.191   1.00 0.55  ? 97  PHE A HE1  1  
ATOM 1470  H HE2  . PHE A 1 97  ? -6.107  -1.851  0.122   1.00 0.55  ? 97  PHE A HE2  1  
ATOM 1471  H HZ   . PHE A 1 97  ? -7.496  -1.594  2.144   1.00 0.40  ? 97  PHE A HZ   1  
ATOM 1472  N N    . LYS A 1 98  ? -9.687  2.724   -4.809  1.00 0.43  ? 98  LYS A N    1  
ATOM 1473  C CA   . LYS A 1 98  ? -10.073 3.862   -5.647  1.00 0.53  ? 98  LYS A CA   1  
ATOM 1474  C C    . LYS A 1 98  ? -11.585 3.930   -5.833  1.00 0.56  ? 98  LYS A C    1  
ATOM 1475  O O    . LYS A 1 98  ? -12.204 4.972   -5.614  1.00 0.61  ? 98  LYS A O    1  
ATOM 1476  C CB   . LYS A 1 98  ? -9.440  3.780   -7.043  1.00 0.63  ? 98  LYS A CB   1  
ATOM 1477  C CG   . LYS A 1 98  ? -7.969  4.159   -7.128  1.00 0.85  ? 98  LYS A CG   1  
ATOM 1478  C CD   . LYS A 1 98  ? -7.605  4.500   -8.569  1.00 1.13  ? 98  LYS A CD   1  
ATOM 1479  C CE   . LYS A 1 98  ? -6.122  4.778   -8.758  1.00 1.31  ? 98  LYS A CE   1  
ATOM 1480  N NZ   . LYS A 1 98  ? -5.318  3.532   -8.813  1.00 1.92  ? 98  LYS A NZ   1  
ATOM 1481  H H    . LYS A 1 98  ? -9.063  2.051   -5.168  1.00 0.41  ? 98  LYS A H    1  
ATOM 1482  H HA   . LYS A 1 98  ? -9.738  4.764   -5.161  1.00 0.56  ? 98  LYS A HA   1  
ATOM 1483  H HB2  . LYS A 1 98  ? -9.538  2.767   -7.402  1.00 0.80  ? 98  LYS A HB2  1  
ATOM 1484  H HB3  . LYS A 1 98  ? -9.990  4.433   -7.706  1.00 0.82  ? 98  LYS A HB3  1  
ATOM 1485  H HG2  . LYS A 1 98  ? -7.785  5.018   -6.499  1.00 1.09  ? 98  LYS A HG2  1  
ATOM 1486  H HG3  . LYS A 1 98  ? -7.367  3.326   -6.799  1.00 1.12  ? 98  LYS A HG3  1  
ATOM 1487  H HD2  . LYS A 1 98  ? -7.881  3.669   -9.201  1.00 1.77  ? 98  LYS A HD2  1  
ATOM 1488  H HD3  . LYS A 1 98  ? -8.165  5.374   -8.867  1.00 1.65  ? 98  LYS A HD3  1  
ATOM 1489  H HE2  . LYS A 1 98  ? -5.987  5.320   -9.681  1.00 1.69  ? 98  LYS A HE2  1  
ATOM 1490  H HE3  . LYS A 1 98  ? -5.774  5.383   -7.932  1.00 1.94  ? 98  LYS A HE3  1  
ATOM 1491  H HZ1  . LYS A 1 98  ? -5.225  3.115   -7.859  1.00 2.12  ? 98  LYS A HZ1  1  
ATOM 1492  H HZ2  . LYS A 1 98  ? -4.364  3.734   -9.180  1.00 2.50  ? 98  LYS A HZ2  1  
ATOM 1493  H HZ3  . LYS A 1 98  ? -5.774  2.829   -9.440  1.00 2.45  ? 98  LYS A HZ3  1  
ATOM 1494  N N    . LYS A 1 99  ? -12.177 2.806   -6.214  1.00 0.55  ? 99  LYS A N    1  
ATOM 1495  C CA   . LYS A 1 99  ? -13.587 2.771   -6.585  1.00 0.63  ? 99  LYS A CA   1  
ATOM 1496  C C    . LYS A 1 99  ? -14.492 2.943   -5.372  1.00 0.63  ? 99  LYS A C    1  
ATOM 1497  O O    . LYS A 1 99  ? -15.662 3.295   -5.509  1.00 0.75  ? 99  LYS A O    1  
ATOM 1498  C CB   . LYS A 1 99  ? -13.908 1.469   -7.334  1.00 0.66  ? 99  LYS A CB   1  
ATOM 1499  C CG   . LYS A 1 99  ? -13.697 0.201   -6.522  1.00 0.60  ? 99  LYS A CG   1  
ATOM 1500  C CD   . LYS A 1 99  ? -14.999 -0.298  -5.910  1.00 0.76  ? 99  LYS A CD   1  
ATOM 1501  C CE   . LYS A 1 99  ? -14.854 -1.713  -5.371  1.00 1.62  ? 99  LYS A CE   1  
ATOM 1502  N NZ   . LYS A 1 99  ? -14.595 -2.698  -6.455  1.00 2.04  ? 99  LYS A NZ   1  
ATOM 1503  H H    . LYS A 1 99  ? -11.652 1.974   -6.246  1.00 0.53  ? 99  LYS A H    1  
ATOM 1504  H HA   . LYS A 1 99  ? -13.760 3.601   -7.256  1.00 0.70  ? 99  LYS A HA   1  
ATOM 1505  H HB2  . LYS A 1 99  ? -14.940 1.496   -7.648  1.00 0.73  ? 99  LYS A HB2  1  
ATOM 1506  H HB3  . LYS A 1 99  ? -13.280 1.414   -8.212  1.00 0.70  ? 99  LYS A HB3  1  
ATOM 1507  H HG2  . LYS A 1 99  ? -13.289 -0.567  -7.162  1.00 0.67  ? 99  LYS A HG2  1  
ATOM 1508  H HG3  . LYS A 1 99  ? -12.997 0.413   -5.726  1.00 0.65  ? 99  LYS A HG3  1  
ATOM 1509  H HD2  . LYS A 1 99  ? -15.279 0.358   -5.100  1.00 1.19  ? 99  LYS A HD2  1  
ATOM 1510  H HD3  . LYS A 1 99  ? -15.769 -0.288  -6.668  1.00 1.16  ? 99  LYS A HD3  1  
ATOM 1511  H HE2  . LYS A 1 99  ? -14.030 -1.735  -4.672  1.00 2.17  ? 99  LYS A HE2  1  
ATOM 1512  H HE3  . LYS A 1 99  ? -15.766 -1.983  -4.859  1.00 2.18  ? 99  LYS A HE3  1  
ATOM 1513  H HZ1  . LYS A 1 99  ? -13.737 -2.437  -6.986  1.00 2.53  ? 99  LYS A HZ1  1  
ATOM 1514  H HZ2  . LYS A 1 99  ? -15.399 -2.723  -7.121  1.00 2.23  ? 99  LYS A HZ2  1  
ATOM 1515  H HZ3  . LYS A 1 99  ? -14.463 -3.651  -6.055  1.00 2.44  ? 99  LYS A HZ3  1  
ATOM 1516  N N    . CYS A 1 100 ? -13.951 2.707   -4.188  1.00 0.55  ? 100 CYS A N    1  
ATOM 1517  C CA   . CYS A 1 100 ? -14.738 2.826   -2.972  1.00 0.60  ? 100 CYS A CA   1  
ATOM 1518  C C    . CYS A 1 100 ? -14.409 4.124   -2.238  1.00 0.61  ? 100 CYS A C    1  
ATOM 1519  O O    . CYS A 1 100 ? -15.016 4.444   -1.213  1.00 0.68  ? 100 CYS A O    1  
ATOM 1520  C CB   . CYS A 1 100 ? -14.494 1.618   -2.061  1.00 0.60  ? 100 CYS A CB   1  
ATOM 1521  S SG   . CYS A 1 100 ? -15.693 1.448   -0.716  1.00 1.39  ? 100 CYS A SG   1  
ATOM 1522  H H    . CYS A 1 100 ? -13.007 2.446   -4.131  1.00 0.51  ? 100 CYS A H    1  
ATOM 1523  H HA   . CYS A 1 100 ? -15.780 2.844   -3.257  1.00 0.68  ? 100 CYS A HA   1  
ATOM 1524  H HB2  . CYS A 1 100 ? -14.532 0.715   -2.650  1.00 1.12  ? 100 CYS A HB2  1  
ATOM 1525  H HB3  . CYS A 1 100 ? -13.513 1.708   -1.615  1.00 0.81  ? 100 CYS A HB3  1  
ATOM 1526  H HG   . CYS A 1 100 ? -15.749 2.611   -0.081  1.00 2.19  ? 100 CYS A HG   1  
ATOM 1527  N N    . ARG A 1 101 ? -13.450 4.874   -2.792  1.00 0.59  ? 101 ARG A N    1  
ATOM 1528  C CA   . ARG A 1 101 ? -12.972 6.125   -2.197  1.00 0.65  ? 101 ARG A CA   1  
ATOM 1529  C C    . ARG A 1 101 ? -12.453 5.891   -0.783  1.00 0.64  ? 101 ARG A C    1  
ATOM 1530  O O    . ARG A 1 101 ? -12.752 6.650   0.141   1.00 0.75  ? 101 ARG A O    1  
ATOM 1531  C CB   . ARG A 1 101 ? -14.067 7.204   -2.188  1.00 0.77  ? 101 ARG A CB   1  
ATOM 1532  C CG   . ARG A 1 101 ? -14.339 7.832   -3.549  1.00 0.79  ? 101 ARG A CG   1  
ATOM 1533  C CD   . ARG A 1 101 ? -15.068 6.884   -4.491  1.00 1.19  ? 101 ARG A CD   1  
ATOM 1534  N NE   . ARG A 1 101 ? -16.440 6.611   -4.057  1.00 2.14  ? 101 ARG A NE   1  
ATOM 1535  C CZ   . ARG A 1 101 ? -17.431 6.291   -4.890  1.00 3.08  ? 101 ARG A CZ   1  
ATOM 1536  N NH1  . ARG A 1 101 ? -17.198 6.199   -6.194  1.00 3.37  ? 101 ARG A NH1  1  
ATOM 1537  N NH2  . ARG A 1 101 ? -18.654 6.073   -4.422  1.00 4.09  ? 101 ARG A NH2  1  
ATOM 1538  H H    . ARG A 1 101 ? -13.044 4.570   -3.635  1.00 0.57  ? 101 ARG A H    1  
ATOM 1539  H HA   . ARG A 1 101 ? -12.150 6.473   -2.804  1.00 0.66  ? 101 ARG A HA   1  
ATOM 1540  H HB2  . ARG A 1 101 ? -14.986 6.762   -1.831  1.00 0.79  ? 101 ARG A HB2  1  
ATOM 1541  H HB3  . ARG A 1 101 ? -13.770 7.990   -1.508  1.00 0.92  ? 101 ARG A HB3  1  
ATOM 1542  H HG2  . ARG A 1 101 ? -14.947 8.714   -3.409  1.00 1.42  ? 101 ARG A HG2  1  
ATOM 1543  H HG3  . ARG A 1 101 ? -13.398 8.113   -3.997  1.00 1.29  ? 101 ARG A HG3  1  
ATOM 1544  H HD2  . ARG A 1 101 ? -15.095 7.326   -5.477  1.00 1.59  ? 101 ARG A HD2  1  
ATOM 1545  H HD3  . ARG A 1 101 ? -14.524 5.951   -4.533  1.00 1.65  ? 101 ARG A HD3  1  
ATOM 1546  H HE   . ARG A 1 101 ? -16.634 6.678   -3.089  1.00 2.45  ? 101 ARG A HE   1  
ATOM 1547  H HH11 . ARG A 1 101 ? -16.280 6.364   -6.551  1.00 3.01  ? 101 ARG A HH11 1  
ATOM 1548  H HH12 . ARG A 1 101 ? -17.947 5.975   -6.830  1.00 4.21  ? 101 ARG A HH12 1  
ATOM 1549  H HH21 . ARG A 1 101 ? -18.844 6.153   -3.437  1.00 4.30  ? 101 ARG A HH21 1  
ATOM 1550  H HH22 . ARG A 1 101 ? -19.399 5.818   -5.050  1.00 4.83  ? 101 ARG A HH22 1  
ATOM 1551  N N    . VAL A 1 102 ? -11.665 4.836   -0.628  1.00 0.55  ? 102 VAL A N    1  
ATOM 1552  C CA   . VAL A 1 102 ? -11.143 4.447   0.672   1.00 0.57  ? 102 VAL A CA   1  
ATOM 1553  C C    . VAL A 1 102 ? -9.620  4.508   0.681   1.00 0.49  ? 102 VAL A C    1  
ATOM 1554  O O    . VAL A 1 102 ? -8.970  4.041   -0.250  1.00 0.46  ? 102 VAL A O    1  
ATOM 1555  C CB   . VAL A 1 102 ? -11.604 3.022   1.051   1.00 0.69  ? 102 VAL A CB   1  
ATOM 1556  C CG1  . VAL A 1 102 ? -11.001 2.583   2.373   1.00 0.89  ? 102 VAL A CG1  1  
ATOM 1557  C CG2  . VAL A 1 102 ? -13.118 2.946   1.112   1.00 1.42  ? 102 VAL A CG2  1  
ATOM 1558  H H    . VAL A 1 102 ? -11.410 4.310   -1.419  1.00 0.51  ? 102 VAL A H    1  
ATOM 1559  H HA   . VAL A 1 102 ? -11.528 5.138   1.409   1.00 0.66  ? 102 VAL A HA   1  
ATOM 1560  H HB   . VAL A 1 102 ? -11.265 2.341   0.284   1.00 1.38  ? 102 VAL A HB   1  
ATOM 1561  H HG11 . VAL A 1 102 ? -11.292 3.275   3.151   1.00 1.44  ? 102 VAL A HG11 1  
ATOM 1562  H HG12 . VAL A 1 102 ? -9.924  2.571   2.289   1.00 1.45  ? 102 VAL A HG12 1  
ATOM 1563  H HG13 . VAL A 1 102 ? -11.354 1.592   2.619   1.00 1.57  ? 102 VAL A HG13 1  
ATOM 1564  H HG21 . VAL A 1 102 ? -13.418 1.935   1.350   1.00 2.00  ? 102 VAL A HG21 1  
ATOM 1565  H HG22 . VAL A 1 102 ? -13.529 3.226   0.154   1.00 2.08  ? 102 VAL A HG22 1  
ATOM 1566  H HG23 . VAL A 1 102 ? -13.483 3.620   1.873   1.00 1.73  ? 102 VAL A HG23 1  
ATOM 1567  N N    . ILE A 1 103 ? -9.061  5.095   1.728   1.00 0.54  ? 103 ILE A N    1  
ATOM 1568  C CA   . ILE A 1 103 ? -7.616  5.169   1.883   1.00 0.50  ? 103 ILE A CA   1  
ATOM 1569  C C    . ILE A 1 103 ? -7.118  3.987   2.711   1.00 0.43  ? 103 ILE A C    1  
ATOM 1570  O O    . ILE A 1 103 ? -7.537  3.799   3.856   1.00 0.46  ? 103 ILE A O    1  
ATOM 1571  C CB   . ILE A 1 103 ? -7.187  6.495   2.556   1.00 0.61  ? 103 ILE A CB   1  
ATOM 1572  C CG1  . ILE A 1 103 ? -7.638  7.693   1.709   1.00 0.78  ? 103 ILE A CG1  1  
ATOM 1573  C CG2  . ILE A 1 103 ? -5.680  6.531   2.774   1.00 0.62  ? 103 ILE A CG2  1  
ATOM 1574  C CD1  . ILE A 1 103 ? -7.074  7.696   0.303   1.00 1.33  ? 103 ILE A CD1  1  
ATOM 1575  H H    . ILE A 1 103 ? -9.635  5.489   2.419   1.00 0.65  ? 103 ILE A H    1  
ATOM 1576  H HA   . ILE A 1 103 ? -7.169  5.123   0.901   1.00 0.50  ? 103 ILE A HA   1  
ATOM 1577  H HB   . ILE A 1 103 ? -7.665  6.549   3.522   1.00 0.64  ? 103 ILE A HB   1  
ATOM 1578  H HG12 . ILE A 1 103 ? -8.715  7.685   1.632   1.00 1.38  ? 103 ILE A HG12 1  
ATOM 1579  H HG13 . ILE A 1 103 ? -7.326  8.607   2.194   1.00 1.26  ? 103 ILE A HG13 1  
ATOM 1580  H HG21 . ILE A 1 103 ? -5.384  5.682   3.373   1.00 1.17  ? 103 ILE A HG21 1  
ATOM 1581  H HG22 . ILE A 1 103 ? -5.412  7.444   3.286   1.00 1.19  ? 103 ILE A HG22 1  
ATOM 1582  H HG23 . ILE A 1 103 ? -5.177  6.492   1.821   1.00 1.09  ? 103 ILE A HG23 1  
ATOM 1583  H HD11 . ILE A 1 103 ? -7.446  8.558   -0.233  1.00 1.78  ? 103 ILE A HD11 1  
ATOM 1584  H HD12 . ILE A 1 103 ? -7.377  6.795   -0.209  1.00 1.83  ? 103 ILE A HD12 1  
ATOM 1585  H HD13 . ILE A 1 103 ? -5.995  7.738   0.348   1.00 1.99  ? 103 ILE A HD13 1  
ATOM 1586  N N    . PRO A 1 104 ? -6.238  3.160   2.133   1.00 0.39  ? 104 PRO A N    1  
ATOM 1587  C CA   . PRO A 1 104 ? -5.672  2.000   2.825   1.00 0.37  ? 104 PRO A CA   1  
ATOM 1588  C C    . PRO A 1 104 ? -4.815  2.403   4.019   1.00 0.37  ? 104 PRO A C    1  
ATOM 1589  O O    . PRO A 1 104 ? -4.100  3.403   3.967   1.00 0.45  ? 104 PRO A O    1  
ATOM 1590  C CB   . PRO A 1 104 ? -4.809  1.323   1.756   1.00 0.41  ? 104 PRO A CB   1  
ATOM 1591  C CG   . PRO A 1 104 ? -4.518  2.393   0.760   1.00 0.53  ? 104 PRO A CG   1  
ATOM 1592  C CD   . PRO A 1 104 ? -5.721  3.292   0.759   1.00 0.44  ? 104 PRO A CD   1  
ATOM 1593  H HA   . PRO A 1 104 ? -6.444  1.320   3.152   1.00 0.37  ? 104 PRO A HA   1  
ATOM 1594  H HB2  . PRO A 1 104 ? -3.903  0.945   2.210   1.00 0.57  ? 104 PRO A HB2  1  
ATOM 1595  H HB3  . PRO A 1 104 ? -5.359  0.507   1.308   1.00 0.55  ? 104 PRO A HB3  1  
ATOM 1596  H HG2  . PRO A 1 104 ? -3.638  2.943   1.059   1.00 0.86  ? 104 PRO A HG2  1  
ATOM 1597  H HG3  . PRO A 1 104 ? -4.374  1.957   -0.218  1.00 0.82  ? 104 PRO A HG3  1  
ATOM 1598  H HD2  . PRO A 1 104 ? -5.432  4.313   0.549   1.00 0.59  ? 104 PRO A HD2  1  
ATOM 1599  H HD3  . PRO A 1 104 ? -6.450  2.949   0.039   1.00 0.57  ? 104 PRO A HD3  1  
ATOM 1600  N N    . SER A 1 105 ? -4.891  1.625   5.089   1.00 0.32  ? 105 SER A N    1  
ATOM 1601  C CA   . SER A 1 105 ? -4.105  1.891   6.277   1.00 0.34  ? 105 SER A CA   1  
ATOM 1602  C C    . SER A 1 105 ? -3.866  0.585   7.029   1.00 0.34  ? 105 SER A C    1  
ATOM 1603  O O    . SER A 1 105 ? -4.307  -0.478  6.576   1.00 0.33  ? 105 SER A O    1  
ATOM 1604  C CB   . SER A 1 105 ? -4.810  2.920   7.174   1.00 0.43  ? 105 SER A CB   1  
ATOM 1605  O OG   . SER A 1 105 ? -3.947  3.419   8.184   1.00 1.42  ? 105 SER A OG   1  
ATOM 1606  H H    . SER A 1 105 ? -5.478  0.846   5.080   1.00 0.31  ? 105 SER A H    1  
ATOM 1607  H HA   . SER A 1 105 ? -3.151  2.289   5.961   1.00 0.34  ? 105 SER A HA   1  
ATOM 1608  H HB2  . SER A 1 105 ? -5.148  3.747   6.572   1.00 1.18  ? 105 SER A HB2  1  
ATOM 1609  H HB3  . SER A 1 105 ? -5.661  2.454   7.648   1.00 0.94  ? 105 SER A HB3  1  
ATOM 1610  H HG   . SER A 1 105 ? -3.028  3.419   7.847   1.00 1.92  ? 105 SER A HG   1  
ATOM 1611  N N    . GLN A 1 106 ? -3.172  0.659   8.152   1.00 0.39  ? 106 GLN A N    1  
ATOM 1612  C CA   . GLN A 1 106 ? -2.848  -0.522  8.948   1.00 0.43  ? 106 GLN A CA   1  
ATOM 1613  C C    . GLN A 1 106 ? -4.100  -1.296  9.383   1.00 0.45  ? 106 GLN A C    1  
ATOM 1614  O O    . GLN A 1 106 ? -4.067  -2.516  9.519   1.00 0.50  ? 106 GLN A O    1  
ATOM 1615  C CB   . GLN A 1 106 ? -2.048  -0.109  10.179  1.00 0.52  ? 106 GLN A CB   1  
ATOM 1616  C CG   . GLN A 1 106 ? -0.850  0.768   9.854   1.00 0.68  ? 106 GLN A CG   1  
ATOM 1617  C CD   . GLN A 1 106 ? -0.136  1.273   11.092  1.00 0.96  ? 106 GLN A CD   1  
ATOM 1618  O OE1  . GLN A 1 106 ? -0.076  0.592   12.115  1.00 1.66  ? 106 GLN A OE1  1  
ATOM 1619  N NE2  . GLN A 1 106 ? 0.398   2.483   11.011  1.00 1.42  ? 106 GLN A NE2  1  
ATOM 1620  H H    . GLN A 1 106 ? -2.839  1.535   8.445   1.00 0.42  ? 106 GLN A H    1  
ATOM 1621  H HA   . GLN A 1 106 ? -2.237  -1.170  8.339   1.00 0.42  ? 106 GLN A HA   1  
ATOM 1622  H HB2  . GLN A 1 106 ? -2.697  0.436   10.851  1.00 0.66  ? 106 GLN A HB2  1  
ATOM 1623  H HB3  . GLN A 1 106 ? -1.697  -0.999  10.674  1.00 0.73  ? 106 GLN A HB3  1  
ATOM 1624  H HG2  . GLN A 1 106 ? -0.150  0.194   9.262   1.00 0.91  ? 106 GLN A HG2  1  
ATOM 1625  H HG3  . GLN A 1 106 ? -1.188  1.619   9.281   1.00 1.06  ? 106 GLN A HG3  1  
ATOM 1626  H HE21 . GLN A 1 106 ? 0.304   2.979   10.159  1.00 1.87  ? 106 GLN A HE21 1  
ATOM 1627  H HE22 . GLN A 1 106 ? 0.859   2.841   11.799  1.00 1.72  ? 106 GLN A HE22 1  
ATOM 1628  N N    . GLU A 1 107 ? -5.205  -0.593  9.583   1.00 0.46  ? 107 GLU A N    1  
ATOM 1629  C CA   . GLU A 1 107 ? -6.431  -1.231  10.060  1.00 0.51  ? 107 GLU A CA   1  
ATOM 1630  C C    . GLU A 1 107 ? -7.043  -2.149  8.995   1.00 0.42  ? 107 GLU A C    1  
ATOM 1631  O O    . GLU A 1 107 ? -7.706  -3.136  9.315   1.00 0.49  ? 107 GLU A O    1  
ATOM 1632  C CB   . GLU A 1 107 ? -7.439  -0.184  10.558  1.00 0.59  ? 107 GLU A CB   1  
ATOM 1633  C CG   . GLU A 1 107 ? -7.377  1.156   9.834   1.00 1.41  ? 107 GLU A CG   1  
ATOM 1634  C CD   . GLU A 1 107 ? -7.827  1.073   8.395   1.00 2.16  ? 107 GLU A CD   1  
ATOM 1635  O OE1  . GLU A 1 107 ? -9.043  1.195   8.146   1.00 2.63  ? 107 GLU A OE1  1  
ATOM 1636  O OE2  . GLU A 1 107 ? -6.966  0.880   7.512   1.00 2.82  ? 107 GLU A OE2  1  
ATOM 1637  H H    . GLU A 1 107 ? -5.204  0.370   9.394   1.00 0.48  ? 107 GLU A H    1  
ATOM 1638  H HA   . GLU A 1 107 ? -6.150  -1.851  10.900  1.00 0.62  ? 107 GLU A HA   1  
ATOM 1639  H HB2  . GLU A 1 107 ? -8.436  -0.581  10.437  1.00 1.12  ? 107 GLU A HB2  1  
ATOM 1640  H HB3  . GLU A 1 107 ? -7.261  -0.007  11.608  1.00 1.19  ? 107 GLU A HB3  1  
ATOM 1641  H HG2  . GLU A 1 107 ? -8.012  1.858   10.351  1.00 2.02  ? 107 GLU A HG2  1  
ATOM 1642  H HG3  . GLU A 1 107 ? -6.358  1.512   9.857   1.00 2.03  ? 107 GLU A HG3  1  
ATOM 1643  N N    . HIS A 1 108 ? -6.811  -1.823  7.730   1.00 0.34  ? 108 HIS A N    1  
ATOM 1644  C CA   . HIS A 1 108 ? -7.324  -2.618  6.626   1.00 0.37  ? 108 HIS A CA   1  
ATOM 1645  C C    . HIS A 1 108 ? -6.496  -3.883  6.418   1.00 0.46  ? 108 HIS A C    1  
ATOM 1646  O O    . HIS A 1 108 ? -6.920  -4.788  5.707   1.00 0.53  ? 108 HIS A O    1  
ATOM 1647  C CB   . HIS A 1 108 ? -7.369  -1.793  5.336   1.00 0.38  ? 108 HIS A CB   1  
ATOM 1648  C CG   . HIS A 1 108 ? -8.472  -0.775  5.313   1.00 0.40  ? 108 HIS A CG   1  
ATOM 1649  N ND1  . HIS A 1 108 ? -8.254  0.571   5.122   1.00 0.52  ? 108 HIS A ND1  1  
ATOM 1650  C CD2  . HIS A 1 108 ? -9.812  -0.919  5.446   1.00 0.52  ? 108 HIS A CD2  1  
ATOM 1651  C CE1  . HIS A 1 108 ? -9.407  1.208   5.138   1.00 0.52  ? 108 HIS A CE1  1  
ATOM 1652  N NE2  . HIS A 1 108 ? -10.373 0.330   5.333   1.00 0.52  ? 108 HIS A NE2  1  
ATOM 1653  H H    . HIS A 1 108 ? -6.285  -1.016  7.535   1.00 0.33  ? 108 HIS A H    1  
ATOM 1654  H HA   . HIS A 1 108 ? -8.331  -2.912  6.882   1.00 0.42  ? 108 HIS A HA   1  
ATOM 1655  H HB2  . HIS A 1 108 ? -6.432  -1.269  5.221   1.00 0.36  ? 108 HIS A HB2  1  
ATOM 1656  H HB3  . HIS A 1 108 ? -7.508  -2.457  4.496   1.00 0.45  ? 108 HIS A HB3  1  
ATOM 1657  H HD1  . HIS A 1 108 ? -7.381  1.006   5.051   1.00 0.70  ? 108 HIS A HD1  1  
ATOM 1658  H HD2  . HIS A 1 108 ? -10.342 -1.845  5.616   1.00 0.71  ? 108 HIS A HD2  1  
ATOM 1659  H HE1  . HIS A 1 108 ? -9.536  2.271   5.011   1.00 0.64  ? 108 HIS A HE1  1  
ATOM 1660  H HE2  . HIS A 1 108 ? -11.281 0.569   5.654   1.00 0.63  ? 108 HIS A HE2  1  
ATOM 1661  N N    . LEU A 1 109 ? -5.307  -3.928  7.027   1.00 0.52  ? 109 LEU A N    1  
ATOM 1662  C CA   . LEU A 1 109 ? -4.418  -5.089  6.909   1.00 0.70  ? 109 LEU A CA   1  
ATOM 1663  C C    . LEU A 1 109 ? -5.129  -6.388  7.282   1.00 0.79  ? 109 LEU A C    1  
ATOM 1664  O O    . LEU A 1 109 ? -5.201  -7.320  6.481   1.00 1.24  ? 109 LEU A O    1  
ATOM 1665  C CB   . LEU A 1 109 ? -3.191  -4.914  7.805   1.00 0.96  ? 109 LEU A CB   1  
ATOM 1666  C CG   . LEU A 1 109 ? -2.263  -3.763  7.426   1.00 0.44  ? 109 LEU A CG   1  
ATOM 1667  C CD1  . LEU A 1 109 ? -1.157  -3.612  8.460   1.00 0.84  ? 109 LEU A CD1  1  
ATOM 1668  C CD2  . LEU A 1 109 ? -1.673  -3.997  6.052   1.00 0.67  ? 109 LEU A CD2  1  
ATOM 1669  H H    . LEU A 1 109 ? -5.018  -3.159  7.572   1.00 0.47  ? 109 LEU A H    1  
ATOM 1670  H HA   . LEU A 1 109 ? -4.092  -5.154  5.881   1.00 0.77  ? 109 LEU A HA   1  
ATOM 1671  H HB2  . LEU A 1 109 ? -3.534  -4.753  8.817   1.00 1.47  ? 109 LEU A HB2  1  
ATOM 1672  H HB3  . LEU A 1 109 ? -2.619  -5.829  7.779   1.00 1.46  ? 109 LEU A HB3  1  
ATOM 1673  H HG   . LEU A 1 109 ? -2.831  -2.840  7.397   1.00 0.43  ? 109 LEU A HG   1  
ATOM 1674  H HD11 . LEU A 1 109 ? -0.525  -2.778  8.192   1.00 1.39  ? 109 LEU A HD11 1  
ATOM 1675  H HD12 . LEU A 1 109 ? -0.567  -4.515  8.489   1.00 1.39  ? 109 LEU A HD12 1  
ATOM 1676  H HD13 . LEU A 1 109 ? -1.595  -3.436  9.431   1.00 1.37  ? 109 LEU A HD13 1  
ATOM 1677  H HD21 . LEU A 1 109 ? -1.073  -4.893  6.067   1.00 1.19  ? 109 LEU A HD21 1  
ATOM 1678  H HD22 . LEU A 1 109 ? -1.057  -3.154  5.776   1.00 1.41  ? 109 LEU A HD22 1  
ATOM 1679  H HD23 . LEU A 1 109 ? -2.471  -4.111  5.333   1.00 1.28  ? 109 LEU A HD23 1  
ATOM 1680  N N    . ASN A 1 110 ? -5.642  -6.450  8.504   1.00 1.37  ? 110 ASN A N    1  
ATOM 1681  C CA   . ASN A 1 110 ? -6.334  -7.644  8.981   1.00 1.67  ? 110 ASN A CA   1  
ATOM 1682  C C    . ASN A 1 110 ? -7.835  -7.391  9.074   1.00 1.44  ? 110 ASN A C    1  
ATOM 1683  O O    . ASN A 1 110 ? -8.578  -8.162  9.689   1.00 1.77  ? 110 ASN A O    1  
ATOM 1684  C CB   . ASN A 1 110 ? -5.775  -8.085  10.343  1.00 2.17  ? 110 ASN A CB   1  
ATOM 1685  C CG   . ASN A 1 110 ? -6.056  -7.089  11.454  1.00 2.95  ? 110 ASN A CG   1  
ATOM 1686  O OD1  . ASN A 1 110 ? -5.307  -6.133  11.655  1.00 3.70  ? 110 ASN A OD1  1  
ATOM 1687  N ND2  . ASN A 1 110 ? -7.111  -7.331  12.214  1.00 3.35  ? 110 ASN A ND2  1  
ATOM 1688  H H    . ASN A 1 110 ? -5.549  -5.677  9.104   1.00 1.89  ? 110 ASN A H    1  
ATOM 1689  H HA   . ASN A 1 110 ? -6.162  -8.431  8.262   1.00 1.91  ? 110 ASN A HA   1  
ATOM 1690  H HB2  . ASN A 1 110 ? -6.222  -9.030  10.616  1.00 2.54  ? 110 ASN A HB2  1  
ATOM 1691  H HB3  . ASN A 1 110 ? -4.705  -8.213  10.259  1.00 2.33  ? 110 ASN A HB3  1  
ATOM 1692  H HD21 . ASN A 1 110 ? -7.646  -8.136  12.021  1.00 3.18  ? 110 ASN A HD21 1  
ATOM 1693  H HD22 . ASN A 1 110 ? -7.322  -6.696  12.932  1.00 4.09  ? 110 ASN A HD22 1  
ATOM 1694  N N    . GLY A 1 111 ? -8.278  -6.310  8.448   1.00 1.12  ? 111 GLY A N    1  
ATOM 1695  C CA   . GLY A 1 111 ? -9.685  -5.962  8.462   1.00 1.12  ? 111 GLY A CA   1  
ATOM 1696  C C    . GLY A 1 111 ? -10.420 -6.533  7.266   1.00 0.87  ? 111 GLY A C    1  
ATOM 1697  O O    . GLY A 1 111 ? -9.814  -6.754  6.218   1.00 0.93  ? 111 GLY A O    1  
ATOM 1698  H H    . GLY A 1 111 ? -7.644  -5.752  7.954   1.00 1.15  ? 111 GLY A H    1  
ATOM 1699  H HA2  . GLY A 1 111 ? -10.134 -6.346  9.367   1.00 1.39  ? 111 GLY A HA2  1  
ATOM 1700  H HA3  . GLY A 1 111 ? -9.782  -4.887  8.451   1.00 1.34  ? 111 GLY A HA3  1  
ATOM 1701  N N    . PRO A 1 112 ? -11.736 -6.772  7.388   1.00 0.86  ? 112 PRO A N    1  
ATOM 1702  C CA   . PRO A 1 112 ? -12.555 -7.360  6.318   1.00 0.93  ? 112 PRO A CA   1  
ATOM 1703  C C    . PRO A 1 112 ? -12.901 -6.365  5.213   1.00 0.89  ? 112 PRO A C    1  
ATOM 1704  O O    . PRO A 1 112 ? -13.947 -6.479  4.564   1.00 1.31  ? 112 PRO A O    1  
ATOM 1705  C CB   . PRO A 1 112 ? -13.835 -7.801  7.040   1.00 1.25  ? 112 PRO A CB   1  
ATOM 1706  C CG   . PRO A 1 112 ? -13.595 -7.566  8.496   1.00 1.30  ? 112 PRO A CG   1  
ATOM 1707  C CD   . PRO A 1 112 ? -12.537 -6.507  8.582   1.00 1.10  ? 112 PRO A CD   1  
ATOM 1708  H HA   . PRO A 1 112 ? -12.070 -8.220  5.882   1.00 1.00  ? 112 PRO A HA   1  
ATOM 1709  H HB2  . PRO A 1 112 ? -14.662 -7.210  6.681   1.00 1.52  ? 112 PRO A HB2  1  
ATOM 1710  H HB3  . PRO A 1 112 ? -14.018 -8.845  6.834   1.00 1.43  ? 112 PRO A HB3  1  
ATOM 1711  H HG2  . PRO A 1 112 ? -14.505 -7.223  8.967   1.00 1.65  ? 112 PRO A HG2  1  
ATOM 1712  H HG3  . PRO A 1 112 ? -13.251 -8.476  8.963   1.00 1.44  ? 112 PRO A HG3  1  
ATOM 1713  H HD2  . PRO A 1 112 ? -12.980 -5.522  8.545   1.00 1.29  ? 112 PRO A HD2  1  
ATOM 1714  H HD3  . PRO A 1 112 ? -11.948 -6.628  9.480   1.00 1.17  ? 112 PRO A HD3  1  
ATOM 1715  N N    . LEU A 1 113 ? -11.998 -5.416  5.001   1.00 0.62  ? 113 LEU A N    1  
ATOM 1716  C CA   . LEU A 1 113 ? -12.151 -4.357  4.011   1.00 0.58  ? 113 LEU A CA   1  
ATOM 1717  C C    . LEU A 1 113 ? -13.399 -3.487  4.243   1.00 0.69  ? 113 LEU A C    1  
ATOM 1718  O O    . LEU A 1 113 ? -14.282 -3.836  5.029   1.00 0.90  ? 113 LEU A O    1  
ATOM 1719  C CB   . LEU A 1 113 ? -12.147 -4.974  2.618   1.00 0.58  ? 113 LEU A CB   1  
ATOM 1720  C CG   . LEU A 1 113 ? -10.829 -5.641  2.238   1.00 0.57  ? 113 LEU A CG   1  
ATOM 1721  C CD1  . LEU A 1 113 ? -10.892 -6.151  0.819   1.00 1.11  ? 113 LEU A CD1  1  
ATOM 1722  C CD2  . LEU A 1 113 ? -9.667  -4.670  2.423   1.00 1.05  ? 113 LEU A CD2  1  
ATOM 1723  H H    . LEU A 1 113 ? -11.170 -5.462  5.503   1.00 0.73  ? 113 LEU A H    1  
ATOM 1724  H HA   . LEU A 1 113 ? -11.284 -3.719  4.097   1.00 0.56  ? 113 LEU A HA   1  
ATOM 1725  H HB2  . LEU A 1 113 ? -12.935 -5.713  2.568   1.00 0.65  ? 113 LEU A HB2  1  
ATOM 1726  H HB3  . LEU A 1 113 ? -12.356 -4.201  1.901   1.00 0.60  ? 113 LEU A HB3  1  
ATOM 1727  H HG   . LEU A 1 113 ? -10.662 -6.490  2.883   1.00 0.65  ? 113 LEU A HG   1  
ATOM 1728  H HD11 . LEU A 1 113 ? -11.695 -6.865  0.733   1.00 1.60  ? 113 LEU A HD11 1  
ATOM 1729  H HD12 . LEU A 1 113 ? -9.956  -6.623  0.566   1.00 1.75  ? 113 LEU A HD12 1  
ATOM 1730  H HD13 . LEU A 1 113 ? -11.074 -5.323  0.151   1.00 1.54  ? 113 LEU A HD13 1  
ATOM 1731  H HD21 . LEU A 1 113 ? -9.634  -4.333  3.451   1.00 1.60  ? 113 LEU A HD21 1  
ATOM 1732  H HD22 . LEU A 1 113 ? -9.799  -3.821  1.770   1.00 1.47  ? 113 LEU A HD22 1  
ATOM 1733  H HD23 . LEU A 1 113 ? -8.739  -5.167  2.180   1.00 1.63  ? 113 LEU A HD23 1  
ATOM 1734  N N    . PRO A 1 114 ? -13.455 -2.303  3.597   1.00 0.68  ? 114 PRO A N    1  
ATOM 1735  C CA   . PRO A 1 114 ? -14.609 -1.397  3.693   1.00 0.83  ? 114 PRO A CA   1  
ATOM 1736  C C    . PRO A 1 114 ? -15.903 -2.038  3.196   1.00 0.86  ? 114 PRO A C    1  
ATOM 1737  O O    . PRO A 1 114 ? -15.886 -2.994  2.414   1.00 1.15  ? 114 PRO A O    1  
ATOM 1738  C CB   . PRO A 1 114 ? -14.224 -0.216  2.789   1.00 1.02  ? 114 PRO A CB   1  
ATOM 1739  C CG   . PRO A 1 114 ? -13.137 -0.735  1.914   1.00 0.90  ? 114 PRO A CG   1  
ATOM 1740  C CD   . PRO A 1 114 ? -12.394 -1.733  2.748   1.00 0.70  ? 114 PRO A CD   1  
ATOM 1741  H HA   . PRO A 1 114 ? -14.754 -1.046  4.704   1.00 1.05  ? 114 PRO A HA   1  
ATOM 1742  H HB2  . PRO A 1 114 ? -15.083 0.090   2.210   1.00 1.15  ? 114 PRO A HB2  1  
ATOM 1743  H HB3  . PRO A 1 114 ? -13.882 0.609   3.395   1.00 1.31  ? 114 PRO A HB3  1  
ATOM 1744  H HG2  . PRO A 1 114 ? -13.561 -1.213  1.041   1.00 0.99  ? 114 PRO A HG2  1  
ATOM 1745  H HG3  . PRO A 1 114 ? -12.483 0.073   1.621   1.00 1.13  ? 114 PRO A HG3  1  
ATOM 1746  H HD2  . PRO A 1 114 ? -11.947 -2.489  2.123   1.00 0.68  ? 114 PRO A HD2  1  
ATOM 1747  H HD3  . PRO A 1 114 ? -11.642 -1.243  3.347   1.00 0.81  ? 114 PRO A HD3  1  
ATOM 1748  N N    . VAL A 1 115 ? -17.021 -1.513  3.673   1.00 1.26  ? 115 VAL A N    1  
ATOM 1749  C CA   . VAL A 1 115 ? -18.331 -1.989  3.266   1.00 1.45  ? 115 VAL A CA   1  
ATOM 1750  C C    . VAL A 1 115 ? -18.687 -1.477  1.869   1.00 1.91  ? 115 VAL A C    1  
ATOM 1751  O O    . VAL A 1 115 ? -18.415 -0.322  1.526   1.00 2.44  ? 115 VAL A O    1  
ATOM 1752  C CB   . VAL A 1 115 ? -19.422 -1.563  4.273   1.00 1.96  ? 115 VAL A CB   1  
ATOM 1753  C CG1  . VAL A 1 115 ? -19.215 -2.259  5.611   1.00 2.60  ? 115 VAL A CG1  1  
ATOM 1754  C CG2  . VAL A 1 115 ? -19.435 -0.053  4.462   1.00 2.98  ? 115 VAL A CG2  1  
ATOM 1755  H H    . VAL A 1 115 ? -16.962 -0.782  4.329   1.00 1.67  ? 115 VAL A H    1  
ATOM 1756  H HA   . VAL A 1 115 ? -18.296 -3.068  3.241   1.00 1.85  ? 115 VAL A HA   1  
ATOM 1757  H HB   . VAL A 1 115 ? -20.383 -1.865  3.882   1.00 2.15  ? 115 VAL A HB   1  
ATOM 1758  H HG11 . VAL A 1 115 ? -19.986 -1.947  6.301   1.00 2.96  ? 115 VAL A HG11 1  
ATOM 1759  H HG12 . VAL A 1 115 ? -18.248 -1.994  6.009   1.00 3.01  ? 115 VAL A HG12 1  
ATOM 1760  H HG13 . VAL A 1 115 ? -19.267 -3.328  5.472   1.00 3.05  ? 115 VAL A HG13 1  
ATOM 1761  H HG21 . VAL A 1 115 ? -19.636 0.425   3.516   1.00 3.35  ? 115 VAL A HG21 1  
ATOM 1762  H HG22 . VAL A 1 115 ? -18.473 0.272   4.832   1.00 3.47  ? 115 VAL A HG22 1  
ATOM 1763  H HG23 . VAL A 1 115 ? -20.203 0.216   5.173   1.00 3.42  ? 115 VAL A HG23 1  
ATOM 1764  N N    . PRO A 1 116 ? -19.288 -2.350  1.041   1.00 2.53  ? 116 PRO A N    1  
ATOM 1765  C CA   . PRO A 1 116 ? -19.647 -2.026  -0.344  1.00 3.48  ? 116 PRO A CA   1  
ATOM 1766  C C    . PRO A 1 116 ? -20.577 -0.820  -0.447  1.00 3.68  ? 116 PRO A C    1  
ATOM 1767  O O    . PRO A 1 116 ? -21.512 -0.674  0.342   1.00 3.90  ? 116 PRO A O    1  
ATOM 1768  C CB   . PRO A 1 116 ? -20.355 -3.289  -0.843  1.00 4.23  ? 116 PRO A CB   1  
ATOM 1769  C CG   . PRO A 1 116 ? -19.885 -4.376  0.058   1.00 4.01  ? 116 PRO A CG   1  
ATOM 1770  C CD   . PRO A 1 116 ? -19.659 -3.731  1.394   1.00 2.94  ? 116 PRO A CD   1  
ATOM 1771  H HA   . PRO A 1 116 ? -18.767 -1.847  -0.945  1.00 3.92  ? 116 PRO A HA   1  
ATOM 1772  H HB2  . PRO A 1 116 ? -21.427 -3.156  -0.776  1.00 4.47  ? 116 PRO A HB2  1  
ATOM 1773  H HB3  . PRO A 1 116 ? -20.077 -3.480  -1.869  1.00 4.93  ? 116 PRO A HB3  1  
ATOM 1774  H HG2  . PRO A 1 116 ? -20.641 -5.144  0.135   1.00 4.47  ? 116 PRO A HG2  1  
ATOM 1775  H HG3  . PRO A 1 116 ? -18.963 -4.792  -0.320  1.00 4.42  ? 116 PRO A HG3  1  
ATOM 1776  H HD2  . PRO A 1 116 ? -20.566 -3.748  1.982   1.00 2.94  ? 116 PRO A HD2  1  
ATOM 1777  H HD3  . PRO A 1 116 ? -18.855 -4.222  1.922   1.00 2.95  ? 116 PRO A HD3  1  
ATOM 1778  N N    . PHE A 1 117 ? -20.291 0.040   -1.429  1.00 4.03  ? 117 PHE A N    1  
ATOM 1779  C CA   . PHE A 1 117 ? -21.084 1.238   -1.711  1.00 4.72  ? 117 PHE A CA   1  
ATOM 1780  C C    . PHE A 1 117 ? -20.976 2.278   -0.598  1.00 5.62  ? 117 PHE A C    1  
ATOM 1781  O O    . PHE A 1 117 ? -21.705 3.273   -0.602  1.00 6.22  ? 117 PHE A O    1  
ATOM 1782  C CB   . PHE A 1 117 ? -22.545 0.875   -1.973  1.00 5.32  ? 117 PHE A CB   1  
ATOM 1783  C CG   . PHE A 1 117 ? -22.732 -0.020  -3.167  1.00 5.77  ? 117 PHE A CG   1  
ATOM 1784  C CD1  . PHE A 1 117 ? -22.605 0.482   -4.453  1.00 6.27  ? 117 PHE A CD1  1  
ATOM 1785  C CD2  . PHE A 1 117 ? -23.032 -1.363  -3.003  1.00 6.08  ? 117 PHE A CD2  1  
ATOM 1786  C CE1  . PHE A 1 117 ? -22.765 -0.340  -5.552  1.00 7.04  ? 117 PHE A CE1  1  
ATOM 1787  C CE2  . PHE A 1 117 ? -23.195 -2.190  -4.098  1.00 6.87  ? 117 PHE A CE2  1  
ATOM 1788  C CZ   . PHE A 1 117 ? -23.063 -1.676  -5.374  1.00 7.33  ? 117 PHE A CZ   1  
ATOM 1789  H H    . PHE A 1 117 ? -19.521 -0.141  -1.995  1.00 4.08  ? 117 PHE A H    1  
ATOM 1790  H HA   . PHE A 1 117 ? -20.679 1.677   -2.611  1.00 4.55  ? 117 PHE A HA   1  
ATOM 1791  H HB2  . PHE A 1 117 ? -22.944 0.366   -1.108  1.00 5.24  ? 117 PHE A HB2  1  
ATOM 1792  H HB3  . PHE A 1 117 ? -23.102 1.779   -2.143  1.00 5.94  ? 117 PHE A HB3  1  
ATOM 1793  H HD1  . PHE A 1 117 ? -22.371 1.528   -4.594  1.00 6.29  ? 117 PHE A HD1  1  
ATOM 1794  H HD2  . PHE A 1 117 ? -23.135 -1.763  -2.007  1.00 5.96  ? 117 PHE A HD2  1  
ATOM 1795  H HE1  . PHE A 1 117 ? -22.663 0.061   -6.550  1.00 7.60  ? 117 PHE A HE1  1  
ATOM 1796  H HE2  . PHE A 1 117 ? -23.427 -3.235  -3.957  1.00 7.32  ? 117 PHE A HE2  1  
ATOM 1797  H HZ   . PHE A 1 117 ? -23.189 -2.320  -6.231  1.00 8.10  ? 117 PHE A HZ   1  
ATOM 1798  N N    . THR A 1 118 ? -20.067 2.036   0.350   1.00 6.05  ? 118 THR A N    1  
ATOM 1799  C CA   . THR A 1 118 ? -19.749 2.991   1.411   1.00 7.13  ? 118 THR A CA   1  
ATOM 1800  C C    . THR A 1 118 ? -20.855 3.079   2.469   1.00 7.53  ? 118 THR A C    1  
ATOM 1801  O O    . THR A 1 118 ? -20.608 2.828   3.648   1.00 8.01  ? 118 THR A O    1  
ATOM 1802  C CB   . THR A 1 118 ? -19.459 4.393   0.837   1.00 8.07  ? 118 THR A CB   1  
ATOM 1803  O OG1  . THR A 1 118 ? -18.492 4.287   -0.216  1.00 8.43  ? 118 THR A OG1  1  
ATOM 1804  C CG2  . THR A 1 118 ? -18.934 5.326   1.918   1.00 8.78  ? 118 THR A CG2  1  
ATOM 1805  H H    . THR A 1 118 ? -19.602 1.171   0.345   1.00 5.82  ? 118 THR A H    1  
ATOM 1806  H HA   . THR A 1 118 ? -18.847 2.643   1.895   1.00 7.30  ? 118 THR A HA   1  
ATOM 1807  H HB   . THR A 1 118 ? -20.376 4.804   0.437   1.00 8.25  ? 118 THR A HB   1  
ATOM 1808  H HG1  . THR A 1 118 ? -18.330 3.356   -0.404  1.00 8.41  ? 118 THR A HG1  1  
ATOM 1809  H HG21 . THR A 1 118 ? -18.034 4.911   2.346   1.00 9.07  ? 118 THR A HG21 1  
ATOM 1810  H HG22 . THR A 1 118 ? -19.680 5.439   2.691   1.00 8.92  ? 118 THR A HG22 1  
ATOM 1811  H HG23 . THR A 1 118 ? -18.715 6.294   1.486   1.00 9.11  ? 118 THR A HG23 1  
ATOM 1812  N N    . ASN A 1 119 ? -22.065 3.428   2.058   1.00 7.62  ? 119 ASN A N    1  
ATOM 1813  C CA   . ASN A 1 119 ? -23.167 3.573   3.001   1.00 8.32  ? 119 ASN A CA   1  
ATOM 1814  C C    . ASN A 1 119 ? -24.344 2.702   2.581   1.00 9.00  ? 119 ASN A C    1  
ATOM 1815  O O    . ASN A 1 119 ? -24.502 1.587   3.079   1.00 9.23  ? 119 ASN A O    1  
ATOM 1816  C CB   . ASN A 1 119 ? -23.594 5.043   3.109   1.00 8.46  ? 119 ASN A CB   1  
ATOM 1817  C CG   . ASN A 1 119 ? -24.546 5.298   4.266   1.00 8.93  ? 119 ASN A CG   1  
ATOM 1818  O OD1  . ASN A 1 119 ? -24.118 5.567   5.387   1.00 9.34  ? 119 ASN A OD1  1  
ATOM 1819  N ND2  . ASN A 1 119 ? -25.840 5.232   4.004   1.00 9.14  ? 119 ASN A ND2  1  
ATOM 1820  H H    . ASN A 1 119 ? -22.227 3.573   1.098   1.00 7.43  ? 119 ASN A H    1  
ATOM 1821  H HA   . ASN A 1 119 ? -22.817 3.238   3.968   1.00 8.58  ? 119 ASN A HA   1  
ATOM 1822  H HB2  . ASN A 1 119 ? -22.717 5.654   3.251   1.00 8.54  ? 119 ASN A HB2  1  
ATOM 1823  H HB3  . ASN A 1 119 ? -24.086 5.334   2.193   1.00 8.45  ? 119 ASN A HB3  1  
ATOM 1824  H HD21 . ASN A 1 119 ? -26.118 5.020   3.089   1.00 8.98  ? 119 ASN A HD21 1  
ATOM 1825  H HD22 . ASN A 1 119 ? -26.473 5.392   4.742   1.00 9.61  ? 119 ASN A HD22 1  
ATOM 1826  N N    . GLY A 1 120 ? -25.143 3.200   1.639   1.00 9.55  ? 120 GLY A N    1  
ATOM 1827  C CA   . GLY A 1 120 ? -26.319 2.477   1.193   1.00 10.42 ? 120 GLY A CA   1  
ATOM 1828  C C    . GLY A 1 120 ? -27.294 2.194   2.321   1.00 11.21 ? 120 GLY A C    1  
ATOM 1829  O O    . GLY A 1 120 ? -27.242 2.841   3.366   1.00 11.55 ? 120 GLY A O    1  
ATOM 1830  H H    . GLY A 1 120 ? -24.927 4.071   1.236   1.00 9.52  ? 120 GLY A H    1  
ATOM 1831  H HA2  . GLY A 1 120 ? -26.821 3.063   0.438   1.00 10.61 ? 120 GLY A HA2  1  
ATOM 1832  H HA3  . GLY A 1 120 ? -26.009 1.540   0.756   1.00 10.51 ? 120 GLY A HA3  1  
ATOM 1833  N N    . GLU A 1 121 ? -28.187 1.234   2.095   1.00 11.70 ? 121 GLU A N    1  
ATOM 1834  C CA   . GLU A 1 121 ? -29.114 0.766   3.125   1.00 12.64 ? 121 GLU A CA   1  
ATOM 1835  C C    . GLU A 1 121 ? -30.008 1.881   3.660   1.00 13.44 ? 121 GLU A C    1  
ATOM 1836  O O    . GLU A 1 121 ? -29.697 2.511   4.671   1.00 13.92 ? 121 GLU A O    1  
ATOM 1837  C CB   . GLU A 1 121 ? -28.342 0.125   4.280   1.00 12.94 ? 121 GLU A CB   1  
ATOM 1838  C CG   . GLU A 1 121 ? -27.625 -1.152  3.890   1.00 12.93 ? 121 GLU A CG   1  
ATOM 1839  C CD   . GLU A 1 121 ? -28.573 -2.190  3.338   1.00 13.41 ? 121 GLU A CD   1  
ATOM 1840  O OE1  . GLU A 1 121 ? -29.264 -2.854  4.135   1.00 13.66 ? 121 GLU A OE1  1  
ATOM 1841  O OE2  . GLU A 1 121 ? -28.634 -2.351  2.103   1.00 13.68 ? 121 GLU A OE2  1  
ATOM 1842  H H    . GLU A 1 121 ? -28.224 0.826   1.201   1.00 11.54 ? 121 GLU A H    1  
ATOM 1843  H HA   . GLU A 1 121 ? -29.743 0.014   2.675   1.00 12.73 ? 121 GLU A HA   1  
ATOM 1844  H HB2  . GLU A 1 121 ? -27.606 0.829   4.641   1.00 13.04 ? 121 GLU A HB2  1  
ATOM 1845  H HB3  . GLU A 1 121 ? -29.033 -0.104  5.079   1.00 13.27 ? 121 GLU A HB3  1  
ATOM 1846  H HG2  . GLU A 1 121 ? -26.886 -0.922  3.136   1.00 12.74 ? 121 GLU A HG2  1  
ATOM 1847  H HG3  . GLU A 1 121 ? -27.135 -1.559  4.763   1.00 12.97 ? 121 GLU A HG3  1  
ATOM 1848  N N    . ILE A 1 122 ? -31.134 2.097   2.998   1.00 13.73 ? 122 ILE A N    1  
ATOM 1849  C CA   . ILE A 1 122 ? -32.116 3.080   3.448   1.00 14.64 ? 122 ILE A CA   1  
ATOM 1850  C C    . ILE A 1 122 ? -32.984 2.510   4.573   1.00 15.74 ? 122 ILE A C    1  
ATOM 1851  O O    . ILE A 1 122 ? -34.213 2.584   4.532   1.00 16.21 ? 122 ILE A O    1  
ATOM 1852  C CB   . ILE A 1 122 ? -33.017 3.547   2.283   1.00 14.54 ? 122 ILE A CB   1  
ATOM 1853  C CG1  . ILE A 1 122 ? -33.601 2.339   1.534   1.00 14.04 ? 122 ILE A CG1  1  
ATOM 1854  C CG2  . ILE A 1 122 ? -32.232 4.449   1.337   1.00 14.69 ? 122 ILE A CG2  1  
ATOM 1855  C CD1  . ILE A 1 122 ? -34.562 2.708   0.424   1.00 14.09 ? 122 ILE A CD1  1  
ATOM 1856  H H    . ILE A 1 122 ? -31.313 1.585   2.181   1.00 13.43 ? 122 ILE A H    1  
ATOM 1857  H HA   . ILE A 1 122 ? -31.578 3.937   3.826   1.00 14.76 ? 122 ILE A HA   1  
ATOM 1858  H HB   . ILE A 1 122 ? -33.826 4.125   2.700   1.00 14.93 ? 122 ILE A HB   1  
ATOM 1859  H HG12 . ILE A 1 122 ? -32.794 1.774   1.093   1.00 13.68 ? 122 ILE A HG12 1  
ATOM 1860  H HG13 . ILE A 1 122 ? -34.131 1.710   2.235   1.00 14.16 ? 122 ILE A HG13 1  
ATOM 1861  H HG21 . ILE A 1 122 ? -31.840 5.294   1.885   1.00 14.66 ? 122 ILE A HG21 1  
ATOM 1862  H HG22 . ILE A 1 122 ? -32.884 4.800   0.553   1.00 14.82 ? 122 ILE A HG22 1  
ATOM 1863  H HG23 . ILE A 1 122 ? -31.414 3.891   0.903   1.00 14.87 ? 122 ILE A HG23 1  
ATOM 1864  H HD11 . ILE A 1 122 ? -35.391 3.267   0.835   1.00 14.08 ? 122 ILE A HD11 1  
ATOM 1865  H HD12 . ILE A 1 122 ? -34.933 1.808   -0.045  1.00 14.17 ? 122 ILE A HD12 1  
ATOM 1866  H HD13 . ILE A 1 122 ? -34.050 3.313   -0.310  1.00 14.24 ? 122 ILE A HD13 1  
ATOM 1867  N N    . GLN A 1 123 ? -32.326 1.950   5.579   1.00 16.25 ? 123 GLN A N    1  
ATOM 1868  C CA   . GLN A 1 123 ? -33.008 1.307   6.694   1.00 17.37 ? 123 GLN A CA   1  
ATOM 1869  C C    . GLN A 1 123 ? -33.716 2.332   7.574   1.00 18.25 ? 123 GLN A C    1  
ATOM 1870  O O    . GLN A 1 123 ? -33.080 3.244   8.106   1.00 18.70 ? 123 GLN A O    1  
ATOM 1871  C CB   . GLN A 1 123 ? -32.006 0.513   7.537   1.00 17.69 ? 123 GLN A CB   1  
ATOM 1872  C CG   . GLN A 1 123 ? -32.618 -0.142  8.771   1.00 18.12 ? 123 GLN A CG   1  
ATOM 1873  C CD   . GLN A 1 123 ? -31.576 -0.697  9.728   1.00 18.49 ? 123 GLN A CD   1  
ATOM 1874  O OE1  . GLN A 1 123 ? -31.786 -0.730  10.941  1.00 18.82 ? 123 GLN A OE1  1  
ATOM 1875  N NE2  . GLN A 1 123 ? -30.452 -1.146  9.195   1.00 18.57 ? 123 GLN A NE2  1  
ATOM 1876  H H    . GLN A 1 123 ? -31.346 1.979   5.575   1.00 15.95 ? 123 GLN A H    1  
ATOM 1877  H HA   . GLN A 1 123 ? -33.742 0.628   6.289   1.00 17.46 ? 123 GLN A HA   1  
ATOM 1878  H HB2  . GLN A 1 123 ? -31.575 -0.261  6.920   1.00 17.45 ? 123 GLN A HB2  1  
ATOM 1879  H HB3  . GLN A 1 123 ? -31.221 1.180   7.861   1.00 18.00 ? 123 GLN A HB3  1  
ATOM 1880  H HG2  . GLN A 1 123 ? -33.209 0.593   9.297   1.00 18.20 ? 123 GLN A HG2  1  
ATOM 1881  H HG3  . GLN A 1 123 ? -33.257 -0.951  8.451   1.00 18.23 ? 123 GLN A HG3  1  
ATOM 1882  H HE21 . GLN A 1 123 ? -30.349 -1.104  8.216   1.00 18.37 ? 123 GLN A HE21 1  
ATOM 1883  H HE22 . GLN A 1 123 ? -29.762 -1.502  9.795   1.00 18.90 ? 123 GLN A HE22 1  
ATOM 1884  N N    . LYS A 1 124 ? -35.031 2.159   7.713   1.00 18.59 ? 124 LYS A N    1  
ATOM 1885  C CA   . LYS A 1 124 ? -35.860 2.990   8.582   1.00 19.51 ? 124 LYS A CA   1  
ATOM 1886  C C    . LYS A 1 124 ? -35.629 4.480   8.323   1.00 20.23 ? 124 LYS A C    1  
ATOM 1887  O O    . LYS A 1 124 ? -35.114 5.208   9.176   1.00 20.83 ? 124 LYS A O    1  
ATOM 1888  C CB   . LYS A 1 124 ? -35.599 2.639   10.053  1.00 19.61 ? 124 LYS A CB   1  
ATOM 1889  C CG   . LYS A 1 124 ? -36.544 3.324   11.030  1.00 19.54 ? 124 LYS A CG   1  
ATOM 1890  C CD   . LYS A 1 124 ? -36.379 2.778   12.438  1.00 19.77 ? 124 LYS A CD   1  
ATOM 1891  C CE   . LYS A 1 124 ? -34.965 2.981   12.962  1.00 20.14 ? 124 LYS A CE   1  
ATOM 1892  N NZ   . LYS A 1 124 ? -34.633 4.421   13.134  1.00 20.17 ? 124 LYS A NZ   1  
ATOM 1893  H H    . LYS A 1 124 ? -35.463 1.430   7.211   1.00 18.29 ? 124 LYS A H    1  
ATOM 1894  H HA   . LYS A 1 124 ? -36.891 2.763   8.353   1.00 19.72 ? 124 LYS A HA   1  
ATOM 1895  H HB2  . LYS A 1 124 ? -35.700 1.570   10.180  1.00 19.67 ? 124 LYS A HB2  1  
ATOM 1896  H HB3  . LYS A 1 124 ? -34.590 2.927   10.302  1.00 19.83 ? 124 LYS A HB3  1  
ATOM 1897  H HG2  . LYS A 1 124 ? -36.330 4.382   11.039  1.00 19.49 ? 124 LYS A HG2  1  
ATOM 1898  H HG3  . LYS A 1 124 ? -37.562 3.162   10.707  1.00 19.51 ? 124 LYS A HG3  1  
ATOM 1899  H HD2  . LYS A 1 124 ? -37.069 3.288   13.093  1.00 19.80 ? 124 LYS A HD2  1  
ATOM 1900  H HD3  . LYS A 1 124 ? -36.602 1.721   12.431  1.00 19.76 ? 124 LYS A HD3  1  
ATOM 1901  H HE2  . LYS A 1 124 ? -34.871 2.483   13.915  1.00 20.61 ? 124 LYS A HE2  1  
ATOM 1902  H HE3  . LYS A 1 124 ? -34.272 2.545   12.258  1.00 20.05 ? 124 LYS A HE3  1  
ATOM 1903  H HZ1  . LYS A 1 124 ? -33.696 4.520   13.581  1.00 20.17 ? 124 LYS A HZ1  1  
ATOM 1904  H HZ2  . LYS A 1 124 ? -35.346 4.883   13.741  1.00 20.36 ? 124 LYS A HZ2  1  
ATOM 1905  H HZ3  . LYS A 1 124 ? -34.619 4.903   12.211  1.00 20.13 ? 124 LYS A HZ3  1  
ATOM 1906  N N    . GLU A 1 125 ? -36.012 4.925   7.136   1.00 20.28 ? 125 GLU A N    1  
ATOM 1907  C CA   . GLU A 1 125 ? -35.868 6.323   6.765   1.00 21.04 ? 125 GLU A CA   1  
ATOM 1908  C C    . GLU A 1 125 ? -37.039 7.127   7.325   1.00 21.94 ? 125 GLU A C    1  
ATOM 1909  O O    . GLU A 1 125 ? -38.020 7.398   6.625   1.00 22.50 ? 125 GLU A O    1  
ATOM 1910  C CB   . GLU A 1 125 ? -35.810 6.465   5.242   1.00 20.98 ? 125 GLU A CB   1  
ATOM 1911  C CG   . GLU A 1 125 ? -35.379 7.842   4.775   1.00 20.93 ? 125 GLU A CG   1  
ATOM 1912  C CD   . GLU A 1 125 ? -35.540 8.021   3.280   1.00 21.01 ? 125 GLU A CD   1  
ATOM 1913  O OE1  . GLU A 1 125 ? -34.784 7.389   2.516   1.00 20.79 ? 125 GLU A OE1  1  
ATOM 1914  O OE2  . GLU A 1 125 ? -36.429 8.793   2.865   1.00 21.38 ? 125 GLU A OE2  1  
ATOM 1915  H H    . GLU A 1 125 ? -36.411 4.298   6.494   1.00 19.85 ? 125 GLU A H    1  
ATOM 1916  H HA   . GLU A 1 125 ? -34.947 6.692   7.193   1.00 21.11 ? 125 GLU A HA   1  
ATOM 1917  H HB2  . GLU A 1 125 ? -35.108 5.742   4.853   1.00 20.83 ? 125 GLU A HB2  1  
ATOM 1918  H HB3  . GLU A 1 125 ? -36.788 6.260   4.835   1.00 21.23 ? 125 GLU A HB3  1  
ATOM 1919  H HG2  . GLU A 1 125 ? -35.982 8.584   5.277   1.00 20.90 ? 125 GLU A HG2  1  
ATOM 1920  H HG3  . GLU A 1 125 ? -34.340 7.988   5.032   1.00 21.00 ? 125 GLU A HG3  1  
ATOM 1921  N N    . ASN A 1 126 ? -36.953 7.481   8.597   1.00 22.18 ? 126 ASN A N    1  
ATOM 1922  C CA   . ASN A 1 126 ? -38.033 8.207   9.252   1.00 23.12 ? 126 ASN A CA   1  
ATOM 1923  C C    . ASN A 1 126 ? -37.823 9.708   9.116   1.00 23.54 ? 126 ASN A C    1  
ATOM 1924  O O    . ASN A 1 126 ? -38.762 10.432  8.788   1.00 23.81 ? 126 ASN A O    1  
ATOM 1925  C CB   . ASN A 1 126 ? -38.132 7.816   10.731  1.00 23.38 ? 126 ASN A CB   1  
ATOM 1926  C CG   . ASN A 1 126 ? -39.417 8.312   11.378  1.00 23.74 ? 126 ASN A CG   1  
ATOM 1927  O OD1  . ASN A 1 126 ? -40.441 8.462   10.711  1.00 23.88 ? 126 ASN A OD1  1  
ATOM 1928  N ND2  . ASN A 1 126 ? -39.380 8.561   12.679  1.00 23.99 ? 126 ASN A ND2  1  
ATOM 1929  H H    . ASN A 1 126 ? -36.143 7.249   9.108   1.00 21.78 ? 126 ASN A H    1  
ATOM 1930  H HA   . ASN A 1 126 ? -38.955 7.942   8.756   1.00 23.43 ? 126 ASN A HA   1  
ATOM 1931  H HB2  . ASN A 1 126 ? -38.101 6.742   10.815  1.00 23.29 ? 126 ASN A HB2  1  
ATOM 1932  H HB3  . ASN A 1 126 ? -37.293 8.241   11.265  1.00 23.53 ? 126 ASN A HB3  1  
ATOM 1933  H HD21 . ASN A 1 126 ? -38.530 8.416   13.160  1.00 23.94 ? 126 ASN A HD21 1  
ATOM 1934  H HD22 . ASN A 1 126 ? -40.202 8.874   13.114  1.00 24.29 ? 126 ASN A HD22 1  
ATOM 1935  N N    . SER A 1 127 ? -36.595 10.163  9.340   1.00 23.70 ? 127 SER A N    1  
ATOM 1936  C CA   . SER A 1 127 ? -36.245 11.575  9.188   1.00 24.19 ? 127 SER A CA   1  
ATOM 1937  C C    . SER A 1 127 ? -37.239 12.498  9.898   1.00 24.67 ? 127 SER A C    1  
ATOM 1938  O O    . SER A 1 127 ? -37.731 13.467  9.316   1.00 25.00 ? 127 SER A O    1  
ATOM 1939  C CB   . SER A 1 127 ? -36.162 11.942  7.702   1.00 24.36 ? 127 SER A CB   1  
ATOM 1940  O OG   . SER A 1 127 ? -35.170 11.174  7.040   1.00 24.58 ? 127 SER A OG   1  
ATOM 1941  H H    . SER A 1 127 ? -35.894 9.526   9.605   1.00 23.55 ? 127 SER A H    1  
ATOM 1942  H HA   . SER A 1 127 ? -35.271 11.717  9.630   1.00 24.21 ? 127 SER A HA   1  
ATOM 1943  H HB2  . SER A 1 127 ? -37.118 11.757  7.233   1.00 24.43 ? 127 SER A HB2  1  
ATOM 1944  H HB3  . SER A 1 127 ? -35.913 12.988  7.608   1.00 24.36 ? 127 SER A HB3  1  
ATOM 1945  H HG   . SER A 1 127 ? -35.430 11.047  6.113   1.00 24.78 ? 127 SER A HG   1  
ATOM 1946  N N    . ARG A 1 128 ? -37.548 12.184  11.145  1.00 24.79 ? 128 ARG A N    1  
ATOM 1947  C CA   . ARG A 1 128 ? -38.402 13.035  11.953  1.00 25.33 ? 128 ARG A CA   1  
ATOM 1948  C C    . ARG A 1 128 ? -37.580 13.667  13.059  1.00 25.41 ? 128 ARG A C    1  
ATOM 1949  O O    . ARG A 1 128 ? -37.108 14.807  12.870  1.00 25.41 ? 128 ARG A O    1  
ATOM 1950  C CB   . ARG A 1 128 ? -39.575 12.249  12.545  1.00 25.71 ? 128 ARG A CB   1  
ATOM 1951  C CG   . ARG A 1 128 ? -40.697 11.967  11.555  1.00 25.88 ? 128 ARG A CG   1  
ATOM 1952  C CD   . ARG A 1 128 ? -41.840 11.230  12.231  1.00 26.27 ? 128 ARG A CD   1  
ATOM 1953  N NE   . ARG A 1 128 ? -43.033 11.129  11.390  1.00 26.63 ? 128 ARG A NE   1  
ATOM 1954  C CZ   . ARG A 1 128 ? -44.201 10.652  11.827  1.00 27.12 ? 128 ARG A CZ   1  
ATOM 1955  N NH1  . ARG A 1 128 ? -44.298 10.154  13.054  1.00 27.29 ? 128 ARG A NH1  1  
ATOM 1956  N NH2  . ARG A 1 128 ? -45.261 10.652  11.032  1.00 27.52 ? 128 ARG A NH2  1  
ATOM 1957  O OXT  . ARG A 1 128 ? -37.373 13.011  14.096  1.00 25.55 ? 128 ARG A OXT  1  
ATOM 1958  H H    . ARG A 1 128 ? -37.180 11.362  11.539  1.00 24.58 ? 128 ARG A H    1  
ATOM 1959  H HA   . ARG A 1 128 ? -38.787 13.818  11.316  1.00 25.50 ? 128 ARG A HA   1  
ATOM 1960  H HB2  . ARG A 1 128 ? -39.207 11.304  12.917  1.00 25.74 ? 128 ARG A HB2  1  
ATOM 1961  H HB3  . ARG A 1 128 ? -39.988 12.811  13.369  1.00 25.93 ? 128 ARG A HB3  1  
ATOM 1962  H HG2  . ARG A 1 128 ? -41.066 12.901  11.162  1.00 25.82 ? 128 ARG A HG2  1  
ATOM 1963  H HG3  . ARG A 1 128 ? -40.312 11.358  10.748  1.00 25.90 ? 128 ARG A HG3  1  
ATOM 1964  H HD2  . ARG A 1 128 ? -41.506 10.233  12.480  1.00 26.12 ? 128 ARG A HD2  1  
ATOM 1965  H HD3  . ARG A 1 128 ? -42.096 11.756  13.139  1.00 26.52 ? 128 ARG A HD3  1  
ATOM 1966  H HE   . ARG A 1 128 ? -42.966 11.454  10.459  1.00 26.57 ? 128 ARG A HE   1  
ATOM 1967  H HH11 . ARG A 1 128 ? -43.493 10.129  13.655  1.00 27.05 ? 128 ARG A HH11 1  
ATOM 1968  H HH12 . ARG A 1 128 ? -45.181 9.799   13.389  1.00 27.71 ? 128 ARG A HH12 1  
ATOM 1969  H HH21 . ARG A 1 128 ? -45.193 11.010  10.095  1.00 27.46 ? 128 ARG A HH21 1  
ATOM 1970  H HH22 . ARG A 1 128 ? -46.148 10.302  11.366  1.00 27.94 ? 128 ARG A HH22 1  
ATOM 1971  N N    . GLY A 1 1   ? -12.534 -12.133 12.235  1.00 11.87 ? 1   GLY A N    2  
ATOM 1972  C CA   . GLY A 1 1   ? -12.966 -13.136 11.237  1.00 11.28 ? 1   GLY A CA   2  
ATOM 1973  C C    . GLY A 1 1   ? -12.017 -13.210 10.062  1.00 10.17 ? 1   GLY A C    2  
ATOM 1974  O O    . GLY A 1 1   ? -11.234 -12.285 9.833   1.00 9.93  ? 1   GLY A O    2  
ATOM 1975  H H1   . GLY A 1 1   ? -13.231 -12.068 13.006  1.00 12.05 ? 1   GLY A H1   2  
ATOM 1976  H H2   . GLY A 1 1   ? -12.441 -11.197 11.784  1.00 12.06 ? 1   GLY A H2   2  
ATOM 1977  H H3   . GLY A 1 1   ? -11.613 -12.406 12.637  1.00 12.09 ? 1   GLY A H3   2  
ATOM 1978  H HA2  . GLY A 1 1   ? -13.012 -14.105 11.712  1.00 11.56 ? 1   GLY A HA2  2  
ATOM 1979  H HA3  . GLY A 1 1   ? -13.950 -12.873 10.878  1.00 11.57 ? 1   GLY A HA3  2  
ATOM 1980  N N    . ILE A 1 2   ? -12.068 -14.313 9.328   1.00 9.64  ? 2   ILE A N    2  
ATOM 1981  C CA   . ILE A 1 2   ? -11.255 -14.472 8.130   1.00 8.69  ? 2   ILE A CA   2  
ATOM 1982  C C    . ILE A 1 2   ? -12.020 -14.027 6.888   1.00 7.70  ? 2   ILE A C    2  
ATOM 1983  O O    . ILE A 1 2   ? -13.226 -13.780 6.942   1.00 7.79  ? 2   ILE A O    2  
ATOM 1984  C CB   . ILE A 1 2   ? -10.760 -15.932 7.957   1.00 9.07  ? 2   ILE A CB   2  
ATOM 1985  C CG1  . ILE A 1 2   ? -11.889 -16.957 8.168   1.00 9.41  ? 2   ILE A CG1  2  
ATOM 1986  C CG2  . ILE A 1 2   ? -9.612  -16.206 8.913   1.00 9.20  ? 2   ILE A CG2  2  
ATOM 1987  C CD1  . ILE A 1 2   ? -12.848 -17.094 7.002   1.00 9.86  ? 2   ILE A CD1  2  
ATOM 1988  H H    . ILE A 1 2   ? -12.665 -15.045 9.605   1.00 10.00 ? 2   ILE A H    2  
ATOM 1989  H HA   . ILE A 1 2   ? -10.387 -13.838 8.242   1.00 8.63  ? 2   ILE A HA   2  
ATOM 1990  H HB   . ILE A 1 2   ? -10.380 -16.033 6.951   1.00 9.29  ? 2   ILE A HB   2  
ATOM 1991  H HG12 . ILE A 1 2   ? -11.449 -17.927 8.341   1.00 9.55  ? 2   ILE A HG12 2  
ATOM 1992  H HG13 . ILE A 1 2   ? -12.463 -16.672 9.038   1.00 9.48  ? 2   ILE A HG13 2  
ATOM 1993  H HG21 . ILE A 1 2   ? -9.948  -16.065 9.929   1.00 9.37  ? 2   ILE A HG21 2  
ATOM 1994  H HG22 . ILE A 1 2   ? -8.801  -15.524 8.703   1.00 9.31  ? 2   ILE A HG22 2  
ATOM 1995  H HG23 . ILE A 1 2   ? -9.272  -17.222 8.783   1.00 9.29  ? 2   ILE A HG23 2  
ATOM 1996  H HD11 . ILE A 1 2   ? -13.610 -17.819 7.249   1.00 9.83  ? 2   ILE A HD11 2  
ATOM 1997  H HD12 . ILE A 1 2   ? -12.308 -17.424 6.127   1.00 10.30 ? 2   ILE A HD12 2  
ATOM 1998  H HD13 . ILE A 1 2   ? -13.312 -16.139 6.801   1.00 9.99  ? 2   ILE A HD13 2  
ATOM 1999  N N    . ASP A 1 3   ? -11.306 -13.915 5.778   1.00 6.96  ? 3   ASP A N    2  
ATOM 2000  C CA   . ASP A 1 3   ? -11.907 -13.505 4.516   1.00 6.18  ? 3   ASP A CA   2  
ATOM 2001  C C    . ASP A 1 3   ? -12.331 -14.719 3.714   1.00 5.44  ? 3   ASP A C    2  
ATOM 2002  O O    . ASP A 1 3   ? -11.564 -15.670 3.569   1.00 5.15  ? 3   ASP A O    2  
ATOM 2003  C CB   . ASP A 1 3   ? -10.916 -12.693 3.687   1.00 6.00  ? 3   ASP A CB   2  
ATOM 2004  C CG   . ASP A 1 3   ? -10.336 -11.523 4.444   1.00 6.08  ? 3   ASP A CG   2  
ATOM 2005  O OD1  . ASP A 1 3   ? -11.007 -10.470 4.511   1.00 6.51  ? 3   ASP A OD1  2  
ATOM 2006  O OD2  . ASP A 1 3   ? -9.220  -11.647 4.986   1.00 6.03  ? 3   ASP A OD2  2  
ATOM 2007  H H    . ASP A 1 3   ? -10.347 -14.113 5.806   1.00 7.10  ? 3   ASP A H    2  
ATOM 2008  H HA   . ASP A 1 3   ? -12.774 -12.898 4.732   1.00 6.61  ? 3   ASP A HA   2  
ATOM 2009  H HB2  . ASP A 1 3   ? -10.103 -13.336 3.383   1.00 6.26  ? 3   ASP A HB2  2  
ATOM 2010  H HB3  . ASP A 1 3   ? -11.417 -12.317 2.808   1.00 5.95  ? 3   ASP A HB3  2  
ATOM 2011  N N    . PRO A 1 4   ? -13.562 -14.705 3.186   1.00 5.55  ? 4   PRO A N    2  
ATOM 2012  C CA   . PRO A 1 4   ? -14.057 -15.770 2.315   1.00 5.42  ? 4   PRO A CA   2  
ATOM 2013  C C    . PRO A 1 4   ? -13.320 -15.787 0.976   1.00 4.78  ? 4   PRO A C    2  
ATOM 2014  O O    . PRO A 1 4   ? -12.593 -16.731 0.665   1.00 4.92  ? 4   PRO A O    2  
ATOM 2015  C CB   . PRO A 1 4   ? -15.540 -15.425 2.111   1.00 6.21  ? 4   PRO A CB   2  
ATOM 2016  C CG   . PRO A 1 4   ? -15.858 -14.402 3.149   1.00 6.65  ? 4   PRO A CG   2  
ATOM 2017  C CD   . PRO A 1 4   ? -14.576 -13.668 3.413   1.00 6.29  ? 4   PRO A CD   2  
ATOM 2018  H HA   . PRO A 1 4   ? -13.968 -16.739 2.786   1.00 5.67  ? 4   PRO A HA   2  
ATOM 2019  H HB2  . PRO A 1 4   ? -15.685 -15.033 1.115   1.00 6.22  ? 4   PRO A HB2  2  
ATOM 2020  H HB3  . PRO A 1 4   ? -16.136 -16.315 2.241   1.00 6.74  ? 4   PRO A HB3  2  
ATOM 2021  H HG2  . PRO A 1 4   ? -16.609 -13.721 2.776   1.00 6.90  ? 4   PRO A HG2  2  
ATOM 2022  H HG3  . PRO A 1 4   ? -16.204 -14.888 4.050   1.00 7.27  ? 4   PRO A HG3  2  
ATOM 2023  H HD2  . PRO A 1 4   ? -14.455 -12.851 2.718   1.00 6.29  ? 4   PRO A HD2  2  
ATOM 2024  H HD3  . PRO A 1 4   ? -14.542 -13.312 4.432   1.00 6.88  ? 4   PRO A HD3  2  
ATOM 2025  N N    . PHE A 1 5   ? -13.507 -14.729 0.195   1.00 4.52  ? 5   PHE A N    2  
ATOM 2026  C CA   . PHE A 1 5   ? -12.833 -14.591 -1.090  1.00 4.35  ? 5   PHE A CA   2  
ATOM 2027  C C    . PHE A 1 5   ? -12.231 -13.195 -1.217  1.00 3.69  ? 5   PHE A C    2  
ATOM 2028  O O    . PHE A 1 5   ? -11.985 -12.707 -2.323  1.00 3.93  ? 5   PHE A O    2  
ATOM 2029  C CB   . PHE A 1 5   ? -13.814 -14.832 -2.244  1.00 5.29  ? 5   PHE A CB   2  
ATOM 2030  C CG   . PHE A 1 5   ? -14.497 -16.168 -2.198  1.00 6.13  ? 5   PHE A CG   2  
ATOM 2031  C CD1  . PHE A 1 5   ? -13.839 -17.314 -2.613  1.00 6.78  ? 5   PHE A CD1  2  
ATOM 2032  C CD2  . PHE A 1 5   ? -15.798 -16.280 -1.736  1.00 6.53  ? 5   PHE A CD2  2  
ATOM 2033  C CE1  . PHE A 1 5   ? -14.466 -18.544 -2.571  1.00 7.72  ? 5   PHE A CE1  2  
ATOM 2034  C CE2  . PHE A 1 5   ? -16.430 -17.508 -1.691  1.00 7.42  ? 5   PHE A CE2  2  
ATOM 2035  C CZ   . PHE A 1 5   ? -15.761 -18.642 -2.108  1.00 7.99  ? 5   PHE A CZ   2  
ATOM 2036  H H    . PHE A 1 5   ? -14.128 -14.023 0.484   1.00 4.77  ? 5   PHE A H    2  
ATOM 2037  H HA   . PHE A 1 5   ? -12.041 -15.322 -1.137  1.00 4.48  ? 5   PHE A HA   2  
ATOM 2038  H HB2  . PHE A 1 5   ? -14.578 -14.070 -2.220  1.00 5.51  ? 5   PHE A HB2  2  
ATOM 2039  H HB3  . PHE A 1 5   ? -13.278 -14.767 -3.179  1.00 5.50  ? 5   PHE A HB3  2  
ATOM 2040  H HD1  . PHE A 1 5   ? -12.826 -17.240 -2.974  1.00 6.71  ? 5   PHE A HD1  2  
ATOM 2041  H HD2  . PHE A 1 5   ? -16.324 -15.395 -1.409  1.00 6.31  ? 5   PHE A HD2  2  
ATOM 2042  H HE1  . PHE A 1 5   ? -13.942 -19.429 -2.899  1.00 8.37  ? 5   PHE A HE1  2  
ATOM 2043  H HE2  . PHE A 1 5   ? -17.444 -17.583 -1.326  1.00 7.82  ? 5   PHE A HE2  2  
ATOM 2044  H HZ   . PHE A 1 5   ? -16.253 -19.603 -2.074  1.00 8.77  ? 5   PHE A HZ   2  
ATOM 2045  N N    . THR A 1 6   ? -11.990 -12.557 -0.082  1.00 3.31  ? 6   THR A N    2  
ATOM 2046  C CA   . THR A 1 6   ? -11.504 -11.187 -0.072  1.00 3.02  ? 6   THR A CA   2  
ATOM 2047  C C    . THR A 1 6   ? -9.988  -11.135 0.113   1.00 2.13  ? 6   THR A C    2  
ATOM 2048  O O    . THR A 1 6   ? -9.487  -11.145 1.235   1.00 2.37  ? 6   THR A O    2  
ATOM 2049  C CB   . THR A 1 6   ? -12.180 -10.368 1.042   1.00 3.65  ? 6   THR A CB   2  
ATOM 2050  O OG1  . THR A 1 6   ? -13.594 -10.600 1.025   1.00 4.26  ? 6   THR A OG1  2  
ATOM 2051  C CG2  . THR A 1 6   ? -11.906 -8.886  0.855   1.00 4.04  ? 6   THR A CG2  2  
ATOM 2052  H H    . THR A 1 6   ? -12.135 -13.021 0.770   1.00 3.60  ? 6   THR A H    2  
ATOM 2053  H HA   . THR A 1 6   ? -11.756 -10.736 -1.022  1.00 3.50  ? 6   THR A HA   2  
ATOM 2054  H HB   . THR A 1 6   ? -11.779 -10.678 1.996   1.00 3.99  ? 6   THR A HB   2  
ATOM 2055  H HG1  . THR A 1 6   ? -13.794 -11.346 0.446   1.00 4.39  ? 6   THR A HG1  2  
ATOM 2056  H HG21 . THR A 1 6   ? -12.398 -8.329  1.638   1.00 4.31  ? 6   THR A HG21 2  
ATOM 2057  H HG22 . THR A 1 6   ? -12.282 -8.570  -0.106  1.00 4.49  ? 6   THR A HG22 2  
ATOM 2058  H HG23 . THR A 1 6   ? -10.843 -8.710  0.901   1.00 4.15  ? 6   THR A HG23 2  
ATOM 2059  N N    . MET A 1 7   ? -9.260  -11.081 -0.995  1.00 1.53  ? 7   MET A N    2  
ATOM 2060  C CA   . MET A 1 7   ? -7.806  -10.987 -0.942  1.00 1.05  ? 7   MET A CA   2  
ATOM 2061  C C    . MET A 1 7   ? -7.343  -9.596  -1.369  1.00 0.83  ? 7   MET A C    2  
ATOM 2062  O O    . MET A 1 7   ? -6.176  -9.391  -1.703  1.00 1.39  ? 7   MET A O    2  
ATOM 2063  C CB   . MET A 1 7   ? -7.155  -12.061 -1.822  1.00 1.50  ? 7   MET A CB   2  
ATOM 2064  C CG   . MET A 1 7   ? -7.530  -11.965 -3.293  1.00 2.32  ? 7   MET A CG   2  
ATOM 2065  S SD   . MET A 1 7   ? -6.655  -13.166 -4.319  1.00 3.29  ? 7   MET A SD   2  
ATOM 2066  C CE   . MET A 1 7   ? -7.204  -14.707 -3.585  1.00 3.84  ? 7   MET A CE   2  
ATOM 2067  H H    . MET A 1 7   ? -9.711  -11.111 -1.868  1.00 1.86  ? 7   MET A H    2  
ATOM 2068  H HA   . MET A 1 7   ? -7.505  -11.147 0.083   1.00 1.34  ? 7   MET A HA   2  
ATOM 2069  H HB2  . MET A 1 7   ? -6.082  -11.973 -1.740  1.00 1.93  ? 7   MET A HB2  2  
ATOM 2070  H HB3  . MET A 1 7   ? -7.454  -13.033 -1.461  1.00 1.78  ? 7   MET A HB3  2  
ATOM 2071  H HG2  . MET A 1 7   ? -8.591  -12.136 -3.390  1.00 2.59  ? 7   MET A HG2  2  
ATOM 2072  H HG3  . MET A 1 7   ? -7.294  -10.972 -3.644  1.00 2.65  ? 7   MET A HG3  2  
ATOM 2073  H HE1  . MET A 1 7   ? -6.759  -15.536 -4.116  1.00 4.06  ? 7   MET A HE1  2  
ATOM 2074  H HE2  . MET A 1 7   ? -8.282  -14.774 -3.649  1.00 4.06  ? 7   MET A HE2  2  
ATOM 2075  H HE3  . MET A 1 7   ? -6.903  -14.742 -2.549  1.00 4.32  ? 7   MET A HE3  2  
ATOM 2076  N N    . LEU A 1 8   ? -8.268  -8.646  -1.340  1.00 0.80  ? 8   LEU A N    2  
ATOM 2077  C CA   . LEU A 1 8   ? -7.979  -7.268  -1.729  1.00 0.56  ? 8   LEU A CA   2  
ATOM 2078  C C    . LEU A 1 8   ? -7.442  -6.492  -0.535  1.00 0.48  ? 8   LEU A C    2  
ATOM 2079  O O    . LEU A 1 8   ? -8.004  -5.475  -0.135  1.00 0.47  ? 8   LEU A O    2  
ATOM 2080  C CB   . LEU A 1 8   ? -9.250  -6.593  -2.246  1.00 0.47  ? 8   LEU A CB   2  
ATOM 2081  C CG   . LEU A 1 8   ? -9.945  -7.305  -3.403  1.00 0.56  ? 8   LEU A CG   2  
ATOM 2082  C CD1  . LEU A 1 8   ? -11.270 -6.629  -3.707  1.00 0.61  ? 8   LEU A CD1  2  
ATOM 2083  C CD2  . LEU A 1 8   ? -9.057  -7.317  -4.637  1.00 0.72  ? 8   LEU A CD2  2  
ATOM 2084  H H    . LEU A 1 8   ? -9.166  -8.870  -1.032  1.00 1.36  ? 8   LEU A H    2  
ATOM 2085  H HA   . LEU A 1 8   ? -7.234  -7.284  -2.512  1.00 0.70  ? 8   LEU A HA   2  
ATOM 2086  H HB2  . LEU A 1 8   ? -9.949  -6.518  -1.426  1.00 0.54  ? 8   LEU A HB2  2  
ATOM 2087  H HB3  . LEU A 1 8   ? -8.994  -5.595  -2.570  1.00 0.53  ? 8   LEU A HB3  2  
ATOM 2088  H HG   . LEU A 1 8   ? -10.146 -8.327  -3.121  1.00 0.64  ? 8   LEU A HG   2  
ATOM 2089  H HD11 . LEU A 1 8   ? -11.785 -7.179  -4.481  1.00 1.21  ? 8   LEU A HD11 2  
ATOM 2090  H HD12 . LEU A 1 8   ? -11.088 -5.619  -4.044  1.00 0.99  ? 8   LEU A HD12 2  
ATOM 2091  H HD13 . LEU A 1 8   ? -11.875 -6.606  -2.812  1.00 1.34  ? 8   LEU A HD13 2  
ATOM 2092  H HD21 . LEU A 1 8   ? -8.129  -7.822  -4.408  1.00 1.31  ? 8   LEU A HD21 2  
ATOM 2093  H HD22 . LEU A 1 8   ? -8.848  -6.301  -4.938  1.00 1.24  ? 8   LEU A HD22 2  
ATOM 2094  H HD23 . LEU A 1 8   ? -9.562  -7.834  -5.438  1.00 1.27  ? 8   LEU A HD23 2  
ATOM 2095  N N    . ARG A 1 9   ? -6.363  -6.984  0.037   1.00 0.52  ? 9   ARG A N    2  
ATOM 2096  C CA   . ARG A 1 9   ? -5.830  -6.416  1.260   1.00 0.51  ? 9   ARG A CA   2  
ATOM 2097  C C    . ARG A 1 9   ? -4.453  -5.822  1.041   1.00 0.43  ? 9   ARG A C    2  
ATOM 2098  O O    . ARG A 1 9   ? -3.687  -6.293  0.200   1.00 0.47  ? 9   ARG A O    2  
ATOM 2099  C CB   . ARG A 1 9   ? -5.746  -7.486  2.346   1.00 0.69  ? 9   ARG A CB   2  
ATOM 2100  C CG   . ARG A 1 9   ? -7.095  -7.962  2.837   1.00 1.15  ? 9   ARG A CG   2  
ATOM 2101  C CD   . ARG A 1 9   ? -6.943  -8.906  4.012   1.00 1.21  ? 9   ARG A CD   2  
ATOM 2102  N NE   . ARG A 1 9   ? -8.213  -9.150  4.675   1.00 1.84  ? 9   ARG A NE   2  
ATOM 2103  C CZ   . ARG A 1 9   ? -8.664  -8.428  5.687   1.00 2.23  ? 9   ARG A CZ   2  
ATOM 2104  N NH1  . ARG A 1 9   ? -7.946  -7.424  6.162   1.00 2.21  ? 9   ARG A NH1  2  
ATOM 2105  N NH2  . ARG A 1 9   ? -9.835  -8.716  6.226   1.00 3.09  ? 9   ARG A NH2  2  
ATOM 2106  H H    . ARG A 1 9   ? -5.898  -7.736  -0.385  1.00 0.60  ? 9   ARG A H    2  
ATOM 2107  H HA   . ARG A 1 9   ? -6.501  -5.637  1.588   1.00 0.51  ? 9   ARG A HA   2  
ATOM 2108  H HB2  . ARG A 1 9   ? -5.207  -8.335  1.956   1.00 1.21  ? 9   ARG A HB2  2  
ATOM 2109  H HB3  . ARG A 1 9   ? -5.204  -7.083  3.190   1.00 1.12  ? 9   ARG A HB3  2  
ATOM 2110  H HG2  . ARG A 1 9   ? -7.680  -7.108  3.143   1.00 1.62  ? 9   ARG A HG2  2  
ATOM 2111  H HG3  . ARG A 1 9   ? -7.599  -8.477  2.032   1.00 1.68  ? 9   ARG A HG3  2  
ATOM 2112  H HD2  . ARG A 1 9   ? -6.547  -9.845  3.658   1.00 1.50  ? 9   ARG A HD2  2  
ATOM 2113  H HD3  . ARG A 1 9   ? -6.258  -8.471  4.723   1.00 1.36  ? 9   ARG A HD3  2  
ATOM 2114  H HE   . ARG A 1 9   ? -8.762  -9.908  4.348   1.00 2.36  ? 9   ARG A HE   2  
ATOM 2115  H HH11 . ARG A 1 9   ? -7.056  -7.207  5.762   1.00 1.99  ? 9   ARG A HH11 2  
ATOM 2116  H HH12 . ARG A 1 9   ? -8.303  -6.866  6.921   1.00 2.76  ? 9   ARG A HH12 2  
ATOM 2117  H HH21 . ARG A 1 9   ? -10.384 -9.482  5.860   1.00 3.51  ? 9   ARG A HH21 2  
ATOM 2118  H HH22 . ARG A 1 9   ? -10.178 -8.178  7.002   1.00 3.49  ? 9   ARG A HH22 2  
ATOM 2119  N N    . PRO A 1 10  ? -4.119  -4.782  1.814   1.00 0.36  ? 10  PRO A N    2  
ATOM 2120  C CA   . PRO A 1 10  ? -2.791  -4.210  1.816   1.00 0.30  ? 10  PRO A CA   2  
ATOM 2121  C C    . PRO A 1 10  ? -1.830  -5.144  2.518   1.00 0.28  ? 10  PRO A C    2  
ATOM 2122  O O    . PRO A 1 10  ? -2.244  -6.076  3.208   1.00 0.38  ? 10  PRO A O    2  
ATOM 2123  C CB   . PRO A 1 10  ? -2.929  -2.904  2.615   1.00 0.29  ? 10  PRO A CB   2  
ATOM 2124  C CG   . PRO A 1 10  ? -4.386  -2.743  2.894   1.00 0.47  ? 10  PRO A CG   2  
ATOM 2125  C CD   . PRO A 1 10  ? -5.000  -4.104  2.762   1.00 0.40  ? 10  PRO A CD   2  
ATOM 2126  H HA   . PRO A 1 10  ? -2.439  -4.000  0.815   1.00 0.33  ? 10  PRO A HA   2  
ATOM 2127  H HB2  . PRO A 1 10  ? -2.356  -2.984  3.532   1.00 0.37  ? 10  PRO A HB2  2  
ATOM 2128  H HB3  . PRO A 1 10  ? -2.555  -2.082  2.028   1.00 0.38  ? 10  PRO A HB3  2  
ATOM 2129  H HG2  . PRO A 1 10  ? -4.527  -2.367  3.896   1.00 0.70  ? 10  PRO A HG2  2  
ATOM 2130  H HG3  . PRO A 1 10  ? -4.822  -2.066  2.175   1.00 0.81  ? 10  PRO A HG3  2  
ATOM 2131  H HD2  . PRO A 1 10  ? -5.001  -4.611  3.719   1.00 0.50  ? 10  PRO A HD2  2  
ATOM 2132  H HD3  . PRO A 1 10  ? -5.991  -4.026  2.370   1.00 0.57  ? 10  PRO A HD3  2  
ATOM 2133  N N    . ARG A 1 11  ? -0.562  -4.899  2.349   1.00 0.29  ? 11  ARG A N    2  
ATOM 2134  C CA   . ARG A 1 11  ? 0.445   -5.704  3.009   1.00 0.34  ? 11  ARG A CA   2  
ATOM 2135  C C    . ARG A 1 11  ? 1.418   -4.808  3.762   1.00 0.27  ? 11  ARG A C    2  
ATOM 2136  O O    . ARG A 1 11  ? 1.908   -3.812  3.225   1.00 0.27  ? 11  ARG A O    2  
ATOM 2137  C CB   . ARG A 1 11  ? 1.166   -6.596  1.988   1.00 0.49  ? 11  ARG A CB   2  
ATOM 2138  C CG   . ARG A 1 11  ? 1.752   -5.830  0.814   1.00 0.63  ? 11  ARG A CG   2  
ATOM 2139  C CD   . ARG A 1 11  ? 1.690   -6.636  -0.474  1.00 1.00  ? 11  ARG A CD   2  
ATOM 2140  N NE   . ARG A 1 11  ? 0.313   -6.989  -0.819  1.00 1.22  ? 11  ARG A NE   2  
ATOM 2141  C CZ   . ARG A 1 11  ? -0.304  -6.617  -1.940  1.00 1.59  ? 11  ARG A CZ   2  
ATOM 2142  N NH1  . ARG A 1 11  ? 0.336   -5.902  -2.860  1.00 1.95  ? 11  ARG A NH1  2  
ATOM 2143  N NH2  . ARG A 1 11  ? -1.570  -6.966  -2.134  1.00 2.37  ? 11  ARG A NH2  2  
ATOM 2144  H H    . ARG A 1 11  ? -0.294  -4.158  1.767   1.00 0.33  ? 11  ARG A H    2  
ATOM 2145  H HA   . ARG A 1 11  ? -0.070  -6.334  3.727   1.00 0.40  ? 11  ARG A HA   2  
ATOM 2146  H HB2  . ARG A 1 11  ? 1.970   -7.120  2.486   1.00 0.63  ? 11  ARG A HB2  2  
ATOM 2147  H HB3  . ARG A 1 11  ? 0.463   -7.320  1.602   1.00 0.78  ? 11  ARG A HB3  2  
ATOM 2148  H HG2  . ARG A 1 11  ? 1.193   -4.917  0.682   1.00 0.94  ? 11  ARG A HG2  2  
ATOM 2149  H HG3  . ARG A 1 11  ? 2.785   -5.593  1.031   1.00 0.71  ? 11  ARG A HG3  2  
ATOM 2150  H HD2  . ARG A 1 11  ? 2.114   -6.050  -1.275  1.00 1.68  ? 11  ARG A HD2  2  
ATOM 2151  H HD3  . ARG A 1 11  ? 2.262   -7.543  -0.346  1.00 1.50  ? 11  ARG A HD3  2  
ATOM 2152  H HE   . ARG A 1 11  ? -0.191  -7.534  -0.163  1.00 1.83  ? 11  ARG A HE   2  
ATOM 2153  H HH11 . ARG A 1 11  ? 1.304   -5.630  -2.720  1.00 2.06  ? 11  ARG A HH11 2  
ATOM 2154  H HH12 . ARG A 1 11  ? -0.132  -5.628  -3.699  1.00 2.55  ? 11  ARG A HH12 2  
ATOM 2155  H HH21 . ARG A 1 11  ? -2.053  -7.506  -1.438  1.00 2.82  ? 11  ARG A HH21 2  
ATOM 2156  H HH22 . ARG A 1 11  ? -2.058  -6.691  -2.978  1.00 2.79  ? 11  ARG A HH22 2  
ATOM 2157  N N    . LEU A 1 12  ? 1.665   -5.150  5.017   1.00 0.29  ? 12  LEU A N    2  
ATOM 2158  C CA   . LEU A 1 12  ? 2.539   -4.358  5.861   1.00 0.26  ? 12  LEU A CA   2  
ATOM 2159  C C    . LEU A 1 12  ? 3.921   -4.986  5.891   1.00 0.25  ? 12  LEU A C    2  
ATOM 2160  O O    . LEU A 1 12  ? 4.106   -6.081  6.419   1.00 0.32  ? 12  LEU A O    2  
ATOM 2161  C CB   . LEU A 1 12  ? 1.950   -4.240  7.273   1.00 0.34  ? 12  LEU A CB   2  
ATOM 2162  C CG   . LEU A 1 12  ? 2.494   -3.091  8.137   1.00 0.60  ? 12  LEU A CG   2  
ATOM 2163  C CD1  . LEU A 1 12  ? 3.817   -3.461  8.784   1.00 1.32  ? 12  LEU A CD1  2  
ATOM 2164  C CD2  . LEU A 1 12  ? 2.651   -1.823  7.306   1.00 1.28  ? 12  LEU A CD2  2  
ATOM 2165  H H    . LEU A 1 12  ? 1.257   -5.965  5.381   1.00 0.35  ? 12  LEU A H    2  
ATOM 2166  H HA   . LEU A 1 12  ? 2.609   -3.375  5.427   1.00 0.24  ? 12  LEU A HA   2  
ATOM 2167  H HB2  . LEU A 1 12  ? 0.881   -4.114  7.181   1.00 0.72  ? 12  LEU A HB2  2  
ATOM 2168  H HB3  . LEU A 1 12  ? 2.139   -5.168  7.792   1.00 0.66  ? 12  LEU A HB3  2  
ATOM 2169  H HG   . LEU A 1 12  ? 1.789   -2.882  8.926   1.00 1.58  ? 12  LEU A HG   2  
ATOM 2170  H HD11 . LEU A 1 12  ? 3.685   -4.345  9.390   1.00 1.80  ? 12  LEU A HD11 2  
ATOM 2171  H HD12 . LEU A 1 12  ? 4.151   -2.644  9.407   1.00 1.95  ? 12  LEU A HD12 2  
ATOM 2172  H HD13 . LEU A 1 12  ? 4.552   -3.655  8.017   1.00 1.91  ? 12  LEU A HD13 2  
ATOM 2173  H HD21 . LEU A 1 12  ? 3.034   -1.030  7.929   1.00 1.90  ? 12  LEU A HD21 2  
ATOM 2174  H HD22 . LEU A 1 12  ? 1.691   -1.536  6.905   1.00 1.96  ? 12  LEU A HD22 2  
ATOM 2175  H HD23 . LEU A 1 12  ? 3.340   -2.009  6.494   1.00 1.71  ? 12  LEU A HD23 2  
ATOM 2176  N N    . CYS A 1 13  ? 4.882   -4.290  5.317   1.00 0.23  ? 13  CYS A N    2  
ATOM 2177  C CA   . CYS A 1 13  ? 6.223   -4.817  5.170   1.00 0.25  ? 13  CYS A CA   2  
ATOM 2178  C C    . CYS A 1 13  ? 7.174   -4.154  6.159   1.00 0.22  ? 13  CYS A C    2  
ATOM 2179  O O    . CYS A 1 13  ? 7.268   -2.930  6.213   1.00 0.24  ? 13  CYS A O    2  
ATOM 2180  C CB   . CYS A 1 13  ? 6.709   -4.586  3.737   1.00 0.29  ? 13  CYS A CB   2  
ATOM 2181  S SG   . CYS A 1 13  ? 5.535   -5.116  2.468   1.00 0.40  ? 13  CYS A SG   2  
ATOM 2182  H H    . CYS A 1 13  ? 4.685   -3.384  4.986   1.00 0.23  ? 13  CYS A H    2  
ATOM 2183  H HA   . CYS A 1 13  ? 6.191   -5.877  5.367   1.00 0.28  ? 13  CYS A HA   2  
ATOM 2184  H HB2  . CYS A 1 13  ? 6.895   -3.532  3.593   1.00 0.31  ? 13  CYS A HB2  2  
ATOM 2185  H HB3  . CYS A 1 13  ? 7.629   -5.133  3.585   1.00 0.31  ? 13  CYS A HB3  2  
ATOM 2186  H HG   . CYS A 1 13  ? 4.648   -4.147  2.302   1.00 1.17  ? 13  CYS A HG   2  
ATOM 2187  N N    . THR A 1 14  ? 7.866   -4.960  6.946   1.00 0.23  ? 14  THR A N    2  
ATOM 2188  C CA   . THR A 1 14  ? 8.845   -4.442  7.885   1.00 0.24  ? 14  THR A CA   2  
ATOM 2189  C C    . THR A 1 14  ? 10.235  -4.862  7.439   1.00 0.22  ? 14  THR A C    2  
ATOM 2190  O O    . THR A 1 14  ? 10.546  -6.054  7.398   1.00 0.25  ? 14  THR A O    2  
ATOM 2191  C CB   . THR A 1 14  ? 8.585   -4.972  9.308   1.00 0.31  ? 14  THR A CB   2  
ATOM 2192  O OG1  . THR A 1 14  ? 7.214   -4.757  9.660   1.00 0.35  ? 14  THR A OG1  2  
ATOM 2193  C CG2  . THR A 1 14  ? 9.484   -4.285  10.325  1.00 0.35  ? 14  THR A CG2  2  
ATOM 2194  H H    . THR A 1 14  ? 7.739   -5.937  6.874   1.00 0.26  ? 14  THR A H    2  
ATOM 2195  H HA   . THR A 1 14  ? 8.778   -3.362  7.894   1.00 0.23  ? 14  THR A HA   2  
ATOM 2196  H HB   . THR A 1 14  ? 8.791   -6.034  9.326   1.00 0.33  ? 14  THR A HB   2  
ATOM 2197  H HG1  . THR A 1 14  ? 6.685   -4.716  8.857   1.00 0.65  ? 14  THR A HG1  2  
ATOM 2198  H HG21 . THR A 1 14  ? 9.303   -3.220  10.303  1.00 1.01  ? 14  THR A HG21 2  
ATOM 2199  H HG22 . THR A 1 14  ? 10.518  -4.480  10.082  1.00 1.13  ? 14  THR A HG22 2  
ATOM 2200  H HG23 . THR A 1 14  ? 9.268   -4.666  11.312  1.00 1.10  ? 14  THR A HG23 2  
ATOM 2201  N N    . MET A 1 15  ? 11.074  -3.893  7.123   1.00 0.20  ? 15  MET A N    2  
ATOM 2202  C CA   . MET A 1 15  ? 12.387  -4.187  6.576   1.00 0.19  ? 15  MET A CA   2  
ATOM 2203  C C    . MET A 1 15  ? 13.477  -3.502  7.380   1.00 0.21  ? 15  MET A C    2  
ATOM 2204  O O    . MET A 1 15  ? 13.376  -2.324  7.714   1.00 0.21  ? 15  MET A O    2  
ATOM 2205  C CB   . MET A 1 15  ? 12.463  -3.770  5.102   1.00 0.21  ? 15  MET A CB   2  
ATOM 2206  C CG   . MET A 1 15  ? 12.080  -2.321  4.858   1.00 0.24  ? 15  MET A CG   2  
ATOM 2207  S SD   . MET A 1 15  ? 12.146  -1.857  3.116   1.00 0.88  ? 15  MET A SD   2  
ATOM 2208  C CE   . MET A 1 15  ? 10.776  -2.810  2.465   1.00 0.28  ? 15  MET A CE   2  
ATOM 2209  H H    . MET A 1 15  ? 10.808  -2.955  7.264   1.00 0.21  ? 15  MET A H    2  
ATOM 2210  H HA   . MET A 1 15  ? 12.536  -5.255  6.639   1.00 0.22  ? 15  MET A HA   2  
ATOM 2211  H HB2  . MET A 1 15  ? 13.474  -3.916  4.750   1.00 0.26  ? 15  MET A HB2  2  
ATOM 2212  H HB3  . MET A 1 15  ? 11.799  -4.397  4.528   1.00 0.23  ? 15  MET A HB3  2  
ATOM 2213  H HG2  . MET A 1 15  ? 11.072  -2.167  5.216   1.00 0.48  ? 15  MET A HG2  2  
ATOM 2214  H HG3  . MET A 1 15  ? 12.753  -1.690  5.410   1.00 0.46  ? 15  MET A HG3  2  
ATOM 2215  H HE1  . MET A 1 15  ? 9.865   -2.529  2.976   1.00 1.04  ? 15  MET A HE1  2  
ATOM 2216  H HE2  . MET A 1 15  ? 10.965  -3.862  2.621   1.00 1.08  ? 15  MET A HE2  2  
ATOM 2217  H HE3  . MET A 1 15  ? 10.672  -2.617  1.408   1.00 1.03  ? 15  MET A HE3  2  
ATOM 2218  N N    . LYS A 1 16  ? 14.508  -4.264  7.690   1.00 0.29  ? 16  LYS A N    2  
ATOM 2219  C CA   . LYS A 1 16  ? 15.639  -3.763  8.449   1.00 0.37  ? 16  LYS A CA   2  
ATOM 2220  C C    . LYS A 1 16  ? 16.873  -3.700  7.568   1.00 0.40  ? 16  LYS A C    2  
ATOM 2221  O O    . LYS A 1 16  ? 17.080  -4.554  6.708   1.00 0.48  ? 16  LYS A O    2  
ATOM 2222  C CB   . LYS A 1 16  ? 15.898  -4.657  9.666   1.00 0.50  ? 16  LYS A CB   2  
ATOM 2223  C CG   . LYS A 1 16  ? 17.169  -4.298  10.417  1.00 0.90  ? 16  LYS A CG   2  
ATOM 2224  C CD   . LYS A 1 16  ? 17.368  -5.170  11.640  1.00 1.09  ? 16  LYS A CD   2  
ATOM 2225  C CE   . LYS A 1 16  ? 18.740  -4.949  12.253  1.00 1.96  ? 16  LYS A CE   2  
ATOM 2226  N NZ   . LYS A 1 16  ? 18.992  -3.521  12.580  1.00 2.58  ? 16  LYS A NZ   2  
ATOM 2227  H H    . LYS A 1 16  ? 14.514  -5.195  7.393   1.00 0.34  ? 16  LYS A H    2  
ATOM 2228  H HA   . LYS A 1 16  ? 15.404  -2.765  8.786   1.00 0.41  ? 16  LYS A HA   2  
ATOM 2229  H HB2  . LYS A 1 16  ? 15.066  -4.568  10.347  1.00 0.99  ? 16  LYS A HB2  2  
ATOM 2230  H HB3  . LYS A 1 16  ? 15.977  -5.683  9.337   1.00 1.07  ? 16  LYS A HB3  2  
ATOM 2231  H HG2  . LYS A 1 16  ? 18.014  -4.429  9.756   1.00 1.53  ? 16  LYS A HG2  2  
ATOM 2232  H HG3  . LYS A 1 16  ? 17.112  -3.266  10.728  1.00 1.46  ? 16  LYS A HG3  2  
ATOM 2233  H HD2  . LYS A 1 16  ? 16.613  -4.927  12.371  1.00 1.54  ? 16  LYS A HD2  2  
ATOM 2234  H HD3  . LYS A 1 16  ? 17.276  -6.207  11.351  1.00 1.45  ? 16  LYS A HD3  2  
ATOM 2235  H HE2  . LYS A 1 16  ? 18.810  -5.531  13.160  1.00 2.45  ? 16  LYS A HE2  2  
ATOM 2236  H HE3  . LYS A 1 16  ? 19.490  -5.287  11.552  1.00 2.53  ? 16  LYS A HE3  2  
ATOM 2237  H HZ1  . LYS A 1 16  ? 18.934  -2.932  11.716  1.00 2.80  ? 16  LYS A HZ1  2  
ATOM 2238  H HZ2  . LYS A 1 16  ? 19.945  -3.413  12.988  1.00 3.11  ? 16  LYS A HZ2  2  
ATOM 2239  H HZ3  . LYS A 1 16  ? 18.292  -3.175  13.271  1.00 3.02  ? 16  LYS A HZ3  2  
ATOM 2240  N N    . LYS A 1 17  ? 17.672  -2.672  7.787   1.00 0.41  ? 17  LYS A N    2  
ATOM 2241  C CA   . LYS A 1 17  ? 18.899  -2.463  7.042   1.00 0.50  ? 17  LYS A CA   2  
ATOM 2242  C C    . LYS A 1 17  ? 19.882  -3.601  7.263   1.00 0.60  ? 17  LYS A C    2  
ATOM 2243  O O    . LYS A 1 17  ? 20.525  -3.701  8.307   1.00 0.67  ? 17  LYS A O    2  
ATOM 2244  C CB   . LYS A 1 17  ? 19.503  -1.124  7.446   1.00 0.51  ? 17  LYS A CB   2  
ATOM 2245  C CG   . LYS A 1 17  ? 19.024  0.020   6.579   1.00 0.52  ? 17  LYS A CG   2  
ATOM 2246  C CD   . LYS A 1 17  ? 19.419  1.368   7.157   1.00 0.53  ? 17  LYS A CD   2  
ATOM 2247  C CE   . LYS A 1 17  ? 18.589  2.491   6.556   1.00 0.62  ? 17  LYS A CE   2  
ATOM 2248  N NZ   . LYS A 1 17  ? 18.928  3.820   7.126   1.00 0.92  ? 17  LYS A NZ   2  
ATOM 2249  H H    . LYS A 1 17  ? 17.426  -2.020  8.490   1.00 0.41  ? 17  LYS A H    2  
ATOM 2250  H HA   . LYS A 1 17  ? 18.645  -2.425  5.993   1.00 0.52  ? 17  LYS A HA   2  
ATOM 2251  H HB2  . LYS A 1 17  ? 19.208  -0.914  8.462   1.00 0.68  ? 17  LYS A HB2  2  
ATOM 2252  H HB3  . LYS A 1 17  ? 20.571  -1.177  7.396   1.00 0.68  ? 17  LYS A HB3  2  
ATOM 2253  H HG2  . LYS A 1 17  ? 19.463  -0.085  5.597   1.00 0.67  ? 17  LYS A HG2  2  
ATOM 2254  H HG3  . LYS A 1 17  ? 17.950  -0.033  6.500   1.00 0.68  ? 17  LYS A HG3  2  
ATOM 2255  H HD2  . LYS A 1 17  ? 19.266  1.349   8.224   1.00 0.91  ? 17  LYS A HD2  2  
ATOM 2256  H HD3  . LYS A 1 17  ? 20.463  1.548   6.942   1.00 0.79  ? 17  LYS A HD3  2  
ATOM 2257  H HE2  . LYS A 1 17  ? 18.764  2.514   5.495   1.00 0.85  ? 17  LYS A HE2  2  
ATOM 2258  H HE3  . LYS A 1 17  ? 17.544  2.286   6.740   1.00 0.95  ? 17  LYS A HE3  2  
ATOM 2259  H HZ1  . LYS A 1 17  ? 18.327  4.557   6.697   1.00 1.50  ? 17  LYS A HZ1  2  
ATOM 2260  H HZ2  . LYS A 1 17  ? 19.927  4.051   6.935   1.00 1.28  ? 17  LYS A HZ2  2  
ATOM 2261  H HZ3  . LYS A 1 17  ? 18.773  3.821   8.157   1.00 1.39  ? 17  LYS A HZ3  2  
ATOM 2262  N N    . GLY A 1 18  ? 19.989  -4.451  6.257   1.00 0.68  ? 18  GLY A N    2  
ATOM 2263  C CA   . GLY A 1 18  ? 20.867  -5.602  6.338   1.00 0.85  ? 18  GLY A CA   2  
ATOM 2264  C C    . GLY A 1 18  ? 22.300  -5.233  6.025   1.00 1.05  ? 18  GLY A C    2  
ATOM 2265  O O    . GLY A 1 18  ? 23.106  -5.039  6.936   1.00 1.28  ? 18  GLY A O    2  
ATOM 2266  H H    . GLY A 1 18  ? 19.464  -4.286  5.444   1.00 0.68  ? 18  GLY A H    2  
ATOM 2267  H HA2  . GLY A 1 18  ? 20.817  -6.010  7.337   1.00 0.90  ? 18  GLY A HA2  2  
ATOM 2268  H HA3  . GLY A 1 18  ? 20.534  -6.350  5.633   1.00 0.94  ? 18  GLY A HA3  2  
ATOM 2269  N N    . PRO A 1 19  ? 22.650  -5.112  4.734   1.00 1.24  ? 19  PRO A N    2  
ATOM 2270  C CA   . PRO A 1 19  ? 23.969  -4.638  4.313   1.00 1.57  ? 19  PRO A CA   2  
ATOM 2271  C C    . PRO A 1 19  ? 24.083  -3.120  4.456   1.00 1.57  ? 19  PRO A C    2  
ATOM 2272  O O    . PRO A 1 19  ? 24.525  -2.424  3.538   1.00 2.23  ? 19  PRO A O    2  
ATOM 2273  C CB   . PRO A 1 19  ? 24.038  -5.054  2.843   1.00 1.91  ? 19  PRO A CB   2  
ATOM 2274  C CG   . PRO A 1 19  ? 22.620  -5.055  2.387   1.00 1.86  ? 19  PRO A CG   2  
ATOM 2275  C CD   . PRO A 1 19  ? 21.791  -5.447  3.582   1.00 1.40  ? 19  PRO A CD   2  
ATOM 2276  H HA   . PRO A 1 19  ? 24.762  -5.117  4.870   1.00 1.77  ? 19  PRO A HA   2  
ATOM 2277  H HB2  . PRO A 1 19  ? 24.630  -4.340  2.291   1.00 2.10  ? 19  PRO A HB2  2  
ATOM 2278  H HB3  . PRO A 1 19  ? 24.478  -6.037  2.762   1.00 2.19  ? 19  PRO A HB3  2  
ATOM 2279  H HG2  . PRO A 1 19  ? 22.344  -4.068  2.047   1.00 2.16  ? 19  PRO A HG2  2  
ATOM 2280  H HG3  . PRO A 1 19  ? 22.492  -5.775  1.592   1.00 2.10  ? 19  PRO A HG3  2  
ATOM 2281  H HD2  . PRO A 1 19  ? 20.876  -4.875  3.606   1.00 1.45  ? 19  PRO A HD2  2  
ATOM 2282  H HD3  . PRO A 1 19  ? 21.576  -6.504  3.559   1.00 1.43  ? 19  PRO A HD3  2  
ATOM 2283  N N    . SER A 1 20  ? 23.661  -2.627  5.624   1.00 1.40  ? 20  SER A N    2  
ATOM 2284  C CA   . SER A 1 20  ? 23.603  -1.198  5.915   1.00 1.65  ? 20  SER A CA   2  
ATOM 2285  C C    . SER A 1 20  ? 22.644  -0.490  4.957   1.00 1.43  ? 20  SER A C    2  
ATOM 2286  O O    . SER A 1 20  ? 22.792  0.698   4.675   1.00 1.93  ? 20  SER A O    2  
ATOM 2287  C CB   . SER A 1 20  ? 24.999  -0.574  5.840   1.00 2.14  ? 20  SER A CB   2  
ATOM 2288  O OG   . SER A 1 20  ? 25.917  -1.279  6.662   1.00 2.87  ? 20  SER A OG   2  
ATOM 2289  H H    . SER A 1 20  ? 23.388  -3.259  6.325   1.00 1.61  ? 20  SER A H    2  
ATOM 2290  H HA   . SER A 1 20  ? 23.225  -1.087  6.921   1.00 1.88  ? 20  SER A HA   2  
ATOM 2291  H HB2  . SER A 1 20  ? 25.351  -0.604  4.819   1.00 2.20  ? 20  SER A HB2  2  
ATOM 2292  H HB3  . SER A 1 20  ? 24.951  0.452   6.173   1.00 2.54  ? 20  SER A HB3  2  
ATOM 2293  H HG   . SER A 1 20  ? 25.639  -1.213  7.582   1.00 3.28  ? 20  SER A HG   2  
ATOM 2294  N N    . GLY A 1 21  ? 21.655  -1.229  4.467   1.00 1.04  ? 21  GLY A N    2  
ATOM 2295  C CA   . GLY A 1 21  ? 20.695  -0.670  3.541   1.00 0.94  ? 21  GLY A CA   2  
ATOM 2296  C C    . GLY A 1 21  ? 19.616  -1.663  3.165   1.00 0.97  ? 21  GLY A C    2  
ATOM 2297  O O    . GLY A 1 21  ? 19.599  -2.789  3.668   1.00 1.93  ? 21  GLY A O    2  
ATOM 2298  H H    . GLY A 1 21  ? 21.578  -2.169  4.735   1.00 1.21  ? 21  GLY A H    2  
ATOM 2299  H HA2  . GLY A 1 21  ? 20.233  0.194   3.995   1.00 0.97  ? 21  GLY A HA2  2  
ATOM 2300  H HA3  . GLY A 1 21  ? 21.212  -0.360  2.645   1.00 1.07  ? 21  GLY A HA3  2  
ATOM 2301  N N    . TYR A 1 22  ? 18.715  -1.244  2.287   1.00 0.74  ? 22  TYR A N    2  
ATOM 2302  C CA   . TYR A 1 22  ? 17.640  -2.106  1.815   1.00 0.70  ? 22  TYR A CA   2  
ATOM 2303  C C    . TYR A 1 22  ? 17.930  -2.540  0.377   1.00 0.89  ? 22  TYR A C    2  
ATOM 2304  O O    . TYR A 1 22  ? 19.065  -2.438  -0.082  1.00 1.82  ? 22  TYR A O    2  
ATOM 2305  C CB   . TYR A 1 22  ? 16.296  -1.373  1.883   1.00 0.64  ? 22  TYR A CB   2  
ATOM 2306  C CG   . TYR A 1 22  ? 16.037  -0.659  3.195   1.00 0.50  ? 22  TYR A CG   2  
ATOM 2307  C CD1  . TYR A 1 22  ? 15.882  -1.383  4.372   1.00 0.47  ? 22  TYR A CD1  2  
ATOM 2308  C CD2  . TYR A 1 22  ? 15.951  0.731   3.267   1.00 0.55  ? 22  TYR A CD2  2  
ATOM 2309  C CE1  . TYR A 1 22  ? 15.647  -0.750  5.576   1.00 0.46  ? 22  TYR A CE1  2  
ATOM 2310  C CE2  . TYR A 1 22  ? 15.717  1.369   4.472   1.00 0.54  ? 22  TYR A CE2  2  
ATOM 2311  C CZ   . TYR A 1 22  ? 15.556  0.681   5.589   1.00 0.46  ? 22  TYR A CZ   2  
ATOM 2312  O OH   . TYR A 1 22  ? 15.333  1.250   6.823   1.00 0.59  ? 22  TYR A OH   2  
ATOM 2313  H H    . TYR A 1 22  ? 18.780  -0.333  1.937   1.00 1.40  ? 22  TYR A H    2  
ATOM 2314  H HA   . TYR A 1 22  ? 17.606  -2.979  2.448   1.00 0.72  ? 22  TYR A HA   2  
ATOM 2315  H HB2  . TYR A 1 22  ? 16.258  -0.637  1.094   1.00 0.75  ? 22  TYR A HB2  2  
ATOM 2316  H HB3  . TYR A 1 22  ? 15.500  -2.089  1.732   1.00 0.71  ? 22  TYR A HB3  2  
ATOM 2317  H HD1  . TYR A 1 22  ? 15.942  -2.460  4.335   1.00 0.58  ? 22  TYR A HD1  2  
ATOM 2318  H HD2  . TYR A 1 22  ? 16.065  1.315   2.365   1.00 0.70  ? 22  TYR A HD2  2  
ATOM 2319  H HE1  . TYR A 1 22  ? 15.530  -1.334  6.478   1.00 0.57  ? 22  TYR A HE1  2  
ATOM 2320  H HE2  . TYR A 1 22  ? 15.655  2.447   4.509   1.00 0.68  ? 22  TYR A HE2  2  
ATOM 2321  H HH   . TYR A 1 22  ? 15.912  0.881   7.496   1.00 1.17  ? 22  TYR A HH   2  
ATOM 2322  N N    . GLY A 1 23  ? 16.912  -3.014  -0.333  1.00 0.43  ? 23  GLY A N    2  
ATOM 2323  C CA   . GLY A 1 23  ? 17.125  -3.477  -1.692  1.00 0.42  ? 23  GLY A CA   2  
ATOM 2324  C C    . GLY A 1 23  ? 15.889  -3.359  -2.559  1.00 0.39  ? 23  GLY A C    2  
ATOM 2325  O O    . GLY A 1 23  ? 15.244  -4.361  -2.868  1.00 0.39  ? 23  GLY A O    2  
ATOM 2326  H H    . GLY A 1 23  ? 16.015  -3.041  0.062   1.00 0.96  ? 23  GLY A H    2  
ATOM 2327  H HA2  . GLY A 1 23  ? 17.917  -2.893  -2.137  1.00 0.44  ? 23  GLY A HA2  2  
ATOM 2328  H HA3  . GLY A 1 23  ? 17.432  -4.512  -1.663  1.00 0.48  ? 23  GLY A HA3  2  
ATOM 2329  N N    . PHE A 1 24  ? 15.552  -2.137  -2.946  1.00 0.37  ? 24  PHE A N    2  
ATOM 2330  C CA   . PHE A 1 24  ? 14.416  -1.903  -3.825  1.00 0.36  ? 24  PHE A CA   2  
ATOM 2331  C C    . PHE A 1 24  ? 14.598  -0.596  -4.587  1.00 0.38  ? 24  PHE A C    2  
ATOM 2332  O O    . PHE A 1 24  ? 15.303  0.308   -4.131  1.00 0.40  ? 24  PHE A O    2  
ATOM 2333  C CB   . PHE A 1 24  ? 13.099  -1.876  -3.031  1.00 0.34  ? 24  PHE A CB   2  
ATOM 2334  C CG   . PHE A 1 24  ? 12.990  -0.743  -2.041  1.00 0.32  ? 24  PHE A CG   2  
ATOM 2335  C CD1  . PHE A 1 24  ? 13.560  -0.849  -0.781  1.00 0.33  ? 24  PHE A CD1  2  
ATOM 2336  C CD2  . PHE A 1 24  ? 12.325  0.428   -2.373  1.00 0.34  ? 24  PHE A CD2  2  
ATOM 2337  C CE1  . PHE A 1 24  ? 13.465  0.186   0.129   1.00 0.35  ? 24  PHE A CE1  2  
ATOM 2338  C CE2  . PHE A 1 24  ? 12.228  1.467   -1.468  1.00 0.36  ? 24  PHE A CE2  2  
ATOM 2339  C CZ   . PHE A 1 24  ? 12.775  1.346   -0.219  1.00 0.36  ? 24  PHE A CZ   2  
ATOM 2340  H H    . PHE A 1 24  ? 16.081  -1.370  -2.642  1.00 0.39  ? 24  PHE A H    2  
ATOM 2341  H HA   . PHE A 1 24  ? 14.378  -2.717  -4.535  1.00 0.37  ? 24  PHE A HA   2  
ATOM 2342  H HB2  . PHE A 1 24  ? 12.277  -1.786  -3.723  1.00 0.35  ? 24  PHE A HB2  2  
ATOM 2343  H HB3  . PHE A 1 24  ? 13.002  -2.806  -2.488  1.00 0.34  ? 24  PHE A HB3  2  
ATOM 2344  H HD1  . PHE A 1 24  ? 14.081  -1.756  -0.511  1.00 0.35  ? 24  PHE A HD1  2  
ATOM 2345  H HD2  . PHE A 1 24  ? 11.877  0.524   -3.353  1.00 0.37  ? 24  PHE A HD2  2  
ATOM 2346  H HE1  . PHE A 1 24  ? 13.911  0.091   1.108   1.00 0.38  ? 24  PHE A HE1  2  
ATOM 2347  H HE2  . PHE A 1 24  ? 11.708  2.372   -1.740  1.00 0.40  ? 24  PHE A HE2  2  
ATOM 2348  H HZ   . PHE A 1 24  ? 12.694  2.157   0.490   1.00 0.39  ? 24  PHE A HZ   2  
ATOM 2349  N N    . ASN A 1 25  ? 13.971  -0.504  -5.746  1.00 0.43  ? 25  ASN A N    2  
ATOM 2350  C CA   . ASN A 1 25  ? 14.033  0.705   -6.549  1.00 0.46  ? 25  ASN A CA   2  
ATOM 2351  C C    . ASN A 1 25  ? 12.682  1.406   -6.512  1.00 0.42  ? 25  ASN A C    2  
ATOM 2352  O O    . ASN A 1 25  ? 11.635  0.766   -6.646  1.00 0.39  ? 25  ASN A O    2  
ATOM 2353  C CB   . ASN A 1 25  ? 14.429  0.381   -7.990  1.00 0.51  ? 25  ASN A CB   2  
ATOM 2354  C CG   . ASN A 1 25  ? 14.832  1.618   -8.771  1.00 1.23  ? 25  ASN A CG   2  
ATOM 2355  O OD1  . ASN A 1 25  ? 13.998  2.286   -9.382  1.00 2.18  ? 25  ASN A OD1  2  
ATOM 2356  N ND2  . ASN A 1 25  ? 16.118  1.927   -8.763  1.00 1.65  ? 25  ASN A ND2  2  
ATOM 2357  H H    . ASN A 1 25  ? 13.440  -1.267  -6.069  1.00 0.48  ? 25  ASN A H    2  
ATOM 2358  H HA   . ASN A 1 25  ? 14.777  1.357   -6.113  1.00 0.53  ? 25  ASN A HA   2  
ATOM 2359  H HB2  . ASN A 1 25  ? 15.265  -0.302  -7.979  1.00 1.01  ? 25  ASN A HB2  2  
ATOM 2360  H HB3  . ASN A 1 25  ? 13.594  -0.083  -8.492  1.00 0.91  ? 25  ASN A HB3  2  
ATOM 2361  H HD21 . ASN A 1 25  ? 16.733  1.345   -8.255  1.00 1.88  ? 25  ASN A HD21 2  
ATOM 2362  H HD22 . ASN A 1 25  ? 16.409  2.719   -9.265  1.00 2.23  ? 25  ASN A HD22 2  
ATOM 2363  N N    . LEU A 1 26  ? 12.710  2.712   -6.318  1.00 0.50  ? 26  LEU A N    2  
ATOM 2364  C CA   . LEU A 1 26  ? 11.496  3.488   -6.121  1.00 0.52  ? 26  LEU A CA   2  
ATOM 2365  C C    . LEU A 1 26  ? 11.146  4.300   -7.368  1.00 0.55  ? 26  LEU A C    2  
ATOM 2366  O O    . LEU A 1 26  ? 12.019  4.660   -8.153  1.00 0.73  ? 26  LEU A O    2  
ATOM 2367  C CB   . LEU A 1 26  ? 11.676  4.419   -4.917  1.00 0.69  ? 26  LEU A CB   2  
ATOM 2368  C CG   . LEU A 1 26  ? 10.397  5.078   -4.397  1.00 0.87  ? 26  LEU A CG   2  
ATOM 2369  C CD1  . LEU A 1 26  ? 9.430   4.021   -3.891  1.00 1.52  ? 26  LEU A CD1  2  
ATOM 2370  C CD2  . LEU A 1 26  ? 10.721  6.078   -3.296  1.00 1.48  ? 26  LEU A CD2  2  
ATOM 2371  H H    . LEU A 1 26  ? 13.577  3.172   -6.302  1.00 0.61  ? 26  LEU A H    2  
ATOM 2372  H HA   . LEU A 1 26  ? 10.691  2.798   -5.915  1.00 0.49  ? 26  LEU A HA   2  
ATOM 2373  H HB2  . LEU A 1 26  ? 12.112  3.848   -4.113  1.00 1.10  ? 26  LEU A HB2  2  
ATOM 2374  H HB3  . LEU A 1 26  ? 12.367  5.200   -5.197  1.00 1.29  ? 26  LEU A HB3  2  
ATOM 2375  H HG   . LEU A 1 26  ? 9.917   5.611   -5.206  1.00 1.73  ? 26  LEU A HG   2  
ATOM 2376  H HD11 . LEU A 1 26  ? 9.148   3.372   -4.706  1.00 2.08  ? 26  LEU A HD11 2  
ATOM 2377  H HD12 . LEU A 1 26  ? 8.549   4.498   -3.488  1.00 2.11  ? 26  LEU A HD12 2  
ATOM 2378  H HD13 . LEU A 1 26  ? 9.909   3.439   -3.117  1.00 1.96  ? 26  LEU A HD13 2  
ATOM 2379  H HD21 . LEU A 1 26  ? 9.807   6.526   -2.936  1.00 2.11  ? 26  LEU A HD21 2  
ATOM 2380  H HD22 . LEU A 1 26  ? 11.369  6.848   -3.688  1.00 1.96  ? 26  LEU A HD22 2  
ATOM 2381  H HD23 . LEU A 1 26  ? 11.219  5.570   -2.483  1.00 1.94  ? 26  LEU A HD23 2  
ATOM 2382  N N    . HIS A 1 27  ? 9.861   4.578   -7.541  1.00 0.56  ? 27  HIS A N    2  
ATOM 2383  C CA   . HIS A 1 27  ? 9.395   5.429   -8.628  1.00 0.67  ? 27  HIS A CA   2  
ATOM 2384  C C    . HIS A 1 27  ? 8.988   6.775   -8.054  1.00 0.68  ? 27  HIS A C    2  
ATOM 2385  O O    . HIS A 1 27  ? 8.135   6.848   -7.170  1.00 0.95  ? 27  HIS A O    2  
ATOM 2386  C CB   . HIS A 1 27  ? 8.190   4.799   -9.337  1.00 1.23  ? 27  HIS A CB   2  
ATOM 2387  C CG   . HIS A 1 27  ? 8.462   4.319   -10.733 1.00 0.70  ? 27  HIS A CG   2  
ATOM 2388  N ND1  . HIS A 1 27  ? 8.553   5.164   -11.814 1.00 0.97  ? 27  HIS A ND1  2  
ATOM 2389  C CD2  . HIS A 1 27  ? 8.622   3.068   -11.227 1.00 0.81  ? 27  HIS A CD2  2  
ATOM 2390  C CE1  . HIS A 1 27  ? 8.759   4.459   -12.908 1.00 1.30  ? 27  HIS A CE1  2  
ATOM 2391  N NE2  . HIS A 1 27  ? 8.804   3.181   -12.585 1.00 1.34  ? 27  HIS A NE2  2  
ATOM 2392  H H    . HIS A 1 27  ? 9.202   4.197   -6.917  1.00 0.64  ? 27  HIS A H    2  
ATOM 2393  H HA   . HIS A 1 27  ? 10.204  5.567   -9.331  1.00 0.83  ? 27  HIS A HA   2  
ATOM 2394  H HB2  . HIS A 1 27  ? 7.851   3.951   -8.762  1.00 1.96  ? 27  HIS A HB2  2  
ATOM 2395  H HB3  . HIS A 1 27  ? 7.395   5.528   -9.386  1.00 2.02  ? 27  HIS A HB3  2  
ATOM 2396  H HD1  . HIS A 1 27  ? 8.470   6.153   -11.791 1.00 1.24  ? 27  HIS A HD1  2  
ATOM 2397  H HD2  . HIS A 1 27  ? 8.609   2.149   -10.658 1.00 0.91  ? 27  HIS A HD2  2  
ATOM 2398  H HE1  . HIS A 1 27  ? 8.869   4.860   -13.904 1.00 1.74  ? 27  HIS A HE1  2  
ATOM 2399  H HE2  . HIS A 1 27  ? 8.674   2.443   -13.233 1.00 1.74  ? 27  HIS A HE2  2  
ATOM 2400  N N    . SER A 1 28  ? 9.606   7.833   -8.551  1.00 0.75  ? 28  SER A N    2  
ATOM 2401  C CA   . SER A 1 28  ? 9.395   9.162   -8.002  1.00 1.14  ? 28  SER A CA   2  
ATOM 2402  C C    . SER A 1 28  ? 9.124   10.175  -9.103  1.00 1.03  ? 28  SER A C    2  
ATOM 2403  O O    . SER A 1 28  ? 9.736   11.244  -9.159  1.00 1.34  ? 28  SER A O    2  
ATOM 2404  C CB   . SER A 1 28  ? 10.610  9.569   -7.177  1.00 1.74  ? 28  SER A CB   2  
ATOM 2405  O OG   . SER A 1 28  ? 11.820  9.292   -7.868  1.00 2.30  ? 28  SER A OG   2  
ATOM 2406  H H    . SER A 1 28  ? 10.218  7.721   -9.316  1.00 0.74  ? 28  SER A H    2  
ATOM 2407  H HA   . SER A 1 28  ? 8.533   9.115   -7.354  1.00 1.51  ? 28  SER A HA   2  
ATOM 2408  H HB2  . SER A 1 28  ? 10.562  10.627  -6.974  1.00 2.11  ? 28  SER A HB2  2  
ATOM 2409  H HB3  . SER A 1 28  ? 10.607  9.026   -6.247  1.00 2.17  ? 28  SER A HB3  2  
ATOM 2410  H HG   . SER A 1 28  ? 11.922  8.341   -7.966  1.00 2.75  ? 28  SER A HG   2  
ATOM 2411  N N    . ASP A 1 29  ? 8.184   9.838   -9.960  1.00 1.23  ? 29  ASP A N    2  
ATOM 2412  C CA   . ASP A 1 29  ? 7.844   10.676  -11.097 1.00 1.54  ? 29  ASP A CA   2  
ATOM 2413  C C    . ASP A 1 29  ? 6.820   11.719  -10.689 1.00 1.63  ? 29  ASP A C    2  
ATOM 2414  O O    . ASP A 1 29  ? 5.918   11.441  -9.904  1.00 1.73  ? 29  ASP A O    2  
ATOM 2415  C CB   . ASP A 1 29  ? 7.283   9.825   -12.235 1.00 2.09  ? 29  ASP A CB   2  
ATOM 2416  C CG   . ASP A 1 29  ? 8.276   8.794   -12.727 1.00 2.87  ? 29  ASP A CG   2  
ATOM 2417  O OD1  . ASP A 1 29  ? 8.444   7.753   -12.059 1.00 3.19  ? 29  ASP A OD1  2  
ATOM 2418  O OD2  . ASP A 1 29  ? 8.888   9.015   -13.794 1.00 3.48  ? 29  ASP A OD2  2  
ATOM 2419  H H    . ASP A 1 29  ? 7.695   9.002   -9.818  1.00 1.49  ? 29  ASP A H    2  
ATOM 2420  H HA   . ASP A 1 29  ? 8.742   11.173  -11.431 1.00 1.59  ? 29  ASP A HA   2  
ATOM 2421  H HB2  . ASP A 1 29  ? 6.398   9.312   -11.891 1.00 2.22  ? 29  ASP A HB2  2  
ATOM 2422  H HB3  . ASP A 1 29  ? 7.021   10.469  -13.062 1.00 2.29  ? 29  ASP A HB3  2  
ATOM 2423  N N    . LYS A 1 30  ? 6.959   12.919  -11.228 1.00 1.90  ? 30  LYS A N    2  
ATOM 2424  C CA   . LYS A 1 30  ? 6.041   14.008  -10.912 1.00 2.10  ? 30  LYS A CA   2  
ATOM 2425  C C    . LYS A 1 30  ? 4.742   13.857  -11.694 1.00 2.35  ? 30  LYS A C    2  
ATOM 2426  O O    . LYS A 1 30  ? 3.799   14.628  -11.514 1.00 2.78  ? 30  LYS A O    2  
ATOM 2427  C CB   . LYS A 1 30  ? 6.691   15.360  -11.220 1.00 2.29  ? 30  LYS A CB   2  
ATOM 2428  C CG   . LYS A 1 30  ? 7.982   15.605  -10.454 1.00 2.65  ? 30  LYS A CG   2  
ATOM 2429  C CD   . LYS A 1 30  ? 7.765   15.581  -8.949  1.00 3.12  ? 30  LYS A CD   2  
ATOM 2430  C CE   . LYS A 1 30  ? 6.849   16.704  -8.498  1.00 3.99  ? 30  LYS A CE   2  
ATOM 2431  N NZ   . LYS A 1 30  ? 6.619   16.673  -7.032  1.00 4.54  ? 30  LYS A NZ   2  
ATOM 2432  H H    . LYS A 1 30  ? 7.703   13.082  -11.856 1.00 2.13  ? 30  LYS A H    2  
ATOM 2433  H HA   . LYS A 1 30  ? 5.820   13.957  -9.857  1.00 2.09  ? 30  LYS A HA   2  
ATOM 2434  H HB2  . LYS A 1 30  ? 6.910   15.408  -12.276 1.00 2.49  ? 30  LYS A HB2  2  
ATOM 2435  H HB3  . LYS A 1 30  ? 5.993   16.146  -10.970 1.00 2.60  ? 30  LYS A HB3  2  
ATOM 2436  H HG2  . LYS A 1 30  ? 8.692   14.834  -10.713 1.00 2.99  ? 30  LYS A HG2  2  
ATOM 2437  H HG3  . LYS A 1 30  ? 8.377   16.569  -10.735 1.00 2.97  ? 30  LYS A HG3  2  
ATOM 2438  H HD2  . LYS A 1 30  ? 7.322   14.636  -8.671  1.00 3.37  ? 30  LYS A HD2  2  
ATOM 2439  H HD3  . LYS A 1 30  ? 8.722   15.690  -8.458  1.00 3.23  ? 30  LYS A HD3  2  
ATOM 2440  H HE2  . LYS A 1 30  ? 7.301   17.649  -8.762  1.00 4.39  ? 30  LYS A HE2  2  
ATOM 2441  H HE3  . LYS A 1 30  ? 5.902   16.603  -9.005  1.00 4.35  ? 30  LYS A HE3  2  
ATOM 2442  H HZ1  . LYS A 1 30  ? 6.009   17.469  -6.749  1.00 4.89  ? 30  LYS A HZ1  2  
ATOM 2443  H HZ2  . LYS A 1 30  ? 7.530   16.753  -6.526  1.00 4.83  ? 30  LYS A HZ2  2  
ATOM 2444  H HZ3  . LYS A 1 30  ? 6.159   15.777  -6.756  1.00 4.73  ? 30  LYS A HZ3  2  
ATOM 2445  N N    . SER A 1 31  ? 4.706   12.859  -12.564 1.00 2.29  ? 31  SER A N    2  
ATOM 2446  C CA   . SER A 1 31  ? 3.523   12.563  -13.353 1.00 2.61  ? 31  SER A CA   2  
ATOM 2447  C C    . SER A 1 31  ? 2.477   11.833  -12.514 1.00 2.43  ? 31  SER A C    2  
ATOM 2448  O O    . SER A 1 31  ? 1.280   11.907  -12.793 1.00 2.50  ? 31  SER A O    2  
ATOM 2449  C CB   . SER A 1 31  ? 3.916   11.706  -14.558 1.00 2.93  ? 31  SER A CB   2  
ATOM 2450  O OG   . SER A 1 31  ? 4.955   12.320  -15.299 1.00 3.49  ? 31  SER A OG   2  
ATOM 2451  H H    . SER A 1 31  ? 5.507   12.309  -12.688 1.00 2.20  ? 31  SER A H    2  
ATOM 2452  H HA   . SER A 1 31  ? 3.108   13.495  -13.701 1.00 2.83  ? 31  SER A HA   2  
ATOM 2453  H HB2  . SER A 1 31  ? 4.258   10.741  -14.215 1.00 3.18  ? 31  SER A HB2  2  
ATOM 2454  H HB3  . SER A 1 31  ? 3.059   11.577  -15.203 1.00 2.98  ? 31  SER A HB3  2  
ATOM 2455  H HG   . SER A 1 31  ? 4.586   13.036  -15.836 1.00 3.79  ? 31  SER A HG   2  
ATOM 2456  N N    . LYS A 1 32  ? 2.929   11.139  -11.476 1.00 2.27  ? 32  LYS A N    2  
ATOM 2457  C CA   . LYS A 1 32  ? 2.037   10.343  -10.645 1.00 2.14  ? 32  LYS A CA   2  
ATOM 2458  C C    . LYS A 1 32  ? 2.287   10.612  -9.168  1.00 1.84  ? 32  LYS A C    2  
ATOM 2459  O O    . LYS A 1 32  ? 3.431   10.580  -8.715  1.00 1.68  ? 32  LYS A O    2  
ATOM 2460  C CB   . LYS A 1 32  ? 2.225   8.847   -10.925 1.00 2.21  ? 32  LYS A CB   2  
ATOM 2461  C CG   . LYS A 1 32  ? 1.945   8.445   -12.365 1.00 2.25  ? 32  LYS A CG   2  
ATOM 2462  C CD   . LYS A 1 32  ? 2.025   6.936   -12.547 1.00 2.41  ? 32  LYS A CD   2  
ATOM 2463  C CE   . LYS A 1 32  ? 1.771   6.530   -13.990 1.00 2.93  ? 32  LYS A CE   2  
ATOM 2464  N NZ   . LYS A 1 32  ? 0.445   6.993   -14.477 1.00 3.00  ? 32  LYS A NZ   2  
ATOM 2465  H H    . LYS A 1 32  ? 3.883   11.177  -11.250 1.00 2.30  ? 32  LYS A H    2  
ATOM 2466  H HA   . LYS A 1 32  ? 1.021   10.622  -10.886 1.00 2.30  ? 32  LYS A HA   2  
ATOM 2467  H HB2  . LYS A 1 32  ? 3.245   8.575   -10.690 1.00 2.38  ? 32  LYS A HB2  2  
ATOM 2468  H HB3  . LYS A 1 32  ? 1.559   8.289   -10.283 1.00 2.55  ? 32  LYS A HB3  2  
ATOM 2469  H HG2  . LYS A 1 32  ? 0.956   8.779   -12.636 1.00 2.42  ? 32  LYS A HG2  2  
ATOM 2470  H HG3  . LYS A 1 32  ? 2.676   8.915   -13.007 1.00 2.49  ? 32  LYS A HG3  2  
ATOM 2471  H HD2  . LYS A 1 32  ? 3.009   6.600   -12.257 1.00 2.64  ? 32  LYS A HD2  2  
ATOM 2472  H HD3  . LYS A 1 32  ? 1.284   6.469   -11.915 1.00 2.50  ? 32  LYS A HD3  2  
ATOM 2473  H HE2  . LYS A 1 32  ? 2.540   6.961   -14.613 1.00 3.27  ? 32  LYS A HE2  2  
ATOM 2474  H HE3  . LYS A 1 32  ? 1.815   5.453   -14.060 1.00 3.51  ? 32  LYS A HE3  2  
ATOM 2475  H HZ1  . LYS A 1 32  ? 0.274   6.644   -15.445 1.00 3.05  ? 32  LYS A HZ1  2  
ATOM 2476  H HZ2  . LYS A 1 32  ? 0.409   8.035   -14.490 1.00 3.40  ? 32  LYS A HZ2  2  
ATOM 2477  H HZ3  . LYS A 1 32  ? -0.312  6.641   -13.854 1.00 3.29  ? 32  LYS A HZ3  2  
ATOM 2478  N N    . PRO A 1 33  ? 1.225   10.903  -8.404  1.00 1.87  ? 33  PRO A N    2  
ATOM 2479  C CA   . PRO A 1 33  ? 1.325   11.049  -6.955  1.00 1.71  ? 33  PRO A CA   2  
ATOM 2480  C C    . PRO A 1 33  ? 1.459   9.696   -6.268  1.00 1.40  ? 33  PRO A C    2  
ATOM 2481  O O    . PRO A 1 33  ? 0.960   8.683   -6.763  1.00 1.40  ? 33  PRO A O    2  
ATOM 2482  C CB   . PRO A 1 33  ? 0.009   11.718  -6.572  1.00 1.97  ? 33  PRO A CB   2  
ATOM 2483  C CG   . PRO A 1 33  ? -0.952  11.277  -7.622  1.00 2.24  ? 33  PRO A CG   2  
ATOM 2484  C CD   . PRO A 1 33  ? -0.152  11.118  -8.890  1.00 2.19  ? 33  PRO A CD   2  
ATOM 2485  H HA   . PRO A 1 33  ? 2.156   11.682  -6.673  1.00 1.77  ? 33  PRO A HA   2  
ATOM 2486  H HB2  . PRO A 1 33  ? -0.294  11.384  -5.589  1.00 1.85  ? 33  PRO A HB2  2  
ATOM 2487  H HB3  . PRO A 1 33  ? 0.133   12.788  -6.573  1.00 2.24  ? 33  PRO A HB3  2  
ATOM 2488  H HG2  . PRO A 1 33  ? -1.392  10.334  -7.337  1.00 2.37  ? 33  PRO A HG2  2  
ATOM 2489  H HG3  . PRO A 1 33  ? -1.719  12.026  -7.754  1.00 2.55  ? 33  PRO A HG3  2  
ATOM 2490  H HD2  . PRO A 1 33  ? -0.500  10.263  -9.451  1.00 2.33  ? 33  PRO A HD2  2  
ATOM 2491  H HD3  . PRO A 1 33  ? -0.213  12.014  -9.490  1.00 2.38  ? 33  PRO A HD3  2  
ATOM 2492  N N    . GLY A 1 34  ? 2.110   9.687   -5.123  1.00 1.29  ? 34  GLY A N    2  
ATOM 2493  C CA   . GLY A 1 34  ? 2.396   8.442   -4.450  1.00 1.05  ? 34  GLY A CA   2  
ATOM 2494  C C    . GLY A 1 34  ? 3.651   7.801   -4.996  1.00 0.85  ? 34  GLY A C    2  
ATOM 2495  O O    . GLY A 1 34  ? 4.050   8.065   -6.127  1.00 0.88  ? 34  GLY A O    2  
ATOM 2496  H H    . GLY A 1 34  ? 2.401   10.539  -4.727  1.00 1.47  ? 34  GLY A H    2  
ATOM 2497  H HA2  . GLY A 1 34  ? 2.525   8.632   -3.395  1.00 1.11  ? 34  GLY A HA2  2  
ATOM 2498  H HA3  . GLY A 1 34  ? 1.566   7.765   -4.591  1.00 1.10  ? 34  GLY A HA3  2  
ATOM 2499  N N    . GLN A 1 35  ? 4.291   6.974   -4.195  1.00 0.74  ? 35  GLN A N    2  
ATOM 2500  C CA   . GLN A 1 35  ? 5.524   6.331   -4.614  1.00 0.59  ? 35  GLN A CA   2  
ATOM 2501  C C    . GLN A 1 35  ? 5.258   4.885   -5.018  1.00 0.52  ? 35  GLN A C    2  
ATOM 2502  O O    . GLN A 1 35  ? 4.632   4.127   -4.277  1.00 0.58  ? 35  GLN A O    2  
ATOM 2503  C CB   . GLN A 1 35  ? 6.565   6.397   -3.493  1.00 0.58  ? 35  GLN A CB   2  
ATOM 2504  C CG   . GLN A 1 35  ? 6.811   7.809   -2.968  1.00 0.82  ? 35  GLN A CG   2  
ATOM 2505  C CD   . GLN A 1 35  ? 7.395   8.747   -4.014  1.00 0.75  ? 35  GLN A CD   2  
ATOM 2506  O OE1  . GLN A 1 35  ? 8.611   8.873   -4.139  1.00 1.50  ? 35  GLN A OE1  2  
ATOM 2507  N NE2  . GLN A 1 35  ? 6.535   9.416   -4.767  1.00 0.78  ? 35  GLN A NE2  2  
ATOM 2508  H H    . GLN A 1 35  ? 3.924   6.787   -3.307  1.00 0.85  ? 35  GLN A H    2  
ATOM 2509  H HA   . GLN A 1 35  ? 5.900   6.868   -5.472  1.00 0.60  ? 35  GLN A HA   2  
ATOM 2510  H HB2  . GLN A 1 35  ? 6.231   5.782   -2.671  1.00 0.76  ? 35  GLN A HB2  2  
ATOM 2511  H HB3  . GLN A 1 35  ? 7.500   6.008   -3.866  1.00 0.65  ? 35  GLN A HB3  2  
ATOM 2512  H HG2  . GLN A 1 35  ? 5.873   8.221   -2.626  1.00 1.35  ? 35  GLN A HG2  2  
ATOM 2513  H HG3  . GLN A 1 35  ? 7.499   7.751   -2.138  1.00 1.50  ? 35  GLN A HG3  2  
ATOM 2514  H HE21 . GLN A 1 35  ? 5.577   9.274   -4.617  1.00 1.10  ? 35  GLN A HE21 2  
ATOM 2515  H HE22 . GLN A 1 35  ? 6.889   10.022  -5.451  1.00 1.07  ? 35  GLN A HE22 2  
ATOM 2516  N N    . PHE A 1 36  ? 5.725   4.514   -6.201  1.00 0.47  ? 36  PHE A N    2  
ATOM 2517  C CA   . PHE A 1 36  ? 5.497   3.176   -6.738  1.00 0.43  ? 36  PHE A CA   2  
ATOM 2518  C C    . PHE A 1 36  ? 6.756   2.330   -6.617  1.00 0.39  ? 36  PHE A C    2  
ATOM 2519  O O    . PHE A 1 36  ? 7.870   2.855   -6.639  1.00 0.45  ? 36  PHE A O    2  
ATOM 2520  C CB   . PHE A 1 36  ? 5.080   3.256   -8.212  1.00 0.48  ? 36  PHE A CB   2  
ATOM 2521  C CG   . PHE A 1 36  ? 3.770   3.958   -8.452  1.00 0.58  ? 36  PHE A CG   2  
ATOM 2522  C CD1  . PHE A 1 36  ? 3.701   5.341   -8.440  1.00 0.70  ? 36  PHE A CD1  2  
ATOM 2523  C CD2  . PHE A 1 36  ? 2.609   3.235   -8.684  1.00 0.68  ? 36  PHE A CD2  2  
ATOM 2524  C CE1  . PHE A 1 36  ? 2.502   5.990   -8.656  1.00 0.83  ? 36  PHE A CE1  2  
ATOM 2525  C CE2  . PHE A 1 36  ? 1.407   3.880   -8.901  1.00 0.81  ? 36  PHE A CE2  2  
ATOM 2526  C CZ   . PHE A 1 36  ? 1.349   5.246   -8.903  1.00 0.87  ? 36  PHE A CZ   2  
ATOM 2527  H H    . PHE A 1 36  ? 6.248   5.156   -6.729  1.00 0.51  ? 36  PHE A H    2  
ATOM 2528  H HA   . PHE A 1 36  ? 4.705   2.714   -6.168  1.00 0.42  ? 36  PHE A HA   2  
ATOM 2529  H HB2  . PHE A 1 36  ? 5.843   3.786   -8.763  1.00 0.50  ? 36  PHE A HB2  2  
ATOM 2530  H HB3  . PHE A 1 36  ? 4.996   2.253   -8.605  1.00 0.48  ? 36  PHE A HB3  2  
ATOM 2531  H HD1  . PHE A 1 36  ? 4.600   5.913   -8.261  1.00 0.74  ? 36  PHE A HD1  2  
ATOM 2532  H HD2  . PHE A 1 36  ? 2.650   2.155   -8.695  1.00 0.72  ? 36  PHE A HD2  2  
ATOM 2533  H HE1  . PHE A 1 36  ? 2.463   7.070   -8.644  1.00 0.95  ? 36  PHE A HE1  2  
ATOM 2534  H HE2  . PHE A 1 36  ? 0.510   3.306   -9.080  1.00 0.93  ? 36  PHE A HE2  2  
ATOM 2535  H HZ   . PHE A 1 36  ? 0.408   5.746   -9.079  1.00 0.99  ? 36  PHE A HZ   2  
ATOM 2536  N N    . ILE A 1 37  ? 6.582   1.021   -6.496  1.00 0.36  ? 37  ILE A N    2  
ATOM 2537  C CA   . ILE A 1 37  ? 7.714   0.113   -6.411  1.00 0.33  ? 37  ILE A CA   2  
ATOM 2538  C C    . ILE A 1 37  ? 8.149   -0.316  -7.806  1.00 0.33  ? 37  ILE A C    2  
ATOM 2539  O O    . ILE A 1 37  ? 7.477   -1.108  -8.471  1.00 0.38  ? 37  ILE A O    2  
ATOM 2540  C CB   . ILE A 1 37  ? 7.391   -1.140  -5.562  1.00 0.34  ? 37  ILE A CB   2  
ATOM 2541  C CG1  . ILE A 1 37  ? 6.906   -0.730  -4.164  1.00 0.39  ? 37  ILE A CG1  2  
ATOM 2542  C CG2  . ILE A 1 37  ? 8.615   -2.046  -5.458  1.00 0.33  ? 37  ILE A CG2  2  
ATOM 2543  C CD1  . ILE A 1 37  ? 7.912   0.088   -3.383  1.00 0.38  ? 37  ILE A CD1  2  
ATOM 2544  H H    . ILE A 1 37  ? 5.666   0.654   -6.465  1.00 0.41  ? 37  ILE A H    2  
ATOM 2545  H HA   . ILE A 1 37  ? 8.528   0.643   -5.940  1.00 0.33  ? 37  ILE A HA   2  
ATOM 2546  H HB   . ILE A 1 37  ? 6.608   -1.693  -6.060  1.00 0.37  ? 37  ILE A HB   2  
ATOM 2547  H HG12 . ILE A 1 37  ? 6.008   -0.139  -4.263  1.00 0.47  ? 37  ILE A HG12 2  
ATOM 2548  H HG13 . ILE A 1 37  ? 6.682   -1.619  -3.590  1.00 0.44  ? 37  ILE A HG13 2  
ATOM 2549  H HG21 . ILE A 1 37  ? 9.438   -1.493  -5.028  1.00 1.05  ? 37  ILE A HG21 2  
ATOM 2550  H HG22 . ILE A 1 37  ? 8.891   -2.394  -6.442  1.00 1.00  ? 37  ILE A HG22 2  
ATOM 2551  H HG23 . ILE A 1 37  ? 8.383   -2.894  -4.829  1.00 1.04  ? 37  ILE A HG23 2  
ATOM 2552  H HD11 . ILE A 1 37  ? 7.490   0.359   -2.425  1.00 1.09  ? 37  ILE A HD11 2  
ATOM 2553  H HD12 . ILE A 1 37  ? 8.155   0.983   -3.935  1.00 1.12  ? 37  ILE A HD12 2  
ATOM 2554  H HD13 . ILE A 1 37  ? 8.808   -0.495  -3.230  1.00 1.05  ? 37  ILE A HD13 2  
ATOM 2555  N N    . ARG A 1 38  ? 9.278   0.233   -8.235  1.00 0.34  ? 38  ARG A N    2  
ATOM 2556  C CA   . ARG A 1 38  ? 9.861   -0.068  -9.536  1.00 0.41  ? 38  ARG A CA   2  
ATOM 2557  C C    . ARG A 1 38  ? 10.252  -1.536  -9.619  1.00 0.40  ? 38  ARG A C    2  
ATOM 2558  O O    . ARG A 1 38  ? 9.830   -2.253  -10.524 1.00 0.49  ? 38  ARG A O    2  
ATOM 2559  C CB   . ARG A 1 38  ? 11.086  0.827   -9.748  1.00 0.50  ? 38  ARG A CB   2  
ATOM 2560  C CG   . ARG A 1 38  ? 12.025  0.392   -10.864 1.00 0.67  ? 38  ARG A CG   2  
ATOM 2561  C CD   . ARG A 1 38  ? 11.470  0.690   -12.242 1.00 1.24  ? 38  ARG A CD   2  
ATOM 2562  N NE   . ARG A 1 38  ? 12.533  0.696   -13.244 1.00 1.56  ? 38  ARG A NE   2  
ATOM 2563  C CZ   . ARG A 1 38  ? 12.382  0.297   -14.504 1.00 2.17  ? 38  ARG A CZ   2  
ATOM 2564  N NH1  . ARG A 1 38  ? 11.227  -0.207  -14.918 1.00 2.83  ? 38  ARG A NH1  2  
ATOM 2565  N NH2  . ARG A 1 38  ? 13.407  0.384   -15.342 1.00 2.62  ? 38  ARG A NH2  2  
ATOM 2566  H H    . ARG A 1 38  ? 9.749   0.859   -7.642  1.00 0.35  ? 38  ARG A H    2  
ATOM 2567  H HA   . ARG A 1 38  ? 9.126   0.148   -10.295 1.00 0.46  ? 38  ARG A HA   2  
ATOM 2568  H HB2  . ARG A 1 38  ? 10.746  1.826   -9.972  1.00 0.58  ? 38  ARG A HB2  2  
ATOM 2569  H HB3  . ARG A 1 38  ? 11.652  0.854   -8.828  1.00 0.52  ? 38  ARG A HB3  2  
ATOM 2570  H HG2  . ARG A 1 38  ? 12.963  0.913   -10.749 1.00 1.18  ? 38  ARG A HG2  2  
ATOM 2571  H HG3  . ARG A 1 38  ? 12.192  -0.671  -10.777 1.00 1.34  ? 38  ARG A HG3  2  
ATOM 2572  H HD2  . ARG A 1 38  ? 10.745  -0.068  -12.498 1.00 1.95  ? 38  ARG A HD2  2  
ATOM 2573  H HD3  . ARG A 1 38  ? 10.995  1.658   -12.226 1.00 1.74  ? 38  ARG A HD3  2  
ATOM 2574  H HE   . ARG A 1 38  ? 13.412  1.032   -12.960 1.00 1.83  ? 38  ARG A HE   2  
ATOM 2575  H HH11 . ARG A 1 38  ? 10.450  -0.294  -14.280 1.00 2.92  ? 38  ARG A HH11 2  
ATOM 2576  H HH12 . ARG A 1 38  ? 11.119  -0.509  -15.875 1.00 3.48  ? 38  ARG A HH12 2  
ATOM 2577  H HH21 . ARG A 1 38  ? 14.292  0.745   -15.023 1.00 2.77  ? 38  ARG A HH21 2  
ATOM 2578  H HH22 . ARG A 1 38  ? 13.304  0.099   -16.301 1.00 3.10  ? 38  ARG A HH22 2  
ATOM 2579  N N    . SER A 1 39  ? 11.047  -1.974  -8.661  1.00 0.36  ? 39  SER A N    2  
ATOM 2580  C CA   . SER A 1 39  ? 11.516  -3.346  -8.626  1.00 0.40  ? 39  SER A CA   2  
ATOM 2581  C C    . SER A 1 39  ? 12.165  -3.639  -7.283  1.00 0.32  ? 39  SER A C    2  
ATOM 2582  O O    . SER A 1 39  ? 12.906  -2.810  -6.750  1.00 0.37  ? 39  SER A O    2  
ATOM 2583  C CB   . SER A 1 39  ? 12.513  -3.589  -9.768  1.00 0.54  ? 39  SER A CB   2  
ATOM 2584  O OG   . SER A 1 39  ? 13.550  -2.617  -9.762  1.00 1.26  ? 39  SER A OG   2  
ATOM 2585  H H    . SER A 1 39  ? 11.332  -1.355  -7.954  1.00 0.35  ? 39  SER A H    2  
ATOM 2586  H HA   . SER A 1 39  ? 10.664  -3.995  -8.755  1.00 0.44  ? 39  SER A HA   2  
ATOM 2587  H HB2  . SER A 1 39  ? 12.954  -4.568  -9.654  1.00 1.11  ? 39  SER A HB2  2  
ATOM 2588  H HB3  . SER A 1 39  ? 11.993  -3.536  -10.712 1.00 1.13  ? 39  SER A HB3  2  
ATOM 2589  H HG   . SER A 1 39  ? 14.320  -2.975  -9.290  1.00 1.82  ? 39  SER A HG   2  
ATOM 2590  N N    . VAL A 1 40  ? 11.874  -4.800  -6.725  1.00 0.36  ? 40  VAL A N    2  
ATOM 2591  C CA   . VAL A 1 40  ? 12.510  -5.215  -5.489  1.00 0.30  ? 40  VAL A CA   2  
ATOM 2592  C C    . VAL A 1 40  ? 13.584  -6.253  -5.797  1.00 0.31  ? 40  VAL A C    2  
ATOM 2593  O O    . VAL A 1 40  ? 13.355  -7.196  -6.557  1.00 0.37  ? 40  VAL A O    2  
ATOM 2594  C CB   . VAL A 1 40  ? 11.483  -5.771  -4.473  1.00 0.33  ? 40  VAL A CB   2  
ATOM 2595  C CG1  . VAL A 1 40  ? 10.767  -6.999  -5.014  1.00 0.37  ? 40  VAL A CG1  2  
ATOM 2596  C CG2  . VAL A 1 40  ? 12.155  -6.077  -3.146  1.00 0.32  ? 40  VAL A CG2  2  
ATOM 2597  H H    . VAL A 1 40  ? 11.224  -5.393  -7.155  1.00 0.49  ? 40  VAL A H    2  
ATOM 2598  H HA   . VAL A 1 40  ? 12.984  -4.345  -5.054  1.00 0.31  ? 40  VAL A HA   2  
ATOM 2599  H HB   . VAL A 1 40  ? 10.740  -5.005  -4.299  1.00 0.38  ? 40  VAL A HB   2  
ATOM 2600  H HG11 . VAL A 1 40  ? 11.488  -7.781  -5.205  1.00 1.03  ? 40  VAL A HG11 2  
ATOM 2601  H HG12 . VAL A 1 40  ? 10.259  -6.746  -5.933  1.00 1.05  ? 40  VAL A HG12 2  
ATOM 2602  H HG13 . VAL A 1 40  ? 10.047  -7.345  -4.288  1.00 1.11  ? 40  VAL A HG13 2  
ATOM 2603  H HG21 . VAL A 1 40  ? 12.944  -6.798  -3.301  1.00 1.08  ? 40  VAL A HG21 2  
ATOM 2604  H HG22 . VAL A 1 40  ? 11.426  -6.483  -2.460  1.00 1.09  ? 40  VAL A HG22 2  
ATOM 2605  H HG23 . VAL A 1 40  ? 12.571  -5.170  -2.735  1.00 1.02  ? 40  VAL A HG23 2  
ATOM 2606  N N    . ASP A 1 41  ? 14.770  -6.053  -5.253  1.00 0.35  ? 41  ASP A N    2  
ATOM 2607  C CA   . ASP A 1 41  ? 15.887  -6.948  -5.516  1.00 0.45  ? 41  ASP A CA   2  
ATOM 2608  C C    . ASP A 1 41  ? 15.717  -8.242  -4.741  1.00 0.48  ? 41  ASP A C    2  
ATOM 2609  O O    . ASP A 1 41  ? 15.358  -8.223  -3.563  1.00 0.51  ? 41  ASP A O    2  
ATOM 2610  C CB   . ASP A 1 41  ? 17.213  -6.279  -5.150  1.00 0.54  ? 41  ASP A CB   2  
ATOM 2611  C CG   . ASP A 1 41  ? 17.580  -5.157  -6.100  1.00 1.27  ? 41  ASP A CG   2  
ATOM 2612  O OD1  . ASP A 1 41  ? 17.092  -4.024  -5.908  1.00 2.28  ? 41  ASP A OD1  2  
ATOM 2613  O OD2  . ASP A 1 41  ? 18.362  -5.401  -7.045  1.00 1.32  ? 41  ASP A OD2  2  
ATOM 2614  H H    . ASP A 1 41  ? 14.899  -5.289  -4.646  1.00 0.39  ? 41  ASP A H    2  
ATOM 2615  H HA   . ASP A 1 41  ? 15.886  -7.175  -6.571  1.00 0.52  ? 41  ASP A HA   2  
ATOM 2616  H HB2  . ASP A 1 41  ? 17.141  -5.870  -4.154  1.00 0.79  ? 41  ASP A HB2  2  
ATOM 2617  H HB3  . ASP A 1 41  ? 18.000  -7.018  -5.174  1.00 1.00  ? 41  ASP A HB3  2  
ATOM 2618  N N    . PRO A 1 42  ? 15.962  -9.382  -5.400  1.00 0.58  ? 42  PRO A N    2  
ATOM 2619  C CA   . PRO A 1 42  ? 15.805  -10.702 -4.786  1.00 0.69  ? 42  PRO A CA   2  
ATOM 2620  C C    . PRO A 1 42  ? 16.769  -10.922 -3.629  1.00 0.69  ? 42  PRO A C    2  
ATOM 2621  O O    . PRO A 1 42  ? 17.938  -10.532 -3.695  1.00 1.17  ? 42  PRO A O    2  
ATOM 2622  C CB   . PRO A 1 42  ? 16.099  -11.677 -5.930  1.00 0.84  ? 42  PRO A CB   2  
ATOM 2623  C CG   . PRO A 1 42  ? 16.904  -10.893 -6.908  1.00 0.93  ? 42  PRO A CG   2  
ATOM 2624  C CD   . PRO A 1 42  ? 16.412  -9.478  -6.801  1.00 0.69  ? 42  PRO A CD   2  
ATOM 2625  H HA   . PRO A 1 42  ? 14.795  -10.852 -4.434  1.00 0.75  ? 42  PRO A HA   2  
ATOM 2626  H HB2  . PRO A 1 42  ? 16.651  -12.525 -5.552  1.00 0.99  ? 42  PRO A HB2  2  
ATOM 2627  H HB3  . PRO A 1 42  ? 15.170  -12.013 -6.367  1.00 0.96  ? 42  PRO A HB3  2  
ATOM 2628  H HG2  . PRO A 1 42  ? 17.951  -10.947 -6.650  1.00 1.27  ? 42  PRO A HG2  2  
ATOM 2629  H HG3  . PRO A 1 42  ? 16.741  -11.273 -7.906  1.00 1.17  ? 42  PRO A HG3  2  
ATOM 2630  H HD2  . PRO A 1 42  ? 17.216  -8.785  -6.997  1.00 0.79  ? 42  PRO A HD2  2  
ATOM 2631  H HD3  . PRO A 1 42  ? 15.591  -9.311  -7.482  1.00 0.77  ? 42  PRO A HD3  2  
ATOM 2632  N N    . ASP A 1 43  ? 16.256  -11.542 -2.573  1.00 0.75  ? 43  ASP A N    2  
ATOM 2633  C CA   . ASP A 1 43  ? 17.021  -11.826 -1.362  1.00 0.87  ? 43  ASP A CA   2  
ATOM 2634  C C    . ASP A 1 43  ? 17.511  -10.534 -0.715  1.00 0.70  ? 43  ASP A C    2  
ATOM 2635  O O    . ASP A 1 43  ? 18.684  -10.383 -0.371  1.00 0.86  ? 43  ASP A O    2  
ATOM 2636  C CB   . ASP A 1 43  ? 18.190  -12.769 -1.660  1.00 1.14  ? 43  ASP A CB   2  
ATOM 2637  C CG   . ASP A 1 43  ? 18.862  -13.269 -0.399  1.00 1.69  ? 43  ASP A CG   2  
ATOM 2638  O OD1  . ASP A 1 43  ? 18.150  -13.672 0.544   1.00 1.92  ? 43  ASP A OD1  2  
ATOM 2639  O OD2  . ASP A 1 43  ? 20.111  -13.245 -0.334  1.00 2.40  ? 43  ASP A OD2  2  
ATOM 2640  H H    . ASP A 1 43  ? 15.305  -11.819 -2.609  1.00 1.09  ? 43  ASP A H    2  
ATOM 2641  H HA   . ASP A 1 43  ? 16.355  -12.316 -0.668  1.00 1.00  ? 43  ASP A HA   2  
ATOM 2642  H HB2  . ASP A 1 43  ? 17.822  -13.621 -2.211  1.00 1.42  ? 43  ASP A HB2  2  
ATOM 2643  H HB3  . ASP A 1 43  ? 18.924  -12.248 -2.258  1.00 1.58  ? 43  ASP A HB3  2  
ATOM 2644  N N    . SER A 1 44  ? 16.601  -9.593  -0.569  1.00 0.57  ? 44  SER A N    2  
ATOM 2645  C CA   . SER A 1 44  ? 16.902  -8.356  0.120   1.00 0.48  ? 44  SER A CA   2  
ATOM 2646  C C    . SER A 1 44  ? 15.975  -8.201  1.315   1.00 0.40  ? 44  SER A C    2  
ATOM 2647  O O    . SER A 1 44  ? 14.925  -8.844  1.364   1.00 0.39  ? 44  SER A O    2  
ATOM 2648  C CB   . SER A 1 44  ? 16.737  -7.164  -0.825  1.00 0.47  ? 44  SER A CB   2  
ATOM 2649  O OG   . SER A 1 44  ? 15.387  -7.030  -1.238  1.00 0.46  ? 44  SER A OG   2  
ATOM 2650  H H    . SER A 1 44  ? 15.704  -9.734  -0.939  1.00 0.68  ? 44  SER A H    2  
ATOM 2651  H HA   . SER A 1 44  ? 17.924  -8.400  0.468   1.00 0.55  ? 44  SER A HA   2  
ATOM 2652  H HB2  . SER A 1 44  ? 17.037  -6.260  -0.317  1.00 0.50  ? 44  SER A HB2  2  
ATOM 2653  H HB3  . SER A 1 44  ? 17.356  -7.310  -1.698  1.00 0.51  ? 44  SER A HB3  2  
ATOM 2654  H HG   . SER A 1 44  ? 15.298  -7.368  -2.144  1.00 0.41  ? 44  SER A HG   2  
ATOM 2655  N N    . PRO A 1 45  ? 16.332  -7.358  2.296   1.00 0.43  ? 45  PRO A N    2  
ATOM 2656  C CA   . PRO A 1 45  ? 15.447  -7.052  3.421   1.00 0.45  ? 45  PRO A CA   2  
ATOM 2657  C C    . PRO A 1 45  ? 14.083  -6.556  2.944   1.00 0.38  ? 45  PRO A C    2  
ATOM 2658  O O    . PRO A 1 45  ? 13.063  -6.765  3.603   1.00 0.39  ? 45  PRO A O    2  
ATOM 2659  C CB   . PRO A 1 45  ? 16.183  -5.941  4.180   1.00 0.57  ? 45  PRO A CB   2  
ATOM 2660  C CG   . PRO A 1 45  ? 17.279  -5.488  3.274   1.00 0.65  ? 45  PRO A CG   2  
ATOM 2661  C CD   . PRO A 1 45  ? 17.618  -6.662  2.407   1.00 0.52  ? 45  PRO A CD   2  
ATOM 2662  H HA   . PRO A 1 45  ? 15.315  -7.909  4.064   1.00 0.48  ? 45  PRO A HA   2  
ATOM 2663  H HB2  . PRO A 1 45  ? 15.493  -5.137  4.395   1.00 0.68  ? 45  PRO A HB2  2  
ATOM 2664  H HB3  . PRO A 1 45  ? 16.575  -6.336  5.104   1.00 0.68  ? 45  PRO A HB3  2  
ATOM 2665  H HG2  . PRO A 1 45  ? 16.936  -4.662  2.668   1.00 0.81  ? 45  PRO A HG2  2  
ATOM 2666  H HG3  . PRO A 1 45  ? 18.139  -5.191  3.858   1.00 0.87  ? 45  PRO A HG3  2  
ATOM 2667  H HD2  . PRO A 1 45  ? 17.967  -6.332  1.438   1.00 0.56  ? 45  PRO A HD2  2  
ATOM 2668  H HD3  . PRO A 1 45  ? 18.358  -7.288  2.884   1.00 0.60  ? 45  PRO A HD3  2  
ATOM 2669  N N    . ALA A 1 46  ? 14.079  -5.917  1.780   1.00 0.35  ? 46  ALA A N    2  
ATOM 2670  C CA   . ALA A 1 46  ? 12.854  -5.403  1.191   1.00 0.33  ? 46  ALA A CA   2  
ATOM 2671  C C    . ALA A 1 46  ? 11.970  -6.548  0.711   1.00 0.30  ? 46  ALA A C    2  
ATOM 2672  O O    . ALA A 1 46  ? 10.790  -6.619  1.043   1.00 0.31  ? 46  ALA A O    2  
ATOM 2673  C CB   . ALA A 1 46  ? 13.175  -4.460  0.043   1.00 0.36  ? 46  ALA A CB   2  
ATOM 2674  H H    . ALA A 1 46  ? 14.924  -5.803  1.300   1.00 0.37  ? 46  ALA A H    2  
ATOM 2675  H HA   . ALA A 1 46  ? 12.327  -4.845  1.951   1.00 0.35  ? 46  ALA A HA   2  
ATOM 2676  H HB1  . ALA A 1 46  ? 13.822  -3.669  0.394   1.00 1.17  ? 46  ALA A HB1  2  
ATOM 2677  H HB2  . ALA A 1 46  ? 12.260  -4.033  -0.338  1.00 0.96  ? 46  ALA A HB2  2  
ATOM 2678  H HB3  . ALA A 1 46  ? 13.672  -5.006  -0.746  1.00 1.10  ? 46  ALA A HB3  2  
ATOM 2679  N N    . GLU A 1 47  ? 12.553  -7.458  -0.057  1.00 0.31  ? 47  GLU A N    2  
ATOM 2680  C CA   . GLU A 1 47  ? 11.818  -8.605  -0.567  1.00 0.33  ? 47  GLU A CA   2  
ATOM 2681  C C    . GLU A 1 47  ? 11.380  -9.513  0.581   1.00 0.34  ? 47  GLU A C    2  
ATOM 2682  O O    . GLU A 1 47  ? 10.287  -10.077 0.556   1.00 0.40  ? 47  GLU A O    2  
ATOM 2683  C CB   . GLU A 1 47  ? 12.672  -9.380  -1.572  1.00 0.40  ? 47  GLU A CB   2  
ATOM 2684  C CG   . GLU A 1 47  ? 11.976  -10.596 -2.155  1.00 0.53  ? 47  GLU A CG   2  
ATOM 2685  C CD   . GLU A 1 47  ? 12.805  -11.287 -3.212  1.00 1.12  ? 47  GLU A CD   2  
ATOM 2686  O OE1  . GLU A 1 47  ? 13.690  -12.091 -2.844  1.00 2.01  ? 47  GLU A OE1  2  
ATOM 2687  O OE2  . GLU A 1 47  ? 12.585  -11.027 -4.411  1.00 1.51  ? 47  GLU A OE2  2  
ATOM 2688  H H    . GLU A 1 47  ? 13.501  -7.353  -0.291  1.00 0.33  ? 47  GLU A H    2  
ATOM 2689  H HA   . GLU A 1 47  ? 10.937  -8.233  -1.069  1.00 0.36  ? 47  GLU A HA   2  
ATOM 2690  H HB2  . GLU A 1 47  ? 12.934  -8.720  -2.387  1.00 0.44  ? 47  GLU A HB2  2  
ATOM 2691  H HB3  . GLU A 1 47  ? 13.576  -9.707  -1.084  1.00 0.42  ? 47  GLU A HB3  2  
ATOM 2692  H HG2  . GLU A 1 47  ? 11.778  -11.298 -1.359  1.00 1.14  ? 47  GLU A HG2  2  
ATOM 2693  H HG3  . GLU A 1 47  ? 11.041  -10.284 -2.598  1.00 1.17  ? 47  GLU A HG3  2  
ATOM 2694  N N    . ALA A 1 48  ? 12.228  -9.619  1.598   1.00 0.34  ? 48  ALA A N    2  
ATOM 2695  C CA   . ALA A 1 48  ? 11.938  -10.449 2.761   1.00 0.38  ? 48  ALA A CA   2  
ATOM 2696  C C    . ALA A 1 48  ? 10.773  -9.888  3.578   1.00 0.37  ? 48  ALA A C    2  
ATOM 2697  O O    . ALA A 1 48  ? 10.023  -10.641 4.197   1.00 0.47  ? 48  ALA A O    2  
ATOM 2698  C CB   . ALA A 1 48  ? 13.178  -10.584 3.634   1.00 0.44  ? 48  ALA A CB   2  
ATOM 2699  H H    . ALA A 1 48  ? 13.082  -9.132  1.560   1.00 0.34  ? 48  ALA A H    2  
ATOM 2700  H HA   . ALA A 1 48  ? 11.670  -11.434 2.407   1.00 0.42  ? 48  ALA A HA   2  
ATOM 2701  H HB1  . ALA A 1 48  ? 13.452  -9.616  4.021   1.00 1.15  ? 48  ALA A HB1  2  
ATOM 2702  H HB2  . ALA A 1 48  ? 13.992  -10.981 3.043   1.00 0.97  ? 48  ALA A HB2  2  
ATOM 2703  H HB3  . ALA A 1 48  ? 12.970  -11.256 4.455   1.00 1.06  ? 48  ALA A HB3  2  
ATOM 2704  N N    . SER A 1 49  ? 10.622  -8.564  3.574   1.00 0.31  ? 49  SER A N    2  
ATOM 2705  C CA   . SER A 1 49  ? 9.552   -7.916  4.322   1.00 0.32  ? 49  SER A CA   2  
ATOM 2706  C C    . SER A 1 49  ? 8.199   -8.145  3.644   1.00 0.35  ? 49  SER A C    2  
ATOM 2707  O O    . SER A 1 49  ? 7.146   -8.001  4.265   1.00 0.40  ? 49  SER A O    2  
ATOM 2708  C CB   . SER A 1 49  ? 9.845   -6.416  4.463   1.00 0.32  ? 49  SER A CB   2  
ATOM 2709  O OG   . SER A 1 49  ? 9.750   -5.738  3.223   1.00 0.31  ? 49  SER A OG   2  
ATOM 2710  H H    . SER A 1 49  ? 11.254  -8.011  3.074   1.00 0.29  ? 49  SER A H    2  
ATOM 2711  H HA   . SER A 1 49  ? 9.525   -8.359  5.306   1.00 0.36  ? 49  SER A HA   2  
ATOM 2712  H HB2  . SER A 1 49  ? 9.143   -5.971  5.151   1.00 0.35  ? 49  SER A HB2  2  
