data_2KLQ
# 
_entry.id   2KLQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KLQ         
RCSB  RCSB101277   
WWPDB D_1000101277 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KLQ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-08 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Liu, C.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Characterization and structure determination of the Cdt1 binding domain of human minichromosome maintenance (Mcm) 6' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            285 
_citation.page_first                12469 
_citation.page_last                 12473 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20202939 
_citation.pdbx_database_id_DOI      10.1074/jbc.C109.094599 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wei, Z.'   1 
primary 'Liu, C.'   2 
primary 'Wu, X.'    3 
primary 'Xu, N.'    4 
primary 'Zhou, B.'  5 
primary 'Liang, C.' 6 
primary 'Zhu, G.'   7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'DNA replication licensing factor MCM6' 
_entity.formula_weight             13303.877 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              C721S 
_entity.pdbx_fragment              'RESIDUES 708-821' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CBD, p105MCM' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APKASLRLGFSEYSRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVL
IELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APKASLRLGFSEYSRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVL
IELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   LYS n 
1 4   ALA n 
1 5   SER n 
1 6   LEU n 
1 7   ARG n 
1 8   LEU n 
1 9   GLY n 
1 10  PHE n 
1 11  SER n 
1 12  GLU n 
1 13  TYR n 
1 14  SER n 
1 15  ARG n 
1 16  ILE n 
1 17  SER n 
1 18  ASN n 
1 19  LEU n 
1 20  ILE n 
1 21  VAL n 
1 22  LEU n 
1 23  HIS n 
1 24  LEU n 
1 25  ARG n 
1 26  LYS n 
1 27  VAL n 
1 28  GLU n 
1 29  GLU n 
1 30  GLU n 
1 31  GLU n 
1 32  ASP n 
1 33  GLU n 
1 34  SER n 
1 35  ALA n 
1 36  LEU n 
1 37  LYS n 
1 38  ARG n 
1 39  SER n 
1 40  GLU n 
1 41  LEU n 
1 42  VAL n 
1 43  ASN n 
1 44  TRP n 
1 45  TYR n 
1 46  LEU n 
1 47  LYS n 
1 48  GLU n 
1 49  ILE n 
1 50  GLU n 
1 51  SER n 
1 52  GLU n 
1 53  ILE n 
1 54  ASP n 
1 55  SER n 
1 56  GLU n 
1 57  GLU n 
1 58  GLU n 
1 59  LEU n 
1 60  ILE n 
1 61  ASN n 
1 62  LYS n 
1 63  LYS n 
1 64  ARG n 
1 65  ILE n 
1 66  ILE n 
1 67  GLU n 
1 68  LYS n 
1 69  VAL n 
1 70  ILE n 
1 71  HIS n 
1 72  ARG n 
1 73  LEU n 
1 74  THR n 
1 75  HIS n 
1 76  TYR n 
1 77  ASP n 
1 78  HIS n 
1 79  VAL n 
1 80  LEU n 
1 81  ILE n 
1 82  GLU n 
1 83  LEU n 
1 84  THR n 
1 85  GLN n 
1 86  ALA n 
1 87  GLY n 
1 88  LEU n 
1 89  LYS n 
1 90  GLY n 
1 91  SER n 
1 92  THR n 
1 93  GLU n 
1 94  GLY n 
1 95  SER n 
1 96  GLU n 
1 97  SER n 
1 98  TYR n 
1 99  GLU n 
1 100 GLU n 
1 101 ASP n 
1 102 PRO n 
1 103 TYR n 
1 104 LEU n 
1 105 VAL n 
1 106 VAL n 
1 107 ASN n 
1 108 PRO n 
1 109 ASN n 
1 110 TYR n 
1 111 LEU n 
1 112 LEU n 
1 113 GLU n 
1 114 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET-28a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MCM6_HUMAN 
_struct_ref.pdbx_db_accession          Q14566 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;APKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVL
IELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED
;
_struct_ref.pdbx_align_begin           708 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KLQ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 114 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14566 
_struct_ref_seq.db_align_beg                  708 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  821 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       708 
_struct_ref_seq.pdbx_auth_seq_align_end       821 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2KLQ 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      14 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q14566 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          721 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            721 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-13C HSQC'  
1 3  2 '3D CBCA(CO)NH'   
1 4  2 '3D HNCACB'       
1 5  2 '3D HNCO'         
1 6  2 '3D H(CCO)NH'     
1 7  2 '3D C(CO)NH'      
1 8  2 '3D HCCH-TOCSY'   
1 9  2 '3D HCCH-COSY'    
1 10 2 '3D HBHA(CO)NH'   
1 11 1 '3D 1H-15N NOESY' 
1 12 2 '3D 1H-13C NOESY' 
1 13 3 '2D 1H-1H NOESY'  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.5 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.5 mM [U-100% 13C; U-100% 15N] CBD,MES,EDTA,Glycerol,NaCl-1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' 
'0.5 mM [U-100% 13C; U-100% 15N] CBD,MES,EDTA,Glycerol,NaCl-2, 100% D2O'        2 '100% D2O'        
'0.5 mM CBD,MES,EDTA,Glycerol,NaCl-3, 100% D2O'                                 3 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
750 Varian INOVA 1 'Varian INOVA' 
500 Varian INOVA 2 'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2KLQ 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            'recalculated in CNS,water refinement' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  QUALITY 
_pdbx_nmr_ensemble.conformers_calculated_total_number            300 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KLQ 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KLQ 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 
'Guntert, Mumenthaler and Wuthrich' refinement           CYANA 2.1 2 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KLQ 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KLQ 
_struct.title                     'The solution structure of CBD of human MCM6' 
_struct.pdbx_descriptor           'DNA replication licensing factor MCM6' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KLQ 
_struct_keywords.pdbx_keywords   REPLICATION 
_struct_keywords.text            
;DNA replication, Pre-RC, Mcm6, Cdt1, CBD structure, ATP-binding, Cell cycle, DNA-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Transcription, Transcription regulation, REPLICATION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 10 ? GLU A 31 ? PHE A 717 GLU A 738 1 ? 22 
HELX_P HELX_P2 2 LYS A 37 ? GLU A 50 ? LYS A 744 GLU A 757 1 ? 14 
HELX_P HELX_P3 3 SER A 55 ? TYR A 76 ? SER A 762 TYR A 783 1 ? 22 
HELX_P HELX_P4 4 GLN A 85 ? GLY A 90 ? GLN A 792 GLY A 797 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 80  ? ILE A 81  ? LEU A 787 ILE A 788 
A 2 VAL A 105 ? VAL A 106 ? VAL A 812 VAL A 813 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    81 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     788 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    105 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     812 
# 
_atom_sites.entry_id                    2KLQ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1   ? -17.490 15.888  2.348   1.00 0.00 ? 708 ALA A N    1  
ATOM 2     C CA   . ALA A 1 1   ? -18.405 14.873  1.909   1.00 0.00 ? 708 ALA A CA   1  
ATOM 3     C C    . ALA A 1 1   ? -18.494 13.779  2.961   1.00 0.00 ? 708 ALA A C    1  
ATOM 4     O O    . ALA A 1 1   ? -17.469 13.398  3.549   1.00 0.00 ? 708 ALA A O    1  
ATOM 5     C CB   . ALA A 1 1   ? -17.951 14.298  0.571   1.00 0.00 ? 708 ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1   ? -16.530 15.748  2.202   1.00 0.00 ? 708 ALA A H1   1  
ATOM 7     H HA   . ALA A 1 1   ? -19.375 15.331  1.779   1.00 0.00 ? 708 ALA A HA   1  
ATOM 8     H HB1  . ALA A 1 1   ? -18.656 13.548  0.244   1.00 0.00 ? 708 ALA A HB1  1  
ATOM 9     H HB2  . ALA A 1 1   ? -16.975 13.849  0.687   1.00 0.00 ? 708 ALA A HB2  1  
ATOM 10    H HB3  . ALA A 1 1   ? -17.899 15.090  -0.161  1.00 0.00 ? 708 ALA A HB3  1  
ATOM 11    N N    . PRO A 1 2   ? -19.708 13.270  3.245   1.00 0.00 ? 709 PRO A N    1  
ATOM 12    C CA   . PRO A 1 2   ? -19.890 12.184  4.210   1.00 0.00 ? 709 PRO A CA   1  
ATOM 13    C C    . PRO A 1 2   ? -19.269 10.891  3.682   1.00 0.00 ? 709 PRO A C    1  
ATOM 14    O O    . PRO A 1 2   ? -18.725 10.079  4.438   1.00 0.00 ? 709 PRO A O    1  
ATOM 15    C CB   . PRO A 1 2   ? -21.418 12.044  4.310   1.00 0.00 ? 709 PRO A CB   1  
ATOM 16    C CG   . PRO A 1 2   ? -21.944 12.627  3.039   1.00 0.00 ? 709 PRO A CG   1  
ATOM 17    C CD   . PRO A 1 2   ? -20.994 13.726  2.667   1.00 0.00 ? 709 PRO A CD   1  
ATOM 18    H HA   . PRO A 1 2   ? -19.466 12.426  5.174   1.00 0.00 ? 709 PRO A HA   1  
ATOM 19    H HB2  . PRO A 1 2   ? -21.680 11.001  4.409   1.00 0.00 ? 709 PRO A HB2  1  
ATOM 20    H HB3  . PRO A 1 2   ? -21.774 12.591  5.172   1.00 0.00 ? 709 PRO A HB3  1  
ATOM 21    H HG2  . PRO A 1 2   ? -21.958 11.870  2.270   1.00 0.00 ? 709 PRO A HG2  1  
ATOM 22    H HG3  . PRO A 1 2   ? -22.939 13.021  3.194   1.00 0.00 ? 709 PRO A HG3  1  
ATOM 23    H HD2  . PRO A 1 2   ? -20.930 13.822  1.594   1.00 0.00 ? 709 PRO A HD2  1  
ATOM 24    H HD3  . PRO A 1 2   ? -21.305 14.656  3.118   1.00 0.00 ? 709 PRO A HD3  1  
ATOM 25    N N    . LYS A 1 3   ? -19.353 10.743  2.371   1.00 0.00 ? 710 LYS A N    1  
ATOM 26    C CA   . LYS A 1 3   ? -18.845 9.633   1.612   1.00 0.00 ? 710 LYS A CA   1  
ATOM 27    C C    . LYS A 1 3   ? -19.123 9.938   0.157   1.00 0.00 ? 710 LYS A C    1  
ATOM 28    O O    . LYS A 1 3   ? -19.998 10.766  -0.135  1.00 0.00 ? 710 LYS A O    1  
ATOM 29    C CB   . LYS A 1 3   ? -19.534 8.308   2.023   1.00 0.00 ? 710 LYS A CB   1  
ATOM 30    C CG   . LYS A 1 3   ? -21.064 8.340   1.929   1.00 0.00 ? 710 LYS A CG   1  
ATOM 31    C CD   . LYS A 1 3   ? -21.700 7.005   2.307   1.00 0.00 ? 710 LYS A CD   1  
ATOM 32    C CE   . LYS A 1 3   ? -21.394 6.600   3.737   1.00 0.00 ? 710 LYS A CE   1  
ATOM 33    N NZ   . LYS A 1 3   ? -22.043 5.325   4.102   1.00 0.00 ? 710 LYS A NZ   1  
ATOM 34    H H    . LYS A 1 3   ? -19.799 11.442  1.844   1.00 0.00 ? 710 LYS A H    1  
ATOM 35    H HA   . LYS A 1 3   ? -17.778 9.563   1.771   1.00 0.00 ? 710 LYS A HA   1  
ATOM 36    H HB2  . LYS A 1 3   ? -19.174 7.516   1.385   1.00 0.00 ? 710 LYS A HB2  1  
ATOM 37    H HB3  . LYS A 1 3   ? -19.261 8.087   3.044   1.00 0.00 ? 710 LYS A HB3  1  
ATOM 38    H HG2  . LYS A 1 3   ? -21.438 9.103   2.595   1.00 0.00 ? 710 LYS A HG2  1  
ATOM 39    H HG3  . LYS A 1 3   ? -21.339 8.592   0.916   1.00 0.00 ? 710 LYS A HG3  1  
ATOM 40    H HD2  . LYS A 1 3   ? -22.770 7.088   2.191   1.00 0.00 ? 710 LYS A HD2  1  
ATOM 41    H HD3  . LYS A 1 3   ? -21.329 6.243   1.636   1.00 0.00 ? 710 LYS A HD3  1  
ATOM 42    H HE2  . LYS A 1 3   ? -20.327 6.483   3.847   1.00 0.00 ? 710 LYS A HE2  1  
ATOM 43    H HE3  . LYS A 1 3   ? -21.742 7.378   4.401   1.00 0.00 ? 710 LYS A HE3  1  
ATOM 44    H HZ1  . LYS A 1 3   ? -21.764 4.544   3.474   1.00 0.00 ? 710 LYS A HZ1  1  
ATOM 45    H HZ2  . LYS A 1 3   ? -23.078 5.417   4.065   1.00 0.00 ? 710 LYS A HZ2  1  
ATOM 46    H HZ3  . LYS A 1 3   ? -21.806 5.057   5.079   1.00 0.00 ? 710 LYS A HZ3  1  
ATOM 47    N N    . ALA A 1 4   ? -18.373 9.351   -0.729  1.00 0.00 ? 711 ALA A N    1  
ATOM 48    C CA   . ALA A 1 4   ? -18.612 9.508   -2.149  1.00 0.00 ? 711 ALA A CA   1  
ATOM 49    C C    . ALA A 1 4   ? -19.426 8.334   -2.648  1.00 0.00 ? 711 ALA A C    1  
ATOM 50    O O    . ALA A 1 4   ? -20.273 8.484   -3.539  1.00 0.00 ? 711 ALA A O    1  
ATOM 51    C CB   . ALA A 1 4   ? -17.297 9.600   -2.905  1.00 0.00 ? 711 ALA A CB   1  
ATOM 52    H H    . ALA A 1 4   ? -17.612 8.807   -0.436  1.00 0.00 ? 711 ALA A H    1  
ATOM 53    H HA   . ALA A 1 4   ? -19.170 10.420  -2.300  1.00 0.00 ? 711 ALA A HA   1  
ATOM 54    H HB1  . ALA A 1 4   ? -16.714 10.422  -2.519  1.00 0.00 ? 711 ALA A HB1  1  
ATOM 55    H HB2  . ALA A 1 4   ? -17.499 9.762   -3.954  1.00 0.00 ? 711 ALA A HB2  1  
ATOM 56    H HB3  . ALA A 1 4   ? -16.748 8.678   -2.786  1.00 0.00 ? 711 ALA A HB3  1  
ATOM 57    N N    . SER A 1 5   ? -19.177 7.176   -2.025  1.00 0.00 ? 712 SER A N    1  
ATOM 58    C CA   . SER A 1 5   ? -19.829 5.916   -2.345  1.00 0.00 ? 712 SER A CA   1  
ATOM 59    C C    . SER A 1 5   ? -19.489 5.466   -3.757  1.00 0.00 ? 712 SER A C    1  
ATOM 60    O O    . SER A 1 5   ? -20.199 5.779   -4.727  1.00 0.00 ? 712 SER A O    1  
ATOM 61    C CB   . SER A 1 5   ? -21.342 5.979   -2.122  1.00 0.00 ? 712 SER A CB   1  
ATOM 62    O OG   . SER A 1 5   ? -21.641 6.299   -0.765  1.00 0.00 ? 712 SER A OG   1  
ATOM 63    H H    . SER A 1 5   ? -18.500 7.174   -1.318  1.00 0.00 ? 712 SER A H    1  
ATOM 64    H HA   . SER A 1 5   ? -19.407 5.193   -1.663  1.00 0.00 ? 712 SER A HA   1  
ATOM 65    H HB2  . SER A 1 5   ? -21.759 6.740   -2.763  1.00 0.00 ? 712 SER A HB2  1  
ATOM 66    H HB3  . SER A 1 5   ? -21.783 5.023   -2.365  1.00 0.00 ? 712 SER A HB3  1  
ATOM 67    H HG   . SER A 1 5   ? -22.220 7.069   -0.773  1.00 0.00 ? 712 SER A HG   1  
ATOM 68    N N    . LEU A 1 6   ? -18.366 4.788   -3.877  1.00 0.00 ? 713 LEU A N    1  
ATOM 69    C CA   . LEU A 1 6   ? -17.876 4.345   -5.145  1.00 0.00 ? 713 LEU A CA   1  
ATOM 70    C C    . LEU A 1 6   ? -18.721 3.214   -5.697  1.00 0.00 ? 713 LEU A C    1  
ATOM 71    O O    . LEU A 1 6   ? -18.629 2.060   -5.240  1.00 0.00 ? 713 LEU A O    1  
ATOM 72    C CB   . LEU A 1 6   ? -16.388 3.956   -5.096  1.00 0.00 ? 713 LEU A CB   1  
ATOM 73    C CG   . LEU A 1 6   ? -15.439 4.977   -4.460  1.00 0.00 ? 713 LEU A CG   1  
ATOM 74    C CD1  . LEU A 1 6   ? -14.001 4.492   -4.522  1.00 0.00 ? 713 LEU A CD1  1  
ATOM 75    C CD2  . LEU A 1 6   ? -15.580 6.325   -5.119  1.00 0.00 ? 713 LEU A CD2  1  
ATOM 76    H H    . LEU A 1 6   ? -17.844 4.587   -3.077  1.00 0.00 ? 713 LEU A H    1  
ATOM 77    H HA   . LEU A 1 6   ? -17.982 5.211   -5.767  1.00 0.00 ? 713 LEU A HA   1  
ATOM 78    H HB2  . LEU A 1 6   ? -16.284 3.022   -4.567  1.00 0.00 ? 713 LEU A HB2  1  
ATOM 79    H HB3  . LEU A 1 6   ? -16.057 3.792   -6.110  1.00 0.00 ? 713 LEU A HB3  1  
ATOM 80    H HG   . LEU A 1 6   ? -15.698 5.081   -3.416  1.00 0.00 ? 713 LEU A HG   1  
ATOM 81    H HD11 . LEU A 1 6   ? -13.713 4.341   -5.552  1.00 0.00 ? 713 LEU A HD11 1  
ATOM 82    H HD12 . LEU A 1 6   ? -13.917 3.561   -3.980  1.00 0.00 ? 713 LEU A HD12 1  
ATOM 83    H HD13 . LEU A 1 6   ? -13.357 5.229   -4.070  1.00 0.00 ? 713 LEU A HD13 1  
ATOM 84    H HD21 . LEU A 1 6   ? -15.409 6.212   -6.179  1.00 0.00 ? 713 LEU A HD21 1  
ATOM 85    H HD22 . LEU A 1 6   ? -14.854 7.004   -4.697  1.00 0.00 ? 713 LEU A HD22 1  
ATOM 86    H HD23 . LEU A 1 6   ? -16.577 6.701   -4.946  1.00 0.00 ? 713 LEU A HD23 1  
ATOM 87    N N    . ARG A 1 7   ? -19.565 3.569   -6.646  1.00 0.00 ? 714 ARG A N    1  
ATOM 88    C CA   . ARG A 1 7   ? -20.456 2.644   -7.325  1.00 0.00 ? 714 ARG A CA   1  
ATOM 89    C C    . ARG A 1 7   ? -19.701 1.560   -8.089  1.00 0.00 ? 714 ARG A C    1  
ATOM 90    O O    . ARG A 1 7   ? -19.272 1.736   -9.254  1.00 0.00 ? 714 ARG A O    1  
ATOM 91    C CB   . ARG A 1 7   ? -21.492 3.395   -8.177  1.00 0.00 ? 714 ARG A CB   1  
ATOM 92    C CG   . ARG A 1 7   ? -20.928 4.580   -8.942  1.00 0.00 ? 714 ARG A CG   1  
ATOM 93    C CD   . ARG A 1 7   ? -22.029 5.379   -9.598  1.00 0.00 ? 714 ARG A CD   1  
ATOM 94    N NE   . ARG A 1 7   ? -21.558 6.696   -10.025 1.00 0.00 ? 714 ARG A NE   1  
ATOM 95    C CZ   . ARG A 1 7   ? -22.264 7.829   -9.905  1.00 0.00 ? 714 ARG A CZ   1  
ATOM 96    N NH1  . ARG A 1 7   ? -23.521 7.789   -9.467  1.00 0.00 ? 714 ARG A NH1  1  
ATOM 97    N NH2  . ARG A 1 7   ? -21.718 8.997   -10.225 1.00 0.00 ? 714 ARG A NH2  1  
ATOM 98    H H    . ARG A 1 7   ? -19.573 4.518   -6.885  1.00 0.00 ? 714 ARG A H    1  
ATOM 99    H HA   . ARG A 1 7   ? -20.982 2.137   -6.528  1.00 0.00 ? 714 ARG A HA   1  
ATOM 100   H HB2  . ARG A 1 7   ? -21.921 2.706   -8.890  1.00 0.00 ? 714 ARG A HB2  1  
ATOM 101   H HB3  . ARG A 1 7   ? -22.275 3.756   -7.526  1.00 0.00 ? 714 ARG A HB3  1  
ATOM 102   H HG2  . ARG A 1 7   ? -20.396 5.227   -8.262  1.00 0.00 ? 714 ARG A HG2  1  
ATOM 103   H HG3  . ARG A 1 7   ? -20.251 4.222   -9.704  1.00 0.00 ? 714 ARG A HG3  1  
ATOM 104   H HD2  . ARG A 1 7   ? -22.385 4.835   -10.460 1.00 0.00 ? 714 ARG A HD2  1  
ATOM 105   H HD3  . ARG A 1 7   ? -22.835 5.504   -8.891  1.00 0.00 ? 714 ARG A HD3  1  
ATOM 106   H HE   . ARG A 1 7   ? -20.638 6.706   -10.384 1.00 0.00 ? 714 ARG A HE   1  
ATOM 107   H HH11 . ARG A 1 7   ? -23.974 6.930   -9.215  1.00 0.00 ? 714 ARG A HH11 1  
ATOM 108   H HH12 . ARG A 1 7   ? -24.085 8.615   -9.373  1.00 0.00 ? 714 ARG A HH12 1  
ATOM 109   H HH21 . ARG A 1 7   ? -20.775 9.073   -10.562 1.00 0.00 ? 714 ARG A HH21 1  
ATOM 110   H HH22 . ARG A 1 7   ? -22.221 9.858   -10.125 1.00 0.00 ? 714 ARG A HH22 1  
ATOM 111   N N    . LEU A 1 8   ? -19.530 0.463   -7.377  1.00 0.00 ? 715 LEU A N    1  
ATOM 112   C CA   . LEU A 1 8   ? -18.794 -0.722  -7.765  1.00 0.00 ? 715 LEU A CA   1  
ATOM 113   C C    . LEU A 1 8   ? -18.700 -1.609  -6.540  1.00 0.00 ? 715 LEU A C    1  
ATOM 114   O O    . LEU A 1 8   ? -18.956 -2.817  -6.591  1.00 0.00 ? 715 LEU A O    1  
ATOM 115   C CB   . LEU A 1 8   ? -17.354 -0.373  -8.218  1.00 0.00 ? 715 LEU A CB   1  
ATOM 116   C CG   . LEU A 1 8   ? -16.412 -1.564  -8.491  1.00 0.00 ? 715 LEU A CG   1  
ATOM 117   C CD1  . LEU A 1 8   ? -16.932 -2.441  -9.617  1.00 0.00 ? 715 LEU A CD1  1  
ATOM 118   C CD2  . LEU A 1 8   ? -15.003 -1.080  -8.790  1.00 0.00 ? 715 LEU A CD2  1  
ATOM 119   H H    . LEU A 1 8   ? -19.959 0.449   -6.493  1.00 0.00 ? 715 LEU A H    1  
ATOM 120   H HA   . LEU A 1 8   ? -19.321 -1.228  -8.560  1.00 0.00 ? 715 LEU A HA   1  
ATOM 121   H HB2  . LEU A 1 8   ? -17.419 0.221   -9.117  1.00 0.00 ? 715 LEU A HB2  1  
ATOM 122   H HB3  . LEU A 1 8   ? -16.905 0.236   -7.447  1.00 0.00 ? 715 LEU A HB3  1  
ATOM 123   H HG   . LEU A 1 8   ? -16.373 -2.178  -7.602  1.00 0.00 ? 715 LEU A HG   1  
ATOM 124   H HD11 . LEU A 1 8   ? -16.253 -3.267  -9.772  1.00 0.00 ? 715 LEU A HD11 1  
ATOM 125   H HD12 . LEU A 1 8   ? -17.002 -1.860  -10.523 1.00 0.00 ? 715 LEU A HD12 1  
ATOM 126   H HD13 . LEU A 1 8   ? -17.908 -2.821  -9.354  1.00 0.00 ? 715 LEU A HD13 1  
ATOM 127   H HD21 . LEU A 1 8   ? -14.363 -1.932  -8.970  1.00 0.00 ? 715 LEU A HD21 1  
ATOM 128   H HD22 . LEU A 1 8   ? -14.625 -0.517  -7.950  1.00 0.00 ? 715 LEU A HD22 1  
ATOM 129   H HD23 . LEU A 1 8   ? -15.016 -0.451  -9.668  1.00 0.00 ? 715 LEU A HD23 1  
ATOM 130   N N    . GLY A 1 9   ? -18.392 -0.983  -5.430  1.00 0.00 ? 716 GLY A N    1  
ATOM 131   C CA   . GLY A 1 9   ? -18.138 -1.698  -4.213  1.00 0.00 ? 716 GLY A CA   1  
ATOM 132   C C    . GLY A 1 9   ? -16.669 -1.628  -3.919  1.00 0.00 ? 716 GLY A C    1  
ATOM 133   O O    . GLY A 1 9   ? -15.853 -2.183  -4.669  1.00 0.00 ? 716 GLY A O    1  
ATOM 134   H H    . GLY A 1 9   ? -18.319 -0.002  -5.431  1.00 0.00 ? 716 GLY A H    1  
ATOM 135   H HA2  . GLY A 1 9   ? -18.697 -1.246  -3.406  1.00 0.00 ? 716 GLY A HA2  1  
ATOM 136   H HA3  . GLY A 1 9   ? -18.425 -2.732  -4.328  1.00 0.00 ? 716 GLY A HA3  1  
ATOM 137   N N    . PHE A 1 10  ? -16.308 -0.934  -2.870  1.00 0.00 ? 717 PHE A N    1  
ATOM 138   C CA   . PHE A 1 10  ? -14.913 -0.705  -2.600  1.00 0.00 ? 717 PHE A CA   1  
ATOM 139   C C    . PHE A 1 10  ? -14.514 -1.100  -1.195  1.00 0.00 ? 717 PHE A C    1  
ATOM 140   O O    . PHE A 1 10  ? -13.469 -0.665  -0.708  1.00 0.00 ? 717 PHE A O    1  
ATOM 141   C CB   . PHE A 1 10  ? -14.528 0.762   -2.883  1.00 0.00 ? 717 PHE A CB   1  
ATOM 142   C CG   . PHE A 1 10  ? -15.198 1.796   -2.005  1.00 0.00 ? 717 PHE A CG   1  
ATOM 143   C CD1  . PHE A 1 10  ? -16.451 2.274   -2.315  1.00 0.00 ? 717 PHE A CD1  1  
ATOM 144   C CD2  . PHE A 1 10  ? -14.556 2.305   -0.884  1.00 0.00 ? 717 PHE A CD2  1  
ATOM 145   C CE1  . PHE A 1 10  ? -17.054 3.226   -1.543  1.00 0.00 ? 717 PHE A CE1  1  
ATOM 146   C CE2  . PHE A 1 10  ? -15.162 3.264   -0.099  1.00 0.00 ? 717 PHE A CE2  1  
ATOM 147   C CZ   . PHE A 1 10  ? -16.416 3.728   -0.432  1.00 0.00 ? 717 PHE A CZ   1  
ATOM 148   H H    . PHE A 1 10  ? -16.994 -0.578  -2.263  1.00 0.00 ? 717 PHE A H    1  
ATOM 149   H HA   . PHE A 1 10  ? -14.366 -1.326  -3.291  1.00 0.00 ? 717 PHE A HA   1  
ATOM 150   H HB2  . PHE A 1 10  ? -13.463 0.875   -2.751  1.00 0.00 ? 717 PHE A HB2  1  
ATOM 151   H HB3  . PHE A 1 10  ? -14.773 0.990   -3.910  1.00 0.00 ? 717 PHE A HB3  1  
ATOM 152   H HD1  . PHE A 1 10  ? -16.976 1.899   -3.182  1.00 0.00 ? 717 PHE A HD1  1  
ATOM 153   H HD2  . PHE A 1 10  ? -13.572 1.942   -0.625  1.00 0.00 ? 717 PHE A HD2  1  
ATOM 154   H HE1  . PHE A 1 10  ? -18.029 3.579   -1.847  1.00 0.00 ? 717 PHE A HE1  1  
ATOM 155   H HE2  . PHE A 1 10  ? -14.655 3.655   0.769   1.00 0.00 ? 717 PHE A HE2  1  
ATOM 156   H HZ   . PHE A 1 10  ? -16.897 4.478   0.178   1.00 0.00 ? 717 PHE A HZ   1  
ATOM 157   N N    . SER A 1 11  ? -15.287 -1.961  -0.559  1.00 0.00 ? 718 SER A N    1  
ATOM 158   C CA   . SER A 1 11  ? -14.950 -2.422  0.784   1.00 0.00 ? 718 SER A CA   1  
ATOM 159   C C    . SER A 1 11  ? -13.589 -3.132  0.770   1.00 0.00 ? 718 SER A C    1  
ATOM 160   O O    . SER A 1 11  ? -12.811 -3.030  1.716   1.00 0.00 ? 718 SER A O    1  
ATOM 161   C CB   . SER A 1 11  ? -16.045 -3.329  1.328   1.00 0.00 ? 718 SER A CB   1  
ATOM 162   O OG   . SER A 1 11  ? -17.299 -2.644  1.339   1.00 0.00 ? 718 SER A OG   1  
ATOM 163   H H    . SER A 1 11  ? -16.104 -2.303  -0.984  1.00 0.00 ? 718 SER A H    1  
ATOM 164   H HA   . SER A 1 11  ? -14.864 -1.545  1.410   1.00 0.00 ? 718 SER A HA   1  
ATOM 165   H HB2  . SER A 1 11  ? -16.124 -4.211  0.711   1.00 0.00 ? 718 SER A HB2  1  
ATOM 166   H HB3  . SER A 1 11  ? -15.799 -3.618  2.338   1.00 0.00 ? 718 SER A HB3  1  
ATOM 167   H HG   . SER A 1 11  ? -17.885 -3.193  1.875   1.00 0.00 ? 718 SER A HG   1  
ATOM 168   N N    . GLU A 1 12  ? -13.296 -3.778  -0.354  1.00 0.00 ? 719 GLU A N    1  
ATOM 169   C CA   . GLU A 1 12  ? -12.023 -4.427  -0.596  1.00 0.00 ? 719 GLU A CA   1  
ATOM 170   C C    . GLU A 1 12  ? -10.917 -3.385  -0.535  1.00 0.00 ? 719 GLU A C    1  
ATOM 171   O O    . GLU A 1 12  ? -9.960  -3.515  0.220   1.00 0.00 ? 719 GLU A O    1  
ATOM 172   C CB   . GLU A 1 12  ? -12.008 -5.081  -1.993  1.00 0.00 ? 719 GLU A CB   1  
ATOM 173   C CG   . GLU A 1 12  ? -12.998 -6.228  -2.231  1.00 0.00 ? 719 GLU A CG   1  
ATOM 174   C CD   . GLU A 1 12  ? -14.460 -5.856  -2.067  1.00 0.00 ? 719 GLU A CD   1  
ATOM 175   O OE1  . GLU A 1 12  ? -14.864 -4.732  -2.446  1.00 0.00 ? 719 GLU A OE1  1  
ATOM 176   O OE2  . GLU A 1 12  ? -15.225 -6.671  -1.520  1.00 0.00 ? 719 GLU A OE2  1  
ATOM 177   H H    . GLU A 1 12  ? -13.981 -3.842  -1.060  1.00 0.00 ? 719 GLU A H    1  
ATOM 178   H HA   . GLU A 1 12  ? -11.839 -5.178  0.156   1.00 0.00 ? 719 GLU A HA   1  
ATOM 179   H HB2  . GLU A 1 12  ? -12.212 -4.314  -2.726  1.00 0.00 ? 719 GLU A HB2  1  
ATOM 180   H HB3  . GLU A 1 12  ? -11.009 -5.454  -2.163  1.00 0.00 ? 719 GLU A HB3  1  
ATOM 181   H HG2  . GLU A 1 12  ? -12.864 -6.589  -3.239  1.00 0.00 ? 719 GLU A HG2  1  
ATOM 182   H HG3  . GLU A 1 12  ? -12.762 -7.024  -1.541  1.00 0.00 ? 719 GLU A HG3  1  
ATOM 183   N N    . TYR A 1 13  ? -11.096 -2.316  -1.298  1.00 0.00 ? 720 TYR A N    1  
ATOM 184   C CA   . TYR A 1 13  ? -10.126 -1.230  -1.350  1.00 0.00 ? 720 TYR A CA   1  
ATOM 185   C C    . TYR A 1 13  ? -10.005 -0.547  0.001   1.00 0.00 ? 720 TYR A C    1  
ATOM 186   O O    . TYR A 1 13  ? -8.933  -0.099  0.372   1.00 0.00 ? 720 TYR A O    1  
ATOM 187   C CB   . TYR A 1 13  ? -10.482 -0.201  -2.431  1.00 0.00 ? 720 TYR A CB   1  
ATOM 188   C CG   . TYR A 1 13  ? -10.432 -0.743  -3.842  1.00 0.00 ? 720 TYR A CG   1  
ATOM 189   C CD1  . TYR A 1 13  ? -9.222  -0.878  -4.506  1.00 0.00 ? 720 TYR A CD1  1  
ATOM 190   C CD2  . TYR A 1 13  ? -11.589 -1.110  -4.510  1.00 0.00 ? 720 TYR A CD2  1  
ATOM 191   C CE1  . TYR A 1 13  ? -9.165  -1.368  -5.794  1.00 0.00 ? 720 TYR A CE1  1  
ATOM 192   C CE2  . TYR A 1 13  ? -11.542 -1.601  -5.799  1.00 0.00 ? 720 TYR A CE2  1  
ATOM 193   C CZ   . TYR A 1 13  ? -10.327 -1.727  -6.435  1.00 0.00 ? 720 TYR A CZ   1  
ATOM 194   O OH   . TYR A 1 13  ? -10.274 -2.217  -7.717  1.00 0.00 ? 720 TYR A OH   1  
ATOM 195   H H    . TYR A 1 13  ? -11.915 -2.267  -1.833  1.00 0.00 ? 720 TYR A H    1  
ATOM 196   H HA   . TYR A 1 13  ? -9.170  -1.670  -1.591  1.00 0.00 ? 720 TYR A HA   1  
ATOM 197   H HB2  . TYR A 1 13  ? -11.484 0.161   -2.255  1.00 0.00 ? 720 TYR A HB2  1  
ATOM 198   H HB3  . TYR A 1 13  ? -9.793  0.627   -2.365  1.00 0.00 ? 720 TYR A HB3  1  
ATOM 199   H HD1  . TYR A 1 13  ? -8.311  -0.596  -3.999  1.00 0.00 ? 720 TYR A HD1  1  
ATOM 200   H HD2  . TYR A 1 13  ? -12.537 -1.006  -4.007  1.00 0.00 ? 720 TYR A HD2  1  
ATOM 201   H HE1  . TYR A 1 13  ? -8.213  -1.465  -6.295  1.00 0.00 ? 720 TYR A HE1  1  
ATOM 202   H HE2  . TYR A 1 13  ? -12.454 -1.881  -6.304  1.00 0.00 ? 720 TYR A HE2  1  
ATOM 203   H HH   . TYR A 1 13  ? -10.912 -1.730  -8.252  1.00 0.00 ? 720 TYR A HH   1  
ATOM 204   N N    . SER A 1 14  ? -11.101 -0.490  0.731   1.00 0.00 ? 721 SER A N    1  
ATOM 205   C CA   . SER A 1 14  ? -11.120 0.096   2.045   1.00 0.00 ? 721 SER A CA   1  
ATOM 206   C C    . SER A 1 14  ? -10.284 -0.755  3.015   1.00 0.00 ? 721 SER A C    1  
ATOM 207   O O    . SER A 1 14  ? -9.542  -0.215  3.826   1.00 0.00 ? 721 SER A O    1  
ATOM 208   C CB   . SER A 1 14  ? -12.568 0.262   2.540   1.00 0.00 ? 721 SER A CB   1  
ATOM 209   O OG   . SER A 1 14  ? -12.625 0.969   3.770   1.00 0.00 ? 721 SER A OG   1  
ATOM 210   H H    . SER A 1 14  ? -11.940 -0.839  0.351   1.00 0.00 ? 721 SER A H    1  
ATOM 211   H HA   . SER A 1 14  ? -10.662 1.070   1.969   1.00 0.00 ? 721 SER A HA   1  
ATOM 212   H HB2  . SER A 1 14  ? -13.138 0.808   1.803   1.00 0.00 ? 721 SER A HB2  1  
ATOM 213   H HB3  . SER A 1 14  ? -13.007 -0.716  2.680   1.00 0.00 ? 721 SER A HB3  1  
ATOM 214   H HG   . SER A 1 14  ? -12.114 1.783   3.682   1.00 0.00 ? 721 SER A HG   1  
ATOM 215   N N    . ARG A 1 15  ? -10.374 -2.082  2.888   1.00 0.00 ? 722 ARG A N    1  
ATOM 216   C CA   . ARG A 1 15  ? -9.588  -2.995  3.723   1.00 0.00 ? 722 ARG A CA   1  
ATOM 217   C C    . ARG A 1 15  ? -8.102  -2.839  3.434   1.00 0.00 ? 722 ARG A C    1  
ATOM 218   O O    . ARG A 1 15  ? -7.268  -2.869  4.340   1.00 0.00 ? 722 ARG A O    1  
ATOM 219   C CB   . ARG A 1 15  ? -10.028 -4.453  3.521   1.00 0.00 ? 722 ARG A CB   1  
ATOM 220   C CG   . ARG A 1 15  ? -11.434 -4.758  4.017   1.00 0.00 ? 722 ARG A CG   1  
ATOM 221   C CD   . ARG A 1 15  ? -11.534 -4.557  5.512   1.00 0.00 ? 722 ARG A CD   1  
ATOM 222   N NE   . ARG A 1 15  ? -12.881 -4.792  6.030   1.00 0.00 ? 722 ARG A NE   1  
ATOM 223   C CZ   . ARG A 1 15  ? -13.225 -4.644  7.311   1.00 0.00 ? 722 ARG A CZ   1  
ATOM 224   N NH1  . ARG A 1 15  ? -12.304 -4.314  8.217   1.00 0.00 ? 722 ARG A NH1  1  
ATOM 225   N NH2  . ARG A 1 15  ? -14.483 -4.835  7.684   1.00 0.00 ? 722 ARG A NH2  1  
ATOM 226   H H    . ARG A 1 15  ? -10.999 -2.455  2.226   1.00 0.00 ? 722 ARG A H    1  
ATOM 227   H HA   . ARG A 1 15  ? -9.750  -2.715  4.752   1.00 0.00 ? 722 ARG A HA   1  
ATOM 228   H HB2  . ARG A 1 15  ? -9.984  -4.682  2.467   1.00 0.00 ? 722 ARG A HB2  1  
ATOM 229   H HB3  . ARG A 1 15  ? -9.334  -5.094  4.046   1.00 0.00 ? 722 ARG A HB3  1  
ATOM 230   H HG2  . ARG A 1 15  ? -12.136 -4.100  3.526   1.00 0.00 ? 722 ARG A HG2  1  
ATOM 231   H HG3  . ARG A 1 15  ? -11.675 -5.784  3.786   1.00 0.00 ? 722 ARG A HG3  1  
ATOM 232   H HD2  . ARG A 1 15  ? -10.862 -5.248  5.998   1.00 0.00 ? 722 ARG A HD2  1  
ATOM 233   H HD3  . ARG A 1 15  ? -11.243 -3.547  5.752   1.00 0.00 ? 722 ARG A HD3  1  
ATOM 234   H HE   . ARG A 1 15  ? -13.560 -5.067  5.371   1.00 0.00 ? 722 ARG A HE   1  
ATOM 235   H HH11 . ARG A 1 15  ? -11.343 -4.170  7.965   1.00 0.00 ? 722 ARG A HH11 1  
ATOM 236   H HH12 . ARG A 1 15  ? -12.523 -4.210  9.190   1.00 0.00 ? 722 ARG A HH12 1  
ATOM 237   H HH21 . ARG A 1 15  ? -15.181 -5.089  7.007   1.00 0.00 ? 722 ARG A HH21 1  
ATOM 238   H HH22 . ARG A 1 15  ? -14.773 -4.750  8.641   1.00 0.00 ? 722 ARG A HH22 1  
ATOM 239   N N    . ILE A 1 16  ? -7.780  -2.668  2.180   1.00 0.00 ? 723 ILE A N    1  
ATOM 240   C CA   . ILE A 1 16  ? -6.401  -2.430  1.773   1.00 0.00 ? 723 ILE A CA   1  
ATOM 241   C C    . ILE A 1 16  ? -5.924  -1.039  2.223   1.00 0.00 ? 723 ILE A C    1  
ATOM 242   O O    . ILE A 1 16  ? -4.818  -0.888  2.739   1.00 0.00 ? 723 ILE A O    1  
ATOM 243   C CB   . ILE A 1 16  ? -6.199  -2.633  0.239   1.00 0.00 ? 723 ILE A CB   1  
ATOM 244   C CG1  . ILE A 1 16  ? -6.042  -4.118  -0.125  1.00 0.00 ? 723 ILE A CG1  1  
ATOM 245   C CG2  . ILE A 1 16  ? -5.013  -1.845  -0.288  1.00 0.00 ? 723 ILE A CG2  1  
ATOM 246   C CD1  . ILE A 1 16  ? -7.222  -5.019  0.180   1.00 0.00 ? 723 ILE A CD1  1  
ATOM 247   H H    . ILE A 1 16  ? -8.492  -2.735  1.505   1.00 0.00 ? 723 ILE A H    1  
ATOM 248   H HA   . ILE A 1 16  ? -5.798  -3.155  2.300   1.00 0.00 ? 723 ILE A HA   1  
ATOM 249   H HB   . ILE A 1 16  ? -7.083  -2.258  -0.254  1.00 0.00 ? 723 ILE A HB   1  
ATOM 250   H HG12 . ILE A 1 16  ? -5.888  -4.143  -1.190  1.00 0.00 ? 723 ILE A HG12 1  
ATOM 251   H HG13 . ILE A 1 16  ? -5.165  -4.511  0.368   1.00 0.00 ? 723 ILE A HG13 1  
ATOM 252   H HG21 . ILE A 1 16  ? -5.193  -0.791  -0.140  1.00 0.00 ? 723 ILE A HG21 1  
ATOM 253   H HG22 . ILE A 1 16  ? -4.877  -2.053  -1.339  1.00 0.00 ? 723 ILE A HG22 1  
ATOM 254   H HG23 . ILE A 1 16  ? -4.125  -2.135  0.253   1.00 0.00 ? 723 ILE A HG23 1  
ATOM 255   H HD11 . ILE A 1 16  ? -7.418  -5.006  1.242   1.00 0.00 ? 723 ILE A HD11 1  
ATOM 256   H HD12 . ILE A 1 16  ? -6.998  -6.027  -0.134  1.00 0.00 ? 723 ILE A HD12 1  
ATOM 257   H HD13 . ILE A 1 16  ? -8.095  -4.664  -0.348  1.00 0.00 ? 723 ILE A HD13 1  
ATOM 258   N N    . SER A 1 17  ? -6.759  -0.045  2.032   1.00 0.00 ? 724 SER A N    1  
ATOM 259   C CA   . SER A 1 17  ? -6.450  1.314   2.486   1.00 0.00 ? 724 SER A CA   1  
ATOM 260   C C    . SER A 1 17  ? -6.264  1.343   4.008   1.00 0.00 ? 724 SER A C    1  
ATOM 261   O O    . SER A 1 17  ? -5.418  2.073   4.527   1.00 0.00 ? 724 SER A O    1  
ATOM 262   C CB   . SER A 1 17  ? -7.545  2.297   2.058   1.00 0.00 ? 724 SER A CB   1  
ATOM 263   O OG   . SER A 1 17  ? -7.696  2.300   0.647   1.00 0.00 ? 724 SER A OG   1  
ATOM 264   H H    . SER A 1 17  ? -7.584  -0.245  1.535   1.00 0.00 ? 724 SER A H    1  
ATOM 265   H HA   . SER A 1 17  ? -5.516  1.601   2.027   1.00 0.00 ? 724 SER A HA   1  
ATOM 266   H HB2  . SER A 1 17  ? -8.481  2.001   2.509   1.00 0.00 ? 724 SER A HB2  1  
ATOM 267   H HB3  . SER A 1 17  ? -7.283  3.292   2.388   1.00 0.00 ? 724 SER A HB3  1  
ATOM 268   H HG   . SER A 1 17  ? -8.089  1.459   0.382   1.00 0.00 ? 724 SER A HG   1  
ATOM 269   N N    . ASN A 1 18  ? -7.042  0.518   4.706   1.00 0.00 ? 725 ASN A N    1  
ATOM 270   C CA   . ASN A 1 18  ? -6.947  0.377   6.152   1.00 0.00 ? 725 ASN A CA   1  
ATOM 271   C C    . ASN A 1 18  ? -5.574  -0.184  6.499   1.00 0.00 ? 725 ASN A C    1  
ATOM 272   O O    . ASN A 1 18  ? -4.928  0.288   7.394   1.00 0.00 ? 725 ASN A O    1  
ATOM 273   C CB   . ASN A 1 18  ? -8.045  -0.557  6.668   1.00 0.00 ? 725 ASN A CB   1  
ATOM 274   C CG   . ASN A 1 18  ? -8.203  -0.506  8.172   1.00 0.00 ? 725 ASN A CG   1  
ATOM 275   O OD1  . ASN A 1 18  ? -7.983  0.536   8.794   1.00 0.00 ? 725 ASN A OD1  1  
ATOM 276   N ND2  . ASN A 1 18  ? -8.598  -1.600  8.758   1.00 0.00 ? 725 ASN A ND2  1  
ATOM 277   H H    . ASN A 1 18  ? -7.727  -0.001  4.226   1.00 0.00 ? 725 ASN A H    1  
ATOM 278   H HA   . ASN A 1 18  ? -7.052  1.352   6.611   1.00 0.00 ? 725 ASN A HA   1  
ATOM 279   H HB2  . ASN A 1 18  ? -8.987  -0.279  6.218   1.00 0.00 ? 725 ASN A HB2  1  
ATOM 280   H HB3  . ASN A 1 18  ? -7.799  -1.569  6.384   1.00 0.00 ? 725 ASN A HB3  1  
ATOM 281   H HD21 . ASN A 1 18  ? -8.771  -2.392  8.202   1.00 0.00 ? 725 ASN A HD21 1  
ATOM 282   H HD22 . ASN A 1 18  ? -8.719  -1.607  9.733   1.00 0.00 ? 725 ASN A HD22 1  
ATOM 283   N N    . LEU A 1 19  ? -5.143  -1.180  5.740   1.00 0.00 ? 726 LEU A N    1  
ATOM 284   C CA   . LEU A 1 19  ? -3.801  -1.755  5.851   1.00 0.00 ? 726 LEU A CA   1  
ATOM 285   C C    . LEU A 1 19  ? -2.733  -0.673  5.695   1.00 0.00 ? 726 LEU A C    1  
ATOM 286   O O    . LEU A 1 19  ? -1.811  -0.587  6.511   1.00 0.00 ? 726 LEU A O    1  
ATOM 287   C CB   . LEU A 1 19  ? -3.687  -2.944  4.825   1.00 0.00 ? 726 LEU A CB   1  
ATOM 288   C CG   . LEU A 1 19  ? -2.318  -3.439  4.290   1.00 0.00 ? 726 LEU A CG   1  
ATOM 289   C CD1  . LEU A 1 19  ? -1.735  -2.547  3.222   1.00 0.00 ? 726 LEU A CD1  1  
ATOM 290   C CD2  . LEU A 1 19  ? -1.350  -3.592  5.379   1.00 0.00 ? 726 LEU A CD2  1  
ATOM 291   H H    . LEU A 1 19  ? -5.752  -1.562  5.071   1.00 0.00 ? 726 LEU A H    1  
ATOM 292   H HA   . LEU A 1 19  ? -3.671  -2.150  6.850   1.00 0.00 ? 726 LEU A HA   1  
ATOM 293   H HB2  . LEU A 1 19  ? -4.080  -3.799  5.356   1.00 0.00 ? 726 LEU A HB2  1  
ATOM 294   H HB3  . LEU A 1 19  ? -4.335  -2.729  3.987   1.00 0.00 ? 726 LEU A HB3  1  
ATOM 295   H HG   . LEU A 1 19  ? -2.471  -4.420  3.868   1.00 0.00 ? 726 LEU A HG   1  
ATOM 296   H HD11 . LEU A 1 19  ? -2.408  -2.497  2.379   1.00 0.00 ? 726 LEU A HD11 1  
ATOM 297   H HD12 . LEU A 1 19  ? -0.780  -2.942  2.913   1.00 0.00 ? 726 LEU A HD12 1  
ATOM 298   H HD13 . LEU A 1 19  ? -1.596  -1.559  3.637   1.00 0.00 ? 726 LEU A HD13 1  
ATOM 299   H HD21 . LEU A 1 19  ? -0.404  -3.925  4.980   1.00 0.00 ? 726 LEU A HD21 1  
ATOM 300   H HD22 . LEU A 1 19  ? -1.727  -4.322  6.079   1.00 0.00 ? 726 LEU A HD22 1  
ATOM 301   H HD23 . LEU A 1 19  ? -1.220  -2.642  5.877   1.00 0.00 ? 726 LEU A HD23 1  
ATOM 302   N N    . ILE A 1 20  ? -2.889  0.167   4.695   1.00 0.00 ? 727 ILE A N    1  
ATOM 303   C CA   . ILE A 1 20  ? -1.952  1.246   4.447   1.00 0.00 ? 727 ILE A CA   1  
ATOM 304   C C    . ILE A 1 20  ? -1.890  2.209   5.613   1.00 0.00 ? 727 ILE A C    1  
ATOM 305   O O    . ILE A 1 20  ? -0.800  2.502   6.128   1.00 0.00 ? 727 ILE A O    1  
ATOM 306   C CB   . ILE A 1 20  ? -2.247  1.981   3.095   1.00 0.00 ? 727 ILE A CB   1  
ATOM 307   C CG1  . ILE A 1 20  ? -1.763  1.131   1.917   1.00 0.00 ? 727 ILE A CG1  1  
ATOM 308   C CG2  . ILE A 1 20  ? -1.641  3.387   3.040   1.00 0.00 ? 727 ILE A CG2  1  