ATOM 2713  H HB3  . SER A 1 49  ? 10.845  -6.290  4.848   1.00 0.36  ? 49  SER A HB3  2  
ATOM 2714  H HG   . SER A 1 49  ? 10.206  -6.244  2.540   1.00 0.29  ? 49  SER A HG   2  
ATOM 2715  N N    . GLY A 1 50  ? 8.241   -8.522  2.371   1.00 0.36  ? 50  GLY A N    2  
ATOM 2716  C CA   . GLY A 1 50  ? 7.019   -8.784  1.635   1.00 0.43  ? 50  GLY A CA   2  
ATOM 2717  C C    . GLY A 1 50  ? 6.741   -7.735  0.579   1.00 0.43  ? 50  GLY A C    2  
ATOM 2718  O O    . GLY A 1 50  ? 5.631   -7.663  0.049   1.00 0.62  ? 50  GLY A O    2  
ATOM 2719  H H    . GLY A 1 50  ? 9.109   -8.636  1.932   1.00 0.34  ? 50  GLY A H    2  
ATOM 2720  H HA2  . GLY A 1 50  ? 7.097   -9.750  1.158   1.00 0.49  ? 50  GLY A HA2  2  
ATOM 2721  H HA3  . GLY A 1 50  ? 6.193   -8.804  2.331   1.00 0.45  ? 50  GLY A HA3  2  
ATOM 2722  N N    . LEU A 1 51  ? 7.748   -6.922  0.272   1.00 0.41  ? 51  LEU A N    2  
ATOM 2723  C CA   . LEU A 1 51  ? 7.608   -5.879  -0.734  1.00 0.40  ? 51  LEU A CA   2  
ATOM 2724  C C    . LEU A 1 51  ? 7.515   -6.493  -2.124  1.00 0.48  ? 51  LEU A C    2  
ATOM 2725  O O    . LEU A 1 51  ? 8.463   -7.119  -2.604  1.00 0.65  ? 51  LEU A O    2  
ATOM 2726  C CB   . LEU A 1 51  ? 8.789   -4.908  -0.666  1.00 0.38  ? 51  LEU A CB   2  
ATOM 2727  C CG   . LEU A 1 51  ? 8.660   -3.667  -1.547  1.00 0.35  ? 51  LEU A CG   2  
ATOM 2728  C CD1  . LEU A 1 51  ? 7.454   -2.843  -1.131  1.00 0.38  ? 51  LEU A CD1  2  
ATOM 2729  C CD2  . LEU A 1 51  ? 9.926   -2.832  -1.474  1.00 0.37  ? 51  LEU A CD2  2  
ATOM 2730  H H    . LEU A 1 51  ? 8.604   -7.024  0.735   1.00 0.54  ? 51  LEU A H    2  
ATOM 2731  H HA   . LEU A 1 51  ? 6.696   -5.337  -0.533  1.00 0.41  ? 51  LEU A HA   2  
ATOM 2732  H HB2  . LEU A 1 51  ? 8.904   -4.586  0.359   1.00 0.42  ? 51  LEU A HB2  2  
ATOM 2733  H HB3  . LEU A 1 51  ? 9.681   -5.439  -0.961  1.00 0.48  ? 51  LEU A HB3  2  
ATOM 2734  H HG   . LEU A 1 51  ? 8.518   -3.974  -2.572  1.00 0.42  ? 51  LEU A HG   2  
ATOM 2735  H HD11 . LEU A 1 51  ? 6.561   -3.444  -1.219  1.00 1.04  ? 51  LEU A HD11 2  
ATOM 2736  H HD12 . LEU A 1 51  ? 7.369   -1.978  -1.773  1.00 1.12  ? 51  LEU A HD12 2  
ATOM 2737  H HD13 . LEU A 1 51  ? 7.574   -2.522  -0.107  1.00 1.10  ? 51  LEU A HD13 2  
ATOM 2738  H HD21 . LEU A 1 51  ? 10.762  -3.414  -1.832  1.00 1.03  ? 51  LEU A HD21 2  
ATOM 2739  H HD22 . LEU A 1 51  ? 10.105  -2.541  -0.449  1.00 1.05  ? 51  LEU A HD22 2  
ATOM 2740  H HD23 . LEU A 1 51  ? 9.811   -1.949  -2.084  1.00 1.08  ? 51  LEU A HD23 2  
ATOM 2741  N N    . ARG A 1 52  ? 6.364   -6.322  -2.753  1.00 0.53  ? 52  ARG A N    2  
ATOM 2742  C CA   . ARG A 1 52  ? 6.124   -6.860  -4.082  1.00 0.65  ? 52  ARG A CA   2  
ATOM 2743  C C    . ARG A 1 52  ? 6.358   -5.778  -5.130  1.00 0.55  ? 52  ARG A C    2  
ATOM 2744  O O    . ARG A 1 52  ? 6.181   -4.590  -4.859  1.00 0.61  ? 52  ARG A O    2  
ATOM 2745  C CB   . ARG A 1 52  ? 4.690   -7.387  -4.173  1.00 0.86  ? 52  ARG A CB   2  
ATOM 2746  C CG   . ARG A 1 52  ? 4.382   -8.113  -5.472  1.00 1.23  ? 52  ARG A CG   2  
ATOM 2747  C CD   . ARG A 1 52  ? 2.941   -8.591  -5.513  1.00 2.05  ? 52  ARG A CD   2  
ATOM 2748  N NE   . ARG A 1 52  ? 2.647   -9.345  -6.732  1.00 2.59  ? 52  ARG A NE   2  
ATOM 2749  C CZ   . ARG A 1 52  ? 1.439   -9.807  -7.049  1.00 3.57  ? 52  ARG A CZ   2  
ATOM 2750  N NH1  . ARG A 1 52  ? 0.404   -9.591  -6.244  1.00 4.13  ? 52  ARG A NH1  2  
ATOM 2751  N NH2  . ARG A 1 52  ? 1.259   -10.492 -8.170  1.00 4.38  ? 52  ARG A NH2  2  
ATOM 2752  H H    . ARG A 1 52  ? 5.652   -5.813  -2.312  1.00 0.62  ? 52  ARG A H    2  
ATOM 2753  H HA   . ARG A 1 52  ? 6.815   -7.673  -4.248  1.00 0.74  ? 52  ARG A HA   2  
ATOM 2754  H HB2  . ARG A 1 52  ? 4.516   -8.072  -3.355  1.00 1.11  ? 52  ARG A HB2  2  
ATOM 2755  H HB3  . ARG A 1 52  ? 4.008   -6.555  -4.083  1.00 1.35  ? 52  ARG A HB3  2  
ATOM 2756  H HG2  . ARG A 1 52  ? 4.552   -7.440  -6.299  1.00 1.80  ? 52  ARG A HG2  2  
ATOM 2757  H HG3  . ARG A 1 52  ? 5.038   -8.966  -5.559  1.00 1.46  ? 52  ARG A HG3  2  
ATOM 2758  H HD2  . ARG A 1 52  ? 2.762   -9.223  -4.658  1.00 2.55  ? 52  ARG A HD2  2  
ATOM 2759  H HD3  . ARG A 1 52  ? 2.289   -7.731  -5.466  1.00 2.57  ? 52  ARG A HD3  2  
ATOM 2760  H HE   . ARG A 1 52  ? 3.397   -9.519  -7.345  1.00 2.68  ? 52  ARG A HE   2  
ATOM 2761  H HH11 . ARG A 1 52  ? 0.525   -9.079  -5.390  1.00 3.93  ? 52  ARG A HH11 2  
ATOM 2762  H HH12 . ARG A 1 52  ? -0.506  -9.949  -6.484  1.00 4.99  ? 52  ARG A HH12 2  
ATOM 2763  H HH21 . ARG A 1 52  ? 2.037   -10.670 -8.791  1.00 4.42  ? 52  ARG A HH21 2  
ATOM 2764  H HH22 . ARG A 1 52  ? 0.345   -10.835 -8.407  1.00 5.17  ? 52  ARG A HH22 2  
ATOM 2765  N N    . ALA A 1 53  ? 6.788   -6.191  -6.314  1.00 0.53  ? 53  ALA A N    2  
ATOM 2766  C CA   . ALA A 1 53  ? 6.995   -5.263  -7.414  1.00 0.54  ? 53  ALA A CA   2  
ATOM 2767  C C    . ALA A 1 53  ? 5.658   -4.820  -8.001  1.00 0.61  ? 53  ALA A C    2  
ATOM 2768  O O    . ALA A 1 53  ? 4.670   -5.557  -7.934  1.00 1.44  ? 53  ALA A O    2  
ATOM 2769  C CB   . ALA A 1 53  ? 7.872   -5.899  -8.482  1.00 0.68  ? 53  ALA A CB   2  
ATOM 2770  H H    . ALA A 1 53  ? 6.966   -7.144  -6.454  1.00 0.60  ? 53  ALA A H    2  
ATOM 2771  H HA   . ALA A 1 53  ? 7.511   -4.396  -7.025  1.00 0.52  ? 53  ALA A HA   2  
ATOM 2772  H HB1  . ALA A 1 53  ? 8.040   -5.189  -9.279  1.00 1.00  ? 53  ALA A HB1  2  
ATOM 2773  H HB2  . ALA A 1 53  ? 7.381   -6.775  -8.877  1.00 1.18  ? 53  ALA A HB2  2  
ATOM 2774  H HB3  . ALA A 1 53  ? 8.821   -6.182  -8.048  1.00 1.17  ? 53  ALA A HB3  2  
ATOM 2775  N N    . GLN A 1 54  ? 5.644   -3.610  -8.563  1.00 0.65  ? 54  GLN A N    2  
ATOM 2776  C CA   . GLN A 1 54  ? 4.440   -3.005  -9.142  1.00 0.74  ? 54  GLN A CA   2  
ATOM 2777  C C    . GLN A 1 54  ? 3.428   -2.613  -8.065  1.00 0.59  ? 54  GLN A C    2  
ATOM 2778  O O    . GLN A 1 54  ? 2.285   -2.267  -8.372  1.00 0.67  ? 54  GLN A O    2  
ATOM 2779  C CB   . GLN A 1 54  ? 3.778   -3.914  -10.192 1.00 0.99  ? 54  GLN A CB   2  
ATOM 2780  C CG   . GLN A 1 54  ? 4.475   -3.910  -11.549 1.00 1.46  ? 54  GLN A CG   2  
ATOM 2781  C CD   . GLN A 1 54  ? 5.735   -4.754  -11.586 1.00 2.34  ? 54  GLN A CD   2  
ATOM 2782  O OE1  . GLN A 1 54  ? 5.839   -5.774  -10.907 1.00 2.99  ? 54  GLN A OE1  2  
ATOM 2783  N NE2  . GLN A 1 54  ? 6.705   -4.334  -12.381 1.00 3.06  ? 54  GLN A NE2  2  
ATOM 2784  H H    . GLN A 1 54  ? 6.477   -3.095  -8.585  1.00 1.26  ? 54  GLN A H    2  
ATOM 2785  H HA   . GLN A 1 54  ? 4.756   -2.099  -9.637  1.00 0.86  ? 54  GLN A HA   2  
ATOM 2786  H HB2  . GLN A 1 54  ? 3.776   -4.928  -9.820  1.00 1.00  ? 54  GLN A HB2  2  
ATOM 2787  H HB3  . GLN A 1 54  ? 2.758   -3.591  -10.337 1.00 1.09  ? 54  GLN A HB3  2  
ATOM 2788  H HG2  . GLN A 1 54  ? 3.788   -4.292  -12.288 1.00 1.69  ? 54  GLN A HG2  2  
ATOM 2789  H HG3  . GLN A 1 54  ? 4.736   -2.892  -11.798 1.00 1.84  ? 54  GLN A HG3  2  
ATOM 2790  H HE21 . GLN A 1 54  ? 6.561   -3.509  -12.898 1.00 3.14  ? 54  GLN A HE21 2  
ATOM 2791  H HE22 . GLN A 1 54  ? 7.530   -4.863  -12.424 1.00 3.80  ? 54  GLN A HE22 2  
ATOM 2792  N N    . ASP A 1 55  ? 3.853   -2.661  -6.809  1.00 0.47  ? 55  ASP A N    2  
ATOM 2793  C CA   . ASP A 1 55  ? 3.023   -2.201  -5.703  1.00 0.45  ? 55  ASP A CA   2  
ATOM 2794  C C    . ASP A 1 55  ? 3.179   -0.697  -5.535  1.00 0.39  ? 55  ASP A C    2  
ATOM 2795  O O    . ASP A 1 55  ? 4.068   -0.085  -6.135  1.00 0.48  ? 55  ASP A O    2  
ATOM 2796  C CB   . ASP A 1 55  ? 3.394   -2.914  -4.397  1.00 0.50  ? 55  ASP A CB   2  
ATOM 2797  C CG   . ASP A 1 55  ? 2.731   -4.275  -4.243  1.00 0.67  ? 55  ASP A CG   2  
ATOM 2798  O OD1  . ASP A 1 55  ? 2.215   -4.804  -5.254  1.00 1.02  ? 55  ASP A OD1  2  
ATOM 2799  O OD2  . ASP A 1 55  ? 2.727   -4.825  -3.120  1.00 1.01  ? 55  ASP A OD2  2  
ATOM 2800  H H    . ASP A 1 55  ? 4.746   -3.009  -6.621  1.00 0.46  ? 55  ASP A H    2  
ATOM 2801  H HA   . ASP A 1 55  ? 1.993   -2.420  -5.946  1.00 0.52  ? 55  ASP A HA   2  
ATOM 2802  H HB2  . ASP A 1 55  ? 4.464   -3.055  -4.367  1.00 0.55  ? 55  ASP A HB2  2  
ATOM 2803  H HB3  . ASP A 1 55  ? 3.098   -2.295  -3.566  1.00 0.57  ? 55  ASP A HB3  2  
ATOM 2804  N N    . ARG A 1 56  ? 2.319   -0.097  -4.731  1.00 0.38  ? 56  ARG A N    2  
ATOM 2805  C CA   . ARG A 1 56  ? 2.361   1.335   -4.519  1.00 0.42  ? 56  ARG A CA   2  
ATOM 2806  C C    . ARG A 1 56  ? 2.313   1.639   -3.025  1.00 0.39  ? 56  ARG A C    2  
ATOM 2807  O O    . ARG A 1 56  ? 1.475   1.099   -2.301  1.00 0.39  ? 56  ARG A O    2  
ATOM 2808  C CB   . ARG A 1 56  ? 1.195   1.989   -5.269  1.00 0.56  ? 56  ARG A CB   2  
ATOM 2809  C CG   . ARG A 1 56  ? 1.310   3.494   -5.420  1.00 0.78  ? 56  ARG A CG   2  
ATOM 2810  C CD   . ARG A 1 56  ? 0.643   4.221   -4.276  1.00 0.79  ? 56  ARG A CD   2  
ATOM 2811  N NE   . ARG A 1 56  ? -0.769  3.862   -4.154  1.00 0.89  ? 56  ARG A NE   2  
ATOM 2812  C CZ   . ARG A 1 56  ? -1.480  4.072   -3.058  1.00 0.91  ? 56  ARG A CZ   2  
ATOM 2813  N NH1  . ARG A 1 56  ? -0.880  4.533   -1.973  1.00 1.51  ? 56  ARG A NH1  2  
ATOM 2814  N NH2  . ARG A 1 56  ? -2.769  3.765   -3.030  1.00 1.57  ? 56  ARG A NH2  2  
ATOM 2815  H H    . ARG A 1 56  ? 1.632   -0.628  -4.275  1.00 0.45  ? 56  ARG A H    2  
ATOM 2816  H HA   . ARG A 1 56  ? 3.292   1.705   -4.923  1.00 0.43  ? 56  ARG A HA   2  
ATOM 2817  H HB2  . ARG A 1 56  ? 1.131   1.558   -6.254  1.00 0.70  ? 56  ARG A HB2  2  
ATOM 2818  H HB3  . ARG A 1 56  ? 0.279   1.773   -4.737  1.00 0.54  ? 56  ARG A HB3  2  
ATOM 2819  H HG2  . ARG A 1 56  ? 2.355   3.764   -5.443  1.00 1.15  ? 56  ARG A HG2  2  
ATOM 2820  H HG3  . ARG A 1 56  ? 0.840   3.789   -6.346  1.00 1.24  ? 56  ARG A HG3  2  
ATOM 2821  H HD2  . ARG A 1 56  ? 1.150   3.964   -3.357  1.00 1.55  ? 56  ARG A HD2  2  
ATOM 2822  H HD3  . ARG A 1 56  ? 0.722   5.284   -4.446  1.00 1.33  ? 56  ARG A HD3  2  
ATOM 2823  H HE   . ARG A 1 56  ? -1.209  3.458   -4.941  1.00 1.71  ? 56  ARG A HE   2  
ATOM 2824  H HH11 . ARG A 1 56  ? 0.112   4.703   -1.985  1.00 1.92  ? 56  ARG A HH11 2  
ATOM 2825  H HH12 . ARG A 1 56  ? -1.408  4.739   -1.148  1.00 2.03  ? 56  ARG A HH12 2  
ATOM 2826  H HH21 . ARG A 1 56  ? -3.209  3.360   -3.853  1.00 2.26  ? 56  ARG A HH21 2  
ATOM 2827  H HH22 . ARG A 1 56  ? -3.310  3.928   -2.208  1.00 1.73  ? 56  ARG A HH22 2  
ATOM 2828  N N    . ILE A 1 57  ? 3.224   2.495   -2.573  1.00 0.40  ? 57  ILE A N    2  
ATOM 2829  C CA   . ILE A 1 57  ? 3.358   2.808   -1.153  1.00 0.38  ? 57  ILE A CA   2  
ATOM 2830  C C    . ILE A 1 57  ? 2.204   3.676   -0.669  1.00 0.38  ? 57  ILE A C    2  
ATOM 2831  O O    . ILE A 1 57  ? 1.853   4.680   -1.294  1.00 0.49  ? 57  ILE A O    2  
ATOM 2832  C CB   . ILE A 1 57  ? 4.699   3.515   -0.852  1.00 0.46  ? 57  ILE A CB   2  
ATOM 2833  C CG1  . ILE A 1 57  ? 5.872   2.638   -1.305  1.00 0.53  ? 57  ILE A CG1  2  
ATOM 2834  C CG2  . ILE A 1 57  ? 4.815   3.835   0.635   1.00 0.45  ? 57  ILE A CG2  2  
ATOM 2835  C CD1  . ILE A 1 57  ? 7.230   3.262   -1.063  1.00 0.68  ? 57  ILE A CD1  2  
ATOM 2836  H H    . ILE A 1 57  ? 3.820   2.942   -3.217  1.00 0.45  ? 57  ILE A H    2  
ATOM 2837  H HA   . ILE A 1 57  ? 3.339   1.876   -0.603  1.00 0.35  ? 57  ILE A HA   2  
ATOM 2838  H HB   . ILE A 1 57  ? 4.722   4.445   -1.397  1.00 0.52  ? 57  ILE A HB   2  
ATOM 2839  H HG12 . ILE A 1 57  ? 5.842   1.700   -0.769  1.00 1.01  ? 57  ILE A HG12 2  
ATOM 2840  H HG13 . ILE A 1 57  ? 5.780   2.444   -2.363  1.00 0.84  ? 57  ILE A HG13 2  
ATOM 2841  H HG21 . ILE A 1 57  ? 5.769   4.303   0.829   1.00 1.02  ? 57  ILE A HG21 2  
ATOM 2842  H HG22 . ILE A 1 57  ? 4.737   2.923   1.209   1.00 1.06  ? 57  ILE A HG22 2  
ATOM 2843  H HG23 . ILE A 1 57  ? 4.019   4.508   0.920   1.00 1.21  ? 57  ILE A HG23 2  
ATOM 2844  H HD11 . ILE A 1 57  ? 7.305   4.187   -1.616  1.00 1.25  ? 57  ILE A HD11 2  
ATOM 2845  H HD12 . ILE A 1 57  ? 8.003   2.582   -1.391  1.00 1.30  ? 57  ILE A HD12 2  
ATOM 2846  H HD13 . ILE A 1 57  ? 7.351   3.462   -0.009  1.00 1.37  ? 57  ILE A HD13 2  
ATOM 2847  N N    . VAL A 1 58  ? 1.608   3.260   0.436   1.00 0.29  ? 58  VAL A N    2  
ATOM 2848  C CA   . VAL A 1 58  ? 0.499   3.971   1.040   1.00 0.32  ? 58  VAL A CA   2  
ATOM 2849  C C    . VAL A 1 58  ? 0.941   4.676   2.318   1.00 0.30  ? 58  VAL A C    2  
ATOM 2850  O O    . VAL A 1 58  ? 0.657   5.857   2.521   1.00 0.37  ? 58  VAL A O    2  
ATOM 2851  C CB   . VAL A 1 58  ? -0.652  3.014   1.388   1.00 0.37  ? 58  VAL A CB   2  
ATOM 2852  C CG1  . VAL A 1 58  ? -1.865  3.796   1.854   1.00 0.87  ? 58  VAL A CG1  2  
ATOM 2853  C CG2  . VAL A 1 58  ? -0.997  2.120   0.207   1.00 0.62  ? 58  VAL A CG2  2  
ATOM 2854  H H    . VAL A 1 58  ? 1.926   2.431   0.861   1.00 0.27  ? 58  VAL A H    2  
ATOM 2855  H HA   . VAL A 1 58  ? 0.136   4.703   0.333   1.00 0.38  ? 58  VAL A HA   2  
ATOM 2856  H HB   . VAL A 1 58  ? -0.330  2.383   2.204   1.00 0.66  ? 58  VAL A HB   2  
ATOM 2857  H HG11 . VAL A 1 58  ? -2.193  4.457   1.064   1.00 1.32  ? 58  VAL A HG11 2  
ATOM 2858  H HG12 . VAL A 1 58  ? -1.604  4.378   2.725   1.00 1.56  ? 58  VAL A HG12 2  
ATOM 2859  H HG13 . VAL A 1 58  ? -2.661  3.111   2.104   1.00 1.41  ? 58  VAL A HG13 2  
ATOM 2860  H HG21 . VAL A 1 58  ? -0.142  1.509   -0.041  1.00 1.24  ? 58  VAL A HG21 2  
ATOM 2861  H HG22 . VAL A 1 58  ? -1.260  2.733   -0.643  1.00 1.25  ? 58  VAL A HG22 2  
ATOM 2862  H HG23 . VAL A 1 58  ? -1.831  1.486   0.466   1.00 1.22  ? 58  VAL A HG23 2  
ATOM 2863  N N    . GLU A 1 59  ? 1.635   3.940   3.177   1.00 0.24  ? 59  GLU A N    2  
ATOM 2864  C CA   . GLU A 1 59  ? 2.067   4.469   4.464   1.00 0.25  ? 59  GLU A CA   2  
ATOM 2865  C C    . GLU A 1 59  ? 3.524   4.127   4.725   1.00 0.22  ? 59  GLU A C    2  
ATOM 2866  O O    . GLU A 1 59  ? 4.014   3.085   4.284   1.00 0.23  ? 59  GLU A O    2  
ATOM 2867  C CB   . GLU A 1 59  ? 1.214   3.904   5.608   1.00 0.29  ? 59  GLU A CB   2  
ATOM 2868  C CG   . GLU A 1 59  ? -0.248  4.315   5.568   1.00 0.40  ? 59  GLU A CG   2  
ATOM 2869  C CD   . GLU A 1 59  ? -0.951  4.043   6.883   1.00 0.44  ? 59  GLU A CD   2  
ATOM 2870  O OE1  . GLU A 1 59  ? -1.204  2.860   7.193   1.00 0.43  ? 59  GLU A OE1  2  
ATOM 2871  O OE2  . GLU A 1 59  ? -1.278  5.008   7.599   1.00 0.89  ? 59  GLU A OE2  2  
ATOM 2872  H H    . GLU A 1 59  ? 1.879   3.022   2.932   1.00 0.24  ? 59  GLU A H    2  
ATOM 2873  H HA   . GLU A 1 59  ? 1.957   5.542   4.440   1.00 0.27  ? 59  GLU A HA   2  
ATOM 2874  H HB2  . GLU A 1 59  ? 1.258   2.827   5.567   1.00 0.26  ? 59  GLU A HB2  2  
ATOM 2875  H HB3  . GLU A 1 59  ? 1.630   4.232   6.549   1.00 0.37  ? 59  GLU A HB3  2  
ATOM 2876  H HG2  . GLU A 1 59  ? -0.310  5.369   5.352   1.00 0.55  ? 59  GLU A HG2  2  
ATOM 2877  H HG3  . GLU A 1 59  ? -0.746  3.759   4.787   1.00 0.44  ? 59  GLU A HG3  2  
ATOM 2878  N N    . VAL A 1 60  ? 4.207   5.008   5.438   1.00 0.22  ? 60  VAL A N    2  
ATOM 2879  C CA   . VAL A 1 60  ? 5.571   4.747   5.880   1.00 0.21  ? 60  VAL A CA   2  
ATOM 2880  C C    . VAL A 1 60  ? 5.664   4.915   7.389   1.00 0.22  ? 60  VAL A C    2  
ATOM 2881  O O    . VAL A 1 60  ? 5.399   5.995   7.911   1.00 0.27  ? 60  VAL A O    2  
ATOM 2882  C CB   . VAL A 1 60  ? 6.600   5.683   5.209   1.00 0.23  ? 60  VAL A CB   2  
ATOM 2883  C CG1  . VAL A 1 60  ? 8.010   5.351   5.685   1.00 0.54  ? 60  VAL A CG1  2  
ATOM 2884  C CG2  . VAL A 1 60  ? 6.510   5.592   3.693   1.00 0.66  ? 60  VAL A CG2  2  
ATOM 2885  H H    . VAL A 1 60  ? 3.781   5.862   5.681   1.00 0.25  ? 60  VAL A H    2  
ATOM 2886  H HA   . VAL A 1 60  ? 5.818   3.727   5.625   1.00 0.22  ? 60  VAL A HA   2  
ATOM 2887  H HB   . VAL A 1 60  ? 6.377   6.699   5.500   1.00 0.52  ? 60  VAL A HB   2  
ATOM 2888  H HG11 . VAL A 1 60  ? 8.723   5.979   5.171   1.00 1.16  ? 60  VAL A HG11 2  
ATOM 2889  H HG12 . VAL A 1 60  ? 8.227   4.313   5.477   1.00 1.03  ? 60  VAL A HG12 2  
ATOM 2890  H HG13 . VAL A 1 60  ? 8.080   5.525   6.750   1.00 1.01  ? 60  VAL A HG13 2  
ATOM 2891  H HG21 . VAL A 1 60  ? 5.524   5.894   3.372   1.00 1.23  ? 60  VAL A HG21 2  
ATOM 2892  H HG22 . VAL A 1 60  ? 6.693   4.573   3.383   1.00 1.29  ? 60  VAL A HG22 2  
ATOM 2893  H HG23 . VAL A 1 60  ? 7.249   6.242   3.249   1.00 1.22  ? 60  VAL A HG23 2  
ATOM 2894  N N    . ASN A 1 61  ? 6.004   3.830   8.079   1.00 0.25  ? 61  ASN A N    2  
ATOM 2895  C CA   . ASN A 1 61  ? 6.176   3.838   9.536   1.00 0.30  ? 61  ASN A CA   2  
ATOM 2896  C C    . ASN A 1 61  ? 4.895   4.280   10.240  1.00 0.36  ? 61  ASN A C    2  
ATOM 2897  O O    . ASN A 1 61  ? 4.933   4.891   11.307  1.00 0.47  ? 61  ASN A O    2  
ATOM 2898  C CB   . ASN A 1 61  ? 7.347   4.743   9.949   1.00 0.39  ? 61  ASN A CB   2  
ATOM 2899  C CG   . ASN A 1 61  ? 8.669   4.310   9.340   1.00 0.53  ? 61  ASN A CG   2  
ATOM 2900  O OD1  . ASN A 1 61  ? 8.886   3.132   9.061   1.00 1.17  ? 61  ASN A OD1  2  
ATOM 2901  N ND2  . ASN A 1 61  ? 9.560   5.264   9.122   1.00 0.61  ? 61  ASN A ND2  2  
ATOM 2902  H H    . ASN A 1 61  ? 6.151   2.985   7.589   1.00 0.27  ? 61  ASN A H    2  
ATOM 2903  H HA   . ASN A 1 61  ? 6.397   2.826   9.841   1.00 0.40  ? 61  ASN A HA   2  
ATOM 2904  H HB2  . ASN A 1 61  ? 7.140   5.754   9.634   1.00 0.67  ? 61  ASN A HB2  2  
ATOM 2905  H HB3  . ASN A 1 61  ? 7.446   4.722   11.025  1.00 0.55  ? 61  ASN A HB3  2  
ATOM 2906  H HD21 . ASN A 1 61  ? 9.324   6.185   9.365   1.00 0.97  ? 61  ASN A HD21 2  
ATOM 2907  H HD22 . ASN A 1 61  ? 10.420  5.015   8.725   1.00 0.74  ? 61  ASN A HD22 2  
ATOM 2908  N N    . GLY A 1 62  ? 3.757   3.972   9.627   1.00 0.37  ? 62  GLY A N    2  
ATOM 2909  C CA   . GLY A 1 62  ? 2.477   4.313   10.218  1.00 0.50  ? 62  GLY A CA   2  
ATOM 2910  C C    . GLY A 1 62  ? 2.046   5.735   9.908   1.00 0.51  ? 62  GLY A C    2  
ATOM 2911  O O    . GLY A 1 62  ? 1.131   6.262   10.540  1.00 0.66  ? 62  GLY A O    2  
ATOM 2912  H H    . GLY A 1 62  ? 3.789   3.504   8.767   1.00 0.34  ? 62  GLY A H    2  
ATOM 2913  H HA2  . GLY A 1 62  ? 1.727   3.633   9.846   1.00 0.55  ? 62  GLY A HA2  2  
ATOM 2914  H HA3  . GLY A 1 62  ? 2.550   4.199   11.289  1.00 0.58  ? 62  GLY A HA3  2  
ATOM 2915  N N    . VAL A 1 63  ? 2.717   6.366   8.957   1.00 0.42  ? 63  VAL A N    2  
ATOM 2916  C CA   . VAL A 1 63  ? 2.347   7.705   8.516   1.00 0.50  ? 63  VAL A CA   2  
ATOM 2917  C C    . VAL A 1 63  ? 1.699   7.647   7.137   1.00 0.43  ? 63  VAL A C    2  
ATOM 2918  O O    . VAL A 1 63  ? 2.305   7.158   6.177   1.00 0.39  ? 63  VAL A O    2  
ATOM 2919  C CB   . VAL A 1 63  ? 3.571   8.648   8.470   1.00 0.61  ? 63  VAL A CB   2  
ATOM 2920  C CG1  . VAL A 1 63  ? 3.161   10.049  8.042   1.00 0.98  ? 63  VAL A CG1  2  
ATOM 2921  C CG2  . VAL A 1 63  ? 4.271   8.688   9.821   1.00 1.17  ? 63  VAL A CG2  2  
ATOM 2922  H H    . VAL A 1 63  ? 3.491   5.927   8.544   1.00 0.36  ? 63  VAL A H    2  
ATOM 2923  H HA   . VAL A 1 63  ? 1.631   8.104   9.221   1.00 0.62  ? 63  VAL A HA   2  
ATOM 2924  H HB   . VAL A 1 63  ? 4.267   8.262   7.742   1.00 1.15  ? 63  VAL A HB   2  
ATOM 2925  H HG11 . VAL A 1 63  ? 2.440   10.442  8.743   1.00 1.65  ? 63  VAL A HG11 2  
ATOM 2926  H HG12 . VAL A 1 63  ? 2.724   10.011  7.056   1.00 1.44  ? 63  VAL A HG12 2  
ATOM 2927  H HG13 . VAL A 1 63  ? 4.032   10.688  8.025   1.00 1.53  ? 63  VAL A HG13 2  
ATOM 2928  H HG21 . VAL A 1 63  ? 5.131   9.339   9.760   1.00 1.72  ? 63  VAL A HG21 2  
ATOM 2929  H HG22 . VAL A 1 63  ? 4.591   7.694   10.091  1.00 1.75  ? 63  VAL A HG22 2  
ATOM 2930  H HG23 . VAL A 1 63  ? 3.589   9.064   10.569  1.00 1.64  ? 63  VAL A HG23 2  
ATOM 2931  N N    . CYS A 1 64  ? 0.464   8.125   7.058   1.00 0.49  ? 64  CYS A N    2  
ATOM 2932  C CA   . CYS A 1 64  ? -0.291  8.139   5.816   1.00 0.49  ? 64  CYS A CA   2  
ATOM 2933  C C    . CYS A 1 64  ? 0.356   9.049   4.782   1.00 0.47  ? 64  CYS A C    2  
ATOM 2934  O O    . CYS A 1 64  ? 0.610   10.226  5.041   1.00 0.51  ? 64  CYS A O    2  
ATOM 2935  C CB   . CYS A 1 64  ? -1.724  8.597   6.089   1.00 0.59  ? 64  CYS A CB   2  
ATOM 2936  S SG   . CYS A 1 64  ? -2.693  7.451   7.094   1.00 1.68  ? 64  CYS A SG   2  
ATOM 2937  H H    . CYS A 1 64  ? 0.042   8.478   7.867   1.00 0.57  ? 64  CYS A H    2  
ATOM 2938  H HA   . CYS A 1 64  ? -0.315  7.135   5.428   1.00 0.51  ? 64  CYS A HA   2  
ATOM 2939  H HB2  . CYS A 1 64  ? -1.695  9.542   6.609   1.00 1.19  ? 64  CYS A HB2  2  
ATOM 2940  H HB3  . CYS A 1 64  ? -2.237  8.725   5.150   1.00 1.14  ? 64  CYS A HB3  2  
ATOM 2941  H HG   . CYS A 1 64  ? -2.019  6.302   7.168   1.00 2.36  ? 64  CYS A HG   2  
ATOM 2942  N N    . MET A 1 65  ? 0.611   8.495   3.608   1.00 0.48  ? 65  MET A N    2  
ATOM 2943  C CA   . MET A 1 65  ? 1.176   9.250   2.505   1.00 0.53  ? 65  MET A CA   2  
ATOM 2944  C C    . MET A 1 65  ? 0.084   9.524   1.485   1.00 0.61  ? 65  MET A C    2  
ATOM 2945  O O    . MET A 1 65  ? 0.066   8.956   0.391   1.00 0.81  ? 65  MET A O    2  
ATOM 2946  C CB   . MET A 1 65  ? 2.344   8.493   1.868   1.00 0.61  ? 65  MET A CB   2  
ATOM 2947  C CG   . MET A 1 65  ? 3.481   8.226   2.838   1.00 0.63  ? 65  MET A CG   2  
ATOM 2948  S SD   . MET A 1 65  ? 4.148   9.745   3.542   1.00 0.61  ? 65  MET A SD   2  
ATOM 2949  C CE   . MET A 1 65  ? 5.267   9.090   4.772   1.00 0.74  ? 65  MET A CE   2  
ATOM 2950  H H    . MET A 1 65  ? 0.398   7.549   3.471   1.00 0.50  ? 65  MET A H    2  
ATOM 2951  H HA   . MET A 1 65  ? 1.534   10.194  2.896   1.00 0.54  ? 65  MET A HA   2  
ATOM 2952  H HB2  . MET A 1 65  ? 1.986   7.546   1.496   1.00 0.69  ? 65  MET A HB2  2  
ATOM 2953  H HB3  . MET A 1 65  ? 2.730   9.073   1.045   1.00 0.65  ? 65  MET A HB3  2  
ATOM 2954  H HG2  . MET A 1 65  ? 3.114   7.604   3.641   1.00 0.66  ? 65  MET A HG2  2  
ATOM 2955  H HG3  . MET A 1 65  ? 4.270   7.708   2.313   1.00 0.74  ? 65  MET A HG3  2  
ATOM 2956  H HE1  . MET A 1 65  ? 4.707   8.520   5.502   1.00 1.42  ? 65  MET A HE1  2  
ATOM 2957  H HE2  . MET A 1 65  ? 5.777   9.904   5.264   1.00 1.16  ? 65  MET A HE2  2  
ATOM 2958  H HE3  . MET A 1 65  ? 5.992   8.448   4.294   1.00 1.11  ? 65  MET A HE3  2  
ATOM 2959  N N    . GLU A 1 66  ? -0.849  10.368  1.892   1.00 0.83  ? 66  GLU A N    2  
ATOM 2960  C CA   . GLU A 1 66  ? -2.002  10.725  1.071   1.00 1.01  ? 66  GLU A CA   2  
ATOM 2961  C C    . GLU A 1 66  ? -1.568  11.513  -0.158  1.00 1.08  ? 66  GLU A C    2  
ATOM 2962  O O    . GLU A 1 66  ? -1.574  11.003  -1.279  1.00 1.86  ? 66  GLU A O    2  
ATOM 2963  C CB   . GLU A 1 66  ? -2.989  11.565  1.884   1.00 1.29  ? 66  GLU A CB   2  
ATOM 2964  C CG   . GLU A 1 66  ? -3.339  10.972  3.237   1.00 2.19  ? 66  GLU A CG   2  
ATOM 2965  C CD   . GLU A 1 66  ? -4.328  11.827  3.997   1.00 3.03  ? 66  GLU A CD   2  
ATOM 2966  O OE1  . GLU A 1 66  ? -5.547  11.629  3.816   1.00 3.33  ? 66  GLU A OE1  2  
ATOM 2967  O OE2  . GLU A 1 66  ? -3.892  12.685  4.788   1.00 3.75  ? 66  GLU A OE2  2  
ATOM 2968  H H    . GLU A 1 66  ? -0.762  10.759  2.785   1.00 1.03  ? 66  GLU A H    2  
ATOM 2969  H HA   . GLU A 1 66  ? -2.488  9.814   0.754   1.00 1.16  ? 66  GLU A HA   2  
ATOM 2970  H HB2  . GLU A 1 66  ? -2.559  12.543  2.046   1.00 1.44  ? 66  GLU A HB2  2  
ATOM 2971  H HB3  . GLU A 1 66  ? -3.902  11.674  1.317   1.00 1.69  ? 66  GLU A HB3  2  
ATOM 2972  H HG2  . GLU A 1 66  ? -3.770  9.994   3.087   1.00 2.66  ? 66  GLU A HG2  2  
ATOM 2973  H HG3  . GLU A 1 66  ? -2.436  10.883  3.823   1.00 2.52  ? 66  GLU A HG3  2  
ATOM 2974  N N    . GLY A 1 67  ? -1.191  12.760  0.071   1.00 1.21  ? 67  GLY A N    2  
ATOM 2975  C CA   . GLY A 1 67  ? -0.712  13.608  -0.997  1.00 1.36  ? 67  GLY A CA   2  
ATOM 2976  C C    . GLY A 1 67  ? 0.651   14.161  -0.665  1.00 1.24  ? 67  GLY A C    2  
ATOM 2977  O O    . GLY A 1 67  ? 1.038   15.231  -1.139  1.00 1.47  ? 67  GLY A O    2  
ATOM 2978  H H    . GLY A 1 67  ? -1.233  13.115  0.991   1.00 1.78  ? 67  GLY A H    2  
ATOM 2979  H HA2  . GLY A 1 67  ? -0.653  13.031  -1.910  1.00 1.51  ? 67  GLY A HA2  2  
ATOM 2980  H HA3  . GLY A 1 67  ? -1.400  14.428  -1.138  1.00 1.54  ? 67  GLY A HA3  2  
ATOM 2981  N N    . LYS A 1 68  ? 1.365   13.420  0.172   1.00 0.97  ? 68  LYS A N    2  
ATOM 2982  C CA   . LYS A 1 68  ? 2.679   13.816  0.646   1.00 0.87  ? 68  LYS A CA   2  
ATOM 2983  C C    . LYS A 1 68  ? 3.647   14.029  -0.502  1.00 0.90  ? 68  LYS A C    2  
ATOM 2984  O O    . LYS A 1 68  ? 3.578   13.357  -1.536  1.00 1.06  ? 68  LYS A O    2  
ATOM 2985  C CB   . LYS A 1 68  ? 3.239   12.750  1.583   1.00 0.73  ? 68  LYS A CB   2  
ATOM 2986  C CG   . LYS A 1 68  ? 2.430   12.569  2.851   1.00 1.24  ? 68  LYS A CG   2  
ATOM 2987  C CD   . LYS A 1 68  ? 2.601   13.737  3.805   1.00 2.01  ? 68  LYS A CD   2  
ATOM 2988  C CE   . LYS A 1 68  ? 1.765   13.547  5.062   1.00 2.81  ? 68  LYS A CE   2  
ATOM 2989  N NZ   . LYS A 1 68  ? 2.085   14.556  6.100   1.00 3.36  ? 68  LYS A NZ   2  
ATOM 2990  H H    . LYS A 1 68  ? 0.987   12.575  0.488   1.00 0.95  ? 68  LYS A H    2  
ATOM 2991  H HA   . LYS A 1 68  ? 2.571   14.741  1.192   1.00 0.97  ? 68  LYS A HA   2  
ATOM 2992  H HB2  . LYS A 1 68  ? 3.262   11.806  1.060   1.00 0.95  ? 68  LYS A HB2  2  
ATOM 2993  H HB3  . LYS A 1 68  ? 4.247   13.023  1.858   1.00 0.87  ? 68  LYS A HB3  2  
ATOM 2994  H HG2  . LYS A 1 68  ? 1.387   12.484  2.590   1.00 1.54  ? 68  LYS A HG2  2  
ATOM 2995  H HG3  . LYS A 1 68  ? 2.755   11.666  3.342   1.00 1.43  ? 68  LYS A HG3  2  
ATOM 2996  H HD2  . LYS A 1 68  ? 3.641   13.817  4.082   1.00 2.15  ? 68  LYS A HD2  2  
ATOM 2997  H HD3  . LYS A 1 68  ? 2.286   14.642  3.308   1.00 2.21  ? 68  LYS A HD3  2  
ATOM 2998  H HE2  . LYS A 1 68  ? 0.720   13.634  4.799   1.00 3.07  ? 68  LYS A HE2  2  
ATOM 2999  H HE3  . LYS A 1 68  ? 1.952   12.559  5.458   1.00 3.16  ? 68  LYS A HE3  2  
ATOM 3000  H HZ1  . LYS A 1 68  ? 1.330   14.586  6.818   1.00 3.73  ? 68  LYS A HZ1  2  
ATOM 3001  H HZ2  . LYS A 1 68  ? 2.182   15.499  5.667   1.00 3.59  ? 68  LYS A HZ2  2  
ATOM 3002  H HZ3  . LYS A 1 68  ? 2.986   14.310  6.570   1.00 3.71  ? 68  LYS A HZ3  2  
ATOM 3003  N N    . GLN A 1 69  ? 4.549   14.968  -0.305  1.00 0.87  ? 69  GLN A N    2  
ATOM 3004  C CA   . GLN A 1 69  ? 5.569   15.270  -1.292  1.00 0.93  ? 69  GLN A CA   2  
ATOM 3005  C C    . GLN A 1 69  ? 6.670   14.216  -1.254  1.00 0.81  ? 69  GLN A C    2  
ATOM 3006  O O    . GLN A 1 69  ? 6.798   13.494  -0.260  1.00 0.74  ? 69  GLN A O    2  
ATOM 3007  C CB   . GLN A 1 69  ? 6.154   16.664  -1.045  1.00 1.07  ? 69  GLN A CB   2  
ATOM 3008  C CG   . GLN A 1 69  ? 6.693   16.867  0.363   1.00 1.33  ? 69  GLN A CG   2  
ATOM 3009  C CD   . GLN A 1 69  ? 7.122   18.296  0.628   1.00 2.12  ? 69  GLN A CD   2  
ATOM 3010  O OE1  . GLN A 1 69  ? 6.574   19.238  0.055   1.00 2.64  ? 69  GLN A OE1  2  
ATOM 3011  N NE2  . GLN A 1 69  ? 8.093   18.473  1.511   1.00 2.89  ? 69  GLN A NE2  2  
ATOM 3012  H H    . GLN A 1 69  ? 4.527   15.474  0.540   1.00 0.90  ? 69  GLN A H    2  
ATOM 3013  H HA   . GLN A 1 69  ? 5.103   15.250  -2.266  1.00 1.04  ? 69  GLN A HA   2  
ATOM 3014  H HB2  . GLN A 1 69  ? 6.965   16.826  -1.739  1.00 1.06  ? 69  GLN A HB2  2  
ATOM 3015  H HB3  . GLN A 1 69  ? 5.386   17.402  -1.224  1.00 1.25  ? 69  GLN A HB3  2  
ATOM 3016  H HG2  . GLN A 1 69  ? 5.918   16.605  1.070   1.00 1.71  ? 69  GLN A HG2  2  
ATOM 3017  H HG3  . GLN A 1 69  ? 7.543   16.217  0.508   1.00 1.61  ? 69  GLN A HG3  2  
ATOM 3018  H HE21 . GLN A 1 69  ? 8.480   17.681  1.947   1.00 2.96  ? 69  GLN A HE21 2  
ATOM 3019  H HE22 . GLN A 1 69  ? 8.385   19.389  1.700   1.00 3.61  ? 69  GLN A HE22 2  
ATOM 3020  N N    . HIS A 1 70  ? 7.461   14.125  -2.315  1.00 0.84  ? 70  HIS A N    2  
ATOM 3021  C CA   . HIS A 1 70  ? 8.532   13.134  -2.380  1.00 0.79  ? 70  HIS A CA   2  
ATOM 3022  C C    . HIS A 1 70  ? 9.462   13.274  -1.177  1.00 0.70  ? 70  HIS A C    2  
ATOM 3023  O O    . HIS A 1 70  ? 9.853   12.281  -0.560  1.00 0.65  ? 70  HIS A O    2  
ATOM 3024  C CB   . HIS A 1 70  ? 9.318   13.278  -3.688  1.00 0.88  ? 70  HIS A CB   2  
ATOM 3025  C CG   . HIS A 1 70  ? 10.489  12.345  -3.801  1.00 0.90  ? 70  HIS A CG   2  
ATOM 3026  N ND1  . HIS A 1 70  ? 10.359  10.983  -3.979  1.00 1.42  ? 70  HIS A ND1  2  
ATOM 3027  C CD2  . HIS A 1 70  ? 11.820  12.587  -3.745  1.00 1.37  ? 70  HIS A CD2  2  
ATOM 3028  C CE1  . HIS A 1 70  ? 11.557  10.432  -4.025  1.00 1.31  ? 70  HIS A CE1  2  
ATOM 3029  N NE2  . HIS A 1 70  ? 12.460  11.381  -3.886  1.00 1.13  ? 70  HIS A NE2  2  
ATOM 3030  H H    . HIS A 1 70  ? 7.325   14.739  -3.068  1.00 0.93  ? 70  HIS A H    2  
ATOM 3031  H HA   . HIS A 1 70  ? 8.075   12.156  -2.350  1.00 0.78  ? 70  HIS A HA   2  
ATOM 3032  H HB2  . HIS A 1 70  ? 8.658   13.078  -4.518  1.00 0.96  ? 70  HIS A HB2  2  
ATOM 3033  H HB3  . HIS A 1 70  ? 9.689   14.289  -3.767  1.00 0.92  ? 70  HIS A HB3  2  
ATOM 3034  H HD1  . HIS A 1 70  ? 9.509   10.488  -4.061  1.00 2.13  ? 70  HIS A HD1  2  
ATOM 3035  H HD2  . HIS A 1 70  ? 12.293  13.550  -3.613  1.00 2.20  ? 70  HIS A HD2  2  
ATOM 3036  H HE1  . HIS A 1 70  ? 11.762  9.380   -4.155  1.00 1.85  ? 70  HIS A HE1  2  
ATOM 3037  H HE2  . HIS A 1 70  ? 13.432  11.259  -4.036  1.00 1.45  ? 70  HIS A HE2  2  
ATOM 3038  N N    . GLY A 1 71  ? 9.782   14.516  -0.837  1.00 0.72  ? 71  GLY A N    2  
ATOM 3039  C CA   . GLY A 1 71  ? 10.661  14.782  0.281   1.00 0.69  ? 71  GLY A CA   2  
ATOM 3040  C C    . GLY A 1 71  ? 10.085  14.318  1.603   1.00 0.62  ? 71  GLY A C    2  
ATOM 3041  O O    . GLY A 1 71  ? 10.819  13.834  2.463   1.00 0.62  ? 71  GLY A O    2  
ATOM 3042  H H    . GLY A 1 71  ? 9.412   15.269  -1.357  1.00 0.78  ? 71  GLY A H    2  
ATOM 3043  H HA2  . GLY A 1 71  ? 11.601  14.276  0.114   1.00 0.70  ? 71  GLY A HA2  2  
ATOM 3044  H HA3  . GLY A 1 71  ? 10.841  15.845  0.336   1.00 0.75  ? 71  GLY A HA3  2  
ATOM 3045  N N    . ASP A 1 72  ? 8.771   14.445  1.758   1.00 0.61  ? 72  ASP A N    2  
ATOM 3046  C CA   . ASP A 1 72  ? 8.108   14.068  3.006   1.00 0.58  ? 72  ASP A CA   2  
ATOM 3047  C C    . ASP A 1 72  ? 8.211   12.563  3.217   1.00 0.49  ? 72  ASP A C    2  
ATOM 3048  O O    . ASP A 1 72  ? 8.583   12.095  4.293   1.00 0.44  ? 72  ASP A O    2  
ATOM 3049  C CB   . ASP A 1 72  ? 6.634   14.480  2.973   1.00 0.68  ? 72  ASP A CB   2  
ATOM 3050  C CG   . ASP A 1 72  ? 6.019   14.601  4.356   1.00 1.16  ? 72  ASP A CG   2  
ATOM 3051  O OD1  . ASP A 1 72  ? 6.200   13.689  5.185   1.00 2.03  ? 72  ASP A OD1  2  
ATOM 3052  O OD2  . ASP A 1 72  ? 5.336   15.615  4.614   1.00 1.47  ? 72  ASP A OD2  2  
ATOM 3053  H H    . ASP A 1 72  ? 8.232   14.791  1.012   1.00 0.65  ? 72  ASP A H    2  
ATOM 3054  H HA   . ASP A 1 72  ? 8.605   14.575  3.821   1.00 0.61  ? 72  ASP A HA   2  
ATOM 3055  H HB2  . ASP A 1 72  ? 6.545   15.436  2.478   1.00 1.25  ? 72  ASP A HB2  2  
ATOM 3056  H HB3  . ASP A 1 72  ? 6.077   13.740  2.416   1.00 0.87  ? 72  ASP A HB3  2  
ATOM 3057  N N    . VAL A 1 73  ? 7.909   11.816  2.161   1.00 0.50  ? 73  VAL A N    2  
ATOM 3058  C CA   . VAL A 1 73  ? 7.950   10.361  2.207   1.00 0.45  ? 73  VAL A CA   2  
ATOM 3059  C C    . VAL A 1 73  ? 9.370   9.870   2.490   1.00 0.44  ? 73  VAL A C    2  
ATOM 3060  O O    . VAL A 1 73  ? 9.582   9.004   3.340   1.00 0.43  ? 73  VAL A O    2  
ATOM 3061  C CB   . VAL A 1 73  ? 7.444   9.743   0.884   1.00 0.51  ? 73  VAL A CB   2  
ATOM 3062  C CG1  . VAL A 1 73  ? 7.421   8.223   0.966   1.00 1.08  ? 73  VAL A CG1  2  
ATOM 3063  C CG2  . VAL A 1 73  ? 6.064   10.283  0.526   1.00 0.97  ? 73  VAL A CG2  2  
ATOM 3064  H H    . VAL A 1 73  ? 7.644   12.259  1.327   1.00 0.56  ? 73  VAL A H    2  
ATOM 3065  H HA   . VAL A 1 73  ? 7.300   10.034  3.006   1.00 0.44  ? 73  VAL A HA   2  
ATOM 3066  H HB   . VAL A 1 73  ? 8.128   10.023  0.097   1.00 0.92  ? 73  VAL A HB   2  
ATOM 3067  H HG11 . VAL A 1 73  ? 6.741   7.914   1.747   1.00 1.67  ? 73  VAL A HG11 2  
ATOM 3068  H HG12 . VAL A 1 73  ? 8.414   7.861   1.190   1.00 1.48  ? 73  VAL A HG12 2  
ATOM 3069  H HG13 . VAL A 1 73  ? 7.093   7.815   0.021   1.00 1.71  ? 73  VAL A HG13 2  
ATOM 3070  H HG21 . VAL A 1 73  ? 5.729   9.835   -0.399  1.00 1.47  ? 73  VAL A HG21 2  
ATOM 3071  H HG22 . VAL A 1 73  ? 6.118   11.356  0.405   1.00 1.57  ? 73  VAL A HG22 2  
ATOM 3072  H HG23 . VAL A 1 73  ? 5.365   10.046  1.315   1.00 1.50  ? 73  VAL A HG23 2  
ATOM 3073  N N    . VAL A 1 74  ? 10.343  10.442  1.787   1.00 0.49  ? 74  VAL A N    2  
ATOM 3074  C CA   . VAL A 1 74  ? 11.740  10.061  1.964   1.00 0.53  ? 74  VAL A CA   2  
ATOM 3075  C C    . VAL A 1 74  ? 12.218  10.387  3.376   1.00 0.51  ? 74  VAL A C    2  
ATOM 3076  O O    . VAL A 1 74  ? 12.928  9.593   3.999   1.00 0.52  ? 74  VAL A O    2  
ATOM 3077  C CB   . VAL A 1 74  ? 12.656  10.757  0.932   1.00 0.64  ? 74  VAL A CB   2  
ATOM 3078  C CG1  . VAL A 1 74  ? 14.120  10.431  1.186   1.00 0.72  ? 74  VAL A CG1  2  
ATOM 3079  C CG2  . VAL A 1 74  ? 12.265  10.349  -0.480  1.00 0.70  ? 74  VAL A CG2  2  
ATOM 3080  H H    . VAL A 1 74  ? 10.114  11.137  1.132   1.00 0.52  ? 74  VAL A H    2  
ATOM 3081  H HA   . VAL A 1 74  ? 11.812  8.993   1.813   1.00 0.55  ? 74  VAL A HA   2  
ATOM 3082  H HB   . VAL A 1 74  ? 12.526  11.825  1.024   1.00 0.66  ? 74  VAL A HB   2  
ATOM 3083  H HG11 . VAL A 1 74  ? 14.273  9.366   1.095   1.00 1.19  ? 74  VAL A HG11 2  
ATOM 3084  H HG12 . VAL A 1 74  ? 14.392  10.750  2.181   1.00 1.34  ? 74  VAL A HG12 2  
ATOM 3085  H HG13 . VAL A 1 74  ? 14.735  10.947  0.462   1.00 1.20  ? 74  VAL A HG13 2  
ATOM 3086  H HG21 . VAL A 1 74  ? 12.391  9.283   -0.597  1.00 1.37  ? 74  VAL A HG21 2  
ATOM 3087  H HG22 . VAL A 1 74  ? 12.893  10.868  -1.191  1.00 1.03  ? 74  VAL A HG22 2  
ATOM 3088  H HG23 . VAL A 1 74  ? 11.233  10.611  -0.655  1.00 1.19  ? 74  VAL A HG23 2  
ATOM 3089  N N    . SER A 1 75  ? 11.804  11.542  3.887   1.00 0.51  ? 75  SER A N    2  
ATOM 3090  C CA   . SER A 1 75  ? 12.171  11.957  5.232   1.00 0.52  ? 75  SER A CA   2  
ATOM 3091  C C    . SER A 1 75  ? 11.623  10.965  6.252   1.00 0.47  ? 75  SER A C    2  
ATOM 3092  O O    . SER A 1 75  ? 12.294  10.629  7.226   1.00 0.51  ? 75  SER A O    2  
ATOM 3093  C CB   . SER A 1 75  ? 11.644  13.367  5.523   1.00 0.58  ? 75  SER A CB   2  
ATOM 3094  O OG   . SER A 1 75  ? 12.118  13.849  6.771   1.00 0.66  ? 75  SER A OG   2  
ATOM 3095  H H    . SER A 1 75  ? 11.234  12.131  3.343   1.00 0.52  ? 75  SER A H    2  
ATOM 3096  H HA   . SER A 1 75  ? 13.249  11.962  5.294   1.00 0.57  ? 75  SER A HA   2  
ATOM 3097  H HB2  . SER A 1 75  ? 11.972  14.041  4.745   1.00 0.61  ? 75  SER A HB2  2  
ATOM 3098  H HB3  . SER A 1 75  ? 10.565  13.346  5.548   1.00 0.57  ? 75  SER A HB3  2  
ATOM 3099  H HG   . SER A 1 75  ? 11.371  13.955  7.380   1.00 1.12  ? 75  SER A HG   2  
ATOM 3100  N N    . ALA A 1 76  ? 10.406  10.486  6.009   1.00 0.42  ? 76  ALA A N    2  
ATOM 3101  C CA   . ALA A 1 76  ? 9.776   9.515   6.893   1.00 0.39  ? 76  ALA A CA   2  
ATOM 3102  C C    . ALA A 1 76  ? 10.549  8.199   6.900   1.00 0.37  ? 76  ALA A C    2  
ATOM 3103  O O    . ALA A 1 76  ? 10.773  7.610   7.956   1.00 0.39  ? 76  ALA A O    2  
ATOM 3104  C CB   . ALA A 1 76  ? 8.330   9.288   6.482   1.00 0.39  ? 76  ALA A CB   2  
ATOM 3105  H H    . ALA A 1 76  ? 9.916   10.801  5.216   1.00 0.42  ? 76  ALA A H    2  
ATOM 3106  H HA   . ALA A 1 76  ? 9.781   9.925   7.891   1.00 0.42  ? 76  ALA A HA   2  
ATOM 3107  H HB1  . ALA A 1 76  ? 7.806   10.233  6.474   1.00 1.09  ? 76  ALA A HB1  2  
ATOM 3108  H HB2  . ALA A 1 76  ? 7.856   8.618   7.184   1.00 1.06  ? 76  ALA A HB2  2  
ATOM 3109  H HB3  . ALA A 1 76  ? 8.301   8.852   5.494   1.00 1.06  ? 76  ALA A HB3  2  
ATOM 3110  N N    . ILE A 1 77  ? 10.968  7.748   5.718   1.00 0.37  ? 77  ILE A N    2  
ATOM 3111  C CA   . ILE A 1 77  ? 11.760  6.528   5.600   1.00 0.39  ? 77  ILE A CA   2  
ATOM 3112  C C    . ILE A 1 77  ? 13.078  6.666   6.361   1.00 0.41  ? 77  ILE A C    2  
ATOM 3113  O O    . ILE A 1 77  ? 13.473  5.775   7.115   1.00 0.44  ? 77  ILE A O    2  
ATOM 3114  C CB   . ILE A 1 77  ? 12.058  6.200   4.122   1.00 0.45  ? 77  ILE A CB   2  
ATOM 3115  C CG1  . ILE A 1 77  ? 10.750  6.064   3.337   1.00 0.53  ? 77  ILE A CG1  2  
ATOM 3116  C CG2  . ILE A 1 77  ? 12.879  4.922   4.011   1.00 0.50  ? 77  ILE A CG2  2  
ATOM 3117  C CD1  . ILE A 1 77  ? 10.950  5.996   1.840   1.00 0.69  ? 77  ILE A CD1  2  
ATOM 3118  H H    . ILE A 1 77  ? 10.728  8.243   4.900   1.00 0.38  ? 77  ILE A H    2  
ATOM 3119  H HA   . ILE A 1 77  ? 11.191  5.714   6.024   1.00 0.40  ? 77  ILE A HA   2  
ATOM 3120  H HB   . ILE A 1 77  ? 12.637  7.010   3.705   1.00 0.50  ? 77  ILE A HB   2  
ATOM 3121  H HG12 . ILE A 1 77  ? 10.244  5.161   3.644   1.00 0.98  ? 77  ILE A HG12 2  
ATOM 3122  H HG13 . ILE A 1 77  ? 10.119  6.915   3.550   1.00 1.00  ? 77  ILE A HG13 2  
ATOM 3123  H HG21 . ILE A 1 77  ? 12.342  4.106   4.471   1.00 1.07  ? 77  ILE A HG21 2  
ATOM 3124  H HG22 . ILE A 1 77  ? 13.826  5.058   4.513   1.00 1.16  ? 77  ILE A HG22 2  
ATOM 3125  H HG23 . ILE A 1 77  ? 13.055  4.696   2.970   1.00 1.05  ? 77  ILE A HG23 2  
ATOM 3126  H HD11 . ILE A 1 77  ? 11.433  6.902   1.504   1.00 1.20  ? 77  ILE A HD11 2  
ATOM 3127  H HD12 . ILE A 1 77  ? 9.992   5.897   1.354   1.00 1.34  ? 77  ILE A HD12 2  
ATOM 3128  H HD13 . ILE A 1 77  ? 11.569  5.146   1.597   1.00 1.35  ? 77  ILE A HD13 2  
ATOM 3129  N N    . ARG A 1 78  ? 13.741  7.802   6.180   1.00 0.43  ? 78  ARG A N    2  
ATOM 3130  C CA   . ARG A 1 78  ? 15.010  8.067   6.848   1.00 0.50  ? 78  ARG A CA   2  
ATOM 3131  C C    . ARG A 1 78  ? 14.815  8.253   8.352   1.00 0.50  ? 78  ARG A C    2  
ATOM 3132  O O    . ARG A 1 78  ? 15.736  8.033   9.138   1.00 0.56  ? 78  ARG A O    2  
ATOM 3133  C CB   . ARG A 1 78  ? 15.690  9.296   6.241   1.00 0.58  ? 78  ARG A CB   2  
ATOM 3134  C CG   . ARG A 1 78  ? 16.201  9.066   4.825   1.00 0.66  ? 78  ARG A CG   2  
ATOM 3135  C CD   . ARG A 1 78  ? 16.909  10.293  4.272   1.00 0.89  ? 78  ARG A CD   2  
ATOM 3136  N NE   . ARG A 1 78  ? 18.006  10.727  5.137   1.00 1.59  ? 78  ARG A NE   2  
ATOM 3137  C CZ   . ARG A 1 78  ? 19.245  10.969  4.713   1.00 2.11  ? 78  ARG A CZ   2  
ATOM 3138  N NH1  . ARG A 1 78  ? 19.565  10.788  3.437   1.00 2.12  ? 78  ARG A NH1  2  
ATOM 3139  N NH2  . ARG A 1 78  ? 20.165  11.375  5.577   1.00 3.09  ? 78  ARG A NH2  2  
ATOM 3140  H H    . ARG A 1 78  ? 13.367  8.482   5.573   1.00 0.42  ? 78  ARG A H    2  
ATOM 3141  H HA   . ARG A 1 78  ? 15.644  7.207   6.690   1.00 0.54  ? 78  ARG A HA   2  
ATOM 3142  H HB2  . ARG A 1 78  ? 14.979  10.110  6.219   1.00 0.60  ? 78  ARG A HB2  2  
ATOM 3143  H HB3  . ARG A 1 78  ? 16.526  9.575   6.864   1.00 0.65  ? 78  ARG A HB3  2  
ATOM 3144  H HG2  . ARG A 1 78  ? 16.895  8.241   4.835   1.00 0.78  ? 78  ARG A HG2  2  
ATOM 3145  H HG3  . ARG A 1 78  ? 15.364  8.827   4.186   1.00 0.83  ? 78  ARG A HG3  2  
ATOM 3146  H HD2  . ARG A 1 78  ? 17.307  10.053  3.296   1.00 1.36  ? 78  ARG A HD2  2  
ATOM 3147  H HD3  . ARG A 1 78  ? 16.193  11.095  4.181   1.00 1.38  ? 78  ARG A HD3  2  
ATOM 3148  H HE   . ARG A 1 78  ? 17.803  10.855  6.093   1.00 2.12  ? 78  ARG A HE   2  
ATOM 3149  H HH11 . ARG A 1 78  ? 18.872  10.464  2.778   1.00 1.97  ? 78  ARG A HH11 2  
ATOM 3150  H HH12 . ARG A 1 78  ? 20.502  10.977  3.117   1.00 2.67  ? 78  ARG A HH12 2  
ATOM 3151  H HH21 . ARG A 1 78  ? 19.920  11.500  6.545   1.00 3.55  ? 78  ARG A HH21 2  
ATOM 3152  H HH22 . ARG A 1 78  ? 21.112  11.553  5.273   1.00 3.52  ? 78  ARG A HH22 2  
ATOM 3153  N N    . ALA A 1 79  ? 13.613  8.658   8.744   1.00 0.47  ? 79  ALA A N    2  
ATOM 3154  C CA   . ALA A 1 79  ? 13.286  8.858   10.151  1.00 0.51  ? 79  ALA A CA   2  
ATOM 3155  C C    . ALA A 1 79  ? 13.054  7.526   10.855  1.00 0.43  ? 79  ALA A C    2  
ATOM 3156  O O    . ALA A 1 79  ? 12.945  7.471   12.081  1.00 0.46  ? 79  ALA A O    2  
ATOM 3157  C CB   . ALA A 1 79  ? 12.056  9.739   10.289  1.00 0.65  ? 79  ALA A CB   2  
ATOM 3158  H H    . ALA A 1 79  ? 12.923  8.833   8.067   1.00 0.45  ? 79  ALA A H    2  
ATOM 3159  H HA   . ALA A 1 79  ? 14.119  9.364   10.620  1.00 0.60  ? 79  ALA A HA   2  
ATOM 3160  H HB1  . ALA A 1 79  ? 12.248  10.699  9.834   1.00 1.28  ? 79  ALA A HB1  2  
ATOM 3161  H HB2  . ALA A 1 79  ? 11.828  9.876   11.336  1.00 1.20  ? 79  ALA A HB2  2  
ATOM 3162  H HB3  . ALA A 1 79  ? 11.219  9.270   9.796   1.00 1.18  ? 79  ALA A HB3  2  
ATOM 3163  N N    . GLY A 1 80  ? 12.963  6.457   10.075  1.00 0.41  ? 80  GLY A N    2  
ATOM 3164  C CA   . GLY A 1 80  ? 12.785  5.138   10.646  1.00 0.42  ? 80  GLY A CA   2  
ATOM 3165  C C    . GLY A 1 80  ? 14.027  4.664   11.371  1.00 0.46  ? 80  GLY A C    2  
ATOM 3166  O O    . GLY A 1 80  ? 13.942  3.968   12.384  1.00 0.60  ? 80  GLY A O    2  
ATOM 3167  H H    . GLY A 1 80  ? 13.014  6.566   9.100   1.00 0.46  ? 80  GLY A H    2  
ATOM 3168  H HA2  . GLY A 1 80  ? 11.959  5.166   11.344  1.00 0.51  ? 80  GLY A HA2  2  
ATOM 3169  H HA3  . GLY A 1 80  ? 12.555  4.441   9.855   1.00 0.43  ? 80  GLY A HA3  2  
ATOM 3170  N N    . GLY A 1 81  ? 15.184  5.066   10.862  1.00 0.49  ? 81  GLY A N    2  
ATOM 3171  C CA   . GLY A 1 81  ? 16.441  4.666   11.459  1.00 0.63  ? 81  GLY A CA   2  
ATOM 3172  C C    . GLY A 1 81  ? 17.137  3.588   10.657  1.00 0.64  ? 81  GLY A C    2  
ATOM 3173  O O    . GLY A 1 81  ? 17.625  3.845   9.555   1.00 1.10  ? 81  GLY A O    2  
ATOM 3174  H H    . GLY A 1 81  ? 15.183  5.648   10.072  1.00 0.51  ? 81  GLY A H    2  
ATOM 3175  H HA2  . GLY A 1 81  ? 17.088  5.528   11.524  1.00 0.75  ? 81  GLY A HA2  2  
ATOM 3176  H HA3  . GLY A 1 81  ? 16.253  4.295   12.457  1.00 0.70  ? 81  GLY A HA3  2  
ATOM 3177  N N    . ASP A 1 82  ? 17.172  2.379   11.198  1.00 0.43  ? 82  ASP A N    2  
ATOM 3178  C CA   . ASP A 1 82  ? 17.819  1.259   10.530  1.00 0.44  ? 82  ASP A CA   2  
ATOM 3179  C C    . ASP A 1 82  ? 16.768  0.371   9.891   1.00 0.39  ? 82  ASP A C    2  
ATOM 3180  O O    . ASP A 1 82  ? 17.041  -0.351  8.945   1.00 0.55  ? 82  ASP A O    2  
ATOM 3181  C CB   . ASP A 1 82  ? 18.655  0.451   11.527  1.00 0.55  ? 82  ASP A CB   2  
ATOM 3182  C CG   . ASP A 1 82  ? 19.647  -0.482  10.867  1.00 1.41  ? 82  ASP A CG   2  
ATOM 3183  O OD1  . ASP A 1 82  ? 20.771  -0.028  10.542  1.00 1.97  ? 82  ASP A OD1  2  
ATOM 3184  O OD2  . ASP A 1 82  ? 19.336  -1.678  10.715  1.00 2.12  ? 82  ASP A OD2  2  
ATOM 3185  H H    . ASP A 1 82  ? 16.739  2.232   12.072  1.00 0.64  ? 82  ASP A H    2  
ATOM 3186  H HA   . ASP A 1 82  ? 18.465  1.654   9.757   1.00 0.51  ? 82  ASP A HA   2  
ATOM 3187  H HB2  . ASP A 1 82  ? 19.205  1.129   12.156  1.00 0.96  ? 82  ASP A HB2  2  
ATOM 3188  H HB3  . ASP A 1 82  ? 17.991  -0.141  12.135  1.00 0.95  ? 82  ASP A HB3  2  
ATOM 3189  N N    . GLU A 1 83  ? 15.559  0.429   10.414  1.00 0.38  ? 83  GLU A N    2  
ATOM 3190  C CA   . GLU A 1 83  ? 14.464  -0.324  9.837   1.00 0.39  ? 83  GLU A CA   2  
ATOM 3191  C C    . GLU A 1 83  ? 13.283  0.590   9.551   1.00 0.38  ? 83  GLU A C    2  
ATOM 3192  O O    . GLU A 1 83  ? 13.161  1.671   10.131  1.00 0.53  ? 83  GLU A O    2  
ATOM 3193  C CB   . GLU A 1 83  ? 14.067  -1.495  10.746  1.00 0.47  ? 83  GLU A CB   2  
ATOM 3194  C CG   . GLU A 1 83  ? 13.617  -1.101  12.144  1.00 0.86  ? 83  GLU A CG   2  
ATOM 3195  C CD   . GLU A 1 83  ? 12.118  -0.874  12.247  1.00 1.62  ? 83  GLU A CD   2  
ATOM 3196  O OE1  . GLU A 1 83  ? 11.344  -1.809  11.947  1.00 2.11  ? 83  GLU A OE1  2  
ATOM 3197  O OE2  . GLU A 1 83  ? 11.709  0.230   12.655  1.00 2.00  ? 83  GLU A OE2  2  
ATOM 3198  H H    . GLU A 1 83  ? 15.396  0.995   11.200  1.00 0.49  ? 83  GLU A H    2  
ATOM 3199  H HA   . GLU A 1 83  ? 14.814  -0.725  8.896   1.00 0.42  ? 83  GLU A HA   2  
ATOM 3200  H HB2  . GLU A 1 83  ? 13.257  -2.034  10.277  1.00 0.89  ? 83  GLU A HB2  2  
ATOM 3201  H HB3  . GLU A 1 83  ? 14.914  -2.157  10.841  1.00 0.82  ? 83  GLU A HB3  2  
ATOM 3202  H HG2  . GLU A 1 83  ? 13.898  -1.888  12.826  1.00 1.20  ? 83  GLU A HG2  2  
ATOM 3203  H HG3  . GLU A 1 83  ? 14.124  -0.189  12.424  1.00 1.09  ? 83  GLU A HG3  2  
ATOM 3204  N N    . THR A 1 84  ? 12.436  0.167   8.637   1.00 0.27  ? 84  THR A N    2  
ATOM 3205  C CA   . THR A 1 84  ? 11.287  0.951   8.243   1.00 0.26  ? 84  THR A CA   2  
ATOM 3206  C C    . THR A 1 84  ? 10.132  0.029   7.880   1.00 0.22  ? 84  THR A C    2  
ATOM 3207  O O    . THR A 1 84  ? 10.344  -1.106  7.435   1.00 0.21  ? 84  THR A O    2  
ATOM 3208  C CB   . THR A 1 84  ? 11.624  1.887   7.057   1.00 0.30  ? 84  THR A CB   2  
ATOM 3209  O OG1  . THR A 1 84  ? 10.540  2.791   6.808   1.00 0.32  ? 84  THR A OG1  2  
ATOM 3210  C CG2  . THR A 1 84  ? 11.924  1.094   5.792   1.00 0.30  ? 84  THR A CG2  2  
ATOM 3211  H H    . THR A 1 84  ? 12.586  -0.708  8.212   1.00 0.23  ? 84  THR A H    2  
ATOM 3212  H HA   . THR A 1 84  ? 10.993  1.561   9.086   1.00 0.30  ? 84  THR A HA   2  
ATOM 3213  H HB   . THR A 1 84  ? 12.503  2.460   7.315   1.00 0.36  ? 84  THR A HB   2  
ATOM 3214  H HG1  . THR A 1 84  ? 10.038  2.926   7.622   1.00 0.60  ? 84  THR A HG1  2  
ATOM 3215  H HG21 . THR A 1 84  ? 11.055  0.514   5.514   1.00 1.03  ? 84  THR A HG21 2  
ATOM 3216  H HG22 . THR A 1 84  ? 12.756  0.427   5.974   1.00 1.05  ? 84  THR A HG22 2  
ATOM 3217  H HG23 . THR A 1 84  ? 12.176  1.773   4.991   1.00 1.09  ? 84  THR A HG23 2  
ATOM 3218  N N    . LYS A 1 85  ? 8.919   0.496   8.107   1.00 0.24  ? 85  LYS A N    2  
ATOM 3219  C CA   . LYS A 1 85  ? 7.740   -0.291  7.811   1.00 0.23  ? 85  LYS A CA   2  
ATOM 3220  C C    . LYS A 1 85  ? 6.946   0.367   6.698   1.00 0.23  ? 85  LYS A C    2  
ATOM 3221  O O    . LYS A 1 85  ? 6.440   1.478   6.851   1.00 0.26  ? 85  LYS A O    2  
ATOM 3222  C CB   . LYS A 1 85  ? 6.883   -0.443  9.067   1.00 0.28  ? 85  LYS A CB   2  
ATOM 3223  C CG   . LYS A 1 85  ? 7.623   -1.119  10.207  1.00 0.37  ? 85  LYS A CG   2  
ATOM 3224  C CD   . LYS A 1 85  ? 6.816   -1.114  11.490  1.00 0.50  ? 85  LYS A CD   2  
ATOM 3225  C CE   . LYS A 1 85  ? 7.575   -1.778  12.627  1.00 0.78  ? 85  LYS A CE   2  
ATOM 3226  N NZ   . LYS A 1 85  ? 8.874   -1.106  12.913  1.00 1.63  ? 85  LYS A NZ   2  
ATOM 3227  H H    . LYS A 1 85  ? 8.814   1.406   8.469   1.00 0.27  ? 85  LYS A H    2  
ATOM 3228  H HA   . LYS A 1 85  ? 8.064   -1.268  7.483   1.00 0.22  ? 85  LYS A HA   2  
ATOM 3229  H HB2  . LYS A 1 85  ? 6.568   0.535   9.397   1.00 0.34  ? 85  LYS A HB2  2  
ATOM 3230  H HB3  . LYS A 1 85  ? 6.012   -1.034  8.829   1.00 0.36  ? 85  LYS A HB3  2  
ATOM 3231  H HG2  . LYS A 1 85  ? 7.828   -2.142  9.930   1.00 0.55  ? 85  LYS A HG2  2  
ATOM 3232  H HG3  . LYS A 1 85  ? 8.554   -0.598  10.377  1.00 0.55  ? 85  LYS A HG3  2  
ATOM 3233  H HD2  . LYS A 1 85  ? 6.598   -0.094  11.763  1.00 0.71  ? 85  LYS A HD2  2  
ATOM 3234  H HD3  . LYS A 1 85  ? 5.893   -1.650  11.324  1.00 0.72  ? 85  LYS A HD3  2  
ATOM 3235  H HE2  . LYS A 1 85  ? 6.962   -1.747  13.515  1.00 1.42  ? 85  LYS A HE2  2  
ATOM 3236  H HE3  . LYS A 1 85  ? 7.765   -2.808  12.360  1.00 1.22  ? 85  LYS A HE3  2  
ATOM 3237  H HZ1  . LYS A 1 85  ? 9.599   -1.395  12.218  1.00 2.25  ? 85  LYS A HZ1  2  
ATOM 3238  H HZ2  . LYS A 1 85  ? 9.207   -1.362  13.867  1.00 1.97  ? 85  LYS A HZ2  2  
ATOM 3239  H HZ3  . LYS A 1 85  ? 8.761   -0.069  12.865  1.00 2.17  ? 85  LYS A HZ3  2  
ATOM 3240  N N    . LEU A 1 86  ? 6.832   -0.329  5.585   1.00 0.22  ? 86  LEU A N    2  
ATOM 3241  C CA   . LEU A 1 86  ? 6.180   0.214   4.410   1.00 0.22  ? 86  LEU A CA   2  
ATOM 3242  C C    . LEU A 1 86  ? 4.852   -0.479  4.169   1.00 0.22  ? 86  LEU A C    2  
ATOM 3243  O O    . LEU A 1 86  ? 4.742   -1.700  4.281   1.00 0.27  ? 86  LEU A O    2  
ATOM 3244  C CB   . LEU A 1 86  ? 7.078   0.063   3.178   1.00 0.24  ? 86  LEU A CB   2  
ATOM 3245  C CG   . LEU A 1 86  ? 8.426   0.789   3.252   1.00 0.25  ? 86  LEU A CG   2  
ATOM 3246  C CD1  . LEU A 1 86  ? 9.227   0.549   1.982   1.00 0.28  ? 86  LEU A CD1  2  
ATOM 3247  C CD2  . LEU A 1 86  ? 8.219   2.279   3.481   1.00 0.28  ? 86  LEU A CD2  2  
ATOM 3248  H H    . LEU A 1 86  ? 7.183   -1.249  5.555   1.00 0.22  ? 86  LEU A H    2  
ATOM 3249  H HA   . LEU A 1 86  ? 6.000   1.264   4.586   1.00 0.23  ? 86  LEU A HA   2  
ATOM 3250  H HB2  . LEU A 1 86  ? 7.268   -0.990  3.026   1.00 0.24  ? 86  LEU A HB2  2  
ATOM 3251  H HB3  . LEU A 1 86  ? 6.541   0.440   2.322   1.00 0.25  ? 86  LEU A HB3  2  
ATOM 3252  H HG   . LEU A 1 86  ? 8.993   0.397   4.085   1.00 0.26  ? 86  LEU A HG   2  
ATOM 3253  H HD11 . LEU A 1 86  ? 10.172  1.070   2.047   1.00 1.02  ? 86  LEU A HD11 2  
ATOM 3254  H HD12 . LEU A 1 86  ? 8.672   0.917   1.132   1.00 0.97  ? 86  LEU A HD12 2  
ATOM 3255  H HD13 . LEU A 1 86  ? 9.408   -0.510  1.863   1.00 1.02  ? 86  LEU A HD13 2  
ATOM 3256  H HD21 . LEU A 1 86  ? 7.703   2.431   4.418   1.00 1.04  ? 86  LEU A HD21 2  
ATOM 3257  H HD22 . LEU A 1 86  ? 7.629   2.687   2.674   1.00 1.00  ? 86  LEU A HD22 2  
ATOM 3258  H HD23 . LEU A 1 86  ? 9.177   2.776   3.512   1.00 1.03  ? 86  LEU A HD23 2  
ATOM 3259  N N    . LEU A 1 87  ? 3.846   0.307   3.853   1.00 0.20  ? 87  LEU A N    2  
ATOM 3260  C CA   . LEU A 1 87  ? 2.550   -0.228  3.497   1.00 0.21  ? 87  LEU A CA   2  
ATOM 3261  C C    . LEU A 1 87  ? 2.360   -0.116  2.000   1.00 0.21  ? 87  LEU A C    2  
ATOM 3262  O O    . LEU A 1 87  ? 2.490   0.969   1.439   1.00 0.26  ? 87  LEU A O    2  
ATOM 3263  C CB   . LEU A 1 87  ? 1.434   0.522   4.218   1.00 0.27  ? 87  LEU A CB   2  
ATOM 3264  C CG   . LEU A 1 87  ? 0.025   0.074   3.845   1.00 0.39  ? 87  LEU A CG   2  
ATOM 3265  C CD1  . LEU A 1 87  ? -0.169  -1.384  4.198   1.00 0.51  ? 87  LEU A CD1  2  
ATOM 3266  C CD2  . LEU A 1 87  ? -1.010  0.936   4.537   1.00 0.45  ? 87  LEU A CD2  2  
ATOM 3267  H H    . LEU A 1 87  ? 3.977   1.283   3.858   1.00 0.20  ? 87  LEU A H    2  
ATOM 3268  H HA   . LEU A 1 87  ? 2.524   -1.270  3.779   1.00 0.23  ? 87  LEU A HA   2  
ATOM 3269  H HB2  . LEU A 1 87  ? 1.567   0.386   5.282   1.00 0.29  ? 87  LEU A HB2  2  
ATOM 3270  H HB3  . LEU A 1 87  ? 1.527   1.575   3.991   1.00 0.27  ? 87  LEU A HB3  2  
ATOM 3271  H HG   . LEU A 1 87  ? -0.113  0.175   2.779   1.00 0.63  ? 87  LEU A HG   2  
ATOM 3272  H HD11 . LEU A 1 87  ? -1.172  -1.684  3.942   1.00 1.22  ? 87  LEU A HD11 2  
ATOM 3273  H HD12 . LEU A 1 87  ? -0.010  -1.522  5.258   1.00 1.05  ? 87  LEU A HD12 2  
ATOM 3274  H HD13 . LEU A 1 87  ? 0.540   -1.984  3.647   1.00 1.12  ? 87  LEU A HD13 2  
ATOM 3275  H HD21 . LEU A 1 87  ? -0.874  1.966   4.244   1.00 1.05  ? 87  LEU A HD21 2  
ATOM 3276  H HD22 . LEU A 1 87  ? -0.894  0.848   5.608   1.00 1.12  ? 87  LEU A HD22 2  
ATOM 3277  H HD23 . LEU A 1 87  ? -2.000  0.610   4.255   1.00 1.19  ? 87  LEU A HD23 2  
ATOM 3278  N N    . VAL A 1 88  ? 2.064   -1.228  1.355   1.00 0.20  ? 88  VAL A N    2  
ATOM 3279  C CA   . VAL A 1 88  ? 1.931   -1.240  -0.090  1.00 0.23  ? 88  VAL A CA   2  
ATOM 3280  C C    . VAL A 1 88  ? 0.702   -2.023  -0.523  1.00 0.24  ? 88  VAL A C    2  
ATOM 3281  O O    . VAL A 1 88  ? 0.234   -2.921  0.184   1.00 0.27  ? 88  VAL A O    2  
ATOM 3282  C CB   . VAL A 1 88  ? 3.187   -1.811  -0.786  1.00 0.28  ? 88  VAL A CB   2  
ATOM 3283  C CG1  . VAL A 1 88  ? 4.343   -0.826  -0.699  1.00 0.31  ? 88  VAL A CG1  2  
ATOM 3284  C CG2  . VAL A 1 88  ? 3.589   -3.146  -0.180  1.00 0.33  ? 88  VAL A CG2  2  
ATOM 3285  H H    . VAL A 1 88  ? 1.910   -2.058  1.863   1.00 0.20  ? 88  VAL A H    2  
ATOM 3286  H HA   . VAL A 1 88  ? 1.812   -0.214  -0.411  1.00 0.26  ? 88  VAL A HA   2  
ATOM 3287  H HB   . VAL A 1 88  ? 2.955   -1.967  -1.828  1.00 0.32  ? 88  VAL A HB   2  
ATOM 3288  H HG11 . VAL A 1 88  ? 4.574   -0.634  0.339   1.00 1.05  ? 88  VAL A HG11 2  
ATOM 3289  H HG12 . VAL A 1 88  ? 4.066   0.098   -1.183  1.00 1.02  ? 88  VAL A HG12 2  
ATOM 3290  H HG13 . VAL A 1 88  ? 5.211   -1.244  -1.190  1.00 1.03  ? 88  VAL A HG13 2  
ATOM 3291  H HG21 . VAL A 1 88  ? 2.783   -3.854  -0.302  1.00 1.07  ? 88  VAL A HG21 2  
ATOM 3292  H HG22 . VAL A 1 88  ? 3.797   -3.015  0.872   1.00 1.02  ? 88  VAL A HG22 2  
ATOM 3293  H HG23 . VAL A 1 88  ? 4.472   -3.516  -0.679  1.00 1.09  ? 88  VAL A HG23 2  
ATOM 3294  N N    . VAL A 1 89  ? 0.165   -1.645  -1.672  1.00 0.24  ? 89  VAL A N    2  
ATOM 3295  C CA   . VAL A 1 89  ? -0.994  -2.304  -2.243  1.00 0.27  ? 89  VAL A CA   2  
ATOM 3296  C C    . VAL A 1 89  ? -0.736  -2.646  -3.703  1.00 0.34  ? 89  VAL A C    2  
ATOM 3297  O O    . VAL A 1 89  ? 0.039   -1.967  -4.379  1.00 0.42  ? 89  VAL A O    2  
ATOM 3298  C CB   . VAL A 1 89  ? -2.258  -1.420  -2.141  1.00 0.25  ? 89  VAL A CB   2  
ATOM 3299  C CG1  . VAL A 1 89  ? -2.714  -1.293  -0.696  1.00 0.29  ? 89  VAL A CG1  2  
ATOM 3300  C CG2  . VAL A 1 89  ? -2.006  -0.042  -2.735  1.00 0.30  ? 89  VAL A CG2  2  
ATOM 3301  H H    . VAL A 1 89  ? 0.566   -0.892  -2.157  1.00 0.26  ? 89  VAL A H    2  
ATOM 3302  H HA   . VAL A 1 89  ? -1.169  -3.217  -1.692  1.00 0.32  ? 89  VAL A HA   2  
ATOM 3303  H HB   . VAL A 1 89  ? -3.049  -1.891  -2.704  1.00 0.28  ? 89  VAL A HB   2  
ATOM 3304  H HG11 . VAL A 1 89  ? -1.935  -0.828  -0.110  1.00 1.04  ? 89  VAL A HG11 2  
ATOM 3305  H HG12 . VAL A 1 89  ? -2.926  -2.274  -0.299  1.00 1.07  ? 89  VAL A HG12 2  
ATOM 3306  H HG13 . VAL A 1 89  ? -3.607  -0.687  -0.653  1.00 1.01  ? 89  VAL A HG13 2  
ATOM 3307  H HG21 . VAL A 1 89  ? -2.893  0.565   -2.626  1.00 1.03  ? 89  VAL A HG21 2  
ATOM 3308  H HG22 . VAL A 1 89  ? -1.765  -0.139  -3.782  1.00 1.08  ? 89  VAL A HG22 2  
ATOM 3309  H HG23 . VAL A 1 89  ? -1.181  0.428   -2.218  1.00 1.05  ? 89  VAL A HG23 2  
ATOM 3310  N N    . ASP A 1 90  ? -1.374  -3.707  -4.173  1.00 0.41  ? 90  ASP A N    2  
ATOM 3311  C CA   . ASP A 1 90  ? -1.254  -4.132  -5.562  1.00 0.51  ? 90  ASP A CA   2  
ATOM 3312  C C    . ASP A 1 90  ? -2.328  -3.453  -6.393  1.00 0.48  ? 90  ASP A C    2  
ATOM 3313  O O    . ASP A 1 90  ? -3.180  -2.763  -5.843  1.00 0.45  ? 90  ASP A O    2  
ATOM 3314  C CB   . ASP A 1 90  ? -1.407  -5.647  -5.678  1.00 0.68  ? 90  ASP A CB   2  
ATOM 3315  C CG   . ASP A 1 90  ? -2.801  -6.098  -5.304  1.00 1.20  ? 90  ASP A CG   2  
ATOM 3316  O OD1  . ASP A 1 90  ? -3.112  -6.114  -4.096  1.00 1.92  ? 90  ASP A OD1  2  
ATOM 3317  O OD2  . ASP A 1 90  ? -3.590  -6.413  -6.216  1.00 1.86  ? 90  ASP A OD2  2  
ATOM 3318  H H    . ASP A 1 90  ? -1.958  -4.216  -3.572  1.00 0.44  ? 90  ASP A H    2  
ATOM 3319  H HA   . ASP A 1 90  ? -0.281  -3.838  -5.927  1.00 0.59  ? 90  ASP A HA   2  
ATOM 3320  H HB2  . ASP A 1 90  ? -1.208  -5.950  -6.695  1.00 1.54  ? 90  ASP A HB2  2  
ATOM 3321  H HB3  . ASP A 1 90  ? -0.702  -6.128  -5.015  1.00 1.21  ? 90  ASP A HB3  2  
ATOM 3322  N N    . ARG A 1 91  ? -2.305  -3.676  -7.701  1.00 0.57  ? 91  ARG A N    2  
ATOM 3323  C CA   . ARG A 1 91  ? -3.214  -2.997  -8.624  1.00 0.61  ? 91  ARG A CA   2  
ATOM 3324  C C    . ARG A 1 91  ? -4.679  -3.154  -8.213  1.00 0.55  ? 91  ARG A C    2  
ATOM 3325  O O    . ARG A 1 91  ? -5.405  -2.166  -8.120  1.00 0.55  ? 91  ARG A O    2  
ATOM 3326  C CB   . ARG A 1 91  ? -3.021  -3.538  -10.042 1.00 0.75  ? 91  ARG A CB   2  
ATOM 3327  C CG   . ARG A 1 91  ? -3.972  -2.932  -11.061 1.00 0.82  ? 91  ARG A CG   2  
ATOM 3328  C CD   . ARG A 1 91  ? -3.813  -3.583  -12.421 1.00 1.44  ? 91  ARG A CD   2  
ATOM 3329  N NE   . ARG A 1 91  ? -4.779  -3.075  -13.393 1.00 2.25  ? 91  ARG A NE   2  
ATOM 3330  C CZ   . ARG A 1 91  ? -5.529  -3.857  -14.171 1.00 3.13  ? 91  ARG A CZ   2  
ATOM 3331  N NH1  . ARG A 1 91  ? -5.459  -5.179  -14.061 1.00 3.39  ? 91  ARG A NH1  2  
ATOM 3332  N NH2  . ARG A 1 91  ? -6.358  -3.322  -15.057 1.00 4.16  ? 91  ARG A NH2  2  
ATOM 3333  H H    . ARG A 1 91  ? -1.657  -4.315  -8.059  1.00 0.66  ? 91  ARG A H    2  
ATOM 3334  H HA   . ARG A 1 91  ? -2.963  -1.947  -8.617  1.00 0.63  ? 91  ARG A HA   2  
ATOM 3335  H HB2  . ARG A 1 91  ? -2.009  -3.334  -10.359 1.00 0.85  ? 91  ARG A HB2  2  
ATOM 3336  H HB3  . ARG A 1 91  ? -3.175  -4.607  -10.030 1.00 0.78  ? 91  ARG A HB3  2  
ATOM 3337  H HG2  . ARG A 1 91  ? -4.987  -3.075  -10.721 1.00 1.07  ? 91  ARG A HG2  2  
ATOM 3338  H HG3  . ARG A 1 91  ? -3.765  -1.876  -11.150 1.00 1.01  ? 91  ARG A HG3  2  
ATOM 3339  H HD2  . ARG A 1 91  ? -2.815  -3.386  -12.784 1.00 1.95  ? 91  ARG A HD2  2  
ATOM 3340  H HD3  . ARG A 1 91  ? -3.951  -4.649  -12.313 1.00 1.87  ? 91  ARG A HD3  2  
ATOM 3341  H HE   . ARG A 1 91  ? -4.863  -2.092  -13.474 1.00 2.59  ? 91  ARG A HE   2  
ATOM 3342  H HH11 . ARG A 1 91  ? -4.838  -5.602  -13.387 1.00 3.07  ? 91  ARG A HH11 2  
ATOM 3343  H HH12 . ARG A 1 91  ? -6.028  -5.764  -14.643 1.00 4.20  ? 91  ARG A HH12 2  
ATOM 3344  H HH21 . ARG A 1 91  ? -6.429  -2.316  -15.151 1.00 4.40  ? 91  ARG A HH21 2  
ATOM 3345  H HH22 . ARG A 1 91  ? -6.932  -3.918  -15.639 1.00 4.87  ? 91  ARG A HH22 2  
ATOM 3346  N N    . GLU A 1 92  ? -5.099  -4.382  -7.925  1.00 0.57  ? 92  GLU A N    2  
ATOM 3347  C CA   . GLU A 1 92  ? -6.503  -4.654  -7.616  1.00 0.61  ? 92  GLU A CA   2  
ATOM 3348  C C    . GLU A 1 92  ? -6.931  -3.946  -6.338  1.00 0.51  ? 92  GLU A C    2  
ATOM 3349  O O    . GLU A 1 92  ? -8.003  -3.343  -6.277  1.00 0.56  ? 92  GLU A O    2  
ATOM 3350  C CB   . GLU A 1 92  ? -6.742  -6.161  -7.481  1.00 0.74  ? 92  GLU A CB   2  
ATOM 3351  C CG   . GLU A 1 92  ? -7.104  -6.851  -8.789  1.00 1.44  ? 92  GLU A CG   2  
ATOM 3352  C CD   . GLU A 1 92  ? -6.130  -6.557  -9.913  1.00 1.98  ? 92  GLU A CD   2  
ATOM 3353  O OE1  . GLU A 1 92  ? -4.973  -7.029  -9.849  1.00 2.26  ? 92  GLU A OE1  2  
ATOM 3354  O OE2  . GLU A 1 92  ? -6.521  -5.868  -10.876 1.00 2.68  ? 92  GLU A OE2  2  
ATOM 3355  H H    . GLU A 1 92  ? -4.451  -5.122  -7.907  1.00 0.59  ? 92  GLU A H    2  
ATOM 3356  H HA   . GLU A 1 92  ? -7.098  -4.279  -8.434  1.00 0.67  ? 92  GLU A HA   2  
ATOM 3357  H HB2  . GLU A 1 92  ? -5.847  -6.623  -7.094  1.00 1.34  ? 92  GLU A HB2  2  
ATOM 3358  H HB3  . GLU A 1 92  ? -7.550  -6.322  -6.781  1.00 1.23  ? 92  GLU A HB3  2  
ATOM 3359  H HG2  . GLU A 1 92  ? -7.123  -7.919  -8.624  1.00 1.97  ? 92  GLU A HG2  2  
ATOM 3360  H HG3  . GLU A 1 92  ? -8.088  -6.521  -9.091  1.00 1.93  ? 92  GLU A HG3  2  
ATOM 3361  N N    . THR A 1 93  ? -6.074  -3.999  -5.333  1.00 0.44  ? 93  THR A N    2  
ATOM 3362  C CA   . THR A 1 93  ? -6.347  -3.354  -4.060  1.00 0.38  ? 93  THR A CA   2  
ATOM 3363  C C    . THR A 1 93  ? -6.259  -1.832  -4.194  1.00 0.33  ? 93  THR A C    2  
ATOM 3364  O O    . THR A 1 93  ? -7.089  -1.092  -3.660  1.00 0.37  ? 93  THR A O    2  
ATOM 3365  C CB   . THR A 1 93  ? -5.346  -3.841  -3.002  1.00 0.36  ? 93  THR A CB   2  
ATOM 3366  O OG1  . THR A 1 93  ? -5.347  -5.275  -2.962  1.00 0.47  ? 93  THR A OG1  2  
ATOM 3367  C CG2  . THR A 1 93  ? -5.694  -3.298  -1.628  1.00 0.36  ? 93  THR A CG2  2  
ATOM 3368  H H    . THR A 1 93  ? -5.239  -4.502  -5.443  1.00 0.45  ? 93  THR A H    2  
ATOM 3369  H HA   . THR A 1 93  ? -7.343  -3.629  -3.745  1.00 0.45  ? 93  THR A HA   2  
ATOM 3370  H HB   . THR A 1 93  ? -4.360  -3.491  -3.277  1.00 0.33  ? 93  THR A HB   2  
ATOM 3371  H HG1  . THR A 1 93  ? -4.550  -5.617  -3.405  1.00 0.82  ? 93  THR A HG1  2  
ATOM 3372  H HG21 . THR A 1 93  ? -6.675  -3.646  -1.343  1.00 1.00  ? 93  THR A HG21 2  
ATOM 3373  H HG22 . THR A 1 93  ? -5.688  -2.218  -1.655  1.00 1.04  ? 93  THR A HG22 2  
ATOM 3374  H HG23 . THR A 1 93  ? -4.965  -3.644  -0.909  1.00 1.08  ? 93  THR A HG23 2  
ATOM 3375  N N    . ASP A 1 94  ? -5.261  -1.381  -4.941  1.00 0.33  ? 94  ASP A N    2  
ATOM 3376  C CA   . ASP A 1 94  ? -5.002  0.042   -5.135  1.00 0.39  ? 94  ASP A CA   2  
ATOM 3377  C C    . ASP A 1 94  ? -6.149  0.711   -5.889  1.00 0.43  ? 94  ASP A C    2  
ATOM 3378  O O    . ASP A 1 94  ? -6.539  1.833   -5.575  1.00 0.50  ? 94  ASP A O    2  
ATOM 3379  C CB   . ASP A 1 94  ? -3.676  0.225   -5.884  1.00 0.48  ? 94  ASP A CB   2  
ATOM 3380  C CG   . ASP A 1 94  ? -3.305  1.676   -6.109  1.00 0.71  ? 94  ASP A CG   2  
ATOM 3381  O OD1  . ASP A 1 94  ? -3.460  2.483   -5.168  1.00 0.77  ? 94  ASP A OD1  2  
ATOM 3382  O OD2  . ASP A 1 94  ? -2.838  2.014   -7.213  1.00 1.18  ? 94  ASP A OD2  2  
ATOM 3383  H H    . ASP A 1 94  ? -4.667  -2.033  -5.381  1.00 0.34  ? 94  ASP A H    2  
ATOM 3384  H HA   . ASP A 1 94  ? -4.917  0.499   -4.160  1.00 0.43  ? 94  ASP A HA   2  
ATOM 3385  H HB2  . ASP A 1 94  ? -2.885  -0.238  -5.314  1.00 0.48  ? 94  ASP A HB2  2  
ATOM 3386  H HB3  . ASP A 1 94  ? -3.746  -0.261  -6.846  1.00 0.53  ? 94  ASP A HB3  2  
ATOM 3387  N N    . GLU A 1 95  ? -6.698  0.018   -6.881  1.00 0.43  ? 95  GLU A N    2  
ATOM 3388  C CA   . GLU A 1 95  ? -7.842  0.535   -7.629  1.00 0.49  ? 95  GLU A CA   2  
ATOM 3389  C C    . GLU A 1 95  ? -9.105  0.488   -6.772  1.00 0.45  ? 95  GLU A C    2  
ATOM 3390  O O    . GLU A 1 95  ? -9.952  1.380   -6.845  1.00 0.50  ? 95  GLU A O    2  
ATOM 3391  C CB   . GLU A 1 95  ? -8.056  -0.271  -8.915  1.00 0.60  ? 95  GLU A CB   2  
ATOM 3392  C CG   . GLU A 1 95  ? -6.887  -0.211  -9.890  1.00 0.72  ? 95  GLU A CG   2  
ATOM 3393  C CD   . GLU A 1 95  ? -6.724  1.141   -10.552 1.00 1.17  ? 95  GLU A CD   2  
ATOM 3394  O OE1  . GLU A 1 95  ? -6.400  2.117   -9.845  1.00 1.94  ? 95  GLU A OE1  2  
ATOM 3395  O OE2  . GLU A 1 95  ? -6.941  1.249   -11.776 1.00 1.23  ? 95  GLU A OE2  2  
ATOM 3396  H H    . GLU A 1 95  ? -6.324  -0.861  -7.119  1.00 0.44  ? 95  GLU A H    2  
ATOM 3397  H HA   . GLU A 1 95  ? -7.634  1.565   -7.886  1.00 0.54  ? 95  GLU A HA   2  
ATOM 3398  H HB2  . GLU A 1 95  ? -8.221  -1.305  -8.652  1.00 0.60  ? 95  GLU A HB2  2  
ATOM 3399  H HB3  . GLU A 1 95  ? -8.933  0.107   -9.417  1.00 0.66  ? 95  GLU A HB3  2  
ATOM 3400  H HG2  . GLU A 1 95  ? -5.979  -0.439  -9.353  1.00 1.08  ? 95  GLU A HG2  2  
ATOM 3401  H HG3  . GLU A 1 95  ? -7.042  -0.954  -10.659 1.00 1.05  ? 95  GLU A HG3  2  
ATOM 3402  N N    . PHE A 1 96  ? -9.211  -0.552  -5.947  1.00 0.41  ? 96  PHE A N    2  
ATOM 3403  C CA   . PHE A 1 96  ? -10.370 -0.735  -5.075  1.00 0.41  ? 96  PHE A CA   2  
ATOM 3404  C C    . PHE A 1 96  ? -10.479 0.402   -4.065  1.00 0.36  ? 96  PHE A C    2  
ATOM 3405  O O    . PHE A 1 96  ? -11.548 0.987   -3.886  1.00 0.40  ? 96  PHE A O    2  
ATOM 3406  C CB   . PHE A 1 96  ? -10.268 -2.082  -4.347  1.00 0.44  ? 96  PHE A CB   2  
ATOM 3407  C CG   . PHE A 1 96  ? -11.383 -2.341  -3.372  1.00 0.51  ? 96  PHE A CG   2  
ATOM 3408  C CD1  . PHE A 1 96  ? -12.649 -2.677  -3.820  1.00 0.63  ? 96  PHE A CD1  2  
ATOM 3409  C CD2  . PHE A 1 96  ? -11.160 -2.255  -2.006  1.00 0.52  ? 96  PHE A CD2  2  
ATOM 3410  C CE1  . PHE A 1 96  ? -13.672 -2.923  -2.926  1.00 0.73  ? 96  PHE A CE1  2  
ATOM 3411  C CE2  . PHE A 1 96  ? -12.180 -2.498  -1.107  1.00 0.62  ? 96  PHE A CE2  2  
ATOM 3412  C CZ   . PHE A 1 96  ? -13.438 -2.832  -1.567  1.00 0.72  ? 96  PHE A CZ   2  
ATOM 3413  H H    . PHE A 1 96  ? -8.493  -1.221  -5.929  1.00 0.41  ? 96  PHE A H    2  
ATOM 3414  H HA   . PHE A 1 96  ? -11.254 -0.736  -5.695  1.00 0.46  ? 96  PHE A HA   2  
ATOM 3415  H HB2  . PHE A 1 96  ? -10.278 -2.877  -5.077  1.00 0.49  ? 96  PHE A HB2  2  
ATOM 3416  H HB3  . PHE A 1 96  ? -9.336  -2.115  -3.802  1.00 0.41  ? 96  PHE A HB3  2  
ATOM 3417  H HD1  . PHE A 1 96  ? -12.832 -2.748  -4.882  1.00 0.67  ? 96  PHE A HD1  2  
ATOM 3418  H HD2  . PHE A 1 96  ? -10.175 -1.994  -1.647  1.00 0.48  ? 96  PHE A HD2  2  
ATOM 3419  H HE1  . PHE A 1 96  ? -14.655 -3.185  -3.288  1.00 0.83  ? 96  PHE A HE1  2  
ATOM 3420  H HE2  . PHE A 1 96  ? -11.993 -2.425  -0.046  1.00 0.66  ? 96  PHE A HE2  2  
ATOM 3421  H HZ   . PHE A 1 96  ? -14.237 -3.024  -0.866  1.00 0.81  ? 96  PHE A HZ   2  
ATOM 3422  N N    . PHE A 1 97  ? -9.369  0.717   -3.414  1.00 0.32  ? 97  PHE A N    2  
ATOM 3423  C CA   . PHE A 1 97  ? -9.337  1.801   -2.438  1.00 0.32  ? 97  PHE A CA   2  
ATOM 3424  C C    . PHE A 1 97  ? -9.609  3.159   -3.091  1.00 0.39  ? 97  PHE A C    2  
ATOM 3425  O O    . PHE A 1 97  ? -10.257 4.012   -2.483  1.00 0.44  ? 97  PHE A O    2  
ATOM 3426  C CB   . PHE A 1 97  ? -8.000  1.806   -1.688  1.00 0.30  ? 97  PHE A CB   2  
ATOM 3427  C CG   . PHE A 1 97  ? -7.982  0.892   -0.487  1.00 0.29  ? 97  PHE A CG   2  
ATOM 3428  C CD1  . PHE A 1 97  ? -8.400  1.354   0.751   1.00 0.38  ? 97  PHE A CD1  2  
ATOM 3429  C CD2  . PHE A 1 97  ? -7.552  -0.421  -0.594  1.00 0.37  ? 97  PHE A CD2  2  
ATOM 3430  C CE1  . PHE A 1 97  ? -8.389  0.527   1.859   1.00 0.41  ? 97  PHE A CE1  2  
ATOM 3431  C CE2  . PHE A 1 97  ? -7.537  -1.255  0.514   1.00 0.40  ? 97  PHE A CE2  2  
ATOM 3432  C CZ   . PHE A 1 97  ? -7.958  -0.779  1.742   1.00 0.35  ? 97  PHE A CZ   2  
ATOM 3433  H H    . PHE A 1 97  ? -8.546  0.199   -3.589  1.00 0.30  ? 97  PHE A H    2  
ATOM 3434  H HA   . PHE A 1 97  ? -10.131 1.616   -1.720  1.00 0.34  ? 97  PHE A HA   2  
ATOM 3435  H HB2  . PHE A 1 97  ? -7.219  1.483   -2.361  1.00 0.29  ? 97  PHE A HB2  2  
ATOM 3436  H HB3  . PHE A 1 97  ? -7.787  2.809   -1.351  1.00 0.35  ? 97  PHE A HB3  2  
ATOM 3437  H HD1  . PHE A 1 97  ? -8.732  2.376   0.846   1.00 0.53  ? 97  PHE A HD1  2  
ATOM 3438  H HD2  . PHE A 1 97  ? -7.223  -0.794  -1.553  1.00 0.50  ? 97  PHE A HD2  2  
ATOM 3439  H HE1  . PHE A 1 97  ? -8.719  0.903   2.815   1.00 0.55  ? 97  PHE A HE1  2  
ATOM 3440  H HE2  . PHE A 1 97  ? -7.200  -2.276  0.418   1.00 0.55  ? 97  PHE A HE2  2  
ATOM 3441  H HZ   . PHE A 1 97  ? -7.945  -1.424  2.612   1.00 0.40  ? 97  PHE A HZ   2  
ATOM 3442  N N    . LYS A 1 98  ? -9.125  3.359   -4.321  1.00 0.43  ? 98  LYS A N    2  
ATOM 3443  C CA   . LYS A 1 98  ? -9.335  4.630   -5.023  1.00 0.53  ? 98  LYS A CA   2  
ATOM 3444  C C    . LYS A 1 98  ? -10.817 4.946   -5.190  1.00 0.56  ? 98  LYS A C    2  
ATOM 3445  O O    . LYS A 1 98  ? -11.266 6.043   -4.855  1.00 0.61  ? 98  LYS A O    2  
ATOM 3446  C CB   . LYS A 1 98  ? -8.686  4.620   -6.406  1.00 0.63  ? 98  LYS A CB   2  
ATOM 3447  C CG   . LYS A 1 98  ? -7.173  4.694   -6.395  1.00 0.85  ? 98  LYS A CG   2  
ATOM 3448  C CD   . LYS A 1 98  ? -6.643  5.094   -7.762  1.00 1.13  ? 98  LYS A CD   2  
ATOM 3449  C CE   . LYS A 1 98  ? -5.196  4.691   -7.933  1.00 1.31  ? 98  LYS A CE   2  
ATOM 3450  N NZ   . LYS A 1 98  ? -5.049  3.219   -7.897  1.00 1.92  ? 98  LYS A NZ   2  
ATOM 3451  H H    . LYS A 1 98  ? -8.618  2.645   -4.763  1.00 0.41  ? 98  LYS A H    2  
ATOM 3452  H HA   . LYS A 1 98  ? -8.881  5.410   -4.432  1.00 0.56  ? 98  LYS A HA   2  
ATOM 3453  H HB2  . LYS A 1 98  ? -8.972  3.709   -6.911  1.00 0.80  ? 98  LYS A HB2  2  
ATOM 3454  H HB3  . LYS A 1 98  ? -9.061  5.459   -6.970  1.00 0.82  ? 98  LYS A HB3  2  
ATOM 3455  H HG2  . LYS A 1 98  ? -6.861  5.428   -5.668  1.00 1.09  ? 98  LYS A HG2  2  
ATOM 3456  H HG3  . LYS A 1 98  ? -6.774  3.725   -6.131  1.00 1.12  ? 98  LYS A HG3  2  
ATOM 3457  H HD2  . LYS A 1 98  ? -7.234  4.606   -8.524  1.00 1.77  ? 98  LYS A HD2  2  
ATOM 3458  H HD3  . LYS A 1 98  ? -6.727  6.165   -7.871  1.00 1.65  ? 98  LYS A HD3  2  
ATOM 3459  H HE2  . LYS A 1 98  ? -4.838  5.061   -8.885  1.00 1.69  ? 98  LYS A HE2  2  
ATOM 3460  H HE3  . LYS A 1 98  ? -4.614  5.125   -7.134  1.00 1.94  ? 98  LYS A HE3  2  
ATOM 3461  H HZ1  . LYS A 1 98  ? -5.479  2.839   -7.028  1.00 2.12  ? 98  LYS A HZ1  2  
ATOM 3462  H HZ2  . LYS A 1 98  ? -4.039  2.952   -7.910  1.00 2.50  ? 98  LYS A HZ2  2  
ATOM 3463  H HZ3  . LYS A 1 98  ? -5.525  2.788   -8.724  1.00 2.45  ? 98  LYS A HZ3  2  
ATOM 3464  N N    . LYS A 1 99  ? -11.582 3.980   -5.688  1.00 0.55  ? 99  LYS A N    2  
ATOM 3465  C CA   . LYS A 1 99  ? -13.006 4.195   -5.922  1.00 0.63  ? 99  LYS A CA   2  
ATOM 3466  C C    . LYS A 1 99  ? -13.757 4.282   -4.602  1.00 0.63  ? 99  LYS A C    2  
ATOM 3467  O O    . LYS A 1 99  ? -14.839 4.862   -4.524  1.00 0.75  ? 99  LYS A O    2  
ATOM 3468  C CB   . LYS A 1 99  ? -13.606 3.089   -6.794  1.00 0.66  ? 99  LYS A CB   2  
ATOM 3469  C CG   . LYS A 1 99  ? -13.535 1.701   -6.177  1.00 0.60  ? 99  LYS A CG   2  
ATOM 3470  C CD   . LYS A 1 99  ? -14.682 0.824   -6.655  1.00 0.76  ? 99  LYS A CD   2  
ATOM 3471  C CE   . LYS A 1 99  ? -16.026 1.407   -6.236  1.00 1.62  ? 99  LYS A CE   2  
ATOM 3472  N NZ   . LYS A 1 99  ? -17.173 0.569   -6.675  1.00 2.04  ? 99  LYS A NZ   2  
ATOM 3473  H H    . LYS A 1 99  ? -11.179 3.112   -5.910  1.00 0.53  ? 99  LYS A H    2  
ATOM 3474  H HA   . LYS A 1 99  ? -13.111 5.141   -6.436  1.00 0.70  ? 99  LYS A HA   2  
ATOM 3475  H HB2  . LYS A 1 99  ? -14.643 3.320   -6.981  1.00 0.73  ? 99  LYS A HB2  2  
ATOM 3476  H HB3  . LYS A 1 99  ? -13.077 3.066   -7.736  1.00 0.70  ? 99  LYS A HB3  2  
ATOM 3477  H HG2  . LYS A 1 99  ? -12.600 1.241   -6.458  1.00 0.67  ? 99  LYS A HG2  2  
ATOM 3478  H HG3  . LYS A 1 99  ? -13.585 1.792   -5.101  1.00 0.65  ? 99  LYS A HG3  2  
ATOM 3479  H HD2  . LYS A 1 99  ? -14.646 0.759   -7.732  1.00 1.19  ? 99  LYS A HD2  2  
ATOM 3480  H HD3  . LYS A 1 99  ? -14.576 -0.160  -6.226  1.00 1.16  ? 99  LYS A HD3  2  
ATOM 3481  H HE2  . LYS A 1 99  ? -16.048 1.488   -5.160  1.00 2.17  ? 99  LYS A HE2  2  
ATOM 3482  H HE3  . LYS A 1 99  ? -16.128 2.392   -6.669  1.00 2.18  ? 99  LYS A HE3  2  
ATOM 3483  H HZ1  . LYS A 1 99  ? -17.172 0.472   -7.715  1.00 2.53  ? 99  LYS A HZ1  2  
ATOM 3484  H HZ2  . LYS A 1 99  ? -18.068 1.017   -6.385  1.00 2.23  ? 99  LYS A HZ2  2  
ATOM 3485  H HZ3  . LYS A 1 99  ? -17.113 -0.380  -6.245  1.00 2.44  ? 99  LYS A HZ3  2  
ATOM 3486  N N    . CYS A 1 100 ? -13.171 3.704   -3.565  1.00 0.55  ? 100 CYS A N    2  
ATOM 3487  C CA   . CYS A 1 100 ? -13.753 3.752   -2.235  1.00 0.60  ? 100 CYS A CA   2  
ATOM 3488  C C    . CYS A 1 100 ? -13.438 5.081   -1.557  1.00 0.61  ? 100 CYS A C    2  
ATOM 3489  O O    . CYS A 1 100 ? -13.947 5.374   -0.474  1.00 0.68  ? 100 CYS A O    2  
ATOM 3490  C CB   . CYS A 1 100 ? -13.234 2.585   -1.395  1.00 0.60  ? 100 CYS A CB   2  
ATOM 3491  S SG   . CYS A 1 100 ? -13.762 0.963   -1.993  1.00 1.39  ? 100 CYS A SG   2  
ATOM 3492  H H    . CYS A 1 100 ? -12.322 3.229   -3.697  1.00 0.51  ? 100 CYS A H    2  
ATOM 3493  H HA   . CYS A 1 100 ? -14.825 3.660   -2.342  1.00 0.68  ? 100 CYS A HA   2  
ATOM 3494  H HB2  . CYS A 1 100 ? -12.154 2.599   -1.405  1.00 1.12  ? 100 CYS A HB2  2  
ATOM 3495  H HB3  . CYS A 1 100 ? -13.579 2.694   -0.381  1.00 0.81  ? 100 CYS A HB3  2  
ATOM 3496  H HG   . CYS A 1 100 ? -12.947 0.614   -2.980  1.00 2.19  ? 100 CYS A HG   2  
ATOM 3497  N N    . ARG A 1 101 ? -12.587 5.874   -2.216  1.00 0.59  ? 101 ARG A N    2  
ATOM 3498  C CA   . ARG A 1 101 ? -12.199 7.200   -1.741  1.00 0.65  ? 101 ARG A CA   2  
ATOM 3499  C C    . ARG A 1 101 ? -11.576 7.130   -0.354  1.00 0.64  ? 101 ARG A C    2  
ATOM 3500  O O    . ARG A 1 101 ? -11.648 8.085   0.420   1.00 0.75  ? 101 ARG A O    2  
ATOM 3501  C CB   . ARG A 1 101 ? -13.397 8.155   -1.734  1.00 0.77  ? 101 ARG A CB   2  
ATOM 3502  C CG   . ARG A 1 101 ? -13.973 8.429   -3.115  1.00 0.79  ? 101 ARG A CG   2  
ATOM 3503  C CD   . ARG A 1 101 ? -12.922 8.991   -4.060  1.00 1.19  ? 101 ARG A CD   2  
ATOM 3504  N NE   . ARG A 1 101 ? -12.302 10.205  -3.533  1.00 2.14  ? 101 ARG A NE   2  
ATOM 3505  C CZ   . ARG A 1 101 ? -11.295 10.843  -4.128  1.00 3.08  ? 101 ARG A CZ   2  
ATOM 3506  N NH1  . ARG A 1 101 ? -10.827 10.403  -5.291  1.00 3.37  ? 101 ARG A NH1  2  
ATOM 3507  N NH2  . ARG A 1 101 ? -10.767 11.925  -3.566  1.00 4.09  ? 101 ARG A NH2  2  
ATOM 3508  H H    . ARG A 1 101 ? -12.200 5.548   -3.057  1.00 0.57  ? 101 ARG A H    2  
ATOM 3509  H HA   . ARG A 1 101 ? -11.458 7.583   -2.426  1.00 0.66  ? 101 ARG A HA   2  
ATOM 3510  H HB2  . ARG A 1 101 ? -14.178 7.732   -1.119  1.00 0.79  ? 101 ARG A HB2  2  
ATOM 3511  H HB3  . ARG A 1 101 ? -13.087 9.098   -1.305  1.00 0.92  ? 101 ARG A HB3  2  
ATOM 3512  H HG2  . ARG A 1 101 ? -14.352 7.504   -3.526  1.00 1.42  ? 101 ARG A HG2  2  
ATOM 3513  H HG3  . ARG A 1 101 ? -14.781 9.141   -3.024  1.00 1.29  ? 101 ARG A HG3  2  
ATOM 3514  H HD2  . ARG A 1 101 ? -12.155 8.245   -4.210  1.00 1.59  ? 101 ARG A HD2  2  
ATOM 3515  H HD3  . ARG A 1 101 ? -13.391 9.219   -5.006  1.00 1.65  ? 101 ARG A HD3  2  
ATOM 3516  H HE   . ARG A 1 101 ? -12.655 10.561  -2.683  1.00 2.45  ? 101 ARG A HE   2  
ATOM 3517  H HH11 . ARG A 1 101 ? -11.231 9.592   -5.721  1.00 3.01  ? 101 ARG A HH11 2  
ATOM 3518  H HH12 . ARG A 1 101 ? -10.073 10.883  -5.753  1.00 4.21  ? 101 ARG A HH12 2  
ATOM 3519  H HH21 . ARG A 1 101 ? -11.127 12.266  -2.690  1.00 4.30  ? 101 ARG A HH21 2  
ATOM 3520  H HH22 . ARG A 1 101 ? -10.001 12.409  -4.007  1.00 4.83  ? 101 ARG A HH22 2  
ATOM 3521  N N    . VAL A 1 102 ? -10.949 6.004   -0.055  1.00 0.55  ? 102 VAL A N    2  
ATOM 3522  C CA   . VAL A 1 102 ? -10.375 5.782   1.258   1.00 0.57  ? 102 VAL A CA   2  
ATOM 3523  C C    . VAL A 1 102 ? -8.952  5.253   1.121   1.00 0.49  ? 102 VAL A C    2  
ATOM 3524  O O    . VAL A 1 102 ? -8.628  4.555   0.158   1.00 0.46  ? 102 VAL A O    2  
ATOM 3525  C CB   . VAL A 1 102 ? -11.246 4.803   2.084   1.00 0.69  ? 102 VAL A CB   2  
ATOM 3526  C CG1  . VAL A 1 102 ? -11.223 3.407   1.493   1.00 0.89  ? 102 VAL A CG1  2  
ATOM 3527  C CG2  . VAL A 1 102 ? -10.815 4.779   3.542   1.00 1.42  ? 102 VAL A CG2  2  
ATOM 3528  H H    . VAL A 1 102 ? -10.859 5.308   -0.741  1.00 0.51  ? 102 VAL A H    2  
ATOM 3529  H HA   . VAL A 1 102 ? -10.348 6.732   1.772   1.00 0.66  ? 102 VAL A HA   2  
ATOM 3530  H HB   . VAL A 1 102 ? -12.264 5.154   2.042   1.00 1.38  ? 102 VAL A HB   2  
ATOM 3531  H HG11 . VAL A 1 102 ? -11.506 3.449   0.452   1.00 1.44  ? 102 VAL A HG11 2  
ATOM 3532  H HG12 . VAL A 1 102 ? -11.918 2.777   2.030   1.00 1.45  ? 102 VAL A HG12 2  
ATOM 3533  H HG13 . VAL A 1 102 ? -10.230 2.997   1.580   1.00 1.57  ? 102 VAL A HG13 2  
ATOM 3534  H HG21 . VAL A 1 102 ? -10.909 5.769   3.961   1.00 2.00  ? 102 VAL A HG21 2  
ATOM 3535  H HG22 . VAL A 1 102 ? -9.787  4.454   3.608   1.00 2.08  ? 102 VAL A HG22 2  
ATOM 3536  H HG23 . VAL A 1 102 ? -11.446 4.095   4.091   1.00 1.73  ? 102 VAL A HG23 2  
ATOM 3537  N N    . ILE A 1 103 ? -8.104  5.614   2.062   1.00 0.54  ? 103 ILE A N    2  
ATOM 3538  C CA   . ILE A 1 103 ? -6.707  5.233   2.016   1.00 0.50  ? 103 ILE A CA   2  
ATOM 3539  C C    . ILE A 1 103 ? -6.430  4.072   2.967   1.00 0.43  ? 103 ILE A C    2  
ATOM 3540  O O    . ILE A 1 103 ? -6.826  4.096   4.132   1.00 0.46  ? 103 ILE A O    2  
ATOM 3541  C CB   . ILE A 1 103 ? -5.819  6.450   2.350   1.00 0.61  ? 103 ILE A CB   2  
ATOM 3542  C CG1  . ILE A 1 103 ? -6.007  7.518   1.269   1.00 0.78  ? 103 ILE A CG1  2  
ATOM 3543  C CG2  . ILE A 1 103 ? -4.355  6.053   2.478   1.00 0.62  ? 103 ILE A CG2  2  
ATOM 3544  C CD1  . ILE A 1 103 ? -5.209  8.777   1.502   1.00 1.33  ? 103 ILE A CD1  2  
ATOM 3545  H H    . ILE A 1 103 ? -8.425  6.164   2.817   1.00 0.65  ? 103 ILE A H    2  
ATOM 3546  H HA   . ILE A 1 103 ? -6.483  4.916   1.007   1.00 0.50  ? 103 ILE A HA   2  
ATOM 3547  H HB   . ILE A 1 103 ? -6.140  6.850   3.299   1.00 0.64  ? 103 ILE A HB   2  
ATOM 3548  H HG12 . ILE A 1 103 ? -5.707  7.113   0.315   1.00 1.38  ? 103 ILE A HG12 2  
ATOM 3549  H HG13 . ILE A 1 103 ? -7.052  7.792   1.223   1.00 1.26  ? 103 ILE A HG13 2  
ATOM 3550  H HG21 . ILE A 1 103 ? -3.765  6.925   2.717   1.00 1.17  ? 103 ILE A HG21 2  
ATOM 3551  H HG22 . ILE A 1 103 ? -4.012  5.631   1.544   1.00 1.19  ? 103 ILE A HG22 2  
ATOM 3552  H HG23 . ILE A 1 103 ? -4.250  5.319   3.263   1.00 1.09  ? 103 ILE A HG23 2  
ATOM 3553  H HD11 . ILE A 1 103 ? -5.490  9.209   2.452   1.00 1.78  ? 103 ILE A HD11 2  
ATOM 3554  H HD12 . ILE A 1 103 ? -5.412  9.484   0.712   1.00 1.83  ? 103 ILE A HD12 2  
ATOM 3555  H HD13 . ILE A 1 103 ? -4.155  8.540   1.512   1.00 1.99  ? 103 ILE A HD13 2  
ATOM 3556  N N    . PRO A 1 104 ? -5.789  3.009   2.450   1.00 0.39  ? 104 PRO A N    2  
ATOM 3557  C CA   . PRO A 1 104 ? -5.472  1.819   3.238   1.00 0.37  ? 104 PRO A CA   2  
ATOM 3558  C C    . PRO A 1 104 ? -4.504  2.106   4.380   1.00 0.37  ? 104 PRO A C    2  
ATOM 3559  O O    . PRO A 1 104 ? -3.737  3.064   4.337   1.00 0.45  ? 104 PRO A O    2  
ATOM 3560  C CB   . PRO A 1 104 ? -4.839  0.858   2.227   1.00 0.41  ? 104 PRO A CB   2  
ATOM 3561  C CG   . PRO A 1 104 ? -4.430  1.696   1.067   1.00 0.53  ? 104 PRO A CG   2  
ATOM 3562  C CD   . PRO A 1 104 ? -5.343  2.890   1.051   1.00 0.44  ? 104 PRO A CD   2  
ATOM 3563  H HA   . PRO A 1 104 ? -6.369  1.371   3.643   1.00 0.37  ? 104 PRO A HA   2  
ATOM 3564  H HB2  . PRO A 1 104 ? -3.986  0.373   2.678   1.00 0.57  ? 104 PRO A HB2  2  
ATOM 3565  H HB3  . PRO A 1 104 ? -5.565  0.113   1.936   1.00 0.55  ? 104 PRO A HB3  2  
ATOM 3566  H HG2  . PRO A 1 104 ? -3.405  2.013   1.189   1.00 0.86  ? 104 PRO A HG2  2  
ATOM 3567  H HG3  . PRO A 1 104 ? -4.540  1.131   0.152   1.00 0.82  ? 104 PRO A HG3  2  
ATOM 3568  H HD2  . PRO A 1 104 ? -4.802  3.772   0.742   1.00 0.59  ? 104 PRO A HD2  2  
ATOM 3569  H HD3  . PRO A 1 104 ? -6.181  2.712   0.393   1.00 0.57  ? 104 PRO A HD3  2  
ATOM 3570  N N    . SER A 1 105 ? -4.552  1.257   5.397   1.00 0.32  ? 105 SER A N    2  
ATOM 3571  C CA   . SER A 1 105 ? -3.711  1.391   6.574   1.00 0.34  ? 105 SER A CA   2  
ATOM 3572  C C    . SER A 1 105 ? -3.450  0.000   7.137   1.00 0.34  ? 105 SER A C    2  
ATOM 3573  O O    . SER A 1 105 ? -4.017  -0.972  6.623   1.00 0.33  ? 105 SER A O    2  
ATOM 3574  C CB   . SER A 1 105 ? -4.407  2.265   7.623   1.00 0.43  ? 105 SER A CB   2  
ATOM 3575  O OG   . SER A 1 105 ? -5.064  3.366   7.020   1.00 1.42  ? 105 SER A OG   2  
ATOM 3576  H H    . SER A 1 105 ? -5.156  0.497   5.346   1.00 0.31  ? 105 SER A H    2  
ATOM 3577  H HA   . SER A 1 105 ? -2.774  1.844   6.281   1.00 0.34  ? 105 SER A HA   2  
ATOM 3578  H HB2  . SER A 1 105 ? -5.140  1.673   8.151   1.00 1.18  ? 105 SER A HB2  2  
ATOM 3579  H HB3  . SER A 1 105 ? -3.674  2.638   8.324   1.00 0.94  ? 105 SER A HB3  2  
ATOM 3580  H HG   . SER A 1 105 ? -4.418  3.897   6.532   1.00 1.92  ? 105 SER A HG   2  
ATOM 3581  N N    . GLN A 1 106 ? -2.626  -0.116  8.171   1.00 0.39  ? 106 GLN A N    2  
ATOM 3582  C CA   . GLN A 1 106 ? -2.376  -1.423  8.783   1.00 0.43  ? 106 GLN A CA   2  
ATOM 3583  C C    . GLN A 1 106 ? -3.686  -2.023  9.296   1.00 0.45  ? 106 GLN A C    2  
ATOM 3584  O O    . GLN A 1 106 ? -3.905  -3.231  9.230   1.00 0.50  ? 106 GLN A O    2  
ATOM 3585  C CB   . GLN A 1 106 ? -1.355  -1.340  9.928   1.00 0.52  ? 106 GLN A CB   2  
ATOM 3586  C CG   . GLN A 1 106 ? 0.001   -0.774  9.529   1.00 0.68  ? 106 GLN A CG   2  
ATOM 3587  C CD   . GLN A 1 106 ? -0.028  0.728   9.323   1.00 0.96  ? 106 GLN A CD   2  
ATOM 3588  O OE1  . GLN A 1 106 ? -0.791  1.440   9.978   1.00 1.66  ? 106 GLN A OE1  2  
ATOM 3589  N NE2  . GLN A 1 106 ? 0.786   1.218   8.405   1.00 1.42  ? 106 GLN A NE2  2  
ATOM 3590  H H    . GLN A 1 106 ? -2.161  0.685   8.517   1.00 0.42  ? 106 GLN A H    2  
ATOM 3591  H HA   . GLN A 1 106 ? -1.985  -2.072  8.014   1.00 0.42  ? 106 GLN A HA   2  
ATOM 3592  H HB2  . GLN A 1 106 ? -1.757  -0.719  10.705  1.00 0.66  ? 106 GLN A HB2  2  
ATOM 3593  H HB3  . GLN A 1 106 ? -1.202  -2.334  10.321  1.00 0.73  ? 106 GLN A HB3  2  
ATOM 3594  H HG2  . GLN A 1 106 ? 0.713   -1.000  10.307  1.00 0.91  ? 106 GLN A HG2  2  
ATOM 3595  H HG3  . GLN A 1 106 ? 0.315   -1.244  8.608   1.00 1.06  ? 106 GLN A HG3  2  
ATOM 3596  H HE21 . GLN A 1 106 ? 1.364   0.598   7.918   1.00 1.87  ? 106 GLN A HE21 2  
ATOM 3597  H HE22 . GLN A 1 106 ? 0.745   2.183   8.222   1.00 1.72  ? 106 GLN A HE22 2  
ATOM 3598  N N    . GLU A 1 107 ? -4.566  -1.157  9.779   1.00 0.46  ? 107 GLU A N    2  
ATOM 3599  C CA   . GLU A 1 107 ? -5.885  -1.574  10.245  1.00 0.51  ? 107 GLU A CA   2  
ATOM 3600  C C    . GLU A 1 107 ? -6.717  -2.184  9.115   1.00 0.42  ? 107 GLU A C    2  
ATOM 3601  O O    . GLU A 1 107 ? -7.544  -3.054  9.353   1.00 0.49  ? 107 GLU A O    2  
ATOM 3602  C CB   . GLU A 1 107 ? -6.624  -0.385  10.855  1.00 0.59  ? 107 GLU A CB   2  
ATOM 3603  C CG   . GLU A 1 107 ? -6.688  0.829   9.944   1.00 1.41  ? 107 GLU A CG   2  
ATOM 3604  C CD   . GLU A 1 107 ? -7.424  1.989   10.577  1.00 2.16  ? 107 GLU A CD   2  
ATOM 3605  O OE1  . GLU A 1 107 ? -6.806  2.728   11.372  1.00 2.82  ? 107 GLU A OE1  2  
ATOM 3606  O OE2  . GLU A 1 107 ? -8.622  2.166   10.277  1.00 2.63  ? 107 GLU A OE2  2  
ATOM 3607  H H    . GLU A 1 107 ? -4.317  -0.212  9.847   1.00 0.48  ? 107 GLU A H    2  
ATOM 3608  H HA   . GLU A 1 107 ? -5.742  -2.320  11.010  1.00 0.62  ? 107 GLU A HA   2  
ATOM 3609  H HB2  . GLU A 1 107 ? -7.634  -0.687  11.083  1.00 1.12  ? 107 GLU A HB2  2  
ATOM 3610  H HB3  . GLU A 1 107 ? -6.128  -0.095  11.769  1.00 1.19  ? 107 GLU A HB3  2  
ATOM 3611  H HG2  . GLU A 1 107 ? -5.681  1.143   9.714   1.00 2.02  ? 107 GLU A HG2  2  
ATOM 3612  H HG3  . GLU A 1 107 ? -7.196  0.552   9.032   1.00 2.03  ? 107 GLU A HG3  2  
ATOM 3613  N N    . HIS A 1 108 ? -6.488  -1.733  7.887   1.00 0.34  ? 108 HIS A N    2  
ATOM 3614  C CA   . HIS A 1 108 ? -7.251  -2.214  6.737   1.00 0.37  ? 108 HIS A CA   2  
ATOM 3615  C C    . HIS A 1 108 ? -6.743  -3.566  6.263   1.00 0.46  ? 108 HIS A C    2  
ATOM 3616  O O    . HIS A 1 108 ? -7.473  -4.329  5.638   1.00 0.53  ? 108 HIS A O    2  
ATOM 3617  C CB   . HIS A 1 108 ? -7.174  -1.211  5.585   1.00 0.38  ? 108 HIS A CB   2  
ATOM 3618  C CG   . HIS A 1 108 ? -8.027  0.007   5.785   1.00 0.40  ? 108 HIS A CG   2  
ATOM 3619  N ND1  . HIS A 1 108 ? -7.516  1.267   6.042   1.00 0.52  ? 108 HIS A ND1  2  
ATOM 3620  C CD2  . HIS A 1 108 ? -9.374  0.156   5.753   1.00 0.52  ? 108 HIS A CD2  2  
ATOM 3621  C CE1  . HIS A 1 108 ? -8.509  2.127   6.157   1.00 0.52  ? 108 HIS A CE1  2  
ATOM 3622  N NE2  . HIS A 1 108 ? -9.646  1.480   5.986   1.00 0.52  ? 108 HIS A NE2  2  
ATOM 3623  H H    . HIS A 1 108 ? -5.779  -1.073  7.747   1.00 0.33  ? 108 HIS A H    2  
ATOM 3624  H HA   . HIS A 1 108 ? -8.281  -2.316  7.043   1.00 0.42  ? 108 HIS A HA   2  
ATOM 3625  H HB2  . HIS A 1 108 ? -6.153  -0.888  5.476   1.00 0.36  ? 108 HIS A HB2  2  
ATOM 3626  H HB3  . HIS A 1 108 ? -7.484  -1.699  4.671   1.00 0.45  ? 108 HIS A HB3  2  
ATOM 3627  H HD1  . HIS A 1 108 ? -6.566  1.503   6.131   1.00 0.70  ? 108 HIS A HD1  2  
ATOM 3628  H HD2  . HIS A 1 108 ? -10.099 -0.628  5.579   1.00 0.71  ? 108 HIS A HD2  2  
ATOM 3629  H HE1  . HIS A 1 108 ? -8.406  3.181   6.353   1.00 0.64  ? 108 HIS A HE1  2  
ATOM 3630  H HE2  . HIS A 1 108 ? -10.540 1.845   6.204   1.00 0.63  ? 108 HIS A HE2  2  
ATOM 3631  N N    . LEU A 1 109 ? -5.488  -3.854  6.558   1.00 0.52  ? 109 LEU A N    2  
ATOM 3632  C CA   . LEU A 1 109 ? -4.877  -5.101  6.130   1.00 0.70  ? 109 LEU A CA   2  
ATOM 3633  C C    . LEU A 1 109 ? -5.039  -6.173  7.207   1.00 0.79  ? 109 LEU A C    2  
ATOM 3634  O O    . LEU A 1 109 ? -4.857  -7.364  6.948   1.00 1.24  ? 109 LEU A O    2  
ATOM 3635  C CB   . LEU A 1 109 ? -3.420  -4.845  5.745   1.00 0.96  ? 109 LEU A CB   2  
ATOM 3636  C CG   . LEU A 1 109 ? -2.534  -4.336  6.856   1.00 0.44  ? 109 LEU A CG   2  
ATOM 3637  C CD1  . LEU A 1 109 ? -2.056  -5.512  7.651   1.00 0.84  ? 109 LEU A CD1  2  
ATOM 3638  C CD2  . LEU A 1 109 ? -1.365  -3.549  6.309   1.00 0.67  ? 109 LEU A CD2  2  
ATOM 3639  H H    . LEU A 1 109 ? -4.955  -3.214  7.082   1.00 0.47  ? 109 LEU A H    2  
ATOM 3640  H HA   . LEU A 1 109 ? -5.390  -5.440  5.260   1.00 0.77  ? 109 LEU A HA   2  
ATOM 3641  H HB2  . LEU A 1 109 ? -3.001  -5.771  5.378   1.00 1.47  ? 109 LEU A HB2  2  
ATOM 3642  H HB3  . LEU A 1 109 ? -3.403  -4.122  4.943   1.00 1.46  ? 109 LEU A HB3  2  
ATOM 3643  H HG   . LEU A 1 109 ? -3.112  -3.686  7.502   1.00 0.43  ? 109 LEU A HG   2  
ATOM 3644  H HD11 . LEU A 1 109 ? -1.196  -5.941  7.160   1.00 1.39  ? 109 LEU A HD11 2  
ATOM 3645  H HD12 . LEU A 1 109 ? -2.859  -6.240  7.676   1.00 1.39  ? 109 LEU A HD12 2  
ATOM 3646  H HD13 . LEU A 1 109 ? -1.802  -5.203  8.651   1.00 1.37  ? 109 LEU A HD13 2  
ATOM 3647  H HD21 . LEU A 1 109 ? -1.732  -2.730  5.708   1.00 1.19  ? 109 LEU A HD21 2  
ATOM 3648  H HD22 . LEU A 1 109 ? -0.748  -4.194  5.702   1.00 1.41  ? 109 LEU A HD22 2  
ATOM 3649  H HD23 . LEU A 1 109 ? -0.780  -3.157  7.130   1.00 1.28  ? 109 LEU A HD23 2  
ATOM 3650  N N    . ASN A 1 110 ? -5.414  -5.740  8.405   1.00 1.37  ? 110 ASN A N    2  
ATOM 3651  C CA   . ASN A 1 110 ? -5.675  -6.654  9.513   1.00 1.67  ? 110 ASN A CA   2  
ATOM 3652  C C    . ASN A 1 110 ? -7.175  -6.814  9.741   1.00 1.44  ? 110 ASN A C    2  
ATOM 3653  O O    . ASN A 1 110 ? -7.689  -7.931  9.802   1.00 1.77  ? 110 ASN A O    2  
ATOM 3654  C CB   . ASN A 1 110 ? -4.994  -6.149  10.793  1.00 2.17  ? 110 ASN A CB   2  
ATOM 3655  C CG   . ASN A 1 110 ? -5.380  -6.952  12.025  1.00 2.95  ? 110 ASN A CG   2  
ATOM 3656  O OD1  . ASN A 1 110 ? -6.318  -6.602  12.741  1.00 3.70  ? 110 ASN A OD1  2  
ATOM 3657  N ND2  . ASN A 1 110 ? -4.657  -8.029  12.290  1.00 3.35  ? 110 ASN A ND2  2  
ATOM 3658  H H    . ASN A 1 110 ? -5.512  -4.776  8.552   1.00 1.89  ? 110 ASN A H    2  
ATOM 3659  H HA   . ASN A 1 110 ? -5.260  -7.615  9.250   1.00 1.91  ? 110 ASN A HA   2  
ATOM 3660  H HB2  . ASN A 1 110 ? -3.924  -6.207  10.671  1.00 2.54  ? 110 ASN A HB2  2  
ATOM 3661  H HB3  . ASN A 1 110 ? -5.277  -5.119  10.955  1.00 2.33  ? 110 ASN A HB3  2  
ATOM 3662  H HD21 . ASN A 1 110 ? -3.914  -8.254  11.681  1.00 3.18  ? 110 ASN A HD21 2  
ATOM 3663  H HD22 . ASN A 1 110 ? -4.888  -8.557  13.082  1.00 4.09  ? 110 ASN A HD22 2  
ATOM 3664  N N    . GLY A 1 111 ? -7.876  -5.692  9.852   1.00 1.12  ? 111 GLY A N    2  
ATOM 3665  C CA   . GLY A 1 111 ? -9.304  -5.728  10.097  1.00 1.12  ? 111 GLY A CA   2  
ATOM 3666  C C    . GLY A 1 111 ? -10.110 -5.785  8.813   1.00 0.87  ? 111 GLY A C    2  
ATOM 3667  O O    . GLY A 1 111 ? -9.706  -6.440  7.858   1.00 0.93  ? 111 GLY A O    2  
ATOM 3668  H H    . GLY A 1 111 ? -7.421  -4.828  9.762   1.00 1.15  ? 111 GLY A H    2  
ATOM 3669  H HA2  . GLY A 1 111 ? -9.535  -6.598  10.694  1.00 1.39  ? 111 GLY A HA2  2  
ATOM 3670  H HA3  . GLY A 1 111 ? -9.587  -4.843  10.647  1.00 1.34  ? 111 GLY A HA3  2  
ATOM 3671  N N    . PRO A 1 112 ? -11.257 -5.106  8.757   1.00 0.86  ? 112 PRO A N    2  
ATOM 3672  C CA   . PRO A 1 112 ? -12.130 -5.126  7.586   1.00 0.93  ? 112 PRO A CA   2  
ATOM 3673  C C    . PRO A 1 112 ? -11.725 -4.111  6.513   1.00 0.89  ? 112 PRO A C    2  
ATOM 3674  O O    . PRO A 1 112 ? -10.959 -3.175  6.768   1.00 1.31  ? 112 PRO A O    2  
ATOM 3675  C CB   . PRO A 1 112 ? -13.485 -4.760  8.183   1.00 1.25  ? 112 PRO A CB   2  
ATOM 3676  C CG   . PRO A 1 112 ? -13.168 -3.867  9.333   1.00 1.30  ? 112 PRO A CG   2  
ATOM 3677  C CD   . PRO A 1 112 ? -11.804 -4.268  9.836   1.00 1.10  ? 112 PRO A CD   2  
ATOM 3678  H HA   . PRO A 1 112 ? -12.183 -6.112  7.147   1.00 1.00  ? 112 PRO A HA   2  
ATOM 3679  H HB2  . PRO A 1 112 ? -14.082 -4.251  7.441   1.00 1.52  ? 112 PRO A HB2  2  
ATOM 3680  H HB3  . PRO A 1 112 ? -13.992 -5.656  8.508   1.00 1.43  ? 112 PRO A HB3  2  
ATOM 3681  H HG2  . PRO A 1 112 ? -13.156 -2.839  9.003   1.00 1.65  ? 112 PRO A HG2  2  
ATOM 3682  H HG3  . PRO A 1 112 ? -13.905 -3.999  10.111  1.00 1.44  ? 112 PRO A HG3  2  
ATOM 3683  H HD2  . PRO A 1 112 ? -11.189 -3.394  9.991   1.00 1.29  ? 112 PRO A HD2  2  
ATOM 3684  H HD3  . PRO A 1 112 ? -11.894 -4.832  10.754  1.00 1.17  ? 112 PRO A HD3  2  
ATOM 3685  N N    . LEU A 1 113 ? -12.246 -4.313  5.310   1.00 0.62  ? 113 LEU A N    2  
ATOM 3686  C CA   . LEU A 1 113 ? -12.035 -3.392  4.206   1.00 0.58  ? 113 LEU A CA   2  
ATOM 3687  C C    . LEU A 1 113 ? -13.164 -2.368  4.183   1.00 0.69  ? 113 LEU A C    2  
ATOM 3688  O O    . LEU A 1 113 ? -14.180 -2.553  4.856   1.00 0.90  ? 113 LEU A O    2  
ATOM 3689  C CB   . LEU A 1 113 ? -11.997 -4.145  2.869   1.00 0.58  ? 113 LEU A CB   2  
ATOM 3690  C CG   . LEU A 1 113 ? -10.785 -5.051  2.641   1.00 0.57  ? 113 LEU A CG   2  
ATOM 3691  C CD1  . LEU A 1 113 ? -10.810 -5.604  1.227   1.00 1.11  ? 113 LEU A CD1  2  
ATOM 3692  C CD2  . LEU A 1 113 ? -9.486  -4.302  2.899   1.00 1.05  ? 113 LEU A CD2  2  
ATOM 3693  H H    . LEU A 1 113 ? -12.812 -5.104  5.165   1.00 0.73  ? 113 LEU A H    2  
ATOM 3694  H HA   . LEU A 1 113 ? -11.096 -2.883  4.363   1.00 0.56  ? 113 LEU A HA   2  
ATOM 3695  H HB2  . LEU A 1 113 ? -12.888 -4.753  2.803   1.00 0.65  ? 113 LEU A HB2  2  
ATOM 3696  H HB3  . LEU A 1 113 ? -12.027 -3.416  2.073   1.00 0.60  ? 113 LEU A HB3  2  
ATOM 3697  H HG   . LEU A 1 113 ? -10.834 -5.886  3.319   1.00 0.65  ? 113 LEU A HG   2  
ATOM 3698  H HD11 . LEU A 1 113 ? -9.943  -6.228  1.071   1.00 1.60  ? 113 LEU A HD11 2  
ATOM 3699  H HD12 . LEU A 1 113 ? -10.799 -4.787  0.520   1.00 1.75  ? 113 LEU A HD12 2  
ATOM 3700  H HD13 . LEU A 1 113 ? -11.706 -6.191  1.085   1.00 1.54  ? 113 LEU A HD13 2  
ATOM 3701  H HD21 . LEU A 1 113 ? -9.457  -3.972  3.927   1.00 1.60  ? 113 LEU A HD21 2  
ATOM 3702  H HD22 . LEU A 1 113 ? -9.427  -3.444  2.245   1.00 1.47  ? 113 LEU A HD22 2  
ATOM 3703  H HD23 . LEU A 1 113 ? -8.648  -4.958  2.707   1.00 1.63  ? 113 LEU A HD23 2  
ATOM 3704  N N    . PRO A 1 114 ? -13.006 -1.269  3.429   1.00 0.68  ? 114 PRO A N    2  
ATOM 3705  C CA   . PRO A 1 114 ? -14.071 -0.281  3.262   1.00 0.83  ? 114 PRO A CA   2  
ATOM 3706  C C    . PRO A 1 114 ? -15.311 -0.899  2.636   1.00 0.86  ? 114 PRO A C    2  
ATOM 3707  O O    . PRO A 1 114 ? -15.220 -1.644  1.659   1.00 1.15  ? 114 PRO A O    2  
ATOM 3708  C CB   . PRO A 1 114 ? -13.468 0.765   2.323   1.00 1.02  ? 114 PRO A CB   2  
ATOM 3709  C CG   . PRO A 1 114 ? -12.313 0.082   1.673   1.00 0.90  ? 114 PRO A CG   2  
ATOM 3710  C CD   . PRO A 1 114 ? -11.795 -0.898  2.685   1.00 0.70  ? 114 PRO A CD   2  
ATOM 3711  H HA   . PRO A 1 114 ? -14.334 0.179   4.203   1.00 1.05  ? 114 PRO A HA   2  
ATOM 3712  H HB2  . PRO A 1 114 ? -14.212 1.065   1.600   1.00 1.15  ? 114 PRO A HB2  2  
ATOM 3713  H HB3  . PRO A 1 114 ? -13.147 1.624   2.895   1.00 1.31  ? 114 PRO A HB3  2  
ATOM 3714  H HG2  . PRO A 1 114 ? -12.644 -0.434  0.784   1.00 0.99  ? 114 PRO A HG2  2  
ATOM 3715  H HG3  . PRO A 1 114 ? -11.549 0.805   1.426   1.00 1.13  ? 114 PRO A HG3  2  
ATOM 3716  H HD2  . PRO A 1 114 ? -11.363 -1.756  2.195   1.00 0.68  ? 114 PRO A HD2  2  
ATOM 3717  H HD3  . PRO A 1 114 ? -11.074 -0.430  3.334   1.00 0.81  ? 114 PRO A HD3  2  
ATOM 3718  N N    . VAL A 1 115 ? -16.461 -0.589  3.203   1.00 1.26  ? 115 VAL A N    2  
ATOM 3719  C CA   . VAL A 1 115 ? -17.713 -1.161  2.750   1.00 1.45  ? 115 VAL A CA   2  
ATOM 3720  C C    . VAL A 1 115 ? -18.201 -0.441  1.499   1.00 1.91  ? 115 VAL A C    2  
ATOM 3721  O O    . VAL A 1 115 ? -18.440 0.769   1.525   1.00 2.44  ? 115 VAL A O    2  
ATOM 3722  C CB   . VAL A 1 115 ? -18.788 -1.073  3.848   1.00 1.96  ? 115 VAL A CB   2  
ATOM 3723  C CG1  . VAL A 1 115 ? -20.011 -1.895  3.477   1.00 2.60  ? 115 VAL A CG1  2  
ATOM 3724  C CG2  . VAL A 1 115 ? -18.214 -1.518  5.181   1.00 2.98  ? 115 VAL A CG2  2  
ATOM 3725  H H    . VAL A 1 115 ? -16.467 0.055   3.945   1.00 1.67  ? 115 VAL A H    2  
ATOM 3726  H HA   . VAL A 1 115 ? -17.545 -2.203  2.518   1.00 1.85  ? 115 VAL A HA   2  
ATOM 3727  H HB   . VAL A 1 115 ? -19.091 -0.044  3.938   1.00 2.15  ? 115 VAL A HB   2  
ATOM 3728  H HG11 . VAL A 1 115 ? -20.756 -1.802  4.255   1.00 2.96  ? 115 VAL A HG11 2  
ATOM 3729  H HG12 . VAL A 1 115 ? -19.729 -2.932  3.370   1.00 3.01  ? 115 VAL A HG12 2  
ATOM 3730  H HG13 . VAL A 1 115 ? -20.416 -1.534  2.543   1.00 3.05  ? 115 VAL A HG13 2  
ATOM 3731  H HG21 . VAL A 1 115 ? -17.342 -0.921  5.411   1.00 3.35  ? 115 VAL A HG21 2  
ATOM 3732  H HG22 . VAL A 1 115 ? -17.931 -2.559  5.121   1.00 3.47  ? 115 VAL A HG22 2  
ATOM 3733  H HG23 . VAL A 1 115 ? -18.953 -1.388  5.956   1.00 3.42  ? 115 VAL A HG23 2  
ATOM 3734  N N    . PRO A 1 116 ? -18.334 -1.176  0.387   1.00 2.53  ? 116 PRO A N    2  
ATOM 3735  C CA   . PRO A 1 116 ? -18.787 -0.616  -0.890  1.00 3.48  ? 116 PRO A CA   2  
ATOM 3736  C C    . PRO A 1 116 ? -20.163 0.032   -0.775  1.00 3.68  ? 116 PRO A C    2  
ATOM 3737  O O    . PRO A 1 116 ? -21.171 -0.653  -0.591  1.00 3.90  ? 116 PRO A O    2  
ATOM 3738  C CB   . PRO A 1 116 ? -18.842 -1.835  -1.822  1.00 4.23  ? 116 PRO A CB   2  
ATOM 3739  C CG   . PRO A 1 116 ? -17.943 -2.841  -1.192  1.00 4.01  ? 116 PRO A CG   2  
ATOM 3740  C CD   . PRO A 1 116 ? -18.049 -2.615  0.288   1.00 2.94  ? 116 PRO A CD   2  
ATOM 3741  H HA   . PRO A 1 116 ? -18.082 0.105   -1.277  1.00 3.92  ? 116 PRO A HA   2  
ATOM 3742  H HB2  . PRO A 1 116 ? -19.858 -2.197  -1.885  1.00 4.47  ? 116 PRO A HB2  2  
ATOM 3743  H HB3  . PRO A 1 116 ? -18.494 -1.554  -2.805  1.00 4.93  ? 116 PRO A HB3  2  
ATOM 3744  H HG2  . PRO A 1 116 ? -18.275 -3.837  -1.443  1.00 4.47  ? 116 PRO A HG2  2  
ATOM 3745  H HG3  . PRO A 1 116 ? -16.927 -2.687  -1.523  1.00 4.42  ? 116 PRO A HG3  2  
ATOM 3746  H HD2  . PRO A 1 116 ? -18.860 -3.196  0.704   1.00 2.94  ? 116 PRO A HD2  2  
ATOM 3747  H HD3  . PRO A 1 116 ? -17.119 -2.857  0.776   1.00 2.95  ? 116 PRO A HD3  2  
ATOM 3748  N N    . PHE A 1 117 ? -20.182 1.357   -0.855  1.00 4.03  ? 117 PHE A N    2  
ATOM 3749  C CA   . PHE A 1 117 ? -21.420 2.121   -0.784  1.00 4.72  ? 117 PHE A CA   2  
ATOM 3750  C C    . PHE A 1 117 ? -22.285 1.828   -2.006  1.00 5.62  ? 117 PHE A C    2  
ATOM 3751  O O    . PHE A 1 117 ? -23.415 1.357   -1.883  1.00 6.22  ? 117 PHE A O    2  
ATOM 3752  C CB   . PHE A 1 117 ? -21.105 3.617   -0.686  1.00 5.32  ? 117 PHE A CB   2  
ATOM 3753  C CG   . PHE A 1 117 ? -22.320 4.491   -0.599  1.00 5.77  ? 117 PHE A CG   2  
ATOM 3754  C CD1  . PHE A 1 117 ? -22.973 4.667   0.608   1.00 6.08  ? 117 PHE A CD1  2  
ATOM 3755  C CD2  . PHE A 1 117 ? -22.806 5.137   -1.725  1.00 6.27  ? 117 PHE A CD2  2  
ATOM 3756  C CE1  . PHE A 1 117 ? -24.089 5.474   0.691   1.00 6.87  ? 117 PHE A CE1  2  
ATOM 3757  C CE2  . PHE A 1 117 ? -23.920 5.944   -1.648  1.00 7.04  ? 117 PHE A CE2  2  
ATOM 3758  C CZ   . PHE A 1 117 ? -24.563 6.112   -0.439  1.00 7.33  ? 117 PHE A CZ   2  
ATOM 3759  H H    . PHE A 1 117 ? -19.336 1.838   -0.961  1.00 4.08  ? 117 PHE A H    2  
ATOM 3760  H HA   . PHE A 1 117 ? -21.952 1.811   0.103   1.00 4.55  ? 117 PHE A HA   2  
ATOM 3761  H HB2  . PHE A 1 117 ? -20.509 3.795   0.196   1.00 5.24  ? 117 PHE A HB2  2  
ATOM 3762  H HB3  . PHE A 1 117 ? -20.544 3.916   -1.558  1.00 5.94  ? 117 PHE A HB3  2  
ATOM 3763  H HD1  . PHE A 1 117 ? -22.602 4.168   1.494   1.00 5.96  ? 117 PHE A HD1  2  
ATOM 3764  H HD2  . PHE A 1 117 ? -22.302 5.003   -2.673  1.00 6.29  ? 117 PHE A HD2  2  
ATOM 3765  H HE1  . PHE A 1 117 ? -24.591 5.607   1.637   1.00 7.32  ? 117 PHE A HE1  2  
ATOM 3766  H HE2  . PHE A 1 117 ? -24.289 6.443   -2.532  1.00 7.60  ? 117 PHE A HE2  2  
ATOM 3767  H HZ   . PHE A 1 117 ? -25.434 6.742   -0.377  1.00 8.10  ? 117 PHE A HZ   2  
ATOM 3768  N N    . THR A 1 118 ? -21.738 2.099   -3.181  1.00 6.05  ? 118 THR A N    2  
ATOM 3769  C CA   . THR A 1 118 ? -22.399 1.757   -4.428  1.00 7.13  ? 118 THR A CA   2  
ATOM 3770  C C    . THR A 1 118 ? -22.003 0.342   -4.844  1.00 7.53  ? 118 THR A C    2  
ATOM 3771  O O    . THR A 1 118 ? -20.867 0.097   -5.257  1.00 8.01  ? 118 THR A O    2  
ATOM 3772  C CB   . THR A 1 118 ? -22.031 2.762   -5.540  1.00 8.07  ? 118 THR A CB   2  
ATOM 3773  O OG1  . THR A 1 118 ? -22.362 4.094   -5.116  1.00 8.43  ? 118 THR A OG1  2  
ATOM 3774  C CG2  . THR A 1 118 ? -22.766 2.442   -6.832  1.00 8.78  ? 118 THR A CG2  2  
ATOM 3775  H H    . THR A 1 118 ? -20.861 2.542   -3.213  1.00 5.82  ? 118 THR A H    2  
ATOM 3776  H HA   . THR A 1 118 ? -23.468 1.795   -4.266  1.00 7.30  ? 118 THR A HA   2  
ATOM 3777  H HB   . THR A 1 118 ? -20.967 2.704   -5.721  1.00 8.25  ? 118 THR A HB   2  
ATOM 3778  H HG1  . THR A 1 118 ? -23.319 4.142   -4.934  1.00 8.41  ? 118 THR A HG1  2  
ATOM 3779  H HG21 . THR A 1 118 ? -23.830 2.514   -6.667  1.00 9.07  ? 118 THR A HG21 2  
ATOM 3780  H HG22 . THR A 1 118 ? -22.518 1.439   -7.148  1.00 8.92  ? 118 THR A HG22 2  
ATOM 3781  H HG23 . THR A 1 118 ? -22.472 3.146   -7.597  1.00 9.11  ? 118 THR A HG23 2  
ATOM 3782  N N    . ASN A 1 119 ? -22.937 -0.589  -4.716  1.00 7.62  ? 119 ASN A N    2  
ATOM 3783  C CA   . ASN A 1 119 ? -22.651 -1.997  -4.959  1.00 8.32  ? 119 ASN A CA   2  
ATOM 3784  C C    . ASN A 1 119 ? -22.930 -2.372  -6.407  1.00 9.00  ? 119 ASN A C    2  
ATOM 3785  O O    . ASN A 1 119 ? -23.883 -1.883  -7.019  1.00 9.23  ? 119 ASN A O    2  
ATOM 3786  C CB   . ASN A 1 119 ? -23.477 -2.883  -4.018  1.00 8.46  ? 119 ASN A CB   2  
ATOM 3787  C CG   . ASN A 1 119 ? -23.203 -4.368  -4.207  1.00 8.93  ? 119 ASN A CG   2  
ATOM 3788  O OD1  . ASN A 1 119 ? -22.285 -4.920  -3.603  1.00 9.34  ? 119 ASN A OD1  2  
ATOM 3789  N ND2  . ASN A 1 119 ? -24.004 -5.025  -5.034  1.00 9.14  ? 119 ASN A ND2  2  
ATOM 3790  H H    . ASN A 1 119 ? -23.851 -0.320  -4.470  1.00 7.43  ? 119 ASN A H    2  
ATOM 3791  H HA   . ASN A 1 119 ? -21.602 -2.157  -4.757  1.00 8.58  ? 119 ASN A HA   2  
ATOM 3792  H HB2  . ASN A 1 119 ? -23.244 -2.622  -2.996  1.00 8.54  ? 119 ASN A HB2  2  
ATOM 3793  H HB3  . ASN A 1 119 ? -24.528 -2.705  -4.199  1.00 8.45  ? 119 ASN A HB3  2  
ATOM 3794  H HD21 . ASN A 1 119 ? -24.731 -4.522  -5.478  1.00 8.98  ? 119 ASN A HD21 2  
ATOM 3795  H HD22 . ASN A 1 119 ? -23.845 -5.984  -5.176  1.00 9.61  ? 119 ASN A HD22 2  
ATOM 3796  N N    . GLY A 1 120 ? -22.084 -3.233  -6.949  1.00 9.55  ? 120 GLY A N    2  
ATOM 3797  C CA   . GLY A 1 120 ? -22.293 -3.749  -8.281  1.00 10.42 ? 120 GLY A CA   2  
ATOM 3798  C C    . GLY A 1 120 ? -22.186 -5.259  -8.306  1.00 11.21 ? 120 GLY A C    2  
ATOM 3799  O O    . GLY A 1 120 ? -21.344 -5.834  -7.613  1.00 11.55 ? 120 GLY A O    2  
ATOM 3800  H H    . GLY A 1 120 ? -21.302 -3.529  -6.435  1.00 9.52  ? 120 GLY A H    2  
ATOM 3801  H HA2  . GLY A 1 120 ? -23.277 -3.457  -8.622  1.00 10.61 ? 120 GLY A HA2  2  
ATOM 3802  H HA3  . GLY A 1 120 ? -21.550 -3.332  -8.943  1.00 10.51 ? 120 GLY A HA3  2  
ATOM 3803  N N    . GLU A 1 121 ? -23.036 -5.903  -9.086  1.00 11.70 ? 121 GLU A N    2  
ATOM 3804  C CA   . GLU A 1 121 ? -23.020 -7.352  -9.200  1.00 12.64 ? 121 GLU A CA   2  
ATOM 3805  C C    . GLU A 1 121 ? -22.030 -7.779  -10.269 1.00 13.44 ? 121 GLU A C    2  
ATOM 3806  O O    . GLU A 1 121 ? -22.166 -7.417  -11.438 1.00 13.92 ? 121 GLU A O    2  
ATOM 3807  C CB   . GLU A 1 121 ? -24.416 -7.888  -9.516  1.00 12.94 ? 121 GLU A CB   2  
ATOM 3808  C CG   . GLU A 1 121 ? -25.397 -7.720  -8.368  1.00 12.93 ? 121 GLU A CG   2  
ATOM 3809  C CD   . GLU A 1 121 ? -24.931 -8.414  -7.104  1.00 13.41 ? 121 GLU A CD   2  
ATOM 3810  O OE1  . GLU A 1 121 ? -25.095 -9.650  -7.002  1.00 13.66 ? 121 GLU A OE1  2  
ATOM 3811  O OE2  . GLU A 1 121 ? -24.403 -7.730  -6.202  1.00 13.68 ? 121 GLU A OE2  2  
ATOM 3812  H H    . GLU A 1 121 ? -23.680 -5.388  -9.620  1.00 11.54 ? 121 GLU A H    2  
ATOM 3813  H HA   . GLU A 1 121 ? -22.697 -7.753  -8.249  1.00 12.73 ? 121 GLU A HA   2  
ATOM 3814  H HB2  . GLU A 1 121 ? -24.805 -7.363  -10.375 1.00 13.04 ? 121 GLU A HB2  2  
ATOM 3815  H HB3  . GLU A 1 121 ? -24.342 -8.940  -9.748  1.00 13.27 ? 121 GLU A HB3  2  
ATOM 3816  H HG2  . GLU A 1 121 ? -25.513 -6.667  -8.161  1.00 12.74 ? 121 GLU A HG2  2  
ATOM 3817  H HG3  . GLU A 1 121 ? -26.350 -8.136  -8.662  1.00 12.97 ? 121 GLU A HG3  2  
ATOM 3818  N N    . ILE A 1 122 ? -21.027 -8.538  -9.859  1.00 13.73 ? 122 ILE A N    2  
ATOM 3819  C CA   . ILE A 1 122 ? -19.971 -8.957  -10.763 1.00 14.64 ? 122 ILE A CA   2  
ATOM 3820  C C    . ILE A 1 122 ? -20.366 -10.226 -11.509 1.00 15.74 ? 122 ILE A C    2  
ATOM 3821  O O    . ILE A 1 122 ? -20.176 -11.341 -11.015 1.00 16.21 ? 122 ILE A O    2  
ATOM 3822  C CB   . ILE A 1 122 ? -18.645 -9.194  -10.010 1.00 14.54 ? 122 ILE A CB   2  
ATOM 3823  C CG1  . ILE A 1 122 ? -18.259 -7.944  -9.215  1.00 14.04 ? 122 ILE A CG1  2  
ATOM 3824  C CG2  . ILE A 1 122 ? -17.536 -9.566  -10.988 1.00 14.69 ? 122 ILE A CG2  2  
ATOM 3825  C CD1  . ILE A 1 122 ? -16.983 -8.098  -8.417  1.00 14.09 ? 122 ILE A CD1  2  
ATOM 3826  H H    . ILE A 1 122 ? -21.002 -8.830  -8.924  1.00 13.43 ? 122 ILE A H    2  
ATOM 3827  H HA   . ILE A 1 122 ? -19.815 -8.165  -11.481 1.00 14.76 ? 122 ILE A HA   2  
ATOM 3828  H HB   . ILE A 1 122 ? -18.783 -10.019 -9.328  1.00 14.93 ? 122 ILE A HB   2  
ATOM 3829  H HG12 . ILE A 1 122 ? -18.125 -7.119  -9.897  1.00 13.68 ? 122 ILE A HG12 2  
ATOM 3830  H HG13 . ILE A 1 122 ? -19.056 -7.706  -8.524  1.00 14.16 ? 122 ILE A HG13 2  
ATOM 3831  H HG21 . ILE A 1 122 ? -17.372 -8.748  -11.674 1.00 14.66 ? 122 ILE A HG21 2  
ATOM 3832  H HG22 . ILE A 1 122 ? -17.825 -10.448 -11.542 1.00 14.82 ? 122 ILE A HG22 2  
ATOM 3833  H HG23 . ILE A 1 122 ? -16.627 -9.767  -10.441 1.00 14.87 ? 122 ILE A HG23 2  
ATOM 3834  H HD11 . ILE A 1 122 ? -17.104 -8.890  -7.696  1.00 14.08 ? 122 ILE A HD11 2  
ATOM 3835  H HD12 . ILE A 1 122 ? -16.766 -7.173  -7.904  1.00 14.17 ? 122 ILE A HD12 2  
ATOM 3836  H HD13 . ILE A 1 122 ? -16.169 -8.339  -9.085  1.00 14.24 ? 122 ILE A HD13 2  
ATOM 3837  N N    . GLN A 1 123 ? -20.936 -10.044 -12.689 1.00 16.25 ? 123 GLN A N    2  
ATOM 3838  C CA   . GLN A 1 123 ? -21.260 -11.164 -13.554 1.00 17.37 ? 123 GLN A CA   2  
ATOM 3839  C C    . GLN A 1 123 ? -20.021 -11.571 -14.340 1.00 18.25 ? 123 GLN A C    2  
ATOM 3840  O O    . GLN A 1 123 ? -19.163 -10.737 -14.636 1.00 18.70 ? 123 GLN A O    2  
ATOM 3841  C CB   . GLN A 1 123 ? -22.424 -10.815 -14.485 1.00 17.69 ? 123 GLN A CB   2  
ATOM 3842  C CG   . GLN A 1 123 ? -23.737 -10.636 -13.739 1.00 18.12 ? 123 GLN A CG   2  
ATOM 3843  C CD   . GLN A 1 123 ? -24.922 -10.412 -14.659 1.00 18.49 ? 123 GLN A CD   2  
ATOM 3844  O OE1  . GLN A 1 123 ? -24.795 -9.819  -15.732 1.00 18.82 ? 123 GLN A OE1  2  
ATOM 3845  N NE2  . GLN A 1 123 ? -26.085 -10.895 -14.248 1.00 18.57 ? 123 GLN A NE2  2  
ATOM 3846  H H    . GLN A 1 123 ? -21.140 -9.133  -12.984 1.00 15.95 ? 123 GLN A H    2  
ATOM 3847  H HA   . GLN A 1 123 ? -21.553 -11.991 -12.921 1.00 17.46 ? 123 GLN A HA   2  
ATOM 3848  H HB2  . GLN A 1 123 ? -22.195 -9.896  -15.005 1.00 17.45 ? 123 GLN A HB2  2  
ATOM 3849  H HB3  . GLN A 1 123 ? -22.548 -11.608 -15.207 1.00 18.00 ? 123 GLN A HB3  2  
ATOM 3850  H HG2  . GLN A 1 123 ? -23.923 -11.522 -13.151 1.00 18.20 ? 123 GLN A HG2  2  
ATOM 3851  H HG3  . GLN A 1 123 ? -23.645 -9.784  -13.082 1.00 18.23 ? 123 GLN A HG3  2  
ATOM 3852  H HE21 . GLN A 1 123 ? -26.115 -11.360 -13.384 1.00 18.37 ? 123 GLN A HE21 2  
ATOM 3853  H HE22 . GLN A 1 123 ? -26.871 -10.776 -14.824 1.00 18.90 ? 123 GLN A HE22 2  
ATOM 3854  N N    . LYS A 1 124 ? -19.928 -12.849 -14.676 1.00 18.59 ? 124 LYS A N    2  
ATOM 3855  C CA   . LYS A 1 124 ? -18.690 -13.407 -15.212 1.00 19.51 ? 124 LYS A CA   2  
ATOM 3856  C C    . LYS A 1 124 ? -18.579 -13.247 -16.727 1.00 20.23 ? 124 LYS A C    2  
ATOM 3857  O O    . LYS A 1 124 ? -18.259 -14.196 -17.443 1.00 20.83 ? 124 LYS A O    2  
ATOM 3858  C CB   . LYS A 1 124 ? -18.551 -14.882 -14.820 1.00 19.61 ? 124 LYS A CB   2  
ATOM 3859  C CG   . LYS A 1 124 ? -18.637 -15.132 -13.319 1.00 19.54 ? 124 LYS A CG   2  
ATOM 3860  C CD   . LYS A 1 124 ? -17.687 -14.234 -12.534 1.00 19.77 ? 124 LYS A CD   2  
ATOM 3861  C CE   . LYS A 1 124 ? -16.229 -14.511 -12.871 1.00 20.14 ? 124 LYS A CE   2  
ATOM 3862  N NZ   . LYS A 1 124 ? -15.312 -13.563 -12.185 1.00 20.17 ? 124 LYS A NZ   2  
ATOM 3863  H H    . LYS A 1 124 ? -20.714 -13.435 -14.561 1.00 18.29 ? 124 LYS A H    2  
ATOM 3864  H HA   . LYS A 1 124 ? -17.874 -12.861 -14.761 1.00 19.72 ? 124 LYS A HA   2  
ATOM 3865  H HB2  . LYS A 1 124 ? -19.338 -15.445 -15.300 1.00 19.67 ? 124 LYS A HB2  2  
ATOM 3866  H HB3  . LYS A 1 124 ? -17.596 -15.247 -15.170 1.00 19.83 ? 124 LYS A HB3  2  
ATOM 3867  H HG2  . LYS A 1 124 ? -19.647 -14.942 -12.989 1.00 19.49 ? 124 LYS A HG2  2  
ATOM 3868  H HG3  . LYS A 1 124 ? -18.382 -16.164 -13.123 1.00 19.51 ? 124 LYS A HG3  2  
ATOM 3869  H HD2  . LYS A 1 124 ? -17.907 -13.203 -12.768 1.00 19.80 ? 124 LYS A HD2  2  
ATOM 3870  H HD3  . LYS A 1 124 ? -17.841 -14.405 -11.478 1.00 19.76 ? 124 LYS A HD3  2  
ATOM 3871  H HE2  . LYS A 1 124 ? -15.988 -15.519 -12.563 1.00 20.61 ? 124 LYS A HE2  2  
ATOM 3872  H HE3  . LYS A 1 124 ? -16.096 -14.421 -13.940 1.00 20.05 ? 124 LYS A HE3  2  
ATOM 3873  H HZ1  . LYS A 1 124 ? -15.478 -12.594 -12.527 1.00 20.17 ? 124 LYS A HZ1  2  
ATOM 3874  H HZ2  . LYS A 1 124 ? -14.318 -13.820 -12.373 1.00 20.36 ? 124 LYS A HZ2  2  
ATOM 3875  H HZ3  . LYS A 1 124 ? -15.478 -13.588 -11.152 1.00 20.13 ? 124 LYS A HZ3  2  
ATOM 3876  N N    . GLU A 1 125 ? -18.824 -12.038 -17.208 1.00 20.28 ? 125 GLU A N    2  
ATOM 3877  C CA   . GLU A 1 125 ? -18.563 -11.710 -18.601 1.00 21.04 ? 125 GLU A CA   2  
ATOM 3878  C C    . GLU A 1 125 ? -17.114 -11.268 -18.751 1.00 21.94 ? 125 GLU A C    2  
ATOM 3879  O O    . GLU A 1 125 ? -16.834 -10.134 -19.143 1.00 22.50 ? 125 GLU A O    2  
ATOM 3880  C CB   . GLU A 1 125 ? -19.501 -10.606 -19.098 1.00 20.98 ? 125 GLU A CB   2  
ATOM 3881  C CG   . GLU A 1 125 ? -20.899 -11.091 -19.446 1.00 20.93 ? 125 GLU A CG   2  
ATOM 3882  C CD   . GLU A 1 125 ? -20.903 -12.107 -20.576 1.00 21.01 ? 125 GLU A CD   2  
ATOM 3883  O OE1  . GLU A 1 125 ? -20.186 -11.899 -21.581 1.00 20.79 ? 125 GLU A OE1  2  
ATOM 3884  O OE2  . GLU A 1 125 ? -21.633 -13.114 -20.468 1.00 21.38 ? 125 GLU A OE2  2  
ATOM 3885  H H    . GLU A 1 125 ? -19.177 -11.347 -16.609 1.00 19.85 ? 125 GLU A H    2  
ATOM 3886  H HA   . GLU A 1 125 ? -18.718 -12.603 -19.190 1.00 21.11 ? 125 GLU A HA   2  
ATOM 3887  H HB2  . GLU A 1 125 ? -19.586 -9.852  -18.331 1.00 20.83 ? 125 GLU A HB2  2  
ATOM 3888  H HB3  . GLU A 1 125 ? -19.069 -10.158 -19.982 1.00 21.23 ? 125 GLU A HB3  2  
ATOM 3889  H HG2  . GLU A 1 125 ? -21.334 -11.551 -18.570 1.00 20.90 ? 125 GLU A HG2  2  
ATOM 3890  H HG3  . GLU A 1 125 ? -21.499 -10.242 -19.742 1.00 21.00 ? 125 GLU A HG3  2  
ATOM 3891  N N    . ASN A 1 126 ? -16.200 -12.166 -18.406 1.00 22.18 ? 126 ASN A N    2  
ATOM 3892  C CA   . ASN A 1 126 ? -14.775 -11.872 -18.455 1.00 23.12 ? 126 ASN A CA   2  
ATOM 3893  C C    . ASN A 1 126 ? -14.319 -11.681 -19.894 1.00 23.54 ? 126 ASN A C    2  
ATOM 3894  O O    . ASN A 1 126 ? -14.026 -10.562 -20.322 1.00 23.81 ? 126 ASN A O    2  
ATOM 3895  C CB   . ASN A 1 126 ? -13.963 -12.998 -17.802 1.00 23.38 ? 126 ASN A CB   2  
ATOM 3896  C CG   . ASN A 1 126 ? -14.177 -13.106 -16.300 1.00 23.74 ? 126 ASN A CG   2  
ATOM 3897  O OD1  . ASN A 1 126 ? -15.246 -12.788 -15.776 1.00 23.88 ? 126 ASN A OD1  2  
ATOM 3898  N ND2  . ASN A 1 126 ? -13.155 -13.564 -15.596 1.00 23.99 ? 126 ASN A ND2  2  
ATOM 3899  H H    . ASN A 1 126 ? -16.497 -13.052 -18.107 1.00 21.78 ? 126 ASN A H    2  
ATOM 3900  H HA   . ASN A 1 126 ? -14.606 -10.955 -17.911 1.00 23.43 ? 126 ASN A HA   2  
ATOM 3901  H HB2  . ASN A 1 126 ? -14.246 -13.938 -18.249 1.00 23.29 ? 126 ASN A HB2  2  
ATOM 3902  H HB3  . ASN A 1 126 ? -12.912 -12.823 -17.982 1.00 23.53 ? 126 ASN A HB3  2  
ATOM 3903  H HD21 . ASN A 1 126 ? -12.332 -13.802 -16.077 1.00 23.94 ? 126 ASN A HD21 2  
ATOM 3904  H HD22 . ASN A 1 126 ? -13.258 -13.647 -14.624 1.00 24.29 ? 126 ASN A HD22 2  
ATOM 3905  N N    . SER A 1 127 ? -14.275 -12.776 -20.637 1.00 23.70 ? 127 SER A N    2  
ATOM 3906  C CA   . SER A 1 127 ? -13.878 -12.737 -22.031 1.00 24.19 ? 127 SER A CA   2  
ATOM 3907  C C    . SER A 1 127 ? -14.159 -14.082 -22.691 1.00 24.67 ? 127 SER A C    2  
ATOM 3908  O O    . SER A 1 127 ? -13.320 -14.983 -22.677 1.00 25.00 ? 127 SER A O    2  
ATOM 3909  C CB   . SER A 1 127 ? -12.391 -12.387 -22.156 1.00 24.36 ? 127 SER A CB   2  
ATOM 3910  O OG   . SER A 1 127 ? -12.048 -12.085 -23.498 1.00 24.58 ? 127 SER A OG   2  
ATOM 3911  H H    . SER A 1 127 ? -14.514 -13.636 -20.236 1.00 23.55 ? 127 SER A H    2  
ATOM 3912  H HA   . SER A 1 127 ? -14.465 -11.976 -22.525 1.00 24.21 ? 127 SER A HA   2  
ATOM 3913  H HB2  . SER A 1 127 ? -12.174 -11.527 -21.542 1.00 24.43 ? 127 SER A HB2  2  
ATOM 3914  H HB3  . SER A 1 127 ? -11.797 -13.226 -21.825 1.00 24.36 ? 127 SER A HB3  2  
ATOM 3915  H HG   . SER A 1 127 ? -12.799 -11.645 -23.931 1.00 24.78 ? 127 SER A HG   2  
ATOM 3916  N N    . ARG A 1 128 ? -15.352 -14.225 -23.243 1.00 24.79 ? 128 ARG A N    2  
ATOM 3917  C CA   . ARG A 1 128 ? -15.712 -15.433 -23.964 1.00 25.33 ? 128 ARG A CA   2  
ATOM 3918  C C    . ARG A 1 128 ? -16.056 -15.096 -25.410 1.00 25.41 ? 128 ARG A C    2  
ATOM 3919  O O    . ARG A 1 128 ? -17.159 -14.578 -25.667 1.00 25.41 ? 128 ARG A O    2  
ATOM 3920  C CB   . ARG A 1 128 ? -16.862 -16.172 -23.261 1.00 25.71 ? 128 ARG A CB   2  
ATOM 3921  C CG   . ARG A 1 128 ? -18.072 -15.305 -22.949 1.00 25.88 ? 128 ARG A CG   2  
ATOM 3922  C CD   . ARG A 1 128 ? -19.153 -16.100 -22.238 1.00 26.27 ? 128 ARG A CD   2  
ATOM 3923  N NE   . ARG A 1 128 ? -20.370 -15.314 -22.058 1.00 26.63 ? 128 ARG A NE   2  
ATOM 3924  C CZ   . ARG A 1 128 ? -21.544 -15.626 -22.597 1.00 27.12 ? 128 ARG A CZ   2  
ATOM 3925  N NH1  . ARG A 1 128 ? -21.686 -16.748 -23.295 1.00 27.29 ? 128 ARG A NH1  2  
ATOM 3926  N NH2  . ARG A 1 128 ? -22.581 -14.823 -22.423 1.00 27.52 ? 128 ARG A NH2  2  
ATOM 3927  O OXT  . ARG A 1 128 ? -15.195 -15.329 -26.286 1.00 25.55 ? 128 ARG A OXT  2  
ATOM 3928  H H    . ARG A 1 128 ? -16.008 -13.498 -23.172 1.00 24.58 ? 128 ARG A H    2  
ATOM 3929  H HA   . ARG A 1 128 ? -14.842 -16.076 -23.966 1.00 25.50 ? 128 ARG A HA   2  
ATOM 3930  H HB2  . ARG A 1 128 ? -17.189 -16.984 -23.894 1.00 25.74 ? 128 ARG A HB2  2  
ATOM 3931  H HB3  . ARG A 1 128 ? -16.492 -16.582 -22.333 1.00 25.93 ? 128 ARG A HB3  2  
ATOM 3932  H HG2  . ARG A 1 128 ? -17.764 -14.488 -22.314 1.00 25.82 ? 128 ARG A HG2  2  
ATOM 3933  H HG3  . ARG A 1 128 ? -18.475 -14.914 -23.873 1.00 25.90 ? 128 ARG A HG3  2  
ATOM 3934  H HD2  . ARG A 1 128 ? -19.384 -16.978 -22.824 1.00 26.12 ? 128 ARG A HD2  2  
ATOM 3935  H HD3  . ARG A 1 128 ? -18.782 -16.402 -21.270 1.00 26.52 ? 128 ARG A HD3  2  
ATOM 3936  H HE   . ARG A 1 128 ? -20.302 -14.493 -21.515 1.00 26.57 ? 128 ARG A HE   2  
ATOM 3937  H HH11 . ARG A 1 128 ? -20.903 -17.374 -23.413 1.00 27.05 ? 128 ARG A HH11 2  
ATOM 3938  H HH12 . ARG A 1 128 ? -22.567 -16.973 -23.718 1.00 27.71 ? 128 ARG A HH12 2  
ATOM 3939  H HH21 . ARG A 1 128 ? -22.477 -13.981 -21.876 1.00 27.46 ? 128 ARG A HH21 2  
ATOM 3940  H HH22 . ARG A 1 128 ? -23.472 -15.041 -22.839 1.00 27.94 ? 128 ARG A HH22 2  
ATOM 3941  N N    . GLY A 1 1   ? -24.015 -12.371 1.200   1.00 11.87 ? 1   GLY A N    3  
ATOM 3942  C CA   . GLY A 1 1   ? -23.024 -12.788 2.220   1.00 11.28 ? 1   GLY A CA   3  
ATOM 3943  C C    . GLY A 1 1   ? -21.697 -12.093 2.033   1.00 10.17 ? 1   GLY A C    3  
ATOM 3944  O O    . GLY A 1 1   ? -21.544 -11.277 1.121   1.00 9.93  ? 1   GLY A O    3  
ATOM 3945  H H1   . GLY A 1 1   ? -24.922 -12.855 1.361   1.00 12.05 ? 1   GLY A H1   3  
ATOM 3946  H H2   . GLY A 1 1   ? -23.667 -12.606 0.245   1.00 12.06 ? 1   GLY A H2   3  
ATOM 3947  H H3   . GLY A 1 1   ? -24.170 -11.343 1.251   1.00 12.09 ? 1   GLY A H3   3  
ATOM 3948  H HA2  . GLY A 1 1   ? -23.410 -12.550 3.201   1.00 11.56 ? 1   GLY A HA2  3  
ATOM 3949  H HA3  . GLY A 1 1   ? -22.874 -13.855 2.151   1.00 11.57 ? 1   GLY A HA3  3  
ATOM 3950  N N    . ILE A 1 2   ? -20.734 -12.406 2.886   1.00 9.64  ? 2   ILE A N    3  
ATOM 3951  C CA   . ILE A 1 2   ? -19.423 -11.779 2.800   1.00 8.69  ? 2   ILE A CA   3  
ATOM 3952  C C    . ILE A 1 2   ? -18.386 -12.758 2.265   1.00 7.70  ? 2   ILE A C    3  
ATOM 3953  O O    . ILE A 1 2   ? -18.381 -13.937 2.620   1.00 7.79  ? 2   ILE A O    3  
ATOM 3954  C CB   . ILE A 1 2   ? -18.934 -11.192 4.153   1.00 9.07  ? 2   ILE A CB   3  
ATOM 3955  C CG1  . ILE A 1 2   ? -18.657 -12.287 5.203   1.00 9.41  ? 2   ILE A CG1  3  