ATOM 309   C CD1  . ILE A 1 20  ? -0.263  0.858   1.952   1.00 0.00 ? 727 ILE A CD1  1  
ATOM 310   H H    . ILE A 1 20  ? -3.663  0.049   4.103   1.00 0.00 ? 727 ILE A H    1  
ATOM 311   H HA   . ILE A 1 20  ? -0.976  0.792   4.379   1.00 0.00 ? 727 ILE A HA   1  
ATOM 312   H HB   . ILE A 1 20  ? -3.318  2.088   3.013   1.00 0.00 ? 727 ILE A HB   1  
ATOM 313   H HG12 . ILE A 1 20  ? -2.273  0.178   1.934   1.00 0.00 ? 727 ILE A HG12 1  
ATOM 314   H HG13 . ILE A 1 20  ? -1.988  1.644   0.994   1.00 0.00 ? 727 ILE A HG13 1  
ATOM 315   H HG21 . ILE A 1 20  ? -2.060  3.976   3.842   1.00 0.00 ? 727 ILE A HG21 1  
ATOM 316   H HG22 . ILE A 1 20  ? -1.874  3.842   2.090   1.00 0.00 ? 727 ILE A HG22 1  
ATOM 317   H HG23 . ILE A 1 20  ? -0.571  3.318   3.161   1.00 0.00 ? 727 ILE A HG23 1  
ATOM 318   H HD11 . ILE A 1 20  ? -0.018  0.248   2.809   1.00 0.00 ? 727 ILE A HD11 1  
ATOM 319   H HD12 . ILE A 1 20  ? 0.247   1.804   2.069   1.00 0.00 ? 727 ILE A HD12 1  
ATOM 320   H HD13 . ILE A 1 20  ? 0.057   0.370   1.043   1.00 0.00 ? 727 ILE A HD13 1  
ATOM 321   N N    . VAL A 1 21  ? -3.041  2.648   6.067   1.00 0.00 ? 728 VAL A N    1  
ATOM 322   C CA   . VAL A 1 21  ? -3.080  3.581   7.149   1.00 0.00 ? 728 VAL A CA   1  
ATOM 323   C C    . VAL A 1 21  ? -2.600  2.935   8.467   1.00 0.00 ? 728 VAL A C    1  
ATOM 324   O O    . VAL A 1 21  ? -1.854  3.552   9.202   1.00 0.00 ? 728 VAL A O    1  
ATOM 325   C CB   . VAL A 1 21  ? -4.468  4.299   7.288   1.00 0.00 ? 728 VAL A CB   1  
ATOM 326   C CG1  . VAL A 1 21  ? -5.592  3.336   7.552   1.00 0.00 ? 728 VAL A CG1  1  
ATOM 327   C CG2  . VAL A 1 21  ? -4.444  5.359   8.350   1.00 0.00 ? 728 VAL A CG2  1  
ATOM 328   H H    . VAL A 1 21  ? -3.873  2.332   5.647   1.00 0.00 ? 728 VAL A H    1  
ATOM 329   H HA   . VAL A 1 21  ? -2.339  4.317   6.875   1.00 0.00 ? 728 VAL A HA   1  
ATOM 330   H HB   . VAL A 1 21  ? -4.676  4.781   6.344   1.00 0.00 ? 728 VAL A HB   1  
ATOM 331   H HG11 . VAL A 1 21  ? -5.633  2.643   6.726   1.00 0.00 ? 728 VAL A HG11 1  
ATOM 332   H HG12 . VAL A 1 21  ? -6.524  3.876   7.626   1.00 0.00 ? 728 VAL A HG12 1  
ATOM 333   H HG13 . VAL A 1 21  ? -5.405  2.797   8.468   1.00 0.00 ? 728 VAL A HG13 1  
ATOM 334   H HG21 . VAL A 1 21  ? -4.205  4.890   9.292   1.00 0.00 ? 728 VAL A HG21 1  
ATOM 335   H HG22 . VAL A 1 21  ? -5.430  5.794   8.406   1.00 0.00 ? 728 VAL A HG22 1  
ATOM 336   H HG23 . VAL A 1 21  ? -3.708  6.109   8.107   1.00 0.00 ? 728 VAL A HG23 1  
ATOM 337   N N    . LEU A 1 22  ? -2.979  1.676   8.709   1.00 0.00 ? 729 LEU A N    1  
ATOM 338   C CA   . LEU A 1 22  ? -2.570  0.940   9.912   1.00 0.00 ? 729 LEU A CA   1  
ATOM 339   C C    . LEU A 1 22  ? -1.074  0.729   9.979   1.00 0.00 ? 729 LEU A C    1  
ATOM 340   O O    . LEU A 1 22  ? -0.454  1.029   11.004  1.00 0.00 ? 729 LEU A O    1  
ATOM 341   C CB   . LEU A 1 22  ? -3.283  -0.403  10.013  1.00 0.00 ? 729 LEU A CB   1  
ATOM 342   C CG   . LEU A 1 22  ? -4.743  -0.354  10.432  1.00 0.00 ? 729 LEU A CG   1  
ATOM 343   C CD1  . LEU A 1 22  ? -5.389  -1.695  10.180  1.00 0.00 ? 729 LEU A CD1  1  
ATOM 344   C CD2  . LEU A 1 22  ? -4.853  -0.011  11.909  1.00 0.00 ? 729 LEU A CD2  1  
ATOM 345   H H    . LEU A 1 22  ? -3.561  1.222   8.060   1.00 0.00 ? 729 LEU A H    1  
ATOM 346   H HA   . LEU A 1 22  ? -2.869  1.539   10.759  1.00 0.00 ? 729 LEU A HA   1  
ATOM 347   H HB2  . LEU A 1 22  ? -3.228  -0.882  9.046   1.00 0.00 ? 729 LEU A HB2  1  
ATOM 348   H HB3  . LEU A 1 22  ? -2.750  -1.014  10.726  1.00 0.00 ? 729 LEU A HB3  1  
ATOM 349   H HG   . LEU A 1 22  ? -5.243  0.422   9.870   1.00 0.00 ? 729 LEU A HG   1  
ATOM 350   H HD11 . LEU A 1 22  ? -6.426  -1.662  10.475  1.00 0.00 ? 729 LEU A HD11 1  
ATOM 351   H HD12 . LEU A 1 22  ? -4.870  -2.454  10.744  1.00 0.00 ? 729 LEU A HD12 1  
ATOM 352   H HD13 . LEU A 1 22  ? -5.323  -1.911  9.123   1.00 0.00 ? 729 LEU A HD13 1  
ATOM 353   H HD21 . LEU A 1 22  ? -5.894  0.003   12.199  1.00 0.00 ? 729 LEU A HD21 1  
ATOM 354   H HD22 . LEU A 1 22  ? -4.422  0.962   12.087  1.00 0.00 ? 729 LEU A HD22 1  
ATOM 355   H HD23 . LEU A 1 22  ? -4.327  -0.750  12.493  1.00 0.00 ? 729 LEU A HD23 1  
ATOM 356   N N    . HIS A 1 23  ? -0.493  0.230   8.892   1.00 0.00 ? 730 HIS A N    1  
ATOM 357   C CA   . HIS A 1 23  ? 0.937   -0.034  8.856   1.00 0.00 ? 730 HIS A CA   1  
ATOM 358   C C    . HIS A 1 23  ? 1.689   1.253   9.098   1.00 0.00 ? 730 HIS A C    1  
ATOM 359   O O    . HIS A 1 23  ? 2.490   1.347   10.019  1.00 0.00 ? 730 HIS A O    1  
ATOM 360   C CB   . HIS A 1 23  ? 1.367   -0.654  7.509   1.00 0.00 ? 730 HIS A CB   1  
ATOM 361   C CG   . HIS A 1 23  ? 2.813   -1.117  7.477   1.00 0.00 ? 730 HIS A CG   1  
ATOM 362   N ND1  . HIS A 1 23  ? 3.821   -0.516  6.736   1.00 0.00 ? 730 HIS A ND1  1  
ATOM 363   C CD2  . HIS A 1 23  ? 3.400   -2.166  8.104   1.00 0.00 ? 730 HIS A CD2  1  
ATOM 364   C CE1  . HIS A 1 23  ? 4.948   -1.205  6.935   1.00 0.00 ? 730 HIS A CE1  1  
ATOM 365   N NE2  . HIS A 1 23  ? 4.748   -2.216  7.758   1.00 0.00 ? 730 HIS A NE2  1  
ATOM 366   H H    . HIS A 1 23  ? -1.042  0.029   8.098   1.00 0.00 ? 730 HIS A H    1  
ATOM 367   H HA   . HIS A 1 23  ? 1.164   -0.726  9.654   1.00 0.00 ? 730 HIS A HA   1  
ATOM 368   H HB2  . HIS A 1 23  ? 0.729   -1.496  7.292   1.00 0.00 ? 730 HIS A HB2  1  
ATOM 369   H HB3  . HIS A 1 23  ? 1.235   0.083   6.730   1.00 0.00 ? 730 HIS A HB3  1  
ATOM 370   H HD1  . HIS A 1 23  ? 3.765   0.276   6.156   1.00 0.00 ? 730 HIS A HD1  1  
ATOM 371   H HD2  . HIS A 1 23  ? 2.909   -2.862  8.767   1.00 0.00 ? 730 HIS A HD2  1  
ATOM 372   H HE1  . HIS A 1 23  ? 5.899   -0.964  6.484   1.00 0.00 ? 730 HIS A HE1  1  
ATOM 373   N N    . LEU A 1 24  ? 1.376   2.257   8.307   1.00 0.00 ? 731 LEU A N    1  
ATOM 374   C CA   . LEU A 1 24  ? 2.038   3.532   8.413   1.00 0.00 ? 731 LEU A CA   1  
ATOM 375   C C    . LEU A 1 24  ? 1.857   4.174   9.797   1.00 0.00 ? 731 LEU A C    1  
ATOM 376   O O    . LEU A 1 24  ? 2.846   4.589   10.384  1.00 0.00 ? 731 LEU A O    1  
ATOM 377   C CB   . LEU A 1 24  ? 1.644   4.433   7.211   1.00 0.00 ? 731 LEU A CB   1  
ATOM 378   C CG   . LEU A 1 24  ? 2.161   5.905   7.107   1.00 0.00 ? 731 LEU A CG   1  
ATOM 379   C CD1  . LEU A 1 24  ? 1.511   6.839   8.114   1.00 0.00 ? 731 LEU A CD1  1  
ATOM 380   C CD2  . LEU A 1 24  ? 3.674   5.970   7.217   1.00 0.00 ? 731 LEU A CD2  1  
ATOM 381   H H    . LEU A 1 24  ? 0.674   2.138   7.627   1.00 0.00 ? 731 LEU A H    1  
ATOM 382   H HA   . LEU A 1 24  ? 3.093   3.309   8.330   1.00 0.00 ? 731 LEU A HA   1  
ATOM 383   H HB2  . LEU A 1 24  ? 2.088   3.908   6.377   1.00 0.00 ? 731 LEU A HB2  1  
ATOM 384   H HB3  . LEU A 1 24  ? 0.570   4.412   7.113   1.00 0.00 ? 731 LEU A HB3  1  
ATOM 385   H HG   . LEU A 1 24  ? 1.889   6.274   6.130   1.00 0.00 ? 731 LEU A HG   1  
ATOM 386   H HD11 . LEU A 1 24  ? 1.941   7.824   8.009   1.00 0.00 ? 731 LEU A HD11 1  
ATOM 387   H HD12 . LEU A 1 24  ? 1.688   6.473   9.115   1.00 0.00 ? 731 LEU A HD12 1  
ATOM 388   H HD13 . LEU A 1 24  ? 0.447   6.887   7.931   1.00 0.00 ? 731 LEU A HD13 1  
ATOM 389   H HD21 . LEU A 1 24  ? 4.119   5.412   6.406   1.00 0.00 ? 731 LEU A HD21 1  
ATOM 390   H HD22 . LEU A 1 24  ? 3.985   5.547   8.161   1.00 0.00 ? 731 LEU A HD22 1  
ATOM 391   H HD23 . LEU A 1 24  ? 3.995   7.000   7.164   1.00 0.00 ? 731 LEU A HD23 1  
ATOM 392   N N    . ARG A 1 25  ? 0.622   4.194   10.343  1.00 0.00 ? 732 ARG A N    1  
ATOM 393   C CA   . ARG A 1 25  ? 0.389   4.835   11.660  1.00 0.00 ? 732 ARG A CA   1  
ATOM 394   C C    . ARG A 1 25  ? 1.195   4.176   12.769  1.00 0.00 ? 732 ARG A C    1  
ATOM 395   O O    . ARG A 1 25  ? 1.676   4.855   13.684  1.00 0.00 ? 732 ARG A O    1  
ATOM 396   C CB   . ARG A 1 25  ? -1.103  4.934   12.058  1.00 0.00 ? 732 ARG A CB   1  
ATOM 397   C CG   . ARG A 1 25  ? -1.829  3.615   12.190  1.00 0.00 ? 732 ARG A CG   1  
ATOM 398   C CD   . ARG A 1 25  ? -3.254  3.785   12.701  1.00 0.00 ? 732 ARG A CD   1  
ATOM 399   N NE   . ARG A 1 25  ? -4.017  4.806   11.962  1.00 0.00 ? 732 ARG A NE   1  
ATOM 400   C CZ   . ARG A 1 25  ? -5.352  4.938   11.997  1.00 0.00 ? 732 ARG A CZ   1  
ATOM 401   N NH1  . ARG A 1 25  ? -6.098  4.073   12.667  1.00 0.00 ? 732 ARG A NH1  1  
ATOM 402   N NH2  . ARG A 1 25  ? -5.933  5.948   11.370  1.00 0.00 ? 732 ARG A NH2  1  
ATOM 403   H H    . ARG A 1 25  ? -0.129  3.786   9.856   1.00 0.00 ? 732 ARG A H    1  
ATOM 404   H HA   . ARG A 1 25  ? 0.783   5.836   11.557  1.00 0.00 ? 732 ARG A HA   1  
ATOM 405   H HB2  . ARG A 1 25  ? -1.175  5.438   13.009  1.00 0.00 ? 732 ARG A HB2  1  
ATOM 406   H HB3  . ARG A 1 25  ? -1.612  5.527   11.313  1.00 0.00 ? 732 ARG A HB3  1  
ATOM 407   H HG2  . ARG A 1 25  ? -1.856  3.158   11.213  1.00 0.00 ? 732 ARG A HG2  1  
ATOM 408   H HG3  . ARG A 1 25  ? -1.277  2.979   12.867  1.00 0.00 ? 732 ARG A HG3  1  
ATOM 409   H HD2  . ARG A 1 25  ? -3.764  2.842   12.565  1.00 0.00 ? 732 ARG A HD2  1  
ATOM 410   H HD3  . ARG A 1 25  ? -3.223  4.048   13.747  1.00 0.00 ? 732 ARG A HD3  1  
ATOM 411   H HE   . ARG A 1 25  ? -3.477  5.454   11.454  1.00 0.00 ? 732 ARG A HE   1  
ATOM 412   H HH11 . ARG A 1 25  ? -5.711  3.300   13.175  1.00 0.00 ? 732 ARG A HH11 1  
ATOM 413   H HH12 . ARG A 1 25  ? -7.097  4.169   12.690  1.00 0.00 ? 732 ARG A HH12 1  
ATOM 414   H HH21 . ARG A 1 25  ? -5.402  6.633   10.864  1.00 0.00 ? 732 ARG A HH21 1  
ATOM 415   H HH22 . ARG A 1 25  ? -6.931  6.070   11.398  1.00 0.00 ? 732 ARG A HH22 1  
ATOM 416   N N    . LYS A 1 26  ? 1.352   2.869   12.686  1.00 0.00 ? 733 LYS A N    1  
ATOM 417   C CA   . LYS A 1 26  ? 2.148   2.157   13.652  1.00 0.00 ? 733 LYS A CA   1  
ATOM 418   C C    . LYS A 1 26  ? 3.611   2.457   13.444  1.00 0.00 ? 733 LYS A C    1  
ATOM 419   O O    . LYS A 1 26  ? 4.294   2.912   14.351  1.00 0.00 ? 733 LYS A O    1  
ATOM 420   C CB   . LYS A 1 26  ? 1.910   0.655   13.570  1.00 0.00 ? 733 LYS A CB   1  
ATOM 421   C CG   . LYS A 1 26  ? 0.529   0.215   14.016  1.00 0.00 ? 733 LYS A CG   1  
ATOM 422   C CD   . LYS A 1 26  ? 0.315   -1.302  13.890  1.00 0.00 ? 733 LYS A CD   1  
ATOM 423   C CE   . LYS A 1 26  ? 1.154   -2.163  14.871  1.00 0.00 ? 733 LYS A CE   1  
ATOM 424   N NZ   . LYS A 1 26  ? 2.622   -2.186  14.592  1.00 0.00 ? 733 LYS A NZ   1  
ATOM 425   H H    . LYS A 1 26  ? 0.921   2.376   11.954  1.00 0.00 ? 733 LYS A H    1  
ATOM 426   H HA   . LYS A 1 26  ? 1.862   2.502   14.634  1.00 0.00 ? 733 LYS A HA   1  
ATOM 427   H HB2  . LYS A 1 26  ? 2.052   0.340   12.547  1.00 0.00 ? 733 LYS A HB2  1  
ATOM 428   H HB3  . LYS A 1 26  ? 2.642   0.161   14.190  1.00 0.00 ? 733 LYS A HB3  1  
ATOM 429   H HG2  . LYS A 1 26  ? 0.389   0.496   15.049  1.00 0.00 ? 733 LYS A HG2  1  
ATOM 430   H HG3  . LYS A 1 26  ? -0.204  0.723   13.406  1.00 0.00 ? 733 LYS A HG3  1  
ATOM 431   H HD2  . LYS A 1 26  ? -0.729  -1.515  14.062  1.00 0.00 ? 733 LYS A HD2  1  
ATOM 432   H HD3  . LYS A 1 26  ? 0.564   -1.584  12.879  1.00 0.00 ? 733 LYS A HD3  1  
ATOM 433   H HE2  . LYS A 1 26  ? 1.009   -1.780  15.869  1.00 0.00 ? 733 LYS A HE2  1  
ATOM 434   H HE3  . LYS A 1 26  ? 0.770   -3.172  14.831  1.00 0.00 ? 733 LYS A HE3  1  
ATOM 435   H HZ1  . LYS A 1 26  ? 3.127   -1.323  14.903  1.00 0.00 ? 733 LYS A HZ1  1  
ATOM 436   H HZ2  . LYS A 1 26  ? 2.810   -2.288  13.576  1.00 0.00 ? 733 LYS A HZ2  1  
ATOM 437   H HZ3  . LYS A 1 26  ? 3.073   -3.002  15.053  1.00 0.00 ? 733 LYS A HZ3  1  
ATOM 438   N N    . VAL A 1 27  ? 4.071   2.272   12.223  1.00 0.00 ? 734 VAL A N    1  
ATOM 439   C CA   . VAL A 1 27  ? 5.467   2.439   11.895  1.00 0.00 ? 734 VAL A CA   1  
ATOM 440   C C    . VAL A 1 27  ? 5.968   3.875   12.128  1.00 0.00 ? 734 VAL A C    1  
ATOM 441   O O    . VAL A 1 27  ? 7.094   4.065   12.560  1.00 0.00 ? 734 VAL A O    1  
ATOM 442   C CB   . VAL A 1 27  ? 5.781   1.986   10.453  1.00 0.00 ? 734 VAL A CB   1  
ATOM 443   C CG1  . VAL A 1 27  ? 7.237   2.178   10.150  1.00 0.00 ? 734 VAL A CG1  1  
ATOM 444   C CG2  . VAL A 1 27  ? 5.401   0.536   10.249  1.00 0.00 ? 734 VAL A CG2  1  
ATOM 445   H H    . VAL A 1 27  ? 3.450   2.000   11.511  1.00 0.00 ? 734 VAL A H    1  
ATOM 446   H HA   . VAL A 1 27  ? 6.015   1.797   12.568  1.00 0.00 ? 734 VAL A HA   1  
ATOM 447   H HB   . VAL A 1 27  ? 5.204   2.589   9.768   1.00 0.00 ? 734 VAL A HB   1  
ATOM 448   H HG11 . VAL A 1 27  ? 7.446   1.819   9.154   1.00 0.00 ? 734 VAL A HG11 1  
ATOM 449   H HG12 . VAL A 1 27  ? 7.833   1.656   10.883  1.00 0.00 ? 734 VAL A HG12 1  
ATOM 450   H HG13 . VAL A 1 27  ? 7.424   3.240   10.196  1.00 0.00 ? 734 VAL A HG13 1  
ATOM 451   H HG21 . VAL A 1 27  ? 5.947   -0.091  10.937  1.00 0.00 ? 734 VAL A HG21 1  
ATOM 452   H HG22 . VAL A 1 27  ? 5.619   0.257   9.229   1.00 0.00 ? 734 VAL A HG22 1  
ATOM 453   H HG23 . VAL A 1 27  ? 4.339   0.435   10.421  1.00 0.00 ? 734 VAL A HG23 1  
ATOM 454   N N    . GLU A 1 28  ? 5.144   4.871   11.872  1.00 0.00 ? 735 GLU A N    1  
ATOM 455   C CA   . GLU A 1 28  ? 5.566   6.258   12.091  1.00 0.00 ? 735 GLU A CA   1  
ATOM 456   C C    . GLU A 1 28  ? 5.711   6.556   13.588  1.00 0.00 ? 735 GLU A C    1  
ATOM 457   O O    . GLU A 1 28  ? 6.517   7.384   13.995  1.00 0.00 ? 735 GLU A O    1  
ATOM 458   C CB   . GLU A 1 28  ? 4.614   7.265   11.428  1.00 0.00 ? 735 GLU A CB   1  
ATOM 459   C CG   . GLU A 1 28  ? 3.211   7.219   11.972  1.00 0.00 ? 735 GLU A CG   1  
ATOM 460   C CD   . GLU A 1 28  ? 2.296   8.272   11.390  1.00 0.00 ? 735 GLU A CD   1  
ATOM 461   O OE1  . GLU A 1 28  ? 2.794   9.321   10.900  1.00 0.00 ? 735 GLU A OE1  1  
ATOM 462   O OE2  . GLU A 1 28  ? 1.053   8.092   11.455  1.00 0.00 ? 735 GLU A OE2  1  
ATOM 463   H H    . GLU A 1 28  ? 4.239   4.691   11.524  1.00 0.00 ? 735 GLU A H    1  
ATOM 464   H HA   . GLU A 1 28  ? 6.545   6.353   11.646  1.00 0.00 ? 735 GLU A HA   1  
ATOM 465   H HB2  . GLU A 1 28  ? 4.999   8.262   11.582  1.00 0.00 ? 735 GLU A HB2  1  
ATOM 466   H HB3  . GLU A 1 28  ? 4.575   7.064   10.368  1.00 0.00 ? 735 GLU A HB3  1  
ATOM 467   H HG2  . GLU A 1 28  ? 2.825   6.238   11.732  1.00 0.00 ? 735 GLU A HG2  1  
ATOM 468   H HG3  . GLU A 1 28  ? 3.256   7.327   13.046  1.00 0.00 ? 735 GLU A HG3  1  
ATOM 469   N N    . GLU A 1 29  ? 4.939   5.862   14.390  1.00 0.00 ? 736 GLU A N    1  
ATOM 470   C CA   . GLU A 1 29  ? 4.948   6.046   15.819  1.00 0.00 ? 736 GLU A CA   1  
ATOM 471   C C    . GLU A 1 29  ? 6.078   5.217   16.447  1.00 0.00 ? 736 GLU A C    1  
ATOM 472   O O    . GLU A 1 29  ? 6.747   5.651   17.387  1.00 0.00 ? 736 GLU A O    1  
ATOM 473   C CB   . GLU A 1 29  ? 3.586   5.629   16.370  1.00 0.00 ? 736 GLU A CB   1  
ATOM 474   C CG   . GLU A 1 29  ? 3.351   5.954   17.826  1.00 0.00 ? 736 GLU A CG   1  
ATOM 475   C CD   . GLU A 1 29  ? 1.967   5.561   18.262  1.00 0.00 ? 736 GLU A CD   1  
ATOM 476   O OE1  . GLU A 1 29  ? 0.985   6.181   17.800  1.00 0.00 ? 736 GLU A OE1  1  
ATOM 477   O OE2  . GLU A 1 29  ? 1.828   4.639   19.080  1.00 0.00 ? 736 GLU A OE2  1  
ATOM 478   H H    . GLU A 1 29  ? 4.335   5.191   14.005  1.00 0.00 ? 736 GLU A H    1  
ATOM 479   H HA   . GLU A 1 29  ? 5.111   7.093   16.033  1.00 0.00 ? 736 GLU A HA   1  
ATOM 480   H HB2  . GLU A 1 29  ? 2.817   6.122   15.795  1.00 0.00 ? 736 GLU A HB2  1  
ATOM 481   H HB3  . GLU A 1 29  ? 3.479   4.563   16.241  1.00 0.00 ? 736 GLU A HB3  1  
ATOM 482   H HG2  . GLU A 1 29  ? 4.070   5.414   18.424  1.00 0.00 ? 736 GLU A HG2  1  
ATOM 483   H HG3  . GLU A 1 29  ? 3.476   7.016   17.980  1.00 0.00 ? 736 GLU A HG3  1  
ATOM 484   N N    . GLU A 1 30  ? 6.282   4.036   15.908  1.00 0.00 ? 737 GLU A N    1  
ATOM 485   C CA   . GLU A 1 30  ? 7.306   3.124   16.378  1.00 0.00 ? 737 GLU A CA   1  
ATOM 486   C C    . GLU A 1 30  ? 8.697   3.512   15.886  1.00 0.00 ? 737 GLU A C    1  
ATOM 487   O O    . GLU A 1 30  ? 9.629   3.616   16.682  1.00 0.00 ? 737 GLU A O    1  
ATOM 488   C CB   . GLU A 1 30  ? 6.972   1.688   15.959  1.00 0.00 ? 737 GLU A CB   1  
ATOM 489   C CG   . GLU A 1 30  ? 5.745   1.120   16.657  1.00 0.00 ? 737 GLU A CG   1  
ATOM 490   C CD   . GLU A 1 30  ? 5.315   -0.223  16.114  1.00 0.00 ? 737 GLU A CD   1  
ATOM 491   O OE1  . GLU A 1 30  ? 6.074   -1.214  16.229  1.00 0.00 ? 737 GLU A OE1  1  
ATOM 492   O OE2  . GLU A 1 30  ? 4.207   -0.323  15.579  1.00 0.00 ? 737 GLU A OE2  1  
ATOM 493   H H    . GLU A 1 30  ? 5.697   3.747   15.171  1.00 0.00 ? 737 GLU A H    1  
ATOM 494   H HA   . GLU A 1 30  ? 7.304   3.165   17.456  1.00 0.00 ? 737 GLU A HA   1  
ATOM 495   H HB2  . GLU A 1 30  ? 6.792   1.676   14.894  1.00 0.00 ? 737 GLU A HB2  1  
ATOM 496   H HB3  . GLU A 1 30  ? 7.814   1.051   16.182  1.00 0.00 ? 737 GLU A HB3  1  
ATOM 497   H HG2  . GLU A 1 30  ? 5.964   1.006   17.708  1.00 0.00 ? 737 GLU A HG2  1  
ATOM 498   H HG3  . GLU A 1 30  ? 4.928   1.816   16.538  1.00 0.00 ? 737 GLU A HG3  1  
ATOM 499   N N    . GLU A 1 31  ? 8.831   3.758   14.599  1.00 0.00 ? 738 GLU A N    1  
ATOM 500   C CA   . GLU A 1 31  ? 10.138  3.998   14.014  1.00 0.00 ? 738 GLU A CA   1  
ATOM 501   C C    . GLU A 1 31  ? 10.220  5.311   13.231  1.00 0.00 ? 738 GLU A C    1  