ATOM 3956  C CG2  . ILE A 1 2   ? -19.942 -10.182 4.686   1.00 9.20  ? 2   ILE A CG2  3  
ATOM 3957  C CD1  . ILE A 1 2   ? -19.895 -12.918 5.807   1.00 9.86  ? 2   ILE A CD1  3  
ATOM 3958  H H    . ILE A 1 2   ? -20.904 -13.083 3.579   1.00 10.00 ? 2   ILE A H    3  
ATOM 3959  H HA   . ILE A 1 2   ? -19.507 -10.961 2.097   1.00 8.63  ? 2   ILE A HA   3  
ATOM 3960  H HB   . ILE A 1 2   ? -18.011 -10.659 3.960   1.00 9.29  ? 2   ILE A HB   3  
ATOM 3961  H HG12 . ILE A 1 2   ? -18.083 -13.077 4.741   1.00 9.55  ? 2   ILE A HG12 3  
ATOM 3962  H HG13 . ILE A 1 2   ? -18.078 -11.859 6.009   1.00 9.48  ? 2   ILE A HG13 3  
ATOM 3963  H HG21 . ILE A 1 2   ? -20.904 -10.660 4.802   1.00 9.37  ? 2   ILE A HG21 3  
ATOM 3964  H HG22 . ILE A 1 2   ? -20.029 -9.358  3.992   1.00 9.31  ? 2   ILE A HG22 3  
ATOM 3965  H HG23 . ILE A 1 2   ? -19.607 -9.810  5.643   1.00 9.29  ? 2   ILE A HG23 3  
ATOM 3966  H HD11 . ILE A 1 2   ? -20.490 -13.367 5.026   1.00 9.83  ? 2   ILE A HD11 3  
ATOM 3967  H HD12 . ILE A 1 2   ? -20.476 -12.159 6.309   1.00 10.30 ? 2   ILE A HD12 3  
ATOM 3968  H HD13 . ILE A 1 2   ? -19.602 -13.676 6.517   1.00 9.99  ? 2   ILE A HD13 3  
ATOM 3969  N N    . ASP A 1 3   ? -17.546 -12.267 1.371   1.00 6.96  ? 3   ASP A N    3  
ATOM 3970  C CA   . ASP A 1 3   ? -16.443 -13.050 0.831   1.00 6.18  ? 3   ASP A CA   3  
ATOM 3971  C C    . ASP A 1 3   ? -15.166 -12.776 1.626   1.00 5.44  ? 3   ASP A C    3  
ATOM 3972  O O    . ASP A 1 3   ? -14.586 -11.693 1.526   1.00 5.15  ? 3   ASP A O    3  
ATOM 3973  C CB   . ASP A 1 3   ? -16.223 -12.714 -0.646  1.00 6.00  ? 3   ASP A CB   3  
ATOM 3974  C CG   . ASP A 1 3   ? -15.061 -13.478 -1.250  1.00 6.08  ? 3   ASP A CG   3  
ATOM 3975  O OD1  . ASP A 1 3   ? -13.899 -13.123 -0.973  1.00 6.03  ? 3   ASP A OD1  3  
ATOM 3976  O OD2  . ASP A 1 3   ? -15.304 -14.454 -1.988  1.00 6.51  ? 3   ASP A OD2  3  
ATOM 3977  H H    . ASP A 1 3   ? -17.659 -11.336 1.071   1.00 7.10  ? 3   ASP A H    3  
ATOM 3978  H HA   . ASP A 1 3   ? -16.698 -14.095 0.923   1.00 6.61  ? 3   ASP A HA   3  
ATOM 3979  H HB2  . ASP A 1 3   ? -17.116 -12.960 -1.201  1.00 6.26  ? 3   ASP A HB2  3  
ATOM 3980  H HB3  . ASP A 1 3   ? -16.024 -11.656 -0.743  1.00 5.95  ? 3   ASP A HB3  3  
ATOM 3981  N N    . PRO A 1 4   ? -14.716 -13.740 2.440   1.00 5.55  ? 4   PRO A N    3  
ATOM 3982  C CA   . PRO A 1 4   ? -13.502 -13.597 3.237   1.00 5.42  ? 4   PRO A CA   3  
ATOM 3983  C C    . PRO A 1 4   ? -12.252 -14.098 2.511   1.00 4.78  ? 4   PRO A C    3  
ATOM 3984  O O    . PRO A 1 4   ? -11.203 -14.294 3.127   1.00 4.92  ? 4   PRO A O    3  
ATOM 3985  C CB   . PRO A 1 4   ? -13.812 -14.474 4.446   1.00 6.21  ? 4   PRO A CB   3  
ATOM 3986  C CG   . PRO A 1 4   ? -14.668 -15.576 3.910   1.00 6.65  ? 4   PRO A CG   3  
ATOM 3987  C CD   . PRO A 1 4   ? -15.366 -15.040 2.681   1.00 6.29  ? 4   PRO A CD   3  
ATOM 3988  H HA   . PRO A 1 4   ? -13.350 -12.577 3.558   1.00 5.67  ? 4   PRO A HA   3  
ATOM 3989  H HB2  . PRO A 1 4   ? -12.891 -14.858 4.865   1.00 6.22  ? 4   PRO A HB2  3  
ATOM 3990  H HB3  . PRO A 1 4   ? -14.338 -13.895 5.190   1.00 6.74  ? 4   PRO A HB3  3  
ATOM 3991  H HG2  . PRO A 1 4   ? -14.051 -16.422 3.645   1.00 6.90  ? 4   PRO A HG2  3  
ATOM 3992  H HG3  . PRO A 1 4   ? -15.396 -15.866 4.653   1.00 7.27  ? 4   PRO A HG3  3  
ATOM 3993  H HD2  . PRO A 1 4   ? -15.214 -15.705 1.842   1.00 6.29  ? 4   PRO A HD2  3  
ATOM 3994  H HD3  . PRO A 1 4   ? -16.420 -14.912 2.875   1.00 6.88  ? 4   PRO A HD3  3  
ATOM 3995  N N    . PHE A 1 5   ? -12.363 -14.288 1.203   1.00 4.52  ? 5   PHE A N    3  
ATOM 3996  C CA   . PHE A 1 5   ? -11.276 -14.860 0.420   1.00 4.35  ? 5   PHE A CA   3  
ATOM 3997  C C    . PHE A 1 5   ? -10.496 -13.771 -0.303  1.00 3.69  ? 5   PHE A C    3  
ATOM 3998  O O    . PHE A 1 5   ? -9.264  -13.760 -0.280  1.00 3.93  ? 5   PHE A O    3  
ATOM 3999  C CB   . PHE A 1 5   ? -11.825 -15.858 -0.603  1.00 5.29  ? 5   PHE A CB   3  
ATOM 4000  C CG   . PHE A 1 5   ? -12.749 -16.885 -0.011  1.00 6.13  ? 5   PHE A CG   3  
ATOM 4001  C CD1  . PHE A 1 5   ? -12.274 -17.825 0.886   1.00 6.78  ? 5   PHE A CD1  3  
ATOM 4002  C CD2  . PHE A 1 5   ? -14.090 -16.902 -0.352  1.00 6.53  ? 5   PHE A CD2  3  
ATOM 4003  C CE1  . PHE A 1 5   ? -13.123 -18.765 1.432   1.00 7.72  ? 5   PHE A CE1  3  
ATOM 4004  C CE2  . PHE A 1 5   ? -14.942 -17.842 0.192   1.00 7.42  ? 5   PHE A CE2  3  
ATOM 4005  C CZ   . PHE A 1 5   ? -14.459 -18.774 1.084   1.00 7.99  ? 5   PHE A CZ   3  
ATOM 4006  H H    . PHE A 1 5   ? -13.194 -14.023 0.748   1.00 4.77  ? 5   PHE A H    3  
ATOM 4007  H HA   . PHE A 1 5   ? -10.612 -15.377 1.096   1.00 4.48  ? 5   PHE A HA   3  
ATOM 4008  H HB2  . PHE A 1 5   ? -12.374 -15.320 -1.362  1.00 5.51  ? 5   PHE A HB2  3  
ATOM 4009  H HB3  . PHE A 1 5   ? -10.999 -16.379 -1.064  1.00 5.50  ? 5   PHE A HB3  3  
ATOM 4010  H HD1  . PHE A 1 5   ? -11.228 -17.819 1.158   1.00 6.71  ? 5   PHE A HD1  3  
ATOM 4011  H HD2  . PHE A 1 5   ? -14.470 -16.171 -1.051  1.00 6.31  ? 5   PHE A HD2  3  
ATOM 4012  H HE1  . PHE A 1 5   ? -12.742 -19.495 2.130   1.00 8.37  ? 5   PHE A HE1  3  
ATOM 4013  H HE2  . PHE A 1 5   ? -15.985 -17.845 -0.080  1.00 7.82  ? 5   PHE A HE2  3  
ATOM 4014  H HZ   . PHE A 1 5   ? -15.124 -19.510 1.510   1.00 8.77  ? 5   PHE A HZ   3  
ATOM 4015  N N    . THR A 1 6   ? -11.232 -12.864 -0.937  1.00 3.31  ? 6   THR A N    3  
ATOM 4016  C CA   . THR A 1 6   ? -10.645 -11.800 -1.741  1.00 3.02  ? 6   THR A CA   3  
ATOM 4017  C C    . THR A 1 6   ? -9.675  -10.955 -0.918  1.00 2.13  ? 6   THR A C    3  
ATOM 4018  O O    . THR A 1 6   ? -10.082 -10.216 -0.016  1.00 2.37  ? 6   THR A O    3  
ATOM 4019  C CB   . THR A 1 6   ? -11.745 -10.896 -2.325  1.00 3.65  ? 6   THR A CB   3  
ATOM 4020  O OG1  . THR A 1 6   ? -12.801 -11.702 -2.861  1.00 4.26  ? 6   THR A OG1  3  
ATOM 4021  C CG2  . THR A 1 6   ? -11.197 -9.998  -3.421  1.00 4.04  ? 6   THR A CG2  3  
ATOM 4022  H H    . THR A 1 6   ? -12.215 -12.916 -0.863  1.00 3.60  ? 6   THR A H    3  
ATOM 4023  H HA   . THR A 1 6   ? -10.107 -12.254 -2.560  1.00 3.50  ? 6   THR A HA   3  
ATOM 4024  H HB   . THR A 1 6   ? -12.140 -10.275 -1.532  1.00 3.99  ? 6   THR A HB   3  
ATOM 4025  H HG1  . THR A 1 6   ? -13.278 -12.130 -2.129  1.00 4.39  ? 6   THR A HG1  3  
ATOM 4026  H HG21 . THR A 1 6   ? -10.797 -10.606 -4.220  1.00 4.31  ? 6   THR A HG21 3  
ATOM 4027  H HG22 . THR A 1 6   ? -10.412 -9.375  -3.017  1.00 4.49  ? 6   THR A HG22 3  
ATOM 4028  H HG23 . THR A 1 6   ? -11.990 -9.373  -3.806  1.00 4.15  ? 6   THR A HG23 3  
ATOM 4029  N N    . MET A 1 7   ? -8.393  -11.065 -1.238  1.00 1.53  ? 7   MET A N    3  
ATOM 4030  C CA   . MET A 1 7   ? -7.356  -10.390 -0.470  1.00 1.05  ? 7   MET A CA   3  
ATOM 4031  C C    . MET A 1 7   ? -7.048  -9.003  -1.038  1.00 0.83  ? 7   MET A C    3  
ATOM 4032  O O    . MET A 1 7   ? -5.896  -8.663  -1.305  1.00 1.39  ? 7   MET A O    3  
ATOM 4033  C CB   . MET A 1 7   ? -6.082  -11.247 -0.416  1.00 1.50  ? 7   MET A CB   3  
ATOM 4034  C CG   . MET A 1 7   ? -5.450  -11.511 -1.773  1.00 2.32  ? 7   MET A CG   3  
ATOM 4035  S SD   . MET A 1 7   ? -3.922  -12.462 -1.652  1.00 3.29  ? 7   MET A SD   3  
ATOM 4036  C CE   . MET A 1 7   ? -3.336  -12.370 -3.343  1.00 3.84  ? 7   MET A CE   3  
ATOM 4037  H H    . MET A 1 7   ? -8.139  -11.626 -2.006  1.00 1.86  ? 7   MET A H    3  
ATOM 4038  H HA   . MET A 1 7   ? -7.729  -10.270 0.535   1.00 1.34  ? 7   MET A HA   3  
ATOM 4039  H HB2  . MET A 1 7   ? -5.353  -10.745 0.203   1.00 1.93  ? 7   MET A HB2  3  
ATOM 4040  H HB3  . MET A 1 7   ? -6.323  -12.199 0.035   1.00 1.78  ? 7   MET A HB3  3  
ATOM 4041  H HG2  . MET A 1 7   ? -6.152  -12.062 -2.381  1.00 2.59  ? 7   MET A HG2  3  
ATOM 4042  H HG3  . MET A 1 7   ? -5.234  -10.564 -2.244  1.00 2.65  ? 7   MET A HG3  3  
ATOM 4043  H HE1  . MET A 1 7   ? -2.411  -12.923 -3.433  1.00 4.06  ? 7   MET A HE1  3  
ATOM 4044  H HE2  . MET A 1 7   ? -3.163  -11.337 -3.607  1.00 4.06  ? 7   MET A HE2  3  
ATOM 4045  H HE3  . MET A 1 7   ? -4.075  -12.795 -4.006  1.00 4.32  ? 7   MET A HE3  3  
ATOM 4046  N N    . LEU A 1 8   ? -8.080  -8.187  -1.196  1.00 0.80  ? 8   LEU A N    3  
ATOM 4047  C CA   . LEU A 1 8   ? -7.899  -6.812  -1.652  1.00 0.56  ? 8   LEU A CA   3  
ATOM 4048  C C    . LEU A 1 8   ? -7.498  -5.928  -0.482  1.00 0.48  ? 8   LEU A C    3  
ATOM 4049  O O    . LEU A 1 8   ? -8.077  -4.868  -0.250  1.00 0.47  ? 8   LEU A O    3  
ATOM 4050  C CB   . LEU A 1 8   ? -9.176  -6.282  -2.304  1.00 0.47  ? 8   LEU A CB   3  
ATOM 4051  C CG   . LEU A 1 8   ? -9.609  -7.023  -3.562  1.00 0.56  ? 8   LEU A CG   3  
ATOM 4052  C CD1  . LEU A 1 8   ? -10.822 -6.354  -4.179  1.00 0.61  ? 8   LEU A CD1  3  
ATOM 4053  C CD2  . LEU A 1 8   ? -8.468  -7.086  -4.560  1.00 0.72  ? 8   LEU A CD2  3  
ATOM 4054  H H    . LEU A 1 8   ? -8.983  -8.512  -0.993  1.00 1.36  ? 8   LEU A H    3  
ATOM 4055  H HA   . LEU A 1 8   ? -7.102  -6.809  -2.382  1.00 0.70  ? 8   LEU A HA   3  
ATOM 4056  H HB2  . LEU A 1 8   ? -9.975  -6.343  -1.580  1.00 0.54  ? 8   LEU A HB2  3  
ATOM 4057  H HB3  . LEU A 1 8   ? -9.022  -5.244  -2.558  1.00 0.53  ? 8   LEU A HB3  3  
ATOM 4058  H HG   . LEU A 1 8   ? -9.882  -8.034  -3.299  1.00 0.64  ? 8   LEU A HG   3  
ATOM 4059  H HD11 . LEU A 1 8   ? -10.569 -5.344  -4.466  1.00 1.21  ? 8   LEU A HD11 3  
ATOM 4060  H HD12 . LEU A 1 8   ? -11.626 -6.335  -3.457  1.00 0.99  ? 8   LEU A HD12 3  
ATOM 4061  H HD13 . LEU A 1 8   ? -11.133 -6.909  -5.053  1.00 1.34  ? 8   LEU A HD13 3  
ATOM 4062  H HD21 . LEU A 1 8   ? -7.623  -7.589  -4.110  1.00 1.31  ? 8   LEU A HD21 3  
ATOM 4063  H HD22 . LEU A 1 8   ? -8.182  -6.085  -4.844  1.00 1.24  ? 8   LEU A HD22 3  
ATOM 4064  H HD23 . LEU A 1 8   ? -8.787  -7.632  -5.435  1.00 1.27  ? 8   LEU A HD23 3  
ATOM 4065  N N    . ARG A 1 9   ? -6.495  -6.379  0.241   1.00 0.52  ? 9   ARG A N    3  
ATOM 4066  C CA   . ARG A 1 9   ? -6.052  -5.720  1.448   1.00 0.51  ? 9   ARG A CA   3  
ATOM 4067  C C    . ARG A 1 9   ? -4.590  -5.327  1.316   1.00 0.43  ? 9   ARG A C    3  
ATOM 4068  O O    . ARG A 1 9   ? -3.833  -5.978  0.596   1.00 0.47  ? 9   ARG A O    3  
ATOM 4069  C CB   . ARG A 1 9   ? -6.259  -6.653  2.641   1.00 0.69  ? 9   ARG A CB   3  
ATOM 4070  C CG   . ARG A 1 9   ? -5.641  -8.030  2.454   1.00 1.15  ? 9   ARG A CG   3  
ATOM 4071  C CD   . ARG A 1 9   ? -5.930  -8.931  3.639   1.00 1.21  ? 9   ARG A CD   3  
ATOM 4072  N NE   . ARG A 1 9   ? -5.267  -10.227 3.518   1.00 1.84  ? 9   ARG A NE   3  
ATOM 4073  C CZ   . ARG A 1 9   ? -4.305  -10.644 4.340   1.00 2.23  ? 9   ARG A CZ   3  
ATOM 4074  N NH1  . ARG A 1 9   ? -3.841  -9.834  5.286   1.00 2.21  ? 9   ARG A NH1  3  
ATOM 4075  N NH2  . ARG A 1 9   ? -3.784  -11.855 4.197   1.00 3.09  ? 9   ARG A NH2  3  
ATOM 4076  H H    . ARG A 1 9   ? -6.016  -7.181  -0.063  1.00 0.60  ? 9   ARG A H    3  
ATOM 4077  H HA   . ARG A 1 9   ? -6.647  -4.829  1.585   1.00 0.51  ? 9   ARG A HA   3  
ATOM 4078  H HB2  . ARG A 1 9   ? -5.817  -6.201  3.516   1.00 1.21  ? 9   ARG A HB2  3  
ATOM 4079  H HB3  . ARG A 1 9   ? -7.320  -6.777  2.808   1.00 1.12  ? 9   ARG A HB3  3  
ATOM 4080  H HG2  . ARG A 1 9   ? -6.049  -8.482  1.562   1.00 1.62  ? 9   ARG A HG2  3  
ATOM 4081  H HG3  . ARG A 1 9   ? -4.571  -7.923  2.348   1.00 1.68  ? 9   ARG A HG3  3  
ATOM 4082  H HD2  . ARG A 1 9   ? -5.583  -8.442  4.538   1.00 1.50  ? 9   ARG A HD2  3  
ATOM 4083  H HD3  . ARG A 1 9   ? -6.998  -9.086  3.706   1.00 1.36  ? 9   ARG A HD3  3  
ATOM 4084  H HE   . ARG A 1 9   ? -5.572  -10.826 2.797   1.00 2.36  ? 9   ARG A HE   3  
ATOM 4085  H HH11 . ARG A 1 9   ? -4.206  -8.903  5.382   1.00 1.99  ? 9   ARG A HH11 3  
ATOM 4086  H HH12 . ARG A 1 9   ? -3.125  -10.152 5.918   1.00 2.76  ? 9   ARG A HH12 3  
ATOM 4087  H HH21 . ARG A 1 9   ? -4.112  -12.466 3.461   1.00 3.51  ? 9   ARG A HH21 3  
ATOM 4088  H HH22 . ARG A 1 9   ? -3.061  -12.173 4.824   1.00 3.49  ? 9   ARG A HH22 3  
ATOM 4089  N N    . PRO A 1 10  ? -4.182  -4.240  1.987   1.00 0.36  ? 10  PRO A N    3  
ATOM 4090  C CA   . PRO A 1 10  ? -2.807  -3.758  1.934   1.00 0.30  ? 10  PRO A CA   3  
ATOM 4091  C C    . PRO A 1 10  ? -1.847  -4.701  2.641   1.00 0.28  ? 10  PRO A C    3  
ATOM 4092  O O    . PRO A 1 10  ? -2.250  -5.493  3.497   1.00 0.38  ? 10  PRO A O    3  
ATOM 4093  C CB   . PRO A 1 10  ? -2.871  -2.415  2.665   1.00 0.29  ? 10  PRO A CB   3  
ATOM 4094  C CG   . PRO A 1 10  ? -4.035  -2.541  3.580   1.00 0.47  ? 10  PRO A CG   3  
ATOM 4095  C CD   . PRO A 1 10  ? -5.026  -3.405  2.855   1.00 0.40  ? 10  PRO A CD   3  
ATOM 4096  H HA   . PRO A 1 10  ? -2.480  -3.603  0.916   1.00 0.33  ? 10  PRO A HA   3  
ATOM 4097  H HB2  . PRO A 1 10  ? -1.953  -2.256  3.213   1.00 0.37  ? 10  PRO A HB2  3  
ATOM 4098  H HB3  . PRO A 1 10  ? -3.015  -1.619  1.953   1.00 0.38  ? 10  PRO A HB3  3  
ATOM 4099  H HG2  . PRO A 1 10  ? -3.730  -3.011  4.504   1.00 0.70  ? 10  PRO A HG2  3  
ATOM 4100  H HG3  . PRO A 1 10  ? -4.458  -1.566  3.774   1.00 0.81  ? 10  PRO A HG3  3  
ATOM 4101  H HD2  . PRO A 1 10  ? -5.573  -4.012  3.554   1.00 0.50  ? 10  PRO A HD2  3  
ATOM 4102  H HD3  . PRO A 1 10  ? -5.698  -2.797  2.269   1.00 0.57  ? 10  PRO A HD3  3  
ATOM 4103  N N    . ARG A 1 11  ? -0.584  -4.605  2.283   1.00 0.29  ? 11  ARG A N    3  
ATOM 4104  C CA   . ARG A 1 11  ? 0.448   -5.428  2.886   1.00 0.34  ? 11  ARG A CA   3  
ATOM 4105  C C    . ARG A 1 11  ? 1.471   -4.546  3.596   1.00 0.27  ? 11  ARG A C    3  
ATOM 4106  O O    . ARG A 1 11  ? 1.944   -3.554  3.037   1.00 0.27  ? 11  ARG A O    3  
ATOM 4107  C CB   . ARG A 1 11  ? 1.122   -6.307  1.820   1.00 0.49  ? 11  ARG A CB   3  
ATOM 4108  C CG   . ARG A 1 11  ? 1.697   -5.523  0.648   1.00 0.63  ? 11  ARG A CG   3  
ATOM 4109  C CD   . ARG A 1 11  ? 2.266   -6.436  -0.431  1.00 1.00  ? 11  ARG A CD   3  
ATOM 4110  N NE   . ARG A 1 11  ? 1.232   -7.248  -1.076  1.00 1.22  ? 11  ARG A NE   3  
ATOM 4111  C CZ   . ARG A 1 11  ? 0.965   -7.212  -2.384  1.00 1.59  ? 11  ARG A CZ   3  
ATOM 4112  N NH1  . ARG A 1 11  ? 1.610   -6.370  -3.178  1.00 1.95  ? 11  ARG A NH1  3  
ATOM 4113  N NH2  . ARG A 1 11  ? 0.048   -8.020  -2.895  1.00 2.37  ? 11  ARG A NH2  3  
ATOM 4114  H H    . ARG A 1 11  ? -0.334  -3.949  1.592   1.00 0.33  ? 11  ARG A H    3  
ATOM 4115  H HA   . ARG A 1 11  ? -0.026  -6.066  3.618   1.00 0.40  ? 11  ARG A HA   3  
ATOM 4116  H HB2  . ARG A 1 11  ? 1.927   -6.858  2.283   1.00 0.63  ? 11  ARG A HB2  3  
ATOM 4117  H HB3  . ARG A 1 11  ? 0.396   -7.006  1.436   1.00 0.78  ? 11  ARG A HB3  3  
ATOM 4118  H HG2  . ARG A 1 11  ? 0.913   -4.922  0.213   1.00 0.94  ? 11  ARG A HG2  3  
ATOM 4119  H HG3  . ARG A 1 11  ? 2.484   -4.877  1.010   1.00 0.71  ? 11  ARG A HG3  3  
ATOM 4120  H HD2  . ARG A 1 11  ? 2.749   -5.828  -1.180  1.00 1.68  ? 11  ARG A HD2  3  
ATOM 4121  H HD3  . ARG A 1 11  ? 2.993   -7.093  0.022   1.00 1.50  ? 11  ARG A HD3  3  
ATOM 4122  H HE   . ARG A 1 11  ? 0.724   -7.867  -0.506  1.00 1.83  ? 11  ARG A HE   3  
ATOM 4123  H HH11 . ARG A 1 11  ? 2.315   -5.743  -2.803  1.00 2.06  ? 11  ARG A HH11 3  
ATOM 4124  H HH12 . ARG A 1 11  ? 1.407   -6.337  -4.159  1.00 2.55  ? 11  ARG A HH12 3  
ATOM 4125  H HH21 . ARG A 1 11  ? -0.448  -8.668  -2.294  1.00 2.82  ? 11  ARG A HH21 3  
ATOM 4126  H HH22 . ARG A 1 11  ? -0.158  -7.995  -3.875  1.00 2.79  ? 11  ARG A HH22 3  
ATOM 4127  N N    . LEU A 1 12  ? 1.794   -4.896  4.833   1.00 0.29  ? 12  LEU A N    3  
ATOM 4128  C CA   . LEU A 1 12  ? 2.754   -4.129  5.614   1.00 0.26  ? 12  LEU A CA   3  
ATOM 4129  C C    . LEU A 1 12  ? 4.125   -4.779  5.527   1.00 0.25  ? 12  LEU A C    3  
ATOM 4130  O O    . LEU A 1 12  ? 4.346   -5.868  6.056   1.00 0.32  ? 12  LEU A O    3  
ATOM 4131  C CB   . LEU A 1 12  ? 2.309   -4.032  7.078   1.00 0.34  ? 12  LEU A CB   3  
ATOM 4132  C CG   . LEU A 1 12  ? 3.168   -3.124  7.967   1.00 0.60  ? 12  LEU A CG   3  
ATOM 4133  C CD1  . LEU A 1 12  ? 3.046   -1.671  7.533   1.00 1.32  ? 12  LEU A CD1  3  
ATOM 4134  C CD2  . LEU A 1 12  ? 2.775   -3.272  9.430   1.00 1.28  ? 12  LEU A CD2  3  
ATOM 4135  H H    . LEU A 1 12  ? 1.383   -5.692  5.231   1.00 0.35  ? 12  LEU A H    3  
ATOM 4136  H HA   . LEU A 1 12  ? 2.810   -3.135  5.192   1.00 0.24  ? 12  LEU A HA   3  
ATOM 4137  H HB2  . LEU A 1 12  ? 1.294   -3.664  7.098   1.00 0.72  ? 12  LEU A HB2  3  
ATOM 4138  H HB3  . LEU A 1 12  ? 2.322   -5.025  7.501   1.00 0.66  ? 12  LEU A HB3  3  
ATOM 4139  H HG   . LEU A 1 12  ? 4.205   -3.413  7.869   1.00 1.58  ? 12  LEU A HG   3  
ATOM 4140  H HD11 . LEU A 1 12  ? 2.020   -1.347  7.644   1.00 1.80  ? 12  LEU A HD11 3  
ATOM 4141  H HD12 . LEU A 1 12  ? 3.344   -1.576  6.500   1.00 1.95  ? 12  LEU A HD12 3  
ATOM 4142  H HD13 . LEU A 1 12  ? 3.684   -1.056  8.151   1.00 1.91  ? 12  LEU A HD13 3  
ATOM 4143  H HD21 . LEU A 1 12  ? 3.408   -2.642  10.038  1.00 1.90  ? 12  LEU A HD21 3  
ATOM 4144  H HD22 . LEU A 1 12  ? 2.893   -4.301  9.733   1.00 1.96  ? 12  LEU A HD22 3  
ATOM 4145  H HD23 . LEU A 1 12  ? 1.744   -2.974  9.559   1.00 1.71  ? 12  LEU A HD23 3  
ATOM 4146  N N    . CYS A 1 13  ? 5.037   -4.107  4.856   1.00 0.23  ? 13  CYS A N    3  
ATOM 4147  C CA   . CYS A 1 13  ? 6.377   -4.620  4.667   1.00 0.25  ? 13  CYS A CA   3  
ATOM 4148  C C    . CYS A 1 13  ? 7.301   -4.069  5.739   1.00 0.22  ? 13  CYS A C    3  
ATOM 4149  O O    . CYS A 1 13  ? 7.511   -2.862  5.828   1.00 0.24  ? 13  CYS A O    3  
ATOM 4150  C CB   . CYS A 1 13  ? 6.883   -4.232  3.278   1.00 0.29  ? 13  CYS A CB   3  
ATOM 4151  S SG   . CYS A 1 13  ? 5.726   -4.634  1.950   1.00 0.40  ? 13  CYS A SG   3  
ATOM 4152  H H    . CYS A 1 13  ? 4.805   -3.226  4.479   1.00 0.23  ? 13  CYS A H    3  
ATOM 4153  H HA   . CYS A 1 13  ? 6.341   -5.697  4.746   1.00 0.28  ? 13  CYS A HA   3  
ATOM 4154  H HB2  . CYS A 1 13  ? 7.057   -3.166  3.252   1.00 0.31  ? 13  CYS A HB2  3  
ATOM 4155  H HB3  . CYS A 1 13  ? 7.809   -4.750  3.079   1.00 0.31  ? 13  CYS A HB3  3  
ATOM 4156  H HG   . CYS A 1 13  ? 4.565   -4.945  2.509   1.00 1.17  ? 13  CYS A HG   3  
ATOM 4157  N N    . THR A 1 14  ? 7.844   -4.951  6.556   1.00 0.23  ? 14  THR A N    3  
ATOM 4158  C CA   . THR A 1 14  ? 8.744   -4.531  7.615   1.00 0.24  ? 14  THR A CA   3  
ATOM 4159  C C    . THR A 1 14  ? 10.154  -4.994  7.289   1.00 0.22  ? 14  THR A C    3  
ATOM 4160  O O    . THR A 1 14  ? 10.413  -6.195  7.191   1.00 0.25  ? 14  THR A O    3  
ATOM 4161  C CB   . THR A 1 14  ? 8.305   -5.107  8.976   1.00 0.31  ? 14  THR A CB   3  
ATOM 4162  O OG1  . THR A 1 14  ? 6.934   -4.770  9.227   1.00 0.35  ? 14  THR A OG1  3  
ATOM 4163  C CG2  . THR A 1 14  ? 9.176   -4.572  10.105  1.00 0.35  ? 14  THR A CG2  3  
ATOM 4164  H H    . THR A 1 14  ? 7.661   -5.906  6.427   1.00 0.26  ? 14  THR A H    3  
ATOM 4165  H HA   . THR A 1 14  ? 8.722   -3.451  7.672   1.00 0.23  ? 14  THR A HA   3  
ATOM 4166  H HB   . THR A 1 14  ? 8.403   -6.182  8.943   1.00 0.33  ? 14  THR A HB   3  
ATOM 4167  H HG1  . THR A 1 14  ? 6.388   -5.079  8.496   1.00 0.65  ? 14  THR A HG1  3  
ATOM 4168  H HG21 . THR A 1 14  ? 9.126   -3.494  10.119  1.00 1.01  ? 14  THR A HG21 3  
ATOM 4169  H HG22 . THR A 1 14  ? 10.200  -4.882  9.950   1.00 1.13  ? 14  THR A HG22 3  
ATOM 4170  H HG23 . THR A 1 14  ? 8.822   -4.961  11.048  1.00 1.10  ? 14  THR A HG23 3  
ATOM 4171  N N    . MET A 1 15  ? 11.061  -4.046  7.125   1.00 0.20  ? 15  MET A N    3  
ATOM 4172  C CA   . MET A 1 15  ? 12.411  -4.357  6.685   1.00 0.19  ? 15  MET A CA   3  
ATOM 4173  C C    . MET A 1 15  ? 13.438  -3.726  7.606   1.00 0.21  ? 15  MET A C    3  
ATOM 4174  O O    . MET A 1 15  ? 13.302  -2.568  8.003   1.00 0.21  ? 15  MET A O    3  
ATOM 4175  C CB   . MET A 1 15  ? 12.630  -3.878  5.246   1.00 0.21  ? 15  MET A CB   3  
ATOM 4176  C CG   . MET A 1 15  ? 12.352  -2.397  5.044   1.00 0.24  ? 15  MET A CG   3  
ATOM 4177  S SD   . MET A 1 15  ? 12.489  -1.884  3.320   1.00 0.88  ? 15  MET A SD   3  
ATOM 4178  C CE   . MET A 1 15  ? 11.114  -2.769  2.592   1.00 0.28  ? 15  MET A CE   3  
ATOM 4179  H H    . MET A 1 15  ? 10.819  -3.109  7.314   1.00 0.21  ? 15  MET A H    3  
ATOM 4180  H HA   . MET A 1 15  ? 12.528  -5.429  6.717   1.00 0.22  ? 15  MET A HA   3  
ATOM 4181  H HB2  . MET A 1 15  ? 13.656  -4.068  4.970   1.00 0.26  ? 15  MET A HB2  3  
ATOM 4182  H HB3  . MET A 1 15  ? 11.984  -4.436  4.589   1.00 0.23  ? 15  MET A HB3  3  
ATOM 4183  H HG2  . MET A 1 15  ? 11.350  -2.183  5.386   1.00 0.48  ? 15  MET A HG2  3  
ATOM 4184  H HG3  . MET A 1 15  ? 13.058  -1.830  5.630   1.00 0.46  ? 15  MET A HG3  3  
ATOM 4185  H HE1  . MET A 1 15  ? 11.251  -3.829  2.740   1.00 1.04  ? 15  MET A HE1  3  
ATOM 4186  H HE2  . MET A 1 15  ? 11.068  -2.557  1.534   1.00 1.08  ? 15  MET A HE2  3  
ATOM 4187  H HE3  . MET A 1 15  ? 10.194  -2.456  3.064   1.00 1.03  ? 15  MET A HE3  3  
ATOM 4188  N N    . LYS A 1 16  ? 14.455  -4.497  7.942   1.00 0.29  ? 16  LYS A N    3  
ATOM 4189  C CA   . LYS A 1 16  ? 15.527  -4.022  8.794   1.00 0.37  ? 16  LYS A CA   3  
ATOM 4190  C C    . LYS A 1 16  ? 16.801  -3.892  7.972   1.00 0.40  ? 16  LYS A C    3  
ATOM 4191  O O    . LYS A 1 16  ? 17.080  -4.731  7.113   1.00 0.48  ? 16  LYS A O    3  
ATOM 4192  C CB   . LYS A 1 16  ? 15.735  -4.984  9.964   1.00 0.50  ? 16  LYS A CB   3  
ATOM 4193  C CG   . LYS A 1 16  ? 16.626  -4.425  11.058  1.00 0.90  ? 16  LYS A CG   3  
ATOM 4194  C CD   . LYS A 1 16  ? 16.739  -5.385  12.230  1.00 1.09  ? 16  LYS A CD   3  
ATOM 4195  C CE   . LYS A 1 16  ? 17.515  -4.768  13.383  1.00 1.96  ? 16  LYS A CE   3  
ATOM 4196  N NZ   . LYS A 1 16  ? 18.887  -4.362  12.980  1.00 2.58  ? 16  LYS A NZ   3  
ATOM 4197  H H    . LYS A 1 16  ? 14.494  -5.414  7.594   1.00 0.34  ? 16  LYS A H    3  
ATOM 4198  H HA   . LYS A 1 16  ? 15.250  -3.049  9.174   1.00 0.41  ? 16  LYS A HA   3  
ATOM 4199  H HB2  . LYS A 1 16  ? 14.773  -5.220  10.397  1.00 0.99  ? 16  LYS A HB2  3  
ATOM 4200  H HB3  . LYS A 1 16  ? 16.184  -5.892  9.592   1.00 1.07  ? 16  LYS A HB3  3  
ATOM 4201  H HG2  . LYS A 1 16  ? 17.611  -4.255  10.650  1.00 1.53  ? 16  LYS A HG2  3  
ATOM 4202  H HG3  . LYS A 1 16  ? 16.210  -3.490  11.404  1.00 1.46  ? 16  LYS A HG3  3  
ATOM 4203  H HD2  . LYS A 1 16  ? 15.747  -5.639  12.572  1.00 1.54  ? 16  LYS A HD2  3  
ATOM 4204  H HD3  . LYS A 1 16  ? 17.250  -6.280  11.902  1.00 1.45  ? 16  LYS A HD3  3  
ATOM 4205  H HE2  . LYS A 1 16  ? 16.982  -3.896  13.731  1.00 2.45  ? 16  LYS A HE2  3  
ATOM 4206  H HE3  . LYS A 1 16  ? 17.582  -5.490  14.184  1.00 2.53  ? 16  LYS A HE3  3  
ATOM 4207  H HZ1  . LYS A 1 16  ? 19.387  -5.164  12.538  1.00 2.80  ? 16  LYS A HZ1  3  
ATOM 4208  H HZ2  . LYS A 1 16  ? 19.428  -4.048  13.812  1.00 3.11  ? 16  LYS A HZ2  3  
ATOM 4209  H HZ3  . LYS A 1 16  ? 18.844  -3.573  12.294  1.00 3.02  ? 16  LYS A HZ3  3  
ATOM 4210  N N    . LYS A 1 17  ? 17.551  -2.830  8.223   1.00 0.41  ? 17  LYS A N    3  
ATOM 4211  C CA   . LYS A 1 17  ? 18.722  -2.509  7.430   1.00 0.50  ? 17  LYS A CA   3  
ATOM 4212  C C    . LYS A 1 17  ? 19.786  -3.595  7.504   1.00 0.60  ? 17  LYS A C    3  
ATOM 4213  O O    . LYS A 1 17  ? 20.241  -3.970  8.589   1.00 0.67  ? 17  LYS A O    3  
ATOM 4214  C CB   . LYS A 1 17  ? 19.311  -1.188  7.901   1.00 0.51  ? 17  LYS A CB   3  
ATOM 4215  C CG   . LYS A 1 17  ? 19.715  -0.278  6.765   1.00 0.52  ? 17  LYS A CG   3  
ATOM 4216  C CD   . LYS A 1 17  ? 20.200  1.062   7.284   1.00 0.53  ? 17  LYS A CD   3  
ATOM 4217  C CE   . LYS A 1 17  ? 19.075  1.833   7.954   1.00 0.62  ? 17  LYS A CE   3  
ATOM 4218  N NZ   . LYS A 1 17  ? 19.583  3.015   8.696   1.00 0.92  ? 17  LYS A NZ   3  
ATOM 4219  H H    . LYS A 1 17  ? 17.299  -2.224  8.964   1.00 0.41  ? 17  LYS A H    3  
ATOM 4220  H HA   . LYS A 1 17  ? 18.406  -2.401  6.404   1.00 0.52  ? 17  LYS A HA   3  
ATOM 4221  H HB2  . LYS A 1 17  ? 18.577  -0.672  8.504   1.00 0.68  ? 17  LYS A HB2  3  
ATOM 4222  H HB3  . LYS A 1 17  ? 20.182  -1.389  8.503   1.00 0.68  ? 17  LYS A HB3  3  
ATOM 4223  H HG2  . LYS A 1 17  ? 20.505  -0.747  6.198   1.00 0.67  ? 17  LYS A HG2  3  
ATOM 4224  H HG3  . LYS A 1 17  ? 18.852  -0.124  6.138   1.00 0.68  ? 17  LYS A HG3  3  
ATOM 4225  H HD2  . LYS A 1 17  ? 20.989  0.896   8.004   1.00 0.91  ? 17  LYS A HD2  3  
ATOM 4226  H HD3  . LYS A 1 17  ? 20.581  1.644   6.457   1.00 0.79  ? 17  LYS A HD3  3  
ATOM 4227  H HE2  . LYS A 1 17  ? 18.382  2.164   7.194   1.00 0.85  ? 17  LYS A HE2  3  
ATOM 4228  H HE3  . LYS A 1 17  ? 18.565  1.175   8.643   1.00 0.95  ? 17  LYS A HE3  3  
ATOM 4229  H HZ1  . LYS A 1 17  ? 18.786  3.559   9.093   1.00 1.50  ? 17  LYS A HZ1  3  
ATOM 4230  H HZ2  . LYS A 1 17  ? 20.131  3.633   8.060   1.00 1.28  ? 17  LYS A HZ2  3  
ATOM 4231  H HZ3  . LYS A 1 17  ? 20.201  2.706   9.479   1.00 1.39  ? 17  LYS A HZ3  3  
ATOM 4232  N N    . GLY A 1 18  ? 20.178  -4.094  6.340   1.00 0.68  ? 18  GLY A N    3  
ATOM 4233  C CA   . GLY A 1 18  ? 21.268  -5.034  6.261   1.00 0.85  ? 18  GLY A CA   3  
ATOM 4234  C C    . GLY A 1 18  ? 22.515  -4.385  5.699   1.00 1.05  ? 18  GLY A C    3  
ATOM 4235  O O    . GLY A 1 18  ? 22.713  -3.181  5.865   1.00 1.28  ? 18  GLY A O    3  
ATOM 4236  H H    . GLY A 1 18  ? 19.713  -3.820  5.520   1.00 0.68  ? 18  GLY A H    3  
ATOM 4237  H HA2  . GLY A 1 18  ? 21.481  -5.413  7.251   1.00 0.90  ? 18  GLY A HA2  3  
ATOM 4238  H HA3  . GLY A 1 18  ? 20.982  -5.856  5.621   1.00 0.94  ? 18  GLY A HA3  3  
ATOM 4239  N N    . PRO A 1 19  ? 23.362  -5.153  5.006   1.00 1.24  ? 19  PRO A N    3  
ATOM 4240  C CA   . PRO A 1 19  ? 24.630  -4.654  4.458   1.00 1.57  ? 19  PRO A CA   3  
ATOM 4241  C C    . PRO A 1 19  ? 24.424  -3.698  3.285   1.00 1.57  ? 19  PRO A C    3  
ATOM 4242  O O    . PRO A 1 19  ? 25.224  -2.788  3.058   1.00 2.23  ? 19  PRO A O    3  
ATOM 4243  C CB   . PRO A 1 19  ? 25.350  -5.927  3.987   1.00 1.91  ? 19  PRO A CB   3  
ATOM 4244  C CG   . PRO A 1 19  ? 24.571  -7.070  4.557   1.00 1.86  ? 19  PRO A CG   3  
ATOM 4245  C CD   . PRO A 1 19  ? 23.164  -6.574  4.710   1.00 1.40  ? 19  PRO A CD   3  
ATOM 4246  H HA   . PRO A 1 19  ? 25.220  -4.164  5.218   1.00 1.77  ? 19  PRO A HA   3  
ATOM 4247  H HB2  . PRO A 1 19  ? 25.358  -5.957  2.907   1.00 2.10  ? 19  PRO A HB2  3  
ATOM 4248  H HB3  . PRO A 1 19  ? 26.365  -5.923  4.357   1.00 2.19  ? 19  PRO A HB3  3  
ATOM 4249  H HG2  . PRO A 1 19  ? 24.601  -7.909  3.876   1.00 2.16  ? 19  PRO A HG2  3  
ATOM 4250  H HG3  . PRO A 1 19  ? 24.978  -7.350  5.518   1.00 2.10  ? 19  PRO A HG3  3  
ATOM 4251  H HD2  . PRO A 1 19  ? 22.610  -6.705  3.792   1.00 1.45  ? 19  PRO A HD2  3  
ATOM 4252  H HD3  . PRO A 1 19  ? 22.668  -7.074  5.530   1.00 1.43  ? 19  PRO A HD3  3  
ATOM 4253  N N    . SER A 1 20  ? 23.350  -3.910  2.538   1.00 1.40  ? 20  SER A N    3  
ATOM 4254  C CA   . SER A 1 20  ? 23.050  -3.081  1.379   1.00 1.65  ? 20  SER A CA   3  
ATOM 4255  C C    . SER A 1 20  ? 21.842  -2.188  1.656   1.00 1.43  ? 20  SER A C    3  
ATOM 4256  O O    . SER A 1 20  ? 21.204  -1.688  0.730   1.00 1.93  ? 20  SER A O    3  
ATOM 4257  C CB   . SER A 1 20  ? 22.775  -3.965  0.160   1.00 2.14  ? 20  SER A CB   3  
ATOM 4258  O OG   . SER A 1 20  ? 23.833  -4.886  -0.059  1.00 2.87  ? 20  SER A OG   3  
ATOM 4259  H H    . SER A 1 20  ? 22.746  -4.642  2.770   1.00 1.61  ? 20  SER A H    3  
ATOM 4260  H HA   . SER A 1 20  ? 23.911  -2.460  1.179   1.00 1.88  ? 20  SER A HA   3  
ATOM 4261  H HB2  . SER A 1 20  ? 21.860  -4.520  0.319   1.00 2.20  ? 20  SER A HB2  3  
ATOM 4262  H HB3  . SER A 1 20  ? 22.668  -3.340  -0.715  1.00 2.54  ? 20  SER A HB3  3  
ATOM 4263  H HG   . SER A 1 20  ? 24.650  -4.538  0.334   1.00 3.28  ? 20  SER A HG   3  
ATOM 4264  N N    . GLY A 1 21  ? 21.536  -1.989  2.932   1.00 1.04  ? 21  GLY A N    3  
ATOM 4265  C CA   . GLY A 1 21  ? 20.370  -1.213  3.297   1.00 0.94  ? 21  GLY A CA   3  
ATOM 4266  C C    . GLY A 1 21  ? 19.103  -2.025  3.211   1.00 0.97  ? 21  GLY A C    3  
ATOM 4267  O O    . GLY A 1 21  ? 18.880  -2.922  4.025   1.00 1.93  ? 21  GLY A O    3  
ATOM 4268  H H    . GLY A 1 21  ? 22.111  -2.366  3.630   1.00 1.21  ? 21  GLY A H    3  
ATOM 4269  H HA2  . GLY A 1 21  ? 20.480  -0.858  4.311   1.00 0.97  ? 21  GLY A HA2  3  
ATOM 4270  H HA3  . GLY A 1 21  ? 20.287  -0.364  2.635   1.00 1.07  ? 21  GLY A HA3  3  
ATOM 4271  N N    . TYR A 1 22  ? 18.279  -1.727  2.220   1.00 0.74  ? 22  TYR A N    3  
ATOM 4272  C CA   . TYR A 1 22  ? 17.006  -2.410  2.065   1.00 0.70  ? 22  TYR A CA   3  
ATOM 4273  C C    . TYR A 1 22  ? 16.951  -3.143  0.726   1.00 0.89  ? 22  TYR A C    3  
ATOM 4274  O O    . TYR A 1 22  ? 16.581  -4.314  0.665   1.00 1.82  ? 22  TYR A O    3  
ATOM 4275  C CB   . TYR A 1 22  ? 15.855  -1.412  2.181   1.00 0.64  ? 22  TYR A CB   3  
ATOM 4276  C CG   . TYR A 1 22  ? 15.922  -0.538  3.420   1.00 0.50  ? 22  TYR A CG   3  
ATOM 4277  C CD1  . TYR A 1 22  ? 15.978  -1.094  4.694   1.00 0.47  ? 22  TYR A CD1  3  
ATOM 4278  C CD2  . TYR A 1 22  ? 15.915  0.846   3.313   1.00 0.55  ? 22  TYR A CD2  3  
ATOM 4279  C CE1  . TYR A 1 22  ? 16.025  -0.294  5.820   1.00 0.46  ? 22  TYR A CE1  3  
ATOM 4280  C CE2  . TYR A 1 22  ? 15.966  1.652   4.433   1.00 0.54  ? 22  TYR A CE2  3  
ATOM 4281  C CZ   . TYR A 1 22  ? 16.020  1.077   5.683   1.00 0.46  ? 22  TYR A CZ   3  
ATOM 4282  O OH   . TYR A 1 22  ? 16.066  1.879   6.800   1.00 0.59  ? 22  TYR A OH   3  
ATOM 4283  H H    . TYR A 1 22  ? 18.536  -1.030  1.576   1.00 1.40  ? 22  TYR A H    3  
ATOM 4284  H HA   . TYR A 1 22  ? 16.922  -3.135  2.857   1.00 0.72  ? 22  TYR A HA   3  
ATOM 4285  H HB2  . TYR A 1 22  ? 15.862  -0.762  1.317   1.00 0.75  ? 22  TYR A HB2  3  
ATOM 4286  H HB3  . TYR A 1 22  ? 14.921  -1.953  2.207   1.00 0.71  ? 22  TYR A HB3  3  
ATOM 4287  H HD1  . TYR A 1 22  ? 15.991  -2.170  4.801   1.00 0.58  ? 22  TYR A HD1  3  
ATOM 4288  H HD2  . TYR A 1 22  ? 15.877  1.294   2.332   1.00 0.70  ? 22  TYR A HD2  3  
ATOM 4289  H HE1  . TYR A 1 22  ? 16.068  -0.743  6.798   1.00 0.57  ? 22  TYR A HE1  3  
ATOM 4290  H HE2  . TYR A 1 22  ? 15.964  2.725   4.325   1.00 0.68  ? 22  TYR A HE2  3  
ATOM 4291  H HH   . TYR A 1 22  ? 15.359  2.530   6.756   1.00 1.17  ? 22  TYR A HH   3  
ATOM 4292  N N    . GLY A 1 23  ? 17.314  -2.444  -0.341  1.00 0.43  ? 23  GLY A N    3  
ATOM 4293  C CA   . GLY A 1 23  ? 17.423  -3.073  -1.646  1.00 0.42  ? 23  GLY A CA   3  
ATOM 4294  C C    . GLY A 1 23  ? 16.134  -3.037  -2.449  1.00 0.39  ? 23  GLY A C    3  
ATOM 4295  O O    . GLY A 1 23  ? 15.495  -4.069  -2.663  1.00 0.39  ? 23  GLY A O    3  
ATOM 4296  H H    . GLY A 1 23  ? 17.522  -1.492  -0.244  1.00 0.96  ? 23  GLY A H    3  
ATOM 4297  H HA2  . GLY A 1 23  ? 18.191  -2.565  -2.208  1.00 0.44  ? 23  GLY A HA2  3  
ATOM 4298  H HA3  . GLY A 1 23  ? 17.717  -4.103  -1.510  1.00 0.48  ? 23  GLY A HA3  3  
ATOM 4299  N N    . PHE A 1 24  ? 15.752  -1.854  -2.903  1.00 0.37  ? 24  PHE A N    3  
ATOM 4300  C CA   . PHE A 1 24  ? 14.596  -1.704  -3.779  1.00 0.36  ? 24  PHE A CA   3  
ATOM 4301  C C    . PHE A 1 24  ? 14.720  -0.422  -4.586  1.00 0.38  ? 24  PHE A C    3  
ATOM 4302  O O    . PHE A 1 24  ? 15.418  0.507   -4.181  1.00 0.40  ? 24  PHE A O    3  
ATOM 4303  C CB   . PHE A 1 24  ? 13.282  -1.712  -2.978  1.00 0.34  ? 24  PHE A CB   3  
ATOM 4304  C CG   . PHE A 1 24  ? 13.144  -0.586  -1.985  1.00 0.32  ? 24  PHE A CG   3  
ATOM 4305  C CD1  . PHE A 1 24  ? 13.633  -0.716  -0.694  1.00 0.33  ? 24  PHE A CD1  3  
ATOM 4306  C CD2  . PHE A 1 24  ? 12.515  0.597   -2.342  1.00 0.34  ? 24  PHE A CD2  3  
ATOM 4307  C CE1  . PHE A 1 24  ? 13.499  0.312   0.221   1.00 0.35  ? 24  PHE A CE1  3  
ATOM 4308  C CE2  . PHE A 1 24  ? 12.377  1.627   -1.432  1.00 0.36  ? 24  PHE A CE2  3  
ATOM 4309  C CZ   . PHE A 1 24  ? 12.871  1.484   -0.148  1.00 0.36  ? 24  PHE A CZ   3  
ATOM 4310  H H    . PHE A 1 24  ? 16.263  -1.055  -2.651  1.00 0.39  ? 24  PHE A H    3  
ATOM 4311  H HA   . PHE A 1 24  ? 14.593  -2.540  -4.463  1.00 0.37  ? 24  PHE A HA   3  
ATOM 4312  H HB2  . PHE A 1 24  ? 12.455  -1.642  -3.667  1.00 0.35  ? 24  PHE A HB2  3  
ATOM 4313  H HB3  . PHE A 1 24  ? 13.210  -2.645  -2.436  1.00 0.34  ? 24  PHE A HB3  3  
ATOM 4314  H HD1  . PHE A 1 24  ? 14.125  -1.632  -0.403  1.00 0.35  ? 24  PHE A HD1  3  
ATOM 4315  H HD2  . PHE A 1 24  ? 12.130  0.709   -3.345  1.00 0.37  ? 24  PHE A HD2  3  
ATOM 4316  H HE1  . PHE A 1 24  ? 13.886  0.197   1.222   1.00 0.38  ? 24  PHE A HE1  3  
ATOM 4317  H HE2  . PHE A 1 24  ? 11.886  2.544   -1.724  1.00 0.40  ? 24  PHE A HE2  3  
ATOM 4318  H HZ   . PHE A 1 24  ? 12.764  2.288   0.566   1.00 0.39  ? 24  PHE A HZ   3  
ATOM 4319  N N    . ASN A 1 25  ? 14.056  -0.376  -5.727  1.00 0.43  ? 25  ASN A N    3  
ATOM 4320  C CA   . ASN A 1 25  ? 14.053  0.820   -6.553  1.00 0.46  ? 25  ASN A CA   3  
ATOM 4321  C C    . ASN A 1 25  ? 12.750  1.573   -6.363  1.00 0.42  ? 25  ASN A C    3  
ATOM 4322  O O    . ASN A 1 25  ? 11.666  1.005   -6.522  1.00 0.39  ? 25  ASN A O    3  
ATOM 4323  C CB   . ASN A 1 25  ? 14.246  0.470   -8.030  1.00 0.51  ? 25  ASN A CB   3  
ATOM 4324  C CG   . ASN A 1 25  ? 15.618  -0.106  -8.314  1.00 1.23  ? 25  ASN A CG   3  
ATOM 4325  O OD1  . ASN A 1 25  ? 16.574  0.629   -8.553  1.00 2.18  ? 25  ASN A OD1  3  
ATOM 4326  N ND2  . ASN A 1 25  ? 15.725  -1.426  -8.296  1.00 1.65  ? 25  ASN A ND2  3  
ATOM 4327  H H    . ASN A 1 25  ? 13.550  -1.167  -6.025  1.00 0.48  ? 25  ASN A H    3  
ATOM 4328  H HA   . ASN A 1 25  ? 14.870  1.448   -6.229  1.00 0.53  ? 25  ASN A HA   3  
ATOM 4329  H HB2  . ASN A 1 25  ? 13.503  -0.259  -8.321  1.00 1.01  ? 25  ASN A HB2  3  
ATOM 4330  H HB3  . ASN A 1 25  ? 14.120  1.363   -8.623  1.00 0.91  ? 25  ASN A HB3  3  
ATOM 4331  H HD21 . ASN A 1 25  ? 14.920  -1.953  -8.102  1.00 1.88  ? 25  ASN A HD21 3  
ATOM 4332  H HD22 . ASN A 1 25  ? 16.601  -1.823  -8.483  1.00 2.23  ? 25  ASN A HD22 3  
ATOM 4333  N N    . LEU A 1 26  ? 12.861  2.845   -6.033  1.00 0.50  ? 26  LEU A N    3  
ATOM 4334  C CA   . LEU A 1 26  ? 11.701  3.666   -5.727  1.00 0.52  ? 26  LEU A CA   3  
ATOM 4335  C C    . LEU A 1 26  ? 11.328  4.527   -6.926  1.00 0.55  ? 26  LEU A C    3  
ATOM 4336  O O    . LEU A 1 26  ? 12.181  4.870   -7.745  1.00 0.73  ? 26  LEU A O    3  
ATOM 4337  C CB   . LEU A 1 26  ? 11.989  4.547   -4.509  1.00 0.69  ? 26  LEU A CB   3  
ATOM 4338  C CG   . LEU A 1 26  ? 10.771  5.250   -3.907  1.00 0.87  ? 26  LEU A CG   3  
ATOM 4339  C CD1  . LEU A 1 26  ? 9.763   4.228   -3.400  1.00 1.52  ? 26  LEU A CD1  3  
ATOM 4340  C CD2  . LEU A 1 26  ? 11.200  6.182   -2.783  1.00 1.48  ? 26  LEU A CD2  3  
ATOM 4341  H H    . LEU A 1 26  ? 13.757  3.251   -5.986  1.00 0.61  ? 26  LEU A H    3  
ATOM 4342  H HA   . LEU A 1 26  ? 10.877  3.007   -5.500  1.00 0.49  ? 26  LEU A HA   3  
ATOM 4343  H HB2  . LEU A 1 26  ? 12.434  3.928   -3.743  1.00 1.10  ? 26  LEU A HB2  3  
ATOM 4344  H HB3  . LEU A 1 26  ? 12.705  5.301   -4.799  1.00 1.29  ? 26  LEU A HB3  3  
ATOM 4345  H HG   . LEU A 1 26  ? 10.290  5.844   -4.672  1.00 1.73  ? 26  LEU A HG   3  
ATOM 4346  H HD11 . LEU A 1 26  ? 10.228  3.611   -2.645  1.00 2.08  ? 26  LEU A HD11 3  
ATOM 4347  H HD12 . LEU A 1 26  ? 9.436   3.606   -4.221  1.00 2.11  ? 26  LEU A HD12 3  
ATOM 4348  H HD13 . LEU A 1 26  ? 8.911   4.739   -2.975  1.00 1.96  ? 26  LEU A HD13 3  
ATOM 4349  H HD21 . LEU A 1 26  ? 11.883  6.925   -3.169  1.00 2.11  ? 26  LEU A HD21 3  
ATOM 4350  H HD22 . LEU A 1 26  ? 11.691  5.612   -2.009  1.00 1.96  ? 26  LEU A HD22 3  
ATOM 4351  H HD23 . LEU A 1 26  ? 10.331  6.674   -2.370  1.00 1.94  ? 26  LEU A HD23 3  
ATOM 4352  N N    . HIS A 1 27  ? 10.055  4.878   -7.023  1.00 0.56  ? 27  HIS A N    3  
ATOM 4353  C CA   . HIS A 1 27  ? 9.556   5.628   -8.164  1.00 0.67  ? 27  HIS A CA   3  
ATOM 4354  C C    . HIS A 1 27  ? 9.276   7.065   -7.762  1.00 0.68  ? 27  HIS A C    3  
ATOM 4355  O O    . HIS A 1 27  ? 8.498   7.323   -6.842  1.00 0.95  ? 27  HIS A O    3  
ATOM 4356  C CB   . HIS A 1 27  ? 8.265   4.998   -8.686  1.00 1.23  ? 27  HIS A CB   3  
ATOM 4357  C CG   . HIS A 1 27  ? 8.290   4.671   -10.142 1.00 0.70  ? 27  HIS A CG   3  
ATOM 4358  N ND1  . HIS A 1 27  ? 7.853   5.531   -11.122 1.00 0.97  ? 27  HIS A ND1  3  
ATOM 4359  C CD2  . HIS A 1 27  ? 8.699   3.554   -10.780 1.00 0.81  ? 27  HIS A CD2  3  
ATOM 4360  C CE1  . HIS A 1 27  ? 8.000   4.958   -12.301 1.00 1.30  ? 27  HIS A CE1  3  
ATOM 4361  N NE2  . HIS A 1 27  ? 8.512   3.757   -12.123 1.00 1.34  ? 27  HIS A NE2  3  
ATOM 4362  H H    . HIS A 1 27  ? 9.431   4.621   -6.309  1.00 0.64  ? 27  HIS A H    3  
ATOM 4363  H HA   . HIS A 1 27  ? 10.305  5.611   -8.942  1.00 0.83  ? 27  HIS A HA   3  
ATOM 4364  H HB2  . HIS A 1 27  ? 8.079   4.081   -8.146  1.00 1.96  ? 27  HIS A HB2  3  
ATOM 4365  H HB3  . HIS A 1 27  ? 7.447   5.681   -8.512  1.00 2.02  ? 27  HIS A HB3  3  
ATOM 4366  H HD1  . HIS A 1 27  ? 7.464   6.434   -10.976 1.00 1.24  ? 27  HIS A HD1  3  
ATOM 4367  H HD2  . HIS A 1 27  ? 9.093   2.664   -10.314 1.00 0.91  ? 27  HIS A HD2  3  
ATOM 4368  H HE1  . HIS A 1 27  ? 7.744   5.401   -13.252 1.00 1.74  ? 27  HIS A HE1  3  
ATOM 4369  H HE2  . HIS A 1 27  ? 8.508   3.042   -12.808 1.00 1.74  ? 27  HIS A HE2  3  
ATOM 4370  N N    . SER A 1 28  ? 9.915   7.990   -8.453  1.00 0.75  ? 28  SER A N    3  
ATOM 4371  C CA   . SER A 1 28  ? 9.761   9.399   -8.165  1.00 1.14  ? 28  SER A CA   3  
ATOM 4372  C C    . SER A 1 28  ? 9.048   10.090  -9.316  1.00 1.03  ? 28  SER A C    3  
ATOM 4373  O O    . SER A 1 28  ? 9.678   10.693  -10.190 1.00 1.34  ? 28  SER A O    3  
ATOM 4374  C CB   . SER A 1 28  ? 11.128  10.036  -7.921  1.00 1.74  ? 28  SER A CB   3  
ATOM 4375  O OG   . SER A 1 28  ? 11.009  11.349  -7.400  1.00 2.30  ? 28  SER A OG   3  
ATOM 4376  H H    . SER A 1 28  ? 10.514  7.716   -9.186  1.00 0.74  ? 28  SER A H    3  
ATOM 4377  H HA   . SER A 1 28  ? 9.162   9.494   -7.272  1.00 1.51  ? 28  SER A HA   3  
ATOM 4378  H HB2  . SER A 1 28  ? 11.677  9.434   -7.216  1.00 2.11  ? 28  SER A HB2  3  
ATOM 4379  H HB3  . SER A 1 28  ? 11.667  10.079  -8.855  1.00 2.17  ? 28  SER A HB3  3  
ATOM 4380  H HG   . SER A 1 28  ? 11.635  11.927  -7.850  1.00 2.75  ? 28  SER A HG   3  
ATOM 4381  N N    . ASP A 1 29  ? 7.732   9.977   -9.323  1.00 1.23  ? 29  ASP A N    3  
ATOM 4382  C CA   . ASP A 1 29  ? 6.917   10.645  -10.323 1.00 1.54  ? 29  ASP A CA   3  
ATOM 4383  C C    . ASP A 1 29  ? 6.610   12.058  -9.864  1.00 1.63  ? 29  ASP A C    3  
ATOM 4384  O O    . ASP A 1 29  ? 6.025   12.265  -8.803  1.00 1.73  ? 29  ASP A O    3  
ATOM 4385  C CB   . ASP A 1 29  ? 5.615   9.880   -10.582 1.00 2.09  ? 29  ASP A CB   3  
ATOM 4386  C CG   . ASP A 1 29  ? 5.802   8.698   -11.515 1.00 2.87  ? 29  ASP A CG   3  
ATOM 4387  O OD1  . ASP A 1 29  ? 6.261   7.634   -11.048 1.00 3.19  ? 29  ASP A OD1  3  
ATOM 4388  O OD2  . ASP A 1 29  ? 5.504   8.825   -12.723 1.00 3.48  ? 29  ASP A OD2  3  
ATOM 4389  H H    . ASP A 1 29  ? 7.300   9.440   -8.631  1.00 1.49  ? 29  ASP A H    3  
ATOM 4390  H HA   . ASP A 1 29  ? 7.490   10.694  -11.238 1.00 1.59  ? 29  ASP A HA   3  
ATOM 4391  H HB2  . ASP A 1 29  ? 5.230   9.513   -9.643  1.00 2.22  ? 29  ASP A HB2  3  
ATOM 4392  H HB3  . ASP A 1 29  ? 4.892   10.552  -11.023 1.00 2.29  ? 29  ASP A HB3  3  
ATOM 4393  N N    . LYS A 1 30  ? 7.019   13.026  -10.666 1.00 1.90  ? 30  LYS A N    3  
ATOM 4394  C CA   . LYS A 1 30  ? 6.870   14.427  -10.311 1.00 2.10  ? 30  LYS A CA   3  
ATOM 4395  C C    . LYS A 1 30  ? 5.537   14.965  -10.815 1.00 2.35  ? 30  LYS A C    3  
ATOM 4396  O O    . LYS A 1 30  ? 5.064   16.012  -10.375 1.00 2.78  ? 30  LYS A O    3  
ATOM 4397  C CB   . LYS A 1 30  ? 8.030   15.228  -10.909 1.00 2.29  ? 30  LYS A CB   3  
ATOM 4398  C CG   . LYS A 1 30  ? 8.158   16.636  -10.358 1.00 2.65  ? 30  LYS A CG   3  
ATOM 4399  C CD   . LYS A 1 30  ? 8.468   16.627  -8.868  1.00 3.12  ? 30  LYS A CD   3  
ATOM 4400  C CE   . LYS A 1 30  ? 8.603   18.037  -8.317  1.00 3.99  ? 30  LYS A CE   3  
ATOM 4401  N NZ   . LYS A 1 30  ? 7.349   18.815  -8.482  1.00 4.54  ? 30  LYS A NZ   3  
ATOM 4402  H H    . LYS A 1 30  ? 7.445   12.790  -11.515 1.00 2.13  ? 30  LYS A H    3  
ATOM 4403  H HA   . LYS A 1 30  ? 6.899   14.508  -9.237  1.00 2.09  ? 30  LYS A HA   3  
ATOM 4404  H HB2  . LYS A 1 30  ? 8.950   14.703  -10.707 1.00 2.49  ? 30  LYS A HB2  3  
ATOM 4405  H HB3  . LYS A 1 30  ? 7.891   15.295  -11.979 1.00 2.60  ? 30  LYS A HB3  3  
ATOM 4406  H HG2  . LYS A 1 30  ? 8.955   17.144  -10.878 1.00 2.99  ? 30  LYS A HG2  3  
ATOM 4407  H HG3  . LYS A 1 30  ? 7.227   17.160  -10.520 1.00 2.97  ? 30  LYS A HG3  3  
ATOM 4408  H HD2  . LYS A 1 30  ? 7.667   16.123  -8.349  1.00 3.37  ? 30  LYS A HD2  3  
ATOM 4409  H HD3  . LYS A 1 30  ? 9.395   16.095  -8.705  1.00 3.23  ? 30  LYS A HD3  3  
ATOM 4410  H HE2  . LYS A 1 30  ? 8.844   17.978  -7.266  1.00 4.39  ? 30  LYS A HE2  3  
ATOM 4411  H HE3  . LYS A 1 30  ? 9.401   18.540  -8.841  1.00 4.35  ? 30  LYS A HE3  3  
ATOM 4412  H HZ1  . LYS A 1 30  ? 7.456   19.763  -8.060  1.00 4.89  ? 30  LYS A HZ1  3  
ATOM 4413  H HZ2  . LYS A 1 30  ? 6.557   18.325  -8.011  1.00 4.83  ? 30  LYS A HZ2  3  
ATOM 4414  H HZ3  . LYS A 1 30  ? 7.122   18.923  -9.495  1.00 4.73  ? 30  LYS A HZ3  3  
ATOM 4415  N N    . SER A 1 31  ? 4.928   14.227  -11.728 1.00 2.29  ? 31  SER A N    3  
ATOM 4416  C CA   . SER A 1 31  ? 3.696   14.659  -12.362 1.00 2.61  ? 31  SER A CA   3  
ATOM 4417  C C    . SER A 1 31  ? 2.469   14.250  -11.546 1.00 2.43  ? 31  SER A C    3  
ATOM 4418  O O    . SER A 1 31  ? 1.373   14.773  -11.754 1.00 2.50  ? 31  SER A O    3  
ATOM 4419  C CB   . SER A 1 31  ? 3.621   14.064  -13.766 1.00 2.93  ? 31  SER A CB   3  
ATOM 4420  O OG   . SER A 1 31  ? 4.837   14.281  -14.462 1.00 3.49  ? 31  SER A OG   3  
ATOM 4421  H H    . SER A 1 31  ? 5.324   13.372  -11.990 1.00 2.20  ? 31  SER A H    3  
ATOM 4422  H HA   . SER A 1 31  ? 3.720   15.734  -12.439 1.00 2.83  ? 31  SER A HA   3  
ATOM 4423  H HB2  . SER A 1 31  ? 3.442   13.001  -13.696 1.00 3.18  ? 31  SER A HB2  3  
ATOM 4424  H HB3  . SER A 1 31  ? 2.816   14.533  -14.312 1.00 2.98  ? 31  SER A HB3  3  
ATOM 4425  H HG   . SER A 1 31  ? 4.878   13.698  -15.236 1.00 3.79  ? 31  SER A HG   3  
ATOM 4426  N N    . LYS A 1 32  ? 2.656   13.320  -10.618 1.00 2.27  ? 32  LYS A N    3  
ATOM 4427  C CA   . LYS A 1 32  ? 1.556   12.825  -9.798  1.00 2.14  ? 32  LYS A CA   3  
ATOM 4428  C C    . LYS A 1 32  ? 2.086   12.274  -8.481  1.00 1.84  ? 32  LYS A C    3  
ATOM 4429  O O    . LYS A 1 32  ? 3.009   11.459  -8.466  1.00 1.68  ? 32  LYS A O    3  
ATOM 4430  C CB   . LYS A 1 32  ? 0.755   11.757  -10.558 1.00 2.21  ? 32  LYS A CB   3  
ATOM 4431  C CG   . LYS A 1 32  ? 1.600   10.634  -11.136 1.00 2.25  ? 32  LYS A CG   3  
ATOM 4432  C CD   . LYS A 1 32  ? 0.774   9.739   -12.046 1.00 2.41  ? 32  LYS A CD   3  
ATOM 4433  C CE   . LYS A 1 32  ? 1.628   8.682   -12.727 1.00 2.93  ? 32  LYS A CE   3  
ATOM 4434  N NZ   . LYS A 1 32  ? 2.098   7.639   -11.778 1.00 3.00  ? 32  LYS A NZ   3  
ATOM 4435  H H    . LYS A 1 32  ? 3.558   12.967  -10.465 1.00 2.30  ? 32  LYS A H    3  
ATOM 4436  H HA   . LYS A 1 32  ? 0.907   13.661  -9.586  1.00 2.30  ? 32  LYS A HA   3  
ATOM 4437  H HB2  . LYS A 1 32  ? 0.035   11.320  -9.884  1.00 2.38  ? 32  LYS A HB2  3  
ATOM 4438  H HB3  . LYS A 1 32  ? 0.227   12.233  -11.371 1.00 2.55  ? 32  LYS A HB3  3  
ATOM 4439  H HG2  . LYS A 1 32  ? 2.410   11.062  -11.706 1.00 2.42  ? 32  LYS A HG2  3  
ATOM 4440  H HG3  . LYS A 1 32  ? 2.000   10.041  -10.325 1.00 2.49  ? 32  LYS A HG3  3  
ATOM 4441  H HD2  . LYS A 1 32  ? 0.017   9.246   -11.455 1.00 2.64  ? 32  LYS A HD2  3  
ATOM 4442  H HD3  . LYS A 1 32  ? 0.301   10.349  -12.802 1.00 2.50  ? 32  LYS A HD3  3  
ATOM 4443  H HE2  . LYS A 1 32  ? 1.042   8.212   -13.503 1.00 3.27  ? 32  LYS A HE2  3  
ATOM 4444  H HE3  . LYS A 1 32  ? 2.485   9.168   -13.171 1.00 3.51  ? 32  LYS A HE3  3  
ATOM 4445  H HZ1  . LYS A 1 32  ? 2.507   8.075   -10.930 1.00 3.05  ? 32  LYS A HZ1  3  
ATOM 4446  H HZ2  . LYS A 1 32  ? 2.825   7.044   -12.232 1.00 3.40  ? 32  LYS A HZ2  3  
ATOM 4447  H HZ3  . LYS A 1 32  ? 1.299   7.025   -11.494 1.00 3.29  ? 32  LYS A HZ3  3  
ATOM 4448  N N    . PRO A 1 33  ? 1.516   12.739  -7.357  1.00 1.87  ? 33  PRO A N    3  
ATOM 4449  C CA   . PRO A 1 33  ? 1.943   12.330  -6.016  1.00 1.71  ? 33  PRO A CA   3  
ATOM 4450  C C    . PRO A 1 33  ? 1.615   10.871  -5.719  1.00 1.40  ? 33  PRO A C    3  
ATOM 4451  O O    . PRO A 1 33  ? 0.705   10.290  -6.314  1.00 1.40  ? 33  PRO A O    3  
ATOM 4452  C CB   . PRO A 1 33  ? 1.154   13.256  -5.090  1.00 1.97  ? 33  PRO A CB   3  
ATOM 4453  C CG   . PRO A 1 33  ? -0.045  13.644  -5.878  1.00 2.24  ? 33  PRO A CG   3  
ATOM 4454  C CD   . PRO A 1 33  ? 0.408   13.708  -7.307  1.00 2.19  ? 33  PRO A CD   3  
ATOM 4455  H HA   . PRO A 1 33  ? 3.001   12.491  -5.873  1.00 1.77  ? 33  PRO A HA   3  
ATOM 4456  H HB2  . PRO A 1 33  ? 0.880   12.723  -4.191  1.00 1.85  ? 33  PRO A HB2  3  
ATOM 4457  H HB3  . PRO A 1 33  ? 1.755   14.116  -4.838  1.00 2.24  ? 33  PRO A HB3  3  
ATOM 4458  H HG2  . PRO A 1 33  ? -0.817  12.899  -5.762  1.00 2.37  ? 33  PRO A HG2  3  
ATOM 4459  H HG3  . PRO A 1 33  ? -0.401  14.611  -5.553  1.00 2.55  ? 33  PRO A HG3  3  
ATOM 4460  H HD2  . PRO A 1 33  ? -0.394  13.414  -7.969  1.00 2.33  ? 33  PRO A HD2  3  
ATOM 4461  H HD3  . PRO A 1 33  ? 0.754   14.701  -7.550  1.00 2.38  ? 33  PRO A HD3  3  
ATOM 4462  N N    . GLY A 1 34  ? 2.344   10.298  -4.778  1.00 1.29  ? 34  GLY A N    3  
ATOM 4463  C CA   . GLY A 1 34  ? 2.204   8.889   -4.490  1.00 1.05  ? 34  GLY A CA   3  
ATOM 4464  C C    . GLY A 1 34  ? 3.412   8.113   -4.964  1.00 0.85  ? 34  GLY A C    3  
ATOM 4465  O O    . GLY A 1 34  ? 3.805   8.214   -6.123  1.00 0.88  ? 34  GLY A O    3  
ATOM 4466  H H    . GLY A 1 34  ? 2.987   10.838  -4.274  1.00 1.47  ? 34  GLY A H    3  
ATOM 4467  H HA2  . GLY A 1 34  ? 2.091   8.755   -3.423  1.00 1.11  ? 34  GLY A HA2  3  
ATOM 4468  H HA3  . GLY A 1 34  ? 1.326   8.512   -4.991  1.00 1.10  ? 34  GLY A HA3  3  
ATOM 4469  N N    . GLN A 1 35  ? 4.022   7.353   -4.073  1.00 0.74  ? 35  GLN A N    3  
ATOM 4470  C CA   . GLN A 1 35  ? 5.246   6.649   -4.396  1.00 0.59  ? 35  GLN A CA   3  
ATOM 4471  C C    . GLN A 1 35  ? 4.960   5.223   -4.852  1.00 0.52  ? 35  GLN A C    3  
ATOM 4472  O O    . GLN A 1 35  ? 4.096   4.544   -4.296  1.00 0.58  ? 35  GLN A O    3  
ATOM 4473  C CB   . GLN A 1 35  ? 6.168   6.647   -3.183  1.00 0.58  ? 35  GLN A CB   3  
ATOM 4474  C CG   . GLN A 1 35  ? 7.593   7.062   -3.497  1.00 0.82  ? 35  GLN A CG   3  
ATOM 4475  C CD   . GLN A 1 35  ? 7.751   8.543   -3.813  1.00 0.75  ? 35  GLN A CD   3  
ATOM 4476  O OE1  . GLN A 1 35  ? 8.794   9.127   -3.539  1.00 1.50  ? 35  GLN A OE1  3  
ATOM 4477  N NE2  . GLN A 1 35  ? 6.740   9.159   -4.408  1.00 0.78  ? 35  GLN A NE2  3  
ATOM 4478  H H    . GLN A 1 35  ? 3.642   7.261   -3.177  1.00 0.85  ? 35  GLN A H    3  
ATOM 4479  H HA   . GLN A 1 35  ? 5.731   7.180   -5.202  1.00 0.60  ? 35  GLN A HA   3  
ATOM 4480  H HB2  . GLN A 1 35  ? 5.773   7.329   -2.444  1.00 0.76  ? 35  GLN A HB2  3  
ATOM 4481  H HB3  . GLN A 1 35  ? 6.190   5.651   -2.763  1.00 0.65  ? 35  GLN A HB3  3  
ATOM 4482  H HG2  . GLN A 1 35  ? 8.208   6.831   -2.645  1.00 1.35  ? 35  GLN A HG2  3  
ATOM 4483  H HG3  . GLN A 1 35  ? 7.934   6.494   -4.347  1.00 1.50  ? 35  GLN A HG3  3  
ATOM 4484  H HE21 . GLN A 1 35  ? 5.937   8.640   -4.619  1.00 1.10  ? 35  GLN A HE21 3  
ATOM 4485  H HE22 . GLN A 1 35  ? 6.836   10.112  -4.613  1.00 1.07  ? 35  GLN A HE22 3  
ATOM 4486  N N    . PHE A 1 36  ? 5.688   4.775   -5.866  1.00 0.47  ? 36  PHE A N    3  
ATOM 4487  C CA   . PHE A 1 36  ? 5.494   3.444   -6.425  1.00 0.43  ? 36  PHE A CA   3  
ATOM 4488  C C    . PHE A 1 36  ? 6.766   2.622   -6.270  1.00 0.39  ? 36  PHE A C    3  
ATOM 4489  O O    . PHE A 1 36  ? 7.859   3.178   -6.139  1.00 0.45  ? 36  PHE A O    3  
ATOM 4490  C CB   . PHE A 1 36  ? 5.130   3.534   -7.911  1.00 0.48  ? 36  PHE A CB   3  
ATOM 4491  C CG   . PHE A 1 36  ? 3.990   4.467   -8.211  1.00 0.58  ? 36  PHE A CG   3  
ATOM 4492  C CD1  . PHE A 1 36  ? 2.684   4.012   -8.203  1.00 0.68  ? 36  PHE A CD1  3  
ATOM 4493  C CD2  . PHE A 1 36  ? 4.227   5.802   -8.502  1.00 0.70  ? 36  PHE A CD2  3  
ATOM 4494  C CE1  . PHE A 1 36  ? 1.635   4.868   -8.478  1.00 0.81  ? 36  PHE A CE1  3  
ATOM 4495  C CE2  . PHE A 1 36  ? 3.182   6.662   -8.776  1.00 0.83  ? 36  PHE A CE2  3  
ATOM 4496  C CZ   . PHE A 1 36  ? 1.885   6.195   -8.763  1.00 0.87  ? 36  PHE A CZ   3  
ATOM 4497  H H    . PHE A 1 36  ? 6.379   5.353   -6.253  1.00 0.51  ? 36  PHE A H    3  
ATOM 4498  H HA   . PHE A 1 36  ? 4.690   2.962   -5.888  1.00 0.42  ? 36  PHE A HA   3  
ATOM 4499  H HB2  . PHE A 1 36  ? 5.992   3.880   -8.463  1.00 0.50  ? 36  PHE A HB2  3  
ATOM 4500  H HB3  . PHE A 1 36  ? 4.858   2.550   -8.266  1.00 0.48  ? 36  PHE A HB3  3  
ATOM 4501  H HD1  . PHE A 1 36  ? 2.487   2.974   -7.980  1.00 0.72  ? 36  PHE A HD1  3  
ATOM 4502  H HD2  . PHE A 1 36  ? 5.242   6.168   -8.512  1.00 0.74  ? 36  PHE A HD2  3  
ATOM 4503  H HE1  . PHE A 1 36  ? 0.619   4.499   -8.465  1.00 0.93  ? 36  PHE A HE1  3  
ATOM 4504  H HE2  . PHE A 1 36  ? 3.381   7.701   -9.001  1.00 0.95  ? 36  PHE A HE2  3  
ATOM 4505  H HZ   . PHE A 1 36  ? 1.065   6.867   -8.976  1.00 0.99  ? 36  PHE A HZ   3  
ATOM 4506  N N    . ILE A 1 37  ? 6.623   1.307   -6.280  1.00 0.36  ? 37  ILE A N    3  
ATOM 4507  C CA   . ILE A 1 37  ? 7.771   0.420   -6.236  1.00 0.33  ? 37  ILE A CA   3  
ATOM 4508  C C    . ILE A 1 37  ? 8.138   -0.015  -7.647  1.00 0.33  ? 37  ILE A C    3  
ATOM 4509  O O    . ILE A 1 37  ? 7.406   -0.769  -8.293  1.00 0.38  ? 37  ILE A O    3  
ATOM 4510  C CB   . ILE A 1 37  ? 7.509   -0.830  -5.366  1.00 0.34  ? 37  ILE A CB   3  
ATOM 4511  C CG1  . ILE A 1 37  ? 7.035   -0.417  -3.967  1.00 0.39  ? 37  ILE A CG1  3  
ATOM 4512  C CG2  . ILE A 1 37  ? 8.767   -1.688  -5.270  1.00 0.33  ? 37  ILE A CG2  3  
ATOM 4513  C CD1  . ILE A 1 37  ? 8.021   0.457   -3.216  1.00 0.38  ? 37  ILE A CD1  3  
ATOM 4514  H H    . ILE A 1 37  ? 5.718   0.918   -6.314  1.00 0.41  ? 37  ILE A H    3  
ATOM 4515  H HA   . ILE A 1 37  ? 8.602   0.967   -5.809  1.00 0.33  ? 37  ILE A HA   3  
ATOM 4516  H HB   . ILE A 1 37  ? 6.740   -1.419  -5.843  1.00 0.37  ? 37  ILE A HB   3  
ATOM 4517  H HG12 . ILE A 1 37  ? 6.112   0.133   -4.057  1.00 0.47  ? 37  ILE A HG12 3  
ATOM 4518  H HG13 . ILE A 1 37  ? 6.861   -1.304  -3.377  1.00 0.44  ? 37  ILE A HG13 3  
ATOM 4519  H HG21 . ILE A 1 37  ? 8.568   -2.550  -4.649  1.00 1.05  ? 37  ILE A HG21 3  
ATOM 4520  H HG22 . ILE A 1 37  ? 9.568   -1.107  -4.834  1.00 1.00  ? 37  ILE A HG22 3  
ATOM 4521  H HG23 . ILE A 1 37  ? 9.058   -2.015  -6.258  1.00 1.04  ? 37  ILE A HG23 3  
ATOM 4522  H HD11 . ILE A 1 37  ? 8.954   -0.074  -3.087  1.00 1.09  ? 37  ILE A HD11 3  
ATOM 4523  H HD12 . ILE A 1 37  ? 7.613   0.707   -2.248  1.00 1.12  ? 37  ILE A HD12 3  
ATOM 4524  H HD13 . ILE A 1 37  ? 8.198   1.364   -3.775  1.00 1.05  ? 37  ILE A HD13 3  
ATOM 4525  N N    . ARG A 1 38  ? 9.274   0.486   -8.115  1.00 0.34  ? 38  ARG A N    3  
ATOM 4526  C CA   . ARG A 1 38  ? 9.768   0.187   -9.453  1.00 0.41  ? 38  ARG A CA   3  
ATOM 4527  C C    . ARG A 1 38  ? 10.136  -1.285  -9.565  1.00 0.40  ? 38  ARG A C    3  
ATOM 4528  O O    . ARG A 1 38  ? 9.633   -1.998  -10.434 1.00 0.49  ? 38  ARG A O    3  
ATOM 4529  C CB   . ARG A 1 38  ? 10.977  1.076   -9.763  1.00 0.50  ? 38  ARG A CB   3  
ATOM 4530  C CG   . ARG A 1 38  ? 11.648  0.783   -11.095 1.00 0.67  ? 38  ARG A CG   3  
ATOM 4531  C CD   . ARG A 1 38  ? 12.815  1.727   -11.332 1.00 1.24  ? 38  ARG A CD   3  
ATOM 4532  N NE   . ARG A 1 38  ? 13.662  1.301   -12.447 1.00 1.56  ? 38  ARG A NE   3  
ATOM 4533  C CZ   . ARG A 1 38  ? 14.923  1.700   -12.610 1.00 2.17  ? 38  ARG A CZ   3  
ATOM 4534  N NH1  . ARG A 1 38  ? 15.455  2.578   -11.767 1.00 2.83  ? 38  ARG A NH1  3  
ATOM 4535  N NH2  . ARG A 1 38  ? 15.646  1.237   -13.624 1.00 2.62  ? 38  ARG A NH2  3  
ATOM 4536  H H    . ARG A 1 38  ? 9.806   1.069   -7.532  1.00 0.35  ? 38  ARG A H    3  
ATOM 4537  H HA   . ARG A 1 38  ? 8.982   0.406   -10.157 1.00 0.46  ? 38  ARG A HA   3  
ATOM 4538  H HB2  . ARG A 1 38  ? 10.655  2.106   -9.772  1.00 0.58  ? 38  ARG A HB2  3  
ATOM 4539  H HB3  . ARG A 1 38  ? 11.711  0.947   -8.980  1.00 0.52  ? 38  ARG A HB3  3  
ATOM 4540  H HG2  . ARG A 1 38  ? 12.012  -0.234  -11.089 1.00 1.18  ? 38  ARG A HG2  3  
ATOM 4541  H HG3  . ARG A 1 38  ? 10.926  0.906   -11.889 1.00 1.34  ? 38  ARG A HG3  3  
ATOM 4542  H HD2  . ARG A 1 38  ? 12.426  2.710   -11.550 1.00 1.95  ? 38  ARG A HD2  3  
ATOM 4543  H HD3  . ARG A 1 38  ? 13.411  1.769   -10.434 1.00 1.74  ? 38  ARG A HD3  3  
ATOM 4544  H HE   . ARG A 1 38  ? 13.269  0.667   -13.097 1.00 1.83  ? 38  ARG A HE   3  
ATOM 4545  H HH11 . ARG A 1 38  ? 14.910  2.945   -11.007 1.00 2.92  ? 38  ARG A HH11 3  
ATOM 4546  H HH12 . ARG A 1 38  ? 16.409  2.880   -11.881 1.00 3.48  ? 38  ARG A HH12 3  
ATOM 4547  H HH21 . ARG A 1 38  ? 15.245  0.583   -14.277 1.00 2.77  ? 38  ARG A HH21 3  
ATOM 4548  H HH22 . ARG A 1 38  ? 16.603  1.531   -13.741 1.00 3.10  ? 38  ARG A HH22 3  
ATOM 4549  N N    . SER A 1 39  ? 11.002  -1.733  -8.668  1.00 0.36  ? 39  SER A N    3  
ATOM 4550  C CA   . SER A 1 39  ? 11.425  -3.119  -8.633  1.00 0.40  ? 39  SER A CA   3  
ATOM 4551  C C    . SER A 1 39  ? 12.210  -3.381  -7.356  1.00 0.32  ? 39  SER A C    3  
ATOM 4552  O O    . SER A 1 39  ? 13.004  -2.545  -6.924  1.00 0.37  ? 39  SER A O    3  
ATOM 4553  C CB   . SER A 1 39  ? 12.277  -3.453  -9.863  1.00 0.54  ? 39  SER A CB   3  
ATOM 4554  O OG   . SER A 1 39  ? 13.405  -2.598  -9.954  1.00 1.26  ? 39  SER A OG   3  
ATOM 4555  H H    . SER A 1 39  ? 11.374  -1.109  -8.008  1.00 0.35  ? 39  SER A H    3  
ATOM 4556  H HA   . SER A 1 39  ? 10.543  -3.738  -8.634  1.00 0.44  ? 39  SER A HA   3  
ATOM 4557  H HB2  . SER A 1 39  ? 12.622  -4.474  -9.792  1.00 1.11  ? 39  SER A HB2  3  
ATOM 4558  H HB3  . SER A 1 39  ? 11.677  -3.336  -10.755 1.00 1.13  ? 39  SER A HB3  3  
ATOM 4559  H HG   . SER A 1 39  ? 14.212  -3.130  -9.882  1.00 1.82  ? 39  SER A HG   3  
ATOM 4560  N N    . VAL A 1 40  ? 11.971  -4.525  -6.747  1.00 0.36  ? 40  VAL A N    3  
ATOM 4561  C CA   . VAL A 1 40  ? 12.671  -4.897  -5.528  1.00 0.30  ? 40  VAL A CA   3  
ATOM 4562  C C    . VAL A 1 40  ? 13.859  -5.794  -5.862  1.00 0.31  ? 40  VAL A C    3  
ATOM 4563  O O    . VAL A 1 40  ? 13.764  -6.666  -6.728  1.00 0.37  ? 40  VAL A O    3  
ATOM 4564  C CB   . VAL A 1 40  ? 11.715  -5.594  -4.527  1.00 0.33  ? 40  VAL A CB   3  
ATOM 4565  C CG1  . VAL A 1 40  ? 10.971  -6.741  -5.189  1.00 0.37  ? 40  VAL A CG1  3  
ATOM 4566  C CG2  . VAL A 1 40  ? 12.465  -6.082  -3.297  1.00 0.32  ? 40  VAL A CG2  3  
ATOM 4567  H H    . VAL A 1 40  ? 11.321  -5.148  -7.134  1.00 0.49  ? 40  VAL A H    3  
ATOM 4568  H HA   . VAL A 1 40  ? 13.038  -3.990  -5.070  1.00 0.31  ? 40  VAL A HA   3  
ATOM 4569  H HB   . VAL A 1 40  ? 10.981  -4.868  -4.204  1.00 0.38  ? 40  VAL A HB   3  
ATOM 4570  H HG11 . VAL A 1 40  ? 10.370  -7.250  -4.452  1.00 1.03  ? 40  VAL A HG11 3  
ATOM 4571  H HG12 . VAL A 1 40  ? 11.682  -7.432  -5.617  1.00 1.05  ? 40  VAL A HG12 3  
ATOM 4572  H HG13 . VAL A 1 40  ? 10.332  -6.351  -5.968  1.00 1.11  ? 40  VAL A HG13 3  
ATOM 4573  H HG21 . VAL A 1 40  ? 13.238  -6.775  -3.596  1.00 1.08  ? 40  VAL A HG21 3  
ATOM 4574  H HG22 . VAL A 1 40  ? 11.775  -6.577  -2.628  1.00 1.09  ? 40  VAL A HG22 3  
ATOM 4575  H HG23 . VAL A 1 40  ? 12.914  -5.240  -2.792  1.00 1.02  ? 40  VAL A HG23 3  
ATOM 4576  N N    . ASP A 1 41  ? 14.987  -5.551  -5.202  1.00 0.35  ? 41  ASP A N    3  
ATOM 4577  C CA   . ASP A 1 41  ? 16.199  -6.320  -5.446  1.00 0.45  ? 41  ASP A CA   3  
ATOM 4578  C C    . ASP A 1 41  ? 16.024  -7.726  -4.877  1.00 0.48  ? 41  ASP A C    3  
ATOM 4579  O O    . ASP A 1 41  ? 15.708  -7.890  -3.703  1.00 0.51  ? 41  ASP A O    3  
ATOM 4580  C CB   . ASP A 1 41  ? 17.408  -5.622  -4.806  1.00 0.54  ? 41  ASP A CB   3  
ATOM 4581  C CG   . ASP A 1 41  ? 18.721  -5.987  -5.474  1.00 1.27  ? 41  ASP A CG   3  
ATOM 4582  O OD1  . ASP A 1 41  ? 19.299  -7.039  -5.120  1.00 2.28  ? 41  ASP A OD1  3  
ATOM 4583  O OD2  . ASP A 1 41  ? 19.173  -5.242  -6.363  1.00 1.32  ? 41  ASP A OD2  3  
ATOM 4584  H H    . ASP A 1 41  ? 15.000  -4.847  -4.520  1.00 0.39  ? 41  ASP A H    3  
ATOM 4585  H HA   . ASP A 1 41  ? 16.346  -6.386  -6.514  1.00 0.52  ? 41  ASP A HA   3  
ATOM 4586  H HB2  . ASP A 1 41  ? 17.276  -4.554  -4.879  1.00 0.79  ? 41  ASP A HB2  3  
ATOM 4587  H HB3  . ASP A 1 41  ? 17.466  -5.902  -3.764  1.00 1.00  ? 41  ASP A HB3  3  
ATOM 4588  N N    . PRO A 1 42  ? 16.199  -8.754  -5.713  1.00 0.58  ? 42  PRO A N    3  
ATOM 4589  C CA   . PRO A 1 42  ? 15.921  -10.149 -5.340  1.00 0.69  ? 42  PRO A CA   3  
ATOM 4590  C C    . PRO A 1 42  ? 16.685  -10.619 -4.106  1.00 0.69  ? 42  PRO A C    3  
ATOM 4591  O O    . PRO A 1 42  ? 17.895  -10.405 -3.982  1.00 1.17  ? 42  PRO A O    3  
ATOM 4592  C CB   . PRO A 1 42  ? 16.351  -10.947 -6.574  1.00 0.84  ? 42  PRO A CB   3  
ATOM 4593  C CG   . PRO A 1 42  ? 16.320  -9.970  -7.696  1.00 0.93  ? 42  PRO A CG   3  
ATOM 4594  C CD   . PRO A 1 42  ? 16.681  -8.642  -7.096  1.00 0.69  ? 42  PRO A CD   3  
ATOM 4595  H HA   . PRO A 1 42  ? 14.866  -10.298 -5.165  1.00 0.75  ? 42  PRO A HA   3  
ATOM 4596  H HB2  . PRO A 1 42  ? 17.346  -11.338 -6.420  1.00 0.99  ? 42  PRO A HB2  3  
ATOM 4597  H HB3  . PRO A 1 42  ? 15.661  -11.760 -6.740  1.00 0.96  ? 42  PRO A HB3  3  
ATOM 4598  H HG2  . PRO A 1 42  ? 17.043  -10.249 -8.448  1.00 1.27  ? 42  PRO A HG2  3  
ATOM 4599  H HG3  . PRO A 1 42  ? 15.329  -9.929  -8.124  1.00 1.17  ? 42  PRO A HG3  3  
ATOM 4600  H HD2  . PRO A 1 42  ? 17.748  -8.490  -7.119  1.00 0.79  ? 42  PRO A HD2  3  
ATOM 4601  H HD3  . PRO A 1 42  ? 16.173  -7.843  -7.615  1.00 0.77  ? 42  PRO A HD3  3  
ATOM 4602  N N    . ASP A 1 43  ? 15.946  -11.262 -3.200  1.00 0.75  ? 43  ASP A N    3  
ATOM 4603  C CA   . ASP A 1 43  ? 16.489  -11.798 -1.951  1.00 0.87  ? 43  ASP A CA   3  
ATOM 4604  C C    . ASP A 1 43  ? 17.154  -10.697 -1.129  1.00 0.70  ? 43  ASP A C    3  
ATOM 4605  O O    . ASP A 1 43  ? 18.292  -10.826 -0.681  1.00 0.86  ? 43  ASP A O    3  
ATOM 4606  C CB   . ASP A 1 43  ? 17.469  -12.947 -2.223  1.00 1.14  ? 43  ASP A CB   3  
ATOM 4607  C CG   . ASP A 1 43  ? 17.794  -13.740 -0.970  1.00 1.69  ? 43  ASP A CG   3  
ATOM 4608  O OD1  . ASP A 1 43  ? 16.911  -14.465 -0.466  1.00 1.92  ? 43  ASP A OD1  3  
ATOM 4609  O OD2  . ASP A 1 43  ? 18.938  -13.634 -0.479  1.00 2.40  ? 43  ASP A OD2  3  
ATOM 4610  H H    . ASP A 1 43  ? 14.991  -11.386 -3.383  1.00 1.09  ? 43  ASP A H    3  
ATOM 4611  H HA   . ASP A 1 43  ? 15.657  -12.186 -1.381  1.00 1.00  ? 43  ASP A HA   3  
ATOM 4612  H HB2  . ASP A 1 43  ? 17.033  -13.617 -2.946  1.00 1.42  ? 43  ASP A HB2  3  
ATOM 4613  H HB3  . ASP A 1 43  ? 18.390  -12.543 -2.621  1.00 1.58  ? 43  ASP A HB3  3  
ATOM 4614  N N    . SER A 1 44  ? 16.448  -9.595  -0.971  1.00 0.57  ? 44  SER A N    3  
ATOM 4615  C CA   . SER A 1 44  ? 16.900  -8.516  -0.104  1.00 0.48  ? 44  SER A CA   3  
ATOM 4616  C C    . SER A 1 44  ? 16.002  -8.424  1.125   1.00 0.40  ? 44  SER A C    3  
ATOM 4617  O O    . SER A 1 44  ? 14.962  -9.086  1.173   1.00 0.39  ? 44  SER A O    3  
ATOM 4618  C CB   . SER A 1 44  ? 16.873  -7.193  -0.866  1.00 0.47  ? 44  SER A CB   3  
ATOM 4619  O OG   . SER A 1 44  ? 15.562  -6.910  -1.325  1.00 0.46  ? 44  SER A OG   3  
ATOM 4620  H H    . SER A 1 44  ? 15.607  -9.491  -1.469  1.00 0.68  ? 44  SER A H    3  
ATOM 4621  H HA   . SER A 1 44  ? 17.909  -8.730  0.211   1.00 0.55  ? 44  SER A HA   3  
ATOM 4622  H HB2  . SER A 1 44  ? 17.195  -6.395  -0.216  1.00 0.50  ? 44  SER A HB2  3  
ATOM 4623  H HB3  . SER A 1 44  ? 17.534  -7.255  -1.719  1.00 0.51  ? 44  SER A HB3  3  
ATOM 4624  H HG   . SER A 1 44  ? 15.534  -7.018  -2.288  1.00 0.41  ? 44  SER A HG   3  
ATOM 4625  N N    . PRO A 1 45  ? 16.380  -7.633  2.143   1.00 0.43  ? 45  PRO A N    3  
ATOM 4626  C CA   . PRO A 1 45  ? 15.493  -7.346  3.268   1.00 0.45  ? 45  PRO A CA   3  
ATOM 4627  C C    . PRO A 1 45  ? 14.157  -6.769  2.791   1.00 0.38  ? 45  PRO A C    3  
ATOM 4628  O O    . PRO A 1 45  ? 13.109  -7.024  3.386   1.00 0.39  ? 45  PRO A O    3  
ATOM 4629  C CB   . PRO A 1 45  ? 16.263  -6.319  4.114   1.00 0.57  ? 45  PRO A CB   3  
ATOM 4630  C CG   . PRO A 1 45  ? 17.423  -5.887  3.276   1.00 0.65  ? 45  PRO A CG   3  
ATOM 4631  C CD   . PRO A 1 45  ? 17.698  -7.004  2.310   1.00 0.52  ? 45  PRO A CD   3  
ATOM 4632  H HA   . PRO A 1 45  ? 15.308  -8.235  3.852   1.00 0.48  ? 45  PRO A HA   3  
ATOM 4633  H HB2  . PRO A 1 45  ? 15.616  -5.486  4.345   1.00 0.68  ? 45  PRO A HB2  3  
ATOM 4634  H HB3  . PRO A 1 45  ? 16.594  -6.785  5.032   1.00 0.68  ? 45  PRO A HB3  3  
ATOM 4635  H HG2  . PRO A 1 45  ? 17.169  -4.983  2.740   1.00 0.81  ? 45  PRO A HG2  3  
ATOM 4636  H HG3  . PRO A 1 45  ? 18.285  -5.715  3.906   1.00 0.87  ? 45  PRO A HG3  3  
ATOM 4637  H HD2  . PRO A 1 45  ? 18.061  -6.612  1.371   1.00 0.56  ? 45  PRO A HD2  3  
ATOM 4638  H HD3  . PRO A 1 45  ? 18.407  -7.702  2.729   1.00 0.60  ? 45  PRO A HD3  3  
ATOM 4639  N N    . ALA A 1 46  ? 14.205  -6.009  1.700   1.00 0.35  ? 46  ALA A N    3  
ATOM 4640  C CA   . ALA A 1 46  ? 13.006  -5.466  1.075   1.00 0.33  ? 46  ALA A CA   3  
ATOM 4641  C C    . ALA A 1 46  ? 12.087  -6.587  0.619   1.00 0.30  ? 46  ALA A C    3  
ATOM 4642  O O    . ALA A 1 46  ? 10.889  -6.583  0.889   1.00 0.31  ? 46  ALA A O    3  
ATOM 4643  C CB   . ALA A 1 46  ? 13.387  -4.618  -0.117  1.00 0.36  ? 46  ALA A CB   3  
ATOM 4644  H H    . ALA A 1 46  ? 15.082  -5.806  1.301   1.00 0.37  ? 46  ALA A H    3  
ATOM 4645  H HA   . ALA A 1 46  ? 12.491  -4.844  1.793   1.00 0.35  ? 46  ALA A HA   3  
ATOM 4646  H HB1  . ALA A 1 46  ? 13.858  -5.248  -0.862  1.00 1.17  ? 46  ALA A HB1  3  
ATOM 4647  H HB2  . ALA A 1 46  ? 14.077  -3.849  0.193   1.00 0.96  ? 46  ALA A HB2  3  
ATOM 4648  H HB3  . ALA A 1 46  ? 12.503  -4.166  -0.536  1.00 1.10  ? 46  ALA A HB3  3  
ATOM 4649  N N    . GLU A 1 47  ? 12.669  -7.545  -0.074  1.00 0.31  ? 47  GLU A N    3  
ATOM 4650  C CA   . GLU A 1 47  ? 11.951  -8.726  -0.526  1.00 0.33  ? 47  GLU A CA   3  
ATOM 4651  C C    . GLU A 1 47  ? 11.401  -9.474  0.649   1.00 0.34  ? 47  GLU A C    3  
ATOM 4652  O O    . GLU A 1 47  ? 10.222  -9.813  0.709   1.00 0.40  ? 47  GLU A O    3  
ATOM 4653  C CB   . GLU A 1 47  ? 12.927  -9.637  -1.222  1.00 0.40  ? 47  GLU A CB   3  
ATOM 4654  C CG   . GLU A 1 47  ? 12.312  -10.859 -1.881  1.00 0.53  ? 47  GLU A CG   3  
ATOM 4655  C CD   . GLU A 1 47  ? 11.457  -10.518 -3.084  1.00 1.12  ? 47  GLU A CD   3  
ATOM 4656  O OE1  . GLU A 1 47  ? 12.024  -10.315 -4.178  1.00 1.51  ? 47  GLU A OE1  3  
ATOM 4657  O OE2  . GLU A 1 47  ? 10.215  -10.486 -2.950  1.00 2.01  ? 47  GLU A OE2  3  
ATOM 4658  H H    . GLU A 1 47  ? 13.622  -7.457  -0.293  1.00 0.33  ? 47  GLU A H    3  
ATOM 4659  H HA   . GLU A 1 47  ? 11.161  -8.438  -1.200  1.00 0.36  ? 47  GLU A HA   3  
ATOM 4660  H HB2  . GLU A 1 47  ? 13.423  -9.072  -1.947  1.00 0.44  ? 47  GLU A HB2  3  
ATOM 4661  H HB3  . GLU A 1 47  ? 13.651  -9.969  -0.497  1.00 0.42  ? 47  GLU A HB3  3  
ATOM 4662  H HG2  . GLU A 1 47  ? 13.106  -11.517 -2.201  1.00 1.14  ? 47  GLU A HG2  3  
ATOM 4663  H HG3  . GLU A 1 47  ? 11.697  -11.370 -1.155  1.00 1.17  ? 47  GLU A HG3  3  
ATOM 4664  N N    . ALA A 1 48  ? 12.292  -9.714  1.588   1.00 0.34  ? 48  ALA A N    3  
ATOM 4665  C CA   . ALA A 1 48  ? 11.982  -10.514 2.742   1.00 0.38  ? 48  ALA A CA   3  
ATOM 4666  C C    . ALA A 1 48  ? 10.891  -9.865  3.592   1.00 0.37  ? 48  ALA A C    3  
ATOM 4667  O O    . ALA A 1 48  ? 10.270  -10.516 4.429   1.00 0.47  ? 48  ALA A O    3  
ATOM 4668  C CB   . ALA A 1 48  ? 13.232  -10.770 3.571   1.00 0.44  ? 48  ALA A CB   3  
ATOM 4669  H H    . ALA A 1 48  ? 13.203  -9.352  1.482   1.00 0.34  ? 48  ALA A H    3  
ATOM 4670  H HA   . ALA A 1 48  ? 11.629  -11.460 2.364   1.00 0.42  ? 48  ALA A HA   3  
ATOM 4671  H HB1  . ALA A 1 48  ? 13.613  -9.832  3.950   1.00 1.15  ? 48  ALA A HB1  3  
ATOM 4672  H HB2  . ALA A 1 48  ? 13.982  -11.242 2.955   1.00 0.97  ? 48  ALA A HB2  3  
ATOM 4673  H HB3  . ALA A 1 48  ? 12.987  -11.419 4.399   1.00 1.06  ? 48  ALA A HB3  3  
ATOM 4674  N N    . SER A 1 49  ? 10.667  -8.572  3.375   1.00 0.31  ? 49  SER A N    3  
ATOM 4675  C CA   . SER A 1 49  ? 9.643   -7.852  4.111   1.00 0.32  ? 49  SER A CA   3  
ATOM 4676  C C    . SER A 1 49  ? 8.287   -8.037  3.438   1.00 0.35  ? 49  SER A C    3  
ATOM 4677  O O    . SER A 1 49  ? 7.241   -7.797  4.044   1.00 0.40  ? 49  SER A O    3  
ATOM 4678  C CB   . SER A 1 49  ? 9.990   -6.363  4.210   1.00 0.32  ? 49  SER A CB   3  
ATOM 4679  O OG   . SER A 1 49  ? 9.763   -5.687  2.989   1.00 0.31  ? 49  SER A OG   3  
ATOM 4680  H H    . SER A 1 49  ? 11.204  -8.098  2.701   1.00 0.29  ? 49  SER A H    3  
ATOM 4681  H HA   . SER A 1 49  ? 9.596   -8.269  5.107   1.00 0.36  ? 49  SER A HA   3  
ATOM 4682  H HB2  . SER A 1 49  ? 9.382   -5.904  4.976   1.00 0.35  ? 49  SER A HB2  3  
ATOM 4683  H HB3  . SER A 1 49  ? 11.033  -6.259  4.474   1.00 0.36  ? 49  SER A HB3  3  
ATOM 4684  H HG   . SER A 1 49  ? 10.336  -6.058  2.302   1.00 0.29  ? 49  SER A HG   3  
ATOM 4685  N N    . GLY A 1 50  ? 8.312   -8.479  2.184   1.00 0.36  ? 50  GLY A N    3  
ATOM 4686  C CA   . GLY A 1 50  ? 7.083   -8.701  1.453   1.00 0.43  ? 50  GLY A CA   3  
ATOM 4687  C C    . GLY A 1 50  ? 6.841   -7.655  0.386   1.00 0.43  ? 50  GLY A C    3  
ATOM 4688  O O    . GLY A 1 50  ? 5.836   -7.710  -0.327  1.00 0.62  ? 50  GLY A O    3  
ATOM 4689  H H    . GLY A 1 50  ? 9.181   -8.670  1.751   1.00 0.34  ? 50  GLY A H    3  
ATOM 4690  H HA2  . GLY A 1 50  ? 7.131   -9.671  0.983   1.00 0.49  ? 50  GLY A HA2  3  
ATOM 4691  H HA3  . GLY A 1 50  ? 6.255   -8.691  2.148   1.00 0.45  ? 50  GLY A HA3  3  
ATOM 4692  N N    . LEU A 1 51  ? 7.767   -6.711  0.268   1.00 0.41  ? 51  LEU A N    3  
ATOM 4693  C CA   . LEU A 1 51  ? 7.647   -5.632  -0.705  1.00 0.40  ? 51  LEU A CA   3  
ATOM 4694  C C    . LEU A 1 51  ? 7.616   -6.196  -2.118  1.00 0.48  ? 51  LEU A C    3  
ATOM 4695  O O    . LEU A 1 51  ? 8.480   -6.984  -2.500  1.00 0.65  ? 51  LEU A O    3  
ATOM 4696  C CB   . LEU A 1 51  ? 8.809   -4.648  -0.553  1.00 0.38  ? 51  LEU A CB   3  
ATOM 4697  C CG   . LEU A 1 51  ? 8.702   -3.383  -1.400  1.00 0.35  ? 51  LEU A CG   3  
ATOM 4698  C CD1  . LEU A 1 51  ? 7.483   -2.572  -0.988  1.00 0.38  ? 51  LEU A CD1  3  
ATOM 4699  C CD2  . LEU A 1 51  ? 9.967   -2.550  -1.272  1.00 0.37  ? 51  LEU A CD2  3  
ATOM 4700  H H    . LEU A 1 51  ? 8.554   -6.743  0.849   1.00 0.54  ? 51  LEU A H    3  
ATOM 4701  H HA   . LEU A 1 51  ? 6.718   -5.113  -0.515  1.00 0.41  ? 51  LEU A HA   3  
ATOM 4702  H HB2  . LEU A 1 51  ? 8.870   -4.356  0.484   1.00 0.42  ? 51  LEU A HB2  3  
ATOM 4703  H HB3  . LEU A 1 51  ? 9.723   -5.159  -0.822  1.00 0.48  ? 51  LEU A HB3  3  
ATOM 4704  H HG   . LEU A 1 51  ? 8.585   -3.660  -2.439  1.00 0.42  ? 51  LEU A HG   3  
ATOM 4705  H HD11 . LEU A 1 51  ? 7.399   -1.701  -1.620  1.00 1.04  ? 51  LEU A HD11 3  
ATOM 4706  H HD12 . LEU A 1 51  ? 7.590   -2.262  0.041   1.00 1.12  ? 51  LEU A HD12 3  
ATOM 4707  H HD13 . LEU A 1 51  ? 6.594   -3.179  -1.090  1.00 1.10  ? 51  LEU A HD13 3  
ATOM 4708  H HD21 . LEU A 1 51  ? 10.815  -3.133  -1.601  1.00 1.03  ? 51  LEU A HD21 3  
ATOM 4709  H HD22 . LEU A 1 51  ? 10.105  -2.264  -0.240  1.00 1.05  ? 51  LEU A HD22 3  
ATOM 4710  H HD23 . LEU A 1 51  ? 9.881   -1.664  -1.883  1.00 1.08  ? 51  LEU A HD23 3  
ATOM 4711  N N    . ARG A 1 52  ? 6.616   -5.797  -2.885  1.00 0.53  ? 52  ARG A N    3  
ATOM 4712  C CA   . ARG A 1 52  ? 6.425   -6.326  -4.222  1.00 0.65  ? 52  ARG A CA   3  
ATOM 4713  C C    . ARG A 1 52  ? 6.545   -5.202  -5.248  1.00 0.55  ? 52  ARG A C    3  
ATOM 4714  O O    . ARG A 1 52  ? 6.336   -4.034  -4.928  1.00 0.61  ? 52  ARG A O    3  
ATOM 4715  C CB   . ARG A 1 52  ? 5.053   -7.001  -4.301  1.00 0.86  ? 52  ARG A CB   3  
ATOM 4716  C CG   . ARG A 1 52  ? 4.925   -8.021  -5.414  1.00 1.23  ? 52  ARG A CG   3  
ATOM 4717  C CD   . ARG A 1 52  ? 3.668   -8.860  -5.256  1.00 2.05  ? 52  ARG A CD   3  
ATOM 4718  N NE   . ARG A 1 52  ? 3.628   -9.559  -3.963  1.00 2.59  ? 52  ARG A NE   3  
ATOM 4719  C CZ   . ARG A 1 52  ? 2.669   -10.416 -3.607  1.00 3.57  ? 52  ARG A CZ   3  
ATOM 4720  N NH1  . ARG A 1 52  ? 1.738   -10.779 -4.482  1.00 4.13  ? 52  ARG A NH1  3  
ATOM 4721  N NH2  . ARG A 1 52  ? 2.660   -10.944 -2.388  1.00 4.38  ? 52  ARG A NH2  3  
ATOM 4722  H H    . ARG A 1 52  ? 5.985   -5.127  -2.543  1.00 0.62  ? 52  ARG A H    3  
ATOM 4723  H HA   . ARG A 1 52  ? 7.194   -7.060  -4.409  1.00 0.74  ? 52  ARG A HA   3  
ATOM 4724  H HB2  . ARG A 1 52  ? 4.858   -7.500  -3.364  1.00 1.11  ? 52  ARG A HB2  3  
ATOM 4725  H HB3  . ARG A 1 52  ? 4.300   -6.241  -4.453  1.00 1.35  ? 52  ARG A HB3  3  
ATOM 4726  H HG2  . ARG A 1 52  ? 4.885   -7.503  -6.362  1.00 1.80  ? 52  ARG A HG2  3  
ATOM 4727  H HG3  . ARG A 1 52  ? 5.787   -8.671  -5.394  1.00 1.46  ? 52  ARG A HG3  3  
ATOM 4728  H HD2  . ARG A 1 52  ? 2.806   -8.213  -5.330  1.00 2.55  ? 52  ARG A HD2  3  
ATOM 4729  H HD3  . ARG A 1 52  ? 3.636   -9.593  -6.049  1.00 2.57  ? 52  ARG A HD3  3  
ATOM 4730  H HE   . ARG A 1 52  ? 4.348   -9.351  -3.316  1.00 2.68  ? 52  ARG A HE   3  
ATOM 4731  H HH11 . ARG A 1 52  ? 1.752   -10.409 -5.423  1.00 3.93  ? 52  ARG A HH11 3  
ATOM 4732  H HH12 . ARG A 1 52  ? 1.018   -11.423 -4.215  1.00 4.99  ? 52  ARG A HH12 3  
ATOM 4733  H HH21 . ARG A 1 52  ? 3.375   -10.707 -1.721  1.00 4.42  ? 52  ARG A HH21 3  
ATOM 4734  H HH22 . ARG A 1 52  ? 1.925   -11.582 -2.119  1.00 5.17  ? 52  ARG A HH22 3  
ATOM 4735  N N    . ALA A 1 53  ? 6.919   -5.554  -6.472  1.00 0.53  ? 53  ALA A N    3  
ATOM 4736  C CA   . ALA A 1 53  ? 7.056   -4.570  -7.536  1.00 0.54  ? 53  ALA A CA   3  
ATOM 4737  C C    . ALA A 1 53  ? 5.692   -4.210  -8.100  1.00 0.61  ? 53  ALA A C    3  
ATOM 4738  O O    . ALA A 1 53  ? 4.813   -5.069  -8.176  1.00 1.44  ? 53  ALA A O    3  
ATOM 4739  C CB   . ALA A 1 53  ? 7.969   -5.099  -8.633  1.00 0.68  ? 53  ALA A CB   3  
ATOM 4740  H H    . ALA A 1 53  ? 7.091   -6.498  -6.667  1.00 0.60  ? 53  ALA A H    3  
ATOM 4741  H HA   . ALA A 1 53  ? 7.509   -3.682  -7.115  1.00 0.52  ? 53  ALA A HA   3  
ATOM 4742  H HB1  . ALA A 1 53  ? 7.510   -5.958  -9.100  1.00 1.00  ? 53  ALA A HB1  3  
ATOM 4743  H HB2  . ALA A 1 53  ? 8.917   -5.388  -8.204  1.00 1.18  ? 53  ALA A HB2  3  
ATOM 4744  H HB3  . ALA A 1 53  ? 8.127   -4.328  -9.373  1.00 1.17  ? 53  ALA A HB3  3  
ATOM 4745  N N    . GLN A 1 54  ? 5.540   -2.939  -8.494  1.00 0.65  ? 54  GLN A N    3  
ATOM 4746  C CA   . GLN A 1 54  ? 4.272   -2.385  -8.994  1.00 0.74  ? 54  GLN A CA   3  
ATOM 4747  C C    . GLN A 1 54  ? 3.322   -2.058  -7.846  1.00 0.59  ? 54  GLN A C    3  
ATOM 4748  O O    . GLN A 1 54  ? 2.186   -1.633  -8.073  1.00 0.67  ? 54  GLN A O    3  
ATOM 4749  C CB   . GLN A 1 54  ? 3.588   -3.315  -10.005 1.00 0.99  ? 54  GLN A CB   3  
ATOM 4750  C CG   . GLN A 1 54  ? 4.350   -3.456  -11.311 1.00 1.46  ? 54  GLN A CG   3  
ATOM 4751  C CD   . GLN A 1 54  ? 4.435   -2.157  -12.089 1.00 2.34  ? 54  GLN A CD   3  
ATOM 4752  O OE1  . GLN A 1 54  ? 3.542   -1.309  -12.020 1.00 2.99  ? 54  GLN A OE1  3  
ATOM 4753  N NE2  . GLN A 1 54  ? 5.519   -1.987  -12.826 1.00 3.06  ? 54  GLN A NE2  3  
ATOM 4754  H H    . GLN A 1 54  ? 6.316   -2.338  -8.438  1.00 1.26  ? 54  GLN A H    3  
ATOM 4755  H HA   . GLN A 1 54  ? 4.514   -1.458  -9.498  1.00 0.86  ? 54  GLN A HA   3  
ATOM 4756  H HB2  . GLN A 1 54  ? 3.490   -4.296  -9.564  1.00 1.00  ? 54  GLN A HB2  3  
ATOM 4757  H HB3  . GLN A 1 54  ? 2.605   -2.927  -10.226 1.00 1.09  ? 54  GLN A HB3  3  
ATOM 4758  H HG2  . GLN A 1 54  ? 5.353   -3.788  -11.093 1.00 1.69  ? 54  GLN A HG2  3  
ATOM 4759  H HG3  . GLN A 1 54  ? 3.853   -4.195  -11.924 1.00 1.84  ? 54  GLN A HG3  3  
ATOM 4760  H HE21 . GLN A 1 54  ? 6.197   -2.699  -12.824 1.00 3.14  ? 54  GLN A HE21 3  
ATOM 4761  H HE22 . GLN A 1 54  ? 5.595   -1.163  -13.358 1.00 3.80  ? 54  GLN A HE22 3  
ATOM 4762  N N    . ASP A 1 55  ? 3.797   -2.252  -6.620  1.00 0.47  ? 55  ASP A N    3  
ATOM 4763  C CA   . ASP A 1 55  ? 3.049   -1.859  -5.435  1.00 0.45  ? 55  ASP A CA   3  
ATOM 4764  C C    . ASP A 1 55  ? 3.092   -0.347  -5.279  1.00 0.39  ? 55  ASP A C    3  
ATOM 4765  O O    . ASP A 1 55  ? 4.004   0.315   -5.788  1.00 0.48  ? 55  ASP A O    3  
ATOM 4766  C CB   . ASP A 1 55  ? 3.621   -2.516  -4.175  1.00 0.50  ? 55  ASP A CB   3  
ATOM 4767  C CG   . ASP A 1 55  ? 3.242   -3.978  -4.022  1.00 0.67  ? 55  ASP A CG   3  
ATOM 4768  O OD1  . ASP A 1 55  ? 2.687   -4.567  -4.974  1.00 1.02  ? 55  ASP A OD1  3  
ATOM 4769  O OD2  . ASP A 1 55  ? 3.493   -4.547  -2.931  1.00 1.01  ? 55  ASP A OD2  3  
ATOM 4770  H H    . ASP A 1 55  ? 4.668   -2.677  -6.507  1.00 0.46  ? 55  ASP A H    3  
ATOM 4771  H HA   . ASP A 1 55  ? 2.024   -2.173  -5.565  1.00 0.52  ? 55  ASP A HA   3  
ATOM 4772  H HB2  . ASP A 1 55  ? 4.698   -2.452  -4.207  1.00 0.55  ? 55  ASP A HB2  3  
ATOM 4773  H HB3  . ASP A 1 55  ? 3.264   -1.981  -3.309  1.00 0.57  ? 55  ASP A HB3  3  
ATOM 4774  N N    . ARG A 1 56  ? 2.119   0.201   -4.576  1.00 0.38  ? 56  ARG A N    3  
ATOM 4775  C CA   . ARG A 1 56  ? 2.049   1.629   -4.386  1.00 0.42  ? 56  ARG A CA   3  
ATOM 4776  C C    . ARG A 1 56  ? 2.015   1.949   -2.894  1.00 0.39  ? 56  ARG A C    3  
ATOM 4777  O O    . ARG A 1 56  ? 1.220   1.378   -2.146  1.00 0.39  ? 56  ARG A O    3  
ATOM 4778  C CB   . ARG A 1 56  ? 0.820   2.174   -5.118  1.00 0.56  ? 56  ARG A CB   3  
ATOM 4779  C CG   . ARG A 1 56  ? 0.826   3.676   -5.296  1.00 0.78  ? 56  ARG A CG   3  
ATOM 4780  C CD   . ARG A 1 56  ? 0.121   4.366   -4.159  1.00 0.79  ? 56  ARG A CD   3  
ATOM 4781  N NE   . ARG A 1 56  ? -1.296  4.020   -4.108  1.00 0.89  ? 56  ARG A NE   3  
ATOM 4782  C CZ   . ARG A 1 56  ? -2.080  4.358   -3.103  1.00 0.91  ? 56  ARG A CZ   3  
ATOM 4783  N NH1  . ARG A 1 56  ? -1.528  4.828   -2.000  1.00 1.51  ? 56  ARG A NH1  3  
ATOM 4784  N NH2  . ARG A 1 56  ? -3.390  4.147   -3.168  1.00 1.57  ? 56  ARG A NH2  3  
ATOM 4785  H H    . ARG A 1 56  ? 1.429   -0.368  -4.177  1.00 0.45  ? 56  ARG A H    3  
ATOM 4786  H HA   . ARG A 1 56  ? 2.937   2.066   -4.815  1.00 0.43  ? 56  ARG A HA   3  
ATOM 4787  H HB2  . ARG A 1 56  ? 0.766   1.719   -6.093  1.00 0.70  ? 56  ARG A HB2  3  
ATOM 4788  H HB3  . ARG A 1 56  ? -0.065  1.905   -4.559  1.00 0.54  ? 56  ARG A HB3  3  
ATOM 4789  H HG2  . ARG A 1 56  ? 1.849   4.021   -5.332  1.00 1.15  ? 56  ARG A HG2  3  
ATOM 4790  H HG3  . ARG A 1 56  ? 0.331   3.921   -6.220  1.00 1.24  ? 56  ARG A HG3  3  
ATOM 4791  H HD2  . ARG A 1 56  ? 0.588   4.074   -3.232  1.00 1.55  ? 56  ARG A HD2  3  
ATOM 4792  H HD3  . ARG A 1 56  ? 0.217   5.435   -4.288  1.00 1.33  ? 56  ARG A HD3  3  
ATOM 4793  H HE   . ARG A 1 56  ? -1.686  3.546   -4.889  1.00 1.71  ? 56  ARG A HE   3  
ATOM 4794  H HH11 . ARG A 1 56  ? -0.527  4.899   -1.937  1.00 1.92  ? 56  ARG A HH11 3  
ATOM 4795  H HH12 . ARG A 1 56  ? -2.102  5.147   -1.232  1.00 2.03  ? 56  ARG A HH12 3  
ATOM 4796  H HH21 . ARG A 1 56  ? -3.794  3.715   -3.989  1.00 2.26  ? 56  ARG A HH21 3  
ATOM 4797  H HH22 . ARG A 1 56  ? -3.988  4.432   -2.412  1.00 1.73  ? 56  ARG A HH22 3  
ATOM 4798  N N    . ILE A 1 57  ? 2.892   2.851   -2.471  1.00 0.40  ? 57  ILE A N    3  
ATOM 4799  C CA   . ILE A 1 57  ? 3.059   3.164   -1.057  1.00 0.38  ? 57  ILE A CA   3  
ATOM 4800  C C    . ILE A 1 57  ? 1.925   4.039   -0.544  1.00 0.38  ? 57  ILE A C    3  
ATOM 4801  O O    . ILE A 1 57  ? 1.569   5.050   -1.157  1.00 0.49  ? 57  ILE A O    3  
ATOM 4802  C CB   . ILE A 1 57  ? 4.408   3.868   -0.792  1.00 0.46  ? 57  ILE A CB   3  
ATOM 4803  C CG1  . ILE A 1 57  ? 5.566   2.985   -1.267  1.00 0.53  ? 57  ILE A CG1  3  
ATOM 4804  C CG2  . ILE A 1 57  ? 4.560   4.193   0.689   1.00 0.45  ? 57  ILE A CG2  3  
ATOM 4805  C CD1  . ILE A 1 57  ? 6.936   3.592   -1.037  1.00 0.68  ? 57  ILE A CD1  3  
ATOM 4806  H H    . ILE A 1 57  ? 3.440   3.331   -3.134  1.00 0.45  ? 57  ILE A H    3  
ATOM 4807  H HA   . ILE A 1 57  ? 3.050   2.235   -0.503  1.00 0.35  ? 57  ILE A HA   3  
ATOM 4808  H HB   . ILE A 1 57  ? 4.421   4.797   -1.343  1.00 0.52  ? 57  ILE A HB   3  
ATOM 4809  H HG12 . ILE A 1 57  ? 5.530   2.045   -0.739  1.00 1.01  ? 57  ILE A HG12 3  
ATOM 4810  H HG13 . ILE A 1 57  ? 5.457   2.801   -2.325  1.00 0.84  ? 57  ILE A HG13 3  
ATOM 4811  H HG21 . ILE A 1 57  ? 5.506   4.686   0.855   1.00 1.02  ? 57  ILE A HG21 3  
ATOM 4812  H HG22 . ILE A 1 57  ? 4.523   3.280   1.264   1.00 1.06  ? 57  ILE A HG22 3  
ATOM 4813  H HG23 . ILE A 1 57  ? 3.755   4.846   0.997   1.00 1.21  ? 57  ILE A HG23 3  
ATOM 4814  H HD11 . ILE A 1 57  ? 7.695   2.921   -1.412  1.00 1.25  ? 57  ILE A HD11 3  
ATOM 4815  H HD12 . ILE A 1 57  ? 7.087   3.748   0.021   1.00 1.30  ? 57  ILE A HD12 3  
ATOM 4816  H HD13 . ILE A 1 57  ? 7.004   4.538   -1.555  1.00 1.37  ? 57  ILE A HD13 3  
ATOM 4817  N N    . VAL A 1 58  ? 1.353   3.623   0.574   1.00 0.29  ? 58  VAL A N    3  
ATOM 4818  C CA   . VAL A 1 58  ? 0.301   4.375   1.230   1.00 0.32  ? 58  VAL A CA   3  
ATOM 4819  C C    . VAL A 1 58  ? 0.833   5.020   2.504   1.00 0.30  ? 58  VAL A C    3  
ATOM 4820  O O    . VAL A 1 58  ? 0.695   6.224   2.710   1.00 0.37  ? 58  VAL A O    3  
ATOM 4821  C CB   . VAL A 1 58  ? -0.893  3.471   1.594   1.00 0.37  ? 58  VAL A CB   3  
ATOM 4822  C CG1  . VAL A 1 58  ? -2.057  4.301   2.102   1.00 0.87  ? 58  VAL A CG1  3  
ATOM 4823  C CG2  . VAL A 1 58  ? -1.311  2.616   0.408   1.00 0.62  ? 58  VAL A CG2  3  
ATOM 4824  H H    . VAL A 1 58  ? 1.647   2.772   0.969   1.00 0.27  ? 58  VAL A H    3  
ATOM 4825  H HA   . VAL A 1 58  ? -0.041  5.146   0.554   1.00 0.38  ? 58  VAL A HA   3  
ATOM 4826  H HB   . VAL A 1 58  ? -0.582  2.811   2.391   1.00 0.66  ? 58  VAL A HB   3  
ATOM 4827  H HG11 . VAL A 1 58  ? -2.389  4.969   1.323   1.00 1.32  ? 58  VAL A HG11 3  
ATOM 4828  H HG12 . VAL A 1 58  ? -1.741  4.877   2.961   1.00 1.56  ? 58  VAL A HG12 3  
ATOM 4829  H HG13 . VAL A 1 58  ? -2.867  3.646   2.386   1.00 1.41  ? 58  VAL A HG13 3  
ATOM 4830  H HG21 . VAL A 1 58  ? -1.563  3.255   -0.426  1.00 1.24  ? 58  VAL A HG21 3  
ATOM 4831  H HG22 . VAL A 1 58  ? -2.170  2.023   0.679   1.00 1.25  ? 58  VAL A HG22 3  
ATOM 4832  H HG23 . VAL A 1 58  ? -0.497  1.965   0.128   1.00 1.22  ? 58  VAL A HG23 3  
ATOM 4833  N N    . GLU A 1 59  ? 1.461   4.207   3.348   1.00 0.24  ? 59  GLU A N    3  
ATOM 4834  C CA   . GLU A 1 59  ? 1.971   4.682   4.628   1.00 0.25  ? 59  GLU A CA   3  
ATOM 4835  C C    . GLU A 1 59  ? 3.418   4.255   4.832   1.00 0.22  ? 59  GLU A C    3  
ATOM 4836  O O    . GLU A 1 59  ? 3.820   3.170   4.416   1.00 0.23  ? 59  GLU A O    3  
ATOM 4837  C CB   . GLU A 1 59  ? 1.124   4.159   5.798   1.00 0.29  ? 59  GLU A CB   3  
ATOM 4838  C CG   . GLU A 1 59  ? -0.309  4.661   5.812   1.00 0.40  ? 59  GLU A CG   3  
ATOM 4839  C CD   . GLU A 1 59  ? -0.947  4.545   7.184   1.00 0.44  ? 59  GLU A CD   3  
ATOM 4840  O OE1  . GLU A 1 59  ? -1.342  3.424   7.563   1.00 0.43  ? 59  GLU A OE1  3  
ATOM 4841  O OE2  . GLU A 1 59  ? -1.070  5.570   7.889   1.00 0.89  ? 59  GLU A OE2  3  
ATOM 4842  H H    . GLU A 1 59  ? 1.603   3.269   3.092   1.00 0.24  ? 59  GLU A H    3  
ATOM 4843  H HA   . GLU A 1 59  ? 1.927   5.762   4.620   1.00 0.27  ? 59  GLU A HA   3  
ATOM 4844  H HB2  . GLU A 1 59  ? 1.099   3.081   5.745   1.00 0.26  ? 59  GLU A HB2  3  
ATOM 4845  H HB3  . GLU A 1 59  ? 1.592   4.449   6.726   1.00 0.37  ? 59  GLU A HB3  3  
ATOM 4846  H HG2  . GLU A 1 59  ? -0.319  5.698   5.513   1.00 0.55  ? 59  GLU A HG2  3  
ATOM 4847  H HG3  . GLU A 1 59  ? -0.890  4.079   5.111   1.00 0.44  ? 59  GLU A HG3  3  
ATOM 4848  N N    . VAL A 1 60  ? 4.196   5.119   5.467   1.00 0.22  ? 60  VAL A N    3  
ATOM 4849  C CA   . VAL A 1 60  ? 5.554   4.784   5.868   1.00 0.21  ? 60  VAL A CA   3  
ATOM 4850  C C    . VAL A 1 60  ? 5.679   4.912   7.377   1.00 0.22  ? 60  VAL A C    3  
ATOM 4851  O O    . VAL A 1 60  ? 5.466   5.990   7.930   1.00 0.27  ? 60  VAL A O    3  
ATOM 4852  C CB   . VAL A 1 60  ? 6.617   5.682   5.198   1.00 0.23  ? 60  VAL A CB   3  
ATOM 4853  C CG1  . VAL A 1 60  ? 8.013   5.280   5.655   1.00 0.54  ? 60  VAL A CG1  3  
ATOM 4854  C CG2  . VAL A 1 60  ? 6.511   5.610   3.685   1.00 0.66  ? 60  VAL A CG2  3  
ATOM 4855  H H    . VAL A 1 60  ? 3.843   6.015   5.680   1.00 0.25  ? 60  VAL A H    3  
ATOM 4856  H HA   . VAL A 1 60  ? 5.744   3.757   5.588   1.00 0.22  ? 60  VAL A HA   3  
ATOM 4857  H HB   . VAL A 1 60  ? 6.441   6.704   5.503   1.00 0.52  ? 60  VAL A HB   3  
ATOM 4858  H HG11 . VAL A 1 60  ? 8.195   4.250   5.390   1.00 1.16  ? 60  VAL A HG11 3  
ATOM 4859  H HG12 . VAL A 1 60  ? 8.086   5.394   6.727   1.00 1.03  ? 60  VAL A HG12 3  
ATOM 4860  H HG13 . VAL A 1 60  ? 8.747   5.913   5.176   1.00 1.01  ? 60  VAL A HG13 3  
ATOM 4861  H HG21 . VAL A 1 60  ? 5.521   5.910   3.377   1.00 1.23  ? 60  VAL A HG21 3  
ATOM 4862  H HG22 . VAL A 1 60  ? 6.698   4.597   3.359   1.00 1.29  ? 60  VAL A HG22 3  
ATOM 4863  H HG23 . VAL A 1 60  ? 7.242   6.271   3.242   1.00 1.22  ? 60  VAL A HG23 3  
ATOM 4864  N N    . ASN A 1 61  ? 5.988   3.799   8.035   1.00 0.25  ? 61  ASN A N    3  
ATOM 4865  C CA   . ASN A 1 61  ? 6.122   3.748   9.492   1.00 0.30  ? 61  ASN A CA   3  
ATOM 4866  C C    . ASN A 1 61  ? 4.808   4.127   10.175  1.00 0.36  ? 61  ASN A C    3  
ATOM 4867  O O    . ASN A 1 61  ? 4.791   4.524   11.343  1.00 0.47  ? 61  ASN A O    3  
ATOM 4868  C CB   . ASN A 1 61  ? 7.257   4.669   9.972   1.00 0.39  ? 61  ASN A CB   3  
ATOM 4869  C CG   . ASN A 1 61  ? 8.595   4.336   9.334   1.00 0.53  ? 61  ASN A CG   3  
ATOM 4870  O OD1  . ASN A 1 61  ? 8.873   3.182   8.997   1.00 1.17  ? 61  ASN A OD1  3  
ATOM 4871  N ND2  . ASN A 1 61  ? 9.430   5.347   9.156   1.00 0.61  ? 61  ASN A ND2  3  
ATOM 4872  H H    . ASN A 1 61  ? 6.146   2.975   7.516   1.00 0.27  ? 61  ASN A H    3  
ATOM 4873  H HA   . ASN A 1 61  ? 6.364   2.730   9.761   1.00 0.40  ? 61  ASN A HA   3  
ATOM 4874  H HB2  . ASN A 1 61  ? 7.009   5.691   9.726   1.00 0.67  ? 61  ASN A HB2  3  
ATOM 4875  H HB3  . ASN A 1 61  ? 7.355   4.576   11.043  1.00 0.55  ? 61  ASN A HB3  3  
ATOM 4876  H HD21 . ASN A 1 61  ? 9.140   6.248   9.441   1.00 0.97  ? 61  ASN A HD21 3  
ATOM 4877  H HD22 . ASN A 1 61  ? 10.298  5.167   8.740   1.00 0.74  ? 61  ASN A HD22 3  
ATOM 4878  N N    . GLY A 1 62  ? 3.710   3.978   9.438   1.00 0.37  ? 62  GLY A N    3  
ATOM 4879  C CA   . GLY A 1 62  ? 2.401   4.311   9.966   1.00 0.50  ? 62  GLY A CA   3  
ATOM 4880  C C    . GLY A 1 62  ? 1.978   5.733   9.644   1.00 0.51  ? 62  GLY A C    3  
ATOM 4881  O O    . GLY A 1 62  ? 0.949   6.200   10.130  1.00 0.66  ? 62  GLY A O    3  
ATOM 4882  H H    . GLY A 1 62  ? 3.794   3.645   8.523   1.00 0.34  ? 62  GLY A H    3  
ATOM 4883  H HA2  . GLY A 1 62  ? 1.675   3.630   9.547   1.00 0.55  ? 62  GLY A HA2  3  
ATOM 4884  H HA3  . GLY A 1 62  ? 2.415   4.186   11.039  1.00 0.58  ? 62  GLY A HA3  3  
ATOM 4885  N N    . VAL A 1 63  ? 2.772   6.425   8.836   1.00 0.42  ? 63  VAL A N    3  
ATOM 4886  C CA   . VAL A 1 63  ? 2.435   7.778   8.409   1.00 0.50  ? 63  VAL A CA   3  
ATOM 4887  C C    . VAL A 1 63  ? 1.977   7.777   6.954   1.00 0.43  ? 63  VAL A C    3  
ATOM 4888  O O    . VAL A 1 63  ? 2.718   7.358   6.063   1.00 0.39  ? 63  VAL A O    3  
ATOM 4889  C CB   . VAL A 1 63  ? 3.636   8.740   8.563   1.00 0.61  ? 63  VAL A CB   3  
ATOM 4890  C CG1  . VAL A 1 63  ? 3.247   10.163  8.182   1.00 0.98  ? 63  VAL A CG1  3  
ATOM 4891  C CG2  . VAL A 1 63  ? 4.180   8.698   9.981   1.00 1.17  ? 63  VAL A CG2  3  
ATOM 4892  H H    . VAL A 1 63  ? 3.612   6.020   8.526   1.00 0.36  ? 63  VAL A H    3  
ATOM 4893  H HA   . VAL A 1 63  ? 1.625   8.136   9.027   1.00 0.62  ? 63  VAL A HA   3  
ATOM 4894  H HB   . VAL A 1 63  ? 4.418   8.415   7.893   1.00 1.15  ? 63  VAL A HB   3  
ATOM 4895  H HG11 . VAL A 1 63  ? 4.113   10.805  8.254   1.00 1.65  ? 63  VAL A HG11 3  
ATOM 4896  H HG12 . VAL A 1 63  ? 2.478   10.517  8.852   1.00 1.44  ? 63  VAL A HG12 3  
ATOM 4897  H HG13 . VAL A 1 63  ? 2.874   10.174  7.168   1.00 1.53  ? 63  VAL A HG13 3  
ATOM 4898  H HG21 . VAL A 1 63  ? 4.492   7.692   10.219  1.00 1.72  ? 63  VAL A HG21 3  
ATOM 4899  H HG22 . VAL A 1 63  ? 3.410   9.010   10.671  1.00 1.75  ? 63  VAL A HG22 3  
ATOM 4900  H HG23 . VAL A 1 63  ? 5.025   9.367   10.061  1.00 1.64  ? 63  VAL A HG23 3  
ATOM 4901  N N    . CYS A 1 64  ? 0.751   8.235   6.726   1.00 0.49  ? 64  CYS A N    3  
ATOM 4902  C CA   . CYS A 1 64  ? 0.184   8.302   5.388   1.00 0.49  ? 64  CYS A CA   3  
ATOM 4903  C C    . CYS A 1 64  ? 0.975   9.264   4.512   1.00 0.47  ? 64  CYS A C    3  
ATOM 4904  O O    . CYS A 1 64  ? 1.237   10.400  4.906   1.00 0.51  ? 64  CYS A O    3  
ATOM 4905  C CB   . CYS A 1 64  ? -1.271  8.758   5.462   1.00 0.59  ? 64  CYS A CB   3  
ATOM 4906  S SG   . CYS A 1 64  ? -2.383  7.587   6.267   1.00 1.68  ? 64  CYS A SG   3  
ATOM 4907  H H    . CYS A 1 64  ? 0.209   8.546   7.484   1.00 0.57  ? 64  CYS A H    3  
ATOM 4908  H HA   . CYS A 1 64  ? 0.226   7.316   4.956   1.00 0.51  ? 64  CYS A HA   3  
ATOM 4909  H HB2  . CYS A 1 64  ? -1.317  9.682   6.018   1.00 1.19  ? 64  CYS A HB2  3  
ATOM 4910  H HB3  . CYS A 1 64  ? -1.635  8.928   4.463   1.00 1.14  ? 64  CYS A HB3  3  
ATOM 4911  H HG   . CYS A 1 64  ? -1.641  6.719   6.953   1.00 2.36  ? 64  CYS A HG   3  
ATOM 4912  N N    . MET A 1 65  ? 1.351   8.804   3.324   1.00 0.48  ? 65  MET A N    3  
ATOM 4913  C CA   . MET A 1 65  ? 2.095   9.626   2.378   1.00 0.53  ? 65  MET A CA   3  
ATOM 4914  C C    . MET A 1 65  ? 1.219   9.994   1.189   1.00 0.61  ? 65  MET A C    3  
ATOM 4915  O O    . MET A 1 65  ? 1.708   10.381  0.127   1.00 0.81  ? 65  MET A O    3  
ATOM 4916  C CB   . MET A 1 65  ? 3.355   8.899   1.911   1.00 0.61  ? 65  MET A CB   3  
ATOM 4917  C CG   . MET A 1 65  ? 4.348   8.656   3.034   1.00 0.63  ? 65  MET A CG   3  
ATOM 4918  S SD   . MET A 1 65  ? 4.895   10.188  3.810   1.00 0.61  ? 65  MET A SD   3  
ATOM 4919  C CE   . MET A 1 65  ? 5.791   9.547   5.217   1.00 0.74  ? 65  MET A CE   3  
ATOM 4920  H H    . MET A 1 65  ? 1.121   7.875   3.076   1.00 0.50  ? 65  MET A H    3  
ATOM 4921  H HA   . MET A 1 65  ? 2.383   10.535  2.887   1.00 0.54  ? 65  MET A HA   3  
ATOM 4922  H HB2  . MET A 1 65  ? 3.073   7.944   1.491   1.00 0.69  ? 65  MET A HB2  3  
ATOM 4923  H HB3  . MET A 1 65  ? 3.841   9.491   1.150   1.00 0.65  ? 65  MET A HB3  3  
ATOM 4924  H HG2  . MET A 1 65  ? 3.875   8.037   3.784   1.00 0.66  ? 65  MET A HG2  3  
ATOM 4925  H HG3  . MET A 1 65  ? 5.210   8.145   2.634   1.00 0.74  ? 65  MET A HG3  3  
ATOM 4926  H HE1  . MET A 1 65  ? 5.126   8.960   5.830   1.00 1.42  ? 65  MET A HE1  3  
ATOM 4927  H HE2  . MET A 1 65  ? 6.186   10.368  5.797   1.00 1.16  ? 65  MET A HE2  3  
ATOM 4928  H HE3  . MET A 1 65  ? 6.602   8.924   4.871   1.00 1.11  ? 65  MET A HE3  3  
ATOM 4929  N N    . GLU A 1 66  ? -0.083  9.864   1.390   1.00 0.83  ? 66  GLU A N    3  
ATOM 4930  C CA   . GLU A 1 66  ? -1.069  10.230  0.383   1.00 1.01  ? 66  GLU A CA   3  
ATOM 4931  C C    . GLU A 1 66  ? -0.971  11.713  0.046   1.00 1.08  ? 66  GLU A C    3  
ATOM 4932  O O    . GLU A 1 66  ? -1.154  12.570  0.911   1.00 1.86  ? 66  GLU A O    3  
ATOM 4933  C CB   . GLU A 1 66  ? -2.475  9.908   0.889   1.00 1.29  ? 66  GLU A CB   3  
ATOM 4934  C CG   . GLU A 1 66  ? -2.747  8.421   1.046   1.00 2.19  ? 66  GLU A CG   3  
ATOM 4935  C CD   . GLU A 1 66  ? -2.827  7.693   -0.281  1.00 3.03  ? 66  GLU A CD   3  
ATOM 4936  O OE1  . GLU A 1 66  ? -2.963  8.361   -1.328  1.00 3.33  ? 66  GLU A OE1  3  
ATOM 4937  O OE2  . GLU A 1 66  ? -2.779  6.445   -0.280  1.00 3.75  ? 66  GLU A OE2  3  
ATOM 4938  H H    . GLU A 1 66  ? -0.390  9.504   2.244   1.00 1.03  ? 66  GLU A H    3  
ATOM 4939  H HA   . GLU A 1 66  ? -0.872  9.651   -0.508  1.00 1.16  ? 66  GLU A HA   3  
ATOM 4940  H HB2  . GLU A 1 66  ? -2.612  10.379  1.851   1.00 1.44  ? 66  GLU A HB2  3  
ATOM 4941  H HB3  . GLU A 1 66  ? -3.198  10.312  0.195   1.00 1.69  ? 66  GLU A HB3  3  
ATOM 4942  H HG2  . GLU A 1 66  ? -1.953  7.982   1.630   1.00 2.66  ? 66  GLU A HG2  3  
ATOM 4943  H HG3  . GLU A 1 66  ? -3.686  8.294   1.566   1.00 2.52  ? 66  GLU A HG3  3  
ATOM 4944  N N    . GLY A 1 67  ? -0.654  12.009  -1.205  1.00 1.21  ? 67  GLY A N    3  
ATOM 4945  C CA   . GLY A 1 67  ? -0.593  13.388  -1.650  1.00 1.36  ? 67  GLY A CA   3  
ATOM 4946  C C    . GLY A 1 67  ? 0.768   14.020  -1.432  1.00 1.24  ? 67  GLY A C    3  
ATOM 4947  O O    . GLY A 1 67  ? 1.077   15.060  -2.018  1.00 1.47  ? 67  GLY A O    3  
ATOM 4948  H H    . GLY A 1 67  ? -0.454  11.285  -1.833  1.00 1.78  ? 67  GLY A H    3  
ATOM 4949  H HA2  . GLY A 1 67  ? -0.829  13.425  -2.702  1.00 1.51  ? 67  GLY A HA2  3  
ATOM 4950  H HA3  . GLY A 1 67  ? -1.331  13.959  -1.106  1.00 1.54  ? 67  GLY A HA3  3  
ATOM 4951  N N    . LYS A 1 68  ? 1.580   13.400  -0.590  1.00 0.97  ? 68  LYS A N    3  
ATOM 4952  C CA   . LYS A 1 68  ? 2.908   13.912  -0.294  1.00 0.87  ? 68  LYS A CA   3  
ATOM 4953  C C    . LYS A 1 68  ? 3.884   13.647  -1.434  1.00 0.90  ? 68  LYS A C    3  
ATOM 4954  O O    . LYS A 1 68  ? 3.562   12.950  -2.402  1.00 1.06  ? 68  LYS A O    3  
ATOM 4955  C CB   . LYS A 1 68  ? 3.407   13.304  1.001   1.00 0.73  ? 68  LYS A CB   3  
ATOM 4956  C CG   . LYS A 1 68  ? 2.538   13.697  2.172   1.00 1.24  ? 68  LYS A CG   3  
ATOM 4957  C CD   . LYS A 1 68  ? 3.042   13.118  3.468   1.00 2.01  ? 68  LYS A CD   3  
ATOM 4958  C CE   . LYS A 1 68  ? 2.085   13.439  4.593   1.00 2.81  ? 68  LYS A CE   3  
ATOM 4959  N NZ   . LYS A 1 68  ? 2.020   14.899  4.873   1.00 3.36  ? 68  LYS A NZ   3  
ATOM 4960  H H    . LYS A 1 68  ? 1.274   12.583  -0.139  1.00 0.95  ? 68  LYS A H    3  
ATOM 4961  H HA   . LYS A 1 68  ? 2.821   14.979  -0.157  1.00 0.97  ? 68  LYS A HA   3  
ATOM 4962  H HB2  . LYS A 1 68  ? 3.405   12.228  0.912   1.00 0.95  ? 68  LYS A HB2  3  
ATOM 4963  H HB3  . LYS A 1 68  ? 4.413   13.648  1.190   1.00 0.87  ? 68  LYS A HB3  3  
ATOM 4964  H HG2  . LYS A 1 68  ? 2.527   14.772  2.255   1.00 1.54  ? 68  LYS A HG2  3  
ATOM 4965  H HG3  . LYS A 1 68  ? 1.534   13.338  1.997   1.00 1.43  ? 68  LYS A HG3  3  
ATOM 4966  H HD2  . LYS A 1 68  ? 3.127   12.046  3.366   1.00 2.15  ? 68  LYS A HD2  3  
ATOM 4967  H HD3  . LYS A 1 68  ? 4.009   13.545  3.690   1.00 2.21  ? 68  LYS A HD3  3  
ATOM 4968  H HE2  . LYS A 1 68  ? 1.101   13.095  4.302   1.00 3.07  ? 68  LYS A HE2  3  
ATOM 4969  H HE3  . LYS A 1 68  ? 2.404   12.919  5.482   1.00 3.16  ? 68  LYS A HE3  3  
ATOM 4970  H HZ1  . LYS A 1 68  ? 1.415   15.077  5.705   1.00 3.73  ? 68  LYS A HZ1  3  
ATOM 4971  H HZ2  . LYS A 1 68  ? 1.613   15.406  4.055   1.00 3.59  ? 68  LYS A HZ2  3  
ATOM 4972  H HZ3  . LYS A 1 68  ? 2.975   15.276  5.060   1.00 3.71  ? 68  LYS A HZ3  3  
ATOM 4973  N N    . GLN A 1 69  ? 5.077   14.204  -1.306  1.00 0.87  ? 69  GLN A N    3  
ATOM 4974  C CA   . GLN A 1 69  ? 6.049   14.203  -2.383  1.00 0.93  ? 69  GLN A CA   3  
ATOM 4975  C C    . GLN A 1 69  ? 7.142   13.170  -2.146  1.00 0.81  ? 69  GLN A C    3  
ATOM 4976  O O    . GLN A 1 69  ? 7.091   12.408  -1.179  1.00 0.74  ? 69  GLN A O    3  
ATOM 4977  C CB   . GLN A 1 69  ? 6.660   15.597  -2.509  1.00 1.07  ? 69  GLN A CB   3  
ATOM 4978  C CG   . GLN A 1 69  ? 5.640   16.666  -2.863  1.00 1.33  ? 69  GLN A CG   3  
ATOM 4979  C CD   . GLN A 1 69  ? 6.109   18.065  -2.518  1.00 2.12  ? 69  GLN A CD   3  
ATOM 4980  O OE1  . GLN A 1 69  ? 7.308   18.352  -2.508  1.00 2.64  ? 69  GLN A OE1  3  
ATOM 4981  N NE2  . GLN A 1 69  ? 5.163   18.948  -2.235  1.00 2.89  ? 69  GLN A NE2  3  
ATOM 4982  H H    . GLN A 1 69  ? 5.322   14.624  -0.445  1.00 0.90  ? 69  GLN A H    3  
ATOM 4983  H HA   . GLN A 1 69  ? 5.535   13.961  -3.300  1.00 1.04  ? 69  GLN A HA   3  
ATOM 4984  H HB2  . GLN A 1 69  ? 7.121   15.863  -1.570  1.00 1.06  ? 69  GLN A HB2  3  
ATOM 4985  H HB3  . GLN A 1 69  ? 7.414   15.578  -3.280  1.00 1.25  ? 69  GLN A HB3  3  
ATOM 4986  H HG2  . GLN A 1 69  ? 5.444   16.622  -3.924  1.00 1.71  ? 69  GLN A HG2  3  
ATOM 4987  H HG3  . GLN A 1 69  ? 4.728   16.466  -2.321  1.00 1.61  ? 69  GLN A HG3  3  
ATOM 4988  H HE21 . GLN A 1 69  ? 4.230   18.650  -2.266  1.00 2.96  ? 69  GLN A HE21 3  
ATOM 4989  H HE22 . GLN A 1 69  ? 5.433   19.864  -2.001  1.00 3.61  ? 69  GLN A HE22 3  
ATOM 4990  N N    . HIS A 1 70  ? 8.133   13.157  -3.027  1.00 0.84  ? 70  HIS A N    3  
ATOM 4991  C CA   . HIS A 1 70  ? 9.233   12.205  -2.941  1.00 0.79  ? 70  HIS A CA   3  
ATOM 4992  C C    . HIS A 1 70  ? 10.022  12.423  -1.654  1.00 0.70  ? 70  HIS A C    3  
ATOM 4993  O O    . HIS A 1 70  ? 10.369  11.468  -0.955  1.00 0.65  ? 70  HIS A O    3  
ATOM 4994  C CB   . HIS A 1 70  ? 10.145  12.359  -4.168  1.00 0.88  ? 70  HIS A CB   3  
ATOM 4995  C CG   . HIS A 1 70  ? 11.298  11.399  -4.222  1.00 0.90  ? 70  HIS A CG   3  
ATOM 4996  N ND1  . HIS A 1 70  ? 11.143  10.040  -4.393  1.00 1.42  ? 70  HIS A ND1  3  
ATOM 4997  C CD2  . HIS A 1 70  ? 12.630  11.615  -4.162  1.00 1.37  ? 70  HIS A CD2  3  
ATOM 4998  C CE1  . HIS A 1 70  ? 12.328  9.466   -4.438  1.00 1.31  ? 70  HIS A CE1  3  
ATOM 4999  N NE2  . HIS A 1 70  ? 13.252  10.398  -4.305  1.00 1.13  ? 70  HIS A NE2  3  
ATOM 5000  H H    . HIS A 1 70  ? 8.130   13.817  -3.754  1.00 0.93  ? 70  HIS A H    3  
ATOM 5001  H HA   . HIS A 1 70  ? 8.816   11.208  -2.934  1.00 0.78  ? 70  HIS A HA   3  
ATOM 5002  H HB2  . HIS A 1 70  ? 9.557   12.210  -5.060  1.00 0.96  ? 70  HIS A HB2  3  
ATOM 5003  H HB3  . HIS A 1 70  ? 10.549  13.363  -4.178  1.00 0.92  ? 70  HIS A HB3  3  
ATOM 5004  H HD1  . HIS A 1 70  ? 10.282  9.563   -4.450  1.00 2.13  ? 70  HIS A HD1  3  
ATOM 5005  H HD2  . HIS A 1 70  ? 13.117  12.571  -4.026  1.00 2.20  ? 70  HIS A HD2  3  
ATOM 5006  H HE1  . HIS A 1 70  ? 12.513  8.409   -4.565  1.00 1.85  ? 70  HIS A HE1  3  
ATOM 5007  H HE2  . HIS A 1 70  ? 14.208  10.276  -4.519  1.00 1.45  ? 70  HIS A HE2  3  
ATOM 5008  N N    . GLY A 1 71  ? 10.268  13.688  -1.336  1.00 0.72  ? 71  GLY A N    3  
ATOM 5009  C CA   . GLY A 1 71  ? 11.015  14.036  -0.142  1.00 0.69  ? 71  GLY A CA   3  
ATOM 5010  C C    . GLY A 1 71  ? 10.358  13.552  1.136   1.00 0.62  ? 71  GLY A C    3  
ATOM 5011  O O    . GLY A 1 71  ? 11.041  13.079  2.045   1.00 0.62  ? 71  GLY A O    3  
ATOM 5012  H H    . GLY A 1 71  ? 9.943   14.401  -1.930  1.00 0.78  ? 71  GLY A H    3  
ATOM 5013  H HA2  . GLY A 1 71  ? 12.001  13.602  -0.210  1.00 0.70  ? 71  GLY A HA2  3  
ATOM 5014  H HA3  . GLY A 1 71  ? 11.112  15.112  -0.094  1.00 0.75  ? 71  GLY A HA3  3  
ATOM 5015  N N    . ASP A 1 72  ? 9.032   13.651  1.199   1.00 0.61  ? 72  ASP A N    3  
ATOM 5016  C CA   . ASP A 1 72  ? 8.286   13.246  2.392   1.00 0.58  ? 72  ASP A CA   3  
ATOM 5017  C C    . ASP A 1 72  ? 8.463   11.757  2.660   1.00 0.49  ? 72  ASP A C    3  
ATOM 5018  O O    . ASP A 1 72  ? 8.759   11.344  3.783   1.00 0.44  ? 72  ASP A O    3  
ATOM 5019  C CB   . ASP A 1 72  ? 6.787   13.538  2.233   1.00 0.68  ? 72  ASP A CB   3  
ATOM 5020  C CG   . ASP A 1 72  ? 6.472   15.010  2.059   1.00 1.16  ? 72  ASP A CG   3  
ATOM 5021  O OD1  . ASP A 1 72  ? 6.463   15.745  3.069   1.00 1.47  ? 72  ASP A OD1  3  
ATOM 5022  O OD2  . ASP A 1 72  ? 6.209   15.434  0.914   1.00 2.03  ? 72  ASP A OD2  3  
ATOM 5023  H H    . ASP A 1 72  ? 8.543   14.006  0.429   1.00 0.65  ? 72  ASP A H    3  
ATOM 5024  H HA   . ASP A 1 72  ? 8.668   13.803  3.233   1.00 0.61  ? 72  ASP A HA   3  
ATOM 5025  H HB2  . ASP A 1 72  ? 6.418   13.012  1.365   1.00 1.25  ? 72  ASP A HB2  3  
ATOM 5026  H HB3  . ASP A 1 72  ? 6.266   13.180  3.109   1.00 0.87  ? 72  ASP A HB3  3  
ATOM 5027  N N    . VAL A 1 73  ? 8.301   10.962  1.611   1.00 0.50  ? 73  VAL A N    3  
ATOM 5028  C CA   . VAL A 1 73  ? 8.351   9.513   1.730   1.00 0.45  ? 73  VAL A CA   3  
ATOM 5029  C C    . VAL A 1 73  ? 9.763   9.041   2.070   1.00 0.44  ? 73  VAL A C    3  
ATOM 5030  O O    . VAL A 1 73  ? 9.955   8.235   2.982   1.00 0.43  ? 73  VAL A O    3  
ATOM 5031  C CB   . VAL A 1 73  ? 7.875   8.834   0.426   1.00 0.51  ? 73  VAL A CB   3  
ATOM 5032  C CG1  . VAL A 1 73  ? 7.870   7.319   0.566   1.00 1.08  ? 73  VAL A CG1  3  
ATOM 5033  C CG2  . VAL A 1 73  ? 6.492   9.340   0.037   1.00 0.97  ? 73  VAL A CG2  3  
ATOM 5034  H H    . VAL A 1 73  ? 8.140   11.363  0.731   1.00 0.56  ? 73  VAL A H    3  
ATOM 5035  H HA   . VAL A 1 73  ? 7.685   9.223   2.528   1.00 0.44  ? 73  VAL A HA   3  
ATOM 5036  H HB   . VAL A 1 73  ? 8.564   9.097   -0.363  1.00 0.92  ? 73  VAL A HB   3  
ATOM 5037  H HG11 . VAL A 1 73  ? 7.533   6.874   -0.359  1.00 1.67  ? 73  VAL A HG11 3  
ATOM 5038  H HG12 . VAL A 1 73  ? 7.206   7.032   1.367   1.00 1.48  ? 73  VAL A HG12 3  
ATOM 5039  H HG13 . VAL A 1 73  ? 8.870   6.975   0.787   1.00 1.71  ? 73  VAL A HG13 3  
ATOM 5040  H HG21 . VAL A 1 73  ? 6.180   8.868   -0.883  1.00 1.47  ? 73  VAL A HG21 3  
ATOM 5041  H HG22 . VAL A 1 73  ? 6.525   10.410  -0.103  1.00 1.57  ? 73  VAL A HG22 3  
ATOM 5042  H HG23 . VAL A 1 73  ? 5.785   9.101   0.822   1.00 1.50  ? 73  VAL A HG23 3  
ATOM 5043  N N    . VAL A 1 74  ? 10.749  9.569   1.354   1.00 0.49  ? 74  VAL A N    3  
ATOM 5044  C CA   . VAL A 1 74  ? 12.139  9.173   1.561   1.00 0.53  ? 74  VAL A CA   3  
ATOM 5045  C C    . VAL A 1 74  ? 12.623  9.579   2.951   1.00 0.51  ? 74  VAL A C    3  
ATOM 5046  O O    . VAL A 1 74  ? 13.328  8.820   3.621   1.00 0.52  ? 74  VAL A O    3  
ATOM 5047  C CB   . VAL A 1 74  ? 13.067  9.781   0.484   1.00 0.64  ? 74  VAL A CB   3  
ATOM 5048  C CG1  . VAL A 1 74  ? 14.526  9.436   0.751   1.00 0.72  ? 74  VAL A CG1  3  
ATOM 5049  C CG2  . VAL A 1 74  ? 12.660  9.297   -0.897  1.00 0.70  ? 74  VAL A CG2  3  
ATOM 5050  H H    . VAL A 1 74  ? 10.537  10.241  0.666   1.00 0.52  ? 74  VAL A H    3  
ATOM 5051  H HA   . VAL A 1 74  ? 12.189  8.096   1.479   1.00 0.55  ? 74  VAL A HA   3  
ATOM 5052  H HB   . VAL A 1 74  ? 12.964  10.857  0.509   1.00 0.66  ? 74  VAL A HB   3  
ATOM 5053  H HG11 . VAL A 1 74  ? 14.644  8.363   0.762   1.00 1.19  ? 74  VAL A HG11 3  
ATOM 5054  H HG12 . VAL A 1 74  ? 14.822  9.841   1.707   1.00 1.34  ? 74  VAL A HG12 3  
ATOM 5055  H HG13 . VAL A 1 74  ? 15.143  9.859   -0.028  1.00 1.20  ? 74  VAL A HG13 3  
ATOM 5056  H HG21 . VAL A 1 74  ? 12.678  8.217   -0.919  1.00 1.37  ? 74  VAL A HG21 3  
ATOM 5057  H HG22 . VAL A 1 74  ? 13.351  9.684   -1.633  1.00 1.03  ? 74  VAL A HG22 3  
ATOM 5058  H HG23 . VAL A 1 74  ? 11.663  9.646   -1.122  1.00 1.19  ? 74  VAL A HG23 3  
ATOM 5059  N N    . SER A 1 75  ? 12.225  10.767  3.387   1.00 0.51  ? 75  SER A N    3  
ATOM 5060  C CA   . SER A 1 75  ? 12.621  11.274  4.691   1.00 0.52  ? 75  SER A CA   3  
ATOM 5061  C C    . SER A 1 75  ? 12.135  10.350  5.803   1.00 0.47  ? 75  SER A C    3  
ATOM 5062  O O    . SER A 1 75  ? 12.873  10.060  6.742   1.00 0.51  ? 75  SER A O    3  
ATOM 5063  C CB   . SER A 1 75  ? 12.069  12.686  4.894   1.00 0.58  ? 75  SER A CB   3  
ATOM 5064  O OG   . SER A 1 75  ? 12.457  13.227  6.144   1.00 0.66  ? 75  SER A OG   3  
ATOM 5065  H H    . SER A 1 75  ? 11.645  11.319  2.816   1.00 0.52  ? 75  SER A H    3  
ATOM 5066  H HA   . SER A 1 75  ? 13.699  11.313  4.718   1.00 0.57  ? 75  SER A HA   3  
ATOM 5067  H HB2  . SER A 1 75  ? 12.437  13.329  4.110   1.00 0.61  ? 75  SER A HB2  3  
ATOM 5068  H HB3  . SER A 1 75  ? 10.992  12.650  4.851   1.00 0.57  ? 75  SER A HB3  3  
ATOM 5069  H HG   . SER A 1 75  ? 11.675  13.590  6.587   1.00 1.12  ? 75  SER A HG   3  
ATOM 5070  N N    . ALA A 1 76  ? 10.902  9.868   5.681   1.00 0.42  ? 76  ALA A N    3  
ATOM 5071  C CA   . ALA A 1 76  ? 10.318  9.000   6.696   1.00 0.39  ? 76  ALA A CA   3  
ATOM 5072  C C    . ALA A 1 76  ? 11.039  7.657   6.760   1.00 0.37  ? 76  ALA A C    3  
ATOM 5073  O O    . ALA A 1 76  ? 11.329  7.151   7.844   1.00 0.39  ? 76  ALA A O    3  
ATOM 5074  C CB   . ALA A 1 76  ? 8.840   8.793   6.431   1.00 0.39  ? 76  ALA A CB   3  
ATOM 5075  H H    . ALA A 1 76  ? 10.369  10.104  4.890   1.00 0.42  ? 76  ALA A H    3  
ATOM 5076  H HA   . ALA A 1 76  ? 10.421  9.494   7.650   1.00 0.42  ? 76  ALA A HA   3  
ATOM 5077  H HB1  . ALA A 1 76  ? 8.352   9.754   6.351   1.00 1.09  ? 76  ALA A HB1  3  
ATOM 5078  H HB2  . ALA A 1 76  ? 8.402   8.234   7.246   1.00 1.06  ? 76  ALA A HB2  3  
ATOM 5079  H HB3  . ALA A 1 76  ? 8.711   8.246   5.508   1.00 1.06  ? 76  ALA A HB3  3  
ATOM 5080  N N    . ILE A 1 77  ? 11.335  7.087   5.595   1.00 0.37  ? 77  ILE A N    3  
ATOM 5081  C CA   . ILE A 1 77  ? 12.065  5.828   5.523   1.00 0.39  ? 77  ILE A CA   3  
ATOM 5082  C C    . ILE A 1 77  ? 13.426  5.961   6.207   1.00 0.41  ? 77  ILE A C    3  
ATOM 5083  O O    . ILE A 1 77  ? 13.856  5.084   6.958   1.00 0.44  ? 77  ILE A O    3  
ATOM 5084  C CB   . ILE A 1 77  ? 12.270  5.398   4.054   1.00 0.45  ? 77  ILE A CB   3  
ATOM 5085  C CG1  . ILE A 1 77  ? 10.917  5.230   3.359   1.00 0.53  ? 77  ILE A CG1  3  
ATOM 5086  C CG2  . ILE A 1 77  ? 13.069  4.104   3.982   1.00 0.50  ? 77  ILE A CG2  3  
ATOM 5087  C CD1  . ILE A 1 77  ? 11.022  5.078   1.860   1.00 0.69  ? 77  ILE A CD1  3  
ATOM 5088  H H    . ILE A 1 77  ? 11.047  7.521   4.760   1.00 0.38  ? 77  ILE A H    3  
ATOM 5089  H HA   . ILE A 1 77  ? 11.484  5.071   6.027   1.00 0.40  ? 77  ILE A HA   3  
ATOM 5090  H HB   . ILE A 1 77  ? 12.833  6.169   3.551   1.00 0.50  ? 77  ILE A HB   3  
ATOM 5091  H HG12 . ILE A 1 77  ? 10.429  4.348   3.746   1.00 0.98  ? 77  ILE A HG12 3  
ATOM 5092  H HG13 . ILE A 1 77  ? 10.302  6.094   3.564   1.00 1.00  ? 77  ILE A HG13 3  
ATOM 5093  H HG21 . ILE A 1 77  ? 13.225  3.836   2.948   1.00 1.07  ? 77  ILE A HG21 3  
ATOM 5094  H HG22 . ILE A 1 77  ? 12.524  3.317   4.481   1.00 1.16  ? 77  ILE A HG22 3  
ATOM 5095  H HG23 . ILE A 1 77  ? 14.025  4.244   4.467   1.00 1.05  ? 77  ILE A HG23 3  
ATOM 5096  H HD11 . ILE A 1 77  ? 11.512  5.947   1.447   1.00 1.20  ? 77  ILE A HD11 3  
ATOM 5097  H HD12 . ILE A 1 77  ? 10.033  4.987   1.438   1.00 1.34  ? 77  ILE A HD12 3  
ATOM 5098  H HD13 . ILE A 1 77  ? 11.597  4.194   1.628   1.00 1.35  ? 77  ILE A HD13 3  
ATOM 5099  N N    . ARG A 1 78  ? 14.083  7.086   5.956   1.00 0.43  ? 78  ARG A N    3  
ATOM 5100  C CA   . ARG A 1 78  ? 15.403  7.356   6.509   1.00 0.50  ? 78  ARG A CA   3  
ATOM 5101  C C    . ARG A 1 78  ? 15.331  7.701   7.995   1.00 0.50  ? 78  ARG A C    3  
ATOM 5102  O O    . ARG A 1 78  ? 16.245  7.389   8.758   1.00 0.56  ? 78  ARG A O    3  
ATOM 5103  C CB   . ARG A 1 78  ? 16.069  8.488   5.727   1.00 0.58  ? 78  ARG A CB   3  
ATOM 5104  C CG   . ARG A 1 78  ? 16.441  8.087   4.309   1.00 0.66  ? 78  ARG A CG   3  
ATOM 5105  C CD   . ARG A 1 78  ? 16.971  9.261   3.500   1.00 0.89  ? 78  ARG A CD   3  
ATOM 5106  N NE   . ARG A 1 78  ? 18.166  9.855   4.095   1.00 1.59  ? 78  ARG A NE   3  
ATOM 5107  C CZ   . ARG A 1 78  ? 19.337  9.954   3.472   1.00 2.11  ? 78  ARG A CZ   3  
ATOM 5108  N NH1  . ARG A 1 78  ? 19.495  9.426   2.261   1.00 2.12  ? 78  ARG A NH1  3  
ATOM 5109  N NH2  . ARG A 1 78  ? 20.351  10.564  4.064   1.00 3.09  ? 78  ARG A NH2  3  
ATOM 5110  H H    . ARG A 1 78  ? 13.663  7.760   5.377   1.00 0.42  ? 78  ARG A H    3  
ATOM 5111  H HA   . ARG A 1 78  ? 15.994  6.462   6.394   1.00 0.54  ? 78  ARG A HA   3  
ATOM 5112  H HB2  . ARG A 1 78  ? 15.386  9.328   5.677   1.00 0.60  ? 78  ARG A HB2  3  
ATOM 5113  H HB3  . ARG A 1 78  ? 16.968  8.791   6.245   1.00 0.65  ? 78  ARG A HB3  3  
ATOM 5114  H HG2  . ARG A 1 78  ? 17.204  7.325   4.352   1.00 0.78  ? 78  ARG A HG2  3  
ATOM 5115  H HG3  . ARG A 1 78  ? 15.564  7.691   3.817   1.00 0.83  ? 78  ARG A HG3  3  
ATOM 5116  H HD2  . ARG A 1 78  ? 17.211  8.915   2.506   1.00 1.36  ? 78  ARG A HD2  3  
ATOM 5117  H HD3  . ARG A 1 78  ? 16.200  10.015  3.438   1.00 1.38  ? 78  ARG A HD3  3  
ATOM 5118  H HE   . ARG A 1 78  ? 18.084  10.221  5.013   1.00 2.12  ? 78  ARG A HE   3  
ATOM 5119  H HH11 . ARG A 1 78  ? 18.734  8.955   1.816   1.00 1.97  ? 78  ARG A HH11 3  
ATOM 5120  H HH12 . ARG A 1 78  ? 20.387  9.487   1.792   1.00 2.67  ? 78  ARG A HH12 3  
ATOM 5121  H HH21 . ARG A 1 78  ? 20.240  10.948  4.988   1.00 3.55  ? 78  ARG A HH21 3  
ATOM 5122  H HH22 . ARG A 1 78  ? 21.232  10.663  3.587   1.00 3.52  ? 78  ARG A HH22 3  
ATOM 5123  N N    . ALA A 1 79  ? 14.239  8.332   8.402   1.00 0.47  ? 79  ALA A N    3  
ATOM 5124  C CA   . ALA A 1 79  ? 14.059  8.725   9.796   1.00 0.51  ? 79  ALA A CA   3  
ATOM 5125  C C    . ALA A 1 79  ? 13.558  7.558   10.638  1.00 0.43  ? 79  ALA A C    3  
ATOM 5126  O O    . ALA A 1 79  ? 13.480  7.656   11.865  1.00 0.46  ? 79  ALA A O    3  
ATOM 5127  C CB   . ALA A 1 79  ? 13.100  9.901   9.901   1.00 0.65  ? 79  ALA A CB   3  
ATOM 5128  H H    . ALA A 1 79  ? 13.538  8.551   7.749   1.00 0.45  ? 79  ALA A H    3  
ATOM 5129  H HA   . ALA A 1 79  ? 15.021  9.041   10.177  1.00 0.60  ? 79  ALA A HA   3  
ATOM 5130  H HB1  . ALA A 1 79  ? 13.475  10.726  9.313   1.00 1.28  ? 79  ALA A HB1  3  
ATOM 5131  H HB2  . ALA A 1 79  ? 13.011  10.205  10.933  1.00 1.20  ? 79  ALA A HB2  3  
ATOM 5132  H HB3  . ALA A 1 79  ? 12.129  9.607   9.527   1.00 1.18  ? 79  ALA A HB3  3  
ATOM 5133  N N    . GLY A 1 80  ? 13.221  6.458   9.975   1.00 0.41  ? 80  GLY A N    3  
ATOM 5134  C CA   . GLY A 1 80  ? 12.739  5.279   10.671  1.00 0.42  ? 80  GLY A CA   3  
ATOM 5135  C C    . GLY A 1 80  ? 13.796  4.675   11.573  1.00 0.46  ? 80  GLY A C    3  
ATOM 5136  O O    . GLY A 1 80  ? 13.478  4.058   12.589  1.00 0.60  ? 80  GLY A O    3  
ATOM 5137  H H    . GLY A 1 80  ? 13.293  6.449   8.996   1.00 0.46  ? 80  GLY A H    3  
ATOM 5138  H HA2  . GLY A 1 80  ? 11.883  5.552   11.269  1.00 0.51  ? 80  GLY A HA2  3  
ATOM 5139  H HA3  . GLY A 1 80  ? 12.437  4.541   9.943   1.00 0.43  ? 80  GLY A HA3  3  
ATOM 5140  N N    . GLY A 1 81  ? 15.053  4.865   11.209  1.00 0.49  ? 81  GLY A N    3  
ATOM 5141  C CA   . GLY A 1 81  ? 16.138  4.324   11.994  1.00 0.63  ? 81  GLY A CA   3  
ATOM 5142  C C    . GLY A 1 81  ? 16.828  3.186   11.281  1.00 0.64  ? 81  GLY A C    3  
ATOM 5143  O O    . GLY A 1 81  ? 17.236  3.332   10.127  1.00 1.10  ? 81  GLY A O    3  
ATOM 5144  H H    . GLY A 1 81  ? 15.245  5.373   10.391  1.00 0.51  ? 81  GLY A H    3  
ATOM 5145  H HA2  . GLY A 1 81  ? 16.856  5.107   12.187  1.00 0.75  ? 81  GLY A HA2  3  
ATOM 5146  H HA3  . GLY A 1 81  ? 15.748  3.963   12.934  1.00 0.70  ? 81  GLY A HA3  3  
ATOM 5147  N N    . ASP A 1 82  ? 16.949  2.050   11.952  1.00 0.43  ? 82  ASP A N    3  
ATOM 5148  C CA   . ASP A 1 82  ? 17.584  0.883   11.354  1.00 0.44  ? 82  ASP A CA   3  
ATOM 5149  C C    . ASP A 1 82  ? 16.578  0.116   10.518  1.00 0.39  ? 82  ASP A C    3  
ATOM 5150  O O    . ASP A 1 82  ? 16.934  -0.545  9.551   1.00 0.55  ? 82  ASP A O    3  
ATOM 5151  C CB   . ASP A 1 82  ? 18.155  -0.041  12.428  1.00 0.55  ? 82  ASP A CB   3  
ATOM 5152  C CG   . ASP A 1 82  ? 19.191  -1.002  11.884  1.00 1.41  ? 82  ASP A CG   3  
ATOM 5153  O OD1  . ASP A 1 82  ? 20.379  -0.620  11.808  1.00 1.97  ? 82  ASP A OD1  3  
ATOM 5154  O OD2  . ASP A 1 82  ? 18.835  -2.149  11.560  1.00 2.12  ? 82  ASP A OD2  3  
ATOM 5155  H H    . ASP A 1 82  ? 16.602  1.994   12.874  1.00 0.64  ? 82  ASP A H    3  
ATOM 5156  H HA   . ASP A 1 82  ? 18.384  1.224   10.715  1.00 0.51  ? 82  ASP A HA   3  
ATOM 5157  H HB2  . ASP A 1 82  ? 18.617  0.554   13.201  1.00 0.96  ? 82  ASP A HB2  3  
ATOM 5158  H HB3  . ASP A 1 82  ? 17.350  -0.620  12.856  1.00 0.95  ? 82  ASP A HB3  3  
ATOM 5159  N N    . GLU A 1 83  ? 15.315  0.209   10.891  1.00 0.38  ? 83  GLU A N    3  
ATOM 5160  C CA   . GLU A 1 83  ? 14.270  -0.487  10.171  1.00 0.39  ? 83  GLU A CA   3  
ATOM 5161  C C    . GLU A 1 83  ? 13.145  0.467   9.806   1.00 0.38  ? 83  GLU A C    3  
ATOM 5162  O O    . GLU A 1 83  ? 13.012  1.546   10.386  1.00 0.53  ? 83  GLU A O    3  
ATOM 5163  C CB   . GLU A 1 83  ? 13.755  -1.683  10.984  1.00 0.47  ? 83  GLU A CB   3  
ATOM 5164  C CG   . GLU A 1 83  ? 13.328  -1.352  12.407  1.00 0.86  ? 83  GLU A CG   3  
ATOM 5165  C CD   . GLU A 1 83  ? 11.885  -0.885  12.508  1.00 1.62  ? 83  GLU A CD   3  
ATOM 5166  O OE1  . GLU A 1 83  ? 10.984  -1.597  12.014  1.00 2.11  ? 83  GLU A OE1  3  
ATOM 5167  O OE2  . GLU A 1 83  ? 11.644  0.205   13.070  1.00 2.00  ? 83  GLU A OE2  3  
ATOM 5168  H H    . GLU A 1 83  ? 15.078  0.768   11.659  1.00 0.49  ? 83  GLU A H    3  
ATOM 5169  H HA   . GLU A 1 83  ? 14.705  -0.858  9.255   1.00 0.42  ? 83  GLU A HA   3  
ATOM 5170  H HB2  . GLU A 1 83  ? 12.906  -2.107  10.472  1.00 0.89  ? 83  GLU A HB2  3  
ATOM 5171  H HB3  . GLU A 1 83  ? 14.538  -2.427  11.034  1.00 0.82  ? 83  GLU A HB3  3  
ATOM 5172  H HG2  . GLU A 1 83  ? 13.448  -2.235  13.012  1.00 1.20  ? 83  GLU A HG2  3  
ATOM 5173  H HG3  . GLU A 1 83  ? 13.970  -0.570  12.786  1.00 1.09  ? 83  GLU A HG3  3  
ATOM 5174  N N    . THR A 1 84  ? 12.357  0.069   8.828   1.00 0.27  ? 84  THR A N    3  
ATOM 5175  C CA   . THR A 1 84  ? 11.254  0.876   8.358   1.00 0.26  ? 84  THR A CA   3  
ATOM 5176  C C    . THR A 1 84  ? 10.106  -0.028  7.924   1.00 0.22  ? 84  THR A C    3  
ATOM 5177  O O    . THR A 1 84  ? 10.323  -1.164  7.489   1.00 0.21  ? 84  THR A O    3  
ATOM 5178  C CB   . THR A 1 84  ? 11.688  1.791   7.188   1.00 0.30  ? 84  THR A CB   3  
ATOM 5179  O OG1  . THR A 1 84  ? 10.611  2.655   6.800   1.00 0.32  ? 84  THR A OG1  3  
ATOM 5180  C CG2  . THR A 1 84  ? 12.140  0.969   5.990   1.00 0.30  ? 84  THR A CG2  3  
ATOM 5181  H H    . THR A 1 84  ? 12.520  -0.805  8.409   1.00 0.23  ? 84  THR A H    3  
ATOM 5182  H HA   . THR A 1 84  ? 10.920  1.498   9.174   1.00 0.30  ? 84  THR A HA   3  
ATOM 5183  H HB   . THR A 1 84  ? 12.519  2.397   7.519   1.00 0.36  ? 84  THR A HB   3  
ATOM 5184  H HG1  . THR A 1 84  ? 10.099  2.903   7.580   1.00 0.60  ? 84  THR A HG1  3  
ATOM 5185  H HG21 . THR A 1 84  ? 12.489  1.630   5.211   1.00 1.03  ? 84  THR A HG21 3  
ATOM 5186  H HG22 . THR A 1 84  ? 11.311  0.384   5.622   1.00 1.05  ? 84  THR A HG22 3  
ATOM 5187  H HG23 . THR A 1 84  ? 12.942  0.308   6.288   1.00 1.09  ? 84  THR A HG23 3  
ATOM 5188  N N    . LYS A 1 85  ? 8.889   0.461   8.082   1.00 0.24  ? 85  LYS A N    3  
ATOM 5189  C CA   . LYS A 1 85  ? 7.713   -0.299  7.711   1.00 0.23  ? 85  LYS A CA   3  
ATOM 5190  C C    . LYS A 1 85  ? 6.969   0.407   6.592   1.00 0.23  ? 85  LYS A C    3  
ATOM 5191  O O    . LYS A 1 85  ? 6.482   1.524   6.757   1.00 0.26  ? 85  LYS A O    3  
ATOM 5192  C CB   . LYS A 1 85  ? 6.805   -0.491  8.923   1.00 0.28  ? 85  LYS A CB   3  
ATOM 5193  C CG   . LYS A 1 85  ? 7.472   -1.251  10.056  1.00 0.37  ? 85  LYS A CG   3  
ATOM 5194  C CD   . LYS A 1 85  ? 6.583   -1.315  11.282  1.00 0.50  ? 85  LYS A CD   3  
ATOM 5195  C CE   . LYS A 1 85  ? 7.296   -1.959  12.460  1.00 0.78  ? 85  LYS A CE   3  
ATOM 5196  N NZ   . LYS A 1 85  ? 8.497   -1.187  12.881  1.00 1.63  ? 85  LYS A NZ   3  
ATOM 5197  H H    . LYS A 1 85  ? 8.779   1.369   8.444   1.00 0.27  ? 85  LYS A H    3  
ATOM 5198  H HA   . LYS A 1 85  ? 8.039   -1.267  7.358   1.00 0.22  ? 85  LYS A HA   3  
ATOM 5199  H HB2  . LYS A 1 85  ? 6.506   0.479   9.295   1.00 0.34  ? 85  LYS A HB2  3  
ATOM 5200  H HB3  . LYS A 1 85  ? 5.925   -1.038  8.619   1.00 0.36  ? 85  LYS A HB3  3  
ATOM 5201  H HG2  . LYS A 1 85  ? 7.678   -2.258  9.724   1.00 0.55  ? 85  LYS A HG2  3  
ATOM 5202  H HG3  . LYS A 1 85  ? 8.397   -0.759  10.316  1.00 0.55  ? 85  LYS A HG3  3  
ATOM 5203  H HD2  . LYS A 1 85  ? 6.295   -0.311  11.553  1.00 0.71  ? 85  LYS A HD2  3  
ATOM 5204  H HD3  . LYS A 1 85  ? 5.701   -1.892  11.045  1.00 0.72  ? 85  LYS A HD3  3  
ATOM 5205  H HE2  . LYS A 1 85  ? 6.610   -2.017  13.291  1.00 1.42  ? 85  LYS A HE2  3  
ATOM 5206  H HE3  . LYS A 1 85  ? 7.600   -2.956  12.175  1.00 1.22  ? 85  LYS A HE3  3  
ATOM 5207  H HZ1  . LYS A 1 85  ? 9.283   -1.335  12.206  1.00 2.25  ? 85  LYS A HZ1  3  
ATOM 5208  H HZ2  . LYS A 1 85  ? 8.808   -1.494  13.826  1.00 1.97  ? 85  LYS A HZ2  3  
ATOM 5209  H HZ3  . LYS A 1 85  ? 8.276   -0.167  12.916  1.00 2.17  ? 85  LYS A HZ3  3  
ATOM 5210  N N    . LEU A 1 86  ? 6.880   -0.250  5.456   1.00 0.22  ? 86  LEU A N    3  
ATOM 5211  C CA   . LEU A 1 86  ? 6.223   0.325   4.304   1.00 0.22  ? 86  LEU A CA   3  
ATOM 5212  C C    . LEU A 1 86  ? 4.875   -0.338  4.099   1.00 0.22  ? 86  LEU A C    3  
ATOM 5213  O O    . LEU A 1 86  ? 4.773   -1.563  4.056   1.00 0.27  ? 86  LEU A O    3  
ATOM 5214  C CB   . LEU A 1 86  ? 7.085   0.158   3.048   1.00 0.24  ? 86  LEU A CB   3  
ATOM 5215  C CG   . LEU A 1 86  ? 8.476   0.795   3.115   1.00 0.25  ? 86  LEU A CG   3  
ATOM 5216  C CD1  . LEU A 1 86  ? 9.241   0.532   1.828   1.00 0.28  ? 86  LEU A CD1  3  
ATOM 5217  C CD2  . LEU A 1 86  ? 8.372   2.289   3.373   1.00 0.28  ? 86  LEU A CD2  3  
ATOM 5218  H H    . LEU A 1 86  ? 7.258   -1.157  5.393   1.00 0.22  ? 86  LEU A H    3  
ATOM 5219  H HA   . LEU A 1 86  ? 6.072   1.378   4.494   1.00 0.23  ? 86  LEU A HA   3  
ATOM 5220  H HB2  . LEU A 1 86  ? 7.205   -0.898  2.859   1.00 0.24  ? 86  LEU A HB2  3  
ATOM 5221  H HB3  . LEU A 1 86  ? 6.557   0.595   2.215   1.00 0.25  ? 86  LEU A HB3  3  
ATOM 5222  H HG   . LEU A 1 86  ? 9.031   0.350   3.928   1.00 0.26  ? 86  LEU A HG   3  
ATOM 5223  H HD11 . LEU A 1 86  ? 10.222  0.979   1.894   1.00 1.02  ? 86  LEU A HD11 3  
ATOM 5224  H HD12 . LEU A 1 86  ? 8.705   0.961   0.995   1.00 0.97  ? 86  LEU A HD12 3  
ATOM 5225  H HD13 . LEU A 1 86  ? 9.342   -0.534  1.681   1.00 1.02  ? 86  LEU A HD13 3  
ATOM 5226  H HD21 . LEU A 1 86  ? 9.362   2.719   3.397   1.00 1.04  ? 86  LEU A HD21 3  
ATOM 5227  H HD22 . LEU A 1 86  ? 7.883   2.458   4.321   1.00 1.00  ? 86  LEU A HD22 3  
ATOM 5228  H HD23 . LEU A 1 86  ? 7.797   2.751   2.584   1.00 1.03  ? 86  LEU A HD23 3  
ATOM 5229  N N    . LEU A 1 87  ? 3.841   0.466   3.979   1.00 0.20  ? 87  LEU A N    3  
ATOM 5230  C CA   . LEU A 1 87  ? 2.516   -0.052  3.734   1.00 0.21  ? 87  LEU A CA   3  
ATOM 5231  C C    . LEU A 1 87  ? 2.168   0.176   2.280   1.00 0.21  ? 87  LEU A C    3  
ATOM 5232  O O    . LEU A 1 87  ? 2.053   1.317   1.833   1.00 0.26  ? 87  LEU A O    3  
ATOM 5233  C CB   . LEU A 1 87  ? 1.484   0.633   4.633   1.00 0.27  ? 87  LEU A CB   3  
ATOM 5234  C CG   . LEU A 1 87  ? 0.045   0.157   4.440   1.00 0.39  ? 87  LEU A CG   3  
ATOM 5235  C CD1  . LEU A 1 87  ? -0.095  -1.292  4.864   1.00 0.51  ? 87  LEU A CD1  3  
ATOM 5236  C CD2  . LEU A 1 87  ? -0.918  1.037   5.215   1.00 0.45  ? 87  LEU A CD2  3  
ATOM 5237  H H    . LEU A 1 87  ? 3.974   1.439   4.049   1.00 0.20  ? 87  LEU A H    3  
ATOM 5238  H HA   . LEU A 1 87  ? 2.523   -1.112  3.938   1.00 0.23  ? 87  LEU A HA   3  
ATOM 5239  H HB2  . LEU A 1 87  ? 1.763   0.462   5.662   1.00 0.29  ? 87  LEU A HB2  3  
ATOM 5240  H HB3  . LEU A 1 87  ? 1.517   1.695   4.440   1.00 0.27  ? 87  LEU A HB3  3  
ATOM 5241  H HG   . LEU A 1 87  ? -0.210  0.223   3.391   1.00 0.63  ? 87  LEU A HG   3  
ATOM 5242  H HD11 . LEU A 1 87  ? 0.168   -1.388  5.906   1.00 1.22  ? 87  LEU A HD11 3  
ATOM 5243  H HD12 . LEU A 1 87  ? 0.563   -1.907  4.268   1.00 1.05  ? 87  LEU A HD12 3  
ATOM 5244  H HD13 . LEU A 1 87  ? -1.117  -1.614  4.721   1.00 1.12  ? 87  LEU A HD13 3  
ATOM 5245  H HD21 . LEU A 1 87  ? -1.930  0.696   5.050   1.00 1.05  ? 87  LEU A HD21 3  
ATOM 5246  H HD22 . LEU A 1 87  ? -0.824  2.059   4.877   1.00 1.12  ? 87  LEU A HD22 3  
ATOM 5247  H HD23 . LEU A 1 87  ? -0.687  0.984   6.268   1.00 1.19  ? 87  LEU A HD23 3  
ATOM 5248  N N    . VAL A 1 88  ? 2.014   -0.908  1.547   1.00 0.20  ? 88  VAL A N    3  
ATOM 5249  C CA   . VAL A 1 88  ? 1.766   -0.830  0.121   1.00 0.23  ? 88  VAL A CA   3  
ATOM 5250  C C    . VAL A 1 88  ? 0.540   -1.643  -0.261  1.00 0.24  ? 88  VAL A C    3  
ATOM 5251  O O    . VAL A 1 88  ? 0.078   -2.496  0.501   1.00 0.27  ? 88  VAL A O    3  
ATOM 5252  C CB   . VAL A 1 88  ? 2.984   -1.312  -0.698  1.00 0.28  ? 88  VAL A CB   3  
ATOM 5253  C CG1  . VAL A 1 88  ? 4.144   -0.335  -0.570  1.00 0.31  ? 88  VAL A CG1  3  
ATOM 5254  C CG2  . VAL A 1 88  ? 3.413   -2.700  -0.254  1.00 0.33  ? 88  VAL A CG2  3  
ATOM 5255  H H    . VAL A 1 88  ? 2.064   -1.792  1.977   1.00 0.20  ? 88  VAL A H    3  
ATOM 5256  H HA   . VAL A 1 88  ? 1.582   0.206   -0.126  1.00 0.26  ? 88  VAL A HA   3  
ATOM 5257  H HB   . VAL A 1 88  ? 2.697   -1.361  -1.737  1.00 0.32  ? 88  VAL A HB   3  
ATOM 5258  H HG11 . VAL A 1 88  ? 4.447   -0.275  0.465   1.00 1.05  ? 88  VAL A HG11 3  
ATOM 5259  H HG12 . VAL A 1 88  ? 3.831   0.641   -0.912  1.00 1.02  ? 88  VAL A HG12 3  
ATOM 5260  H HG13 . VAL A 1 88  ? 4.974   -0.678  -1.170  1.00 1.03  ? 88  VAL A HG13 3  
ATOM 5261  H HG21 . VAL A 1 88  ? 4.231   -3.041  -0.872  1.00 1.07  ? 88  VAL A HG21 3  
ATOM 5262  H HG22 . VAL A 1 88  ? 2.580   -3.381  -0.348  1.00 1.02  ? 88  VAL A HG22 3  
ATOM 5263  H HG23 . VAL A 1 88  ? 3.732   -2.663  0.777   1.00 1.09  ? 88  VAL A HG23 3  
ATOM 5264  N N    . VAL A 1 89  ? 0.013   -1.359  -1.437  1.00 0.24  ? 89  VAL A N    3  
ATOM 5265  C CA   . VAL A 1 89  ? -1.164  -2.044  -1.938  1.00 0.27  ? 89  VAL A CA   3  
ATOM 5266  C C    . VAL A 1 89  ? -0.902  -2.605  -3.328  1.00 0.34  ? 89  VAL A C    3  
ATOM 5267  O O    . VAL A 1 89  ? -0.149  -2.021  -4.110  1.00 0.42  ? 89  VAL A O    3  
ATOM 5268  C CB   . VAL A 1 89  ? -2.393  -1.105  -1.991  1.00 0.25  ? 89  VAL A CB   3  
ATOM 5269  C CG1  . VAL A 1 89  ? -2.861  -0.754  -0.588  1.00 0.29  ? 89  VAL A CG1  3  
ATOM 5270  C CG2  . VAL A 1 89  ? -2.078  0.159   -2.778  1.00 0.30  ? 89  VAL A CG2  3  
ATOM 5271  H H    . VAL A 1 89  ? 0.430   -0.664  -1.988  1.00 0.26  ? 89  VAL A H    3  
ATOM 5272  H HA   . VAL A 1 89  ? -1.387  -2.862  -1.269  1.00 0.32  ? 89  VAL A HA   3  
ATOM 5273  H HB   . VAL A 1 89  ? -3.198  -1.625  -2.493  1.00 0.28  ? 89  VAL A HB   3  
ATOM 5274  H HG11 . VAL A 1 89  ? -3.132  -1.657  -0.063  1.00 1.04  ? 89  VAL A HG11 3  
ATOM 5275  H HG12 . VAL A 1 89  ? -3.718  -0.101  -0.650  1.00 1.07  ? 89  VAL A HG12 3  
ATOM 5276  H HG13 . VAL A 1 89  ? -2.064  -0.254  -0.058  1.00 1.01  ? 89  VAL A HG13 3  
ATOM 5277  H HG21 . VAL A 1 89  ? -1.784  -0.108  -3.785  1.00 1.03  ? 89  VAL A HG21 3  
ATOM 5278  H HG22 . VAL A 1 89  ? -1.271  0.693   -2.298  1.00 1.08  ? 89  VAL A HG22 3  
ATOM 5279  H HG23 . VAL A 1 89  ? -2.954  0.789   -2.815  1.00 1.05  ? 89  VAL A HG23 3  
ATOM 5280  N N    . ASP A 1 90  ? -1.513  -3.748  -3.612  1.00 0.41  ? 90  ASP A N    3  
ATOM 5281  C CA   . ASP A 1 90  ? -1.392  -4.387  -4.917  1.00 0.51  ? 90  ASP A CA   3  
ATOM 5282  C C    . ASP A 1 90  ? -2.215  -3.623  -5.945  1.00 0.48  ? 90  ASP A C    3  
ATOM 5283  O O    . ASP A 1 90  ? -3.051  -2.797  -5.577  1.00 0.45  ? 90  ASP A O    3  
ATOM 5284  C CB   . ASP A 1 90  ? -1.868  -5.846  -4.836  1.00 0.68  ? 90  ASP A CB   3  
ATOM 5285  C CG   . ASP A 1 90  ? -1.801  -6.595  -6.158  1.00 1.20  ? 90  ASP A CG   3  
ATOM 5286  O OD1  . ASP A 1 90  ? -0.740  -7.171  -6.468  1.00 1.86  ? 90  ASP A OD1  3  
ATOM 5287  O OD2  . ASP A 1 90  ? -2.824  -6.630  -6.882  1.00 1.92  ? 90  ASP A OD2  3  
ATOM 5288  H H    . ASP A 1 90  ? -2.066  -4.174  -2.926  1.00 0.44  ? 90  ASP A H    3  
ATOM 5289  H HA   . ASP A 1 90  ? -0.353  -4.365  -5.205  1.00 0.59  ? 90  ASP A HA   3  
ATOM 5290  H HB2  . ASP A 1 90  ? -1.256  -6.373  -4.125  1.00 1.54  ? 90  ASP A HB2  3  
ATOM 5291  H HB3  . ASP A 1 90  ? -2.892  -5.856  -4.495  1.00 1.21  ? 90  ASP A HB3  3  
ATOM 5292  N N    . ARG A 1 91  ? -1.989  -3.904  -7.215  1.00 0.57  ? 91  ARG A N    3  
ATOM 5293  C CA   . ARG A 1 91  ? -2.707  -3.238  -8.298  1.00 0.61  ? 91  ARG A CA   3  
ATOM 5294  C C    . ARG A 1 91  ? -4.219  -3.344  -8.095  1.00 0.55  ? 91  ARG A C    3  
ATOM 5295  O O    . ARG A 1 91  ? -4.939  -2.345  -8.152  1.00 0.55  ? 91  ARG A O    3  
ATOM 5296  C CB   . ARG A 1 91  ? -2.320  -3.867  -9.639  1.00 0.75  ? 91  ARG A CB   3  
ATOM 5297  C CG   . ARG A 1 91  ? -3.108  -3.330  -10.824 1.00 0.82  ? 91  ARG A CG   3  
ATOM 5298  C CD   . ARG A 1 91  ? -2.886  -4.176  -12.066 1.00 1.44  ? 91  ARG A CD   3  
ATOM 5299  N NE   . ARG A 1 91  ? -1.492  -4.161  -12.506 1.00 2.25  ? 91  ARG A NE   3  
ATOM 5300  C CZ   . ARG A 1 91  ? -0.811  -5.244  -12.873 1.00 3.13  ? 91  ARG A CZ   3  
ATOM 5301  N NH1  . ARG A 1 91  ? -1.375  -6.446  -12.822 1.00 3.39  ? 91  ARG A NH1  3  
ATOM 5302  N NH2  . ARG A 1 91  ? 0.439   -5.120  -13.291 1.00 4.16  ? 91  ARG A NH2  3  
ATOM 5303  H H    . ARG A 1 91  ? -1.330  -4.597  -7.431  1.00 0.66  ? 91  ARG A H    3  
ATOM 5304  H HA   . ARG A 1 91  ? -2.424  -2.196  -8.300  1.00 0.63  ? 91  ARG A HA   3  
ATOM 5305  H HB2  . ARG A 1 91  ? -1.271  -3.683  -9.819  1.00 0.85  ? 91  ARG A HB2  3  
ATOM 5306  H HB3  . ARG A 1 91  ? -2.482  -4.934  -9.579  1.00 0.78  ? 91  ARG A HB3  3  
ATOM 5307  H HG2  . ARG A 1 91  ? -4.159  -3.339  -10.579 1.00 1.07  ? 91  ARG A HG2  3  
ATOM 5308  H HG3  . ARG A 1 91  ? -2.791  -2.318  -11.028 1.00 1.01  ? 91  ARG A HG3  3  
ATOM 5309  H HD2  . ARG A 1 91  ? -3.171  -5.194  -11.847 1.00 1.95  ? 91  ARG A HD2  3  
ATOM 5310  H HD3  . ARG A 1 91  ? -3.508  -3.794  -12.861 1.00 1.87  ? 91  ARG A HD3  3  
ATOM 5311  H HE   . ARG A 1 91  ? -1.040  -3.283  -12.544 1.00 2.59  ? 91  ARG A HE   3  
ATOM 5312  H HH11 . ARG A 1 91  ? -2.322  -6.547  -12.507 1.00 3.07  ? 91  ARG A HH11 3  
ATOM 5313  H HH12 . ARG A 1 91  ? -0.851  -7.264  -13.087 1.00 4.20  ? 91  ARG A HH12 3  
ATOM 5314  H HH21 . ARG A 1 91  ? 0.872   -4.209  -13.322 1.00 4.40  ? 91  ARG A HH21 3  
ATOM 5315  H HH22 . ARG A 1 91  ? 0.957   -5.928  -13.598 1.00 4.87  ? 91  ARG A HH22 3  
ATOM 5316  N N    . GLU A 1 92  ? -4.683  -4.556  -7.807  1.00 0.57  ? 92  GLU A N    3  
ATOM 5317  C CA   . GLU A 1 92  ? -6.111  -4.819  -7.674  1.00 0.61  ? 92  GLU A CA   3  
ATOM 5318  C C    . GLU A 1 92  ? -6.631  -4.227  -6.365  1.00 0.51  ? 92  GLU A C    3  
ATOM 5319  O O    . GLU A 1 92  ? -7.796  -3.845  -6.254  1.00 0.56  ? 92  GLU A O    3  
ATOM 5320  C CB   . GLU A 1 92  ? -6.356  -6.331  -7.731  1.00 0.74  ? 92  GLU A CB   3  
ATOM 5321  C CG   . GLU A 1 92  ? -7.798  -6.726  -7.996  1.00 1.44  ? 92  GLU A CG   3  
ATOM 5322  C CD   . GLU A 1 92  ? -7.933  -8.199  -8.333  1.00 1.98  ? 92  GLU A CD   3  
ATOM 5323  O OE1  . GLU A 1 92  ? -7.816  -9.039  -7.417  1.00 2.26  ? 92  GLU A OE1  3  
ATOM 5324  O OE2  . GLU A 1 92  ? -8.135  -8.524  -9.523  1.00 2.68  ? 92  GLU A OE2  3  
ATOM 5325  H H    . GLU A 1 92  ? -4.045  -5.293  -7.668  1.00 0.59  ? 92  GLU A H    3  
ATOM 5326  H HA   . GLU A 1 92  ? -6.617  -4.345  -8.502  1.00 0.67  ? 92  GLU A HA   3  
ATOM 5327  H HB2  . GLU A 1 92  ? -5.746  -6.750  -8.513  1.00 1.34  ? 92  GLU A HB2  3  
ATOM 5328  H HB3  . GLU A 1 92  ? -6.057  -6.764  -6.789  1.00 1.23  ? 92  GLU A HB3  3  
ATOM 5329  H HG2  . GLU A 1 92  ? -8.384  -6.518  -7.113  1.00 1.97  ? 92  GLU A HG2  3  
ATOM 5330  H HG3  . GLU A 1 92  ? -8.175  -6.145  -8.824  1.00 1.93  ? 92  GLU A HG3  3  
ATOM 5331  N N    . THR A 1 93  ? -5.741  -4.141  -5.388  1.00 0.44  ? 93  THR A N    3  
ATOM 5332  C CA   . THR A 1 93  ? -6.060  -3.558  -4.096  1.00 0.38  ? 93  THR A CA   3  
ATOM 5333  C C    . THR A 1 93  ? -6.242  -2.048  -4.216  1.00 0.33  ? 93  THR A C    3  
ATOM 5334  O O    . THR A 1 93  ? -7.222  -1.485  -3.723  1.00 0.37  ? 93  THR A O    3  
ATOM 5335  C CB   . THR A 1 93  ? -4.927  -3.837  -3.096  1.00 0.36  ? 93  THR A CB   3  
ATOM 5336  O OG1  . THR A 1 93  ? -4.528  -5.210  -3.182  1.00 0.47  ? 93  THR A OG1  3  
ATOM 5337  C CG2  . THR A 1 93  ? -5.360  -3.519  -1.677  1.00 0.36  ? 93  THR A CG2  3  
ATOM 5338  H H    . THR A 1 93  ? -4.835  -4.480  -5.543  1.00 0.45  ? 93  THR A H    3  
ATOM 5339  H HA   . THR A 1 93  ? -6.970  -4.007  -3.727  1.00 0.45  ? 93  THR A HA   3  
ATOM 5340  H HB   . THR A 1 93  ? -4.088  -3.206  -3.348  1.00 0.33  ? 93  THR A HB   3  
ATOM 5341  H HG1  . THR A 1 93  ? -5.257  -5.775  -2.911  1.00 0.82  ? 93  THR A HG1  3  
ATOM 5342  H HG21 . THR A 1 93  ? -6.223  -4.118  -1.422  1.00 1.00  ? 93  THR A HG21 3  
ATOM 5343  H HG22 . THR A 1 93  ? -5.616  -2.472  -1.603  1.00 1.04  ? 93  THR A HG22 3  
ATOM 5344  H HG23 . THR A 1 93  ? -4.553  -3.743  -0.995  1.00 1.08  ? 93  THR A HG23 3  
ATOM 5345  N N    . ASP A 1 94  ? -5.292  -1.410  -4.889  1.00 0.33  ? 94  ASP A N    3  
ATOM 5346  C CA   . ASP A 1 94  ? -5.278  0.040   -5.040  1.00 0.39  ? 94  ASP A CA   3  
ATOM 5347  C C    . ASP A 1 94  ? -6.548  0.516   -5.736  1.00 0.43  ? 94  ASP A C    3  
ATOM 5348  O O    . ASP A 1 94  ? -7.185  1.476   -5.303  1.00 0.50  ? 94  ASP A O    3  
ATOM 5349  C CB   . ASP A 1 94  ? -4.041  0.462   -5.842  1.00 0.48  ? 94  ASP A CB   3  
ATOM 5350  C CG   . ASP A 1 94  ? -3.663  1.922   -5.653  1.00 0.71  ? 94  ASP A CG   3  
ATOM 5351  O OD1  . ASP A 1 94  ? -4.554  2.755   -5.397  1.00 0.77  ? 94  ASP A OD1  3  
ATOM 5352  O OD2  . ASP A 1 94  ? -2.469  2.250   -5.790  1.00 1.18  ? 94  ASP A OD2  3  
ATOM 5353  H H    . ASP A 1 94  ? -4.566  -1.936  -5.299  1.00 0.34  ? 94  ASP A H    3  
ATOM 5354  H HA   . ASP A 1 94  ? -5.228  0.479   -4.056  1.00 0.43  ? 94  ASP A HA   3  
ATOM 5355  H HB2  . ASP A 1 94  ? -3.203  -0.146  -5.534  1.00 0.48  ? 94  ASP A HB2  3  
ATOM 5356  H HB3  . ASP A 1 94  ? -4.231  0.292   -6.891  1.00 0.53  ? 94  ASP A HB3  3  
ATOM 5357  N N    . GLU A 1 95  ? -6.928  -0.179  -6.804  1.00 0.43  ? 95  GLU A N    3  
ATOM 5358  C CA   . GLU A 1 95  ? -8.132  0.161   -7.551  1.00 0.49  ? 95  GLU A CA   3  
ATOM 5359  C C    . GLU A 1 95  ? -9.377  0.012   -6.679  1.00 0.45  ? 95  GLU A C    3  
ATOM 5360  O O    . GLU A 1 95  ? -10.317 0.802   -6.787  1.00 0.50  ? 95  GLU A O    3  
ATOM 5361  C CB   . GLU A 1 95  ? -8.257  -0.713  -8.801  1.00 0.60  ? 95  GLU A CB   3  
ATOM 5362  C CG   . GLU A 1 95  ? -7.072  -0.601  -9.746  1.00 0.72  ? 95  GLU A CG   3  
ATOM 5363  C CD   . GLU A 1 95  ? -6.822  0.817   -10.215 1.00 1.17  ? 95  GLU A CD   3  
ATOM 5364  O OE1  . GLU A 1 95  ? -7.391  1.220   -11.249 1.00 1.23  ? 95  GLU A OE1  3  
ATOM 5365  O OE2  . GLU A 1 95  ? -6.068  1.549   -9.540  1.00 1.94  ? 95  GLU A OE2  3  
ATOM 5366  H H    . GLU A 1 95  ? -6.378  -0.939  -7.100  1.00 0.44  ? 95  GLU A H    3  
ATOM 5367  H HA   . GLU A 1 95  ? -8.050  1.194   -7.856  1.00 0.54  ? 95  GLU A HA   3  
ATOM 5368  H HB2  . GLU A 1 95  ? -8.351  -1.743  -8.496  1.00 0.60  ? 95  GLU A HB2  3  
ATOM 5369  H HB3  . GLU A 1 95  ? -9.147  -0.424  -9.341  1.00 0.66  ? 95  GLU A HB3  3  
ATOM 5370  H HG2  . GLU A 1 95  ? -6.188  -0.955  -9.235  1.00 1.08  ? 95  GLU A HG2  3  
ATOM 5371  H HG3  . GLU A 1 95  ? -7.259  -1.223  -10.610 1.00 1.05  ? 95  GLU A HG3  3  
ATOM 5372  N N    . PHE A 1 96  ? -9.371  -0.992  -5.806  1.00 0.41  ? 96  PHE A N    3  
ATOM 5373  C CA   . PHE A 1 96  ? -10.482 -1.213  -4.885  1.00 0.41  ? 96  PHE A CA   3  
ATOM 5374  C C    . PHE A 1 96  ? -10.635 -0.028  -3.936  1.00 0.36  ? 96  PHE A C    3  
ATOM 5375  O O    . PHE A 1 96  ? -11.740 0.469   -3.719  1.00 0.40  ? 96  PHE A O    3  
ATOM 5376  C CB   . PHE A 1 96  ? -10.271 -2.505  -4.090  1.00 0.44  ? 96  PHE A CB   3  
ATOM 5377  C CG   . PHE A 1 96  ? -11.301 -2.738  -3.017  1.00 0.51  ? 96  PHE A CG   3  
ATOM 5378  C CD1  . PHE A 1 96  ? -12.589 -3.133  -3.348  1.00 0.63  ? 96  PHE A CD1  3  
ATOM 5379  C CD2  . PHE A 1 96  ? -10.980 -2.562  -1.680  1.00 0.52  ? 96  PHE A CD2  3  
ATOM 5380  C CE1  . PHE A 1 96  ? -13.535 -3.348  -2.364  1.00 0.73  ? 96  PHE A CE1  3  
ATOM 5381  C CE2  . PHE A 1 96  ? -11.923 -2.775  -0.693  1.00 0.62  ? 96  PHE A CE2  3  
ATOM 5382  C CZ   . PHE A 1 96  ? -13.202 -3.168  -1.036  1.00 0.72  ? 96  PHE A CZ   3  
ATOM 5383  H H    . PHE A 1 96  ? -8.601  -1.600  -5.781  1.00 0.41  ? 96  PHE A H    3  
ATOM 5384  H HA   . PHE A 1 96  ? -11.384 -1.304  -5.473  1.00 0.46  ? 96  PHE A HA   3  
ATOM 5385  H HB2  . PHE A 1 96  ? -10.307 -3.345  -4.768  1.00 0.49  ? 96  PHE A HB2  3  
ATOM 5386  H HB3  . PHE A 1 96  ? -9.299  -2.473  -3.617  1.00 0.41  ? 96  PHE A HB3  3  
ATOM 5387  H HD1  . PHE A 1 96  ? -12.852 -3.274  -4.386  1.00 0.67  ? 96  PHE A HD1  3  
ATOM 5388  H HD2  . PHE A 1 96  ? -9.979  -2.254  -1.413  1.00 0.48  ? 96  PHE A HD2  3  
ATOM 5389  H HE1  . PHE A 1 96  ? -14.533 -3.655  -2.634  1.00 0.83  ? 96  PHE A HE1  3  
ATOM 5390  H HE2  . PHE A 1 96  ? -11.659 -2.634  0.345   1.00 0.66  ? 96  PHE A HE2  3  
ATOM 5391  H HZ   . PHE A 1 96  ? -13.941 -3.337  -0.267  1.00 0.81  ? 96  PHE A HZ   3  
ATOM 5392  N N    . PHE A 1 97  ? -9.522  0.425   -3.381  1.00 0.32  ? 97  PHE A N    3  
ATOM 5393  C CA   . PHE A 1 97  ? -9.535  1.586   -2.499  1.00 0.32  ? 97  PHE A CA   3  
ATOM 5394  C C    . PHE A 1 97  ? -9.927  2.853   -3.257  1.00 0.39  ? 97  PHE A C    3  
ATOM 5395  O O    . PHE A 1 97  ? -10.623 3.715   -2.716  1.00 0.44  ? 97  PHE A O    3  
ATOM 5396  C CB   . PHE A 1 97  ? -8.180  1.759   -1.810  1.00 0.30  ? 97  PHE A CB   3  
ATOM 5397  C CG   . PHE A 1 97  ? -7.975  0.804   -0.667  1.00 0.29  ? 97  PHE A CG   3  
ATOM 5398  C CD1  . PHE A 1 97  ? -8.566  1.049   0.560   1.00 0.38  ? 97  PHE A CD1  3  
ATOM 5399  C CD2  . PHE A 1 97  ? -7.200  -0.335  -0.815  1.00 0.37  ? 97  PHE A CD2  3  
ATOM 5400  C CE1  . PHE A 1 97  ? -8.392  0.181   1.618   1.00 0.41  ? 97  PHE A CE1  3  
ATOM 5401  C CE2  . PHE A 1 97  ? -7.020  -1.210  0.243   1.00 0.40  ? 97  PHE A CE2  3  
ATOM 5402  C CZ   . PHE A 1 97  ? -7.619  -0.950  1.461   1.00 0.35  ? 97  PHE A CZ   3  
ATOM 5403  H H    . PHE A 1 97  ? -8.667  -0.035  -3.565  1.00 0.30  ? 97  PHE A H    3  
ATOM 5404  H HA   . PHE A 1 97  ? -10.285 1.404   -1.740  1.00 0.34  ? 97  PHE A HA   3  
ATOM 5405  H HB2  . PHE A 1 97  ? -7.392  1.594   -2.529  1.00 0.29  ? 97  PHE A HB2  3  
ATOM 5406  H HB3  . PHE A 1 97  ? -8.105  2.765   -1.422  1.00 0.35  ? 97  PHE A HB3  3  
ATOM 5407  H HD1  . PHE A 1 97  ? -9.171  1.934   0.684   1.00 0.53  ? 97  PHE A HD1  3  
ATOM 5408  H HD2  . PHE A 1 97  ? -6.731  -0.539  -1.768  1.00 0.50  ? 97  PHE A HD2  3  
ATOM 5409  H HE1  . PHE A 1 97  ? -8.861  0.387   2.568   1.00 0.55  ? 97  PHE A HE1  3  
ATOM 5410  H HE2  . PHE A 1 97  ? -6.415  -2.095  0.116   1.00 0.55  ? 97  PHE A HE2  3  
ATOM 5411  H HZ   . PHE A 1 97  ? -7.479  -1.631  2.289   1.00 0.40  ? 97  PHE A HZ   3  
ATOM 5412  N N    . LYS A 1 98  ? -9.479  2.968   -4.506  1.00 0.43  ? 98  LYS A N    3  
ATOM 5413  C CA   . LYS A 1 98  ? -9.815  4.129   -5.329  1.00 0.53  ? 98  LYS A CA   3  
ATOM 5414  C C    . LYS A 1 98  ? -11.324 4.269   -5.511  1.00 0.56  ? 98  LYS A C    3  
ATOM 5415  O O    . LYS A 1 98  ? -11.880 5.340   -5.279  1.00 0.61  ? 98  LYS A O    3  
ATOM 5416  C CB   . LYS A 1 98  ? -9.160  4.051   -6.710  1.00 0.63  ? 98  LYS A CB   3  
ATOM 5417  C CG   . LYS A 1 98  ? -7.660  4.290   -6.719  1.00 0.85  ? 98  LYS A CG   3  
ATOM 5418  C CD   . LYS A 1 98  ? -7.165  4.515   -8.140  1.00 1.13  ? 98  LYS A CD   3  
ATOM 5419  C CE   . LYS A 1 98  ? -5.653  4.642   -8.211  1.00 1.31  ? 98  LYS A CE   3  
ATOM 5420  N NZ   . LYS A 1 98  ? -4.975  3.350   -7.948  1.00 1.92  ? 98  LYS A NZ   3  
ATOM 5421  H H    . LYS A 1 98  ? -8.898  2.264   -4.874  1.00 0.41  ? 98  LYS A H    3  
ATOM 5422  H HA   . LYS A 1 98  ? -9.448  5.006   -4.819  1.00 0.56  ? 98  LYS A HA   3  
ATOM 5423  H HB2  . LYS A 1 98  ? -9.345  3.070   -7.123  1.00 0.80  ? 98  LYS A HB2  3  
ATOM 5424  H HB3  . LYS A 1 98  ? -9.623  4.787   -7.348  1.00 0.82  ? 98  LYS A HB3  3  
ATOM 5425  H HG2  . LYS A 1 98  ? -7.438  5.163   -6.124  1.00 1.09  ? 98  LYS A HG2  3  
ATOM 5426  H HG3  . LYS A 1 98  ? -7.162  3.428   -6.303  1.00 1.12  ? 98  LYS A HG3  3  
ATOM 5427  H HD2  . LYS A 1 98  ? -7.472  3.680   -8.751  1.00 1.77  ? 98  LYS A HD2  3  
ATOM 5428  H HD3  . LYS A 1 98  ? -7.609  5.422   -8.522  1.00 1.65  ? 98  LYS A HD3  3  
ATOM 5429  H HE2  . LYS A 1 98  ? -5.377  4.989   -9.196  1.00 1.69  ? 98  LYS A HE2  3  
ATOM 5430  H HE3  . LYS A 1 98  ? -5.332  5.363   -7.474  1.00 1.94  ? 98  LYS A HE3  3  
ATOM 5431  H HZ1  . LYS A 1 98  ? -5.064  3.096   -6.938  1.00 2.12  ? 98  LYS A HZ1  3  
ATOM 5432  H HZ2  . LYS A 1 98  ? -3.964  3.416   -8.190  1.00 2.50  ? 98  LYS A HZ2  3  
ATOM 5433  H HZ3  . LYS A 1 98  ? -5.409  2.591   -8.525  1.00 2.45  ? 98  LYS A HZ3  3  
ATOM 5434  N N    . LYS A 1 99  ? -11.990 3.184   -5.898  1.00 0.55  ? 99  LYS A N    3  
ATOM 5435  C CA   . LYS A 1 99  ? -13.429 3.229   -6.153  1.00 0.63  ? 99  LYS A CA   3  
ATOM 5436  C C    . LYS A 1 99  ? -14.216 3.385   -4.858  1.00 0.63  ? 99  LYS A C    3  
ATOM 5437  O O    . LYS A 1 99  ? -15.380 3.788   -4.870  1.00 0.75  ? 99  LYS A O    3  
ATOM 5438  C CB   . LYS A 1 99  ? -13.901 1.970   -6.891  1.00 0.66  ? 99  LYS A CB   3  
ATOM 5439  C CG   . LYS A 1 99  ? -13.593 0.675   -6.156  1.00 0.60  ? 99  LYS A CG   3  
ATOM 5440  C CD   . LYS A 1 99  ? -14.434 -0.483  -6.668  1.00 0.76  ? 99  LYS A CD   3  
ATOM 5441  C CE   . LYS A 1 99  ? -15.892 -0.337  -6.261  1.00 1.62  ? 99  LYS A CE   3  
ATOM 5442  N NZ   . LYS A 1 99  ? -16.704 -1.520  -6.655  1.00 2.04  ? 99  LYS A NZ   3  
ATOM 5443  H H    . LYS A 1 99  ? -11.500 2.341   -6.028  1.00 0.53  ? 99  LYS A H    3  
ATOM 5444  H HA   . LYS A 1 99  ? -13.624 4.089   -6.776  1.00 0.70  ? 99  LYS A HA   3  
ATOM 5445  H HB2  . LYS A 1 99  ? -14.970 2.031   -7.037  1.00 0.73  ? 99  LYS A HB2  3  
ATOM 5446  H HB3  . LYS A 1 99  ? -13.417 1.934   -7.856  1.00 0.70  ? 99  LYS A HB3  3  
ATOM 5447  H HG2  . LYS A 1 99  ? -12.550 0.437   -6.298  1.00 0.67  ? 99  LYS A HG2  3  
ATOM 5448  H HG3  . LYS A 1 99  ? -13.791 0.815   -5.103  1.00 0.65  ? 99  LYS A HG3  3  
ATOM 5449  H HD2  . LYS A 1 99  ? -14.371 -0.510  -7.745  1.00 1.19  ? 99  LYS A HD2  3  
ATOM 5450  H HD3  . LYS A 1 99  ? -14.046 -1.405  -6.259  1.00 1.16  ? 99  LYS A HD3  3  
ATOM 5451  H HE2  . LYS A 1 99  ? -15.944 -0.215  -5.190  1.00 2.17  ? 99  LYS A HE2  3  
ATOM 5452  H HE3  . LYS A 1 99  ? -16.297 0.542   -6.741  1.00 2.18  ? 99  LYS A HE3  3  
ATOM 5453  H HZ1  . LYS A 1 99  ? -16.832 -1.546  -7.690  1.00 2.53  ? 99  LYS A HZ1  3  
ATOM 5454  H HZ2  . LYS A 1 99  ? -17.648 -1.477  -6.202  1.00 2.23  ? 99  LYS A HZ2  3  
ATOM 5455  H HZ3  . LYS A 1 99  ? -16.231 -2.399  -6.352  1.00 2.44  ? 99  LYS A HZ3  3  
ATOM 5456  N N    . CYS A 1 100 ? -13.574 3.073   -3.743  1.00 0.55  ? 100 CYS A N    3  
ATOM 5457  C CA   . CYS A 1 100 ? -14.228 3.138   -2.448  1.00 0.60  ? 100 CYS A CA   3  
ATOM 5458  C C    . CYS A 1 100 ? -14.014 4.515   -1.829  1.00 0.61  ? 100 CYS A C    3  
ATOM 5459  O O    . CYS A 1 100 ? -14.758 4.942   -0.945  1.00 0.68  ? 100 CYS A O    3  
ATOM 5460  C CB   . CYS A 1 100 ? -13.696 2.039   -1.523  1.00 0.60  ? 100 CYS A CB   3  
ATOM 5461  S SG   . CYS A 1 100 ? -14.638 1.832   0.010   1.00 1.39  ? 100 CYS A SG   3  
ATOM 5462  H H    . CYS A 1 100 ? -12.635 2.809   -3.793  1.00 0.51  ? 100 CYS A H    3  
ATOM 5463  H HA   . CYS A 1 100 ? -15.286 2.987   -2.605  1.00 0.68  ? 100 CYS A HA   3  
ATOM 5464  H HB2  . CYS A 1 100 ? -13.716 1.096   -2.051  1.00 1.12  ? 100 CYS A HB2  3  
ATOM 5465  H HB3  . CYS A 1 100 ? -12.674 2.270   -1.257  1.00 0.81  ? 100 CYS A HB3  3  
ATOM 5466  H HG   . CYS A 1 100 ? -14.533 0.563   0.389   1.00 2.19  ? 100 CYS A HG   3  
ATOM 5467  N N    . ARG A 1 101 ? -12.990 5.205   -2.342  1.00 0.59  ? 101 ARG A N    3  
ATOM 5468  C CA   . ARG A 1 101 ? -12.664 6.574   -1.947  1.00 0.65  ? 101 ARG A CA   3  
ATOM 5469  C C    . ARG A 1 101 ? -12.186 6.645   -0.504  1.00 0.64  ? 101 ARG A C    3  
ATOM 5470  O O    . ARG A 1 101 ? -12.384 7.647   0.183   1.00 0.75  ? 101 ARG A O    3  
ATOM 5471  C CB   . ARG A 1 101 ? -13.862 7.502   -2.176  1.00 0.77  ? 101 ARG A CB   3  
ATOM 5472  C CG   . ARG A 1 101 ? -14.321 7.551   -3.628  1.00 0.79  ? 101 ARG A CG   3  
ATOM 5473  C CD   . ARG A 1 101 ? -13.385 8.375   -4.510  1.00 1.19  ? 101 ARG A CD   3  
ATOM 5474  N NE   . ARG A 1 101 ? -11.983 7.966   -4.409  1.00 2.14  ? 101 ARG A NE   3  
ATOM 5475  C CZ   . ARG A 1 101 ? -10.947 8.790   -4.586  1.00 3.08  ? 101 ARG A CZ   3  
ATOM 5476  N NH1  . ARG A 1 101 ? -11.151 10.062  -4.904  1.00 3.37  ? 101 ARG A NH1  3  
ATOM 5477  N NH2  . ARG A 1 101 ? -9.707  8.343   -4.433  1.00 4.09  ? 101 ARG A NH2  3  
ATOM 5478  H H    . ARG A 1 101 ? -12.428 4.768   -3.015  1.00 0.57  ? 101 ARG A H    3  
ATOM 5479  H HA   . ARG A 1 101 ? -11.855 6.902   -2.581  1.00 0.66  ? 101 ARG A HA   3  
ATOM 5480  H HB2  . ARG A 1 101 ? -14.687 7.159   -1.569  1.00 0.79  ? 101 ARG A HB2  3  
ATOM 5481  H HB3  . ARG A 1 101 ? -13.591 8.502   -1.869  1.00 0.92  ? 101 ARG A HB3  3  
ATOM 5482  H HG2  . ARG A 1 101 ? -14.361 6.544   -4.015  1.00 1.42  ? 101 ARG A HG2  3  
ATOM 5483  H HG3  . ARG A 1 101 ? -15.309 7.988   -3.665  1.00 1.29  ? 101 ARG A HG3  3  
ATOM 5484  H HD2  . ARG A 1 101 ? -13.699 8.257   -5.536  1.00 1.59  ? 101 ARG A HD2  3  
ATOM 5485  H HD3  . ARG A 1 101 ? -13.470 9.413   -4.227  1.00 1.65  ? 101 ARG A HD3  3  
ATOM 5486  H HE   . ARG A 1 101 ? -11.808 7.023   -4.189  1.00 2.45  ? 101 ARG A HE   3  
ATOM 5487  H HH11 . ARG A 1 101 ? -12.091 10.419  -5.014  1.00 3.01  ? 101 ARG A HH11 3  
ATOM 5488  H HH12 . ARG A 1 101 ? -10.369 10.685  -5.037  1.00 4.21  ? 101 ARG A HH12 3  
ATOM 5489  H HH21 . ARG A 1 101 ? -9.543  7.386   -4.171  1.00 4.30  ? 101 ARG A HH21 3  
ATOM 5490  H HH22 . ARG A 1 101 ? -8.921  8.960   -4.593  1.00 4.83  ? 101 ARG A HH22 3  
ATOM 5491  N N    . VAL A 1 102 ? -11.532 5.581   -0.069  1.00 0.55  ? 102 VAL A N    3  
ATOM 5492  C CA   . VAL A 1 102 ? -11.009 5.506   1.284   1.00 0.57  ? 102 VAL A CA   3  
ATOM 5493  C C    . VAL A 1 102 ? -9.507  5.232   1.245   1.00 0.49  ? 102 VAL A C    3  
ATOM 5494  O O    . VAL A 1 102 ? -9.027  4.478   0.395   1.00 0.46  ? 102 VAL A O    3  
ATOM 5495  C CB   . VAL A 1 102 ? -11.738 4.412   2.106   1.00 0.69  ? 102 VAL A CB   3  
ATOM 5496  C CG1  . VAL A 1 102 ? -11.479 3.026   1.539   1.00 0.89  ? 102 VAL A CG1  3  
ATOM 5497  C CG2  . VAL A 1 102 ? -11.338 4.474   3.574   1.00 1.42  ? 102 VAL A CG2  3  
ATOM 5498  H H    . VAL A 1 102 ? -11.386 4.827   -0.678  1.00 0.51  ? 102 VAL A H    3  
ATOM 5499  H HA   . VAL A 1 102 ? -11.178 6.462   1.759   1.00 0.66  ? 102 VAL A HA   3  
ATOM 5500  H HB   . VAL A 1 102 ? -12.799 4.597   2.040   1.00 1.38  ? 102 VAL A HB   3  
ATOM 5501  H HG11 . VAL A 1 102 ? -12.086 2.304   2.066   1.00 1.44  ? 102 VAL A HG11 3  
ATOM 5502  H HG12 . VAL A 1 102 ? -10.436 2.777   1.664   1.00 1.45  ? 102 VAL A HG12 3  
ATOM 5503  H HG13 . VAL A 1 102 ? -11.730 3.010   0.488   1.00 1.57  ? 102 VAL A HG13 3  
ATOM 5504  H HG21 . VAL A 1 102 ? -11.846 3.692   4.117   1.00 2.00  ? 102 VAL A HG21 3  
ATOM 5505  H HG22 . VAL A 1 102 ? -11.616 5.434   3.982   1.00 2.08  ? 102 VAL A HG22 3  
ATOM 5506  H HG23 . VAL A 1 102 ? -10.271 4.338   3.663   1.00 1.73  ? 102 VAL A HG23 3  
ATOM 5507  N N    . ILE A 1 103 ? -8.770  5.870   2.141   1.00 0.54  ? 103 ILE A N    3  
ATOM 5508  C CA   . ILE A 1 103 ? -7.328  5.703   2.204   1.00 0.50  ? 103 ILE A CA   3  
ATOM 5509  C C    . ILE A 1 103 ? -6.973  4.441   2.986   1.00 0.43  ? 103 ILE A C    3  
ATOM 5510  O O    . ILE A 1 103 ? -7.478  4.219   4.089   1.00 0.46  ? 103 ILE A O    3  
ATOM 5511  C CB   . ILE A 1 103 ? -6.653  6.934   2.856   1.00 0.61  ? 103 ILE A CB   3  
ATOM 5512  C CG1  . ILE A 1 103 ? -6.884  8.180   1.993   1.00 0.78  ? 103 ILE A CG1  3  
ATOM 5513  C CG2  . ILE A 1 103 ? -5.162  6.692   3.056   1.00 0.62  ? 103 ILE A CG2  3  
ATOM 5514  C CD1  . ILE A 1 103 ? -6.265  9.443   2.557   1.00 1.33  ? 103 ILE A CD1  3  
ATOM 5515  H H    . ILE A 1 103 ? -9.209  6.469   2.787   1.00 0.65  ? 103 ILE A H    3  
ATOM 5516  H HA   . ILE A 1 103 ? -6.959  5.606   1.193   1.00 0.50  ? 103 ILE A HA   3  
ATOM 5517  H HB   . ILE A 1 103 ? -7.102  7.089   3.825   1.00 0.64  ? 103 ILE A HB   3  
ATOM 5518  H HG12 . ILE A 1 103 ? -6.459  8.015   1.016   1.00 1.38  ? 103 ILE A HG12 3  
ATOM 5519  H HG13 . ILE A 1 103 ? -7.947  8.349   1.894   1.00 1.26  ? 103 ILE A HG13 3  
ATOM 5520  H HG21 . ILE A 1 103 ? -4.698  6.501   2.100   1.00 1.17  ? 103 ILE A HG21 3  
ATOM 5521  H HG22 . ILE A 1 103 ? -5.020  5.838   3.703   1.00 1.19  ? 103 ILE A HG22 3  
ATOM 5522  H HG23 . ILE A 1 103 ? -4.712  7.564   3.508   1.00 1.09  ? 103 ILE A HG23 3  
ATOM 5523  H HD11 . ILE A 1 103 ? -6.659  9.630   3.545   1.00 1.78  ? 103 ILE A HD11 3  
ATOM 5524  H HD12 . ILE A 1 103 ? -6.500  10.277  1.912   1.00 1.83  ? 103 ILE A HD12 3  
ATOM 5525  H HD13 . ILE A 1 103 ? -5.192  9.323   2.613   1.00 1.99  ? 103 ILE A HD13 3  
ATOM 5526  N N    . PRO A 1 104 ? -6.122  3.579   2.409   1.00 0.39  ? 104 PRO A N    3  
ATOM 5527  C CA   . PRO A 1 104 ? -5.660  2.362   3.070   1.00 0.37  ? 104 PRO A CA   3  
ATOM 5528  C C    . PRO A 1 104 ? -4.796  2.676   4.283   1.00 0.37  ? 104 PRO A C    3  
ATOM 5529  O O    . PRO A 1 104 ? -4.127  3.702   4.327   1.00 0.45  ? 104 PRO A O    3  
ATOM 5530  C CB   . PRO A 1 104 ? -4.830  1.639   2.000   1.00 0.41  ? 104 PRO A CB   3  
ATOM 5531  C CG   . PRO A 1 104 ? -5.128  2.335   0.714   1.00 0.53  ? 104 PRO A CG   3  
ATOM 5532  C CD   . PRO A 1 104 ? -5.538  3.732   1.070   1.00 0.44  ? 104 PRO A CD   3  
ATOM 5533  H HA   . PRO A 1 104 ? -6.487  1.737   3.372   1.00 0.37  ? 104 PRO A HA   3  
ATOM 5534  H HB2  . PRO A 1 104 ? -3.782  1.707   2.248   1.00 0.57  ? 104 PRO A HB2  3  
ATOM 5535  H HB3  . PRO A 1 104 ? -5.124  0.601   1.958   1.00 0.55  ? 104 PRO A HB3  3  
ATOM 5536  H HG2  . PRO A 1 104 ? -4.243  2.352   0.095   1.00 0.86  ? 104 PRO A HG2  3  
ATOM 5537  H HG3  . PRO A 1 104 ? -5.933  1.826   0.202   1.00 0.82  ? 104 PRO A HG3  3  
ATOM 5538  H HD2  . PRO A 1 104 ? -4.678  4.385   1.096   1.00 0.59  ? 104 PRO A HD2  3  
ATOM 5539  H HD3  . PRO A 1 104 ? -6.273  4.100   0.370   1.00 0.57  ? 104 PRO A HD3  3  
ATOM 5540  N N    . SER A 1 105 ? -4.812  1.790   5.265   1.00 0.32  ? 105 SER A N    3  
ATOM 5541  C CA   . SER A 1 105 ? -4.031  1.987   6.465   1.00 0.34  ? 105 SER A CA   3  
ATOM 5542  C C    . SER A 1 105 ? -3.909  0.667   7.217   1.00 0.34  ? 105 SER A C    3  
ATOM 5543  O O    . SER A 1 105 ? -4.472  -0.347  6.780   1.00 0.33  ? 105 SER A O    3  
ATOM 5544  C CB   . SER A 1 105 ? -4.674  3.069   7.348   1.00 0.43  ? 105 SER A CB   3  
ATOM 5545  O OG   . SER A 1 105 ? -3.815  3.468   8.406   1.00 1.42  ? 105 SER A OG   3  
ATOM 5546  H H    . SER A 1 105 ? -5.353  0.985   5.181   1.00 0.31  ? 105 SER A H    3  
ATOM 5547  H HA   . SER A 1 105 ? -3.044  2.312   6.168   1.00 0.34  ? 105 SER A HA   3  
ATOM 5548  H HB2  . SER A 1 105 ? -4.899  3.934   6.744   1.00 1.18  ? 105 SER A HB2  3  
ATOM 5549  H HB3  . SER A 1 105 ? -5.591  2.683   7.772   1.00 0.94  ? 105 SER A HB3  3  
ATOM 5550  H HG   . SER A 1 105 ? -2.919  3.626   8.048   1.00 1.92  ? 105 SER A HG   3  
ATOM 5551  N N    . GLN A 1 106 ? -3.188  0.679   8.330   1.00 0.39  ? 106 GLN A N    3  
ATOM 5552  C CA   . GLN A 1 106 ? -2.974  -0.520  9.139   1.00 0.43  ? 106 GLN A CA   3  
ATOM 5553  C C    . GLN A 1 106 ? -4.291  -1.190  9.561   1.00 0.45  ? 106 GLN A C    3  
ATOM 5554  O O    . GLN A 1 106 ? -4.322  -2.397  9.776   1.00 0.50  ? 106 GLN A O    3  
ATOM 5555  C CB   . GLN A 1 106 ? -2.105  -0.212  10.358  1.00 0.52  ? 106 GLN A CB   3  
ATOM 5556  C CG   . GLN A 1 106 ? -0.698  0.236   9.994   1.00 0.68  ? 106 GLN A CG   3  
ATOM 5557  C CD   . GLN A 1 106 ? 0.224   0.311   11.193  1.00 0.96  ? 106 GLN A CD   3  
ATOM 5558  O OE1  . GLN A 1 106 ? 0.076   -0.439  12.157  1.00 1.66  ? 106 GLN A OE1  3  
ATOM 5559  N NE2  . GLN A 1 106 ? 1.178   1.223   11.146  1.00 1.42  ? 106 GLN A NE2  3  
ATOM 5560  H H    . GLN A 1 106 ? -2.769  1.525   8.612   1.00 0.42  ? 106 GLN A H    3  
ATOM 5561  H HA   . GLN A 1 106 ? -2.437  -1.219  8.516   1.00 0.42  ? 106 GLN A HA   3  
ATOM 5562  H HB2  . GLN A 1 106 ? -2.569  0.569   10.932  1.00 0.66  ? 106 GLN A HB2  3  
ATOM 5563  H HB3  . GLN A 1 106 ? -2.029  -1.101  10.966  1.00 0.73  ? 106 GLN A HB3  3  
ATOM 5564  H HG2  . GLN A 1 106 ? -0.282  -0.466  9.286   1.00 0.91  ? 106 GLN A HG2  3  
ATOM 5565  H HG3  . GLN A 1 106 ? -0.752  1.214   9.542   1.00 1.06  ? 106 GLN A HG3  3  
ATOM 5566  H HE21 . GLN A 1 106 ? 1.233   1.795   10.353  1.00 1.87  ? 106 GLN A HE21 3  
ATOM 5567  H HE22 . GLN A 1 106 ? 1.802   1.284   11.906  1.00 1.72  ? 106 GLN A HE22 3  
ATOM 5568  N N    . GLU A 1 107 ? -5.371  -0.416  9.662   1.00 0.46  ? 107 GLU A N    3  
ATOM 5569  C CA   . GLU A 1 107 ? -6.683  -0.952  10.062  1.00 0.51  ? 107 GLU A CA   3  
ATOM 5570  C C    . GLU A 1 107 ? -7.119  -2.103  9.148   1.00 0.42  ? 107 GLU A C    3  
ATOM 5571  O O    . GLU A 1 107 ? -7.809  -3.030  9.574   1.00 0.49  ? 107 GLU A O    3  
ATOM 5572  C CB   . GLU A 1 107 ? -7.741  0.160   9.999   1.00 0.59  ? 107 GLU A CB   3  
ATOM 5573  C CG   . GLU A 1 107 ? -9.162  -0.326  10.248  1.00 1.41  ? 107 GLU A CG   3  
ATOM 5574  C CD   . GLU A 1 107 ? -10.209 0.662   9.772   1.00 2.16  ? 107 GLU A CD   3  
ATOM 5575  O OE1  . GLU A 1 107 ? -10.445 0.751   8.545   1.00 2.82  ? 107 GLU A OE1  3  
ATOM 5576  O OE2  . GLU A 1 107 ? -10.809 1.352   10.620  1.00 2.63  ? 107 GLU A OE2  3  
ATOM 5577  H H    . GLU A 1 107 ? -5.286  0.549   9.485   1.00 0.48  ? 107 GLU A H    3  
ATOM 5578  H HA   . GLU A 1 107 ? -6.608  -1.312  11.075  1.00 0.62  ? 107 GLU A HA   3  
ATOM 5579  H HB2  . GLU A 1 107 ? -7.508  0.906   10.744  1.00 1.12  ? 107 GLU A HB2  3  
ATOM 5580  H HB3  . GLU A 1 107 ? -7.708  0.620   9.021   1.00 1.19  ? 107 GLU A HB3  3  
ATOM 5581  H HG2  . GLU A 1 107 ? -9.305  -1.259  9.722   1.00 2.02  ? 107 GLU A HG2  3  
ATOM 5582  H HG3  . GLU A 1 107 ? -9.293  -0.489  11.308  1.00 2.03  ? 107 GLU A HG3  3  
ATOM 5583  N N    . HIS A 1 108 ? -6.696  -2.048  7.896   1.00 0.34  ? 108 HIS A N    3  
ATOM 5584  C CA   . HIS A 1 108 ? -7.101  -3.034  6.908   1.00 0.37  ? 108 HIS A CA   3  
ATOM 5585  C C    . HIS A 1 108 ? -6.135  -4.215  6.882   1.00 0.46  ? 108 HIS A C    3  
ATOM 5586  O O    . HIS A 1 108 ? -6.410  -5.242  6.262   1.00 0.53  ? 108 HIS A O    3  
ATOM 5587  C CB   . HIS A 1 108 ? -7.239  -2.371  5.538   1.00 0.38  ? 108 HIS A CB   3  
ATOM 5588  C CG   . HIS A 1 108 ? -8.270  -1.281  5.556   1.00 0.40  ? 108 HIS A CG   3  
ATOM 5589  N ND1  . HIS A 1 108 ? -8.116  -0.073  4.914   1.00 0.52  ? 108 HIS A ND1  3  
ATOM 5590  C CD2  . HIS A 1 108 ? -9.453  -1.207  6.208   1.00 0.52  ? 108 HIS A CD2  3  
ATOM 5591  C CE1  . HIS A 1 108 ? -9.154  0.699   5.181   1.00 0.52  ? 108 HIS A CE1  3  
ATOM 5592  N NE2  . HIS A 1 108 ? -9.984  0.036   5.968   1.00 0.52  ? 108 HIS A NE2  3  
ATOM 5593  H H    . HIS A 1 108 ? -6.087  -1.329  7.630   1.00 0.33  ? 108 HIS A H    3  
ATOM 5594  H HA   . HIS A 1 108 ? -8.073  -3.403  7.208   1.00 0.42  ? 108 HIS A HA   3  
ATOM 5595  H HB2  . HIS A 1 108 ? -6.291  -1.936  5.253   1.00 0.36  ? 108 HIS A HB2  3  
ATOM 5596  H HB3  . HIS A 1 108 ? -7.533  -3.106  4.805   1.00 0.45  ? 108 HIS A HB3  3  
ATOM 5597  H HD1  . HIS A 1 108 ? -7.363  0.182   4.349   1.00 0.70  ? 108 HIS A HD1  3  
ATOM 5598  H HD2  . HIS A 1 108 ? -9.899  -1.985  6.812   1.00 0.71  ? 108 HIS A HD2  3  
ATOM 5599  H HE1  . HIS A 1 108 ? -9.295  1.710   4.828   1.00 0.64  ? 108 HIS A HE1  3  
ATOM 5600  H HE2  . HIS A 1 108 ? -10.619 0.478   6.582   1.00 0.63  ? 108 HIS A HE2  3  
ATOM 5601  N N    . LEU A 1 109 ? -4.986  -4.043  7.528   1.00 0.52  ? 109 LEU A N    3  
ATOM 5602  C CA   . LEU A 1 109 ? -4.016  -5.121  7.666   1.00 0.70  ? 109 LEU A CA   3  
ATOM 5603  C C    . LEU A 1 109 ? -4.595  -6.253  8.504   1.00 0.79  ? 109 LEU A C    3  
ATOM 5604  O O    . LEU A 1 109 ? -4.815  -6.097  9.710   1.00 1.24  ? 109 LEU A O    3  
ATOM 5605  C CB   . LEU A 1 109 ? -2.732  -4.604  8.314   1.00 0.96  ? 109 LEU A CB   3  
ATOM 5606  C CG   . LEU A 1 109 ? -1.952  -3.581  7.491   1.00 0.44  ? 109 LEU A CG   3  
ATOM 5607  C CD1  . LEU A 1 109 ? -0.791  -3.030  8.300   1.00 0.84  ? 109 LEU A CD1  3  
ATOM 5608  C CD2  . LEU A 1 109 ? -1.452  -4.217  6.206   1.00 0.67  ? 109 LEU A CD2  3  
ATOM 5609  H H    . LEU A 1 109 ? -4.797  -3.176  7.946   1.00 0.47  ? 109 LEU A H    3  
ATOM 5610  H HA   . LEU A 1 109 ? -3.791  -5.494  6.678   1.00 0.77  ? 109 LEU A HA   3  
ATOM 5611  H HB2  . LEU A 1 109 ? -2.990  -4.151  9.260   1.00 1.47  ? 109 LEU A HB2  3  
ATOM 5612  H HB3  . LEU A 1 109 ? -2.084  -5.447  8.504   1.00 1.46  ? 109 LEU A HB3  3  
ATOM 5613  H HG   . LEU A 1 109 ? -2.604  -2.757  7.231   1.00 0.43  ? 109 LEU A HG   3  
ATOM 5614  H HD11 . LEU A 1 109 ? -0.244  -2.314  7.703   1.00 1.39  ? 109 LEU A HD11 3  
ATOM 5615  H HD12 . LEU A 1 109 ? -0.132  -3.838  8.586   1.00 1.39  ? 109 LEU A HD12 3  
ATOM 5616  H HD13 . LEU A 1 109 ? -1.170  -2.546  9.187   1.00 1.37  ? 109 LEU A HD13 3  
ATOM 5617  H HD21 . LEU A 1 109 ? -0.835  -5.071  6.443   1.00 1.19  ? 109 LEU A HD21 3  
ATOM 5618  H HD22 . LEU A 1 109 ? -0.872  -3.496  5.650   1.00 1.41  ? 109 LEU A HD22 3  
ATOM 5619  H HD23 . LEU A 1 109 ? -2.294  -4.537  5.612   1.00 1.28  ? 109 LEU A HD23 3  
ATOM 5620  N N    . ASN A 1 110 ? -4.844  -7.385  7.851   1.00 1.37  ? 110 ASN A N    3  
ATOM 5621  C CA   . ASN A 1 110 ? -5.459  -8.547  8.491   1.00 1.67  ? 110 ASN A CA   3  
ATOM 5622  C C    . ASN A 1 110 ? -6.797  -8.165  9.112   1.00 1.44  ? 110 ASN A C    3  
ATOM 5623  O O    . ASN A 1 110 ? -7.172  -8.656  10.179  1.00 1.77  ? 110 ASN A O    3  
ATOM 5624  C CB   . ASN A 1 110 ? -4.529  -9.156  9.551   1.00 2.17  ? 110 ASN A CB   3  
ATOM 5625  C CG   . ASN A 1 110 ? -3.325  -9.861  8.951   1.00 2.95  ? 110 ASN A CG   3  
ATOM 5626  O OD1  . ASN A 1 110 ? -2.829  -9.483  7.889   1.00 3.70  ? 110 ASN A OD1  3  
ATOM 5627  N ND2  . ASN A 1 110 ? -2.853  -10.896 9.625   1.00 3.35  ? 110 ASN A ND2  3  
ATOM 5628  H H    . ASN A 1 110 ? -4.598  -7.442  6.902   1.00 1.89  ? 110 ASN A H    3  
ATOM 5629  H HA   . ASN A 1 110 ? -5.638  -9.283  7.722   1.00 1.91  ? 110 ASN A HA   3  
ATOM 5630  H HB2  . ASN A 1 110 ? -4.174  -8.372  10.202  1.00 2.54  ? 110 ASN A HB2  3  
ATOM 5631  H HB3  . ASN A 1 110 ? -5.088  -9.874  10.135  1.00 2.33  ? 110 ASN A HB3  3  
ATOM 5632  H HD21 . ASN A 1 110 ? -3.307  -11.150 10.464  1.00 3.18  ? 110 ASN A HD21 3  
ATOM 5633  H HD22 . ASN A 1 110 ? -2.074  -11.366 9.267   1.00 4.09  ? 110 ASN A HD22 3  
ATOM 5634  N N    . GLY A 1 111 ? -7.506  -7.273  8.439   1.00 1.12  ? 111 GLY A N    3  
ATOM 5635  C CA   . GLY A 1 111 ? -8.783  -6.811  8.931   1.00 1.12  ? 111 GLY A CA   3  
ATOM 5636  C C    . GLY A 1 111 ? -9.825  -6.766  7.836   1.00 0.87  ? 111 GLY A C    3  
ATOM 5637  O O    . GLY A 1 111 ? -9.605  -7.300  6.749   1.00 0.93  ? 111 GLY A O    3  
ATOM 5638  H H    . GLY A 1 111 ? -7.160  -6.926  7.589   1.00 1.15  ? 111 GLY A H    3  
ATOM 5639  H HA2  . GLY A 1 111 ? -9.122  -7.479  9.709   1.00 1.39  ? 111 GLY A HA2  3  
ATOM 5640  H HA3  . GLY A 1 111 ? -8.665  -5.820  9.344   1.00 1.34  ? 111 GLY A HA3  3  
ATOM 5641  N N    . PRO A 1 112 ? -10.974 -6.128  8.091   1.00 0.86  ? 112 PRO A N    3  
ATOM 5642  C CA   . PRO A 1 112 ? -12.059 -6.046  7.121   1.00 0.93  ? 112 PRO A CA   3  
ATOM 5643  C C    . PRO A 1 112 ? -11.811 -4.979  6.060   1.00 0.89  ? 112 PRO A C    3  
ATOM 5644  O O    . PRO A 1 112 ? -11.141 -3.974  6.313   1.00 1.31  ? 112 PRO A O    3  
ATOM 5645  C CB   . PRO A 1 112 ? -13.262 -5.676  7.986   1.00 1.25  ? 112 PRO A CB   3  
ATOM 5646  C CG   . PRO A 1 112 ? -12.689 -4.887  9.114   1.00 1.30  ? 112 PRO A CG   3  
ATOM 5647  C CD   . PRO A 1 112 ? -11.302 -5.430  9.349   1.00 1.10  ? 112 PRO A CD   3  
ATOM 5648  H HA   . PRO A 1 112 ? -12.235 -6.997  6.643   1.00 1.00  ? 112 PRO A HA   3  
ATOM 5649  H HB2  . PRO A 1 112 ? -13.961 -5.089  7.407   1.00 1.52  ? 112 PRO A HB2  3  
ATOM 5650  H HB3  . PRO A 1 112 ? -13.745 -6.575  8.340   1.00 1.43  ? 112 PRO A HB3  3  
ATOM 5651  H HG2  . PRO A 1 112 ? -12.642 -3.843  8.842   1.00 1.65  ? 112 PRO A HG2  3  
ATOM 5652  H HG3  . PRO A 1 112 ? -13.296 -5.018  9.997   1.00 1.44  ? 112 PRO A HG3  3  
ATOM 5653  H HD2  . PRO A 1 112 ? -10.609 -4.622  9.531   1.00 1.29  ? 112 PRO A HD2  3  
ATOM 5654  H HD3  . PRO A 1 112 ? -11.305 -6.119  10.180  1.00 1.17  ? 112 PRO A HD3  3  
ATOM 5655  N N    . LEU A 1 113 ? -12.342 -5.213  4.870   1.00 0.62  ? 113 LEU A N    3  
ATOM 5656  C CA   . LEU A 1 113 ? -12.265 -4.240  3.798   1.00 0.58  ? 113 LEU A CA   3  
ATOM 5657  C C    . LEU A 1 113 ? -13.520 -3.382  3.805   1.00 0.69  ? 113 LEU A C    3  
ATOM 5658  O O    . LEU A 1 113 ? -14.634 -3.905  3.886   1.00 0.90  ? 113 LEU A O    3  
ATOM 5659  C CB   . LEU A 1 113 ? -12.099 -4.932  2.442   1.00 0.58  ? 113 LEU A CB   3  
ATOM 5660  C CG   . LEU A 1 113 ? -10.842 -5.789  2.300   1.00 0.57  ? 113 LEU A CG   3  
ATOM 5661  C CD1  . LEU A 1 113 ? -10.724 -6.328  0.889   1.00 1.11  ? 113 LEU A CD1  3  
ATOM 5662  C CD2  . LEU A 1 113 ? -9.599  -4.993  2.686   1.00 1.05  ? 113 LEU A CD2  3  
ATOM 5663  H H    . LEU A 1 113 ? -12.805 -6.055  4.710   1.00 0.73  ? 113 LEU A H    3  
ATOM 5664  H HA   . LEU A 1 113 ? -11.407 -3.609  3.982   1.00 0.56  ? 113 LEU A HA   3  
ATOM 5665  H HB2  . LEU A 1 113 ? -12.960 -5.563  2.277   1.00 0.65  ? 113 LEU A HB2  3  
ATOM 5666  H HB3  . LEU A 1 113 ? -12.079 -4.172  1.675   1.00 0.60  ? 113 LEU A HB3  3  
ATOM 5667  H HG   . LEU A 1 113 ? -10.916 -6.634  2.964   1.00 0.65  ? 113 LEU A HG   3  
ATOM 5668  H HD11 . LEU A 1 113 ? -11.584 -6.941  0.663   1.00 1.60  ? 113 LEU A HD11 3  
ATOM 5669  H HD12 . LEU A 1 113 ? -9.826  -6.923  0.807   1.00 1.75  ? 113 LEU A HD12 3  
ATOM 5670  H HD13 . LEU A 1 113 ? -10.675 -5.505  0.192   1.00 1.54  ? 113 LEU A HD13 3  
ATOM 5671  H HD21 . LEU A 1 113 ? -8.722  -5.610  2.560   1.00 1.60  ? 113 LEU A HD21 3  
ATOM 5672  H HD22 . LEU A 1 113 ? -9.675  -4.682  3.719   1.00 1.47  ? 113 LEU A HD22 3  
ATOM 5673  H HD23 . LEU A 1 113 ? -9.518  -4.119  2.054   1.00 1.63  ? 113 LEU A HD23 3  
ATOM 5674  N N    . PRO A 1 114 ? -13.354 -2.056  3.743   1.00 0.68  ? 114 PRO A N    3  
ATOM 5675  C CA   . PRO A 1 114 ? -14.467 -1.113  3.838   1.00 0.83  ? 114 PRO A CA   3  
ATOM 5676  C C    . PRO A 1 114 ? -15.382 -1.156  2.622   1.00 0.86  ? 114 PRO A C    3  
ATOM 5677  O O    . PRO A 1 114 ? -14.947 -0.957  1.485   1.00 1.15  ? 114 PRO A O    3  
ATOM 5678  C CB   . PRO A 1 114 ? -13.783 0.247   3.933   1.00 1.02  ? 114 PRO A CB   3  
ATOM 5679  C CG   . PRO A 1 114 ? -12.461 0.050   3.276   1.00 0.90  ? 114 PRO A CG   3  
ATOM 5680  C CD   . PRO A 1 114 ? -12.067 -1.372  3.566   1.00 0.70  ? 114 PRO A CD   3  
ATOM 5681  H HA   . PRO A 1 114 ? -15.050 -1.286  4.730   1.00 1.05  ? 114 PRO A HA   3  
ATOM 5682  H HB2  . PRO A 1 114 ? -14.384 0.980   3.419   1.00 1.15  ? 114 PRO A HB2  3  
ATOM 5683  H HB3  . PRO A 1 114 ? -13.671 0.527   4.970   1.00 1.31  ? 114 PRO A HB3  3  
ATOM 5684  H HG2  . PRO A 1 114 ? -12.553 0.209   2.211   1.00 0.99  ? 114 PRO A HG2  3  
ATOM 5685  H HG3  . PRO A 1 114 ? -11.737 0.733   3.697   1.00 1.13  ? 114 PRO A HG3  3  
ATOM 5686  H HD2  . PRO A 1 114 ? -11.522 -1.796  2.736   1.00 0.68  ? 114 PRO A HD2  3  
ATOM 5687  H HD3  . PRO A 1 114 ? -11.478 -1.423  4.468   1.00 0.81  ? 114 PRO A HD3  3  
ATOM 5688  N N    . VAL A 1 115 ? -16.651 -1.409  2.883   1.00 1.26  ? 115 VAL A N    3  
ATOM 5689  C CA   . VAL A 1 115 ? -17.668 -1.469  1.843   1.00 1.45  ? 115 VAL A CA   3  
ATOM 5690  C C    . VAL A 1 115 ? -18.953 -0.800  2.322   1.00 1.91  ? 115 VAL A C    3  
ATOM 5691  O O    . VAL A 1 115 ? -19.844 -1.446  2.875   1.00 2.44  ? 115 VAL A O    3  
ATOM 5692  C CB   . VAL A 1 115 ? -17.962 -2.920  1.396   1.00 1.96  ? 115 VAL A CB   3  
ATOM 5693  C CG1  . VAL A 1 115 ? -16.905 -3.395  0.416   1.00 2.60  ? 115 VAL A CG1  3  
ATOM 5694  C CG2  . VAL A 1 115 ? -18.034 -3.862  2.592   1.00 2.98  ? 115 VAL A CG2  3  
ATOM 5695  H H    . VAL A 1 115 ? -16.918 -1.543  3.813   1.00 1.67  ? 115 VAL A H    3  
ATOM 5696  H HA   . VAL A 1 115 ? -17.295 -0.922  0.988   1.00 1.85  ? 115 VAL A HA   3  
ATOM 5697  H HB   . VAL A 1 115 ? -18.916 -2.935  0.894   1.00 2.15  ? 115 VAL A HB   3  
ATOM 5698  H HG11 . VAL A 1 115 ? -15.935 -3.363  0.889   1.00 2.96  ? 115 VAL A HG11 3  
ATOM 5699  H HG12 . VAL A 1 115 ? -16.904 -2.749  -0.449  1.00 3.01  ? 115 VAL A HG12 3  
ATOM 5700  H HG13 . VAL A 1 115 ? -17.124 -4.406  0.111   1.00 3.05  ? 115 VAL A HG13 3  
ATOM 5701  H HG21 . VAL A 1 115 ? -18.814 -3.533  3.262   1.00 3.35  ? 115 VAL A HG21 3  
ATOM 5702  H HG22 . VAL A 1 115 ? -17.087 -3.857  3.113   1.00 3.47  ? 115 VAL A HG22 3  
ATOM 5703  H HG23 . VAL A 1 115 ? -18.251 -4.862  2.250   1.00 3.42  ? 115 VAL A HG23 3  
ATOM 5704  N N    . PRO A 1 116 ? -19.055 0.518   2.114   1.00 2.53  ? 116 PRO A N    3  
ATOM 5705  C CA   . PRO A 1 116 ? -20.186 1.320   2.587   1.00 3.48  ? 116 PRO A CA   3  
ATOM 5706  C C    . PRO A 1 116 ? -21.419 1.202   1.694   1.00 3.68  ? 116 PRO A C    3  
ATOM 5707  O O    . PRO A 1 116 ? -22.117 2.187   1.450   1.00 3.90  ? 116 PRO A O    3  
ATOM 5708  C CB   . PRO A 1 116 ? -19.630 2.741   2.548   1.00 4.23  ? 116 PRO A CB   3  
ATOM 5709  C CG   . PRO A 1 116 ? -18.634 2.728   1.437   1.00 4.01  ? 116 PRO A CG   3  
ATOM 5710  C CD   . PRO A 1 116 ? -18.061 1.334   1.396   1.00 2.94  ? 116 PRO A CD   3  
ATOM 5711  H HA   . PRO A 1 116 ? -20.452 1.065   3.603   1.00 3.92  ? 116 PRO A HA   3  
ATOM 5712  H HB2  . PRO A 1 116 ? -20.432 3.438   2.355   1.00 4.47  ? 116 PRO A HB2  3  
ATOM 5713  H HB3  . PRO A 1 116 ? -19.163 2.978   3.493   1.00 4.93  ? 116 PRO A HB3  3  
ATOM 5714  H HG2  . PRO A 1 116 ? -19.123 2.960   0.502   1.00 4.47  ? 116 PRO A HG2  3  
ATOM 5715  H HG3  . PRO A 1 116 ? -17.852 3.446   1.640   1.00 4.42  ? 116 PRO A HG3  3  
ATOM 5716  H HD2  . PRO A 1 116 ? -17.958 0.997   0.374   1.00 2.94  ? 116 PRO A HD2  3  
ATOM 5717  H HD3  . PRO A 1 116 ? -17.108 1.305   1.900   1.00 2.95  ? 116 PRO A HD3  3  
ATOM 5718  N N    . PHE A 1 117 ? -21.681 -0.005  1.209   1.00 4.03  ? 117 PHE A N    3  
ATOM 5719  C CA   . PHE A 1 117 ? -22.837 -0.257  0.361   1.00 4.72  ? 117 PHE A CA   3  
ATOM 5720  C C    . PHE A 1 117 ? -23.207 -1.736  0.410   1.00 5.62  ? 117 PHE A C    3  
ATOM 5721  O O    . PHE A 1 117 ? -22.664 -2.553  -0.333  1.00 6.22  ? 117 PHE A O    3  
ATOM 5722  C CB   . PHE A 1 117 ? -22.553 0.183   -1.080  1.00 5.32  ? 117 PHE A CB   3  
ATOM 5723  C CG   . PHE A 1 117 ? -23.777 0.218   -1.955  1.00 5.77  ? 117 PHE A CG   3  
ATOM 5724  C CD1  . PHE A 1 117 ? -24.922 0.878   -1.540  1.00 6.08  ? 117 PHE A CD1  3  
ATOM 5725  C CD2  . PHE A 1 117 ? -23.785 -0.421  -3.186  1.00 6.27  ? 117 PHE A CD2  3  
ATOM 5726  C CE1  . PHE A 1 117 ? -26.051 0.902   -2.335  1.00 6.87  ? 117 PHE A CE1  3  
ATOM 5727  C CE2  . PHE A 1 117 ? -24.913 -0.402  -3.985  1.00 7.04  ? 117 PHE A CE2  3  
ATOM 5728  C CZ   . PHE A 1 117 ? -26.030 0.306   -3.581  1.00 7.33  ? 117 PHE A CZ   3  
ATOM 5729  H H    . PHE A 1 117 ? -21.082 -0.749  1.433   1.00 4.08  ? 117 PHE A H    3  
ATOM 5730  H HA   . PHE A 1 117 ? -23.662 0.322   0.748   1.00 4.55  ? 117 PHE A HA   3  
ATOM 5731  H HB2  . PHE A 1 117 ? -22.125 1.174   -1.067  1.00 5.24  ? 117 PHE A HB2  3  
ATOM 5732  H HB3  . PHE A 1 117 ? -21.845 -0.502  -1.524  1.00 5.94  ? 117 PHE A HB3  3  
ATOM 5733  H HD1  . PHE A 1 117 ? -24.926 1.380   -0.584  1.00 5.96  ? 117 PHE A HD1  3  
ATOM 5734  H HD2  . PHE A 1 117 ? -22.899 -0.938  -3.521  1.00 6.29  ? 117 PHE A HD2  3  
ATOM 5735  H HE1  . PHE A 1 117 ? -26.936 1.421   -2.000  1.00 7.32  ? 117 PHE A HE1  3  
ATOM 5736  H HE2  . PHE A 1 117 ? -24.907 -0.903  -4.942  1.00 7.60  ? 117 PHE A HE2  3  
ATOM 5737  H HZ   . PHE A 1 117 ? -26.903 0.341   -4.214  1.00 8.10  ? 117 PHE A HZ   3  
ATOM 5738  N N    . THR A 1 118 ? -24.118 -2.075  1.310   1.00 6.05  ? 118 THR A N    3  
ATOM 5739  C CA   . THR A 1 118 ? -24.554 -3.450  1.478   1.00 7.13  ? 118 THR A CA   3  
ATOM 5740  C C    . THR A 1 118 ? -25.743 -3.753  0.571   1.00 7.53  ? 118 THR A C    3  
ATOM 5741  O O    . THR A 1 118 ? -26.234 -2.864  -0.131  1.00 8.01  ? 118 THR A O    3  
ATOM 5742  C CB   . THR A 1 118 ? -24.930 -3.741  2.946   1.00 8.07  ? 118 THR A CB   3  
ATOM 5743  O OG1  . THR A 1 118 ? -25.898 -2.786  3.406   1.00 8.43  ? 118 THR A OG1  3  
ATOM 5744  C CG2  . THR A 1 118 ? -23.700 -3.694  3.840   1.00 8.78  ? 118 THR A CG2  3  
ATOM 5745  H H    . THR A 1 118 ? -24.518 -1.373  1.873   1.00 5.82  ? 118 THR A H    3  
ATOM 5746  H HA   . THR A 1 118 ? -23.731 -4.096  1.205   1.00 7.30  ? 118 THR A HA   3  
ATOM 5747  H HB   . THR A 1 118 ? -25.360 -4.731  3.003   1.00 8.25  ? 118 THR A HB   3  
ATOM 5748  H HG1  . THR A 1 118 ? -25.506 -1.903  3.406   1.00 8.41  ? 118 THR A HG1  3  
ATOM 5749  H HG21 . THR A 1 118 ? -23.987 -3.912  4.858   1.00 9.07  ? 118 THR A HG21 3  
ATOM 5750  H HG22 . THR A 1 118 ? -23.259 -2.710  3.794   1.00 8.92  ? 118 THR A HG22 3  
ATOM 5751  H HG23 . THR A 1 118 ? -22.983 -4.429  3.504   1.00 9.11  ? 118 THR A HG23 3  
ATOM 5752  N N    . ASN A 1 119 ? -26.199 -5.007  0.594   1.00 7.62  ? 119 ASN A N    3  
ATOM 5753  C CA   . ASN A 1 119 ? -27.305 -5.462  -0.253  1.00 8.32  ? 119 ASN A CA   3  
ATOM 5754  C C    . ASN A 1 119 ? -26.889 -5.472  -1.716  1.00 9.00  ? 119 ASN A C    3  
ATOM 5755  O O    . ASN A 1 119 ? -27.697 -5.216  -2.611  1.00 9.23  ? 119 ASN A O    3  
ATOM 5756  C CB   . ASN A 1 119 ? -28.561 -4.600  -0.060  1.00 8.46  ? 119 ASN A CB   3  
ATOM 5757  C CG   . ASN A 1 119 ? -29.301 -4.910  1.227   1.00 8.93  ? 119 ASN A CG   3  
ATOM 5758  O OD1  . ASN A 1 119 ? -30.182 -5.767  1.253   1.00 9.34  ? 119 ASN A OD1  3  
ATOM 5759  N ND2  . ASN A 1 119 ? -28.953 -4.217  2.302   1.00 9.14  ? 119 ASN A ND2  3  
ATOM 5760  H H    . ASN A 1 119 ? -25.768 -5.658  1.197   1.00 7.43  ? 119 ASN A H    3  
ATOM 5761  H HA   . ASN A 1 119 ? -27.534 -6.478  0.039   1.00 8.58  ? 119 ASN A HA   3  
ATOM 5762  H HB2  . ASN A 1 119 ? -28.274 -3.560  -0.042  1.00 8.54  ? 119 ASN A HB2  3  
ATOM 5763  H HB3  . ASN A 1 119 ? -29.233 -4.768  -0.888  1.00 8.45  ? 119 ASN A HB3  3  
ATOM 5764  H HD21 . ASN A 1 119 ? -28.239 -3.549  2.216   1.00 8.98  ? 119 ASN A HD21 3  
ATOM 5765  H HD22 . ASN A 1 119 ? -29.432 -4.394  3.143   1.00 9.61  ? 119 ASN A HD22 3  
ATOM 5766  N N    . GLY A 1 120 ? -25.618 -5.770  -1.948  1.00 9.55  ? 120 GLY A N    3  
ATOM 5767  C CA   . GLY A 1 120 ? -25.110 -5.861  -3.298  1.00 10.42 ? 120 GLY A CA   3  
ATOM 5768  C C    . GLY A 1 120 ? -24.510 -4.561  -3.789  1.00 11.21 ? 120 GLY A C    3  
ATOM 5769  O O    . GLY A 1 120 ? -25.236 -3.617  -4.113  1.00 11.55 ? 120 GLY A O    3  
ATOM 5770  H H    . GLY A 1 120 ? -25.018 -5.924  -1.189  1.00 9.52  ? 120 GLY A H    3  
ATOM 5771  H HA2  . GLY A 1 120 ? -24.352 -6.629  -3.332  1.00 10.61 ? 120 GLY A HA2  3  
ATOM 5772  H HA3  . GLY A 1 120 ? -25.920 -6.142  -3.956  1.00 10.51 ? 120 GLY A HA3  3  
ATOM 5773  N N    . GLU A 1 121 ? -23.184 -4.511  -3.833  1.00 11.70 ? 121 GLU A N    3  
ATOM 5774  C CA   . GLU A 1 121 ? -22.472 -3.366  -4.391  1.00 12.64 ? 121 GLU A CA   3  
ATOM 5775  C C    . GLU A 1 121 ? -22.425 -3.523  -5.909  1.00 13.44 ? 121 GLU A C    3  
ATOM 5776  O O    . GLU A 1 121 ? -21.377 -3.799  -6.497  1.00 13.92 ? 121 GLU A O    3  
ATOM 5777  C CB   . GLU A 1 121 ? -21.062 -3.285  -3.790  1.00 12.94 ? 121 GLU A CB   3  
ATOM 5778  C CG   . GLU A 1 121 ? -20.515 -1.868  -3.655  1.00 12.93 ? 121 GLU A CG   3  
ATOM 5779  C CD   . GLU A 1 121 ? -20.110 -1.242  -4.974  1.00 13.41 ? 121 GLU A CD   3  
ATOM 5780  O OE1  . GLU A 1 121 ? -20.977 -0.636  -5.633  1.00 13.66 ? 121 GLU A OE1  3  
ATOM 5781  O OE2  . GLU A 1 121 ? -18.932 -1.362  -5.364  1.00 13.68 ? 121 GLU A OE2  3  
ATOM 5782  H H    . GLU A 1 121 ? -22.667 -5.261  -3.479  1.00 11.54 ? 121 GLU A H    3  
ATOM 5783  H HA   . GLU A 1 121 ? -23.025 -2.471  -4.142  1.00 12.73 ? 121 GLU A HA   3  
ATOM 5784  H HB2  . GLU A 1 121 ? -21.080 -3.732  -2.806  1.00 13.04 ? 121 GLU A HB2  3  
ATOM 5785  H HB3  . GLU A 1 121 ? -20.386 -3.850  -4.416  1.00 13.27 ? 121 GLU A HB3  3  
ATOM 5786  H HG2  . GLU A 1 121 ? -21.276 -1.248  -3.208  1.00 12.74 ? 121 GLU A HG2  3  
ATOM 5787  H HG3  . GLU A 1 121 ? -19.651 -1.894  -3.007  1.00 12.97 ? 121 GLU A HG3  3  
ATOM 5788  N N    . ILE A 1 122 ? -23.586 -3.371  -6.525  1.00 13.73 ? 122 ILE A N    3  
ATOM 5789  C CA   . ILE A 1 122 ? -23.762 -3.665  -7.938  1.00 14.64 ? 122 ILE A CA   3  
ATOM 5790  C C    . ILE A 1 122 ? -23.864 -2.388  -8.763  1.00 15.74 ? 122 ILE A C    3  
ATOM 5791  O O    . ILE A 1 122 ? -24.099 -1.303  -8.228  1.00 16.21 ? 122 ILE A O    3  
ATOM 5792  C CB   . ILE A 1 122 ? -25.024 -4.522  -8.158  1.00 14.54 ? 122 ILE A CB   3  
ATOM 5793  C CG1  . ILE A 1 122 ? -26.251 -3.835  -7.549  1.00 14.04 ? 122 ILE A CG1  3  
ATOM 5794  C CG2  . ILE A 1 122 ? -24.828 -5.910  -7.560  1.00 14.69 ? 122 ILE A CG2  3  
ATOM 5795  C CD1  . ILE A 1 122 ? -27.542 -4.602  -7.736  1.00 14.09 ? 122 ILE A CD1  3  
ATOM 5796  H H    . ILE A 1 122 ? -24.353 -3.038  -6.013  1.00 13.43 ? 122 ILE A H    3  
ATOM 5797  H HA   . ILE A 1 122 ? -22.903 -4.230  -8.271  1.00 14.76 ? 122 ILE A HA   3  
ATOM 5798  H HB   . ILE A 1 122 ? -25.174 -4.635  -9.222  1.00 14.93 ? 122 ILE A HB   3  
ATOM 5799  H HG12 . ILE A 1 122 ? -26.093 -3.710  -6.488  1.00 13.68 ? 122 ILE A HG12 3  
ATOM 5800  H HG13 . ILE A 1 122 ? -26.373 -2.862  -8.005  1.00 14.16 ? 122 ILE A HG13 3  
ATOM 5801  H HG21 . ILE A 1 122 ? -25.733 -6.486  -7.685  1.00 14.66 ? 122 ILE A HG21 3  
ATOM 5802  H HG22 . ILE A 1 122 ? -24.601 -5.820  -6.509  1.00 14.82 ? 122 ILE A HG22 3  
ATOM 5803  H HG23 . ILE A 1 122 ? -24.011 -6.407  -8.063  1.00 14.87 ? 122 ILE A HG23 3  
ATOM 5804  H HD11 . ILE A 1 122 ? -28.356 -4.052  -7.288  1.00 14.08 ? 122 ILE A HD11 3  
ATOM 5805  H HD12 . ILE A 1 122 ? -27.456 -5.568  -7.264  1.00 14.17 ? 122 ILE A HD12 3  
ATOM 5806  H HD13 . ILE A 1 122 ? -27.735 -4.732  -8.792  1.00 14.24 ? 122 ILE A HD13 3  
ATOM 5807  N N    . GLN A 1 123 ? -23.705 -2.529  -10.071 1.00 16.25 ? 123 GLN A N    3  
ATOM 5808  C CA   . GLN A 1 123 ? -23.670 -1.377  -10.961 1.00 17.37 ? 123 GLN A CA   3  
ATOM 5809  C C    . GLN A 1 123 ? -24.428 -1.650  -12.261 1.00 18.25 ? 123 GLN A C    3  
ATOM 5810  O O    . GLN A 1 123 ? -25.179 -0.792  -12.735 1.00 18.70 ? 123 GLN A O    3  
ATOM 5811  C CB   . GLN A 1 123 ? -22.215 -0.986  -11.259 1.00 17.69 ? 123 GLN A CB   3  
ATOM 5812  C CG   . GLN A 1 123 ? -22.071 0.195   -12.207 1.00 18.12 ? 123 GLN A CG   3  
ATOM 5813  C CD   . GLN A 1 123 ? -20.632 0.648   -12.365 1.00 18.49 ? 123 GLN A CD   3  
ATOM 5814  O OE1  . GLN A 1 123 ? -20.155 1.518   -11.636 1.00 18.82 ? 123 GLN A OE1  3  
ATOM 5815  N NE2  . GLN A 1 123 ? -19.927 0.058   -13.316 1.00 18.57 ? 123 GLN A NE2  3  
ATOM 5816  H H    . GLN A 1 123 ? -23.625 -3.440  -10.450 1.00 15.95 ? 123 GLN A H    3  
ATOM 5817  H HA   . GLN A 1 123 ? -24.152 -0.557  -10.450 1.00 17.46 ? 123 GLN A HA   3  
ATOM 5818  H HB2  . GLN A 1 123 ? -21.727 -0.734  -10.330 1.00 17.45 ? 123 GLN A HB2  3  
ATOM 5819  H HB3  . GLN A 1 123 ? -21.711 -1.836  -11.698 1.00 18.00 ? 123 GLN A HB3  3  
ATOM 5820  H HG2  . GLN A 1 123 ? -22.448 -0.092  -13.178 1.00 18.20 ? 123 GLN A HG2  3  
ATOM 5821  H HG3  . GLN A 1 123 ? -22.654 1.020   -11.827 1.00 18.23 ? 123 GLN A HG3  3  
ATOM 5822  H HE21 . GLN A 1 123 ? -20.366 -0.632  -13.860 1.00 18.37 ? 123 GLN A HE21 3  
ATOM 5823  H HE22 . GLN A 1 123 ? -18.992 0.333   -13.441 1.00 18.90 ? 123 GLN A HE22 3  
ATOM 5824  N N    . LYS A 1 124 ? -24.259 -2.849  -12.817 1.00 18.59 ? 124 LYS A N    3  
ATOM 5825  C CA   . LYS A 1 124 ? -24.850 -3.192  -14.113 1.00 19.51 ? 124 LYS A CA   3  
ATOM 5826  C C    . LYS A 1 124 ? -24.579 -4.655  -14.465 1.00 20.23 ? 124 LYS A C    3  
ATOM 5827  O O    . LYS A 1 124 ? -25.374 -5.281  -15.167 1.00 20.83 ? 124 LYS A O    3  
ATOM 5828  C CB   . LYS A 1 124 ? -24.316 -2.259  -15.210 1.00 19.61 ? 124 LYS A CB   3  
ATOM 5829  C CG   . LYS A 1 124 ? -22.810 -2.332  -15.418 1.00 19.54 ? 124 LYS A CG   3  
ATOM 5830  C CD   . LYS A 1 124 ? -22.262 -1.021  -15.965 1.00 19.77 ? 124 LYS A CD   3  
ATOM 5831  C CE   . LYS A 1 124 ? -22.984 -0.585  -17.231 1.00 20.14 ? 124 LYS A CE   3  
ATOM 5832  N NZ   . LYS A 1 124 ? -22.565 0.774   -17.666 1.00 20.17 ? 124 LYS A NZ   3  
ATOM 5833  H H    . LYS A 1 124 ? -23.755 -3.539  -12.324 1.00 18.29 ? 124 LYS A H    3  
ATOM 5834  H HA   . LYS A 1 124 ? -25.916 -3.053  -14.029 1.00 19.72 ? 124 LYS A HA   3  
ATOM 5835  H HB2  . LYS A 1 124 ? -24.796 -2.508  -16.143 1.00 19.67 ? 124 LYS A HB2  3  
ATOM 5836  H HB3  . LYS A 1 124 ? -24.568 -1.241  -14.951 1.00 19.83 ? 124 LYS A HB3  3  
ATOM 5837  H HG2  . LYS A 1 124 ? -22.337 -2.540  -14.471 1.00 19.49 ? 124 LYS A HG2  3  
ATOM 5838  H HG3  . LYS A 1 124 ? -22.591 -3.127  -16.118 1.00 19.51 ? 124 LYS A HG3  3  
ATOM 5839  H HD2  . LYS A 1 124 ? -22.384 -0.255  -15.215 1.00 19.80 ? 124 LYS A HD2  3  
ATOM 5840  H HD3  . LYS A 1 124 ? -21.213 -1.146  -16.184 1.00 19.76 ? 124 LYS A HD3  3  
ATOM 5841  H HE2  . LYS A 1 124 ? -22.765 -1.291  -18.018 1.00 20.61 ? 124 LYS A HE2  3  
ATOM 5842  H HE3  . LYS A 1 124 ? -24.046 -0.580  -17.039 1.00 20.05 ? 124 LYS A HE3  3  
ATOM 5843  H HZ1  . LYS A 1 124 ? -21.556 0.773   -17.936 1.00 20.17 ? 124 LYS A HZ1  3  
ATOM 5844  H HZ2  . LYS A 1 124 ? -22.703 1.457   -16.888 1.00 20.36 ? 124 LYS A HZ2  3  
ATOM 5845  H HZ3  . LYS A 1 124 ? -23.132 1.080   -18.482 1.00 20.13 ? 124 LYS A HZ3  3  
ATOM 5846  N N    . GLU A 1 125 ? -23.469 -5.194  -13.957 1.00 20.28 ? 125 GLU A N    3  
ATOM 5847  C CA   . GLU A 1 125 ? -23.144 -6.618  -14.096 1.00 21.04 ? 125 GLU A CA   3  
ATOM 5848  C C    . GLU A 1 125 ? -23.206 -7.085  -15.550 1.00 21.94 ? 125 GLU A C    3  
ATOM 5849  O O    . GLU A 1 125 ? -24.132 -7.804  -15.948 1.00 22.50 ? 125 GLU A O    3  
ATOM 5850  C CB   . GLU A 1 125 ? -24.077 -7.486  -13.235 1.00 20.98 ? 125 GLU A CB   3  
ATOM 5851  C CG   . GLU A 1 125 ? -23.938 -7.270  -11.733 1.00 20.93 ? 125 GLU A CG   3  
ATOM 5852  C CD   . GLU A 1 125 ? -24.546 -5.965  -11.261 1.00 21.01 ? 125 GLU A CD   3  
ATOM 5853  O OE1  . GLU A 1 125 ? -25.763 -5.943  -10.970 1.00 21.38 ? 125 GLU A OE1  3  
ATOM 5854  O OE2  . GLU A 1 125 ? -23.809 -4.956  -11.178 1.00 20.79 ? 125 GLU A OE2  3  
ATOM 5855  H H    . GLU A 1 125 ? -22.851 -4.619  -13.461 1.00 19.85 ? 125 GLU A H    3  
ATOM 5856  H HA   . GLU A 1 125 ? -22.134 -6.752  -13.744 1.00 21.11 ? 125 GLU A HA   3  
ATOM 5857  H HB2  . GLU A 1 125 ? -25.099 -7.270  -13.510 1.00 20.83 ? 125 GLU A HB2  3  
ATOM 5858  H HB3  . GLU A 1 125 ? -23.874 -8.526  -13.446 1.00 21.23 ? 125 GLU A HB3  3  
ATOM 5859  H HG2  . GLU A 1 125 ? -24.432 -8.080  -11.219 1.00 20.90 ? 125 GLU A HG2  3  
ATOM 5860  H HG3  . GLU A 1 125 ? -22.889 -7.273  -11.479 1.00 21.00 ? 125 GLU A HG3  3  
ATOM 5861  N N    . ASN A 1 126 ? -22.219 -6.679  -16.336 1.00 22.18 ? 126 ASN A N    3  
ATOM 5862  C CA   . ASN A 1 126 ? -22.118 -7.124  -17.719 1.00 23.12 ? 126 ASN A CA   3  
ATOM 5863  C C    . ASN A 1 126 ? -21.680 -8.583  -17.757 1.00 23.54 ? 126 ASN A C    3  
ATOM 5864  O O    . ASN A 1 126 ? -20.497 -8.894  -17.616 1.00 23.81 ? 126 ASN A O    3  
ATOM 5865  C CB   . ASN A 1 126 ? -21.129 -6.255  -18.499 1.00 23.38 ? 126 ASN A CB   3  
ATOM 5866  C CG   . ASN A 1 126 ? -21.049 -6.641  -19.968 1.00 23.74 ? 126 ASN A CG   3  
ATOM 5867  O OD1  . ASN A 1 126 ? -20.239 -7.482  -20.364 1.00 23.88 ? 126 ASN A OD1  3  
ATOM 5868  N ND2  . ASN A 1 126 ? -21.887 -6.027  -20.786 1.00 23.99 ? 126 ASN A ND2  3  
ATOM 5869  H H    . ASN A 1 126 ? -21.543 -6.070  -15.977 1.00 21.78 ? 126 ASN A H    3  
ATOM 5870  H HA   . ASN A 1 126 ? -23.098 -7.040  -18.167 1.00 23.43 ? 126 ASN A HA   3  
ATOM 5871  H HB2  . ASN A 1 126 ? -21.437 -5.222  -18.434 1.00 23.29 ? 126 ASN A HB2  3  
ATOM 5872  H HB3  . ASN A 1 126 ? -20.146 -6.361  -18.065 1.00 23.53 ? 126 ASN A HB3  3  
ATOM 5873  H HD21 . ASN A 1 126 ? -22.509 -5.361  -20.403 1.00 23.94 ? 126 ASN A HD21 3  
ATOM 5874  H HD22 . ASN A 1 126 ? -21.860 -6.259  -21.738 1.00 24.29 ? 126 ASN A HD22 3  
ATOM 5875  N N    . SER A 1 127 ? -22.643 -9.475  -17.922 1.00 23.70 ? 127 SER A N    3  
ATOM 5876  C CA   . SER A 1 127 ? -22.371 -10.900 -17.917 1.00 24.19 ? 127 SER A CA   3  
ATOM 5877  C C    . SER A 1 127 ? -22.632 -11.492 -19.298 1.00 24.67 ? 127 SER A C    3  
ATOM 5878  O O    . SER A 1 127 ? -23.253 -10.852 -20.150 1.00 25.00 ? 127 SER A O    3  
ATOM 5879  C CB   . SER A 1 127 ? -23.245 -11.592 -16.864 1.00 24.36 ? 127 SER A CB   3  
ATOM 5880  O OG   . SER A 1 127 ? -22.893 -12.956 -16.704 1.00 24.58 ? 127 SER A OG   3  
ATOM 5881  H H    . SER A 1 127 ? -23.564 -9.166  -18.050 1.00 23.55 ? 127 SER A H    3  
ATOM 5882  H HA   . SER A 1 127 ? -21.331 -11.042 -17.664 1.00 24.21 ? 127 SER A HA   3  
ATOM 5883  H HB2  . SER A 1 127 ? -23.125 -11.091 -15.917 1.00 24.43 ? 127 SER A HB2  3  
ATOM 5884  H HB3  . SER A 1 127 ? -24.279 -11.536 -17.171 1.00 24.36 ? 127 SER A HB3  3  
ATOM 5885  H HG   . SER A 1 127 ? -23.624 -13.516 -17.008 1.00 24.78 ? 127 SER A HG   3  
ATOM 5886  N N    . ARG A 1 128 ? -22.150 -12.703 -19.515 1.00 24.79 ? 128 ARG A N    3  
ATOM 5887  C CA   . ARG A 1 128 ? -22.368 -13.403 -20.770 1.00 25.33 ? 128 ARG A CA   3  
ATOM 5888  C C    . ARG A 1 128 ? -23.606 -14.289 -20.663 1.00 25.41 ? 128 ARG A C    3  
ATOM 5889  O O    . ARG A 1 128 ? -23.589 -15.254 -19.868 1.00 25.41 ? 128 ARG A O    3  
ATOM 5890  C CB   . ARG A 1 128 ? -21.130 -14.223 -21.157 1.00 25.71 ? 128 ARG A CB   3  
ATOM 5891  C CG   . ARG A 1 128 ? -20.659 -15.189 -20.081 1.00 25.88 ? 128 ARG A CG   3  
ATOM 5892  C CD   . ARG A 1 128 ? -19.370 -15.885 -20.483 1.00 26.27 ? 128 ARG A CD   3  
ATOM 5893  N NE   . ARG A 1 128 ? -19.509 -16.643 -21.728 1.00 26.63 ? 128 ARG A NE   3  
ATOM 5894  C CZ   . ARG A 1 128 ? -18.549 -16.742 -22.646 1.00 27.12 ? 128 ARG A CZ   3  
ATOM 5895  N NH1  . ARG A 1 128 ? -17.385 -16.127 -22.466 1.00 27.29 ? 128 ARG A NH1  3  
ATOM 5896  N NH2  . ARG A 1 128 ? -18.748 -17.459 -23.744 1.00 27.52 ? 128 ARG A NH2  3  
ATOM 5897  O OXT  . ARG A 1 128 ? -24.605 -14.000 -21.351 1.00 25.55 ? 128 ARG A OXT  3  
ATOM 5898  H H    . ARG A 1 128 ? -21.641 -13.149 -18.804 1.00 24.58 ? 128 ARG A H    3  
ATOM 5899  H HA   . ARG A 1 128 ? -22.545 -12.657 -21.532 1.00 25.50 ? 128 ARG A HA   3  
ATOM 5900  H HB2  . ARG A 1 128 ? -21.356 -14.795 -22.044 1.00 25.74 ? 128 ARG A HB2  3  
ATOM 5901  H HB3  . ARG A 1 128 ? -20.319 -13.544 -21.378 1.00 25.93 ? 128 ARG A HB3  3  
ATOM 5902  H HG2  . ARG A 1 128 ? -20.491 -14.638 -19.168 1.00 25.82 ? 128 ARG A HG2  3  
ATOM 5903  H HG3  . ARG A 1 128 ? -21.425 -15.934 -19.919 1.00 25.90 ? 128 ARG A HG3  3  
ATOM 5904  H HD2  . ARG A 1 128 ? -18.600 -15.138 -20.615 1.00 26.12 ? 128 ARG A HD2  3  
ATOM 5905  H HD3  . ARG A 1 128 ? -19.080 -16.560 -19.692 1.00 26.52 ? 128 ARG A HD3  3  
ATOM 5906  H HE   . ARG A 1 128 ? -20.368 -17.109 -21.882 1.00 26.57 ? 128 ARG A HE   3  
ATOM 5907  H HH11 . ARG A 1 128 ? -17.222 -15.584 -21.639 1.00 27.05 ? 128 ARG A HH11 3  
ATOM 5908  H HH12 . ARG A 1 128 ? -16.661 -16.200 -23.162 1.00 27.71 ? 128 ARG A HH12 3  
ATOM 5909  H HH21 . ARG A 1 128 ? -19.623 -17.931 -23.892 1.00 27.46 ? 128 ARG A HH21 3  
ATOM 5910  H HH22 . ARG A 1 128 ? -18.019 -17.538 -24.434 1.00 27.94 ? 128 ARG A HH22 3  
ATOM 5911  N N    . GLY A 1 1   ? -2.266  -21.157 -9.413  1.00 11.87 ? 1   GLY A N    4  
ATOM 5912  C CA   . GLY A 1 1   ? -2.346  -21.417 -7.956  1.00 11.28 ? 1   GLY A CA   4  
ATOM 5913  C C    . GLY A 1 1   ? -3.209  -20.395 -7.252  1.00 10.17 ? 1   GLY A C    4  
ATOM 5914  O O    . GLY A 1 1   ? -4.121  -19.825 -7.852  1.00 9.93  ? 1   GLY A O    4  
ATOM 5915  H H1   . GLY A 1 1   ? -1.952  -20.177 -9.583  1.00 12.05 ? 1   GLY A H1   4  
ATOM 5916  H H2   . GLY A 1 1   ? -3.199  -21.291 -9.853  1.00 12.06 ? 1   GLY A H2   4  
ATOM 5917  H H3   . GLY A 1 1   ? -1.584  -21.808 -9.857  1.00 12.09 ? 1   GLY A H3   4  
ATOM 5918  H HA2  . GLY A 1 1   ? -2.765  -22.399 -7.797  1.00 11.56 ? 1   GLY A HA2  4  
ATOM 5919  H HA3  . GLY A 1 1   ? -1.351  -21.385 -7.538  1.00 11.57 ? 1   GLY A HA3  4  
ATOM 5920  N N    . ILE A 1 2   ? -2.929  -20.166 -5.979  1.00 9.64  ? 2   ILE A N    4  
ATOM 5921  C CA   . ILE A 1 2   ? -3.660  -19.178 -5.200  1.00 8.69  ? 2   ILE A CA   4  
ATOM 5922  C C    . ILE A 1 2   ? -2.683  -18.246 -4.492  1.00 7.70  ? 2   ILE A C    4  
ATOM 5923  O O    . ILE A 1 2   ? -1.931  -18.675 -3.617  1.00 7.79  ? 2   ILE A O    4  
ATOM 5924  C CB   . ILE A 1 2   ? -4.577  -19.842 -4.148  1.00 9.07  ? 2   ILE A CB   4  
ATOM 5925  C CG1  . ILE A 1 2   ? -5.545  -20.824 -4.818  1.00 9.41  ? 2   ILE A CG1  4  
ATOM 5926  C CG2  . ILE A 1 2   ? -5.349  -18.779 -3.379  1.00 9.20  ? 2   ILE A CG2  4  
ATOM 5927  C CD1  . ILE A 1 2   ? -6.430  -21.569 -3.842  1.00 9.86  ? 2   ILE A CD1  4  
ATOM 5928  H H    . ILE A 1 2   ? -2.205  -20.674 -5.548  1.00 10.00 ? 2   ILE A H    4  
ATOM 5929  H HA   . ILE A 1 2   ? -4.274  -18.599 -5.877  1.00 8.63  ? 2   ILE A HA   4  
ATOM 5930  H HB   . ILE A 1 2   ? -3.954  -20.380 -3.447  1.00 9.29  ? 2   ILE A HB   4  
ATOM 5931  H HG12 . ILE A 1 2   ? -6.186  -20.280 -5.493  1.00 9.55  ? 2   ILE A HG12 4  
ATOM 5932  H HG13 . ILE A 1 2   ? -4.979  -21.554 -5.376  1.00 9.48  ? 2   ILE A HG13 4  
ATOM 5933  H HG21 . ILE A 1 2   ? -5.989  -19.256 -2.651  1.00 9.37  ? 2   ILE A HG21 4  
ATOM 5934  H HG22 . ILE A 1 2   ? -5.953  -18.207 -4.066  1.00 9.31  ? 2   ILE A HG22 4  
ATOM 5935  H HG23 . ILE A 1 2   ? -4.657  -18.123 -2.874  1.00 9.29  ? 2   ILE A HG23 4  
ATOM 5936  H HD11 . ILE A 1 2   ? -7.045  -20.865 -3.303  1.00 9.83  ? 2   ILE A HD11 4  
ATOM 5937  H HD12 . ILE A 1 2   ? -5.813  -22.118 -3.145  1.00 10.30 ? 2   ILE A HD12 4  
ATOM 5938  H HD13 . ILE A 1 2   ? -7.062  -22.258 -4.383  1.00 9.99  ? 2   ILE A HD13 4  
ATOM 5939  N N    . ASP A 1 3   ? -2.687  -16.980 -4.879  1.00 6.96  ? 3   ASP A N    4  
ATOM 5940  C CA   . ASP A 1 3   ? -1.796  -16.004 -4.271  1.00 6.18  ? 3   ASP A CA   4  
ATOM 5941  C C    . ASP A 1 3   ? -2.470  -15.366 -3.056  1.00 5.44  ? 3   ASP A C    4  
ATOM 5942  O O    . ASP A 1 3   ? -3.656  -15.039 -3.094  1.00 5.15  ? 3   ASP A O    4  
ATOM 5943  C CB   . ASP A 1 3   ? -1.374  -14.922 -5.285  1.00 6.00  ? 3   ASP A CB   4  
ATOM 5944  C CG   . ASP A 1 3   ? -2.468  -13.915 -5.592  1.00 6.08  ? 3   ASP A CG   4  
ATOM 5945  O OD1  . ASP A 1 3   ? -3.261  -14.152 -6.531  1.00 6.51  ? 3   ASP A OD1  4  
ATOM 5946  O OD2  . ASP A 1 3   ? -2.525  -12.873 -4.909  1.00 6.03  ? 3   ASP A OD2  4  
ATOM 5947  H H    . ASP A 1 3   ? -3.311  -16.694 -5.583  1.00 7.10  ? 3   ASP A H    4  
ATOM 5948  H HA   . ASP A 1 3   ? -0.917  -16.533 -3.942  1.00 6.61  ? 3   ASP A HA   4  
ATOM 5949  H HB2  . ASP A 1 3   ? -0.528  -14.384 -4.887  1.00 6.26  ? 3   ASP A HB2  4  
ATOM 5950  H HB3  . ASP A 1 3   ? -1.084  -15.402 -6.208  1.00 5.95  ? 3   ASP A HB3  4  
ATOM 5951  N N    . PRO A 1 4   ? -1.736  -15.216 -1.943  1.00 5.55  ? 4   PRO A N    4  
ATOM 5952  C CA   . PRO A 1 4   ? -2.253  -14.592 -0.732  1.00 5.42  ? 4   PRO A CA   4  
ATOM 5953  C C    . PRO A 1 4   ? -2.071  -13.077 -0.743  1.00 4.78  ? 4   PRO A C    4  
ATOM 5954  O O    . PRO A 1 4   ? -2.318  -12.406 0.259   1.00 4.92  ? 4   PRO A O    4  
ATOM 5955  C CB   . PRO A 1 4   ? -1.414  -15.226 0.388   1.00 6.21  ? 4   PRO A CB   4  
ATOM 5956  C CG   . PRO A 1 4   ? -0.331  -16.020 -0.285  1.00 6.65  ? 4   PRO A CG   4  
ATOM 5957  C CD   . PRO A 1 4   ? -0.358  -15.669 -1.747  1.00 6.29  ? 4   PRO A CD   4  
ATOM 5958  H HA   . PRO A 1 4   ? -3.297  -14.827 -0.582  1.00 5.67  ? 4   PRO A HA   4  
ATOM 5959  H HB2  . PRO A 1 4   ? -0.997  -14.447 1.007   1.00 6.22  ? 4   PRO A HB2  4  
ATOM 5960  H HB3  . PRO A 1 4   ? -2.047  -15.862 0.990   1.00 6.74  ? 4   PRO A HB3  4  
ATOM 5961  H HG2  . PRO A 1 4   ? 0.626   -15.758 0.140   1.00 6.90  ? 4   PRO A HG2  4  
ATOM 5962  H HG3  . PRO A 1 4   ? -0.520  -17.076 -0.152  1.00 7.27  ? 4   PRO A HG3  4  
ATOM 5963  H HD2  . PRO A 1 4   ? 0.344   -14.877 -1.961  1.00 6.29  ? 4   PRO A HD2  4  
ATOM 5964  H HD3  . PRO A 1 4   ? -0.147  -16.539 -2.347  1.00 6.88  ? 4   PRO A HD3  4  
ATOM 5965  N N    . PHE A 1 5   ? -1.650  -12.550 -1.884  1.00 4.52  ? 5   PHE A N    4  
ATOM 5966  C CA   . PHE A 1 5   ? -1.400  -11.122 -2.028  1.00 4.35  ? 5   PHE A CA   4  
ATOM 5967  C C    . PHE A 1 5   ? -2.673  -10.401 -2.453  1.00 3.69  ? 5   PHE A C    4  
ATOM 5968  O O    . PHE A 1 5   ? -2.795  -9.188  -2.302  1.00 3.93  ? 5   PHE A O    4  
ATOM 5969  C CB   . PHE A 1 5   ? -0.296  -10.878 -3.059  1.00 5.29  ? 5   PHE A CB   4  
ATOM 5970  C CG   . PHE A 1 5   ? 1.021   -11.502 -2.700  1.00 6.13  ? 5   PHE A CG   4  
ATOM 5971  C CD1  . PHE A 1 5   ? 1.886   -10.872 -1.821  1.00 6.78  ? 5   PHE A CD1  4  
ATOM 5972  C CD2  . PHE A 1 5   ? 1.396   -12.719 -3.245  1.00 6.53  ? 5   PHE A CD2  4  
ATOM 5973  C CE1  . PHE A 1 5   ? 3.100   -11.444 -1.491  1.00 7.72  ? 5   PHE A CE1  4  
ATOM 5974  C CE2  . PHE A 1 5   ? 2.608   -13.296 -2.920  1.00 7.42  ? 5   PHE A CE2  4  
ATOM 5975  C CZ   . PHE A 1 5   ? 3.461   -12.658 -2.042  1.00 7.99  ? 5   PHE A CZ   4  
ATOM 5976  H H    . PHE A 1 5   ? -1.516  -13.137 -2.658  1.00 4.77  ? 5   PHE A H    4  
ATOM 5977  H HA   . PHE A 1 5   ? -1.080  -10.739 -1.069  1.00 4.48  ? 5   PHE A HA   4  
ATOM 5978  H HB2  . PHE A 1 5   ? -0.607  -11.285 -4.008  1.00 5.51  ? 5   PHE A HB2  4  
ATOM 5979  H HB3  . PHE A 1 5   ? -0.142  -9.813  -3.164  1.00 5.50  ? 5   PHE A HB3  4  
ATOM 5980  H HD1  . PHE A 1 5   ? 1.603   -9.923  -1.390  1.00 6.71  ? 5   PHE A HD1  4  
ATOM 5981  H HD2  . PHE A 1 5   ? 0.730   -13.219 -3.933  1.00 6.31  ? 5   PHE A HD2  4  
ATOM 5982  H HE1  . PHE A 1 5   ? 3.765   -10.943 -0.805  1.00 8.37  ? 5   PHE A HE1  4  
ATOM 5983  H HE2  . PHE A 1 5   ? 2.886   -14.245 -3.351  1.00 7.82  ? 5   PHE A HE2  4  
ATOM 5984  H HZ   . PHE A 1 5   ? 4.411   -13.109 -1.788  1.00 8.77  ? 5   PHE A HZ   4  
ATOM 5985  N N    . THR A 1 6   ? -3.609  -11.167 -2.993  1.00 3.31  ? 6   THR A N    4  
ATOM 5986  C CA   . THR A 1 6   ? -4.882  -10.635 -3.450  1.00 3.02  ? 6   THR A CA   4  
ATOM 5987  C C    . THR A 1 6   ? -5.846  -10.430 -2.264  1.00 2.13  ? 6   THR A C    4  
ATOM 5988  O O    . THR A 1 6   ? -5.403  -10.154 -1.146  1.00 2.37  ? 6   THR A O    4  
ATOM 5989  C CB   . THR A 1 6   ? -5.497  -11.578 -4.520  1.00 3.65  ? 6   THR A CB   4  
ATOM 5990  O OG1  . THR A 1 6   ? -6.630  -10.959 -5.146  1.00 4.26  ? 6   THR A OG1  4  
ATOM 5991  C CG2  . THR A 1 6   ? -5.909  -12.922 -3.922  1.00 4.04  ? 6   THR A CG2  4  
ATOM 5992  H H    . THR A 1 6   ? -3.429  -12.123 -3.111  1.00 3.60  ? 6   THR A H    4  
ATOM 5993  H HA   . THR A 1 6   ? -4.692  -9.676  -3.914  1.00 3.50  ? 6   THR A HA   4  
ATOM 5994  H HB   . THR A 1 6   ? -4.745  -11.762 -5.276  1.00 3.99  ? 6   THR A HB   4  
ATOM 5995  H HG1  . THR A 1 6   ? -6.357  -10.589 -5.999  1.00 4.39  ? 6   THR A HG1  4  
ATOM 5996  H HG21 . THR A 1 6   ? -5.044  -13.400 -3.484  1.00 4.31  ? 6   THR A HG21 4  
ATOM 5997  H HG22 . THR A 1 6   ? -6.314  -13.553 -4.697  1.00 4.49  ? 6   THR A HG22 4  
ATOM 5998  H HG23 . THR A 1 6   ? -6.657  -12.763 -3.159  1.00 4.15  ? 6   THR A HG23 4  
ATOM 5999  N N    . MET A 1 7   ? -7.153  -10.541 -2.528  1.00 1.53  ? 7   MET A N    4  
ATOM 6000  C CA   . MET A 1 7   ? -8.198  -10.363 -1.525  1.00 1.05  ? 7   MET A CA   4  
ATOM 6001  C C    . MET A 1 7   ? -8.403  -8.879  -1.218  1.00 0.83  ? 7   MET A C    4  
ATOM 6002  O O    . MET A 1 7   ? -9.050  -8.520  -0.240  1.00 1.39  ? 7   MET A O    4  
ATOM 6003  C CB   . MET A 1 7   ? -7.887  -11.153 -0.246  1.00 1.50  ? 7   MET A CB   4  
ATOM 6004  C CG   . MET A 1 7   ? -9.074  -11.278 0.684   1.00 2.32  ? 7   MET A CG   4  
ATOM 6005  S SD   . MET A 1 7   ? -8.650  -12.026 2.269   1.00 3.29  ? 7   MET A SD   4  
ATOM 6006  C CE   . MET A 1 7   ? -10.219 -11.897 3.124   1.00 3.84  ? 7   MET A CE   4  
ATOM 6007  H H    . MET A 1 7   ? -7.426  -10.774 -3.441  1.00 1.86  ? 7   MET A H    4  
ATOM 6008  H HA   . MET A 1 7   ? -9.116  -10.746 -1.949  1.00 1.34  ? 7   MET A HA   4  
ATOM 6009  H HB2  . MET A 1 7   ? -7.564  -12.146 -0.522  1.00 1.93  ? 7   MET A HB2  4  
ATOM 6010  H HB3  . MET A 1 7   ? -7.088  -10.657 0.286   1.00 1.78  ? 7   MET A HB3  4  
ATOM 6011  H HG2  . MET A 1 7   ? -9.476  -10.293 0.860   1.00 2.59  ? 7   MET A HG2  4  
ATOM 6012  H HG3  . MET A 1 7   ? -9.821  -11.887 0.197   1.00 2.65  ? 7   MET A HG3  4  
ATOM 6013  H HE1  . MET A 1 7   ? -10.503 -10.858 3.198   1.00 4.06  ? 7   MET A HE1  4  
ATOM 6014  H HE2  . MET A 1 7   ? -10.127 -12.316 4.114   1.00 4.06  ? 7   MET A HE2  4  
ATOM 6015  H HE3  . MET A 1 7   ? -10.975 -12.440 2.573   1.00 4.32  ? 7   MET A HE3  4  
ATOM 6016  N N    . LEU A 1 8   ? -7.846  -8.026  -2.079  1.00 0.80  ? 8   LEU A N    4  
ATOM 6017  C CA   . LEU A 1 8   ? -8.028  -6.573  -1.993  1.00 0.56  ? 8   LEU A CA   4  
ATOM 6018  C C    . LEU A 1 8   ? -7.485  -5.996  -0.689  1.00 0.48  ? 8   LEU A C    4  
ATOM 6019  O O    . LEU A 1 8   ? -7.944  -4.953  -0.226  1.00 0.47  ? 8   LEU A O    4  
ATOM 6020  C CB   . LEU A 1 8   ? -9.507  -6.202  -2.127  1.00 0.47  ? 8   LEU A CB   4  
ATOM 6021  C CG   . LEU A 1 8   ? -10.178 -6.628  -3.428  1.00 0.56  ? 8   LEU A CG   4  
ATOM 6022  C CD1  . LEU A 1 8   ? -11.622 -6.166  -3.441  1.00 0.61  ? 8   LEU A CD1  4  
ATOM 6023  C CD2  . LEU A 1 8   ? -9.435  -6.062  -4.621  1.00 0.72  ? 8   LEU A CD2  4  
ATOM 6024  H H    . LEU A 1 8   ? -7.295  -8.389  -2.800  1.00 1.36  ? 8   LEU A H    4  
ATOM 6025  H HA   . LEU A 1 8   ? -7.487  -6.128  -2.814  1.00 0.70  ? 8   LEU A HA   4  
ATOM 6026  H HB2  . LEU A 1 8   ? -10.040 -6.660  -1.308  1.00 0.54  ? 8   LEU A HB2  4  
ATOM 6027  H HB3  . LEU A 1 8   ? -9.595  -5.130  -2.037  1.00 0.53  ? 8   LEU A HB3  4  
ATOM 6028  H HG   . LEU A 1 8   ? -10.167 -7.705  -3.500  1.00 0.64  ? 8   LEU A HG   4  
ATOM 6029  H HD11 . LEU A 1 8   ? -12.100 -6.507  -4.347  1.00 1.21  ? 8   LEU A HD11 4  
ATOM 6030  H HD12 . LEU A 1 8   ? -11.648 -5.086  -3.403  1.00 0.99  ? 8   LEU A HD12 4  
ATOM 6031  H HD13 . LEU A 1 8   ? -12.136 -6.569  -2.581  1.00 1.34  ? 8   LEU A HD13 4  
ATOM 6032  H HD21 . LEU A 1 8   ? -9.468  -4.983  -4.588  1.00 1.31  ? 8   LEU A HD21 4  
ATOM 6033  H HD22 . LEU A 1 8   ? -9.896  -6.409  -5.532  1.00 1.24  ? 8   LEU A HD22 4  
ATOM 6034  H HD23 . LEU A 1 8   ? -8.405  -6.391  -4.591  1.00 1.27  ? 8   LEU A HD23 4  
ATOM 6035  N N    . ARG A 1 9   ? -6.495  -6.650  -0.117  1.00 0.52  ? 9   ARG A N    4  
ATOM 6036  C CA   . ARG A 1 9   ? -5.939  -6.206  1.148   1.00 0.51  ? 9   ARG A CA   4  
ATOM 6037  C C    . ARG A 1 9   ? -4.529  -5.663  0.953   1.00 0.43  ? 9   ARG A C    4  
ATOM 6038  O O    . ARG A 1 9   ? -3.768  -6.167  0.123   1.00 0.47  ? 9   ARG A O    4  
ATOM 6039  C CB   . ARG A 1 9   ? -5.921  -7.356  2.156   1.00 0.69  ? 9   ARG A CB   4  
ATOM 6040  C CG   . ARG A 1 9   ? -5.043  -8.517  1.734   1.00 1.15  ? 9   ARG A CG   4  
ATOM 6041  C CD   . ARG A 1 9   ? -4.910  -9.540  2.843   1.00 1.21  ? 9   ARG A CD   4  
ATOM 6042  N NE   . ARG A 1 9   ? -3.947  -10.589 2.502   1.00 1.84  ? 9   ARG A NE   4  
ATOM 6043  C CZ   . ARG A 1 9   ? -3.332  -11.365 3.398   1.00 2.23  ? 9   ARG A CZ   4  
ATOM 6044  N NH1  . ARG A 1 9   ? -3.550  -11.190 4.698   1.00 2.21  ? 9   ARG A NH1  4  
ATOM 6045  N NH2  . ARG A 1 9   ? -2.482  -12.304 2.995   1.00 3.09  ? 9   ARG A NH2  4  
ATOM 6046  H H    . ARG A 1 9   ? -6.124  -7.444  -0.552  1.00 0.60  ? 9   ARG A H    4  
ATOM 6047  H HA   . ARG A 1 9   ? -6.567  -5.416  1.528   1.00 0.51  ? 9   ARG A HA   4  
ATOM 6048  H HB2  . ARG A 1 9   ? -5.561  -6.984  3.104   1.00 1.21  ? 9   ARG A HB2  4  
ATOM 6049  H HB3  . ARG A 1 9   ? -6.930  -7.722  2.283   1.00 1.12  ? 9   ARG A HB3  4  
ATOM 6050  H HG2  . ARG A 1 9   ? -5.487  -8.994  0.873   1.00 1.62  ? 9   ARG A HG2  4  
ATOM 6051  H HG3  . ARG A 1 9   ? -4.063  -8.143  1.478   1.00 1.68  ? 9   ARG A HG3  4  
ATOM 6052  H HD2  . ARG A 1 9   ? -4.580  -9.037  3.740   1.00 1.50  ? 9   ARG A HD2  4  
ATOM 6053  H HD3  . ARG A 1 9   ? -5.877  -9.989  3.015   1.00 1.36  ? 9   ARG A HD3  4  
ATOM 6054  H HE   . ARG A 1 9   ? -3.748  -10.718 1.545   1.00 2.36  ? 9   ARG A HE   4  
ATOM 6055  H HH11 . ARG A 1 9   ? -4.171  -10.460 5.017   1.00 1.99  ? 9   ARG A HH11 4  
ATOM 6056  H HH12 . ARG A 1 9   ? -3.109  -11.795 5.371   1.00 2.76  ? 9   ARG A HH12 4  
ATOM 6057  H HH21 . ARG A 1 9   ? -2.299  -12.433 2.013   1.00 3.51  ? 9   ARG A HH21 4  
ATOM 6058  H HH22 . ARG A 1 9   ? -2.006  -12.878 3.669   1.00 3.49  ? 9   ARG A HH22 4  
ATOM 6059  N N    . PRO A 1 10  ? -4.177  -4.606  1.699   1.00 0.36  ? 10  PRO A N    4  
ATOM 6060  C CA   . PRO A 1 10  ? -2.819  -4.070  1.714   1.00 0.30  ? 10  PRO A CA   4  
ATOM 6061  C C    . PRO A 1 10  ? -1.882  -4.971  2.512   1.00 0.28  ? 10  PRO A C    4  
ATOM 6062  O O    . PRO A 1 10  ? -2.315  -5.965  3.098   1.00 0.38  ? 10  PRO A O    4  
ATOM 6063  C CB   . PRO A 1 10  ? -2.984  -2.713  2.401   1.00 0.29  ? 10  PRO A CB   4  
ATOM 6064  C CG   . PRO A 1 10  ? -4.169  -2.881  3.288   1.00 0.47  ? 10  PRO A CG   4  
ATOM 6065  C CD   . PRO A 1 10  ? -5.081  -3.851  2.586   1.00 0.40  ? 10  PRO A CD   4  
ATOM 6066  H HA   . PRO A 1 10  ? -2.432  -3.934  0.715   1.00 0.33  ? 10  PRO A HA   4  
ATOM 6067  H HB2  . PRO A 1 10  ? -2.094  -2.484  2.969   1.00 0.37  ? 10  PRO A HB2  4  
ATOM 6068  H HB3  . PRO A 1 10  ? -3.153  -1.947  1.659   1.00 0.38  ? 10  PRO A HB3  4  
ATOM 6069  H HG2  . PRO A 1 10  ? -3.860  -3.280  4.242   1.00 0.70  ? 10  PRO A HG2  4  
ATOM 6070  H HG3  . PRO A 1 10  ? -4.665  -1.931  3.421   1.00 0.81  ? 10  PRO A HG3  4  
ATOM 6071  H HD2  . PRO A 1 10  ? -5.555  -4.508  3.303   1.00 0.50  ? 10  PRO A HD2  4  
ATOM 6072  H HD3  . PRO A 1 10  ? -5.823  -3.319  2.012   1.00 0.57  ? 10  PRO A HD3  4  
ATOM 6073  N N    . ARG A 1 11  ? -0.606  -4.624  2.551   1.00 0.29  ? 11  ARG A N    4  
ATOM 6074  C CA   . ARG A 1 11  ? 0.373   -5.429  3.269   1.00 0.34  ? 11  ARG A CA   4  
ATOM 6075  C C    . ARG A 1 11  ? 1.469   -4.560  3.873   1.00 0.27  ? 11  ARG A C    4  
ATOM 6076  O O    . ARG A 1 11  ? 1.937   -3.606  3.248   1.00 0.27  ? 11  ARG A O    4  
ATOM 6077  C CB   . ARG A 1 11  ? 0.961   -6.491  2.336   1.00 0.49  ? 11  ARG A CB   4  
ATOM 6078  C CG   . ARG A 1 11  ? 1.311   -5.972  0.950   1.00 0.63  ? 11  ARG A CG   4  
ATOM 6079  C CD   . ARG A 1 11  ? 1.611   -7.113  -0.005  1.00 1.00  ? 11  ARG A CD   4  
ATOM 6080  N NE   . ARG A 1 11  ? 1.721   -6.653  -1.389  1.00 1.22  ? 11  ARG A NE   4  
ATOM 6081  C CZ   . ARG A 1 11  ? 0.888   -7.023  -2.360  1.00 1.59  ? 11  ARG A CZ   4  
ATOM 6082  N NH1  . ARG A 1 11  ? -0.158  -7.790  -2.090  1.00 1.95  ? 11  ARG A NH1  4  
ATOM 6083  N NH2  . ARG A 1 11  ? 1.088   -6.605  -3.597  1.00 2.37  ? 11  ARG A NH2  4  
ATOM 6084  H H    . ARG A 1 11  ? -0.312  -3.811  2.082   1.00 0.33  ? 11  ARG A H    4  
ATOM 6085  H HA   . ARG A 1 11  ? -0.147  -5.930  4.073   1.00 0.40  ? 11  ARG A HA   4  
ATOM 6086  H HB2  . ARG A 1 11  ? 1.860   -6.887  2.784   1.00 0.63  ? 11  ARG A HB2  4  
ATOM 6087  H HB3  . ARG A 1 11  ? 0.244   -7.291  2.224   1.00 0.78  ? 11  ARG A HB3  4  
ATOM 6088  H HG2  . ARG A 1 11  ? 0.477   -5.404  0.565   1.00 0.94  ? 11  ARG A HG2  4  
ATOM 6089  H HG3  . ARG A 1 11  ? 2.181   -5.335  1.024   1.00 0.71  ? 11  ARG A HG3  4  
ATOM 6090  H HD2  . ARG A 1 11  ? 2.543   -7.573  0.288   1.00 1.68  ? 11  ARG A HD2  4  
ATOM 6091  H HD3  . ARG A 1 11  ? 0.815   -7.840  0.062   1.00 1.50  ? 11  ARG A HD3  4  
ATOM 6092  H HE   . ARG A 1 11  ? 2.468   -6.049  -1.613  1.00 1.83  ? 11  ARG A HE   4  
ATOM 6093  H HH11 . ARG A 1 11  ? -0.331  -8.096  -1.153  1.00 2.06  ? 11  ARG A HH11 4  
ATOM 6094  H HH12 . ARG A 1 11  ? -0.785  -8.068  -2.829  1.00 2.55  ? 11  ARG A HH12 4  
ATOM 6095  H HH21 . ARG A 1 11  ? 1.872   -5.996  -3.807  1.00 2.82  ? 11  ARG A HH21 4  
ATOM 6096  H HH22 . ARG A 1 11  ? 0.470   -6.895  -4.335  1.00 2.79  ? 11  ARG A HH22 4  
ATOM 6097  N N    . LEU A 1 12  ? 1.850   -4.886  5.107   1.00 0.29  ? 12  LEU A N    4  
ATOM 6098  C CA   . LEU A 1 12  ? 2.902   -4.165  5.812   1.00 0.26  ? 12  LEU A CA   4  
ATOM 6099  C C    . LEU A 1 12  ? 4.240   -4.847  5.593   1.00 0.25  ? 12  LEU A C    4  
ATOM 6100  O O    . LEU A 1 12  ? 4.433   -5.999  5.982   1.00 0.32  ? 12  LEU A O    4  
ATOM 6101  C CB   . LEU A 1 12  ? 2.614   -4.103  7.318   1.00 0.34  ? 12  LEU A CB   4  
ATOM 6102  C CG   . LEU A 1 12  ? 2.410   -2.700  7.909   1.00 0.60  ? 12  LEU A CG   4  
ATOM 6103  C CD1  . LEU A 1 12  ? 2.252   -2.780  9.420   1.00 1.32  ? 12  LEU A CD1  4  
ATOM 6104  C CD2  . LEU A 1 12  ? 3.570   -1.778  7.557   1.00 1.28  ? 12  LEU A CD2  4  
ATOM 6105  H H    . LEU A 1 12  ? 1.417   -5.647  5.553   1.00 0.35  ? 12  LEU A H    4  
ATOM 6106  H HA   . LEU A 1 12  ? 2.948   -3.162  5.417   1.00 0.24  ? 12  LEU A HA   4  
ATOM 6107  H HB2  . LEU A 1 12  ? 1.721   -4.680  7.511   1.00 0.72  ? 12  LEU A HB2  4  
ATOM 6108  H HB3  . LEU A 1 12  ? 3.438   -4.569  7.837   1.00 0.66  ? 12  LEU A HB3  4  
ATOM 6109  H HG   . LEU A 1 12  ? 1.506   -2.273  7.500   1.00 1.58  ? 12  LEU A HG   4  
ATOM 6110  H HD11 . LEU A 1 12  ? 3.151   -3.194  9.855   1.00 1.80  ? 12  LEU A HD11 4  
ATOM 6111  H HD12 . LEU A 1 12  ? 1.410   -3.410  9.663   1.00 1.95  ? 12  LEU A HD12 4  
ATOM 6112  H HD13 . LEU A 1 12  ? 2.085   -1.789  9.816   1.00 1.91  ? 12  LEU A HD13 4  
ATOM 6113  H HD21 . LEU A 1 12  ? 3.362   -0.784  7.929   1.00 1.90  ? 12  LEU A HD21 4  
ATOM 6114  H HD22 . LEU A 1 12  ? 3.692   -1.743  6.485   1.00 1.96  ? 12  LEU A HD22 4  
ATOM 6115  H HD23 . LEU A 1 12  ? 4.478   -2.146  8.015   1.00 1.71  ? 12  LEU A HD23 4  
ATOM 6116  N N    . CYS A 1 13  ? 5.151   -4.148  4.955   1.00 0.23  ? 13  CYS A N    4  
ATOM 6117  C CA   . CYS A 1 13  ? 6.488   -4.655  4.757   1.00 0.25  ? 13  CYS A CA   4  
ATOM 6118  C C    . CYS A 1 13  ? 7.404   -4.081  5.832   1.00 0.22  ? 13  CYS A C    4  
ATOM 6119  O O    . CYS A 1 13  ? 7.614   -2.873  5.891   1.00 0.24  ? 13  CYS A O    4  
ATOM 6120  C CB   . CYS A 1 13  ? 6.984   -4.250  3.369   1.00 0.29  ? 13  CYS A CB   4  
ATOM 6121  S SG   . CYS A 1 13  ? 5.727   -4.390  2.073   1.00 0.40  ? 13  CYS A SG   4  
ATOM 6122  H H    . CYS A 1 13  ? 4.918   -3.259  4.600   1.00 0.23  ? 13  CYS A H    4  
ATOM 6123  H HA   . CYS A 1 13  ? 6.464   -5.733  4.836   1.00 0.28  ? 13  CYS A HA   4  
ATOM 6124  H HB2  . CYS A 1 13  ? 7.313   -3.223  3.397   1.00 0.31  ? 13  CYS A HB2  4  
ATOM 6125  H HB3  . CYS A 1 13  ? 7.814   -4.884  3.093   1.00 0.31  ? 13  CYS A HB3  4  
ATOM 6126  H HG   . CYS A 1 13  ? 5.832   -5.590  1.517   1.00 1.17  ? 13  CYS A HG   4  
ATOM 6127  N N    . THR A 1 14  ? 7.943   -4.936  6.683   1.00 0.23  ? 14  THR A N    4  
ATOM 6128  C CA   . THR A 1 14  ? 8.823   -4.474  7.741   1.00 0.24  ? 14  THR A CA   4  
ATOM 6129  C C    . THR A 1 14  ? 10.245  -4.927  7.447   1.00 0.22  ? 14  THR A C    4  
ATOM 6130  O O    . THR A 1 14  ? 10.531  -6.125  7.402   1.00 0.25  ? 14  THR A O    4  
ATOM 6131  C CB   . THR A 1 14  ? 8.367   -5.008  9.113   1.00 0.31  ? 14  THR A CB   4  
ATOM 6132  O OG1  . THR A 1 14  ? 6.978   -4.706  9.311   1.00 0.35  ? 14  THR A OG1  4  
ATOM 6133  C CG2  . THR A 1 14  ? 9.182   -4.389  10.240  1.00 0.35  ? 14  THR A CG2  4  
ATOM 6134  H H    . THR A 1 14  ? 7.760   -5.894  6.590   1.00 0.26  ? 14  THR A H    4  
ATOM 6135  H HA   . THR A 1 14  ? 8.791   -3.394  7.762   1.00 0.23  ? 14  THR A HA   4  
ATOM 6136  H HB   . THR A 1 14  ? 8.503   -6.080  9.132   1.00 0.33  ? 14  THR A HB   4  
ATOM 6137  H HG1  . THR A 1 14  ? 6.437   -5.454  9.000   1.00 0.65  ? 14  THR A HG1  4  
ATOM 6138  H HG21 . THR A 1 14  ? 8.869   -4.809  11.185  1.00 1.01  ? 14  THR A HG21 4  
ATOM 6139  H HG22 . THR A 1 14  ? 9.026   -3.320  10.253  1.00 1.13  ? 14  THR A HG22 4  
ATOM 6140  H HG23 . THR A 1 14  ? 10.229  -4.599  10.082  1.00 1.10  ? 14  THR A HG23 4  
ATOM 6141  N N    . MET A 1 15  ? 11.135  -3.968  7.260   1.00 0.20  ? 15  MET A N    4  
ATOM 6142  C CA   . MET A 1 15  ? 12.475  -4.267  6.793   1.00 0.19  ? 15  MET A CA   4  
ATOM 6143  C C    . MET A 1 15  ? 13.518  -3.504  7.594   1.00 0.21  ? 15  MET A C    4  
ATOM 6144  O O    . MET A 1 15  ? 13.320  -2.342  7.942   1.00 0.21  ? 15  MET A O    4  
ATOM 6145  C CB   . MET A 1 15  ? 12.593  -3.919  5.305   1.00 0.21  ? 15  MET A CB   4  
ATOM 6146  C CG   . MET A 1 15  ? 12.328  -2.453  5.000   1.00 0.24  ? 15  MET A CG   4  
ATOM 6147  S SD   . MET A 1 15  ? 12.368  -2.079  3.238   1.00 0.88  ? 15  MET A SD   4  
ATOM 6148  C CE   . MET A 1 15  ? 10.824  -2.815  2.705   1.00 0.28  ? 15  MET A CE   4  
ATOM 6149  H H    . MET A 1 15  ? 10.884  -3.032  7.436   1.00 0.21  ? 15  MET A H    4  
ATOM 6150  H HA   . MET A 1 15  ? 12.640  -5.325  6.919   1.00 0.22  ? 15  MET A HA   4  
ATOM 6151  H HB2  . MET A 1 15  ? 13.591  -4.158  4.970   1.00 0.26  ? 15  MET A HB2  4  
ATOM 6152  H HB3  . MET A 1 15  ? 11.883  -4.514  4.749   1.00 0.23  ? 15  MET A HB3  4  
ATOM 6153  H HG2  . MET A 1 15  ? 11.353  -2.195  5.384   1.00 0.48  ? 15  MET A HG2  4  
ATOM 6154  H HG3  . MET A 1 15  ? 13.075  -1.858  5.501   1.00 0.46  ? 15  MET A HG3  4  
ATOM 6155  H HE1  . MET A 1 15  ? 10.002  -2.322  3.200   1.00 1.04  ? 15  MET A HE1  4  
ATOM 6156  H HE2  . MET A 1 15  ? 10.819  -3.866  2.957   1.00 1.08  ? 15  MET A HE2  4  
ATOM 6157  H HE3  . MET A 1 15  ? 10.721  -2.701  1.636   1.00 1.03  ? 15  MET A HE3  4  
ATOM 6158  N N    . LYS A 1 16  ? 14.620  -4.169  7.885   1.00 0.29  ? 16  LYS A N    4  
ATOM 6159  C CA   . LYS A 1 16  ? 15.724  -3.558  8.605   1.00 0.37  ? 16  LYS A CA   4  
ATOM 6160  C C    . LYS A 1 16  ? 16.906  -3.386  7.662   1.00 0.40  ? 16  LYS A C    4  
ATOM 6161  O O    . LYS A 1 16  ? 17.033  -4.122  6.680   1.00 0.48  ? 16  LYS A O    4  
ATOM 6162  C CB   . LYS A 1 16  ? 16.124  -4.427  9.802   1.00 0.50  ? 16  LYS A CB   4  
ATOM 6163  C CG   . LYS A 1 16  ? 17.168  -3.783  10.700  1.00 0.90  ? 16  LYS A CG   4  
ATOM 6164  C CD   . LYS A 1 16  ? 17.595  -4.713  11.823  1.00 1.09  ? 16  LYS A CD   4  
ATOM 6165  C CE   . LYS A 1 16  ? 18.683  -4.084  12.684  1.00 1.96  ? 16  LYS A CE   4  
ATOM 6166  N NZ   . LYS A 1 16  ? 19.888  -3.729  11.887  1.00 2.58  ? 16  LYS A NZ   4  
ATOM 6167  H H    . LYS A 1 16  ? 14.702  -5.100  7.597   1.00 0.34  ? 16  LYS A H    4  
ATOM 6168  H HA   . LYS A 1 16  ? 15.404  -2.588  8.957   1.00 0.41  ? 16  LYS A HA   4  
ATOM 6169  H HB2  . LYS A 1 16  ? 15.245  -4.630  10.396  1.00 0.99  ? 16  LYS A HB2  4  
ATOM 6170  H HB3  . LYS A 1 16  ? 16.522  -5.361  9.435   1.00 1.07  ? 16  LYS A HB3  4  
ATOM 6171  H HG2  . LYS A 1 16  ? 18.034  -3.533  10.105  1.00 1.53  ? 16  LYS A HG2  4  
ATOM 6172  H HG3  . LYS A 1 16  ? 16.751  -2.884  11.127  1.00 1.46  ? 16  LYS A HG3  4  
ATOM 6173  H HD2  . LYS A 1 16  ? 16.738  -4.927  12.443  1.00 1.54  ? 16  LYS A HD2  4  
ATOM 6174  H HD3  . LYS A 1 16  ? 17.970  -5.631  11.396  1.00 1.45  ? 16  LYS A HD3  4  
ATOM 6175  H HE2  . LYS A 1 16  ? 18.291  -3.188  13.142  1.00 2.45  ? 16  LYS A HE2  4  
ATOM 6176  H HE3  . LYS A 1 16  ? 18.966  -4.788  13.455  1.00 2.53  ? 16  LYS A HE3  4  
ATOM 6177  H HZ1  . LYS A 1 16  ? 19.663  -2.947  11.226  1.00 2.80  ? 16  LYS A HZ1  4  
ATOM 6178  H HZ2  . LYS A 1 16  ? 20.213  -4.553  11.337  1.00 3.11  ? 16  LYS A HZ2  4  
ATOM 6179  H HZ3  . LYS A 1 16  ? 20.660  -3.419  12.516  1.00 3.02  ? 16  LYS A HZ3  4  
ATOM 6180  N N    . LYS A 1 17  ? 17.748  -2.402  7.943   1.00 0.41  ? 17  LYS A N    4  
ATOM 6181  C CA   . LYS A 1 17  ? 18.905  -2.131  7.112   1.00 0.50  ? 17  LYS A CA   4  
ATOM 6182  C C    . LYS A 1 17  ? 19.938  -3.241  7.232   1.00 0.60  ? 17  LYS A C    4  
ATOM 6183  O O    . LYS A 1 17  ? 20.729  -3.285  8.176   1.00 0.67  ? 17  LYS A O    4  
ATOM 6184  C CB   . LYS A 1 17  ? 19.531  -0.800  7.491   1.00 0.51  ? 17  LYS A CB   4  
ATOM 6185  C CG   . LYS A 1 17  ? 19.688  0.141   6.314   1.00 0.52  ? 17  LYS A CG   4  
ATOM 6186  C CD   . LYS A 1 17  ? 20.255  1.481   6.738   1.00 0.53  ? 17  LYS A CD   4  
ATOM 6187  C CE   . LYS A 1 17  ? 19.296  2.217   7.653   1.00 0.62  ? 17  LYS A CE   4  
ATOM 6188  N NZ   . LYS A 1 17  ? 19.870  3.495   8.142   1.00 0.92  ? 17  LYS A NZ   4  
ATOM 6189  H H    . LYS A 1 17  ? 17.579  -1.830  8.733   1.00 0.41  ? 17  LYS A H    4  
ATOM 6190  H HA   . LYS A 1 17  ? 18.570  -2.079  6.087   1.00 0.52  ? 17  LYS A HA   4  
ATOM 6191  H HB2  . LYS A 1 17  ? 18.911  -0.320  8.232   1.00 0.68  ? 17  LYS A HB2  4  
ATOM 6192  H HB3  . LYS A 1 17  ? 20.502  -0.987  7.912   1.00 0.68  ? 17  LYS A HB3  4  
ATOM 6193  H HG2  . LYS A 1 17  ? 20.351  -0.309  5.592   1.00 0.67  ? 17  LYS A HG2  4  
ATOM 6194  H HG3  . LYS A 1 17  ? 18.717  0.295   5.870   1.00 0.68  ? 17  LYS A HG3  4  
ATOM 6195  H HD2  . LYS A 1 17  ? 21.185  1.319   7.263   1.00 0.91  ? 17  LYS A HD2  4  
ATOM 6196  H HD3  . LYS A 1 17  ? 20.433  2.083   5.859   1.00 0.79  ? 17  LYS A HD3  4  
ATOM 6197  H HE2  . LYS A 1 17  ? 18.387  2.426   7.108   1.00 0.85  ? 17  LYS A HE2  4  
ATOM 6198  H HE3  . LYS A 1 17  ? 19.069  1.585   8.501   1.00 0.95  ? 17  LYS A HE3  4  
ATOM 6199  H HZ1  . LYS A 1 17  ? 20.744  3.313   8.682   1.00 1.50  ? 17  LYS A HZ1  4  
ATOM 6200  H HZ2  . LYS A 1 17  ? 19.187  3.980   8.761   1.00 1.28  ? 17  LYS A HZ2  4  
ATOM 6201  H HZ3  . LYS A 1 17  ? 20.097  4.117   7.336   1.00 1.39  ? 17  LYS A HZ3  4  
ATOM 6202  N N    . GLY A 1 18  ? 19.916  -4.129  6.262   1.00 0.68  ? 18  GLY A N    4  
ATOM 6203  C CA   . GLY A 1 18  ? 20.834  -5.244  6.241   1.00 0.85  ? 18  GLY A CA   4  
ATOM 6204  C C    . GLY A 1 18  ? 21.913  -5.052  5.201   1.00 1.05  ? 18  GLY A C    4  
ATOM 6205  O O    . GLY A 1 18  ? 22.808  -4.228  5.387   1.00 1.28  ? 18  GLY A O    4  
ATOM 6206  H H    . GLY A 1 18  ? 19.272  -4.015  5.540   1.00 0.68  ? 18  GLY A H    4  
ATOM 6207  H HA2  . GLY A 1 18  ? 21.295  -5.339  7.214   1.00 0.90  ? 18  GLY A HA2  4  
ATOM 6208  H HA3  . GLY A 1 18  ? 20.287  -6.148  6.017   1.00 0.94  ? 18  GLY A HA3  4  
ATOM 6209  N N    . PRO A 1 19  ? 21.849  -5.793  4.087   1.00 1.24  ? 19  PRO A N    4  
ATOM 6210  C CA   . PRO A 1 19  ? 22.818  -5.668  2.998   1.00 1.57  ? 19  PRO A CA   4  
ATOM 6211  C C    . PRO A 1 19  ? 22.682  -4.355  2.224   1.00 1.57  ? 19  PRO A C    4  
ATOM 6212  O O    . PRO A 1 19  ? 22.009  -4.291  1.192   1.00 2.23  ? 19  PRO A O    4  
ATOM 6213  C CB   . PRO A 1 19  ? 22.508  -6.863  2.094   1.00 1.91  ? 19  PRO A CB   4  
ATOM 6214  C CG   . PRO A 1 19  ? 21.087  -7.207  2.380   1.00 1.86  ? 19  PRO A CG   4  
ATOM 6215  C CD   . PRO A 1 19  ? 20.846  -6.837  3.818   1.00 1.40  ? 19  PRO A CD   4  
ATOM 6216  H HA   . PRO A 1 19  ? 23.831  -5.753  3.366   1.00 1.77  ? 19  PRO A HA   4  
ATOM 6217  H HB2  . PRO A 1 19  ? 22.646  -6.579  1.060   1.00 2.10  ? 19  PRO A HB2  4  
ATOM 6218  H HB3  . PRO A 1 19  ? 23.169  -7.682  2.337   1.00 2.19  ? 19  PRO A HB3  4  
ATOM 6219  H HG2  . PRO A 1 19  ? 20.437  -6.636  1.735   1.00 2.16  ? 19  PRO A HG2  4  
ATOM 6220  H HG3  . PRO A 1 19  ? 20.929  -8.264  2.234   1.00 2.10  ? 19  PRO A HG3  4  
ATOM 6221  H HD2  . PRO A 1 19  ? 19.846  -6.451  3.945   1.00 1.45  ? 19  PRO A HD2  4  
ATOM 6222  H HD3  . PRO A 1 19  ? 21.003  -7.694  4.458   1.00 1.43  ? 19  PRO A HD3  4  
ATOM 6223  N N    . SER A 1 20  ? 23.310  -3.314  2.756   1.00 1.40  ? 20  SER A N    4  
ATOM 6224  C CA   . SER A 1 20  ? 23.457  -2.033  2.070   1.00 1.65  ? 20  SER A CA   4  
ATOM 6225  C C    . SER A 1 20  ? 22.121  -1.335  1.792   1.00 1.43  ? 20  SER A C    4  
ATOM 6226  O O    . SER A 1 20  ? 21.712  -1.189  0.641   1.00 1.93  ? 20  SER A O    4  
ATOM 6227  C CB   . SER A 1 20  ? 24.243  -2.228  0.772   1.00 2.14  ? 20  SER A CB   4  
ATOM 6228  O OG   . SER A 1 20  ? 25.522  -2.779  1.041   1.00 2.87  ? 20  SER A OG   4  
ATOM 6229  H H    . SER A 1 20  ? 23.692  -3.411  3.656   1.00 1.61  ? 20  SER A H    4  
ATOM 6230  H HA   . SER A 1 20  ? 24.037  -1.395  2.719   1.00 1.88  ? 20  SER A HA   4  
ATOM 6231  H HB2  . SER A 1 20  ? 23.704  -2.901  0.123   1.00 2.20  ? 20  SER A HB2  4  
ATOM 6232  H HB3  . SER A 1 20  ? 24.368  -1.274  0.281   1.00 2.54  ? 20  SER A HB3  4  
ATOM 6233  H HG   . SER A 1 20  ? 25.421  -3.700  1.328   1.00 3.28  ? 20  SER A HG   4  
ATOM 6234  N N    . GLY A 1 21  ? 21.454  -0.904  2.856   1.00 1.04  ? 21  GLY A N    4  
ATOM 6235  C CA   . GLY A 1 21  ? 20.315  -0.010  2.718   1.00 0.94  ? 21  GLY A CA   4  
ATOM 6236  C C    . GLY A 1 21  ? 19.083  -0.657  2.115   1.00 0.97  ? 21  GLY A C    4  
ATOM 6237  O O    . GLY A 1 21  ? 18.574  -0.184  1.100   1.00 1.93  ? 21  GLY A O    4  
ATOM 6238  H H    . GLY A 1 21  ? 21.737  -1.199  3.755   1.00 1.21  ? 21  GLY A H    4  
ATOM 6239  H HA2  . GLY A 1 21  ? 20.055  0.369   3.695   1.00 0.97  ? 21  GLY A HA2  4  
ATOM 6240  H HA3  . GLY A 1 21  ? 20.606  0.821   2.093   1.00 1.07  ? 21  GLY A HA3  4  
ATOM 6241  N N    . TYR A 1 22  ? 18.608  -1.726  2.753   1.00 0.74  ? 22  TYR A N    4  
ATOM 6242  C CA   . TYR A 1 22  ? 17.354  -2.393  2.377   1.00 0.70  ? 22  TYR A CA   4  
ATOM 6243  C C    . TYR A 1 22  ? 17.471  -3.086  1.014   1.00 0.89  ? 22  TYR A C    4  
ATOM 6244  O O    . TYR A 1 22  ? 17.569  -4.310  0.946   1.00 1.82  ? 22  TYR A O    4  
ATOM 6245  C CB   . TYR A 1 22  ? 16.182  -1.399  2.363   1.00 0.64  ? 22  TYR A CB   4  
ATOM 6246  C CG   . TYR A 1 22  ? 16.083  -0.525  3.599   1.00 0.50  ? 22  TYR A CG   4  
ATOM 6247  C CD1  . TYR A 1 22  ? 15.847  -1.089  4.847   1.00 0.47  ? 22  TYR A CD1  4  
ATOM 6248  C CD2  . TYR A 1 22  ? 16.227  0.855   3.521   1.00 0.55  ? 22  TYR A CD2  4  
ATOM 6249  C CE1  . TYR A 1 22  ? 15.753  -0.306  5.980   1.00 0.46  ? 22  TYR A CE1  4  
ATOM 6250  C CE2  . TYR A 1 22  ? 16.135  1.646   4.653   1.00 0.54  ? 22  TYR A CE2  4  
ATOM 6251  C CZ   . TYR A 1 22  ? 15.904  1.094   5.855   1.00 0.46  ? 22  TYR A CZ   4  
ATOM 6252  O OH   . TYR A 1 22  ? 15.804  1.843   7.008   1.00 0.59  ? 22  TYR A OH   4  
ATOM 6253  H H    . TYR A 1 22  ? 19.122  -2.087  3.501   1.00 1.40  ? 22  TYR A H    4  
ATOM 6254  H HA   . TYR A 1 22  ? 17.155  -3.148  3.124   1.00 0.72  ? 22  TYR A HA   4  
ATOM 6255  H HB2  . TYR A 1 22  ? 16.289  -0.748  1.510   1.00 0.75  ? 22  TYR A HB2  4  
ATOM 6256  H HB3  . TYR A 1 22  ? 15.259  -1.951  2.272   1.00 0.71  ? 22  TYR A HB3  4  
ATOM 6257  H HD1  . TYR A 1 22  ? 15.734  -2.161  4.925   1.00 0.58  ? 22  TYR A HD1  4  
ATOM 6258  H HD2  . TYR A 1 22  ? 16.407  1.312   2.560   1.00 0.70  ? 22  TYR A HD2  4  
ATOM 6259  H HE1  . TYR A 1 22  ? 15.570  -0.766  6.941   1.00 0.57  ? 22  TYR A HE1  4  
ATOM 6260  H HE2  . TYR A 1 22  ? 16.250  2.716   4.573   1.00 0.68  ? 22  TYR A HE2  4  
ATOM 6261  H HH   . TYR A 1 22  ? 16.400  1.508   7.685   1.00 1.17  ? 22  TYR A HH   4  
ATOM 6262  N N    . GLY A 1 23  ? 17.453  -2.308  -0.060  1.00 0.43  ? 23  GLY A N    4  
ATOM 6263  C CA   . GLY A 1 23  ? 17.575  -2.873  -1.390  1.00 0.42  ? 23  GLY A CA   4  
ATOM 6264  C C    . GLY A 1 23  ? 16.268  -2.848  -2.161  1.00 0.39  ? 23  GLY A C    4  
ATOM 6265  O O    . GLY A 1 23  ? 15.656  -3.892  -2.400  1.00 0.39  ? 23  GLY A O    4  
ATOM 6266  H H    . GLY A 1 23  ? 17.376  -1.336  0.053   1.00 0.96  ? 23  GLY A H    4  
ATOM 6267  H HA2  . GLY A 1 23  ? 18.317  -2.312  -1.940  1.00 0.44  ? 23  GLY A HA2  4  
ATOM 6268  H HA3  . GLY A 1 23  ? 17.910  -3.897  -1.302  1.00 0.48  ? 23  GLY A HA3  4  
ATOM 6269  N N    . PHE A 1 24  ? 15.841  -1.653  -2.554  1.00 0.37  ? 24  PHE A N    4  
ATOM 6270  C CA   . PHE A 1 24  ? 14.657  -1.486  -3.386  1.00 0.36  ? 24  PHE A CA   4  
ATOM 6271  C C    . PHE A 1 24  ? 14.749  -0.174  -4.155  1.00 0.38  ? 24  PHE A C    4  
ATOM 6272  O O    . PHE A 1 24  ? 15.402  0.771   -3.710  1.00 0.40  ? 24  PHE A O    4  
ATOM 6273  C CB   . PHE A 1 24  ? 13.370  -1.528  -2.544  1.00 0.34  ? 24  PHE A CB   4  
ATOM 6274  C CG   . PHE A 1 24  ? 13.250  -0.428  -1.520  1.00 0.32  ? 24  PHE A CG   4  
ATOM 6275  C CD1  . PHE A 1 24  ? 13.811  -0.565  -0.260  1.00 0.33  ? 24  PHE A CD1  4  
ATOM 6276  C CD2  . PHE A 1 24  ? 12.572  0.743   -1.819  1.00 0.34  ? 24  PHE A CD2  4  
ATOM 6277  C CE1  . PHE A 1 24  ? 13.697  0.443   0.680   1.00 0.35  ? 24  PHE A CE1  4  
ATOM 6278  C CE2  . PHE A 1 24  ? 12.455  1.753   -0.883  1.00 0.36  ? 24  PHE A CE2  4  
ATOM 6279  C CZ   . PHE A 1 24  ? 13.020  1.604   0.366   1.00 0.36  ? 24  PHE A CZ   4  
ATOM 6280  H H    . PHE A 1 24  ? 16.339  -0.854  -2.278  1.00 0.39  ? 24  PHE A H    4  
ATOM 6281  H HA   . PHE A 1 24  ? 14.639  -2.301  -4.095  1.00 0.37  ? 24  PHE A HA   4  
ATOM 6282  H HB2  . PHE A 1 24  ? 12.520  -1.449  -3.206  1.00 0.35  ? 24  PHE A HB2  4  
ATOM 6283  H HB3  . PHE A 1 24  ? 13.321  -2.474  -2.024  1.00 0.34  ? 24  PHE A HB3  4  
ATOM 6284  H HD1  . PHE A 1 24  ? 14.342  -1.473  -0.013  1.00 0.35  ? 24  PHE A HD1  4  
ATOM 6285  H HD2  . PHE A 1 24  ? 12.129  0.864   -2.796  1.00 0.37  ? 24  PHE A HD2  4  
ATOM 6286  H HE1  . PHE A 1 24  ? 14.140  0.323   1.657   1.00 0.38  ? 24  PHE A HE1  4  
ATOM 6287  H HE2  . PHE A 1 24  ? 11.923  2.660   -1.130  1.00 0.40  ? 24  PHE A HE2  4  
ATOM 6288  H HZ   . PHE A 1 24  ? 12.929  2.394   1.098   1.00 0.39  ? 24  PHE A HZ   4  
ATOM 6289  N N    . ASN A 1 25  ? 14.109  -0.124  -5.309  1.00 0.43  ? 25  ASN A N    4  
ATOM 6290  C CA   . ASN A 1 25  ? 14.120  1.068   -6.142  1.00 0.46  ? 25  ASN A CA   4  
ATOM 6291  C C    . ASN A 1 25  ? 12.794  1.804   -6.021  1.00 0.42  ? 25  ASN A C    4  
ATOM 6292  O O    . ASN A 1 25  ? 11.725  1.193   -6.080  1.00 0.39  ? 25  ASN A O    4  
ATOM 6293  C CB   . ASN A 1 25  ? 14.384  0.704   -7.605  1.00 0.51  ? 25  ASN A CB   4  
ATOM 6294  C CG   . ASN A 1 25  ? 15.683  -0.060  -7.796  1.00 1.23  ? 25  ASN A CG   4  
ATOM 6295  O OD1  . ASN A 1 25  ? 15.701  -1.291  -7.750  1.00 2.18  ? 25  ASN A OD1  4  
ATOM 6296  N ND2  . ASN A 1 25  ? 16.776  0.656   -8.019  1.00 1.65  ? 25  ASN A ND2  4  
ATOM 6297  H H    . ASN A 1 25  ? 13.611  -0.916  -5.613  1.00 0.48  ? 25  ASN A H    4  
ATOM 6298  H HA   . ASN A 1 25  ? 14.912  1.712   -5.790  1.00 0.53  ? 25  ASN A HA   4  
ATOM 6299  H HB2  . ASN A 1 25  ? 13.573  0.092   -7.968  1.00 1.01  ? 25  ASN A HB2  4  
ATOM 6300  H HB3  . ASN A 1 25  ? 14.431  1.612   -8.191  1.00 0.91  ? 25  ASN A HB3  4  
ATOM 6301  H HD21 . ASN A 1 25  ? 16.696  1.639   -8.054  1.00 1.88  ? 25  ASN A HD21 4  
ATOM 6302  H HD22 . ASN A 1 25  ? 17.630  0.177   -8.128  1.00 2.23  ? 25  ASN A HD22 4  
ATOM 6303  N N    . LEU A 1 26  ? 12.873  3.115   -5.873  1.00 0.50  ? 26  LEU A N    4  
ATOM 6304  C CA   . LEU A 1 26  ? 11.697  3.950   -5.661  1.00 0.52  ? 26  LEU A CA   4  
ATOM 6305  C C    . LEU A 1 26  ? 11.316  4.637   -6.970  1.00 0.55  ? 26  LEU A C    4  
ATOM 6306  O O    . LEU A 1 26  ? 12.175  4.872   -7.823  1.00 0.73  ? 26  LEU A O    4  
ATOM 6307  C CB   . LEU A 1 26  ? 12.002  4.989   -4.566  1.00 0.69  ? 26  LEU A CB   4  
ATOM 6308  C CG   . LEU A 1 26  ? 10.877  5.273   -3.553  1.00 0.87  ? 26  LEU A CG   4  
ATOM 6309  C CD1  . LEU A 1 26  ? 9.769   6.114   -4.167  1.00 1.52  ? 26  LEU A CD1  4  
ATOM 6310  C CD2  . LEU A 1 26  ? 10.310  3.970   -3.005  1.00 1.48  ? 26  LEU A CD2  4  
ATOM 6311  H H    . LEU A 1 26  ? 13.757  3.544   -5.915  1.00 0.61  ? 26  LEU A H    4  
ATOM 6312  H HA   . LEU A 1 26  ? 10.883  3.318   -5.341  1.00 0.49  ? 26  LEU A HA   4  
ATOM 6313  H HB2  . LEU A 1 26  ? 12.867  4.648   -4.016  1.00 1.10  ? 26  LEU A HB2  4  
ATOM 6314  H HB3  . LEU A 1 26  ? 12.257  5.920   -5.053  1.00 1.29  ? 26  LEU A HB3  4  
ATOM 6315  H HG   . LEU A 1 26  ? 11.287  5.831   -2.723  1.00 1.73  ? 26  LEU A HG   4  
ATOM 6316  H HD11 . LEU A 1 26  ? 9.068   6.404   -3.397  1.00 2.08  ? 26  LEU A HD11 4  
ATOM 6317  H HD12 . LEU A 1 26  ? 9.254   5.537   -4.917  1.00 2.11  ? 26  LEU A HD12 4  
ATOM 6318  H HD13 . LEU A 1 26  ? 10.193  6.998   -4.621  1.00 1.96  ? 26  LEU A HD13 4  
ATOM 6319  H HD21 . LEU A 1 26  ? 9.868   3.403   -3.809  1.00 2.11  ? 26  LEU A HD21 4  
ATOM 6320  H HD22 . LEU A 1 26  ? 9.557   4.189   -2.262  1.00 1.96  ? 26  LEU A HD22 4  
ATOM 6321  H HD23 . LEU A 1 26  ? 11.104  3.394   -2.552  1.00 1.94  ? 26  LEU A HD23 4  
ATOM 6322  N N    . HIS A 1 27  ? 10.038  4.943   -7.136  1.00 0.56  ? 27  HIS A N    4  
ATOM 6323  C CA   . HIS A 1 27  ? 9.563   5.588   -8.350  1.00 0.67  ? 27  HIS A CA   4  
ATOM 6324  C C    . HIS A 1 27  ? 9.244   7.049   -8.074  1.00 0.68  ? 27  HIS A C    4  
ATOM 6325  O O    . HIS A 1 27  ? 8.421   7.364   -7.216  1.00 0.95  ? 27  HIS A O    4  
ATOM 6326  C CB   . HIS A 1 27  ? 8.290   4.899   -8.851  1.00 1.23  ? 27  HIS A CB   4  
ATOM 6327  C CG   . HIS A 1 27  ? 8.315   4.526   -10.301 1.00 0.70  ? 27  HIS A CG   4  
ATOM 6328  N ND1  . HIS A 1 27  ? 8.121   5.425   -11.332 1.00 0.97  ? 27  HIS A ND1  4  
ATOM 6329  C CD2  . HIS A 1 27  ? 8.505   3.325   -10.887 1.00 0.81  ? 27  HIS A CD2  4  
ATOM 6330  C CE1  . HIS A 1 27  ? 8.195   4.786   -12.486 1.00 1.30  ? 27  HIS A CE1  4  
ATOM 6331  N NE2  . HIS A 1 27  ? 8.427   3.514   -12.241 1.00 1.34  ? 27  HIS A NE2  4  
ATOM 6332  H H    . HIS A 1 27  ? 9.392   4.708   -6.439  1.00 0.64  ? 27  HIS A H    4  
ATOM 6333  H HA   . HIS A 1 27  ? 10.334  5.519   -9.102  1.00 0.83  ? 27  HIS A HA   4  
ATOM 6334  H HB2  . HIS A 1 27  ? 8.137   3.993   -8.282  1.00 1.96  ? 27  HIS A HB2  4  
ATOM 6335  H HB3  . HIS A 1 27  ? 7.450   5.560   -8.692  1.00 2.02  ? 27  HIS A HB3  4  
ATOM 6336  H HD1  . HIS A 1 27  ? 7.960   6.392   -11.238 1.00 1.24  ? 27  HIS A HD1  4  
ATOM 6337  H HD2  . HIS A 1 27  ? 8.674   2.386   -10.377 1.00 0.91  ? 27  HIS A HD2  4  
ATOM 6338  H HE1  . HIS A 1 27  ? 8.084   5.231   -13.464 1.00 1.74  ? 27  HIS A HE1  4  
ATOM 6339  H HE2  . HIS A 1 27  ? 8.572   2.817   -12.931 1.00 1.74  ? 27  HIS A HE2  4  
ATOM 6340  N N    . SER A 1 28  ? 9.898   7.933   -8.807  1.00 0.75  ? 28  SER A N    4  
ATOM 6341  C CA   . SER A 1 28  ? 9.679   9.360   -8.660  1.00 1.14  ? 28  SER A CA   4  
ATOM 6342  C C    . SER A 1 28  ? 8.669   9.842   -9.688  1.00 1.03  ? 28  SER A C    4  
ATOM 6343  O O    . SER A 1 28  ? 8.968   9.905   -10.881 1.00 1.34  ? 28  SER A O    4  
ATOM 6344  C CB   . SER A 1 28  ? 11.003  10.105  -8.820  1.00 1.74  ? 28  SER A CB   4  
ATOM 6345  O OG   . SER A 1 28  ? 11.980  9.598   -7.926  1.00 2.30  ? 28  SER A OG   4  
ATOM 6346  H H    . SER A 1 28  ? 10.549  7.615   -9.470  1.00 0.74  ? 28  SER A H    4  
ATOM 6347  H HA   . SER A 1 28  ? 9.288   9.538   -7.670  1.00 1.51  ? 28  SER A HA   4  
ATOM 6348  H HB2  . SER A 1 28  ? 11.363  9.985   -9.831  1.00 2.11  ? 28  SER A HB2  4  
ATOM 6349  H HB3  . SER A 1 28  ? 10.851  11.154  -8.611  1.00 2.17  ? 28  SER A HB3  4  
ATOM 6350  H HG   . SER A 1 28  ? 12.815  9.493   -8.392  1.00 2.75  ? 28  SER A HG   4  
ATOM 6351  N N    . ASP A 1 29  ? 7.470   10.165  -9.230  1.00 1.23  ? 29  ASP A N    4  
ATOM 6352  C CA   . ASP A 1 29  ? 6.414   10.598  -10.130 1.00 1.54  ? 29  ASP A CA   4  
ATOM 6353  C C    . ASP A 1 29  ? 5.897   11.970  -9.720  1.00 1.63  ? 29  ASP A C    4  
ATOM 6354  O O    . ASP A 1 29  ? 6.037   12.373  -8.564  1.00 1.73  ? 29  ASP A O    4  
ATOM 6355  C CB   . ASP A 1 29  ? 5.268   9.587   -10.140 1.00 2.09  ? 29  ASP A CB   4  
ATOM 6356  C CG   . ASP A 1 29  ? 4.446   9.687   -11.401 1.00 2.87  ? 29  ASP A CG   4  
ATOM 6357  O OD1  . ASP A 1 29  ? 3.533   10.527  -11.455 1.00 3.48  ? 29  ASP A OD1  4  
ATOM 6358  O OD2  . ASP A 1 29  ? 4.723   8.930   -12.353 1.00 3.19  ? 29  ASP A OD2  4  
ATOM 6359  H H    . ASP A 1 29  ? 7.293   10.124  -8.269  1.00 1.49  ? 29  ASP A H    4  
ATOM 6360  H HA   . ASP A 1 29  ? 6.828   10.666  -11.125 1.00 1.59  ? 29  ASP A HA   4  
ATOM 6361  H HB2  . ASP A 1 29  ? 5.668   8.588   -10.072 1.00 2.22  ? 29  ASP A HB2  4  
ATOM 6362  H HB3  . ASP A 1 29  ? 4.619   9.772   -9.295  1.00 2.29  ? 29  ASP A HB3  4  
ATOM 6363  N N    . LYS A 1 30  ? 5.310   12.681  -10.676 1.00 1.90  ? 30  LYS A N    4  
ATOM 6364  C CA   . LYS A 1 30  ? 4.787   14.019  -10.439 1.00 2.10  ? 30  LYS A CA   4  
ATOM 6365  C C    . LYS A 1 30  ? 3.414   14.164  -11.101 1.00 2.35  ? 30  LYS A C    4  
ATOM 6366  O O    . LYS A 1 30  ? 2.856   15.259  -11.202 1.00 2.78  ? 30  LYS A O    4  
ATOM 6367  C CB   . LYS A 1 30  ? 5.770   15.059  -10.995 1.00 2.29  ? 30  LYS A CB   4  
ATOM 6368  C CG   . LYS A 1 30  ? 5.495   16.486  -10.553 1.00 2.65  ? 30  LYS A CG   4  
ATOM 6369  C CD   . LYS A 1 30  ? 6.553   17.436  -11.087 1.00 3.12  ? 30  LYS A CD   4  
ATOM 6370  C CE   . LYS A 1 30  ? 6.333   18.858  -10.600 1.00 3.99  ? 30  LYS A CE   4  
ATOM 6371  N NZ   . LYS A 1 30  ? 7.450   19.757  -10.994 1.00 4.54  ? 30  LYS A NZ   4  
ATOM 6372  H H    . LYS A 1 30  ? 5.224   12.290  -11.570 1.00 2.13  ? 30  LYS A H    4  
ATOM 6373  H HA   . LYS A 1 30  ? 4.684   14.159  -9.374  1.00 2.09  ? 30  LYS A HA   4  
ATOM 6374  H HB2  . LYS A 1 30  ? 6.768   14.796  -10.676 1.00 2.49  ? 30  LYS A HB2  4  
ATOM 6375  H HB3  . LYS A 1 30  ? 5.731   15.026  -12.073 1.00 2.60  ? 30  LYS A HB3  4  
ATOM 6376  H HG2  . LYS A 1 30  ? 4.527   16.791  -10.923 1.00 2.99  ? 30  LYS A HG2  4  
ATOM 6377  H HG3  . LYS A 1 30  ? 5.500   16.524  -9.474  1.00 2.97  ? 30  LYS A HG3  4  
ATOM 6378  H HD2  . LYS A 1 30  ? 7.523   17.100  -10.751 1.00 3.37  ? 30  LYS A HD2  4  
ATOM 6379  H HD3  . LYS A 1 30  ? 6.521   17.425  -12.167 1.00 3.23  ? 30  LYS A HD3  4  
ATOM 6380  H HE2  . LYS A 1 30  ? 5.413   19.232  -11.022 1.00 4.39  ? 30  LYS A HE2  4  
ATOM 6381  H HE3  . LYS A 1 30  ? 6.255   18.847  -9.522  1.00 4.35  ? 30  LYS A HE3  4  
ATOM 6382  H HZ1  . LYS A 1 30  ? 7.339   20.694  -10.547 1.00 4.89  ? 30  LYS A HZ1  4  
ATOM 6383  H HZ2  . LYS A 1 30  ? 7.466   19.883  -12.031 1.00 4.83  ? 30  LYS A HZ2  4  
ATOM 6384  H HZ3  . LYS A 1 30  ? 8.361   19.346  -10.696 1.00 4.73  ? 30  LYS A HZ3  4  
ATOM 6385  N N    . SER A 1 31  ? 2.867   13.042  -11.545 1.00 2.29  ? 31  SER A N    4  
ATOM 6386  C CA   . SER A 1 31  ? 1.585   13.037  -12.232 1.00 2.61  ? 31  SER A CA   4  
ATOM 6387  C C    . SER A 1 31  ? 0.552   12.212  -11.465 1.00 2.43  ? 31  SER A C    4  
ATOM 6388  O O    . SER A 1 31  ? -0.616  12.596  -11.372 1.00 2.50  ? 31  SER A O    4  
ATOM 6389  C CB   . SER A 1 31  ? 1.753   12.508  -13.664 1.00 2.93  ? 31  SER A CB   4  
ATOM 6390  O OG   . SER A 1 31  ? 2.485   11.291  -13.694 1.00 3.49  ? 31  SER A OG   4  
ATOM 6391  H H    . SER A 1 31  ? 3.331   12.185  -11.391 1.00 2.20  ? 31  SER A H    4  
ATOM 6392  H HA   . SER A 1 31  ? 1.239   14.057  -12.280 1.00 2.83  ? 31  SER A HA   4  
ATOM 6393  H HB2  . SER A 1 31  ? 0.778   12.332  -14.096 1.00 3.18  ? 31  SER A HB2  4  
ATOM 6394  H HB3  . SER A 1 31  ? 2.279   13.242  -14.256 1.00 2.98  ? 31  SER A HB3  4  
ATOM 6395  H HG   . SER A 1 31  ? 2.825   11.091  -12.805 1.00 3.79  ? 31  SER A HG   4  
ATOM 6396  N N    . LYS A 1 32  ? 0.983   11.090  -10.905 1.00 2.27  ? 32  LYS A N    4  
ATOM 6397  C CA   . LYS A 1 32  ? 0.094   10.242  -10.129 1.00 2.14  ? 32  LYS A CA   4  
ATOM 6398  C C    . LYS A 1 32  ? 0.489   10.262  -8.656  1.00 1.84  ? 32  LYS A C    4  
ATOM 6399  O O    . LYS A 1 32  ? 1.674   10.318  -8.325  1.00 1.68  ? 32  LYS A O    4  
ATOM 6400  C CB   . LYS A 1 32  ? 0.079   8.806   -10.675 1.00 2.21  ? 32  LYS A CB   4  
ATOM 6401  C CG   . LYS A 1 32  ? 1.451   8.189   -10.903 1.00 2.25  ? 32  LYS A CG   4  
ATOM 6402  C CD   . LYS A 1 32  ? 1.328   6.767   -11.434 1.00 2.41  ? 32  LYS A CD   4  
ATOM 6403  C CE   . LYS A 1 32  ? 2.677   6.182   -11.830 1.00 2.93  ? 32  LYS A CE   4  
ATOM 6404  N NZ   . LYS A 1 32  ? 3.252   6.861   -13.021 1.00 3.00  ? 32  LYS A NZ   4  
ATOM 6405  H H    . LYS A 1 32  ? 1.932   10.829  -11.007 1.00 2.30  ? 32  LYS A H    4  
ATOM 6406  H HA   . LYS A 1 32  ? -0.901  10.655  -10.217 1.00 2.30  ? 32  LYS A HA   4  
ATOM 6407  H HB2  . LYS A 1 32  ? -0.450  8.179   -9.974  1.00 2.38  ? 32  LYS A HB2  4  
ATOM 6408  H HB3  . LYS A 1 32  ? -0.450  8.803   -11.615 1.00 2.55  ? 32  LYS A HB3  4  
ATOM 6409  H HG2  . LYS A 1 32  ? 1.993   8.788   -11.619 1.00 2.42  ? 32  LYS A HG2  4  
ATOM 6410  H HG3  . LYS A 1 32  ? 1.988   8.168   -9.965  1.00 2.49  ? 32  LYS A HG3  4  
ATOM 6411  H HD2  . LYS A 1 32  ? 0.892   6.146   -10.667 1.00 2.64  ? 32  LYS A HD2  4  
ATOM 6412  H HD3  . LYS A 1 32  ? 0.682   6.775   -12.301 1.00 2.50  ? 32  LYS A HD3  4  
ATOM 6413  H HE2  . LYS A 1 32  ? 3.361   6.292   -11.001 1.00 3.27  ? 32  LYS A HE2  4  
ATOM 6414  H HE3  . LYS A 1 32  ? 2.548   5.133   -12.051 1.00 3.51  ? 32  LYS A HE3  4  
ATOM 6415  H HZ1  . LYS A 1 32  ? 2.564   6.855   -13.806 1.00 3.05  ? 32  LYS A HZ1  4  
ATOM 6416  H HZ2  . LYS A 1 32  ? 4.117   6.373   -13.334 1.00 3.40  ? 32  LYS A HZ2  4  
ATOM 6417  H HZ3  . LYS A 1 32  ? 3.492   7.852   -12.793 1.00 3.29  ? 32  LYS A HZ3  4  
ATOM 6418  N N    . PRO A 1 33  ? -0.508  10.250  -7.756  1.00 1.87  ? 33  PRO A N    4  
ATOM 6419  C CA   . PRO A 1 33  ? -0.274  10.301  -6.312  1.00 1.71  ? 33  PRO A CA   4  
ATOM 6420  C C    . PRO A 1 33  ? 0.222   8.972   -5.754  1.00 1.40  ? 33  PRO A C    4  
ATOM 6421  O O    . PRO A 1 33  ? -0.064  7.905   -6.299  1.00 1.40  ? 33  PRO A O    4  
ATOM 6422  C CB   . PRO A 1 33  ? -1.651  10.634  -5.745  1.00 1.97  ? 33  PRO A CB   4  
ATOM 6423  C CG   . PRO A 1 33  ? -2.606  10.054  -6.727  1.00 2.24  ? 33  PRO A CG   4  
ATOM 6424  C CD   . PRO A 1 33  ? -1.947  10.181  -8.075  1.00 2.19  ? 33  PRO A CD   4  
ATOM 6425  H HA   . PRO A 1 33  ? 0.425   11.083  -6.052  1.00 1.77  ? 33  PRO A HA   4  
ATOM 6426  H HB2  . PRO A 1 33  ? -1.760  10.180  -4.770  1.00 1.85  ? 33  PRO A HB2  4  
ATOM 6427  H HB3  . PRO A 1 33  ? -1.762  11.704  -5.666  1.00 2.24  ? 33  PRO A HB3  4  
ATOM 6428  H HG2  . PRO A 1 33  ? -2.784  9.014   -6.492  1.00 2.37  ? 33  PRO A HG2  4  
ATOM 6429  H HG3  . PRO A 1 33  ? -3.533  10.608  -6.709  1.00 2.55  ? 33  PRO A HG3  4  
ATOM 6430  H HD2  . PRO A 1 33  ? -2.164  9.314   -8.683  1.00 2.33  ? 33  PRO A HD2  4  
ATOM 6431  H HD3  . PRO A 1 33  ? -2.275  11.082  -8.572  1.00 2.38  ? 33  PRO A HD3  4  
ATOM 6432  N N    . GLY A 1 34  ? 0.951   9.047   -4.654  1.00 1.29  ? 34  GLY A N    4  
ATOM 6433  C CA   . GLY A 1 34  ? 1.520   7.864   -4.063  1.00 1.05  ? 34  GLY A CA   4  
ATOM 6434  C C    . GLY A 1 34  ? 2.898   7.573   -4.616  1.00 0.85  ? 34  GLY A C    4  
ATOM 6435  O O    . GLY A 1 34  ? 3.313   8.158   -5.615  1.00 0.88  ? 34  GLY A O    4  
ATOM 6436  H H    . GLY A 1 34  ? 1.111   9.916   -4.244  1.00 1.47  ? 34  GLY A H    4  
ATOM 6437  H HA2  . GLY A 1 34  ? 1.591   8.005   -2.994  1.00 1.11  ? 34  GLY A HA2  4  
ATOM 6438  H HA3  . GLY A 1 34  ? 0.875   7.023   -4.266  1.00 1.10  ? 34  GLY A HA3  4  
ATOM 6439  N N    . GLN A 1 35  ? 3.612   6.688   -3.960  1.00 0.74  ? 35  GLN A N    4  
ATOM 6440  C CA   . GLN A 1 35  ? 4.936   6.289   -4.412  1.00 0.59  ? 35  GLN A CA   4  
ATOM 6441  C C    . GLN A 1 35  ? 4.930   4.817   -4.779  1.00 0.52  ? 35  GLN A C    4  
ATOM 6442  O O    . GLN A 1 35  ? 4.448   3.987   -4.017  1.00 0.58  ? 35  GLN A O    4  