ATOM 502   O O    . GLU A 1 31  ? 10.793  6.302   13.701  1.00 0.00 ? 738 GLU A O    1  
ATOM 503   C CB   . GLU A 1 31  ? 10.507  2.873   13.051  1.00 0.00 ? 738 GLU A CB   1  
ATOM 504   C CG   . GLU A 1 31  ? 10.499  1.480   13.626  1.00 0.00 ? 738 GLU A CG   1  
ATOM 505   C CD   . GLU A 1 31  ? 10.800  0.472   12.564  1.00 0.00 ? 738 GLU A CD   1  
ATOM 506   O OE1  . GLU A 1 31  ? 9.931   0.195   11.740  1.00 0.00 ? 738 GLU A OE1  1  
ATOM 507   O OE2  . GLU A 1 31  ? 11.945  -0.025  12.493  1.00 0.00 ? 738 GLU A OE2  1  
ATOM 508   H H    . GLU A 1 31  ? 8.041   3.794   14.015  1.00 0.00 ? 738 GLU A H    1  
ATOM 509   H HA   . GLU A 1 31  ? 10.871  4.000   14.806  1.00 0.00 ? 738 GLU A HA   1  
ATOM 510   H HB2  . GLU A 1 31  ? 9.810   2.888   12.227  1.00 0.00 ? 738 GLU A HB2  1  
ATOM 511   H HB3  . GLU A 1 31  ? 11.495  3.075   12.663  1.00 0.00 ? 738 GLU A HB3  1  
ATOM 512   H HG2  . GLU A 1 31  ? 11.249  1.413   14.401  1.00 0.00 ? 738 GLU A HG2  1  
ATOM 513   H HG3  . GLU A 1 31  ? 9.524   1.272   14.040  1.00 0.00 ? 738 GLU A HG3  1  
ATOM 514   N N    . ASP A 1 32  ? 9.614   5.323   12.045  1.00 0.00 ? 739 ASP A N    1  
ATOM 515   C CA   . ASP A 1 32  ? 9.849   6.406   11.092  1.00 0.00 ? 739 ASP A CA   1  
ATOM 516   C C    . ASP A 1 32  ? 8.638   6.722   10.189  1.00 0.00 ? 739 ASP A C    1  
ATOM 517   O O    . ASP A 1 32  ? 7.836   7.577   10.552  1.00 0.00 ? 739 ASP A O    1  
ATOM 518   C CB   . ASP A 1 32  ? 11.124  6.098   10.293  1.00 0.00 ? 739 ASP A CB   1  
ATOM 519   C CG   . ASP A 1 32  ? 11.440  7.066   9.189   1.00 0.00 ? 739 ASP A CG   1  
ATOM 520   O OD1  . ASP A 1 32  ? 11.619  8.279   9.461   1.00 0.00 ? 739 ASP A OD1  1  
ATOM 521   O OD2  . ASP A 1 32  ? 11.531  6.618   8.032   1.00 0.00 ? 739 ASP A OD2  1  
ATOM 522   H H    . ASP A 1 32  ? 8.973   4.608   11.840  1.00 0.00 ? 739 ASP A H    1  
ATOM 523   H HA   . ASP A 1 32  ? 10.041  7.288   11.683  1.00 0.00 ? 739 ASP A HA   1  
ATOM 524   H HB2  . ASP A 1 32  ? 11.963  6.095   10.971  1.00 0.00 ? 739 ASP A HB2  1  
ATOM 525   H HB3  . ASP A 1 32  ? 11.028  5.109   9.872   1.00 0.00 ? 739 ASP A HB3  1  
ATOM 526   N N    . GLU A 1 33  ? 8.485   6.019   9.041   1.00 0.00 ? 740 GLU A N    1  
ATOM 527   C CA   . GLU A 1 33  ? 7.360   6.283   8.094   1.00 0.00 ? 740 GLU A CA   1  
ATOM 528   C C    . GLU A 1 33  ? 7.174   5.196   7.052   1.00 0.00 ? 740 GLU A C    1  
ATOM 529   O O    . GLU A 1 33  ? 7.259   5.432   5.852   1.00 0.00 ? 740 GLU A O    1  
ATOM 530   C CB   . GLU A 1 33  ? 7.408   7.689   7.460   1.00 0.00 ? 740 GLU A CB   1  
ATOM 531   C CG   . GLU A 1 33  ? 8.762   8.094   6.889   1.00 0.00 ? 740 GLU A CG   1  
ATOM 532   C CD   . GLU A 1 33  ? 8.741   9.457   6.255   1.00 0.00 ? 740 GLU A CD   1  
ATOM 533   O OE1  . GLU A 1 33  ? 8.213   10.415  6.872   1.00 0.00 ? 740 GLU A OE1  1  
ATOM 534   O OE2  . GLU A 1 33  ? 9.267   9.616   5.134   1.00 0.00 ? 740 GLU A OE2  1  
ATOM 535   H H    . GLU A 1 33  ? 9.151   5.335   8.803   1.00 0.00 ? 740 GLU A H    1  
ATOM 536   H HA   . GLU A 1 33  ? 6.448   6.193   8.656   1.00 0.00 ? 740 GLU A HA   1  
ATOM 537   H HB2  . GLU A 1 33  ? 6.697   7.700   6.646   1.00 0.00 ? 740 GLU A HB2  1  
ATOM 538   H HB3  . GLU A 1 33  ? 7.110   8.418   8.198   1.00 0.00 ? 740 GLU A HB3  1  
ATOM 539   H HG2  . GLU A 1 33  ? 9.489   8.097   7.688   1.00 0.00 ? 740 GLU A HG2  1  
ATOM 540   H HG3  . GLU A 1 33  ? 9.052   7.366   6.144   1.00 0.00 ? 740 GLU A HG3  1  
ATOM 541   N N    . SER A 1 34  ? 6.901   4.006   7.551   1.00 0.00 ? 741 SER A N    1  
ATOM 542   C CA   . SER A 1 34  ? 6.676   2.781   6.794   1.00 0.00 ? 741 SER A CA   1  
ATOM 543   C C    . SER A 1 34  ? 7.966   2.353   6.134   1.00 0.00 ? 741 SER A C    1  
ATOM 544   O O    . SER A 1 34  ? 8.644   1.452   6.617   1.00 0.00 ? 741 SER A O    1  
ATOM 545   C CB   . SER A 1 34  ? 5.513   2.928   5.771   1.00 0.00 ? 741 SER A CB   1  
ATOM 546   O OG   . SER A 1 34  ? 5.186   1.684   5.155   1.00 0.00 ? 741 SER A OG   1  
ATOM 547   H H    . SER A 1 34  ? 6.884   3.947   8.522   1.00 0.00 ? 741 SER A H    1  
ATOM 548   H HA   . SER A 1 34  ? 6.416   2.017   7.514   1.00 0.00 ? 741 SER A HA   1  
ATOM 549   H HB2  . SER A 1 34  ? 4.636   3.296   6.284   1.00 0.00 ? 741 SER A HB2  1  
ATOM 550   H HB3  . SER A 1 34  ? 5.802   3.633   5.006   1.00 0.00 ? 741 SER A HB3  1  
ATOM 551   H HG   . SER A 1 34  ? 5.889   1.453   4.535   1.00 0.00 ? 741 SER A HG   1  
ATOM 552   N N    . ALA A 1 35  ? 8.353   3.136   5.159   1.00 0.00 ? 742 ALA A N    1  
ATOM 553   C CA   . ALA A 1 35  ? 9.515   2.909   4.269   1.00 0.00 ? 742 ALA A CA   1  
ATOM 554   C C    . ALA A 1 35  ? 9.733   1.405   3.896   1.00 0.00 ? 742 ALA A C    1  
ATOM 555   O O    . ALA A 1 35  ? 8.804   0.581   3.974   1.00 0.00 ? 742 ALA A O    1  
ATOM 556   C CB   . ALA A 1 35  ? 10.760  3.516   4.917   1.00 0.00 ? 742 ALA A CB   1  
ATOM 557   H H    . ALA A 1 35  ? 7.842   3.983   5.149   1.00 0.00 ? 742 ALA A H    1  
ATOM 558   H HA   . ALA A 1 35  ? 9.321   3.449   3.353   1.00 0.00 ? 742 ALA A HA   1  
ATOM 559   H HB1  . ALA A 1 35  ? 10.568  4.551   5.161   1.00 0.00 ? 742 ALA A HB1  1  
ATOM 560   H HB2  . ALA A 1 35  ? 11.591  3.459   4.228   1.00 0.00 ? 742 ALA A HB2  1  
ATOM 561   H HB3  . ALA A 1 35  ? 11.000  2.971   5.817   1.00 0.00 ? 742 ALA A HB3  1  
ATOM 562   N N    . LEU A 1 36  ? 10.945  1.097   3.423   1.00 0.00 ? 743 LEU A N    1  
ATOM 563   C CA   . LEU A 1 36  ? 11.406  -0.278  3.174   1.00 0.00 ? 743 LEU A CA   1  
ATOM 564   C C    . LEU A 1 36  ? 10.686  -0.980  1.990   1.00 0.00 ? 743 LEU A C    1  
ATOM 565   O O    . LEU A 1 36  ? 10.141  -0.319  1.092   1.00 0.00 ? 743 LEU A O    1  
ATOM 566   C CB   . LEU A 1 36  ? 11.399  -1.144  4.478   1.00 0.00 ? 743 LEU A CB   1  
ATOM 567   C CG   . LEU A 1 36  ? 12.488  -0.865  5.549   1.00 0.00 ? 743 LEU A CG   1  
ATOM 568   C CD1  . LEU A 1 36  ? 13.881  -0.976  4.959   1.00 0.00 ? 743 LEU A CD1  1  
ATOM 569   C CD2  . LEU A 1 36  ? 12.300  0.474   6.244   1.00 0.00 ? 743 LEU A CD2  1  
ATOM 570   H H    . LEU A 1 36  ? 11.545  1.839   3.186   1.00 0.00 ? 743 LEU A H    1  
ATOM 571   H HA   . LEU A 1 36  ? 12.432  -0.169  2.855   1.00 0.00 ? 743 LEU A HA   1  
ATOM 572   H HB2  . LEU A 1 36  ? 10.440  -1.017  4.953   1.00 0.00 ? 743 LEU A HB2  1  
ATOM 573   H HB3  . LEU A 1 36  ? 11.491  -2.183  4.200   1.00 0.00 ? 743 LEU A HB3  1  
ATOM 574   H HG   . LEU A 1 36  ? 12.418  -1.646  6.291   1.00 0.00 ? 743 LEU A HG   1  
ATOM 575   H HD11 . LEU A 1 36  ? 14.024  -1.964  4.546   1.00 0.00 ? 743 LEU A HD11 1  
ATOM 576   H HD12 . LEU A 1 36  ? 14.603  -0.810  5.743   1.00 0.00 ? 743 LEU A HD12 1  
ATOM 577   H HD13 . LEU A 1 36  ? 14.016  -0.233  4.187   1.00 0.00 ? 743 LEU A HD13 1  
ATOM 578   H HD21 . LEU A 1 36  ? 12.353  1.265   5.510   1.00 0.00 ? 743 LEU A HD21 1  
ATOM 579   H HD22 . LEU A 1 36  ? 13.078  0.611   6.981   1.00 0.00 ? 743 LEU A HD22 1  
ATOM 580   H HD23 . LEU A 1 36  ? 11.336  0.499   6.731   1.00 0.00 ? 743 LEU A HD23 1  
ATOM 581   N N    . LYS A 1 37  ? 10.735  -2.310  1.978   1.00 0.00 ? 744 LYS A N    1  
ATOM 582   C CA   . LYS A 1 37  ? 10.249  -3.117  0.878   1.00 0.00 ? 744 LYS A CA   1  
ATOM 583   C C    . LYS A 1 37  ? 8.716   -3.143  0.817   1.00 0.00 ? 744 LYS A C    1  
ATOM 584   O O    . LYS A 1 37  ? 8.062   -3.774  1.638   1.00 0.00 ? 744 LYS A O    1  
ATOM 585   C CB   . LYS A 1 37  ? 10.804  -4.550  1.010   1.00 0.00 ? 744 LYS A CB   1  
ATOM 586   C CG   . LYS A 1 37  ? 10.434  -5.504  -0.129  1.00 0.00 ? 744 LYS A CG   1  
ATOM 587   C CD   . LYS A 1 37  ? 11.055  -5.102  -1.466  1.00 0.00 ? 744 LYS A CD   1  
ATOM 588   C CE   . LYS A 1 37  ? 12.582  -5.201  -1.446  1.00 0.00 ? 744 LYS A CE   1  
ATOM 589   N NZ   . LYS A 1 37  ? 13.172  -4.842  -2.746  1.00 0.00 ? 744 LYS A NZ   1  
ATOM 590   H H    . LYS A 1 37  ? 11.062  -2.790  2.768   1.00 0.00 ? 744 LYS A H    1  
ATOM 591   H HA   . LYS A 1 37  ? 10.630  -2.692  -0.037  1.00 0.00 ? 744 LYS A HA   1  
ATOM 592   H HB2  . LYS A 1 37  ? 11.881  -4.506  1.079   1.00 0.00 ? 744 LYS A HB2  1  
ATOM 593   H HB3  . LYS A 1 37  ? 10.424  -4.967  1.930   1.00 0.00 ? 744 LYS A HB3  1  
ATOM 594   H HG2  . LYS A 1 37  ? 10.775  -6.498  0.120   1.00 0.00 ? 744 LYS A HG2  1  
ATOM 595   H HG3  . LYS A 1 37  ? 9.358   -5.513  -0.230  1.00 0.00 ? 744 LYS A HG3  1  
ATOM 596   H HD2  . LYS A 1 37  ? 10.677  -5.763  -2.232  1.00 0.00 ? 744 LYS A HD2  1  
ATOM 597   H HD3  . LYS A 1 37  ? 10.768  -4.087  -1.699  1.00 0.00 ? 744 LYS A HD3  1  
ATOM 598   H HE2  . LYS A 1 37  ? 12.971  -4.529  -0.697  1.00 0.00 ? 744 LYS A HE2  1  
ATOM 599   H HE3  . LYS A 1 37  ? 12.864  -6.214  -1.200  1.00 0.00 ? 744 LYS A HE3  1  
ATOM 600   H HZ1  . LYS A 1 37  ? 12.974  -3.857  -2.999  1.00 0.00 ? 744 LYS A HZ1  1  
ATOM 601   H HZ2  . LYS A 1 37  ? 12.812  -5.458  -3.503  1.00 0.00 ? 744 LYS A HZ2  1  
ATOM 602   H HZ3  . LYS A 1 37  ? 14.204  -4.973  -2.733  1.00 0.00 ? 744 LYS A HZ3  1  
ATOM 603   N N    . ARG A 1 38  ? 8.170   -2.474  -0.189  1.00 0.00 ? 745 ARG A N    1  
ATOM 604   C CA   . ARG A 1 38  ? 6.714   -2.415  -0.430  1.00 0.00 ? 745 ARG A CA   1  
ATOM 605   C C    . ARG A 1 38  ? 6.062   -3.806  -0.507  1.00 0.00 ? 745 ARG A C    1  
ATOM 606   O O    . ARG A 1 38  ? 4.940   -4.004  -0.039  1.00 0.00 ? 745 ARG A O    1  
ATOM 607   C CB   . ARG A 1 38  ? 6.405   -1.624  -1.713  1.00 0.00 ? 745 ARG A CB   1  
ATOM 608   C CG   . ARG A 1 38  ? 7.146   -2.114  -2.961  1.00 0.00 ? 745 ARG A CG   1  
ATOM 609   C CD   . ARG A 1 38  ? 6.661   -1.388  -4.199  1.00 0.00 ? 745 ARG A CD   1  
ATOM 610   N NE   . ARG A 1 38  ? 7.472   -1.680  -5.395  1.00 0.00 ? 745 ARG A NE   1  
ATOM 611   C CZ   . ARG A 1 38  ? 6.966   -1.933  -6.616  1.00 0.00 ? 745 ARG A CZ   1  
ATOM 612   N NH1  . ARG A 1 38  ? 5.713   -2.366  -6.752  1.00 0.00 ? 745 ARG A NH1  1  
ATOM 613   N NH2  . ARG A 1 38  ? 7.739   -1.846  -7.682  1.00 0.00 ? 745 ARG A NH2  1  
ATOM 614   H H    . ARG A 1 38  ? 8.774   -1.957  -0.762  1.00 0.00 ? 745 ARG A H    1  
ATOM 615   H HA   . ARG A 1 38  ? 6.279   -1.885  0.403   1.00 0.00 ? 745 ARG A HA   1  
ATOM 616   H HB2  . ARG A 1 38  ? 5.345   -1.687  -1.907  1.00 0.00 ? 745 ARG A HB2  1  
ATOM 617   H HB3  . ARG A 1 38  ? 6.665   -0.589  -1.549  1.00 0.00 ? 745 ARG A HB3  1  
ATOM 618   H HG2  . ARG A 1 38  ? 8.203   -1.933  -2.839  1.00 0.00 ? 745 ARG A HG2  1  
ATOM 619   H HG3  . ARG A 1 38  ? 6.971   -3.174  -3.078  1.00 0.00 ? 745 ARG A HG3  1  
ATOM 620   H HD2  . ARG A 1 38  ? 5.640   -1.678  -4.393  1.00 0.00 ? 745 ARG A HD2  1  
ATOM 621   H HD3  . ARG A 1 38  ? 6.691   -0.326  -4.009  1.00 0.00 ? 745 ARG A HD3  1  
ATOM 622   H HE   . ARG A 1 38  ? 8.445   -1.562  -5.278  1.00 0.00 ? 745 ARG A HE   1  
ATOM 623   H HH11 . ARG A 1 38  ? 5.125   -2.525  -5.954  1.00 0.00 ? 745 ARG A HH11 1  
ATOM 624   H HH12 . ARG A 1 38  ? 5.301   -2.548  -7.647  1.00 0.00 ? 745 ARG A HH12 1  
ATOM 625   H HH21 . ARG A 1 38  ? 8.707   -1.591  -7.612  1.00 0.00 ? 745 ARG A HH21 1  
ATOM 626   H HH22 . ARG A 1 38  ? 7.391   -2.003  -8.611  1.00 0.00 ? 745 ARG A HH22 1  
ATOM 627   N N    . SER A 1 39  ? 6.785   -4.757  -1.059  1.00 0.00 ? 746 SER A N    1  
ATOM 628   C CA   . SER A 1 39  ? 6.308   -6.106  -1.249  1.00 0.00 ? 746 SER A CA   1  
ATOM 629   C C    . SER A 1 39  ? 6.025   -6.804  0.105   1.00 0.00 ? 746 SER A C    1  
ATOM 630   O O    . SER A 1 39  ? 5.128   -7.644  0.207   1.00 0.00 ? 746 SER A O    1  
ATOM 631   C CB   . SER A 1 39  ? 7.370   -6.844  -2.029  1.00 0.00 ? 746 SER A CB   1  
ATOM 632   O OG   . SER A 1 39  ? 7.862   -5.998  -3.073  1.00 0.00 ? 746 SER A OG   1  
ATOM 633   H H    . SER A 1 39  ? 7.683   -4.564  -1.400  1.00 0.00 ? 746 SER A H    1  
ATOM 634   H HA   . SER A 1 39  ? 5.406   -6.076  -1.841  1.00 0.00 ? 746 SER A HA   1  
ATOM 635   H HB2  . SER A 1 39  ? 8.182   -7.118  -1.373  1.00 0.00 ? 746 SER A HB2  1  
ATOM 636   H HB3  . SER A 1 39  ? 6.937   -7.727  -2.473  1.00 0.00 ? 746 SER A HB3  1  
ATOM 637   H HG   . SER A 1 39  ? 7.429   -6.244  -3.900  1.00 0.00 ? 746 SER A HG   1  
ATOM 638   N N    . GLU A 1 40  ? 6.762   -6.401  1.144   1.00 0.00 ? 747 GLU A N    1  
ATOM 639   C CA   . GLU A 1 40  ? 6.623   -6.952  2.479   1.00 0.00 ? 747 GLU A CA   1  
ATOM 640   C C    . GLU A 1 40  ? 5.256   -6.607  3.049   1.00 0.00 ? 747 GLU A C    1  
ATOM 641   O O    . GLU A 1 40  ? 4.663   -7.405  3.769   1.00 0.00 ? 747 GLU A O    1  
ATOM 642   C CB   . GLU A 1 40  ? 7.747   -6.437  3.386   1.00 0.00 ? 747 GLU A CB   1  
ATOM 643   C CG   . GLU A 1 40  ? 7.713   -6.962  4.815   1.00 0.00 ? 747 GLU A CG   1  
ATOM 644   C CD   . GLU A 1 40  ? 8.899   -6.501  5.617   1.00 0.00 ? 747 GLU A CD   1  
ATOM 645   O OE1  . GLU A 1 40  ? 9.978   -7.125  5.505   1.00 0.00 ? 747 GLU A OE1  1  
ATOM 646   O OE2  . GLU A 1 40  ? 8.794   -5.500  6.355   1.00 0.00 ? 747 GLU A OE2  1  
ATOM 647   H H    . GLU A 1 40  ? 7.420   -5.688  1.016   1.00 0.00 ? 747 GLU A H    1  
ATOM 648   H HA   . GLU A 1 40  ? 6.702   -8.026  2.397   1.00 0.00 ? 747 GLU A HA   1  
ATOM 649   H HB2  . GLU A 1 40  ? 8.696   -6.713  2.953   1.00 0.00 ? 747 GLU A HB2  1  
ATOM 650   H HB3  . GLU A 1 40  ? 7.681   -5.359  3.421   1.00 0.00 ? 747 GLU A HB3  1  
ATOM 651   H HG2  . GLU A 1 40  ? 6.814   -6.605  5.294   1.00 0.00 ? 747 GLU A HG2  1  
ATOM 652   H HG3  . GLU A 1 40  ? 7.704   -8.041  4.788   1.00 0.00 ? 747 GLU A HG3  1  
ATOM 653   N N    . LEU A 1 41  ? 4.737   -5.442  2.673   1.00 0.00 ? 748 LEU A N    1  
ATOM 654   C CA   . LEU A 1 41  ? 3.421   -5.007  3.123   1.00 0.00 ? 748 LEU A CA   1  
ATOM 655   C C    . LEU A 1 41  ? 2.349   -5.962  2.632   1.00 0.00 ? 748 LEU A C    1  
ATOM 656   O O    . LEU A 1 41  ? 1.479   -6.352  3.395   1.00 0.00 ? 748 LEU A O    1  
ATOM 657   C CB   . LEU A 1 41  ? 3.096   -3.552  2.711   1.00 0.00 ? 748 LEU A CB   1  
ATOM 658   C CG   . LEU A 1 41  ? 3.807   -2.411  3.484   1.00 0.00 ? 748 LEU A CG   1  
ATOM 659   C CD1  . LEU A 1 41  ? 5.318   -2.428  3.297   1.00 0.00 ? 748 LEU A CD1  1  
ATOM 660   C CD2  . LEU A 1 41  ? 3.237   -1.060  3.080   1.00 0.00 ? 748 LEU A CD2  1  
ATOM 661   H H    . LEU A 1 41  ? 5.255   -4.861  2.075   1.00 0.00 ? 748 LEU A H    1  
ATOM 662   H HA   . LEU A 1 41  ? 3.436   -5.069  4.202   1.00 0.00 ? 748 LEU A HA   1  
ATOM 663   H HB2  . LEU A 1 41  ? 3.347   -3.445  1.666   1.00 0.00 ? 748 LEU A HB2  1  
ATOM 664   H HB3  . LEU A 1 41  ? 2.030   -3.412  2.815   1.00 0.00 ? 748 LEU A HB3  1  
ATOM 665   H HG   . LEU A 1 41  ? 3.616   -2.545  4.538   1.00 0.00 ? 748 LEU A HG   1  
ATOM 666   H HD11 . LEU A 1 41  ? 5.760   -1.609  3.845   1.00 0.00 ? 748 LEU A HD11 1  
ATOM 667   H HD12 . LEU A 1 41  ? 5.550   -2.327  2.248   1.00 0.00 ? 748 LEU A HD12 1  
ATOM 668   H HD13 . LEU A 1 41  ? 5.715   -3.363  3.663   1.00 0.00 ? 748 LEU A HD13 1  
ATOM 669   H HD21 . LEU A 1 41  ? 2.182   -1.031  3.308   1.00 0.00 ? 748 LEU A HD21 1  
ATOM 670   H HD22 . LEU A 1 41  ? 3.379   -0.908  2.020   1.00 0.00 ? 748 LEU A HD22 1  
ATOM 671   H HD23 . LEU A 1 41  ? 3.743   -0.279  3.627   1.00 0.00 ? 748 LEU A HD23 1  
ATOM 672   N N    . VAL A 1 42  ? 2.450   -6.376  1.368   1.00 0.00 ? 749 VAL A N    1  
ATOM 673   C CA   . VAL A 1 42  ? 1.513   -7.349  0.804   1.00 0.00 ? 749 VAL A CA   1  
ATOM 674   C C    . VAL A 1 42  ? 1.719   -8.670  1.503   1.00 0.00 ? 749 VAL A C    1  
ATOM 675   O O    . VAL A 1 42  ? 0.770   -9.318  1.914   1.00 0.00 ? 749 VAL A O    1  
ATOM 676   C CB   . VAL A 1 42  ? 1.751   -7.591  -0.712  1.00 0.00 ? 749 VAL A CB   1  
ATOM 677   C CG1  . VAL A 1 42  ? 0.686   -8.517  -1.296  1.00 0.00 ? 749 VAL A CG1  1  
ATOM 678   C CG2  . VAL A 1 42  ? 1.800   -6.297  -1.472  1.00 0.00 ? 749 VAL A CG2  1  
ATOM 679   H H    . VAL A 1 42  ? 3.169   -6.018  0.807   1.00 0.00 ? 749 VAL A H    1  
ATOM 680   H HA   . VAL A 1 42  ? 0.503   -6.999  0.959   1.00 0.00 ? 749 VAL A HA   1  
ATOM 681   H HB   . VAL A 1 42  ? 2.704   -8.089  -0.814  1.00 0.00 ? 749 VAL A HB   1  
ATOM 682   H HG11 . VAL A 1 42  ? -0.289  -8.071  -1.163  1.00 0.00 ? 749 VAL A HG11 1  
ATOM 683   H HG12 . VAL A 1 42  ? 0.705   -9.463  -0.776  1.00 0.00 ? 749 VAL A HG12 1  
ATOM 684   H HG13 . VAL A 1 42  ? 0.865   -8.684  -2.347  1.00 0.00 ? 749 VAL A HG13 1  
ATOM 685   H HG21 . VAL A 1 42  ? 1.966   -6.498  -2.520  1.00 0.00 ? 749 VAL A HG21 1  
ATOM 686   H HG22 . VAL A 1 42  ? 2.600   -5.681  -1.089  1.00 0.00 ? 749 VAL A HG22 1  
ATOM 687   H HG23 . VAL A 1 42  ? 0.859   -5.780  -1.351  1.00 0.00 ? 749 VAL A HG23 1  
ATOM 688   N N    . ASN A 1 43  ? 2.987   -9.011  1.664   1.00 0.00 ? 750 ASN A N    1  
ATOM 689   C CA   . ASN A 1 43  ? 3.435   -10.272 2.254   1.00 0.00 ? 750 ASN A CA   1  
ATOM 690   C C    . ASN A 1 43  ? 2.750   -10.519 3.591   1.00 0.00 ? 750 ASN A C    1  
ATOM 691   O O    . ASN A 1 43  ? 1.969   -11.471 3.736   1.00 0.00 ? 750 ASN A O    1  
ATOM 692   C CB   . ASN A 1 43  ? 4.963   -10.235 2.459   1.00 0.00 ? 750 ASN A CB   1  
ATOM 693   C CG   . ASN A 1 43  ? 5.547   -11.583 2.857   1.00 0.00 ? 750 ASN A CG   1  
ATOM 694   O OD1  . ASN A 1 43  ? 5.044   -12.635 2.463   1.00 0.00 ? 750 ASN A OD1  1  
ATOM 695   N ND2  . ASN A 1 43  ? 6.594   -11.562 3.646   1.00 0.00 ? 750 ASN A ND2  1  
ATOM 696   H H    . ASN A 1 43  ? 3.656   -8.362  1.360   1.00 0.00 ? 750 ASN A H    1  
ATOM 697   H HA   . ASN A 1 43  ? 3.191   -11.084 1.587   1.00 0.00 ? 750 ASN A HA   1  
ATOM 698   H HB2  . ASN A 1 43  ? 5.467   -9.843  1.585   1.00 0.00 ? 750 ASN A HB2  1  
ATOM 699   H HB3  . ASN A 1 43  ? 5.154   -9.547  3.269   1.00 0.00 ? 750 ASN A HB3  1  
ATOM 700   H HD21 . ASN A 1 43  ? 6.950   -10.700 3.951   1.00 0.00 ? 750 ASN A HD21 1  
ATOM 701   H HD22 . ASN A 1 43  ? 6.998   -12.423 3.892   1.00 0.00 ? 750 ASN A HD22 1  
ATOM 702   N N    . TRP A 1 44  ? 2.960   -9.616  4.540   1.00 0.00 ? 751 TRP A N    1  
ATOM 703   C CA   . TRP A 1 44  ? 2.381   -9.788  5.851   1.00 0.00 ? 751 TRP A CA   1  
ATOM 704   C C    . TRP A 1 44  ? 0.864   -9.597  5.812   1.00 0.00 ? 751 TRP A C    1  
ATOM 705   O O    . TRP A 1 44  ? 0.143   -10.163 6.641   1.00 0.00 ? 751 TRP A O    1  
ATOM 706   C CB   . TRP A 1 44  ? 3.058   -8.929  6.959   1.00 0.00 ? 751 TRP A CB   1  
ATOM 707   C CG   . TRP A 1 44  ? 2.794   -7.451  6.905   1.00 0.00 ? 751 TRP A CG   1  
ATOM 708   C CD1  . TRP A 1 44  ? 3.604   -6.485  6.401   1.00 0.00 ? 751 TRP A CD1  1  
ATOM 709   C CD2  . TRP A 1 44  ? 1.630   -6.784  7.396   1.00 0.00 ? 751 TRP A CD2  1  
ATOM 710   N NE1  . TRP A 1 44  ? 3.009   -5.257  6.545   1.00 0.00 ? 751 TRP A NE1  1  
ATOM 711   C CE2  . TRP A 1 44  ? 1.787   -5.425  7.140   1.00 0.00 ? 751 TRP A CE2  1  
ATOM 712   C CE3  . TRP A 1 44  ? 0.462   -7.220  8.017   1.00 0.00 ? 751 TRP A CE3  1  
ATOM 713   C CZ2  . TRP A 1 44  ? 0.818   -4.500  7.482   1.00 0.00 ? 751 TRP A CZ2  1  
ATOM 714   C CZ3  . TRP A 1 44  ? -0.491  -6.304  8.343   1.00 0.00 ? 751 TRP A CZ3  1  
ATOM 715   C CH2  . TRP A 1 44  ? -0.315  -4.962  8.075   1.00 0.00 ? 751 TRP A CH2  1  
ATOM 716   H H    . TRP A 1 44  ? 3.512   -8.825  4.345   1.00 0.00 ? 751 TRP A H    1  
ATOM 717   H HA   . TRP A 1 44  ? 2.539   -10.832 6.081   1.00 0.00 ? 751 TRP A HA   1  
ATOM 718   H HB2  . TRP A 1 44  ? 2.712   -9.273  7.921   1.00 0.00 ? 751 TRP A HB2  1  
ATOM 719   H HB3  . TRP A 1 44  ? 4.125   -9.082  6.903   1.00 0.00 ? 751 TRP A HB3  1  
ATOM 720   H HD1  . TRP A 1 44  ? 4.574   -6.669  5.965   1.00 0.00 ? 751 TRP A HD1  1  
ATOM 721   H HE1  . TRP A 1 44  ? 3.384   -4.398  6.257   1.00 0.00 ? 751 TRP A HE1  1  
ATOM 722   H HE3  . TRP A 1 44  ? 0.304   -8.266  8.236   1.00 0.00 ? 751 TRP A HE3  1  
ATOM 723   H HZ2  . TRP A 1 44  ? 0.897   -3.442  7.276   1.00 0.00 ? 751 TRP A HZ2  1  
ATOM 724   H HZ3  . TRP A 1 44  ? -1.407  -6.630  8.813   1.00 0.00 ? 751 TRP A HZ3  1  
ATOM 725   H HH2  . TRP A 1 44  ? -1.106  -4.268  8.319   1.00 0.00 ? 751 TRP A HH2  1  
ATOM 726   N N    . TYR A 1 45  ? 0.381   -8.785  4.859   1.00 0.00 ? 752 TYR A N    1  
ATOM 727   C CA   . TYR A 1 45  ? -1.046  -8.529  4.721   1.00 0.00 ? 752 TYR A CA   1  
ATOM 728   C C    . TYR A 1 45  ? -1.767  -9.816  4.408   1.00 0.00 ? 752 TYR A C    1  
ATOM 729   O O    . TYR A 1 45  ? -2.783  -10.133 5.006   1.00 0.00 ? 752 TYR A O    1  
ATOM 730   C CB   . TYR A 1 45  ? -1.331  -7.508  3.615   1.00 0.00 ? 752 TYR A CB   1  
ATOM 731   C CG   . TYR A 1 45  ? -2.789  -7.116  3.526   1.00 0.00 ? 752 TYR A CG   1  
ATOM 732   C CD1  . TYR A 1 45  ? -3.459  -6.674  4.658   1.00 0.00 ? 752 TYR A CD1  1  
ATOM 733   C CD2  . TYR A 1 45  ? -3.499  -7.164  2.317   1.00 0.00 ? 752 TYR A CD2  1  
ATOM 734   C CE1  . TYR A 1 45  ? -4.774  -6.299  4.605   1.00 0.00 ? 752 TYR A CE1  1  
ATOM 735   C CE2  . TYR A 1 45  ? -4.810  -6.790  2.266   1.00 0.00 ? 752 TYR A CE2  1  
ATOM 736   C CZ   . TYR A 1 45  ? -5.448  -6.354  3.416   1.00 0.00 ? 752 TYR A CZ   1  
ATOM 737   O OH   . TYR A 1 45  ? -6.766  -5.972  3.375   1.00 0.00 ? 752 TYR A OH   1  
ATOM 738   H H    . TYR A 1 45  ? 0.995   -8.353  4.224   1.00 0.00 ? 752 TYR A H    1  
ATOM 739   H HA   . TYR A 1 45  ? -1.399  -8.138  5.663   1.00 0.00 ? 752 TYR A HA   1  
ATOM 740   H HB2  . TYR A 1 45  ? -0.728  -6.625  3.771   1.00 0.00 ? 752 TYR A HB2  1  
ATOM 741   H HB3  . TYR A 1 45  ? -1.050  -7.947  2.669   1.00 0.00 ? 752 TYR A HB3  1  
ATOM 742   H HD1  . TYR A 1 45  ? -2.933  -6.634  5.601   1.00 0.00 ? 752 TYR A HD1  1  
ATOM 743   H HD2  . TYR A 1 45  ? -3.062  -7.501  1.386   1.00 0.00 ? 752 TYR A HD2  1  
ATOM 744   H HE1  . TYR A 1 45  ? -5.269  -5.958  5.499   1.00 0.00 ? 752 TYR A HE1  1  
ATOM 745   H HE2  . TYR A 1 45  ? -5.311  -6.845  1.312   1.00 0.00 ? 752 TYR A HE2  1  
ATOM 746   H HH   . TYR A 1 45  ? -6.846  -5.176  3.912   1.00 0.00 ? 752 TYR A HH   1  
ATOM 747   N N    . LEU A 1 46  ? -1.208  -10.571 3.506   1.00 0.00 ? 753 LEU A N    1  
ATOM 748   C CA   . LEU A 1 46  ? -1.774  -11.836 3.107   1.00 0.00 ? 753 LEU A CA   1  
ATOM 749   C C    . LEU A 1 46  ? -1.731  -12.785 4.268   1.00 0.00 ? 753 LEU A C    1  
ATOM 750   O O    . LEU A 1 46  ? -2.639  -13.570 4.474   1.00 0.00 ? 753 LEU A O    1  
ATOM 751   C CB   . LEU A 1 46  ? -0.999  -12.403 1.947   1.00 0.00 ? 753 LEU A CB   1  
ATOM 752   C CG   . LEU A 1 46  ? -0.896  -11.502 0.733   1.00 0.00 ? 753 LEU A CG   1  
ATOM 753   C CD1  . LEU A 1 46  ? -0.001  -12.132 -0.292  1.00 0.00 ? 753 LEU A CD1  1  
ATOM 754   C CD2  . LEU A 1 46  ? -2.274  -11.178 0.158   1.00 0.00 ? 753 LEU A CD2  1  
ATOM 755   H H    . LEU A 1 46  ? -0.374  -10.258 3.086   1.00 0.00 ? 753 LEU A H    1  
ATOM 756   H HA   . LEU A 1 46  ? -2.797  -11.674 2.807   1.00 0.00 ? 753 LEU A HA   1  
ATOM 757   H HB2  . LEU A 1 46  ? 0.001   -12.626 2.290   1.00 0.00 ? 753 LEU A HB2  1  
ATOM 758   H HB3  . LEU A 1 46  ? -1.468  -13.327 1.644   1.00 0.00 ? 753 LEU A HB3  1  
ATOM 759   H HG   . LEU A 1 46  ? -0.430  -10.577 1.038   1.00 0.00 ? 753 LEU A HG   1  
ATOM 760   H HD11 . LEU A 1 46  ? -0.399  -13.093 -0.578  1.00 0.00 ? 753 LEU A HD11 1  
ATOM 761   H HD12 . LEU A 1 46  ? 0.961   -12.256 0.184   1.00 0.00 ? 753 LEU A HD12 1  
ATOM 762   H HD13 . LEU A 1 46  ? 0.088   -11.480 -1.148  1.00 0.00 ? 753 LEU A HD13 1  
ATOM 763   H HD21 . LEU A 1 46  ? -2.859  -10.639 0.890   1.00 0.00 ? 753 LEU A HD21 1  
ATOM 764   H HD22 . LEU A 1 46  ? -2.783  -12.094 -0.099  1.00 0.00 ? 753 LEU A HD22 1  
ATOM 765   H HD23 . LEU A 1 46  ? -2.161  -10.565 -0.725  1.00 0.00 ? 753 LEU A HD23 1  
ATOM 766   N N    . LYS A 1 47  ? -0.671  -12.681 5.027   1.00 0.00 ? 754 LYS A N    1  
ATOM 767   C CA   . LYS A 1 47  ? -0.489  -13.474 6.241   1.00 0.00 ? 754 LYS A CA   1  
ATOM 768   C C    . LYS A 1 47  ? -1.552  -13.151 7.304   1.00 0.00 ? 754 LYS A C    1  
ATOM 769   O O    . LYS A 1 47  ? -1.857  -13.977 8.162   1.00 0.00 ? 754 LYS A O    1  
ATOM 770   C CB   . LYS A 1 47  ? 0.909   -13.265 6.820   1.00 0.00 ? 754 LYS A CB   1  
ATOM 771   C CG   . LYS A 1 47  ? 2.039   -13.616 5.876   1.00 0.00 ? 754 LYS A CG   1  
ATOM 772   C CD   . LYS A 1 47  ? 1.903   -15.022 5.371   1.00 0.00 ? 754 LYS A CD   1  
ATOM 773   C CE   . LYS A 1 47  ? 3.018   -15.379 4.401   1.00 0.00 ? 754 LYS A CE   1  
ATOM 774   N NZ   . LYS A 1 47  ? 2.988   -16.808 4.024   1.00 0.00 ? 754 LYS A NZ   1  
ATOM 775   H H    . LYS A 1 47  ? 0.030   -12.068 4.712   1.00 0.00 ? 754 LYS A H    1  
ATOM 776   H HA   . LYS A 1 47  ? -0.601  -14.515 5.979   1.00 0.00 ? 754 LYS A HA   1  
ATOM 777   H HB2  . LYS A 1 47  ? 1.004   -12.216 7.059   1.00 0.00 ? 754 LYS A HB2  1  
ATOM 778   H HB3  . LYS A 1 47  ? 1.012   -13.851 7.720   1.00 0.00 ? 754 LYS A HB3  1  
ATOM 779   H HG2  . LYS A 1 47  ? 2.020   -12.937 5.037   1.00 0.00 ? 754 LYS A HG2  1  
ATOM 780   H HG3  . LYS A 1 47  ? 2.979   -13.516 6.399   1.00 0.00 ? 754 LYS A HG3  1  
ATOM 781   H HD2  . LYS A 1 47  ? 1.897   -15.696 6.213   1.00 0.00 ? 754 LYS A HD2  1  
ATOM 782   H HD3  . LYS A 1 47  ? 0.952   -15.057 4.862   1.00 0.00 ? 754 LYS A HD3  1  
ATOM 783   H HE2  . LYS A 1 47  ? 2.897   -14.783 3.507   1.00 0.00 ? 754 LYS A HE2  1  
ATOM 784   H HE3  . LYS A 1 47  ? 3.967   -15.146 4.857   1.00 0.00 ? 754 LYS A HE3  1  
ATOM 785   H HZ1  . LYS A 1 47  ? 2.910   -17.405 4.871   1.00 0.00 ? 754 LYS A HZ1  1  
ATOM 786   H HZ2  . LYS A 1 47  ? 3.876   -17.086 3.559   1.00 0.00 ? 754 LYS A HZ2  1  
ATOM 787   H HZ3  . LYS A 1 47  ? 2.207   -17.043 3.379   1.00 0.00 ? 754 LYS A HZ3  1  
ATOM 788   N N    . GLU A 1 48  ? -2.068  -11.945 7.293   1.00 0.00 ? 755 GLU A N    1  
ATOM 789   C CA   . GLU A 1 48  ? -3.127  -11.608 8.245   1.00 0.00 ? 755 GLU A CA   1  
ATOM 790   C C    . GLU A 1 48  ? -4.486  -12.006 7.735   1.00 0.00 ? 755 GLU A C    1  
ATOM 791   O O    . GLU A 1 48  ? -5.253  -12.690 8.420   1.00 0.00 ? 755 GLU A O    1  
ATOM 792   C CB   . GLU A 1 48  ? -3.155  -10.149 8.748   1.00 0.00 ? 755 GLU A CB   1  
ATOM 793   C CG   . GLU A 1 48  ? -3.442  -9.065  7.724   1.00 0.00 ? 755 GLU A CG   1  
ATOM 794   C CD   . GLU A 1 48  ? -4.059  -7.833  8.348   1.00 0.00 ? 755 GLU A CD   1  
ATOM 795   O OE1  . GLU A 1 48  ? -3.339  -6.994  8.894   1.00 0.00 ? 755 GLU A OE1  1  
ATOM 796   O OE2  . GLU A 1 48  ? -5.303  -7.699  8.322   1.00 0.00 ? 755 GLU A OE2  1  
ATOM 797   H H    . GLU A 1 48  ? -1.719  -11.337 6.606   1.00 0.00 ? 755 GLU A H    1  
ATOM 798   H HA   . GLU A 1 48  ? -2.948  -12.257 9.088   1.00 0.00 ? 755 GLU A HA   1  
ATOM 799   H HB2  . GLU A 1 48  ? -3.945  -10.102 9.478   1.00 0.00 ? 755 GLU A HB2  1  
ATOM 800   H HB3  . GLU A 1 48  ? -2.208  -9.942  9.216   1.00 0.00 ? 755 GLU A HB3  1  
ATOM 801   H HG2  . GLU A 1 48  ? -2.511  -8.784  7.252   1.00 0.00 ? 755 GLU A HG2  1  
ATOM 802   H HG3  . GLU A 1 48  ? -4.118  -9.461  6.982   1.00 0.00 ? 755 GLU A HG3  1  
ATOM 803   N N    . ILE A 1 49  ? -4.769  -11.623 6.507   1.00 0.00 ? 756 ILE A N    1  
ATOM 804   C CA   . ILE A 1 49  ? -6.076  -11.826 5.930   1.00 0.00 ? 756 ILE A CA   1  
ATOM 805   C C    . ILE A 1 49  ? -6.328  -13.254 5.589   1.00 0.00 ? 756 ILE A C    1  
ATOM 806   O O    . ILE A 1 49  ? -7.443  -13.624 5.279   1.00 0.00 ? 756 ILE A O    1  
ATOM 807   C CB   . ILE A 1 49  ? -6.358  -10.896 4.710   1.00 0.00 ? 756 ILE A CB   1  
ATOM 808   C CG1  . ILE A 1 49  ? -5.286  -11.007 3.603   1.00 0.00 ? 756 ILE A CG1  1  
ATOM 809   C CG2  . ILE A 1 49  ? -6.506  -9.461  5.160   1.00 0.00 ? 756 ILE A CG2  1  
ATOM 810   C CD1  . ILE A 1 49  ? -5.411  -12.207 2.675   1.00 0.00 ? 756 ILE A CD1  1  
ATOM 811   H H    . ILE A 1 49  ? -4.064  -11.182 5.978   1.00 0.00 ? 756 ILE A H    1  
ATOM 812   H HA   . ILE A 1 49  ? -6.779  -11.564 6.706   1.00 0.00 ? 756 ILE A HA   1  
ATOM 813   H HB   . ILE A 1 49  ? -7.312  -11.201 4.304   1.00 0.00 ? 756 ILE A HB   1  
ATOM 814   H HG12 . ILE A 1 49  ? -5.271  -10.101 3.019   1.00 0.00 ? 756 ILE A HG12 1  
ATOM 815   H HG13 . ILE A 1 49  ? -4.330  -11.082 4.103   1.00 0.00 ? 756 ILE A HG13 1  
ATOM 816   H HG21 . ILE A 1 49  ? -7.323  -9.389  5.862   1.00 0.00 ? 756 ILE A HG21 1  
ATOM 817   H HG22 . ILE A 1 49  ? -6.706  -8.836  4.303   1.00 0.00 ? 756 ILE A HG22 1  
ATOM 818   H HG23 . ILE A 1 49  ? -5.592  -9.135  5.633   1.00 0.00 ? 756 ILE A HG23 1  
ATOM 819   H HD11 . ILE A 1 49  ? -5.339  -13.118 3.252   1.00 0.00 ? 756 ILE A HD11 1  
ATOM 820   H HD12 . ILE A 1 49  ? -4.623  -12.183 1.937   1.00 0.00 ? 756 ILE A HD12 1  
ATOM 821   H HD13 . ILE A 1 49  ? -6.367  -12.167 2.176   1.00 0.00 ? 756 ILE A HD13 1  
ATOM 822   N N    . GLU A 1 50  ? -5.303  -14.070 5.687   1.00 0.00 ? 757 GLU A N    1  
ATOM 823   C CA   . GLU A 1 50  ? -5.437  -15.481 5.357   1.00 0.00 ? 757 GLU A CA   1  
ATOM 824   C C    . GLU A 1 50  ? -6.420  -16.174 6.306   1.00 0.00 ? 757 GLU A C    1  
ATOM 825   O O    . GLU A 1 50  ? -7.049  -17.168 5.954   1.00 0.00 ? 757 GLU A O    1  
ATOM 826   C CB   . GLU A 1 50  ? -4.089  -16.183 5.356   1.00 0.00 ? 757 GLU A CB   1  
ATOM 827   C CG   . GLU A 1 50  ? -3.412  -16.285 6.702   1.00 0.00 ? 757 GLU A CG   1  
ATOM 828   C CD   . GLU A 1 50  ? -2.153  -17.096 6.622   1.00 0.00 ? 757 GLU A CD   1  
ATOM 829   O OE1  . GLU A 1 50  ? -1.115  -16.555 6.227   1.00 0.00 ? 757 GLU A OE1  1  
ATOM 830   O OE2  . GLU A 1 50  ? -2.199  -18.313 6.911   1.00 0.00 ? 757 GLU A OE2  1  
ATOM 831   H H    . GLU A 1 50  ? -4.440  -13.686 5.976   1.00 0.00 ? 757 GLU A H    1  
ATOM 832   H HA   . GLU A 1 50  ? -5.855  -15.524 4.363   1.00 0.00 ? 757 GLU A HA   1  
ATOM 833   H HB2  . GLU A 1 50  ? -4.178  -17.172 4.935   1.00 0.00 ? 757 GLU A HB2  1  
ATOM 834   H HB3  . GLU A 1 50  ? -3.448  -15.577 4.728   1.00 0.00 ? 757 GLU A HB3  1  
ATOM 835   H HG2  . GLU A 1 50  ? -3.166  -15.291 7.047   1.00 0.00 ? 757 GLU A HG2  1  
ATOM 836   H HG3  . GLU A 1 50  ? -4.088  -16.752 7.402   1.00 0.00 ? 757 GLU A HG3  1  
ATOM 837   N N    . SER A 1 51  ? -6.583  -15.599 7.479   1.00 0.00 ? 758 SER A N    1  
ATOM 838   C CA   . SER A 1 51  ? -7.472  -16.118 8.475   1.00 0.00 ? 758 SER A CA   1  
ATOM 839   C C    . SER A 1 51  ? -8.945  -15.792 8.134   1.00 0.00 ? 758 SER A C    1  
ATOM 840   O O    . SER A 1 51  ? -9.854  -16.504 8.558   1.00 0.00 ? 758 SER A O    1  
ATOM 841   C CB   . SER A 1 51  ? -7.077  -15.551 9.846   1.00 0.00 ? 758 SER A CB   1  
ATOM 842   O OG   . SER A 1 51  ? -7.889  -16.050 10.892  1.00 0.00 ? 758 SER A OG   1  
ATOM 843   H H    . SER A 1 51  ? -6.066  -14.788 7.678   1.00 0.00 ? 758 SER A H    1  
ATOM 844   H HA   . SER A 1 51  ? -7.351  -17.191 8.502   1.00 0.00 ? 758 SER A HA   1  
ATOM 845   H HB2  . SER A 1 51  ? -6.053  -15.817 10.055  1.00 0.00 ? 758 SER A HB2  1  
ATOM 846   H HB3  . SER A 1 51  ? -7.170  -14.477 9.812   1.00 0.00 ? 758 SER A HB3  1  
ATOM 847   H HG   . SER A 1 51  ? -7.669  -16.977 11.044  1.00 0.00 ? 758 SER A HG   1  
ATOM 848   N N    . GLU A 1 52  ? -9.185  -14.749 7.335   1.00 0.00 ? 759 GLU A N    1  
ATOM 849   C CA   . GLU A 1 52  ? -10.564 -14.366 7.017   1.00 0.00 ? 759 GLU A CA   1  
ATOM 850   C C    . GLU A 1 52  ? -10.993 -14.966 5.691   1.00 0.00 ? 759 GLU A C    1  
ATOM 851   O O    . GLU A 1 52  ? -12.149 -14.861 5.300   1.00 0.00 ? 759 GLU A O    1  
ATOM 852   C CB   . GLU A 1 52  ? -10.766 -12.826 6.999   1.00 0.00 ? 759 GLU A CB   1  
ATOM 853   C CG   . GLU A 1 52  ? -9.964  -12.082 5.937   1.00 0.00 ? 759 GLU A CG   1  
ATOM 854   C CD   . GLU A 1 52  ? -10.273 -10.602 5.879   1.00 0.00 ? 759 GLU A CD   1  
ATOM 855   O OE1  . GLU A 1 52  ? -9.740  -9.832  6.717   1.00 0.00 ? 759 GLU A OE1  1  
ATOM 856   O OE2  . GLU A 1 52  ? -11.041 -10.172 4.979   1.00 0.00 ? 759 GLU A OE2  1  
ATOM 857   H H    . GLU A 1 52  ? -8.443  -14.252 6.927   1.00 0.00 ? 759 GLU A H    1  
ATOM 858   H HA   . GLU A 1 52  ? -11.190 -14.791 7.789   1.00 0.00 ? 759 GLU A HA   1  
ATOM 859   H HB2  . GLU A 1 52  ? -11.811 -12.617 6.821   1.00 0.00 ? 759 GLU A HB2  1  
ATOM 860   H HB3  . GLU A 1 52  ? -10.496 -12.431 7.966   1.00 0.00 ? 759 GLU A HB3  1  
ATOM 861   H HG2  . GLU A 1 52  ? -8.913  -12.203 6.149   1.00 0.00 ? 759 GLU A HG2  1  
ATOM 862   H HG3  . GLU A 1 52  ? -10.183 -12.520 4.974   1.00 0.00 ? 759 GLU A HG3  1  
ATOM 863   N N    . ILE A 1 53  ? -10.057 -15.602 5.012   1.00 0.00 ? 760 ILE A N    1  
ATOM 864   C CA   . ILE A 1 53  ? -10.314 -16.179 3.704   1.00 0.00 ? 760 ILE A CA   1  
ATOM 865   C C    . ILE A 1 53  ? -11.235 -17.382 3.815   1.00 0.00 ? 760 ILE A C    1  
ATOM 866   O O    . ILE A 1 53  ? -10.862 -18.417 4.360   1.00 0.00 ? 760 ILE A O    1  
ATOM 867   C CB   . ILE A 1 53  ? -8.995  -16.600 2.994   1.00 0.00 ? 760 ILE A CB   1  
ATOM 868   C CG1  . ILE A 1 53  ? -8.052  -15.406 2.819   1.00 0.00 ? 760 ILE A CG1  1  
ATOM 869   C CG2  . ILE A 1 53  ? -9.256  -17.284 1.664   1.00 0.00 ? 760 ILE A CG2  1  
ATOM 870   C CD1  . ILE A 1 53  ? -8.652  -14.233 2.066   1.00 0.00 ? 760 ILE A CD1  1  
ATOM 871   H H    . ILE A 1 53  ? -9.170  -15.700 5.415   1.00 0.00 ? 760 ILE A H    1  
ATOM 872   H HA   . ILE A 1 53  ? -10.805 -15.433 3.098   1.00 0.00 ? 760 ILE A HA   1  
ATOM 873   H HB   . ILE A 1 53  ? -8.518  -17.330 3.626   1.00 0.00 ? 760 ILE A HB   1  
ATOM 874   H HG12 . ILE A 1 53  ? -7.771  -15.040 3.794   1.00 0.00 ? 760 ILE A HG12 1  
ATOM 875   H HG13 . ILE A 1 53  ? -7.168  -15.725 2.287   1.00 0.00 ? 760 ILE A HG13 1  
ATOM 876   H HG21 . ILE A 1 53  ? -9.882  -18.149 1.824   1.00 0.00 ? 760 ILE A HG21 1  
ATOM 877   H HG22 . ILE A 1 53  ? -8.315  -17.596 1.236   1.00 0.00 ? 760 ILE A HG22 1  
ATOM 878   H HG23 . ILE A 1 53  ? -9.749  -16.597 0.995   1.00 0.00 ? 760 ILE A HG23 1  
ATOM 879   H HD11 . ILE A 1 53  ? -9.492  -13.836 2.616   1.00 0.00 ? 760 ILE A HD11 1  
ATOM 880   H HD12 . ILE A 1 53  ? -8.987  -14.566 1.095   1.00 0.00 ? 760 ILE A HD12 1  
ATOM 881   H HD13 . ILE A 1 53  ? -7.908  -13.462 1.938   1.00 0.00 ? 760 ILE A HD13 1  
ATOM 882   N N    . ASP A 1 54  ? -12.438 -17.216 3.335   1.00 0.00 ? 761 ASP A N    1  
ATOM 883   C CA   . ASP A 1 54  ? -13.410 -18.299 3.301   1.00 0.00 ? 761 ASP A CA   1  
ATOM 884   C C    . ASP A 1 54  ? -13.167 -19.204 2.107   1.00 0.00 ? 761 ASP A C    1  
ATOM 885   O O    . ASP A 1 54  ? -13.304 -20.419 2.197   1.00 0.00 ? 761 ASP A O    1  
ATOM 886   C CB   . ASP A 1 54  ? -14.831 -17.734 3.230   1.00 0.00 ? 761 ASP A CB   1  
ATOM 887   C CG   . ASP A 1 54  ? -15.872 -18.789 2.902   1.00 0.00 ? 761 ASP A CG   1  