ATOM 6443  C CB   . GLN A 1 35  ? 5.974   6.564   -3.324  1.00 0.58  ? 35  GLN A CB   4  
ATOM 6444  C CG   . GLN A 1 35  ? 6.123   8.042   -3.003  1.00 0.82  ? 35  GLN A CG   4  
ATOM 6445  C CD   . GLN A 1 35  ? 6.721   8.841   -4.145  1.00 0.75  ? 35  GLN A CD   4  
ATOM 6446  O OE1  . GLN A 1 35  ? 7.934   9.014   -4.227  1.00 1.50  ? 35  GLN A OE1  4  
ATOM 6447  N NE2  . GLN A 1 35  ? 5.878   9.329   -5.041  1.00 0.78  ? 35  GLN A NE2  4  
ATOM 6448  H H    . GLN A 1 35  ? 3.239   6.284   -3.150  1.00 0.85  ? 35  GLN A H    4  
ATOM 6449  H HA   . GLN A 1 35  ? 5.180   6.870   -5.289  1.00 0.60  ? 35  GLN A HA   4  
ATOM 6450  H HB2  . GLN A 1 35  ? 5.679   6.047   -2.423  1.00 0.76  ? 35  GLN A HB2  4  
ATOM 6451  H HB3  . GLN A 1 35  ? 6.932   6.187   -3.650  1.00 0.65  ? 35  GLN A HB3  4  
ATOM 6452  H HG2  . GLN A 1 35  ? 5.147   8.445   -2.779  1.00 1.35  ? 35  GLN A HG2  4  
ATOM 6453  H HG3  . GLN A 1 35  ? 6.761   8.145   -2.137  1.00 1.50  ? 35  GLN A HG3  4  
ATOM 6454  H HE21 . GLN A 1 35  ? 4.918   9.145   -4.926  1.00 1.10  ? 35  GLN A HE21 4  
ATOM 6455  H HE22 . GLN A 1 35  ? 6.242   9.851   -5.781  1.00 1.07  ? 35  GLN A HE22 4  
ATOM 6456  N N    . PHE A 1 36  ? 5.449   4.494   -5.947  1.00 0.47  ? 36  PHE A N    4  
ATOM 6457  C CA   . PHE A 1 36  ? 5.407   3.126   -6.432  1.00 0.43  ? 36  PHE A CA   4  
ATOM 6458  C C    . PHE A 1 36  ? 6.764   2.457   -6.292  1.00 0.39  ? 36  PHE A C    4  
ATOM 6459  O O    . PHE A 1 36  ? 7.807   3.107   -6.381  1.00 0.45  ? 36  PHE A O    4  
ATOM 6460  C CB   . PHE A 1 36  ? 4.954   3.093   -7.892  1.00 0.48  ? 36  PHE A CB   4  
ATOM 6461  C CG   . PHE A 1 36  ? 3.500   3.427   -8.080  1.00 0.58  ? 36  PHE A CG   4  
ATOM 6462  C CD1  . PHE A 1 36  ? 3.080   4.748   -8.086  1.00 0.70  ? 36  PHE A CD1  4  
ATOM 6463  C CD2  . PHE A 1 36  ? 2.558   2.427   -8.249  1.00 0.68  ? 36  PHE A CD2  4  
ATOM 6464  C CE1  . PHE A 1 36  ? 1.747   5.064   -8.259  1.00 0.83  ? 36  PHE A CE1  4  
ATOM 6465  C CE2  . PHE A 1 36  ? 1.223   2.736   -8.422  1.00 0.81  ? 36  PHE A CE2  4  
ATOM 6466  C CZ   . PHE A 1 36  ? 0.811   4.035   -8.426  1.00 0.87  ? 36  PHE A CZ   4  
ATOM 6467  H H    . PHE A 1 36  ? 5.884   5.185   -6.490  1.00 0.51  ? 36  PHE A H    4  
ATOM 6468  H HA   . PHE A 1 36  ? 4.690   2.586   -5.832  1.00 0.42  ? 36  PHE A HA   4  
ATOM 6469  H HB2  . PHE A 1 36  ? 5.533   3.807   -8.459  1.00 0.50  ? 36  PHE A HB2  4  
ATOM 6470  H HB3  . PHE A 1 36  ? 5.121   2.104   -8.291  1.00 0.48  ? 36  PHE A HB3  4  
ATOM 6471  H HD1  . PHE A 1 36  ? 3.806   5.535   -7.958  1.00 0.74  ? 36  PHE A HD1  4  
ATOM 6472  H HD2  . PHE A 1 36  ? 2.877   1.395   -8.246  1.00 0.72  ? 36  PHE A HD2  4  
ATOM 6473  H HE1  . PHE A 1 36  ? 1.433   6.097   -8.263  1.00 0.95  ? 36  PHE A HE1  4  
ATOM 6474  H HE2  . PHE A 1 36  ? 0.497   1.947   -8.552  1.00 0.93  ? 36  PHE A HE2  4  
ATOM 6475  H HZ   . PHE A 1 36  ? -0.233  4.271   -8.561  1.00 0.99  ? 36  PHE A HZ   4  
ATOM 6476  N N    . ILE A 1 37  ? 6.735   1.158   -6.050  1.00 0.36  ? 37  ILE A N    4  
ATOM 6477  C CA   . ILE A 1 37  ? 7.946   0.362   -5.990  1.00 0.33  ? 37  ILE A CA   4  
ATOM 6478  C C    . ILE A 1 37  ? 8.415   0.059   -7.406  1.00 0.33  ? 37  ILE A C    4  
ATOM 6479  O O    . ILE A 1 37  ? 7.799   -0.733  -8.124  1.00 0.38  ? 37  ILE A O    4  
ATOM 6480  C CB   . ILE A 1 37  ? 7.713   -0.954  -5.214  1.00 0.34  ? 37  ILE A CB   4  
ATOM 6481  C CG1  . ILE A 1 37  ? 7.208   -0.647  -3.803  1.00 0.39  ? 37  ILE A CG1  4  
ATOM 6482  C CG2  . ILE A 1 37  ? 8.988   -1.790  -5.153  1.00 0.33  ? 37  ILE A CG2  4  
ATOM 6483  C CD1  . ILE A 1 37  ? 8.182   0.156   -2.965  1.00 0.38  ? 37  ILE A CD1  4  
ATOM 6484  H H    . ILE A 1 37  ? 5.867   0.717   -5.908  1.00 0.41  ? 37  ILE A H    4  
ATOM 6485  H HA   . ILE A 1 37  ? 8.704   0.938   -5.479  1.00 0.33  ? 37  ILE A HA   4  
ATOM 6486  H HB   . ILE A 1 37  ? 6.964   -1.527  -5.740  1.00 0.37  ? 37  ILE A HB   4  
ATOM 6487  H HG12 . ILE A 1 37  ? 6.290   -0.083  -3.872  1.00 0.47  ? 37  ILE A HG12 4  
ATOM 6488  H HG13 . ILE A 1 37  ? 7.015   -1.575  -3.289  1.00 0.44  ? 37  ILE A HG13 4  
ATOM 6489  H HG21 . ILE A 1 37  ? 8.804   -2.689  -4.577  1.00 1.05  ? 37  ILE A HG21 4  
ATOM 6490  H HG22 . ILE A 1 37  ? 9.773   -1.217  -4.684  1.00 1.00  ? 37  ILE A HG22 4  
ATOM 6491  H HG23 . ILE A 1 37  ? 9.289   -2.060  -6.155  1.00 1.04  ? 37  ILE A HG23 4  
ATOM 6492  H HD11 . ILE A 1 37  ? 9.103   -0.397  -2.858  1.00 1.09  ? 37  ILE A HD11 4  
ATOM 6493  H HD12 . ILE A 1 37  ? 7.753   0.335   -1.989  1.00 1.12  ? 37  ILE A HD12 4  
ATOM 6494  H HD13 . ILE A 1 37  ? 8.382   1.099   -3.450  1.00 1.05  ? 37  ILE A HD13 4  
ATOM 6495  N N    . ARG A 1 38  ? 9.492   0.725   -7.803  1.00 0.34  ? 38  ARG A N    4  
ATOM 6496  C CA   . ARG A 1 38  ? 10.049  0.588   -9.143  1.00 0.41  ? 38  ARG A CA   4  
ATOM 6497  C C    . ARG A 1 38  ? 10.507  -0.843  -9.375  1.00 0.40  ? 38  ARG A C    4  
ATOM 6498  O O    . ARG A 1 38  ? 10.122  -1.486  -10.352 1.00 0.49  ? 38  ARG A O    4  
ATOM 6499  C CB   . ARG A 1 38  ? 11.226  1.548   -9.312  1.00 0.50  ? 38  ARG A CB   4  
ATOM 6500  C CG   . ARG A 1 38  ? 11.775  1.612   -10.725 1.00 0.67  ? 38  ARG A CG   4  
ATOM 6501  C CD   . ARG A 1 38  ? 13.044  2.441   -10.773 1.00 1.24  ? 38  ARG A CD   4  
ATOM 6502  N NE   . ARG A 1 38  ? 13.526  2.640   -12.137 1.00 1.56  ? 38  ARG A NE   4  
ATOM 6503  C CZ   . ARG A 1 38  ? 14.703  2.201   -12.586 1.00 2.17  ? 38  ARG A CZ   4  
ATOM 6504  N NH1  . ARG A 1 38  ? 15.498  1.486   -11.793 1.00 2.83  ? 38  ARG A NH1  4  
ATOM 6505  N NH2  . ARG A 1 38  ? 15.082  2.468   -13.828 1.00 2.62  ? 38  ARG A NH2  4  
ATOM 6506  H H    . ARG A 1 38  ? 9.938   1.325   -7.164  1.00 0.35  ? 38  ARG A H    4  
ATOM 6507  H HA   . ARG A 1 38  ? 9.284   0.836   -9.858  1.00 0.46  ? 38  ARG A HA   4  
ATOM 6508  H HB2  . ARG A 1 38  ? 10.905  2.540   -9.032  1.00 0.58  ? 38  ARG A HB2  4  
ATOM 6509  H HB3  . ARG A 1 38  ? 12.025  1.240   -8.653  1.00 0.52  ? 38  ARG A HB3  4  
ATOM 6510  H HG2  . ARG A 1 38  ? 11.995  0.610   -11.065 1.00 1.18  ? 38  ARG A HG2  4  
ATOM 6511  H HG3  . ARG A 1 38  ? 11.037  2.061   -11.371 1.00 1.34  ? 38  ARG A HG3  4  
ATOM 6512  H HD2  . ARG A 1 38  ? 12.844  3.403   -10.328 1.00 1.95  ? 38  ARG A HD2  4  
ATOM 6513  H HD3  . ARG A 1 38  ? 13.803  1.932   -10.201 1.00 1.74  ? 38  ARG A HD3  4  
ATOM 6514  H HE   . ARG A 1 38  ? 12.941  3.152   -12.748 1.00 1.83  ? 38  ARG A HE   4  
ATOM 6515  H HH11 . ARG A 1 38  ? 15.219  1.278   -10.858 1.00 2.92  ? 38  ARG A HH11 4  
ATOM 6516  H HH12 . ARG A 1 38  ? 16.384  1.144   -12.135 1.00 3.48  ? 38  ARG A HH12 4  
ATOM 6517  H HH21 . ARG A 1 38  ? 14.482  3.004   -14.438 1.00 2.77  ? 38  ARG A HH21 4  
ATOM 6518  H HH22 . ARG A 1 38  ? 15.971  2.148   -14.167 1.00 3.10  ? 38  ARG A HH22 4  
ATOM 6519  N N    . SER A 1 39  ? 11.333  -1.327  -8.463  1.00 0.36  ? 39  SER A N    4  
ATOM 6520  C CA   . SER A 1 39  ? 11.847  -2.683  -8.512  1.00 0.40  ? 39  SER A CA   4  
ATOM 6521  C C    . SER A 1 39  ? 12.365  -3.063  -7.136  1.00 0.32  ? 39  SER A C    4  
ATOM 6522  O O    . SER A 1 39  ? 12.871  -2.213  -6.410  1.00 0.37  ? 39  SER A O    4  
ATOM 6523  C CB   . SER A 1 39  ? 12.982  -2.800  -9.539  1.00 0.54  ? 39  SER A CB   4  
ATOM 6524  O OG   . SER A 1 39  ? 12.561  -2.380  -10.827 1.00 1.26  ? 39  SER A OG   4  
ATOM 6525  H H    . SER A 1 39  ? 11.602  -0.751  -7.715  1.00 0.35  ? 39  SER A H    4  
ATOM 6526  H HA   . SER A 1 39  ? 11.040  -3.346  -8.788  1.00 0.44  ? 39  SER A HA   4  
ATOM 6527  H HB2  . SER A 1 39  ? 13.809  -2.177  -9.229  1.00 1.11  ? 39  SER A HB2  4  
ATOM 6528  H HB3  . SER A 1 39  ? 13.310  -3.826  -9.597  1.00 1.13  ? 39  SER A HB3  4  
ATOM 6529  H HG   . SER A 1 39  ? 11.603  -2.239  -10.818 1.00 1.82  ? 39  SER A HG   4  
ATOM 6530  N N    . VAL A 1 40  ? 12.214  -4.316  -6.763  1.00 0.36  ? 40  VAL A N    4  
ATOM 6531  C CA   . VAL A 1 40  ? 12.796  -4.795  -5.528  1.00 0.30  ? 40  VAL A CA   4  
ATOM 6532  C C    . VAL A 1 40  ? 13.703  -5.977  -5.828  1.00 0.31  ? 40  VAL A C    4  
ATOM 6533  O O    . VAL A 1 40  ? 13.329  -6.883  -6.572  1.00 0.37  ? 40  VAL A O    4  
ATOM 6534  C CB   . VAL A 1 40  ? 11.716  -5.168  -4.484  1.00 0.33  ? 40  VAL A CB   4  
ATOM 6535  C CG1  . VAL A 1 40  ? 10.812  -6.284  -4.983  1.00 0.37  ? 40  VAL A CG1  4  
ATOM 6536  C CG2  . VAL A 1 40  ? 12.356  -5.543  -3.158  1.00 0.32  ? 40  VAL A CG2  4  
ATOM 6537  H H    . VAL A 1 40  ? 11.709  -4.936  -7.331  1.00 0.49  ? 40  VAL A H    4  
ATOM 6538  H HA   . VAL A 1 40  ? 13.398  -3.995  -5.120  1.00 0.31  ? 40  VAL A HA   4  
ATOM 6539  H HB   . VAL A 1 40  ? 11.103  -4.294  -4.320  1.00 0.38  ? 40  VAL A HB   4  
ATOM 6540  H HG11 . VAL A 1 40  ? 10.339  -5.981  -5.905  1.00 1.03  ? 40  VAL A HG11 4  
ATOM 6541  H HG12 . VAL A 1 40  ? 10.053  -6.489  -4.242  1.00 1.05  ? 40  VAL A HG12 4  
ATOM 6542  H HG13 . VAL A 1 40  ? 11.399  -7.174  -5.154  1.00 1.11  ? 40  VAL A HG13 4  
ATOM 6543  H HG21 . VAL A 1 40  ? 13.003  -6.397  -3.296  1.00 1.08  ? 40  VAL A HG21 4  
ATOM 6544  H HG22 . VAL A 1 40  ? 11.586  -5.787  -2.442  1.00 1.09  ? 40  VAL A HG22 4  
ATOM 6545  H HG23 . VAL A 1 40  ? 12.937  -4.709  -2.791  1.00 1.02  ? 40  VAL A HG23 4  
ATOM 6546  N N    . ASP A 1 41  ? 14.910  -5.939  -5.293  1.00 0.35  ? 41  ASP A N    4  
ATOM 6547  C CA   . ASP A 1 41  ? 15.897  -6.965  -5.588  1.00 0.45  ? 41  ASP A CA   4  
ATOM 6548  C C    . ASP A 1 41  ? 15.611  -8.212  -4.762  1.00 0.48  ? 41  ASP A C    4  
ATOM 6549  O O    . ASP A 1 41  ? 15.613  -8.161  -3.536  1.00 0.51  ? 41  ASP A O    4  
ATOM 6550  C CB   . ASP A 1 41  ? 17.306  -6.444  -5.302  1.00 0.54  ? 41  ASP A CB   4  
ATOM 6551  C CG   . ASP A 1 41  ? 18.359  -7.131  -6.146  1.00 1.27  ? 41  ASP A CG   4  
ATOM 6552  O OD1  . ASP A 1 41  ? 18.586  -6.709  -7.299  1.00 1.32  ? 41  ASP A OD1  4  
ATOM 6553  O OD2  . ASP A 1 41  ? 18.961  -8.112  -5.659  1.00 2.28  ? 41  ASP A OD2  4  
ATOM 6554  H H    . ASP A 1 41  ? 15.141  -5.213  -4.677  1.00 0.39  ? 41  ASP A H    4  
ATOM 6555  H HA   . ASP A 1 41  ? 15.817  -7.213  -6.636  1.00 0.52  ? 41  ASP A HA   4  
ATOM 6556  H HB2  . ASP A 1 41  ? 17.340  -5.386  -5.509  1.00 0.79  ? 41  ASP A HB2  4  
ATOM 6557  H HB3  . ASP A 1 41  ? 17.540  -6.612  -4.261  1.00 1.00  ? 41  ASP A HB3  4  
ATOM 6558  N N    . PRO A 1 42  ? 15.334  -9.341  -5.433  1.00 0.58  ? 42  PRO A N    4  
ATOM 6559  C CA   . PRO A 1 42  ? 14.966  -10.599 -4.769  1.00 0.69  ? 42  PRO A CA   4  
ATOM 6560  C C    . PRO A 1 42  ? 16.006  -11.064 -3.755  1.00 0.69  ? 42  PRO A C    4  
ATOM 6561  O O    . PRO A 1 42  ? 17.214  -10.927 -3.980  1.00 1.17  ? 42  PRO A O    4  
ATOM 6562  C CB   . PRO A 1 42  ? 14.858  -11.599 -5.926  1.00 0.84  ? 42  PRO A CB   4  
ATOM 6563  C CG   . PRO A 1 42  ? 14.602  -10.762 -7.129  1.00 0.93  ? 42  PRO A CG   4  
ATOM 6564  C CD   . PRO A 1 42  ? 15.349  -9.480  -6.899  1.00 0.69  ? 42  PRO A CD   4  
ATOM 6565  H HA   . PRO A 1 42  ? 14.007  -10.514 -4.279  1.00 0.75  ? 42  PRO A HA   4  
ATOM 6566  H HB2  . PRO A 1 42  ? 15.784  -12.150 -6.016  1.00 0.99  ? 42  PRO A HB2  4  
ATOM 6567  H HB3  . PRO A 1 42  ? 14.044  -12.282 -5.740  1.00 0.96  ? 42  PRO A HB3  4  
ATOM 6568  H HG2  . PRO A 1 42  ? 14.976  -11.263 -8.011  1.00 1.27  ? 42  PRO A HG2  4  
ATOM 6569  H HG3  . PRO A 1 42  ? 13.545  -10.569 -7.225  1.00 1.17  ? 42  PRO A HG3  4  
ATOM 6570  H HD2  . PRO A 1 42  ? 16.361  -9.559  -7.267  1.00 0.79  ? 42  PRO A HD2  4  
ATOM 6571  H HD3  . PRO A 1 42  ? 14.838  -8.654  -7.368  1.00 0.77  ? 42  PRO A HD3  4  
ATOM 6572  N N    . ASP A 1 43  ? 15.515  -11.618 -2.648  1.00 0.75  ? 43  ASP A N    4  
ATOM 6573  C CA   . ASP A 1 43  ? 16.356  -12.097 -1.549  1.00 0.87  ? 43  ASP A CA   4  
ATOM 6574  C C    . ASP A 1 43  ? 17.042  -10.927 -0.843  1.00 0.70  ? 43  ASP A C    4  
ATOM 6575  O O    . ASP A 1 43  ? 18.253  -10.938 -0.608  1.00 0.86  ? 43  ASP A O    4  
ATOM 6576  C CB   . ASP A 1 43  ? 17.400  -13.105 -2.041  1.00 1.14  ? 43  ASP A CB   4  
ATOM 6577  C CG   . ASP A 1 43  ? 17.806  -14.094 -0.966  1.00 1.69  ? 43  ASP A CG   4  
ATOM 6578  O OD1  . ASP A 1 43  ? 18.494  -13.698 -0.002  1.00 2.40  ? 43  ASP A OD1  4  
ATOM 6579  O OD2  . ASP A 1 43  ? 17.443  -15.282 -1.088  1.00 1.92  ? 43  ASP A OD2  4  
ATOM 6580  H H    . ASP A 1 43  ? 14.535  -11.715 -2.570  1.00 1.09  ? 43  ASP A H    4  
ATOM 6581  H HA   . ASP A 1 43  ? 15.708  -12.590 -0.838  1.00 1.00  ? 43  ASP A HA   4  
ATOM 6582  H HB2  . ASP A 1 43  ? 16.994  -13.657 -2.876  1.00 1.42  ? 43  ASP A HB2  4  
ATOM 6583  H HB3  . ASP A 1 43  ? 18.280  -12.570 -2.364  1.00 1.58  ? 43  ASP A HB3  4  
ATOM 6584  N N    . SER A 1 44  ? 16.257  -9.910  -0.527  1.00 0.57  ? 44  SER A N    4  
ATOM 6585  C CA   . SER A 1 44  ? 16.739  -8.772  0.241   1.00 0.48  ? 44  SER A CA   4  
ATOM 6586  C C    . SER A 1 44  ? 15.808  -8.536  1.424   1.00 0.40  ? 44  SER A C    4  
ATOM 6587  O O    . SER A 1 44  ? 14.696  -9.062  1.429   1.00 0.39  ? 44  SER A O    4  
ATOM 6588  C CB   . SER A 1 44  ? 16.790  -7.520  -0.638  1.00 0.47  ? 44  SER A CB   4  
ATOM 6589  O OG   . SER A 1 44  ? 15.497  -7.191  -1.121  1.00 0.46  ? 44  SER A OG   4  
ATOM 6590  H H    . SER A 1 44  ? 15.323  -9.922  -0.817  1.00 0.68  ? 44  SER A H    4  
ATOM 6591  H HA   . SER A 1 44  ? 17.729  -8.999  0.606   1.00 0.55  ? 44  SER A HA   4  
ATOM 6592  H HB2  . SER A 1 44  ? 17.167  -6.691  -0.060  1.00 0.50  ? 44  SER A HB2  4  
ATOM 6593  H HB3  . SER A 1 44  ? 17.440  -7.701  -1.480  1.00 0.51  ? 44  SER A HB3  4  
ATOM 6594  H HG   . SER A 1 44  ? 15.451  -7.396  -2.067  1.00 0.41  ? 44  SER A HG   4  
ATOM 6595  N N    . PRO A 1 45  ? 16.220  -7.758  2.438   1.00 0.43  ? 45  PRO A N    4  
ATOM 6596  C CA   . PRO A 1 45  ? 15.347  -7.446  3.567   1.00 0.45  ? 45  PRO A CA   4  
ATOM 6597  C C    . PRO A 1 45  ? 14.055  -6.779  3.102   1.00 0.38  ? 45  PRO A C    4  
ATOM 6598  O O    . PRO A 1 45  ? 12.988  -7.001  3.674   1.00 0.39  ? 45  PRO A O    4  
ATOM 6599  C CB   . PRO A 1 45  ? 16.178  -6.494  4.437   1.00 0.57  ? 45  PRO A CB   4  
ATOM 6600  C CG   . PRO A 1 45  ? 17.301  -6.038  3.569   1.00 0.65  ? 45  PRO A CG   4  
ATOM 6601  C CD   . PRO A 1 45  ? 17.543  -7.139  2.575   1.00 0.52  ? 45  PRO A CD   4  
ATOM 6602  H HA   . PRO A 1 45  ? 15.102  -8.334  4.130   1.00 0.48  ? 45  PRO A HA   4  
ATOM 6603  H HB2  . PRO A 1 45  ? 15.564  -5.666  4.755   1.00 0.68  ? 45  PRO A HB2  4  
ATOM 6604  H HB3  . PRO A 1 45  ? 16.544  -7.026  5.303   1.00 0.68  ? 45  PRO A HB3  4  
ATOM 6605  H HG2  . PRO A 1 45  ? 17.024  -5.128  3.058   1.00 0.81  ? 45  PRO A HG2  4  
ATOM 6606  H HG3  . PRO A 1 45  ? 18.184  -5.877  4.170   1.00 0.87  ? 45  PRO A HG3  4  
ATOM 6607  H HD2  . PRO A 1 45  ? 17.878  -6.731  1.632   1.00 0.56  ? 45  PRO A HD2  4  
ATOM 6608  H HD3  . PRO A 1 45  ? 18.261  -7.846  2.960   1.00 0.60  ? 45  PRO A HD3  4  
ATOM 6609  N N    . ALA A 1 46  ? 14.159  -5.991  2.040   1.00 0.35  ? 46  ALA A N    4  
ATOM 6610  C CA   . ALA A 1 46  ? 13.002  -5.327  1.464   1.00 0.33  ? 46  ALA A CA   4  
ATOM 6611  C C    . ALA A 1 46  ? 12.059  -6.341  0.832   1.00 0.30  ? 46  ALA A C    4  
ATOM 6612  O O    . ALA A 1 46  ? 10.873  -6.375  1.143   1.00 0.31  ? 46  ALA A O    4  
ATOM 6613  C CB   . ALA A 1 46  ? 13.438  -4.305  0.429   1.00 0.36  ? 46  ALA A CB   4  
ATOM 6614  H H    . ALA A 1 46  ? 15.039  -5.860  1.628   1.00 0.37  ? 46  ALA A H    4  
ATOM 6615  H HA   . ALA A 1 46  ? 12.482  -4.807  2.257   1.00 0.35  ? 46  ALA A HA   4  
ATOM 6616  H HB1  . ALA A 1 46  ? 14.087  -3.576  0.891   1.00 1.17  ? 46  ALA A HB1  4  
ATOM 6617  H HB2  . ALA A 1 46  ? 12.566  -3.808  0.026   1.00 0.96  ? 46  ALA A HB2  4  
ATOM 6618  H HB3  . ALA A 1 46  ? 13.967  -4.805  -0.368  1.00 1.10  ? 46  ALA A HB3  4  
ATOM 6619  N N    . GLU A 1 47  ? 12.593  -7.181  -0.037  1.00 0.31  ? 47  GLU A N    4  
ATOM 6620  C CA   . GLU A 1 47  ? 11.784  -8.178  -0.723  1.00 0.33  ? 47  GLU A CA   4  
ATOM 6621  C C    . GLU A 1 47  ? 11.208  -9.177  0.283   1.00 0.34  ? 47  GLU A C    4  
ATOM 6622  O O    . GLU A 1 47  ? 10.030  -9.530  0.221   1.00 0.40  ? 47  GLU A O    4  
ATOM 6623  C CB   . GLU A 1 47  ? 12.636  -8.876  -1.791  1.00 0.40  ? 47  GLU A CB   4  
ATOM 6624  C CG   . GLU A 1 47  ? 11.851  -9.719  -2.783  1.00 0.53  ? 47  GLU A CG   4  
ATOM 6625  C CD   . GLU A 1 47  ? 11.768  -11.173 -2.383  1.00 1.12  ? 47  GLU A CD   4  
ATOM 6626  O OE1  . GLU A 1 47  ? 12.747  -11.910 -2.617  1.00 1.51  ? 47  GLU A OE1  4  
ATOM 6627  O OE2  . GLU A 1 47  ? 10.725  -11.591 -1.842  1.00 2.01  ? 47  GLU A OE2  4  
ATOM 6628  H H    . GLU A 1 47  ? 13.556  -7.130  -0.229  1.00 0.33  ? 47  GLU A H    4  
ATOM 6629  H HA   . GLU A 1 47  ? 10.966  -7.665  -1.207  1.00 0.36  ? 47  GLU A HA   4  
ATOM 6630  H HB2  . GLU A 1 47  ? 13.176  -8.123  -2.346  1.00 0.44  ? 47  GLU A HB2  4  
ATOM 6631  H HB3  . GLU A 1 47  ? 13.347  -9.518  -1.296  1.00 0.42  ? 47  GLU A HB3  4  
ATOM 6632  H HG2  . GLU A 1 47  ? 10.847  -9.324  -2.855  1.00 1.14  ? 47  GLU A HG2  4  
ATOM 6633  H HG3  . GLU A 1 47  ? 12.330  -9.654  -3.748  1.00 1.17  ? 47  GLU A HG3  4  
ATOM 6634  N N    . ALA A 1 48  ? 12.034  -9.580  1.245   1.00 0.34  ? 48  ALA A N    4  
ATOM 6635  C CA   . ALA A 1 48  ? 11.632  -10.559 2.253   1.00 0.38  ? 48  ALA A CA   4  
ATOM 6636  C C    . ALA A 1 48  ? 10.599  -9.986  3.223   1.00 0.37  ? 48  ALA A C    4  
ATOM 6637  O O    . ALA A 1 48  ? 9.841   -10.732 3.845   1.00 0.47  ? 48  ALA A O    4  
ATOM 6638  C CB   . ALA A 1 48  ? 12.847  -11.057 3.015   1.00 0.44  ? 48  ALA A CB   4  
ATOM 6639  H H    . ALA A 1 48  ? 12.946  -9.213  1.276   1.00 0.34  ? 48  ALA A H    4  
ATOM 6640  H HA   . ALA A 1 48  ? 11.194  -11.401 1.737   1.00 0.42  ? 48  ALA A HA   4  
ATOM 6641  H HB1  . ALA A 1 48  ? 12.542  -11.805 3.730   1.00 1.15  ? 48  ALA A HB1  4  
ATOM 6642  H HB2  . ALA A 1 48  ? 13.310  -10.230 3.534   1.00 0.97  ? 48  ALA A HB2  4  
ATOM 6643  H HB3  . ALA A 1 48  ? 13.556  -11.489 2.323   1.00 1.06  ? 48  ALA A HB3  4  
ATOM 6644  N N    . SER A 1 49  ? 10.561  -8.663  3.342   1.00 0.31  ? 49  SER A N    4  
ATOM 6645  C CA   . SER A 1 49  ? 9.622   -8.008  4.243   1.00 0.32  ? 49  SER A CA   4  
ATOM 6646  C C    . SER A 1 49  ? 8.205   -8.082  3.679   1.00 0.35  ? 49  SER A C    4  
ATOM 6647  O O    . SER A 1 49  ? 7.228   -7.761  4.359   1.00 0.40  ? 49  SER A O    4  
ATOM 6648  C CB   . SER A 1 49  ? 10.035  -6.549  4.469   1.00 0.32  ? 49  SER A CB   4  
ATOM 6649  O OG   . SER A 1 49  ? 9.747   -5.741  3.345   1.00 0.31  ? 49  SER A OG   4  
ATOM 6650  H H    . SER A 1 49  ? 11.183  -8.114  2.823   1.00 0.29  ? 49  SER A H    4  
ATOM 6651  H HA   . SER A 1 49  ? 9.648   -8.532  5.188   1.00 0.36  ? 49  SER A HA   4  
ATOM 6652  H HB2  . SER A 1 49  ? 9.509   -6.151  5.323   1.00 0.35  ? 49  SER A HB2  4  
ATOM 6653  H HB3  . SER A 1 49  ? 11.097  -6.512  4.657   1.00 0.36  ? 49  SER A HB3  4  
ATOM 6654  H HG   . SER A 1 49  ? 10.242  -6.060  2.580   1.00 0.29  ? 49  SER A HG   4  
ATOM 6655  N N    . GLY A 1 50  ? 8.108   -8.521  2.432   1.00 0.36  ? 50  GLY A N    4  
ATOM 6656  C CA   . GLY A 1 50  ? 6.822   -8.630  1.777   1.00 0.43  ? 50  GLY A CA   4  
ATOM 6657  C C    . GLY A 1 50  ? 6.593   -7.502  0.801   1.00 0.43  ? 50  GLY A C    4  
ATOM 6658  O O    . GLY A 1 50  ? 5.461   -7.061  0.602   1.00 0.62  ? 50  GLY A O    4  
ATOM 6659  H H    . GLY A 1 50  ? 8.924   -8.774  1.950   1.00 0.34  ? 50  GLY A H    4  
ATOM 6660  H HA2  . GLY A 1 50  ? 6.778   -9.570  1.246   1.00 0.49  ? 50  GLY A HA2  4  
ATOM 6661  H HA3  . GLY A 1 50  ? 6.043   -8.610  2.524   1.00 0.45  ? 50  GLY A HA3  4  
ATOM 6662  N N    . LEU A 1 51  ? 7.674   -7.019  0.206   1.00 0.41  ? 51  LEU A N    4  
ATOM 6663  C CA   . LEU A 1 51  ? 7.592   -5.948  -0.770  1.00 0.40  ? 51  LEU A CA   4  
ATOM 6664  C C    . LEU A 1 51  ? 7.595   -6.525  -2.178  1.00 0.48  ? 51  LEU A C    4  
ATOM 6665  O O    . LEU A 1 51  ? 8.324   -7.477  -2.463  1.00 0.65  ? 51  LEU A O    4  
ATOM 6666  C CB   . LEU A 1 51  ? 8.764   -4.980  -0.597  1.00 0.38  ? 51  LEU A CB   4  
ATOM 6667  C CG   . LEU A 1 51  ? 8.670   -3.689  -1.410  1.00 0.35  ? 51  LEU A CG   4  
ATOM 6668  C CD1  . LEU A 1 51  ? 7.470   -2.868  -0.965  1.00 0.38  ? 51  LEU A CD1  4  
ATOM 6669  C CD2  . LEU A 1 51  ? 9.952   -2.881  -1.270  1.00 0.37  ? 51  LEU A CD2  4  
ATOM 6670  H H    . LEU A 1 51  ? 8.552   -7.398  0.425   1.00 0.54  ? 51  LEU A H    4  
ATOM 6671  H HA   . LEU A 1 51  ? 6.665   -5.416  -0.609  1.00 0.41  ? 51  LEU A HA   4  
ATOM 6672  H HB2  . LEU A 1 51  ? 8.838   -4.719  0.449   1.00 0.42  ? 51  LEU A HB2  4  
ATOM 6673  H HB3  . LEU A 1 51  ? 9.669   -5.494  -0.886  1.00 0.48  ? 51  LEU A HB3  4  
ATOM 6674  H HG   . LEU A 1 51  ? 8.539   -3.935  -2.454  1.00 0.42  ? 51  LEU A HG   4  
ATOM 6675  H HD11 . LEU A 1 51  ? 7.576   -2.611  0.078   1.00 1.04  ? 51  LEU A HD11 4  
ATOM 6676  H HD12 . LEU A 1 51  ? 6.566   -3.445  -1.104  1.00 1.12  ? 51  LEU A HD12 4  
ATOM 6677  H HD13 . LEU A 1 51  ? 7.413   -1.964  -1.553  1.00 1.10  ? 51  LEU A HD13 4  
ATOM 6678  H HD21 . LEU A 1 51  ? 10.103  -2.624  -0.231  1.00 1.03  ? 51  LEU A HD21 4  
ATOM 6679  H HD22 . LEU A 1 51  ? 9.874   -1.978  -1.856  1.00 1.05  ? 51  LEU A HD22 4  
ATOM 6680  H HD23 . LEU A 1 51  ? 10.788  -3.467  -1.621  1.00 1.08  ? 51  LEU A HD23 4  
ATOM 6681  N N    . ARG A 1 52  ? 6.773   -5.957  -3.043  1.00 0.53  ? 52  ARG A N    4  
ATOM 6682  C CA   . ARG A 1 52  ? 6.694   -6.388  -4.430  1.00 0.65  ? 52  ARG A CA   4  
ATOM 6683  C C    . ARG A 1 52  ? 6.768   -5.173  -5.345  1.00 0.55  ? 52  ARG A C    4  
ATOM 6684  O O    . ARG A 1 52  ? 6.334   -4.083  -4.975  1.00 0.61  ? 52  ARG A O    4  
ATOM 6685  C CB   . ARG A 1 52  ? 5.386   -7.150  -4.676  1.00 0.86  ? 52  ARG A CB   4  
ATOM 6686  C CG   . ARG A 1 52  ? 5.310   -7.808  -6.047  1.00 1.23  ? 52  ARG A CG   4  
ATOM 6687  C CD   . ARG A 1 52  ? 3.905   -8.295  -6.357  1.00 2.05  ? 52  ARG A CD   4  
ATOM 6688  N NE   . ARG A 1 52  ? 2.947   -7.192  -6.416  1.00 2.59  ? 52  ARG A NE   4  
ATOM 6689  C CZ   . ARG A 1 52  ? 1.676   -7.315  -6.784  1.00 3.57  ? 52  ARG A CZ   4  
ATOM 6690  N NH1  . ARG A 1 52  ? 1.178   -8.496  -7.133  1.00 4.13  ? 52  ARG A NH1  4  
ATOM 6691  N NH2  . ARG A 1 52  ? 0.898   -6.245  -6.789  1.00 4.38  ? 52  ARG A NH2  4  
ATOM 6692  H H    . ARG A 1 52  ? 6.201   -5.216  -2.744  1.00 0.62  ? 52  ARG A H    4  
ATOM 6693  H HA   . ARG A 1 52  ? 7.532   -7.037  -4.632  1.00 0.74  ? 52  ARG A HA   4  
ATOM 6694  H HB2  . ARG A 1 52  ? 5.288   -7.921  -3.927  1.00 1.11  ? 52  ARG A HB2  4  
ATOM 6695  H HB3  . ARG A 1 52  ? 4.559   -6.463  -4.584  1.00 1.35  ? 52  ARG A HB3  4  
ATOM 6696  H HG2  . ARG A 1 52  ? 5.606   -7.091  -6.798  1.00 1.80  ? 52  ARG A HG2  4  
ATOM 6697  H HG3  . ARG A 1 52  ? 5.985   -8.652  -6.066  1.00 1.46  ? 52  ARG A HG3  4  
ATOM 6698  H HD2  . ARG A 1 52  ? 3.915   -8.803  -7.311  1.00 2.55  ? 52  ARG A HD2  4  
ATOM 6699  H HD3  . ARG A 1 52  ? 3.598   -8.985  -5.586  1.00 2.57  ? 52  ARG A HD3  4  
ATOM 6700  H HE   . ARG A 1 52  ? 3.275   -6.293  -6.155  1.00 2.68  ? 52  ARG A HE   4  
ATOM 6701  H HH11 . ARG A 1 52  ? 1.760   -9.308  -7.127  1.00 3.93  ? 52  ARG A HH11 4  
ATOM 6702  H HH12 . ARG A 1 52  ? 0.211   -8.578  -7.395  1.00 4.99  ? 52  ARG A HH12 4  
ATOM 6703  H HH21 . ARG A 1 52  ? 1.279   -5.346  -6.515  1.00 4.42  ? 52  ARG A HH21 4  
ATOM 6704  H HH22 . ARG A 1 52  ? -0.072  -6.323  -7.047  1.00 5.17  ? 52  ARG A HH22 4  
ATOM 6705  N N    . ALA A 1 53  ? 7.337   -5.354  -6.526  1.00 0.53  ? 53  ALA A N    4  
ATOM 6706  C CA   . ALA A 1 53  ? 7.415   -4.280  -7.497  1.00 0.54  ? 53  ALA A CA   4  
ATOM 6707  C C    . ALA A 1 53  ? 6.042   -4.025  -8.107  1.00 0.61  ? 53  ALA A C    4  
ATOM 6708  O O    . ALA A 1 53  ? 5.231   -4.947  -8.216  1.00 1.44  ? 53  ALA A O    4  
ATOM 6709  C CB   . ALA A 1 53  ? 8.435   -4.607  -8.578  1.00 0.68  ? 53  ALA A CB   4  
ATOM 6710  H H    . ALA A 1 53  ? 7.709   -6.240  -6.754  1.00 0.60  ? 53  ALA A H    4  
ATOM 6711  H HA   . ALA A 1 53  ? 7.740   -3.388  -6.982  1.00 0.52  ? 53  ALA A HA   4  
ATOM 6712  H HB1  . ALA A 1 53  ? 8.144   -5.514  -9.086  1.00 1.00  ? 53  ALA A HB1  4  
ATOM 6713  H HB2  . ALA A 1 53  ? 9.408   -4.742  -8.126  1.00 1.18  ? 53  ALA A HB2  4  
ATOM 6714  H HB3  . ALA A 1 53  ? 8.479   -3.795  -9.288  1.00 1.17  ? 53  ALA A HB3  4  
ATOM 6715  N N    . GLN A 1 54  ? 5.806   -2.768  -8.493  1.00 0.65  ? 54  GLN A N    4  
ATOM 6716  C CA   . GLN A 1 54  ? 4.522   -2.308  -9.037  1.00 0.74  ? 54  GLN A CA   4  
ATOM 6717  C C    . GLN A 1 54  ? 3.496   -2.071  -7.927  1.00 0.59  ? 54  GLN A C    4  
ATOM 6718  O O    . GLN A 1 54  ? 2.334   -1.773  -8.204  1.00 0.67  ? 54  GLN A O    4  
ATOM 6719  C CB   . GLN A 1 54  ? 3.953   -3.272  -10.091 1.00 0.99  ? 54  GLN A CB   4  
ATOM 6720  C CG   . GLN A 1 54  ? 4.803   -3.391  -11.347 1.00 1.46  ? 54  GLN A CG   4  
ATOM 6721  C CD   . GLN A 1 54  ? 4.120   -4.208  -12.429 1.00 2.34  ? 54  GLN A CD   4  
ATOM 6722  O OE1  . GLN A 1 54  ? 2.891   -4.231  -12.522 1.00 2.99  ? 54  GLN A OE1  4  
ATOM 6723  N NE2  . GLN A 1 54  ? 4.906   -4.879  -13.256 1.00 3.06  ? 54  GLN A NE2  4  
ATOM 6724  H H    . GLN A 1 54  ? 6.531   -2.110  -8.401  1.00 1.26  ? 54  GLN A H    4  
ATOM 6725  H HA   . GLN A 1 54  ? 4.711   -1.357  -9.518  1.00 0.86  ? 54  GLN A HA   4  
ATOM 6726  H HB2  . GLN A 1 54  ? 3.865   -4.254  -9.651  1.00 1.00  ? 54  GLN A HB2  4  
ATOM 6727  H HB3  . GLN A 1 54  ? 2.969   -2.930  -10.380 1.00 1.09  ? 54  GLN A HB3  4  
ATOM 6728  H HG2  . GLN A 1 54  ? 4.998   -2.400  -11.730 1.00 1.69  ? 54  GLN A HG2  4  
ATOM 6729  H HG3  . GLN A 1 54  ? 5.737   -3.869  -11.090 1.00 1.84  ? 54  GLN A HG3  4  
ATOM 6730  H HE21 . GLN A 1 54  ? 5.876   -4.815  -13.131 1.00 3.14  ? 54  GLN A HE21 4  
ATOM 6731  H HE22 . GLN A 1 54  ? 4.482   -5.421  -13.962 1.00 3.80  ? 54  GLN A HE22 4  
ATOM 6732  N N    . ASP A 1 55  ? 3.931   -2.188  -6.676  1.00 0.47  ? 55  ASP A N    4  
ATOM 6733  C CA   . ASP A 1 55  ? 3.069   -1.893  -5.536  1.00 0.45  ? 55  ASP A CA   4  
ATOM 6734  C C    . ASP A 1 55  ? 3.177   -0.419  -5.178  1.00 0.39  ? 55  ASP A C    4  
ATOM 6735  O O    . ASP A 1 55  ? 4.231   0.193   -5.366  1.00 0.48  ? 55  ASP A O    4  
ATOM 6736  C CB   . ASP A 1 55  ? 3.449   -2.741  -4.316  1.00 0.50  ? 55  ASP A CB   4  
ATOM 6737  C CG   . ASP A 1 55  ? 3.016   -4.190  -4.431  1.00 0.67  ? 55  ASP A CG   4  
ATOM 6738  O OD1  . ASP A 1 55  ? 2.526   -4.587  -5.513  1.00 1.02  ? 55  ASP A OD1  4  
ATOM 6739  O OD2  . ASP A 1 55  ? 3.163   -4.945  -3.449  1.00 1.01  ? 55  ASP A OD2  4  
ATOM 6740  H H    . ASP A 1 55  ? 4.849   -2.481  -6.515  1.00 0.46  ? 55  ASP A H    4  
ATOM 6741  H HA   . ASP A 1 55  ? 2.050   -2.114  -5.821  1.00 0.52  ? 55  ASP A HA   4  
ATOM 6742  H HB2  . ASP A 1 55  ? 4.520   -2.719  -4.194  1.00 0.55  ? 55  ASP A HB2  4  
ATOM 6743  H HB3  . ASP A 1 55  ? 2.985   -2.317  -3.438  1.00 0.57  ? 55  ASP A HB3  4  
ATOM 6744  N N    . ARG A 1 56  ? 2.095   0.159   -4.680  1.00 0.38  ? 56  ARG A N    4  
ATOM 6745  C CA   . ARG A 1 56  ? 2.102   1.553   -4.275  1.00 0.42  ? 56  ARG A CA   4  
ATOM 6746  C C    . ARG A 1 56  ? 2.168   1.687   -2.758  1.00 0.39  ? 56  ARG A C    4  
ATOM 6747  O O    . ARG A 1 56  ? 1.444   1.006   -2.034  1.00 0.39  ? 56  ARG A O    4  
ATOM 6748  C CB   . ARG A 1 56  ? 0.857   2.253   -4.805  1.00 0.56  ? 56  ARG A CB   4  
ATOM 6749  C CG   . ARG A 1 56  ? 0.667   3.644   -4.244  1.00 0.78  ? 56  ARG A CG   4  
ATOM 6750  C CD   . ARG A 1 56  ? -0.638  4.237   -4.712  1.00 0.79  ? 56  ARG A CD   4  
ATOM 6751  N NE   . ARG A 1 56  ? -1.046  5.366   -3.892  1.00 0.89  ? 56  ARG A NE   4  
ATOM 6752  C CZ   . ARG A 1 56  ? -2.291  5.560   -3.480  1.00 0.91  ? 56  ARG A CZ   4  
ATOM 6753  N NH1  . ARG A 1 56  ? -3.219  4.646   -3.735  1.00 1.51  ? 56  ARG A NH1  4  
ATOM 6754  N NH2  . ARG A 1 56  ? -2.601  6.644   -2.782  1.00 1.57  ? 56  ARG A NH2  4  
ATOM 6755  H H    . ARG A 1 56  ? 1.264   -0.358  -4.592  1.00 0.45  ? 56  ARG A H    4  
ATOM 6756  H HA   . ARG A 1 56  ? 2.976   2.020   -4.703  1.00 0.43  ? 56  ARG A HA   4  
ATOM 6757  H HB2  . ARG A 1 56  ? 0.928   2.326   -5.881  1.00 0.70  ? 56  ARG A HB2  4  
ATOM 6758  H HB3  . ARG A 1 56  ? -0.010  1.664   -4.549  1.00 0.54  ? 56  ARG A HB3  4  
ATOM 6759  H HG2  . ARG A 1 56  ? 0.664   3.594   -3.166  1.00 1.15  ? 56  ARG A HG2  4  
ATOM 6760  H HG3  . ARG A 1 56  ? 1.479   4.273   -4.578  1.00 1.24  ? 56  ARG A HG3  4  
ATOM 6761  H HD2  . ARG A 1 56  ? -0.519  4.572   -5.731  1.00 1.55  ? 56  ARG A HD2  4  
ATOM 6762  H HD3  . ARG A 1 56  ? -1.402  3.476   -4.670  1.00 1.33  ? 56  ARG A HD3  4  
ATOM 6763  H HE   . ARG A 1 56  ? -0.359  6.017   -3.651  1.00 1.71  ? 56  ARG A HE   4  
ATOM 6764  H HH11 . ARG A 1 56  ? -2.976  3.792   -4.243  1.00 1.92  ? 56  ARG A HH11 4  
ATOM 6765  H HH12 . ARG A 1 56  ? -4.161  4.787   -3.429  1.00 2.03  ? 56  ARG A HH12 4  
ATOM 6766  H HH21 . ARG A 1 56  ? -1.898  7.319   -2.556  1.00 2.26  ? 56  ARG A HH21 4  
ATOM 6767  H HH22 . ARG A 1 56  ? -3.556  6.800   -2.489  1.00 1.73  ? 56  ARG A HH22 4  
ATOM 6768  N N    . ILE A 1 57  ? 3.032   2.579   -2.295  1.00 0.40  ? 57  ILE A N    4  
ATOM 6769  C CA   . ILE A 1 57  ? 3.194   2.842   -0.873  1.00 0.38  ? 57  ILE A CA   4  
ATOM 6770  C C    . ILE A 1 57  ? 2.161   3.859   -0.410  1.00 0.38  ? 57  ILE A C    4  
ATOM 6771  O O    . ILE A 1 57  ? 1.980   4.905   -1.041  1.00 0.49  ? 57  ILE A O    4  
ATOM 6772  C CB   . ILE A 1 57  ? 4.606   3.386   -0.559  1.00 0.46  ? 57  ILE A CB   4  
ATOM 6773  C CG1  . ILE A 1 57  ? 5.682   2.435   -1.091  1.00 0.53  ? 57  ILE A CG1  4  
ATOM 6774  C CG2  . ILE A 1 57  ? 4.773   3.596   0.942   1.00 0.45  ? 57  ILE A CG2  4  
ATOM 6775  C CD1  . ILE A 1 57  ? 7.095   2.943   -0.885  1.00 0.68  ? 57  ILE A CD1  4  
ATOM 6776  H H    . ILE A 1 57  ? 3.570   3.096   -2.938  1.00 0.45  ? 57  ILE A H    4  
ATOM 6777  H HA   . ILE A 1 57  ? 3.050   1.918   -0.333  1.00 0.35  ? 57  ILE A HA   4  
ATOM 6778  H HB   . ILE A 1 57  ? 4.712   4.344   -1.044  1.00 0.52  ? 57  ILE A HB   4  
ATOM 6779  H HG12 . ILE A 1 57  ? 5.596   1.485   -0.586  1.00 1.01  ? 57  ILE A HG12 4  
ATOM 6780  H HG13 . ILE A 1 57  ? 5.533   2.288   -2.151  1.00 0.84  ? 57  ILE A HG13 4  
ATOM 6781  H HG21 . ILE A 1 57  ? 4.063   4.334   1.283   1.00 1.02  ? 57  ILE A HG21 4  
ATOM 6782  H HG22 . ILE A 1 57  ? 5.777   3.942   1.147   1.00 1.06  ? 57  ILE A HG22 4  
ATOM 6783  H HG23 . ILE A 1 57  ? 4.601   2.664   1.458   1.00 1.21  ? 57  ILE A HG23 4  
ATOM 6784  H HD11 . ILE A 1 57  ? 7.794   2.252   -1.330  1.00 1.25  ? 57  ILE A HD11 4  
ATOM 6785  H HD12 . ILE A 1 57  ? 7.295   3.028   0.172   1.00 1.30  ? 57  ILE A HD12 4  
ATOM 6786  H HD13 . ILE A 1 57  ? 7.201   3.914   -1.350  1.00 1.37  ? 57  ILE A HD13 4  
ATOM 6787  N N    . VAL A 1 58  ? 1.479   3.540   0.681   1.00 0.29  ? 58  VAL A N    4  
ATOM 6788  C CA   . VAL A 1 58  ? 0.463   4.422   1.236   1.00 0.32  ? 58  VAL A CA   4  
ATOM 6789  C C    . VAL A 1 58  ? 0.918   5.003   2.572   1.00 0.30  ? 58  VAL A C    4  
ATOM 6790  O O    . VAL A 1 58  ? 0.741   6.191   2.836   1.00 0.37  ? 58  VAL A O    4  
ATOM 6791  C CB   . VAL A 1 58  ? -0.877  3.684   1.428   1.00 0.37  ? 58  VAL A CB   4  
ATOM 6792  C CG1  . VAL A 1 58  ? -1.957  4.645   1.903   1.00 0.87  ? 58  VAL A CG1  4  
ATOM 6793  C CG2  . VAL A 1 58  ? -1.296  2.994   0.138   1.00 0.62  ? 58  VAL A CG2  4  
ATOM 6794  H H    . VAL A 1 58  ? 1.661   2.680   1.121   1.00 0.27  ? 58  VAL A H    4  
ATOM 6795  H HA   . VAL A 1 58  ? 0.307   5.230   0.537   1.00 0.38  ? 58  VAL A HA   4  
ATOM 6796  H HB   . VAL A 1 58  ? -0.744  2.927   2.187   1.00 0.66  ? 58  VAL A HB   4  
ATOM 6797  H HG11 . VAL A 1 58  ? -2.092  5.424   1.168   1.00 1.32  ? 58  VAL A HG11 4  
ATOM 6798  H HG12 . VAL A 1 58  ? -1.657  5.084   2.843   1.00 1.56  ? 58  VAL A HG12 4  
ATOM 6799  H HG13 . VAL A 1 58  ? -2.884  4.108   2.035   1.00 1.41  ? 58  VAL A HG13 4  
ATOM 6800  H HG21 . VAL A 1 58  ? -0.526  2.298   -0.163  1.00 1.24  ? 58  VAL A HG21 4  
ATOM 6801  H HG22 . VAL A 1 58  ? -1.437  3.733   -0.636  1.00 1.25  ? 58  VAL A HG22 4  
ATOM 6802  H HG23 . VAL A 1 58  ? -2.221  2.459   0.298   1.00 1.22  ? 58  VAL A HG23 4  
ATOM 6803  N N    . GLU A 1 59  ? 1.511   4.164   3.413   1.00 0.24  ? 59  GLU A N    4  
ATOM 6804  C CA   . GLU A 1 59  ? 1.990   4.608   4.717   1.00 0.25  ? 59  GLU A CA   4  
ATOM 6805  C C    . GLU A 1 59  ? 3.422   4.145   4.945   1.00 0.22  ? 59  GLU A C    4  
ATOM 6806  O O    . GLU A 1 59  ? 3.800   3.048   4.532   1.00 0.23  ? 59  GLU A O    4  
ATOM 6807  C CB   . GLU A 1 59  ? 1.103   4.080   5.851   1.00 0.29  ? 59  GLU A CB   4  
ATOM 6808  C CG   . GLU A 1 59  ? -0.348  4.522   5.766   1.00 0.40  ? 59  GLU A CG   4  
ATOM 6809  C CD   . GLU A 1 59  ? -1.108  4.269   7.054   1.00 0.44  ? 59  GLU A CD   4  
ATOM 6810  O OE1  . GLU A 1 59  ? -1.364  3.089   7.372   1.00 0.43  ? 59  GLU A OE1  4  
ATOM 6811  O OE2  . GLU A 1 59  ? -1.466  5.244   7.752   1.00 0.89  ? 59  GLU A OE2  4  
ATOM 6812  H H    . GLU A 1 59  ? 1.646   3.232   3.145   1.00 0.24  ? 59  GLU A H    4  
ATOM 6813  H HA   . GLU A 1 59  ? 1.967   5.689   4.728   1.00 0.27  ? 59  GLU A HA   4  
ATOM 6814  H HB2  . GLU A 1 59  ? 1.126   3.001   5.834   1.00 0.26  ? 59  GLU A HB2  4  
ATOM 6815  H HB3  . GLU A 1 59  ? 1.504   4.422   6.794   1.00 0.37  ? 59  GLU A HB3  4  
ATOM 6816  H HG2  . GLU A 1 59  ? -0.376  5.579   5.549   1.00 0.55  ? 59  GLU A HG2  4  
ATOM 6817  H HG3  . GLU A 1 59  ? -0.829  3.976   4.967   1.00 0.44  ? 59  GLU A HG3  4  
ATOM 6818  N N    . VAL A 1 60  ? 4.214   4.985   5.599   1.00 0.22  ? 60  VAL A N    4  
ATOM 6819  C CA   . VAL A 1 60  ? 5.590   4.638   5.939   1.00 0.21  ? 60  VAL A CA   4  
ATOM 6820  C C    . VAL A 1 60  ? 5.792   4.744   7.446   1.00 0.22  ? 60  VAL A C    4  
ATOM 6821  O O    . VAL A 1 60  ? 5.587   5.804   8.029   1.00 0.27  ? 60  VAL A O    4  
ATOM 6822  C CB   . VAL A 1 60  ? 6.618   5.544   5.223   1.00 0.23  ? 60  VAL A CB   4  
ATOM 6823  C CG1  . VAL A 1 60  ? 8.038   5.077   5.511   1.00 0.54  ? 60  VAL A CG1  4  
ATOM 6824  C CG2  . VAL A 1 60  ? 6.360   5.583   3.725   1.00 0.66  ? 60  VAL A CG2  4  
ATOM 6825  H H    . VAL A 1 60  ? 3.862   5.867   5.868   1.00 0.25  ? 60  VAL A H    4  
ATOM 6826  H HA   . VAL A 1 60  ? 5.762   3.616   5.633   1.00 0.22  ? 60  VAL A HA   4  
ATOM 6827  H HB   . VAL A 1 60  ? 6.512   6.547   5.611   1.00 0.52  ? 60  VAL A HB   4  
ATOM 6828  H HG11 . VAL A 1 60  ? 8.166   4.067   5.150   1.00 1.16  ? 60  VAL A HG11 4  
ATOM 6829  H HG12 . VAL A 1 60  ? 8.217   5.104   6.575   1.00 1.03  ? 60  VAL A HG12 4  
ATOM 6830  H HG13 . VAL A 1 60  ? 8.740   5.728   5.011   1.00 1.01  ? 60  VAL A HG13 4  
ATOM 6831  H HG21 . VAL A 1 60  ? 6.453   4.587   3.318   1.00 1.23  ? 60  VAL A HG21 4  
ATOM 6832  H HG22 . VAL A 1 60  ? 7.079   6.234   3.251   1.00 1.29  ? 60  VAL A HG22 4  
ATOM 6833  H HG23 . VAL A 1 60  ? 5.363   5.955   3.542   1.00 1.22  ? 60  VAL A HG23 4  
ATOM 6834  N N    . ASN A 1 61  ? 6.164   3.626   8.064   1.00 0.25  ? 61  ASN A N    4  
ATOM 6835  C CA   . ASN A 1 61  ? 6.370   3.536   9.516   1.00 0.30  ? 61  ASN A CA   4  
ATOM 6836  C C    . ASN A 1 61  ? 5.077   3.807   10.275  1.00 0.36  ? 61  ASN A C    4  
ATOM 6837  O O    . ASN A 1 61  ? 5.098   4.104   11.467  1.00 0.47  ? 61  ASN A O    4  
ATOM 6838  C CB   . ASN A 1 61  ? 7.451   4.513   10.003  1.00 0.39  ? 61  ASN A CB   4  
ATOM 6839  C CG   . ASN A 1 61  ? 8.785   4.317   9.314   1.00 0.53  ? 61  ASN A CG   4  
ATOM 6840  O OD1  . ASN A 1 61  ? 9.112   3.221   8.858   1.00 1.17  ? 61  ASN A OD1  4  
ATOM 6841  N ND2  . ASN A 1 61  ? 9.567   5.381   9.241   1.00 0.61  ? 61  ASN A ND2  4  
ATOM 6842  H H    . ASN A 1 61  ? 6.320   2.819   7.519   1.00 0.27  ? 61  ASN A H    4  
ATOM 6843  H HA   . ASN A 1 61  ? 6.691   2.529   9.735   1.00 0.40  ? 61  ASN A HA   4  
ATOM 6844  H HB2  . ASN A 1 61  ? 7.119   5.525   9.821   1.00 0.67  ? 61  ASN A HB2  4  
ATOM 6845  H HB3  . ASN A 1 61  ? 7.592   4.374   11.065  1.00 0.55  ? 61  ASN A HB3  4  
ATOM 6846  H HD21 . ASN A 1 61  ? 9.245   6.227   9.634   1.00 0.97  ? 61  ASN A HD21 4  
ATOM 6847  H HD22 . ASN A 1 61  ? 10.431  5.292   8.789   1.00 0.74  ? 61  ASN A HD22 4  
ATOM 6848  N N    . GLY A 1 62  ? 3.954   3.700   9.580   1.00 0.37  ? 62  GLY A N    4  
ATOM 6849  C CA   . GLY A 1 62  ? 2.677   3.999   10.193  1.00 0.50  ? 62  GLY A CA   4  
ATOM 6850  C C    . GLY A 1 62  ? 2.282   5.447   9.995   1.00 0.51  ? 62  GLY A C    4  
ATOM 6851  O O    . GLY A 1 62  ? 1.232   5.883   10.465  1.00 0.66  ? 62  GLY A O    4  
ATOM 6852  H H    . GLY A 1 62  ? 3.995   3.421   8.644   1.00 0.34  ? 62  GLY A H    4  
ATOM 6853  H HA2  . GLY A 1 62  ? 1.921   3.365   9.753   1.00 0.55  ? 62  GLY A HA2  4  
ATOM 6854  H HA3  . GLY A 1 62  ? 2.738   3.793   11.251  1.00 0.58  ? 62  GLY A HA3  4  
ATOM 6855  N N    . VAL A 1 63  ? 3.139   6.192   9.312   1.00 0.42  ? 63  VAL A N    4  
ATOM 6856  C CA   . VAL A 1 63  ? 2.864   7.582   8.980   1.00 0.50  ? 63  VAL A CA   4  
ATOM 6857  C C    . VAL A 1 63  ? 2.221   7.667   7.605   1.00 0.43  ? 63  VAL A C    4  
ATOM 6858  O O    . VAL A 1 63  ? 2.725   7.092   6.636   1.00 0.39  ? 63  VAL A O    4  
ATOM 6859  C CB   . VAL A 1 63  ? 4.149   8.438   9.000   1.00 0.61  ? 63  VAL A CB   4  
ATOM 6860  C CG1  . VAL A 1 63  ? 3.833   9.900   8.721   1.00 0.98  ? 63  VAL A CG1  4  
ATOM 6861  C CG2  . VAL A 1 63  ? 4.874   8.288   10.329  1.00 1.17  ? 63  VAL A CG2  4  
ATOM 6862  H H    . VAL A 1 63  ? 3.990   5.798   9.023   1.00 0.36  ? 63  VAL A H    4  
ATOM 6863  H HA   . VAL A 1 63  ? 2.174   7.973   9.713   1.00 0.62  ? 63  VAL A HA   4  
ATOM 6864  H HB   . VAL A 1 63  ? 4.805   8.083   8.219   1.00 1.15  ? 63  VAL A HB   4  
ATOM 6865  H HG11 . VAL A 1 63  ? 3.139   10.265  9.461   1.00 1.65  ? 63  VAL A HG11 4  
ATOM 6866  H HG12 . VAL A 1 63  ? 3.394   9.992   7.738   1.00 1.44  ? 63  VAL A HG12 4  
ATOM 6867  H HG13 . VAL A 1 63  ? 4.744   10.480  8.764   1.00 1.53  ? 63  VAL A HG13 4  
ATOM 6868  H HG21 . VAL A 1 63  ? 5.137   7.252   10.481  1.00 1.72  ? 63  VAL A HG21 4  
ATOM 6869  H HG22 . VAL A 1 63  ? 4.227   8.616   11.130  1.00 1.75  ? 63  VAL A HG22 4  
ATOM 6870  H HG23 . VAL A 1 63  ? 5.770   8.890   10.320  1.00 1.64  ? 63  VAL A HG23 4  
ATOM 6871  N N    . CYS A 1 64  ? 1.105   8.369   7.536   1.00 0.49  ? 64  CYS A N    4  
ATOM 6872  C CA   . CYS A 1 64  ? 0.330   8.477   6.314   1.00 0.49  ? 64  CYS A CA   4  
ATOM 6873  C C    . CYS A 1 64  ? 1.086   9.249   5.228   1.00 0.47  ? 64  CYS A C    4  
ATOM 6874  O O    . CYS A 1 64  ? 1.563   10.364  5.452   1.00 0.51  ? 64  CYS A O    4  
ATOM 6875  C CB   . CYS A 1 64  ? -1.004  9.144   6.639   1.00 0.59  ? 64  CYS A CB   4  
ATOM 6876  S SG   . CYS A 1 64  ? -0.864  10.758  7.438   1.00 1.68  ? 64  CYS A SG   4  
ATOM 6877  H H    . CYS A 1 64  ? 0.784   8.833   8.338   1.00 0.57  ? 64  CYS A H    4  
ATOM 6878  H HA   . CYS A 1 64  ? 0.139   7.476   5.959   1.00 0.51  ? 64  CYS A HA   4  
ATOM 6879  H HB2  . CYS A 1 64  ? -1.558  9.281   5.727   1.00 1.19  ? 64  CYS A HB2  4  
ATOM 6880  H HB3  . CYS A 1 64  ? -1.564  8.501   7.302   1.00 1.14  ? 64  CYS A HB3  4  
ATOM 6881  H HG   . CYS A 1 64  ? -1.324  11.670  6.586   1.00 2.36  ? 64  CYS A HG   4  
ATOM 6882  N N    . MET A 1 65  ? 1.212   8.640   4.053   1.00 0.48  ? 65  MET A N    4  
ATOM 6883  C CA   . MET A 1 65  ? 1.912   9.253   2.927   1.00 0.53  ? 65  MET A CA   4  
ATOM 6884  C C    . MET A 1 65  ? 1.094   9.109   1.646   1.00 0.61  ? 65  MET A C    4  
ATOM 6885  O O    . MET A 1 65  ? 1.642   8.883   0.567   1.00 0.81  ? 65  MET A O    4  
ATOM 6886  C CB   . MET A 1 65  ? 3.291   8.609   2.735   1.00 0.61  ? 65  MET A CB   4  
ATOM 6887  C CG   . MET A 1 65  ? 4.256   8.862   3.881   1.00 0.63  ? 65  MET A CG   4  
ATOM 6888  S SD   . MET A 1 65  ? 4.661   10.606  4.082   1.00 0.61  ? 65  MET A SD   4  
ATOM 6889  C CE   . MET A 1 65  ? 5.709   10.533  5.528   1.00 0.74  ? 65  MET A CE   4  
ATOM 6890  H H    . MET A 1 65  ? 0.821   7.745   3.935   1.00 0.50  ? 65  MET A H    4  
ATOM 6891  H HA   . MET A 1 65  ? 2.039   10.302  3.144   1.00 0.54  ? 65  MET A HA   4  
ATOM 6892  H HB2  . MET A 1 65  ? 3.163   7.542   2.632   1.00 0.69  ? 65  MET A HB2  4  
ATOM 6893  H HB3  . MET A 1 65  ? 3.734   8.997   1.828   1.00 0.65  ? 65  MET A HB3  4  
ATOM 6894  H HG2  . MET A 1 65  ? 3.807   8.505   4.797   1.00 0.66  ? 65  MET A HG2  4  
ATOM 6895  H HG3  . MET A 1 65  ? 5.168   8.314   3.693   1.00 0.74  ? 65  MET A HG3  4  
ATOM 6896  H HE1  . MET A 1 65  ? 6.026   11.529  5.798   1.00 1.42  ? 65  MET A HE1  4  
ATOM 6897  H HE2  . MET A 1 65  ? 6.575   9.926   5.312   1.00 1.16  ? 65  MET A HE2  4  
ATOM 6898  H HE3  . MET A 1 65  ? 5.158   10.095  6.347   1.00 1.11  ? 65  MET A HE3  4  
ATOM 6899  N N    . GLU A 1 66  ? -0.220  9.256   1.777   1.00 0.83  ? 66  GLU A N    4  
ATOM 6900  C CA   . GLU A 1 66  ? -1.144  9.070   0.662   1.00 1.01  ? 66  GLU A CA   4  
ATOM 6901  C C    . GLU A 1 66  ? -0.860  10.062  -0.461  1.00 1.08  ? 66  GLU A C    4  
ATOM 6902  O O    . GLU A 1 66  ? -0.699  9.672   -1.620  1.00 1.86  ? 66  GLU A O    4  
ATOM 6903  C CB   . GLU A 1 66  ? -2.599  9.230   1.125   1.00 1.29  ? 66  GLU A CB   4  
ATOM 6904  C CG   . GLU A 1 66  ? -3.000  8.302   2.266   1.00 2.19  ? 66  GLU A CG   4  
ATOM 6905  C CD   . GLU A 1 66  ? -2.635  8.843   3.639   1.00 3.03  ? 66  GLU A CD   4  
ATOM 6906  O OE1  . GLU A 1 66  ? -1.881  9.839   3.715   1.00 3.33  ? 66  GLU A OE1  4  
ATOM 6907  O OE2  . GLU A 1 66  ? -3.103  8.275   4.649   1.00 3.75  ? 66  GLU A OE2  4  
ATOM 6908  H H    . GLU A 1 66  ? -0.589  9.496   2.661   1.00 1.03  ? 66  GLU A H    4  
ATOM 6909  H HA   . GLU A 1 66  ? -1.006  8.068   0.284   1.00 1.16  ? 66  GLU A HA   4  
ATOM 6910  H HB2  . GLU A 1 66  ? -2.746  10.248  1.454   1.00 1.44  ? 66  GLU A HB2  4  
ATOM 6911  H HB3  . GLU A 1 66  ? -3.254  9.038   0.287   1.00 1.69  ? 66  GLU A HB3  4  
ATOM 6912  H HG2  . GLU A 1 66  ? -4.070  8.151   2.232   1.00 2.66  ? 66  GLU A HG2  4  
ATOM 6913  H HG3  . GLU A 1 66  ? -2.502  7.354   2.128   1.00 2.52  ? 66  GLU A HG3  4  
ATOM 6914  N N    . GLY A 1 67  ? -0.810  11.341  -0.112  1.00 1.21  ? 67  GLY A N    4  
ATOM 6915  C CA   . GLY A 1 67  ? -0.581  12.369  -1.105  1.00 1.36  ? 67  GLY A CA   4  
ATOM 6916  C C    . GLY A 1 67  ? 0.509   13.334  -0.697  1.00 1.24  ? 67  GLY A C    4  
ATOM 6917  O O    . GLY A 1 67  ? 0.442   14.526  -0.996  1.00 1.47  ? 67  GLY A O    4  
ATOM 6918  H H    . GLY A 1 67  ? -0.936  11.590  0.829   1.00 1.78  ? 67  GLY A H    4  
ATOM 6919  H HA2  . GLY A 1 67  ? -0.296  11.899  -2.034  1.00 1.51  ? 67  GLY A HA2  4  
ATOM 6920  H HA3  . GLY A 1 67  ? -1.496  12.921  -1.258  1.00 1.54  ? 67  GLY A HA3  4  
ATOM 6921  N N    . LYS A 1 68  ? 1.514   12.818  -0.008  1.00 0.97  ? 68  LYS A N    4  
ATOM 6922  C CA   . LYS A 1 68  ? 2.637   13.635  0.425   1.00 0.87  ? 68  LYS A CA   4  
ATOM 6923  C C    . LYS A 1 68  ? 3.617   13.854  -0.725  1.00 0.90  ? 68  LYS A C    4  
ATOM 6924  O O    . LYS A 1 68  ? 3.362   13.439  -1.858  1.00 1.06  ? 68  LYS A O    4  
ATOM 6925  C CB   . LYS A 1 68  ? 3.347   12.971  1.605   1.00 0.73  ? 68  LYS A CB   4  
ATOM 6926  C CG   . LYS A 1 68  ? 2.438   12.728  2.798   1.00 1.24  ? 68  LYS A CG   4  
ATOM 6927  C CD   . LYS A 1 68  ? 1.914   14.030  3.377   1.00 2.01  ? 68  LYS A CD   4  
ATOM 6928  C CE   . LYS A 1 68  ? 0.940   13.779  4.515   1.00 2.81  ? 68  LYS A CE   4  
ATOM 6929  N NZ   . LYS A 1 68  ? 1.566   13.026  5.636   1.00 3.36  ? 68  LYS A NZ   4  
ATOM 6930  H H    . LYS A 1 68  ? 1.501   11.864  0.214   1.00 0.95  ? 68  LYS A H    4  
ATOM 6931  H HA   . LYS A 1 68  ? 2.248   14.593  0.740   1.00 0.97  ? 68  LYS A HA   4  
ATOM 6932  H HB2  . LYS A 1 68  ? 3.744   12.022  1.282   1.00 0.95  ? 68  LYS A HB2  4  
ATOM 6933  H HB3  . LYS A 1 68  ? 4.161   13.606  1.923   1.00 0.87  ? 68  LYS A HB3  4  
ATOM 6934  H HG2  . LYS A 1 68  ? 1.601   12.123  2.483   1.00 1.54  ? 68  LYS A HG2  4  
ATOM 6935  H HG3  . LYS A 1 68  ? 2.995   12.205  3.559   1.00 1.43  ? 68  LYS A HG3  4  
ATOM 6936  H HD2  . LYS A 1 68  ? 2.748   14.608  3.749   1.00 2.15  ? 68  LYS A HD2  4  
ATOM 6937  H HD3  . LYS A 1 68  ? 1.410   14.581  2.598   1.00 2.21  ? 68  LYS A HD3  4  
ATOM 6938  H HE2  . LYS A 1 68  ? 0.588   14.730  4.886   1.00 3.07  ? 68  LYS A HE2  4  
ATOM 6939  H HE3  . LYS A 1 68  ? 0.104   13.210  4.133   1.00 3.16  ? 68  LYS A HE3  4  
ATOM 6940  H HZ1  . LYS A 1 68  ? 1.706   12.027  5.367   1.00 3.73  ? 68  LYS A HZ1  4  
ATOM 6941  H HZ2  . LYS A 1 68  ? 0.954   13.065  6.481   1.00 3.59  ? 68  LYS A HZ2  4  
ATOM 6942  H HZ3  . LYS A 1 68  ? 2.492   13.441  5.880   1.00 3.71  ? 68  LYS A HZ3  4  
ATOM 6943  N N    . GLN A 1 69  ? 4.735   14.506  -0.434  1.00 0.87  ? 69  GLN A N    4  
ATOM 6944  C CA   . GLN A 1 69  ? 5.746   14.770  -1.447  1.00 0.93  ? 69  GLN A CA   4  
ATOM 6945  C C    . GLN A 1 69  ? 6.687   13.579  -1.591  1.00 0.81  ? 69  GLN A C    4  
ATOM 6946  O O    . GLN A 1 69  ? 6.758   12.729  -0.700  1.00 0.74  ? 69  GLN A O    4  
ATOM 6947  C CB   . GLN A 1 69  ? 6.549   16.028  -1.093  1.00 1.07  ? 69  GLN A CB   4  
ATOM 6948  C CG   . GLN A 1 69  ? 5.709   17.294  -1.020  1.00 1.33  ? 69  GLN A CG   4  
ATOM 6949  C CD   . GLN A 1 69  ? 5.197   17.727  -2.377  1.00 2.12  ? 69  GLN A CD   4  
ATOM 6950  O OE1  . GLN A 1 69  ? 5.838   17.487  -3.399  1.00 2.64  ? 69  GLN A OE1  4  
ATOM 6951  N NE2  . GLN A 1 69  ? 4.042   18.373  -2.403  1.00 2.89  ? 69  GLN A NE2  4  
ATOM 6952  H H    . GLN A 1 69  ? 4.893   14.808  0.490   1.00 0.90  ? 69  GLN A H    4  
ATOM 6953  H HA   . GLN A 1 69  ? 5.239   14.930  -2.387  1.00 1.04  ? 69  GLN A HA   4  
ATOM 6954  H HB2  . GLN A 1 69  ? 7.023   15.880  -0.133  1.00 1.06  ? 69  GLN A HB2  4  
ATOM 6955  H HB3  . GLN A 1 69  ? 7.316   16.175  -1.841  1.00 1.25  ? 69  GLN A HB3  4  
ATOM 6956  H HG2  . GLN A 1 69  ? 4.863   17.113  -0.374  1.00 1.71  ? 69  GLN A HG2  4  
ATOM 6957  H HG3  . GLN A 1 69  ? 6.313   18.089  -0.607  1.00 1.61  ? 69  GLN A HG3  4  
ATOM 6958  H HE21 . GLN A 1 69  ? 3.577   18.538  -1.548  1.00 2.96  ? 69  GLN A HE21 4  
ATOM 6959  H HE22 . GLN A 1 69  ? 3.698   18.667  -3.273  1.00 3.61  ? 69  GLN A HE22 4  
ATOM 6960  N N    . HIS A 1 70  ? 7.401   13.510  -2.708  1.00 0.84  ? 70  HIS A N    4  
ATOM 6961  C CA   . HIS A 1 70  ? 8.406   12.470  -2.904  1.00 0.79  ? 70  HIS A CA   4  
ATOM 6962  C C    . HIS A 1 70  ? 9.417   12.505  -1.763  1.00 0.70  ? 70  HIS A C    4  
ATOM 6963  O O    . HIS A 1 70  ? 9.791   11.466  -1.214  1.00 0.65  ? 70  HIS A O    4  
ATOM 6964  C CB   . HIS A 1 70  ? 9.106   12.658  -4.260  1.00 0.88  ? 70  HIS A CB   4  
ATOM 6965  C CG   . HIS A 1 70  ? 10.272  11.736  -4.503  1.00 0.90  ? 70  HIS A CG   4  
ATOM 6966  N ND1  . HIS A 1 70  ? 10.144  10.371  -4.619  1.00 1.42  ? 70  HIS A ND1  4  
ATOM 6967  C CD2  . HIS A 1 70  ? 11.589  12.001  -4.666  1.00 1.37  ? 70  HIS A CD2  4  
ATOM 6968  C CE1  . HIS A 1 70  ? 11.329  9.836   -4.845  1.00 1.31  ? 70  HIS A CE1  4  
ATOM 6969  N NE2  . HIS A 1 70  ? 12.225  10.803  -4.878  1.00 1.13  ? 70  HIS A NE2  4  
ATOM 6970  H H    . HIS A 1 70  ? 7.241   14.170  -3.423  1.00 0.93  ? 70  HIS A H    4  
ATOM 6971  H HA   . HIS A 1 70  ? 7.901   11.514  -2.894  1.00 0.78  ? 70  HIS A HA   4  
ATOM 6972  H HB2  . HIS A 1 70  ? 8.390   12.489  -5.051  1.00 0.96  ? 70  HIS A HB2  4  
ATOM 6973  H HB3  . HIS A 1 70  ? 9.468   13.672  -4.325  1.00 0.92  ? 70  HIS A HB3  4  
ATOM 6974  H HD1  . HIS A 1 70  ? 9.302   9.860   -4.540  1.00 2.13  ? 70  HIS A HD1  4  
ATOM 6975  H HD2  . HIS A 1 70  ? 12.055  12.976  -4.635  1.00 2.20  ? 70  HIS A HD2  4  
ATOM 6976  H HE1  . HIS A 1 70  ? 11.531  8.783   -4.976  1.00 1.85  ? 70  HIS A HE1  4  
ATOM 6977  H HE2  . HIS A 1 70  ? 13.146  10.705  -5.227  1.00 1.45  ? 70  HIS A HE2  4  
ATOM 6978  N N    . GLY A 1 71  ? 9.823   13.718  -1.394  1.00 0.72  ? 71  GLY A N    4  
ATOM 6979  C CA   . GLY A 1 71  ? 10.769  13.902  -0.313  1.00 0.69  ? 71  GLY A CA   4  
ATOM 6980  C C    . GLY A 1 71  ? 10.275  13.346  1.009   1.00 0.62  ? 71  GLY A C    4  
ATOM 6981  O O    . GLY A 1 71  ? 11.050  12.758  1.759   1.00 0.62  ? 71  GLY A O    4  
ATOM 6982  H H    . GLY A 1 71  ? 9.477   14.504  -1.876  1.00 0.78  ? 71  GLY A H    4  
ATOM 6983  H HA2  . GLY A 1 71  ? 11.694  13.409  -0.573  1.00 0.70  ? 71  GLY A HA2  4  
ATOM 6984  H HA3  . GLY A 1 71  ? 10.960  14.959  -0.196  1.00 0.75  ? 71  GLY A HA3  4  
ATOM 6985  N N    . ASP A 1 72  ? 8.983   13.515  1.291   1.00 0.61  ? 72  ASP A N    4  
ATOM 6986  C CA   . ASP A 1 72  ? 8.415   13.072  2.566   1.00 0.58  ? 72  ASP A CA   4  
ATOM 6987  C C    . ASP A 1 72  ? 8.494   11.560  2.712   1.00 0.49  ? 72  ASP A C    4  
ATOM 6988  O O    . ASP A 1 72  ? 8.937   11.051  3.740   1.00 0.44  ? 72  ASP A O    4  
ATOM 6989  C CB   . ASP A 1 72  ? 6.950   13.503  2.708   1.00 0.68  ? 72  ASP A CB   4  
ATOM 6990  C CG   . ASP A 1 72  ? 6.782   14.992  2.906   1.00 1.16  ? 72  ASP A CG   4  
ATOM 6991  O OD1  . ASP A 1 72  ? 7.218   15.506  3.953   1.00 1.47  ? 72  ASP A OD1  4  
ATOM 6992  O OD2  . ASP A 1 72  ? 6.232   15.660  1.999   1.00 2.03  ? 72  ASP A OD2  4  
ATOM 6993  H H    . ASP A 1 72  ? 8.399   13.935  0.627   1.00 0.65  ? 72  ASP A H    4  
ATOM 6994  H HA   . ASP A 1 72  ? 8.990   13.527  3.358   1.00 0.61  ? 72  ASP A HA   4  
ATOM 6995  H HB2  . ASP A 1 72  ? 6.412   13.219  1.817   1.00 1.25  ? 72  ASP A HB2  4  
ATOM 6996  H HB3  . ASP A 1 72  ? 6.518   12.998  3.559   1.00 0.87  ? 72  ASP A HB3  4  
ATOM 6997  N N    . VAL A 1 73  ? 8.087   10.847  1.672   1.00 0.50  ? 73  VAL A N    4  
ATOM 6998  C CA   . VAL A 1 73  ? 8.062   9.392   1.711   1.00 0.45  ? 73  VAL A CA   4  
ATOM 6999  C C    . VAL A 1 73  ? 9.474   8.831   1.850   1.00 0.44  ? 73  VAL A C    4  
ATOM 7000  O O    . VAL A 1 73  ? 9.719   7.919   2.641   1.00 0.43  ? 73  VAL A O    4  
ATOM 7001  C CB   . VAL A 1 73  ? 7.389   8.809   0.453   1.00 0.51  ? 73  VAL A CB   4  
ATOM 7002  C CG1  . VAL A 1 73  ? 7.309   7.291   0.533   1.00 1.08  ? 73  VAL A CG1  4  
ATOM 7003  C CG2  . VAL A 1 73  ? 6.003   9.407   0.266   1.00 0.97  ? 73  VAL A CG2  4  
ATOM 7004  H H    . VAL A 1 73  ? 7.789   11.312  0.860   1.00 0.56  ? 73  VAL A H    4  
ATOM 7005  H HA   . VAL A 1 73  ? 7.485   9.094   2.574   1.00 0.44  ? 73  VAL A HA   4  
ATOM 7006  H HB   . VAL A 1 73  ? 7.989   9.070   -0.406  1.00 0.92  ? 73  VAL A HB   4  
ATOM 7007  H HG11 . VAL A 1 73  ? 6.746   7.007   1.410   1.00 1.67  ? 73  VAL A HG11 4  
ATOM 7008  H HG12 . VAL A 1 73  ? 8.305   6.882   0.594   1.00 1.48  ? 73  VAL A HG12 4  
ATOM 7009  H HG13 . VAL A 1 73  ? 6.816   6.912   -0.349  1.00 1.71  ? 73  VAL A HG13 4  
ATOM 7010  H HG21 . VAL A 1 73  ? 5.534   8.963   -0.600  1.00 1.47  ? 73  VAL A HG21 4  
ATOM 7011  H HG22 . VAL A 1 73  ? 6.088   10.473  0.122   1.00 1.57  ? 73  VAL A HG22 4  
ATOM 7012  H HG23 . VAL A 1 73  ? 5.404   9.209   1.143   1.00 1.50  ? 73  VAL A HG23 4  
ATOM 7013  N N    . VAL A 1 74  ? 10.406  9.395   1.094   1.00 0.49  ? 74  VAL A N    4  
ATOM 7014  C CA   . VAL A 1 74  ? 11.796  8.969   1.158   1.00 0.53  ? 74  VAL A CA   4  
ATOM 7015  C C    . VAL A 1 74  ? 12.391  9.297   2.525   1.00 0.51  ? 74  VAL A C    4  
ATOM 7016  O O    . VAL A 1 74  ? 13.104  8.482   3.116   1.00 0.52  ? 74  VAL A O    4  
ATOM 7017  C CB   . VAL A 1 74  ? 12.639  9.628   0.046   1.00 0.64  ? 74  VAL A CB   4  
ATOM 7018  C CG1  . VAL A 1 74  ? 14.098  9.210   0.145   1.00 0.72  ? 74  VAL A CG1  4  
ATOM 7019  C CG2  . VAL A 1 74  ? 12.074  9.280   -1.324  1.00 0.70  ? 74  VAL A CG2  4  
ATOM 7020  H H    . VAL A 1 74  ? 10.152  10.120  0.480   1.00 0.52  ? 74  VAL A H    4  
ATOM 7021  H HA   . VAL A 1 74  ? 11.821  7.898   1.014   1.00 0.55  ? 74  VAL A HA   4  
ATOM 7022  H HB   . VAL A 1 74  ? 12.586  10.700  0.170   1.00 0.66  ? 74  VAL A HB   4  
ATOM 7023  H HG11 . VAL A 1 74  ? 14.501  9.531   1.094   1.00 1.19  ? 74  VAL A HG11 4  
ATOM 7024  H HG12 . VAL A 1 74  ? 14.658  9.666   -0.659  1.00 1.34  ? 74  VAL A HG12 4  
ATOM 7025  H HG13 . VAL A 1 74  ? 14.171  8.135   0.070   1.00 1.20  ? 74  VAL A HG13 4  
ATOM 7026  H HG21 . VAL A 1 74  ? 12.046  8.207   -1.441  1.00 1.37  ? 74  VAL A HG21 4  
ATOM 7027  H HG22 . VAL A 1 74  ? 12.701  9.710   -2.091  1.00 1.03  ? 74  VAL A HG22 4  
ATOM 7028  H HG23 . VAL A 1 74  ? 11.073  9.678   -1.414  1.00 1.19  ? 74  VAL A HG23 4  
ATOM 7029  N N    . SER A 1 75  ? 12.073  10.484  3.031   1.00 0.51  ? 75  SER A N    4  
ATOM 7030  C CA   . SER A 1 75  ? 12.565  10.922  4.329   1.00 0.52  ? 75  SER A CA   4  
ATOM 7031  C C    . SER A 1 75  ? 12.060  9.999   5.430   1.00 0.47  ? 75  SER A C    4  
ATOM 7032  O O    . SER A 1 75  ? 12.828  9.589   6.294   1.00 0.51  ? 75  SER A O    4  
ATOM 7033  C CB   . SER A 1 75  ? 12.129  12.364  4.614   1.00 0.58  ? 75  SER A CB   4  
ATOM 7034  O OG   . SER A 1 75  ? 12.723  12.862  5.804   1.00 0.66  ? 75  SER A OG   4  
ATOM 7035  H H    . SER A 1 75  ? 11.490  11.084  2.515   1.00 0.52  ? 75  SER A H    4  
ATOM 7036  H HA   . SER A 1 75  ? 13.644  10.879  4.305   1.00 0.57  ? 75  SER A HA   4  
ATOM 7037  H HB2  . SER A 1 75  ? 12.422  12.996  3.792   1.00 0.61  ? 75  SER A HB2  4  
ATOM 7038  H HB3  . SER A 1 75  ? 11.057  12.392  4.726   1.00 0.57  ? 75  SER A HB3  4  
ATOM 7039  H HG   . SER A 1 75  ? 12.034  13.033  6.462   1.00 1.12  ? 75  SER A HG   4  
ATOM 7040  N N    . ALA A 1 76  ? 10.774  9.662   5.380   1.00 0.42  ? 76  ALA A N    4  
ATOM 7041  C CA   . ALA A 1 76  ? 10.165  8.784   6.376   1.00 0.39  ? 76  ALA A CA   4  
ATOM 7042  C C    . ALA A 1 76  ? 10.883  7.440   6.444   1.00 0.37  ? 76  ALA A C    4  
ATOM 7043  O O    . ALA A 1 76  ? 11.100  6.896   7.524   1.00 0.39  ? 76  ALA A O    4  
ATOM 7044  C CB   . ALA A 1 76  ? 8.693   8.581   6.067   1.00 0.39  ? 76  ALA A CB   4  
ATOM 7045  H H    . ALA A 1 76  ? 10.212  10.025  4.659   1.00 0.42  ? 76  ALA A H    4  
ATOM 7046  H HA   . ALA A 1 76  ? 10.243  9.269   7.338   1.00 0.42  ? 76  ALA A HA   4  
ATOM 7047  H HB1  . ALA A 1 76  ? 8.249   7.954   6.826   1.00 1.09  ? 76  ALA A HB1  4  
ATOM 7048  H HB2  . ALA A 1 76  ? 8.590   8.107   5.102   1.00 1.06  ? 76  ALA A HB2  4  
ATOM 7049  H HB3  . ALA A 1 76  ? 8.195   9.538   6.054   1.00 1.06  ? 76  ALA A HB3  4  
ATOM 7050  N N    . ILE A 1 77  ? 11.271  6.924   5.284   1.00 0.37  ? 77  ILE A N    4  
ATOM 7051  C CA   . ILE A 1 77  ? 12.027  5.681   5.208   1.00 0.39  ? 77  ILE A CA   4  
ATOM 7052  C C    . ILE A 1 77  ? 13.321  5.785   6.014   1.00 0.41  ? 77  ILE A C    4  
ATOM 7053  O O    . ILE A 1 77  ? 13.666  4.891   6.787   1.00 0.44  ? 77  ILE A O    4  
ATOM 7054  C CB   . ILE A 1 77  ? 12.366  5.358   3.739   1.00 0.45  ? 77  ILE A CB   4  
ATOM 7055  C CG1  . ILE A 1 77  ? 11.114  4.885   3.001   1.00 0.53  ? 77  ILE A CG1  4  
ATOM 7056  C CG2  . ILE A 1 77  ? 13.483  4.327   3.645   1.00 0.50  ? 77  ILE A CG2  4  
ATOM 7057  C CD1  . ILE A 1 77  ? 11.268  4.869   1.499   1.00 0.69  ? 77  ILE A CD1  4  
ATOM 7058  H H    . ILE A 1 77  ? 11.025  7.386   4.450   1.00 0.38  ? 77  ILE A H    4  
ATOM 7059  H HA   . ILE A 1 77  ? 11.417  4.884   5.606   1.00 0.40  ? 77  ILE A HA   4  
ATOM 7060  H HB   . ILE A 1 77  ? 12.718  6.267   3.274   1.00 0.50  ? 77  ILE A HB   4  
ATOM 7061  H HG12 . ILE A 1 77  ? 10.873  3.882   3.321   1.00 0.98  ? 77  ILE A HG12 4  
ATOM 7062  H HG13 . ILE A 1 77  ? 10.291  5.541   3.245   1.00 1.00  ? 77  ILE A HG13 4  
ATOM 7063  H HG21 . ILE A 1 77  ? 13.210  3.446   4.205   1.00 1.07  ? 77  ILE A HG21 4  
ATOM 7064  H HG22 . ILE A 1 77  ? 14.395  4.752   4.054   1.00 1.16  ? 77  ILE A HG22 4  
ATOM 7065  H HG23 . ILE A 1 77  ? 13.645  4.065   2.610   1.00 1.05  ? 77  ILE A HG23 4  
ATOM 7066  H HD11 . ILE A 1 77  ? 10.349  4.531   1.045   1.00 1.20  ? 77  ILE A HD11 4  
ATOM 7067  H HD12 . ILE A 1 77  ? 12.073  4.202   1.226   1.00 1.34  ? 77  ILE A HD12 4  
ATOM 7068  H HD13 . ILE A 1 77  ? 11.494  5.868   1.154   1.00 1.35  ? 77  ILE A HD13 4  
ATOM 7069  N N    . ARG A 1 78  ? 14.018  6.893   5.838   1.00 0.43  ? 78  ARG A N    4  
ATOM 7070  C CA   . ARG A 1 78  ? 15.272  7.125   6.537   1.00 0.50  ? 78  ARG A CA   4  
ATOM 7071  C C    . ARG A 1 78  ? 15.024  7.487   7.999   1.00 0.50  ? 78  ARG A C    4  
ATOM 7072  O O    . ARG A 1 78  ? 15.818  7.145   8.877   1.00 0.56  ? 78  ARG A O    4  
ATOM 7073  C CB   . ARG A 1 78  ? 16.073  8.228   5.843   1.00 0.58  ? 78  ARG A CB   4  
ATOM 7074  C CG   . ARG A 1 78  ? 16.835  7.764   4.605   1.00 0.66  ? 78  ARG A CG   4  
ATOM 7075  C CD   . ARG A 1 78  ? 15.923  7.382   3.452   1.00 0.89  ? 78  ARG A CD   4  
ATOM 7076  N NE   . ARG A 1 78  ? 16.678  7.196   2.210   1.00 1.59  ? 78  ARG A NE   4  
ATOM 7077  C CZ   . ARG A 1 78  ? 16.319  6.377   1.224   1.00 2.11  ? 78  ARG A CZ   4  
ATOM 7078  N NH1  . ARG A 1 78  ? 15.179  5.704   1.294   1.00 2.12  ? 78  ARG A NH1  4  
ATOM 7079  N NH2  . ARG A 1 78  ? 17.099  6.240   0.159   1.00 3.09  ? 78  ARG A NH2  4  
ATOM 7080  H H    . ARG A 1 78  ? 13.673  7.581   5.230   1.00 0.42  ? 78  ARG A H    4  
ATOM 7081  H HA   . ARG A 1 78  ? 15.840  6.207   6.502   1.00 0.54  ? 78  ARG A HA   4  
ATOM 7082  H HB2  . ARG A 1 78  ? 15.391  9.017   5.543   1.00 0.60  ? 78  ARG A HB2  4  
ATOM 7083  H HB3  . ARG A 1 78  ? 16.784  8.631   6.546   1.00 0.65  ? 78  ARG A HB3  4  
ATOM 7084  H HG2  . ARG A 1 78  ? 17.479  8.556   4.278   1.00 0.78  ? 78  ARG A HG2  4  
ATOM 7085  H HG3  . ARG A 1 78  ? 17.435  6.906   4.872   1.00 0.83  ? 78  ARG A HG3  4  
ATOM 7086  H HD2  . ARG A 1 78  ? 15.417  6.461   3.700   1.00 1.36  ? 78  ARG A HD2  4  
ATOM 7087  H HD3  . ARG A 1 78  ? 15.196  8.167   3.309   1.00 1.38  ? 78  ARG A HD3  4  
ATOM 7088  H HE   . ARG A 1 78  ? 17.513  7.715   2.112   1.00 2.12  ? 78  ARG A HE   4  
ATOM 7089  H HH11 . ARG A 1 78  ? 14.579  5.817   2.086   1.00 1.97  ? 78  ARG A HH11 4  
ATOM 7090  H HH12 . ARG A 1 78  ? 14.928  5.059   0.565   1.00 2.67  ? 78  ARG A HH12 4  
ATOM 7091  H HH21 . ARG A 1 78  ? 17.969  6.751   0.096   1.00 3.55  ? 78  ARG A HH21 4  
ATOM 7092  H HH22 . ARG A 1 78  ? 16.828  5.632   -0.590  1.00 3.52  ? 78  ARG A HH22 4  
ATOM 7093  N N    . ALA A 1 79  ? 13.903  8.157   8.248   1.00 0.47  ? 79  ALA A N    4  
ATOM 7094  C CA   . ALA A 1 79  ? 13.534  8.611   9.587   1.00 0.51  ? 79  ALA A CA   4  
ATOM 7095  C C    . ALA A 1 79  ? 13.220  7.445   10.515  1.00 0.43  ? 79  ALA A C    4  
ATOM 7096  O O    . ALA A 1 79  ? 13.150  7.615   11.733  1.00 0.46  ? 79  ALA A O    4  
ATOM 7097  C CB   . ALA A 1 79  ? 12.343  9.554   9.507   1.00 0.65  ? 79  ALA A CB   4  
ATOM 7098  H H    . ALA A 1 79  ? 13.303  8.367   7.498   1.00 0.45  ? 79  ALA A H    4  
ATOM 7099  H HA   . ALA A 1 79  ? 14.370  9.165   9.991   1.00 0.60  ? 79  ALA A HA   4  
ATOM 7100  H HB1  . ALA A 1 79  ? 12.595  10.401  8.887   1.00 1.28  ? 79  ALA A HB1  4  
ATOM 7101  H HB2  . ALA A 1 79  ? 12.087  9.895   10.499  1.00 1.20  ? 79  ALA A HB2  4  
ATOM 7102  H HB3  . ALA A 1 79  ? 11.500  9.033   9.077   1.00 1.18  ? 79  ALA A HB3  4  
ATOM 7103  N N    . GLY A 1 80  ? 13.025  6.265   9.938   1.00 0.41  ? 80  GLY A N    4  
ATOM 7104  C CA   . GLY A 1 80  ? 12.805  5.074   10.737  1.00 0.42  ? 80  GLY A CA   4  
ATOM 7105  C C    . GLY A 1 80  ? 14.057  4.657   11.487  1.00 0.46  ? 80  GLY A C    4  
ATOM 7106  O O    . GLY A 1 80  ? 14.003  3.838   12.404  1.00 0.60  ? 80  GLY A O    4  
ATOM 7107  H H    . GLY A 1 80  ? 13.021  6.205   8.958   1.00 0.46  ? 80  GLY A H    4  
ATOM 7108  H HA2  . GLY A 1 80  ? 12.017  5.270   11.450  1.00 0.51  ? 80  GLY A HA2  4  
ATOM 7109  H HA3  . GLY A 1 80  ? 12.500  4.267   10.089  1.00 0.43  ? 80  GLY A HA3  4  
ATOM 7110  N N    . GLY A 1 81  ? 15.189  5.230   11.098  1.00 0.49  ? 81  GLY A N    4  
ATOM 7111  C CA   . GLY A 1 81  ? 16.440  4.918   11.750  1.00 0.63  ? 81  GLY A CA   4  
ATOM 7112  C C    . GLY A 1 81  ? 17.205  3.840   11.019  1.00 0.64  ? 81  GLY A C    4  
ATOM 7113  O O    . GLY A 1 81  ? 17.866  4.114   10.013  1.00 1.10  ? 81  GLY A O    4  
ATOM 7114  H H    . GLY A 1 81  ? 15.173  5.871   10.354  1.00 0.51  ? 81  GLY A H    4  
ATOM 7115  H HA2  . GLY A 1 81  ? 17.048  5.810   11.793  1.00 0.75  ? 81  GLY A HA2  4  
ATOM 7116  H HA3  . GLY A 1 81  ? 16.238  4.581   12.757  1.00 0.70  ? 81  GLY A HA3  4  
ATOM 7117  N N    . ASP A 1 82  ? 17.114  2.614   11.512  1.00 0.43  ? 82  ASP A N    4  
ATOM 7118  C CA   . ASP A 1 82  ? 17.790  1.493   10.872  1.00 0.44  ? 82  ASP A CA   4  
ATOM 7119  C C    . ASP A 1 82  ? 16.792  0.630   10.115  1.00 0.39  ? 82  ASP A C    4  
ATOM 7120  O O    . ASP A 1 82  ? 17.158  -0.099  9.201   1.00 0.55  ? 82  ASP A O    4  
ATOM 7121  C CB   . ASP A 1 82  ? 18.529  0.640   11.903  1.00 0.55  ? 82  ASP A CB   4  
ATOM 7122  C CG   . ASP A 1 82  ? 19.577  -0.258  11.278  1.00 1.41  ? 82  ASP A CG   4  
ATOM 7123  O OD1  . ASP A 1 82  ? 19.241  -1.388  10.870  1.00 2.12  ? 82  ASP A OD1  4  
ATOM 7124  O OD2  . ASP A 1 82  ? 20.755  0.162   11.209  1.00 1.97  ? 82  ASP A OD2  4  
ATOM 7125  H H    . ASP A 1 82  ? 16.583  2.458   12.324  1.00 0.64  ? 82  ASP A H    4  
ATOM 7126  H HA   . ASP A 1 82  ? 18.506  1.895   10.171  1.00 0.51  ? 82  ASP A HA   4  
ATOM 7127  H HB2  . ASP A 1 82  ? 19.016  1.288   12.615  1.00 0.96  ? 82  ASP A HB2  4  
ATOM 7128  H HB3  . ASP A 1 82  ? 17.816  0.016   12.419  1.00 0.95  ? 82  ASP A HB3  4  
ATOM 7129  N N    . GLU A 1 83  ? 15.527  0.722   10.487  1.00 0.38  ? 83  GLU A N    4  
ATOM 7130  C CA   . GLU A 1 83  ? 14.495  -0.066  9.839   1.00 0.39  ? 83  GLU A CA   4  
ATOM 7131  C C    . GLU A 1 83  ? 13.309  0.808   9.475   1.00 0.38  ? 83  GLU A C    4  
ATOM 7132  O O    . GLU A 1 83  ? 13.162  1.917   9.987   1.00 0.53  ? 83  GLU A O    4  
ATOM 7133  C CB   . GLU A 1 83  ? 14.071  -1.243  10.729  1.00 0.47  ? 83  GLU A CB   4  
ATOM 7134  C CG   . GLU A 1 83  ? 13.516  -0.856  12.090  1.00 0.86  ? 83  GLU A CG   4  
ATOM 7135  C CD   . GLU A 1 83  ? 11.999  -0.768  12.111  1.00 1.62  ? 83  GLU A CD   4  
ATOM 7136  O OE1  . GLU A 1 83  ? 11.335  -1.746  11.698  1.00 2.11  ? 83  GLU A OE1  4  
ATOM 7137  O OE2  . GLU A 1 83  ? 11.466  0.259   12.577  1.00 2.00  ? 83  GLU A OE2  4  
ATOM 7138  H H    . GLU A 1 83  ? 15.275  1.344   11.199  1.00 0.49  ? 83  GLU A H    4  
ATOM 7139  H HA   . GLU A 1 83  ? 14.918  -0.458  8.926   1.00 0.42  ? 83  GLU A HA   4  
ATOM 7140  H HB2  . GLU A 1 83  ? 13.311  -1.808  10.211  1.00 0.89  ? 83  GLU A HB2  4  
ATOM 7141  H HB3  . GLU A 1 83  ? 14.929  -1.882  10.885  1.00 0.82  ? 83  GLU A HB3  4  
ATOM 7142  H HG2  . GLU A 1 83  ? 13.827  -1.595  12.811  1.00 1.20  ? 83  GLU A HG2  4  
ATOM 7143  H HG3  . GLU A 1 83  ? 13.921  0.106   12.367  1.00 1.09  ? 83  GLU A HG3  4  
ATOM 7144  N N    . THR A 1 84  ? 12.480  0.312   8.579   1.00 0.27  ? 84  THR A N    4  
ATOM 7145  C CA   . THR A 1 84  ? 11.333  1.057   8.110   1.00 0.26  ? 84  THR A CA   4  
ATOM 7146  C C    . THR A 1 84  ? 10.198  0.106   7.750   1.00 0.22  ? 84  THR A C    4  
ATOM 7147  O O    . THR A 1 84  ? 10.432  -1.038  7.348   1.00 0.21  ? 84  THR A O    4  
ATOM 7148  C CB   . THR A 1 84  ? 11.700  1.942   6.892   1.00 0.30  ? 84  THR A CB   4  
ATOM 7149  O OG1  . THR A 1 84  ? 10.588  2.761   6.510   1.00 0.32  ? 84  THR A OG1  4  
ATOM 7150  C CG2  . THR A 1 84  ? 12.141  1.092   5.705   1.00 0.30  ? 84  THR A CG2  4  
ATOM 7151  H H    . THR A 1 84  ? 12.644  -0.588  8.218   1.00 0.23  ? 84  THR A H    4  
ATOM 7152  H HA   . THR A 1 84  ? 11.005  1.704   8.913   1.00 0.30  ? 84  THR A HA   4  
ATOM 7153  H HB   . THR A 1 84  ? 12.522  2.583   7.174   1.00 0.36  ? 84  THR A HB   4  
ATOM 7154  H HG1  . THR A 1 84  ? 10.134  3.078   7.303   1.00 0.60  ? 84  THR A HG1  4  
ATOM 7155  H HG21 . THR A 1 84  ? 13.016  0.518   5.976   1.00 1.03  ? 84  THR A HG21 4  
ATOM 7156  H HG22 . THR A 1 84  ? 12.375  1.733   4.868   1.00 1.05  ? 84  THR A HG22 4  
ATOM 7157  H HG23 . THR A 1 84  ? 11.341  0.419   5.429   1.00 1.09  ? 84  THR A HG23 4  
ATOM 7158  N N    . LYS A 1 85  ? 8.970   0.566   7.932   1.00 0.24  ? 85  LYS A N    4  
ATOM 7159  C CA   . LYS A 1 85  ? 7.803   -0.226  7.590   1.00 0.23  ? 85  LYS A CA   4  
ATOM 7160  C C    . LYS A 1 85  ? 7.067   0.412   6.426   1.00 0.23  ? 85  LYS A C    4  
ATOM 7161  O O    . LYS A 1 85  ? 6.587   1.538   6.530   1.00 0.26  ? 85  LYS A O    4  
ATOM 7162  C CB   . LYS A 1 85  ? 6.857   -0.346  8.783   1.00 0.28  ? 85  LYS A CB   4  
ATOM 7163  C CG   . LYS A 1 85  ? 7.536   -0.801  10.062  1.00 0.37  ? 85  LYS A CG   4  
ATOM 7164  C CD   . LYS A 1 85  ? 6.526   -0.999  11.175  1.00 0.50  ? 85  LYS A CD   4  
ATOM 7165  C CE   . LYS A 1 85  ? 7.188   -1.008  12.541  1.00 0.78  ? 85  LYS A CE   4  
ATOM 7166  N NZ   . LYS A 1 85  ? 8.269   -2.024  12.650  1.00 1.63  ? 85  LYS A NZ   4  
ATOM 7167  H H    . LYS A 1 85  ? 8.848   1.471   8.298   1.00 0.27  ? 85  LYS A H    4  
ATOM 7168  H HA   . LYS A 1 85  ? 8.138   -1.210  7.301   1.00 0.22  ? 85  LYS A HA   4  
ATOM 7169  H HB2  . LYS A 1 85  ? 6.404   0.617   8.966   1.00 0.34  ? 85  LYS A HB2  4  
ATOM 7170  H HB3  . LYS A 1 85  ? 6.080   -1.058  8.541   1.00 0.36  ? 85  LYS A HB3  4  
ATOM 7171  H HG2  . LYS A 1 85  ? 8.037   -1.739  9.874   1.00 0.55  ? 85  LYS A HG2  4  
ATOM 7172  H HG3  . LYS A 1 85  ? 8.257   -0.055  10.364  1.00 0.55  ? 85  LYS A HG3  4  
ATOM 7173  H HD2  . LYS A 1 85  ? 5.810   -0.194  11.142  1.00 0.71  ? 85  LYS A HD2  4  
ATOM 7174  H HD3  . LYS A 1 85  ? 6.018   -1.941  11.024  1.00 0.72  ? 85  LYS A HD3  4  
ATOM 7175  H HE2  . LYS A 1 85  ? 7.606   -0.033  12.729  1.00 1.42  ? 85  LYS A HE2  4  
ATOM 7176  H HE3  . LYS A 1 85  ? 6.431   -1.221  13.283  1.00 1.22  ? 85  LYS A HE3  4  
ATOM 7177  H HZ1  . LYS A 1 85  ? 9.014   -1.839  11.947  1.00 2.25  ? 85  LYS A HZ1  4  
ATOM 7178  H HZ2  . LYS A 1 85  ? 7.882   -2.979  12.495  1.00 1.97  ? 85  LYS A HZ2  4  
ATOM 7179  H HZ3  . LYS A 1 85  ? 8.692   -1.991  13.604  1.00 2.17  ? 85  LYS A HZ3  4  
ATOM 7180  N N    . LEU A 1 86  ? 6.971   -0.301  5.327   1.00 0.22  ? 86  LEU A N    4  
ATOM 7181  C CA   . LEU A 1 86  ? 6.291   0.212   4.153   1.00 0.22  ? 86  LEU A CA   4  
ATOM 7182  C C    . LEU A 1 86  ? 4.945   -0.470  3.994   1.00 0.22  ? 86  LEU A C    4  
ATOM 7183  O O    . LEU A 1 86  ? 4.852   -1.693  4.003   1.00 0.27  ? 86  LEU A O    4  
ATOM 7184  C CB   . LEU A 1 86  ? 7.139   -0.010  2.897   1.00 0.24  ? 86  LEU A CB   4  
ATOM 7185  C CG   . LEU A 1 86  ? 8.494   0.700   2.887   1.00 0.25  ? 86  LEU A CG   4  
ATOM 7186  C CD1  . LEU A 1 86  ? 9.249   0.387   1.605   1.00 0.28  ? 86  LEU A CD1  4  
ATOM 7187  C CD2  . LEU A 1 86  ? 8.311   2.202   3.042   1.00 0.28  ? 86  LEU A CD2  4  
ATOM 7188  H H    . LEU A 1 86  ? 7.358   -1.206  5.304   1.00 0.22  ? 86  LEU A H    4  
ATOM 7189  H HA   . LEU A 1 86  ? 6.135   1.270   4.294   1.00 0.23  ? 86  LEU A HA   4  
ATOM 7190  H HB2  . LEU A 1 86  ? 7.314   -1.071  2.792   1.00 0.24  ? 86  LEU A HB2  4  
ATOM 7191  H HB3  . LEU A 1 86  ? 6.574   0.330   2.043   1.00 0.25  ? 86  LEU A HB3  4  
ATOM 7192  H HG   . LEU A 1 86  ? 9.086   0.345   3.719   1.00 0.26  ? 86  LEU A HG   4  
ATOM 7193  H HD11 . LEU A 1 86  ? 8.675   0.732   0.755   1.00 1.02  ? 86  LEU A HD11 4  
ATOM 7194  H HD12 . LEU A 1 86  ? 9.400   -0.680  1.526   1.00 0.97  ? 86  LEU A HD12 4  
ATOM 7195  H HD13 . LEU A 1 86  ? 10.206  0.887   1.618   1.00 1.02  ? 86  LEU A HD13 4  
ATOM 7196  H HD21 . LEU A 1 86  ? 7.743   2.584   2.207   1.00 1.04  ? 86  LEU A HD21 4  
ATOM 7197  H HD22 . LEU A 1 86  ? 9.279   2.682   3.070   1.00 1.00  ? 86  LEU A HD22 4  
ATOM 7198  H HD23 . LEU A 1 86  ? 7.782   2.406   3.961   1.00 1.03  ? 86  LEU A HD23 4  
ATOM 7199  N N    . LEU A 1 87  ? 3.904   0.323   3.861   1.00 0.20  ? 87  LEU A N    4  
ATOM 7200  C CA   . LEU A 1 87  ? 2.579   -0.213  3.634   1.00 0.21  ? 87  LEU A CA   4  
ATOM 7201  C C    . LEU A 1 87  ? 2.220   -0.031  2.177   1.00 0.21  ? 87  LEU A C    4  
ATOM 7202  O O    . LEU A 1 87  ? 2.147   1.094   1.682   1.00 0.26  ? 87  LEU A O    4  
ATOM 7203  C CB   . LEU A 1 87  ? 1.543   0.487   4.510   1.00 0.27  ? 87  LEU A CB   4  
ATOM 7204  C CG   . LEU A 1 87  ? 0.108   -0.005  4.315   1.00 0.39  ? 87  LEU A CG   4  
ATOM 7205  C CD1  . LEU A 1 87  ? -0.059  -1.410  4.867   1.00 0.51  ? 87  LEU A CD1  4  
ATOM 7206  C CD2  . LEU A 1 87  ? -0.873  0.948   4.969   1.00 0.45  ? 87  LEU A CD2  4  
ATOM 7207  H H    . LEU A 1 87  ? 4.027   1.298   3.913   1.00 0.20  ? 87  LEU A H    4  
ATOM 7208  H HA   . LEU A 1 87  ? 2.595   -1.266  3.868   1.00 0.23  ? 87  LEU A HA   4  
ATOM 7209  H HB2  . LEU A 1 87  ? 1.817   0.342   5.544   1.00 0.29  ? 87  LEU A HB2  4  
ATOM 7210  H HB3  . LEU A 1 87  ? 1.571   1.544   4.291   1.00 0.27  ? 87  LEU A HB3  4  
ATOM 7211  H HG   . LEU A 1 87  ? -0.112  -0.035  3.257   1.00 0.63  ? 87  LEU A HG   4  
ATOM 7212  H HD11 . LEU A 1 87  ? 0.625   -2.077  4.364   1.00 1.22  ? 87  LEU A HD11 4  
ATOM 7213  H HD12 . LEU A 1 87  ? -1.074  -1.743  4.702   1.00 1.05  ? 87  LEU A HD12 4  
ATOM 7214  H HD13 . LEU A 1 87  ? 0.152   -1.408  5.926   1.00 1.12  ? 87  LEU A HD13 4  
ATOM 7215  H HD21 . LEU A 1 87  ? -0.769  1.930   4.530   1.00 1.05  ? 87  LEU A HD21 4  
ATOM 7216  H HD22 . LEU A 1 87  ? -0.669  1.004   6.028   1.00 1.12  ? 87  LEU A HD22 4  
ATOM 7217  H HD23 . LEU A 1 87  ? -1.880  0.591   4.814   1.00 1.19  ? 87  LEU A HD23 4  
ATOM 7218  N N    . VAL A 1 88  ? 1.998   -1.135  1.492   1.00 0.20  ? 88  VAL A N    4  
ATOM 7219  C CA   . VAL A 1 88  ? 1.747   -1.096  0.066   1.00 0.23  ? 88  VAL A CA   4  
ATOM 7220  C C    . VAL A 1 88  ? 0.446   -1.799  -0.277  1.00 0.24  ? 88  VAL A C    4  
ATOM 7221  O O    . VAL A 1 88  ? -0.089  -2.576  0.520   1.00 0.27  ? 88  VAL A O    4  
ATOM 7222  C CB   . VAL A 1 88  ? 2.904   -1.733  -0.738  1.00 0.28  ? 88  VAL A CB   4  
ATOM 7223  C CG1  . VAL A 1 88  ? 4.184   -0.928  -0.568  1.00 0.31  ? 88  VAL A CG1  4  
ATOM 7224  C CG2  . VAL A 1 88  ? 3.124   -3.179  -0.319  1.00 0.33  ? 88  VAL A CG2  4  
ATOM 7225  H H    . VAL A 1 88  ? 2.004   -2.002  1.957   1.00 0.20  ? 88  VAL A H    4  
ATOM 7226  H HA   . VAL A 1 88  ? 1.666   -0.058  -0.228  1.00 0.26  ? 88  VAL A HA   4  
ATOM 7227  H HB   . VAL A 1 88  ? 2.636   -1.720  -1.785  1.00 0.32  ? 88  VAL A HB   4  
ATOM 7228  H HG11 . VAL A 1 88  ? 4.462   -0.912  0.475   1.00 1.05  ? 88  VAL A HG11 4  
ATOM 7229  H HG12 . VAL A 1 88  ? 4.021   0.083   -0.912  1.00 1.02  ? 88  VAL A HG12 4  
ATOM 7230  H HG13 . VAL A 1 88  ? 4.975   -1.382  -1.145  1.00 1.03  ? 88  VAL A HG13 4  
ATOM 7231  H HG21 . VAL A 1 88  ? 2.236   -3.754  -0.534  1.00 1.07  ? 88  VAL A HG21 4  
ATOM 7232  H HG22 . VAL A 1 88  ? 3.331   -3.219  0.740   1.00 1.02  ? 88  VAL A HG22 4  
ATOM 7233  H HG23 . VAL A 1 88  ? 3.961   -3.589  -0.866  1.00 1.09  ? 88  VAL A HG23 4  
ATOM 7234  N N    . VAL A 1 89  ? -0.058  -1.509  -1.461  1.00 0.24  ? 89  VAL A N    4  
ATOM 7235  C CA   . VAL A 1 89  ? -1.324  -2.051  -1.917  1.00 0.27  ? 89  VAL A CA   4  
ATOM 7236  C C    . VAL A 1 89  ? -1.160  -2.719  -3.275  1.00 0.34  ? 89  VAL A C    4  
ATOM 7237  O O    . VAL A 1 89  ? -0.389  -2.254  -4.116  1.00 0.42  ? 89  VAL A O    4  
ATOM 7238  C CB   . VAL A 1 89  ? -2.405  -0.947  -2.010  1.00 0.25  ? 89  VAL A CB   4  
ATOM 7239  C CG1  . VAL A 1 89  ? -2.864  -0.530  -0.622  1.00 0.29  ? 89  VAL A CG1  4  
ATOM 7240  C CG2  . VAL A 1 89  ? -1.884  0.263   -2.778  1.00 0.30  ? 89  VAL A CG2  4  
ATOM 7241  H H    . VAL A 1 89  ? 0.441   -0.906  -2.053  1.00 0.26  ? 89  VAL A H    4  
ATOM 7242  H HA   . VAL A 1 89  ? -1.652  -2.788  -1.199  1.00 0.32  ? 89  VAL A HA   4  
ATOM 7243  H HB   . VAL A 1 89  ? -3.256  -1.347  -2.543  1.00 0.28  ? 89  VAL A HB   4  
ATOM 7244  H HG11 . VAL A 1 89  ? -3.647  0.209   -0.706  1.00 1.04  ? 89  VAL A HG11 4  
ATOM 7245  H HG12 . VAL A 1 89  ? -2.029  -0.109  -0.080  1.00 1.07  ? 89  VAL A HG12 4  
ATOM 7246  H HG13 . VAL A 1 89  ? -3.238  -1.393  -0.091  1.00 1.01  ? 89  VAL A HG13 4  
ATOM 7247  H HG21 . VAL A 1 89  ? -2.671  0.999   -2.871  1.00 1.03  ? 89  VAL A HG21 4  
ATOM 7248  H HG22 . VAL A 1 89  ? -1.563  -0.043  -3.762  1.00 1.08  ? 89  VAL A HG22 4  
ATOM 7249  H HG23 . VAL A 1 89  ? -1.050  0.697   -2.246  1.00 1.05  ? 89  VAL A HG23 4  
ATOM 7250  N N    . ASP A 1 90  ? -1.876  -3.824  -3.469  1.00 0.41  ? 90  ASP A N    4  
ATOM 7251  C CA   . ASP A 1 90  ? -1.809  -4.573  -4.719  1.00 0.51  ? 90  ASP A CA   4  
ATOM 7252  C C    . ASP A 1 90  ? -2.594  -3.841  -5.802  1.00 0.48  ? 90  ASP A C    4  
ATOM 7253  O O    . ASP A 1 90  ? -3.293  -2.876  -5.506  1.00 0.45  ? 90  ASP A O    4  
ATOM 7254  C CB   . ASP A 1 90  ? -2.370  -5.987  -4.524  1.00 0.68  ? 90  ASP A CB   4  
ATOM 7255  C CG   . ASP A 1 90  ? -1.733  -7.008  -5.449  1.00 1.20  ? 90  ASP A CG   4  
ATOM 7256  O OD1  . ASP A 1 90  ? -1.814  -6.823  -6.681  1.00 1.92  ? 90  ASP A OD1  4  
ATOM 7257  O OD2  . ASP A 1 90  ? -1.181  -8.016  -4.956  1.00 1.86  ? 90  ASP A OD2  4  
ATOM 7258  H H    . ASP A 1 90  ? -2.461  -4.146  -2.753  1.00 0.44  ? 90  ASP A H    4  
ATOM 7259  H HA   . ASP A 1 90  ? -0.772  -4.638  -5.018  1.00 0.59  ? 90  ASP A HA   4  
ATOM 7260  H HB2  . ASP A 1 90  ? -2.193  -6.296  -3.506  1.00 1.54  ? 90  ASP A HB2  4  
ATOM 7261  H HB3  . ASP A 1 90  ? -3.435  -5.975  -4.709  1.00 1.21  ? 90  ASP A HB3  4  
ATOM 7262  N N    . ARG A 1 91  ? -2.507  -4.306  -7.038  1.00 0.57  ? 91  ARG A N    4  
ATOM 7263  C CA   . ARG A 1 91  ? -3.141  -3.620  -8.160  1.00 0.61  ? 91  ARG A CA   4  
ATOM 7264  C C    . ARG A 1 91  ? -4.648  -3.519  -7.951  1.00 0.55  ? 91  ARG A C    4  
ATOM 7265  O O    . ARG A 1 91  ? -5.236  -2.441  -8.069  1.00 0.55  ? 91  ARG A O    4  
ATOM 7266  C CB   . ARG A 1 91  ? -2.844  -4.364  -9.462  1.00 0.75  ? 91  ARG A CB   4  
ATOM 7267  C CG   . ARG A 1 91  ? -3.435  -3.705  -10.698 1.00 0.82  ? 91  ARG A CG   4  
ATOM 7268  C CD   . ARG A 1 91  ? -3.224  -4.561  -11.938 1.00 1.44  ? 91  ARG A CD   4  
ATOM 7269  N NE   . ARG A 1 91  ? -1.805  -4.808  -12.209 1.00 2.25  ? 91  ARG A NE   4  
ATOM 7270  C CZ   . ARG A 1 91  ? -1.200  -5.983  -12.022 1.00 3.13  ? 91  ARG A CZ   4  
ATOM 7271  N NH1  . ARG A 1 91  ? -1.882  -7.011  -11.528 1.00 3.39  ? 91  ARG A NH1  4  
ATOM 7272  N NH2  . ARG A 1 91  ? 0.085   -6.125  -12.322 1.00 4.16  ? 91  ARG A NH2  4  
ATOM 7273  H H    . ARG A 1 91  ? -2.023  -5.151  -7.197  1.00 0.66  ? 91  ARG A H    4  
ATOM 7274  H HA   . ARG A 1 91  ? -2.726  -2.624  -8.220  1.00 0.63  ? 91  ARG A HA   4  
ATOM 7275  H HB2  . ARG A 1 91  ? -1.774  -4.425  -9.591  1.00 0.85  ? 91  ARG A HB2  4  
ATOM 7276  H HB3  . ARG A 1 91  ? -3.245  -5.363  -9.389  1.00 0.78  ? 91  ARG A HB3  4  
ATOM 7277  H HG2  . ARG A 1 91  ? -4.494  -3.563  -10.547 1.00 1.07  ? 91  ARG A HG2  4  
ATOM 7278  H HG3  . ARG A 1 91  ? -2.958  -2.747  -10.848 1.00 1.01  ? 91  ARG A HG3  4  
ATOM 7279  H HD2  . ARG A 1 91  ? -3.721  -5.509  -11.792 1.00 1.95  ? 91  ARG A HD2  4  
ATOM 7280  H HD3  . ARG A 1 91  ? -3.661  -4.055  -12.787 1.00 1.87  ? 91  ARG A HD3  4  
ATOM 7281  H HE   . ARG A 1 91  ? -1.277  -4.055  -12.567 1.00 2.59  ? 91  ARG A HE   4  
ATOM 7282  H HH11 . ARG A 1 91  ? -2.853  -6.909  -11.301 1.00 3.07  ? 91  ARG A HH11 4  
ATOM 7283  H HH12 . ARG A 1 91  ? -1.422  -7.895  -11.364 1.00 4.20  ? 91  ARG A HH12 4  
ATOM 7284  H HH21 . ARG A 1 91  ? 0.605   -5.346  -12.689 1.00 4.40  ? 91  ARG A HH21 4  
ATOM 7285  H HH22 . ARG A 1 91  ? 0.547   -7.017  -12.197 1.00 4.87  ? 91  ARG A HH22 4  
ATOM 7286  N N    . GLU A 1 92  ? -5.260  -4.642  -7.596  1.00 0.57  ? 92  GLU A N    4  
ATOM 7287  C CA   . GLU A 1 92  ? -6.696  -4.691  -7.356  1.00 0.61  ? 92  GLU A CA   4  
ATOM 7288  C C    . GLU A 1 92  ? -7.057  -3.845  -6.145  1.00 0.51  ? 92  GLU A C    4  
ATOM 7289  O O    . GLU A 1 92  ? -8.056  -3.132  -6.146  1.00 0.56  ? 92  GLU A O    4  
ATOM 7290  C CB   . GLU A 1 92  ? -7.155  -6.137  -7.137  1.00 0.74  ? 92  GLU A CB   4  
ATOM 7291  C CG   . GLU A 1 92  ? -7.301  -6.951  -8.413  1.00 1.44  ? 92  GLU A CG   4  
ATOM 7292  C CD   . GLU A 1 92  ? -6.034  -6.996  -9.242  1.00 1.98  ? 92  GLU A CD   4  
ATOM 7293  O OE1  . GLU A 1 92  ? -5.013  -7.515  -8.744  1.00 2.26  ? 92  GLU A OE1  4  
ATOM 7294  O OE2  . GLU A 1 92  ? -6.054  -6.503  -10.390 1.00 2.68  ? 92  GLU A OE2  4  
ATOM 7295  H H    . GLU A 1 92  ? -4.731  -5.464  -7.494  1.00 0.59  ? 92  GLU A H    4  
ATOM 7296  H HA   . GLU A 1 92  ? -7.194  -4.290  -8.226  1.00 0.67  ? 92  GLU A HA   4  
ATOM 7297  H HB2  . GLU A 1 92  ? -6.436  -6.633  -6.502  1.00 1.34  ? 92  GLU A HB2  4  
ATOM 7298  H HB3  . GLU A 1 92  ? -8.111  -6.123  -6.635  1.00 1.23  ? 92  GLU A HB3  4  
ATOM 7299  H HG2  . GLU A 1 92  ? -7.571  -7.964  -8.146  1.00 1.97  ? 92  GLU A HG2  4  
ATOM 7300  H HG3  . GLU A 1 92  ? -8.092  -6.519  -9.010  1.00 1.93  ? 92  GLU A HG3  4  
ATOM 7301  N N    . THR A 1 93  ? -6.215  -3.925  -5.128  1.00 0.44  ? 93  THR A N    4  
ATOM 7302  C CA   . THR A 1 93  ? -6.416  -3.201  -3.883  1.00 0.38  ? 93  THR A CA   4  
ATOM 7303  C C    . THR A 1 93  ? -6.369  -1.693  -4.117  1.00 0.33  ? 93  THR A C    4  
ATOM 7304  O O    . THR A 1 93  ? -7.268  -0.953  -3.713  1.00 0.37  ? 93  THR A O    4  
ATOM 7305  C CB   . THR A 1 93  ? -5.310  -3.575  -2.883  1.00 0.36  ? 93  THR A CB   4  
ATOM 7306  O OG1  . THR A 1 93  ? -5.122  -4.994  -2.879  1.00 0.47  ? 93  THR A OG1  4  
ATOM 7307  C CG2  . THR A 1 93  ? -5.646  -3.093  -1.483  1.00 0.36  ? 93  THR A CG2  4  
ATOM 7308  H H    . THR A 1 93  ? -5.419  -4.486  -5.218  1.00 0.45  ? 93  THR A H    4  
ATOM 7309  H HA   . THR A 1 93  ? -7.377  -3.480  -3.467  1.00 0.45  ? 93  THR A HA   4  
ATOM 7310  H HB   . THR A 1 93  ? -4.392  -3.098  -3.198  1.00 0.33  ? 93  THR A HB   4  
ATOM 7311  H HG1  . THR A 1 93  ? -5.957  -5.425  -2.695  1.00 0.82  ? 93  THR A HG1  4  
ATOM 7312  H HG21 . THR A 1 93  ? -5.760  -2.019  -1.489  1.00 1.00  ? 93  THR A HG21 4  
ATOM 7313  H HG22 . THR A 1 93  ? -4.849  -3.366  -0.806  1.00 1.04  ? 93  THR A HG22 4  
ATOM 7314  H HG23 . THR A 1 93  ? -6.569  -3.552  -1.157  1.00 1.08  ? 93  THR A HG23 4  
ATOM 7315  N N    . ASP A 1 94  ? -5.310  -1.266  -4.790  1.00 0.33  ? 94  ASP A N    4  
ATOM 7316  C CA   . ASP A 1 94  ? -5.038  0.143   -5.039  1.00 0.39  ? 94  ASP A CA   4  
ATOM 7317  C C    . ASP A 1 94  ? -6.178  0.803   -5.812  1.00 0.43  ? 94  ASP A C    4  
ATOM 7318  O O    . ASP A 1 94  ? -6.574  1.929   -5.514  1.00 0.50  ? 94  ASP A O    4  
ATOM 7319  C CB   . ASP A 1 94  ? -3.714  0.260   -5.808  1.00 0.48  ? 94  ASP A CB   4  
ATOM 7320  C CG   . ASP A 1 94  ? -3.300  1.688   -6.081  1.00 0.71  ? 94  ASP A CG   4  
ATOM 7321  O OD1  . ASP A 1 94  ? -3.279  2.495   -5.136  1.00 0.77  ? 94  ASP A OD1  4  
ATOM 7322  O OD2  . ASP A 1 94  ? -2.990  2.008   -7.248  1.00 1.18  ? 94  ASP A OD2  4  
ATOM 7323  H H    . ASP A 1 94  ? -4.671  -1.934  -5.136  1.00 0.34  ? 94  ASP A H    4  
ATOM 7324  H HA   . ASP A 1 94  ? -4.936  0.638   -4.084  1.00 0.43  ? 94  ASP A HA   4  
ATOM 7325  H HB2  . ASP A 1 94  ? -2.934  -0.213  -5.231  1.00 0.48  ? 94  ASP A HB2  4  
ATOM 7326  H HB3  . ASP A 1 94  ? -3.813  -0.254  -6.754  1.00 0.53  ? 94  ASP A HB3  4  
ATOM 7327  N N    . GLU A 1 95  ? -6.701  0.101   -6.801  1.00 0.43  ? 95  GLU A N    4  
ATOM 7328  C CA   . GLU A 1 95  ? -7.824  0.603   -7.586  1.00 0.49  ? 95  GLU A CA   4  
ATOM 7329  C C    . GLU A 1 95  ? -9.133  0.522   -6.802  1.00 0.45  ? 95  GLU A C    4  
ATOM 7330  O O    . GLU A 1 95  ? -9.974  1.416   -6.897  1.00 0.50  ? 95  GLU A O    4  
ATOM 7331  C CB   . GLU A 1 95  ? -7.936  -0.180  -8.892  1.00 0.60  ? 95  GLU A CB   4  
ATOM 7332  C CG   . GLU A 1 95  ? -6.736  0.008   -9.804  1.00 0.72  ? 95  GLU A CG   4  
ATOM 7333  C CD   . GLU A 1 95  ? -6.632  1.419   -10.346 1.00 1.17  ? 95  GLU A CD   4  
ATOM 7334  O OE1  . GLU A 1 95  ? -6.170  2.322   -9.614  1.00 1.94  ? 95  GLU A OE1  4  
ATOM 7335  O OE2  . GLU A 1 95  ? -7.017  1.636   -11.514 1.00 1.23  ? 95  GLU A OE2  4  
ATOM 7336  H H    . GLU A 1 95  ? -6.319  -0.779  -7.020  1.00 0.44  ? 95  GLU A H    4  
ATOM 7337  H HA   . GLU A 1 95  ? -7.626  1.642   -7.814  1.00 0.54  ? 95  GLU A HA   4  
ATOM 7338  H HB2  . GLU A 1 95  ? -8.027  -1.231  -8.663  1.00 0.60  ? 95  GLU A HB2  4  
ATOM 7339  H HB3  . GLU A 1 95  ? -8.819  0.144   -9.422  1.00 0.66  ? 95  GLU A HB3  4  
ATOM 7340  H HG2  . GLU A 1 95  ? -5.839  -0.213  -9.244  1.00 1.08  ? 95  GLU A HG2  4  
ATOM 7341  H HG3  . GLU A 1 95  ? -6.820  -0.678  -10.634 1.00 1.05  ? 95  GLU A HG3  4  
ATOM 7342  N N    . PHE A 1 96  ? -9.286  -0.540  -6.014  1.00 0.41  ? 96  PHE A N    4  
ATOM 7343  C CA   . PHE A 1 96  ? -10.495 -0.753  -5.227  1.00 0.41  ? 96  PHE A CA   4  
ATOM 7344  C C    . PHE A 1 96  ? -10.687 0.372   -4.217  1.00 0.36  ? 96  PHE A C    4  
ATOM 7345  O O    . PHE A 1 96  ? -11.774 0.935   -4.103  1.00 0.40  ? 96  PHE A O    4  
ATOM 7346  C CB   . PHE A 1 96  ? -10.421 -2.106  -4.506  1.00 0.44  ? 96  PHE A CB   4  
ATOM 7347  C CG   . PHE A 1 96  ? -11.538 -2.351  -3.528  1.00 0.51  ? 96  PHE A CG   4  
ATOM 7348  C CD1  . PHE A 1 96  ? -12.813 -2.660  -3.978  1.00 0.63  ? 96  PHE A CD1  4  
ATOM 7349  C CD2  . PHE A 1 96  ? -11.315 -2.272  -2.164  1.00 0.52  ? 96  PHE A CD2  4  
ATOM 7350  C CE1  . PHE A 1 96  ? -13.843 -2.885  -3.085  1.00 0.73  ? 96  PHE A CE1  4  
ATOM 7351  C CE2  . PHE A 1 96  ? -12.341 -2.494  -1.266  1.00 0.62  ? 96  PHE A CE2  4  
ATOM 7352  C CZ   . PHE A 1 96  ? -13.598 -2.803  -1.718  1.00 0.72  ? 96  PHE A CZ   4  
ATOM 7353  H H    . PHE A 1 96  ? -8.563  -1.203  -5.965  1.00 0.41  ? 96  PHE A H    4  
ATOM 7354  H HA   . PHE A 1 96  ? -11.337 -0.762  -5.904  1.00 0.46  ? 96  PHE A HA   4  
ATOM 7355  H HB2  . PHE A 1 96  ? -10.450 -2.897  -5.241  1.00 0.49  ? 96  PHE A HB2  4  
ATOM 7356  H HB3  . PHE A 1 96  ? -9.488  -2.164  -3.965  1.00 0.41  ? 96  PHE A HB3  4  
ATOM 7357  H HD1  . PHE A 1 96  ? -12.999 -2.724  -5.039  1.00 0.67  ? 96  PHE A HD1  4  
ATOM 7358  H HD2  . PHE A 1 96  ? -10.326 -2.031  -1.801  1.00 0.48  ? 96  PHE A HD2  4  
ATOM 7359  H HE1  . PHE A 1 96  ? -14.832 -3.125  -3.447  1.00 0.83  ? 96  PHE A HE1  4  
ATOM 7360  H HE2  . PHE A 1 96  ? -12.154 -2.431  -0.203  1.00 0.66  ? 96  PHE A HE2  4  
ATOM 7361  H HZ   . PHE A 1 96  ? -14.399 -2.979  -1.015  1.00 0.81  ? 96  PHE A HZ   4  
ATOM 7362  N N    . PHE A 1 97  ? -9.621  0.699   -3.502  1.00 0.32  ? 97  PHE A N    4  
ATOM 7363  C CA   . PHE A 1 97  ? -9.646  1.778   -2.528  1.00 0.32  ? 97  PHE A CA   4  
ATOM 7364  C C    . PHE A 1 97  ? -9.957  3.119   -3.186  1.00 0.39  ? 97  PHE A C    4  
ATOM 7365  O O    . PHE A 1 97  ? -10.697 3.923   -2.626  1.00 0.44  ? 97  PHE A O    4  
ATOM 7366  C CB   . PHE A 1 97  ? -8.312  1.846   -1.779  1.00 0.30  ? 97  PHE A CB   4  
ATOM 7367  C CG   . PHE A 1 97  ? -8.259  0.967   -0.559  1.00 0.29  ? 97  PHE A CG   4  
ATOM 7368  C CD1  . PHE A 1 97  ? -8.908  1.331   0.610   1.00 0.38  ? 97  PHE A CD1  4  
ATOM 7369  C CD2  . PHE A 1 97  ? -7.566  -0.230  -0.588  1.00 0.37  ? 97  PHE A CD2  4  
ATOM 7370  C CE1  . PHE A 1 97  ? -8.860  0.516   1.728   1.00 0.41  ? 97  PHE A CE1  4  
ATOM 7371  C CE2  . PHE A 1 97  ? -7.515  -1.050  0.525   1.00 0.40  ? 97  PHE A CE2  4  
ATOM 7372  C CZ   . PHE A 1 97  ? -8.162  -0.641  1.711   1.00 0.35  ? 97  PHE A CZ   4  
ATOM 7373  H H    . PHE A 1 97  ? -8.794  0.191   -3.626  1.00 0.30  ? 97  PHE A H    4  
ATOM 7374  H HA   . PHE A 1 97  ? -10.429 1.558   -1.818  1.00 0.34  ? 97  PHE A HA   4  
ATOM 7375  H HB2  . PHE A 1 97  ? -7.522  1.533   -2.443  1.00 0.29  ? 97  PHE A HB2  4  
ATOM 7376  H HB3  . PHE A 1 97  ? -8.128  2.862   -1.468  1.00 0.35  ? 97  PHE A HB3  4  
ATOM 7377  H HD1  . PHE A 1 97  ? -9.453  2.263   0.647   1.00 0.53  ? 97  PHE A HD1  4  
ATOM 7378  H HD2  . PHE A 1 97  ? -7.057  -0.525  -1.494  1.00 0.50  ? 97  PHE A HD2  4  
ATOM 7379  H HE1  . PHE A 1 97  ? -9.369  0.810   2.632   1.00 0.55  ? 97  PHE A HE1  4  
ATOM 7380  H HE2  . PHE A 1 97  ? -6.972  -1.981  0.485   1.00 0.55  ? 97  PHE A HE2  4  
ATOM 7381  H HZ   . PHE A 1 97  ? -8.121  -1.265  2.595   1.00 0.40  ? 97  PHE A HZ   4  
ATOM 7382  N N    . LYS A 1 98  ? -9.422  3.347   -4.383  1.00 0.43  ? 98  LYS A N    4  
ATOM 7383  C CA   . LYS A 1 98  ? -9.642  4.614   -5.080  1.00 0.53  ? 98  LYS A CA   4  
ATOM 7384  C C    . LYS A 1 98  ? -11.100 4.787   -5.479  1.00 0.56  ? 98  LYS A C    4  
ATOM 7385  O O    . LYS A 1 98  ? -11.700 5.827   -5.212  1.00 0.61  ? 98  LYS A O    4  
ATOM 7386  C CB   . LYS A 1 98  ? -8.776  4.719   -6.335  1.00 0.63  ? 98  LYS A CB   4  
ATOM 7387  C CG   . LYS A 1 98  ? -7.300  4.911   -6.060  1.00 0.85  ? 98  LYS A CG   4  
ATOM 7388  C CD   . LYS A 1 98  ? -6.587  5.449   -7.287  1.00 1.13  ? 98  LYS A CD   4  
ATOM 7389  C CE   . LYS A 1 98  ? -5.155  4.965   -7.345  1.00 1.31  ? 98  LYS A CE   4  
ATOM 7390  N NZ   . LYS A 1 98  ? -5.100  3.493   -7.492  1.00 1.92  ? 98  LYS A NZ   4  
ATOM 7391  H H    . LYS A 1 98  ? -8.872  2.655   -4.805  1.00 0.41  ? 98  LYS A H    4  
ATOM 7392  H HA   . LYS A 1 98  ? -9.373  5.411   -4.403  1.00 0.56  ? 98  LYS A HA   4  
ATOM 7393  H HB2  . LYS A 1 98  ? -8.892  3.812   -6.910  1.00 0.80  ? 98  LYS A HB2  4  
ATOM 7394  H HB3  . LYS A 1 98  ? -9.120  5.549   -6.928  1.00 0.82  ? 98  LYS A HB3  4  
ATOM 7395  H HG2  . LYS A 1 98  ? -7.182  5.612   -5.249  1.00 1.09  ? 98  LYS A HG2  4  
ATOM 7396  H HG3  . LYS A 1 98  ? -6.865  3.961   -5.788  1.00 1.12  ? 98  LYS A HG3  4  
ATOM 7397  H HD2  . LYS A 1 98  ? -7.107  5.114   -8.171  1.00 1.77  ? 98  LYS A HD2  4  
ATOM 7398  H HD3  . LYS A 1 98  ? -6.593  6.529   -7.252  1.00 1.65  ? 98  LYS A HD3  4  
ATOM 7399  H HE2  . LYS A 1 98  ? -4.663  5.425   -8.189  1.00 1.69  ? 98  LYS A HE2  4  
ATOM 7400  H HE3  . LYS A 1 98  ? -4.651  5.250   -6.433  1.00 1.94  ? 98  LYS A HE3  4  
ATOM 7401  H HZ1  . LYS A 1 98  ? -4.106  3.164   -7.503  1.00 2.12  ? 98  LYS A HZ1  4  
ATOM 7402  H HZ2  . LYS A 1 98  ? -5.558  3.199   -8.384  1.00 2.50  ? 98  LYS A HZ2  4  
ATOM 7403  H HZ3  . LYS A 1 98  ? -5.592  3.033   -6.698  1.00 2.45  ? 98  LYS A HZ3  4  
ATOM 7404  N N    . LYS A 1 99  ? -11.665 3.769   -6.119  1.00 0.55  ? 99  LYS A N    4  
ATOM 7405  C CA   . LYS A 1 99  ? -13.046 3.839   -6.580  1.00 0.63  ? 99  LYS A CA   4  
ATOM 7406  C C    . LYS A 1 99  ? -14.028 3.746   -5.415  1.00 0.63  ? 99  LYS A C    4  
ATOM 7407  O O    . LYS A 1 99  ? -15.199 4.100   -5.545  1.00 0.75  ? 99  LYS A O    4  
ATOM 7408  C CB   . LYS A 1 99  ? -13.342 2.740   -7.600  1.00 0.66  ? 99  LYS A CB   4  
ATOM 7409  C CG   . LYS A 1 99  ? -13.186 1.329   -7.060  1.00 0.60  ? 99  LYS A CG   4  
ATOM 7410  C CD   . LYS A 1 99  ? -13.797 0.315   -8.009  1.00 0.76  ? 99  LYS A CD   4  
ATOM 7411  C CE   . LYS A 1 99  ? -15.264 0.621   -8.288  1.00 1.62  ? 99  LYS A CE   4  
ATOM 7412  N NZ   . LYS A 1 99  ? -15.808 -0.199  -9.399  1.00 2.04  ? 99  LYS A NZ   4  
ATOM 7413  H H    . LYS A 1 99  ? -11.137 2.958   -6.298  1.00 0.53  ? 99  LYS A H    4  
ATOM 7414  H HA   . LYS A 1 99  ? -13.179 4.797   -7.058  1.00 0.70  ? 99  LYS A HA   4  
ATOM 7415  H HB2  . LYS A 1 99  ? -14.357 2.856   -7.949  1.00 0.73  ? 99  LYS A HB2  4  
ATOM 7416  H HB3  . LYS A 1 99  ? -12.670 2.857   -8.437  1.00 0.70  ? 99  LYS A HB3  4  
ATOM 7417  H HG2  . LYS A 1 99  ? -12.133 1.112   -6.949  1.00 0.67  ? 99  LYS A HG2  4  
ATOM 7418  H HG3  . LYS A 1 99  ? -13.672 1.258   -6.098  1.00 0.65  ? 99  LYS A HG3  4  
ATOM 7419  H HD2  . LYS A 1 99  ? -13.253 0.335   -8.940  1.00 1.19  ? 99  LYS A HD2  4  
ATOM 7420  H HD3  . LYS A 1 99  ? -13.724 -0.665  -7.565  1.00 1.16  ? 99  LYS A HD3  4  
ATOM 7421  H HE2  . LYS A 1 99  ? -15.836 0.422   -7.396  1.00 2.17  ? 99  LYS A HE2  4  
ATOM 7422  H HE3  . LYS A 1 99  ? -15.354 1.665   -8.546  1.00 2.18  ? 99  LYS A HE3  4  
ATOM 7423  H HZ1  . LYS A 1 99  ? -15.662 -1.214  -9.204  1.00 2.53  ? 99  LYS A HZ1  4  
ATOM 7424  H HZ2  . LYS A 1 99  ? -15.327 0.043   -10.295 1.00 2.23  ? 99  LYS A HZ2  4  
ATOM 7425  H HZ3  . LYS A 1 99  ? -16.831 -0.021  -9.511  1.00 2.44  ? 99  LYS A HZ3  4  
ATOM 7426  N N    . CYS A 1 100 ? -13.554 3.252   -4.284  1.00 0.55  ? 100 CYS A N    4  
ATOM 7427  C CA   . CYS A 1 100 ? -14.382 3.159   -3.098  1.00 0.60  ? 100 CYS A CA   4  
ATOM 7428  C C    . CYS A 1 100 ? -14.241 4.449   -2.301  1.00 0.61  ? 100 CYS A C    4  
ATOM 7429  O O    . CYS A 1 100 ? -15.029 4.732   -1.396  1.00 0.68  ? 100 CYS A O    4  
ATOM 7430  C CB   . CYS A 1 100 ? -13.979 1.949   -2.245  1.00 0.60  ? 100 CYS A CB   4  
ATOM 7431  S SG   . CYS A 1 100 ? -15.218 1.442   -1.029  1.00 1.39  ? 100 CYS A SG   4  
ATOM 7432  H H    . CYS A 1 100 ? -12.624 2.956   -4.243  1.00 0.51  ? 100 CYS A H    4  
ATOM 7433  H HA   . CYS A 1 100 ? -15.408 3.046   -3.419  1.00 0.68  ? 100 CYS A HA   4  
ATOM 7434  H HB2  . CYS A 1 100 ? -13.796 1.107   -2.892  1.00 1.12  ? 100 CYS A HB2  4  
ATOM 7435  H HB3  . CYS A 1 100 ? -13.071 2.187   -1.708  1.00 0.81  ? 100 CYS A HB3  4  
ATOM 7436  H HG   . CYS A 1 100 ? -14.926 0.209   -0.633  1.00 2.19  ? 100 CYS A HG   4  
ATOM 7437  N N    . ARG A 1 101 ? -13.221 5.231   -2.680  1.00 0.59  ? 101 ARG A N    4  
ATOM 7438  C CA   . ARG A 1 101 ? -12.940 6.535   -2.083  1.00 0.65  ? 101 ARG A CA   4  
ATOM 7439  C C    . ARG A 1 101 ? -12.476 6.377   -0.642  1.00 0.64  ? 101 ARG A C    4  
ATOM 7440  O O    . ARG A 1 101 ? -12.727 7.231   0.211   1.00 0.75  ? 101 ARG A O    4  
ATOM 7441  C CB   . ARG A 1 101 ? -14.175 7.424   -2.182  1.00 0.77  ? 101 ARG A CB   4  
ATOM 7442  C CG   . ARG A 1 101 ? -14.656 7.590   -3.614  1.00 0.79  ? 101 ARG A CG   4  
ATOM 7443  C CD   . ARG A 1 101 ? -16.114 7.987   -3.662  1.00 1.19  ? 101 ARG A CD   4  
ATOM 7444  N NE   . ARG A 1 101 ? -16.344 9.304   -3.073  1.00 2.14  ? 101 ARG A NE   4  
ATOM 7445  C CZ   . ARG A 1 101 ? -17.471 9.662   -2.463  1.00 3.08  ? 101 ARG A CZ   4  
ATOM 7446  N NH1  . ARG A 1 101 ? -18.433 8.770   -2.253  1.00 3.37  ? 101 ARG A NH1  4  
ATOM 7447  N NH2  . ARG A 1 101 ? -17.627 10.905  -2.024  1.00 4.09  ? 101 ARG A NH2  4  
ATOM 7448  H H    . ARG A 1 101 ? -12.633 4.915   -3.398  1.00 0.57  ? 101 ARG A H    4  
ATOM 7449  H HA   . ARG A 1 101 ? -12.139 6.986   -2.651  1.00 0.66  ? 101 ARG A HA   4  
ATOM 7450  H HB2  . ARG A 1 101 ? -14.973 6.986   -1.599  1.00 0.79  ? 101 ARG A HB2  4  
ATOM 7451  H HB3  . ARG A 1 101 ? -13.939 8.400   -1.787  1.00 0.92  ? 101 ARG A HB3  4  
ATOM 7452  H HG2  . ARG A 1 101 ? -14.069 8.358   -4.094  1.00 1.42  ? 101 ARG A HG2  4  
ATOM 7453  H HG3  . ARG A 1 101 ? -14.528 6.654   -4.138  1.00 1.29  ? 101 ARG A HG3  4  
ATOM 7454  H HD2  . ARG A 1 101 ? -16.433 8.001   -4.693  1.00 1.59  ? 101 ARG A HD2  4  
ATOM 7455  H HD3  . ARG A 1 101 ? -16.688 7.251   -3.119  1.00 1.65  ? 101 ARG A HD3  4  
ATOM 7456  H HE   . ARG A 1 101 ? -15.615 9.967   -3.159  1.00 2.45  ? 101 ARG A HE   4  
ATOM 7457  H HH11 . ARG A 1 101 ? -18.313 7.815   -2.548  1.00 3.01  ? 101 ARG A HH11 4  
ATOM 7458  H HH12 . ARG A 1 101 ? -19.287 9.048   -1.800  1.00 4.21  ? 101 ARG A HH12 4  
ATOM 7459  H HH21 . ARG A 1 101 ? -16.893 11.585  -2.151  1.00 4.30  ? 101 ARG A HH21 4  
ATOM 7460  H HH22 . ARG A 1 101 ? -18.481 11.174  -1.566  1.00 4.83  ? 101 ARG A HH22 4  
ATOM 7461  N N    . VAL A 1 102 ? -11.768 5.282   -0.401  1.00 0.55  ? 102 VAL A N    4  
ATOM 7462  C CA   . VAL A 1 102 ? -11.287 4.933   0.924   1.00 0.57  ? 102 VAL A CA   4  
ATOM 7463  C C    . VAL A 1 102 ? -9.765  5.007   0.962   1.00 0.49  ? 102 VAL A C    4  
ATOM 7464  O O    . VAL A 1 102 ? -9.100  4.769   -0.047  1.00 0.46  ? 102 VAL A O    4  
ATOM 7465  C CB   . VAL A 1 102 ? -11.729 3.505   1.309   1.00 0.69  ? 102 VAL A CB   4  
ATOM 7466  C CG1  . VAL A 1 102 ? -11.305 3.157   2.727   1.00 0.89  ? 102 VAL A CG1  4  
ATOM 7467  C CG2  . VAL A 1 102 ? -13.230 3.351   1.147   1.00 1.42  ? 102 VAL A CG2  4  
ATOM 7468  H H    . VAL A 1 102 ? -11.542 4.692   -1.155  1.00 0.51  ? 102 VAL A H    4  
ATOM 7469  H HA   . VAL A 1 102 ? -11.701 5.631   1.637   1.00 0.66  ? 102 VAL A HA   4  
ATOM 7470  H HB   . VAL A 1 102 ? -11.246 2.811   0.636   1.00 1.38  ? 102 VAL A HB   4  
ATOM 7471  H HG11 . VAL A 1 102 ? -11.801 3.815   3.424   1.00 1.44  ? 102 VAL A HG11 4  
ATOM 7472  H HG12 . VAL A 1 102 ? -10.234 3.275   2.820   1.00 1.45  ? 102 VAL A HG12 4  
ATOM 7473  H HG13 . VAL A 1 102 ? -11.573 2.135   2.942   1.00 1.57  ? 102 VAL A HG13 4  
ATOM 7474  H HG21 . VAL A 1 102 ? -13.524 2.356   1.444   1.00 2.00  ? 102 VAL A HG21 4  
ATOM 7475  H HG22 . VAL A 1 102 ? -13.495 3.510   0.112   1.00 2.08  ? 102 VAL A HG22 4  
ATOM 7476  H HG23 . VAL A 1 102 ? -13.734 4.078   1.766   1.00 1.73  ? 102 VAL A HG23 4  
ATOM 7477  N N    . ILE A 1 103 ? -9.218  5.352   2.114   1.00 0.54  ? 103 ILE A N    4  
ATOM 7478  C CA   . ILE A 1 103 ? -7.778  5.378   2.286   1.00 0.50  ? 103 ILE A CA   4  
ATOM 7479  C C    . ILE A 1 103 ? -7.301  4.081   2.939   1.00 0.43  ? 103 ILE A C    4  
ATOM 7480  O O    . ILE A 1 103 ? -7.780  3.702   4.010   1.00 0.46  ? 103 ILE A O    4  
ATOM 7481  C CB   . ILE A 1 103 ? -7.328  6.590   3.130   1.00 0.61  ? 103 ILE A CB   4  
ATOM 7482  C CG1  . ILE A 1 103 ? -7.702  7.894   2.415   1.00 0.78  ? 103 ILE A CG1  4  
ATOM 7483  C CG2  . ILE A 1 103 ? -5.828  6.534   3.396   1.00 0.62  ? 103 ILE A CG2  4  
ATOM 7484  C CD1  . ILE A 1 103 ? -7.277  9.143   3.157   1.00 1.33  ? 103 ILE A CD1  4  
ATOM 7485  H H    . ILE A 1 103 ? -9.799  5.587   2.876   1.00 0.65  ? 103 ILE A H    4  
ATOM 7486  H HA   . ILE A 1 103 ? -7.329  5.463   1.308   1.00 0.50  ? 103 ILE A HA   4  
ATOM 7487  H HB   . ILE A 1 103 ? -7.838  6.551   4.081   1.00 0.64  ? 103 ILE A HB   4  
ATOM 7488  H HG12 . ILE A 1 103 ? -7.230  7.914   1.444   1.00 1.38  ? 103 ILE A HG12 4  
ATOM 7489  H HG13 . ILE A 1 103 ? -8.775  7.930   2.289   1.00 1.26  ? 103 ILE A HG13 4  
ATOM 7490  H HG21 . ILE A 1 103 ? -5.533  7.399   3.971   1.00 1.17  ? 103 ILE A HG21 4  
ATOM 7491  H HG22 . ILE A 1 103 ? -5.297  6.529   2.456   1.00 1.19  ? 103 ILE A HG22 4  
ATOM 7492  H HG23 . ILE A 1 103 ? -5.592  5.636   3.950   1.00 1.09  ? 103 ILE A HG23 4  
ATOM 7493  H HD11 . ILE A 1 103 ? -7.597  10.015  2.607   1.00 1.78  ? 103 ILE A HD11 4  
ATOM 7494  H HD12 . ILE A 1 103 ? -6.202  9.153   3.252   1.00 1.83  ? 103 ILE A HD12 4  
ATOM 7495  H HD13 . ILE A 1 103 ? -7.726  9.151   4.139   1.00 1.99  ? 103 ILE A HD13 4  
ATOM 7496  N N    . PRO A 1 104 ? -6.380  3.368   2.279   1.00 0.39  ? 104 PRO A N    4  
ATOM 7497  C CA   . PRO A 1 104 ? -5.797  2.146   2.824   1.00 0.37  ? 104 PRO A CA   4  
ATOM 7498  C C    . PRO A 1 104 ? -4.860  2.445   3.987   1.00 0.37  ? 104 PRO A C    4  
ATOM 7499  O O    . PRO A 1 104 ? -4.185  3.470   4.000   1.00 0.45  ? 104 PRO A O    4  
ATOM 7500  C CB   . PRO A 1 104 ? -5.034  1.544   1.643   1.00 0.41  ? 104 PRO A CB   4  
ATOM 7501  C CG   . PRO A 1 104 ? -4.761  2.685   0.723   1.00 0.53  ? 104 PRO A CG   4  
ATOM 7502  C CD   . PRO A 1 104 ? -5.840  3.710   0.954   1.00 0.44  ? 104 PRO A CD   4  
ATOM 7503  H HA   . PRO A 1 104 ? -6.560  1.457   3.152   1.00 0.37  ? 104 PRO A HA   4  
ATOM 7504  H HB2  . PRO A 1 104 ? -4.117  1.094   1.997   1.00 0.57  ? 104 PRO A HB2  4  
ATOM 7505  H HB3  . PRO A 1 104 ? -5.646  0.793   1.167   1.00 0.55  ? 104 PRO A HB3  4  
ATOM 7506  H HG2  . PRO A 1 104 ? -3.795  3.109   0.947   1.00 0.86  ? 104 PRO A HG2  4  
ATOM 7507  H HG3  . PRO A 1 104 ? -4.788  2.341   -0.301  1.00 0.82  ? 104 PRO A HG3  4  
ATOM 7508  H HD2  . PRO A 1 104 ? -5.415  4.703   0.961   1.00 0.59  ? 104 PRO A HD2  4  
ATOM 7509  H HD3  . PRO A 1 104 ? -6.607  3.633   0.199   1.00 0.57  ? 104 PRO A HD3  4  
ATOM 7510  N N    . SER A 1 105 ? -4.821  1.549   4.961   1.00 0.32  ? 105 SER A N    4  
ATOM 7511  C CA   . SER A 1 105 ? -4.043  1.785   6.163   1.00 0.34  ? 105 SER A CA   4  
ATOM 7512  C C    . SER A 1 105 ? -3.760  0.481   6.893   1.00 0.34  ? 105 SER A C    4  
ATOM 7513  O O    . SER A 1 105 ? -4.332  -0.561  6.552   1.00 0.33  ? 105 SER A O    4  
ATOM 7514  C CB   . SER A 1 105 ? -4.788  2.751   7.091   1.00 0.43  ? 105 SER A CB   4  
ATOM 7515  O OG   . SER A 1 105 ? -6.087  2.264   7.403   1.00 1.42  ? 105 SER A OG   4  
ATOM 7516  H H    . SER A 1 105 ? -5.308  0.710   4.866   1.00 0.31  ? 105 SER A H    4  
ATOM 7517  H HA   . SER A 1 105 ? -3.107  2.232   5.869   1.00 0.34  ? 105 SER A HA   4  
ATOM 7518  H HB2  . SER A 1 105 ? -4.230  2.865   8.008   1.00 1.18  ? 105 SER A HB2  4  
ATOM 7519  H HB3  . SER A 1 105 ? -4.883  3.712   6.606   1.00 0.94  ? 105 SER A HB3  4  
ATOM 7520  H HG   . SER A 1 105 ? -6.474  2.818   8.104   1.00 1.92  ? 105 SER A HG   4  
ATOM 7521  N N    . GLN A 1 106 ? -2.888  0.544   7.893   1.00 0.39  ? 106 GLN A N    4  
ATOM 7522  C CA   . GLN A 1 106 ? -2.571  -0.610  8.735   1.00 0.43  ? 106 GLN A CA   4  
ATOM 7523  C C    . GLN A 1 106 ? -3.832  -1.194  9.373   1.00 0.45  ? 106 GLN A C    4  
ATOM 7524  O O    . GLN A 1 106 ? -3.913  -2.394  9.634   1.00 0.50  ? 106 GLN A O    4  
ATOM 7525  C CB   . GLN A 1 106 ? -1.569  -0.216  9.820   1.00 0.52  ? 106 GLN A CB   4  
ATOM 7526  C CG   . GLN A 1 106 ? -0.235  0.265   9.279   1.00 0.68  ? 106 GLN A CG   4  
ATOM 7527  C CD   . GLN A 1 106 ? 0.648   0.842   10.365  1.00 0.96  ? 106 GLN A CD   4  
ATOM 7528  O OE1  . GLN A 1 106 ? 0.161   1.415   11.341  1.00 1.66  ? 106 GLN A OE1  4  
ATOM 7529  N NE2  . GLN A 1 106 ? 1.954   0.684   10.217  1.00 1.42  ? 106 GLN A NE2  4  
ATOM 7530  H H    . GLN A 1 106 ? -2.425  1.399   8.062   1.00 0.42  ? 106 GLN A H    4  
ATOM 7531  H HA   . GLN A 1 106 ? -2.123  -1.362  8.103   1.00 0.42  ? 106 GLN A HA   4  
ATOM 7532  H HB2  . GLN A 1 106 ? -1.992  0.574   10.420  1.00 0.66  ? 106 GLN A HB2  4  
ATOM 7533  H HB3  . GLN A 1 106 ? -1.386  -1.073  10.450  1.00 0.73  ? 106 GLN A HB3  4  
ATOM 7534  H HG2  . GLN A 1 106 ? 0.277   -0.568  8.821   1.00 0.91  ? 106 GLN A HG2  4  
ATOM 7535  H HG3  . GLN A 1 106 ? -0.417  1.030   8.537   1.00 1.06  ? 106 GLN A HG3  4  
ATOM 7536  H HE21 . GLN A 1 106 ? 2.276   0.212   9.422   1.00 1.87  ? 106 GLN A HE21 4  
ATOM 7537  H HE22 . GLN A 1 106 ? 2.545   1.040   10.918  1.00 1.72  ? 106 GLN A HE22 4  
ATOM 7538  N N    . GLU A 1 107 ? -4.822  -0.335  9.601   1.00 0.46  ? 107 GLU A N    4  
ATOM 7539  C CA   . GLU A 1 107 ? -6.096  -0.746  10.187  1.00 0.51  ? 107 GLU A CA   4  
ATOM 7540  C C    . GLU A 1 107 ? -6.770  -1.818  9.333   1.00 0.42  ? 107 GLU A C    4  
ATOM 7541  O O    . GLU A 1 107 ? -7.479  -2.679  9.843   1.00 0.49  ? 107 GLU A O    4  
ATOM 7542  C CB   . GLU A 1 107 ? -7.030  0.456   10.282  1.00 0.59  ? 107 GLU A CB   4  
ATOM 7543  C CG   . GLU A 1 107 ? -6.405  1.682   10.918  1.00 1.41  ? 107 GLU A CG   4  
ATOM 7544  C CD   . GLU A 1 107 ? -7.224  2.924   10.652  1.00 2.16  ? 107 GLU A CD   4  
ATOM 7545  O OE1  . GLU A 1 107 ? -8.152  3.204   11.440  1.00 2.63  ? 107 GLU A OE1  4  
ATOM 7546  O OE2  . GLU A 1 107 ? -6.932  3.636   9.670   1.00 2.82  ? 107 GLU A OE2  4  
ATOM 7547  H H    . GLU A 1 107 ? -4.685  0.609   9.380   1.00 0.48  ? 107 GLU A H    4  
ATOM 7548  H HA   . GLU A 1 107 ? -5.911  -1.136  11.175  1.00 0.62  ? 107 GLU A HA   4  
ATOM 7549  H HB2  . GLU A 1 107 ? -7.355  0.723   9.288   1.00 1.12  ? 107 GLU A HB2  4  
ATOM 7550  H HB3  . GLU A 1 107 ? -7.892  0.176   10.868  1.00 1.19  ? 107 GLU A HB3  4  
ATOM 7551  H HG2  . GLU A 1 107 ? -6.341  1.529   11.985  1.00 2.02  ? 107 GLU A HG2  4  
ATOM 7552  H HG3  . GLU A 1 107 ? -5.413  1.825   10.512  1.00 2.03  ? 107 GLU A HG3  4  
ATOM 7553  N N    . HIS A 1 108 ? -6.530  -1.757  8.030   1.00 0.34  ? 108 HIS A N    4  
ATOM 7554  C CA   . HIS A 1 108 ? -7.160  -2.669  7.085   1.00 0.37  ? 108 HIS A CA   4  
ATOM 7555  C C    . HIS A 1 108 ? -6.434  -4.008  7.041   1.00 0.46  ? 108 HIS A C    4  
ATOM 7556  O O    . HIS A 1 108 ? -6.963  -4.992  6.526   1.00 0.53  ? 108 HIS A O    4  
ATOM 7557  C CB   . HIS A 1 108 ? -7.210  -2.031  5.695   1.00 0.38  ? 108 HIS A CB   4  
ATOM 7558  C CG   . HIS A 1 108 ? -8.194  -0.905  5.597   1.00 0.40  ? 108 HIS A CG   4  
ATOM 7559  N ND1  . HIS A 1 108 ? -7.882  0.409   5.892   1.00 0.52  ? 108 HIS A ND1  4  
ATOM 7560  C CD2  . HIS A 1 108 ? -9.496  -0.904  5.231   1.00 0.52  ? 108 HIS A CD2  4  
ATOM 7561  C CE1  . HIS A 1 108 ? -8.952  1.162   5.712   1.00 0.52  ? 108 HIS A CE1  4  
ATOM 7562  N NE2  . HIS A 1 108 ? -9.945  0.390   5.310   1.00 0.52  ? 108 HIS A NE2  4  
ATOM 7563  H H    . HIS A 1 108 ? -5.898  -1.086  7.693   1.00 0.33  ? 108 HIS A H    4  
ATOM 7564  H HA   . HIS A 1 108 ? -8.171  -2.840  7.423   1.00 0.42  ? 108 HIS A HA   4  
ATOM 7565  H HB2  . HIS A 1 108 ? -6.233  -1.639  5.452   1.00 0.36  ? 108 HIS A HB2  4  
ATOM 7566  H HB3  . HIS A 1 108 ? -7.484  -2.781  4.969   1.00 0.45  ? 108 HIS A HB3  4  
ATOM 7567  H HD1  . HIS A 1 108 ? -7.014  0.743   6.213   1.00 0.70  ? 108 HIS A HD1  4  
ATOM 7568  H HD2  . HIS A 1 108 ? -10.074 -1.766  4.931   1.00 0.71  ? 108 HIS A HD2  4  
ATOM 7569  H HE1  . HIS A 1 108 ? -9.003  2.230   5.860   1.00 0.64  ? 108 HIS A HE1  4  
ATOM 7570  H HE2  . HIS A 1 108 ? -10.902 0.647   5.362   1.00 0.63  ? 108 HIS A HE2  4  
ATOM 7571  N N    . LEU A 1 109 ? -5.222  -4.036  7.581   1.00 0.52  ? 109 LEU A N    4  
ATOM 7572  C CA   . LEU A 1 109 ? -4.433  -5.263  7.635   1.00 0.70  ? 109 LEU A CA   4  
ATOM 7573  C C    . LEU A 1 109 ? -5.081  -6.268  8.577   1.00 0.79  ? 109 LEU A C    4  
ATOM 7574  O O    . LEU A 1 109 ? -5.380  -7.399  8.195   1.00 1.24  ? 109 LEU A O    4  
ATOM 7575  C CB   . LEU A 1 109 ? -3.015  -4.960  8.118   1.00 0.96  ? 109 LEU A CB   4  
ATOM 7576  C CG   . LEU A 1 109 ? -2.239  -3.953  7.275   1.00 0.44  ? 109 LEU A CG   4  
ATOM 7577  C CD1  . LEU A 1 109 ? -0.920  -3.615  7.944   1.00 0.84  ? 109 LEU A CD1  4  
ATOM 7578  C CD2  . LEU A 1 109 ? -2.004  -4.501  5.883   1.00 0.67  ? 109 LEU A CD2  4  
ATOM 7579  H H    . LEU A 1 109 ? -4.849  -3.214  7.967   1.00 0.47  ? 109 LEU A H    4  
ATOM 7580  H HA   . LEU A 1 109 ? -4.390  -5.683  6.641   1.00 0.77  ? 109 LEU A HA   4  
ATOM 7581  H HB2  . LEU A 1 109 ? -3.078  -4.578  9.127   1.00 1.47  ? 109 LEU A HB2  4  
ATOM 7582  H HB3  . LEU A 1 109 ? -2.458  -5.886  8.137   1.00 1.46  ? 109 LEU A HB3  4  
ATOM 7583  H HG   . LEU A 1 109 ? -2.816  -3.042  7.188   1.00 0.43  ? 109 LEU A HG   4  
ATOM 7584  H HD11 . LEU A 1 109 ? -0.336  -4.514  8.065   1.00 1.39  ? 109 LEU A HD11 4  
ATOM 7585  H HD12 . LEU A 1 109 ? -1.111  -3.174  8.912   1.00 1.39  ? 109 LEU A HD12 4  
ATOM 7586  H HD13 . LEU A 1 109 ? -0.376  -2.911  7.331   1.00 1.37  ? 109 LEU A HD13 4  
ATOM 7587  H HD21 . LEU A 1 109 ? -2.953  -4.705  5.411   1.00 1.19  ? 109 LEU A HD21 4  
ATOM 7588  H HD22 . LEU A 1 109 ? -1.432  -5.415  5.947   1.00 1.41  ? 109 LEU A HD22 4  
ATOM 7589  H HD23 . LEU A 1 109 ? -1.459  -3.776  5.296   1.00 1.28  ? 109 LEU A HD23 4  
ATOM 7590  N N    . ASN A 1 110 ? -5.307  -5.831  9.806   1.00 1.37  ? 110 ASN A N    4  
ATOM 7591  C CA   . ASN A 1 110 ? -5.920  -6.674  10.825  1.00 1.67  ? 110 ASN A CA   4  
ATOM 7592  C C    . ASN A 1 110 ? -7.412  -6.389  10.925  1.00 1.44  ? 110 ASN A C    4  
ATOM 7593  O O    . ASN A 1 110 ? -8.065  -6.767  11.898  1.00 1.77  ? 110 ASN A O    4  
ATOM 7594  C CB   . ASN A 1 110 ? -5.247  -6.450  12.187  1.00 2.17  ? 110 ASN A CB   4  
ATOM 7595  C CG   . ASN A 1 110 ? -5.252  -4.993  12.620  1.00 2.95  ? 110 ASN A CG   4  
ATOM 7596  O OD1  . ASN A 1 110 ? -6.210  -4.511  13.231  1.00 3.70  ? 110 ASN A OD1  4  
ATOM 7597  N ND2  . ASN A 1 110 ? -4.173  -4.287  12.325  1.00 3.35  ? 110 ASN A ND2  4  
ATOM 7598  H H    . ASN A 1 110 ? -5.056  -4.912  10.038  1.00 1.89  ? 110 ASN A H    4  
ATOM 7599  H HA   . ASN A 1 110 ? -5.782  -7.704  10.530  1.00 1.91  ? 110 ASN A HA   4  
ATOM 7600  H HB2  . ASN A 1 110 ? -5.764  -7.028  12.938  1.00 2.54  ? 110 ASN A HB2  4  
ATOM 7601  H HB3  . ASN A 1 110 ? -4.219  -6.783  12.130  1.00 2.33  ? 110 ASN A HB3  4  
ATOM 7602  H HD21 . ASN A 1 110 ? -3.433  -4.742  11.854  1.00 3.18  ? 110 ASN A HD21 4  
ATOM 7603  H HD22 . ASN A 1 110 ? -4.147  -3.341  12.586  1.00 4.09  ? 110 ASN A HD22 4  
ATOM 7604  N N    . GLY A 1 111 ? -7.948  -5.736  9.907   1.00 1.12  ? 111 GLY A N    4  
ATOM 7605  C CA   . GLY A 1 111 ? -9.339  -5.353  9.922   1.00 1.12  ? 111 GLY A CA   4  
ATOM 7606  C C    . GLY A 1 111 ? -10.072 -5.797  8.672   1.00 0.87  ? 111 GLY A C    4  
ATOM 7607  O O    . GLY A 1 111 ? -9.588  -6.665  7.941   1.00 0.93  ? 111 GLY A O    4  
ATOM 7608  H H    . GLY A 1 111 ? -7.394  -5.525  9.128   1.00 1.15  ? 111 GLY A H    4  
ATOM 7609  H HA2  . GLY A 1 111 ? -9.815  -5.797  10.783  1.00 1.39  ? 111 GLY A HA2  4  
ATOM 7610  H HA3  . GLY A 1 111 ? -9.405  -4.277  10.002  1.00 1.34  ? 111 GLY A HA3  4  
ATOM 7611  N N    . PRO A 1 112 ? -11.249 -5.226  8.411   1.00 0.86  ? 112 PRO A N    4  
ATOM 7612  C CA   . PRO A 1 112 ? -12.068 -5.567  7.257   1.00 0.93  ? 112 PRO A CA   4  
ATOM 7613  C C    . PRO A 1 112 ? -11.830 -4.644  6.062   1.00 0.89  ? 112 PRO A C    4  
ATOM 7614  O O    . PRO A 1 112 ? -11.042 -3.695  6.135   1.00 1.31  ? 112 PRO A O    4  
ATOM 7615  C CB   . PRO A 1 112 ? -13.471 -5.356  7.806   1.00 1.25  ? 112 PRO A CB   4  
ATOM 7616  C CG   . PRO A 1 112 ? -13.332 -4.202  8.748   1.00 1.30  ? 112 PRO A CG   4  
ATOM 7617  C CD   . PRO A 1 112 ? -11.903 -4.204  9.243   1.00 1.10  ? 112 PRO A CD   4  
ATOM 7618  H HA   . PRO A 1 112 ? -11.940 -6.597  6.959   1.00 1.00  ? 112 PRO A HA   4  
ATOM 7619  H HB2  . PRO A 1 112 ? -14.148 -5.128  6.993   1.00 1.52  ? 112 PRO A HB2  4  
ATOM 7620  H HB3  . PRO A 1 112 ? -13.800 -6.248  8.319   1.00 1.43  ? 112 PRO A HB3  4  
ATOM 7621  H HG2  . PRO A 1 112 ? -13.541 -3.280  8.226   1.00 1.65  ? 112 PRO A HG2  4  
ATOM 7622  H HG3  . PRO A 1 112 ? -14.014 -4.324  9.576   1.00 1.44  ? 112 PRO A HG3  4  
ATOM 7623  H HD2  . PRO A 1 112 ? -11.450 -3.236  9.088   1.00 1.29  ? 112 PRO A HD2  4  
ATOM 7624  H HD3  . PRO A 1 112 ? -11.865 -4.478  10.286  1.00 1.17  ? 112 PRO A HD3  4  
ATOM 7625  N N    . LEU A 1 113 ? -12.521 -4.932  4.967   1.00 0.62  ? 113 LEU A N    4  
ATOM 7626  C CA   . LEU A 1 113 ? -12.472 -4.096  3.780   1.00 0.58  ? 113 LEU A CA   4  
ATOM 7627  C C    . LEU A 1 113 ? -13.862 -3.529  3.510   1.00 0.69  ? 113 LEU A C    4  
ATOM 7628  O O    . LEU A 1 113 ? -14.845 -4.271  3.498   1.00 0.90  ? 113 LEU A O    4  
ATOM 7629  C CB   . LEU A 1 113 ? -11.993 -4.907  2.571   1.00 0.58  ? 113 LEU A CB   4  
ATOM 7630  C CG   . LEU A 1 113 ? -10.641 -5.605  2.750   1.00 0.57  ? 113 LEU A CG   4  
ATOM 7631  C CD1  . LEU A 1 113 ? -10.308 -6.447  1.534   1.00 1.11  ? 113 LEU A CD1  4  
ATOM 7632  C CD2  . LEU A 1 113 ? -9.536  -4.593  3.013   1.00 1.05  ? 113 LEU A CD2  4  
ATOM 7633  H H    . LEU A 1 113 ? -13.086 -5.730  4.956   1.00 0.73  ? 113 LEU A H    4  
ATOM 7634  H HA   . LEU A 1 113 ? -11.784 -3.283  3.965   1.00 0.56  ? 113 LEU A HA   4  
ATOM 7635  H HB2  . LEU A 1 113 ? -12.737 -5.656  2.351   1.00 0.65  ? 113 LEU A HB2  4  
ATOM 7636  H HB3  . LEU A 1 113 ? -11.917 -4.241  1.725   1.00 0.60  ? 113 LEU A HB3  4  
ATOM 7637  H HG   . LEU A 1 113 ? -10.699 -6.267  3.598   1.00 0.65  ? 113 LEU A HG   4  
ATOM 7638  H HD11 . LEU A 1 113 ? -9.367  -6.958  1.695   1.00 1.60  ? 113 LEU A HD11 4  
ATOM 7639  H HD12 . LEU A 1 113 ? -10.225 -5.808  0.666   1.00 1.75  ? 113 LEU A HD12 4  
ATOM 7640  H HD13 . LEU A 1 113 ? -11.090 -7.172  1.373   1.00 1.54  ? 113 LEU A HD13 4  
ATOM 7641  H HD21 . LEU A 1 113 ? -9.763  -4.035  3.910   1.00 1.60  ? 113 LEU A HD21 4  
ATOM 7642  H HD22 . LEU A 1 113 ? -9.462  -3.913  2.176   1.00 1.47  ? 113 LEU A HD22 4  
ATOM 7643  H HD23 . LEU A 1 113 ? -8.596  -5.111  3.139   1.00 1.63  ? 113 LEU A HD23 4  
ATOM 7644  N N    . PRO A 1 114 ? -13.962 -2.210  3.308   1.00 0.68  ? 114 PRO A N    4  
ATOM 7645  C CA   . PRO A 1 114 ? -15.248 -1.534  3.111   1.00 0.83  ? 114 PRO A CA   4  
ATOM 7646  C C    . PRO A 1 114 ? -15.935 -1.947  1.816   1.00 0.86  ? 114 PRO A C    4  
ATOM 7647  O O    . PRO A 1 114 ? -15.337 -1.920  0.738   1.00 1.15  ? 114 PRO A O    4  
ATOM 7648  C CB   . PRO A 1 114 ? -14.883 -0.051  3.058   1.00 1.02  ? 114 PRO A CB   4  
ATOM 7649  C CG   . PRO A 1 114 ? -13.442 -0.022  2.677   1.00 0.90  ? 114 PRO A CG   4  
ATOM 7650  C CD   . PRO A 1 114 ? -12.832 -1.274  3.243   1.00 0.70  ? 114 PRO A CD   4  
ATOM 7651  H HA   . PRO A 1 114 ? -15.917 -1.710  3.941   1.00 1.05  ? 114 PRO A HA   4  
ATOM 7652  H HB2  . PRO A 1 114 ? -15.501 0.440   2.319   1.00 1.15  ? 114 PRO A HB2  4  
ATOM 7653  H HB3  . PRO A 1 114 ? -15.046 0.399   4.027   1.00 1.31  ? 114 PRO A HB3  4  
ATOM 7654  H HG2  . PRO A 1 114 ? -13.346 -0.012  1.600   1.00 0.99  ? 114 PRO A HG2  4  
ATOM 7655  H HG3  . PRO A 1 114 ? -12.968 0.849   3.104   1.00 1.13  ? 114 PRO A HG3  4  
ATOM 7656  H HD2  . PRO A 1 114 ? -12.062 -1.650  2.586   1.00 0.68  ? 114 PRO A HD2  4  
ATOM 7657  H HD3  . PRO A 1 114 ? -12.432 -1.090  4.226   1.00 0.81  ? 114 PRO A HD3  4  
ATOM 7658  N N    . VAL A 1 115 ? -17.196 -2.310  1.928   1.00 1.26  ? 115 VAL A N    4  
ATOM 7659  C CA   . VAL A 1 115 ? -17.961 -2.776  0.785   1.00 1.45  ? 115 VAL A CA   4  
ATOM 7660  C C    . VAL A 1 115 ? -18.956 -1.709  0.320   1.00 1.91  ? 115 VAL A C    4  
ATOM 7661  O O    . VAL A 1 115 ? -19.774 -1.217  1.101   1.00 2.44  ? 115 VAL A O    4  
ATOM 7662  C CB   . VAL A 1 115 ? -18.702 -4.094  1.111   1.00 1.96  ? 115 VAL A CB   4  
ATOM 7663  C CG1  . VAL A 1 115 ? -19.555 -3.942  2.359   1.00 2.60  ? 115 VAL A CG1  4  
ATOM 7664  C CG2  . VAL A 1 115 ? -19.548 -4.553  -0.069  1.00 2.98  ? 115 VAL A CG2  4  
ATOM 7665  H H    . VAL A 1 115 ? -17.632 -2.254  2.809   1.00 1.67  ? 115 VAL A H    4  
ATOM 7666  H HA   . VAL A 1 115 ? -17.264 -2.972  -0.017  1.00 1.85  ? 115 VAL A HA   4  
ATOM 7667  H HB   . VAL A 1 115 ? -17.961 -4.856  1.305   1.00 2.15  ? 115 VAL A HB   4  
ATOM 7668  H HG11 . VAL A 1 115 ? -20.053 -4.874  2.574   1.00 2.96  ? 115 VAL A HG11 4  
ATOM 7669  H HG12 . VAL A 1 115 ? -20.290 -3.166  2.199   1.00 3.01  ? 115 VAL A HG12 4  
ATOM 7670  H HG13 . VAL A 1 115 ? -18.922 -3.669  3.193   1.00 3.05  ? 115 VAL A HG13 4  
ATOM 7671  H HG21 . VAL A 1 115 ? -18.911 -4.726  -0.924  1.00 3.35  ? 115 VAL A HG21 4  
ATOM 7672  H HG22 . VAL A 1 115 ? -20.273 -3.790  -0.309  1.00 3.47  ? 115 VAL A HG22 4  
ATOM 7673  H HG23 . VAL A 1 115 ? -20.059 -5.468  0.190   1.00 3.42  ? 115 VAL A HG23 4  
ATOM 7674  N N    . PRO A 1 116 ? -18.865 -1.303  -0.953  1.00 2.53  ? 116 PRO A N    4  
ATOM 7675  C CA   . PRO A 1 116 ? -19.810 -0.363  -1.548  1.00 3.48  ? 116 PRO A CA   4  
ATOM 7676  C C    . PRO A 1 116 ? -21.147 -1.032  -1.856  1.00 3.68  ? 116 PRO A C    4  
ATOM 7677  O O    . PRO A 1 116 ? -21.195 -2.057  -2.541  1.00 3.90  ? 116 PRO A O    4  
ATOM 7678  C CB   . PRO A 1 116 ? -19.124 0.078   -2.851  1.00 4.23  ? 116 PRO A CB   4  
ATOM 7679  C CG   . PRO A 1 116 ? -17.748 -0.509  -2.810  1.00 4.01  ? 116 PRO A CG   4  
ATOM 7680  C CD   . PRO A 1 116 ? -17.828 -1.703  -1.907  1.00 2.94  ? 116 PRO A CD   4  
ATOM 7681  H HA   . PRO A 1 116 ? -19.972 0.495   -0.911  1.00 3.92  ? 116 PRO A HA   4  
ATOM 7682  H HB2  . PRO A 1 116 ? -19.684 -0.298  -3.696  1.00 4.47  ? 116 PRO A HB2  4  
ATOM 7683  H HB3  . PRO A 1 116 ? -19.090 1.156   -2.892  1.00 4.93  ? 116 PRO A HB3  4  
ATOM 7684  H HG2  . PRO A 1 116 ? -17.448 -0.810  -3.802  1.00 4.47  ? 116 PRO A HG2  4  
ATOM 7685  H HG3  . PRO A 1 116 ? -17.053 0.215   -2.412  1.00 4.42  ? 116 PRO A HG3  4  