ATOM 888   O OD1  . ASP A 1 54  ? -16.341 -19.496 3.814   1.00 0.00 ? 761 ASP A OD1  1  
ATOM 889   O OD2  . ASP A 1 54  ? -16.237 -18.918 1.714   1.00 0.00 ? 761 ASP A OD2  1  
ATOM 890   H H    . ASP A 1 54  ? -12.703 -16.326 3.021   1.00 0.00 ? 761 ASP A H    1  
ATOM 891   H HA   . ASP A 1 54  ? -13.313 -18.874 4.210   1.00 0.00 ? 761 ASP A HA   1  
ATOM 892   H HB2  . ASP A 1 54  ? -15.087 -17.295 4.183   1.00 0.00 ? 761 ASP A HB2  1  
ATOM 893   H HB3  . ASP A 1 54  ? -14.867 -16.972 2.467   1.00 0.00 ? 761 ASP A HB3  1  
ATOM 894   N N    . SER A 1 55  ? -12.760 -18.605 1.015   1.00 0.00 ? 762 SER A N    1  
ATOM 895   C CA   . SER A 1 55  ? -12.610 -19.277 -0.236  1.00 0.00 ? 762 SER A CA   1  
ATOM 896   C C    . SER A 1 55  ? -11.480 -18.648 -1.015  1.00 0.00 ? 762 SER A C    1  
ATOM 897   O O    . SER A 1 55  ? -11.155 -17.479 -0.797  1.00 0.00 ? 762 SER A O    1  
ATOM 898   C CB   . SER A 1 55  ? -13.920 -19.191 -1.018  1.00 0.00 ? 762 SER A CB   1  
ATOM 899   O OG   . SER A 1 55  ? -14.961 -19.944 -0.395  1.00 0.00 ? 762 SER A OG   1  
ATOM 900   H H    . SER A 1 55  ? -12.491 -17.665 1.031   1.00 0.00 ? 762 SER A H    1  
ATOM 901   H HA   . SER A 1 55  ? -12.364 -20.315 -0.086  1.00 0.00 ? 762 SER A HA   1  
ATOM 902   H HB2  . SER A 1 55  ? -14.227 -18.157 -1.071  1.00 0.00 ? 762 SER A HB2  1  
ATOM 903   H HB3  . SER A 1 55  ? -13.738 -19.565 -2.010  1.00 0.00 ? 762 SER A HB3  1  
ATOM 904   H HG   . SER A 1 55  ? -15.274 -19.498 0.411   1.00 0.00 ? 762 SER A HG   1  
ATOM 905   N N    . GLU A 1 56  ? -10.900 -19.421 -1.919  1.00 0.00 ? 763 GLU A N    1  
ATOM 906   C CA   . GLU A 1 56  ? -9.768  -19.029 -2.751  1.00 0.00 ? 763 GLU A CA   1  
ATOM 907   C C    . GLU A 1 56  ? -10.009 -17.686 -3.449  1.00 0.00 ? 763 GLU A C    1  
ATOM 908   O O    . GLU A 1 56  ? -9.093  -16.866 -3.544  1.00 0.00 ? 763 GLU A O    1  
ATOM 909   C CB   . GLU A 1 56  ? -9.499  -20.136 -3.771  1.00 0.00 ? 763 GLU A CB   1  
ATOM 910   C CG   . GLU A 1 56  ? -8.350  -19.874 -4.714  1.00 0.00 ? 763 GLU A CG   1  
ATOM 911   C CD   . GLU A 1 56  ? -8.215  -20.955 -5.745  1.00 0.00 ? 763 GLU A CD   1  
ATOM 912   O OE1  . GLU A 1 56  ? -8.995  -20.968 -6.707  1.00 0.00 ? 763 GLU A OE1  1  
ATOM 913   O OE2  . GLU A 1 56  ? -7.321  -21.813 -5.619  1.00 0.00 ? 763 GLU A OE2  1  
ATOM 914   H H    . GLU A 1 56  ? -11.241 -20.334 -2.039  1.00 0.00 ? 763 GLU A H    1  
ATOM 915   H HA   . GLU A 1 56  ? -8.898  -18.928 -2.120  1.00 0.00 ? 763 GLU A HA   1  
ATOM 916   H HB2  . GLU A 1 56  ? -9.283  -21.049 -3.236  1.00 0.00 ? 763 GLU A HB2  1  
ATOM 917   H HB3  . GLU A 1 56  ? -10.393 -20.289 -4.356  1.00 0.00 ? 763 GLU A HB3  1  
ATOM 918   H HG2  . GLU A 1 56  ? -8.522  -18.935 -5.217  1.00 0.00 ? 763 GLU A HG2  1  
ATOM 919   H HG3  . GLU A 1 56  ? -7.433  -19.817 -4.145  1.00 0.00 ? 763 GLU A HG3  1  
ATOM 920   N N    . GLU A 1 57  ? -11.252 -17.446 -3.866  1.00 0.00 ? 764 GLU A N    1  
ATOM 921   C CA   . GLU A 1 57  ? -11.618 -16.190 -4.532  1.00 0.00 ? 764 GLU A CA   1  
ATOM 922   C C    . GLU A 1 57  ? -11.320 -14.971 -3.673  1.00 0.00 ? 764 GLU A C    1  
ATOM 923   O O    . GLU A 1 57  ? -10.898 -13.942 -4.187  1.00 0.00 ? 764 GLU A O    1  
ATOM 924   C CB   . GLU A 1 57  ? -13.075 -16.170 -4.965  1.00 0.00 ? 764 GLU A CB   1  
ATOM 925   C CG   . GLU A 1 57  ? -13.386 -17.092 -6.119  1.00 0.00 ? 764 GLU A CG   1  
ATOM 926   C CD   . GLU A 1 57  ? -14.779 -16.920 -6.647  1.00 0.00 ? 764 GLU A CD   1  
ATOM 927   O OE1  . GLU A 1 57  ? -15.712 -17.557 -6.117  1.00 0.00 ? 764 GLU A OE1  1  
ATOM 928   O OE2  . GLU A 1 57  ? -14.966 -16.158 -7.627  1.00 0.00 ? 764 GLU A OE2  1  
ATOM 929   H H    . GLU A 1 57  ? -11.925 -18.148 -3.723  1.00 0.00 ? 764 GLU A H    1  
ATOM 930   H HA   . GLU A 1 57  ? -10.999 -16.121 -5.414  1.00 0.00 ? 764 GLU A HA   1  
ATOM 931   H HB2  . GLU A 1 57  ? -13.671 -16.482 -4.121  1.00 0.00 ? 764 GLU A HB2  1  
ATOM 932   H HB3  . GLU A 1 57  ? -13.340 -15.158 -5.225  1.00 0.00 ? 764 GLU A HB3  1  
ATOM 933   H HG2  . GLU A 1 57  ? -12.686 -16.895 -6.916  1.00 0.00 ? 764 GLU A HG2  1  
ATOM 934   H HG3  . GLU A 1 57  ? -13.265 -18.111 -5.784  1.00 0.00 ? 764 GLU A HG3  1  
ATOM 935   N N    . GLU A 1 58  ? -11.513 -15.108 -2.379  1.00 0.00 ? 765 GLU A N    1  
ATOM 936   C CA   . GLU A 1 58  ? -11.243 -14.036 -1.428  1.00 0.00 ? 765 GLU A CA   1  
ATOM 937   C C    . GLU A 1 58  ? -9.762  -13.723 -1.391  1.00 0.00 ? 765 GLU A C    1  
ATOM 938   O O    . GLU A 1 58  ? -9.356  -12.557 -1.368  1.00 0.00 ? 765 GLU A O    1  
ATOM 939   C CB   . GLU A 1 58  ? -11.715 -14.423 -0.025  1.00 0.00 ? 765 GLU A CB   1  
ATOM 940   C CG   . GLU A 1 58  ? -13.199 -14.651 0.080   1.00 0.00 ? 765 GLU A CG   1  
ATOM 941   C CD   . GLU A 1 58  ? -13.967 -13.457 -0.393  1.00 0.00 ? 765 GLU A CD   1  
ATOM 942   O OE1  . GLU A 1 58  ? -14.014 -12.442 0.321   1.00 0.00 ? 765 GLU A OE1  1  
ATOM 943   O OE2  . GLU A 1 58  ? -14.503 -13.498 -1.509  1.00 0.00 ? 765 GLU A OE2  1  
ATOM 944   H H    . GLU A 1 58  ? -11.855 -15.969 -2.062  1.00 0.00 ? 765 GLU A H    1  
ATOM 945   H HA   . GLU A 1 58  ? -11.783 -13.157 -1.747  1.00 0.00 ? 765 GLU A HA   1  
ATOM 946   H HB2  . GLU A 1 58  ? -11.217 -15.336 0.262   1.00 0.00 ? 765 GLU A HB2  1  
ATOM 947   H HB3  . GLU A 1 58  ? -11.437 -13.641 0.666   1.00 0.00 ? 765 GLU A HB3  1  
ATOM 948   H HG2  . GLU A 1 58  ? -13.463 -15.502 -0.531  1.00 0.00 ? 765 GLU A HG2  1  
ATOM 949   H HG3  . GLU A 1 58  ? -13.457 -14.851 1.109   1.00 0.00 ? 765 GLU A HG3  1  
ATOM 950   N N    . LEU A 1 59  ? -8.962  -14.772 -1.414  1.00 0.00 ? 766 LEU A N    1  
ATOM 951   C CA   . LEU A 1 59  ? -7.524  -14.644 -1.376  1.00 0.00 ? 766 LEU A CA   1  
ATOM 952   C C    . LEU A 1 59  ? -7.043  -13.968 -2.647  1.00 0.00 ? 766 LEU A C    1  
ATOM 953   O O    . LEU A 1 59  ? -6.318  -12.974 -2.595  1.00 0.00 ? 766 LEU A O    1  
ATOM 954   C CB   . LEU A 1 59  ? -6.872  -16.026 -1.218  1.00 0.00 ? 766 LEU A CB   1  
ATOM 955   C CG   . LEU A 1 59  ? -5.339  -16.054 -1.143  1.00 0.00 ? 766 LEU A CG   1  
ATOM 956   C CD1  . LEU A 1 59  ? -4.833  -15.314 0.091   1.00 0.00 ? 766 LEU A CD1  1  
ATOM 957   C CD2  . LEU A 1 59  ? -4.834  -17.486 -1.153  1.00 0.00 ? 766 LEU A CD2  1  
ATOM 958   H H    . LEU A 1 59  ? -9.365  -15.663 -1.473  1.00 0.00 ? 766 LEU A H    1  
ATOM 959   H HA   . LEU A 1 59  ? -7.262  -14.029 -0.528  1.00 0.00 ? 766 LEU A HA   1  
ATOM 960   H HB2  . LEU A 1 59  ? -7.270  -16.474 -0.319  1.00 0.00 ? 766 LEU A HB2  1  
ATOM 961   H HB3  . LEU A 1 59  ? -7.183  -16.632 -2.056  1.00 0.00 ? 766 LEU A HB3  1  
ATOM 962   H HG   . LEU A 1 59  ? -4.939  -15.550 -2.011  1.00 0.00 ? 766 LEU A HG   1  
ATOM 963   H HD11 . LEU A 1 59  ? -5.148  -14.282 0.051   1.00 0.00 ? 766 LEU A HD11 1  
ATOM 964   H HD12 . LEU A 1 59  ? -3.754  -15.359 0.119   1.00 0.00 ? 766 LEU A HD12 1  
ATOM 965   H HD13 . LEU A 1 59  ? -5.232  -15.779 0.980   1.00 0.00 ? 766 LEU A HD13 1  
ATOM 966   H HD21 . LEU A 1 59  ? -5.238  -18.019 -0.305  1.00 0.00 ? 766 LEU A HD21 1  
ATOM 967   H HD22 . LEU A 1 59  ? -3.756  -17.488 -1.097  1.00 0.00 ? 766 LEU A HD22 1  
ATOM 968   H HD23 . LEU A 1 59  ? -5.149  -17.972 -2.064  1.00 0.00 ? 766 LEU A HD23 1  
ATOM 969   N N    . ILE A 1 60  ? -7.499  -14.493 -3.777  1.00 0.00 ? 767 ILE A N    1  
ATOM 970   C CA   . ILE A 1 60  ? -7.152  -13.965 -5.094  1.00 0.00 ? 767 ILE A CA   1  
ATOM 971   C C    . ILE A 1 60  ? -7.551  -12.496 -5.198  1.00 0.00 ? 767 ILE A C    1  
ATOM 972   O O    . ILE A 1 60  ? -6.762  -11.657 -5.651  1.00 0.00 ? 767 ILE A O    1  
ATOM 973   C CB   . ILE A 1 60  ? -7.845  -14.771 -6.225  1.00 0.00 ? 767 ILE A CB   1  
ATOM 974   C CG1  . ILE A 1 60  ? -7.417  -16.242 -6.164  1.00 0.00 ? 767 ILE A CG1  1  
ATOM 975   C CG2  . ILE A 1 60  ? -7.515  -14.176 -7.591  1.00 0.00 ? 767 ILE A CG2  1  
ATOM 976   C CD1  . ILE A 1 60  ? -8.087  -17.125 -7.195  1.00 0.00 ? 767 ILE A CD1  1  
ATOM 977   H H    . ILE A 1 60  ? -8.092  -15.278 -3.718  1.00 0.00 ? 767 ILE A H    1  
ATOM 978   H HA   . ILE A 1 60  ? -6.082  -14.046 -5.212  1.00 0.00 ? 767 ILE A HA   1  
ATOM 979   H HB   . ILE A 1 60  ? -8.913  -14.712 -6.076  1.00 0.00 ? 767 ILE A HB   1  
ATOM 980   H HG12 . ILE A 1 60  ? -6.352  -16.302 -6.319  1.00 0.00 ? 767 ILE A HG12 1  
ATOM 981   H HG13 . ILE A 1 60  ? -7.651  -16.634 -5.185  1.00 0.00 ? 767 ILE A HG13 1  
ATOM 982   H HG21 . ILE A 1 60  ? -6.446  -14.187 -7.734  1.00 0.00 ? 767 ILE A HG21 1  
ATOM 983   H HG22 . ILE A 1 60  ? -7.879  -13.160 -7.643  1.00 0.00 ? 767 ILE A HG22 1  
ATOM 984   H HG23 . ILE A 1 60  ? -7.984  -14.768 -8.362  1.00 0.00 ? 767 ILE A HG23 1  
ATOM 985   H HD11 . ILE A 1 60  ? -7.875  -16.749 -8.185  1.00 0.00 ? 767 ILE A HD11 1  
ATOM 986   H HD12 . ILE A 1 60  ? -9.154  -17.127 -7.028  1.00 0.00 ? 767 ILE A HD12 1  
ATOM 987   H HD13 . ILE A 1 60  ? -7.711  -18.133 -7.109  1.00 0.00 ? 767 ILE A HD13 1  
ATOM 988   N N    . ASN A 1 61  ? -8.758  -12.188 -4.738  1.00 0.00 ? 768 ASN A N    1  
ATOM 989   C CA   . ASN A 1 61  ? -9.257  -10.837 -4.746  1.00 0.00 ? 768 ASN A CA   1  
ATOM 990   C C    . ASN A 1 61  ? -8.373  -9.925  -3.921  1.00 0.00 ? 768 ASN A C    1  
ATOM 991   O O    . ASN A 1 61  ? -7.922  -8.904  -4.410  1.00 0.00 ? 768 ASN A O    1  
ATOM 992   C CB   . ASN A 1 61  ? -10.705 -10.771 -4.240  1.00 0.00 ? 768 ASN A CB   1  
ATOM 993   C CG   . ASN A 1 61  ? -11.143 -9.354  -3.959  1.00 0.00 ? 768 ASN A CG   1  
ATOM 994   O OD1  . ASN A 1 61  ? -11.630 -8.649  -4.839  1.00 0.00 ? 768 ASN A OD1  1  
ATOM 995   N ND2  . ASN A 1 61  ? -10.985 -8.939  -2.721  1.00 0.00 ? 768 ASN A ND2  1  
ATOM 996   H H    . ASN A 1 61  ? -9.345  -12.887 -4.376  1.00 0.00 ? 768 ASN A H    1  
ATOM 997   H HA   . ASN A 1 61  ? -9.241  -10.498 -5.771  1.00 0.00 ? 768 ASN A HA   1  
ATOM 998   H HB2  . ASN A 1 61  ? -11.363 -11.193 -4.985  1.00 0.00 ? 768 ASN A HB2  1  
ATOM 999   H HB3  . ASN A 1 61  ? -10.787 -11.344 -3.329  1.00 0.00 ? 768 ASN A HB3  1  
ATOM 1000  H HD21 . ASN A 1 61  ? -10.614 -9.564  -2.060  1.00 0.00 ? 768 ASN A HD21 1  
ATOM 1001  H HD22 . ASN A 1 61  ? -11.212 -8.025  -2.472  1.00 0.00 ? 768 ASN A HD22 1  
ATOM 1002  N N    . LYS A 1 62  ? -8.102  -10.325 -2.686  1.00 0.00 ? 769 LYS A N    1  
ATOM 1003  C CA   . LYS A 1 62  ? -7.319  -9.523  -1.757  1.00 0.00 ? 769 LYS A CA   1  
ATOM 1004  C C    . LYS A 1 62  ? -5.957  -9.195  -2.377  1.00 0.00 ? 769 LYS A C    1  
ATOM 1005  O O    . LYS A 1 62  ? -5.539  -8.037  -2.398  1.00 0.00 ? 769 LYS A O    1  
ATOM 1006  C CB   . LYS A 1 62  ? -7.112  -10.301 -0.466  1.00 0.00 ? 769 LYS A CB   1  
ATOM 1007  C CG   . LYS A 1 62  ? -6.726  -9.436  0.715   1.00 0.00 ? 769 LYS A CG   1  
ATOM 1008  C CD   . LYS A 1 62  ? -7.928  -8.691  1.317   1.00 0.00 ? 769 LYS A CD   1  
ATOM 1009  C CE   . LYS A 1 62  ? -8.878  -9.654  2.037   1.00 0.00 ? 769 LYS A CE   1  
ATOM 1010  N NZ   . LYS A 1 62  ? -10.029 -8.964  2.655   1.00 0.00 ? 769 LYS A NZ   1  
ATOM 1011  H H    . LYS A 1 62  ? -8.437  -11.201 -2.386  1.00 0.00 ? 769 LYS A H    1  
ATOM 1012  H HA   . LYS A 1 62  ? -7.822  -8.593  -1.532  1.00 0.00 ? 769 LYS A HA   1  
ATOM 1013  H HB2  . LYS A 1 62  ? -8.022  -10.833 -0.232  1.00 0.00 ? 769 LYS A HB2  1  
ATOM 1014  H HB3  . LYS A 1 62  ? -6.324  -11.023 -0.628  1.00 0.00 ? 769 LYS A HB3  1  
ATOM 1015  H HG2  . LYS A 1 62  ? -6.311  -10.089 1.464   1.00 0.00 ? 769 LYS A HG2  1  
ATOM 1016  H HG3  . LYS A 1 62  ? -5.981  -8.723  0.397   1.00 0.00 ? 769 LYS A HG3  1  
ATOM 1017  H HD2  . LYS A 1 62  ? -7.569  -7.963  2.028   1.00 0.00 ? 769 LYS A HD2  1  
ATOM 1018  H HD3  . LYS A 1 62  ? -8.466  -8.190  0.526   1.00 0.00 ? 769 LYS A HD3  1  
ATOM 1019  H HE2  . LYS A 1 62  ? -9.265  -10.348 1.306   1.00 0.00 ? 769 LYS A HE2  1  
ATOM 1020  H HE3  . LYS A 1 62  ? -8.332  -10.191 2.798   1.00 0.00 ? 769 LYS A HE3  1  
ATOM 1021  H HZ1  . LYS A 1 62  ? -9.724  -8.145  3.219   1.00 0.00 ? 769 LYS A HZ1  1  
ATOM 1022  H HZ2  . LYS A 1 62  ? -10.523 -9.593  3.327   1.00 0.00 ? 769 LYS A HZ2  1  
ATOM 1023  H HZ3  . LYS A 1 62  ? -10.709 -8.646  1.934   1.00 0.00 ? 769 LYS A HZ3  1  
ATOM 1024  N N    . LYS A 1 63  ? -5.314  -10.227 -2.924  1.00 0.00 ? 770 LYS A N    1  
ATOM 1025  C CA   . LYS A 1 63  ? -4.018  -10.117 -3.585  1.00 0.00 ? 770 LYS A CA   1  
ATOM 1026  C C    . LYS A 1 63  ? -4.056  -9.150  -4.761  1.00 0.00 ? 770 LYS A C    1  
ATOM 1027  O O    . LYS A 1 63  ? -3.195  -8.278  -4.883  1.00 0.00 ? 770 LYS A O    1  
ATOM 1028  C CB   . LYS A 1 63  ? -3.546  -11.493 -4.066  1.00 0.00 ? 770 LYS A CB   1  
ATOM 1029  C CG   . LYS A 1 63  ? -3.272  -12.477 -2.942  1.00 0.00 ? 770 LYS A CG   1  
ATOM 1030  C CD   . LYS A 1 63  ? -2.985  -13.880 -3.451  1.00 0.00 ? 770 LYS A CD   1  
ATOM 1031  C CE   . LYS A 1 63  ? -1.764  -13.932 -4.355  1.00 0.00 ? 770 LYS A CE   1  
ATOM 1032  N NZ   . LYS A 1 63  ? -1.464  -15.317 -4.762  1.00 0.00 ? 770 LYS A NZ   1  
ATOM 1033  H H    . LYS A 1 63  ? -5.729  -11.115 -2.869  1.00 0.00 ? 770 LYS A H    1  
ATOM 1034  H HA   . LYS A 1 63  ? -3.308  -9.750  -2.859  1.00 0.00 ? 770 LYS A HA   1  
ATOM 1035  H HB2  . LYS A 1 63  ? -4.306  -11.913 -4.710  1.00 0.00 ? 770 LYS A HB2  1  
ATOM 1036  H HB3  . LYS A 1 63  ? -2.638  -11.364 -4.635  1.00 0.00 ? 770 LYS A HB3  1  
ATOM 1037  H HG2  . LYS A 1 63  ? -2.416  -12.134 -2.381  1.00 0.00 ? 770 LYS A HG2  1  
ATOM 1038  H HG3  . LYS A 1 63  ? -4.134  -12.507 -2.292  1.00 0.00 ? 770 LYS A HG3  1  
ATOM 1039  H HD2  . LYS A 1 63  ? -2.820  -14.532 -2.606  1.00 0.00 ? 770 LYS A HD2  1  
ATOM 1040  H HD3  . LYS A 1 63  ? -3.845  -14.229 -4.003  1.00 0.00 ? 770 LYS A HD3  1  
ATOM 1041  H HE2  . LYS A 1 63  ? -1.957  -13.341 -5.238  1.00 0.00 ? 770 LYS A HE2  1  
ATOM 1042  H HE3  . LYS A 1 63  ? -0.916  -13.522 -3.827  1.00 0.00 ? 770 LYS A HE3  1  
ATOM 1043  H HZ1  . LYS A 1 63  ? -0.674  -15.342 -5.436  1.00 0.00 ? 770 LYS A HZ1  1  
ATOM 1044  H HZ2  . LYS A 1 63  ? -2.284  -15.761 -5.224  1.00 0.00 ? 770 LYS A HZ2  1  
ATOM 1045  H HZ3  . LYS A 1 63  ? -1.201  -15.885 -3.931  1.00 0.00 ? 770 LYS A HZ3  1  
ATOM 1046  N N    . ARG A 1 64  ? -5.054  -9.280  -5.611  1.00 0.00 ? 771 ARG A N    1  
ATOM 1047  C CA   . ARG A 1 64  ? -5.126  -8.428  -6.779  1.00 0.00 ? 771 ARG A CA   1  
ATOM 1048  C C    . ARG A 1 64  ? -5.527  -6.993  -6.407  1.00 0.00 ? 771 ARG A C    1  
ATOM 1049  O O    . ARG A 1 64  ? -5.112  -6.043  -7.072  1.00 0.00 ? 771 ARG A O    1  
ATOM 1050  C CB   . ARG A 1 64  ? -6.025  -9.020  -7.883  1.00 0.00 ? 771 ARG A CB   1  
ATOM 1051  C CG   . ARG A 1 64  ? -7.502  -9.087  -7.554  1.00 0.00 ? 771 ARG A CG   1  
ATOM 1052  C CD   . ARG A 1 64  ? -8.288  -9.833  -8.626  1.00 0.00 ? 771 ARG A CD   1  
ATOM 1053  N NE   . ARG A 1 64  ? -8.126  -9.246  -9.970  1.00 0.00 ? 771 ARG A NE   1  
ATOM 1054  C CZ   . ARG A 1 64  ? -9.065  -9.238  -10.923 1.00 0.00 ? 771 ARG A CZ   1  
ATOM 1055  N NH1  . ARG A 1 64  ? -10.288 -9.676  -10.669 1.00 0.00 ? 771 ARG A NH1  1  
ATOM 1056  N NH2  . ARG A 1 64  ? -8.774  -8.777  -12.138 1.00 0.00 ? 771 ARG A NH2  1  
ATOM 1057  H H    . ARG A 1 64  ? -5.737  -9.970  -5.452  1.00 0.00 ? 771 ARG A H    1  
ATOM 1058  H HA   . ARG A 1 64  ? -4.113  -8.373  -7.153  1.00 0.00 ? 771 ARG A HA   1  
ATOM 1059  H HB2  . ARG A 1 64  ? -5.912  -8.421  -8.773  1.00 0.00 ? 771 ARG A HB2  1  
ATOM 1060  H HB3  . ARG A 1 64  ? -5.681  -10.021 -8.098  1.00 0.00 ? 771 ARG A HB3  1  
ATOM 1061  H HG2  . ARG A 1 64  ? -7.617  -9.597  -6.609  1.00 0.00 ? 771 ARG A HG2  1  
ATOM 1062  H HG3  . ARG A 1 64  ? -7.886  -8.081  -7.466  1.00 0.00 ? 771 ARG A HG3  1  
ATOM 1063  H HD2  . ARG A 1 64  ? -7.941  -10.855 -8.655  1.00 0.00 ? 771 ARG A HD2  1  
ATOM 1064  H HD3  . ARG A 1 64  ? -9.335  -9.818  -8.361  1.00 0.00 ? 771 ARG A HD3  1  
ATOM 1065  H HE   . ARG A 1 64  ? -7.232  -8.873  -10.158 1.00 0.00 ? 771 ARG A HE   1  
ATOM 1066  H HH11 . ARG A 1 64  ? -10.546 -10.025 -9.761  1.00 0.00 ? 771 ARG A HH11 1  
ATOM 1067  H HH12 . ARG A 1 64  ? -11.008 -9.690  -11.367 1.00 0.00 ? 771 ARG A HH12 1  
ATOM 1068  H HH21 . ARG A 1 64  ? -7.851  -8.438  -12.355 1.00 0.00 ? 771 ARG A HH21 1  
ATOM 1069  H HH22 . ARG A 1 64  ? -9.457  -8.766  -12.876 1.00 0.00 ? 771 ARG A HH22 1  
ATOM 1070  N N    . ILE A 1 65  ? -6.306  -6.836  -5.333  1.00 0.00 ? 772 ILE A N    1  
ATOM 1071  C CA   . ILE A 1 65  ? -6.700  -5.512  -4.853  1.00 0.00 ? 772 ILE A CA   1  
ATOM 1072  C C    . ILE A 1 65  ? -5.500  -4.769  -4.288  1.00 0.00 ? 772 ILE A C    1  
ATOM 1073  O O    . ILE A 1 65  ? -5.229  -3.644  -4.703  1.00 0.00 ? 772 ILE A O    1  
ATOM 1074  C CB   . ILE A 1 65  ? -7.846  -5.555  -3.789  1.00 0.00 ? 772 ILE A CB   1  
ATOM 1075  C CG1  . ILE A 1 65  ? -9.144  -6.119  -4.390  1.00 0.00 ? 772 ILE A CG1  1  
ATOM 1076  C CG2  . ILE A 1 65  ? -8.107  -4.163  -3.194  1.00 0.00 ? 772 ILE A CG2  1  
ATOM 1077  C CD1  . ILE A 1 65  ? -9.740  -5.284  -5.504  1.00 0.00 ? 772 ILE A CD1  1  
ATOM 1078  H H    . ILE A 1 65  ? -6.637  -7.635  -4.859  1.00 0.00 ? 772 ILE A H    1  
ATOM 1079  H HA   . ILE A 1 65  ? -7.047  -4.959  -5.714  1.00 0.00 ? 772 ILE A HA   1  
ATOM 1080  H HB   . ILE A 1 65  ? -7.524  -6.206  -2.988  1.00 0.00 ? 772 ILE A HB   1  