ATOM 7686  H HD2  . PRO A 1 116 ? -18.125 -2.579  -2.463  1.00 2.94  ? 116 PRO A HD2  4  
ATOM 7687  H HD3  . PRO A 1 116 ? -16.884 -1.867  -1.407  1.00 2.95  ? 116 PRO A HD3  4  
ATOM 7688  N N    . PHE A 1 117 ? -22.228 -0.449  -1.355  1.00 4.03  ? 117 PHE A N    4  
ATOM 7689  C CA   . PHE A 1 117 ? -23.559 -1.003  -1.560  1.00 4.72  ? 117 PHE A CA   4  
ATOM 7690  C C    . PHE A 1 117 ? -24.106 -0.600  -2.925  1.00 5.62  ? 117 PHE A C    4  
ATOM 7691  O O    . PHE A 1 117 ? -25.053 0.179   -3.034  1.00 6.22  ? 117 PHE A O    4  
ATOM 7692  C CB   . PHE A 1 117 ? -24.508 -0.554  -0.448  1.00 5.32  ? 117 PHE A CB   4  
ATOM 7693  C CG   . PHE A 1 117 ? -24.160 -1.125  0.898   1.00 5.77  ? 117 PHE A CG   4  
ATOM 7694  C CD1  . PHE A 1 117 ? -24.616 -2.378  1.275   1.00 6.08  ? 117 PHE A CD1  4  
ATOM 7695  C CD2  . PHE A 1 117 ? -23.376 -0.404  1.787   1.00 6.27  ? 117 PHE A CD2  4  
ATOM 7696  C CE1  . PHE A 1 117 ? -24.298 -2.901  2.514   1.00 6.87  ? 117 PHE A CE1  4  
ATOM 7697  C CE2  . PHE A 1 117 ? -23.058 -0.923  3.029   1.00 7.04  ? 117 PHE A CE2  4  
ATOM 7698  C CZ   . PHE A 1 117 ? -23.515 -2.188  3.384   1.00 7.33  ? 117 PHE A CZ   4  
ATOM 7699  H H    . PHE A 1 117 ? -22.128 0.383   -0.837  1.00 4.08  ? 117 PHE A H    4  
ATOM 7700  H HA   . PHE A 1 117 ? -23.472 -2.079  -1.530  1.00 4.55  ? 117 PHE A HA   4  
ATOM 7701  H HB2  . PHE A 1 117 ? -24.478 0.523   -0.370  1.00 5.24  ? 117 PHE A HB2  4  
ATOM 7702  H HB3  . PHE A 1 117 ? -25.512 -0.866  -0.694  1.00 5.94  ? 117 PHE A HB3  4  
ATOM 7703  H HD1  . PHE A 1 117 ? -25.226 -2.950  0.590   1.00 5.96  ? 117 PHE A HD1  4  
ATOM 7704  H HD2  . PHE A 1 117 ? -23.017 0.574   1.504   1.00 6.29  ? 117 PHE A HD2  4  
ATOM 7705  H HE1  . PHE A 1 117 ? -24.660 -3.878  2.796   1.00 7.32  ? 117 PHE A HE1  4  
ATOM 7706  H HE2  . PHE A 1 117 ? -22.447 -0.350  3.712   1.00 7.60  ? 117 PHE A HE2  4  
ATOM 7707  H HZ   . PHE A 1 117 ? -23.265 -2.600  4.349   1.00 8.10  ? 117 PHE A HZ   4  
ATOM 7708  N N    . THR A 1 118 ? -23.466 -1.108  -3.965  1.00 6.05  ? 118 THR A N    4  
ATOM 7709  C CA   . THR A 1 118 ? -23.911 -0.907  -5.334  1.00 7.13  ? 118 THR A CA   4  
ATOM 7710  C C    . THR A 1 118 ? -23.519 -2.132  -6.160  1.00 7.53  ? 118 THR A C    4  
ATOM 7711  O O    . THR A 1 118 ? -23.423 -2.093  -7.387  1.00 8.01  ? 118 THR A O    4  
ATOM 7712  C CB   . THR A 1 118 ? -23.290 0.374   -5.940  1.00 8.07  ? 118 THR A CB   4  
ATOM 7713  O OG1  . THR A 1 118 ? -23.351 1.440   -4.981  1.00 8.43  ? 118 THR A OG1  4  
ATOM 7714  C CG2  . THR A 1 118 ? -24.024 0.806   -7.203  1.00 8.78  ? 118 THR A CG2  4  
ATOM 7715  H H    . THR A 1 118 ? -22.649 -1.630  -3.806  1.00 5.82  ? 118 THR A H    4  
ATOM 7716  H HA   . THR A 1 118 ? -24.989 -0.807  -5.332  1.00 7.30  ? 118 THR A HA   4  
ATOM 7717  H HB   . THR A 1 118 ? -22.258 0.175   -6.186  1.00 8.25  ? 118 THR A HB   4  
ATOM 7718  H HG1  . THR A 1 118 ? -23.947 1.185   -4.263  1.00 8.41  ? 118 THR A HG1  4  
ATOM 7719  H HG21 . THR A 1 118 ? -23.581 1.716   -7.580  1.00 9.07  ? 118 THR A HG21 4  
ATOM 7720  H HG22 . THR A 1 118 ? -25.064 0.978   -6.974  1.00 8.92  ? 118 THR A HG22 4  
ATOM 7721  H HG23 . THR A 1 118 ? -23.942 0.029   -7.950  1.00 9.11  ? 118 THR A HG23 4  
ATOM 7722  N N    . ASN A 1 119 ? -23.294 -3.230  -5.453  1.00 7.62  ? 119 ASN A N    4  
ATOM 7723  C CA   . ASN A 1 119 ? -22.873 -4.476  -6.071  1.00 8.32  ? 119 ASN A CA   4  
ATOM 7724  C C    . ASN A 1 119 ? -24.085 -5.372  -6.284  1.00 9.00  ? 119 ASN A C    4  
ATOM 7725  O O    . ASN A 1 119 ? -24.551 -6.037  -5.357  1.00 9.23  ? 119 ASN A O    4  
ATOM 7726  C CB   . ASN A 1 119 ? -21.841 -5.181  -5.182  1.00 8.46  ? 119 ASN A CB   4  
ATOM 7727  C CG   . ASN A 1 119 ? -21.166 -6.363  -5.860  1.00 8.93  ? 119 ASN A CG   4  
ATOM 7728  O OD1  . ASN A 1 119 ? -21.732 -7.005  -6.744  1.00 9.34  ? 119 ASN A OD1  4  
ATOM 7729  N ND2  . ASN A 1 119 ? -19.944 -6.662  -5.447  1.00 9.14  ? 119 ASN A ND2  4  
ATOM 7730  H H    . ASN A 1 119 ? -23.439 -3.207  -4.482  1.00 7.43  ? 119 ASN A H    4  
ATOM 7731  H HA   . ASN A 1 119 ? -22.427 -4.246  -7.027  1.00 8.58  ? 119 ASN A HA   4  
ATOM 7732  H HB2  . ASN A 1 119 ? -21.077 -4.471  -4.902  1.00 8.54  ? 119 ASN A HB2  4  
ATOM 7733  H HB3  . ASN A 1 119 ? -22.332 -5.537  -4.288  1.00 8.45  ? 119 ASN A HB3  4  
ATOM 7734  H HD21 . ASN A 1 119 ? -19.543 -6.107  -4.735  1.00 8.98  ? 119 ASN A HD21 4  
ATOM 7735  H HD22 . ASN A 1 119 ? -19.488 -7.424  -5.862  1.00 9.61  ? 119 ASN A HD22 4  
ATOM 7736  N N    . GLY A 1 120 ? -24.607 -5.361  -7.498  1.00 9.55  ? 120 GLY A N    4  
ATOM 7737  C CA   . GLY A 1 120 ? -25.751 -6.179  -7.818  1.00 10.42 ? 120 GLY A CA   4  
ATOM 7738  C C    . GLY A 1 120 ? -26.371 -5.779  -9.135  1.00 11.21 ? 120 GLY A C    4  
ATOM 7739  O O    . GLY A 1 120 ? -25.890 -4.852  -9.791  1.00 11.55 ? 120 GLY A O    4  
ATOM 7740  H H    . GLY A 1 120 ? -24.215 -4.783  -8.186  1.00 9.52  ? 120 GLY A H    4  
ATOM 7741  H HA2  . GLY A 1 120 ? -25.442 -7.212  -7.872  1.00 10.61 ? 120 GLY A HA2  4  
ATOM 7742  H HA3  . GLY A 1 120 ? -26.489 -6.073  -7.037  1.00 10.51 ? 120 GLY A HA3  4  
ATOM 7743  N N    . GLU A 1 121 ? -27.427 -6.491  -9.518  1.00 11.70 ? 121 GLU A N    4  
ATOM 7744  C CA   . GLU A 1 121 ? -28.145 -6.234  -10.763 1.00 12.64 ? 121 GLU A CA   4  
ATOM 7745  C C    . GLU A 1 121 ? -27.222 -6.384  -11.969 1.00 13.44 ? 121 GLU A C    4  
ATOM 7746  O O    . GLU A 1 121 ? -27.370 -5.693  -12.979 1.00 13.92 ? 121 GLU A O    4  
ATOM 7747  C CB   . GLU A 1 121 ? -28.789 -4.844  -10.740 1.00 12.94 ? 121 GLU A CB   4  
ATOM 7748  C CG   . GLU A 1 121 ? -29.803 -4.672  -9.621  1.00 12.93 ? 121 GLU A CG   4  
ATOM 7749  C CD   . GLU A 1 121 ? -30.533 -3.346  -9.680  1.00 13.41 ? 121 GLU A CD   4  
ATOM 7750  O OE1  . GLU A 1 121 ? -31.355 -3.153  -10.600 1.00 13.68 ? 121 GLU A OE1  4  
ATOM 7751  O OE2  . GLU A 1 121 ? -30.274 -2.480  -8.812  1.00 13.66 ? 121 GLU A OE2  4  
ATOM 7752  H H    . GLU A 1 121 ? -27.732 -7.227  -8.945  1.00 11.54 ? 121 GLU A H    4  
ATOM 7753  H HA   . GLU A 1 121 ? -28.926 -6.975  -10.843 1.00 12.73 ? 121 GLU A HA   4  
ATOM 7754  H HB2  . GLU A 1 121 ? -28.014 -4.103  -10.612 1.00 13.04 ? 121 GLU A HB2  4  
ATOM 7755  H HB3  . GLU A 1 121 ? -29.289 -4.673  -11.682 1.00 13.27 ? 121 GLU A HB3  4  
ATOM 7756  H HG2  . GLU A 1 121 ? -30.532 -5.468  -9.688  1.00 12.74 ? 121 GLU A HG2  4  
ATOM 7757  H HG3  . GLU A 1 121 ? -29.288 -4.740  -8.675  1.00 12.97 ? 121 GLU A HG3  4  
ATOM 7758  N N    . ILE A 1 122 ? -26.277 -7.309  -11.860 1.00 13.73 ? 122 ILE A N    4  
ATOM 7759  C CA   . ILE A 1 122 ? -25.326 -7.559  -12.927 1.00 14.64 ? 122 ILE A CA   4  
ATOM 7760  C C    . ILE A 1 122 ? -25.814 -8.686  -13.836 1.00 15.74 ? 122 ILE A C    4  
ATOM 7761  O O    . ILE A 1 122 ? -25.428 -9.847  -13.692 1.00 16.21 ? 122 ILE A O    4  
ATOM 7762  C CB   . ILE A 1 122 ? -23.915 -7.883  -12.379 1.00 14.54 ? 122 ILE A CB   4  
ATOM 7763  C CG1  . ILE A 1 122 ? -23.984 -8.942  -11.272 1.00 14.04 ? 122 ILE A CG1  4  
ATOM 7764  C CG2  . ILE A 1 122 ? -23.252 -6.613  -11.862 1.00 14.69 ? 122 ILE A CG2  4  
ATOM 7765  C CD1  . ILE A 1 122 ? -22.628 -9.365  -10.750 1.00 14.09 ? 122 ILE A CD1  4  
ATOM 7766  H H    . ILE A 1 122 ? -26.229 -7.849  -11.037 1.00 13.43 ? 122 ILE A H    4  
ATOM 7767  H HA   . ILE A 1 122 ? -25.255 -6.655  -13.516 1.00 14.76 ? 122 ILE A HA   4  
ATOM 7768  H HB   . ILE A 1 122 ? -23.316 -8.263  -13.195 1.00 14.93 ? 122 ILE A HB   4  
ATOM 7769  H HG12 . ILE A 1 122 ? -24.549 -8.548  -10.441 1.00 13.68 ? 122 ILE A HG12 4  
ATOM 7770  H HG13 . ILE A 1 122 ? -24.482 -9.822  -11.653 1.00 14.16 ? 122 ILE A HG13 4  
ATOM 7771  H HG21 . ILE A 1 122 ? -23.836 -6.207  -11.050 1.00 14.66 ? 122 ILE A HG21 4  
ATOM 7772  H HG22 . ILE A 1 122 ? -23.192 -5.889  -12.661 1.00 14.82 ? 122 ILE A HG22 4  
ATOM 7773  H HG23 . ILE A 1 122 ? -22.257 -6.845  -11.512 1.00 14.87 ? 122 ILE A HG23 4  
ATOM 7774  H HD11 . ILE A 1 122 ? -22.041 -9.771  -11.560 1.00 14.08 ? 122 ILE A HD11 4  
ATOM 7775  H HD12 . ILE A 1 122 ? -22.755 -10.116 -9.984  1.00 14.17 ? 122 ILE A HD12 4  
ATOM 7776  H HD13 . ILE A 1 122 ? -22.121 -8.508  -10.331 1.00 14.24 ? 122 ILE A HD13 4  
ATOM 7777  N N    . GLN A 1 123 ? -26.691 -8.331  -14.758 1.00 16.25 ? 123 GLN A N    4  
ATOM 7778  C CA   . GLN A 1 123 ? -27.221 -9.285  -15.717 1.00 17.37 ? 123 GLN A CA   4  
ATOM 7779  C C    . GLN A 1 123 ? -26.675 -8.971  -17.105 1.00 18.25 ? 123 GLN A C    4  
ATOM 7780  O O    . GLN A 1 123 ? -25.933 -9.764  -17.682 1.00 18.70 ? 123 GLN A O    4  
ATOM 7781  C CB   . GLN A 1 123 ? -28.752 -9.230  -15.724 1.00 17.69 ? 123 GLN A CB   4  
ATOM 7782  C CG   . GLN A 1 123 ? -29.400 -10.236 -16.662 1.00 18.12 ? 123 GLN A CG   4  
ATOM 7783  C CD   . GLN A 1 123 ? -30.912 -10.105 -16.714 1.00 18.49 ? 123 GLN A CD   4  
ATOM 7784  O OE1  . GLN A 1 123 ? -31.627 -11.083 -16.926 1.00 18.82 ? 123 GLN A OE1  4  
ATOM 7785  N NE2  . GLN A 1 123 ? -31.415 -8.897  -16.530 1.00 18.57 ? 123 GLN A NE2  4  
ATOM 7786  H H    . GLN A 1 123 ? -26.988 -7.396  -14.801 1.00 15.95 ? 123 GLN A H    4  
ATOM 7787  H HA   . GLN A 1 123 ? -26.899 -10.273 -15.424 1.00 17.46 ? 123 GLN A HA   4  
ATOM 7788  H HB2  . GLN A 1 123 ? -29.111 -9.422  -14.723 1.00 17.45 ? 123 GLN A HB2  4  
ATOM 7789  H HB3  . GLN A 1 123 ? -29.063 -8.240  -16.023 1.00 18.00 ? 123 GLN A HB3  4  
ATOM 7790  H HG2  . GLN A 1 123 ? -29.007 -10.085 -17.656 1.00 18.20 ? 123 GLN A HG2  4  
ATOM 7791  H HG3  . GLN A 1 123 ? -29.151 -11.234 -16.326 1.00 18.23 ? 123 GLN A HG3  4  
ATOM 7792  H HE21 . GLN A 1 123 ? -30.796 -8.150  -16.367 1.00 18.37 ? 123 GLN A HE21 4  
ATOM 7793  H HE22 . GLN A 1 123 ? -32.390 -8.791  -16.570 1.00 18.90 ? 123 GLN A HE22 4  
ATOM 7794  N N    . LYS A 1 124 ? -27.030 -7.786  -17.602 1.00 18.59 ? 124 LYS A N    4  
ATOM 7795  C CA   . LYS A 1 124 ? -26.612 -7.313  -18.921 1.00 19.51 ? 124 LYS A CA   4  
ATOM 7796  C C    . LYS A 1 124 ? -26.879 -8.361  -20.002 1.00 20.23 ? 124 LYS A C    4  
ATOM 7797  O O    . LYS A 1 124 ? -25.972 -9.071  -20.440 1.00 20.83 ? 124 LYS A O    4  
ATOM 7798  C CB   . LYS A 1 124 ? -25.131 -6.910  -18.906 1.00 19.61 ? 124 LYS A CB   4  
ATOM 7799  C CG   . LYS A 1 124 ? -24.662 -6.252  -20.197 1.00 19.54 ? 124 LYS A CG   4  
ATOM 7800  C CD   . LYS A 1 124 ? -23.231 -5.751  -20.092 1.00 19.77 ? 124 LYS A CD   4  
ATOM 7801  C CE   . LYS A 1 124 ? -23.101 -4.641  -19.061 1.00 20.14 ? 124 LYS A CE   4  
ATOM 7802  N NZ   . LYS A 1 124 ? -23.952 -3.466  -19.393 1.00 20.17 ? 124 LYS A NZ   4  
ATOM 7803  H H    . LYS A 1 124 ? -27.593 -7.200  -17.051 1.00 18.29 ? 124 LYS A H    4  
ATOM 7804  H HA   . LYS A 1 124 ? -27.201 -6.437  -19.148 1.00 19.72 ? 124 LYS A HA   4  
ATOM 7805  H HB2  . LYS A 1 124 ? -24.966 -6.216  -18.095 1.00 19.67 ? 124 LYS A HB2  4  
ATOM 7806  H HB3  . LYS A 1 124 ? -24.530 -7.793  -18.740 1.00 19.83 ? 124 LYS A HB3  4  
ATOM 7807  H HG2  . LYS A 1 124 ? -24.721 -6.971  -20.998 1.00 19.49 ? 124 LYS A HG2  4  
ATOM 7808  H HG3  . LYS A 1 124 ? -25.309 -5.415  -20.415 1.00 19.51 ? 124 LYS A HG3  4  
ATOM 7809  H HD2  . LYS A 1 124 ? -22.592 -6.571  -19.804 1.00 19.80 ? 124 LYS A HD2  4  
ATOM 7810  H HD3  . LYS A 1 124 ? -22.923 -5.373  -21.056 1.00 19.76 ? 124 LYS A HD3  4  
ATOM 7811  H HE2  . LYS A 1 124 ? -23.401 -5.028  -18.100 1.00 20.61 ? 124 LYS A HE2  4  
ATOM 7812  H HE3  . LYS A 1 124 ? -22.070 -4.327  -19.016 1.00 20.05 ? 124 LYS A HE3  4  
ATOM 7813  H HZ1  . LYS A 1 124 ? -24.954 -3.749  -19.446 1.00 20.17 ? 124 LYS A HZ1  4  
ATOM 7814  H HZ2  . LYS A 1 124 ? -23.670 -3.058  -20.313 1.00 20.36 ? 124 LYS A HZ2  4  
ATOM 7815  H HZ3  . LYS A 1 124 ? -23.853 -2.731  -18.658 1.00 20.13 ? 124 LYS A HZ3  4  
ATOM 7816  N N    . GLU A 1 125 ? -28.136 -8.458  -20.421 1.00 20.28 ? 125 GLU A N    4  
ATOM 7817  C CA   . GLU A 1 125 ? -28.511 -9.353  -21.509 1.00 21.04 ? 125 GLU A CA   4  
ATOM 7818  C C    . GLU A 1 125 ? -27.886 -8.877  -22.813 1.00 21.94 ? 125 GLU A C    4  
ATOM 7819  O O    . GLU A 1 125 ? -26.957 -9.493  -23.338 1.00 22.50 ? 125 GLU A O    4  
ATOM 7820  C CB   . GLU A 1 125 ? -30.034 -9.415  -21.651 1.00 20.98 ? 125 GLU A CB   4  
ATOM 7821  C CG   . GLU A 1 125 ? -30.710 -10.314 -20.632 1.00 20.93 ? 125 GLU A CG   4  
ATOM 7822  C CD   . GLU A 1 125 ? -30.378 -11.772 -20.855 1.00 21.01 ? 125 GLU A CD   4  
ATOM 7823  O OE1  . GLU A 1 125 ? -30.654 -12.294 -21.953 1.00 21.38 ? 125 GLU A OE1  4  
ATOM 7824  O OE2  . GLU A 1 125 ? -29.828 -12.405 -19.928 1.00 20.79 ? 125 GLU A OE2  4  
ATOM 7825  H H    . GLU A 1 125 ? -28.827 -7.908  -19.986 1.00 19.85 ? 125 GLU A H    4  
ATOM 7826  H HA   . GLU A 1 125 ? -28.135 -10.338 -21.278 1.00 21.11 ? 125 GLU A HA   4  
ATOM 7827  H HB2  . GLU A 1 125 ? -30.434 -8.418  -21.540 1.00 20.83 ? 125 GLU A HB2  4  
ATOM 7828  H HB3  . GLU A 1 125 ? -30.276 -9.781  -22.638 1.00 21.23 ? 125 GLU A HB3  4  
ATOM 7829  H HG2  . GLU A 1 125 ? -30.383 -10.030 -19.644 1.00 20.90 ? 125 GLU A HG2  4  
ATOM 7830  H HG3  . GLU A 1 125 ? -31.780 -10.185 -20.710 1.00 21.00 ? 125 GLU A HG3  4  
ATOM 7831  N N    . ASN A 1 126 ? -28.400 -7.769  -23.315 1.00 22.18 ? 126 ASN A N    4  
ATOM 7832  C CA   . ASN A 1 126 ? -27.865 -7.117  -24.498 1.00 23.12 ? 126 ASN A CA   4  
ATOM 7833  C C    . ASN A 1 126 ? -28.510 -5.752  -24.639 1.00 23.54 ? 126 ASN A C    4  
ATOM 7834  O O    . ASN A 1 126 ? -29.632 -5.633  -25.134 1.00 23.81 ? 126 ASN A O    4  
ATOM 7835  C CB   . ASN A 1 126 ? -28.121 -7.939  -25.764 1.00 23.38 ? 126 ASN A CB   4  
ATOM 7836  C CG   . ASN A 1 126 ? -27.593 -7.242  -27.005 1.00 23.74 ? 126 ASN A CG   4  
ATOM 7837  O OD1  . ASN A 1 126 ? -26.570 -6.555  -26.960 1.00 23.88 ? 126 ASN A OD1  4  
ATOM 7838  N ND2  . ASN A 1 126 ? -28.302 -7.392  -28.110 1.00 23.99 ? 126 ASN A ND2  4  
ATOM 7839  H H    . ASN A 1 126 ? -29.176 -7.369  -22.871 1.00 21.78 ? 126 ASN A H    4  
ATOM 7840  H HA   . ASN A 1 126 ? -26.800 -6.992  -24.361 1.00 23.43 ? 126 ASN A HA   4  
ATOM 7841  H HB2  . ASN A 1 126 ? -27.633 -8.899  -25.671 1.00 23.29 ? 126 ASN A HB2  4  
ATOM 7842  H HB3  . ASN A 1 126 ? -29.184 -8.088  -25.882 1.00 23.53 ? 126 ASN A HB3  4  
ATOM 7843  H HD21 . ASN A 1 126 ? -29.121 -7.935  -28.067 1.00 23.94 ? 126 ASN A HD21 4  
ATOM 7844  H HD22 . ASN A 1 126 ? -27.987 -6.948  -28.927 1.00 24.29 ? 126 ASN A HD22 4  
ATOM 7845  N N    . SER A 1 127 ? -27.821 -4.730  -24.177 1.00 23.70 ? 127 SER A N    4  
ATOM 7846  C CA   . SER A 1 127 ? -28.373 -3.394  -24.193 1.00 24.19 ? 127 SER A CA   4  
ATOM 7847  C C    . SER A 1 127 ? -27.304 -2.386  -24.585 1.00 24.67 ? 127 SER A C    4  
ATOM 7848  O O    . SER A 1 127 ? -26.140 -2.525  -24.211 1.00 25.00 ? 127 SER A O    4  
ATOM 7849  C CB   . SER A 1 127 ? -28.952 -3.051  -22.817 1.00 24.36 ? 127 SER A CB   4  
ATOM 7850  O OG   . SER A 1 127 ? -29.776 -1.897  -22.871 1.00 24.58 ? 127 SER A OG   4  
ATOM 7851  H H    . SER A 1 127 ? -26.916 -4.871  -23.828 1.00 23.55 ? 127 SER A H    4  
ATOM 7852  H HA   . SER A 1 127 ? -29.166 -3.370  -24.927 1.00 24.21 ? 127 SER A HA   4  
ATOM 7853  H HB2  . SER A 1 127 ? -29.540 -3.882  -22.459 1.00 24.43 ? 127 SER A HB2  4  
ATOM 7854  H HB3  . SER A 1 127 ? -28.140 -2.865  -22.128 1.00 24.36 ? 127 SER A HB3  4  
ATOM 7855  H HG   . SER A 1 127 ? -29.939 -1.664  -23.801 1.00 24.78 ? 127 SER A HG   4  
ATOM 7856  N N    . ARG A 1 128 ? -27.703 -1.392  -25.359 1.00 24.79 ? 128 ARG A N    4  
ATOM 7857  C CA   . ARG A 1 128 ? -26.807 -0.328  -25.760 1.00 25.33 ? 128 ARG A CA   4  
ATOM 7858  C C    . ARG A 1 128 ? -26.986 0.860   -24.825 1.00 25.41 ? 128 ARG A C    4  
ATOM 7859  O O    . ARG A 1 128 ? -28.061 1.494   -24.873 1.00 25.41 ? 128 ARG A O    4  
ATOM 7860  C CB   . ARG A 1 128 ? -27.078 0.088   -27.210 1.00 25.71 ? 128 ARG A CB   4  
ATOM 7861  C CG   . ARG A 1 128 ? -26.045 1.048   -27.779 1.00 25.88 ? 128 ARG A CG   4  
ATOM 7862  C CD   . ARG A 1 128 ? -24.672 0.400   -27.862 1.00 26.27 ? 128 ARG A CD   4  
ATOM 7863  N NE   . ARG A 1 128 ? -23.675 1.288   -28.460 1.00 26.63 ? 128 ARG A NE   4  
ATOM 7864  C CZ   . ARG A 1 128 ? -22.471 0.890   -28.871 1.00 27.12 ? 128 ARG A CZ   4  
ATOM 7865  N NH1  . ARG A 1 128 ? -22.110 -0.383  -28.752 1.00 27.29 ? 128 ARG A NH1  4  
ATOM 7866  N NH2  . ARG A 1 128 ? -21.628 1.769   -29.399 1.00 27.52 ? 128 ARG A NH2  4  
ATOM 7867  O OXT  . ARG A 1 128 ? -26.058 1.154   -24.048 1.00 25.55 ? 128 ARG A OXT  4  
ATOM 7868  H H    . ARG A 1 128 ? -28.639 -1.366  -25.660 1.00 24.58 ? 128 ARG A H    4  
ATOM 7869  H HA   . ARG A 1 128 ? -25.794 -0.691  -25.679 1.00 25.50 ? 128 ARG A HA   4  
ATOM 7870  H HB2  . ARG A 1 128 ? -27.088 -0.797  -27.830 1.00 25.74 ? 128 ARG A HB2  4  
ATOM 7871  H HB3  . ARG A 1 128 ? -28.046 0.564   -27.261 1.00 25.93 ? 128 ARG A HB3  4  
ATOM 7872  H HG2  . ARG A 1 128 ? -26.352 1.348   -28.771 1.00 25.82 ? 128 ARG A HG2  4  
ATOM 7873  H HG3  . ARG A 1 128 ? -25.985 1.918   -27.140 1.00 25.90 ? 128 ARG A HG3  4  
ATOM 7874  H HD2  . ARG A 1 128 ? -24.352 0.138   -26.864 1.00 26.12 ? 128 ARG A HD2  4  
ATOM 7875  H HD3  . ARG A 1 128 ? -24.748 -0.495  -28.461 1.00 26.52 ? 128 ARG A HD3  4  
ATOM 7876  H HE   . ARG A 1 128 ? -23.920 2.237   -28.560 1.00 26.57 ? 128 ARG A HE   4  
ATOM 7877  H HH11 . ARG A 1 128 ? -22.745 -1.059  -28.354 1.00 27.05 ? 128 ARG A HH11 4  
ATOM 7878  H HH12 . ARG A 1 128 ? -21.196 -0.679  -29.051 1.00 27.71 ? 128 ARG A HH12 4  
ATOM 7879  H HH21 . ARG A 1 128 ? -21.895 2.736   -29.488 1.00 27.46 ? 128 ARG A HH21 4  
ATOM 7880  H HH22 . ARG A 1 128 ? -20.719 1.474   -29.721 1.00 27.94 ? 128 ARG A HH22 4  
ATOM 7881  N N    . GLY A 1 1   ? -13.832 -9.077  -10.535 1.00 11.87 ? 1   GLY A N    5  
ATOM 7882  C CA   . GLY A 1 1   ? -13.026 -7.879  -10.194 1.00 11.28 ? 1   GLY A CA   5  
ATOM 7883  C C    . GLY A 1 1   ? -12.941 -7.681  -8.699  1.00 10.17 ? 1   GLY A C    5  
ATOM 7884  O O    . GLY A 1 1   ? -11.872 -7.822  -8.107  1.00 9.93  ? 1   GLY A O    5  
ATOM 7885  H H1   . GLY A 1 1   ? -13.844 -9.230  -11.568 1.00 12.05 ? 1   GLY A H1   5  
ATOM 7886  H H2   . GLY A 1 1   ? -14.813 -8.949  -10.206 1.00 12.06 ? 1   GLY A H2   5  
ATOM 7887  H H3   . GLY A 1 1   ? -13.431 -9.924  -10.071 1.00 12.09 ? 1   GLY A H3   5  
ATOM 7888  H HA2  . GLY A 1 1   ? -12.029 -8.000  -10.590 1.00 11.56 ? 1   GLY A HA2  5  
ATOM 7889  H HA3  . GLY A 1 1   ? -13.482 -7.007  -10.642 1.00 11.57 ? 1   GLY A HA3  5  
ATOM 7890  N N    . ILE A 1 2   ? -14.076 -7.383  -8.078  1.00 9.64  ? 2   ILE A N    5  
ATOM 7891  C CA   . ILE A 1 2   ? -14.143 -7.235  -6.629  1.00 8.69  ? 2   ILE A CA   5  
ATOM 7892  C C    . ILE A 1 2   ? -14.418 -8.586  -5.974  1.00 7.70  ? 2   ILE A C    5  
ATOM 7893  O O    . ILE A 1 2   ? -15.278 -8.719  -5.104  1.00 7.79  ? 2   ILE A O    5  
ATOM 7894  C CB   . ILE A 1 2   ? -15.226 -6.218  -6.205  1.00 9.07  ? 2   ILE A CB   5  
ATOM 7895  C CG1  . ILE A 1 2   ? -16.585 -6.583  -6.814  1.00 9.41  ? 2   ILE A CG1  5  
ATOM 7896  C CG2  . ILE A 1 2   ? -14.814 -4.811  -6.618  1.00 9.20  ? 2   ILE A CG2  5  
ATOM 7897  C CD1  . ILE A 1 2   ? -17.728 -5.718  -6.325  1.00 9.86  ? 2   ILE A CD1  5  
ATOM 7898  H H    . ILE A 1 2   ? -14.898 -7.267  -8.609  1.00 10.00 ? 2   ILE A H    5  
ATOM 7899  H HA   . ILE A 1 2   ? -13.183 -6.872  -6.288  1.00 8.63  ? 2   ILE A HA   5  
ATOM 7900  H HB   . ILE A 1 2   ? -15.304 -6.240  -5.127  1.00 9.29  ? 2   ILE A HB   5  
ATOM 7901  H HG12 . ILE A 1 2   ? -16.531 -6.477  -7.886  1.00 9.55  ? 2   ILE A HG12 5  
ATOM 7902  H HG13 . ILE A 1 2   ? -16.817 -7.610  -6.569  1.00 9.48  ? 2   ILE A HG13 5  
ATOM 7903  H HG21 . ILE A 1 2   ? -13.880 -4.555  -6.141  1.00 9.37  ? 2   ILE A HG21 5  
ATOM 7904  H HG22 . ILE A 1 2   ? -15.577 -4.109  -6.315  1.00 9.31  ? 2   ILE A HG22 5  
ATOM 7905  H HG23 . ILE A 1 2   ? -14.693 -4.771  -7.690  1.00 9.29  ? 2   ILE A HG23 5  
ATOM 7906  H HD11 . ILE A 1 2   ? -18.638 -6.010  -6.825  1.00 9.83  ? 2   ILE A HD11 5  
ATOM 7907  H HD12 . ILE A 1 2   ? -17.514 -4.681  -6.542  1.00 10.30 ? 2   ILE A HD12 5  
ATOM 7908  H HD13 . ILE A 1 2   ? -17.846 -5.846  -5.258  1.00 9.99  ? 2   ILE A HD13 5  
ATOM 7909  N N    . ASP A 1 3   ? -13.661 -9.585  -6.402  1.00 6.96  ? 3   ASP A N    5  
ATOM 7910  C CA   . ASP A 1 3   ? -13.874 -10.959 -5.974  1.00 6.18  ? 3   ASP A CA   5  
ATOM 7911  C C    . ASP A 1 3   ? -13.542 -11.135 -4.499  1.00 5.44  ? 3   ASP A C    5  
ATOM 7912  O O    . ASP A 1 3   ? -12.426 -10.850 -4.066  1.00 5.15  ? 3   ASP A O    5  
ATOM 7913  C CB   . ASP A 1 3   ? -13.029 -11.910 -6.822  1.00 6.00  ? 3   ASP A CB   5  
ATOM 7914  C CG   . ASP A 1 3   ? -13.386 -11.834 -8.292  1.00 6.08  ? 3   ASP A CG   5  
ATOM 7915  O OD1  . ASP A 1 3   ? -12.780 -11.015 -9.019  1.00 6.03  ? 3   ASP A OD1  5  
ATOM 7916  O OD2  . ASP A 1 3   ? -14.264 -12.606 -8.734  1.00 6.51  ? 3   ASP A OD2  5  
ATOM 7917  H H    . ASP A 1 3   ? -12.923 -9.389  -7.019  1.00 7.10  ? 3   ASP A H    5  
ATOM 7918  H HA   . ASP A 1 3   ? -14.916 -11.190 -6.127  1.00 6.61  ? 3   ASP A HA   5  
ATOM 7919  H HB2  . ASP A 1 3   ? -11.985 -11.656 -6.708  1.00 6.26  ? 3   ASP A HB2  5  
ATOM 7920  H HB3  . ASP A 1 3   ? -13.189 -12.923 -6.484  1.00 5.95  ? 3   ASP A HB3  5  
ATOM 7921  N N    . PRO A 1 4   ? -14.506 -11.623 -3.708  1.00 5.55  ? 4   PRO A N    5  
ATOM 7922  C CA   . PRO A 1 4   ? -14.339 -11.798 -2.260  1.00 5.42  ? 4   PRO A CA   5  
ATOM 7923  C C    . PRO A 1 4   ? -13.322 -12.880 -1.906  1.00 4.78  ? 4   PRO A C    5  
ATOM 7924  O O    . PRO A 1 4   ? -12.983 -13.060 -0.739  1.00 4.92  ? 4   PRO A O    5  
ATOM 7925  C CB   . PRO A 1 4   ? -15.736 -12.210 -1.772  1.00 6.21  ? 4   PRO A CB   5  
ATOM 7926  C CG   . PRO A 1 4   ? -16.662 -11.894 -2.898  1.00 6.65  ? 4   PRO A CG   5  
ATOM 7927  C CD   . PRO A 1 4   ? -15.848 -12.027 -4.151  1.00 6.29  ? 4   PRO A CD   5  
ATOM 7928  H HA   . PRO A 1 4   ? -14.051 -10.872 -1.784  1.00 5.67  ? 4   PRO A HA   5  
ATOM 7929  H HB2  . PRO A 1 4   ? -15.740 -13.266 -1.544  1.00 6.22  ? 4   PRO A HB2  5  
ATOM 7930  H HB3  . PRO A 1 4   ? -15.991 -11.647 -0.886  1.00 6.74  ? 4   PRO A HB3  5  
ATOM 7931  H HG2  . PRO A 1 4   ? -17.481 -12.599 -2.907  1.00 6.90  ? 4   PRO A HG2  5  
ATOM 7932  H HG3  . PRO A 1 4   ? -17.034 -10.886 -2.797  1.00 7.27  ? 4   PRO A HG3  5  
ATOM 7933  H HD2  . PRO A 1 4   ? -15.852 -13.048 -4.501  1.00 6.29  ? 4   PRO A HD2  5  
ATOM 7934  H HD3  . PRO A 1 4   ? -16.221 -11.361 -4.914  1.00 6.88  ? 4   PRO A HD3  5  
ATOM 7935  N N    . PHE A 1 5   ? -12.830 -13.597 -2.910  1.00 4.52  ? 5   PHE A N    5  
ATOM 7936  C CA   . PHE A 1 5   ? -11.877 -14.671 -2.671  1.00 4.35  ? 5   PHE A CA   5  
ATOM 7937  C C    . PHE A 1 5   ? -10.453 -14.253 -3.027  1.00 3.69  ? 5   PHE A C    5  
ATOM 7938  O O    . PHE A 1 5   ? -9.555  -15.092 -3.127  1.00 3.93  ? 5   PHE A O    5  
ATOM 7939  C CB   . PHE A 1 5   ? -12.279 -15.941 -3.430  1.00 5.29  ? 5   PHE A CB   5  
ATOM 7940  C CG   . PHE A 1 5   ? -12.466 -15.764 -4.915  1.00 6.13  ? 5   PHE A CG   5  
ATOM 7941  C CD1  . PHE A 1 5   ? -11.376 -15.810 -5.771  1.00 6.78  ? 5   PHE A CD1  5  
ATOM 7942  C CD2  . PHE A 1 5   ? -13.725 -15.527 -5.449  1.00 6.53  ? 5   PHE A CD2  5  
ATOM 7943  C CE1  . PHE A 1 5   ? -11.537 -15.630 -7.130  1.00 7.72  ? 5   PHE A CE1  5  
ATOM 7944  C CE2  . PHE A 1 5   ? -13.891 -15.343 -6.808  1.00 7.42  ? 5   PHE A CE2  5  
ATOM 7945  C CZ   . PHE A 1 5   ? -12.826 -15.485 -7.656  1.00 7.99  ? 5   PHE A CZ   5  
ATOM 7946  H H    . PHE A 1 5   ? -13.112 -13.396 -3.826  1.00 4.77  ? 5   PHE A H    5  
ATOM 7947  H HA   . PHE A 1 5   ? -11.906 -14.888 -1.612  1.00 4.48  ? 5   PHE A HA   5  
ATOM 7948  H HB2  . PHE A 1 5   ? -11.513 -16.688 -3.286  1.00 5.51  ? 5   PHE A HB2  5  
ATOM 7949  H HB3  . PHE A 1 5   ? -13.207 -16.308 -3.022  1.00 5.50  ? 5   PHE A HB3  5  
ATOM 7950  H HD1  . PHE A 1 5   ? -10.392 -15.993 -5.366  1.00 6.71  ? 5   PHE A HD1  5  
ATOM 7951  H HD2  . PHE A 1 5   ? -14.582 -15.490 -4.791  1.00 6.31  ? 5   PHE A HD2  5  
ATOM 7952  H HE1  . PHE A 1 5   ? -10.679 -15.671 -7.785  1.00 8.37  ? 5   PHE A HE1  5  
ATOM 7953  H HE2  . PHE A 1 5   ? -14.875 -15.159 -7.213  1.00 7.82  ? 5   PHE A HE2  5  
ATOM 7954  H HZ   . PHE A 1 5   ? -12.967 -15.378 -8.721  1.00 8.77  ? 5   PHE A HZ   5  
ATOM 7955  N N    . THR A 1 6   ? -10.244 -12.957 -3.220  1.00 3.31  ? 6   THR A N    5  
ATOM 7956  C CA   . THR A 1 6   ? -8.903  -12.434 -3.426  1.00 3.02  ? 6   THR A CA   5  
ATOM 7957  C C    . THR A 1 6   ? -8.514  -11.526 -2.254  1.00 2.13  ? 6   THR A C    5  
ATOM 7958  O O    . THR A 1 6   ? -9.255  -11.429 -1.271  1.00 2.37  ? 6   THR A O    5  
ATOM 7959  C CB   . THR A 1 6   ? -8.763  -11.685 -4.780  1.00 3.65  ? 6   THR A CB   5  
ATOM 7960  O OG1  . THR A 1 6   ? -7.377  -11.442 -5.075  1.00 4.26  ? 6   THR A OG1  5  
ATOM 7961  C CG2  . THR A 1 6   ? -9.518  -10.367 -4.776  1.00 4.04  ? 6   THR A CG2  5  
ATOM 7962  H H    . THR A 1 6   ? -11.007 -12.342 -3.220  1.00 3.60  ? 6   THR A H    5  
ATOM 7963  H HA   . THR A 1 6   ? -8.226  -13.279 -3.439  1.00 3.50  ? 6   THR A HA   5  
ATOM 7964  H HB   . THR A 1 6   ? -9.175  -12.311 -5.558  1.00 3.99  ? 6   THR A HB   5  
ATOM 7965  H HG1  . THR A 1 6   ? -7.211  -10.480 -5.118  1.00 4.39  ? 6   THR A HG1  5  
ATOM 7966  H HG21 . THR A 1 6   ? -9.124  -9.731  -3.997  1.00 4.31  ? 6   THR A HG21 5  
ATOM 7967  H HG22 . THR A 1 6   ? -10.567 -10.550 -4.594  1.00 4.49  ? 6   THR A HG22 5  
ATOM 7968  H HG23 . THR A 1 6   ? -9.399  -9.879  -5.733  1.00 4.15  ? 6   THR A HG23 5  
ATOM 7969  N N    . MET A 1 7   ? -7.369  -10.873 -2.350  1.00 1.53  ? 7   MET A N    5  
ATOM 7970  C CA   . MET A 1 7   ? -6.830  -10.104 -1.236  1.00 1.05  ? 7   MET A CA   5  
ATOM 7971  C C    . MET A 1 7   ? -7.535  -8.772  -1.083  1.00 0.83  ? 7   MET A C    5  
ATOM 7972  O O    . MET A 1 7   ? -8.286  -8.565  -0.125  1.00 1.39  ? 7   MET A O    5  
ATOM 7973  C CB   . MET A 1 7   ? -5.335  -9.866  -1.432  1.00 1.50  ? 7   MET A CB   5  
ATOM 7974  C CG   . MET A 1 7   ? -4.547  -11.143 -1.624  1.00 2.32  ? 7   MET A CG   5  
ATOM 7975  S SD   . MET A 1 7   ? -2.767  -10.863 -1.683  1.00 3.29  ? 7   MET A SD   5  
ATOM 7976  C CE   . MET A 1 7   ? -2.182  -12.542 -1.866  1.00 3.84  ? 7   MET A CE   5  
ATOM 7977  H H    . MET A 1 7   ? -6.876  -10.900 -3.203  1.00 1.86  ? 7   MET A H    5  
ATOM 7978  H HA   . MET A 1 7   ? -6.975  -10.670 -0.343  1.00 1.34  ? 7   MET A HA   5  
ATOM 7979  H HB2  . MET A 1 7   ? -5.190  -9.243  -2.300  1.00 1.93  ? 7   MET A HB2  5  
ATOM 7980  H HB3  . MET A 1 7   ? -4.946  -9.356  -0.562  1.00 1.78  ? 7   MET A HB3  5  
ATOM 7981  H HG2  . MET A 1 7   ? -4.766  -11.812 -0.805  1.00 2.59  ? 7   MET A HG2  5  
ATOM 7982  H HG3  . MET A 1 7   ? -4.859  -11.598 -2.553  1.00 2.65  ? 7   MET A HG3  5  
ATOM 7983  H HE1  . MET A 1 7   ? -2.570  -12.959 -2.783  1.00 4.06  ? 7   MET A HE1  5  
ATOM 7984  H HE2  . MET A 1 7   ? -2.523  -13.135 -1.029  1.00 4.06  ? 7   MET A HE2  5  
ATOM 7985  H HE3  . MET A 1 7   ? -1.103  -12.548 -1.894  1.00 4.32  ? 7   MET A HE3  5  
ATOM 7986  N N    . LEU A 1 8   ? -7.278  -7.890  -2.029  1.00 0.80  ? 8   LEU A N    5  
ATOM 7987  C CA   . LEU A 1 8   ? -7.772  -6.514  -1.996  1.00 0.56  ? 8   LEU A CA   5  
ATOM 7988  C C    . LEU A 1 8   ? -7.415  -5.831  -0.681  1.00 0.48  ? 8   LEU A C    5  
ATOM 7989  O O    . LEU A 1 8   ? -8.182  -5.028  -0.150  1.00 0.47  ? 8   LEU A O    5  
ATOM 7990  C CB   . LEU A 1 8   ? -9.281  -6.476  -2.191  1.00 0.47  ? 8   LEU A CB   5  
ATOM 7991  C CG   . LEU A 1 8   ? -9.793  -7.199  -3.427  1.00 0.56  ? 8   LEU A CG   5  
ATOM 7992  C CD1  . LEU A 1 8   ? -11.250 -6.891  -3.631  1.00 0.61  ? 8   LEU A CD1  5  
ATOM 7993  C CD2  . LEU A 1 8   ? -9.019  -6.793  -4.657  1.00 0.72  ? 8   LEU A CD2  5  
ATOM 7994  H H    . LEU A 1 8   ? -6.751  -8.186  -2.796  1.00 1.36  ? 8   LEU A H    5  
ATOM 7995  H HA   . LEU A 1 8   ? -7.302  -5.976  -2.805  1.00 0.70  ? 8   LEU A HA   5  
ATOM 7996  H HB2  . LEU A 1 8   ? -9.743  -6.925  -1.323  1.00 0.54  ? 8   LEU A HB2  5  
ATOM 7997  H HB3  . LEU A 1 8   ? -9.591  -5.445  -2.249  1.00 0.53  ? 8   LEU A HB3  5  
ATOM 7998  H HG   . LEU A 1 8   ? -9.678  -8.269  -3.290  1.00 0.64  ? 8   LEU A HG   5  
ATOM 7999  H HD11 . LEU A 1 8   ? -11.619 -7.464  -4.464  1.00 1.21  ? 8   LEU A HD11 5  
ATOM 8000  H HD12 . LEU A 1 8   ? -11.351 -5.836  -3.841  1.00 0.99  ? 8   LEU A HD12 5  
ATOM 8001  H HD13 . LEU A 1 8   ? -11.799 -7.141  -2.737  1.00 1.34  ? 8   LEU A HD13 5  
ATOM 8002  H HD21 . LEU A 1 8   ? -9.528  -7.154  -5.537  1.00 1.31  ? 8   LEU A HD21 5  
ATOM 8003  H HD22 . LEU A 1 8   ? -8.035  -7.226  -4.611  1.00 1.24  ? 8   LEU A HD22 5  
ATOM 8004  H HD23 . LEU A 1 8   ? -8.942  -5.717  -4.698  1.00 1.27  ? 8   LEU A HD23 5  
ATOM 8005  N N    . ARG A 1 9   ? -6.241  -6.142  -0.167  1.00 0.52  ? 9   ARG A N    5  
ATOM 8006  C CA   . ARG A 1 9   ? -5.820  -5.626  1.117   1.00 0.51  ? 9   ARG A CA   5  
ATOM 8007  C C    . ARG A 1 9   ? -4.363  -5.207  1.055   1.00 0.43  ? 9   ARG A C    5  
ATOM 8008  O O    . ARG A 1 9   ? -3.551  -5.848  0.387   1.00 0.47  ? 9   ARG A O    5  
ATOM 8009  C CB   . ARG A 1 9   ? -6.046  -6.682  2.204   1.00 0.69  ? 9   ARG A CB   5  
ATOM 8010  C CG   . ARG A 1 9   ? -5.301  -7.987  1.966   1.00 1.15  ? 9   ARG A CG   5  
ATOM 8011  C CD   . ARG A 1 9   ? -5.880  -9.110  2.809   1.00 1.21  ? 9   ARG A CD   5  
ATOM 8012  N NE   . ARG A 1 9   ? -7.266  -9.408  2.425   1.00 1.84  ? 9   ARG A NE   5  
ATOM 8013  C CZ   . ARG A 1 9   ? -8.076  -10.239 3.087   1.00 2.23  ? 9   ARG A CZ   5  
ATOM 8014  N NH1  . ARG A 1 9   ? -7.647  -10.896 4.157   1.00 2.21  ? 9   ARG A NH1  5  
ATOM 8015  N NH2  . ARG A 1 9   ? -9.319  -10.425 2.654   1.00 3.09  ? 9   ARG A NH2  5  
ATOM 8016  H H    . ARG A 1 9   ? -5.632  -6.716  -0.677  1.00 0.60  ? 9   ARG A H    5  
ATOM 8017  H HA   . ARG A 1 9   ? -6.423  -4.758  1.337   1.00 0.51  ? 9   ARG A HA   5  
ATOM 8018  H HB2  . ARG A 1 9   ? -5.725  -6.279  3.153   1.00 1.21  ? 9   ARG A HB2  5  
ATOM 8019  H HB3  . ARG A 1 9   ? -7.101  -6.904  2.257   1.00 1.12  ? 9   ARG A HB3  5  
ATOM 8020  H HG2  . ARG A 1 9   ? -5.383  -8.253  0.923   1.00 1.62  ? 9   ARG A HG2  5  
ATOM 8021  H HG3  . ARG A 1 9   ? -4.261  -7.849  2.226   1.00 1.68  ? 9   ARG A HG3  5  
ATOM 8022  H HD2  . ARG A 1 9   ? -5.277  -9.995  2.674   1.00 1.50  ? 9   ARG A HD2  5  
ATOM 8023  H HD3  . ARG A 1 9   ? -5.857  -8.809  3.848   1.00 1.36  ? 9   ARG A HD3  5  
ATOM 8024  H HE   . ARG A 1 9   ? -7.613  -8.953  1.621   1.00 2.36  ? 9   ARG A HE   5  
ATOM 8025  H HH11 . ARG A 1 9   ? -6.702  -10.783 4.475   1.00 1.99  ? 9   ARG A HH11 5  
ATOM 8026  H HH12 . ARG A 1 9   ? -8.272  -11.500 4.667   1.00 2.76  ? 9   ARG A HH12 5  
ATOM 8027  H HH21 . ARG A 1 9   ? -9.645  -9.947  1.837   1.00 3.51  ? 9   ARG A HH21 5  
ATOM 8028  H HH22 . ARG A 1 9   ? -9.940  -11.053 3.144   1.00 3.49  ? 9   ARG A HH22 5  
ATOM 8029  N N    . PRO A 1 10  ? -4.024  -4.098  1.725   1.00 0.36  ? 10  PRO A N    5  
ATOM 8030  C CA   . PRO A 1 10  ? -2.656  -3.595  1.769   1.00 0.30  ? 10  PRO A CA   5  
ATOM 8031  C C    . PRO A 1 10  ? -1.735  -4.546  2.511   1.00 0.28  ? 10  PRO A C    5  
ATOM 8032  O O    . PRO A 1 10  ? -2.185  -5.394  3.284   1.00 0.38  ? 10  PRO A O    5  
ATOM 8033  C CB   . PRO A 1 10  ? -2.774  -2.268  2.526   1.00 0.29  ? 10  PRO A CB   5  
ATOM 8034  C CG   . PRO A 1 10  ? -4.043  -2.366  3.292   1.00 0.47  ? 10  PRO A CG   5  
ATOM 8035  C CD   . PRO A 1 10  ? -4.949  -3.252  2.489   1.00 0.40  ? 10  PRO A CD   5  
ATOM 8036  H HA   . PRO A 1 10  ? -2.267  -3.416  0.778   1.00 0.33  ? 10  PRO A HA   5  
ATOM 8037  H HB2  . PRO A 1 10  ? -1.925  -2.152  3.184   1.00 0.37  ? 10  PRO A HB2  5  
ATOM 8038  H HB3  . PRO A 1 10  ? -2.800  -1.451  1.821   1.00 0.38  ? 10  PRO A HB3  5  
ATOM 8039  H HG2  . PRO A 1 10  ? -3.852  -2.805  4.260   1.00 0.70  ? 10  PRO A HG2  5  
ATOM 8040  H HG3  . PRO A 1 10  ? -4.480  -1.386  3.403   1.00 0.81  ? 10  PRO A HG3  5  
ATOM 8041  H HD2  . PRO A 1 10  ? -5.559  -3.853  3.140   1.00 0.50  ? 10  PRO A HD2  5  
ATOM 8042  H HD3  . PRO A 1 10  ? -5.565  -2.660  1.827   1.00 0.57  ? 10  PRO A HD3  5  
ATOM 8043  N N    . ARG A 1 11  ? -0.451  -4.399  2.274   1.00 0.29  ? 11  ARG A N    5  
ATOM 8044  C CA   . ARG A 1 11  ? 0.541   -5.224  2.930   1.00 0.34  ? 11  ARG A CA   5  
ATOM 8045  C C    . ARG A 1 11  ? 1.583   -4.354  3.622   1.00 0.27  ? 11  ARG A C    5  
ATOM 8046  O O    . ARG A 1 11  ? 2.092   -3.394  3.038   1.00 0.27  ? 11  ARG A O    5  
ATOM 8047  C CB   . ARG A 1 11  ? 1.198   -6.164  1.915   1.00 0.49  ? 11  ARG A CB   5  
ATOM 8048  C CG   . ARG A 1 11  ? 1.849   -5.448  0.743   1.00 0.63  ? 11  ARG A CG   5  
ATOM 8049  C CD   . ARG A 1 11  ? 2.159   -6.405  -0.393  1.00 1.00  ? 11  ARG A CD   5  
ATOM 8050  N NE   . ARG A 1 11  ? 0.941   -6.897  -1.046  1.00 1.22  ? 11  ARG A NE   5  
ATOM 8051  C CZ   . ARG A 1 11  ? 0.434   -8.116  -0.869  1.00 1.59  ? 11  ARG A CZ   5  
ATOM 8052  N NH1  . ARG A 1 11  ? 1.007   -8.957  -0.016  1.00 1.95  ? 11  ARG A NH1  5  
ATOM 8053  N NH2  . ARG A 1 11  ? -0.650  -8.482  -1.536  1.00 2.37  ? 11  ARG A NH2  5  
ATOM 8054  H H    . ARG A 1 11  ? -0.162  -3.712  1.634   1.00 0.33  ? 11  ARG A H    5  
ATOM 8055  H HA   . ARG A 1 11  ? 0.033   -5.816  3.677   1.00 0.40  ? 11  ARG A HA   5  
ATOM 8056  H HB2  . ARG A 1 11  ? 1.957   -6.744  2.417   1.00 0.63  ? 11  ARG A HB2  5  
ATOM 8057  H HB3  . ARG A 1 11  ? 0.445   -6.834  1.524   1.00 0.78  ? 11  ARG A HB3  5  
ATOM 8058  H HG2  . ARG A 1 11  ? 1.178   -4.682  0.383   1.00 0.94  ? 11  ARG A HG2  5  
ATOM 8059  H HG3  . ARG A 1 11  ? 2.770   -4.992  1.080   1.00 0.71  ? 11  ARG A HG3  5  
ATOM 8060  H HD2  . ARG A 1 11  ? 2.765   -5.890  -1.124  1.00 1.68  ? 11  ARG A HD2  5  
ATOM 8061  H HD3  . ARG A 1 11  ? 2.709   -7.245  0.003   1.00 1.50  ? 11  ARG A HD3  5  
ATOM 8062  H HE   . ARG A 1 11  ? 0.483   -6.282  -1.668  1.00 1.83  ? 11  ARG A HE   5  
ATOM 8063  H HH11 . ARG A 1 11  ? 1.816   -8.673  0.497   1.00 2.06  ? 11  ARG A HH11 5  
ATOM 8064  H HH12 . ARG A 1 11  ? 0.628   -9.883  0.119   1.00 2.55  ? 11  ARG A HH12 5  
ATOM 8065  H HH21 . ARG A 1 11  ? -1.088  -7.832  -2.179  1.00 2.82  ? 11  ARG A HH21 5  
ATOM 8066  H HH22 . ARG A 1 11  ? -1.045  -9.395  -1.408  1.00 2.79  ? 11  ARG A HH22 5  
ATOM 8067  N N    . LEU A 1 12  ? 1.874   -4.675  4.873   1.00 0.29  ? 12  LEU A N    5  
ATOM 8068  C CA   . LEU A 1 12  ? 2.853   -3.925  5.643   1.00 0.26  ? 12  LEU A CA   5  
ATOM 8069  C C    . LEU A 1 12  ? 4.186   -4.645  5.617   1.00 0.25  ? 12  LEU A C    5  
ATOM 8070  O O    . LEU A 1 12  ? 4.332   -5.729  6.183   1.00 0.32  ? 12  LEU A O    5  
ATOM 8071  C CB   . LEU A 1 12  ? 2.383   -3.744  7.088   1.00 0.34  ? 12  LEU A CB   5  
ATOM 8072  C CG   . LEU A 1 12  ? 3.352   -2.988  8.003   1.00 0.60  ? 12  LEU A CG   5  
ATOM 8073  C CD1  . LEU A 1 12  ? 3.594   -1.579  7.485   1.00 1.32  ? 12  LEU A CD1  5  
ATOM 8074  C CD2  . LEU A 1 12  ? 2.815   -2.945  9.425   1.00 1.28  ? 12  LEU A CD2  5  
ATOM 8075  H H    . LEU A 1 12  ? 1.427   -5.444  5.287   1.00 0.35  ? 12  LEU A H    5  
ATOM 8076  H HA   . LEU A 1 12  ? 2.968   -2.955  5.183   1.00 0.24  ? 12  LEU A HA   5  
ATOM 8077  H HB2  . LEU A 1 12  ? 1.446   -3.209  7.071   1.00 0.72  ? 12  LEU A HB2  5  
ATOM 8078  H HB3  . LEU A 1 12  ? 2.213   -4.722  7.512   1.00 0.66  ? 12  LEU A HB3  5  
ATOM 8079  H HG   . LEU A 1 12  ? 4.302   -3.504  8.017   1.00 1.58  ? 12  LEU A HG   5  
ATOM 8080  H HD11 . LEU A 1 12  ? 2.651   -1.057  7.409   1.00 1.80  ? 12  LEU A HD11 5  
ATOM 8081  H HD12 . LEU A 1 12  ? 4.058   -1.629  6.511   1.00 1.95  ? 12  LEU A HD12 5  
ATOM 8082  H HD13 . LEU A 1 12  ? 4.243   -1.051  8.167   1.00 1.91  ? 12  LEU A HD13 5  
ATOM 8083  H HD21 . LEU A 1 12  ? 2.667   -3.953  9.783   1.00 1.90  ? 12  LEU A HD21 5  
ATOM 8084  H HD22 . LEU A 1 12  ? 1.873   -2.416  9.438   1.00 1.96  ? 12  LEU A HD22 5  
ATOM 8085  H HD23 . LEU A 1 12  ? 3.524   -2.437  10.063  1.00 1.71  ? 12  LEU A HD23 5  
ATOM 8086  N N    . CYS A 1 13  ? 5.148   -4.048  4.950   1.00 0.23  ? 13  CYS A N    5  
ATOM 8087  C CA   . CYS A 1 13  ? 6.466   -4.629  4.837   1.00 0.25  ? 13  CYS A CA   5  
ATOM 8088  C C    . CYS A 1 13  ? 7.407   -3.996  5.852   1.00 0.22  ? 13  CYS A C    5  
ATOM 8089  O O    . CYS A 1 13  ? 7.674   -2.799  5.798   1.00 0.24  ? 13  CYS A O    5  
ATOM 8090  C CB   . CYS A 1 13  ? 6.988   -4.410  3.419   1.00 0.29  ? 13  CYS A CB   5  
ATOM 8091  S SG   . CYS A 1 13  ? 5.800   -4.864  2.134   1.00 0.40  ? 13  CYS A SG   5  
ATOM 8092  H H    . CYS A 1 13  ? 4.966   -3.188  4.507   1.00 0.23  ? 13  CYS A H    5  
ATOM 8093  H HA   . CYS A 1 13  ? 6.390   -5.688  5.031   1.00 0.28  ? 13  CYS A HA   5  
ATOM 8094  H HB2  . CYS A 1 13  ? 7.233   -3.365  3.290   1.00 0.31  ? 13  CYS A HB2  5  
ATOM 8095  H HB3  . CYS A 1 13  ? 7.877   -5.005  3.274   1.00 0.31  ? 13  CYS A HB3  5  
ATOM 8096  H HG   . CYS A 1 13  ? 5.786   -6.185  2.043   1.00 1.17  ? 13  CYS A HG   5  
ATOM 8097  N N    . THR A 1 14  ? 7.911   -4.797  6.775   1.00 0.23  ? 14  THR A N    5  
ATOM 8098  C CA   . THR A 1 14  ? 8.846   -4.298  7.767   1.00 0.24  ? 14  THR A CA   5  
ATOM 8099  C C    . THR A 1 14  ? 10.244  -4.760  7.389   1.00 0.22  ? 14  THR A C    5  
ATOM 8100  O O    . THR A 1 14  ? 10.511  -5.961  7.332   1.00 0.25  ? 14  THR A O    5  
ATOM 8101  C CB   . THR A 1 14  ? 8.500   -4.814  9.177   1.00 0.31  ? 14  THR A CB   5  
ATOM 8102  O OG1  . THR A 1 14  ? 7.111   -4.586  9.452   1.00 0.35  ? 14  THR A OG1  5  
ATOM 8103  C CG2  . THR A 1 14  ? 9.348   -4.116  10.231  1.00 0.35  ? 14  THR A CG2  5  
ATOM 8104  H H    . THR A 1 14  ? 7.677   -5.755  6.768   1.00 0.26  ? 14  THR A H    5  
ATOM 8105  H HA   . THR A 1 14  ? 8.803   -3.214  7.772   1.00 0.23  ? 14  THR A HA   5  
ATOM 8106  H HB   . THR A 1 14  ? 8.700   -5.875  9.219   1.00 0.33  ? 14  THR A HB   5  
ATOM 8107  H HG1  . THR A 1 14  ? 6.580   -5.029  8.784   1.00 0.65  ? 14  THR A HG1  5  
ATOM 8108  H HG21 . THR A 1 14  ? 9.093   -4.499  11.209  1.00 1.01  ? 14  THR A HG21 5  
ATOM 8109  H HG22 . THR A 1 14  ? 9.157   -3.054  10.200  1.00 1.13  ? 14  THR A HG22 5  
ATOM 8110  H HG23 . THR A 1 14  ? 10.394  -4.299  10.033  1.00 1.10  ? 14  THR A HG23 5  
ATOM 8111  N N    . MET A 1 15  ? 11.130  -3.820  7.134   1.00 0.20  ? 15  MET A N    5  
ATOM 8112  C CA   . MET A 1 15  ? 12.448  -4.152  6.623   1.00 0.19  ? 15  MET A CA   5  
ATOM 8113  C C    . MET A 1 15  ? 13.537  -3.447  7.421   1.00 0.21  ? 15  MET A C    5  
ATOM 8114  O O    . MET A 1 15  ? 13.445  -2.254  7.705   1.00 0.21  ? 15  MET A O    5  
ATOM 8115  C CB   . MET A 1 15  ? 12.538  -3.795  5.135   1.00 0.21  ? 15  MET A CB   5  
ATOM 8116  C CG   . MET A 1 15  ? 12.146  -2.360  4.833   1.00 0.24  ? 15  MET A CG   5  
ATOM 8117  S SD   . MET A 1 15  ? 12.171  -1.968  3.075   1.00 0.88  ? 15  MET A SD   5  
ATOM 8118  C CE   . MET A 1 15  ? 10.728  -2.863  2.503   1.00 0.28  ? 15  MET A CE   5  
ATOM 8119  H H    . MET A 1 15  ? 10.898  -2.875  7.295   1.00 0.21  ? 15  MET A H    5  
ATOM 8120  H HA   . MET A 1 15  ? 12.579  -5.219  6.732   1.00 0.22  ? 15  MET A HA   5  
ATOM 8121  H HB2  . MET A 1 15  ? 13.554  -3.947  4.802   1.00 0.26  ? 15  MET A HB2  5  
ATOM 8122  H HB3  . MET A 1 15  ? 11.884  -4.451  4.579   1.00 0.23  ? 15  MET A HB3  5  
ATOM 8123  H HG2  . MET A 1 15  ? 11.148  -2.191  5.208   1.00 0.48  ? 15  MET A HG2  5  
ATOM 8124  H HG3  . MET A 1 15  ? 12.830  -1.707  5.343   1.00 0.46  ? 15  MET A HG3  5  
ATOM 8125  H HE1  . MET A 1 15  ? 10.862  -3.918  2.690   1.00 1.04  ? 15  MET A HE1  5  
ATOM 8126  H HE2  . MET A 1 15  ? 10.598  -2.699  1.444   1.00 1.08  ? 15  MET A HE2  5  
ATOM 8127  H HE3  . MET A 1 15  ? 9.854   -2.511  3.032   1.00 1.03  ? 15  MET A HE3  5  
ATOM 8128  N N    . LYS A 1 16  ? 14.560  -4.204  7.785   1.00 0.29  ? 16  LYS A N    5  
ATOM 8129  C CA   . LYS A 1 16  ? 15.664  -3.690  8.580   1.00 0.37  ? 16  LYS A CA   5  
ATOM 8130  C C    . LYS A 1 16  ? 16.887  -3.501  7.682   1.00 0.40  ? 16  LYS A C    5  
ATOM 8131  O O    . LYS A 1 16  ? 17.106  -4.282  6.759   1.00 0.48  ? 16  LYS A O    5  
ATOM 8132  C CB   . LYS A 1 16  ? 15.945  -4.671  9.728   1.00 0.50  ? 16  LYS A CB   5  
ATOM 8133  C CG   . LYS A 1 16  ? 16.744  -4.098  10.892  1.00 0.90  ? 16  LYS A CG   5  
ATOM 8134  C CD   . LYS A 1 16  ? 18.239  -4.076  10.625  1.00 1.09  ? 16  LYS A CD   5  
ATOM 8135  C CE   . LYS A 1 16  ? 18.991  -3.522  11.820  1.00 1.96  ? 16  LYS A CE   5  
ATOM 8136  N NZ   . LYS A 1 16  ? 20.461  -3.523  11.607  1.00 2.58  ? 16  LYS A NZ   5  
ATOM 8137  H H    . LYS A 1 16  ? 14.574  -5.145  7.511   1.00 0.34  ? 16  LYS A H    5  
ATOM 8138  H HA   . LYS A 1 16  ? 15.371  -2.734  8.988   1.00 0.41  ? 16  LYS A HA   5  
ATOM 8139  H HB2  . LYS A 1 16  ? 14.997  -5.013  10.117  1.00 0.99  ? 16  LYS A HB2  5  
ATOM 8140  H HB3  . LYS A 1 16  ? 16.484  -5.520  9.333   1.00 1.07  ? 16  LYS A HB3  5  
ATOM 8141  H HG2  . LYS A 1 16  ? 16.412  -3.089  11.074  1.00 1.53  ? 16  LYS A HG2  5  
ATOM 8142  H HG3  . LYS A 1 16  ? 16.555  -4.701  11.769  1.00 1.46  ? 16  LYS A HG3  5  
ATOM 8143  H HD2  . LYS A 1 16  ? 18.579  -5.083  10.431  1.00 1.54  ? 16  LYS A HD2  5  
ATOM 8144  H HD3  . LYS A 1 16  ? 18.437  -3.454  9.765   1.00 1.45  ? 16  LYS A HD3  5  
ATOM 8145  H HE2  . LYS A 1 16  ? 18.663  -2.507  11.996  1.00 2.45  ? 16  LYS A HE2  5  
ATOM 8146  H HE3  . LYS A 1 16  ? 18.760  -4.126  12.684  1.00 2.53  ? 16  LYS A HE3  5  
ATOM 8147  H HZ1  . LYS A 1 16  ? 20.813  -4.501  11.505  1.00 2.80  ? 16  LYS A HZ1  5  
ATOM 8148  H HZ2  . LYS A 1 16  ? 20.938  -3.079  12.417  1.00 3.11  ? 16  LYS A HZ2  5  
ATOM 8149  H HZ3  . LYS A 1 16  ? 20.701  -2.987  10.747  1.00 3.02  ? 16  LYS A HZ3  5  
ATOM 8150  N N    . LYS A 1 17  ? 17.657  -2.450  7.943   1.00 0.41  ? 17  LYS A N    5  
ATOM 8151  C CA   . LYS A 1 17  ? 18.800  -2.102  7.108   1.00 0.50  ? 17  LYS A CA   5  
ATOM 8152  C C    . LYS A 1 17  ? 19.873  -3.184  7.156   1.00 0.60  ? 17  LYS A C    5  
ATOM 8153  O O    . LYS A 1 17  ? 20.436  -3.476  8.213   1.00 0.67  ? 17  LYS A O    5  
ATOM 8154  C CB   . LYS A 1 17  ? 19.382  -0.764  7.564   1.00 0.51  ? 17  LYS A CB   5  
ATOM 8155  C CG   . LYS A 1 17  ? 19.476  0.273   6.455   1.00 0.52  ? 17  LYS A CG   5  
ATOM 8156  C CD   . LYS A 1 17  ? 19.852  1.642   7.000   1.00 0.53  ? 17  LYS A CD   5  
ATOM 8157  C CE   . LYS A 1 17  ? 18.775  2.172   7.933   1.00 0.62  ? 17  LYS A CE   5  
ATOM 8158  N NZ   . LYS A 1 17  ? 19.188  3.426   8.616   1.00 0.92  ? 17  LYS A NZ   5  
ATOM 8159  H H    . LYS A 1 17  ? 17.457  -1.890  8.732   1.00 0.41  ? 17  LYS A H    5  
ATOM 8160  H HA   . LYS A 1 17  ? 18.449  -2.003  6.092   1.00 0.52  ? 17  LYS A HA   5  
ATOM 8161  H HB2  . LYS A 1 17  ? 18.756  -0.362  8.347   1.00 0.68  ? 17  LYS A HB2  5  
ATOM 8162  H HB3  . LYS A 1 17  ? 20.374  -0.930  7.958   1.00 0.68  ? 17  LYS A HB3  5  
ATOM 8163  H HG2  . LYS A 1 17  ? 20.226  -0.039  5.745   1.00 0.67  ? 17  LYS A HG2  5  
ATOM 8164  H HG3  . LYS A 1 17  ? 18.516  0.341   5.964   1.00 0.68  ? 17  LYS A HG3  5  
ATOM 8165  H HD2  . LYS A 1 17  ? 20.782  1.564   7.545   1.00 0.91  ? 17  LYS A HD2  5  
ATOM 8166  H HD3  . LYS A 1 17  ? 19.971  2.329   6.176   1.00 0.79  ? 17  LYS A HD3  5  
ATOM 8167  H HE2  . LYS A 1 17  ? 17.884  2.365   7.353   1.00 0.85  ? 17  LYS A HE2  5  
ATOM 8168  H HE3  . LYS A 1 17  ? 18.562  1.418   8.676   1.00 0.95  ? 17  LYS A HE3  5  
ATOM 8169  H HZ1  . LYS A 1 17  ? 19.286  4.202   7.926   1.00 1.50  ? 17  LYS A HZ1  5  
ATOM 8170  H HZ2  . LYS A 1 17  ? 20.105  3.286   9.093   1.00 1.28  ? 17  LYS A HZ2  5  
ATOM 8171  H HZ3  . LYS A 1 17  ? 18.478  3.697   9.329   1.00 1.39  ? 17  LYS A HZ3  5  
ATOM 8172  N N    . GLY A 1 18  ? 20.135  -3.782  6.004   1.00 0.68  ? 18  GLY A N    5  
ATOM 8173  C CA   . GLY A 1 18  ? 21.159  -4.798  5.906   1.00 0.85  ? 18  GLY A CA   5  
ATOM 8174  C C    . GLY A 1 18  ? 22.487  -4.220  5.457   1.00 1.05  ? 18  GLY A C    5  
ATOM 8175  O O    . GLY A 1 18  ? 22.999  -3.290  6.079   1.00 1.28  ? 18  GLY A O    5  
ATOM 8176  H H    . GLY A 1 18  ? 19.622  -3.528  5.204   1.00 0.68  ? 18  GLY A H    5  
ATOM 8177  H HA2  . GLY A 1 18  ? 21.286  -5.264  6.873   1.00 0.90  ? 18  GLY A HA2  5  
ATOM 8178  H HA3  . GLY A 1 18  ? 20.846  -5.548  5.194   1.00 0.94  ? 18  GLY A HA3  5  
ATOM 8179  N N    . PRO A 1 19  ? 23.061  -4.744  4.365   1.00 1.24  ? 19  PRO A N    5  
ATOM 8180  C CA   . PRO A 1 19  ? 24.378  -4.320  3.880   1.00 1.57  ? 19  PRO A CA   5  
ATOM 8181  C C    . PRO A 1 19  ? 24.413  -2.858  3.429   1.00 1.57  ? 19  PRO A C    5  
ATOM 8182  O O    . PRO A 1 19  ? 25.058  -2.022  4.061   1.00 2.23  ? 19  PRO A O    5  
ATOM 8183  C CB   . PRO A 1 19  ? 24.650  -5.252  2.695   1.00 1.91  ? 19  PRO A CB   5  
ATOM 8184  C CG   . PRO A 1 19  ? 23.313  -5.764  2.282   1.00 1.86  ? 19  PRO A CG   5  
ATOM 8185  C CD   . PRO A 1 19  ? 22.477  -5.805  3.528   1.00 1.40  ? 19  PRO A CD   5  
ATOM 8186  H HA   . PRO A 1 19  ? 25.137  -4.473  4.635   1.00 1.77  ? 19  PRO A HA   5  
ATOM 8187  H HB2  . PRO A 1 19  ? 25.121  -4.694  1.900   1.00 2.10  ? 19  PRO A HB2  5  
ATOM 8188  H HB3  . PRO A 1 19  ? 25.300  -6.056  3.009   1.00 2.19  ? 19  PRO A HB3  5  
ATOM 8189  H HG2  . PRO A 1 19  ? 22.873  -5.096  1.558   1.00 2.16  ? 19  PRO A HG2  5  
ATOM 8190  H HG3  . PRO A 1 19  ? 23.413  -6.756  1.865   1.00 2.10  ? 19  PRO A HG3  5  
ATOM 8191  H HD2  . PRO A 1 19  ? 21.446  -5.589  3.297   1.00 1.45  ? 19  PRO A HD2  5  
ATOM 8192  H HD3  . PRO A 1 19  ? 22.564  -6.768  4.009   1.00 1.43  ? 19  PRO A HD3  5  
ATOM 8193  N N    . SER A 1 20  ? 23.714  -2.551  2.343   1.00 1.40  ? 20  SER A N    5  
ATOM 8194  C CA   . SER A 1 20  ? 23.739  -1.207  1.778   1.00 1.65  ? 20  SER A CA   5  
ATOM 8195  C C    . SER A 1 20  ? 22.338  -0.606  1.732   1.00 1.43  ? 20  SER A C    5  
ATOM 8196  O O    . SER A 1 20  ? 21.997  0.144   0.816   1.00 1.93  ? 20  SER A O    5  
ATOM 8197  C CB   . SER A 1 20  ? 24.344  -1.244  0.374   1.00 2.14  ? 20  SER A CB   5  
ATOM 8198  O OG   . SER A 1 20  ? 25.651  -1.795  0.399   1.00 2.87  ? 20  SER A OG   5  
ATOM 8199  H H    . SER A 1 20  ? 23.171  -3.241  1.912   1.00 1.61  ? 20  SER A H    5  
ATOM 8200  H HA   . SER A 1 20  ? 24.360  -0.591  2.411   1.00 1.88  ? 20  SER A HA   5  
ATOM 8201  H HB2  . SER A 1 20  ? 23.721  -1.850  -0.268  1.00 2.20  ? 20  SER A HB2  5  
ATOM 8202  H HB3  . SER A 1 20  ? 24.396  -0.239  -0.019  1.00 2.54  ? 20  SER A HB3  5  
ATOM 8203  H HG   . SER A 1 20  ? 25.595  -2.757  0.333   1.00 3.28  ? 20  SER A HG   5  
ATOM 8204  N N    . GLY A 1 21  ? 21.530  -0.930  2.727   1.00 1.04  ? 21  GLY A N    5  
ATOM 8205  C CA   . GLY A 1 21  ? 20.175  -0.425  2.768   1.00 0.94  ? 21  GLY A CA   5  
ATOM 8206  C C    . GLY A 1 21  ? 19.165  -1.531  2.959   1.00 0.97  ? 21  GLY A C    5  
ATOM 8207  O O    . GLY A 1 21  ? 19.412  -2.476  3.704   1.00 1.93  ? 21  GLY A O    5  
ATOM 8208  H H    . GLY A 1 21  ? 21.856  -1.520  3.440   1.00 1.21  ? 21  GLY A H    5  
ATOM 8209  H HA2  . GLY A 1 21  ? 20.084  0.276   3.586   1.00 0.97  ? 21  GLY A HA2  5  
ATOM 8210  H HA3  . GLY A 1 21  ? 19.962  0.086   1.842   1.00 1.07  ? 21  GLY A HA3  5  
ATOM 8211  N N    . TYR A 1 22  ? 18.033  -1.425  2.286   1.00 0.74  ? 22  TYR A N    5  
ATOM 8212  C CA   . TYR A 1 22  ? 16.987  -2.423  2.416   1.00 0.70  ? 22  TYR A CA   5  
ATOM 8213  C C    . TYR A 1 22  ? 16.919  -3.274  1.156   1.00 0.89  ? 22  TYR A C    5  
ATOM 8214  O O    . TYR A 1 22  ? 16.633  -4.469  1.210   1.00 1.82  ? 22  TYR A O    5  
ATOM 8215  C CB   . TYR A 1 22  ? 15.641  -1.750  2.676   1.00 0.64  ? 22  TYR A CB   5  
ATOM 8216  C CG   . TYR A 1 22  ? 15.678  -0.717  3.786   1.00 0.50  ? 22  TYR A CG   5  
ATOM 8217  C CD1  . TYR A 1 22  ? 15.695  -1.104  5.120   1.00 0.47  ? 22  TYR A CD1  5  
ATOM 8218  C CD2  . TYR A 1 22  ? 15.694  0.641   3.498   1.00 0.55  ? 22  TYR A CD2  5  
ATOM 8219  C CE1  . TYR A 1 22  ? 15.726  -0.167  6.136   1.00 0.46  ? 22  TYR A CE1  5  
ATOM 8220  C CE2  . TYR A 1 22  ? 15.725  1.585   4.509   1.00 0.54  ? 22  TYR A CE2  5  
ATOM 8221  C CZ   . TYR A 1 22  ? 15.751  1.182   5.820   1.00 0.46  ? 22  TYR A CZ   5  
ATOM 8222  O OH   . TYR A 1 22  ? 15.769  2.113   6.836   1.00 0.59  ? 22  TYR A OH   5  
ATOM 8223  H H    . TYR A 1 22  ? 17.898  -0.660  1.683   1.00 1.40  ? 22  TYR A H    5  
ATOM 8224  H HA   . TYR A 1 22  ? 17.233  -3.056  3.256   1.00 0.72  ? 22  TYR A HA   5  
ATOM 8225  H HB2  . TYR A 1 22  ? 15.315  -1.255  1.774   1.00 0.75  ? 22  TYR A HB2  5  
ATOM 8226  H HB3  . TYR A 1 22  ? 14.916  -2.505  2.948   1.00 0.71  ? 22  TYR A HB3  5  
ATOM 8227  H HD1  . TYR A 1 22  ? 15.682  -2.156  5.363   1.00 0.58  ? 22  TYR A HD1  5  
ATOM 8228  H HD2  . TYR A 1 22  ? 15.676  0.958   2.466   1.00 0.70  ? 22  TYR A HD2  5  
ATOM 8229  H HE1  . TYR A 1 22  ? 15.739  -0.489  7.166   1.00 0.57  ? 22  TYR A HE1  5  
ATOM 8230  H HE2  . TYR A 1 22  ? 15.738  2.636   4.263   1.00 0.68  ? 22  TYR A HE2  5  
ATOM 8231  H HH   . TYR A 1 22  ? 16.493  1.913   7.442   1.00 1.17  ? 22  TYR A HH   5  
ATOM 8232  N N    . GLY A 1 23  ? 17.191  -2.632  0.026   1.00 0.43  ? 23  GLY A N    5  
ATOM 8233  C CA   . GLY A 1 23  ? 17.286  -3.326  -1.246  1.00 0.42  ? 23  GLY A CA   5  
ATOM 8234  C C    . GLY A 1 23  ? 16.008  -3.249  -2.057  1.00 0.39  ? 23  GLY A C    5  
ATOM 8235  O O    . GLY A 1 23  ? 15.331  -4.255  -2.263  1.00 0.39  ? 23  GLY A O    5  
ATOM 8236  H H    . GLY A 1 23  ? 17.321  -1.657  0.055   1.00 0.96  ? 23  GLY A H    5  
ATOM 8237  H HA2  . GLY A 1 23  ? 18.086  -2.888  -1.822  1.00 0.44  ? 23  GLY A HA2  5  
ATOM 8238  H HA3  . GLY A 1 23  ? 17.518  -4.364  -1.059  1.00 0.48  ? 23  GLY A HA3  5  
ATOM 8239  N N    . PHE A 1 24  ? 15.690  -2.055  -2.530  1.00 0.37  ? 24  PHE A N    5  
ATOM 8240  C CA   . PHE A 1 24  ? 14.536  -1.847  -3.391  1.00 0.36  ? 24  PHE A CA   5  
ATOM 8241  C C    . PHE A 1 24  ? 14.729  -0.583  -4.215  1.00 0.38  ? 24  PHE A C    5  
ATOM 8242  O O    . PHE A 1 24  ? 15.491  0.309   -3.831  1.00 0.40  ? 24  PHE A O    5  
ATOM 8243  C CB   . PHE A 1 24  ? 13.240  -1.757  -2.573  1.00 0.34  ? 24  PHE A CB   5  
ATOM 8244  C CG   . PHE A 1 24  ? 13.187  -0.596  -1.616  1.00 0.32  ? 24  PHE A CG   5  
ATOM 8245  C CD1  . PHE A 1 24  ? 13.758  -0.687  -0.356  1.00 0.33  ? 24  PHE A CD1  5  
ATOM 8246  C CD2  . PHE A 1 24  ? 12.559  0.587   -1.976  1.00 0.34  ? 24  PHE A CD2  5  
ATOM 8247  C CE1  . PHE A 1 24  ? 13.705  0.375   0.523   1.00 0.35  ? 24  PHE A CE1  5  
ATOM 8248  C CE2  . PHE A 1 24  ? 12.500  1.652   -1.099  1.00 0.36  ? 24  PHE A CE2  5  
ATOM 8249  C CZ   . PHE A 1 24  ? 13.076  1.546   0.151   1.00 0.36  ? 24  PHE A CZ   5  
ATOM 8250  H H    . PHE A 1 24  ? 16.253  -1.289  -2.304  1.00 0.39  ? 24  PHE A H    5  
ATOM 8251  H HA   . PHE A 1 24  ? 14.467  -2.690  -4.065  1.00 0.37  ? 24  PHE A HA   5  
ATOM 8252  H HB2  . PHE A 1 24  ? 12.405  -1.660  -3.251  1.00 0.35  ? 24  PHE A HB2  5  
ATOM 8253  H HB3  . PHE A 1 24  ? 13.122  -2.668  -2.001  1.00 0.34  ? 24  PHE A HB3  5  
ATOM 8254  H HD1  . PHE A 1 24  ? 14.254  -1.602  -0.064  1.00 0.35  ? 24  PHE A HD1  5  
ATOM 8255  H HD2  . PHE A 1 24  ? 12.109  0.669   -2.955  1.00 0.37  ? 24  PHE A HD2  5  
ATOM 8256  H HE1  . PHE A 1 24  ? 14.155  0.290   1.503   1.00 0.38  ? 24  PHE A HE1  5  
ATOM 8257  H HE2  . PHE A 1 24  ? 12.007  2.568   -1.391  1.00 0.40  ? 24  PHE A HE2  5  
ATOM 8258  H HZ   . PHE A 1 24  ? 13.032  2.375   0.839   1.00 0.39  ? 24  PHE A HZ   5  
ATOM 8259  N N    . ASN A 1 25  ? 14.043  -0.508  -5.341  1.00 0.43  ? 25  ASN A N    5  
ATOM 8260  C CA   . ASN A 1 25  ? 14.131  0.652   -6.209  1.00 0.46  ? 25  ASN A CA   5  
ATOM 8261  C C    . ASN A 1 25  ? 12.758  1.299   -6.362  1.00 0.42  ? 25  ASN A C    5  
ATOM 8262  O O    . ASN A 1 25  ? 11.750  0.610   -6.528  1.00 0.39  ? 25  ASN A O    5  
ATOM 8263  C CB   . ASN A 1 25  ? 14.688  0.247   -7.573  1.00 0.51  ? 25  ASN A CB   5  
ATOM 8264  C CG   . ASN A 1 25  ? 15.050  1.440   -8.431  1.00 1.23  ? 25  ASN A CG   5  
ATOM 8265  O OD1  . ASN A 1 25  ? 14.233  1.938   -9.205  1.00 2.18  ? 25  ASN A OD1  5  
ATOM 8266  N ND2  . ASN A 1 25  ? 16.284  1.894   -8.311  1.00 1.65  ? 25  ASN A ND2  5  
ATOM 8267  H H    . ASN A 1 25  ? 13.464  -1.260  -5.601  1.00 0.48  ? 25  ASN A H    5  
ATOM 8268  H HA   . ASN A 1 25  ? 14.801  1.360   -5.750  1.00 0.53  ? 25  ASN A HA   5  
ATOM 8269  H HB2  . ASN A 1 25  ? 15.578  -0.347  -7.426  1.00 1.01  ? 25  ASN A HB2  5  
ATOM 8270  H HB3  . ASN A 1 25  ? 13.949  -0.341  -8.098  1.00 0.91  ? 25  ASN A HB3  5  
ATOM 8271  H HD21 . ASN A 1 25  ? 16.888  1.438   -7.683  1.00 1.88  ? 25  ASN A HD21 5  
ATOM 8272  H HD22 . ASN A 1 25  ? 16.551  2.677   -8.853  1.00 2.23  ? 25  ASN A HD22 5  
ATOM 8273  N N    . LEU A 1 26  ? 12.729  2.620   -6.311  1.00 0.50  ? 26  LEU A N    5  
ATOM 8274  C CA   . LEU A 1 26  ? 11.480  3.368   -6.308  1.00 0.52  ? 26  LEU A CA   5  
ATOM 8275  C C    . LEU A 1 26  ? 11.161  3.961   -7.674  1.00 0.55  ? 26  LEU A C    5  
ATOM 8276  O O    . LEU A 1 26  ? 12.049  4.215   -8.487  1.00 0.73  ? 26  LEU A O    5  
ATOM 8277  C CB   . LEU A 1 26  ? 11.528  4.489   -5.267  1.00 0.69  ? 26  LEU A CB   5  
ATOM 8278  C CG   . LEU A 1 26  ? 11.396  4.041   -3.812  1.00 0.87  ? 26  LEU A CG   5  
ATOM 8279  C CD1  . LEU A 1 26  ? 11.551  5.228   -2.876  1.00 1.52  ? 26  LEU A CD1  5  
ATOM 8280  C CD2  . LEU A 1 26  ? 10.053  3.363   -3.588  1.00 1.48  ? 26  LEU A CD2  5  
ATOM 8281  H H    . LEU A 1 26  ? 13.573  3.113   -6.284  1.00 0.61  ? 26  LEU A H    5  
ATOM 8282  H HA   . LEU A 1 26  ? 10.690  2.682   -6.041  1.00 0.49  ? 26  LEU A HA   5  
ATOM 8283  H HB2  . LEU A 1 26  ? 12.468  5.011   -5.376  1.00 1.10  ? 26  LEU A HB2  5  
ATOM 8284  H HB3  . LEU A 1 26  ? 10.726  5.182   -5.479  1.00 1.29  ? 26  LEU A HB3  5  
ATOM 8285  H HG   . LEU A 1 26  ? 12.176  3.328   -3.587  1.00 1.73  ? 26  LEU A HG   5  
ATOM 8286  H HD11 . LEU A 1 26  ? 12.513  5.692   -3.042  1.00 2.08  ? 26  LEU A HD11 5  
ATOM 8287  H HD12 . LEU A 1 26  ? 11.486  4.893   -1.853  1.00 2.11  ? 26  LEU A HD12 5  
ATOM 8288  H HD13 . LEU A 1 26  ? 10.767  5.945   -3.071  1.00 1.96  ? 26  LEU A HD13 5  
ATOM 8289  H HD21 . LEU A 1 26  ? 9.258   4.058   -3.816  1.00 2.11  ? 26  LEU A HD21 5  
ATOM 8290  H HD22 . LEU A 1 26  ? 9.974   3.049   -2.558  1.00 1.96  ? 26  LEU A HD22 5  
ATOM 8291  H HD23 . LEU A 1 26  ? 9.973   2.502   -4.234  1.00 1.94  ? 26  LEU A HD23 5  
ATOM 8292  N N    . HIS A 1 27  ? 9.876   4.166   -7.908  1.00 0.56  ? 27  HIS A N    5  
ATOM 8293  C CA   . HIS A 1 27  ? 9.399   4.860   -9.090  1.00 0.67  ? 27  HIS A CA   5  
ATOM 8294  C C    . HIS A 1 27  ? 8.941   6.245   -8.678  1.00 0.68  ? 27  HIS A C    5  
ATOM 8295  O O    . HIS A 1 27  ? 8.080   6.394   -7.810  1.00 0.95  ? 27  HIS A O    5  
ATOM 8296  C CB   . HIS A 1 27  ? 8.210   4.128   -9.731  1.00 1.23  ? 27  HIS A CB   5  
ATOM 8297  C CG   . HIS A 1 27  ? 8.538   3.320   -10.950 1.00 0.70  ? 27  HIS A CG   5  
ATOM 8298  N ND1  . HIS A 1 27  ? 9.135   3.850   -12.070 1.00 0.97  ? 27  HIS A ND1  5  
ATOM 8299  C CD2  . HIS A 1 27  ? 8.319   2.013   -11.228 1.00 0.81  ? 27  HIS A CD2  5  
ATOM 8300  C CE1  . HIS A 1 27  ? 9.270   2.907   -12.985 1.00 1.30  ? 27  HIS A CE1  5  
ATOM 8301  N NE2  . HIS A 1 27  ? 8.783   1.784   -12.497 1.00 1.34  ? 27  HIS A NE2  5  
ATOM 8302  H H    . HIS A 1 27  ? 9.218   3.836   -7.253  1.00 0.64  ? 27  HIS A H    5  
ATOM 8303  H HA   . HIS A 1 27  ? 10.207  4.940   -9.798  1.00 0.83  ? 27  HIS A HA   5  
ATOM 8304  H HB2  . HIS A 1 27  ? 7.784   3.455   -9.003  1.00 1.96  ? 27  HIS A HB2  5  
ATOM 8305  H HB3  . HIS A 1 27  ? 7.463   4.857   -10.010 1.00 2.02  ? 27  HIS A HB3  5  
ATOM 8306  H HD1  . HIS A 1 27  ? 9.415   4.793   -12.186 1.00 1.24  ? 27  HIS A HD1  5  
ATOM 8307  H HD2  . HIS A 1 27  ? 7.863   1.286   -10.571 1.00 0.91  ? 27  HIS A HD2  5  
ATOM 8308  H HE1  . HIS A 1 27  ? 9.702   3.036   -13.965 1.00 1.74  ? 27  HIS A HE1  5  
ATOM 8309  H HE2  . HIS A 1 27  ? 8.639   0.953   -13.020 1.00 1.74  ? 27  HIS A HE2  5  
ATOM 8310  N N    . SER A 1 28  ? 9.547   7.247   -9.278  1.00 0.75  ? 28  SER A N    5  
ATOM 8311  C CA   . SER A 1 28  ? 9.203   8.629   -9.007  1.00 1.14  ? 28  SER A CA   5  
ATOM 8312  C C    . SER A 1 28  ? 9.094   9.376   -10.324 1.00 1.03  ? 28  SER A C    5  
ATOM 8313  O O    . SER A 1 28  ? 10.065  9.952   -10.817 1.00 1.34  ? 28  SER A O    5  
ATOM 8314  C CB   . SER A 1 28  ? 10.252  9.269   -8.095  1.00 1.74  ? 28  SER A CB   5  
ATOM 8315  O OG   . SER A 1 28  ? 10.349  8.558   -6.870  1.00 2.30  ? 28  SER A OG   5  
ATOM 8316  H H    . SER A 1 28  ? 10.244  7.054   -9.940  1.00 0.74  ? 28  SER A H    5  
ATOM 8317  H HA   . SER A 1 28  ? 8.243   8.645   -8.515  1.00 1.51  ? 28  SER A HA   5  
ATOM 8318  H HB2  . SER A 1 28  ? 11.214  9.252   -8.584  1.00 2.11  ? 28  SER A HB2  5  
ATOM 8319  H HB3  . SER A 1 28  ? 9.972   10.290  -7.883  1.00 2.17  ? 28  SER A HB3  5  
ATOM 8320  H HG   . SER A 1 28  ? 10.024  7.660   -6.997  1.00 2.75  ? 28  SER A HG   5  
ATOM 8321  N N    . ASP A 1 29  ? 7.906   9.335   -10.893 1.00 1.23  ? 29  ASP A N    5  
ATOM 8322  C CA   . ASP A 1 29  ? 7.672   9.880   -12.214 1.00 1.54  ? 29  ASP A CA   5  
ATOM 8323  C C    . ASP A 1 29  ? 7.345   11.362  -12.114 1.00 1.63  ? 29  ASP A C    5  
ATOM 8324  O O    . ASP A 1 29  ? 6.595   11.780  -11.233 1.00 1.73  ? 29  ASP A O    5  
ATOM 8325  C CB   . ASP A 1 29  ? 6.523   9.122   -12.877 1.00 2.09  ? 29  ASP A CB   5  
ATOM 8326  C CG   . ASP A 1 29  ? 6.490   9.287   -14.379 1.00 2.87  ? 29  ASP A CG   5  
ATOM 8327  O OD1  . ASP A 1 29  ? 6.361   10.427  -14.858 1.00 3.48  ? 29  ASP A OD1  5  
ATOM 8328  O OD2  . ASP A 1 29  ? 6.583   8.261   -15.082 1.00 3.19  ? 29  ASP A OD2  5  
ATOM 8329  H H    . ASP A 1 29  ? 7.155   8.941   -10.402 1.00 1.49  ? 29  ASP A H    5  
ATOM 8330  H HA   . ASP A 1 29  ? 8.571   9.750   -12.799 1.00 1.59  ? 29  ASP A HA   5  
ATOM 8331  H HB2  . ASP A 1 29  ? 6.622   8.070   -12.655 1.00 2.22  ? 29  ASP A HB2  5  
ATOM 8332  H HB3  . ASP A 1 29  ? 5.587   9.481   -12.474 1.00 2.29  ? 29  ASP A HB3  5  
ATOM 8333  N N    . LYS A 1 30  ? 7.914   12.158  -13.006 1.00 1.90  ? 30  LYS A N    5  
ATOM 8334  C CA   . LYS A 1 30  ? 7.698   13.597  -12.977 1.00 2.10  ? 30  LYS A CA   5  
ATOM 8335  C C    . LYS A 1 30  ? 6.511   13.987  -13.855 1.00 2.35  ? 30  LYS A C    5  
ATOM 8336  O O    . LYS A 1 30  ? 6.172   15.166  -13.980 1.00 2.78  ? 30  LYS A O    5  
ATOM 8337  C CB   . LYS A 1 30  ? 8.978   14.342  -13.389 1.00 2.29  ? 30  LYS A CB   5  
ATOM 8338  C CG   . LYS A 1 30  ? 9.565   13.910  -14.729 1.00 2.65  ? 30  LYS A CG   5  
ATOM 8339  C CD   . LYS A 1 30  ? 9.057   14.765  -15.881 1.00 3.12  ? 30  LYS A CD   5  
ATOM 8340  C CE   . LYS A 1 30  ? 9.517   16.212  -15.749 1.00 3.99  ? 30  LYS A CE   5  
ATOM 8341  N NZ   . LYS A 1 30  ? 10.994  16.316  -15.596 1.00 4.54  ? 30  LYS A NZ   5  
ATOM 8342  H H    . LYS A 1 30  ? 8.482   11.768  -13.703 1.00 2.13  ? 30  LYS A H    5  
ATOM 8343  H HA   . LYS A 1 30  ? 7.462   13.863  -11.957 1.00 2.09  ? 30  LYS A HA   5  
ATOM 8344  H HB2  . LYS A 1 30  ? 8.757   15.397  -13.448 1.00 2.49  ? 30  LYS A HB2  5  
ATOM 8345  H HB3  . LYS A 1 30  ? 9.728   14.185  -12.628 1.00 2.60  ? 30  LYS A HB3  5  
ATOM 8346  H HG2  . LYS A 1 30  ? 10.640  13.996  -14.683 1.00 2.99  ? 30  LYS A HG2  5  
ATOM 8347  H HG3  . LYS A 1 30  ? 9.295   12.878  -14.912 1.00 2.97  ? 30  LYS A HG3  5  
ATOM 8348  H HD2  . LYS A 1 30  ? 9.430   14.362  -16.810 1.00 3.37  ? 30  LYS A HD2  5  
ATOM 8349  H HD3  . LYS A 1 30  ? 7.976   14.740  -15.884 1.00 3.23  ? 30  LYS A HD3  5  
ATOM 8350  H HE2  . LYS A 1 30  ? 9.217   16.755  -16.634 1.00 4.39  ? 30  LYS A HE2  5  
ATOM 8351  H HE3  . LYS A 1 30  ? 9.043   16.648  -14.882 1.00 4.35  ? 30  LYS A HE3  5  
ATOM 8352  H HZ1  . LYS A 1 30  ? 11.306  17.301  -15.742 1.00 4.89  ? 30  LYS A HZ1  5  
ATOM 8353  H HZ2  . LYS A 1 30  ? 11.477  15.704  -16.290 1.00 4.83  ? 30  LYS A HZ2  5  
ATOM 8354  H HZ3  . LYS A 1 30  ? 11.275  16.018  -14.639 1.00 4.73  ? 30  LYS A HZ3  5  
ATOM 8355  N N    . SER A 1 31  ? 5.885   12.988  -14.455 1.00 2.29  ? 31  SER A N    5  
ATOM 8356  C CA   . SER A 1 31  ? 4.670   13.193  -15.218 1.00 2.61  ? 31  SER A CA   5  
ATOM 8357  C C    . SER A 1 31  ? 3.479   12.740  -14.378 1.00 2.43  ? 31  SER A C    5  
ATOM 8358  O O    . SER A 1 31  ? 2.524   13.492  -14.167 1.00 2.50  ? 31  SER A O    5  
ATOM 8359  C CB   . SER A 1 31  ? 4.731   12.397  -16.522 1.00 2.93  ? 31  SER A CB   5  
ATOM 8360  O OG   . SER A 1 31  ? 6.074   12.253  -16.959 1.00 3.49  ? 31  SER A OG   5  
ATOM 8361  H H    . SER A 1 31  ? 6.254   12.076  -14.384 1.00 2.20  ? 31  SER A H    5  
ATOM 8362  H HA   . SER A 1 31  ? 4.576   14.246  -15.439 1.00 2.83  ? 31  SER A HA   5  
ATOM 8363  H HB2  . SER A 1 31  ? 4.310   11.416  -16.365 1.00 3.18  ? 31  SER A HB2  5  
ATOM 8364  H HB3  . SER A 1 31  ? 4.170   12.914  -17.286 1.00 2.98  ? 31  SER A HB3  5  
ATOM 8365  H HG   . SER A 1 31  ? 6.517   11.598  -16.395 1.00 3.79  ? 31  SER A HG   5  
ATOM 8366  N N    . LYS A 1 32  ? 3.565   11.510  -13.877 1.00 2.27  ? 32  LYS A N    5  
ATOM 8367  C CA   . LYS A 1 32  ? 2.541   10.961  -12.997 1.00 2.14  ? 32  LYS A CA   5  
ATOM 8368  C C    . LYS A 1 32  ? 3.085   10.805  -11.577 1.00 1.84  ? 32  LYS A C    5  
ATOM 8369  O O    . LYS A 1 32  ? 3.978   9.996   -11.328 1.00 1.68  ? 32  LYS A O    5  
ATOM 8370  C CB   . LYS A 1 32  ? 2.021   9.618   -13.532 1.00 2.21  ? 32  LYS A CB   5  
ATOM 8371  C CG   . LYS A 1 32  ? 3.104   8.697   -14.079 1.00 2.25  ? 32  LYS A CG   5  
ATOM 8372  C CD   . LYS A 1 32  ? 2.526   7.361   -14.519 1.00 2.41  ? 32  LYS A CD   5  
ATOM 8373  C CE   . LYS A 1 32  ? 3.525   6.544   -15.328 1.00 2.93  ? 32  LYS A CE   5  
ATOM 8374  N NZ   . LYS A 1 32  ? 4.799   6.315   -14.599 1.00 3.00  ? 32  LYS A NZ   5  
ATOM 8375  H H    . LYS A 1 32  ? 4.352   10.961  -14.094 1.00 2.30  ? 32  LYS A H    5  
ATOM 8376  H HA   . LYS A 1 32  ? 1.723   11.665  -12.973 1.00 2.30  ? 32  LYS A HA   5  
ATOM 8377  H HB2  . LYS A 1 32  ? 1.514   9.102   -12.730 1.00 2.38  ? 32  LYS A HB2  5  
ATOM 8378  H HB3  . LYS A 1 32  ? 1.311   9.811   -14.324 1.00 2.55  ? 32  LYS A HB3  5  
ATOM 8379  H HG2  . LYS A 1 32  ? 3.572   9.173   -14.928 1.00 2.42  ? 32  LYS A HG2  5  
ATOM 8380  H HG3  . LYS A 1 32  ? 3.839   8.525   -13.308 1.00 2.49  ? 32  LYS A HG3  5  
ATOM 8381  H HD2  . LYS A 1 32  ? 2.244   6.795   -13.643 1.00 2.64  ? 32  LYS A HD2  5  
ATOM 8382  H HD3  . LYS A 1 32  ? 1.652   7.543   -15.126 1.00 2.50  ? 32  LYS A HD3  5  
ATOM 8383  H HE2  . LYS A 1 32  ? 3.081   5.588   -15.560 1.00 3.27  ? 32  LYS A HE2  5  
ATOM 8384  H HE3  . LYS A 1 32  ? 3.738   7.072   -16.247 1.00 3.51  ? 32  LYS A HE3  5  
ATOM 8385  H HZ1  . LYS A 1 32  ? 5.386   7.181   -14.616 1.00 3.05  ? 32  LYS A HZ1  5  
ATOM 8386  H HZ2  . LYS A 1 32  ? 5.337   5.540   -15.049 1.00 3.40  ? 32  LYS A HZ2  5  
ATOM 8387  H HZ3  . LYS A 1 32  ? 4.607   6.057   -13.612 1.00 3.29  ? 32  LYS A HZ3  5  
ATOM 8388  N N    . PRO A 1 33  ? 2.546   11.591  -10.631 1.00 1.87  ? 33  PRO A N    5  
ATOM 8389  C CA   . PRO A 1 33  ? 3.043   11.633  -9.252  1.00 1.71  ? 33  PRO A CA   5  
ATOM 8390  C C    . PRO A 1 33  ? 2.699   10.381  -8.451  1.00 1.40  ? 33  PRO A C    5  
ATOM 8391  O O    . PRO A 1 33  ? 1.811   9.610   -8.822  1.00 1.40  ? 33  PRO A O    5  
ATOM 8392  C CB   . PRO A 1 33  ? 2.336   12.851  -8.661  1.00 1.97  ? 33  PRO A CB   5  
ATOM 8393  C CG   . PRO A 1 33  ? 1.077   12.978  -9.446  1.00 2.24  ? 33  PRO A CG   5  
ATOM 8394  C CD   . PRO A 1 33  ? 1.400   12.499  -10.834 1.00 2.19  ? 33  PRO A CD   5  
ATOM 8395  H HA   . PRO A 1 33  ? 4.112   11.790  -9.223  1.00 1.77  ? 33  PRO A HA   5  
ATOM 8396  H HB2  . PRO A 1 33  ? 2.134   12.679  -7.614  1.00 1.85  ? 33  PRO A HB2  5  
ATOM 8397  H HB3  . PRO A 1 33  ? 2.960   13.724  -8.775  1.00 2.24  ? 33  PRO A HB3  5  
ATOM 8398  H HG2  . PRO A 1 33  ? 0.307   12.360  -9.008  1.00 2.37  ? 33  PRO A HG2  5  
ATOM 8399  H HG3  . PRO A 1 33  ? 0.761   14.012  -9.470  1.00 2.55  ? 33  PRO A HG3  5  
ATOM 8400  H HD2  . PRO A 1 33  ? 0.558   11.968  -11.256 1.00 2.33  ? 33  PRO A HD2  5  
ATOM 8401  H HD3  . PRO A 1 33  ? 1.674   13.331  -11.465 1.00 2.38  ? 33  PRO A HD3  5  
ATOM 8402  N N    . GLY A 1 34  ? 3.398   10.196  -7.340  1.00 1.29  ? 34  GLY A N    5  
ATOM 8403  C CA   . GLY A 1 34  ? 3.172   9.036   -6.504  1.00 1.05  ? 34  GLY A CA   5  
ATOM 8404  C C    . GLY A 1 34  ? 4.381   8.128   -6.475  1.00 0.85  ? 34  GLY A C    5  
ATOM 8405  O O    . GLY A 1 34  ? 5.105   8.022   -7.465  1.00 0.88  ? 34  GLY A O    5  
ATOM 8406  H H    . GLY A 1 34  ? 4.085   10.849  -7.092  1.00 1.47  ? 34  GLY A H    5  
ATOM 8407  H HA2  . GLY A 1 34  ? 2.950   9.363   -5.499  1.00 1.11  ? 34  GLY A HA2  5  
ATOM 8408  H HA3  . GLY A 1 34  ? 2.327   8.485   -6.890  1.00 1.10  ? 34  GLY A HA3  5  
ATOM 8409  N N    . GLN A 1 35  ? 4.622   7.491   -5.340  1.00 0.74  ? 35  GLN A N    5  
ATOM 8410  C CA   . GLN A 1 35  ? 5.750   6.587   -5.219  1.00 0.59  ? 35  GLN A CA   5  
ATOM 8411  C C    . GLN A 1 35  ? 5.314   5.153   -5.469  1.00 0.52  ? 35  GLN A C    5  
ATOM 8412  O O    . GLN A 1 35  ? 4.374   4.651   -4.846  1.00 0.58  ? 35  GLN A O    5  
ATOM 8413  C CB   . GLN A 1 35  ? 6.406   6.716   -3.841  1.00 0.58  ? 35  GLN A CB   5  
ATOM 8414  C CG   . GLN A 1 35  ? 7.423   7.847   -3.732  1.00 0.82  ? 35  GLN A CG   5  
ATOM 8415  C CD   . GLN A 1 35  ? 6.858   9.214   -4.075  1.00 0.75  ? 35  GLN A CD   5  
ATOM 8416  O OE1  . GLN A 1 35  ? 6.336   9.921   -3.215  1.00 1.50  ? 35  GLN A OE1  5  
ATOM 8417  N NE2  . GLN A 1 35  ? 6.980   9.607   -5.333  1.00 0.78  ? 35  GLN A NE2  5  
ATOM 8418  H H    . GLN A 1 35  ? 4.029   7.623   -4.572  1.00 0.85  ? 35  GLN A H    5  
ATOM 8419  H HA   . GLN A 1 35  ? 6.471   6.864   -5.975  1.00 0.60  ? 35  GLN A HA   5  
ATOM 8420  H HB2  . GLN A 1 35  ? 5.636   6.887   -3.103  1.00 0.76  ? 35  GLN A HB2  5  
ATOM 8421  H HB3  . GLN A 1 35  ? 6.911   5.789   -3.612  1.00 0.65  ? 35  GLN A HB3  5  
ATOM 8422  H HG2  . GLN A 1 35  ? 7.794   7.880   -2.720  1.00 1.35  ? 35  GLN A HG2  5  
ATOM 8423  H HG3  . GLN A 1 35  ? 8.243   7.637   -4.404  1.00 1.50  ? 35  GLN A HG3  5  
ATOM 8424  H HE21 . GLN A 1 35  ? 7.418   9.004   -5.969  1.00 1.10  ? 35  GLN A HE21 5  
ATOM 8425  H HE22 . GLN A 1 35  ? 6.620   10.491  -5.579  1.00 1.07  ? 35  GLN A HE22 5  
ATOM 8426  N N    . PHE A 1 36  ? 6.011   4.504   -6.384  1.00 0.47  ? 36  PHE A N    5  
ATOM 8427  C CA   . PHE A 1 36  ? 5.728   3.124   -6.742  1.00 0.43  ? 36  PHE A CA   5  
ATOM 8428  C C    . PHE A 1 36  ? 6.990   2.297   -6.569  1.00 0.39  ? 36  PHE A C    5  
ATOM 8429  O O    . PHE A 1 36  ? 8.091   2.841   -6.562  1.00 0.45  ? 36  PHE A O    5  
ATOM 8430  C CB   . PHE A 1 36  ? 5.259   3.020   -8.199  1.00 0.48  ? 36  PHE A CB   5  
ATOM 8431  C CG   . PHE A 1 36  ? 4.141   3.954   -8.566  1.00 0.58  ? 36  PHE A CG   5  
ATOM 8432  C CD1  . PHE A 1 36  ? 2.824   3.633   -8.280  1.00 0.68  ? 36  PHE A CD1  5  
ATOM 8433  C CD2  . PHE A 1 36  ? 4.410   5.153   -9.208  1.00 0.70  ? 36  PHE A CD2  5  
ATOM 8434  C CE1  . PHE A 1 36  ? 1.797   4.492   -8.620  1.00 0.81  ? 36  PHE A CE1  5  
ATOM 8435  C CE2  . PHE A 1 36  ? 3.387   6.016   -9.551  1.00 0.83  ? 36  PHE A CE2  5  
ATOM 8436  C CZ   . PHE A 1 36  ? 2.078   5.684   -9.259  1.00 0.87  ? 36  PHE A CZ   5  
ATOM 8437  H H    . PHE A 1 36  ? 6.747   4.970   -6.835  1.00 0.51  ? 36  PHE A H    5  
ATOM 8438  H HA   . PHE A 1 36  ? 4.957   2.749   -6.085  1.00 0.42  ? 36  PHE A HA   5  
ATOM 8439  H HB2  . PHE A 1 36  ? 6.093   3.238   -8.850  1.00 0.50  ? 36  PHE A HB2  5  
ATOM 8440  H HB3  . PHE A 1 36  ? 4.924   2.010   -8.387  1.00 0.48  ? 36  PHE A HB3  5  
ATOM 8441  H HD1  . PHE A 1 36  ? 2.603   2.702   -7.781  1.00 0.72  ? 36  PHE A HD1  5  
ATOM 8442  H HD2  . PHE A 1 36  ? 5.433   5.412   -9.437  1.00 0.74  ? 36  PHE A HD2  5  
ATOM 8443  H HE1  . PHE A 1 36  ? 0.775   4.231   -8.392  1.00 0.93  ? 36  PHE A HE1  5  
ATOM 8444  H HE2  . PHE A 1 36  ? 3.611   6.948   -10.050 1.00 0.95  ? 36  PHE A HE2  5  
ATOM 8445  H HZ   . PHE A 1 36  ? 1.278   6.357   -9.527  1.00 0.99  ? 36  PHE A HZ   5  
ATOM 8446  N N    . ILE A 1 37  ? 6.839   1.000   -6.412  1.00 0.36  ? 37  ILE A N    5  
ATOM 8447  C CA   . ILE A 1 37  ? 7.989   0.114   -6.338  1.00 0.33  ? 37  ILE A CA   5  
ATOM 8448  C C    . ILE A 1 37  ? 8.389   -0.318  -7.745  1.00 0.33  ? 37  ILE A C    5  
ATOM 8449  O O    . ILE A 1 37  ? 7.643   -1.026  -8.424  1.00 0.38  ? 37  ILE A O    5  
ATOM 8450  C CB   . ILE A 1 37  ? 7.691   -1.133  -5.476  1.00 0.34  ? 37  ILE A CB   5  
ATOM 8451  C CG1  . ILE A 1 37  ? 7.124   -0.719  -4.113  1.00 0.39  ? 37  ILE A CG1  5  
ATOM 8452  C CG2  . ILE A 1 37  ? 8.950   -1.977  -5.297  1.00 0.33  ? 37  ILE A CG2  5  
ATOM 8453  C CD1  . ILE A 1 37  ? 8.055   0.157   -3.301  1.00 0.38  ? 37  ILE A CD1  5  
ATOM 8454  H H    . ILE A 1 37  ? 5.932   0.624   -6.335  1.00 0.41  ? 37  ILE A H    5  
ATOM 8455  H HA   . ILE A 1 37  ? 8.807   0.659   -5.889  1.00 0.33  ? 37  ILE A HA   5  
ATOM 8456  H HB   . ILE A 1 37  ? 6.961   -1.735  -5.994  1.00 0.37  ? 37  ILE A HB   5  
ATOM 8457  H HG12 . ILE A 1 37  ? 6.208   -0.169  -4.266  1.00 0.47  ? 37  ILE A HG12 5  
ATOM 8458  H HG13 . ILE A 1 37  ? 6.912   -1.606  -3.534  1.00 0.44  ? 37  ILE A HG13 5  
ATOM 8459  H HG21 . ILE A 1 37  ? 9.723   -1.378  -4.841  1.00 1.05  ? 37  ILE A HG21 5  
ATOM 8460  H HG22 . ILE A 1 37  ? 9.288   -2.330  -6.260  1.00 1.00  ? 37  ILE A HG22 5  
ATOM 8461  H HG23 . ILE A 1 37  ? 8.726   -2.823  -4.661  1.00 1.04  ? 37  ILE A HG23 5  
ATOM 8462  H HD11 . ILE A 1 37  ? 7.576   0.430   -2.373  1.00 1.09  ? 37  ILE A HD11 5  
ATOM 8463  H HD12 . ILE A 1 37  ? 8.288   1.049   -3.863  1.00 1.12  ? 37  ILE A HD12 5  
ATOM 8464  H HD13 . ILE A 1 37  ? 8.967   -0.383  -3.091  1.00 1.05  ? 37  ILE A HD13 5  
ATOM 8465  N N    . ARG A 1 38  ? 9.560   0.140   -8.186  1.00 0.34  ? 38  ARG A N    5  
ATOM 8466  C CA   . ARG A 1 38  ? 10.065  -0.190  -9.514  1.00 0.41  ? 38  ARG A CA   5  
ATOM 8467  C C    . ARG A 1 38  ? 10.435  -1.661  -9.553  1.00 0.40  ? 38  ARG A C    5  
ATOM 8468  O O    . ARG A 1 38  ? 9.942   -2.417  -10.384 1.00 0.49  ? 38  ARG A O    5  
ATOM 8469  C CB   . ARG A 1 38  ? 11.283  0.689   -9.862  1.00 0.50  ? 38  ARG A CB   5  
ATOM 8470  C CG   . ARG A 1 38  ? 11.722  0.621   -11.325 1.00 0.67  ? 38  ARG A CG   5  
ATOM 8471  C CD   . ARG A 1 38  ? 12.694  -0.521  -11.597 1.00 1.24  ? 38  ARG A CD   5  
ATOM 8472  N NE   . ARG A 1 38  ? 14.019  -0.275  -11.019 1.00 1.56  ? 38  ARG A NE   5  
ATOM 8473  C CZ   . ARG A 1 38  ? 15.005  -1.179  -10.998 1.00 2.17  ? 38  ARG A CZ   5  
ATOM 8474  N NH1  . ARG A 1 38  ? 14.814  -2.389  -11.508 1.00 2.83  ? 38  ARG A NH1  5  
ATOM 8475  N NH2  . ARG A 1 38  ? 16.185  -0.869  -10.473 1.00 2.62  ? 38  ARG A NH2  5  
ATOM 8476  H H    . ARG A 1 38  ? 10.106  0.701   -7.593  1.00 0.35  ? 38  ARG A H    5  
ATOM 8477  H HA   . ARG A 1 38  ? 9.276   -0.007  -10.230 1.00 0.46  ? 38  ARG A HA   5  
ATOM 8478  H HB2  . ARG A 1 38  ? 11.044  1.716   -9.633  1.00 0.58  ? 38  ARG A HB2  5  
ATOM 8479  H HB3  . ARG A 1 38  ? 12.117  0.382   -9.247  1.00 0.52  ? 38  ARG A HB3  5  
ATOM 8480  H HG2  . ARG A 1 38  ? 10.848  0.483   -11.942 1.00 1.18  ? 38  ARG A HG2  5  
ATOM 8481  H HG3  . ARG A 1 38  ? 12.199  1.556   -11.585 1.00 1.34  ? 38  ARG A HG3  5  
ATOM 8482  H HD2  . ARG A 1 38  ? 12.291  -1.427  -11.170 1.00 1.95  ? 38  ARG A HD2  5  
ATOM 8483  H HD3  . ARG A 1 38  ? 12.795  -0.642  -12.665 1.00 1.74  ? 38  ARG A HD3  5  
ATOM 8484  H HE   . ARG A 1 38  ? 14.184  0.618   -10.634 1.00 1.83  ? 38  ARG A HE   5  
ATOM 8485  H HH11 . ARG A 1 38  ? 13.931  -2.632  -11.919 1.00 2.92  ? 38  ARG A HH11 5  
ATOM 8486  H HH12 . ARG A 1 38  ? 15.554  -3.075  -11.479 1.00 3.48  ? 38  ARG A HH12 5  
ATOM 8487  H HH21 . ARG A 1 38  ? 16.349  0.047   -10.097 1.00 2.77  ? 38  ARG A HH21 5  
ATOM 8488  H HH22 . ARG A 1 38  ? 16.919  -1.553  -10.441 1.00 3.10  ? 38  ARG A HH22 5  
ATOM 8489  N N    . SER A 1 39  ? 11.298  -2.051  -8.632  1.00 0.36  ? 39  SER A N    5  
ATOM 8490  C CA   . SER A 1 39  ? 11.717  -3.432  -8.483  1.00 0.40  ? 39  SER A CA   5  
ATOM 8491  C C    . SER A 1 39  ? 12.355  -3.596  -7.118  1.00 0.32  ? 39  SER A C    5  
ATOM 8492  O O    . SER A 1 39  ? 13.015  -2.679  -6.631  1.00 0.37  ? 39  SER A O    5  
ATOM 8493  C CB   . SER A 1 39  ? 12.721  -3.830  -9.573  1.00 0.54  ? 39  SER A CB   5  
ATOM 8494  O OG   . SER A 1 39  ? 12.178  -3.654  -10.872 1.00 1.26  ? 39  SER A OG   5  
ATOM 8495  H H    . SER A 1 39  ? 11.667  -1.383  -8.013  1.00 0.35  ? 39  SER A H    5  
ATOM 8496  H HA   . SER A 1 39  ? 10.844  -4.064  -8.546  1.00 0.44  ? 39  SER A HA   5  
ATOM 8497  H HB2  . SER A 1 39  ? 13.607  -3.219  -9.483  1.00 1.11  ? 39  SER A HB2  5  
ATOM 8498  H HB3  . SER A 1 39  ? 12.991  -4.870  -9.447  1.00 1.13  ? 39  SER A HB3  5  
ATOM 8499  H HG   . SER A 1 39  ? 11.267  -3.328  -10.792 1.00 1.82  ? 39  SER A HG   5  
ATOM 8500  N N    . VAL A 1 40  ? 12.139  -4.732  -6.491  1.00 0.36  ? 40  VAL A N    5  
ATOM 8501  C CA   . VAL A 1 40  ? 12.798  -5.020  -5.236  1.00 0.30  ? 40  VAL A CA   5  
ATOM 8502  C C    . VAL A 1 40  ? 14.004  -5.912  -5.501  1.00 0.31  ? 40  VAL A C    5  
ATOM 8503  O O    . VAL A 1 40  ? 13.880  -6.972  -6.117  1.00 0.37  ? 40  VAL A O    5  
ATOM 8504  C CB   . VAL A 1 40  ? 11.838  -5.672  -4.208  1.00 0.33  ? 40  VAL A CB   5  
ATOM 8505  C CG1  . VAL A 1 40  ? 11.178  -6.920  -4.773  1.00 0.37  ? 40  VAL A CG1  5  
ATOM 8506  C CG2  . VAL A 1 40  ? 12.569  -5.992  -2.916  1.00 0.32  ? 40  VAL A CG2  5  
ATOM 8507  H H    . VAL A 1 40  ? 11.540  -5.398  -6.884  1.00 0.49  ? 40  VAL A H    5  
ATOM 8508  H HA   . VAL A 1 40  ? 13.147  -4.080  -4.827  1.00 0.31  ? 40  VAL A HA   5  
ATOM 8509  H HB   . VAL A 1 40  ? 11.059  -4.959  -3.981  1.00 0.38  ? 40  VAL A HB   5  
ATOM 8510  H HG11 . VAL A 1 40  ? 10.594  -6.655  -5.641  1.00 1.03  ? 40  VAL A HG11 5  
ATOM 8511  H HG12 . VAL A 1 40  ? 10.535  -7.357  -4.025  1.00 1.05  ? 40  VAL A HG12 5  
ATOM 8512  H HG13 . VAL A 1 40  ? 11.940  -7.631  -5.055  1.00 1.11  ? 40  VAL A HG13 5  
ATOM 8513  H HG21 . VAL A 1 40  ? 11.877  -6.424  -2.207  1.00 1.08  ? 40  VAL A HG21 5  
ATOM 8514  H HG22 . VAL A 1 40  ? 12.987  -5.086  -2.505  1.00 1.09  ? 40  VAL A HG22 5  
ATOM 8515  H HG23 . VAL A 1 40  ? 13.364  -6.696  -3.117  1.00 1.02  ? 40  VAL A HG23 5  
ATOM 8516  N N    . ASP A 1 41  ? 15.173  -5.445  -5.090  1.00 0.35  ? 41  ASP A N    5  
ATOM 8517  C CA   . ASP A 1 41  ? 16.410  -6.188  -5.292  1.00 0.45  ? 41  ASP A CA   5  
ATOM 8518  C C    . ASP A 1 41  ? 16.336  -7.510  -4.544  1.00 0.48  ? 41  ASP A C    5  
ATOM 8519  O O    . ASP A 1 41  ? 16.248  -7.528  -3.321  1.00 0.51  ? 41  ASP A O    5  
ATOM 8520  C CB   . ASP A 1 41  ? 17.618  -5.369  -4.820  1.00 0.54  ? 41  ASP A CB   5  
ATOM 8521  C CG   . ASP A 1 41  ? 17.831  -4.113  -5.645  1.00 1.27  ? 41  ASP A CG   5  
ATOM 8522  O OD1  . ASP A 1 41  ? 18.488  -4.192  -6.704  1.00 1.32  ? 41  ASP A OD1  5  
ATOM 8523  O OD2  . ASP A 1 41  ? 17.348  -3.036  -5.233  1.00 2.28  ? 41  ASP A OD2  5  
ATOM 8524  H H    . ASP A 1 41  ? 15.208  -4.582  -4.627  1.00 0.39  ? 41  ASP A H    5  
ATOM 8525  H HA   . ASP A 1 41  ? 16.508  -6.391  -6.348  1.00 0.52  ? 41  ASP A HA   5  
ATOM 8526  H HB2  . ASP A 1 41  ? 17.467  -5.080  -3.791  1.00 0.79  ? 41  ASP A HB2  5  
ATOM 8527  H HB3  . ASP A 1 41  ? 18.508  -5.979  -4.890  1.00 1.00  ? 41  ASP A HB3  5  
ATOM 8528  N N    . PRO A 1 42  ? 16.349  -8.633  -5.279  1.00 0.58  ? 42  PRO A N    5  
ATOM 8529  C CA   . PRO A 1 42  ? 16.158  -9.965  -4.699  1.00 0.69  ? 42  PRO A CA   5  
ATOM 8530  C C    . PRO A 1 42  ? 17.183  -10.298 -3.622  1.00 0.69  ? 42  PRO A C    5  
ATOM 8531  O O    . PRO A 1 42  ? 18.320  -9.811  -3.652  1.00 1.17  ? 42  PRO A O    5  
ATOM 8532  C CB   . PRO A 1 42  ? 16.307  -10.914 -5.897  1.00 0.84  ? 42  PRO A CB   5  
ATOM 8533  C CG   . PRO A 1 42  ? 16.988  -10.115 -6.952  1.00 0.93  ? 42  PRO A CG   5  
ATOM 8534  C CD   . PRO A 1 42  ? 16.558  -8.693  -6.732  1.00 0.69  ? 42  PRO A CD   5  
ATOM 8535  H HA   . PRO A 1 42  ? 15.167  -10.069 -4.280  1.00 0.75  ? 42  PRO A HA   5  
ATOM 8536  H HB2  . PRO A 1 42  ? 16.900  -11.770 -5.607  1.00 0.99  ? 42  PRO A HB2  5  
ATOM 8537  H HB3  . PRO A 1 42  ? 15.331  -11.243 -6.221  1.00 0.96  ? 42  PRO A HB3  5  
ATOM 8538  H HG2  . PRO A 1 42  ? 18.060  -10.205 -6.848  1.00 1.27  ? 42  PRO A HG2  5  
ATOM 8539  H HG3  . PRO A 1 42  ? 16.676  -10.452 -7.928  1.00 1.17  ? 42  PRO A HG3  5  
ATOM 8540  H HD2  . PRO A 1 42  ? 17.337  -8.011  -7.039  1.00 0.79  ? 42  PRO A HD2  5  
ATOM 8541  H HD3  . PRO A 1 42  ? 15.640  -8.489  -7.262  1.00 0.77  ? 42  PRO A HD3  5  
ATOM 8542  N N    . ASP A 1 43  ? 16.757  -11.136 -2.678  1.00 0.75  ? 43  ASP A N    5  
ATOM 8543  C CA   . ASP A 1 43  ? 17.600  -11.583 -1.571  1.00 0.87  ? 43  ASP A CA   5  
ATOM 8544  C C    . ASP A 1 43  ? 17.926  -10.418 -0.652  1.00 0.70  ? 43  ASP A C    5  
ATOM 8545  O O    . ASP A 1 43  ? 19.079  -10.205 -0.282  1.00 0.86  ? 43  ASP A O    5  
ATOM 8546  C CB   . ASP A 1 43  ? 18.896  -12.238 -2.071  1.00 1.14  ? 43  ASP A CB   5  
ATOM 8547  C CG   . ASP A 1 43  ? 18.652  -13.323 -3.099  1.00 1.69  ? 43  ASP A CG   5  
ATOM 8548  O OD1  . ASP A 1 43  ? 17.776  -14.183 -2.872  1.00 1.92  ? 43  ASP A OD1  5  
ATOM 8549  O OD2  . ASP A 1 43  ? 19.330  -13.311 -4.151  1.00 2.40  ? 43  ASP A OD2  5  
ATOM 8550  H H    . ASP A 1 43  ? 15.828  -11.462 -2.722  1.00 1.09  ? 43  ASP A H    5  
ATOM 8551  H HA   . ASP A 1 43  ? 17.036  -12.313 -1.007  1.00 1.00  ? 43  ASP A HA   5  
ATOM 8552  H HB2  . ASP A 1 43  ? 19.523  -11.482 -2.520  1.00 1.42  ? 43  ASP A HB2  5  
ATOM 8553  H HB3  . ASP A 1 43  ? 19.414  -12.675 -1.232  1.00 1.58  ? 43  ASP A HB3  5  
ATOM 8554  N N    . SER A 1 44  ? 16.902  -9.659  -0.293  1.00 0.57  ? 44  SER A N    5  
ATOM 8555  C CA   . SER A 1 44  ? 17.077  -8.500  0.561   1.00 0.48  ? 44  SER A CA   5  
ATOM 8556  C C    . SER A 1 44  ? 16.030  -8.485  1.666   1.00 0.40  ? 44  SER A C    5  
ATOM 8557  O O    . SER A 1 44  ? 14.998  -9.152  1.558   1.00 0.39  ? 44  SER A O    5  
ATOM 8558  C CB   . SER A 1 44  ? 16.956  -7.227  -0.271  1.00 0.47  ? 44  SER A CB   5  
ATOM 8559  O OG   . SER A 1 44  ? 15.660  -7.125  -0.839  1.00 0.46  ? 44  SER A OG   5  
ATOM 8560  H H    . SER A 1 44  ? 16.003  -9.884  -0.612  1.00 0.68  ? 44  SER A H    5  
ATOM 8561  H HA   . SER A 1 44  ? 18.059  -8.546  1.003   1.00 0.55  ? 44  SER A HA   5  
ATOM 8562  H HB2  . SER A 1 44  ? 17.129  -6.367  0.359   1.00 0.50  ? 44  SER A HB2  5  
ATOM 8563  H HB3  . SER A 1 44  ? 17.686  -7.245  -1.069  1.00 0.51  ? 44  SER A HB3  5  
ATOM 8564  H HG   . SER A 1 44  ? 15.740  -7.066  -1.805  1.00 0.41  ? 44  SER A HG   5  
ATOM 8565  N N    . PRO A 1 45  ? 16.279  -7.728  2.747   1.00 0.43  ? 45  PRO A N    5  
ATOM 8566  C CA   . PRO A 1 45  ? 15.283  -7.502  3.792   1.00 0.45  ? 45  PRO A CA   5  
ATOM 8567  C C    . PRO A 1 45  ? 14.011  -6.869  3.225   1.00 0.38  ? 45  PRO A C    5  
ATOM 8568  O O    . PRO A 1 45  ? 12.916  -7.077  3.746   1.00 0.39  ? 45  PRO A O    5  
ATOM 8569  C CB   . PRO A 1 45  ? 15.976  -6.543  4.770   1.00 0.57  ? 45  PRO A CB   5  
ATOM 8570  C CG   . PRO A 1 45  ? 17.146  -5.994  4.026   1.00 0.65  ? 45  PRO A CG   5  
ATOM 8571  C CD   . PRO A 1 45  ? 17.553  -7.056  3.047   1.00 0.52  ? 45  PRO A CD   5  
ATOM 8572  H HA   . PRO A 1 45  ? 15.032  -8.422  4.299   1.00 0.48  ? 45  PRO A HA   5  
ATOM 8573  H HB2  . PRO A 1 45  ? 15.289  -5.760  5.054   1.00 0.68  ? 45  PRO A HB2  5  
ATOM 8574  H HB3  . PRO A 1 45  ? 16.292  -7.087  5.648   1.00 0.68  ? 45  PRO A HB3  5  
ATOM 8575  H HG2  . PRO A 1 45  ? 16.858  -5.094  3.501   1.00 0.81  ? 45  PRO A HG2  5  
ATOM 8576  H HG3  . PRO A 1 45  ? 17.953  -5.788  4.711   1.00 0.87  ? 45  PRO A HG3  5  
ATOM 8577  H HD2  . PRO A 1 45  ? 17.976  -6.610  2.158   1.00 0.56  ? 45  PRO A HD2  5  
ATOM 8578  H HD3  . PRO A 1 45  ? 18.253  -7.742  3.500   1.00 0.60  ? 45  PRO A HD3  5  
ATOM 8579  N N    . ALA A 1 46  ? 14.163  -6.110  2.142   1.00 0.35  ? 46  ALA A N    5  
ATOM 8580  C CA   . ALA A 1 46  ? 13.027  -5.495  1.474   1.00 0.33  ? 46  ALA A CA   5  
ATOM 8581  C C    . ALA A 1 46  ? 12.146  -6.560  0.836   1.00 0.30  ? 46  ALA A C    5  
ATOM 8582  O O    . ALA A 1 46  ? 10.924  -6.532  0.971   1.00 0.31  ? 46  ALA A O    5  
ATOM 8583  C CB   . ALA A 1 46  ? 13.494  -4.497  0.431   1.00 0.36  ? 46  ALA A CB   5  
ATOM 8584  H H    . ALA A 1 46  ? 15.066  -5.963  1.785   1.00 0.37  ? 46  ALA A H    5  
ATOM 8585  H HA   . ALA A 1 46  ? 12.449  -4.962  2.217   1.00 0.35  ? 46  ALA A HA   5  
ATOM 8586  H HB1  . ALA A 1 46  ? 12.637  -4.031  -0.031  1.00 1.17  ? 46  ALA A HB1  5  
ATOM 8587  H HB2  . ALA A 1 46  ? 14.077  -5.008  -0.322  1.00 0.96  ? 46  ALA A HB2  5  
ATOM 8588  H HB3  . ALA A 1 46  ? 14.102  -3.740  0.904   1.00 1.10  ? 46  ALA A HB3  5  
ATOM 8589  N N    . GLU A 1 47  ? 12.765  -7.511  0.153   1.00 0.31  ? 47  GLU A N    5  
ATOM 8590  C CA   . GLU A 1 47  ? 12.020  -8.606  -0.449  1.00 0.33  ? 47  GLU A CA   5  
ATOM 8591  C C    . GLU A 1 47  ? 11.424  -9.496  0.639   1.00 0.34  ? 47  GLU A C    5  
ATOM 8592  O O    . GLU A 1 47  ? 10.269  -9.910  0.556   1.00 0.40  ? 47  GLU A O    5  
ATOM 8593  C CB   . GLU A 1 47  ? 12.922  -9.421  -1.379  1.00 0.40  ? 47  GLU A CB   5  
ATOM 8594  C CG   . GLU A 1 47  ? 12.245  -10.645 -1.977  1.00 0.53  ? 47  GLU A CG   5  
ATOM 8595  C CD   . GLU A 1 47  ? 13.151  -11.419 -2.913  1.00 1.12  ? 47  GLU A CD   5  
ATOM 8596  O OE1  . GLU A 1 47  ? 14.173  -11.961 -2.444  1.00 2.01  ? 47  GLU A OE1  5  
ATOM 8597  O OE2  . GLU A 1 47  ? 12.865  -11.462 -4.131  1.00 1.51  ? 47  GLU A OE2  5  
ATOM 8598  H H    . GLU A 1 47  ? 13.743  -7.474  0.048   1.00 0.33  ? 47  GLU A H    5  
ATOM 8599  H HA   . GLU A 1 47  ? 11.214  -8.178  -1.025  1.00 0.36  ? 47  GLU A HA   5  
ATOM 8600  H HB2  . GLU A 1 47  ? 13.247  -8.786  -2.189  1.00 0.44  ? 47  GLU A HB2  5  
ATOM 8601  H HB3  . GLU A 1 47  ? 13.784  -9.748  -0.822  1.00 0.42  ? 47  GLU A HB3  5  
ATOM 8602  H HG2  . GLU A 1 47  ? 11.943  -11.302 -1.173  1.00 1.14  ? 47  GLU A HG2  5  
ATOM 8603  H HG3  . GLU A 1 47  ? 11.372  -10.326 -2.527  1.00 1.17  ? 47  GLU A HG3  5  
ATOM 8604  N N    . ALA A 1 48  ? 12.214  -9.753  1.677   1.00 0.34  ? 48  ALA A N    5  
ATOM 8605  C CA   . ALA A 1 48  ? 11.787  -10.600 2.787   1.00 0.38  ? 48  ALA A CA   5  
ATOM 8606  C C    . ALA A 1 48  ? 10.629  -9.978  3.569   1.00 0.37  ? 48  ALA A C    5  
ATOM 8607  O O    . ALA A 1 48  ? 9.813   -10.691 4.153   1.00 0.47  ? 48  ALA A O    5  
ATOM 8608  C CB   . ALA A 1 48  ? 12.962  -10.874 3.713   1.00 0.44  ? 48  ALA A CB   5  
ATOM 8609  H H    . ALA A 1 48  ? 13.123  -9.374  1.691   1.00 0.34  ? 48  ALA A H    5  
ATOM 8610  H HA   . ALA A 1 48  ? 11.462  -11.544 2.375   1.00 0.42  ? 48  ALA A HA   5  
ATOM 8611  H HB1  . ALA A 1 48  ? 13.293  -9.948  4.159   1.00 1.15  ? 48  ALA A HB1  5  
ATOM 8612  H HB2  . ALA A 1 48  ? 13.772  -11.312 3.146   1.00 0.97  ? 48  ALA A HB2  5  
ATOM 8613  H HB3  . ALA A 1 48  ? 12.657  -11.559 4.490   1.00 1.06  ? 48  ALA A HB3  5  
ATOM 8614  N N    . SER A 1 49  ? 10.559  -8.648  3.577   1.00 0.31  ? 49  SER A N    5  
ATOM 8615  C CA   . SER A 1 49  ? 9.498   -7.942  4.280   1.00 0.32  ? 49  SER A CA   5  
ATOM 8616  C C    . SER A 1 49  ? 8.160   -8.128  3.561   1.00 0.35  ? 49  SER A C    5  
ATOM 8617  O O    . SER A 1 49  ? 7.092   -7.889  4.132   1.00 0.40  ? 49  SER A O    5  
ATOM 8618  C CB   . SER A 1 49  ? 9.851   -6.454  4.394   1.00 0.32  ? 49  SER A CB   5  
ATOM 8619  O OG   . SER A 1 49  ? 9.759   -5.799  3.145   1.00 0.31  ? 49  SER A OG   5  
ATOM 8620  H H    . SER A 1 49  ? 11.250  -8.130  3.120   1.00 0.29  ? 49  SER A H    5  
ATOM 8621  H HA   . SER A 1 49  ? 9.421   -8.363  5.271   1.00 0.36  ? 49  SER A HA   5  
ATOM 8622  H HB2  . SER A 1 49  ? 9.182   -5.971  5.088   1.00 0.35  ? 49  SER A HB2  5  
ATOM 8623  H HB3  . SER A 1 49  ? 10.864  -6.361  4.757   1.00 0.36  ? 49  SER A HB3  5  
ATOM 8624  H HG   . SER A 1 49  ? 10.421  -6.156  2.538   1.00 0.29  ? 49  SER A HG   5  
ATOM 8625  N N    . GLY A 1 50  ? 8.226   -8.566  2.307   1.00 0.36  ? 50  GLY A N    5  
ATOM 8626  C CA   . GLY A 1 50  ? 7.019   -8.817  1.546   1.00 0.43  ? 50  GLY A CA   5  
ATOM 8627  C C    . GLY A 1 50  ? 6.729   -7.737  0.524   1.00 0.43  ? 50  GLY A C    5  
ATOM 8628  O O    . GLY A 1 50  ? 5.617   -7.652  0.009   1.00 0.62  ? 50  GLY A O    5  
ATOM 8629  H H    . GLY A 1 50  ? 9.104   -8.736  1.903   1.00 0.34  ? 50  GLY A H    5  
ATOM 8630  H HA2  . GLY A 1 50  ? 7.123   -9.760  1.032   1.00 0.49  ? 50  GLY A HA2  5  
ATOM 8631  H HA3  . GLY A 1 50  ? 6.184   -8.881  2.229   1.00 0.45  ? 50  GLY A HA3  5  
ATOM 8632  N N    . LEU A 1 51  ? 7.724   -6.909  0.233   1.00 0.41  ? 51  LEU A N    5  
ATOM 8633  C CA   . LEU A 1 51  ? 7.570   -5.846  -0.755  1.00 0.40  ? 51  LEU A CA   5  
ATOM 8634  C C    . LEU A 1 51  ? 7.517   -6.439  -2.159  1.00 0.48  ? 51  LEU A C    5  
ATOM 8635  O O    . LEU A 1 51  ? 8.137   -7.470  -2.427  1.00 0.65  ? 51  LEU A O    5  
ATOM 8636  C CB   . LEU A 1 51  ? 8.729   -4.851  -0.643  1.00 0.38  ? 51  LEU A CB   5  
ATOM 8637  C CG   . LEU A 1 51  ? 8.574   -3.567  -1.461  1.00 0.35  ? 51  LEU A CG   5  
ATOM 8638  C CD1  . LEU A 1 51  ? 7.363   -2.778  -0.986  1.00 0.38  ? 51  LEU A CD1  5  
ATOM 8639  C CD2  . LEU A 1 51  ? 9.835   -2.721  -1.362  1.00 0.37  ? 51  LEU A CD2  5  
ATOM 8640  H H    . LEU A 1 51  ? 8.585   -7.016  0.691   1.00 0.54  ? 51  LEU A H    5  
ATOM 8641  H HA   . LEU A 1 51  ? 6.641   -5.332  -0.555  1.00 0.41  ? 51  LEU A HA   5  
ATOM 8642  H HB2  . LEU A 1 51  ? 8.838   -4.577  0.395   1.00 0.42  ? 51  LEU A HB2  5  
ATOM 8643  H HB3  . LEU A 1 51  ? 9.631   -5.348  -0.963  1.00 0.48  ? 51  LEU A HB3  5  
ATOM 8644  H HG   . LEU A 1 51  ? 8.420   -3.824  -2.499  1.00 0.42  ? 51  LEU A HG   5  
ATOM 8645  H HD11 . LEU A 1 51  ? 7.489   -2.520  0.056   1.00 1.04  ? 51  LEU A HD11 5  
ATOM 8646  H HD12 . LEU A 1 51  ? 6.475   -3.380  -1.103  1.00 1.12  ? 51  LEU A HD12 5  
ATOM 8647  H HD13 . LEU A 1 51  ? 7.267   -1.876  -1.572  1.00 1.10  ? 51  LEU A HD13 5  
ATOM 8648  H HD21 . LEU A 1 51  ? 10.678  -3.287  -1.729  1.00 1.03  ? 51  LEU A HD21 5  
ATOM 8649  H HD22 . LEU A 1 51  ? 10.006  -2.447  -0.331  1.00 1.05  ? 51  LEU A HD22 5  
ATOM 8650  H HD23 . LEU A 1 51  ? 9.717   -1.827  -1.957  1.00 1.08  ? 51  LEU A HD23 5  
ATOM 8651  N N    . ARG A 1 52  ? 6.770   -5.803  -3.050  1.00 0.53  ? 52  ARG A N    5  
ATOM 8652  C CA   . ARG A 1 52  ? 6.626   -6.297  -4.410  1.00 0.65  ? 52  ARG A CA   5  
ATOM 8653  C C    . ARG A 1 52  ? 6.626   -5.130  -5.390  1.00 0.55  ? 52  ARG A C    5  
ATOM 8654  O O    . ARG A 1 52  ? 6.355   -3.992  -5.012  1.00 0.61  ? 52  ARG A O    5  
ATOM 8655  C CB   . ARG A 1 52  ? 5.329   -7.109  -4.518  1.00 0.86  ? 52  ARG A CB   5  
ATOM 8656  C CG   . ARG A 1 52  ? 5.304   -8.120  -5.658  1.00 1.23  ? 52  ARG A CG   5  
ATOM 8657  C CD   . ARG A 1 52  ? 6.497   -9.071  -5.607  1.00 2.05  ? 52  ARG A CD   5  
ATOM 8658  N NE   . ARG A 1 52  ? 6.947   -9.330  -4.236  1.00 2.59  ? 52  ARG A NE   5  
ATOM 8659  C CZ   . ARG A 1 52  ? 7.483   -10.477 -3.815  1.00 3.57  ? 52  ARG A CZ   5  
ATOM 8660  N NH1  . ARG A 1 52  ? 7.551   -11.528 -4.625  1.00 4.13  ? 52  ARG A NH1  5  
ATOM 8661  N NH2  . ARG A 1 52  ? 7.937   -10.571 -2.569  1.00 4.38  ? 52  ARG A NH2  5  
ATOM 8662  H H    . ARG A 1 52  ? 6.295   -4.984  -2.789  1.00 0.62  ? 52  ARG A H    5  
ATOM 8663  H HA   . ARG A 1 52  ? 7.467   -6.940  -4.624  1.00 0.74  ? 52  ARG A HA   5  
ATOM 8664  H HB2  . ARG A 1 52  ? 5.181   -7.645  -3.593  1.00 1.11  ? 52  ARG A HB2  5  
ATOM 8665  H HB3  . ARG A 1 52  ? 4.507   -6.425  -4.659  1.00 1.35  ? 52  ARG A HB3  5  
ATOM 8666  H HG2  . ARG A 1 52  ? 4.396   -8.698  -5.592  1.00 1.80  ? 52  ARG A HG2  5  
ATOM 8667  H HG3  . ARG A 1 52  ? 5.323   -7.588  -6.599  1.00 1.46  ? 52  ARG A HG3  5  
ATOM 8668  H HD2  . ARG A 1 52  ? 6.212   -10.007 -6.063  1.00 2.55  ? 52  ARG A HD2  5  
ATOM 8669  H HD3  . ARG A 1 52  ? 7.310   -8.634  -6.167  1.00 2.57  ? 52  ARG A HD3  5  
ATOM 8670  H HE   . ARG A 1 52  ? 6.876   -8.583  -3.595  1.00 2.68  ? 52  ARG A HE   5  
ATOM 8671  H HH11 . ARG A 1 52  ? 7.196   -11.471 -5.559  1.00 3.93  ? 52  ARG A HH11 5  
ATOM 8672  H HH12 . ARG A 1 52  ? 7.966   -12.390 -4.302  1.00 4.99  ? 52  ARG A HH12 5  
ATOM 8673  H HH21 . ARG A 1 52  ? 7.879   -9.783  -1.952  1.00 4.42  ? 52  ARG A HH21 5  
ATOM 8674  H HH22 . ARG A 1 52  ? 8.336   -11.438 -2.234  1.00 5.17  ? 52  ARG A HH22 5  
ATOM 8675  N N    . ALA A 1 53  ? 6.960   -5.411  -6.642  1.00 0.53  ? 53  ALA A N    5  
ATOM 8676  C CA   . ALA A 1 53  ? 7.037   -4.378  -7.664  1.00 0.54  ? 53  ALA A CA   5  
ATOM 8677  C C    . ALA A 1 53  ? 5.652   -4.035  -8.192  1.00 0.61  ? 53  ALA A C    5  
ATOM 8678  O O    . ALA A 1 53  ? 4.742   -4.863  -8.126  1.00 1.44  ? 53  ALA A O    5  
ATOM 8679  C CB   . ALA A 1 53  ? 7.944   -4.826  -8.800  1.00 0.68  ? 53  ALA A CB   5  
ATOM 8680  H H    . ALA A 1 53  ? 7.145   -6.340  -6.889  1.00 0.60  ? 53  ALA A H    5  
ATOM 8681  H HA   . ALA A 1 53  ? 7.469   -3.495  -7.215  1.00 0.52  ? 53  ALA A HA   5  
ATOM 8682  H HB1  . ALA A 1 53  ? 7.514   -5.691  -9.284  1.00 1.00  ? 53  ALA A HB1  5  
ATOM 8683  H HB2  . ALA A 1 53  ? 8.917   -5.080  -8.406  1.00 1.18  ? 53  ALA A HB2  5  
ATOM 8684  H HB3  . ALA A 1 53  ? 8.044   -4.027  -9.519  1.00 1.17  ? 53  ALA A HB3  5  
ATOM 8685  N N    . GLN A 1 54  ? 5.513   -2.812  -8.714  1.00 0.65  ? 54  GLN A N    5  
ATOM 8686  C CA   . GLN A 1 54  ? 4.252   -2.311  -9.276  1.00 0.74  ? 54  GLN A CA   5  
ATOM 8687  C C    . GLN A 1 54  ? 3.250   -1.947  -8.186  1.00 0.59  ? 54  GLN A C    5  
ATOM 8688  O O    . GLN A 1 54  ? 2.093   -1.628  -8.476  1.00 0.67  ? 54  GLN A O    5  
ATOM 8689  C CB   . GLN A 1 54  ? 3.632   -3.315  -10.258 1.00 0.99  ? 54  GLN A CB   5  
ATOM 8690  C CG   . GLN A 1 54  ? 4.395   -3.433  -11.564 1.00 1.46  ? 54  GLN A CG   5  
ATOM 8691  C CD   . GLN A 1 54  ? 4.324   -2.168  -12.398 1.00 2.34  ? 54  GLN A CD   5  
ATOM 8692  O OE1  . GLN A 1 54  ? 5.261   -1.835  -13.124 1.00 2.99  ? 54  GLN A OE1  5  
ATOM 8693  N NE2  . GLN A 1 54  ? 3.206   -1.463  -12.317 1.00 3.06  ? 54  GLN A NE2  5  
ATOM 8694  H H    . GLN A 1 54  ? 6.295   -2.214  -8.716  1.00 1.26  ? 54  GLN A H    5  
ATOM 8695  H HA   . GLN A 1 54  ? 4.489   -1.409  -9.822  1.00 0.86  ? 54  GLN A HA   5  
ATOM 8696  H HB2  . GLN A 1 54  ? 3.607   -4.287  -9.791  1.00 1.00  ? 54  GLN A HB2  5  
ATOM 8697  H HB3  . GLN A 1 54  ? 2.623   -3.005  -10.483 1.00 1.09  ? 54  GLN A HB3  5  
ATOM 8698  H HG2  . GLN A 1 54  ? 5.431   -3.643  -11.344 1.00 1.69  ? 54  GLN A HG2  5  
ATOM 8699  H HG3  . GLN A 1 54  ? 3.978   -4.250  -12.138 1.00 1.84  ? 54  GLN A HG3  5  
ATOM 8700  H HE21 . GLN A 1 54  ? 2.491   -1.795  -11.733 1.00 3.14  ? 54  GLN A HE21 5  
ATOM 8701  H HE22 . GLN A 1 54  ? 3.137   -0.636  -12.840 1.00 3.80  ? 54  GLN A HE22 5  
ATOM 8702  N N    . ASP A 1 55  ? 3.694   -1.982  -6.939  1.00 0.47  ? 55  ASP A N    5  
ATOM 8703  C CA   . ASP A 1 55  ? 2.850   -1.584  -5.822  1.00 0.45  ? 55  ASP A CA   5  
ATOM 8704  C C    . ASP A 1 55  ? 3.072   -0.113  -5.502  1.00 0.39  ? 55  ASP A C    5  
ATOM 8705  O O    . ASP A 1 55  ? 4.128   0.448   -5.808  1.00 0.48  ? 55  ASP A O    5  
ATOM 8706  C CB   . ASP A 1 55  ? 3.131   -2.434  -4.577  1.00 0.50  ? 55  ASP A CB   5  
ATOM 8707  C CG   . ASP A 1 55  ? 2.719   -3.886  -4.743  1.00 0.67  ? 55  ASP A CG   5  
ATOM 8708  O OD1  . ASP A 1 55  ? 1.818   -4.159  -5.562  1.00 1.02  ? 55  ASP A OD1  5  
ATOM 8709  O OD2  . ASP A 1 55  ? 3.305   -4.758  -4.063  1.00 1.01  ? 55  ASP A OD2  5  
ATOM 8710  H H    . ASP A 1 55  ? 4.607   -2.287  -6.765  1.00 0.46  ? 55  ASP A H    5  
ATOM 8711  H HA   . ASP A 1 55  ? 1.821   -1.724  -6.119  1.00 0.52  ? 55  ASP A HA   5  
ATOM 8712  H HB2  . ASP A 1 55  ? 4.188   -2.405  -4.361  1.00 0.55  ? 55  ASP A HB2  5  
ATOM 8713  H HB3  . ASP A 1 55  ? 2.588   -2.020  -3.740  1.00 0.57  ? 55  ASP A HB3  5  
ATOM 8714  N N    . ARG A 1 56  ? 2.071   0.513   -4.905  1.00 0.38  ? 56  ARG A N    5  
ATOM 8715  C CA   . ARG A 1 56  ? 2.152   1.923   -4.542  1.00 0.42  ? 56  ARG A CA   5  
ATOM 8716  C C    . ARG A 1 56  ? 2.203   2.066   -3.024  1.00 0.39  ? 56  ARG A C    5  
ATOM 8717  O O    . ARG A 1 56  ? 1.422   1.435   -2.311  1.00 0.39  ? 56  ARG A O    5  
ATOM 8718  C CB   . ARG A 1 56  ? 0.951   2.681   -5.140  1.00 0.56  ? 56  ARG A CB   5  
ATOM 8719  C CG   . ARG A 1 56  ? 0.906   4.181   -4.834  1.00 0.78  ? 56  ARG A CG   5  
ATOM 8720  C CD   . ARG A 1 56  ? 0.303   4.463   -3.463  1.00 0.79  ? 56  ARG A CD   5  
ATOM 8721  N NE   . ARG A 1 56  ? -0.956  5.212   -3.526  1.00 0.89  ? 56  ARG A NE   5  
ATOM 8722  C CZ   . ARG A 1 56  ? -2.106  4.721   -3.989  1.00 0.91  ? 56  ARG A CZ   5  
ATOM 8723  N NH1  . ARG A 1 56  ? -2.168  3.495   -4.483  1.00 1.51  ? 56  ARG A NH1  5  
ATOM 8724  N NH2  . ARG A 1 56  ? -3.205  5.459   -3.936  1.00 1.57  ? 56  ARG A NH2  5  
ATOM 8725  H H    . ARG A 1 56  ? 1.252   0.010   -4.700  1.00 0.45  ? 56  ARG A H    5  
ATOM 8726  H HA   . ARG A 1 56  ? 3.065   2.321   -4.960  1.00 0.43  ? 56  ARG A HA   5  
ATOM 8727  H HB2  . ARG A 1 56  ? 0.973   2.564   -6.213  1.00 0.70  ? 56  ARG A HB2  5  
ATOM 8728  H HB3  . ARG A 1 56  ? 0.042   2.235   -4.762  1.00 0.54  ? 56  ARG A HB3  5  
ATOM 8729  H HG2  . ARG A 1 56  ? 1.912   4.572   -4.860  1.00 1.15  ? 56  ARG A HG2  5  
ATOM 8730  H HG3  . ARG A 1 56  ? 0.308   4.673   -5.587  1.00 1.24  ? 56  ARG A HG3  5  
ATOM 8731  H HD2  . ARG A 1 56  ? 0.119   3.521   -2.968  1.00 1.55  ? 56  ARG A HD2  5  
ATOM 8732  H HD3  . ARG A 1 56  ? 1.017   5.033   -2.886  1.00 1.33  ? 56  ARG A HD3  5  
ATOM 8733  H HE   . ARG A 1 56  ? -0.952  6.132   -3.162  1.00 1.71  ? 56  ARG A HE   5  
ATOM 8734  H HH11 . ARG A 1 56  ? -1.354  2.919   -4.515  1.00 1.92  ? 56  ARG A HH11 5  
ATOM 8735  H HH12 . ARG A 1 56  ? -3.052  3.139   -4.836  1.00 2.03  ? 56  ARG A HH12 5  
ATOM 8736  H HH21 . ARG A 1 56  ? -3.170  6.387   -3.543  1.00 2.26  ? 56  ARG A HH21 5  
ATOM 8737  H HH22 . ARG A 1 56  ? -4.075  5.095   -4.286  1.00 1.73  ? 56  ARG A HH22 5  
ATOM 8738  N N    . ILE A 1 57  ? 3.122   2.895   -2.543  1.00 0.40  ? 57  ILE A N    5  
ATOM 8739  C CA   . ILE A 1 57  ? 3.295   3.111   -1.109  1.00 0.38  ? 57  ILE A CA   5  
ATOM 8740  C C    . ILE A 1 57  ? 2.228   4.048   -0.571  1.00 0.38  ? 57  ILE A C    5  
ATOM 8741  O O    . ILE A 1 57  ? 2.067   5.166   -1.058  1.00 0.49  ? 57  ILE A O    5  
ATOM 8742  C CB   . ILE A 1 57  ? 4.688   3.698   -0.797  1.00 0.46  ? 57  ILE A CB   5  
ATOM 8743  C CG1  . ILE A 1 57  ? 5.792   2.756   -1.286  1.00 0.53  ? 57  ILE A CG1  5  
ATOM 8744  C CG2  . ILE A 1 57  ? 4.835   3.971   0.692   1.00 0.45  ? 57  ILE A CG2  5  
ATOM 8745  C CD1  . ILE A 1 57  ? 7.190   3.302   -1.079  1.00 0.68  ? 57  ILE A CD1  5  
ATOM 8746  H H    . ILE A 1 57  ? 3.696   3.387   -3.170  1.00 0.45  ? 57  ILE A H    5  
ATOM 8747  H HA   . ILE A 1 57  ? 3.199   2.160   -0.607  1.00 0.35  ? 57  ILE A HA   5  
ATOM 8748  H HB   . ILE A 1 57  ? 4.778   4.640   -1.316  1.00 0.52  ? 57  ILE A HB   5  
ATOM 8749  H HG12 . ILE A 1 57  ? 5.721   1.820   -0.751  1.00 1.01  ? 57  ILE A HG12 5  
ATOM 8750  H HG13 . ILE A 1 57  ? 5.659   2.572   -2.343  1.00 0.84  ? 57  ILE A HG13 5  
ATOM 8751  H HG21 . ILE A 1 57  ? 4.088   4.687   0.999   1.00 1.02  ? 57  ILE A HG21 5  
ATOM 8752  H HG22 . ILE A 1 57  ? 5.818   4.369   0.889   1.00 1.06  ? 57  ILE A HG22 5  
ATOM 8753  H HG23 . ILE A 1 57  ? 4.700   3.052   1.244   1.00 1.21  ? 57  ILE A HG23 5  
ATOM 8754  H HD11 . ILE A 1 57  ? 7.298   4.228   -1.625  1.00 1.25  ? 57  ILE A HD11 5  
ATOM 8755  H HD12 . ILE A 1 57  ? 7.913   2.587   -1.439  1.00 1.30  ? 57  ILE A HD12 5  
ATOM 8756  H HD13 . ILE A 1 57  ? 7.353   3.482   -0.026  1.00 1.37  ? 57  ILE A HD13 5  
ATOM 8757  N N    . VAL A 1 58  ? 1.504   3.583   0.435   1.00 0.29  ? 58  VAL A N    5  
ATOM 8758  C CA   . VAL A 1 58  ? 0.424   4.361   1.014   1.00 0.32  ? 58  VAL A CA   5  
ATOM 8759  C C    . VAL A 1 58  ? 0.708   4.747   2.466   1.00 0.30  ? 58  VAL A C    5  
ATOM 8760  O O    . VAL A 1 58  ? 0.180   5.743   2.952   1.00 0.37  ? 58  VAL A O    5  
ATOM 8761  C CB   . VAL A 1 58  ? -0.924  3.619   0.924   1.00 0.37  ? 58  VAL A CB   5  
ATOM 8762  C CG1  . VAL A 1 58  ? -1.405  3.555   -0.515  1.00 0.87  ? 58  VAL A CG1  5  
ATOM 8763  C CG2  . VAL A 1 58  ? -0.821  2.223   1.511   1.00 0.62  ? 58  VAL A CG2  5  
ATOM 8764  H H    . VAL A 1 58  ? 1.703   2.690   0.798   1.00 0.27  ? 58  VAL A H    5  
ATOM 8765  H HA   . VAL A 1 58  ? 0.337   5.269   0.434   1.00 0.38  ? 58  VAL A HA   5  
ATOM 8766  H HB   . VAL A 1 58  ? -1.646  4.170   1.494   1.00 0.66  ? 58  VAL A HB   5  
ATOM 8767  H HG11 . VAL A 1 58  ? -2.366  3.065   -0.553  1.00 1.32  ? 58  VAL A HG11 5  
ATOM 8768  H HG12 . VAL A 1 58  ? -0.693  2.997   -1.107  1.00 1.56  ? 58  VAL A HG12 5  
ATOM 8769  H HG13 . VAL A 1 58  ? -1.494  4.556   -0.908  1.00 1.41  ? 58  VAL A HG13 5  
ATOM 8770  H HG21 . VAL A 1 58  ? -0.503  2.288   2.541   1.00 1.24  ? 58  VAL A HG21 5  
ATOM 8771  H HG22 . VAL A 1 58  ? -0.101  1.646   0.948   1.00 1.25  ? 58  VAL A HG22 5  
ATOM 8772  H HG23 . VAL A 1 58  ? -1.785  1.738   1.463   1.00 1.22  ? 58  VAL A HG23 5  
ATOM 8773  N N    . GLU A 1 59  ? 1.531   3.963   3.163   1.00 0.24  ? 59  GLU A N    5  
ATOM 8774  C CA   . GLU A 1 59  ? 1.950   4.312   4.523   1.00 0.25  ? 59  GLU A CA   5  
ATOM 8775  C C    . GLU A 1 59  ? 3.423   3.977   4.734   1.00 0.22  ? 59  GLU A C    5  
ATOM 8776  O O    . GLU A 1 59  ? 3.930   2.994   4.191   1.00 0.23  ? 59  GLU A O    5  
ATOM 8777  C CB   . GLU A 1 59  ? 1.115   3.594   5.596   1.00 0.29  ? 59  GLU A CB   5  
ATOM 8778  C CG   . GLU A 1 59  ? -0.358  3.972   5.618   1.00 0.40  ? 59  GLU A CG   5  
ATOM 8779  C CD   . GLU A 1 59  ? -0.963  3.858   7.006   1.00 0.44  ? 59  GLU A CD   5  
ATOM 8780  O OE1  . GLU A 1 59  ? -1.301  2.730   7.416   1.00 0.43  ? 59  GLU A OE1  5  
ATOM 8781  O OE2  . GLU A 1 59  ? -1.119  4.894   7.687   1.00 0.89  ? 59  GLU A OE2  5  
ATOM 8782  H H    . GLU A 1 59  ? 1.866   3.135   2.757   1.00 0.24  ? 59  GLU A H    5  
ATOM 8783  H HA   . GLU A 1 59  ? 1.822   5.379   4.638   1.00 0.27  ? 59  GLU A HA   5  
ATOM 8784  H HB2  . GLU A 1 59  ? 1.181   2.531   5.431   1.00 0.26  ? 59  GLU A HB2  5  
ATOM 8785  H HB3  . GLU A 1 59  ? 1.535   3.821   6.565   1.00 0.37  ? 59  GLU A HB3  5  
ATOM 8786  H HG2  . GLU A 1 59  ? -0.462  4.989   5.278   1.00 0.55  ? 59  GLU A HG2  5  
ATOM 8787  H HG3  . GLU A 1 59  ? -0.896  3.314   4.953   1.00 0.44  ? 59  GLU A HG3  5  
ATOM 8788  N N    . VAL A 1 60  ? 4.105   4.801   5.522   1.00 0.22  ? 60  VAL A N    5  
ATOM 8789  C CA   . VAL A 1 60  ? 5.498   4.559   5.883   1.00 0.21  ? 60  VAL A CA   5  
ATOM 8790  C C    . VAL A 1 60  ? 5.677   4.710   7.389   1.00 0.22  ? 60  VAL A C    5  
ATOM 8791  O O    . VAL A 1 60  ? 5.311   5.736   7.959   1.00 0.27  ? 60  VAL A O    5  
ATOM 8792  C CB   . VAL A 1 60  ? 6.471   5.522   5.160   1.00 0.23  ? 60  VAL A CB   5  
ATOM 8793  C CG1  . VAL A 1 60  ? 7.899   5.301   5.635   1.00 0.54  ? 60  VAL A CG1  5  
ATOM 8794  C CG2  . VAL A 1 60  ? 6.389   5.350   3.652   1.00 0.66  ? 60  VAL A CG2  5  
ATOM 8795  H H    . VAL A 1 60  ? 3.650   5.598   5.883   1.00 0.25  ? 60  VAL A H    5  
ATOM 8796  H HA   . VAL A 1 60  ? 5.745   3.544   5.599   1.00 0.22  ? 60  VAL A HA   5  
ATOM 8797  H HB   . VAL A 1 60  ? 6.188   6.536   5.402   1.00 0.52  ? 60  VAL A HB   5  
ATOM 8798  H HG11 . VAL A 1 60  ? 7.947   5.433   6.706   1.00 1.16  ? 60  VAL A HG11 5  
ATOM 8799  H HG12 . VAL A 1 60  ? 8.553   6.016   5.155   1.00 1.03  ? 60  VAL A HG12 5  
ATOM 8800  H HG13 . VAL A 1 60  ? 8.212   4.300   5.381   1.00 1.01  ? 60  VAL A HG13 5  
ATOM 8801  H HG21 . VAL A 1 60  ? 6.641   4.334   3.391   1.00 1.23  ? 60  VAL A HG21 5  
ATOM 8802  H HG22 . VAL A 1 60  ? 7.084   6.027   3.174   1.00 1.29  ? 60  VAL A HG22 5  
ATOM 8803  H HG23 . VAL A 1 60  ? 5.385   5.568   3.318   1.00 1.22  ? 60  VAL A HG23 5  
ATOM 8804  N N    . ASN A 1 61  ? 6.214   3.668   8.023   1.00 0.25  ? 61  ASN A N    5  
ATOM 8805  C CA   . ASN A 1 61  ? 6.457   3.645   9.474   1.00 0.30  ? 61  ASN A CA   5  
ATOM 8806  C C    . ASN A 1 61  ? 5.165   3.841   10.261  1.00 0.36  ? 61  ASN A C    5  
ATOM 8807  O O    . ASN A 1 61  ? 5.190   4.237   11.426  1.00 0.47  ? 61  ASN A O    5  
ATOM 8808  C CB   . ASN A 1 61  ? 7.474   4.713   9.896   1.00 0.39  ? 61  ASN A CB   5  
ATOM 8809  C CG   . ASN A 1 61  ? 8.836   4.538   9.251   1.00 0.53  ? 61  ASN A CG   5  
ATOM 8810  O OD1  . ASN A 1 61  ? 9.232   3.432   8.877   1.00 1.17  ? 61  ASN A OD1  5  
ATOM 8811  N ND2  . ASN A 1 61  ? 9.572   5.632   9.141   1.00 0.61  ? 61  ASN A ND2  5  
ATOM 8812  H H    . ASN A 1 61  ? 6.467   2.878   7.490   1.00 0.27  ? 61  ASN A H    5  
ATOM 8813  H HA   . ASN A 1 61  ? 6.858   2.672   9.717   1.00 0.40  ? 61  ASN A HA   5  
ATOM 8814  H HB2  . ASN A 1 61  ? 7.096   5.686   9.621   1.00 0.67  ? 61  ASN A HB2  5  
ATOM 8815  H HB3  . ASN A 1 61  ? 7.598   4.674   10.970  1.00 0.55  ? 61  ASN A HB3  5  
ATOM 8816  H HD21 . ASN A 1 61  ? 9.200   6.480   9.485   1.00 0.97  ? 61  ASN A HD21 5  
ATOM 8817  H HD22 . ASN A 1 61  ? 10.453  5.562   8.718   1.00 0.74  ? 61  ASN A HD22 5  
ATOM 8818  N N    . GLY A 1 62  ? 4.040   3.558   9.623   1.00 0.37  ? 62  GLY A N    5  
ATOM 8819  C CA   . GLY A 1 62  ? 2.761   3.724   10.279  1.00 0.50  ? 62  GLY A CA   5  
ATOM 8820  C C    . GLY A 1 62  ? 2.152   5.092   10.035  1.00 0.51  ? 62  GLY A C    5  
ATOM 8821  O O    . GLY A 1 62  ? 1.101   5.414   10.588  1.00 0.66  ? 62  GLY A O    5  
ATOM 8822  H H    . GLY A 1 62  ? 4.077   3.231   8.701   1.00 0.34  ? 62  GLY A H    5  
ATOM 8823  H HA2  . GLY A 1 62  ? 2.080   2.970   9.912   1.00 0.55  ? 62  GLY A HA2  5  
ATOM 8824  H HA3  . GLY A 1 62  ? 2.893   3.586   11.342  1.00 0.58  ? 62  GLY A HA3  5  
ATOM 8825  N N    . VAL A 1 63  ? 2.818   5.897   9.218   1.00 0.42  ? 63  VAL A N    5  
ATOM 8826  C CA   . VAL A 1 63  ? 2.316   7.217   8.859   1.00 0.50  ? 63  VAL A CA   5  
ATOM 8827  C C    . VAL A 1 63  ? 1.723   7.188   7.456   1.00 0.43  ? 63  VAL A C    5  
ATOM 8828  O O    . VAL A 1 63  ? 2.367   6.715   6.516   1.00 0.39  ? 63  VAL A O    5  
ATOM 8829  C CB   . VAL A 1 63  ? 3.437   8.281   8.911   1.00 0.61  ? 63  VAL A CB   5  
ATOM 8830  C CG1  . VAL A 1 63  ? 2.885   9.670   8.622   1.00 0.98  ? 63  VAL A CG1  5  
ATOM 8831  C CG2  . VAL A 1 63  ? 4.140   8.251   10.259  1.00 1.17  ? 63  VAL A CG2  5  
ATOM 8832  H H    . VAL A 1 63  ? 3.675   5.598   8.844   1.00 0.36  ? 63  VAL A H    5  
ATOM 8833  H HA   . VAL A 1 63  ? 1.546   7.491   9.566   1.00 0.62  ? 63  VAL A HA   5  
ATOM 8834  H HB   . VAL A 1 63  ? 4.163   8.044   8.148   1.00 1.15  ? 63  VAL A HB   5  
ATOM 8835  H HG11 . VAL A 1 63  ? 3.697   10.381  8.594   1.00 1.65  ? 63  VAL A HG11 5  
ATOM 8836  H HG12 . VAL A 1 63  ? 2.189   9.951   9.399   1.00 1.44  ? 63  VAL A HG12 5  
ATOM 8837  H HG13 . VAL A 1 63  ? 2.377   9.663   7.669   1.00 1.53  ? 63  VAL A HG13 5  
ATOM 8838  H HG21 . VAL A 1 63  ? 4.910   9.008   10.279  1.00 1.72  ? 63  VAL A HG21 5  
ATOM 8839  H HG22 . VAL A 1 63  ? 4.586   7.280   10.409  1.00 1.75  ? 63  VAL A HG22 5  
ATOM 8840  H HG23 . VAL A 1 63  ? 3.424   8.445   11.044  1.00 1.64  ? 63  VAL A HG23 5  
ATOM 8841  N N    . CYS A 1 64  ? 0.495   7.675   7.326   1.00 0.49  ? 64  CYS A N    5  
ATOM 8842  C CA   . CYS A 1 64  ? -0.186  7.709   6.038   1.00 0.49  ? 64  CYS A CA   5  
ATOM 8843  C C    . CYS A 1 64  ? 0.557   8.615   5.067   1.00 0.47  ? 64  CYS A C    5  
ATOM 8844  O O    . CYS A 1 64  ? 0.746   9.803   5.328   1.00 0.51  ? 64  CYS A O    5  
ATOM 8845  C CB   . CYS A 1 64  ? -1.630  8.185   6.204   1.00 0.59  ? 64  CYS A CB   5  
ATOM 8846  S SG   . CYS A 1 64  ? -2.593  8.187   4.671   1.00 1.68  ? 64  CYS A SG   5  
ATOM 8847  H H    . CYS A 1 64  ? 0.030   8.012   8.118   1.00 0.57  ? 64  CYS A H    5  
ATOM 8848  H HA   . CYS A 1 64  ? -0.191  6.707   5.642   1.00 0.51  ? 64  CYS A HA   5  
ATOM 8849  H HB2  . CYS A 1 64  ? -2.135  7.539   6.906   1.00 1.19  ? 64  CYS A HB2  5  
ATOM 8850  H HB3  . CYS A 1 64  ? -1.624  9.193   6.590   1.00 1.14  ? 64  CYS A HB3  5  
ATOM 8851  H HG   . CYS A 1 64  ? -3.290  7.058   4.627   1.00 2.36  ? 64  CYS A HG   5  
ATOM 8852  N N    . MET A 1 65  ? 0.975   8.044   3.950   1.00 0.48  ? 65  MET A N    5  
ATOM 8853  C CA   . MET A 1 65  ? 1.763   8.768   2.969   1.00 0.53  ? 65  MET A CA   5  
ATOM 8854  C C    . MET A 1 65  ? 0.951   9.058   1.715   1.00 0.61  ? 65  MET A C    5  
ATOM 8855  O O    . MET A 1 65  ? 1.441   9.695   0.780   1.00 0.81  ? 65  MET A O    5  
ATOM 8856  C CB   . MET A 1 65  ? 3.024   7.985   2.619   1.00 0.61  ? 65  MET A CB   5  
ATOM 8857  C CG   . MET A 1 65  ? 4.007   7.900   3.771   1.00 0.63  ? 65  MET A CG   5  
ATOM 8858  S SD   . MET A 1 65  ? 4.543   9.528   4.323   1.00 0.61  ? 65  MET A SD   5  
ATOM 8859  C CE   . MET A 1 65  ? 5.553   9.108   5.735   1.00 0.74  ? 65  MET A CE   5  
ATOM 8860  H H    . MET A 1 65  ? 0.742   7.102   3.776   1.00 0.50  ? 65  MET A H    5  
ATOM 8861  H HA   . MET A 1 65  ? 2.052   9.707   3.415   1.00 0.54  ? 65  MET A HA   5  
ATOM 8862  H HB2  . MET A 1 65  ? 2.745   6.982   2.332   1.00 0.69  ? 65  MET A HB2  5  
ATOM 8863  H HB3  . MET A 1 65  ? 3.516   8.467   1.788   1.00 0.65  ? 65  MET A HB3  5  
ATOM 8864  H HG2  . MET A 1 65  ? 3.533   7.390   4.597   1.00 0.66  ? 65  MET A HG2  5  
ATOM 8865  H HG3  . MET A 1 65  ? 4.872   7.339   3.450   1.00 0.74  ? 65  MET A HG3  5  
ATOM 8866  H HE1  . MET A 1 65  ? 5.996   10.007  6.138   1.00 1.42  ? 65  MET A HE1  5  
ATOM 8867  H HE2  . MET A 1 65  ? 6.333   8.427   5.429   1.00 1.16  ? 65  MET A HE2  5  
ATOM 8868  H HE3  . MET A 1 65  ? 4.939   8.638   6.491   1.00 1.11  ? 65  MET A HE3  5  
ATOM 8869  N N    . GLU A 1 66  ? -0.294  8.601   1.707   1.00 0.83  ? 66  GLU A N    5  
ATOM 8870  C CA   . GLU A 1 66  ? -1.202  8.861   0.596   1.00 1.01  ? 66  GLU A CA   5  
ATOM 8871  C C    . GLU A 1 66  ? -1.626  10.331  0.609   1.00 1.08  ? 66  GLU A C    5  
ATOM 8872  O O    . GLU A 1 66  ? -2.665  10.696  1.162   1.00 1.86  ? 66  GLU A O    5  
ATOM 8873  C CB   . GLU A 1 66  ? -2.418  7.925   0.677   1.00 1.29  ? 66  GLU A CB   5  
ATOM 8874  C CG   . GLU A 1 66  ? -3.468  8.149   -0.406  1.00 2.19  ? 66  GLU A CG   5  
ATOM 8875  C CD   . GLU A 1 66  ? -2.892  8.172   -1.809  1.00 3.03  ? 66  GLU A CD   5  
ATOM 8876  O OE1  . GLU A 1 66  ? -2.067  7.288   -2.127  1.00 3.75  ? 66  GLU A OE1  5  
ATOM 8877  O OE2  . GLU A 1 66  ? -3.239  9.076   -2.591  1.00 3.33  ? 66  GLU A OE2  5  
ATOM 8878  H H    . GLU A 1 66  ? -0.612  8.075   2.470   1.00 1.03  ? 66  GLU A H    5  
ATOM 8879  H HA   . GLU A 1 66  ? -0.665  8.664   -0.323  1.00 1.16  ? 66  GLU A HA   5  
ATOM 8880  H HB2  . GLU A 1 66  ? -2.072  6.904   0.598   1.00 1.44  ? 66  GLU A HB2  5  
ATOM 8881  H HB3  . GLU A 1 66  ? -2.892  8.056   1.639   1.00 1.69  ? 66  GLU A HB3  5  
ATOM 8882  H HG2  . GLU A 1 66  ? -4.198  7.354   -0.351  1.00 2.66  ? 66  GLU A HG2  5  
ATOM 8883  H HG3  . GLU A 1 66  ? -3.958  9.094   -0.221  1.00 2.52  ? 66  GLU A HG3  5  
ATOM 8884  N N    . GLY A 1 67  ? -0.791  11.174  0.017   1.00 1.21  ? 67  GLY A N    5  
ATOM 8885  C CA   . GLY A 1 67  ? -1.049  12.600  0.004   1.00 1.36  ? 67  GLY A CA   5  
ATOM 8886  C C    . GLY A 1 67  ? 0.185   13.398  0.381   1.00 1.24  ? 67  GLY A C    5  
ATOM 8887  O O    . GLY A 1 67  ? 0.193   14.627  0.290   1.00 1.47  ? 67  GLY A O    5  
ATOM 8888  H H    . GLY A 1 67  ? 0.018   10.821  -0.415  1.00 1.78  ? 67  GLY A H    5  
ATOM 8889  H HA2  . GLY A 1 67  ? -1.369  12.891  -0.986  1.00 1.51  ? 67  GLY A HA2  5  
ATOM 8890  H HA3  . GLY A 1 67  ? -1.836  12.821  0.708   1.00 1.54  ? 67  GLY A HA3  5  
ATOM 8891  N N    . LYS A 1 68  ? 1.222   12.692  0.820   1.00 0.97  ? 68  LYS A N    5  
ATOM 8892  C CA   . LYS A 1 68  ? 2.491   13.314  1.187   1.00 0.87  ? 68  LYS A CA   5  
ATOM 8893  C C    . LYS A 1 68  ? 3.287   13.709  -0.052  1.00 0.90  ? 68  LYS A C    5  
ATOM 8894  O O    . LYS A 1 68  ? 2.794   13.633  -1.178  1.00 1.06  ? 68  LYS A O    5  
ATOM 8895  C CB   . LYS A 1 68  ? 3.323   12.351  2.035   1.00 0.73  ? 68  LYS A CB   5  
ATOM 8896  C CG   . LYS A 1 68  ? 2.667   11.972  3.345   1.00 1.24  ? 68  LYS A CG   5  
ATOM 8897  C CD   . LYS A 1 68  ? 2.659   13.125  4.327   1.00 2.01  ? 68  LYS A CD   5  
ATOM 8898  C CE   . LYS A 1 68  ? 1.904   12.753  5.588   1.00 2.81  ? 68  LYS A CE   5  
ATOM 8899  N NZ   . LYS A 1 68  ? 1.928   13.843  6.599   1.00 3.36  ? 68  LYS A NZ   5  
ATOM 8900  H H    . LYS A 1 68  ? 1.131   11.718  0.907   1.00 0.95  ? 68  LYS A H    5  
ATOM 8901  H HA   . LYS A 1 68  ? 2.276   14.199  1.764   1.00 0.97  ? 68  LYS A HA   5  
ATOM 8902  H HB2  . LYS A 1 68  ? 3.495   11.447  1.470   1.00 0.95  ? 68  LYS A HB2  5  
ATOM 8903  H HB3  . LYS A 1 68  ? 4.274   12.814  2.255   1.00 0.87  ? 68  LYS A HB3  5  
ATOM 8904  H HG2  . LYS A 1 68  ? 1.647   11.673  3.153   1.00 1.54  ? 68  LYS A HG2  5  
ATOM 8905  H HG3  . LYS A 1 68  ? 3.211   11.147  3.779   1.00 1.43  ? 68  LYS A HG3  5  
ATOM 8906  H HD2  . LYS A 1 68  ? 3.678   13.373  4.586   1.00 2.15  ? 68  LYS A HD2  5  
ATOM 8907  H HD3  . LYS A 1 68  ? 2.182   13.977  3.866   1.00 2.21  ? 68  LYS A HD3  5  
ATOM 8908  H HE2  . LYS A 1 68  ? 0.879   12.541  5.320   1.00 3.07  ? 68  LYS A HE2  5  
ATOM 8909  H HE3  . LYS A 1 68  ? 2.354   11.869  6.012   1.00 3.16  ? 68  LYS A HE3  5  
ATOM 8910  H HZ1  . LYS A 1 68  ? 1.273   13.619  7.381   1.00 3.73  ? 68  LYS A HZ1  5  
ATOM 8911  H HZ2  . LYS A 1 68  ? 1.641   14.746  6.165   1.00 3.59  ? 68  LYS A HZ2  5  
ATOM 8912  H HZ3  . LYS A 1 68  ? 2.888   13.949  6.991   1.00 3.71  ? 68  LYS A HZ3  5  
ATOM 8913  N N    . GLN A 1 69  ? 4.520   14.137  0.172   1.00 0.87  ? 69  GLN A N    5  
ATOM 8914  C CA   . GLN A 1 69  ? 5.395   14.557  -0.908  1.00 0.93  ? 69  GLN A CA   5  
ATOM 8915  C C    . GLN A 1 69  ? 6.563   13.586  -1.048  1.00 0.81  ? 69  GLN A C    5  
ATOM 8916  O O    . GLN A 1 69  ? 6.850   12.833  -0.115  1.00 0.74  ? 69  GLN A O    5  
ATOM 8917  C CB   . GLN A 1 69  ? 5.917   15.972  -0.642  1.00 1.07  ? 69  GLN A CB   5  
ATOM 8918  C CG   . GLN A 1 69  ? 4.818   17.014  -0.497  1.00 1.33  ? 69  GLN A CG   5  
ATOM 8919  C CD   . GLN A 1 69  ? 4.043   17.241  -1.779  1.00 2.12  ? 69  GLN A CD   5  
ATOM 8920  O OE1  . GLN A 1 69  ? 4.408   18.086  -2.593  1.00 2.64  ? 69  GLN A OE1  5  
ATOM 8921  N NE2  . GLN A 1 69  ? 2.975   16.487  -1.973  1.00 2.89  ? 69  GLN A NE2  5  
ATOM 8922  H H    . GLN A 1 69  ? 4.855   14.157  1.090   1.00 0.90  ? 69  GLN A H    5  
ATOM 8923  H HA   . GLN A 1 69  ? 4.824   14.555  -1.824  1.00 1.04  ? 69  GLN A HA   5  
ATOM 8924  H HB2  . GLN A 1 69  ? 6.498   15.961  0.267   1.00 1.06  ? 69  GLN A HB2  5  
ATOM 8925  H HB3  . GLN A 1 69  ? 6.554   16.265  -1.462  1.00 1.25  ? 69  GLN A HB3  5  
ATOM 8926  H HG2  . GLN A 1 69  ? 4.126   16.686  0.266   1.00 1.71  ? 69  GLN A HG2  5  
ATOM 8927  H HG3  . GLN A 1 69  ? 5.265   17.950  -0.196  1.00 1.61  ? 69  GLN A HG3  5  
ATOM 8928  H HE21 . GLN A 1 69  ? 2.742   15.827  -1.287  1.00 2.96  ? 69  GLN A HE21 5  