ATOM 1081  H HG12 . ILE A 1 65  ? -8.937  -7.098  -4.796  1.00 0.00 ? 772 ILE A HG12 1  
ATOM 1082  H HG13 . ILE A 1 65  ? -9.883  -6.220  -3.611  1.00 0.00 ? 772 ILE A HG13 1  
ATOM 1083  H HG21 . ILE A 1 65  ? -8.419  -3.489  -3.977  1.00 0.00 ? 772 ILE A HG21 1  
ATOM 1084  H HG22 . ILE A 1 65  ? -7.202  -3.786  -2.739  1.00 0.00 ? 772 ILE A HG22 1  
ATOM 1085  H HG23 . ILE A 1 65  ? -8.878  -4.224  -2.441  1.00 0.00 ? 772 ILE A HG23 1  
ATOM 1086  H HD11 . ILE A 1 65  ? -10.676 -5.719  -5.818  1.00 0.00 ? 772 ILE A HD11 1  
ATOM 1087  H HD12 . ILE A 1 65  ? -9.060  -5.264  -6.342  1.00 0.00 ? 772 ILE A HD12 1  
ATOM 1088  H HD13 . ILE A 1 65  ? -9.909  -4.277  -5.155  1.00 0.00 ? 772 ILE A HD13 1  
ATOM 1089  N N    . ILE A 1 66  ? -4.763  -5.411  -3.373  1.00 0.00 ? 773 ILE A N    1  
ATOM 1090  C CA   . ILE A 1 66  ? -3.587  -4.779  -2.762  1.00 0.00 ? 773 ILE A CA   1  
ATOM 1091  C C    . ILE A 1 66  ? -2.560  -4.410  -3.846  1.00 0.00 ? 773 ILE A C    1  
ATOM 1092  O O    . ILE A 1 66  ? -1.991  -3.321  -3.835  1.00 0.00 ? 773 ILE A O    1  
ATOM 1093  C CB   . ILE A 1 66  ? -2.948  -5.658  -1.608  1.00 0.00 ? 773 ILE A CB   1  
ATOM 1094  C CG1  . ILE A 1 66  ? -1.729  -4.980  -0.970  1.00 0.00 ? 773 ILE A CG1  1  
ATOM 1095  C CG2  . ILE A 1 66  ? -2.583  -7.049  -2.070  1.00 0.00 ? 773 ILE A CG2  1  
ATOM 1096  C CD1  . ILE A 1 66  ? -2.044  -3.696  -0.253  1.00 0.00 ? 773 ILE A CD1  1  
ATOM 1097  H H    . ILE A 1 66  ? -5.018  -6.324  -3.103  1.00 0.00 ? 773 ILE A H    1  
ATOM 1098  H HA   . ILE A 1 66  ? -3.946  -3.851  -2.337  1.00 0.00 ? 773 ILE A HA   1  
ATOM 1099  H HB   . ILE A 1 66  ? -3.705  -5.773  -0.847  1.00 0.00 ? 773 ILE A HB   1  
ATOM 1100  H HG12 . ILE A 1 66  ? -1.284  -5.654  -0.252  1.00 0.00 ? 773 ILE A HG12 1  
ATOM 1101  H HG13 . ILE A 1 66  ? -1.009  -4.761  -1.744  1.00 0.00 ? 773 ILE A HG13 1  
ATOM 1102  H HG21 . ILE A 1 66  ? -2.227  -7.623  -1.228  1.00 0.00 ? 773 ILE A HG21 1  
ATOM 1103  H HG22 . ILE A 1 66  ? -1.809  -6.990  -2.820  1.00 0.00 ? 773 ILE A HG22 1  
ATOM 1104  H HG23 . ILE A 1 66  ? -3.456  -7.529  -2.488  1.00 0.00 ? 773 ILE A HG23 1  
ATOM 1105  H HD11 . ILE A 1 66  ? -2.461  -2.989  -0.954  1.00 0.00 ? 773 ILE A HD11 1  
ATOM 1106  H HD12 . ILE A 1 66  ? -1.144  -3.292  0.184   1.00 0.00 ? 773 ILE A HD12 1  
ATOM 1107  H HD13 . ILE A 1 66  ? -2.769  -3.901  0.522   1.00 0.00 ? 773 ILE A HD13 1  
ATOM 1108  N N    . GLU A 1 67  ? -2.403  -5.301  -4.810  1.00 0.00 ? 774 GLU A N    1  
ATOM 1109  C CA   . GLU A 1 67  ? -1.527  -5.094  -5.940  1.00 0.00 ? 774 GLU A CA   1  
ATOM 1110  C C    . GLU A 1 67  ? -1.983  -3.888  -6.776  1.00 0.00 ? 774 GLU A C    1  
ATOM 1111  O O    . GLU A 1 67  ? -1.172  -3.031  -7.118  1.00 0.00 ? 774 GLU A O    1  
ATOM 1112  C CB   . GLU A 1 67  ? -1.494  -6.358  -6.782  1.00 0.00 ? 774 GLU A CB   1  
ATOM 1113  C CG   . GLU A 1 67  ? -0.620  -6.291  -8.009  1.00 0.00 ? 774 GLU A CG   1  
ATOM 1114  C CD   . GLU A 1 67  ? -0.567  -7.612  -8.699  1.00 0.00 ? 774 GLU A CD   1  
ATOM 1115  O OE1  . GLU A 1 67  ? -1.485  -7.921  -9.485  1.00 0.00 ? 774 GLU A OE1  1  
ATOM 1116  O OE2  . GLU A 1 67  ? 0.374   -8.388  -8.432  1.00 0.00 ? 774 GLU A OE2  1  
ATOM 1117  H H    . GLU A 1 67  ? -2.884  -6.152  -4.739  1.00 0.00 ? 774 GLU A H    1  
ATOM 1118  H HA   . GLU A 1 67  ? -0.534  -4.903  -5.562  1.00 0.00 ? 774 GLU A HA   1  
ATOM 1119  H HB2  . GLU A 1 67  ? -1.139  -7.174  -6.170  1.00 0.00 ? 774 GLU A HB2  1  
ATOM 1120  H HB3  . GLU A 1 67  ? -2.503  -6.581  -7.099  1.00 0.00 ? 774 GLU A HB3  1  
ATOM 1121  H HG2  . GLU A 1 67  ? -1.027  -5.557  -8.690  1.00 0.00 ? 774 GLU A HG2  1  
ATOM 1122  H HG3  . GLU A 1 67  ? 0.381   -6.004  -7.720  1.00 0.00 ? 774 GLU A HG3  1  
ATOM 1123  N N    . LYS A 1 68  ? -3.285  -3.814  -7.077  1.00 0.00 ? 775 LYS A N    1  
ATOM 1124  C CA   . LYS A 1 68  ? -3.820  -2.688  -7.853  1.00 0.00 ? 775 LYS A CA   1  
ATOM 1125  C C    . LYS A 1 68  ? -3.648  -1.378  -7.123  1.00 0.00 ? 775 LYS A C    1  
ATOM 1126  O O    . LYS A 1 68  ? -3.336  -0.369  -7.736  1.00 0.00 ? 775 LYS A O    1  
ATOM 1127  C CB   . LYS A 1 68  ? -5.291  -2.874  -8.249  1.00 0.00 ? 775 LYS A CB   1  
ATOM 1128  C CG   . LYS A 1 68  ? -5.526  -3.880  -9.367  1.00 0.00 ? 775 LYS A CG   1  
ATOM 1129  C CD   . LYS A 1 68  ? -6.999  -3.932  -9.777  1.00 0.00 ? 775 LYS A CD   1  
ATOM 1130  C CE   . LYS A 1 68  ? -7.891  -4.500  -8.680  1.00 0.00 ? 775 LYS A CE   1  
ATOM 1131  N NZ   . LYS A 1 68  ? -9.321  -4.423  -9.045  1.00 0.00 ? 775 LYS A NZ   1  
ATOM 1132  H H    . LYS A 1 68  ? -3.891  -4.523  -6.768  1.00 0.00 ? 775 LYS A H    1  
ATOM 1133  H HA   . LYS A 1 68  ? -3.226  -2.635  -8.753  1.00 0.00 ? 775 LYS A HA   1  
ATOM 1134  H HB2  . LYS A 1 68  ? -5.834  -3.207  -7.377  1.00 0.00 ? 775 LYS A HB2  1  
ATOM 1135  H HB3  . LYS A 1 68  ? -5.689  -1.919  -8.558  1.00 0.00 ? 775 LYS A HB3  1  
ATOM 1136  H HG2  . LYS A 1 68  ? -4.932  -3.595  -10.223 1.00 0.00 ? 775 LYS A HG2  1  
ATOM 1137  H HG3  . LYS A 1 68  ? -5.223  -4.856  -9.021  1.00 0.00 ? 775 LYS A HG3  1  
ATOM 1138  H HD2  . LYS A 1 68  ? -7.331  -2.929  -10.003 1.00 0.00 ? 775 LYS A HD2  1  
ATOM 1139  H HD3  . LYS A 1 68  ? -7.095  -4.542  -10.662 1.00 0.00 ? 775 LYS A HD3  1  
ATOM 1140  H HE2  . LYS A 1 68  ? -7.629  -5.535  -8.513  1.00 0.00 ? 775 LYS A HE2  1  
ATOM 1141  H HE3  . LYS A 1 68  ? -7.734  -3.939  -7.771  1.00 0.00 ? 775 LYS A HE3  1  
ATOM 1142  H HZ1  . LYS A 1 68  ? -9.506  -4.843  -9.976  1.00 0.00 ? 775 LYS A HZ1  1  
ATOM 1143  H HZ2  . LYS A 1 68  ? -9.634  -3.428  -9.049  1.00 0.00 ? 775 LYS A HZ2  1  
ATOM 1144  H HZ3  . LYS A 1 68  ? -9.920  -4.908  -8.347  1.00 0.00 ? 775 LYS A HZ3  1  
ATOM 1145  N N    . VAL A 1 69  ? -3.831  -1.403  -5.817  1.00 0.00 ? 776 VAL A N    1  
ATOM 1146  C CA   . VAL A 1 69  ? -3.661  -0.211  -5.017  1.00 0.00 ? 776 VAL A CA   1  
ATOM 1147  C C    . VAL A 1 69  ? -2.209  0.250   -5.044  1.00 0.00 ? 776 VAL A C    1  
ATOM 1148  O O    . VAL A 1 69  ? -1.946  1.409   -5.272  1.00 0.00 ? 776 VAL A O    1  
ATOM 1149  C CB   . VAL A 1 69  ? -4.179  -0.395  -3.565  1.00 0.00 ? 776 VAL A CB   1  
ATOM 1150  C CG1  . VAL A 1 69  ? -3.877  0.831   -2.704  1.00 0.00 ? 776 VAL A CG1  1  
ATOM 1151  C CG2  . VAL A 1 69  ? -5.677  -0.644  -3.589  1.00 0.00 ? 776 VAL A CG2  1  
ATOM 1152  H H    . VAL A 1 69  ? -4.093  -2.247  -5.385  1.00 0.00 ? 776 VAL A H    1  
ATOM 1153  H HA   . VAL A 1 69  ? -4.248  0.558   -5.499  1.00 0.00 ? 776 VAL A HA   1  
ATOM 1154  H HB   . VAL A 1 69  ? -3.701  -1.260  -3.130  1.00 0.00 ? 776 VAL A HB   1  
ATOM 1155  H HG11 . VAL A 1 69  ? -4.248  0.670   -1.703  1.00 0.00 ? 776 VAL A HG11 1  
ATOM 1156  H HG12 . VAL A 1 69  ? -4.359  1.699   -3.132  1.00 0.00 ? 776 VAL A HG12 1  
ATOM 1157  H HG13 . VAL A 1 69  ? -2.809  0.992   -2.673  1.00 0.00 ? 776 VAL A HG13 1  
ATOM 1158  H HG21 . VAL A 1 69  ? -5.884  -1.549  -4.140  1.00 0.00 ? 776 VAL A HG21 1  
ATOM 1159  H HG22 . VAL A 1 69  ? -6.167  0.188   -4.075  1.00 0.00 ? 776 VAL A HG22 1  
ATOM 1160  H HG23 . VAL A 1 69  ? -6.054  -0.738  -2.581  1.00 0.00 ? 776 VAL A HG23 1  
ATOM 1161  N N    . ILE A 1 70  ? -1.275  -0.675  -4.880  1.00 0.00 ? 777 ILE A N    1  
ATOM 1162  C CA   . ILE A 1 70  ? 0.149   -0.338  -4.933  1.00 0.00 ? 777 ILE A CA   1  
ATOM 1163  C C    . ILE A 1 70  ? 0.537   0.151   -6.336  1.00 0.00 ? 777 ILE A C    1  
ATOM 1164  O O    . ILE A 1 70  ? 1.294   1.123   -6.485  1.00 0.00 ? 777 ILE A O    1  
ATOM 1165  C CB   . ILE A 1 70  ? 1.036   -1.536  -4.505  1.00 0.00 ? 777 ILE A CB   1  
ATOM 1166  C CG1  . ILE A 1 70  ? 0.736   -1.889  -3.049  1.00 0.00 ? 777 ILE A CG1  1  
ATOM 1167  C CG2  . ILE A 1 70  ? 2.528   -1.215  -4.686  1.00 0.00 ? 777 ILE A CG2  1  
ATOM 1168  C CD1  . ILE A 1 70  ? 1.440   -3.123  -2.563  1.00 0.00 ? 777 ILE A CD1  1  
ATOM 1169  H H    . ILE A 1 70  ? -1.546  -1.604  -4.707  1.00 0.00 ? 777 ILE A H    1  
ATOM 1170  H HA   . ILE A 1 70  ? 0.306   0.479   -4.243  1.00 0.00 ? 777 ILE A HA   1  
ATOM 1171  H HB   . ILE A 1 70  ? 0.790   -2.387  -5.125  1.00 0.00 ? 777 ILE A HB   1  
ATOM 1172  H HG12 . ILE A 1 70  ? 1.041   -1.068  -2.415  1.00 0.00 ? 777 ILE A HG12 1  
ATOM 1173  H HG13 . ILE A 1 70  ? -0.327  -2.044  -2.939  1.00 0.00 ? 777 ILE A HG13 1  
ATOM 1174  H HG21 . ILE A 1 70  ? 3.117   -2.065  -4.375  1.00 0.00 ? 777 ILE A HG21 1  
ATOM 1175  H HG22 . ILE A 1 70  ? 2.791   -0.362  -4.078  1.00 0.00 ? 777 ILE A HG22 1  
ATOM 1176  H HG23 . ILE A 1 70  ? 2.731   -0.999  -5.724  1.00 0.00 ? 777 ILE A HG23 1  
ATOM 1177  H HD11 . ILE A 1 70  ? 1.213   -3.283  -1.519  1.00 0.00 ? 777 ILE A HD11 1  
ATOM 1178  H HD12 . ILE A 1 70  ? 2.507   -3.015  -2.692  1.00 0.00 ? 777 ILE A HD12 1  
ATOM 1179  H HD13 . ILE A 1 70  ? 1.084   -3.971  -3.132  1.00 0.00 ? 777 ILE A HD13 1  
ATOM 1180  N N    . HIS A 1 71  ? -0.003  -0.498  -7.352  1.00 0.00 ? 778 HIS A N    1  
ATOM 1181  C CA   . HIS A 1 71  ? 0.226   -0.093  -8.729  1.00 0.00 ? 778 HIS A CA   1  
ATOM 1182  C C    . HIS A 1 71  ? -0.326  1.316   -8.971  1.00 0.00 ? 778 HIS A C    1  
ATOM 1183  O O    . HIS A 1 71  ? 0.297   2.131   -9.656  1.00 0.00 ? 778 HIS A O    1  
ATOM 1184  C CB   . HIS A 1 71  ? -0.390  -1.117  -9.721  1.00 0.00 ? 778 HIS A CB   1  
ATOM 1185  C CG   . HIS A 1 71  ? -0.369  -0.671  -11.162 1.00 0.00 ? 778 HIS A CG   1  
ATOM 1186  N ND1  . HIS A 1 71  ? 0.781   -0.500  -11.899 1.00 0.00 ? 778 HIS A ND1  1  
ATOM 1187  C CD2  . HIS A 1 71  ? -1.391  -0.277  -11.962 1.00 0.00 ? 778 HIS A CD2  1  
ATOM 1188  C CE1  . HIS A 1 71  ? 0.437   -0.002  -13.092 1.00 0.00 ? 778 HIS A CE1  1  
ATOM 1189  N NE2  . HIS A 1 71  ? -0.878  0.148   -13.183 1.00 0.00 ? 778 HIS A NE2  1  
ATOM 1190  H H    . HIS A 1 71  ? -0.565  -1.285  -7.168  1.00 0.00 ? 778 HIS A H    1  
ATOM 1191  H HA   . HIS A 1 71  ? 1.294   -0.061  -8.878  1.00 0.00 ? 778 HIS A HA   1  
ATOM 1192  H HB2  . HIS A 1 71  ? 0.158   -2.045  -9.657  1.00 0.00 ? 778 HIS A HB2  1  
ATOM 1193  H HB3  . HIS A 1 71  ? -1.418  -1.294  -9.439  1.00 0.00 ? 778 HIS A HB3  1  
ATOM 1194  H HD1  . HIS A 1 71  ? 1.694   -0.723  -11.608 1.00 0.00 ? 778 HIS A HD1  1  
ATOM 1195  H HD2  . HIS A 1 71  ? -2.439  -0.299  -11.702 1.00 0.00 ? 778 HIS A HD2  1  
ATOM 1196  H HE1  . HIS A 1 71  ? 1.138   0.282   -13.864 1.00 0.00 ? 778 HIS A HE1  1  
ATOM 1197  N N    . ARG A 1 72  ? -1.465  1.598   -8.388  1.00 0.00 ? 779 ARG A N    1  
ATOM 1198  C CA   . ARG A 1 72  ? -2.095  2.875   -8.555  1.00 0.00 ? 779 ARG A CA   1  
ATOM 1199  C C    . ARG A 1 72  ? -1.297  3.944   -7.803  1.00 0.00 ? 779 ARG A C    1  
ATOM 1200  O O    . ARG A 1 72  ? -0.969  4.995   -8.354  1.00 0.00 ? 779 ARG A O    1  
ATOM 1201  C CB   . ARG A 1 72  ? -3.514  2.845   -8.022  1.00 0.00 ? 779 ARG A CB   1  
ATOM 1202  C CG   . ARG A 1 72  ? -4.388  3.934   -8.588  1.00 0.00 ? 779 ARG A CG   1  
ATOM 1203  C CD   . ARG A 1 72  ? -5.660  4.080   -7.807  1.00 0.00 ? 779 ARG A CD   1  
ATOM 1204  N NE   . ARG A 1 72  ? -5.446  4.840   -6.577  1.00 0.00 ? 779 ARG A NE   1  
ATOM 1205  C CZ   . ARG A 1 72  ? -6.357  5.062   -5.637  1.00 0.00 ? 779 ARG A CZ   1  
ATOM 1206  N NH1  . ARG A 1 72  ? -7.549  4.457   -5.699  1.00 0.00 ? 779 ARG A NH1  1  
ATOM 1207  N NH2  . ARG A 1 72  ? -6.078  5.898   -4.650  1.00 0.00 ? 779 ARG A NH2  1  
ATOM 1208  H H    . ARG A 1 72  ? -1.911  0.913   -7.840  1.00 0.00 ? 779 ARG A H    1  
ATOM 1209  H HA   . ARG A 1 72  ? -2.115  3.066   -9.615  1.00 0.00 ? 779 ARG A HA   1  
ATOM 1210  H HB2  . ARG A 1 72  ? -3.954  1.892   -8.274  1.00 0.00 ? 779 ARG A HB2  1  
ATOM 1211  H HB3  . ARG A 1 72  ? -3.487  2.952   -6.947  1.00 0.00 ? 779 ARG A HB3  1  
ATOM 1212  H HG2  . ARG A 1 72  ? -3.848  4.869   -8.551  1.00 0.00 ? 779 ARG A HG2  1  
ATOM 1213  H HG3  . ARG A 1 72  ? -4.625  3.696   -9.614  1.00 0.00 ? 779 ARG A HG3  1  
ATOM 1214  H HD2  . ARG A 1 72  ? -6.389  4.594   -8.416  1.00 0.00 ? 779 ARG A HD2  1  
ATOM 1215  H HD3  . ARG A 1 72  ? -6.031  3.098   -7.551  1.00 0.00 ? 779 ARG A HD3  1  
ATOM 1216  H HE   . ARG A 1 72  ? -4.549  5.272   -6.505  1.00 0.00 ? 779 ARG A HE   1  
ATOM 1217  H HH11 . ARG A 1 72  ? -7.758  3.839   -6.461  1.00 0.00 ? 779 ARG A HH11 1  
ATOM 1218  H HH12 . ARG A 1 72  ? -8.278  4.592   -5.028  1.00 0.00 ? 779 ARG A HH12 1  
ATOM 1219  H HH21 . ARG A 1 72  ? -5.177  6.372   -4.620  1.00 0.00 ? 779 ARG A HH21 1  
ATOM 1220  H HH22 . ARG A 1 72  ? -6.680  6.142   -3.883  1.00 0.00 ? 779 ARG A HH22 1  
ATOM 1221  N N    . LEU A 1 73  ? -0.966  3.620   -6.563  1.00 0.00 ? 780 LEU A N    1  
ATOM 1222  C CA   . LEU A 1 73  ? -0.220  4.459   -5.626  1.00 0.00 ? 780 LEU A CA   1  
ATOM 1223  C C    . LEU A 1 73  ? 1.064   4.983   -6.268  1.00 0.00 ? 780 LEU A C    1  
ATOM 1224  O O    . LEU A 1 73  ? 1.360   6.197   -6.237  1.00 0.00 ? 780 LEU A O    1  
ATOM 1225  C CB   . LEU A 1 73  ? 0.088   3.585   -4.367  1.00 0.00 ? 780 LEU A CB   1  
ATOM 1226  C CG   . LEU A 1 73  ? 0.807   4.197   -3.141  1.00 0.00 ? 780 LEU A CG   1  
ATOM 1227  C CD1  . LEU A 1 73  ? 0.656   3.257   -1.959  1.00 0.00 ? 780 LEU A CD1  1  
ATOM 1228  C CD2  . LEU A 1 73  ? 2.287   4.380   -3.395  1.00 0.00 ? 780 LEU A CD2  1  
ATOM 1229  H H    . LEU A 1 73  ? -1.269  2.749   -6.221  1.00 0.00 ? 780 LEU A H    1  
ATOM 1230  H HA   . LEU A 1 73  ? -0.855  5.276   -5.321  1.00 0.00 ? 780 LEU A HA   1  
ATOM 1231  H HB2  . LEU A 1 73  ? -0.853  3.193   -4.012  1.00 0.00 ? 780 LEU A HB2  1  
ATOM 1232  H HB3  . LEU A 1 73  ? 0.673   2.744   -4.711  1.00 0.00 ? 780 LEU A HB3  1  
ATOM 1233  H HG   . LEU A 1 73  ? 0.374   5.159   -2.906  1.00 0.00 ? 780 LEU A HG   1  
ATOM 1234  H HD11 . LEU A 1 73  ? 1.148   3.680   -1.095  1.00 0.00 ? 780 LEU A HD11 1  
ATOM 1235  H HD12 . LEU A 1 73  ? 1.114   2.309   -2.201  1.00 0.00 ? 780 LEU A HD12 1  
ATOM 1236  H HD13 . LEU A 1 73  ? -0.389  3.100   -1.741  1.00 0.00 ? 780 LEU A HD13 1  
ATOM 1237  H HD21 . LEU A 1 73  ? 2.742   3.420   -3.584  1.00 0.00 ? 780 LEU A HD21 1  
ATOM 1238  H HD22 . LEU A 1 73  ? 2.745   4.844   -2.534  1.00 0.00 ? 780 LEU A HD22 1  
ATOM 1239  H HD23 . LEU A 1 73  ? 2.406   5.013   -4.262  1.00 0.00 ? 780 LEU A HD23 1  
ATOM 1240  N N    . THR A 1 74  ? 1.786   4.077   -6.874  1.00 0.00 ? 781 THR A N    1  
ATOM 1241  C CA   . THR A 1 74  ? 3.078   4.357   -7.446  1.00 0.00 ? 781 THR A CA   1  
ATOM 1242  C C    . THR A 1 74  ? 2.989   5.177   -8.751  1.00 0.00 ? 781 THR A C    1  
ATOM 1243  O O    . THR A 1 74  ? 3.926   5.896   -9.099  1.00 0.00 ? 781 THR A O    1  
ATOM 1244  C CB   . THR A 1 74  ? 3.835   3.020   -7.699  1.00 0.00 ? 781 THR A CB   1  
ATOM 1245  O OG1  . THR A 1 74  ? 2.966   2.108   -8.395  1.00 0.00 ? 781 THR A OG1  1  
ATOM 1246  C CG2  . THR A 1 74  ? 4.269   2.365   -6.388  1.00 0.00 ? 781 THR A CG2  1  
ATOM 1247  H H    . THR A 1 74  ? 1.432   3.164   -6.947  1.00 0.00 ? 781 THR A H    1  
ATOM 1248  H HA   . THR A 1 74  ? 3.642   4.920   -6.717  1.00 0.00 ? 781 THR A HA   1  
ATOM 1249  H HB   . THR A 1 74  ? 4.704   3.220   -8.307  1.00 0.00 ? 781 THR A HB   1  
ATOM 1250  H HG1  . THR A 1 74  ? 2.464   1.613   -7.732  1.00 0.00 ? 781 THR A HG1  1  
ATOM 1251  H HG21 . THR A 1 74  ? 4.936   3.004   -5.834  1.00 0.00 ? 781 THR A HG21 1  
ATOM 1252  H HG22 . THR A 1 74  ? 4.769   1.433   -6.604  1.00 0.00 ? 781 THR A HG22 1  
ATOM 1253  H HG23 . THR A 1 74  ? 3.394   2.160   -5.789  1.00 0.00 ? 781 THR A HG23 1  
ATOM 1254  N N    . HIS A 1 75  ? 1.857   5.105   -9.432  1.00 0.00 ? 782 HIS A N    1  
ATOM 1255  C CA   . HIS A 1 75  ? 1.732   5.725   -10.749 1.00 0.00 ? 782 HIS A CA   1  
ATOM 1256  C C    . HIS A 1 75  ? 0.797   6.929   -10.791 1.00 0.00 ? 782 HIS A C    1  
ATOM 1257  O O    . HIS A 1 75  ? 1.152   7.974   -11.328 1.00 0.00 ? 782 HIS A O    1  
ATOM 1258  C CB   . HIS A 1 75  ? 1.298   4.685   -11.796 1.00 0.00 ? 782 HIS A CB   1  
ATOM 1259  C CG   . HIS A 1 75  ? 2.344   3.657   -12.102 1.00 0.00 ? 782 HIS A CG   1  
ATOM 1260  N ND1  . HIS A 1 75  ? 2.555   2.527   -11.352 1.00 0.00 ? 782 HIS A ND1  1  
ATOM 1261  C CD2  . HIS A 1 75  ? 3.253   3.616   -13.096 1.00 0.00 ? 782 HIS A CD2  1  
ATOM 1262  C CE1  . HIS A 1 75  ? 3.564   1.849   -11.892 1.00 0.00 ? 782 HIS A CE1  1  
ATOM 1263  N NE2  . HIS A 1 75  ? 4.030   2.468   -12.962 1.00 0.00 ? 782 HIS A NE2  1  
ATOM 1264  H H    . HIS A 1 75  ? 1.101   4.619   -9.039  1.00 0.00 ? 782 HIS A H    1  
ATOM 1265  H HA   . HIS A 1 75  ? 2.719   6.064   -11.028 1.00 0.00 ? 782 HIS A HA   1  
ATOM 1266  H HB2  . HIS A 1 75  ? 0.428   4.162   -11.426 1.00 0.00 ? 782 HIS A HB2  1  
ATOM 1267  H HB3  . HIS A 1 75  ? 1.036   5.185   -12.716 1.00 0.00 ? 782 HIS A HB3  1  
ATOM 1268  H HD1  . HIS A 1 75  ? 2.049   2.274   -10.545 1.00 0.00 ? 782 HIS A HD1  1  
ATOM 1269  H HD2  . HIS A 1 75  ? 3.361   4.347   -13.884 1.00 0.00 ? 782 HIS A HD2  1  
ATOM 1270  H HE1  . HIS A 1 75  ? 3.948   0.916   -11.507 1.00 0.00 ? 782 HIS A HE1  1  
ATOM 1271  N N    . TYR A 1 76  ? -0.374  6.799   -10.230 1.00 0.00 ? 783 TYR A N    1  
ATOM 1272  C CA   . TYR A 1 76  ? -1.398  7.827   -10.354 1.00 0.00 ? 783 TYR A CA   1  