ATOM 8929  H HE22 . GLN A 1 69  ? 2.453   16.620  -2.799  1.00 3.61  ? 69  GLN A HE22 5  
ATOM 8930  N N    . HIS A 1 70  ? 7.233   13.603  -2.195  1.00 0.84  ? 70  HIS A N    5  
ATOM 8931  C CA   . HIS A 1 70  ? 8.355   12.697  -2.440  1.00 0.79  ? 70  HIS A CA   5  
ATOM 8932  C C    . HIS A 1 70  ? 9.427   12.850  -1.361  1.00 0.70  ? 70  HIS A C    5  
ATOM 8933  O O    . HIS A 1 70  ? 9.954   11.861  -0.854  1.00 0.65  ? 70  HIS A O    5  
ATOM 8934  C CB   . HIS A 1 70  ? 8.958   12.961  -3.823  1.00 0.88  ? 70  HIS A CB   5  
ATOM 8935  C CG   . HIS A 1 70  ? 10.109  12.059  -4.170  1.00 0.90  ? 70  HIS A CG   5  
ATOM 8936  N ND1  . HIS A 1 70  ? 11.423  12.472  -4.155  1.00 1.42  ? 70  HIS A ND1  5  
ATOM 8937  C CD2  . HIS A 1 70  ? 10.132  10.761  -4.549  1.00 1.37  ? 70  HIS A CD2  5  
ATOM 8938  C CE1  . HIS A 1 70  ? 12.202  11.472  -4.509  1.00 1.31  ? 70  HIS A CE1  5  
ATOM 8939  N NE2  . HIS A 1 70  ? 11.447  10.421  -4.755  1.00 1.13  ? 70  HIS A NE2  5  
ATOM 8940  H H    . HIS A 1 70  ? 6.966   14.240  -2.899  1.00 0.93  ? 70  HIS A H    5  
ATOM 8941  H HA   . HIS A 1 70  ? 7.976   11.685  -2.411  1.00 0.78  ? 70  HIS A HA   5  
ATOM 8942  H HB2  . HIS A 1 70  ? 8.194   12.822  -4.571  1.00 0.96  ? 70  HIS A HB2  5  
ATOM 8943  H HB3  . HIS A 1 70  ? 9.311   13.982  -3.862  1.00 0.92  ? 70  HIS A HB3  5  
ATOM 8944  H HD1  . HIS A 1 70  ? 11.739  13.383  -3.918  1.00 2.13  ? 70  HIS A HD1  5  
ATOM 8945  H HD2  . HIS A 1 70  ? 9.276   10.111  -4.670  1.00 2.20  ? 70  HIS A HD2  5  
ATOM 8946  H HE1  . HIS A 1 70  ? 13.279  11.508  -4.585  1.00 1.85  ? 70  HIS A HE1  5  
ATOM 8947  H HE2  . HIS A 1 70  ? 11.761  9.593   -5.193  1.00 1.45  ? 70  HIS A HE2  5  
ATOM 8948  N N    . GLY A 1 71  ? 9.722   14.089  -0.997  1.00 0.72  ? 71  GLY A N    5  
ATOM 8949  C CA   . GLY A 1 71  ? 10.730  14.340  0.014   1.00 0.69  ? 71  GLY A CA   5  
ATOM 8950  C C    . GLY A 1 71  ? 10.305  13.861  1.389   1.00 0.62  ? 71  GLY A C    5  
ATOM 8951  O O    . GLY A 1 71  ? 11.135  13.405  2.175   1.00 0.62  ? 71  GLY A O    5  
ATOM 8952  H H    . GLY A 1 71  ? 9.255   14.846  -1.424  1.00 0.78  ? 71  GLY A H    5  
ATOM 8953  H HA2  . GLY A 1 71  ? 11.638  13.829  -0.267  1.00 0.70  ? 71  GLY A HA2  5  
ATOM 8954  H HA3  . GLY A 1 71  ? 10.925  15.401  0.060   1.00 0.75  ? 71  GLY A HA3  5  
ATOM 8955  N N    . ASP A 1 72  ? 9.006   13.935  1.662   1.00 0.61  ? 72  ASP A N    5  
ATOM 8956  C CA   . ASP A 1 72  ? 8.473   13.561  2.970   1.00 0.58  ? 72  ASP A CA   5  
ATOM 8957  C C    . ASP A 1 72  ? 8.557   12.053  3.167   1.00 0.49  ? 72  ASP A C    5  
ATOM 8958  O O    . ASP A 1 72  ? 9.042   11.575  4.192   1.00 0.44  ? 72  ASP A O    5  
ATOM 8959  C CB   . ASP A 1 72  ? 7.015   14.013  3.096   1.00 0.68  ? 72  ASP A CB   5  
ATOM 8960  C CG   . ASP A 1 72  ? 6.540   14.079  4.534   1.00 1.16  ? 72  ASP A CG   5  
ATOM 8961  O OD1  . ASP A 1 72  ? 6.117   13.043  5.078   1.00 1.47  ? 72  ASP A OD1  5  
ATOM 8962  O OD2  . ASP A 1 72  ? 6.576   15.184  5.120   1.00 2.03  ? 72  ASP A OD2  5  
ATOM 8963  H H    . ASP A 1 72  ? 8.390   14.234  0.964   1.00 0.65  ? 72  ASP A H    5  
ATOM 8964  H HA   . ASP A 1 72  ? 9.066   14.051  3.728   1.00 0.61  ? 72  ASP A HA   5  
ATOM 8965  H HB2  . ASP A 1 72  ? 6.908   14.992  2.657   1.00 1.25  ? 72  ASP A HB2  5  
ATOM 8966  H HB3  . ASP A 1 72  ? 6.384   13.313  2.564   1.00 0.87  ? 72  ASP A HB3  5  
ATOM 8967  N N    . VAL A 1 73  ? 8.121   11.309  2.155   1.00 0.50  ? 73  VAL A N    5  
ATOM 8968  C CA   . VAL A 1 73  ? 8.078   9.852   2.238   1.00 0.45  ? 73  VAL A CA   5  
ATOM 8969  C C    . VAL A 1 73  ? 9.484   9.252   2.298   1.00 0.44  ? 73  VAL A C    5  
ATOM 8970  O O    . VAL A 1 73  ? 9.743   8.338   3.078   1.00 0.43  ? 73  VAL A O    5  
ATOM 8971  C CB   . VAL A 1 73  ? 7.287   9.225   1.059   1.00 0.51  ? 73  VAL A CB   5  
ATOM 8972  C CG1  . VAL A 1 73  ? 5.853   9.726   1.056   1.00 1.08  ? 73  VAL A CG1  5  
ATOM 8973  C CG2  . VAL A 1 73  ? 7.945   9.515   -0.281  1.00 0.97  ? 73  VAL A CG2  5  
ATOM 8974  H H    . VAL A 1 73  ? 7.813   11.752  1.334   1.00 0.56  ? 73  VAL A H    5  
ATOM 8975  H HA   . VAL A 1 73  ? 7.562   9.599   3.153   1.00 0.44  ? 73  VAL A HA   5  
ATOM 8976  H HB   . VAL A 1 73  ? 7.267   8.155   1.200   1.00 0.92  ? 73  VAL A HB   5  
ATOM 8977  H HG11 . VAL A 1 73  ? 5.370   9.442   1.978   1.00 1.67  ? 73  VAL A HG11 5  
ATOM 8978  H HG12 . VAL A 1 73  ? 5.321   9.292   0.221   1.00 1.48  ? 73  VAL A HG12 5  
ATOM 8979  H HG13 . VAL A 1 73  ? 5.850   10.802  0.965   1.00 1.71  ? 73  VAL A HG13 5  
ATOM 8980  H HG21 . VAL A 1 73  ? 8.951   9.123   -0.279  1.00 1.47  ? 73  VAL A HG21 5  
ATOM 8981  H HG22 . VAL A 1 73  ? 7.976   10.582  -0.442  1.00 1.57  ? 73  VAL A HG22 5  
ATOM 8982  H HG23 . VAL A 1 73  ? 7.378   9.046   -1.072  1.00 1.50  ? 73  VAL A HG23 5  
ATOM 8983  N N    . VAL A 1 74  ? 10.394  9.785   1.488   1.00 0.49  ? 74  VAL A N    5  
ATOM 8984  C CA   . VAL A 1 74  ? 11.764  9.285   1.438   1.00 0.53  ? 74  VAL A CA   5  
ATOM 8985  C C    . VAL A 1 74  ? 12.502  9.595   2.738   1.00 0.51  ? 74  VAL A C    5  
ATOM 8986  O O    . VAL A 1 74  ? 13.249  8.762   3.256   1.00 0.52  ? 74  VAL A O    5  
ATOM 8987  C CB   . VAL A 1 74  ? 12.539  9.878   0.237   1.00 0.64  ? 74  VAL A CB   5  
ATOM 8988  C CG1  . VAL A 1 74  ? 14.001  9.457   0.266   1.00 0.72  ? 74  VAL A CG1  5  
ATOM 8989  C CG2  . VAL A 1 74  ? 11.892  9.451   -1.073  1.00 0.70  ? 74  VAL A CG2  5  
ATOM 8990  H H    . VAL A 1 74  ? 10.134  10.533  0.906   1.00 0.52  ? 74  VAL A H    5  
ATOM 8991  H HA   . VAL A 1 74  ? 11.719  8.213   1.314   1.00 0.55  ? 74  VAL A HA   5  
ATOM 8992  H HB   . VAL A 1 74  ? 12.494  10.956  0.301   1.00 0.66  ? 74  VAL A HB   5  
ATOM 8993  H HG11 . VAL A 1 74  ? 14.517  9.890   -0.578  1.00 1.19  ? 74  VAL A HG11 5  
ATOM 8994  H HG12 . VAL A 1 74  ? 14.066  8.380   0.215   1.00 1.34  ? 74  VAL A HG12 5  
ATOM 8995  H HG13 . VAL A 1 74  ? 14.456  9.802   1.182   1.00 1.20  ? 74  VAL A HG13 5  
ATOM 8996  H HG21 . VAL A 1 74  ? 11.910  8.374   -1.151  1.00 1.37  ? 74  VAL A HG21 5  
ATOM 8997  H HG22 . VAL A 1 74  ? 12.439  9.880   -1.899  1.00 1.03  ? 74  VAL A HG22 5  
ATOM 8998  H HG23 . VAL A 1 74  ? 10.869  9.798   -1.099  1.00 1.19  ? 74  VAL A HG23 5  
ATOM 8999  N N    . SER A 1 75  ? 12.270  10.788  3.273   1.00 0.51  ? 75  SER A N    5  
ATOM 9000  C CA   . SER A 1 75  ? 12.905  11.194  4.516   1.00 0.52  ? 75  SER A CA   5  
ATOM 9001  C C    . SER A 1 75  ? 12.399  10.333  5.669   1.00 0.47  ? 75  SER A C    5  
ATOM 9002  O O    . SER A 1 75  ? 13.166  9.951   6.550   1.00 0.51  ? 75  SER A O    5  
ATOM 9003  C CB   . SER A 1 75  ? 12.635  12.673  4.795   1.00 0.58  ? 75  SER A CB   5  
ATOM 9004  O OG   . SER A 1 75  ? 13.492  13.173  5.807   1.00 0.66  ? 75  SER A OG   5  
ATOM 9005  H H    . SER A 1 75  ? 11.659  11.410  2.820   1.00 0.52  ? 75  SER A H    5  
ATOM 9006  H HA   . SER A 1 75  ? 13.969  11.044  4.409   1.00 0.57  ? 75  SER A HA   5  
ATOM 9007  H HB2  . SER A 1 75  ? 12.794  13.242  3.891   1.00 0.61  ? 75  SER A HB2  5  
ATOM 9008  H HB3  . SER A 1 75  ? 11.610  12.792  5.120   1.00 0.57  ? 75  SER A HB3  5  
ATOM 9009  H HG   . SER A 1 75  ? 13.418  14.137  5.835   1.00 1.12  ? 75  SER A HG   5  
ATOM 9010  N N    . ALA A 1 76  ? 11.110  10.012  5.640   1.00 0.42  ? 76  ALA A N    5  
ATOM 9011  C CA   . ALA A 1 76  ? 10.499  9.183   6.672   1.00 0.39  ? 76  ALA A CA   5  
ATOM 9012  C C    . ALA A 1 76  ? 11.134  7.797   6.716   1.00 0.37  ? 76  ALA A C    5  
ATOM 9013  O O    . ALA A 1 76  ? 11.386  7.260   7.793   1.00 0.39  ? 76  ALA A O    5  
ATOM 9014  C CB   . ALA A 1 76  ? 9.001   9.070   6.444   1.00 0.39  ? 76  ALA A CB   5  
ATOM 9015  H H    . ALA A 1 76  ? 10.549  10.350  4.908   1.00 0.42  ? 76  ALA A H    5  
ATOM 9016  H HA   . ALA A 1 76  ? 10.657  9.669   7.624   1.00 0.42  ? 76  ALA A HA   5  
ATOM 9017  H HB1  . ALA A 1 76  ? 8.551   8.543   7.272   1.00 1.09  ? 76  ALA A HB1  5  
ATOM 9018  H HB2  . ALA A 1 76  ? 8.818   8.527   5.528   1.00 1.06  ? 76  ALA A HB2  5  
ATOM 9019  H HB3  . ALA A 1 76  ? 8.571   10.059  6.368   1.00 1.06  ? 76  ALA A HB3  5  
ATOM 9020  N N    . ILE A 1 77  ? 11.399  7.230   5.543   1.00 0.37  ? 77  ILE A N    5  
ATOM 9021  C CA   . ILE A 1 77  ? 12.039  5.920   5.446   1.00 0.39  ? 77  ILE A CA   5  
ATOM 9022  C C    . ILE A 1 77  ? 13.397  5.932   6.147   1.00 0.41  ? 77  ILE A C    5  
ATOM 9023  O O    . ILE A 1 77  ? 13.757  4.996   6.865   1.00 0.44  ? 77  ILE A O    5  
ATOM 9024  C CB   . ILE A 1 77  ? 12.231  5.517   3.969   1.00 0.45  ? 77  ILE A CB   5  
ATOM 9025  C CG1  . ILE A 1 77  ? 10.876  5.448   3.264   1.00 0.53  ? 77  ILE A CG1  5  
ATOM 9026  C CG2  . ILE A 1 77  ? 12.959  4.185   3.854   1.00 0.50  ? 77  ILE A CG2  5  
ATOM 9027  C CD1  . ILE A 1 77  ? 10.981  5.318   1.762   1.00 0.69  ? 77  ILE A CD1  5  
ATOM 9028  H H    . ILE A 1 77  ? 11.145  7.699   4.714   1.00 0.38  ? 77  ILE A H    5  
ATOM 9029  H HA   . ILE A 1 77  ? 11.398  5.192   5.922   1.00 0.40  ? 77  ILE A HA   5  
ATOM 9030  H HB   . ILE A 1 77  ? 12.837  6.272   3.489   1.00 0.50  ? 77  ILE A HB   5  
ATOM 9031  H HG12 . ILE A 1 77  ? 10.328  4.593   3.633   1.00 0.98  ? 77  ILE A HG12 5  
ATOM 9032  H HG13 . ILE A 1 77  ? 10.320  6.346   3.481   1.00 1.00  ? 77  ILE A HG13 5  
ATOM 9033  H HG21 . ILE A 1 77  ? 12.372  3.412   4.326   1.00 1.07  ? 77  ILE A HG21 5  
ATOM 9034  H HG22 . ILE A 1 77  ? 13.920  4.256   4.341   1.00 1.16  ? 77  ILE A HG22 5  
ATOM 9035  H HG23 . ILE A 1 77  ? 13.102  3.942   2.811   1.00 1.05  ? 77  ILE A HG23 5  
ATOM 9036  H HD11 . ILE A 1 77  ? 11.540  4.427   1.516   1.00 1.20  ? 77  ILE A HD11 5  
ATOM 9037  H HD12 . ILE A 1 77  ? 11.488  6.184   1.362   1.00 1.34  ? 77  ILE A HD12 5  
ATOM 9038  H HD13 . ILE A 1 77  ? 9.991   5.251   1.337   1.00 1.35  ? 77  ILE A HD13 5  
ATOM 9039  N N    . ARG A 1 78  ? 14.138  7.007   5.941   1.00 0.43  ? 78  ARG A N    5  
ATOM 9040  C CA   . ARG A 1 78  ? 15.455  7.161   6.544   1.00 0.50  ? 78  ARG A CA   5  
ATOM 9041  C C    . ARG A 1 78  ? 15.339  7.488   8.030   1.00 0.50  ? 78  ARG A C    5  
ATOM 9042  O O    . ARG A 1 78  ? 16.144  7.034   8.844   1.00 0.56  ? 78  ARG A O    5  
ATOM 9043  C CB   . ARG A 1 78  ? 16.232  8.262   5.824   1.00 0.58  ? 78  ARG A CB   5  
ATOM 9044  C CG   . ARG A 1 78  ? 16.401  8.008   4.336   1.00 0.66  ? 78  ARG A CG   5  
ATOM 9045  C CD   . ARG A 1 78  ? 17.072  9.180   3.647   1.00 0.89  ? 78  ARG A CD   5  
ATOM 9046  N NE   . ARG A 1 78  ? 17.198  8.971   2.206   1.00 1.59  ? 78  ARG A NE   5  
ATOM 9047  C CZ   . ARG A 1 78  ? 17.610  9.903   1.353   1.00 2.11  ? 78  ARG A CZ   5  
ATOM 9048  N NH1  . ARG A 1 78  ? 17.904  11.125  1.785   1.00 2.12  ? 78  ARG A NH1  5  
ATOM 9049  N NH2  . ARG A 1 78  ? 17.715  9.610   0.062   1.00 3.09  ? 78  ARG A NH2  5  
ATOM 9050  H H    . ARG A 1 78  ? 13.787  7.723   5.369   1.00 0.42  ? 78  ARG A H    5  
ATOM 9051  H HA   . ARG A 1 78  ? 15.983  6.226   6.432   1.00 0.54  ? 78  ARG A HA   5  
ATOM 9052  H HB2  . ARG A 1 78  ? 15.710  9.201   5.952   1.00 0.60  ? 78  ARG A HB2  5  
ATOM 9053  H HB3  . ARG A 1 78  ? 17.214  8.344   6.266   1.00 0.65  ? 78  ARG A HB3  5  
ATOM 9054  H HG2  . ARG A 1 78  ? 17.009  7.127   4.198   1.00 0.78  ? 78  ARG A HG2  5  
ATOM 9055  H HG3  . ARG A 1 78  ? 15.427  7.851   3.894   1.00 0.83  ? 78  ARG A HG3  5  
ATOM 9056  H HD2  . ARG A 1 78  ? 16.486  10.070  3.823   1.00 1.36  ? 78  ARG A HD2  5  
ATOM 9057  H HD3  . ARG A 1 78  ? 18.059  9.310   4.069   1.00 1.38  ? 78  ARG A HD3  5  
ATOM 9058  H HE   . ARG A 1 78  ? 16.962  8.079   1.854   1.00 2.12  ? 78  ARG A HE   5  
ATOM 9059  H HH11 . ARG A 1 78  ? 17.810  11.354  2.763   1.00 1.97  ? 78  ARG A HH11 5  
ATOM 9060  H HH12 . ARG A 1 78  ? 18.217  11.832  1.135   1.00 2.67  ? 78  ARG A HH12 5  
ATOM 9061  H HH21 . ARG A 1 78  ? 17.475  8.691   -0.265  1.00 3.55  ? 78  ARG A HH21 5  
ATOM 9062  H HH22 . ARG A 1 78  ? 18.033  10.304  -0.596  1.00 3.52  ? 78  ARG A HH22 5  
ATOM 9063  N N    . ALA A 1 79  ? 14.320  8.264   8.376   1.00 0.47  ? 79  ALA A N    5  
ATOM 9064  C CA   . ALA A 1 79  ? 14.125  8.727   9.746   1.00 0.51  ? 79  ALA A CA   5  
ATOM 9065  C C    . ALA A 1 79  ? 13.397  7.691   10.598  1.00 0.43  ? 79  ALA A C    5  
ATOM 9066  O O    . ALA A 1 79  ? 13.023  7.970   11.740  1.00 0.46  ? 79  ALA A O    5  
ATOM 9067  C CB   . ALA A 1 79  ? 13.356  10.041  9.747   1.00 0.65  ? 79  ALA A CB   5  
ATOM 9068  H H    . ALA A 1 79  ? 13.680  8.545   7.683   1.00 0.45  ? 79  ALA A H    5  
ATOM 9069  H HA   . ALA A 1 79  ? 15.098  8.911   10.177  1.00 0.60  ? 79  ALA A HA   5  
ATOM 9070  H HB1  . ALA A 1 79  ? 13.901  10.779  9.178   1.00 1.28  ? 79  ALA A HB1  5  
ATOM 9071  H HB2  . ALA A 1 79  ? 13.236  10.386  10.764  1.00 1.20  ? 79  ALA A HB2  5  
ATOM 9072  H HB3  . ALA A 1 79  ? 12.384  9.890   9.304   1.00 1.18  ? 79  ALA A HB3  5  
ATOM 9073  N N    . GLY A 1 80  ? 13.191  6.503   10.047  1.00 0.41  ? 80  GLY A N    5  
ATOM 9074  C CA   . GLY A 1 80  ? 12.548  5.441   10.798  1.00 0.42  ? 80  GLY A CA   5  
ATOM 9075  C C    . GLY A 1 80  ? 13.506  4.762   11.755  1.00 0.46  ? 80  GLY A C    5  
ATOM 9076  O O    . GLY A 1 80  ? 13.089  4.043   12.659  1.00 0.60  ? 80  GLY A O    5  
ATOM 9077  H H    . GLY A 1 80  ? 13.466  6.350   9.118   1.00 0.46  ? 80  GLY A H    5  
ATOM 9078  H HA2  . GLY A 1 80  ? 11.725  5.857   11.361  1.00 0.51  ? 80  GLY A HA2  5  
ATOM 9079  H HA3  . GLY A 1 80  ? 12.165  4.706   10.106  1.00 0.43  ? 80  GLY A HA3  5  
ATOM 9080  N N    . GLY A 1 81  ? 14.792  5.006   11.559  1.00 0.49  ? 81  GLY A N    5  
ATOM 9081  C CA   . GLY A 1 81  ? 15.807  4.368   12.371  1.00 0.63  ? 81  GLY A CA   5  
ATOM 9082  C C    . GLY A 1 81  ? 16.728  3.524   11.520  1.00 0.64  ? 81  GLY A C    5  
ATOM 9083  O O    . GLY A 1 81  ? 17.195  3.977   10.472  1.00 1.10  ? 81  GLY A O    5  
ATOM 9084  H H    . GLY A 1 81  ? 15.058  5.622   10.847  1.00 0.51  ? 81  GLY A H    5  
ATOM 9085  H HA2  . GLY A 1 81  ? 16.385  5.127   12.878  1.00 0.75  ? 81  GLY A HA2  5  
ATOM 9086  H HA3  . GLY A 1 81  ? 15.328  3.738   13.105  1.00 0.70  ? 81  GLY A HA3  5  
ATOM 9087  N N    . ASP A 1 82  ? 16.996  2.298   11.949  1.00 0.43  ? 82  ASP A N    5  
ATOM 9088  C CA   . ASP A 1 82  ? 17.778  1.382   11.132  1.00 0.44  ? 82  ASP A CA   5  
ATOM 9089  C C    . ASP A 1 82  ? 16.858  0.355   10.490  1.00 0.39  ? 82  ASP A C    5  
ATOM 9090  O O    . ASP A 1 82  ? 17.302  -0.642  9.928   1.00 0.55  ? 82  ASP A O    5  
ATOM 9091  C CB   . ASP A 1 82  ? 18.865  0.689   11.952  1.00 0.55  ? 82  ASP A CB   5  
ATOM 9092  C CG   . ASP A 1 82  ? 20.084  0.359   11.112  1.00 1.41  ? 82  ASP A CG   5  
ATOM 9093  O OD1  . ASP A 1 82  ? 20.724  1.303   10.597  1.00 1.97  ? 82  ASP A OD1  5  
ATOM 9094  O OD2  . ASP A 1 82  ? 20.418  -0.834  10.975  1.00 2.12  ? 82  ASP A OD2  5  
ATOM 9095  H H    . ASP A 1 82  ? 16.674  2.009   12.834  1.00 0.64  ? 82  ASP A H    5  
ATOM 9096  H HA   . ASP A 1 82  ? 18.245  1.961   10.350  1.00 0.51  ? 82  ASP A HA   5  
ATOM 9097  H HB2  . ASP A 1 82  ? 19.170  1.335   12.761  1.00 0.96  ? 82  ASP A HB2  5  
ATOM 9098  H HB3  . ASP A 1 82  ? 18.471  -0.233  12.357  1.00 0.95  ? 82  ASP A HB3  5  
ATOM 9099  N N    . GLU A 1 83  ? 15.562  0.614   10.591  1.00 0.38  ? 83  GLU A N    5  
ATOM 9100  C CA   . GLU A 1 83  ? 14.550  -0.200  9.944   1.00 0.39  ? 83  GLU A CA   5  
ATOM 9101  C C    . GLU A 1 83  ? 13.353  0.670   9.583   1.00 0.38  ? 83  GLU A C    5  
ATOM 9102  O O    . GLU A 1 83  ? 13.183  1.758   10.134  1.00 0.53  ? 83  GLU A O    5  
ATOM 9103  C CB   . GLU A 1 83  ? 14.149  -1.380  10.839  1.00 0.47  ? 83  GLU A CB   5  
ATOM 9104  C CG   . GLU A 1 83  ? 13.882  -1.021  12.295  1.00 0.86  ? 83  GLU A CG   5  
ATOM 9105  C CD   . GLU A 1 83  ? 12.461  -0.568  12.551  1.00 1.62  ? 83  GLU A CD   5  
ATOM 9106  O OE1  . GLU A 1 83  ? 11.541  -1.407  12.477  1.00 2.11  ? 83  GLU A OE1  5  
ATOM 9107  O OE2  . GLU A 1 83  ? 12.255  0.636   12.806  1.00 2.00  ? 83  GLU A OE2  5  
ATOM 9108  H H    . GLU A 1 83  ? 15.272  1.385   11.118  1.00 0.49  ? 83  GLU A H    5  
ATOM 9109  H HA   . GLU A 1 83  ? 14.979  -0.588  9.031   1.00 0.42  ? 83  GLU A HA   5  
ATOM 9110  H HB2  . GLU A 1 83  ? 13.255  -1.828  10.438  1.00 0.89  ? 83  GLU A HB2  5  
ATOM 9111  H HB3  . GLU A 1 83  ? 14.944  -2.108  10.815  1.00 0.82  ? 83  GLU A HB3  5  
ATOM 9112  H HG2  . GLU A 1 83  ? 14.079  -1.889  12.905  1.00 1.20  ? 83  GLU A HG2  5  
ATOM 9113  H HG3  . GLU A 1 83  ? 14.554  -0.226  12.581  1.00 1.09  ? 83  GLU A HG3  5  
ATOM 9114  N N    . THR A 1 84  ? 12.544  0.209   8.645   1.00 0.27  ? 84  THR A N    5  
ATOM 9115  C CA   . THR A 1 84  ? 11.421  0.991   8.169   1.00 0.26  ? 84  THR A CA   5  
ATOM 9116  C C    . THR A 1 84  ? 10.274  0.080   7.754   1.00 0.22  ? 84  THR A C    5  
ATOM 9117  O O    . THR A 1 84  ? 10.488  -1.067  7.351   1.00 0.21  ? 84  THR A O    5  
ATOM 9118  C CB   . THR A 1 84  ? 11.827  1.898   6.985   1.00 0.30  ? 84  THR A CB   5  
ATOM 9119  O OG1  . THR A 1 84  ? 10.764  2.804   6.664   1.00 0.32  ? 84  THR A OG1  5  
ATOM 9120  C CG2  . THR A 1 84  ? 12.180  1.074   5.754   1.00 0.30  ? 84  THR A CG2  5  
ATOM 9121  H H    . THR A 1 84  ? 12.705  -0.683  8.261   1.00 0.23  ? 84  THR A H    5  
ATOM 9122  H HA   . THR A 1 84  ? 11.087  1.621   8.981   1.00 0.30  ? 84  THR A HA   5  
ATOM 9123  H HB   . THR A 1 84  ? 12.698  2.468   7.274   1.00 0.36  ? 84  THR A HB   5  
ATOM 9124  H HG1  . THR A 1 84  ? 10.379  3.149   7.481   1.00 0.60  ? 84  THR A HG1  5  
ATOM 9125  H HG21 . THR A 1 84  ? 12.495  1.732   4.959   1.00 1.03  ? 84  THR A HG21 5  
ATOM 9126  H HG22 . THR A 1 84  ? 11.314  0.512   5.434   1.00 1.05  ? 84  THR A HG22 5  
ATOM 9127  H HG23 . THR A 1 84  ? 12.981  0.392   5.995   1.00 1.09  ? 84  THR A HG23 5  
ATOM 9128  N N    . LYS A 1 85  ? 9.059   0.576   7.896   1.00 0.24  ? 85  LYS A N    5  
ATOM 9129  C CA   . LYS A 1 85  ? 7.884   -0.171  7.488   1.00 0.23  ? 85  LYS A CA   5  
ATOM 9130  C C    . LYS A 1 85  ? 7.244   0.487   6.276   1.00 0.23  ? 85  LYS A C    5  
ATOM 9131  O O    . LYS A 1 85  ? 6.785   1.627   6.350   1.00 0.26  ? 85  LYS A O    5  
ATOM 9132  C CB   . LYS A 1 85  ? 6.868   -0.228  8.625   1.00 0.28  ? 85  LYS A CB   5  
ATOM 9133  C CG   . LYS A 1 85  ? 7.444   -0.700  9.948   1.00 0.37  ? 85  LYS A CG   5  
ATOM 9134  C CD   . LYS A 1 85  ? 6.441   -0.500  11.062  1.00 0.50  ? 85  LYS A CD   5  
ATOM 9135  C CE   . LYS A 1 85  ? 7.081   -0.653  12.431  1.00 0.78  ? 85  LYS A CE   5  
ATOM 9136  N NZ   . LYS A 1 85  ? 6.155   -0.253  13.523  1.00 1.63  ? 85  LYS A NZ   5  
ATOM 9137  H H    . LYS A 1 85  ? 8.950   1.474   8.277   1.00 0.27  ? 85  LYS A H    5  
ATOM 9138  H HA   . LYS A 1 85  ? 8.189   -1.174  7.230   1.00 0.22  ? 85  LYS A HA   5  
ATOM 9139  H HB2  . LYS A 1 85  ? 6.454   0.760   8.770   1.00 0.34  ? 85  LYS A HB2  5  
ATOM 9140  H HB3  . LYS A 1 85  ? 6.074   -0.903  8.344   1.00 0.36  ? 85  LYS A HB3  5  
ATOM 9141  H HG2  . LYS A 1 85  ? 7.683   -1.750  9.873   1.00 0.55  ? 85  LYS A HG2  5  
ATOM 9142  H HG3  . LYS A 1 85  ? 8.338   -0.135  10.168  1.00 0.55  ? 85  LYS A HG3  5  
ATOM 9143  H HD2  . LYS A 1 85  ? 6.027   0.489   10.977  1.00 0.71  ? 85  LYS A HD2  5  
ATOM 9144  H HD3  . LYS A 1 85  ? 5.653   -1.233  10.958  1.00 0.72  ? 85  LYS A HD3  5  
ATOM 9145  H HE2  . LYS A 1 85  ? 7.358   -1.687  12.570  1.00 1.42  ? 85  LYS A HE2  5  
ATOM 9146  H HE3  . LYS A 1 85  ? 7.966   -0.034  12.474  1.00 1.22  ? 85  LYS A HE3  5  
ATOM 9147  H HZ1  . LYS A 1 85  ? 5.902   0.756   13.427  1.00 2.25  ? 85  LYS A HZ1  5  
ATOM 9148  H HZ2  . LYS A 1 85  ? 6.612   -0.395  14.450  1.00 1.97  ? 85  LYS A HZ2  5  
ATOM 9149  H HZ3  . LYS A 1 85  ? 5.287   -0.824  13.486  1.00 2.17  ? 85  LYS A HZ3  5  
ATOM 9150  N N    . LEU A 1 86  ? 7.211   -0.227  5.168   1.00 0.22  ? 86  LEU A N    5  
ATOM 9151  C CA   . LEU A 1 86  ? 6.579   0.271   3.962   1.00 0.22  ? 86  LEU A CA   5  
ATOM 9152  C C    . LEU A 1 86  ? 5.266   -0.457  3.734   1.00 0.22  ? 86  LEU A C    5  
ATOM 9153  O O    . LEU A 1 86  ? 5.239   -1.676  3.584   1.00 0.27  ? 86  LEU A O    5  
ATOM 9154  C CB   . LEU A 1 86  ? 7.501   0.088   2.751   1.00 0.24  ? 86  LEU A CB   5  
ATOM 9155  C CG   . LEU A 1 86  ? 8.841   0.825   2.831   1.00 0.25  ? 86  LEU A CG   5  
ATOM 9156  C CD1  . LEU A 1 86  ? 9.656   0.589   1.571   1.00 0.28  ? 86  LEU A CD1  5  
ATOM 9157  C CD2  . LEU A 1 86  ? 8.623   2.315   3.048   1.00 0.28  ? 86  LEU A CD2  5  
ATOM 9158  H H    . LEU A 1 86  ? 7.614   -1.125  5.164   1.00 0.22  ? 86  LEU A H    5  
ATOM 9159  H HA   . LEU A 1 86  ? 6.379   1.324   4.100   1.00 0.23  ? 86  LEU A HA   5  
ATOM 9160  H HB2  . LEU A 1 86  ? 7.702   -0.967  2.637   1.00 0.24  ? 86  LEU A HB2  5  
ATOM 9161  H HB3  . LEU A 1 86  ? 6.977   0.434   1.871   1.00 0.25  ? 86  LEU A HB3  5  
ATOM 9162  H HG   . LEU A 1 86  ? 9.405   0.442   3.671   1.00 0.26  ? 86  LEU A HG   5  
ATOM 9163  H HD11 . LEU A 1 86  ? 9.851   -0.468  1.460   1.00 1.02  ? 86  LEU A HD11 5  
ATOM 9164  H HD12 . LEU A 1 86  ? 10.592  1.122   1.644   1.00 0.97  ? 86  LEU A HD12 5  
ATOM 9165  H HD13 . LEU A 1 86  ? 9.104   0.945   0.713   1.00 1.02  ? 86  LEU A HD13 5  
ATOM 9166  H HD21 . LEU A 1 86  ? 8.036   2.717   2.235   1.00 1.04  ? 86  LEU A HD21 5  
ATOM 9167  H HD22 . LEU A 1 86  ? 9.579   2.816   3.084   1.00 1.00  ? 86  LEU A HD22 5  
ATOM 9168  H HD23 . LEU A 1 86  ? 8.100   2.472   3.981   1.00 1.03  ? 86  LEU A HD23 5  
ATOM 9169  N N    . LEU A 1 87  ? 4.181   0.288   3.727   1.00 0.20  ? 87  LEU A N    5  
ATOM 9170  C CA   . LEU A 1 87  ? 2.872   -0.294  3.521   1.00 0.21  ? 87  LEU A CA   5  
ATOM 9171  C C    . LEU A 1 87  ? 2.384   0.063   2.128   1.00 0.21  ? 87  LEU A C    5  
ATOM 9172  O O    . LEU A 1 87  ? 2.255   1.244   1.789   1.00 0.26  ? 87  LEU A O    5  
ATOM 9173  C CB   . LEU A 1 87  ? 1.908   0.204   4.599   1.00 0.27  ? 87  LEU A CB   5  
ATOM 9174  C CG   . LEU A 1 87  ? 0.633   -0.623  4.790   1.00 0.39  ? 87  LEU A CG   5  
ATOM 9175  C CD1  . LEU A 1 87  ? 0.245   -0.648  6.252   1.00 0.51  ? 87  LEU A CD1  5  
ATOM 9176  C CD2  . LEU A 1 87  ? -0.513  -0.052  3.981   1.00 0.45  ? 87  LEU A CD2  5  
ATOM 9177  H H    . LEU A 1 87  ? 4.259   1.261   3.858   1.00 0.20  ? 87  LEU A H    5  
ATOM 9178  H HA   . LEU A 1 87  ? 2.967   -1.367  3.595   1.00 0.23  ? 87  LEU A HA   5  
ATOM 9179  H HB2  . LEU A 1 87  ? 2.438   0.227   5.540   1.00 0.29  ? 87  LEU A HB2  5  
ATOM 9180  H HB3  . LEU A 1 87  ? 1.618   1.212   4.345   1.00 0.27  ? 87  LEU A HB3  5  
ATOM 9181  H HG   . LEU A 1 87  ? 0.809   -1.638  4.466   1.00 0.63  ? 87  LEU A HG   5  
ATOM 9182  H HD11 . LEU A 1 87  ? 0.101   0.364   6.603   1.00 1.22  ? 87  LEU A HD11 5  
ATOM 9183  H HD12 . LEU A 1 87  ? 1.026   -1.122  6.827   1.00 1.05  ? 87  LEU A HD12 5  
ATOM 9184  H HD13 . LEU A 1 87  ? -0.676  -1.200  6.368   1.00 1.12  ? 87  LEU A HD13 5  
ATOM 9185  H HD21 . LEU A 1 87  ? -0.719  0.955   4.312   1.00 1.05  ? 87  LEU A HD21 5  
ATOM 9186  H HD22 . LEU A 1 87  ? -1.392  -0.664  4.127   1.00 1.12  ? 87  LEU A HD22 5  
ATOM 9187  H HD23 . LEU A 1 87  ? -0.250  -0.043  2.934   1.00 1.19  ? 87  LEU A HD23 5  
ATOM 9188  N N    . VAL A 1 88  ? 2.133   -0.953  1.318   1.00 0.20  ? 88  VAL A N    5  
ATOM 9189  C CA   . VAL A 1 88  ? 1.786   -0.743  -0.078  1.00 0.23  ? 88  VAL A CA   5  
ATOM 9190  C C    . VAL A 1 88  ? 0.486   -1.454  -0.429  1.00 0.24  ? 88  VAL A C    5  
ATOM 9191  O O    . VAL A 1 88  ? -0.010  -2.277  0.342   1.00 0.27  ? 88  VAL A O    5  
ATOM 9192  C CB   . VAL A 1 88  ? 2.908   -1.232  -1.026  1.00 0.28  ? 88  VAL A CB   5  
ATOM 9193  C CG1  . VAL A 1 88  ? 4.192   -0.452  -0.794  1.00 0.31  ? 88  VAL A CG1  5  
ATOM 9194  C CG2  . VAL A 1 88  ? 3.160   -2.722  -0.852  1.00 0.33  ? 88  VAL A CG2  5  
ATOM 9195  H H    . VAL A 1 88  ? 2.174   -1.871  1.670   1.00 0.20  ? 88  VAL A H    5  
ATOM 9196  H HA   . VAL A 1 88  ? 1.654   0.319   -0.230  1.00 0.26  ? 88  VAL A HA   5  
ATOM 9197  H HB   . VAL A 1 88  ? 2.592   -1.061  -2.044  1.00 0.32  ? 88  VAL A HB   5  
ATOM 9198  H HG11 . VAL A 1 88  ? 4.515   -0.586  0.227   1.00 1.05  ? 88  VAL A HG11 5  
ATOM 9199  H HG12 . VAL A 1 88  ? 4.013   0.597   -0.981  1.00 1.02  ? 88  VAL A HG12 5  
ATOM 9200  H HG13 . VAL A 1 88  ? 4.957   -0.811  -1.466  1.00 1.03  ? 88  VAL A HG13 5  
ATOM 9201  H HG21 . VAL A 1 88  ? 2.244   -3.265  -1.032  1.00 1.07  ? 88  VAL A HG21 5  
ATOM 9202  H HG22 . VAL A 1 88  ? 3.500   -2.915  0.155   1.00 1.02  ? 88  VAL A HG22 5  
ATOM 9203  H HG23 . VAL A 1 88  ? 3.913   -3.043  -1.555  1.00 1.09  ? 88  VAL A HG23 5  
ATOM 9204  N N    . VAL A 1 89  ? -0.068  -1.114  -1.586  1.00 0.24  ? 89  VAL A N    5  
ATOM 9205  C CA   . VAL A 1 89  ? -1.307  -1.714  -2.055  1.00 0.27  ? 89  VAL A CA   5  
ATOM 9206  C C    . VAL A 1 89  ? -1.139  -2.265  -3.466  1.00 0.34  ? 89  VAL A C    5  
ATOM 9207  O O    . VAL A 1 89  ? -0.520  -1.632  -4.325  1.00 0.42  ? 89  VAL A O    5  
ATOM 9208  C CB   . VAL A 1 89  ? -2.482  -0.705  -2.047  1.00 0.25  ? 89  VAL A CB   5  
ATOM 9209  C CG1  . VAL A 1 89  ? -2.915  -0.378  -0.629  1.00 0.29  ? 89  VAL A CG1  5  
ATOM 9210  C CG2  . VAL A 1 89  ? -2.111  0.570   -2.793  1.00 0.30  ? 89  VAL A CG2  5  
ATOM 9211  H H    . VAL A 1 89  ? 0.373   -0.438  -2.145  1.00 0.26  ? 89  VAL A H    5  
ATOM 9212  H HA   . VAL A 1 89  ? -1.554  -2.530  -1.391  1.00 0.32  ? 89  VAL A HA   5  
ATOM 9213  H HB   . VAL A 1 89  ? -3.320  -1.160  -2.556  1.00 0.28  ? 89  VAL A HB   5  
ATOM 9214  H HG11 . VAL A 1 89  ? -2.091  0.073   -0.094  1.00 1.04  ? 89  VAL A HG11 5  
ATOM 9215  H HG12 . VAL A 1 89  ? -3.219  -1.283  -0.128  1.00 1.07  ? 89  VAL A HG12 5  
ATOM 9216  H HG13 . VAL A 1 89  ? -3.747  0.312   -0.658  1.00 1.01  ? 89  VAL A HG13 5  
ATOM 9217  H HG21 . VAL A 1 89  ? -1.869  0.332   -3.818  1.00 1.03  ? 89  VAL A HG21 5  
ATOM 9218  H HG22 . VAL A 1 89  ? -1.256  1.029   -2.318  1.00 1.08  ? 89  VAL A HG22 5  
ATOM 9219  H HG23 . VAL A 1 89  ? -2.946  1.255   -2.770  1.00 1.05  ? 89  VAL A HG23 5  
ATOM 9220  N N    . ASP A 1 90  ? -1.678  -3.458  -3.678  1.00 0.41  ? 90  ASP A N    5  
ATOM 9221  C CA   . ASP A 1 90  ? -1.679  -4.094  -4.991  1.00 0.51  ? 90  ASP A CA   5  
ATOM 9222  C C    . ASP A 1 90  ? -2.620  -3.359  -5.935  1.00 0.48  ? 90  ASP A C    5  
ATOM 9223  O O    . ASP A 1 90  ? -3.440  -2.556  -5.485  1.00 0.45  ? 90  ASP A O    5  
ATOM 9224  C CB   . ASP A 1 90  ? -2.136  -5.551  -4.881  1.00 0.68  ? 90  ASP A CB   5  
ATOM 9225  C CG   . ASP A 1 90  ? -1.375  -6.339  -3.836  1.00 1.20  ? 90  ASP A CG   5  
ATOM 9226  O OD1  . ASP A 1 90  ? -1.637  -6.141  -2.632  1.00 1.92  ? 90  ASP A OD1  5  
ATOM 9227  O OD2  . ASP A 1 90  ? -0.539  -7.181  -4.213  1.00 1.86  ? 90  ASP A OD2  5  
ATOM 9228  H H    . ASP A 1 90  ? -2.067  -3.942  -2.921  1.00 0.44  ? 90  ASP A H    5  
ATOM 9229  H HA   . ASP A 1 90  ? -0.675  -4.061  -5.386  1.00 0.59  ? 90  ASP A HA   5  
ATOM 9230  H HB2  . ASP A 1 90  ? -3.183  -5.571  -4.621  1.00 1.54  ? 90  ASP A HB2  5  
ATOM 9231  H HB3  . ASP A 1 90  ? -1.999  -6.034  -5.837  1.00 1.21  ? 90  ASP A HB3  5  
ATOM 9232  N N    . ARG A 1 91  ? -2.525  -3.639  -7.231  1.00 0.57  ? 91  ARG A N    5  
ATOM 9233  C CA   . ARG A 1 91  ? -3.401  -3.006  -8.214  1.00 0.61  ? 91  ARG A CA   5  
ATOM 9234  C C    . ARG A 1 91  ? -4.871  -3.241  -7.864  1.00 0.55  ? 91  ARG A C    5  
ATOM 9235  O O    . ARG A 1 91  ? -5.673  -2.304  -7.849  1.00 0.55  ? 91  ARG A O    5  
ATOM 9236  C CB   . ARG A 1 91  ? -3.121  -3.534  -9.624  1.00 0.75  ? 91  ARG A CB   5  
ATOM 9237  C CG   . ARG A 1 91  ? -3.984  -2.868  -10.681 1.00 0.82  ? 91  ARG A CG   5  
ATOM 9238  C CD   . ARG A 1 91  ? -3.838  -3.526  -12.040 1.00 1.44  ? 91  ARG A CD   5  
ATOM 9239  N NE   . ARG A 1 91  ? -4.709  -2.893  -13.026 1.00 2.25  ? 91  ARG A NE   5  
ATOM 9240  C CZ   . ARG A 1 91  ? -5.086  -3.456  -14.171 1.00 3.13  ? 91  ARG A CZ   5  
ATOM 9241  N NH1  . ARG A 1 91  ? -4.688  -4.685  -14.472 1.00 3.39  ? 91  ARG A NH1  5  
ATOM 9242  N NH2  . ARG A 1 91  ? -5.867  -2.788  -15.009 1.00 4.16  ? 91  ARG A NH2  5  
ATOM 9243  H H    . ARG A 1 91  ? -1.835  -4.269  -7.536  1.00 0.66  ? 91  ARG A H    5  
ATOM 9244  H HA   . ARG A 1 91  ? -3.207  -1.943  -8.194  1.00 0.63  ? 91  ARG A HA   5  
ATOM 9245  H HB2  . ARG A 1 91  ? -2.084  -3.355  -9.866  1.00 0.85  ? 91  ARG A HB2  5  
ATOM 9246  H HB3  . ARG A 1 91  ? -3.313  -4.597  -9.647  1.00 0.78  ? 91  ARG A HB3  5  
ATOM 9247  H HG2  . ARG A 1 91  ? -5.017  -2.929  -10.377 1.00 1.07  ? 91  ARG A HG2  5  
ATOM 9248  H HG3  . ARG A 1 91  ? -3.694  -1.831  -10.762 1.00 1.01  ? 91  ARG A HG3  5  
ATOM 9249  H HD2  . ARG A 1 91  ? -2.811  -3.437  -12.364 1.00 1.95  ? 91  ARG A HD2  5  
ATOM 9250  H HD3  . ARG A 1 91  ? -4.102  -4.569  -11.953 1.00 1.87  ? 91  ARG A HD3  5  
ATOM 9251  H HE   . ARG A 1 91  ? -5.039  -1.988  -12.815 1.00 2.59  ? 91  ARG A HE   5  
ATOM 9252  H HH11 . ARG A 1 91  ? -4.098  -5.192  -13.841 1.00 3.07  ? 91  ARG A HH11 5  
ATOM 9253  H HH12 . ARG A 1 91  ? -4.993  -5.120  -15.329 1.00 4.20  ? 91  ARG A HH12 5  
ATOM 9254  H HH21 . ARG A 1 91  ? -6.174  -1.854  -14.780 1.00 4.40  ? 91  ARG A HH21 5  
ATOM 9255  H HH22 . ARG A 1 91  ? -6.159  -3.208  -15.876 1.00 4.87  ? 91  ARG A HH22 5  
ATOM 9256  N N    . GLU A 1 92  ? -5.205  -4.494  -7.558  1.00 0.57  ? 92  GLU A N    5  
ATOM 9257  C CA   . GLU A 1 92  ? -6.580  -4.870  -7.232  1.00 0.61  ? 92  GLU A CA   5  
ATOM 9258  C C    . GLU A 1 92  ? -7.061  -4.105  -6.003  1.00 0.51  ? 92  GLU A C    5  
ATOM 9259  O O    . GLU A 1 92  ? -8.210  -3.672  -5.929  1.00 0.56  ? 92  GLU A O    5  
ATOM 9260  C CB   . GLU A 1 92  ? -6.671  -6.382  -6.983  1.00 0.74  ? 92  GLU A CB   5  
ATOM 9261  C CG   . GLU A 1 92  ? -5.894  -6.847  -5.758  1.00 1.44  ? 92  GLU A CG   5  
ATOM 9262  C CD   . GLU A 1 92  ? -5.724  -8.349  -5.695  1.00 1.98  ? 92  GLU A CD   5  
ATOM 9263  O OE1  . GLU A 1 92  ? -4.899  -8.885  -6.472  1.00 2.26  ? 92  GLU A OE1  5  
ATOM 9264  O OE2  . GLU A 1 92  ? -6.399  -8.993  -4.867  1.00 2.68  ? 92  GLU A OE2  5  
ATOM 9265  H H    . GLU A 1 92  ? -4.507  -5.184  -7.543  1.00 0.59  ? 92  GLU A H    5  
ATOM 9266  H HA   . GLU A 1 92  ? -7.204  -4.610  -8.073  1.00 0.67  ? 92  GLU A HA   5  
ATOM 9267  H HB2  . GLU A 1 92  ? -7.708  -6.651  -6.846  1.00 1.34  ? 92  GLU A HB2  5  
ATOM 9268  H HB3  . GLU A 1 92  ? -6.286  -6.902  -7.843  1.00 1.23  ? 92  GLU A HB3  5  
ATOM 9269  H HG2  . GLU A 1 92  ? -4.930  -6.390  -5.773  1.00 1.97  ? 92  GLU A HG2  5  
ATOM 9270  H HG3  . GLU A 1 92  ? -6.419  -6.523  -4.875  1.00 1.93  ? 92  GLU A HG3  5  
ATOM 9271  N N    . THR A 1 93  ? -6.156  -3.933  -5.057  1.00 0.44  ? 93  THR A N    5  
ATOM 9272  C CA   . THR A 1 93  ? -6.448  -3.256  -3.813  1.00 0.38  ? 93  THR A CA   5  
ATOM 9273  C C    . THR A 1 93  ? -6.631  -1.759  -4.044  1.00 0.33  ? 93  THR A C    5  
ATOM 9274  O O    . THR A 1 93  ? -7.607  -1.166  -3.588  1.00 0.37  ? 93  THR A O    5  
ATOM 9275  C CB   . THR A 1 93  ? -5.296  -3.475  -2.818  1.00 0.36  ? 93  THR A CB   5  
ATOM 9276  O OG1  . THR A 1 93  ? -5.005  -4.878  -2.717  1.00 0.47  ? 93  THR A OG1  5  
ATOM 9277  C CG2  . THR A 1 93  ? -5.639  -2.917  -1.447  1.00 0.36  ? 93  THR A CG2  5  
ATOM 9278  H H    . THR A 1 93  ? -5.253  -4.283  -5.202  1.00 0.45  ? 93  THR A H    5  
ATOM 9279  H HA   . THR A 1 93  ? -7.356  -3.676  -3.396  1.00 0.45  ? 93  THR A HA   5  
ATOM 9280  H HB   . THR A 1 93  ? -4.425  -2.958  -3.192  1.00 0.33  ? 93  THR A HB   5  
ATOM 9281  H HG1  . THR A 1 93  ? -4.055  -5.009  -2.619  1.00 0.82  ? 93  THR A HG1  5  
ATOM 9282  H HG21 . THR A 1 93  ? -6.520  -3.413  -1.066  1.00 1.00  ? 93  THR A HG21 5  
ATOM 9283  H HG22 . THR A 1 93  ? -5.830  -1.858  -1.530  1.00 1.04  ? 93  THR A HG22 5  
ATOM 9284  H HG23 . THR A 1 93  ? -4.812  -3.082  -0.773  1.00 1.08  ? 93  THR A HG23 5  
ATOM 9285  N N    . ASP A 1 94  ? -5.691  -1.163  -4.773  1.00 0.33  ? 94  ASP A N    5  
ATOM 9286  C CA   . ASP A 1 94  ? -5.709  0.275   -5.017  1.00 0.39  ? 94  ASP A CA   5  
ATOM 9287  C C    . ASP A 1 94  ? -6.974  0.686   -5.749  1.00 0.43  ? 94  ASP A C    5  
ATOM 9288  O O    . ASP A 1 94  ? -7.675  1.597   -5.318  1.00 0.50  ? 94  ASP A O    5  
ATOM 9289  C CB   . ASP A 1 94  ? -4.485  0.700   -5.830  1.00 0.48  ? 94  ASP A CB   5  
ATOM 9290  C CG   . ASP A 1 94  ? -4.520  2.169   -6.207  1.00 0.71  ? 94  ASP A CG   5  
ATOM 9291  O OD1  . ASP A 1 94  ? -4.571  3.019   -5.295  1.00 0.77  ? 94  ASP A OD1  5  
ATOM 9292  O OD2  . ASP A 1 94  ? -4.463  2.483   -7.411  1.00 1.18  ? 94  ASP A OD2  5  
ATOM 9293  H H    . ASP A 1 94  ? -4.963  -1.704  -5.158  1.00 0.34  ? 94  ASP A H    5  
ATOM 9294  H HA   . ASP A 1 94  ? -5.684  0.774   -4.059  1.00 0.43  ? 94  ASP A HA   5  
ATOM 9295  H HB2  . ASP A 1 94  ? -3.595  0.517   -5.249  1.00 0.48  ? 94  ASP A HB2  5  
ATOM 9296  H HB3  . ASP A 1 94  ? -4.445  0.115   -6.738  1.00 0.53  ? 94  ASP A HB3  5  
ATOM 9297  N N    . GLU A 1 95  ? -7.292  -0.022  -6.823  1.00 0.43  ? 95  GLU A N    5  
ATOM 9298  C CA   . GLU A 1 95  ? -8.475  0.294   -7.611  1.00 0.49  ? 95  GLU A CA   5  
ATOM 9299  C C    . GLU A 1 95  ? -9.751  0.075   -6.801  1.00 0.45  ? 95  GLU A C    5  
ATOM 9300  O O    . GLU A 1 95  ? -10.765 0.735   -7.037  1.00 0.50  ? 95  GLU A O    5  
ATOM 9301  C CB   . GLU A 1 95  ? -8.510  -0.526  -8.901  1.00 0.60  ? 95  GLU A CB   5  
ATOM 9302  C CG   . GLU A 1 95  ? -7.418  -0.147  -9.891  1.00 0.72  ? 95  GLU A CG   5  
ATOM 9303  C CD   . GLU A 1 95  ? -7.672  -0.710  -11.272 1.00 1.17  ? 95  GLU A CD   5  
ATOM 9304  O OE1  . GLU A 1 95  ? -8.773  -0.479  -11.809 1.00 1.23  ? 95  GLU A OE1  5  
ATOM 9305  O OE2  . GLU A 1 95  ? -6.773  -1.369  -11.838 1.00 1.94  ? 95  GLU A OE2  5  
ATOM 9306  H H    . GLU A 1 95  ? -6.710  -0.765  -7.101  1.00 0.44  ? 95  GLU A H    5  
ATOM 9307  H HA   . GLU A 1 95  ? -8.416  1.340   -7.870  1.00 0.54  ? 95  GLU A HA   5  
ATOM 9308  H HB2  . GLU A 1 95  ? -8.398  -1.572  -8.655  1.00 0.60  ? 95  GLU A HB2  5  
ATOM 9309  H HB3  . GLU A 1 95  ? -9.466  -0.379  -9.381  1.00 0.66  ? 95  GLU A HB3  5  
ATOM 9310  H HG2  . GLU A 1 95  ? -7.372  0.929   -9.959  1.00 1.08  ? 95  GLU A HG2  5  
ATOM 9311  H HG3  . GLU A 1 95  ? -6.472  -0.526  -9.530  1.00 1.05  ? 95  GLU A HG3  5  
ATOM 9312  N N    . PHE A 1 96  ? -9.686  -0.834  -5.837  1.00 0.41  ? 96  PHE A N    5  
ATOM 9313  C CA   . PHE A 1 96  ? -10.814 -1.099  -4.958  1.00 0.41  ? 96  PHE A CA   5  
ATOM 9314  C C    . PHE A 1 96  ? -11.031 0.082   -4.015  1.00 0.36  ? 96  PHE A C    5  
ATOM 9315  O O    . PHE A 1 96  ? -12.150 0.575   -3.873  1.00 0.40  ? 96  PHE A O    5  
ATOM 9316  C CB   . PHE A 1 96  ? -10.565 -2.389  -4.166  1.00 0.44  ? 96  PHE A CB   5  
ATOM 9317  C CG   . PHE A 1 96  ? -11.706 -2.794  -3.274  1.00 0.51  ? 96  PHE A CG   5  
ATOM 9318  C CD1  . PHE A 1 96  ? -12.870 -3.317  -3.811  1.00 0.63  ? 96  PHE A CD1  5  
ATOM 9319  C CD2  . PHE A 1 96  ? -11.612 -2.647  -1.898  1.00 0.52  ? 96  PHE A CD2  5  
ATOM 9320  C CE1  . PHE A 1 96  ? -13.920 -3.686  -2.993  1.00 0.73  ? 96  PHE A CE1  5  
ATOM 9321  C CE2  . PHE A 1 96  ? -12.661 -3.016  -1.076  1.00 0.62  ? 96  PHE A CE2  5  
ATOM 9322  C CZ   . PHE A 1 96  ? -13.810 -3.550  -1.624  1.00 0.72  ? 96  PHE A CZ   5  
ATOM 9323  H H    . PHE A 1 96  ? -8.857  -1.342  -5.716  1.00 0.41  ? 96  PHE A H    5  
ATOM 9324  H HA   . PHE A 1 96  ? -11.693 -1.225  -5.572  1.00 0.46  ? 96  PHE A HA   5  
ATOM 9325  H HB2  . PHE A 1 96  ? -10.387 -3.196  -4.860  1.00 0.49  ? 96  PHE A HB2  5  
ATOM 9326  H HB3  . PHE A 1 96  ? -9.688  -2.257  -3.547  1.00 0.41  ? 96  PHE A HB3  5  
ATOM 9327  H HD1  . PHE A 1 96  ? -12.955 -3.438  -4.881  1.00 0.67  ? 96  PHE A HD1  5  
ATOM 9328  H HD2  . PHE A 1 96  ? -10.708 -2.239  -1.469  1.00 0.48  ? 96  PHE A HD2  5  
ATOM 9329  H HE1  . PHE A 1 96  ? -14.822 -4.093  -3.425  1.00 0.83  ? 96  PHE A HE1  5  
ATOM 9330  H HE2  . PHE A 1 96  ? -12.578 -2.897  -0.006  1.00 0.66  ? 96  PHE A HE2  5  
ATOM 9331  H HZ   . PHE A 1 96  ? -14.628 -3.845  -0.982  1.00 0.81  ? 96  PHE A HZ   5  
ATOM 9332  N N    . PHE A 1 97  ? -9.956  0.540   -3.387  1.00 0.32  ? 97  PHE A N    5  
ATOM 9333  C CA   . PHE A 1 97  ? -10.014 1.697   -2.501  1.00 0.32  ? 97  PHE A CA   5  
ATOM 9334  C C    . PHE A 1 97  ? -10.332 2.984   -3.266  1.00 0.39  ? 97  PHE A C    5  
ATOM 9335  O O    . PHE A 1 97  ? -11.043 3.840   -2.749  1.00 0.44  ? 97  PHE A O    5  
ATOM 9336  C CB   . PHE A 1 97  ? -8.704  1.851   -1.724  1.00 0.30  ? 97  PHE A CB   5  
ATOM 9337  C CG   . PHE A 1 97  ? -8.578  0.933   -0.536  1.00 0.29  ? 97  PHE A CG   5  
ATOM 9338  C CD1  . PHE A 1 97  ? -8.182  -0.387  -0.689  1.00 0.37  ? 97  PHE A CD1  5  
ATOM 9339  C CD2  . PHE A 1 97  ? -8.847  1.399   0.739   1.00 0.38  ? 97  PHE A CD2  5  
ATOM 9340  C CE1  . PHE A 1 97  ? -8.060  -1.220  0.408   1.00 0.40  ? 97  PHE A CE1  5  
ATOM 9341  C CE2  . PHE A 1 97  ? -8.729  0.570   1.838   1.00 0.41  ? 97  PHE A CE2  5  
ATOM 9342  C CZ   . PHE A 1 97  ? -8.333  -0.741  1.673   1.00 0.35  ? 97  PHE A CZ   5  
ATOM 9343  H H    . PHE A 1 97  ? -9.091  0.082   -3.516  1.00 0.30  ? 97  PHE A H    5  
ATOM 9344  H HA   . PHE A 1 97  ? -10.820 1.521   -1.794  1.00 0.34  ? 97  PHE A HA   5  
ATOM 9345  H HB2  . PHE A 1 97  ? -7.878  1.646   -2.386  1.00 0.29  ? 97  PHE A HB2  5  
ATOM 9346  H HB3  . PHE A 1 97  ? -8.625  2.868   -1.367  1.00 0.35  ? 97  PHE A HB3  5  
ATOM 9347  H HD1  . PHE A 1 97  ? -7.966  -0.763  -1.679  1.00 0.50  ? 97  PHE A HD1  5  
ATOM 9348  H HD2  . PHE A 1 97  ? -9.158  2.425   0.873   1.00 0.53  ? 97  PHE A HD2  5  
ATOM 9349  H HE1  . PHE A 1 97  ? -7.751  -2.247  0.274   1.00 0.55  ? 97  PHE A HE1  5  
ATOM 9350  H HE2  . PHE A 1 97  ? -8.942  0.950   2.827   1.00 0.55  ? 97  PHE A HE2  5  
ATOM 9351  H HZ   . PHE A 1 97  ? -8.237  -1.389  2.533   1.00 0.40  ? 97  PHE A HZ   5  
ATOM 9352  N N    . LYS A 1 98  ? -9.806  3.122   -4.485  1.00 0.43  ? 98  LYS A N    5  
ATOM 9353  C CA   . LYS A 1 98  ? -10.010 4.341   -5.280  1.00 0.53  ? 98  LYS A CA   5  
ATOM 9354  C C    . LYS A 1 98  ? -11.492 4.624   -5.507  1.00 0.56  ? 98  LYS A C    5  
ATOM 9355  O O    . LYS A 1 98  ? -11.957 5.735   -5.256  1.00 0.61  ? 98  LYS A O    5  
ATOM 9356  C CB   . LYS A 1 98  ? -9.327  4.222   -6.646  1.00 0.63  ? 98  LYS A CB   5  
ATOM 9357  C CG   . LYS A 1 98  ? -7.813  4.256   -6.596  1.00 0.85  ? 98  LYS A CG   5  
ATOM 9358  C CD   . LYS A 1 98  ? -7.205  3.892   -7.941  1.00 1.13  ? 98  LYS A CD   5  
ATOM 9359  C CE   . LYS A 1 98  ? -7.399  4.986   -8.978  1.00 1.31  ? 98  LYS A CE   5  
ATOM 9360  N NZ   . LYS A 1 98  ? -6.614  6.207   -8.652  1.00 1.92  ? 98  LYS A NZ   5  
ATOM 9361  H H    . LYS A 1 98  ? -9.251  2.395   -4.853  1.00 0.41  ? 98  LYS A H    5  
ATOM 9362  H HA   . LYS A 1 98  ? -9.573  5.167   -4.741  1.00 0.56  ? 98  LYS A HA   5  
ATOM 9363  H HB2  . LYS A 1 98  ? -9.624  3.288   -7.101  1.00 0.80  ? 98  LYS A HB2  5  
ATOM 9364  H HB3  . LYS A 1 98  ? -9.665  5.037   -7.270  1.00 0.82  ? 98  LYS A HB3  5  
ATOM 9365  H HG2  . LYS A 1 98  ? -7.494  5.251   -6.325  1.00 1.09  ? 98  LYS A HG2  5  
ATOM 9366  H HG3  . LYS A 1 98  ? -7.470  3.550   -5.852  1.00 1.12  ? 98  LYS A HG3  5  
ATOM 9367  H HD2  . LYS A 1 98  ? -6.148  3.723   -7.810  1.00 1.77  ? 98  LYS A HD2  5  
ATOM 9368  H HD3  . LYS A 1 98  ? -7.671  2.985   -8.300  1.00 1.65  ? 98  LYS A HD3  5  
ATOM 9369  H HE2  . LYS A 1 98  ? -7.081  4.612   -9.940  1.00 1.69  ? 98  LYS A HE2  5  
ATOM 9370  H HE3  . LYS A 1 98  ? -8.447  5.242   -9.021  1.00 1.94  ? 98  LYS A HE3  5  
ATOM 9371  H HZ1  . LYS A 1 98  ? -5.616  5.952   -8.479  1.00 2.12  ? 98  LYS A HZ1  5  
ATOM 9372  H HZ2  . LYS A 1 98  ? -6.998  6.668   -7.798  1.00 2.50  ? 98  LYS A HZ2  5  
ATOM 9373  H HZ3  . LYS A 1 98  ? -6.656  6.882   -9.444  1.00 2.45  ? 98  LYS A HZ3  5  
ATOM 9374  N N    . LYS A 1 99  ? -12.230 3.616   -5.963  1.00 0.55  ? 99  LYS A N    5  
ATOM 9375  C CA   . LYS A 1 99  ? -13.656 3.779   -6.246  1.00 0.63  ? 99  LYS A CA   5  
ATOM 9376  C C    . LYS A 1 99  ? -14.452 3.913   -4.952  1.00 0.63  ? 99  LYS A C    5  
ATOM 9377  O O    . LYS A 1 99  ? -15.464 4.606   -4.894  1.00 0.75  ? 99  LYS A O    5  
ATOM 9378  C CB   . LYS A 1 99  ? -14.179 2.594   -7.059  1.00 0.66  ? 99  LYS A CB   5  
ATOM 9379  C CG   . LYS A 1 99  ? -13.917 1.246   -6.408  1.00 0.60  ? 99  LYS A CG   5  
ATOM 9380  C CD   . LYS A 1 99  ? -14.749 0.151   -7.042  1.00 0.76  ? 99  LYS A CD   5  
ATOM 9381  C CE   . LYS A 1 99  ? -16.237 0.412   -6.866  1.00 1.62  ? 99  LYS A CE   5  
ATOM 9382  N NZ   . LYS A 1 99  ? -16.646 0.429   -5.435  1.00 2.04  ? 99  LYS A NZ   5  
ATOM 9383  H H    . LYS A 1 99  ? -11.806 2.744   -6.120  1.00 0.53  ? 99  LYS A H    5  
ATOM 9384  H HA   . LYS A 1 99  ? -13.779 4.681   -6.824  1.00 0.70  ? 99  LYS A HA   5  
ATOM 9385  H HB2  . LYS A 1 99  ? -15.247 2.704   -7.191  1.00 0.73  ? 99  LYS A HB2  5  
ATOM 9386  H HB3  . LYS A 1 99  ? -13.704 2.599   -8.030  1.00 0.70  ? 99  LYS A HB3  5  
ATOM 9387  H HG2  . LYS A 1 99  ? -12.872 1.001   -6.523  1.00 0.67  ? 99  LYS A HG2  5  
ATOM 9388  H HG3  . LYS A 1 99  ? -14.160 1.310   -5.358  1.00 0.65  ? 99  LYS A HG3  5  
ATOM 9389  H HD2  . LYS A 1 99  ? -14.524 0.107   -8.098  1.00 1.19  ? 99  LYS A HD2  5  
ATOM 9390  H HD3  . LYS A 1 99  ? -14.499 -0.792  -6.578  1.00 1.16  ? 99  LYS A HD3  5  
ATOM 9391  H HE2  . LYS A 1 99  ? -16.477 1.366   -7.309  1.00 2.17  ? 99  LYS A HE2  5  
ATOM 9392  H HE3  . LYS A 1 99  ? -16.778 -0.363  -7.373  1.00 2.18  ? 99  LYS A HE3  5  
ATOM 9393  H HZ1  . LYS A 1 99  ? -16.213 1.235   -4.946  1.00 2.53  ? 99  LYS A HZ1  5  
ATOM 9394  H HZ2  . LYS A 1 99  ? -16.343 -0.453  -4.965  1.00 2.23  ? 99  LYS A HZ2  5  
ATOM 9395  H HZ3  . LYS A 1 99  ? -17.685 0.504   -5.360  1.00 2.44  ? 99  LYS A HZ3  5  
ATOM 9396  N N    . CYS A 1 100 ? -13.994 3.218   -3.928  1.00 0.55  ? 100 CYS A N    5  
ATOM 9397  C CA   . CYS A 1 100 ? -14.594 3.293   -2.603  1.00 0.60  ? 100 CYS A CA   5  
ATOM 9398  C C    . CYS A 1 100 ? -14.222 4.593   -1.877  1.00 0.61  ? 100 CYS A C    5  
ATOM 9399  O O    . CYS A 1 100 ? -14.797 4.923   -0.840  1.00 0.68  ? 100 CYS A O    5  
ATOM 9400  C CB   . CYS A 1 100 ? -14.149 2.084   -1.781  1.00 0.60  ? 100 CYS A CB   5  
ATOM 9401  S SG   . CYS A 1 100 ? -14.697 0.500   -2.459  1.00 1.39  ? 100 CYS A SG   5  
ATOM 9402  H H    . CYS A 1 100 ? -13.244 2.604   -4.076  1.00 0.51  ? 100 CYS A H    5  
ATOM 9403  H HA   . CYS A 1 100 ? -15.664 3.256   -2.722  1.00 0.68  ? 100 CYS A HA   5  
ATOM 9404  H HB2  . CYS A 1 100 ? -13.070 2.065   -1.743  1.00 1.12  ? 100 CYS A HB2  5  
ATOM 9405  H HB3  . CYS A 1 100 ? -14.532 2.167   -0.779  1.00 0.81  ? 100 CYS A HB3  5  
ATOM 9406  H HG   . CYS A 1 100 ? -13.693 -0.004  -3.168  1.00 2.19  ? 100 CYS A HG   5  
ATOM 9407  N N    . ARG A 1 101 ? -13.251 5.319   -2.443  1.00 0.59  ? 101 ARG A N    5  
ATOM 9408  C CA   . ARG A 1 101 ? -12.728 6.565   -1.862  1.00 0.65  ? 101 ARG A CA   5  
ATOM 9409  C C    . ARG A 1 101 ? -12.234 6.343   -0.434  1.00 0.64  ? 101 ARG A C    5  
ATOM 9410  O O    . ARG A 1 101 ? -12.316 7.236   0.409   1.00 0.75  ? 101 ARG A O    5  
ATOM 9411  C CB   . ARG A 1 101 ? -13.769 7.693   -1.894  1.00 0.77  ? 101 ARG A CB   5  
ATOM 9412  C CG   . ARG A 1 101 ? -13.930 8.361   -3.254  1.00 0.79  ? 101 ARG A CG   5  
ATOM 9413  C CD   . ARG A 1 101 ? -14.634 7.457   -4.249  1.00 1.19  ? 101 ARG A CD   5  
ATOM 9414  N NE   . ARG A 1 101 ? -14.822 8.101   -5.547  1.00 2.14  ? 101 ARG A NE   5  
ATOM 9415  C CZ   . ARG A 1 101 ? -15.854 7.860   -6.355  1.00 3.08  ? 101 ARG A CZ   5  
ATOM 9416  N NH1  . ARG A 1 101 ? -16.759 6.942   -6.028  1.00 3.37  ? 101 ARG A NH1  5  
ATOM 9417  N NH2  . ARG A 1 101 ? -15.968 8.512   -7.504  1.00 4.09  ? 101 ARG A NH2  5  
ATOM 9418  H H    . ARG A 1 101 ? -12.860 4.999   -3.283  1.00 0.57  ? 101 ARG A H    5  
ATOM 9419  H HA   . ARG A 1 101 ? -11.883 6.864   -2.466  1.00 0.66  ? 101 ARG A HA   5  
ATOM 9420  H HB2  . ARG A 1 101 ? -14.728 7.288   -1.607  1.00 0.79  ? 101 ARG A HB2  5  
ATOM 9421  H HB3  . ARG A 1 101 ? -13.481 8.451   -1.179  1.00 0.92  ? 101 ARG A HB3  5  
ATOM 9422  H HG2  . ARG A 1 101 ? -14.510 9.262   -3.134  1.00 1.42  ? 101 ARG A HG2  5  
ATOM 9423  H HG3  . ARG A 1 101 ? -12.951 8.610   -3.640  1.00 1.29  ? 101 ARG A HG3  5  
ATOM 9424  H HD2  . ARG A 1 101 ? -14.043 6.564   -4.385  1.00 1.59  ? 101 ARG A HD2  5  
ATOM 9425  H HD3  . ARG A 1 101 ? -15.601 7.188   -3.847  1.00 1.65  ? 101 ARG A HD3  5  
ATOM 9426  H HE   . ARG A 1 101 ? -14.138 8.763   -5.828  1.00 2.45  ? 101 ARG A HE   5  
ATOM 9427  H HH11 . ARG A 1 101 ? -16.665 6.424   -5.174  1.00 3.01  ? 101 ARG A HH11 5  
ATOM 9428  H HH12 . ARG A 1 101 ? -17.540 6.763   -6.631  1.00 4.21  ? 101 ARG A HH12 5  
ATOM 9429  H HH21 . ARG A 1 101 ? -15.272 9.188   -7.777  1.00 4.30  ? 101 ARG A HH21 5  
ATOM 9430  H HH22 . ARG A 1 101 ? -16.756 8.344   -8.109  1.00 4.83  ? 101 ARG A HH22 5  
ATOM 9431  N N    . VAL A 1 102 ? -11.702 5.158   -0.180  1.00 0.55  ? 102 VAL A N    5  
ATOM 9432  C CA   . VAL A 1 102 ? -11.228 4.798   1.148   1.00 0.57  ? 102 VAL A CA   5  
ATOM 9433  C C    . VAL A 1 102 ? -9.707  4.894   1.208   1.00 0.49  ? 102 VAL A C    5  
ATOM 9434  O O    . VAL A 1 102 ? -9.023  4.589   0.230   1.00 0.46  ? 102 VAL A O    5  
ATOM 9435  C CB   . VAL A 1 102 ? -11.669 3.362   1.529   1.00 0.69  ? 102 VAL A CB   5  
ATOM 9436  C CG1  . VAL A 1 102 ? -11.209 2.995   2.934   1.00 0.89  ? 102 VAL A CG1  5  
ATOM 9437  C CG2  . VAL A 1 102 ? -13.177 3.212   1.414   1.00 1.42  ? 102 VAL A CG2  5  
ATOM 9438  H H    . VAL A 1 102 ? -11.609 4.512   -0.913  1.00 0.51  ? 102 VAL A H    5  
ATOM 9439  H HA   . VAL A 1 102 ? -11.655 5.489   1.859   1.00 0.66  ? 102 VAL A HA   5  
ATOM 9440  H HB   . VAL A 1 102 ? -11.208 2.675   0.836   1.00 1.38  ? 102 VAL A HB   5  
ATOM 9441  H HG11 . VAL A 1 102 ? -10.133 3.083   2.994   1.00 1.44  ? 102 VAL A HG11 5  
ATOM 9442  H HG12 . VAL A 1 102 ? -11.497 1.978   3.151   1.00 1.45  ? 102 VAL A HG12 5  
ATOM 9443  H HG13 . VAL A 1 102 ? -11.666 3.661   3.650   1.00 1.57  ? 102 VAL A HG13 5  
ATOM 9444  H HG21 . VAL A 1 102 ? -13.485 3.434   0.401   1.00 2.00  ? 102 VAL A HG21 5  
ATOM 9445  H HG22 . VAL A 1 102 ? -13.662 3.893   2.097   1.00 2.08  ? 102 VAL A HG22 5  
ATOM 9446  H HG23 . VAL A 1 102 ? -13.455 2.198   1.659   1.00 1.73  ? 102 VAL A HG23 5  
ATOM 9447  N N    . ILE A 1 103 ? -9.185  5.327   2.345   1.00 0.54  ? 103 ILE A N    5  
ATOM 9448  C CA   . ILE A 1 103 ? -7.749  5.423   2.536   1.00 0.50  ? 103 ILE A CA   5  
ATOM 9449  C C    . ILE A 1 103 ? -7.207  4.112   3.101   1.00 0.43  ? 103 ILE A C    5  
ATOM 9450  O O    . ILE A 1 103 ? -7.595  3.690   4.192   1.00 0.46  ? 103 ILE A O    5  
ATOM 9451  C CB   . ILE A 1 103 ? -7.381  6.587   3.485   1.00 0.61  ? 103 ILE A CB   5  
ATOM 9452  C CG1  . ILE A 1 103 ? -7.899  7.919   2.930   1.00 0.78  ? 103 ILE A CG1  5  
ATOM 9453  C CG2  . ILE A 1 103 ? -5.875  6.649   3.703   1.00 0.62  ? 103 ILE A CG2  5  
ATOM 9454  C CD1  . ILE A 1 103 ? -7.354  8.267   1.559   1.00 1.33  ? 103 ILE A CD1  5  
ATOM 9455  H H    . ILE A 1 103 ? -9.782  5.584   3.084   1.00 0.65  ? 103 ILE A H    5  
ATOM 9456  H HA   . ILE A 1 103 ? -7.294  5.607   1.573   1.00 0.50  ? 103 ILE A HA   5  
ATOM 9457  H HB   . ILE A 1 103 ? -7.849  6.400   4.439   1.00 0.64  ? 103 ILE A HB   5  
ATOM 9458  H HG12 . ILE A 1 103 ? -8.975  7.874   2.856   1.00 1.38  ? 103 ILE A HG12 5  
ATOM 9459  H HG13 . ILE A 1 103 ? -7.625  8.715   3.608   1.00 1.26  ? 103 ILE A HG13 5  
ATOM 9460  H HG21 . ILE A 1 103 ? -5.533  5.709   4.108   1.00 1.17  ? 103 ILE A HG21 5  
ATOM 9461  H HG22 . ILE A 1 103 ? -5.642  7.445   4.393   1.00 1.19  ? 103 ILE A HG22 5  
ATOM 9462  H HG23 . ILE A 1 103 ? -5.383  6.834   2.759   1.00 1.09  ? 103 ILE A HG23 5  
ATOM 9463  H HD11 . ILE A 1 103 ? -7.773  9.208   1.233   1.00 1.78  ? 103 ILE A HD11 5  
ATOM 9464  H HD12 . ILE A 1 103 ? -7.621  7.492   0.857   1.00 1.83  ? 103 ILE A HD12 5  
ATOM 9465  H HD13 . ILE A 1 103 ? -6.279  8.352   1.611   1.00 1.99  ? 103 ILE A HD13 5  
ATOM 9466  N N    . PRO A 1 104 ? -6.330  3.434   2.347   1.00 0.39  ? 104 PRO A N    5  
ATOM 9467  C CA   . PRO A 1 104 ? -5.704  2.195   2.800   1.00 0.37  ? 104 PRO A CA   5  
ATOM 9468  C C    . PRO A 1 104 ? -4.713  2.450   3.928   1.00 0.37  ? 104 PRO A C    5  
ATOM 9469  O O    . PRO A 1 104 ? -3.983  3.439   3.910   1.00 0.45  ? 104 PRO A O    5  
ATOM 9470  C CB   . PRO A 1 104 ? -4.990  1.669   1.554   1.00 0.41  ? 104 PRO A CB   5  
ATOM 9471  C CG   . PRO A 1 104 ? -4.758  2.871   0.703   1.00 0.53  ? 104 PRO A CG   5  
ATOM 9472  C CD   . PRO A 1 104 ? -5.888  3.821   0.995   1.00 0.44  ? 104 PRO A CD   5  
ATOM 9473  H HA   . PRO A 1 104 ? -6.445  1.478   3.130   1.00 0.37  ? 104 PRO A HA   5  
ATOM 9474  H HB2  . PRO A 1 104 ? -4.059  1.203   1.839   1.00 0.57  ? 104 PRO A HB2  5  
ATOM 9475  H HB3  . PRO A 1 104 ? -5.619  0.948   1.053   1.00 0.55  ? 104 PRO A HB3  5  
ATOM 9476  H HG2  . PRO A 1 104 ? -3.812  3.325   0.960   1.00 0.86  ? 104 PRO A HG2  5  
ATOM 9477  H HG3  . PRO A 1 104 ? -4.768  2.588   -0.339  1.00 0.82  ? 104 PRO A HG3  5  
ATOM 9478  H HD2  . PRO A 1 104 ? -5.535  4.842   0.985   1.00 0.59  ? 104 PRO A HD2  5  
ATOM 9479  H HD3  . PRO A 1 104 ? -6.685  3.690   0.278   1.00 0.57  ? 104 PRO A HD3  5  
ATOM 9480  N N    . SER A 1 105 ? -4.689  1.555   4.906   1.00 0.32  ? 105 SER A N    5  
ATOM 9481  C CA   . SER A 1 105 ? -3.875  1.760   6.088   1.00 0.34  ? 105 SER A CA   5  
ATOM 9482  C C    . SER A 1 105 ? -3.571  0.438   6.784   1.00 0.34  ? 105 SER A C    5  
ATOM 9483  O O    . SER A 1 105 ? -4.086  -0.612  6.379   1.00 0.33  ? 105 SER A O    5  
ATOM 9484  C CB   . SER A 1 105 ? -4.599  2.702   7.052   1.00 0.43  ? 105 SER A CB   5  
ATOM 9485  O OG   . SER A 1 105 ? -5.905  2.215   7.340   1.00 1.42  ? 105 SER A OG   5  
ATOM 9486  H H    . SER A 1 105 ? -5.218  0.740   4.827   1.00 0.31  ? 105 SER A H    5  
ATOM 9487  H HA   . SER A 1 105 ? -2.947  2.217   5.780   1.00 0.34  ? 105 SER A HA   5  
ATOM 9488  H HB2  . SER A 1 105 ? -4.046  2.769   7.976   1.00 1.18  ? 105 SER A HB2  5  
ATOM 9489  H HB3  . SER A 1 105 ? -4.680  3.682   6.606   1.00 0.94  ? 105 SER A HB3  5  
ATOM 9490  H HG   . SER A 1 105 ? -6.301  2.751   8.051   1.00 1.92  ? 105 SER A HG   5  
ATOM 9491  N N    . GLN A 1 106 ? -2.748  0.498   7.821   1.00 0.39  ? 106 GLN A N    5  
ATOM 9492  C CA   . GLN A 1 106 ? -2.440  -0.663  8.655   1.00 0.43  ? 106 GLN A CA   5  
ATOM 9493  C C    . GLN A 1 106 ? -3.718  -1.320  9.179   1.00 0.45  ? 106 GLN A C    5  
ATOM 9494  O O    . GLN A 1 106 ? -3.802  -2.539  9.307   1.00 0.50  ? 106 GLN A O    5  
ATOM 9495  C CB   . GLN A 1 106 ? -1.573  -0.231  9.835   1.00 0.52  ? 106 GLN A CB   5  
ATOM 9496  C CG   . GLN A 1 106 ? -0.256  0.403   9.431   1.00 0.68  ? 106 GLN A CG   5  
ATOM 9497  C CD   . GLN A 1 106 ? 0.134   1.538   10.349  1.00 0.96  ? 106 GLN A CD   5  
ATOM 9498  O OE1  . GLN A 1 106 ? 0.803   1.337   11.363  1.00 1.66  ? 106 GLN A OE1  5  
ATOM 9499  N NE2  . GLN A 1 106 ? -0.275  2.745   9.991   1.00 1.42  ? 106 GLN A NE2  5  
ATOM 9500  H H    . GLN A 1 106 ? -2.302  1.358   8.017   1.00 0.42  ? 106 GLN A H    5  
ATOM 9501  H HA   . GLN A 1 106 ? -1.893  -1.375  8.056   1.00 0.42  ? 106 GLN A HA   5  
ATOM 9502  H HB2  . GLN A 1 106 ? -2.123  0.484   10.425  1.00 0.66  ? 106 GLN A HB2  5  
ATOM 9503  H HB3  . GLN A 1 106 ? -1.358  -1.096  10.441  1.00 0.73  ? 106 GLN A HB3  5  
ATOM 9504  H HG2  . GLN A 1 106 ? 0.518   -0.350  9.465   1.00 0.91  ? 106 GLN A HG2  5  
ATOM 9505  H HG3  . GLN A 1 106 ? -0.346  0.783   8.425   1.00 1.06  ? 106 GLN A HG3  5  
ATOM 9506  H HE21 . GLN A 1 106 ? -0.800  2.832   9.154   1.00 1.87  ? 106 GLN A HE21 5  
ATOM 9507  H HE22 . GLN A 1 106 ? -0.043  3.503   10.564  1.00 1.72  ? 106 GLN A HE22 5  
ATOM 9508  N N    . GLU A 1 107 ? -4.713  -0.494  9.455   1.00 0.46  ? 107 GLU A N    5  
ATOM 9509  C CA   . GLU A 1 107 ? -6.000  -0.951  9.964   1.00 0.51  ? 107 GLU A CA   5  
ATOM 9510  C C    . GLU A 1 107 ? -6.662  -1.928  8.987   1.00 0.42  ? 107 GLU A C    5  
ATOM 9511  O O    . GLU A 1 107 ? -7.397  -2.827  9.390   1.00 0.49  ? 107 GLU A O    5  
ATOM 9512  C CB   . GLU A 1 107 ? -6.899  0.262   10.186  1.00 0.59  ? 107 GLU A CB   5  
ATOM 9513  C CG   . GLU A 1 107 ? -8.231  -0.048  10.841  1.00 1.41  ? 107 GLU A CG   5  
ATOM 9514  C CD   . GLU A 1 107 ? -9.058  1.201   11.028  1.00 2.16  ? 107 GLU A CD   5  
ATOM 9515  O OE1  . GLU A 1 107 ? -8.516  2.221   11.496  1.00 2.82  ? 107 GLU A OE1  5  
ATOM 9516  O OE2  . GLU A 1 107 ? -10.269 1.162   10.726  1.00 2.63  ? 107 GLU A OE2  5  
ATOM 9517  H H    . GLU A 1 107 ? -4.575  0.468   9.319   1.00 0.48  ? 107 GLU A H    5  
ATOM 9518  H HA   . GLU A 1 107 ? -5.834  -1.450  10.906  1.00 0.62  ? 107 GLU A HA   5  
ATOM 9519  H HB2  . GLU A 1 107 ? -6.377  0.970   10.813  1.00 1.12  ? 107 GLU A HB2  5  
ATOM 9520  H HB3  . GLU A 1 107 ? -7.095  0.723   9.229   1.00 1.19  ? 107 GLU A HB3  5  
ATOM 9521  H HG2  . GLU A 1 107 ? -8.778  -0.739  10.214  1.00 2.02  ? 107 GLU A HG2  5  
ATOM 9522  H HG3  . GLU A 1 107 ? -8.052  -0.497  11.806  1.00 2.03  ? 107 GLU A HG3  5  
ATOM 9523  N N    . HIS A 1 108 ? -6.376  -1.745  7.706   1.00 0.34  ? 108 HIS A N    5  
ATOM 9524  C CA   . HIS A 1 108 ? -6.999  -2.524  6.645   1.00 0.37  ? 108 HIS A CA   5  
ATOM 9525  C C    . HIS A 1 108 ? -6.238  -3.815  6.358   1.00 0.46  ? 108 HIS A C    5  
ATOM 9526  O O    . HIS A 1 108 ? -6.732  -4.669  5.627   1.00 0.53  ? 108 HIS A O    5  
ATOM 9527  C CB   . HIS A 1 108 ? -7.105  -1.684  5.374   1.00 0.38  ? 108 HIS A CB   5  
ATOM 9528  C CG   . HIS A 1 108 ? -8.123  -0.592  5.469   1.00 0.40  ? 108 HIS A CG   5  
ATOM 9529  N ND1  . HIS A 1 108 ? -7.811  0.711   5.797   1.00 0.52  ? 108 HIS A ND1  5  
ATOM 9530  C CD2  . HIS A 1 108 ? -9.460  -0.615  5.268   1.00 0.52  ? 108 HIS A CD2  5  
ATOM 9531  C CE1  . HIS A 1 108 ? -8.909  1.437   5.787   1.00 0.52  ? 108 HIS A CE1  5  
ATOM 9532  N NE2  . HIS A 1 108 ? -9.927  0.659   5.470   1.00 0.52  ? 108 HIS A NE2  5  
ATOM 9533  H H    . HIS A 1 108 ? -5.712  -1.064  7.461   1.00 0.33  ? 108 HIS A H    5  
ATOM 9534  H HA   . HIS A 1 108 ? -7.995  -2.780  6.973   1.00 0.42  ? 108 HIS A HA   5  
ATOM 9535  H HB2  . HIS A 1 108 ? -6.147  -1.228  5.171   1.00 0.36  ? 108 HIS A HB2  5  
ATOM 9536  H HB3  . HIS A 1 108 ? -7.376  -2.325  4.549   1.00 0.45  ? 108 HIS A HB3  5  
ATOM 9537  H HD1  . HIS A 1 108 ? -6.919  1.053   6.037   1.00 0.70  ? 108 HIS A HD1  5  
ATOM 9538  H HD2  . HIS A 1 108 ? -10.052 -1.479  4.998   1.00 0.71  ? 108 HIS A HD2  5  
ATOM 9539  H HE1  . HIS A 1 108 ? -8.961  2.495   5.984   1.00 0.64  ? 108 HIS A HE1  5  
ATOM 9540  H HE2  . HIS A 1 108 ? -10.878 0.888   5.634   1.00 0.63  ? 108 HIS A HE2  5  
ATOM 9541  N N    . LEU A 1 109 ? -5.021  -3.923  6.890   1.00 0.52  ? 109 LEU A N    5  
ATOM 9542  C CA   . LEU A 1 109 ? -4.152  -5.082  6.646   1.00 0.70  ? 109 LEU A CA   5  
ATOM 9543  C C    . LEU A 1 109 ? -4.834  -6.399  7.004   1.00 0.79  ? 109 LEU A C    5  
ATOM 9544  O O    . LEU A 1 109 ? -4.817  -6.819  8.162   1.00 1.24  ? 109 LEU A O    5  
ATOM 9545  C CB   . LEU A 1 109 ? -2.862  -4.969  7.464   1.00 0.96  ? 109 LEU A CB   5  
ATOM 9546  C CG   . LEU A 1 109 ? -2.010  -3.731  7.205   1.00 0.44  ? 109 LEU A CG   5  
ATOM 9547  C CD1  . LEU A 1 109 ? -0.866  -3.672  8.203   1.00 0.84  ? 109 LEU A CD1  5  
ATOM 9548  C CD2  . LEU A 1 109 ? -1.476  -3.734  5.786   1.00 0.67  ? 109 LEU A CD2  5  
ATOM 9549  H H    . LEU A 1 109 ? -4.697  -3.207  7.477   1.00 0.47  ? 109 LEU A H    5  
ATOM 9550  H HA   . LEU A 1 109 ? -3.903  -5.100  5.596   1.00 0.77  ? 109 LEU A HA   5  
ATOM 9551  H HB2  . LEU A 1 109 ? -3.128  -4.977  8.511   1.00 1.47  ? 109 LEU A HB2  5  
ATOM 9552  H HB3  . LEU A 1 109 ? -2.258  -5.839  7.260   1.00 1.46  ? 109 LEU A HB3  5  
ATOM 9553  H HG   . LEU A 1 109 ? -2.621  -2.846  7.333   1.00 0.43  ? 109 LEU A HG   5  
ATOM 9554  H HD11 . LEU A 1 109 ? -0.250  -4.551  8.095   1.00 1.39  ? 109 LEU A HD11 5  
ATOM 9555  H HD12 . LEU A 1 109 ? -1.267  -3.632  9.205   1.00 1.39  ? 109 LEU A HD12 5  
ATOM 9556  H HD13 . LEU A 1 109 ? -0.270  -2.789  8.017   1.00 1.37  ? 109 LEU A HD13 5  
ATOM 9557  H HD21 . LEU A 1 109 ? -2.302  -3.750  5.090   1.00 1.19  ? 109 LEU A HD21 5  
ATOM 9558  H HD22 . LEU A 1 109 ? -0.862  -4.610  5.635   1.00 1.41  ? 109 LEU A HD22 5  
ATOM 9559  H HD23 . LEU A 1 109 ? -0.884  -2.846  5.622   1.00 1.28  ? 109 LEU A HD23 5  
ATOM 9560  N N    . ASN A 1 110 ? -5.453  -7.020  6.001   1.00 1.37  ? 110 ASN A N    5  
ATOM 9561  C CA   . ASN A 1 110 ? -6.029  -8.364  6.122   1.00 1.67  ? 110 ASN A CA   5  
ATOM 9562  C C    . ASN A 1 110 ? -7.307  -8.373  6.968   1.00 1.44  ? 110 ASN A C    5  
ATOM 9563  O O    . ASN A 1 110 ? -8.068  -9.337  6.939   1.00 1.77  ? 110 ASN A O    5  
ATOM 9564  C CB   . ASN A 1 110 ? -4.993  -9.347  6.689   1.00 2.17  ? 110 ASN A CB   5  
ATOM 9565  C CG   . ASN A 1 110 ? -5.456  -10.788 6.637   1.00 2.95  ? 110 ASN A CG   5  
ATOM 9566  O OD1  . ASN A 1 110 ? -5.302  -11.460 5.617   1.00 3.70  ? 110 ASN A OD1  5  
ATOM 9567  N ND2  . ASN A 1 110 ? -6.005  -11.284 7.734   1.00 3.35  ? 110 ASN A ND2  5  
ATOM 9568  H H    . ASN A 1 110 ? -5.540  -6.550  5.147   1.00 1.89  ? 110 ASN A H    5  
ATOM 9569  H HA   . ASN A 1 110 ? -6.291  -8.687  5.123   1.00 1.91  ? 110 ASN A HA   5  
ATOM 9570  H HB2  . ASN A 1 110 ? -4.081  -9.262  6.119   1.00 2.54  ? 110 ASN A HB2  5  
ATOM 9571  H HB3  . ASN A 1 110 ? -4.793  -9.089  7.719   1.00 2.33  ? 110 ASN A HB3  5  
ATOM 9572  H HD21 . ASN A 1 110 ? -6.080  -10.693 8.526   1.00 3.18  ? 110 ASN A HD21 5  
ATOM 9573  H HD22 . ASN A 1 110 ? -6.326  -12.208 7.716   1.00 4.09  ? 110 ASN A HD22 5  
ATOM 9574  N N    . GLY A 1 111 ? -7.545  -7.297  7.699   1.00 1.12  ? 111 GLY A N    5  
ATOM 9575  C CA   . GLY A 1 111 ? -8.721  -7.219  8.539   1.00 1.12  ? 111 GLY A CA   5  
ATOM 9576  C C    . GLY A 1 111 ? -9.956  -6.770  7.777   1.00 0.87  ? 111 GLY A C    5  
ATOM 9577  O O    . GLY A 1 111 ? -10.359 -7.409  6.803   1.00 0.93  ? 111 GLY A O    5  
ATOM 9578  H H    . GLY A 1 111 ? -6.911  -6.551  7.675   1.00 1.15  ? 111 GLY A H    5  
ATOM 9579  H HA2  . GLY A 1 111 ? -8.910  -8.193  8.966   1.00 1.39  ? 111 GLY A HA2  5  
ATOM 9580  H HA3  . GLY A 1 111 ? -8.531  -6.519  9.339   1.00 1.34  ? 111 GLY A HA3  5  
ATOM 9581  N N    . PRO A 1 112 ? -10.575 -5.662  8.192   1.00 0.86  ? 112 PRO A N    5  
ATOM 9582  C CA   . PRO A 1 112 ? -11.805 -5.175  7.593   1.00 0.93  ? 112 PRO A CA   5  
ATOM 9583  C C    . PRO A 1 112 ? -11.558 -4.268  6.393   1.00 0.89  ? 112 PRO A C    5  
ATOM 9584  O O    . PRO A 1 112 ? -11.042 -3.155  6.528   1.00 1.31  ? 112 PRO A O    5  
ATOM 9585  C CB   . PRO A 1 112 ? -12.460 -4.400  8.736   1.00 1.25  ? 112 PRO A CB   5  
ATOM 9586  C CG   . PRO A 1 112 ? -11.343 -3.976  9.641   1.00 1.30  ? 112 PRO A CG   5  
ATOM 9587  C CD   . PRO A 1 112 ? -10.119 -4.786  9.276   1.00 1.10  ? 112 PRO A CD   5  
ATOM 9588  H HA   . PRO A 1 112 ? -12.448 -5.990  7.297   1.00 1.00  ? 112 PRO A HA   5  
ATOM 9589  H HB2  . PRO A 1 112 ? -12.986 -3.547  8.334   1.00 1.52  ? 112 PRO A HB2  5  
ATOM 9590  H HB3  . PRO A 1 112 ? -13.158 -5.044  9.253   1.00 1.43  ? 112 PRO A HB3  5  
ATOM 9591  H HG2  . PRO A 1 112 ? -11.144 -2.924  9.503   1.00 1.65  ? 112 PRO A HG2  5  
ATOM 9592  H HG3  . PRO A 1 112 ? -11.620 -4.169  10.666  1.00 1.44  ? 112 PRO A HG3  5  
ATOM 9593  H HD2  . PRO A 1 112 ? -9.326  -4.137  8.934   1.00 1.29  ? 112 PRO A HD2  5  
ATOM 9594  H HD3  . PRO A 1 112 ? -9.789  -5.368  10.126  1.00 1.17  ? 112 PRO A HD3  5  
ATOM 9595  N N    . LEU A 1 113 ? -11.905 -4.762  5.216   1.00 0.62  ? 113 LEU A N    5  
ATOM 9596  C CA   . LEU A 1 113 ? -11.862 -3.960  4.008   1.00 0.58  ? 113 LEU A CA   5  
ATOM 9597  C C    . LEU A 1 113 ? -13.094 -3.056  3.953   1.00 0.69  ? 113 LEU A C    5  
ATOM 9598  O O    . LEU A 1 113 ? -14.014 -3.230  4.749   1.00 0.90  ? 113 LEU A O    5  
ATOM 9599  C CB   . LEU A 1 113 ? -11.808 -4.865  2.766   1.00 0.58  ? 113 LEU A CB   5  
ATOM 9600  C CG   . LEU A 1 113 ? -10.586 -5.785  2.670   1.00 0.57  ? 113 LEU A CG   5  
ATOM 9601  C CD1  . LEU A 1 113 ? -10.577 -6.517  1.338   1.00 1.11  ? 113 LEU A CD1  5  
ATOM 9602  C CD2  . LEU A 1 113 ? -9.298  -4.990  2.860   1.00 1.05  ? 113 LEU A CD2  5  
ATOM 9603  H H    . LEU A 1 113 ? -12.190 -5.693  5.154   1.00 0.73  ? 113 LEU A H    5  
ATOM 9604  H HA   . LEU A 1 113 ? -10.975 -3.347  4.043   1.00 0.56  ? 113 LEU A HA   5  
ATOM 9605  H HB2  . LEU A 1 113 ? -12.695 -5.481  2.760   1.00 0.65  ? 113 LEU A HB2  5  
ATOM 9606  H HB3  . LEU A 1 113 ? -11.824 -4.234  1.890   1.00 0.60  ? 113 LEU A HB3  5  
ATOM 9607  H HG   . LEU A 1 113 ? -10.640 -6.528  3.448   1.00 0.65  ? 113 LEU A HG   5  
ATOM 9608  H HD11 . LEU A 1 113 ? -11.478 -7.106  1.244   1.00 1.60  ? 113 LEU A HD11 5  
ATOM 9609  H HD12 . LEU A 1 113 ? -9.715  -7.169  1.288   1.00 1.75  ? 113 LEU A HD12 5  
ATOM 9610  H HD13 . LEU A 1 113 ? -10.531 -5.799  0.533   1.00 1.54  ? 113 LEU A HD13 5  
ATOM 9611  H HD21 . LEU A 1 113 ? -8.448  -5.648  2.753   1.00 1.60  ? 113 LEU A HD21 5  
ATOM 9612  H HD22 . LEU A 1 113 ? -9.288  -4.547  3.846   1.00 1.47  ? 113 LEU A HD22 5  
ATOM 9613  H HD23 . LEU A 1 113 ? -9.245  -4.209  2.115   1.00 1.63  ? 113 LEU A HD23 5  
ATOM 9614  N N    . PRO A 1 114 ? -13.110 -2.057  3.052   1.00 0.68  ? 114 PRO A N    5  
ATOM 9615  C CA   . PRO A 1 114 ? -14.277 -1.193  2.849   1.00 0.83  ? 114 PRO A CA   5  
ATOM 9616  C C    . PRO A 1 114 ? -15.585 -1.970  2.786   1.00 0.86  ? 114 PRO A C    5  
ATOM 9617  O O    . PRO A 1 114 ? -16.542 -1.658  3.499   1.00 1.15  ? 114 PRO A O    5  
ATOM 9618  C CB   . PRO A 1 114 ? -13.983 -0.538  1.501   1.00 1.02  ? 114 PRO A CB   5  
ATOM 9619  C CG   . PRO A 1 114 ? -12.497 -0.476  1.429   1.00 0.90  ? 114 PRO A CG   5  
ATOM 9620  C CD   . PRO A 1 114 ? -11.981 -1.669  2.192   1.00 0.70  ? 114 PRO A CD   5  
ATOM 9621  H HA   . PRO A 1 114 ? -14.349 -0.446  3.605   1.00 1.05  ? 114 PRO A HA   5  
ATOM 9622  H HB2  . PRO A 1 114 ? -14.393 -1.145  0.707   1.00 1.15  ? 114 PRO A HB2  5  
ATOM 9623  H HB3  . PRO A 1 114 ? -14.421 0.448   1.474   1.00 1.31  ? 114 PRO A HB3  5  
ATOM 9624  H HG2  . PRO A 1 114 ? -12.179 -0.526  0.398   1.00 0.99  ? 114 PRO A HG2  5  
ATOM 9625  H HG3  . PRO A 1 114 ? -12.146 0.437   1.885   1.00 1.13  ? 114 PRO A HG3  5  
ATOM 9626  H HD2  . PRO A 1 114 ? -11.724 -2.471  1.518   1.00 0.68  ? 114 PRO A HD2  5  
ATOM 9627  H HD3  . PRO A 1 114 ? -11.125 -1.390  2.788   1.00 0.81  ? 114 PRO A HD3  5  
ATOM 9628  N N    . VAL A 1 115 ? -15.582 -2.998  1.956   1.00 1.26  ? 115 VAL A N    5  
ATOM 9629  C CA   . VAL A 1 115 ? -16.759 -3.837  1.704   1.00 1.45  ? 115 VAL A CA   5  
ATOM 9630  C C    . VAL A 1 115 ? -17.834 -3.055  0.942   1.00 1.91  ? 115 VAL A C    5  
ATOM 9631  O O    . VAL A 1 115 ? -18.319 -2.023  1.411   1.00 2.44  ? 115 VAL A O    5  
ATOM 9632  C CB   . VAL A 1 115 ? -17.365 -4.420  3.004   1.00 1.96  ? 115 VAL A CB   5  
ATOM 9633  C CG1  . VAL A 1 115 ? -18.604 -5.257  2.707   1.00 2.60  ? 115 VAL A CG1  5  
ATOM 9634  C CG2  . VAL A 1 115 ? -16.334 -5.251  3.755   1.00 2.98  ? 115 VAL A CG2  5  
ATOM 9635  H H    . VAL A 1 115 ? -14.750 -3.199  1.496   1.00 1.67  ? 115 VAL A H    5  
ATOM 9636  H HA   . VAL A 1 115 ? -16.436 -4.664  1.089   1.00 1.85  ? 115 VAL A HA   5  
ATOM 9637  H HB   . VAL A 1 115 ? -17.660 -3.597  3.635   1.00 2.15  ? 115 VAL A HB   5  
ATOM 9638  H HG11 . VAL A 1 115 ? -18.343 -6.063  2.035   1.00 2.96  ? 115 VAL A HG11 5  
ATOM 9639  H HG12 . VAL A 1 115 ? -19.357 -4.635  2.246   1.00 3.01  ? 115 VAL A HG12 5  
ATOM 9640  H HG13 . VAL A 1 115 ? -18.991 -5.667  3.627   1.00 3.05  ? 115 VAL A HG13 5  
ATOM 9641  H HG21 . VAL A 1 115 ? -15.478 -4.635  3.988   1.00 3.35  ? 115 VAL A HG21 5  
ATOM 9642  H HG22 . VAL A 1 115 ? -16.021 -6.081  3.137   1.00 3.47  ? 115 VAL A HG22 5  
ATOM 9643  H HG23 . VAL A 1 115 ? -16.767 -5.627  4.669   1.00 3.42  ? 115 VAL A HG23 5  
ATOM 9644  N N    . PRO A 1 116 ? -18.223 -3.545  -0.248  1.00 2.53  ? 116 PRO A N    5  
ATOM 9645  C CA   . PRO A 1 116 ? -19.197 -2.875  -1.116  1.00 3.48  ? 116 PRO A CA   5  
ATOM 9646  C C    . PRO A 1 116 ? -20.641 -2.995  -0.606  1.00 3.68  ? 116 PRO A C    5  
ATOM 9647  O O    . PRO A 1 116 ? -21.540 -3.410  -1.345  1.00 3.90  ? 116 PRO A O    5  
ATOM 9648  C CB   . PRO A 1 116 ? -19.044 -3.597  -2.465  1.00 4.23  ? 116 PRO A CB   5  
ATOM 9649  C CG   . PRO A 1 116 ? -17.875 -4.515  -2.314  1.00 4.01  ? 116 PRO A CG   5  
ATOM 9650  C CD   . PRO A 1 116 ? -17.746 -4.792  -0.847  1.00 2.94  ? 116 PRO A CD   5  
ATOM 9651  H HA   . PRO A 1 116 ? -18.952 -1.829  -1.241  1.00 3.92  ? 116 PRO A HA   5  
ATOM 9652  H HB2  . PRO A 1 116 ? -19.947 -4.150  -2.680  1.00 4.47  ? 116 PRO A HB2  5  
ATOM 9653  H HB3  . PRO A 1 116 ? -18.874 -2.869  -3.246  1.00 4.93  ? 116 PRO A HB3  5  
ATOM 9654  H HG2  . PRO A 1 116 ? -18.056 -5.432  -2.853  1.00 4.47  ? 116 PRO A HG2  5  
ATOM 9655  H HG3  . PRO A 1 116 ? -16.981 -4.034  -2.684  1.00 4.42  ? 116 PRO A HG3  5  
ATOM 9656  H HD2  . PRO A 1 116 ? -18.372 -5.623  -0.558  1.00 2.94  ? 116 PRO A HD2  5  
ATOM 9657  H HD3  . PRO A 1 116 ? -16.717 -4.979  -0.586  1.00 2.95  ? 116 PRO A HD3  5  
ATOM 9658  N N    . PHE A 1 117 ? -20.837 -2.622  0.659   1.00 4.03  ? 117 PHE A N    5  
ATOM 9659  C CA   . PHE A 1 117 ? -22.151 -2.581  1.302   1.00 4.72  ? 117 PHE A CA   5  
ATOM 9660  C C    . PHE A 1 117 ? -22.814 -3.956  1.392   1.00 5.62  ? 117 PHE A C    5  
ATOM 9661  O O    . PHE A 1 117 ? -23.440 -4.433  0.446   1.00 6.22  ? 117 PHE A O    5  
ATOM 9662  C CB   . PHE A 1 117 ? -23.084 -1.589  0.596   1.00 5.32  ? 117 PHE A CB   5  
ATOM 9663  C CG   . PHE A 1 117 ? -24.426 -1.453  1.264   1.00 5.77  ? 117 PHE A CG   5  
ATOM 9664  C CD1  . PHE A 1 117 ? -24.555 -0.775  2.466   1.00 6.27  ? 117 PHE A CD1  5  
ATOM 9665  C CD2  . PHE A 1 117 ? -25.561 -1.993  0.681   1.00 6.08  ? 117 PHE A CD2  5  
ATOM 9666  C CE1  . PHE A 1 117 ? -25.788 -0.640  3.074   1.00 7.04  ? 117 PHE A CE1  5  
ATOM 9667  C CE2  . PHE A 1 117 ? -26.797 -1.862  1.285   1.00 6.87  ? 117 PHE A CE2  5  
ATOM 9668  C CZ   . PHE A 1 117 ? -26.900 -1.221  2.509   1.00 7.33  ? 117 PHE A CZ   5  
ATOM 9669  H H    . PHE A 1 117 ? -20.050 -2.355  1.188   1.00 4.08  ? 117 PHE A H    5  
ATOM 9670  H HA   . PHE A 1 117 ? -21.992 -2.228  2.311   1.00 4.55  ? 117 PHE A HA   5  
ATOM 9671  H HB2  . PHE A 1 117 ? -22.619 -0.615  0.582   1.00 5.24  ? 117 PHE A HB2  5  
ATOM 9672  H HB3  . PHE A 1 117 ? -23.248 -1.920  -0.420  1.00 5.94  ? 117 PHE A HB3  5  
ATOM 9673  H HD1  . PHE A 1 117 ? -23.678 -0.349  2.930   1.00 6.29  ? 117 PHE A HD1  5  
ATOM 9674  H HD2  . PHE A 1 117 ? -25.474 -2.524  -0.256  1.00 5.96  ? 117 PHE A HD2  5  
ATOM 9675  H HE1  . PHE A 1 117 ? -25.874 -0.109  4.011   1.00 7.60  ? 117 PHE A HE1  5  
ATOM 9676  H HE2  . PHE A 1 117 ? -27.674 -2.288  0.821   1.00 7.32  ? 117 PHE A HE2  5  
ATOM 9677  H HZ   . PHE A 1 117 ? -27.861 -1.131  2.994   1.00 8.10  ? 117 PHE A HZ   5  
ATOM 9678  N N    . THR A 1 118 ? -22.657 -4.584  2.540   1.00 6.05  ? 118 THR A N    5  
ATOM 9679  C CA   . THR A 1 118 ? -23.422 -5.771  2.882   1.00 7.13  ? 118 THR A CA   5  
ATOM 9680  C C    . THR A 1 118 ? -24.112 -5.526  4.217   1.00 7.53  ? 118 THR A C    5  
ATOM 9681  O O    . THR A 1 118 ? -25.306 -5.781  4.383   1.00 8.01  ? 118 THR A O    5  
ATOM 9682  C CB   . THR A 1 118 ? -22.528 -7.025  2.967   1.00 8.07  ? 118 THR A CB   5  
ATOM 9683  O OG1  . THR A 1 118 ? -21.780 -7.171  1.752   1.00 8.43  ? 118 THR A OG1  5  
ATOM 9684  C CG2  . THR A 1 118 ? -23.365 -8.274  3.196   1.00 8.78  ? 118 THR A CG2  5  
ATOM 9685  H H    . THR A 1 118 ? -22.007 -4.232  3.191   1.00 5.82  ? 118 THR A H    5  
ATOM 9686  H HA   . THR A 1 118 ? -24.168 -5.925  2.115   1.00 7.30  ? 118 THR A HA   5  
ATOM 9687  H HB   . THR A 1 118 ? -21.841 -6.910  3.794   1.00 8.25  ? 118 THR A HB   5  
ATOM 9688  H HG1  . THR A 1 118 ? -21.833 -6.353  1.247   1.00 8.41  ? 118 THR A HG1  5  
ATOM 9689  H HG21 . THR A 1 118 ? -24.068 -8.390  2.384   1.00 9.07  ? 118 THR A HG21 5  
ATOM 9690  H HG22 . THR A 1 118 ? -23.902 -8.180  4.128   1.00 8.92  ? 118 THR A HG22 5  
ATOM 9691  H HG23 . THR A 1 118 ? -22.719 -9.139  3.240   1.00 9.11  ? 118 THR A HG23 5  
ATOM 9692  N N    . ASN A 1 119 ? -23.343 -4.994  5.154   1.00 7.62  ? 119 ASN A N    5  
ATOM 9693  C CA   . ASN A 1 119 ? -23.872 -4.526  6.423   1.00 8.32  ? 119 ASN A CA   5  
ATOM 9694  C C    . ASN A 1 119 ? -23.836 -3.005  6.452   1.00 9.00  ? 119 ASN A C    5  
ATOM 9695  O O    . ASN A 1 119 ? -23.383 -2.377  5.490   1.00 9.23  ? 119 ASN A O    5  
ATOM 9696  C CB   . ASN A 1 119 ? -23.071 -5.107  7.597   1.00 8.46  ? 119 ASN A CB   5  
ATOM 9697  C CG   . ASN A 1 119 ? -21.575 -4.875  7.464   1.00 8.93  ? 119 ASN A CG   5  
ATOM 9698  O OD1  . ASN A 1 119 ? -20.869 -5.680  6.864   1.00 9.34  ? 119 ASN A OD1  5  
ATOM 9699  N ND2  . ASN A 1 119 ? -21.078 -3.790  8.037   1.00 9.14  ? 119 ASN A ND2  5  
ATOM 9700  H H    . ASN A 1 119 ? -22.382 -4.908  4.984   1.00 7.43  ? 119 ASN A H    5  
ATOM 9701  H HA   . ASN A 1 119 ? -24.899 -4.854  6.497   1.00 8.58  ? 119 ASN A HA   5  
ATOM 9702  H HB2  . ASN A 1 119 ? -23.405 -4.644  8.515   1.00 8.54  ? 119 ASN A HB2  5  
ATOM 9703  H HB3  . ASN A 1 119 ? -23.247 -6.170  7.651   1.00 8.45  ? 119 ASN A HB3  5  
ATOM 9704  H HD21 . ASN A 1 119 ? -21.692 -3.193  8.519   1.00 8.98  ? 119 ASN A HD21 5  
ATOM 9705  H HD22 . ASN A 1 119 ? -20.110 -3.621  7.950   1.00 9.61  ? 119 ASN A HD22 5  
ATOM 9706  N N    . GLY A 1 120 ? -24.302 -2.410  7.535   1.00 9.55  ? 120 GLY A N    5  
ATOM 9707  C CA   . GLY A 1 120 ? -24.334 -0.963  7.623   1.00 10.42 ? 120 GLY A CA   5  
ATOM 9708  C C    . GLY A 1 120 ? -22.992 -0.358  7.992   1.00 11.21 ? 120 GLY A C    5  
ATOM 9709  O O    . GLY A 1 120 ? -21.965 -1.040  7.980   1.00 11.55 ? 120 GLY A O    5  
ATOM 9710  H H    . GLY A 1 120 ? -24.634 -2.954  8.281   1.00 9.52  ? 120 GLY A H    5  
ATOM 9711  H HA2  . GLY A 1 120 ? -24.643 -0.564  6.668   1.00 10.61 ? 120 GLY A HA2  5  
ATOM 9712  H HA3  . GLY A 1 120 ? -25.060 -0.677  8.370   1.00 10.51 ? 120 GLY A HA3  5  
ATOM 9713  N N    . GLU A 1 121 ? -23.001 0.927   8.312   1.00 11.70 ? 121 GLU A N    5  
ATOM 9714  C CA   . GLU A 1 121 ? -21.792 1.625   8.718   1.00 12.64 ? 121 GLU A CA   5  
ATOM 9715  C C    . GLU A 1 121 ? -21.474 1.340   10.185  1.00 13.44 ? 121 GLU A C    5  
ATOM 9716  O O    . GLU A 1 121 ? -22.295 1.590   11.072  1.00 13.92 ? 121 GLU A O    5  
ATOM 9717  C CB   . GLU A 1 121 ? -21.937 3.133   8.475   1.00 12.94 ? 121 GLU A CB   5  
ATOM 9718  C CG   . GLU A 1 121 ? -23.250 3.715   8.981   1.00 12.93 ? 121 GLU A CG   5  
ATOM 9719  C CD   . GLU A 1 121 ? -23.367 5.206   8.742   1.00 13.41 ? 121 GLU A CD   5  
ATOM 9720  O OE1  . GLU A 1 121 ? -23.462 5.620   7.573   1.00 13.68 ? 121 GLU A OE1  5  
ATOM 9721  O OE2  . GLU A 1 121 ? -23.362 5.974   9.725   1.00 13.66 ? 121 GLU A OE2  5  
ATOM 9722  H H    . GLU A 1 121 ? -23.851 1.421   8.282   1.00 11.54 ? 121 GLU A H    5  
ATOM 9723  H HA   . GLU A 1 121 ? -20.980 1.250   8.112   1.00 12.73 ? 121 GLU A HA   5  
ATOM 9724  H HB2  . GLU A 1 121 ? -21.126 3.644   8.972   1.00 13.04 ? 121 GLU A HB2  5  
ATOM 9725  H HB3  . GLU A 1 121 ? -21.870 3.321   7.413   1.00 13.27 ? 121 GLU A HB3  5  
ATOM 9726  H HG2  . GLU A 1 121 ? -24.065 3.223   8.472   1.00 12.74 ? 121 GLU A HG2  5  
ATOM 9727  H HG3  . GLU A 1 121 ? -23.325 3.528   10.042  1.00 12.97 ? 121 GLU A HG3  5  
ATOM 9728  N N    . ILE A 1 122 ? -20.288 0.795   10.426  1.00 13.73 ? 122 ILE A N    5  
ATOM 9729  C CA   . ILE A 1 122 ? -19.851 0.467   11.779  1.00 14.64 ? 122 ILE A CA   5  
ATOM 9730  C C    . ILE A 1 122 ? -19.418 1.728   12.524  1.00 15.74 ? 122 ILE A C    5  
ATOM 9731  O O    . ILE A 1 122 ? -19.490 1.779   13.754  1.00 16.21 ? 122 ILE A O    5  
ATOM 9732  C CB   . ILE A 1 122 ? -18.691 -0.557  11.775  1.00 14.54 ? 122 ILE A CB   5  
ATOM 9733  C CG1  . ILE A 1 122 ? -17.477 -0.011  11.013  1.00 14.04 ? 122 ILE A CG1  5  
ATOM 9734  C CG2  . ILE A 1 122 ? -19.155 -1.872  11.165  1.00 14.69 ? 122 ILE A CG2  5  
ATOM 9735  C CD1  . ILE A 1 122 ? -16.279 -0.939  11.028  1.00 14.09 ? 122 ILE A CD1  5  
ATOM 9736  H H    . ILE A 1 122 ? -19.687 0.606   9.671   1.00 13.43 ? 122 ILE A H    5  
ATOM 9737  H HA   . ILE A 1 122 ? -20.689 0.026   12.299  1.00 14.76 ? 122 ILE A HA   5  
ATOM 9738  H HB   . ILE A 1 122 ? -18.409 -0.748  12.799  1.00 14.93 ? 122 ILE A HB   5  
ATOM 9739  H HG12 . ILE A 1 122 ? -17.753 0.154   9.983   1.00 13.68 ? 122 ILE A HG12 5  
ATOM 9740  H HG13 . ILE A 1 122 ? -17.177 0.927   11.455  1.00 14.16 ? 122 ILE A HG13 5  
ATOM 9741  H HG21 . ILE A 1 122 ? -19.963 -2.276  11.757  1.00 14.66 ? 122 ILE A HG21 5  
ATOM 9742  H HG22 . ILE A 1 122 ? -18.334 -2.573  11.150  1.00 14.82 ? 122 ILE A HG22 5  
ATOM 9743  H HG23 . ILE A 1 122 ? -19.499 -1.698  10.156  1.00 14.87 ? 122 ILE A HG23 5  
ATOM 9744  H HD11 . ILE A 1 122 ? -15.987 -1.134  12.049  1.00 14.08 ? 122 ILE A HD11 5  
ATOM 9745  H HD12 . ILE A 1 122 ? -15.457 -0.475  10.501  1.00 14.17 ? 122 ILE A HD12 5  
ATOM 9746  H HD13 . ILE A 1 122 ? -16.537 -1.869  10.543  1.00 14.24 ? 122 ILE A HD13 5  
ATOM 9747  N N    . GLN A 1 123 ? -18.981 2.734   11.764  1.00 16.25 ? 123 GLN A N    5  
ATOM 9748  C CA   . GLN A 1 123 ? -18.659 4.058   12.304  1.00 17.37 ? 123 GLN A CA   5  
ATOM 9749  C C    . GLN A 1 123 ? -17.721 3.993   13.505  1.00 18.25 ? 123 GLN A C    5  
ATOM 9750  O O    . GLN A 1 123 ? -18.135 4.195   14.652  1.00 18.70 ? 123 GLN A O    5  
ATOM 9751  C CB   . GLN A 1 123 ? -19.944 4.799   12.669  1.00 17.69 ? 123 GLN A CB   5  
ATOM 9752  C CG   . GLN A 1 123 ? -20.729 5.274   11.462  1.00 18.12 ? 123 GLN A CG   5  
ATOM 9753  C CD   . GLN A 1 123 ? -20.083 6.463   10.767  1.00 18.49 ? 123 GLN A CD   5  
ATOM 9754  O OE1  . GLN A 1 123 ? -18.865 6.649   10.810  1.00 18.82 ? 123 GLN A OE1  5  
ATOM 9755  N NE2  . GLN A 1 123 ? -20.896 7.272   10.110  1.00 18.57 ? 123 GLN A NE2  5  
ATOM 9756  H H    . GLN A 1 123 ? -18.870 2.578   10.799  1.00 15.95 ? 123 GLN A H    5  
ATOM 9757  H HA   . GLN A 1 123 ? -18.163 4.610   11.520  1.00 17.46 ? 123 GLN A HA   5  
ATOM 9758  H HB2  . GLN A 1 123 ? -20.575 4.139   13.246  1.00 17.45 ? 123 GLN A HB2  5  
ATOM 9759  H HB3  . GLN A 1 123 ? -19.694 5.661   13.271  1.00 18.00 ? 123 GLN A HB3  5  
ATOM 9760  H HG2  . GLN A 1 123 ? -20.798 4.461   10.754  1.00 18.20 ? 123 GLN A HG2  5  
ATOM 9761  H HG3  . GLN A 1 123 ? -21.720 5.557   11.782  1.00 18.23 ? 123 GLN A HG3  5  
ATOM 9762  H HE21 . GLN A 1 123 ? -21.860 7.057   10.102  1.00 18.37 ? 123 GLN A HE21 5  
ATOM 9763  H HE22 . GLN A 1 123 ? -20.510 8.055   9.661   1.00 18.90 ? 123 GLN A HE22 5  
ATOM 9764  N N    . LYS A 1 124 ? -16.458 3.715   13.233  1.00 18.59 ? 124 LYS A N    5  
ATOM 9765  C CA   . LYS A 1 124 ? -15.434 3.734   14.262  1.00 19.51 ? 124 LYS A CA   5  
ATOM 9766  C C    . LYS A 1 124 ? -14.408 4.816   13.961  1.00 20.23 ? 124 LYS A C    5  
ATOM 9767  O O    . LYS A 1 124 ? -14.258 5.235   12.810  1.00 20.83 ? 124 LYS A O    5  
ATOM 9768  C CB   . LYS A 1 124 ? -14.766 2.356   14.404  1.00 19.61 ? 124 LYS A CB   5  
ATOM 9769  C CG   . LYS A 1 124 ? -14.365 1.682   13.091  1.00 19.54 ? 124 LYS A CG   5  
ATOM 9770  C CD   . LYS A 1 124 ? -13.189 2.369   12.407  1.00 19.77 ? 124 LYS A CD   5  
ATOM 9771  C CE   . LYS A 1 124 ? -11.954 2.414   13.299  1.00 20.14 ? 124 LYS A CE   5  
ATOM 9772  N NZ   . LYS A 1 124 ? -10.820 3.104   12.631  1.00 20.17 ? 124 LYS A NZ   5  
ATOM 9773  H H    . LYS A 1 124 ? -16.203 3.499   12.307  1.00 18.29 ? 124 LYS A H    5  
ATOM 9774  H HA   . LYS A 1 124 ? -15.922 3.979   15.194  1.00 19.72 ? 124 LYS A HA   5  
ATOM 9775  H HB2  . LYS A 1 124 ? -13.873 2.469   15.000  1.00 19.67 ? 124 LYS A HB2  5  
ATOM 9776  H HB3  . LYS A 1 124 ? -15.447 1.696   14.922  1.00 19.83 ? 124 LYS A HB3  5  
ATOM 9777  H HG2  . LYS A 1 124 ? -14.092 0.659   13.297  1.00 19.49 ? 124 LYS A HG2  5  
ATOM 9778  H HG3  . LYS A 1 124 ? -15.214 1.698   12.422  1.00 19.51 ? 124 LYS A HG3  5  
ATOM 9779  H HD2  . LYS A 1 124 ? -12.945 1.827   11.507  1.00 19.80 ? 124 LYS A HD2  5  
ATOM 9780  H HD3  . LYS A 1 124 ? -13.476 3.379   12.153  1.00 19.76 ? 124 LYS A HD3  5  
ATOM 9781  H HE2  . LYS A 1 124 ? -12.201 2.941   14.208  1.00 20.61 ? 124 LYS A HE2  5  
ATOM 9782  H HE3  . LYS A 1 124 ? -11.661 1.402   13.538  1.00 20.05 ? 124 LYS A HE3  5  
ATOM 9783  H HZ1  . LYS A 1 124 ? -11.129 4.024   12.250  1.00 20.17 ? 124 LYS A HZ1  5  
ATOM 9784  H HZ2  . LYS A 1 124 ? -10.457 2.519   11.843  1.00 20.36 ? 124 LYS A HZ2  5  
ATOM 9785  H HZ3  . LYS A 1 124 ? -10.042 3.266   13.306  1.00 20.13 ? 124 LYS A HZ3  5  
ATOM 9786  N N    . GLU A 1 125 ? -13.712 5.270   14.991  1.00 20.28 ? 125 GLU A N    5  
ATOM 9787  C CA   . GLU A 1 125 ? -12.694 6.301   14.834  1.00 21.04 ? 125 GLU A CA   5  
ATOM 9788  C C    . GLU A 1 125 ? -11.980 6.531   16.158  1.00 21.94 ? 125 GLU A C    5  
ATOM 9789  O O    . GLU A 1 125 ? -10.798 6.227   16.300  1.00 22.50 ? 125 GLU A O    5  
ATOM 9790  C CB   . GLU A 1 125 ? -13.323 7.610   14.349  1.00 20.98 ? 125 GLU A CB   5  
ATOM 9791  C CG   . GLU A 1 125 ? -12.314 8.619   13.837  1.00 20.93 ? 125 GLU A CG   5  
ATOM 9792  C CD   . GLU A 1 125 ? -12.956 9.942   13.488  1.00 21.01 ? 125 GLU A CD   5  
ATOM 9793  O OE1  . GLU A 1 125 ? -13.656 10.019  12.461  1.00 20.79 ? 125 GLU A OE1  5  
ATOM 9794  O OE2  . GLU A 1 125 ? -12.759 10.915  14.244  1.00 21.38 ? 125 GLU A OE2  5  
ATOM 9795  H H    . GLU A 1 125 ? -13.884 4.899   15.884  1.00 19.85 ? 125 GLU A H    5  
ATOM 9796  H HA   . GLU A 1 125 ? -11.977 5.957   14.104  1.00 21.11 ? 125 GLU A HA   5  
ATOM 9797  H HB2  . GLU A 1 125 ? -14.013 7.387   13.549  1.00 20.83 ? 125 GLU A HB2  5  
ATOM 9798  H HB3  . GLU A 1 125 ? -13.868 8.060   15.167  1.00 21.23 ? 125 GLU A HB3  5  
ATOM 9799  H HG2  . GLU A 1 125 ? -11.567 8.786   14.600  1.00 20.90 ? 125 GLU A HG2  5  
ATOM 9800  H HG3  . GLU A 1 125 ? -11.841 8.220   12.952  1.00 21.00 ? 125 GLU A HG3  5  
ATOM 9801  N N    . ASN A 1 126 ? -12.718 7.050   17.127  1.00 22.18 ? 126 ASN A N    5  
ATOM 9802  C CA   . ASN A 1 126 ? -12.178 7.307   18.457  1.00 23.12 ? 126 ASN A CA   5  
ATOM 9803  C C    . ASN A 1 126 ? -12.068 6.009   19.243  1.00 23.54 ? 126 ASN A C    5  
ATOM 9804  O O    . ASN A 1 126 ? -11.149 5.821   20.040  1.00 23.81 ? 126 ASN A O    5  
ATOM 9805  C CB   . ASN A 1 126 ? -13.070 8.305   19.203  1.00 23.38 ? 126 ASN A CB   5  
ATOM 9806  C CG   . ASN A 1 126 ? -12.667 8.488   20.654  1.00 23.74 ? 126 ASN A CG   5  
ATOM 9807  O OD1  . ASN A 1 126 ? -13.161 7.793   21.543  1.00 23.88 ? 126 ASN A OD1  5  
ATOM 9808  N ND2  . ASN A 1 126 ? -11.771 9.428   20.905  1.00 23.99 ? 126 ASN A ND2  5  
ATOM 9809  H H    . ASN A 1 126 ? -13.662 7.273   16.944  1.00 21.78 ? 126 ASN A H    5  
ATOM 9810  H HA   . ASN A 1 126 ? -11.191 7.731   18.342  1.00 23.43 ? 126 ASN A HA   5  
ATOM 9811  H HB2  . ASN A 1 126 ? -13.010 9.264   18.713  1.00 23.29 ? 126 ASN A HB2  5  
ATOM 9812  H HB3  . ASN A 1 126 ? -14.090 7.954   19.173  1.00 23.53 ? 126 ASN A HB3  5  
ATOM 9813  H HD21 . ASN A 1 126 ? -11.423 9.954   20.146  1.00 23.94 ? 126 ASN A HD21 5  
ATOM 9814  H HD22 . ASN A 1 126 ? -11.486 9.562   21.838  1.00 24.29 ? 126 ASN A HD22 5  
ATOM 9815  N N    . SER A 1 127 ? -13.008 5.112   19.003  1.00 23.70 ? 127 SER A N    5  
ATOM 9816  C CA   . SER A 1 127 ? -13.031 3.835   19.682  1.00 24.19 ? 127 SER A CA   5  
ATOM 9817  C C    . SER A 1 127 ? -13.547 2.755   18.741  1.00 24.67 ? 127 SER A C    5  
ATOM 9818  O O    . SER A 1 127 ? -14.186 3.064   17.727  1.00 25.00 ? 127 SER A O    5  
ATOM 9819  C CB   . SER A 1 127 ? -13.918 3.924   20.931  1.00 24.36 ? 127 SER A CB   5  
ATOM 9820  O OG   . SER A 1 127 ? -13.842 2.744   21.717  1.00 24.58 ? 127 SER A OG   5  
ATOM 9821  H H    . SER A 1 127 ? -13.707 5.315   18.349  1.00 23.55 ? 127 SER A H    5  
ATOM 9822  H HA   . SER A 1 127 ? -12.022 3.592   19.980  1.00 24.21 ? 127 SER A HA   5  
ATOM 9823  H HB2  . SER A 1 127 ? -13.599 4.760   21.536  1.00 24.43 ? 127 SER A HB2  5  
ATOM 9824  H HB3  . SER A 1 127 ? -14.943 4.073   20.628  1.00 24.36 ? 127 SER A HB3  5  
ATOM 9825  H HG   . SER A 1 127 ? -13.830 2.986   22.653  1.00 24.78 ? 127 SER A HG   5  
ATOM 9826  N N    . ARG A 1 128 ? -13.232 1.506   19.075  1.00 24.79 ? 128 ARG A N    5  
ATOM 9827  C CA   . ARG A 1 128 ? -13.736 0.336   18.362  1.00 25.33 ? 128 ARG A CA   5  
ATOM 9828  C C    . ARG A 1 128 ? -13.154 0.274   16.948  1.00 25.41 ? 128 ARG A C    5  
ATOM 9829  O O    . ARG A 1 128 ? -11.989 0.691   16.769  1.00 25.41 ? 128 ARG A O    5  
ATOM 9830  C CB   . ARG A 1 128 ? -15.274 0.363   18.341  1.00 25.71 ? 128 ARG A CB   5  
ATOM 9831  C CG   . ARG A 1 128 ? -15.934 -0.953  17.959  1.00 25.88 ? 128 ARG A CG   5  
ATOM 9832  C CD   . ARG A 1 128 ? -17.420 -0.934  18.283  1.00 26.27 ? 128 ARG A CD   5  
ATOM 9833  N NE   . ARG A 1 128 ? -17.654 -0.788  19.720  1.00 26.63 ? 128 ARG A NE   5  
ATOM 9834  C CZ   . ARG A 1 128 ? -18.384 0.183   20.269  1.00 27.12 ? 128 ARG A CZ   5  
ATOM 9835  N NH1  . ARG A 1 128 ? -18.997 1.079   19.500  1.00 27.29 ? 128 ARG A NH1  5  
ATOM 9836  N NH2  . ARG A 1 128 ? -18.517 0.249   21.588  1.00 27.52 ? 128 ARG A NH2  5  
ATOM 9837  O OXT  . ARG A 1 128 ? -13.835 -0.237  16.035  1.00 25.55 ? 128 ARG A OXT  5  
ATOM 9838  H H    . ARG A 1 128 ? -12.620 1.366   19.830  1.00 24.58 ? 128 ARG A H    5  
ATOM 9839  H HA   . ARG A 1 128 ? -13.411 -0.540  18.906  1.00 25.50 ? 128 ARG A HA   5  
ATOM 9840  H HB2  . ARG A 1 128 ? -15.628 0.638   19.323  1.00 25.74 ? 128 ARG A HB2  5  
ATOM 9841  H HB3  . ARG A 1 128 ? -15.594 1.114   17.634  1.00 25.93 ? 128 ARG A HB3  5  
ATOM 9842  H HG2  . ARG A 1 128 ? -15.809 -1.115  16.898  1.00 25.82 ? 128 ARG A HG2  5  
ATOM 9843  H HG3  . ARG A 1 128 ? -15.465 -1.757  18.508  1.00 25.90 ? 128 ARG A HG3  5  
ATOM 9844  H HD2  . ARG A 1 128 ? -17.880 -0.104  17.765  1.00 26.12 ? 128 ARG A HD2  5  
ATOM 9845  H HD3  . ARG A 1 128 ? -17.862 -1.859  17.946  1.00 26.52 ? 128 ARG A HD3  5  
ATOM 9846  H HE   . ARG A 1 128 ? -17.222 -1.453  20.315  1.00 26.57 ? 128 ARG A HE   5  
ATOM 9847  H HH11 . ARG A 1 128 ? -18.918 1.027   18.498  1.00 27.05 ? 128 ARG A HH11 5  
ATOM 9848  H HH12 . ARG A 1 128 ? -19.535 1.818   19.916  1.00 27.71 ? 128 ARG A HH12 5  
ATOM 9849  H HH21 . ARG A 1 128 ? -18.070 -0.434  22.179  1.00 27.46 ? 128 ARG A HH21 5  
ATOM 9850  H HH22 . ARG A 1 128 ? -19.055 0.994   22.005  1.00 27.94 ? 128 ARG A HH22 5  
ATOM 9851  N N    . GLY A 1 1   ? -12.051 -17.860 -12.942 1.00 11.87 ? 1   GLY A N    6  
ATOM 9852  C CA   . GLY A 1 1   ? -13.079 -18.407 -12.026 1.00 11.28 ? 1   GLY A CA   6  
ATOM 9853  C C    . GLY A 1 1   ? -12.863 -17.948 -10.603 1.00 10.17 ? 1   GLY A C    6  
ATOM 9854  O O    . GLY A 1 1   ? -13.545 -17.042 -10.123 1.00 9.93  ? 1   GLY A O    6  
ATOM 9855  H H1   . GLY A 1 1   ? -12.103 -16.819 -12.957 1.00 12.05 ? 1   GLY A H1   6  
ATOM 9856  H H2   . GLY A 1 1   ? -12.201 -18.219 -13.906 1.00 12.06 ? 1   GLY A H2   6  
ATOM 9857  H H3   . GLY A 1 1   ? -11.099 -18.140 -12.622 1.00 12.09 ? 1   GLY A H3   6  
ATOM 9858  H HA2  . GLY A 1 1   ? -14.055 -18.080 -12.356 1.00 11.56 ? 1   GLY A HA2  6  
ATOM 9859  H HA3  . GLY A 1 1   ? -13.040 -19.487 -12.057 1.00 11.57 ? 1   GLY A HA3  6  
ATOM 9860  N N    . ILE A 1 2   ? -11.903 -18.561 -9.928  1.00 9.64  ? 2   ILE A N    6  
ATOM 9861  C CA   . ILE A 1 2   ? -11.572 -18.185 -8.561  1.00 8.69  ? 2   ILE A CA   6  
ATOM 9862  C C    . ILE A 1 2   ? -10.169 -17.600 -8.487  1.00 7.70  ? 2   ILE A C    6  
ATOM 9863  O O    . ILE A 1 2   ? -9.251  -18.073 -9.161  1.00 7.79  ? 2   ILE A O    6  
ATOM 9864  C CB   . ILE A 1 2   ? -11.671 -19.386 -7.592  1.00 9.07  ? 2   ILE A CB   6  
ATOM 9865  C CG1  . ILE A 1 2   ? -10.807 -20.555 -8.079  1.00 9.41  ? 2   ILE A CG1  6  
ATOM 9866  C CG2  . ILE A 1 2   ? -13.121 -19.816 -7.432  1.00 9.20  ? 2   ILE A CG2  6  
ATOM 9867  C CD1  . ILE A 1 2   ? -10.812 -21.747 -7.146  1.00 9.86  ? 2   ILE A CD1  6  
ATOM 9868  H H    . ILE A 1 2   ? -11.396 -19.288 -10.363 1.00 10.00 ? 2   ILE A H    6  
ATOM 9869  H HA   . ILE A 1 2   ? -12.281 -17.433 -8.243  1.00 8.63  ? 2   ILE A HA   6  
ATOM 9870  H HB   . ILE A 1 2   ? -11.314 -19.065 -6.625  1.00 9.29  ? 2   ILE A HB   6  
ATOM 9871  H HG12 . ILE A 1 2   ? -11.170 -20.885 -9.041  1.00 9.55  ? 2   ILE A HG12 6  
ATOM 9872  H HG13 . ILE A 1 2   ? -9.786  -20.218 -8.182  1.00 9.48  ? 2   ILE A HG13 6  
ATOM 9873  H HG21 . ILE A 1 2   ? -13.175 -20.655 -6.752  1.00 9.37  ? 2   ILE A HG21 6  
ATOM 9874  H HG22 . ILE A 1 2   ? -13.518 -20.105 -8.394  1.00 9.31  ? 2   ILE A HG22 6  
ATOM 9875  H HG23 . ILE A 1 2   ? -13.697 -18.995 -7.036  1.00 9.29  ? 2   ILE A HG23 6  
ATOM 9876  H HD11 . ILE A 1 2   ? -11.820 -22.124 -7.052  1.00 9.83  ? 2   ILE A HD11 6  
ATOM 9877  H HD12 . ILE A 1 2   ? -10.448 -21.444 -6.177  1.00 10.30 ? 2   ILE A HD12 6  
ATOM 9878  H HD13 . ILE A 1 2   ? -10.174 -22.520 -7.547  1.00 9.99  ? 2   ILE A HD13 6  
ATOM 9879  N N    . ASP A 1 3   ? -10.017 -16.545 -7.705  1.00 6.96  ? 3   ASP A N    6  
ATOM 9880  C CA   . ASP A 1 3   ? -8.700  -16.001 -7.416  1.00 6.18  ? 3   ASP A CA   6  
ATOM 9881  C C    . ASP A 1 3   ? -8.163  -16.630 -6.135  1.00 5.44  ? 3   ASP A C    6  
ATOM 9882  O O    . ASP A 1 3   ? -8.933  -16.886 -5.209  1.00 5.15  ? 3   ASP A O    6  
ATOM 9883  C CB   . ASP A 1 3   ? -8.739  -14.472 -7.287  1.00 6.00  ? 3   ASP A CB   6  
ATOM 9884  C CG   . ASP A 1 3   ? -9.526  -13.994 -6.079  1.00 6.08  ? 3   ASP A CG   6  
ATOM 9885  O OD1  . ASP A 1 3   ? -8.935  -13.888 -4.981  1.00 6.03  ? 3   ASP A OD1  6  
ATOM 9886  O OD2  . ASP A 1 3   ? -10.742 -13.738 -6.218  1.00 6.51  ? 3   ASP A OD2  6  
ATOM 9887  H H    . ASP A 1 3   ? -10.810 -16.118 -7.313  1.00 7.10  ? 3   ASP A H    6  
ATOM 9888  H HA   . ASP A 1 3   ? -8.047  -16.268 -8.234  1.00 6.61  ? 3   ASP A HA   6  
ATOM 9889  H HB2  . ASP A 1 3   ? -7.729  -14.101 -7.199  1.00 6.26  ? 3   ASP A HB2  6  
ATOM 9890  H HB3  . ASP A 1 3   ? -9.193  -14.058 -8.175  1.00 5.95  ? 3   ASP A HB3  6  
ATOM 9891  N N    . PRO A 1 4   ? -6.859  -16.929 -6.071  1.00 5.55  ? 4   PRO A N    6  
ATOM 9892  C CA   . PRO A 1 4   ? -6.265  -17.612 -4.917  1.00 5.42  ? 4   PRO A CA   6  
ATOM 9893  C C    . PRO A 1 4   ? -6.475  -16.863 -3.601  1.00 4.78  ? 4   PRO A C    6  
ATOM 9894  O O    . PRO A 1 4   ? -7.255  -17.298 -2.745  1.00 4.92  ? 4   PRO A O    6  
ATOM 9895  C CB   . PRO A 1 4   ? -4.775  -17.688 -5.266  1.00 6.21  ? 4   PRO A CB   6  
ATOM 9896  C CG   . PRO A 1 4   ? -4.724  -17.557 -6.748  1.00 6.65  ? 4   PRO A CG   6  
ATOM 9897  C CD   . PRO A 1 4   ? -5.863  -16.648 -7.116  1.00 6.29  ? 4   PRO A CD   6  
ATOM 9898  H HA   . PRO A 1 4   ? -6.656  -18.614 -4.817  1.00 5.67  ? 4   PRO A HA   6  
ATOM 9899  H HB2  . PRO A 1 4   ? -4.246  -16.882 -4.777  1.00 6.22  ? 4   PRO A HB2  6  
ATOM 9900  H HB3  . PRO A 1 4   ? -4.375  -18.637 -4.941  1.00 6.74  ? 4   PRO A HB3  6  
ATOM 9901  H HG2  . PRO A 1 4   ? -3.782  -17.119 -7.047  1.00 6.90  ? 4   PRO A HG2  6  
ATOM 9902  H HG3  . PRO A 1 4   ? -4.853  -18.526 -7.208  1.00 7.27  ? 4   PRO A HG3  6  
ATOM 9903  H HD2  . PRO A 1 4   ? -5.549  -15.615 -7.083  1.00 6.29  ? 4   PRO A HD2  6  
ATOM 9904  H HD3  . PRO A 1 4   ? -6.248  -16.897 -8.095  1.00 6.88  ? 4   PRO A HD3  6  
ATOM 9905  N N    . PHE A 1 5   ? -5.785  -15.736 -3.442  1.00 4.52  ? 5   PHE A N    6  
ATOM 9906  C CA   . PHE A 1 5   ? -5.845  -14.973 -2.200  1.00 4.35  ? 5   PHE A CA   6  
ATOM 9907  C C    . PHE A 1 5   ? -5.792  -13.472 -2.463  1.00 3.69  ? 5   PHE A C    6  
ATOM 9908  O O    . PHE A 1 5   ? -4.895  -12.782 -1.978  1.00 3.93  ? 5   PHE A O    6  
ATOM 9909  C CB   . PHE A 1 5   ? -4.686  -15.355 -1.272  1.00 5.29  ? 5   PHE A CB   6  
ATOM 9910  C CG   . PHE A 1 5   ? -4.789  -16.738 -0.688  1.00 6.13  ? 5   PHE A CG   6  
ATOM 9911  C CD1  . PHE A 1 5   ? -5.597  -16.983 0.411   1.00 6.53  ? 5   PHE A CD1  6  
ATOM 9912  C CD2  . PHE A 1 5   ? -4.075  -17.792 -1.237  1.00 6.78  ? 5   PHE A CD2  6  
ATOM 9913  C CE1  . PHE A 1 5   ? -5.693  -18.251 0.950   1.00 7.42  ? 5   PHE A CE1  6  
ATOM 9914  C CE2  . PHE A 1 5   ? -4.168  -19.064 -0.701  1.00 7.72  ? 5   PHE A CE2  6  
ATOM 9915  C CZ   . PHE A 1 5   ? -4.979  -19.293 0.393   1.00 7.99  ? 5   PHE A CZ   6  
ATOM 9916  H H    . PHE A 1 5   ? -5.226  -15.409 -4.178  1.00 4.77  ? 5   PHE A H    6  
ATOM 9917  H HA   . PHE A 1 5   ? -6.777  -15.206 -1.711  1.00 4.48  ? 5   PHE A HA   6  
ATOM 9918  H HB2  . PHE A 1 5   ? -3.762  -15.296 -1.827  1.00 5.51  ? 5   PHE A HB2  6  
ATOM 9919  H HB3  . PHE A 1 5   ? -4.650  -14.649 -0.455  1.00 5.50  ? 5   PHE A HB3  6  
ATOM 9920  H HD1  . PHE A 1 5   ? -6.159  -16.169 0.847   1.00 6.31  ? 5   PHE A HD1  6  
ATOM 9921  H HD2  . PHE A 1 5   ? -3.440  -17.615 -2.093  1.00 6.71  ? 5   PHE A HD2  6  
ATOM 9922  H HE1  . PHE A 1 5   ? -6.325  -18.427 1.807   1.00 7.82  ? 5   PHE A HE1  6  
ATOM 9923  H HE2  . PHE A 1 5   ? -3.605  -19.878 -1.139  1.00 8.37  ? 5   PHE A HE2  6  
ATOM 9924  H HZ   . PHE A 1 5   ? -5.053  -20.286 0.813   1.00 8.77  ? 5   PHE A HZ   6  
ATOM 9925  N N    . THR A 1 6   ? -6.741  -12.962 -3.226  1.00 3.31  ? 6   THR A N    6  
ATOM 9926  C CA   . THR A 1 6   ? -6.823  -11.530 -3.447  1.00 3.02  ? 6   THR A CA   6  
ATOM 9927  C C    . THR A 1 6   ? -7.731  -10.904 -2.395  1.00 2.13  ? 6   THR A C    6  
ATOM 9928  O O    . THR A 1 6   ? -8.959  -10.950 -2.505  1.00 2.37  ? 6   THR A O    6  
ATOM 9929  C CB   . THR A 1 6   ? -7.341  -11.206 -4.856  1.00 3.65  ? 6   THR A CB   6  
ATOM 9930  O OG1  . THR A 1 6   ? -6.872  -12.196 -5.778  1.00 4.26  ? 6   THR A OG1  6  
ATOM 9931  C CG2  . THR A 1 6   ? -6.857  -9.836  -5.297  1.00 4.04  ? 6   THR A CG2  6  
ATOM 9932  H H    . THR A 1 6   ? -7.404  -13.556 -3.649  1.00 3.60  ? 6   THR A H    6  
ATOM 9933  H HA   . THR A 1 6   ? -5.828  -11.117 -3.343  1.00 3.50  ? 6   THR A HA   6  
ATOM 9934  H HB   . THR A 1 6   ? -8.421  -11.210 -4.843  1.00 3.99  ? 6   THR A HB   6  
ATOM 9935  H HG1  . THR A 1 6   ? -7.408  -12.994 -5.680  1.00 4.39  ? 6   THR A HG1  6  
ATOM 9936  H HG21 . THR A 1 6   ? -7.206  -9.634  -6.298  1.00 4.31  ? 6   THR A HG21 6  
ATOM 9937  H HG22 . THR A 1 6   ? -5.776  -9.814  -5.277  1.00 4.49  ? 6   THR A HG22 6  
ATOM 9938  H HG23 . THR A 1 6   ? -7.243  -9.086  -4.622  1.00 4.15  ? 6   THR A HG23 6  
ATOM 9939  N N    . MET A 1 7   ? -7.113  -10.320 -1.378  1.00 1.53  ? 7   MET A N    6  
ATOM 9940  C CA   . MET A 1 7   ? -7.826  -9.896  -0.178  1.00 1.05  ? 7   MET A CA   6  
ATOM 9941  C C    . MET A 1 7   ? -8.228  -8.431  -0.249  1.00 0.83  ? 7   MET A C    6  
ATOM 9942  O O    . MET A 1 7   ? -9.048  -7.966  0.540   1.00 1.39  ? 7   MET A O    6  
ATOM 9943  C CB   . MET A 1 7   ? -6.960  -10.160 1.060   1.00 1.50  ? 7   MET A CB   6  
ATOM 9944  C CG   . MET A 1 7   ? -5.604  -9.471  1.017   1.00 2.32  ? 7   MET A CG   6  
ATOM 9945  S SD   . MET A 1 7   ? -4.520  -9.975  2.368   1.00 3.29  ? 7   MET A SD   6  
ATOM 9946  C CE   . MET A 1 7   ? -4.277  -11.708 1.979   1.00 3.84  ? 7   MET A CE   6  
ATOM 9947  H H    . MET A 1 7   ? -6.151  -10.155 -1.440  1.00 1.86  ? 7   MET A H    6  
ATOM 9948  H HA   . MET A 1 7   ? -8.719  -10.488 -0.108  1.00 1.34  ? 7   MET A HA   6  
ATOM 9949  H HB2  . MET A 1 7   ? -7.488  -9.812  1.935   1.00 1.93  ? 7   MET A HB2  6  
ATOM 9950  H HB3  . MET A 1 7   ? -6.795  -11.224 1.147   1.00 1.78  ? 7   MET A HB3  6  
ATOM 9951  H HG2  . MET A 1 7   ? -5.121  -9.712  0.081   1.00 2.59  ? 7   MET A HG2  6  
ATOM 9952  H HG3  . MET A 1 7   ? -5.756  -8.402  1.075   1.00 2.65  ? 7   MET A HG3  6  
ATOM 9953  H HE1  . MET A 1 7   ? -3.628  -12.155 2.717   1.00 4.06  ? 7   MET A HE1  6  
ATOM 9954  H HE2  . MET A 1 7   ? -3.827  -11.797 1.001   1.00 4.06  ? 7   MET A HE2  6  
ATOM 9955  H HE3  . MET A 1 7   ? -5.231  -12.214 1.985   1.00 4.32  ? 7   MET A HE3  6  
ATOM 9956  N N    . LEU A 1 8   ? -7.625  -7.716  -1.189  1.00 0.80  ? 8   LEU A N    6  
ATOM 9957  C CA   . LEU A 1 8   ? -7.975  -6.327  -1.485  1.00 0.56  ? 8   LEU A CA   6  
ATOM 9958  C C    . LEU A 1 8   ? -7.719  -5.397  -0.308  1.00 0.48  ? 8   LEU A C    6  
ATOM 9959  O O    . LEU A 1 8   ? -8.264  -4.294  -0.244  1.00 0.47  ? 8   LEU A O    6  
ATOM 9960  C CB   . LEU A 1 8   ? -9.428  -6.223  -1.921  1.00 0.47  ? 8   LEU A CB   6  
ATOM 9961  C CG   . LEU A 1 8   ? -9.782  -7.030  -3.164  1.00 0.56  ? 8   LEU A CG   6  
ATOM 9962  C CD1  . LEU A 1 8   ? -11.244 -6.855  -3.485  1.00 0.61  ? 8   LEU A CD1  6  
ATOM 9963  C CD2  . LEU A 1 8   ? -8.921  -6.602  -4.343  1.00 0.72  ? 8   LEU A CD2  6  
ATOM 9964  H H    . LEU A 1 8   ? -6.909  -8.140  -1.708  1.00 1.36  ? 8   LEU A H    6  
ATOM 9965  H HA   . LEU A 1 8   ? -7.351  -6.009  -2.307  1.00 0.70  ? 8   LEU A HA   6  
ATOM 9966  H HB2  . LEU A 1 8   ? -10.053 -6.559  -1.106  1.00 0.54  ? 8   LEU A HB2  6  
ATOM 9967  H HB3  . LEU A 1 8   ? -9.648  -5.186  -2.119  1.00 0.53  ? 8   LEU A HB3  6  
ATOM 9968  H HG   . LEU A 1 8   ? -9.600  -8.079  -2.974  1.00 0.64  ? 8   LEU A HG   6  
ATOM 9969  H HD11 . LEU A 1 8   ? -11.492 -7.433  -4.361  1.00 1.21  ? 8   LEU A HD11 6  
ATOM 9970  H HD12 . LEU A 1 8   ? -11.442 -5.811  -3.669  1.00 0.99  ? 8   LEU A HD12 6  
ATOM 9971  H HD13 . LEU A 1 8   ? -11.837 -7.194  -2.646  1.00 1.34  ? 8   LEU A HD13 6  
ATOM 9972  H HD21 . LEU A 1 8   ? -9.158  -7.210  -5.205  1.00 1.31  ? 8   LEU A HD21 6  
ATOM 9973  H HD22 . LEU A 1 8   ? -7.879  -6.729  -4.090  1.00 1.24  ? 8   LEU A HD22 6  
ATOM 9974  H HD23 . LEU A 1 8   ? -9.113  -5.564  -4.570  1.00 1.27  ? 8   LEU A HD23 6  
ATOM 9975  N N    . ARG A 1 9   ? -6.890  -5.838  0.617   1.00 0.52  ? 9   ARG A N    6  
ATOM 9976  C CA   . ARG A 1 9   ? -6.468  -4.992  1.712   1.00 0.51  ? 9   ARG A CA   6  
ATOM 9977  C C    . ARG A 1 9   ? -4.975  -4.737  1.584   1.00 0.43  ? 9   ARG A C    6  
ATOM 9978  O O    . ARG A 1 9   ? -4.282  -5.484  0.891   1.00 0.47  ? 9   ARG A O    6  
ATOM 9979  C CB   . ARG A 1 9   ? -6.807  -5.623  3.070   1.00 0.69  ? 9   ARG A CB   6  
ATOM 9980  C CG   . ARG A 1 9   ? -6.126  -6.952  3.338   1.00 1.15  ? 9   ARG A CG   6  
ATOM 9981  C CD   . ARG A 1 9   ? -6.476  -7.467  4.722   1.00 1.21  ? 9   ARG A CD   6  
ATOM 9982  N NE   . ARG A 1 9   ? -5.957  -8.810  4.963   1.00 1.84  ? 9   ARG A NE   6  
ATOM 9983  C CZ   . ARG A 1 9   ? -6.415  -9.613  5.922   1.00 2.23  ? 9   ARG A CZ   6  
ATOM 9984  N NH1  . ARG A 1 9   ? -7.377  -9.190  6.733   1.00 2.21  ? 9   ARG A NH1  6  
ATOM 9985  N NH2  . ARG A 1 9   ? -5.902  -10.824 6.083   1.00 3.09  ? 9   ARG A NH2  6  
ATOM 9986  H H    . ARG A 1 9   ? -6.539  -6.748  0.552   1.00 0.60  ? 9   ARG A H    6  
ATOM 9987  H HA   . ARG A 1 9   ? -6.990  -4.050  1.620   1.00 0.51  ? 9   ARG A HA   6  
ATOM 9988  H HB2  . ARG A 1 9   ? -6.516  -4.940  3.850   1.00 1.21  ? 9   ARG A HB2  6  
ATOM 9989  H HB3  . ARG A 1 9   ? -7.875  -5.777  3.122   1.00 1.12  ? 9   ARG A HB3  6  
ATOM 9990  H HG2  . ARG A 1 9   ? -6.449  -7.672  2.601   1.00 1.62  ? 9   ARG A HG2  6  
ATOM 9991  H HG3  . ARG A 1 9   ? -5.056  -6.816  3.272   1.00 1.68  ? 9   ARG A HG3  6  
ATOM 9992  H HD2  . ARG A 1 9   ? -6.058  -6.796  5.456   1.00 1.50  ? 9   ARG A HD2  6  
ATOM 9993  H HD3  . ARG A 1 9   ? -7.551  -7.484  4.824   1.00 1.36  ? 9   ARG A HD3  6  
ATOM 9994  H HE   . ARG A 1 9   ? -5.232  -9.128  4.377   1.00 2.36  ? 9   ARG A HE   6  
ATOM 9995  H HH11 . ARG A 1 9   ? -7.753  -8.266  6.629   1.00 1.99  ? 9   ARG A HH11 6  
ATOM 9996  H HH12 . ARG A 1 9   ? -7.739  -9.791  7.452   1.00 2.76  ? 9   ARG A HH12 6  
ATOM 9997  H HH21 . ARG A 1 9   ? -5.153  -11.148 5.484   1.00 3.51  ? 9   ARG A HH21 6  
ATOM 9998  H HH22 . ARG A 1 9   ? -6.258  -11.434 6.804   1.00 3.49  ? 9   ARG A HH22 6  
ATOM 9999  N N    . PRO A 1 10  ? -4.457  -3.681  2.226   1.00 0.36  ? 10  PRO A N    6  
ATOM 10000 C CA   . PRO A 1 10  ? -3.044  -3.333  2.122   1.00 0.30  ? 10  PRO A CA   6  
ATOM 10001 C C    . PRO A 1 10  ? -2.145  -4.433  2.677   1.00 0.28  ? 10  PRO A C    6  
ATOM 10002 O O    . PRO A 1 10  ? -2.609  -5.366  3.338   1.00 0.38  ? 10  PRO A O    6  
ATOM 10003 C CB   . PRO A 1 10  ? -2.921  -2.049  2.953   1.00 0.29  ? 10  PRO A CB   6  
ATOM 10004 C CG   . PRO A 1 10  ? -4.093  -2.066  3.864   1.00 0.47  ? 10  PRO A CG   6  
ATOM 10005 C CD   . PRO A 1 10  ? -5.187  -2.763  3.110   1.00 0.40  ? 10  PRO A CD   6  
ATOM 10006 H HA   . PRO A 1 10  ? -2.765  -3.130  1.098   1.00 0.33  ? 10  PRO A HA   6  
ATOM 10007 H HB2  . PRO A 1 10  ? -1.992  -2.061  3.502   1.00 0.37  ? 10  PRO A HB2  6  
ATOM 10008 H HB3  . PRO A 1 10  ? -2.948  -1.191  2.299   1.00 0.38  ? 10  PRO A HB3  6  
ATOM 10009 H HG2  . PRO A 1 10  ? -3.851  -2.611  4.765   1.00 0.70  ? 10  PRO A HG2  6  
ATOM 10010 H HG3  . PRO A 1 10  ? -4.388  -1.055  4.103   1.00 0.81  ? 10  PRO A HG3  6  
ATOM 10011 H HD2  . PRO A 1 10  ? -5.815  -3.308  3.790   1.00 0.50  ? 10  PRO A HD2  6  
ATOM 10012 H HD3  . PRO A 1 10  ? -5.766  -2.054  2.538   1.00 0.57  ? 10  PRO A HD3  6  
ATOM 10013 N N    . ARG A 1 11  ? -0.866  -4.329  2.393   1.00 0.29  ? 11  ARG A N    6  
ATOM 10014 C CA   . ARG A 1 11  ? 0.102   -5.305  2.855   1.00 0.34  ? 11  ARG A CA   6  
ATOM 10015 C C    . ARG A 1 11  ? 1.265   -4.609  3.552   1.00 0.27  ? 11  ARG A C    6  
ATOM 10016 O O    . ARG A 1 11  ? 1.754   -3.578  3.083   1.00 0.27  ? 11  ARG A O    6  
ATOM 10017 C CB   . ARG A 1 11  ? 0.569   -6.147  1.665   1.00 0.49  ? 11  ARG A CB   6  
ATOM 10018 C CG   . ARG A 1 11  ? 0.934   -5.316  0.442   1.00 0.63  ? 11  ARG A CG   6  
ATOM 10019 C CD   . ARG A 1 11  ? 0.789   -6.102  -0.848  1.00 1.00  ? 11  ARG A CD   6  
ATOM 10020 N NE   . ARG A 1 11  ? 1.548   -7.344  -0.813  1.00 1.22  ? 11  ARG A NE   6  
ATOM 10021 C CZ   . ARG A 1 11  ? 2.791   -7.467  -1.269  1.00 1.59  ? 11  ARG A CZ   6  
ATOM 10022 N NH1  . ARG A 1 11  ? 3.394   -6.437  -1.846  1.00 1.95  ? 11  ARG A NH1  6  
ATOM 10023 N NH2  . ARG A 1 11  ? 3.418   -8.630  -1.168  1.00 2.37  ? 11  ARG A NH2  6  
ATOM 10024 H H    . ARG A 1 11  ? -0.558  -3.575  1.840   1.00 0.33  ? 11  ARG A H    6  
ATOM 10025 H HA   . ARG A 1 11  ? -0.392  -5.949  3.567   1.00 0.40  ? 11  ARG A HA   6  
ATOM 10026 H HB2  . ARG A 1 11  ? 1.437   -6.718  1.961   1.00 0.63  ? 11  ARG A HB2  6  
ATOM 10027 H HB3  . ARG A 1 11  ? -0.222  -6.828  1.388   1.00 0.78  ? 11  ARG A HB3  6  
ATOM 10028 H HG2  . ARG A 1 11  ? 0.284   -4.456  0.399   1.00 0.94  ? 11  ARG A HG2  6  
ATOM 10029 H HG3  . ARG A 1 11  ? 1.958   -4.987  0.538   1.00 0.71  ? 11  ARG A HG3  6  
ATOM 10030 H HD2  . ARG A 1 11  ? -0.255  -6.335  -0.998  1.00 1.68  ? 11  ARG A HD2  6  
ATOM 10031 H HD3  . ARG A 1 11  ? 1.144   -5.495  -1.670  1.00 1.50  ? 11  ARG A HD3  6  
ATOM 10032 H HE   . ARG A 1 11  ? 1.106   -8.130  -0.413  1.00 1.83  ? 11  ARG A HE   6  
ATOM 10033 H HH11 . ARG A 1 11  ? 2.912   -5.554  -1.948  1.00 2.06  ? 11  ARG A HH11 6  
ATOM 10034 H HH12 . ARG A 1 11  ? 4.332   -6.523  -2.185  1.00 2.55  ? 11  ARG A HH12 6  
ATOM 10035 H HH21 . ARG A 1 11  ? 2.955   -9.423  -0.751  1.00 2.82  ? 11  ARG A HH21 6  
ATOM 10036 H HH22 . ARG A 1 11  ? 4.368   -8.724  -1.490  1.00 2.79  ? 11  ARG A HH22 6  
ATOM 10037 N N    . LEU A 1 12  ? 1.677   -5.158  4.688   1.00 0.29  ? 12  LEU A N    6  
ATOM 10038 C CA   . LEU A 1 12  ? 2.722   -4.550  5.500   1.00 0.26  ? 12  LEU A CA   6  
ATOM 10039 C C    . LEU A 1 12  ? 4.068   -5.187  5.189   1.00 0.25  ? 12  LEU A C    6  
ATOM 10040 O O    . LEU A 1 12  ? 4.266   -6.387  5.400   1.00 0.32  ? 12  LEU A O    6  
ATOM 10041 C CB   . LEU A 1 12  ? 2.420   -4.718  6.993   1.00 0.34  ? 12  LEU A CB   6  
ATOM 10042 C CG   . LEU A 1 12  ? 2.446   -3.431  7.832   1.00 0.60  ? 12  LEU A CG   6  
ATOM 10043 C CD1  . LEU A 1 12  ? 2.424   -3.768  9.315   1.00 1.32  ? 12  LEU A CD1  6  
ATOM 10044 C CD2  . LEU A 1 12  ? 3.657   -2.573  7.503   1.00 1.28  ? 12  LEU A CD2  6  
ATOM 10045 H H    . LEU A 1 12  ? 1.285   -6.012  4.979   1.00 0.35  ? 12  LEU A H    6  
ATOM 10046 H HA   . LEU A 1 12  ? 2.763   -3.498  5.261   1.00 0.24  ? 12  LEU A HA   6  
ATOM 10047 H HB2  . LEU A 1 12  ? 1.441   -5.164  7.091   1.00 0.72  ? 12  LEU A HB2  6  
ATOM 10048 H HB3  . LEU A 1 12  ? 3.146   -5.402  7.406   1.00 0.66  ? 12  LEU A HB3  6  
ATOM 10049 H HG   . LEU A 1 12  ? 1.558   -2.855  7.612   1.00 1.58  ? 12  LEU A HG   6  
ATOM 10050 H HD11 . LEU A 1 12  ? 2.452   -2.854  9.894   1.00 1.80  ? 12  LEU A HD11 6  
ATOM 10051 H HD12 . LEU A 1 12  ? 3.285   -4.373  9.558   1.00 1.95  ? 12  LEU A HD12 6  
ATOM 10052 H HD13 . LEU A 1 12  ? 1.522   -4.315  9.546   1.00 1.91  ? 12  LEU A HD13 6  
ATOM 10053 H HD21 . LEU A 1 12  ? 3.641   -2.314  6.456   1.00 1.90  ? 12  LEU A HD21 6  
ATOM 10054 H HD22 . LEU A 1 12  ? 4.560   -3.123  7.725   1.00 1.96  ? 12  LEU A HD22 6  
ATOM 10055 H HD23 . LEU A 1 12  ? 3.629   -1.672  8.100   1.00 1.71  ? 12  LEU A HD23 6  
ATOM 10056 N N    . CYS A 1 13  ? 4.978   -4.391  4.673   1.00 0.23  ? 13  CYS A N    6  
ATOM 10057 C CA   . CYS A 1 13  ? 6.328   -4.845  4.430   1.00 0.25  ? 13  CYS A CA   6  
ATOM 10058 C C    . CYS A 1 13  ? 7.245   -4.332  5.532   1.00 0.22  ? 13  CYS A C    6  
ATOM 10059 O O    . CYS A 1 13  ? 7.411   -3.126  5.702   1.00 0.24  ? 13  CYS A O    6  
ATOM 10060 C CB   . CYS A 1 13  ? 6.807   -4.356  3.064   1.00 0.29  ? 13  CYS A CB   6  
ATOM 10061 S SG   . CYS A 1 13  ? 5.784   -4.926  1.686   1.00 0.40  ? 13  CYS A SG   6  
ATOM 10062 H H    . CYS A 1 13  ? 4.737   -3.462  4.449   1.00 0.23  ? 13  CYS A H    6  
ATOM 10063 H HA   . CYS A 1 13  ? 6.329   -5.926  4.443   1.00 0.28  ? 13  CYS A HA   6  
ATOM 10064 H HB2  . CYS A 1 13  ? 6.798   -3.277  3.054   1.00 0.31  ? 13  CYS A HB2  6  
ATOM 10065 H HB3  . CYS A 1 13  ? 7.815   -4.706  2.897   1.00 0.31  ? 13  CYS A HB3  6  
ATOM 10066 H HG   . CYS A 1 13  ? 5.075   -5.967  2.108   1.00 1.17  ? 13  CYS A HG   6  
ATOM 10067 N N    . THR A 1 14  ? 7.821   -5.249  6.288   1.00 0.23  ? 14  THR A N    6  
ATOM 10068 C CA   . THR A 1 14  ? 8.705   -4.882  7.382   1.00 0.24  ? 14  THR A CA   6  
ATOM 10069 C C    . THR A 1 14  ? 10.138  -5.233  7.013   1.00 0.22  ? 14  THR A C    6  
ATOM 10070 O O    . THR A 1 14  ? 10.450  -6.395  6.737   1.00 0.25  ? 14  THR A O    6  
ATOM 10071 C CB   . THR A 1 14  ? 8.312   -5.610  8.682   1.00 0.31  ? 14  THR A CB   6  
ATOM 10072 O OG1  . THR A 1 14  ? 6.914   -5.421  8.936   1.00 0.35  ? 14  THR A OG1  6  
ATOM 10073 C CG2  . THR A 1 14  ? 9.114   -5.088  9.868   1.00 0.35  ? 14  THR A CG2  6  
ATOM 10074 H H    . THR A 1 14  ? 7.659   -6.195  6.102   1.00 0.26  ? 14  THR A H    6  
ATOM 10075 H HA   . THR A 1 14  ? 8.625   -3.814  7.542   1.00 0.23  ? 14  THR A HA   6  
ATOM 10076 H HB   . THR A 1 14  ? 8.513   -6.664  8.565   1.00 0.33  ? 14  THR A HB   6  
ATOM 10077 H HG1  . THR A 1 14  ? 6.459   -6.270  8.877   1.00 0.65  ? 14  THR A HG1  6  
ATOM 10078 H HG21 . THR A 1 14  ? 10.168  -5.221  9.677   1.00 1.01  ? 14  THR A HG21 6  
ATOM 10079 H HG22 . THR A 1 14  ? 8.840   -5.635  10.758  1.00 1.13  ? 14  THR A HG22 6  
ATOM 10080 H HG23 . THR A 1 14  ? 8.903   -4.038  10.011  1.00 1.10  ? 14  THR A HG23 6  
ATOM 10081 N N    . MET A 1 15  ? 11.001  -4.234  6.987   1.00 0.20  ? 15  MET A N    6  
ATOM 10082 C CA   . MET A 1 15  ? 12.370  -4.433  6.548   1.00 0.19  ? 15  MET A CA   6  
ATOM 10083 C C    . MET A 1 15  ? 13.360  -3.745  7.476   1.00 0.21  ? 15  MET A C    6  
ATOM 10084 O O    . MET A 1 15  ? 13.194  -2.581  7.838   1.00 0.21  ? 15  MET A O    6  
ATOM 10085 C CB   . MET A 1 15  ? 12.547  -3.904  5.128   1.00 0.21  ? 15  MET A CB   6  
ATOM 10086 C CG   . MET A 1 15  ? 11.997  -2.503  4.942   1.00 0.24  ? 15  MET A CG   6  
ATOM 10087 S SD   . MET A 1 15  ? 10.327  -2.477  4.264   1.00 0.88  ? 15  MET A SD   6  
ATOM 10088 C CE   . MET A 1 15  ? 10.635  -3.100  2.621   1.00 0.28  ? 15  MET A CE   6  
ATOM 10089 H H    . MET A 1 15  ? 10.712  -3.334  7.268   1.00 0.21  ? 15  MET A H    6  
ATOM 10090 H HA   . MET A 1 15  ? 12.569  -5.494  6.552   1.00 0.22  ? 15  MET A HA   6  
ATOM 10091 H HB2  . MET A 1 15  ? 13.600  -3.892  4.888   1.00 0.26  ? 15  MET A HB2  6  
ATOM 10092 H HB3  . MET A 1 15  ? 12.036  -4.563  4.443   1.00 0.23  ? 15  MET A HB3  6  
ATOM 10093 H HG2  . MET A 1 15  ? 11.977  -2.016  5.901   1.00 0.48  ? 15  MET A HG2  6  
ATOM 10094 H HG3  . MET A 1 15  ? 12.648  -1.957  4.288   1.00 0.46  ? 15  MET A HG3  6  
ATOM 10095 H HE1  . MET A 1 15  ? 11.327  -2.444  2.117   1.00 1.04  ? 15  MET A HE1  6  
ATOM 10096 H HE2  . MET A 1 15  ? 9.708   -3.138  2.070   1.00 1.08  ? 15  MET A HE2  6  
ATOM 10097 H HE3  . MET A 1 15  ? 11.058  -4.090  2.686   1.00 1.03  ? 15  MET A HE3  6  
ATOM 10098 N N    . LYS A 1 16  ? 14.396  -4.475  7.838   1.00 0.29  ? 16  LYS A N    6  
ATOM 10099 C CA   . LYS A 1 16  ? 15.460  -3.950  8.679   1.00 0.37  ? 16  LYS A CA   6  
ATOM 10100 C C    . LYS A 1 16  ? 16.671  -3.604  7.818   1.00 0.40  ? 16  LYS A C    6  
ATOM 10101 O O    . LYS A 1 16  ? 16.948  -4.280  6.830   1.00 0.48  ? 16  LYS A O    6  
ATOM 10102 C CB   . LYS A 1 16  ? 15.835  -4.988  9.742   1.00 0.50  ? 16  LYS A CB   6  
ATOM 10103 C CG   . LYS A 1 16  ? 17.072  -4.629  10.547  1.00 0.90  ? 16  LYS A CG   6  
ATOM 10104 C CD   . LYS A 1 16  ? 17.446  -5.736  11.517  1.00 1.09  ? 16  LYS A CD   6  
ATOM 10105 C CE   . LYS A 1 16  ? 18.855  -5.543  12.056  1.00 1.96  ? 16  LYS A CE   6  
ATOM 10106 N NZ   . LYS A 1 16  ? 19.883  -5.725  10.993  1.00 2.58  ? 16  LYS A NZ   6  
ATOM 10107 H H    . LYS A 1 16  ? 14.450  -5.406  7.532   1.00 0.34  ? 16  LYS A H    6  
ATOM 10108 H HA   . LYS A 1 16  ? 15.097  -3.056  9.162   1.00 0.41  ? 16  LYS A HA   6  
ATOM 10109 H HB2  . LYS A 1 16  ? 15.009  -5.097  10.428  1.00 0.99  ? 16  LYS A HB2  6  
ATOM 10110 H HB3  . LYS A 1 16  ? 16.012  -5.935  9.255   1.00 1.07  ? 16  LYS A HB3  6  
ATOM 10111 H HG2  . LYS A 1 16  ? 17.896  -4.462  9.871   1.00 1.53  ? 16  LYS A HG2  6  
ATOM 10112 H HG3  . LYS A 1 16  ? 16.874  -3.725  11.107  1.00 1.46  ? 16  LYS A HG3  6  
ATOM 10113 H HD2  . LYS A 1 16  ? 16.749  -5.729  12.341  1.00 1.54  ? 16  LYS A HD2  6  
ATOM 10114 H HD3  . LYS A 1 16  ? 17.393  -6.685  11.004  1.00 1.45  ? 16  LYS A HD3  6  
ATOM 10115 H HE2  . LYS A 1 16  ? 18.938  -4.546  12.460  1.00 2.45  ? 16  LYS A HE2  6  
ATOM 10116 H HE3  . LYS A 1 16  ? 19.027  -6.265  12.842  1.00 2.53  ? 16  LYS A HE3  6  
ATOM 10117 H HZ1  . LYS A 1 16  ? 19.908  -6.722  10.685  1.00 2.80  ? 16  LYS A HZ1  6  
ATOM 10118 H HZ2  . LYS A 1 16  ? 20.827  -5.462  11.354  1.00 3.11  ? 16  LYS A HZ2  6  
ATOM 10119 H HZ3  . LYS A 1 16  ? 19.661  -5.127  10.171  1.00 3.02  ? 16  LYS A HZ3  6  
ATOM 10120 N N    . LYS A 1 17  ? 17.374  -2.538  8.174   1.00 0.41  ? 17  LYS A N    6  
ATOM 10121 C CA   . LYS A 1 17  ? 18.568  -2.143  7.452   1.00 0.50  ? 17  LYS A CA   6  
ATOM 10122 C C    . LYS A 1 17  ? 19.660  -3.192  7.610   1.00 0.60  ? 17  LYS A C    6  
ATOM 10123 O O    . LYS A 1 17  ? 20.178  -3.411  8.709   1.00 0.67  ? 17  LYS A O    6  
ATOM 10124 C CB   . LYS A 1 17  ? 19.074  -0.796  7.952   1.00 0.51  ? 17  LYS A CB   6  
ATOM 10125 C CG   . LYS A 1 17  ? 19.343  0.193   6.836   1.00 0.52  ? 17  LYS A CG   6  
ATOM 10126 C CD   . LYS A 1 17  ? 19.895  1.506   7.368   1.00 0.53  ? 17  LYS A CD   6  
ATOM 10127 C CE   . LYS A 1 17  ? 18.898  2.212   8.276   1.00 0.62  ? 17  LYS A CE   6  
ATOM 10128 N NZ   . LYS A 1 17  ? 19.519  3.338   9.027   1.00 0.92  ? 17  LYS A NZ   6  
ATOM 10129 H H    . LYS A 1 17  ? 17.080  -1.997  8.942   1.00 0.41  ? 17  LYS A H    6  
ATOM 10130 H HA   . LYS A 1 17  ? 18.312  -2.058  6.407   1.00 0.52  ? 17  LYS A HA   6  
ATOM 10131 H HB2  . LYS A 1 17  ? 18.337  -0.368  8.616   1.00 0.68  ? 17  LYS A HB2  6  
ATOM 10132 H HB3  . LYS A 1 17  ? 19.993  -0.951  8.496   1.00 0.68  ? 17  LYS A HB3  6  
ATOM 10133 H HG2  . LYS A 1 17  ? 20.059  -0.237  6.154   1.00 0.67  ? 17  LYS A HG2  6  
ATOM 10134 H HG3  . LYS A 1 17  ? 18.414  0.382   6.320   1.00 0.68  ? 17  LYS A HG3  6  
ATOM 10135 H HD2  . LYS A 1 17  ? 20.797  1.304   7.927   1.00 0.91  ? 17  LYS A HD2  6  
ATOM 10136 H HD3  . LYS A 1 17  ? 20.127  2.148   6.530   1.00 0.79  ? 17  LYS A HD3  6  
ATOM 10137 H HE2  . LYS A 1 17  ? 18.093  2.599   7.669   1.00 0.85  ? 17  LYS A HE2  6  
ATOM 10138 H HE3  . LYS A 1 17  ? 18.503  1.494   8.979   1.00 0.95  ? 17  LYS A HE3  6  
ATOM 10139 H HZ1  . LYS A 1 17  ? 18.812  3.789   9.646   1.00 1.50  ? 17  LYS A HZ1  6  
ATOM 10140 H HZ2  . LYS A 1 17  ? 19.892  4.057   8.365   1.00 1.28  ? 17  LYS A HZ2  6  
ATOM 10141 H HZ3  . LYS A 1 17  ? 20.303  2.986   9.613   1.00 1.39  ? 17  LYS A HZ3  6  
ATOM 10142 N N    . GLY A 1 18  ? 19.982  -3.845  6.510   1.00 0.68  ? 18  GLY A N    6  
ATOM 10143 C CA   . GLY A 1 18  ? 21.056  -4.814  6.504   1.00 0.85  ? 18  GLY A CA   6  
ATOM 10144 C C    . GLY A 1 18  ? 22.120  -4.450  5.491   1.00 1.05  ? 18  GLY A C    6  
ATOM 10145 O O    . GLY A 1 18  ? 22.955  -3.589  5.758   1.00 1.28  ? 18  GLY A O    6  
ATOM 10146 H H    . GLY A 1 18  ? 19.481  -3.671  5.692   1.00 0.68  ? 18  GLY A H    6  
ATOM 10147 H HA2  . GLY A 1 18  ? 21.503  -4.855  7.485   1.00 0.90  ? 18  GLY A HA2  6  
ATOM 10148 H HA3  . GLY A 1 18  ? 20.656  -5.785  6.256   1.00 0.94  ? 18  GLY A HA3  6  
ATOM 10149 N N    . PRO A 1 19  ? 22.100  -5.083  4.308   1.00 1.24  ? 19  PRO A N    6  
ATOM 10150 C CA   . PRO A 1 19  ? 23.054  -4.789  3.235   1.00 1.57  ? 19  PRO A CA   6  
ATOM 10151 C C    . PRO A 1 19  ? 22.890  -3.372  2.684   1.00 1.57  ? 19  PRO A C    6  
ATOM 10152 O O    . PRO A 1 19  ? 21.999  -3.111  1.868   1.00 2.23  ? 19  PRO A O    6  
ATOM 10153 C CB   . PRO A 1 19  ? 22.725  -5.830  2.157   1.00 1.91  ? 19  PRO A CB   6  
ATOM 10154 C CG   . PRO A 1 19  ? 21.327  -6.259  2.444   1.00 1.86  ? 19  PRO A CG   6  
ATOM 10155 C CD   . PRO A 1 19  ? 21.158  -6.149  3.932   1.00 1.40  ? 19  PRO A CD   6  
ATOM 10156 H HA   . PRO A 1 19  ? 24.073  -4.925  3.570   1.00 1.77  ? 19  PRO A HA   6  
ATOM 10157 H HB2  . PRO A 1 19  ? 22.805  -5.377  1.179   1.00 2.10  ? 19  PRO A HB2  6  
ATOM 10158 H HB3  . PRO A 1 19  ? 23.412  -6.658  2.233   1.00 2.19  ? 19  PRO A HB3  6  
ATOM 10159 H HG2  . PRO A 1 19  ? 20.632  -5.606  1.937   1.00 2.16  ? 19  PRO A HG2  6  
ATOM 10160 H HG3  . PRO A 1 19  ? 21.184  -7.279  2.125   1.00 2.10  ? 19  PRO A HG3  6  
ATOM 10161 H HD2  . PRO A 1 19  ? 20.144  -5.869  4.177   1.00 1.45  ? 19  PRO A HD2  6  
ATOM 10162 H HD3  . PRO A 1 19  ? 21.420  -7.081  4.411   1.00 1.43  ? 19  PRO A HD3  6  
ATOM 10163 N N    . SER A 1 20  ? 23.734  -2.466  3.175   1.00 1.40  ? 20  SER A N    6  
ATOM 10164 C CA   . SER A 1 20  ? 23.805  -1.076  2.713   1.00 1.65  ? 20  SER A CA   6  
ATOM 10165 C C    . SER A 1 20  ? 22.587  -0.246  3.151   1.00 1.43  ? 20  SER A C    6  
ATOM 10166 O O    . SER A 1 20  ? 22.737  0.869   3.657   1.00 1.93  ? 20  SER A O    6  
ATOM 10167 C CB   . SER A 1 20  ? 23.980  -1.019  1.189   1.00 2.14  ? 20  SER A CB   6  
ATOM 10168 O OG   . SER A 1 20  ? 24.287  0.296   0.754   1.00 2.87  ? 20  SER A OG   6  
ATOM 10169 H H    . SER A 1 20  ? 24.352  -2.749  3.890   1.00 1.61  ? 20  SER A H    6  
ATOM 10170 H HA   . SER A 1 20  ? 24.681  -0.638  3.168   1.00 1.88  ? 20  SER A HA   6  
ATOM 10171 H HB2  . SER A 1 20  ? 24.785  -1.676  0.898   1.00 2.20  ? 20  SER A HB2  6  
ATOM 10172 H HB3  . SER A 1 20  ? 23.064  -1.340  0.711   1.00 2.54  ? 20  SER A HB3  6  
ATOM 10173 H HG   . SER A 1 20  ? 25.125  0.576   1.146   1.00 3.28  ? 20  SER A HG   6  
ATOM 10174 N N    . GLY A 1 21  ? 21.389  -0.778  2.966   1.00 1.04  ? 21  GLY A N    6  
ATOM 10175 C CA   . GLY A 1 21  ? 20.199  -0.038  3.317   1.00 0.94  ? 21  GLY A CA   6  
ATOM 10176 C C    . GLY A 1 21  ? 18.956  -0.571  2.641   1.00 0.97  ? 21  GLY A C    6  
ATOM 10177 O O    . GLY A 1 21  ? 18.529  -0.035  1.622   1.00 1.93  ? 21  GLY A O    6  
ATOM 10178 H H    . GLY A 1 21  ? 21.315  -1.683  2.589   1.00 1.21  ? 21  GLY A H    6  
ATOM 10179 H HA2  . GLY A 1 21  ? 20.062  -0.085  4.385   1.00 0.97  ? 21  GLY A HA2  6  
ATOM 10180 H HA3  . GLY A 1 21  ? 20.336  0.994   3.030   1.00 1.07  ? 21  GLY A HA3  6  
ATOM 10181 N N    . TYR A 1 22  ? 18.389  -1.632  3.218   1.00 0.74  ? 22  TYR A N    6  
ATOM 10182 C CA   . TYR A 1 22  ? 17.130  -2.226  2.751   1.00 0.70  ? 22  TYR A CA   6  
ATOM 10183 C C    . TYR A 1 22  ? 17.294  -2.890  1.381   1.00 0.89  ? 22  TYR A C    6  
ATOM 10184 O O    . TYR A 1 22  ? 17.431  -4.110  1.300   1.00 1.82  ? 22  TYR A O    6  
ATOM 10185 C CB   . TYR A 1 22  ? 16.009  -1.178  2.702   1.00 0.64  ? 22  TYR A CB   6  
ATOM 10186 C CG   . TYR A 1 22  ? 15.862  -0.375  3.976   1.00 0.50  ? 22  TYR A CG   6  
ATOM 10187 C CD1  . TYR A 1 22  ? 15.662  -1.011  5.195   1.00 0.47  ? 22  TYR A CD1  6  
ATOM 10188 C CD2  . TYR A 1 22  ? 15.916  1.014   3.962   1.00 0.55  ? 22  TYR A CD2  6  
ATOM 10189 C CE1  . TYR A 1 22  ? 15.523  -0.289  6.363   1.00 0.46  ? 22  TYR A CE1  6  
ATOM 10190 C CE2  . TYR A 1 22  ? 15.779  1.742   5.130   1.00 0.54  ? 22  TYR A CE2  6  
ATOM 10191 C CZ   . TYR A 1 22  ? 15.604  1.117   6.310   1.00 0.46  ? 22  TYR A CZ   6  
ATOM 10192 O OH   . TYR A 1 22  ? 15.442  1.806   7.491   1.00 0.59  ? 22  TYR A OH   6  
ATOM 10193 H H    . TYR A 1 22  ? 18.837  -2.037  3.985   1.00 1.40  ? 22  TYR A H    6  
ATOM 10194 H HA   . TYR A 1 22  ? 16.853  -2.989  3.465   1.00 0.72  ? 22  TYR A HA   6  
ATOM 10195 H HB2  . TYR A 1 22  ? 16.206  -0.487  1.895   1.00 0.75  ? 22  TYR A HB2  6  
ATOM 10196 H HB3  . TYR A 1 22  ? 15.068  -1.678  2.517   1.00 0.71  ? 22  TYR A HB3  6  
ATOM 10197 H HD1  . TYR A 1 22  ? 15.616  -2.089  5.222   1.00 0.58  ? 22  TYR A HD1  6  
ATOM 10198 H HD2  . TYR A 1 22  ? 16.064  1.525   3.021   1.00 0.70  ? 22  TYR A HD2  6  
ATOM 10199 H HE1  . TYR A 1 22  ? 15.369  -0.804  7.299   1.00 0.57  ? 22  TYR A HE1  6  
ATOM 10200 H HE2  . TYR A 1 22  ? 15.825  2.820   5.099   1.00 0.68  ? 22  TYR A HE2  6  
ATOM 10201 H HH   . TYR A 1 22  ? 16.018  1.435   8.170   1.00 1.17  ? 22  TYR A HH   6  
ATOM 10202 N N    . GLY A 1 23  ? 17.281  -2.099  0.318   1.00 0.43  ? 23  GLY A N    6  
ATOM 10203 C CA   . GLY A 1 23  ? 17.451  -2.642  -1.017  1.00 0.42  ? 23  GLY A CA   6  
ATOM 10204 C C    . GLY A 1 23  ? 16.162  -2.651  -1.817  1.00 0.39  ? 23  GLY A C    6  
ATOM 10205 O O    . GLY A 1 23  ? 15.591  -3.711  -2.083  1.00 0.39  ? 23  GLY A O    6  
ATOM 10206 H H    . GLY A 1 23  ? 17.165  -1.132  0.440   1.00 0.96  ? 23  GLY A H    6  
ATOM 10207 H HA2  . GLY A 1 23  ? 18.183  -2.048  -1.544  1.00 0.44  ? 23  GLY A HA2  6  
ATOM 10208 H HA3  . GLY A 1 23  ? 17.818  -3.655  -0.936  1.00 0.48  ? 23  GLY A HA3  6  
ATOM 10209 N N    . PHE A 1 24  ? 15.701  -1.466  -2.190  1.00 0.37  ? 24  PHE A N    6  
ATOM 10210 C CA   . PHE A 1 24  ? 14.542  -1.317  -3.061  1.00 0.36  ? 24  PHE A CA   6  
ATOM 10211 C C    . PHE A 1 24  ? 14.601  0.030   -3.768  1.00 0.38  ? 24  PHE A C    6  
ATOM 10212 O O    . PHE A 1 24  ? 15.212  0.976   -3.265  1.00 0.40  ? 24  PHE A O    6  
ATOM 10213 C CB   . PHE A 1 24  ? 13.226  -1.452  -2.278  1.00 0.34  ? 24  PHE A CB   6  
ATOM 10214 C CG   . PHE A 1 24  ? 13.006  -0.385  -1.238  1.00 0.32  ? 24  PHE A CG   6  
ATOM 10215 C CD1  . PHE A 1 24  ? 13.530  -0.527  0.037   1.00 0.33  ? 24  PHE A CD1  6  
ATOM 10216 C CD2  . PHE A 1 24  ? 12.287  0.763   -1.538  1.00 0.34  ? 24  PHE A CD2  6  
ATOM 10217 C CE1  . PHE A 1 24  ? 13.339  0.450   0.994   1.00 0.35  ? 24  PHE A CE1  6  
ATOM 10218 C CE2  . PHE A 1 24  ? 12.094  1.744   -0.583  1.00 0.36  ? 24  PHE A CE2  6  
ATOM 10219 C CZ   . PHE A 1 24  ? 12.580  1.581   0.682   1.00 0.36  ? 24  PHE A CZ   6  
ATOM 10220 H H    . PHE A 1 24  ? 16.162  -0.657  -1.875  1.00 0.39  ? 24  PHE A H    6  
ATOM 10221 H HA   . PHE A 1 24  ? 14.588  -2.099  -3.807  1.00 0.37  ? 24  PHE A HA   6  
ATOM 10222 H HB2  . PHE A 1 24  ? 12.400  -1.403  -2.974  1.00 0.35  ? 24  PHE A HB2  6  
ATOM 10223 H HB3  . PHE A 1 24  ? 13.212  -2.412  -1.781  1.00 0.34  ? 24  PHE A HB3  6  
ATOM 10224 H HD1  . PHE A 1 24  ? 14.092  -1.417  0.283   1.00 0.35  ? 24  PHE A HD1  6  
ATOM 10225 H HD2  . PHE A 1 24  ? 11.871  0.884   -2.527  1.00 0.37  ? 24  PHE A HD2  6  
ATOM 10226 H HE1  . PHE A 1 24  ? 13.752  0.324   1.984   1.00 0.38  ? 24  PHE A HE1  6  
ATOM 10227 H HE2  . PHE A 1 24  ? 11.532  2.632   -0.828  1.00 0.40  ? 24  PHE A HE2  6  
ATOM 10228 H HZ   . PHE A 1 24  ? 12.412  2.344   1.428   1.00 0.39  ? 24  PHE A HZ   6  
ATOM 10229 N N    . ASN A 1 25  ? 13.977  0.118   -4.928  1.00 0.43  ? 25  ASN A N    6  
ATOM 10230 C CA   . ASN A 1 25  ? 13.977  1.357   -5.691  1.00 0.46  ? 25  ASN A CA   6  
ATOM 10231 C C    . ASN A 1 25  ? 12.559  1.877   -5.887  1.00 0.42  ? 25  ASN A C    6  
ATOM 10232 O O    . ASN A 1 25  ? 11.661  1.129   -6.274  1.00 0.39  ? 25  ASN A O    6  
ATOM 10233 C CB   . ASN A 1 25  ? 14.662  1.155   -7.046  1.00 0.51  ? 25  ASN A CB   6  
ATOM 10234 C CG   . ASN A 1 25  ? 16.153  0.890   -6.913  1.00 1.23  ? 25  ASN A CG   6  
ATOM 10235 O OD1  . ASN A 1 25  ? 16.959  1.821   -6.900  1.00 2.18  ? 25  ASN A OD1  6  
ATOM 10236 N ND2  . ASN A 1 25  ? 16.530  -0.379  -6.818  1.00 1.65  ? 25  ASN A ND2  6  
ATOM 10237 H H    . ASN A 1 25  ? 13.509  -0.670  -5.284  1.00 0.48  ? 25  ASN A H    6  
ATOM 10238 H HA   . ASN A 1 25  ? 14.534  2.087   -5.125  1.00 0.53  ? 25  ASN A HA   6  
ATOM 10239 H HB2  . ASN A 1 25  ? 14.210  0.314   -7.550  1.00 1.01  ? 25  ASN A HB2  6  
ATOM 10240 H HB3  . ASN A 1 25  ? 14.527  2.043   -7.645  1.00 0.91  ? 25  ASN A HB3  6  
ATOM 10241 H HD21 . ASN A 1 25  ? 15.841  -1.074  -6.839  1.00 1.88  ? 25  ASN A HD21 6  
ATOM 10242 H HD22 . ASN A 1 25  ? 17.489  -0.575  -6.729  1.00 2.23  ? 25  ASN A HD22 6  
ATOM 10243 N N    . LEU A 1 26  ? 12.366  3.157   -5.608  1.00 0.50  ? 26  LEU A N    6  
ATOM 10244 C CA   . LEU A 1 26  ? 11.071  3.800   -5.771  1.00 0.52  ? 26  LEU A CA   6  
ATOM 10245 C C    . LEU A 1 26  ? 11.046  4.613   -7.055  1.00 0.55  ? 26  LEU A C    6  
ATOM 10246 O O    . LEU A 1 26  ? 11.981  5.362   -7.341  1.00 0.73  ? 26  LEU A O    6  
ATOM 10247 C CB   . LEU A 1 26  ? 10.780  4.720   -4.584  1.00 0.69  ? 26  LEU A CB   6  
ATOM 10248 C CG   . LEU A 1 26  ? 10.637  4.025   -3.230  1.00 0.87  ? 26  LEU A CG   6  
ATOM 10249 C CD1  . LEU A 1 26  ? 10.501  5.053   -2.120  1.00 1.52  ? 26  LEU A CD1  6  
ATOM 10250 C CD2  . LEU A 1 26  ? 9.438   3.091   -3.240  1.00 1.48  ? 26  LEU A CD2  6  
ATOM 10251 H H    . LEU A 1 26  ? 13.124  3.695   -5.276  1.00 0.61  ? 26  LEU A H    6  
ATOM 10252 H HA   . LEU A 1 26  ? 10.315  3.031   -5.822  1.00 0.49  ? 26  LEU A HA   6  
ATOM 10253 H HB2  . LEU A 1 26  ? 11.584  5.438   -4.510  1.00 1.10  ? 26  LEU A HB2  6  
ATOM 10254 H HB3  . LEU A 1 26  ? 9.863   5.253   -4.788  1.00 1.29  ? 26  LEU A HB3  6  
ATOM 10255 H HG   . LEU A 1 26  ? 11.521  3.435   -3.035  1.00 1.73  ? 26  LEU A HG   6  
ATOM 10256 H HD11 . LEU A 1 26  ? 11.379  5.683   -2.106  1.00 2.08  ? 26  LEU A HD11 6  
ATOM 10257 H HD12 . LEU A 1 26  ? 10.405  4.549   -1.169  1.00 2.11  ? 26  LEU A HD12 6  
ATOM 10258 H HD13 . LEU A 1 26  ? 9.627   5.662   -2.296  1.00 1.96  ? 26  LEU A HD13 6  
ATOM 10259 H HD21 . LEU A 1 26  ? 8.545   3.653   -3.468  1.00 2.11  ? 26  LEU A HD21 6  
ATOM 10260 H HD22 . LEU A 1 26  ? 9.335   2.628   -2.269  1.00 1.96  ? 26  LEU A HD22 6  
ATOM 10261 H HD23 . LEU A 1 26  ? 9.585   2.328   -3.989  1.00 1.94  ? 26  LEU A HD23 6  
ATOM 10262 N N    . HIS A 1 27  ? 9.982   4.472   -7.831  1.00 0.56  ? 27  HIS A N    6  
ATOM 10263 C CA   . HIS A 1 27  ? 9.855   5.230   -9.063  1.00 0.67  ? 27  HIS A CA   6  
ATOM 10264 C C    . HIS A 1 27  ? 8.607   6.095   -9.032  1.00 0.68  ? 27  HIS A C    6  
ATOM 10265 O O    . HIS A 1 27  ? 7.553   5.669   -8.555  1.00 0.95  ? 27  HIS A O    6  
ATOM 10266 C CB   . HIS A 1 27  ? 9.857   4.314   -10.302 1.00 1.23  ? 27  HIS A CB   6  
ATOM 10267 C CG   . HIS A 1 27  ? 8.535   3.707   -10.692 1.00 0.70  ? 27  HIS A CG   6  
ATOM 10268 N ND1  . HIS A 1 27  ? 7.728   4.236   -11.680 1.00 0.97  ? 27  HIS A ND1  6  
ATOM 10269 C CD2  . HIS A 1 27  ? 7.909   2.587   -10.263 1.00 0.81  ? 27  HIS A CD2  6  
ATOM 10270 C CE1  . HIS A 1 27  ? 6.665   3.468   -11.835 1.00 1.30  ? 27  HIS A CE1  6  
ATOM 10271 N NE2  . HIS A 1 27  ? 6.751   2.459   -10.991 1.00 1.34  ? 27  HIS A NE2  6  
ATOM 10272 H H    . HIS A 1 27  ? 9.259   3.859   -7.560  1.00 0.64  ? 27  HIS A H    6  
ATOM 10273 H HA   . HIS A 1 27  ? 10.714  5.883   -9.122  1.00 0.83  ? 27  HIS A HA   6  
ATOM 10274 H HB2  . HIS A 1 27  ? 10.205  4.883   -11.147 1.00 1.96  ? 27  HIS A HB2  6  
ATOM 10275 H HB3  . HIS A 1 27  ? 10.545  3.505   -10.121 1.00 2.02  ? 27  HIS A HB3  6  
ATOM 10276 H HD1  . HIS A 1 27  ? 7.913   5.050   -12.200 1.00 1.24  ? 27  HIS A HD1  6  
ATOM 10277 H HD2  . HIS A 1 27  ? 8.254   1.918   -9.486  1.00 0.91  ? 27  HIS A HD2  6  
ATOM 10278 H HE1  . HIS A 1 27  ? 5.858   3.640   -12.533 1.00 1.74  ? 27  HIS A HE1  6  
ATOM 10279 H HE2  . HIS A 1 27  ? 6.172   1.658   -11.004 1.00 1.74  ? 27  HIS A HE2  6  
ATOM 10280 N N    . SER A 1 28  ? 8.740   7.307   -9.531  1.00 0.75  ? 28  SER A N    6  
ATOM 10281 C CA   . SER A 1 28  ? 7.628   8.229   -9.609  1.00 1.14  ? 28  SER A CA   6  
ATOM 10282 C C    . SER A 1 28  ? 7.207   8.375   -11.063 1.00 1.03  ? 28  SER A C    6  
ATOM 10283 O O    . SER A 1 28  ? 8.052   8.534   -11.945 1.00 1.34  ? 28  SER A O    6  
ATOM 10284 C CB   . SER A 1 28  ? 8.034   9.577   -9.018  1.00 1.74  ? 28  SER A CB   6  
ATOM 10285 O OG   . SER A 1 28  ? 8.533   9.413   -7.699  1.00 2.30  ? 28  SER A OG   6  
ATOM 10286 H H    . SER A 1 28  ? 9.619   7.590   -9.877  1.00 0.74  ? 28  SER A H    6  
ATOM 10287 H HA   . SER A 1 28  ? 6.807   7.817   -9.038  1.00 1.51  ? 28  SER A HA   6  
ATOM 10288 H HB2  . SER A 1 28  ? 8.803   10.021  -9.632  1.00 2.11  ? 28  SER A HB2  6  
ATOM 10289 H HB3  . SER A 1 28  ? 7.174   10.231  -8.988  1.00 2.17  ? 28  SER A HB3  6  
ATOM 10290 H HG   . SER A 1 28  ? 9.358   8.901   -7.732  1.00 2.75  ? 28  SER A HG   6  
ATOM 10291 N N    . ASP A 1 29  ? 5.913   8.295   -11.316 1.00 1.23  ? 29  ASP A N    6  
ATOM 10292 C CA   . ASP A 1 29  ? 5.408   8.310   -12.682 1.00 1.54  ? 29  ASP A CA   6  
ATOM 10293 C C    . ASP A 1 29  ? 5.188   9.744   -13.154 1.00 1.63  ? 29  ASP A C    6  
ATOM 10294 O O    . ASP A 1 29  ? 4.771   10.612  -12.383 1.00 1.73  ? 29  ASP A O    6  
ATOM 10295 C CB   . ASP A 1 29  ? 4.110   7.505   -12.759 1.00 2.09  ? 29  ASP A CB   6  
ATOM 10296 C CG   . ASP A 1 29  ? 3.654   7.246   -14.178 1.00 2.87  ? 29  ASP A CG   6  
ATOM 10297 O OD1  . ASP A 1 29  ? 3.015   8.130   -14.782 1.00 3.48  ? 29  ASP A OD1  6  
ATOM 10298 O OD2  . ASP A 1 29  ? 3.908   6.140   -14.691 1.00 3.19  ? 29  ASP A OD2  6  
ATOM 10299 H H    . ASP A 1 29  ? 5.277   8.244   -10.571 1.00 1.49  ? 29  ASP A H    6  
ATOM 10300 H HA   . ASP A 1 29  ? 6.150   7.845   -13.315 1.00 1.59  ? 29  ASP A HA   6  
ATOM 10301 H HB2  . ASP A 1 29  ? 4.259   6.552   -12.274 1.00 2.22  ? 29  ASP A HB2  6  
ATOM 10302 H HB3  . ASP A 1 29  ? 3.331   8.047   -12.243 1.00 2.29  ? 29  ASP A HB3  6  
ATOM 10303 N N    . LYS A 1 30  ? 5.491   9.984   -14.423 1.00 1.90  ? 30  LYS A N    6  
ATOM 10304 C CA   . LYS A 1 30  ? 5.438   11.323  -14.995 1.00 2.10  ? 30  LYS A CA   6  
ATOM 10305 C C    . LYS A 1 30  ? 4.002   11.736  -15.300 1.00 2.35  ? 30  LYS A C    6  
ATOM 10306 O O    . LYS A 1 30  ? 3.667   12.922  -15.279 1.00 2.78  ? 30  LYS A O    6  
ATOM 10307 C CB   . LYS A 1 30  ? 6.287   11.369  -16.267 1.00 2.29  ? 30  LYS A CB   6  
ATOM 10308 C CG   . LYS A 1 30  ? 6.326   12.733  -16.942 1.00 2.65  ? 30  LYS A CG   6  
ATOM 10309 C CD   . LYS A 1 30  ? 7.220   12.720  -18.171 1.00 3.12  ? 30  LYS A CD   6  
ATOM 10310 C CE   . LYS A 1 30  ? 6.722   11.735  -19.219 1.00 3.99  ? 30  LYS A CE   6  
ATOM 10311 N NZ   . LYS A 1 30  ? 5.409   12.134  -19.788 1.00 4.54  ? 30  LYS A NZ   6  
ATOM 10312 H H    . LYS A 1 30  ? 5.754   9.231   -15.001 1.00 2.13  ? 30  LYS A H    6  
ATOM 10313 H HA   . LYS A 1 30  ? 5.852   12.008  -14.271 1.00 2.09  ? 30  LYS A HA   6  
ATOM 10314 H HB2  . LYS A 1 30  ? 7.300   11.088  -16.016 1.00 2.49  ? 30  LYS A HB2  6  
ATOM 10315 H HB3  . LYS A 1 30  ? 5.892   10.654  -16.973 1.00 2.60  ? 30  LYS A HB3  6  
ATOM 10316 H HG2  . LYS A 1 30  ? 5.325   13.005  -17.241 1.00 2.99  ? 30  LYS A HG2  6  
ATOM 10317 H HG3  . LYS A 1 30  ? 6.705   13.462  -16.238 1.00 2.97  ? 30  LYS A HG3  6  
ATOM 10318 H HD2  . LYS A 1 30  ? 7.236   13.708  -18.603 1.00 3.37  ? 30  LYS A HD2  6  
ATOM 10319 H HD3  . LYS A 1 30  ? 8.220   12.439  -17.873 1.00 3.23  ? 30  LYS A HD3  6  
ATOM 10320 H HE2  . LYS A 1 30  ? 7.446   11.682  -20.018 1.00 4.39  ? 30  LYS A HE2  6  
ATOM 10321 H HE3  . LYS A 1 30  ? 6.624   10.763  -18.760 1.00 4.35  ? 30  LYS A HE3  6  
ATOM 10322 H HZ1  . LYS A 1 30  ? 5.492   13.054  -20.274 1.00 4.89  ? 30  LYS A HZ1  6  
ATOM 10323 H HZ2  . LYS A 1 30  ? 4.695   12.217  -19.036 1.00 4.83  ? 30  LYS A HZ2  6  
ATOM 10324 H HZ3  . LYS A 1 30  ? 5.086   11.421  -20.479 1.00 4.73  ? 30  LYS A HZ3  6  
ATOM 10325 N N    . SER A 1 31  ? 3.156   10.756  -15.568 1.00 2.29  ? 31  SER A N    6  
ATOM 10326 C CA   . SER A 1 31  ? 1.770   11.016  -15.910 1.00 2.61  ? 31  SER A CA   6  
ATOM 10327 C C    . SER A 1 31  ? 0.891   10.961  -14.664 1.00 2.43  ? 31  SER A C    6  
ATOM 10328 O O    . SER A 1 31  ? 0.029   11.815  -14.464 1.00 2.50  ? 31  SER A O    6  
ATOM 10329 C CB   . SER A 1 31  ? 1.291   10.002  -16.948 1.00 2.93  ? 31  SER A CB   6  
ATOM 10330 O OG   . SER A 1 31  ? 2.138   10.004  -18.091 1.00 3.49  ? 31  SER A OG   6  
ATOM 10331 H H    . SER A 1 31  ? 3.469   9.824   -15.522 1.00 2.20  ? 31  SER A H    6  
ATOM 10332 H HA   . SER A 1 31  ? 1.712   12.008  -16.335 1.00 2.83  ? 31  SER A HA   6  
ATOM 10333 H HB2  . SER A 1 31  ? 1.298   9.013   -16.514 1.00 3.18  ? 31  SER A HB2  6  
ATOM 10334 H HB3  . SER A 1 31  ? 0.286   10.253  -17.258 1.00 2.98  ? 31  SER A HB3  6  
ATOM 10335 H HG   . SER A 1 31  ? 2.235   10.909  -18.413 1.00 3.79  ? 31  SER A HG   6  
ATOM 10336 N N    . LYS A 1 32  ? 1.126   9.964   -13.821 1.00 2.27  ? 32  LYS A N    6  
ATOM 10337 C CA   . LYS A 1 32  ? 0.358   9.798   -12.590 1.00 2.14  ? 32  LYS A CA   6  
ATOM 10338 C C    . LYS A 1 32  ? 1.269   9.937   -11.371 1.00 1.84  ? 32  LYS A C    6  
ATOM 10339 O O    . LYS A 1 32  ? 2.331   9.325   -11.310 1.00 1.68  ? 32  LYS A O    6  
ATOM 10340 C CB   . LYS A 1 32  ? -0.363  8.438   -12.591 1.00 2.21  ? 32  LYS A CB   6  
ATOM 10341 C CG   . LYS A 1 32  ? 0.551   7.246   -12.822 1.00 2.25  ? 32  LYS A CG   6  
ATOM 10342 C CD   . LYS A 1 32  ? -0.234  5.948   -12.921 1.00 2.41  ? 32  LYS A CD   6  
ATOM 10343 C CE   . LYS A 1 32  ? 0.679   4.745   -13.122 1.00 2.93  ? 32  LYS A CE   6  
ATOM 10344 N NZ   . LYS A 1 32  ? 1.477   4.845   -14.374 1.00 3.00  ? 32  LYS A NZ   6  
ATOM 10345 H H    . LYS A 1 32  ? 1.843   9.319   -14.031 1.00 2.30  ? 32  LYS A H    6  
ATOM 10346 H HA   . LYS A 1 32  ? -0.380  10.586  -12.556 1.00 2.30  ? 32  LYS A HA   6  
ATOM 10347 H HB2  . LYS A 1 32  ? -0.851  8.304   -11.636 1.00 2.38  ? 32  LYS A HB2  6  
ATOM 10348 H HB3  . LYS A 1 32  ? -1.112  8.444   -13.368 1.00 2.55  ? 32  LYS A HB3  6  
ATOM 10349 H HG2  . LYS A 1 32  ? 1.095   7.395   -13.744 1.00 2.42  ? 32  LYS A HG2  6  
ATOM 10350 H HG3  . LYS A 1 32  ? 1.248   7.173   -11.999 1.00 2.49  ? 32  LYS A HG3  6  
ATOM 10351 H HD2  . LYS A 1 32  ? -0.795  5.811   -12.011 1.00 2.64  ? 32  LYS A HD2  6  
ATOM 10352 H HD3  . LYS A 1 32  ? -0.915  6.014   -13.759 1.00 2.50  ? 32  LYS A HD3  6  
ATOM 10353 H HE2  . LYS A 1 32  ? 1.355   4.678   -12.283 1.00 3.27  ? 32  LYS A HE2  6  
ATOM 10354 H HE3  . LYS A 1 32  ? 0.071   3.853   -13.165 1.00 3.51  ? 32  LYS A HE3  6  
ATOM 10355 H HZ1  . LYS A 1 32  ? 0.874   5.148   -15.163 1.00 3.05  ? 32  LYS A HZ1  6  
ATOM 10356 H HZ2  . LYS A 1 32  ? 1.889   3.916   -14.610 1.00 3.40  ? 32  LYS A HZ2  6  
ATOM 10357 H HZ3  . LYS A 1 32  ? 2.255   5.532   -14.261 1.00 3.29  ? 32  LYS A HZ3  6  
ATOM 10358 N N    . PRO A 1 33  ? 0.874   10.761  -10.393 1.00 1.87  ? 33  PRO A N    6  
ATOM 10359 C CA   . PRO A 1 33  ? 1.701   11.043  -9.221  1.00 1.71  ? 33  PRO A CA   6  
ATOM 10360 C C    . PRO A 1 33  ? 1.695   9.903   -8.207  1.00 1.40  ? 33  PRO A C    6  
ATOM 10361 O O    . PRO A 1 33  ? 0.762   9.097   -8.161  1.00 1.40  ? 33  PRO A O    6  
ATOM 10362 C CB   . PRO A 1 33  ? 1.047   12.291  -8.629  1.00 1.97  ? 33  PRO A CB   6  
ATOM 10363 C CG   . PRO A 1 33  ? -0.388  12.176  -9.008  1.00 2.24  ? 33  PRO A CG   6  
ATOM 10364 C CD   . PRO A 1 33  ? -0.415  11.476  -10.343 1.00 2.19  ? 33  PRO A CD   6  
ATOM 10365 H HA   . PRO A 1 33  ? 2.720   11.267  -9.501  1.00 1.77  ? 33  PRO A HA   6  
ATOM 10366 H HB2  . PRO A 1 33  ? 1.175   12.294  -7.555  1.00 1.85  ? 33  PRO A HB2  6  
ATOM 10367 H HB3  . PRO A 1 33  ? 1.498   13.174  -9.053  1.00 2.24  ? 33  PRO A HB3  6  
ATOM 10368 H HG2  . PRO A 1 33  ? -0.917  11.592  -8.268  1.00 2.37  ? 33  PRO A HG2  6  
ATOM 10369 H HG3  . PRO A 1 33  ? -0.827  13.159  -9.092  1.00 2.55  ? 33  PRO A HG3  6  
ATOM 10370 H HD2  . PRO A 1 33  ? -1.239  10.780  -10.388 1.00 2.33  ? 33  PRO A HD2  6  
ATOM 10371 H HD3  . PRO A 1 33  ? -0.486  12.198  -11.143 1.00 2.38  ? 33  PRO A HD3  6  
ATOM 10372 N N    . GLY A 1 34  ? 2.740   9.847   -7.397  1.00 1.29  ? 34  GLY A N    6  
ATOM 10373 C CA   . GLY A 1 34  ? 2.837   8.824   -6.380  1.00 1.05  ? 34  GLY A CA   6  
ATOM 10374 C C    . GLY A 1 34  ? 4.085   7.981   -6.535  1.00 0.85  ? 34  GLY A C    6  
ATOM 10375 O O    . GLY A 1 34  ? 4.692   7.946   -7.609  1.00 0.88  ? 34  GLY A O    6  
ATOM 10376 H H    . GLY A 1 34  ? 3.458   10.504  -7.494  1.00 1.47  ? 34  GLY A H    6  
ATOM 10377 H HA2  . GLY A 1 34  ? 2.851   9.297   -5.408  1.00 1.11  ? 34  GLY A HA2  6  
ATOM 10378 H HA3  . GLY A 1 34  ? 1.971   8.183   -6.445  1.00 1.10  ? 34  GLY A HA3  6  
ATOM 10379 N N    . GLN A 1 35  ? 4.480   7.312   -5.463  1.00 0.74  ? 35  GLN A N    6  
ATOM 10380 C CA   . GLN A 1 35  ? 5.650   6.452   -5.494  1.00 0.59  ? 35  GLN A CA   6  
ATOM 10381 C C    . GLN A 1 35  ? 5.233   5.009   -5.712  1.00 0.52  ? 35  GLN A C    6  
ATOM 10382 O O    . GLN A 1 35  ? 4.358   4.489   -5.013  1.00 0.58  ? 35  GLN A O    6  
ATOM 10383 C CB   . GLN A 1 35  ? 6.448   6.561   -4.190  1.00 0.58  ? 35  GLN A CB   6  
ATOM 10384 C CG   . GLN A 1 35  ? 7.383   7.763   -4.104  1.00 0.82  ? 35  GLN A CG   6  
ATOM 10385 C CD   . GLN A 1 35  ? 6.682   9.095   -4.301  1.00 0.75  ? 35  GLN A CD   6  
ATOM 10386 O OE1  . GLN A 1 35  ? 6.144   9.669   -3.359  1.00 1.50  ? 35  GLN A OE1  6  
ATOM 10387 N NE2  . GLN A 1 35  ? 6.727   9.621   -5.516  1.00 0.78  ? 35  GLN A NE2  6  
ATOM 10388 H H    . GLN A 1 35  ? 3.968   7.389   -4.633  1.00 0.85  ? 35  GLN A H    6  
ATOM 10389 H HA   . GLN A 1 35  ? 6.275   6.767   -6.318  1.00 0.60  ? 35  GLN A HA   6  
ATOM 10390 H HB2  . GLN A 1 35  ? 5.752   6.619   -3.367  1.00 0.76  ? 35  GLN A HB2  6  
ATOM 10391 H HB3  . GLN A 1 35  ? 7.043   5.667   -4.077  1.00 0.65  ? 35  GLN A HB3  6  
ATOM 10392 H HG2  . GLN A 1 35  ? 7.848   7.765   -3.130  1.00 1.35  ? 35  GLN A HG2  6  
ATOM 10393 H HG3  . GLN A 1 35  ? 8.147   7.660   -4.862  1.00 1.50  ? 35  GLN A HG3  6  
ATOM 10394 H HE21 . GLN A 1 35  ? 7.205   9.130   -6.223  1.00 1.10  ? 35  GLN A HE21 6  
ATOM 10395 H HE22 . GLN A 1 35  ? 6.287   10.487  -5.663  1.00 1.07  ? 35  GLN A HE22 6  
ATOM 10396 N N    . PHE A 1 36  ? 5.848   4.371   -6.688  1.00 0.47  ? 36  PHE A N    6  
ATOM 10397 C CA   . PHE A 1 36  ? 5.609   2.964   -6.939  1.00 0.43  ? 36  PHE A CA   6  
ATOM 10398 C C    . PHE A 1 36  ? 6.928   2.222   -6.842  1.00 0.39  ? 36  PHE A C    6  
ATOM 10399 O O    . PHE A 1 36  ? 7.982   2.786   -7.144  1.00 0.45  ? 36  PHE A O    6  
ATOM 10400 C CB   . PHE A 1 36  ? 5.005   2.748   -8.332  1.00 0.48  ? 36  PHE A CB   6  
ATOM 10401 C CG   . PHE A 1 36  ? 3.695   3.443   -8.573  1.00 0.58  ? 36  PHE A CG   6  
ATOM 10402 C CD1  . PHE A 1 36  ? 3.659   4.789   -8.910  1.00 0.70  ? 36  PHE A CD1  6  
ATOM 10403 C CD2  . PHE A 1 36  ? 2.500   2.748   -8.483  1.00 0.68  ? 36  PHE A CD2  6  
ATOM 10404 C CE1  . PHE A 1 36  ? 2.458   5.426   -9.150  1.00 0.83  ? 36  PHE A CE1  6  
ATOM 10405 C CE2  . PHE A 1 36  ? 1.296   3.382   -8.721  1.00 0.81  ? 36  PHE A CE2  6  
ATOM 10406 C CZ   . PHE A 1 36  ? 1.275   4.722   -9.054  1.00 0.87  ? 36  PHE A CZ   6  
ATOM 10407 H H    . PHE A 1 36  ? 6.492   4.858   -7.261  1.00 0.51  ? 36  PHE A H    6  
ATOM 10408 H HA   . PHE A 1 36  ? 4.930   2.593   -6.183  1.00 0.42  ? 36  PHE A HA   6  
ATOM 10409 H HB2  . PHE A 1 36  ? 5.703   3.108   -9.072  1.00 0.50  ? 36  PHE A HB2  6  
ATOM 10410 H HB3  . PHE A 1 36  ? 4.848   1.690   -8.482  1.00 0.48  ? 36  PHE A HB3  6  
ATOM 10411 H HD1  . PHE A 1 36  ? 4.584   5.342   -8.983  1.00 0.74  ? 36  PHE A HD1  6  
ATOM 10412 H HD2  . PHE A 1 36  ? 2.515   1.701   -8.223  1.00 0.72  ? 36  PHE A HD2  6  
ATOM 10413 H HE1  . PHE A 1 36  ? 2.446   6.474   -9.411  1.00 0.95  ? 36  PHE A HE1  6  
ATOM 10414 H HE2  . PHE A 1 36  ? 0.370   2.830   -8.646  1.00 0.93  ? 36  PHE A HE2  6  
ATOM 10415 H HZ   . PHE A 1 36  ? 0.336   5.217   -9.241  1.00 0.99  ? 36  PHE A HZ   6  
ATOM 10416 N N    . ILE A 1 37  ? 6.875   0.975   -6.416  1.00 0.36  ? 37  ILE A N    6  
ATOM 10417 C CA   . ILE A 1 37  ? 8.073   0.160   -6.330  1.00 0.33  ? 37  ILE A CA   6  
ATOM 10418 C C    . ILE A 1 37  ? 8.591   -0.142  -7.727  1.00 0.33  ? 37  ILE A C    6  
ATOM 10419 O O    . ILE A 1 37  ? 7.979   -0.893  -8.484  1.00 0.38  ? 37  ILE A O    6  
ATOM 10420 C CB   . ILE A 1 37  ? 7.811   -1.163  -5.586  1.00 0.34  ? 37  ILE A CB   6  
ATOM 10421 C CG1  . ILE A 1 37  ? 7.144   -0.892  -4.235  1.00 0.39  ? 37  ILE A CG1  6  
ATOM 10422 C CG2  . ILE A 1 37  ? 9.115   -1.930  -5.397  1.00 0.33  ? 37  ILE A CG2  6  
ATOM 10423 C CD1  . ILE A 1 37  ? 7.978   -0.053  -3.292  1.00 0.38  ? 37  ILE A CD1  6  
ATOM 10424 H H    . ILE A 1 37  ? 6.010   0.595   -6.139  1.00 0.41  ? 37  ILE A H    6  
ATOM 10425 H HA   . ILE A 1 37  ? 8.824   0.717   -5.789  1.00 0.33  ? 37  ILE A HA   6  
ATOM 10426 H HB   . ILE A 1 37  ? 7.152   -1.768  -6.192  1.00 0.37  ? 37  ILE A HB   6  
ATOM 10427 H HG12 . ILE A 1 37  ? 6.212   -0.369  -4.402  1.00 0.47  ? 37  ILE A HG12 6  
ATOM 10428 H HG13 . ILE A 1 37  ? 6.935   -1.833  -3.750  1.00 0.44  ? 37  ILE A HG13 6  
ATOM 10429 H HG21 . ILE A 1 37  ? 9.531   -2.175  -6.364  1.00 1.05  ? 37  ILE A HG21 6  
ATOM 10430 H HG22 . ILE A 1 37  ? 8.924   -2.841  -4.846  1.00 1.00  ? 37  ILE A HG22 6  
ATOM 10431 H HG23 . ILE A 1 37  ? 9.819   -1.319  -4.848  1.00 1.04  ? 37  ILE A HG23 6  
ATOM 10432 H HD11 . ILE A 1 37  ? 8.151   0.918   -3.731  1.00 1.09  ? 37  ILE A HD11 6  
ATOM 10433 H HD12 . ILE A 1 37  ? 8.925   -0.544  -3.119  1.00 1.12  ? 37  ILE A HD12 6  
ATOM 10434 H HD13 . ILE A 1 37  ? 7.455   0.062   -2.353  1.00 1.05  ? 37  ILE A HD13 6  
ATOM 10435 N N    . ARG A 1 38  ? 9.717   0.473   -8.062  1.00 0.34  ? 38  ARG A N    6  
ATOM 10436 C CA   . ARG A 1 38  ? 10.337  0.296   -9.364  1.00 0.41  ? 38  ARG A CA   6  
ATOM 10437 C C    . ARG A 1 38  ? 10.799  -1.145  -9.478  1.00 0.40  ? 38  ARG A C    6  
ATOM 10438 O O    . ARG A 1 38  ? 10.427  -1.862  -10.405 1.00 0.49  ? 38  ARG A O    6  
ATOM 10439 C CB   . ARG A 1 38  ? 11.520  1.270   -9.495  1.00 0.50  ? 38  ARG A CB   6  
ATOM 10440 C CG   . ARG A 1 38  ? 11.939  1.609   -10.923 1.00 0.67  ? 38  ARG A CG   6  
ATOM 10441 C CD   . ARG A 1 38  ? 12.872  0.573   -11.523 1.00 1.24  ? 38  ARG A CD   6  
ATOM 10442 N NE   . ARG A 1 38  ? 12.159  -0.455  -12.272 1.00 1.56  ? 38  ARG A NE   6  
ATOM 10443 C CZ   . ARG A 1 38  ? 12.767  -1.422  -12.954 1.00 2.17  ? 38  ARG A CZ   6  
ATOM 10444 N NH1  . ARG A 1 38  ? 14.092  -1.501  -12.947 1.00 2.83  ? 38  ARG A NH1  6  
ATOM 10445 N NH2  . ARG A 1 38  ? 12.052  -2.310  -13.632 1.00 2.62  ? 38  ARG A NH2  6  
ATOM 10446 H H    . ARG A 1 38  ? 10.159  1.048   -7.396  1.00 0.35  ? 38  ARG A H    6  
ATOM 10447 H HA   . ARG A 1 38  ? 9.603   0.504   -10.127 1.00 0.46  ? 38  ARG A HA   6  
ATOM 10448 H HB2  . ARG A 1 38  ? 11.257  2.193   -9.001  1.00 0.58  ? 38  ARG A HB2  6  
ATOM 10449 H HB3  . ARG A 1 38  ? 12.372  0.839   -8.990  1.00 0.52  ? 38  ARG A HB3  6  
ATOM 10450 H HG2  . ARG A 1 38  ? 11.055  1.673   -11.538 1.00 1.18  ? 38  ARG A HG2  6  
ATOM 10451 H HG3  . ARG A 1 38  ? 12.440  2.567   -10.916 1.00 1.34  ? 38  ARG A HG3  6  
ATOM 10452 H HD2  . ARG A 1 38  ? 13.561  1.072   -12.188 1.00 1.95  ? 38  ARG A HD2  6  
ATOM 10453 H HD3  . ARG A 1 38  ? 13.425  0.103   -10.722 1.00 1.74  ? 38  ARG A HD3  6  
ATOM 10454 H HE   . ARG A 1 38  ? 11.174  -0.412  -12.275 1.00 1.83  ? 38  ARG A HE   6  
ATOM 10455 H HH11 . ARG A 1 38  ? 14.638  -0.831  -12.431 1.00 2.92  ? 38  ARG A HH11 6  
ATOM 10456 H HH12 . ARG A 1 38  ? 14.560  -2.236  -13.456 1.00 3.48  ? 38  ARG A HH12 6  
ATOM 10457 H HH21 . ARG A 1 38  ? 11.048  -2.257  -13.638 1.00 2.77  ? 38  ARG A HH21 6  
ATOM 10458 H HH22 . ARG A 1 38  ? 12.513  -3.049  -14.142 1.00 3.10  ? 38  ARG A HH22 6  
ATOM 10459 N N    . SER A 1 39  ? 11.589  -1.556  -8.503  1.00 0.36  ? 39  SER A N    6  
ATOM 10460 C CA   . SER A 1 39  ? 12.044  -2.926  -8.386  1.00 0.40  ? 39  SER A CA   6  
ATOM 10461 C C    . SER A 1 39  ? 12.637  -3.141  -7.013  1.00 0.32  ? 39  SER A C    6  
ATOM 10462 O O    . SER A 1 39  ? 13.370  -2.287  -6.510  1.00 0.37  ? 39  SER A O    6  
ATOM 10463 C CB   . SER A 1 39  ? 13.094  -3.266  -9.449  1.00 0.54  ? 39  SER A CB   6  
ATOM 10464 O OG   . SER A 1 39  ? 12.502  -3.433  -10.723 1.00 1.26  ? 39  SER A OG   6  
ATOM 10465 H H    . SER A 1 39  ? 11.879  -0.910  -7.824  1.00 0.35  ? 39  SER A H    6  
ATOM 10466 H HA   . SER A 1 39  ? 11.191  -3.575  -8.509  1.00 0.44  ? 39  SER A HA   6  
ATOM 10467 H HB2  . SER A 1 39  ? 13.819  -2.468  -9.506  1.00 1.11  ? 39  SER A HB2  6  
ATOM 10468 H HB3  . SER A 1 39  ? 13.593  -4.185  -9.176  1.00 1.13  ? 39  SER A HB3  6  
ATOM 10469 H HG   . SER A 1 39  ? 11.678  -2.923  -10.763 1.00 1.82  ? 39  SER A HG   6  
ATOM 10470 N N    . VAL A 1 40  ? 12.288  -4.248  -6.389  1.00 0.36  ? 40  VAL A N    6  
ATOM 10471 C CA   . VAL A 1 40  ? 12.968  -4.658  -5.183  1.00 0.30  ? 40  VAL A CA   6  
ATOM 10472 C C    . VAL A 1 40  ? 14.074  -5.632  -5.563  1.00 0.31  ? 40  VAL A C    6  
ATOM 10473 O O    . VAL A 1 40  ? 13.825  -6.652  -6.209  1.00 0.37  ? 40  VAL A O    6  
ATOM 10474 C CB   . VAL A 1 40  ? 12.006  -5.286  -4.143  1.00 0.33  ? 40  VAL A CB   6  
ATOM 10475 C CG1  . VAL A 1 40  ? 11.317  -6.531  -4.685  1.00 0.37  ? 40  VAL A CG1  6  
ATOM 10476 C CG2  . VAL A 1 40  ? 12.749  -5.599  -2.856  1.00 0.32  ? 40  VAL A CG2  6  
ATOM 10477 H H    . VAL A 1 40  ? 11.566  -4.804  -6.751  1.00 0.49  ? 40  VAL A H    6  
ATOM 10478 H HA   . VAL A 1 40  ? 13.420  -3.778  -4.744  1.00 0.31  ? 40  VAL A HA   6  
ATOM 10479 H HB   . VAL A 1 40  ? 11.240  -4.558  -3.916  1.00 0.38  ? 40  VAL A HB   6  
ATOM 10480 H HG11 . VAL A 1 40  ? 10.736  -6.272  -5.557  1.00 1.03  ? 40  VAL A HG11 6  
ATOM 10481 H HG12 . VAL A 1 40  ? 10.667  -6.941  -3.925  1.00 1.05  ? 40  VAL A HG12 6  
ATOM 10482 H HG13 . VAL A 1 40  ? 12.063  -7.265  -4.951  1.00 1.11  ? 40  VAL A HG13 6  
ATOM 10483 H HG21 . VAL A 1 40  ? 13.183  -4.692  -2.461  1.00 1.08  ? 40  VAL A HG21 6  
ATOM 10484 H HG22 . VAL A 1 40  ? 13.532  -6.316  -3.056  1.00 1.09  ? 40  VAL A HG22 6  
ATOM 10485 H HG23 . VAL A 1 40  ? 12.059  -6.013  -2.134  1.00 1.02  ? 40  VAL A HG23 6  
ATOM 10486 N N    . ASP A 1 41  ? 15.294  -5.293  -5.210  1.00 0.35  ? 41  ASP A N    6  
ATOM 10487 C CA   . ASP A 1 41  ? 16.434  -6.096  -5.602  1.00 0.45  ? 41  ASP A CA   6  
ATOM 10488 C C    . ASP A 1 41  ? 16.537  -7.323  -4.712  1.00 0.48  ? 41  ASP A C    6  
ATOM 10489 O O    . ASP A 1 41  ? 16.622  -7.209  -3.491  1.00 0.51  ? 41  ASP A O    6  
ATOM 10490 C CB   . ASP A 1 41  ? 17.716  -5.265  -5.556  1.00 0.54  ? 41  ASP A CB   6  
ATOM 10491 C CG   . ASP A 1 41  ? 17.738  -4.196  -6.638  1.00 1.27  ? 41  ASP A CG   6  
ATOM 10492 O OD1  . ASP A 1 41  ? 17.871  -4.549  -7.835  1.00 2.28  ? 41  ASP A OD1  6  
ATOM 10493 O OD2  . ASP A 1 41  ? 17.609  -3.002  -6.304  1.00 1.32  ? 41  ASP A OD2  6  
ATOM 10494 H H    . ASP A 1 41  ? 15.434  -4.490  -4.665  1.00 0.39  ? 41  ASP A H    6  
ATOM 10495 H HA   . ASP A 1 41  ? 16.267  -6.422  -6.618  1.00 0.52  ? 41  ASP A HA   6  
ATOM 10496 H HB2  . ASP A 1 41  ? 17.789  -4.781  -4.593  1.00 0.79  ? 41  ASP A HB2  6  
ATOM 10497 H HB3  . ASP A 1 41  ? 18.567  -5.915  -5.694  1.00 1.00  ? 41  ASP A HB3  6  
ATOM 10498 N N    . PRO A 1 42  ? 16.496  -8.516  -5.328  1.00 0.58  ? 42  PRO A N    6  
ATOM 10499 C CA   . PRO A 1 42  ? 16.503  -9.798  -4.613  1.00 0.69  ? 42  PRO A CA   6  
ATOM 10500 C C    . PRO A 1 42  ? 17.697  -9.941  -3.682  1.00 0.69  ? 42  PRO A C    6  
ATOM 10501 O O    . PRO A 1 42  ? 18.733  -9.309  -3.889  1.00 1.17  ? 42  PRO A O    6  
ATOM 10502 C CB   . PRO A 1 42  ? 16.576  -10.844 -5.731  1.00 0.84  ? 42  PRO A CB   6  
ATOM 10503 C CG   . PRO A 1 42  ? 17.001  -10.094 -6.945  1.00 0.93  ? 42  PRO A CG   6  
ATOM 10504 C CD   . PRO A 1 42  ? 16.448  -8.711  -6.782  1.00 0.69  ? 42  PRO A CD   6  
ATOM 10505 H HA   . PRO A 1 42  ? 15.592  -9.937  -4.048  1.00 0.75  ? 42  PRO A HA   6  
ATOM 10506 H HB2  . PRO A 1 42  ? 17.295  -11.605 -5.467  1.00 0.99  ? 42  PRO A HB2  6  
ATOM 10507 H HB3  . PRO A 1 42  ? 15.605  -11.295 -5.868  1.00 0.96  ? 42  PRO A HB3  6  
ATOM 10508 H HG2  . PRO A 1 42  ? 18.079  -10.064 -6.999  1.00 1.27  ? 42  PRO A HG2  6  
ATOM 10509 H HG3  . PRO A 1 42  ? 16.593  -10.560 -7.829  1.00 1.17  ? 42  PRO A HG3  6  
ATOM 10510 H HD2  . PRO A 1 42  ? 17.071  -7.991  -7.291  1.00 0.79  ? 42  PRO A HD2  6  
ATOM 10511 H HD3  . PRO A 1 42  ? 15.432  -8.661  -7.144  1.00 0.77  ? 42  PRO A HD3  6  
ATOM 10512 N N    . ASP A 1 43  ? 17.539  -10.787 -2.669  1.00 0.75  ? 43  ASP A N    6  
ATOM 10513 C CA   . ASP A 1 43  ? 18.564  -10.996 -1.646  1.00 0.87  ? 43  ASP A CA   6  
ATOM 10514 C C    . ASP A 1 43  ? 18.689  -9.735  -0.795  1.00 0.70  ? 43  ASP A C    6  
ATOM 10515 O O    . ASP A 1 43  ? 19.772  -9.184  -0.601  1.00 0.86  ? 43  ASP A O    6  
ATOM 10516 C CB   . ASP A 1 43  ? 19.913  -11.380 -2.275  1.00 1.14  ? 43  ASP A CB   6  
ATOM 10517 C CG   . ASP A 1 43  ? 20.882  -11.960 -1.267  1.00 1.69  ? 43  ASP A CG   6  
ATOM 10518 O OD1  . ASP A 1 43  ? 20.745  -13.155 -0.934  1.00 1.92  ? 43  ASP A OD1  6  
ATOM 10519 O OD2  . ASP A 1 43  ? 21.785  -11.234 -0.804  1.00 2.40  ? 43  ASP A OD2  6  
ATOM 10520 H H    . ASP A 1 43  ? 16.689  -11.282 -2.596  1.00 1.09  ? 43  ASP A H    6  
ATOM 10521 H HA   . ASP A 1 43  ? 18.229  -11.805 -1.013  1.00 1.00  ? 43  ASP A HA   6  
ATOM 10522 H HB2  . ASP A 1 43  ? 19.747  -12.115 -3.046  1.00 1.42  ? 43  ASP A HB2  6  
ATOM 10523 H HB3  . ASP A 1 43  ? 20.362  -10.500 -2.714  1.00 1.58  ? 43  ASP A HB3  6  
ATOM 10524 N N    . SER A 1 44  ? 17.551  -9.276  -0.308  1.00 0.57  ? 44  SER A N    6  
ATOM 10525 C CA   . SER A 1 44  ? 17.489  -8.091  0.522   1.00 0.48  ? 44  SER A CA   6  
ATOM 10526 C C    . SER A 1 44  ? 16.370  -8.243  1.542   1.00 0.40  ? 44  SER A C    6  
ATOM 10527 O O    . SER A 1 44  ? 15.417  -9.001  1.316   1.00 0.39  ? 44  SER A O    6  
ATOM 10528 C CB   . SER A 1 44  ? 17.233  -6.857  -0.350  1.00 0.47  ? 44  SER A CB   6  
ATOM 10529 O OG   . SER A 1 44  ? 15.955  -6.925  -0.960  1.00 0.46  ? 44  SER A OG   6  
ATOM 10530 H H    . SER A 1 44  ? 16.722  -9.751  -0.517  1.00 0.68  ? 44  SER A H    6  
ATOM 10531 H HA   . SER A 1 44  ? 18.429  -7.980  1.037   1.00 0.55  ? 44  SER A HA   6  
ATOM 10532 H HB2  . SER A 1 44  ? 17.281  -5.968  0.263   1.00 0.50  ? 44  SER A HB2  6  
ATOM 10533 H HB3  . SER A 1 44  ? 17.986  -6.801  -1.125  1.00 0.51  ? 44  SER A HB3  6  
ATOM 10534 H HG   . SER A 1 44  ? 16.064  -6.926  -1.925  1.00 0.41  ? 44  SER A HG   6  
ATOM 10535 N N    . PRO A 1 45  ? 16.475  -7.546  2.685   1.00 0.43  ? 45  PRO A N    6  
ATOM 10536 C CA   . PRO A 1 45  ? 15.412  -7.518  3.690   1.00 0.45  ? 45  PRO A CA   6  
ATOM 10537 C C    . PRO A 1 45  ? 14.125  -6.913  3.134   1.00 0.38  ? 45  PRO A C    6  
ATOM 10538 O O    . PRO A 1 45  ? 13.030  -7.209  3.610   1.00 0.39  ? 45  PRO A O    6  
ATOM 10539 C CB   . PRO A 1 45  ? 15.982  -6.640  4.807   1.00 0.57  ? 45  PRO A CB   6  
ATOM 10540 C CG   . PRO A 1 45  ? 17.088  -5.868  4.175   1.00 0.65  ? 45  PRO A CG   6  
ATOM 10541 C CD   . PRO A 1 45  ? 17.645  -6.752  3.099   1.00 0.52  ? 45  PRO A CD   6  
ATOM 10542 H HA   . PRO A 1 45  ? 15.206  -8.506  4.071   1.00 0.48  ? 45  PRO A HA   6  
ATOM 10543 H HB2  . PRO A 1 45  ? 15.208  -5.983  5.181   1.00 0.68  ? 45  PRO A HB2  6  
ATOM 10544 H HB3  . PRO A 1 45  ? 16.347  -7.266  5.608   1.00 0.68  ? 45  PRO A HB3  6  
ATOM 10545 H HG2  . PRO A 1 45  ? 16.703  -4.952  3.749   1.00 0.81  ? 45  PRO A HG2  6  
ATOM 10546 H HG3  . PRO A 1 45  ? 17.850  -5.649  4.908   1.00 0.87  ? 45  PRO A HG3  6  
ATOM 10547 H HD2  . PRO A 1 45  ? 18.021  -6.158  2.279   1.00 0.56  ? 45  PRO A HD2  6  
ATOM 10548 H HD3  . PRO A 1 45  ? 18.423  -7.389  3.495   1.00 0.60  ? 45  PRO A HD3  6  
ATOM 10549 N N    . ALA A 1 46  ? 14.268  -6.065  2.118   1.00 0.35  ? 46  ALA A N    6  
ATOM 10550 C CA   . ALA A 1 46  ? 13.117  -5.478  1.451   1.00 0.33  ? 46  ALA A CA   6  
ATOM 10551 C C    . ALA A 1 46  ? 12.382  -6.534  0.636   1.00 0.30  ? 46  ALA A C    6  
ATOM 10552 O O    . ALA A 1 46  ? 11.159  -6.605  0.652   1.00 0.31  ? 46  ALA A O    6  
ATOM 10553 C CB   . ALA A 1 46  ? 13.540  -4.324  0.562   1.00 0.36  ? 46  ALA A CB   6  
ATOM 10554 H H    . ALA A 1 46  ? 15.168  -5.832  1.811   1.00 0.37  ? 46  ALA A H    6  
ATOM 10555 H HA   . ALA A 1 46  ? 12.450  -5.094  2.211   1.00 0.35  ? 46  ALA A HA   6  
ATOM 10556 H HB1  . ALA A 1 46  ? 14.037  -3.573  1.159   1.00 1.17  ? 46  ALA A HB1  6  
ATOM 10557 H HB2  . ALA A 1 46  ? 12.665  -3.895  0.094   1.00 0.96  ? 46  ALA A HB2  6  
ATOM 10558 H HB3  . ALA A 1 46  ? 14.215  -4.684  -0.200  1.00 1.10  ? 46  ALA A HB3  6  
ATOM 10559 N N    . GLU A 1 47  ? 13.136  -7.361  -0.071  1.00 0.31  ? 47  GLU A N    6  
ATOM 10560 C CA   . GLU A 1 47  ? 12.554  -8.443  -0.854  1.00 0.33  ? 47  GLU A CA   6  
ATOM 10561 C C    . GLU A 1 47  ? 11.950  -9.490  0.079   1.00 0.34  ? 47  GLU A C    6  
ATOM 10562 O O    . GLU A 1 47  ? 10.906  -10.078 -0.211  1.00 0.40  ? 47  GLU A O    6  
ATOM 10563 C CB   . GLU A 1 47  ? 13.630  -9.053  -1.756  1.00 0.40  ? 47  GLU A CB   6  
ATOM 10564 C CG   . GLU A 1 47  ? 13.151  -10.181 -2.659  1.00 0.53  ? 47  GLU A CG   6  
ATOM 10565 C CD   . GLU A 1 47  ? 13.681  -11.531 -2.224  1.00 1.12  ? 47  GLU A CD   6  
ATOM 10566 O OE1  . GLU A 1 47  ? 14.914  -11.716 -2.214  1.00 1.51  ? 47  GLU A OE1  6  
ATOM 10567 O OE2  . GLU A 1 47  ? 12.862  -12.423 -1.898  1.00 2.01  ? 47  GLU A OE2  6  
ATOM 10568 H H    . GLU A 1 47  ? 14.112  -7.236  -0.080  1.00 0.33  ? 47  GLU A H    6  
ATOM 10569 H HA   . GLU A 1 47  ? 11.766  -8.026  -1.466  1.00 0.36  ? 47  GLU A HA   6  
ATOM 10570 H HB2  . GLU A 1 47  ? 14.035  -8.273  -2.382  1.00 0.44  ? 47  GLU A HB2  6  
ATOM 10571 H HB3  . GLU A 1 47  ? 14.413  -9.436  -1.129  1.00 0.42  ? 47  GLU A HB3  6  
ATOM 10572 H HG2  . GLU A 1 47  ? 12.072  -10.209 -2.637  1.00 1.14  ? 47  GLU A HG2  6  
ATOM 10573 H HG3  . GLU A 1 47  ? 13.487  -9.987  -3.668  1.00 1.17  ? 47  GLU A HG3  6  
ATOM 10574 N N    . ALA A 1 48  ? 12.600  -9.684  1.219   1.00 0.34  ? 48  ALA A N    6  
ATOM 10575 C CA   . ALA A 1 48  ? 12.142  -10.643 2.214   1.00 0.38  ? 48  ALA A CA   6  
ATOM 10576 C C    . ALA A 1 48  ? 10.918  -10.128 2.969   1.00 0.37  ? 48  ALA A C    6  
ATOM 10577 O O    . ALA A 1 48  ? 10.187  -10.904 3.586   1.00 0.47  ? 48  ALA A O    6  
ATOM 10578 C CB   . ALA A 1 48  ? 13.263  -10.959 3.187   1.00 0.44  ? 48  ALA A CB   6  
ATOM 10579 H H    . ALA A 1 48  ? 13.422  -9.175  1.391   1.00 0.34  ? 48  ALA A H    6  
ATOM 10580 H HA   . ALA A 1 48  ? 11.878  -11.555 1.701   1.00 0.42  ? 48  ALA A HA   6  
ATOM 10581 H HB1  . ALA A 1 48  ? 13.541  -10.060 3.716   1.00 1.15  ? 48  ALA A HB1  6  
ATOM 10582 H HB2  . ALA A 1 48  ? 14.116  -11.337 2.642   1.00 0.97  ? 48  ALA A HB2  6  
ATOM 10583 H HB3  . ALA A 1 48  ? 12.926  -11.704 3.893   1.00 1.06  ? 48  ALA A HB3  6  
ATOM 10584 N N    . SER A 1 49  ? 10.695  -8.819  2.921   1.00 0.31  ? 49  SER A N    6  
ATOM 10585 C CA   . SER A 1 49  ? 9.544   -8.220  3.576   1.00 0.32  ? 49  SER A CA   6  
ATOM 10586 C C    . SER A 1 49  ? 8.265   -8.608  2.832   1.00 0.35  ? 49  SER A C    6  
ATOM 10587 O O    . SER A 1 49  ? 7.159   -8.519  3.374   1.00 0.40  ? 49  SER A O    6  
ATOM 10588 C CB   . SER A 1 49  ? 9.697   -6.695  3.622   1.00 0.32  ? 49  SER A CB   6  
ATOM 10589 O OG   . SER A 1 49  ? 9.362   -6.108  2.379   1.00 0.31  ? 49  SER A OG   6  
ATOM 10590 H H    . SER A 1 49  ? 11.325  -8.241  2.447   1.00 0.29  ? 49  SER A H    6  
ATOM 10591 H HA   . SER A 1 49  ? 9.493   -8.604  4.583   1.00 0.36  ? 49  SER A HA   6  
ATOM 10592 H HB2  . SER A 1 49  ? 9.057   -6.283  4.386   1.00 0.35  ? 49  SER A HB2  6  
ATOM 10593 H HB3  . SER A 1 49  ? 10.725  -6.453  3.852   1.00 0.36  ? 49  SER A HB3  6  
ATOM 10594 H HG   . SER A 1 49  ? 10.120  -6.160  1.780   1.00 0.29  ? 49  SER A HG   6  
ATOM 10595 N N    . GLY A 1 50  ? 8.429   -9.057  1.588   1.00 0.36  ? 50  GLY A N    6  
ATOM 10596 C CA   . GLY A 1 50  ? 7.290   -9.452  0.780   1.00 0.43  ? 50  GLY A CA   6  
ATOM 10597 C C    . GLY A 1 50  ? 7.010   -8.465  -0.332  1.00 0.43  ? 50  GLY A C    6  
ATOM 10598 O O    . GLY A 1 50  ? 6.089   -8.654  -1.125  1.00 0.62  ? 50  GLY A O    6  
ATOM 10599 H H    . GLY A 1 50  ? 9.341   -9.129  1.216   1.00 0.34  ? 50  GLY A H    6  
ATOM 10600 H HA2  . GLY A 1 50  ? 7.486   -10.422 0.347   1.00 0.49  ? 50  GLY A HA2  6  
ATOM 10601 H HA3  . GLY A 1 50  ? 6.419   -9.520  1.413   1.00 0.45  ? 50  GLY A HA3  6  
ATOM 10602 N N    . LEU A 1 51  ? 7.816   -7.415  -0.390  1.00 0.41  ? 51  LEU A N    6  
ATOM 10603 C CA   . LEU A 1 51  ? 7.662   -6.377  -1.398  1.00 0.40  ? 51  LEU A CA   6  
ATOM 10604 C C    . LEU A 1 51  ? 7.844   -6.955  -2.803  1.00 0.48  ? 51  LEU A C    6  
ATOM 10605 O O    . LEU A 1 51  ? 8.711   -7.804  -3.024  1.00 0.65  ? 51  LEU A O    6  
ATOM 10606 C CB   . LEU A 1 51  ? 8.692   -5.277  -1.145  1.00 0.38  ? 51  LEU A CB   6  
ATOM 10607 C CG   . LEU A 1 51  ? 8.476   -3.979  -1.921  1.00 0.35  ? 51  LEU A CG   6  
ATOM 10608 C CD1  . LEU A 1 51  ? 7.182   -3.311  -1.479  1.00 0.38  ? 51  LEU A CD1  6  
ATOM 10609 C CD2  . LEU A 1 51  ? 9.661   -3.042  -1.720  1.00 0.37  ? 51  LEU A CD2  6  
ATOM 10610 H H    . LEU A 1 51  ? 8.536   -7.332  0.269   1.00 0.54  ? 51  LEU A H    6  
ATOM 10611 H HA   . LEU A 1 51  ? 6.670   -5.960  -1.313  1.00 0.41  ? 51  LEU A HA   6  
ATOM 10612 H HB2  . LEU A 1 51  ? 8.684   -5.045  -0.091  1.00 0.42  ? 51  LEU A HB2  6  
ATOM 10613 H HB3  . LEU A 1 51  ? 9.667   -5.664  -1.401  1.00 0.48  ? 51  LEU A HB3  6  
ATOM 10614 H HG   . LEU A 1 51  ? 8.396   -4.204  -2.975  1.00 0.42  ? 51  LEU A HG   6  
ATOM 10615 H HD11 . LEU A 1 51  ? 7.231   -3.096  -0.420  1.00 1.04  ? 51  LEU A HD11 6  
ATOM 10616 H HD12 . LEU A 1 51  ? 6.349   -3.971  -1.673  1.00 1.12  ? 51  LEU A HD12 6  
ATOM 10617 H HD13 . LEU A 1 51  ? 7.045   -2.391  -2.025  1.00 1.10  ? 51  LEU A HD13 6  
ATOM 10618 H HD21 . LEU A 1 51  ? 9.705   -2.734  -0.686  1.00 1.03  ? 51  LEU A HD21 6  
ATOM 10619 H HD22 . LEU A 1 51  ? 9.544   -2.174  -2.351  1.00 1.05  ? 51  LEU A HD22 6  
ATOM 10620 H HD23 . LEU A 1 51  ? 10.575  -3.555  -1.982  1.00 1.08  ? 51  LEU A HD23 6  
ATOM 10621 N N    . ARG A 1 52  ? 7.016   -6.512  -3.738  1.00 0.53  ? 52  ARG A N    6  
ATOM 10622 C CA   . ARG A 1 52  ? 7.150   -6.925  -5.127  1.00 0.65  ? 52  ARG A CA   6  
ATOM 10623 C C    . ARG A 1 52  ? 7.274   -5.694  -6.012  1.00 0.55  ? 52  ARG A C    6  
ATOM 10624 O O    . ARG A 1 52  ? 7.549   -4.600  -5.525  1.00 0.61  ? 52  ARG A O    6  
ATOM 10625 C CB   . ARG A 1 52  ? 5.962   -7.788  -5.577  1.00 0.86  ? 52  ARG A CB   6  
ATOM 10626 C CG   . ARG A 1 52  ? 4.621   -7.080  -5.501  1.00 1.23  ? 52  ARG A CG   6  
ATOM 10627 C CD   . ARG A 1 52  ? 3.525   -7.872  -6.191  1.00 2.05  ? 52  ARG A CD   6  
ATOM 10628 N NE   . ARG A 1 52  ? 3.344   -9.203  -5.610  1.00 2.59  ? 52  ARG A NE   6  
ATOM 10629 C CZ   . ARG A 1 52  ? 2.162   -9.705  -5.270  1.00 3.57  ? 52  ARG A CZ   6  
ATOM 10630 N NH1  . ARG A 1 52  ? 1.061   -8.980  -5.427  1.00 4.13  ? 52  ARG A NH1  6  
ATOM 10631 N NH2  . ARG A 1 52  ? 2.074   -10.936 -4.781  1.00 4.38  ? 52  ARG A NH2  6  
ATOM 10632 H H    . ARG A 1 52  ? 6.305   -5.872  -3.494  1.00 0.62  ? 52  ARG A H    6  
ATOM 10633 H HA   . ARG A 1 52  ? 8.057   -7.502  -5.212  1.00 0.74  ? 52  ARG A HA   6  
ATOM 10634 H HB2  . ARG A 1 52  ? 6.121   -8.097  -6.598  1.00 1.11  ? 52  ARG A HB2  6  
ATOM 10635 H HB3  . ARG A 1 52  ? 5.916   -8.667  -4.949  1.00 1.35  ? 52  ARG A HB3  6  
ATOM 10636 H HG2  . ARG A 1 52  ? 4.356   -6.947  -4.462  1.00 1.80  ? 52  ARG A HG2  6  
ATOM 10637 H HG3  . ARG A 1 52  ? 4.713   -6.114  -5.977  1.00 1.46  ? 52  ARG A HG3  6  
ATOM 10638 H HD2  . ARG A 1 52  ? 2.600   -7.326  -6.104  1.00 2.55  ? 52  ARG A HD2  6  
ATOM 10639 H HD3  . ARG A 1 52  ? 3.782   -7.979  -7.235  1.00 2.57  ? 52  ARG A HD3  6  
ATOM 10640 H HE   . ARG A 1 52  ? 4.154   -9.759  -5.482  1.00 2.68  ? 52  ARG A HE   6  
ATOM 10641 H HH11 . ARG A 1 52  ? 1.119   -8.053  -5.800  1.00 3.93  ? 52  ARG A HH11 6  
ATOM 10642 H HH12 . ARG A 1 52  ? 0.164   -9.362  -5.169  1.00 4.99  ? 52  ARG A HH12 6  
ATOM 10643 H HH21 . ARG A 1 52  ? 2.900   -11.493 -4.668  1.00 4.42  ? 52  ARG A HH21 6  
ATOM 10644 H HH22 . ARG A 1 52  ? 1.181   -11.310 -4.519  1.00 5.17  ? 52  ARG A HH22 6  
ATOM 10645 N N    . ALA A 1 53  ? 7.084   -5.867  -7.308  1.00 0.53  ? 53  ALA A N    6  
ATOM 10646 C CA   . ALA A 1 53  ? 7.172   -4.753  -8.230  1.00 0.54  ? 53  ALA A CA   6  
ATOM 10647 C C    . ALA A 1 53  ? 5.826   -4.050  -8.371  1.00 0.61  ? 53  ALA A C    6  
ATOM 10648 O O    . ALA A 1 53  ? 4.772   -4.693  -8.388  1.00 1.44  ? 53  ALA A O    6  
ATOM 10649 C CB   . ALA A 1 53  ? 7.678   -5.227  -9.581  1.00 0.68  ? 53  ALA A CB   6  
ATOM 10650 H H    . ALA A 1 53  ? 6.874   -6.759  -7.650  1.00 0.60  ? 53  ALA A H    6  
ATOM 10651 H HA   . ALA A 1 53  ? 7.890   -4.050  -7.833  1.00 0.52  ? 53  ALA A HA   6  
ATOM 10652 H HB1  . ALA A 1 53  ? 6.981   -5.939  -9.999  1.00 1.00  ? 53  ALA A HB1  6  
ATOM 10653 H HB2  . ALA A 1 53  ? 8.643   -5.699  -9.456  1.00 1.18  ? 53  ALA A HB2  6  
ATOM 10654 H HB3  . ALA A 1 53  ? 7.774   -4.382  -10.247 1.00 1.17  ? 53  ALA A HB3  6  
ATOM 10655 N N    . GLN A 1 54  ? 5.891   -2.724  -8.448  1.00 0.65  ? 54  GLN A N    6  
ATOM 10656 C CA   . GLN A 1 54  ? 4.733   -1.865  -8.695  1.00 0.74  ? 54  GLN A CA   6  
ATOM 10657 C C    . GLN A 1 54  ? 3.750   -1.837  -7.526  1.00 0.59  ? 54  GLN A C    6  
ATOM 10658 O O    . GLN A 1 54  ? 2.555   -1.598  -7.719  1.00 0.67  ? 54  GLN A O    6  
ATOM 10659 C CB   . GLN A 1 54  ? 4.013   -2.260  -9.986  1.00 0.99  ? 54  GLN A CB   6  
ATOM 10660 C CG   . GLN A 1 54  ? 4.912   -2.276  -11.214 1.00 1.46  ? 54  GLN A CG   6  
ATOM 10661 C CD   . GLN A 1 54  ? 5.705   -0.995  -11.395 1.00 2.34  ? 54  GLN A CD   6  
ATOM 10662 O OE1  . GLN A 1 54  ? 5.275   0.094   -11.004 1.00 2.99  ? 54  GLN A OE1  6  
ATOM 10663 N NE2  . GLN A 1 54  ? 6.872   -1.120  -11.998 1.00 3.06  ? 54  GLN A NE2  6  
ATOM 10664 H H    . GLN A 1 54  ? 6.769   -2.294  -8.335  1.00 1.26  ? 54  GLN A H    6  
ATOM 10665 H HA   . GLN A 1 54  ? 5.115   -0.862  -8.821  1.00 0.86  ? 54  GLN A HA   6  
ATOM 10666 H HB2  . GLN A 1 54  ? 3.597   -3.250  -9.860  1.00 1.00  ? 54  GLN A HB2  6  
ATOM 10667 H HB3  . GLN A 1 54  ? 3.210   -1.562  -10.162 1.00 1.09  ? 54  GLN A HB3  6  
ATOM 10668 H HG2  . GLN A 1 54  ? 5.607   -3.098  -11.122 1.00 1.69  ? 54  GLN A HG2  6  
ATOM 10669 H HG3  . GLN A 1 54  ? 4.297   -2.426  -12.089 1.00 1.84  ? 54  GLN A HG3  6  
ATOM 10670 H HE21 . GLN A 1 54  ? 7.149   -2.015  -12.287 1.00 3.14  ? 54  GLN A HE21 6  
ATOM 10671 H HE22 . GLN A 1 54  ? 7.418   -0.316  -12.131 1.00 3.80  ? 54  GLN A HE22 6  
ATOM 10672 N N    . ASP A 1 55  ? 4.249   -2.078  -6.316  1.00 0.47  ? 55  ASP A N    6  
ATOM 10673 C CA   . ASP A 1 55  ? 3.466   -1.811  -5.115  1.00 0.45  ? 55  ASP A CA   6  
ATOM 10674 C C    . ASP A 1 55  ? 3.327   -0.309  -4.959  1.00 0.39  ? 55  ASP A C    6  
ATOM 10675 O O    . ASP A 1 55  ? 4.261   0.437   -5.271  1.00 0.48  ? 55  ASP A O    6  
ATOM 10676 C CB   . ASP A 1 55  ? 4.126   -2.394  -3.859  1.00 0.50  ? 55  ASP A CB   6  
ATOM 10677 C CG   . ASP A 1 55  ? 3.835   -3.866  -3.639  1.00 0.67  ? 55  ASP A CG   6  
ATOM 10678 O OD1  . ASP A 1 55  ? 2.675   -4.205  -3.319  1.00 1.01  ? 55  ASP A OD1  6  
ATOM 10679 O OD2  . ASP A 1 55  ? 4.758   -4.694  -3.812  1.00 1.02  ? 55  ASP A OD2  6  
ATOM 10680 H H    . ASP A 1 55  ? 5.151   -2.438  -6.231  1.00 0.46  ? 55  ASP A H    6  
ATOM 10681 H HA   . ASP A 1 55  ? 2.486   -2.248  -5.246  1.00 0.52  ? 55  ASP A HA   6  
ATOM 10682 H HB2  . ASP A 1 55  ? 5.195   -2.272  -3.939  1.00 0.55  ? 55  ASP A HB2  6  
ATOM 10683 H HB3  . ASP A 1 55  ? 3.776   -1.846  -2.996  1.00 0.57  ? 55  ASP A HB3  6  
ATOM 10684 N N    . ARG A 1 56  ? 2.179   0.148   -4.501  1.00 0.38  ? 56  ARG A N    6  
ATOM 10685 C CA   . ARG A 1 56  ? 1.951   1.570   -4.371  1.00 0.42  ? 56  ARG A CA   6  
ATOM 10686 C C    . ARG A 1 56  ? 1.939   1.950   -2.899  1.00 0.39  ? 56  ARG A C    6  
ATOM 10687 O O    . ARG A 1 56  ? 1.226   1.344   -2.099  1.00 0.39  ? 56  ARG A O    6  
ATOM 10688 C CB   . ARG A 1 56  ? 0.644   1.948   -5.065  1.00 0.56  ? 56  ARG A CB   6  
ATOM 10689 C CG   . ARG A 1 56  ? 0.542   3.423   -5.416  1.00 0.78  ? 56  ARG A CG   6  
ATOM 10690 C CD   . ARG A 1 56  ? -0.093  4.225   -4.302  1.00 0.79  ? 56  ARG A CD   6  
ATOM 10691 N NE   . ARG A 1 56  ? -1.498  3.877   -4.111  1.00 0.89  ? 56  ARG A NE   6  
ATOM 10692 C CZ   . ARG A 1 56  ? -2.167  4.172   -3.005  1.00 0.91  ? 56  ARG A CZ   6  
ATOM 10693 N NH1  . ARG A 1 56  ? -1.507  4.641   -1.961  1.00 1.51  ? 56  ARG A NH1  6  
ATOM 10694 N NH2  . ARG A 1 56  ? -3.473  3.944   -2.925  1.00 1.57  ? 56  ARG A NH2  6  
ATOM 10695 H H    . ARG A 1 56  ? 1.475   -0.478  -4.232  1.00 0.45  ? 56  ARG A H    6  
ATOM 10696 H HA   . ARG A 1 56  ? 2.770   2.082   -4.854  1.00 0.43  ? 56  ARG A HA   6  
ATOM 10697 H HB2  . ARG A 1 56  ? 0.554   1.375   -5.976  1.00 0.70  ? 56  ARG A HB2  6  
ATOM 10698 H HB3  . ARG A 1 56  ? -0.179  1.698   -4.411  1.00 0.54  ? 56  ARG A HB3  6  
ATOM 10699 H HG2  . ARG A 1 56  ? 1.535   3.809   -5.598  1.00 1.15  ? 56  ARG A HG2  6  
ATOM 10700 H HG3  . ARG A 1 56  ? -0.052  3.528   -6.307  1.00 1.24  ? 56  ARG A HG3  6  
ATOM 10701 H HD2  . ARG A 1 56  ? 0.445   4.033   -3.386  1.00 1.55  ? 56  ARG A HD2  6  
ATOM 10702 H HD3  . ARG A 1 56  ? -0.022  5.275   -4.546  1.00 1.33  ? 56  ARG A HD3  6  
ATOM 10703 H HE   . ARG A 1 56  ? -1.972  3.441   -4.864  1.00 1.71  ? 56  ARG A HE   6  
ATOM 10704 H HH11 . ARG A 1 56  ? -0.510  4.755   -2.006  1.00 1.92  ? 56  ARG A HH11 6  
ATOM 10705 H HH12 . ARG A 1 56  ? -2.001  4.914   -1.119  1.00 2.03  ? 56  ARG A HH12 6  
ATOM 10706 H HH21 . ARG A 1 56  ? -3.970  3.535   -3.710  1.00 2.26  ? 56  ARG A HH21 6  
ATOM 10707 H HH22 . ARG A 1 56  ? -3.973  4.180   -2.088  1.00 1.73  ? 56  ARG A HH22 6  
ATOM 10708 N N    . ILE A 1 57  ? 2.735   2.954   -2.556  1.00 0.40  ? 57  ILE A N    6  
ATOM 10709 C CA   . ILE A 1 57  ? 2.948   3.335   -1.163  1.00 0.38  ? 57  ILE A CA   6  
ATOM 10710 C C    . ILE A 1 57  ? 1.713   4.010   -0.580  1.00 0.38  ? 57  ILE A C    6  
ATOM 10711 O O    . ILE A 1 57  ? 1.150   4.924   -1.183  1.00 0.49  ? 57  ILE A O    6  
ATOM 10712 C CB   . ILE A 1 57  ? 4.154   4.294   -1.014  1.00 0.46  ? 57  ILE A CB   6  
ATOM 10713 C CG1  . ILE A 1 57  ? 5.372   3.771   -1.785  1.00 0.53  ? 57  ILE A CG1  6  
ATOM 10714 C CG2  . ILE A 1 57  ? 4.503   4.487   0.462   1.00 0.45  ? 57  ILE A CG2  6  
ATOM 10715 C CD1  . ILE A 1 57  ? 5.892   2.442   -1.289  1.00 0.68  ? 57  ILE A CD1  6  
ATOM 10716 H H    . ILE A 1 57  ? 3.188   3.464   -3.263  1.00 0.45  ? 57  ILE A H    6  
ATOM 10717 H HA   . ILE A 1 57  ? 3.155   2.439   -0.593  1.00 0.35  ? 57  ILE A HA   6  
ATOM 10718 H HB   . ILE A 1 57  ? 3.871   5.253   -1.421  1.00 0.52  ? 57  ILE A HB   6  
ATOM 10719 H HG12 . ILE A 1 57  ? 5.106   3.651   -2.825  1.00 1.01  ? 57  ILE A HG12 6  
ATOM 10720 H HG13 . ILE A 1 57  ? 6.175   4.492   -1.707  1.00 0.84  ? 57  ILE A HG13 6  
ATOM 10721 H HG21 . ILE A 1 57  ? 4.793   3.538   0.895   1.00 1.02  ? 57  ILE A HG21 6  
ATOM 10722 H HG22 . ILE A 1 57  ? 3.642   4.873   0.989   1.00 1.06  ? 57  ILE A HG22 6  
ATOM 10723 H HG23 . ILE A 1 57  ? 5.322   5.186   0.548   1.00 1.21  ? 57  ILE A HG23 6  
ATOM 10724 H HD11 . ILE A 1 57  ? 6.170   2.529   -0.249  1.00 1.25  ? 57  ILE A HD11 6  
ATOM 10725 H HD12 . ILE A 1 57  ? 6.755   2.155   -1.871  1.00 1.30  ? 57  ILE A HD12 6  
ATOM 10726 H HD13 . ILE A 1 57  ? 5.120   1.694   -1.394  1.00 1.37  ? 57  ILE A HD13 6  
ATOM 10727 N N    . VAL A 1 58  ? 1.296   3.533   0.583   1.00 0.29  ? 58  VAL A N    6  
ATOM 10728 C CA   . VAL A 1 58  ? 0.183   4.122   1.310   1.00 0.32  ? 58  VAL A CA   6  
ATOM 10729 C C    . VAL A 1 58  ? 0.687   4.780   2.589   1.00 0.30  ? 58  VAL A C    6  
ATOM 10730 O O    . VAL A 1 58  ? 0.405   5.945   2.860   1.00 0.37  ? 58  VAL A O    6  
ATOM 10731 C CB   . VAL A 1 58  ? -0.878  3.064   1.683   1.00 0.37  ? 58  VAL A CB   6  
ATOM 10732 C CG1  . VAL A 1 58  ? -2.038  3.705   2.426   1.00 0.87  ? 58  VAL A CG1  6  
ATOM 10733 C CG2  . VAL A 1 58  ? -1.370  2.332   0.446   1.00 0.62  ? 58  VAL A CG2  6  
ATOM 10734 H H    . VAL A 1 58  ? 1.751   2.748   0.964   1.00 0.27  ? 58  VAL A H    6  
ATOM 10735 H HA   . VAL A 1 58  ? -0.278  4.868   0.680   1.00 0.38  ? 58  VAL A HA   6  
ATOM 10736 H HB   . VAL A 1 58  ? -0.417  2.341   2.340   1.00 0.66  ? 58  VAL A HB   6  
ATOM 10737 H HG11 . VAL A 1 58  ? -1.675  4.163   3.333   1.00 1.32  ? 58  VAL A HG11 6  
ATOM 10738 H HG12 . VAL A 1 58  ? -2.770  2.949   2.670   1.00 1.56  ? 58  VAL A HG12 6  
ATOM 10739 H HG13 . VAL A 1 58  ? -2.492  4.459   1.800   1.00 1.41  ? 58  VAL A HG13 6  
ATOM 10740 H HG21 . VAL A 1 58  ? -0.533  1.870   -0.056  1.00 1.24  ? 58  VAL A HG21 6  
ATOM 10741 H HG22 . VAL A 1 58  ? -1.848  3.034   -0.222  1.00 1.25  ? 58  VAL A HG22 6  
ATOM 10742 H HG23 . VAL A 1 58  ? -2.080  1.571   0.737   1.00 1.22  ? 58  VAL A HG23 6  
ATOM 10743 N N    . GLU A 1 59  ? 1.449   4.021   3.366   1.00 0.24  ? 59  GLU A N    6  
ATOM 10744 C CA   . GLU A 1 59  ? 1.996   4.516   4.623   1.00 0.25  ? 59  GLU A CA   6  
ATOM 10745 C C    . GLU A 1 59  ? 3.447   4.092   4.769   1.00 0.22  ? 59  GLU A C    6  
ATOM 10746 O O    . GLU A 1 59  ? 3.865   3.073   4.215   1.00 0.23  ? 59  GLU A O    6  
ATOM 10747 C CB   . GLU A 1 59  ? 1.208   3.997   5.836   1.00 0.29  ? 59  GLU A CB   6  
ATOM 10748 C CG   . GLU A 1 59  ? -0.238  4.468   5.908   1.00 0.40  ? 59  GLU A CG   6  
ATOM 10749 C CD   . GLU A 1 59  ? -0.840  4.271   7.289   1.00 0.44  ? 59  GLU A CD   6  
ATOM 10750 O OE1  . GLU A 1 59  ? -0.716  5.187   8.126   1.00 0.89  ? 59  GLU A OE1  6  
ATOM 10751 O OE2  . GLU A 1 59  ? -1.428  3.198   7.551   1.00 0.43  ? 59  GLU A OE2  6  
ATOM 10752 H H    . GLU A 1 59  ? 1.666   3.108   3.075   1.00 0.24  ? 59  GLU A H    6  
ATOM 10753 H HA   . GLU A 1 59  ? 1.946   5.594   4.605   1.00 0.27  ? 59  GLU A HA   6  
ATOM 10754 H HB2  . GLU A 1 59  ? 1.207   2.917   5.808   1.00 0.26  ? 59  GLU A HB2  6  
ATOM 10755 H HB3  . GLU A 1 59  ? 1.713   4.320   6.735   1.00 0.37  ? 59  GLU A HB3  6  
ATOM 10756 H HG2  . GLU A 1 59  ? -0.276  5.514   5.658   1.00 0.55  ? 59  GLU A HG2  6  
ATOM 10757 H HG3  . GLU A 1 59  ? -0.822  3.905   5.193   1.00 0.44  ? 59  GLU A HG3  6  
ATOM 10758 N N    . VAL A 1 60  ? 4.212   4.882   5.506   1.00 0.22  ? 60  VAL A N    6  
ATOM 10759 C CA   . VAL A 1 60  ? 5.579   4.526   5.851   1.00 0.21  ? 60  VAL A CA   6  
ATOM 10760 C C    . VAL A 1 60  ? 5.782   4.677   7.351   1.00 0.22  ? 60  VAL A C    6  
ATOM 10761 O O    . VAL A 1 60  ? 5.669   5.779   7.886   1.00 0.27  ? 60  VAL A O    6  
ATOM 10762 C CB   . VAL A 1 60  ? 6.622   5.393   5.108   1.00 0.23  ? 60  VAL A CB   6  
ATOM 10763 C CG1  . VAL A 1 60  ? 8.030   5.021   5.543   1.00 0.54  ? 60  VAL A CG1  6  
ATOM 10764 C CG2  . VAL A 1 60  ? 6.480   5.247   3.600   1.00 0.66  ? 60  VAL A CG2  6  
ATOM 10765 H H    . VAL A 1 60  ? 3.840   5.734   5.835   1.00 0.25  ? 60  VAL A H    6  
ATOM 10766 H HA   . VAL A 1 60  ? 5.734   3.492   5.576   1.00 0.22  ? 60  VAL A HA   6  
ATOM 10767 H HB   . VAL A 1 60  ? 6.449   6.428   5.365   1.00 0.52  ? 60  VAL A HB   6  
ATOM 10768 H HG11 . VAL A 1 60  ? 8.745   5.644   5.027   1.00 1.16  ? 60  VAL A HG11 6  
ATOM 10769 H HG12 . VAL A 1 60  ? 8.219   3.984   5.306   1.00 1.03  ? 60  VAL A HG12 6  
ATOM 10770 H HG13 . VAL A 1 60  ? 8.129   5.168   6.610   1.00 1.01  ? 60  VAL A HG13 6  
ATOM 10771 H HG21 . VAL A 1 60  ? 6.634   4.215   3.321   1.00 1.23  ? 60  VAL A HG21 6  
ATOM 10772 H HG22 . VAL A 1 60  ? 7.217   5.866   3.109   1.00 1.29  ? 60  VAL A HG22 6  
ATOM 10773 H HG23 . VAL A 1 60  ? 5.491   5.560   3.299   1.00 1.22  ? 60  VAL A HG23 6  
ATOM 10774 N N    . ASN A 1 61  ? 6.050   3.559   8.022   1.00 0.25  ? 61  ASN A N    6  
ATOM 10775 C CA   . ASN A 1 61  ? 6.287   3.540   9.469   1.00 0.30  ? 61  ASN A CA   6  
ATOM 10776 C C    . ASN A 1 61  ? 5.054   4.015   10.236  1.00 0.36  ? 61  ASN A C    6  
ATOM 10777 O O    . ASN A 1 61  ? 5.160   4.529   11.351  1.00 0.47  ? 61  ASN A O    6  
ATOM 10778 C CB   . ASN A 1 61  ? 7.498   4.414   9.832   1.00 0.39  ? 61  ASN A CB   6  
ATOM 10779 C CG   . ASN A 1 61  ? 8.765   3.974   9.129   1.00 0.53  ? 61  ASN A CG   6  
ATOM 10780 O OD1  . ASN A 1 61  ? 8.965   2.791   8.863   1.00 1.17  ? 61  ASN A OD1  6  
ATOM 10781 N ND2  . ASN A 1 61  ? 9.622   4.924   8.805   1.00 0.61  ? 61  ASN A ND2  6  
ATOM 10782 H H    . ASN A 1 61  ? 6.102   2.709   7.522   1.00 0.27  ? 61  ASN A H    6  
ATOM 10783 H HA   . ASN A 1 61  ? 6.499   2.518   9.754   1.00 0.40  ? 61  ASN A HA   6  
ATOM 10784 H HB2  . ASN A 1 61  ? 7.291   5.436   9.550   1.00 0.67  ? 61  ASN A HB2  6  
ATOM 10785 H HB3  . ASN A 1 61  ? 7.662   4.365   10.897  1.00 0.55  ? 61  ASN A HB3  6  
ATOM 10786 H HD21 . ASN A 1 61  ? 9.394   5.849   9.032   1.00 0.97  ? 61  ASN A HD21 6  
ATOM 10787 H HD22 . ASN A 1 61  ? 10.449  4.669   8.342   1.00 0.74  ? 61  ASN A HD22 6  
ATOM 10788 N N    . GLY A 1 62  ? 3.885   3.840   9.631   1.00 0.37  ? 62  GLY A N    6  
ATOM 10789 C CA   . GLY A 1 62  ? 2.650   4.267   10.261  1.00 0.50  ? 62  GLY A CA   6  
ATOM 10790 C C    . GLY A 1 62  ? 2.324   5.722   9.975   1.00 0.51  ? 62  GLY A C    6  
ATOM 10791 O O    . GLY A 1 62  ? 1.487   6.317   10.650  1.00 0.66  ? 62  GLY A O    6  
ATOM 10792 H H    . GLY A 1 62  ? 3.857   3.414   8.749   1.00 0.34  ? 62  GLY A H    6  
ATOM 10793 H HA2  . GLY A 1 62  ? 1.841   3.649   9.901   1.00 0.55  ? 62  GLY A HA2  6  
ATOM 10794 H HA3  . GLY A 1 62  ? 2.740   4.134   11.330  1.00 0.58  ? 62  GLY A HA3  6  
ATOM 10795 N N    . VAL A 1 63  ? 3.021   6.304   9.006   1.00 0.42  ? 63  VAL A N    6  
ATOM 10796 C CA   . VAL A 1 63  ? 2.740   7.666   8.576   1.00 0.50  ? 63  VAL A CA   6  
ATOM 10797 C C    . VAL A 1 63  ? 2.118   7.648   7.184   1.00 0.43  ? 63  VAL A C    6  
ATOM 10798 O O    . VAL A 1 63  ? 2.708   7.111   6.243   1.00 0.39  ? 63  VAL A O    6  
ATOM 10799 C CB   . VAL A 1 63  ? 4.016   8.541   8.553   1.00 0.61  ? 63  VAL A CB   6  
ATOM 10800 C CG1  . VAL A 1 63  ? 3.681   9.974   8.162   1.00 0.98  ? 63  VAL A CG1  6  
ATOM 10801 C CG2  . VAL A 1 63  ? 4.719   8.505   9.902   1.00 1.17  ? 63  VAL A CG2  6  
ATOM 10802 H H    . VAL A 1 63  ? 3.745   5.807   8.569   1.00 0.36  ? 63  VAL A H    6  
ATOM 10803 H HA   . VAL A 1 63  ? 2.036   8.100   9.273   1.00 0.62  ? 63  VAL A HA   6  
ATOM 10804 H HB   . VAL A 1 63  ? 4.689   8.139   7.811   1.00 1.15  ? 63  VAL A HB   6  
ATOM 10805 H HG11 . VAL A 1 63  ? 4.593   10.546  8.077   1.00 1.65  ? 63  VAL A HG11 6  
ATOM 10806 H HG12 . VAL A 1 63  ? 3.048   10.416  8.917   1.00 1.44  ? 63  VAL A HG12 6  
ATOM 10807 H HG13 . VAL A 1 63  ? 3.166   9.977   7.214   1.00 1.53  ? 63  VAL A HG13 6  
ATOM 10808 H HG21 . VAL A 1 63  ? 5.017   7.491   10.124  1.00 1.72  ? 63  VAL A HG21 6  
ATOM 10809 H HG22 . VAL A 1 63  ? 4.046   8.860   10.669  1.00 1.75  ? 63  VAL A HG22 6  
ATOM 10810 H HG23 . VAL A 1 63  ? 5.594   9.137   9.868   1.00 1.64  ? 63  VAL A HG23 6  
ATOM 10811 N N    . CYS A 1 64  ? 0.931   8.225   7.070   1.00 0.49  ? 64  CYS A N    6  
ATOM 10812 C CA   . CYS A 1 64  ? 0.194   8.241   5.812   1.00 0.49  ? 64  CYS A CA   6  
ATOM 10813 C C    . CYS A 1 64  ? 0.923   9.064   4.751   1.00 0.47  ? 64  CYS A C    6  
ATOM 10814 O O    . CYS A 1 64  ? 1.313   10.208  4.994   1.00 0.51  ? 64  CYS A O    6  
ATOM 10815 C CB   . CYS A 1 64  ? -1.210  8.800   6.041   1.00 0.59  ? 64  CYS A CB   6  
ATOM 10816 S SG   . CYS A 1 64  ? -2.296  8.697   4.601   1.00 1.68  ? 64  CYS A SG   6  
ATOM 10817 H H    . CYS A 1 64  ? 0.530   8.643   7.859   1.00 0.57  ? 64  CYS A H    6  
ATOM 10818 H HA   . CYS A 1 64  ? 0.112   7.227   5.463   1.00 0.51  ? 64  CYS A HA   6  
ATOM 10819 H HB2  . CYS A 1 64  ? -1.678  8.253   6.844   1.00 1.19  ? 64  CYS A HB2  6  
ATOM 10820 H HB3  . CYS A 1 64  ? -1.133  9.841   6.320   1.00 1.14  ? 64  CYS A HB3  6  
ATOM 10821 H HG   . CYS A 1 64  ? -2.437  7.413   4.291   1.00 2.36  ? 64  CYS A HG   6  
ATOM 10822 N N    . MET A 1 65  ? 1.095   8.475   3.572   1.00 0.48  ? 65  MET A N    6  
ATOM 10823 C CA   . MET A 1 65  ? 1.818   9.123   2.482   1.00 0.53  ? 65  MET A CA   6  
ATOM 10824 C C    . MET A 1 65  ? 0.898   9.401   1.301   1.00 0.61  ? 65  MET A C    6  
ATOM 10825 O O    . MET A 1 65  ? 1.358   9.707   0.203   1.00 0.81  ? 65  MET A O    6  
ATOM 10826 C CB   . MET A 1 65  ? 2.988   8.247   2.029   1.00 0.61  ? 65  MET A CB   6  
ATOM 10827 C CG   . MET A 1 65  ? 3.984   7.957   3.135   1.00 0.63  ? 65  MET A CG   6  
ATOM 10828 S SD   . MET A 1 65  ? 4.731   9.455   3.805   1.00 0.61  ? 65  MET A SD   6  
ATOM 10829 C CE   . MET A 1 65  ? 5.607   8.782   5.208   1.00 0.74  ? 65  MET A CE   6  
ATOM 10830 H H    . MET A 1 65  ? 0.724   7.572   3.427   1.00 0.50  ? 65  MET A H    6  
ATOM 10831 H HA   . MET A 1 65  ? 2.204   10.062  2.852   1.00 0.54  ? 65  MET A HA   6  
ATOM 10832 H HB2  . MET A 1 65  ? 2.601   7.307   1.663   1.00 0.69  ? 65  MET A HB2  6  
ATOM 10833 H HB3  . MET A 1 65  ? 3.510   8.748   1.226   1.00 0.65  ? 65  MET A HB3  6  
ATOM 10834 H HG2  . MET A 1 65  ? 3.475   7.437   3.933   1.00 0.66  ? 65  MET A HG2  6  
ATOM 10835 H HG3  . MET A 1 65  ? 4.768   7.325   2.739   1.00 0.74  ? 65  MET A HG3  6  
ATOM 10836 H HE1  . MET A 1 65  ? 6.313   8.038   4.870   1.00 1.42  ? 65  MET A HE1  6  
ATOM 10837 H HE2  . MET A 1 65  ? 4.902   8.328   5.888   1.00 1.16  ? 65  MET A HE2  6  
ATOM 10838 H HE3  . MET A 1 65  ? 6.137   9.576   5.715   1.00 1.11  ? 65  MET A HE3  6  
ATOM 10839 N N    . GLU A 1 66  ? -0.401  9.310   1.547   1.00 0.83  ? 66  GLU A N    6  
ATOM 10840 C CA   . GLU A 1 66  ? -1.407  9.522   0.506   1.00 1.01  ? 66  GLU A CA   6  
ATOM 10841 C C    . GLU A 1 66  ? -1.345  10.946  -0.052  1.00 1.08  ? 66  GLU A C    6  
ATOM 10842 O O    . GLU A 1 66  ? -1.652  11.179  -1.220  1.00 1.86  ? 66  GLU A O    6  
ATOM 10843 C CB   . GLU A 1 66  ? -2.810  9.253   1.059   1.00 1.29  ? 66  GLU A CB   6  
ATOM 10844 C CG   . GLU A 1 66  ? -3.072  7.797   1.415   1.00 2.19  ? 66  GLU A CG   6  
ATOM 10845 C CD   . GLU A 1 66  ? -3.249  6.908   0.197   1.00 3.03  ? 66  GLU A CD   6  
ATOM 10846 O OE1  . GLU A 1 66  ? -4.148  7.184   -0.621  1.00 3.33  ? 66  GLU A OE1  6  
ATOM 10847 O OE2  . GLU A 1 66  ? -2.478  5.935   0.050   1.00 3.75  ? 66  GLU A OE2  6  
ATOM 10848 H H    . GLU A 1 66  ? -0.693  9.091   2.456   1.00 1.03  ? 66  GLU A H    6  
ATOM 10849 H HA   . GLU A 1 66  ? -1.206  8.828   -0.293  1.00 1.16  ? 66  GLU A HA   6  
ATOM 10850 H HB2  . GLU A 1 66  ? -2.953  9.847   1.949   1.00 1.44  ? 66  GLU A HB2  6  
ATOM 10851 H HB3  . GLU A 1 66  ? -3.536  9.554   0.318   1.00 1.69  ? 66  GLU A HB3  6  
ATOM 10852 H HG2  . GLU A 1 66  ? -2.235  7.426   1.988   1.00 2.66  ? 66  GLU A HG2  6  
ATOM 10853 H HG3  . GLU A 1 66  ? -3.968  7.743   2.016   1.00 2.52  ? 66  GLU A HG3  6  
ATOM 10854 N N    . GLY A 1 67  ? -0.954  11.896  0.789   1.00 1.21  ? 67  GLY A N    6  
ATOM 10855 C CA   . GLY A 1 67  ? -0.872  13.279  0.358   1.00 1.36  ? 67  GLY A CA   6  
ATOM 10856 C C    . GLY A 1 67  ? 0.550   13.797  0.374   1.00 1.24  ? 67  GLY A C    6  
ATOM 10857 O O    . GLY A 1 67  ? 0.783   15.010  0.416   1.00 1.47  ? 67  GLY A O    6  
ATOM 10858 H H    . GLY A 1 67  ? -0.714  11.656  1.715   1.00 1.78  ? 67  GLY A H    6  
ATOM 10859 H HA2  . GLY A 1 67  ? -1.263  13.357  -0.646  1.00 1.51  ? 67  GLY A HA2  6  
ATOM 10860 H HA3  . GLY A 1 67  ? -1.474  13.889  1.017   1.00 1.54  ? 67  GLY A HA3  6  
ATOM 10861 N N    . LYS A 1 68  ? 1.501   12.878  0.352   1.00 0.97  ? 68  LYS A N    6  
ATOM 10862 C CA   . LYS A 1 68  ? 2.910   13.231  0.392   1.00 0.87  ? 68  LYS A CA   6  
ATOM 10863 C C    . LYS A 1 68  ? 3.527   13.147  -0.998  1.00 0.90  ? 68  LYS A C    6  
ATOM 10864 O O    . LYS A 1 68  ? 2.857   12.792  -1.967  1.00 1.06  ? 68  LYS A O    6  
ATOM 10865 C CB   . LYS A 1 68  ? 3.654   12.303  1.353   1.00 0.73  ? 68  LYS A CB   6  
ATOM 10866 C CG   . LYS A 1 68  ? 3.101   12.344  2.766   1.00 1.24  ? 68  LYS A CG   6  
ATOM 10867 C CD   . LYS A 1 68  ? 3.121   13.753  3.319   1.00 2.01  ? 68  LYS A CD   6  
ATOM 10868 C CE   . LYS A 1 68  ? 2.344   13.854  4.617   1.00 2.81  ? 68  LYS A CE   6  
ATOM 10869 N NZ   . LYS A 1 68  ? 2.283   15.254  5.108   1.00 3.36  ? 68  LYS A NZ   6  
ATOM 10870 H H    . LYS A 1 68  ? 1.249   11.931  0.302   1.00 0.95  ? 68  LYS A H    6  
ATOM 10871 H HA   . LYS A 1 68  ? 2.989   14.246  0.748   1.00 0.97  ? 68  LYS A HA   6  
ATOM 10872 H HB2  . LYS A 1 68  ? 3.583   11.291  0.987   1.00 0.95  ? 68  LYS A HB2  6  
ATOM 10873 H HB3  . LYS A 1 68  ? 4.692   12.595  1.388   1.00 0.87  ? 68  LYS A HB3  6  
ATOM 10874 H HG2  . LYS A 1 68  ? 2.082   11.984  2.758   1.00 1.54  ? 68  LYS A HG2  6  
ATOM 10875 H HG3  . LYS A 1 68  ? 3.705   11.710  3.397   1.00 1.43  ? 68  LYS A HG3  6  
ATOM 10876 H HD2  . LYS A 1 68  ? 4.145   14.042  3.498   1.00 2.15  ? 68  LYS A HD2  6  
ATOM 10877 H HD3  . LYS A 1 68  ? 2.680   14.421  2.592   1.00 2.21  ? 68  LYS A HD3  6  
ATOM 10878 H HE2  . LYS A 1 68  ? 1.340   13.494  4.447   1.00 3.07  ? 68  LYS A HE2  6  
ATOM 10879 H HE3  . LYS A 1 68  ? 2.828   13.239  5.362   1.00 3.16  ? 68  LYS A HE3  6  
ATOM 10880 H HZ1  . LYS A 1 68  ? 1.741   15.301  6.000   1.00 3.73  ? 68  LYS A HZ1  6  
ATOM 10881 H HZ2  . LYS A 1 68  ? 1.816   15.861  4.399   1.00 3.59  ? 68  LYS A HZ2  6  
ATOM 10882 H HZ3  . LYS A 1 68  ? 3.247   15.616  5.278   1.00 3.71  ? 68  LYS A HZ3  6  
ATOM 10883 N N    . GLN A 1 69  ? 4.799   13.500  -1.088  1.00 0.87  ? 69  GLN A N    6  
ATOM 10884 C CA   . GLN A 1 69  ? 5.529   13.444  -2.344  1.00 0.93  ? 69  GLN A CA   6  
ATOM 10885 C C    . GLN A 1 69  ? 6.794   12.611  -2.169  1.00 0.81  ? 69  GLN A C    6  
ATOM 10886 O O    . GLN A 1 69  ? 7.050   12.105  -1.073  1.00 0.74  ? 69  GLN A O    6  
ATOM 10887 C CB   . GLN A 1 69  ? 5.878   14.858  -2.818  1.00 1.07  ? 69  GLN A CB   6  
ATOM 10888 C CG   . GLN A 1 69  ? 4.660   15.731  -3.098  1.00 1.33  ? 69  GLN A CG   6  
ATOM 10889 C CD   . GLN A 1 69  ? 3.900   15.305  -4.343  1.00 2.12  ? 69  GLN A CD   6  
ATOM 10890 O OE1  . GLN A 1 69  ? 4.166   15.792  -5.443  1.00 2.64  ? 69  GLN A OE1  6  
ATOM 10891 N NE2  . GLN A 1 69  ? 2.955   14.392  -4.189  1.00 2.89  ? 69  GLN A NE2  6  
ATOM 10892 H H    . GLN A 1 69  ? 5.269   13.802  -0.284  1.00 0.90  ? 69  GLN A H    6  
ATOM 10893 H HA   . GLN A 1 69  ? 4.898   12.969  -3.078  1.00 1.04  ? 69  GLN A HA   6  
ATOM 10894 H HB2  . GLN A 1 69  ? 6.473   15.342  -2.057  1.00 1.06  ? 69  GLN A HB2  6  
ATOM 10895 H HB3  . GLN A 1 69  ? 6.459   14.788  -3.726  1.00 1.25  ? 69  GLN A HB3  6  
ATOM 10896 H HG2  . GLN A 1 69  ? 3.991   15.673  -2.252  1.00 1.71  ? 69  GLN A HG2  6  
ATOM 10897 H HG3  . GLN A 1 69  ? 4.989   16.752  -3.226  1.00 1.61  ? 69  GLN A HG3  6  
ATOM 10898 H HE21 . GLN A 1 69  ? 2.794   14.031  -3.284  1.00 2.96  ? 69  GLN A HE21 6  
ATOM 10899 H HE22 . GLN A 1 69  ? 2.450   14.110  -4.977  1.00 3.61  ? 69  GLN A HE22 6  
ATOM 10900 N N    . HIS A 1 70  ? 7.591   12.493  -3.229  1.00 0.84  ? 70  HIS A N    6  
ATOM 10901 C CA   . HIS A 1 70  ? 8.767   11.618  -3.223  1.00 0.79  ? 70  HIS A CA   6  
ATOM 10902 C C    . HIS A 1 70  ? 9.698   11.926  -2.048  1.00 0.70  ? 70  HIS A C    6  
ATOM 10903 O O    . HIS A 1 70  ? 10.208  11.011  -1.401  1.00 0.65  ? 70  HIS A O    6  
ATOM 10904 C CB   . HIS A 1 70  ? 9.526   11.742  -4.554  1.00 0.88  ? 70  HIS A CB   6  
ATOM 10905 C CG   . HIS A 1 70  ? 10.733  10.850  -4.669  1.00 0.90  ? 70  HIS A CG   6  
ATOM 10906 N ND1  . HIS A 1 70  ? 11.952  11.294  -5.132  1.00 1.42  ? 70  HIS A ND1  6  
ATOM 10907 C CD2  . HIS A 1 70  ? 10.897  9.533   -4.391  1.00 1.37  ? 70  HIS A CD2  6  
ATOM 10908 C CE1  . HIS A 1 70  ? 12.814  10.293  -5.130  1.00 1.31  ? 70  HIS A CE1  6  
ATOM 10909 N NE2  . HIS A 1 70  ? 12.201  9.213   -4.685  1.00 1.13  ? 70  HIS A NE2  6  
ATOM 10910 H H    . HIS A 1 70  ? 7.378   12.999  -4.040  1.00 0.93  ? 70  HIS A H    6  
ATOM 10911 H HA   . HIS A 1 70  ? 8.414   10.603  -3.120  1.00 0.78  ? 70  HIS A HA   6  
ATOM 10912 H HB2  . HIS A 1 70  ? 8.855   11.492  -5.364  1.00 0.96  ? 70  HIS A HB2  6  
ATOM 10913 H HB3  . HIS A 1 70  ? 9.855   12.764  -4.674  1.00 0.92  ? 70  HIS A HB3  6  
ATOM 10914 H HD1  . HIS A 1 70  ? 12.153  12.213  -5.442  1.00 2.13  ? 70  HIS A HD1  6  
ATOM 10915 H HD2  . HIS A 1 70  ? 10.143  8.860   -4.008  1.00 2.20  ? 70  HIS A HD2  6  
ATOM 10916 H HE1  . HIS A 1 70  ? 13.848  10.349  -5.440  1.00 1.85  ? 70  HIS A HE1  6  
ATOM 10917 H HE2  . HIS A 1 70  ? 12.650  8.363   -4.454  1.00 1.45  ? 70  HIS A HE2  6  
ATOM 10918 N N    . GLY A 1 71  ? 9.893   13.207  -1.760  1.00 0.72  ? 71  GLY A N    6  
ATOM 10919 C CA   . GLY A 1 71  ? 10.800  13.596  -0.697  1.00 0.69  ? 71  GLY A CA   6  
ATOM 10920 C C    . GLY A 1 71  ? 10.308  13.184  0.676   1.00 0.62  ? 71  GLY A C    6  
ATOM 10921 O O    . GLY A 1 71  ? 11.086  12.701  1.499   1.00 0.62  ? 71  GLY A O    6  
ATOM 10922 H H    . GLY A 1 71  ? 9.413   13.896  -2.270  1.00 0.78  ? 71  GLY A H    6  
ATOM 10923 H HA2  . GLY A 1 71  ? 11.761  13.134  -0.875  1.00 0.70  ? 71  GLY A HA2  6  
ATOM 10924 H HA3  . GLY A 1 71  ? 10.922  14.667  -0.715  1.00 0.75  ? 71  GLY A HA3  6  
ATOM 10925 N N    . ASP A 1 72  ? 9.011   13.352  0.916   1.00 0.61  ? 72  ASP A N    6  
ATOM 10926 C CA   . ASP A 1 72  ? 8.422   13.026  2.214   1.00 0.58  ? 72  ASP A CA   6  
ATOM 10927 C C    . ASP A 1 72  ? 8.498   11.534  2.486   1.00 0.49  ? 72  ASP A C    6  
ATOM 10928 O O    . ASP A 1 72  ? 8.883   11.110  3.577   1.00 0.44  ? 72  ASP A O    6  
ATOM 10929 C CB   . ASP A 1 72  ? 6.960   13.475  2.285   1.00 0.68  ? 72  ASP A CB   6  
ATOM 10930 C CG   . ASP A 1 72  ? 6.803   14.975  2.361   1.00 1.16  ? 72  ASP A CG   6  
ATOM 10931 O OD1  . ASP A 1 72  ? 6.866   15.528  3.478   1.00 1.47  ? 72  ASP A OD1  6  
ATOM 10932 O OD2  . ASP A 1 72  ? 6.593   15.609  1.305   1.00 2.03  ? 72  ASP A OD2  6  
ATOM 10933 H H    . ASP A 1 72  ? 8.434   13.698  0.202   1.00 0.65  ? 72  ASP A H    6  
ATOM 10934 H HA   . ASP A 1 72  ? 8.986   13.546  2.974   1.00 0.61  ? 72  ASP A HA   6  
ATOM 10935 H HB2  . ASP A 1 72  ? 6.443   13.126  1.405   1.00 1.25  ? 72  ASP A HB2  6  
ATOM 10936 H HB3  . ASP A 1 72  ? 6.500   13.039  3.161   1.00 0.87  ? 72  ASP A HB3  6  
ATOM 10937 N N    . VAL A 1 73  ? 8.135   10.745  1.483   1.00 0.50  ? 73  VAL A N    6  
ATOM 10938 C CA   . VAL A 1 73  ? 8.122   9.297   1.615   1.00 0.45  ? 73  VAL A CA   6  
ATOM 10939 C C    . VAL A 1 73  ? 9.529   8.762   1.889   1.00 0.44  ? 73  VAL A C    6  
ATOM 10940 O O    . VAL A 1 73  ? 9.730   7.963   2.801   1.00 0.43  ? 73  VAL A O    6  
ATOM 10941 C CB   . VAL A 1 73  ? 7.544   8.624   0.349   1.00 0.51  ? 73  VAL A CB   6  
ATOM 10942 C CG1  . VAL A 1 73  ? 7.565   7.107   0.476   1.00 1.08  ? 73  VAL A CG1  6  
ATOM 10943 C CG2  . VAL A 1 73  ? 6.127   9.119   0.083   1.00 0.97  ? 73  VAL A CG2  6  
ATOM 10944 H H    . VAL A 1 73  ? 7.870   11.150  0.627   1.00 0.56  ? 73  VAL A H    6  
ATOM 10945 H HA   . VAL A 1 73  ? 7.487   9.045   2.451   1.00 0.44  ? 73  VAL A HA   6  
ATOM 10946 H HB   . VAL A 1 73  ? 8.162   8.901   -0.493  1.00 0.92  ? 73  VAL A HB   6  
ATOM 10947 H HG11 . VAL A 1 73  ? 6.976   6.810   1.332   1.00 1.67  ? 73  VAL A HG11 6  
ATOM 10948 H HG12 . VAL A 1 73  ? 8.583   6.770   0.604   1.00 1.48  ? 73  VAL A HG12 6  
ATOM 10949 H HG13 . VAL A 1 73  ? 7.149   6.665   -0.417  1.00 1.71  ? 73  VAL A HG13 6  
ATOM 10950 H HG21 . VAL A 1 73  ? 5.484   8.836   0.905   1.00 1.47  ? 73  VAL A HG21 6  
ATOM 10951 H HG22 . VAL A 1 73  ? 5.757   8.678   -0.830  1.00 1.57  ? 73  VAL A HG22 6  
ATOM 10952 H HG23 . VAL A 1 73  ? 6.132   10.194  -0.014  1.00 1.50  ? 73  VAL A HG23 6  
ATOM 10953 N N    . VAL A 1 74  ? 10.504  9.233   1.116   1.00 0.49  ? 74  VAL A N    6  
ATOM 10954 C CA   . VAL A 1 74  ? 11.885  8.776   1.260   1.00 0.53  ? 74  VAL A CA   6  
ATOM 10955 C C    . VAL A 1 74  ? 12.496  9.250   2.579   1.00 0.51  ? 74  VAL A C    6  
ATOM 10956 O O    . VAL A 1 74  ? 13.250  8.518   3.226   1.00 0.52  ? 74  VAL A O    6  
ATOM 10957 C CB   . VAL A 1 74  ? 12.762  9.250   0.079   1.00 0.64  ? 74  VAL A CB   6  
ATOM 10958 C CG1  . VAL A 1 74  ? 14.222  8.876   0.293   1.00 0.72  ? 74  VAL A CG1  6  
ATOM 10959 C CG2  . VAL A 1 74  ? 12.254  8.655   -1.221  1.00 0.70  ? 74  VAL A CG2  6  
ATOM 10960 H H    . VAL A 1 74  ? 10.289  9.904   0.430   1.00 0.52  ? 74  VAL A H    6  
ATOM 10961 H HA   . VAL A 1 74  ? 11.872  7.694   1.258   1.00 0.55  ? 74  VAL A HA   6  
ATOM 10962 H HB   . VAL A 1 74  ? 12.692  10.328  0.010   1.00 0.66  ? 74  VAL A HB   6  
ATOM 10963 H HG11 . VAL A 1 74  ? 14.584  9.340   1.197   1.00 1.19  ? 74  VAL A HG11 6  
ATOM 10964 H HG12 . VAL A 1 74  ? 14.807  9.218   -0.547  1.00 1.34  ? 74  VAL A HG12 6  
ATOM 10965 H HG13 . VAL A 1 74  ? 14.310  7.803   0.379   1.00 1.20  ? 74  VAL A HG13 6  
ATOM 10966 H HG21 . VAL A 1 74  ? 12.289  7.577   -1.163  1.00 1.37  ? 74  VAL A HG21 6  
ATOM 10967 H HG22 . VAL A 1 74  ? 12.876  8.992   -2.040  1.00 1.03  ? 74  VAL A HG22 6  
ATOM 10968 H HG23 . VAL A 1 74  ? 11.237  8.975   -1.387  1.00 1.19  ? 74  VAL A HG23 6  
ATOM 10969 N N    . SER A 1 75  ? 12.165  10.468  2.982   1.00 0.51  ? 75  SER A N    6  
ATOM 10970 C CA   . SER A 1 75  ? 12.651  11.005  4.244   1.00 0.52  ? 75  SER A CA   6  
ATOM 10971 C C    . SER A 1 75  ? 12.149  10.141  5.400   1.00 0.47  ? 75  SER A C    6  
ATOM 10972 O O    . SER A 1 75  ? 12.881  9.870   6.352   1.00 0.51  ? 75  SER A O    6  
ATOM 10973 C CB   . SER A 1 75  ? 12.189  12.454  4.423   1.00 0.58  ? 75  SER A CB   6  
ATOM 10974 O OG   . SER A 1 75  ? 12.863  13.085  5.498   1.00 0.66  ? 75  SER A OG   6  
ATOM 10975 H H    . SER A 1 75  ? 11.587  11.024  2.415   1.00 0.52  ? 75  SER A H    6  
ATOM 10976 H HA   . SER A 1 75  ? 13.730  10.974  4.228   1.00 0.57  ? 75  SER A HA   6  
ATOM 10977 H HB2  . SER A 1 75  ? 12.388  13.007  3.517   1.00 0.61  ? 75  SER A HB2  6  
ATOM 10978 H HB3  . SER A 1 75  ? 11.128  12.466  4.625   1.00 0.57  ? 75  SER A HB3  6  
ATOM 10979 H HG   . SER A 1 75  ? 12.420  12.856  6.333   1.00 1.12  ? 75  SER A HG   6  
ATOM 10980 N N    . ALA A 1 76  ? 10.906  9.686   5.288   1.00 0.42  ? 76  ALA A N    6  
ATOM 10981 C CA   . ALA A 1 76  ? 10.303  8.831   6.299   1.00 0.39  ? 76  ALA A CA   6  
ATOM 10982 C C    . ALA A 1 76  ? 11.034  7.497   6.400   1.00 0.37  ? 76  ALA A C    6  
ATOM 10983 O O    . ALA A 1 76  ? 11.153  6.931   7.487   1.00 0.39  ? 76  ALA A O    6  
ATOM 10984 C CB   . ALA A 1 76  ? 8.835   8.610   6.000   1.00 0.39  ? 76  ALA A CB   6  
ATOM 10985 H H    . ALA A 1 76  ? 10.376  9.936   4.500   1.00 0.42  ? 76  ALA A H    6  
ATOM 10986 H HA   . ALA A 1 76  ? 10.376  9.341   7.249   1.00 0.42  ? 76  ALA A HA   6  
ATOM 10987 H HB1  . ALA A 1 76  ? 8.330   9.564   5.939   1.00 1.09  ? 76  ALA A HB1  6  
ATOM 10988 H HB2  . ALA A 1 76  ? 8.392   8.017   6.787   1.00 1.06  ? 76  ALA A HB2  6  
ATOM 10989 H HB3  . ALA A 1 76  ? 8.734   8.089   5.058   1.00 1.06  ? 76  ALA A HB3  6  
ATOM 10990 N N    . ILE A 1 77  ? 11.525  7.002   5.261   1.00 0.37  ? 77  ILE A N    6  
ATOM 10991 C CA   . ILE A 1 77  ? 12.291  5.755   5.229   1.00 0.39  ? 77  ILE A CA   6  
ATOM 10992 C C    . ILE A 1 77  ? 13.494  5.877   6.155   1.00 0.41  ? 77  ILE A C    6  
ATOM 10993 O O    . ILE A 1 77  ? 13.823  4.962   6.913   1.00 0.44  ? 77  ILE A O    6  
ATOM 10994 C CB   . ILE A 1 77  ? 12.815  5.430   3.808   1.00 0.45  ? 77  ILE A CB   6  
ATOM 10995 C CG1  . ILE A 1 77  ? 11.702  5.547   2.763   1.00 0.53  ? 77  ILE A CG1  6  
ATOM 10996 C CG2  . ILE A 1 77  ? 13.429  4.038   3.771   1.00 0.50  ? 77  ILE A CG2  6  
ATOM 10997 C CD1  . ILE A 1 77  ? 10.544  4.599   2.975   1.00 0.69  ? 77  ILE A CD1  6  
ATOM 10998 H H    . ILE A 1 77  ? 11.361  7.485   4.421   1.00 0.38  ? 77  ILE A H    6  
ATOM 10999 H HA   . ILE A 1 77  ? 11.654  4.948   5.563   1.00 0.40  ? 77  ILE A HA   6  
ATOM 11000 H HB   . ILE A 1 77  ? 13.594  6.141   3.570   1.00 0.50  ? 77  ILE A HB   6  
ATOM 11001 H HG12 . ILE A 1 77  ? 11.310  6.551   2.782   1.00 0.98  ? 77  ILE A HG12 6  
ATOM 11002 H HG13 . ILE A 1 77  ? 12.117  5.349   1.785   1.00 1.00  ? 77  ILE A HG13 6  
ATOM 11003 H HG21 . ILE A 1 77  ? 12.674  3.307   4.021   1.00 1.07  ? 77  ILE A HG21 6  
ATOM 11004 H HG22 . ILE A 1 77  ? 14.235  3.981   4.488   1.00 1.16  ? 77  ILE A HG22 6  
ATOM 11005 H HG23 . ILE A 1 77  ? 13.813  3.838   2.781   1.00 1.05  ? 77  ILE A HG23 6  
ATOM 11006 H HD11 . ILE A 1 77  ? 10.900  3.580   2.945   1.00 1.20  ? 77  ILE A HD11 6  
ATOM 11007 H HD12 . ILE A 1 77  ? 9.815   4.749   2.193   1.00 1.34  ? 77  ILE A HD12 6  
ATOM 11008 H HD13 . ILE A 1 77  ? 10.090  4.796   3.934   1.00 1.35  ? 77  ILE A HD13 6  
ATOM 11009 N N    . ARG A 1 78  ? 14.135  7.034   6.092   1.00 0.43  ? 78  ARG A N    6  
ATOM 11010 C CA   . ARG A 1 78  ? 15.295  7.323   6.919   1.00 0.50  ? 78  ARG A CA   6  
ATOM 11011 C C    . ARG A 1 78  ? 14.885  7.602   8.360   1.00 0.50  ? 78  ARG A C    6  
ATOM 11012 O O    . ARG A 1 78  ? 15.572  7.200   9.301   1.00 0.56  ? 78  ARG A O    6  
ATOM 11013 C CB   . ARG A 1 78  ? 16.055  8.521   6.355   1.00 0.58  ? 78  ARG A CB   6  
ATOM 11014 C CG   . ARG A 1 78  ? 16.649  8.277   4.980   1.00 0.66  ? 78  ARG A CG   6  
ATOM 11015 C CD   . ARG A 1 78  ? 17.453  9.478   4.517   1.00 0.89  ? 78  ARG A CD   6  
ATOM 11016 N NE   . ARG A 1 78  ? 18.473  9.853   5.494   1.00 1.59  ? 78  ARG A NE   6  
ATOM 11017 C CZ   . ARG A 1 78  ? 18.803  11.111  5.786   1.00 2.11  ? 78  ARG A CZ   6  
ATOM 11018 N NH1  . ARG A 1 78  ? 18.205  12.121  5.164   1.00 2.12  ? 78  ARG A NH1  6  
ATOM 11019 N NH2  . ARG A 1 78  ? 19.731  11.356  6.701   1.00 3.09  ? 78  ARG A NH2  6  
ATOM 11020 H H    . ARG A 1 78  ? 13.810  7.720   5.469   1.00 0.42  ? 78  ARG A H    6  
ATOM 11021 H HA   . ARG A 1 78  ? 15.941  6.459   6.902   1.00 0.54  ? 78  ARG A HA   6  
ATOM 11022 H HB2  . ARG A 1 78  ? 15.380  9.362   6.288   1.00 0.60  ? 78  ARG A HB2  6  
ATOM 11023 H HB3  . ARG A 1 78  ? 16.859  8.771   7.032   1.00 0.65  ? 78  ARG A HB3  6  
ATOM 11024 H HG2  . ARG A 1 78  ? 17.298  7.414   5.026   1.00 0.78  ? 78  ARG A HG2  6  
ATOM 11025 H HG3  . ARG A 1 78  ? 15.849  8.094   4.280   1.00 0.83  ? 78  ARG A HG3  6  
ATOM 11026 H HD2  . ARG A 1 78  ? 17.934  9.234   3.580   1.00 1.36  ? 78  ARG A HD2  6  
ATOM 11027 H HD3  . ARG A 1 78  ? 16.781  10.311  4.370   1.00 1.38  ? 78  ARG A HD3  6  
ATOM 11028 H HE   . ARG A 1 78  ? 18.932  9.118   5.969   1.00 2.12  ? 78  ARG A HE   6  
ATOM 11029 H HH11 . ARG A 1 78  ? 17.505  11.944  4.473   1.00 1.97  ? 78  ARG A HH11 6  
ATOM 11030 H HH12 . ARG A 1 78  ? 18.452  13.078  5.387   1.00 2.67  ? 78  ARG A HH12 6  
ATOM 11031 H HH21 . ARG A 1 78  ? 20.183  10.598  7.175   1.00 3.55  ? 78  ARG A HH21 6  
ATOM 11032 H HH22 . ARG A 1 78  ? 19.984  12.306  6.928   1.00 3.52  ? 78  ARG A HH22 6  
ATOM 11033 N N    . ALA A 1 79  ? 13.753  8.277   8.523   1.00 0.47  ? 79  ALA A N    6  
ATOM 11034 C CA   . ALA A 1 79  ? 13.261  8.669   9.840   1.00 0.51  ? 79  ALA A CA   6  
ATOM 11035 C C    . ALA A 1 79  ? 12.743  7.472   10.637  1.00 0.43  ? 79  ALA A C    6  
ATOM 11036 O O    . ALA A 1 79  ? 12.400  7.604   11.811  1.00 0.46  ? 79  ALA A O    6  
ATOM 11037 C CB   . ALA A 1 79  ? 12.168  9.716   9.698   1.00 0.65  ? 79  ALA A CB   6  
ATOM 11038 H H    . ALA A 1 79  ? 13.236  8.535   7.726   1.00 0.45  ? 79  ALA A H    6  
ATOM 11039 H HA   . ALA A 1 79  ? 14.082  9.116   10.379  1.00 0.60  ? 79  ALA A HA   6  
ATOM 11040 H HB1  . ALA A 1 79  ? 11.320  9.283   9.188   1.00 1.28  ? 79  ALA A HB1  6  
ATOM 11041 H HB2  . ALA A 1 79  ? 12.542  10.552  9.125   1.00 1.20  ? 79  ALA A HB2  6  
ATOM 11042 H HB3  . ALA A 1 79  ? 11.864  10.058  10.678  1.00 1.18  ? 79  ALA A HB3  6  
ATOM 11043 N N    . GLY A 1 80  ? 12.688  6.310   10.000  1.00 0.41  ? 80  GLY A N    6  
ATOM 11044 C CA   . GLY A 1 80  ? 12.237  5.111   10.682  1.00 0.42  ? 80  GLY A CA   6  
ATOM 11045 C C    . GLY A 1 80  ? 13.251  4.595   11.684  1.00 0.46  ? 80  GLY A C    6  
ATOM 11046 O O    . GLY A 1 80  ? 12.888  3.973   12.682  1.00 0.60  ? 80  GLY A O    6  
ATOM 11047 H H    . GLY A 1 80  ? 12.945  6.268   9.054   1.00 0.46  ? 80  GLY A H    6  
ATOM 11048 H HA2  . GLY A 1 80  ? 11.314  5.332   11.201  1.00 0.51  ? 80  GLY A HA2  6  
ATOM 11049 H HA3  . GLY A 1 80  ? 12.050  4.341   9.948   1.00 0.43  ? 80  GLY A HA3  6  
ATOM 11050 N N    . GLY A 1 81  ? 14.521  4.868   11.427  1.00 0.49  ? 81  GLY A N    6  
ATOM 11051 C CA   . GLY A 1 81  ? 15.573  4.387   12.298  1.00 0.63  ? 81  GLY A CA   6  
ATOM 11052 C C    . GLY A 1 81  ? 16.494  3.431   11.576  1.00 0.64  ? 81  GLY A C    6  
ATOM 11053 O O    . GLY A 1 81  ? 17.104  3.795   10.568  1.00 1.10  ? 81  GLY A O    6  
ATOM 11054 H H    . GLY A 1 81  ? 14.748  5.402   10.635  1.00 0.51  ? 81  GLY A H    6  
ATOM 11055 H HA2  . GLY A 1 81  ? 16.146  5.230   12.659  1.00 0.75  ? 81  GLY A HA2  6  
ATOM 11056 H HA3  . GLY A 1 81  ? 15.128  3.879   13.140  1.00 0.70  ? 81  GLY A HA3  6  
ATOM 11057 N N    . ASP A 1 82  ? 16.585  2.205   12.071  1.00 0.43  ? 82  ASP A N    6  
ATOM 11058 C CA   . ASP A 1 82  ? 17.421  1.193   11.437  1.00 0.44  ? 82  ASP A CA   6  
ATOM 11059 C C    . ASP A 1 82  ? 16.560  0.137   10.765  1.00 0.39  ? 82  ASP A C    6  
ATOM 11060 O O    . ASP A 1 82  ? 17.055  -0.889  10.304  1.00 0.55  ? 82  ASP A O    6  
ATOM 11061 C CB   . ASP A 1 82  ? 18.384  0.549   12.436  1.00 0.55  ? 82  ASP A CB   6  
ATOM 11062 C CG   . ASP A 1 82  ? 19.494  1.493   12.856  1.00 1.41  ? 82  ASP A CG   6  
ATOM 11063 O OD1  . ASP A 1 82  ? 20.192  2.032   11.969  1.00 2.12  ? 82  ASP A OD1  6  
ATOM 11064 O OD2  . ASP A 1 82  ? 19.669  1.707   14.077  1.00 1.97  ? 82  ASP A OD2  6  
ATOM 11065 H H    . ASP A 1 82  ? 16.072  1.968   12.878  1.00 0.64  ? 82  ASP A H    6  
ATOM 11066 H HA   . ASP A 1 82  ? 17.999  1.691   10.672  1.00 0.51  ? 82  ASP A HA   6  
ATOM 11067 H HB2  . ASP A 1 82  ? 17.836  0.254   13.318  1.00 0.96  ? 82  ASP A HB2  6  
ATOM 11068 H HB3  . ASP A 1 82  ? 18.830  -0.325  11.984  1.00 0.95  ? 82  ASP A HB3  6  
ATOM 11069 N N    . GLU A 1 83  ? 15.264  0.394   10.731  1.00 0.38  ? 83  GLU A N    6  
ATOM 11070 C CA   . GLU A 1 83  ? 14.331  -0.425  9.980   1.00 0.39  ? 83  GLU A CA   6  
ATOM 11071 C C    . GLU A 1 83  ? 13.156  0.436   9.546   1.00 0.38  ? 83  GLU A C    6  
ATOM 11072 O O    . GLU A 1 83  ? 12.899  1.485   10.146  1.00 0.53  ? 83  GLU A O    6  
ATOM 11073 C CB   . GLU A 1 83  ? 13.867  -1.636  10.805  1.00 0.47  ? 83  GLU A CB   6  
ATOM 11074 C CG   . GLU A 1 83  ? 13.094  -1.299  12.074  1.00 0.86  ? 83  GLU A CG   6  
ATOM 11075 C CD   . GLU A 1 83  ? 11.587  -1.320  11.879  1.00 1.62  ? 83  GLU A CD   6  
ATOM 11076 O OE1  . GLU A 1 83  ? 11.025  -2.422  11.706  1.00 2.11  ? 83  GLU A OE1  6  
ATOM 11077 O OE2  . GLU A 1 83  ? 10.955  -0.244  11.925  1.00 2.00  ? 83  GLU A OE2  6  
ATOM 11078 H H    . GLU A 1 83  ? 14.918  1.165   11.229  1.00 0.49  ? 83  GLU A H    6  
ATOM 11079 H HA   . GLU A 1 83  ? 14.843  -0.778  9.095   1.00 0.42  ? 83  GLU A HA   6  
ATOM 11080 H HB2  . GLU A 1 83  ? 13.233  -2.251  10.183  1.00 0.89  ? 83  GLU A HB2  6  
ATOM 11081 H HB3  . GLU A 1 83  ? 14.736  -2.211  11.084  1.00 0.82  ? 83  GLU A HB3  6  
ATOM 11082 H HG2  . GLU A 1 83  ? 13.351  -2.023  12.834  1.00 1.20  ? 83  GLU A HG2  6  
ATOM 11083 H HG3  . GLU A 1 83  ? 13.386  -0.314  12.406  1.00 1.09  ? 83  GLU A HG3  6  
ATOM 11084 N N    . THR A 1 84  ? 12.465  0.029   8.495   1.00 0.27  ? 84  THR A N    6  
ATOM 11085 C CA   . THR A 1 84  ? 11.318  0.776   8.030   1.00 0.26  ? 84  THR A CA   6  
ATOM 11086 C C    . THR A 1 84  ? 10.176  -0.176  7.690   1.00 0.22  ? 84  THR A C    6  
ATOM 11087 O O    . THR A 1 84  ? 10.402  -1.328  7.316   1.00 0.21  ? 84  THR A O    6  
ATOM 11088 C CB   . THR A 1 84  ? 11.676  1.667   6.813   1.00 0.30  ? 84  THR A CB   6  
ATOM 11089 O OG1  . THR A 1 84  ? 10.592  2.550   6.503   1.00 0.32  ? 84  THR A OG1  6  
ATOM 11090 C CG2  . THR A 1 84  ? 12.014  0.830   5.588   1.00 0.30  ? 84  THR A CG2  6  
ATOM 11091 H H    . THR A 1 84  ? 12.728  -0.800  8.020   1.00 0.23  ? 84  THR A H    6  
ATOM 11092 H HA   . THR A 1 84  ? 10.999  1.422   8.837   1.00 0.30  ? 84  THR A HA   6  
ATOM 11093 H HB   . THR A 1 84  ? 12.543  2.259   7.071   1.00 0.36  ? 84  THR A HB   6  
ATOM 11094 H HG1  . THR A 1 84  ? 9.986   2.588   7.251   1.00 0.60  ? 84  THR A HG1  6  
ATOM 11095 H HG21 . THR A 1 84  ? 12.295  1.479   4.773   1.00 1.03  ? 84  THR A HG21 6  
ATOM 11096 H HG22 . THR A 1 84  ? 11.153  0.244   5.302   1.00 1.05  ? 84  THR A HG22 6  
ATOM 11097 H HG23 . THR A 1 84  ? 12.838  0.168   5.821   1.00 1.09  ? 84  THR A HG23 6  
ATOM 11098 N N    . LYS A 1 85  ? 8.958   0.291   7.877   1.00 0.24  ? 85  LYS A N    6  
ATOM 11099 C CA   . LYS A 1 85  ? 7.786   -0.494  7.556   1.00 0.23  ? 85  LYS A CA   6  
ATOM 11100 C C    . LYS A 1 85  ? 6.997   0.195   6.458   1.00 0.23  ? 85  LYS A C    6  
ATOM 11101 O O    . LYS A 1 85  ? 6.546   1.331   6.620   1.00 0.26  ? 85  LYS A O    6  
ATOM 11102 C CB   . LYS A 1 85  ? 6.920   -0.680  8.798   1.00 0.28  ? 85  LYS A CB   6  
ATOM 11103 C CG   . LYS A 1 85  ? 7.674   -1.279  9.972   1.00 0.37  ? 85  LYS A CG   6  
ATOM 11104 C CD   . LYS A 1 85  ? 6.768   -1.433  11.176  1.00 0.50  ? 85  LYS A CD   6  
ATOM 11105 C CE   . LYS A 1 85  ? 7.531   -1.891  12.406  1.00 0.78  ? 85  LYS A CE   6  
ATOM 11106 N NZ   . LYS A 1 85  ? 8.505   -0.867  12.880  1.00 1.63  ? 85  LYS A NZ   6  
ATOM 11107 H H    . LYS A 1 85  ? 8.842   1.195   8.245   1.00 0.27  ? 85  LYS A H    6  
ATOM 11108 H HA   . LYS A 1 85  ? 8.116   -1.461  7.202   1.00 0.22  ? 85  LYS A HA   6  
ATOM 11109 H HB2  . LYS A 1 85  ? 6.531   0.281   9.098   1.00 0.34  ? 85  LYS A HB2  6  
ATOM 11110 H HB3  . LYS A 1 85  ? 6.095   -1.334  8.555   1.00 0.36  ? 85  LYS A HB3  6  
ATOM 11111 H HG2  . LYS A 1 85  ? 8.049   -2.252  9.690   1.00 0.55  ? 85  LYS A HG2  6  
ATOM 11112 H HG3  . LYS A 1 85  ? 8.497   -0.631  10.230  1.00 0.55  ? 85  LYS A HG3  6  
ATOM 11113 H HD2  . LYS A 1 85  ? 6.308   -0.481  11.382  1.00 0.71  ? 85  LYS A HD2  6  
ATOM 11114 H HD3  . LYS A 1 85  ? 6.003   -2.158  10.946  1.00 0.72  ? 85  LYS A HD3  6  
ATOM 11115 H HE2  . LYS A 1 85  ? 6.822   -2.093  13.194  1.00 1.42  ? 85  LYS A HE2  6  
ATOM 11116 H HE3  . LYS A 1 85  ? 8.065   -2.799  12.163  1.00 1.22  ? 85  LYS A HE3  6  
ATOM 11117 H HZ1  . LYS A 1 85  ? 9.289   -0.764  12.195  1.00 2.25  ? 85  LYS A HZ1  6  
ATOM 11118 H HZ2  . LYS A 1 85  ? 8.901   -1.148  13.802  1.00 1.97  ? 85  LYS A HZ2  6  
ATOM 11119 H HZ3  . LYS A 1 85  ? 8.031   0.057   12.988  1.00 2.17  ? 85  LYS A HZ3  6  
ATOM 11120 N N    . LEU A 1 86  ? 6.837   -0.489  5.349   1.00 0.22  ? 86  LEU A N    6  
ATOM 11121 C CA   . LEU A 1 86  ? 6.149   0.068   4.204   1.00 0.22  ? 86  LEU A CA   6  
ATOM 11122 C C    . LEU A 1 86  ? 4.771   -0.540  4.080   1.00 0.22  ? 86  LEU A C    6  
ATOM 11123 O O    . LEU A 1 86  ? 4.614   -1.760  4.086   1.00 0.27  ? 86  LEU A O    6  
ATOM 11124 C CB   . LEU A 1 86  ? 6.940   -0.196  2.922   1.00 0.24  ? 86  LEU A CB   6  
ATOM 11125 C CG   . LEU A 1 86  ? 8.330   0.435   2.868   1.00 0.25  ? 86  LEU A CG   6  
ATOM 11126 C CD1  . LEU A 1 86  ? 9.005   0.122   1.542   1.00 0.28  ? 86  LEU A CD1  6  
ATOM 11127 C CD2  . LEU A 1 86  ? 8.238   1.937   3.078   1.00 0.28  ? 86  LEU A CD2  6  
ATOM 11128 H H    . LEU A 1 86  ? 7.186   -1.408  5.298   1.00 0.22  ? 86  LEU A H    6  
ATOM 11129 H HA   . LEU A 1 86  ? 6.052   1.137   4.347   1.00 0.23  ? 86  LEU A HA   6  
ATOM 11130 H HB2  . LEU A 1 86  ? 7.048   -1.265  2.809   1.00 0.24  ? 86  LEU A HB2  6  
ATOM 11131 H HB3  . LEU A 1 86  ? 6.368   0.179   2.087   1.00 0.25  ? 86  LEU A HB3  6  
ATOM 11132 H HG   . LEU A 1 86  ? 8.940   0.021   3.658   1.00 0.26  ? 86  LEU A HG   6  
ATOM 11133 H HD11 . LEU A 1 86  ? 9.988   0.572   1.524   1.00 1.02  ? 86  LEU A HD11 6  
ATOM 11134 H HD12 . LEU A 1 86  ? 8.413   0.522   0.734   1.00 0.97  ? 86  LEU A HD12 6  
ATOM 11135 H HD13 . LEU A 1 86  ? 9.096   -0.947  1.428   1.00 1.02  ? 86  LEU A HD13 6  
ATOM 11136 H HD21 . LEU A 1 86  ? 7.768   2.139   4.029   1.00 1.04  ? 86  LEU A HD21 6  
ATOM 11137 H HD22 . LEU A 1 86  ? 7.649   2.374   2.286   1.00 1.00  ? 86  LEU A HD22 6  
ATOM 11138 H HD23 . LEU A 1 86  ? 9.230   2.366   3.066   1.00 1.03  ? 86  LEU A HD23 6  
ATOM 11139 N N    . LEU A 1 87  ? 3.775   0.310   3.974   1.00 0.20  ? 87  LEU A N    6  
ATOM 11140 C CA   . LEU A 1 87  ? 2.429   -0.148  3.737   1.00 0.21  ? 87  LEU A CA   6  
ATOM 11141 C C    . LEU A 1 87  ? 2.092   0.102   2.287   1.00 0.21  ? 87  LEU A C    6  
ATOM 11142 O O    . LEU A 1 87  ? 2.041   1.249   1.840   1.00 0.26  ? 87  LEU A O    6  
ATOM 11143 C CB   . LEU A 1 87  ? 1.430   0.585   4.625   1.00 0.27  ? 87  LEU A CB   6  
ATOM 11144 C CG   . LEU A 1 87  ? -0.015  0.113   4.475   1.00 0.39  ? 87  LEU A CG   6  
ATOM 11145 C CD1  . LEU A 1 87  ? -0.212  -1.226  5.158   1.00 0.51  ? 87  LEU A CD1  6  
ATOM 11146 C CD2  . LEU A 1 87  ? -0.980  1.141   5.024   1.00 0.45  ? 87  LEU A CD2  6  
ATOM 11147 H H    . LEU A 1 87  ? 3.950   1.275   4.051   1.00 0.20  ? 87  LEU A H    6  
ATOM 11148 H HA   . LEU A 1 87  ? 2.386   -1.209  3.936   1.00 0.23  ? 87  LEU A HA   6  
ATOM 11149 H HB2  . LEU A 1 87  ? 1.728   0.453   5.655   1.00 0.29  ? 87  LEU A HB2  6  
ATOM 11150 H HB3  . LEU A 1 87  ? 1.469   1.638   4.385   1.00 0.27  ? 87  LEU A HB3  6  
ATOM 11151 H HG   . LEU A 1 87  ? -0.230  -0.019  3.425   1.00 0.63  ? 87  LEU A HG   6  
ATOM 11152 H HD11 . LEU A 1 87  ? 0.066   -1.143  6.197   1.00 1.22  ? 87  LEU A HD11 6  
ATOM 11153 H HD12 . LEU A 1 87  ? 0.401   -1.972  4.676   1.00 1.05  ? 87  LEU A HD12 6  
ATOM 11154 H HD13 . LEU A 1 87  ? -1.252  -1.514  5.087   1.00 1.12  ? 87  LEU A HD13 6  
ATOM 11155 H HD21 . LEU A 1 87  ? -0.761  1.319   6.066   1.00 1.05  ? 87  LEU A HD21 6  
ATOM 11156 H HD22 . LEU A 1 87  ? -1.992  0.772   4.927   1.00 1.12  ? 87  LEU A HD22 6  
ATOM 11157 H HD23 . LEU A 1 87  ? -0.879  2.062   4.472   1.00 1.19  ? 87  LEU A HD23 6  
ATOM 11158 N N    . VAL A 1 88  ? 1.880   -0.967  1.552   1.00 0.20  ? 88  VAL A N    6  
ATOM 11159 C CA   . VAL A 1 88  ? 1.651   -0.863  0.129   1.00 0.23  ? 88  VAL A CA   6  
ATOM 11160 C C    . VAL A 1 88  ? 0.382   -1.590  -0.273  1.00 0.24  ? 88  VAL A C    6  
ATOM 11161 O O    . VAL A 1 88  ? -0.167  -2.380  0.498   1.00 0.27  ? 88  VAL A O    6  
ATOM 11162 C CB   . VAL A 1 88  ? 2.843   -1.421  -0.678  1.00 0.28  ? 88  VAL A CB   6  
ATOM 11163 C CG1  . VAL A 1 88  ? 4.055   -0.515  -0.537  1.00 0.31  ? 88  VAL A CG1  6  
ATOM 11164 C CG2  . VAL A 1 88  ? 3.188   -2.835  -0.229  1.00 0.33  ? 88  VAL A CG2  6  
ATOM 11165 H H    . VAL A 1 88  ? 1.878   -1.855  1.978   1.00 0.20  ? 88  VAL A H    6  
ATOM 11166 H HA   . VAL A 1 88  ? 1.542   0.184   -0.113  1.00 0.26  ? 88  VAL A HA   6  
ATOM 11167 H HB   . VAL A 1 88  ? 2.565   -1.455  -1.720  1.00 0.32  ? 88  VAL A HB   6  
ATOM 11168 H HG11 . VAL A 1 88  ? 4.326   -0.433  0.506   1.00 1.05  ? 88  VAL A HG11 6  
ATOM 11169 H HG12 . VAL A 1 88  ? 3.817   0.465   -0.925  1.00 1.02  ? 88  VAL A HG12 6  
ATOM 11170 H HG13 . VAL A 1 88  ? 4.882   -0.931  -1.092  1.00 1.03  ? 88  VAL A HG13 6  
ATOM 11171 H HG21 . VAL A 1 88  ? 3.463   -2.824  0.815   1.00 1.07  ? 88  VAL A HG21 6  
ATOM 11172 H HG22 . VAL A 1 88  ? 4.015   -3.210  -0.816  1.00 1.02  ? 88  VAL A HG22 6  
ATOM 11173 H HG23 . VAL A 1 88  ? 2.329   -3.477  -0.369  1.00 1.09  ? 88  VAL A HG23 6  
ATOM 11174 N N    . VAL A 1 89  ? -0.094  -1.288  -1.464  1.00 0.24  ? 89  VAL A N    6  
ATOM 11175 C CA   . VAL A 1 89  ? -1.265  -1.941  -2.013  1.00 0.27  ? 89  VAL A CA   6  
ATOM 11176 C C    . VAL A 1 89  ? -0.978  -2.427  -3.425  1.00 0.34  ? 89  VAL A C    6  
ATOM 11177 O O    . VAL A 1 89  ? -0.305  -1.743  -4.203  1.00 0.42  ? 89  VAL A O    6  
ATOM 11178 C CB   . VAL A 1 89  ? -2.486  -0.993  -2.030  1.00 0.25  ? 89  VAL A CB   6  
ATOM 11179 C CG1  . VAL A 1 89  ? -2.975  -0.718  -0.615  1.00 0.29  ? 89  VAL A CG1  6  
ATOM 11180 C CG2  . VAL A 1 89  ? -2.147  0.313   -2.733  1.00 0.30  ? 89  VAL A CG2  6  
ATOM 11181 H H    . VAL A 1 89  ? 0.358   -0.597  -1.994  1.00 0.26  ? 89  VAL A H    6  
ATOM 11182 H HA   . VAL A 1 89  ? -1.499  -2.790  -1.387  1.00 0.32  ? 89  VAL A HA   6  
ATOM 11183 H HB   . VAL A 1 89  ? -3.284  -1.475  -2.576  1.00 0.28  ? 89  VAL A HB   6  
ATOM 11184 H HG11 . VAL A 1 89  ? -3.246  -1.650  -0.142  1.00 1.04  ? 89  VAL A HG11 6  
ATOM 11185 H HG12 . VAL A 1 89  ? -3.837  -0.068  -0.650  1.00 1.07  ? 89  VAL A HG12 6  
ATOM 11186 H HG13 . VAL A 1 89  ? -2.188  -0.243  -0.047  1.00 1.01  ? 89  VAL A HG13 6  
ATOM 11187 H HG21 . VAL A 1 89  ? -1.906  0.112   -3.766  1.00 1.03  ? 89  VAL A HG21 6  
ATOM 11188 H HG22 . VAL A 1 89  ? -1.297  0.771   -2.248  1.00 1.08  ? 89  VAL A HG22 6  
ATOM 11189 H HG23 . VAL A 1 89  ? -2.993  0.980   -2.683  1.00 1.05  ? 89  VAL A HG23 6  
ATOM 11190 N N    . ASP A 1 90  ? -1.458  -3.622  -3.741  1.00 0.41  ? 90  ASP A N    6  
ATOM 11191 C CA   . ASP A 1 90  ? -1.322  -4.162  -5.083  1.00 0.51  ? 90  ASP A CA   6  
ATOM 11192 C C    . ASP A 1 90  ? -2.349  -3.517  -6.006  1.00 0.48  ? 90  ASP A C    6  
ATOM 11193 O O    . ASP A 1 90  ? -3.186  -2.739  -5.546  1.00 0.45  ? 90  ASP A O    6  
ATOM 11194 C CB   . ASP A 1 90  ? -1.483  -5.687  -5.087  1.00 0.68  ? 90  ASP A CB   6  
ATOM 11195 C CG   . ASP A 1 90  ? -2.838  -6.133  -4.578  1.00 1.20  ? 90  ASP A CG   6  
ATOM 11196 O OD1  . ASP A 1 90  ? -3.819  -6.065  -5.345  1.00 1.86  ? 90  ASP A OD1  6  
ATOM 11197 O OD2  . ASP A 1 90  ? -2.926  -6.548  -3.404  1.00 1.92  ? 90  ASP A OD2  6  
ATOM 11198 H H    . ASP A 1 90  ? -1.918  -4.150  -3.057  1.00 0.44  ? 90  ASP A H    6  
ATOM 11199 H HA   . ASP A 1 90  ? -0.333  -3.914  -5.439  1.00 0.59  ? 90  ASP A HA   6  
ATOM 11200 H HB2  . ASP A 1 90  ? -1.363  -6.052  -6.095  1.00 1.54  ? 90  ASP A HB2  6  
ATOM 11201 H HB3  . ASP A 1 90  ? -0.722  -6.125  -4.458  1.00 1.21  ? 90  ASP A HB3  6  
ATOM 11202 N N    . ARG A 1 91  ? -2.304  -3.839  -7.288  1.00 0.57  ? 91  ARG A N    6  
ATOM 11203 C CA   . ARG A 1 91  ? -3.125  -3.138  -8.271  1.00 0.61  ? 91  ARG A CA   6  
ATOM 11204 C C    . ARG A 1 91  ? -4.619  -3.326  -7.998  1.00 0.55  ? 91  ARG A C    6  
ATOM 11205 O O    . ARG A 1 91  ? -5.391  -2.369  -8.076  1.00 0.55  ? 91  ARG A O    6  
ATOM 11206 C CB   . ARG A 1 91  ? -2.764  -3.588  -9.689  1.00 0.75  ? 91  ARG A CB   6  
ATOM 11207 C CG   . ARG A 1 91  ? -3.280  -2.661  -10.783 1.00 0.82  ? 91  ARG A CG   6  
ATOM 11208 C CD   . ARG A 1 91  ? -3.054  -1.188  -10.446 1.00 1.44  ? 91  ARG A CD   6  
ATOM 11209 N NE   . ARG A 1 91  ? -1.753  -0.947  -9.818  1.00 2.25  ? 91  ARG A NE   6  
ATOM 11210 C CZ   . ARG A 1 91  ? -1.537  -0.004  -8.901  1.00 3.13  ? 91  ARG A CZ   6  
ATOM 11211 N NH1  . ARG A 1 91  ? -2.467  0.908   -8.647  1.00 3.39  ? 91  ARG A NH1  6  
ATOM 11212 N NH2  . ARG A 1 91  ? -0.369  0.052   -8.273  1.00 4.16  ? 91  ARG A NH2  6  
ATOM 11213 H H    . ARG A 1 91  ? -1.717  -4.565  -7.581  1.00 0.66  ? 91  ARG A H    6  
ATOM 11214 H HA   . ARG A 1 91  ? -2.901  -2.085  -8.182  1.00 0.63  ? 91  ARG A HA   6  
ATOM 11215 H HB2  . ARG A 1 91  ? -1.687  -3.643  -9.771  1.00 0.85  ? 91  ARG A HB2  6  
ATOM 11216 H HB3  . ARG A 1 91  ? -3.178  -4.570  -9.857  1.00 0.78  ? 91  ARG A HB3  6  
ATOM 11217 H HG2  . ARG A 1 91  ? -2.763  -2.888  -11.704 1.00 1.07  ? 91  ARG A HG2  6  
ATOM 11218 H HG3  . ARG A 1 91  ? -4.338  -2.833  -10.914 1.00 1.01  ? 91  ARG A HG3  6  
ATOM 11219 H HD2  . ARG A 1 91  ? -3.111  -0.613  -11.359 1.00 1.95  ? 91  ARG A HD2  6  
ATOM 11220 H HD3  . ARG A 1 91  ? -3.833  -0.864  -9.771  1.00 1.87  ? 91  ARG A HD3  6  
ATOM 11221 H HE   . ARG A 1 91  ? -1.012  -1.560  -10.052 1.00 2.59  ? 91  ARG A HE   6  
ATOM 11222 H HH11 . ARG A 1 91  ? -3.336  0.902   -9.156  1.00 3.07  ? 91  ARG A HH11 6  
ATOM 11223 H HH12 . ARG A 1 91  ? -2.321  1.602   -7.925  1.00 4.20  ? 91  ARG A HH12 6  
ATOM 11224 H HH21 . ARG A 1 91  ? 0.352   -0.616  -8.492  1.00 4.40  ? 91  ARG A HH21 6  
ATOM 11225 H HH22 . ARG A 1 91  ? -0.206  0.748   -7.575  1.00 4.87  ? 91  ARG A HH22 6  
ATOM 11226 N N    . GLU A 1 92  ? -5.017  -4.545  -7.650  1.00 0.57  ? 92  GLU A N    6  
ATOM 11227 C CA   . GLU A 1 92  ? -6.417  -4.832  -7.355  1.00 0.61  ? 92  GLU A CA   6  
ATOM 11228 C C    . GLU A 1 92  ? -6.864  -4.099  -6.094  1.00 0.51  ? 92  GLU A C    6  
ATOM 11229 O O    . GLU A 1 92  ? -7.949  -3.519  -6.051  1.00 0.56  ? 92  GLU A O    6  
ATOM 11230 C CB   . GLU A 1 92  ? -6.641  -6.338  -7.187  1.00 0.74  ? 92  GLU A CB   6  
ATOM 11231 C CG   . GLU A 1 92  ? -6.833  -7.093  -8.494  1.00 1.44  ? 92  GLU A CG   6  
ATOM 11232 C CD   . GLU A 1 92  ? -5.683  -6.912  -9.460  1.00 1.98  ? 92  GLU A CD   6  
ATOM 11233 O OE1  . GLU A 1 92  ? -4.632  -7.557  -9.269  1.00 2.26  ? 92  GLU A OE1  6  
ATOM 11234 O OE2  . GLU A 1 92  ? -5.830  -6.122  -10.418 1.00 2.68  ? 92  GLU A OE2  6  
ATOM 11235 H H    . GLU A 1 92  ? -4.353  -5.265  -7.577  1.00 0.59  ? 92  GLU A H    6  
ATOM 11236 H HA   . GLU A 1 92  ? -7.009  -4.481  -8.190  1.00 0.67  ? 92  GLU A HA   6  
ATOM 11237 H HB2  . GLU A 1 92  ? -5.786  -6.759  -6.678  1.00 1.34  ? 92  GLU A HB2  6  
ATOM 11238 H HB3  . GLU A 1 92  ? -7.519  -6.493  -6.576  1.00 1.23  ? 92  GLU A HB3  6  
ATOM 11239 H HG2  . GLU A 1 92  ? -6.931  -8.145  -8.274  1.00 1.97  ? 92  GLU A HG2  6  
ATOM 11240 H HG3  . GLU A 1 92  ? -7.739  -6.741  -8.967  1.00 1.93  ? 92  GLU A HG3  6  
ATOM 11241 N N    . THR A 1 93  ? -6.009  -4.116  -5.082  1.00 0.44  ? 93  THR A N    6  
ATOM 11242 C CA   . THR A 1 93  ? -6.295  -3.454  -3.819  1.00 0.38  ? 93  THR A CA   6  
ATOM 11243 C C    . THR A 1 93  ? -6.355  -1.933  -3.985  1.00 0.33  ? 93  THR A C    6  
ATOM 11244 O O    . THR A 1 93  ? -7.270  -1.280  -3.475  1.00 0.37  ? 93  THR A O    6  
ATOM 11245 C CB   . THR A 1 93  ? -5.222  -3.799  -2.778  1.00 0.36  ? 93  THR A CB   6  
ATOM 11246 O OG1  . THR A 1 93  ? -5.166  -5.220  -2.588  1.00 0.47  ? 93  THR A OG1  6  
ATOM 11247 C CG2  . THR A 1 93  ? -5.500  -3.113  -1.453  1.00 0.36  ? 93  THR A CG2  6  
ATOM 11248 H H    . THR A 1 93  ? -5.158  -4.602  -5.185  1.00 0.45  ? 93  THR A H    6  
ATOM 11249 H HA   . THR A 1 93  ? -7.254  -3.813  -3.458  1.00 0.45  ? 93  THR A HA   6  
ATOM 11250 H HB   . THR A 1 93  ? -4.272  -3.453  -3.149  1.00 0.33  ? 93  THR A HB   6  
ATOM 11251 H HG1  . THR A 1 93  ? -4.479  -5.599  -3.162  1.00 0.82  ? 93  THR A HG1  6  
ATOM 11252 H HG21 . THR A 1 93  ? -4.747  -3.398  -0.732  1.00 1.00  ? 93  THR A HG21 6  
ATOM 11253 H HG22 . THR A 1 93  ? -6.474  -3.409  -1.092  1.00 1.04  ? 93  THR A HG22 6  
ATOM 11254 H HG23 . THR A 1 93  ? -5.477  -2.043  -1.592  1.00 1.08  ? 93  THR A HG23 6  
ATOM 11255 N N    . ASP A 1 94  ? -5.377  -1.376  -4.697  1.00 0.33  ? 94  ASP A N    6  
ATOM 11256 C CA   . ASP A 1 94  ? -5.315  0.067   -4.924  1.00 0.39  ? 94  ASP A CA   6  
ATOM 11257 C C    . ASP A 1 94  ? -6.583  0.520   -5.631  1.00 0.43  ? 94  ASP A C    6  
ATOM 11258 O O    . ASP A 1 94  ? -7.240  1.469   -5.203  1.00 0.50  ? 94  ASP A O    6  
ATOM 11259 C CB   . ASP A 1 94  ? -4.076  0.420   -5.759  1.00 0.48  ? 94  ASP A CB   6  
ATOM 11260 C CG   . ASP A 1 94  ? -3.721  1.902   -5.730  1.00 0.71  ? 94  ASP A CG   6  
ATOM 11261 O OD1  . ASP A 1 94  ? -4.460  2.680   -5.083  1.00 0.77  ? 94  ASP A OD1  6  
ATOM 11262 O OD2  . ASP A 1 94  ? -2.726  2.305   -6.363  1.00 1.18  ? 94  ASP A OD2  6  
ATOM 11263 H H    . ASP A 1 94  ? -4.675  -1.951  -5.080  1.00 0.34  ? 94  ASP A H    6  
ATOM 11264 H HA   . ASP A 1 94  ? -5.253  0.559   -3.961  1.00 0.43  ? 94  ASP A HA   6  
ATOM 11265 H HB2  . ASP A 1 94  ? -3.231  -0.135  -5.380  1.00 0.48  ? 94  ASP A HB2  6  
ATOM 11266 H HB3  . ASP A 1 94  ? -4.253  0.133   -6.787  1.00 0.53  ? 94  ASP A HB3  6  
ATOM 11267 N N    . GLU A 1 95  ? -6.957  -0.206  -6.680  1.00 0.43  ? 95  GLU A N    6  
ATOM 11268 C CA   . GLU A 1 95  ? -8.187  0.075   -7.407  1.00 0.49  ? 95  GLU A CA   6  
ATOM 11269 C C    . GLU A 1 95  ? -9.398  -0.040  -6.488  1.00 0.45  ? 95  GLU A C    6  
ATOM 11270 O O    . GLU A 1 95  ? -10.339 0.749   -6.595  1.00 0.50  ? 95  GLU A O    6  
ATOM 11271 C CB   . GLU A 1 95  ? -8.347  -0.884  -8.587  1.00 0.60  ? 95  GLU A CB   6  
ATOM 11272 C CG   . GLU A 1 95  ? -7.435  -0.574  -9.760  1.00 0.72  ? 95  GLU A CG   6  
ATOM 11273 C CD   . GLU A 1 95  ? -7.757  0.758   -10.405 1.00 1.17  ? 95  GLU A CD   6  
ATOM 11274 O OE1  . GLU A 1 95  ? -8.923  0.976   -10.788 1.00 1.23  ? 95  GLU A OE1  6  
ATOM 11275 O OE2  . GLU A 1 95  ? -6.843  1.596   -10.532 1.00 1.94  ? 95  GLU A OE2  6  
ATOM 11276 H H    . GLU A 1 95  ? -6.387  -0.952  -6.972  1.00 0.44  ? 95  GLU A H    6  
ATOM 11277 H HA   . GLU A 1 95  ? -8.129  1.085   -7.781  1.00 0.54  ? 95  GLU A HA   6  
ATOM 11278 H HB2  . GLU A 1 95  ? -8.135  -1.887  -8.250  1.00 0.60  ? 95  GLU A HB2  6  
ATOM 11279 H HB3  . GLU A 1 95  ? -9.369  -0.840  -8.933  1.00 0.66  ? 95  GLU A HB3  6  
ATOM 11280 H HG2  . GLU A 1 95  ? -6.413  -0.550  -9.410  1.00 1.08  ? 95  GLU A HG2  6  
ATOM 11281 H HG3  . GLU A 1 95  ? -7.544  -1.352  -10.501 1.00 1.05  ? 95  GLU A HG3  6  
ATOM 11282 N N    . PHE A 1 96  ? -9.364  -1.012  -5.579  1.00 0.41  ? 96  PHE A N    6  
ATOM 11283 C CA   . PHE A 1 96  ? -10.467 -1.231  -4.650  1.00 0.41  ? 96  PHE A CA   6  
ATOM 11284 C C    . PHE A 1 96  ? -10.661 -0.024  -3.739  1.00 0.36  ? 96  PHE A C    6  
ATOM 11285 O O    . PHE A 1 96  ? -11.773 0.478   -3.596  1.00 0.40  ? 96  PHE A O    6  
ATOM 11286 C CB   . PHE A 1 96  ? -10.214 -2.487  -3.807  1.00 0.44  ? 96  PHE A CB   6  
ATOM 11287 C CG   . PHE A 1 96  ? -11.245 -2.721  -2.738  1.00 0.51  ? 96  PHE A CG   6  
ATOM 11288 C CD1  . PHE A 1 96  ? -12.448 -3.335  -3.040  1.00 0.63  ? 96  PHE A CD1  6  
ATOM 11289 C CD2  . PHE A 1 96  ? -11.010 -2.322  -1.431  1.00 0.52  ? 96  PHE A CD2  6  
ATOM 11290 C CE1  . PHE A 1 96  ? -13.398 -3.548  -2.059  1.00 0.73  ? 96  PHE A CE1  6  
ATOM 11291 C CE2  . PHE A 1 96  ? -11.955 -2.532  -0.447  1.00 0.62  ? 96  PHE A CE2  6  
ATOM 11292 C CZ   . PHE A 1 96  ? -13.152 -3.146  -0.761  1.00 0.72  ? 96  PHE A CZ   6  
ATOM 11293 H H    . PHE A 1 96  ? -8.578  -1.601  -5.534  1.00 0.41  ? 96  PHE A H    6  
ATOM 11294 H HA   . PHE A 1 96  ? -11.365 -1.374  -5.230  1.00 0.46  ? 96  PHE A HA   6  
ATOM 11295 H HB2  . PHE A 1 96  ? -10.208 -3.350  -4.455  1.00 0.49  ? 96  PHE A HB2  6  
ATOM 11296 H HB3  . PHE A 1 96  ? -9.250  -2.399  -3.326  1.00 0.41  ? 96  PHE A HB3  6  
ATOM 11297 H HD1  . PHE A 1 96  ? -12.641 -3.651  -4.053  1.00 0.67  ? 96  PHE A HD1  6  
ATOM 11298 H HD2  . PHE A 1 96  ? -10.076 -1.842  -1.185  1.00 0.48  ? 96  PHE A HD2  6  
ATOM 11299 H HE1  . PHE A 1 96  ? -14.333 -4.030  -2.306  1.00 0.83  ? 96  PHE A HE1  6  
ATOM 11300 H HE2  . PHE A 1 96  ? -11.761 -2.215  0.566   1.00 0.66  ? 96  PHE A HE2  6  
ATOM 11301 H HZ   . PHE A 1 96  ? -13.893 -3.310  0.008   1.00 0.81  ? 96  PHE A HZ   6  
ATOM 11302 N N    . PHE A 1 97  ? -9.580  0.446   -3.141  1.00 0.32  ? 97  PHE A N    6  
ATOM 11303 C CA   . PHE A 1 97  ? -9.646  1.614   -2.266  1.00 0.32  ? 97  PHE A CA   6  
ATOM 11304 C C    . PHE A 1 97  ? -9.999  2.879   -3.048  1.00 0.39  ? 97  PHE A C    6  
ATOM 11305 O O    . PHE A 1 97  ? -10.755 3.724   -2.560  1.00 0.44  ? 97  PHE A O    6  
ATOM 11306 C CB   . PHE A 1 97  ? -8.330  1.800   -1.510  1.00 0.30  ? 97  PHE A CB   6  
ATOM 11307 C CG   . PHE A 1 97  ? -8.214  0.940   -0.283  1.00 0.29  ? 97  PHE A CG   6  
ATOM 11308 C CD1  . PHE A 1 97  ? -8.748  1.351   0.925   1.00 0.38  ? 97  PHE A CD1  6  
ATOM 11309 C CD2  . PHE A 1 97  ? -7.573  -0.286  -0.345  1.00 0.37  ? 97  PHE A CD2  6  
ATOM 11310 C CE1  . PHE A 1 97  ? -8.646  0.555   2.050   1.00 0.41  ? 97  PHE A CE1  6  
ATOM 11311 C CE2  . PHE A 1 97  ? -7.467  -1.088  0.775   1.00 0.40  ? 97  PHE A CE2  6  
ATOM 11312 C CZ   . PHE A 1 97  ? -7.997  -0.636  1.997   1.00 0.35  ? 97  PHE A CZ   6  
ATOM 11313 H H    . PHE A 1 97  ? -8.715  -0.011  -3.283  1.00 0.30  ? 97  PHE A H    6  
ATOM 11314 H HA   . PHE A 1 97  ? -10.439 1.436   -1.548  1.00 0.34  ? 97  PHE A HA   6  
ATOM 11315 H HB2  . PHE A 1 97  ? -7.507  1.552   -2.164  1.00 0.29  ? 97  PHE A HB2  6  
ATOM 11316 H HB3  . PHE A 1 97  ? -8.238  2.831   -1.204  1.00 0.35  ? 97  PHE A HB3  6  
ATOM 11317 H HD1  . PHE A 1 97  ? -9.250  2.306   0.984   1.00 0.53  ? 97  PHE A HD1  6  
ATOM 11318 H HD2  . PHE A 1 97  ? -7.155  -0.616  -1.282  1.00 0.50  ? 97  PHE A HD2  6  
ATOM 11319 H HE1  . PHE A 1 97  ? -9.068  0.888   2.987   1.00 0.55  ? 97  PHE A HE1  6  
ATOM 11320 H HE2  . PHE A 1 97  ? -6.965  -2.043  0.712   1.00 0.55  ? 97  PHE A HE2  6  
ATOM 11321 H HZ   . PHE A 1 97  ? -7.910  -1.245  2.886   1.00 0.40  ? 97  PHE A HZ   6  
ATOM 11322 N N    . LYS A 1 98  ? -9.462  3.002   -4.261  1.00 0.43  ? 98  LYS A N    6  
ATOM 11323 C CA   . LYS A 1 98  ? -9.752  4.152   -5.119  1.00 0.53  ? 98  LYS A CA   6  
ATOM 11324 C C    . LYS A 1 98  ? -11.239 4.249   -5.431  1.00 0.56  ? 98  LYS A C    6  
ATOM 11325 O O    . LYS A 1 98  ? -11.844 5.314   -5.290  1.00 0.61  ? 98  LYS A O    6  
ATOM 11326 C CB   . LYS A 1 98  ? -8.972  4.057   -6.431  1.00 0.63  ? 98  LYS A CB   6  
ATOM 11327 C CG   . LYS A 1 98  ? -7.470  4.206   -6.265  1.00 0.85  ? 98  LYS A CG   6  
ATOM 11328 C CD   . LYS A 1 98  ? -6.739  3.988   -7.578  1.00 1.13  ? 98  LYS A CD   6  
ATOM 11329 C CE   . LYS A 1 98  ? -6.766  5.229   -8.450  1.00 1.31  ? 98  LYS A CE   6  
ATOM 11330 N NZ   . LYS A 1 98  ? -5.925  6.319   -7.885  1.00 1.92  ? 98  LYS A NZ   6  
ATOM 11331 H H    . LYS A 1 98  ? -8.846  2.305   -4.585  1.00 0.41  ? 98  LYS A H    6  
ATOM 11332 H HA   . LYS A 1 98  ? -9.446  5.046   -4.593  1.00 0.56  ? 98  LYS A HA   6  
ATOM 11333 H HB2  . LYS A 1 98  ? -9.168  3.093   -6.879  1.00 0.80  ? 98  LYS A HB2  6  
ATOM 11334 H HB3  . LYS A 1 98  ? -9.324  4.828   -7.097  1.00 0.82  ? 98  LYS A HB3  6  
ATOM 11335 H HG2  . LYS A 1 98  ? -7.254  5.202   -5.910  1.00 1.09  ? 98  LYS A HG2  6  
ATOM 11336 H HG3  . LYS A 1 98  ? -7.123  3.481   -5.544  1.00 1.12  ? 98  LYS A HG3  6  
ATOM 11337 H HD2  . LYS A 1 98  ? -5.711  3.733   -7.367  1.00 1.77  ? 98  LYS A HD2  6  
ATOM 11338 H HD3  . LYS A 1 98  ? -7.211  3.175   -8.109  1.00 1.65  ? 98  LYS A HD3  6  
ATOM 11339 H HE2  . LYS A 1 98  ? -6.395  4.973   -9.432  1.00 1.69  ? 98  LYS A HE2  6  
ATOM 11340 H HE3  . LYS A 1 98  ? -7.785  5.576   -8.530  1.00 1.94  ? 98  LYS A HE3  6  
ATOM 11341 H HZ1  . LYS A 1 98  ? -4.976  5.954   -7.654  1.00 2.12  ? 98  LYS A HZ1  6  
ATOM 11342 H HZ2  . LYS A 1 98  ? -6.358  6.702   -7.017  1.00 2.50  ? 98  LYS A HZ2  6  
ATOM 11343 H HZ3  . LYS A 1 98  ? -5.826  7.091   -8.577  1.00 2.45  ? 98  LYS A HZ3  6  
ATOM 11344 N N    . LYS A 1 99  ? -11.826 3.134   -5.846  1.00 0.55  ? 99  LYS A N    6  
ATOM 11345 C CA   . LYS A 1 99  ? -13.244 3.105   -6.191  1.00 0.63  ? 99  LYS A CA   6  
ATOM 11346 C C    . LYS A 1 99  ? -14.122 3.219   -4.943  1.00 0.63  ? 99  LYS A C    6  
ATOM 11347 O O    . LYS A 1 99  ? -15.323 3.465   -5.042  1.00 0.75  ? 99  LYS A O    6  
ATOM 11348 C CB   . LYS A 1 99  ? -13.600 1.836   -6.971  1.00 0.66  ? 99  LYS A CB   6  
ATOM 11349 C CG   . LYS A 1 99  ? -13.374 0.550   -6.195  1.00 0.60  ? 99  LYS A CG   6  
ATOM 11350 C CD   . LYS A 1 99  ? -13.933 -0.656  -6.935  1.00 0.76  ? 99  LYS A CD   6  
ATOM 11351 C CE   . LYS A 1 99  ? -13.692 -1.946  -6.165  1.00 1.62  ? 99  LYS A CE   6  
ATOM 11352 N NZ   . LYS A 1 99  ? -14.325 -3.121  -6.821  1.00 2.04  ? 99  LYS A NZ   6  
ATOM 11353 H H    . LYS A 1 99  ? -11.290 2.314   -5.936  1.00 0.53  ? 99  LYS A H    6  
ATOM 11354 H HA   . LYS A 1 99  ? -13.436 3.960   -6.820  1.00 0.70  ? 99  LYS A HA   6  
ATOM 11355 H HB2  . LYS A 1 99  ? -14.643 1.882   -7.249  1.00 0.73  ? 99  LYS A HB2  6  
ATOM 11356 H HB3  . LYS A 1 99  ? -13.000 1.800   -7.869  1.00 0.70  ? 99  LYS A HB3  6  
ATOM 11357 H HG2  . LYS A 1 99  ? -12.312 0.412   -6.057  1.00 0.67  ? 99  LYS A HG2  6  
ATOM 11358 H HG3  . LYS A 1 99  ? -13.856 0.629   -5.232  1.00 0.65  ? 99  LYS A HG3  6  
ATOM 11359 H HD2  . LYS A 1 99  ? -14.996 -0.523  -7.072  1.00 1.19  ? 99  LYS A HD2  6  
ATOM 11360 H HD3  . LYS A 1 99  ? -13.451 -0.727  -7.899  1.00 1.16  ? 99  LYS A HD3  6  
ATOM 11361 H HE2  . LYS A 1 99  ? -12.628 -2.116  -6.098  1.00 2.17  ? 99  LYS A HE2  6  
ATOM 11362 H HE3  . LYS A 1 99  ? -14.101 -1.838  -5.170  1.00 2.18  ? 99  LYS A HE3  6  
ATOM 11363 H HZ1  . LYS A 1 99  ? -14.041 -3.172  -7.823  1.00 2.53  ? 99  LYS A HZ1  6  
ATOM 11364 H HZ2  . LYS A 1 99  ? -15.360 -3.051  -6.765  1.00 2.23  ? 99  LYS A HZ2  6  
ATOM 11365 H HZ3  . LYS A 1 99  ? -14.022 -4.002  -6.347  1.00 2.44  ? 99  LYS A HZ3  6  
ATOM 11366 N N    . CYS A 1 100 ? -13.522 3.024   -3.774  1.00 0.55  ? 100 CYS A N    6  
ATOM 11367 C CA   . CYS A 1 100 ? -14.243 3.136   -2.512  1.00 0.60  ? 100 CYS A CA   6  
ATOM 11368 C C    . CYS A 1 100 ? -14.122 4.545   -1.927  1.00 0.61  ? 100 CYS A C    6  
ATOM 11369 O O    . CYS A 1 100 ? -14.824 4.895   -0.974  1.00 0.68  ? 100 CYS A O    6  
ATOM 11370 C CB   . CYS A 1 100 ? -13.718 2.099   -1.517  1.00 0.60  ? 100 CYS A CB   6  
ATOM 11371 S SG   . CYS A 1 100 ? -14.138 0.393   -1.946  1.00 1.39  ? 100 CYS A SG   6  
ATOM 11372 H H    . CYS A 1 100 ? -12.570 2.790   -3.760  1.00 0.51  ? 100 CYS A H    6  
ATOM 11373 H HA   . CYS A 1 100 ? -15.283 2.933   -2.710  1.00 0.68  ? 100 CYS A HA   6  
ATOM 11374 H HB2  . CYS A 1 100 ? -12.643 2.168   -1.472  1.00 1.12  ? 100 CYS A HB2  6  
ATOM 11375 H HB3  . CYS A 1 100 ? -14.120 2.303   -0.542  1.00 0.81  ? 100 CYS A HB3  6  
ATOM 11376 H HG   . CYS A 1 100 ? -13.154 -0.079  -2.703  1.00 2.19  ? 100 CYS A HG   6  
ATOM 11377 N N    . ARG A 1 101 ? -13.227 5.348   -2.519  1.00 0.59  ? 101 ARG A N    6  
ATOM 11378 C CA   . ARG A 1 101 ? -12.988 6.734   -2.096  1.00 0.65  ? 101 ARG A CA   6  
ATOM 11379 C C    . ARG A 1 101 ? -12.504 6.802   -0.651  1.00 0.64  ? 101 ARG A C    6  
ATOM 11380 O O    . ARG A 1 101 ? -12.709 7.802   0.038   1.00 0.75  ? 101 ARG A O    6  
ATOM 11381 C CB   . ARG A 1 101 ? -14.246 7.603   -2.263  1.00 0.77  ? 101 ARG A CB   6  
ATOM 11382 C CG   . ARG A 1 101 ? -14.590 7.937   -3.707  1.00 0.79  ? 101 ARG A CG   6  
ATOM 11383 C CD   . ARG A 1 101 ? -15.302 6.791   -4.409  1.00 1.19  ? 101 ARG A CD   6  
ATOM 11384 N NE   . ARG A 1 101 ? -16.643 6.568   -3.871  1.00 2.14  ? 101 ARG A NE   6  
ATOM 11385 C CZ   . ARG A 1 101 ? -17.635 6.007   -4.560  1.00 3.08  ? 101 ARG A CZ   6  
ATOM 11386 N NH1  . ARG A 1 101 ? -17.429 5.582   -5.800  1.00 3.37  ? 101 ARG A NH1  6  
ATOM 11387 N NH2  . ARG A 1 101 ? -18.830 5.871   -4.003  1.00 4.09  ? 101 ARG A NH2  6  
ATOM 11388 H H    . ARG A 1 101 ? -12.703 4.990   -3.267  1.00 0.57  ? 101 ARG A H    6  
ATOM 11389 H HA   . ARG A 1 101 ? -12.208 7.132   -2.732  1.00 0.66  ? 101 ARG A HA   6  
ATOM 11390 H HB2  . ARG A 1 101 ? -15.087 7.080   -1.832  1.00 0.79  ? 101 ARG A HB2  6  
ATOM 11391 H HB3  . ARG A 1 101 ? -14.100 8.531   -1.729  1.00 0.92  ? 101 ARG A HB3  6  
ATOM 11392 H HG2  . ARG A 1 101 ? -15.232 8.804   -3.721  1.00 1.42  ? 101 ARG A HG2  6  
ATOM 11393 H HG3  . ARG A 1 101 ? -13.676 8.159   -4.239  1.00 1.29  ? 101 ARG A HG3  6  
ATOM 11394 H HD2  . ARG A 1 101 ? -15.383 7.025   -5.460  1.00 1.59  ? 101 ARG A HD2  6  
ATOM 11395 H HD3  . ARG A 1 101 ? -14.720 5.890   -4.284  1.00 1.65  ? 101 ARG A HD3  6  
ATOM 11396 H HE   . ARG A 1 101 ? -16.819 6.868   -2.948  1.00 2.45  ? 101 ARG A HE   6  
ATOM 11397 H HH11 . ARG A 1 101 ? -16.527 5.678   -6.222  1.00 3.01  ? 101 ARG A HH11 6  
ATOM 11398 H HH12 . ARG A 1 101 ? -18.184 5.169   -6.328  1.00 4.21  ? 101 ARG A HH12 6  
ATOM 11399 H HH21 . ARG A 1 101 ? -18.986 6.191   -3.063  1.00 4.30  ? 101 ARG A HH21 6  
ATOM 11400 H HH22 . ARG A 1 101 ? -19.590 5.460   -4.522  1.00 4.83  ? 101 ARG A HH22 6  
ATOM 11401 N N    . VAL A 1 102 ? -11.839 5.750   -0.204  1.00 0.55  ? 102 VAL A N    6  
ATOM 11402 C CA   . VAL A 1 102 ? -11.396 5.667   1.176   1.00 0.57  ? 102 VAL A CA   6  
ATOM 11403 C C    . VAL A 1 102 ? -9.886  5.444   1.250   1.00 0.49  ? 102 VAL A C    6  
ATOM 11404 O O    . VAL A 1 102 ? -9.307  4.739   0.421   1.00 0.46  ? 102 VAL A O    6  
ATOM 11405 C CB   . VAL A 1 102 ? -12.153 4.549   1.929   1.00 0.69  ? 102 VAL A CB   6  
ATOM 11406 C CG1  . VAL A 1 102 ? -11.898 3.195   1.291   1.00 0.89  ? 102 VAL A CG1  6  
ATOM 11407 C CG2  . VAL A 1 102 ? -11.780 4.531   3.404   1.00 1.42  ? 102 VAL A CG2  6  
ATOM 11408 H H    . VAL A 1 102 ? -11.634 5.013   -0.819  1.00 0.51  ? 102 VAL A H    6  
ATOM 11409 H HA   . VAL A 1 102 ? -11.629 6.610   1.652   1.00 0.66  ? 102 VAL A HA   6  
ATOM 11410 H HB   . VAL A 1 102 ? -13.210 4.754   1.855   1.00 1.38  ? 102 VAL A HB   6  
ATOM 11411 H HG11 . VAL A 1 102 ? -12.548 2.462   1.736   1.00 1.44  ? 102 VAL A HG11 6  
ATOM 11412 H HG12 . VAL A 1 102 ? -10.871 2.911   1.454   1.00 1.45  ? 102 VAL A HG12 6  
ATOM 11413 H HG13 . VAL A 1 102 ? -12.092 3.254   0.230   1.00 1.57  ? 102 VAL A HG13 6  
ATOM 11414 H HG21 . VAL A 1 102 ? -12.067 5.469   3.859   1.00 2.00  ? 102 VAL A HG21 6  
ATOM 11415 H HG22 . VAL A 1 102 ? -10.713 4.395   3.504   1.00 2.