ATOM 1273  C C    . TYR A 1 76  ? -1.378  8.729   -9.147  1.00 0.00 ? 783 TYR A C    1  
ATOM 1274  O O    . TYR A 1 76  ? -1.170  9.938   -9.273  1.00 0.00 ? 783 TYR A O    1  
ATOM 1275  C CB   . TYR A 1 76  ? -2.795  7.194   -10.492 1.00 0.00 ? 783 TYR A CB   1  
ATOM 1276  C CG   . TYR A 1 76  ? -2.918  6.157   -11.590 1.00 0.00 ? 783 TYR A CG   1  
ATOM 1277  C CD1  . TYR A 1 76  ? -2.425  4.886   -11.395 1.00 0.00 ? 783 TYR A CD1  1  
ATOM 1278  C CD2  . TYR A 1 76  ? -3.538  6.437   -12.798 1.00 0.00 ? 783 TYR A CD2  1  
ATOM 1279  C CE1  . TYR A 1 76  ? -2.529  3.914   -12.347 1.00 0.00 ? 783 TYR A CE1  1  
ATOM 1280  C CE2  . TYR A 1 76  ? -3.647  5.461   -13.774 1.00 0.00 ? 783 TYR A CE2  1  
ATOM 1281  C CZ   . TYR A 1 76  ? -3.136  4.202   -13.536 1.00 0.00 ? 783 TYR A CZ   1  
ATOM 1282  O OH   . TYR A 1 76  ? -3.244  3.221   -14.492 1.00 0.00 ? 783 TYR A OH   1  
ATOM 1283  H H    . TYR A 1 76  ? -0.568  6.002   -9.685  1.00 0.00 ? 783 TYR A H    1  
ATOM 1284  H HA   . TYR A 1 76  ? -1.191  8.410   -11.239 1.00 0.00 ? 783 TYR A HA   1  
ATOM 1285  H HB2  . TYR A 1 76  ? -3.050  6.712   -9.560  1.00 0.00 ? 783 TYR A HB2  1  
ATOM 1286  H HB3  . TYR A 1 76  ? -3.517  7.974   -10.685 1.00 0.00 ? 783 TYR A HB3  1  
ATOM 1287  H HD1  . TYR A 1 76  ? -1.940  4.691   -10.452 1.00 0.00 ? 783 TYR A HD1  1  
ATOM 1288  H HD2  . TYR A 1 76  ? -3.932  7.426   -12.977 1.00 0.00 ? 783 TYR A HD2  1  
ATOM 1289  H HE1  . TYR A 1 76  ? -2.132  2.928   -12.157 1.00 0.00 ? 783 TYR A HE1  1  
ATOM 1290  H HE2  . TYR A 1 76  ? -4.128  5.685   -14.715 1.00 0.00 ? 783 TYR A HE2  1  
ATOM 1291  H HH   . TYR A 1 76  ? -3.427  2.384   -14.051 1.00 0.00 ? 783 TYR A HH   1  
ATOM 1292  N N    . ASP A 1 77  ? -1.570  8.123   -7.978  1.00 0.00 ? 784 ASP A N    1  
ATOM 1293  C CA   . ASP A 1 77  ? -1.643  8.843   -6.690  1.00 0.00 ? 784 ASP A CA   1  
ATOM 1294  C C    . ASP A 1 77  ? -0.432  9.725   -6.486  1.00 0.00 ? 784 ASP A C    1  
ATOM 1295  O O    . ASP A 1 77  ? -0.561  10.932  -6.221  1.00 0.00 ? 784 ASP A O    1  
ATOM 1296  C CB   . ASP A 1 77  ? -1.723  7.863   -5.511  1.00 0.00 ? 784 ASP A CB   1  
ATOM 1297  C CG   . ASP A 1 77  ? -2.972  7.012   -5.484  1.00 0.00 ? 784 ASP A CG   1  
ATOM 1298  O OD1  . ASP A 1 77  ? -3.129  6.141   -6.356  1.00 0.00 ? 784 ASP A OD1  1  
ATOM 1299  O OD2  . ASP A 1 77  ? -3.791  7.169   -4.567  1.00 0.00 ? 784 ASP A OD2  1  
ATOM 1300  H H    . ASP A 1 77  ? -1.686  7.145   -7.969  1.00 0.00 ? 784 ASP A H    1  
ATOM 1301  H HA   . ASP A 1 77  ? -2.534  9.452   -6.694  1.00 0.00 ? 784 ASP A HA   1  
ATOM 1302  H HB2  . ASP A 1 77  ? -0.863  7.214   -5.553  1.00 0.00 ? 784 ASP A HB2  1  
ATOM 1303  H HB3  . ASP A 1 77  ? -1.676  8.431   -4.594  1.00 0.00 ? 784 ASP A HB3  1  
ATOM 1304  N N    . HIS A 1 78  ? 0.751   9.108   -6.619  1.00 0.00 ? 785 HIS A N    1  
ATOM 1305  C CA   . HIS A 1 78  ? 2.054   9.771   -6.441  1.00 0.00 ? 785 HIS A CA   1  
ATOM 1306  C C    . HIS A 1 78  ? 2.236   10.120  -4.956  1.00 0.00 ? 785 HIS A C    1  
ATOM 1307  O O    . HIS A 1 78  ? 2.976   11.018  -4.569  1.00 0.00 ? 785 HIS A O    1  
ATOM 1308  C CB   . HIS A 1 78  ? 2.199   11.013  -7.366  1.00 0.00 ? 785 HIS A CB   1  
ATOM 1309  C CG   . HIS A 1 78  ? 3.598   11.579  -7.459  1.00 0.00 ? 785 HIS A CG   1  
ATOM 1310  N ND1  . HIS A 1 78  ? 4.012   12.727  -6.820  1.00 0.00 ? 785 HIS A ND1  1  
ATOM 1311  C CD2  . HIS A 1 78  ? 4.674   11.133  -8.153  1.00 0.00 ? 785 HIS A CD2  1  
ATOM 1312  C CE1  . HIS A 1 78  ? 5.292   12.942  -7.134  1.00 0.00 ? 785 HIS A CE1  1  
ATOM 1313  N NE2  . HIS A 1 78  ? 5.745   11.999  -7.945  1.00 0.00 ? 785 HIS A NE2  1  
ATOM 1314  H H    . HIS A 1 78  ? 0.740   8.150   -6.840  1.00 0.00 ? 785 HIS A H    1  
ATOM 1315  H HA   . HIS A 1 78  ? 2.806   9.035   -6.690  1.00 0.00 ? 785 HIS A HA   1  
ATOM 1316  H HB2  . HIS A 1 78  ? 1.891   10.741  -8.363  1.00 0.00 ? 785 HIS A HB2  1  
ATOM 1317  H HB3  . HIS A 1 78  ? 1.545   11.788  -6.997  1.00 0.00 ? 785 HIS A HB3  1  
ATOM 1318  H HD1  . HIS A 1 78  ? 3.464   13.286  -6.227  1.00 0.00 ? 785 HIS A HD1  1  
ATOM 1319  H HD2  . HIS A 1 78  ? 4.707   10.249  -8.772  1.00 0.00 ? 785 HIS A HD2  1  
ATOM 1320  H HE1  . HIS A 1 78  ? 5.879   13.774  -6.771  1.00 0.00 ? 785 HIS A HE1  1  
ATOM 1321  N N    . VAL A 1 79  ? 1.592   9.334   -4.123  1.00 0.00 ? 786 VAL A N    1  
ATOM 1322  C CA   . VAL A 1 79  ? 1.711   9.474   -2.679  1.00 0.00 ? 786 VAL A CA   1  
ATOM 1323  C C    . VAL A 1 79  ? 2.897   8.646   -2.184  1.00 0.00 ? 786 VAL A C    1  
ATOM 1324  O O    . VAL A 1 79  ? 3.079   8.428   -0.994  1.00 0.00 ? 786 VAL A O    1  
ATOM 1325  C CB   . VAL A 1 79  ? 0.415   9.048   -1.950  1.00 0.00 ? 786 VAL A CB   1  
ATOM 1326  C CG1  . VAL A 1 79  ? -0.736  9.975   -2.311  1.00 0.00 ? 786 VAL A CG1  1  
ATOM 1327  C CG2  . VAL A 1 79  ? 0.061   7.609   -2.271  1.00 0.00 ? 786 VAL A CG2  1  
ATOM 1328  H H    . VAL A 1 79  ? 1.009   8.639   -4.496  1.00 0.00 ? 786 VAL A H    1  
ATOM 1329  H HA   . VAL A 1 79  ? 1.911   10.515  -2.474  1.00 0.00 ? 786 VAL A HA   1  
ATOM 1330  H HB   . VAL A 1 79  ? 0.591   9.126   -0.887  1.00 0.00 ? 786 VAL A HB   1  
ATOM 1331  H HG11 . VAL A 1 79  ? -1.641  9.643   -1.822  1.00 0.00 ? 786 VAL A HG11 1  
ATOM 1332  H HG12 . VAL A 1 79  ? -0.881  9.976   -3.381  1.00 0.00 ? 786 VAL A HG12 1  
ATOM 1333  H HG13 . VAL A 1 79  ? -0.501  10.978  -1.985  1.00 0.00 ? 786 VAL A HG13 1  
ATOM 1334  H HG21 . VAL A 1 79  ? -0.856  7.343   -1.769  1.00 0.00 ? 786 VAL A HG21 1  
ATOM 1335  H HG22 . VAL A 1 79  ? 0.860   6.969   -1.927  1.00 0.00 ? 786 VAL A HG22 1  
ATOM 1336  H HG23 . VAL A 1 79  ? -0.061  7.492   -3.338  1.00 0.00 ? 786 VAL A HG23 1  
ATOM 1337  N N    . LEU A 1 80  ? 3.669   8.190   -3.133  1.00 0.00 ? 787 LEU A N    1  
ATOM 1338  C CA   . LEU A 1 80  ? 4.864   7.437   -2.905  1.00 0.00 ? 787 LEU A CA   1  
ATOM 1339  C C    . LEU A 1 80  ? 6.046   8.385   -2.825  1.00 0.00 ? 787 LEU A C    1  
ATOM 1340  O O    . LEU A 1 80  ? 6.176   9.286   -3.655  1.00 0.00 ? 787 LEU A O    1  
ATOM 1341  C CB   . LEU A 1 80  ? 5.092   6.525   -4.094  1.00 0.00 ? 787 LEU A CB   1  
ATOM 1342  C CG   . LEU A 1 80  ? 6.262   5.567   -3.998  1.00 0.00 ? 787 LEU A CG   1  
ATOM 1343  C CD1  . LEU A 1 80  ? 5.972   4.446   -3.020  1.00 0.00 ? 787 LEU A CD1  1  
ATOM 1344  C CD2  . LEU A 1 80  ? 6.620   5.045   -5.366  1.00 0.00 ? 787 LEU A CD2  1  
ATOM 1345  H H    . LEU A 1 80  ? 3.409   8.376   -4.056  1.00 0.00 ? 787 LEU A H    1  
ATOM 1346  H HA   . LEU A 1 80  ? 4.770   6.836   -2.014  1.00 0.00 ? 787 LEU A HA   1  
ATOM 1347  H HB2  . LEU A 1 80  ? 4.199   5.941   -4.248  1.00 0.00 ? 787 LEU A HB2  1  
ATOM 1348  H HB3  . LEU A 1 80  ? 5.242   7.148   -4.963  1.00 0.00 ? 787 LEU A HB3  1  
ATOM 1349  H HG   . LEU A 1 80  ? 7.112   6.113   -3.614  1.00 0.00 ? 787 LEU A HG   1  
ATOM 1350  H HD11 . LEU A 1 80  ? 5.083   3.919   -3.331  1.00 0.00 ? 787 LEU A HD11 1  
ATOM 1351  H HD12 . LEU A 1 80  ? 5.827   4.851   -2.028  1.00 0.00 ? 787 LEU A HD12 1  
ATOM 1352  H HD13 . LEU A 1 80  ? 6.804   3.762   -3.007  1.00 0.00 ? 787 LEU A HD13 1  
ATOM 1353  H HD21 . LEU A 1 80  ? 5.731   4.706   -5.872  1.00 0.00 ? 787 LEU A HD21 1  
ATOM 1354  H HD22 . LEU A 1 80  ? 7.313   4.223   -5.273  1.00 0.00 ? 787 LEU A HD22 1  
ATOM 1355  H HD23 . LEU A 1 80  ? 7.080   5.836   -5.941  1.00 0.00 ? 787 LEU A HD23 1  
ATOM 1356  N N    . ILE A 1 81  ? 6.876   8.196   -1.847  1.00 0.00 ? 788 ILE A N    1  
ATOM 1357  C CA   . ILE A 1 81  ? 8.093   8.957   -1.720  1.00 0.00 ? 788 ILE A CA   1  
ATOM 1358  C C    . ILE A 1 81  ? 9.245   7.972   -1.859  1.00 0.00 ? 788 ILE A C    1  
ATOM 1359  O O    . ILE A 1 81  ? 9.215   6.902   -1.251  1.00 0.00 ? 788 ILE A O    1  
ATOM 1360  C CB   . ILE A 1 81  ? 8.226   9.746   -0.351  1.00 0.00 ? 788 ILE A CB   1  
ATOM 1361  C CG1  . ILE A 1 81  ? 7.048   10.717  -0.089  1.00 0.00 ? 788 ILE A CG1  1  
ATOM 1362  C CG2  . ILE A 1 81  ? 9.540   10.516  -0.286  1.00 0.00 ? 788 ILE A CG2  1  
ATOM 1363  C CD1  . ILE A 1 81  ? 5.753   10.065  0.364   1.00 0.00 ? 788 ILE A CD1  1  
ATOM 1364  H H    . ILE A 1 81  ? 6.675   7.494   -1.186  1.00 0.00 ? 788 ILE A H    1  
ATOM 1365  H HA   . ILE A 1 81  ? 8.137   9.646   -2.549  1.00 0.00 ? 788 ILE A HA   1  
ATOM 1366  H HB   . ILE A 1 81  ? 8.267   9.023   0.446   1.00 0.00 ? 788 ILE A HB   1  
ATOM 1367  H HG12 . ILE A 1 81  ? 7.336   11.425  0.672   1.00 0.00 ? 788 ILE A HG12 1  
ATOM 1368  H HG13 . ILE A 1 81  ? 6.845   11.256  -1.003  1.00 0.00 ? 788 ILE A HG13 1  
ATOM 1369  H HG21 . ILE A 1 81  ? 9.617   11.017  0.667   1.00 0.00 ? 788 ILE A HG21 1  
ATOM 1370  H HG22 . ILE A 1 81  ? 9.558   11.252  -1.076  1.00 0.00 ? 788 ILE A HG22 1  
ATOM 1371  H HG23 . ILE A 1 81  ? 10.370  9.836   -0.409  1.00 0.00 ? 788 ILE A HG23 1  
ATOM 1372  H HD11 . ILE A 1 81  ? 5.928   9.524   1.283   1.00 0.00 ? 788 ILE A HD11 1  
ATOM 1373  H HD12 . ILE A 1 81  ? 5.411   9.382   -0.400  1.00 0.00 ? 788 ILE A HD12 1  
ATOM 1374  H HD13 . ILE A 1 81  ? 5.005   10.826  0.529   1.00 0.00 ? 788 ILE A HD13 1  
ATOM 1375  N N    . GLU A 1 82  ? 10.206  8.304   -2.683  1.00 0.00 ? 789 GLU A N    1  
ATOM 1376  C CA   . GLU A 1 82  ? 11.357  7.454   -2.932  1.00 0.00 ? 789 GLU A CA   1  
ATOM 1377  C C    . GLU A 1 82  ? 12.585  8.345   -3.161  1.00 0.00 ? 789 GLU A C    1  
ATOM 1378  O O    . GLU A 1 82  ? 12.428  9.483   -3.607  1.00 0.00 ? 789 GLU A O    1  
ATOM 1379  C CB   . GLU A 1 82  ? 11.079  6.534   -4.138  1.00 0.00 ? 789 GLU A CB   1  
ATOM 1380  C CG   . GLU A 1 82  ? 10.675  7.249   -5.428  1.00 0.00 ? 789 GLU A CG   1  
ATOM 1381  C CD   . GLU A 1 82  ? 10.510  6.300   -6.604  1.00 0.00 ? 789 GLU A CD   1  
ATOM 1382  O OE1  . GLU A 1 82  ? 9.467   5.636   -6.716  1.00 0.00 ? 789 GLU A OE1  1  
ATOM 1383  O OE2  . GLU A 1 82  ? 11.418  6.224   -7.461  1.00 0.00 ? 789 GLU A OE2  1  
ATOM 1384  H H    . GLU A 1 82  ? 10.175  9.165   -3.149  1.00 0.00 ? 789 GLU A H    1  
ATOM 1385  H HA   . GLU A 1 82  ? 11.522  6.856   -2.048  1.00 0.00 ? 789 GLU A HA   1  
ATOM 1386  H HB2  . GLU A 1 82  ? 11.979  5.974   -4.330  1.00 0.00 ? 789 GLU A HB2  1  
ATOM 1387  H HB3  . GLU A 1 82  ? 10.292  5.845   -3.867  1.00 0.00 ? 789 GLU A HB3  1  
ATOM 1388  H HG2  . GLU A 1 82  ? 9.736   7.756   -5.263  1.00 0.00 ? 789 GLU A HG2  1  
ATOM 1389  H HG3  . GLU A 1 82  ? 11.435  7.978   -5.670  1.00 0.00 ? 789 GLU A HG3  1  
ATOM 1390  N N    . LEU A 1 83  ? 13.793  7.878   -2.821  1.00 0.00 ? 790 LEU A N    1  
ATOM 1391  C CA   . LEU A 1 83  ? 14.970  8.757   -2.960  1.00 0.00 ? 790 LEU A CA   1  
ATOM 1392  C C    . LEU A 1 83  ? 15.955  8.414   -4.094  1.00 0.00 ? 790 LEU A C    1  
ATOM 1393  O O    . LEU A 1 83  ? 16.013  9.140   -5.085  1.00 0.00 ? 790 LEU A O    1  
ATOM 1394  C CB   . LEU A 1 83  ? 15.723  8.989   -1.632  1.00 0.00 ? 790 LEU A CB   1  
ATOM 1395  C CG   . LEU A 1 83  ? 14.987  9.800   -0.543  1.00 0.00 ? 790 LEU A CG   1  
ATOM 1396  C CD1  . LEU A 1 83  ? 15.902  10.044  0.653   1.00 0.00 ? 790 LEU A CD1  1  
ATOM 1397  C CD2  . LEU A 1 83  ? 14.477  11.130  -1.091  1.00 0.00 ? 790 LEU A CD2  1  
ATOM 1398  H H    . LEU A 1 83  ? 13.893  6.959   -2.484  1.00 0.00 ? 790 LEU A H    1  
ATOM 1399  H HA   . LEU A 1 83  ? 14.553  9.710   -3.249  1.00 0.00 ? 790 LEU A HA   1  
ATOM 1400  H HB2  . LEU A 1 83  ? 15.955  8.019   -1.218  1.00 0.00 ? 790 LEU A HB2  1  
ATOM 1401  H HB3  . LEU A 1 83  ? 16.651  9.493   -1.857  1.00 0.00 ? 790 LEU A HB3  1  
ATOM 1402  H HG   . LEU A 1 83  ? 14.140  9.227   -0.193  1.00 0.00 ? 790 LEU A HG   1  
ATOM 1403  H HD11 . LEU A 1 83  ? 15.359  10.588  1.412   1.00 0.00 ? 790 LEU A HD11 1  
ATOM 1404  H HD12 . LEU A 1 83  ? 16.748  10.635  0.335   1.00 0.00 ? 790 LEU A HD12 1  
ATOM 1405  H HD13 . LEU A 1 83  ? 16.255  9.110   1.059   1.00 0.00 ? 790 LEU A HD13 1  
ATOM 1406  H HD21 . LEU A 1 83  ? 14.018  11.693  -0.292  1.00 0.00 ? 790 LEU A HD21 1  
ATOM 1407  H HD22 . LEU A 1 83  ? 13.739  10.947  -1.857  1.00 0.00 ? 790 LEU A HD22 1  
ATOM 1408  H HD23 . LEU A 1 83  ? 15.300  11.693  -1.506  1.00 0.00 ? 790 LEU A HD23 1  
ATOM 1409  N N    . THR A 1 84  ? 16.722  7.336   -3.959  1.00 0.00 ? 791 THR A N    1  
ATOM 1410  C CA   . THR A 1 84  ? 17.813  7.070   -4.901  1.00 0.00 ? 791 THR A CA   1  
ATOM 1411  C C    . THR A 1 84  ? 17.363  6.540   -6.258  1.00 0.00 ? 791 THR A C    1  
ATOM 1412  O O    . THR A 1 84  ? 17.023  7.297   -7.169  1.00 0.00 ? 791 THR A O    1  
ATOM 1413  C CB   . THR A 1 84  ? 18.917  6.150   -4.288  1.00 0.00 ? 791 THR A CB   1  
ATOM 1414  O OG1  . THR A 1 84  ? 18.353  4.875   -3.892  1.00 0.00 ? 791 THR A OG1  1  
ATOM 1415  C CG2  . THR A 1 84  ? 19.571  6.819   -3.083  1.00 0.00 ? 791 THR A CG2  1  
ATOM 1416  H H    . THR A 1 84  ? 16.555  6.694   -3.225  1.00 0.00 ? 791 THR A H    1  
ATOM 1417  H HA   . THR A 1 84  ? 18.287  8.004   -5.139  1.00 0.00 ? 791 THR A HA   1  
ATOM 1418  H HB   . THR A 1 84  ? 19.666  5.973   -5.046  1.00 0.00 ? 791 THR A HB   1  
ATOM 1419  H HG1  . THR A 1 84  ? 17.713  5.054   -3.177  1.00 0.00 ? 791 THR A HG1  1  
ATOM 1420  H HG21 . THR A 1 84  ? 20.038  7.742   -3.395  1.00 0.00 ? 791 THR A HG21 1  
ATOM 1421  H HG22 . THR A 1 84  ? 20.317  6.161   -2.661  1.00 0.00 ? 791 THR A HG22 1  
ATOM 1422  H HG23 . THR A 1 84  ? 18.816  7.034   -2.340  1.00 0.00 ? 791 THR A HG23 1  
ATOM 1423  N N    . GLN A 1 85  ? 17.351  5.250   -6.344  1.00 0.00 ? 792 GLN A N    1  
ATOM 1424  C CA   . GLN A 1 85  ? 17.022  4.478   -7.500  1.00 0.00 ? 792 GLN A CA   1  
ATOM 1425  C C    . GLN A 1 85  ? 17.213  3.022   -7.128  1.00 0.00 ? 792 GLN A C    1  
ATOM 1426  O O    . GLN A 1 85  ? 16.464  2.139   -7.553  1.00 0.00 ? 792 GLN A O    1  
ATOM 1427  C CB   . GLN A 1 85  ? 17.956  4.823   -8.669  1.00 0.00 ? 792 GLN A CB   1  
ATOM 1428  C CG   . GLN A 1 85  ? 19.450  4.624   -8.386  1.00 0.00 ? 792 GLN A CG   1  
ATOM 1429  C CD   . GLN A 1 85  ? 20.321  4.917   -9.575  1.00 0.00 ? 792 GLN A CD   1  
ATOM 1430  O OE1  . GLN A 1 85  ? 20.597  4.041   -10.385 1.00 0.00 ? 792 GLN A OE1  1  
ATOM 1431  N NE2  . GLN A 1 85  ? 20.803  6.114   -9.662  1.00 0.00 ? 792 GLN A NE2  1  
ATOM 1432  H H    . GLN A 1 85  ? 17.589  4.786   -5.518  1.00 0.00 ? 792 GLN A H    1  
ATOM 1433  H HA   . GLN A 1 85  ? 15.996  4.657   -7.783  1.00 0.00 ? 792 GLN A HA   1  
ATOM 1434  H HB2  . GLN A 1 85  ? 17.678  4.157   -9.465  1.00 0.00 ? 792 GLN A HB2  1  
ATOM 1435  H HB3  . GLN A 1 85  ? 17.781  5.848   -8.958  1.00 0.00 ? 792 GLN A HB3  1  
ATOM 1436  H HG2  . GLN A 1 85  ? 19.738  5.284   -7.583  1.00 0.00 ? 792 GLN A HG2  1  
ATOM 1437  H HG3  . GLN A 1 85  ? 19.610  3.601   -8.076  1.00 0.00 ? 792 GLN A HG3  1  
ATOM 1438  H HE21 . GLN A 1 85  ? 20.590  6.759   -8.952  1.00 0.00 ? 792 GLN A HE21 1  
ATOM 1439  H HE22 . GLN A 1 85  ? 21.359  6.334   -10.440 1.00 0.00 ? 792 GLN A HE22 1  
ATOM 1440  N N    . ALA A 1 86  ? 18.181  2.814   -6.241  1.00 0.00 ? 793 ALA A N    1  
ATOM 1441  C CA   . ALA A 1 86  ? 18.647  1.495   -5.867  1.00 0.00 ? 793 ALA A CA   1  
ATOM 1442  C C    . ALA A 1 86  ? 17.598  0.688   -5.108  1.00 0.00 ? 793 ALA A C    1  
ATOM 1443  O O    . ALA A 1 86  ? 17.053  -0.293  -5.642  1.00 0.00 ? 793 ALA A O    1  
ATOM 1444  C CB   . ALA A 1 86  ? 19.942  1.623   -5.089  1.00 0.00 ? 793 ALA A CB   1  
ATOM 1445  H H    . ALA A 1 86  ? 18.596  3.602   -5.823  1.00 0.00 ? 793 ALA A H    1  
ATOM 1446  H HA   . ALA A 1 86  ? 18.868  0.968   -6.782  1.00 0.00 ? 793 ALA A HA   1  
ATOM 1447  H HB1  . ALA A 1 86  ? 20.629  2.210   -5.681  1.00 0.00 ? 793 ALA A HB1  1  
ATOM 1448  H HB2  . ALA A 1 86  ? 20.362  0.647   -4.896  1.00 0.00 ? 793 ALA A HB2  1  
ATOM 1449  H HB3  . ALA A 1 86  ? 19.752  2.137   -4.158  1.00 0.00 ? 793 ALA A HB3  1  
ATOM 1450  N N    . GLY A 1 87  ? 17.267  1.123   -3.909  1.00 0.00 ? 794 GLY A N    1  
ATOM 1451  C CA   . GLY A 1 87  ? 16.295  0.402   -3.094  1.00 0.00 ? 794 GLY A CA   1  
ATOM 1452  C C    . GLY A 1 87  ? 14.878  0.625   -3.570  1.00 0.00 ? 794 GLY A C    1  
ATOM 1453  O O    . GLY A 1 87  ? 13.945  -0.065  -3.151  1.00 0.00 ? 794 GLY A O    1  
ATOM 1454  H H    . GLY A 1 87  ? 17.673  1.939   -3.545  1.00 0.00 ? 794 GLY A H    1  
ATOM 1455  H HA2  . GLY A 1 87  ? 16.515  -0.655  -3.134  1.00 0.00 ? 794 GLY A HA2  1  
ATOM 1456  H HA3  . GLY A 1 87  ? 16.377  0.739   -2.072  1.00 0.00 ? 794 GLY A HA3  1  
ATOM 1457  N N    . LEU A 1 88  ? 14.728  1.565   -4.469  1.00 0.00 ? 795 LEU A N    1  
ATOM 1458  C CA   . LEU A 1 88  ? 13.434  1.937   -4.995  1.00 0.00 ? 795 LEU A CA   1  
ATOM 1459  C C    . LEU A 1 88  ? 12.945  0.871   -5.951  1.00 0.00 ? 795 LEU A C    1  
ATOM 1460  O O    . LEU A 1 88  ? 11.838  0.349   -5.815  1.00 0.00 ? 795 LEU A O    1  
ATOM 1461  C CB   . LEU A 1 88  ? 13.525  3.270   -5.741  1.00 0.00 ? 795 LEU A CB   1  
ATOM 1462  C CG   . LEU A 1 88  ? 14.282  4.399   -5.046  1.00 0.00 ? 795 LEU A CG   1  
ATOM 1463  C CD1  . LEU A 1 88  ? 14.102  5.704   -5.777  1.00 0.00 ? 795 LEU A CD1  1  
ATOM 1464  C CD2  . LEU A 1 88  ? 13.908  4.520   -3.592  1.00 0.00 ? 795 LEU A CD2  1  
ATOM 1465  H H    . LEU A 1 88  ? 15.539  2.026   -4.762  1.00 0.00 ? 795 LEU A H    1  
ATOM 1466  H HA   . LEU A 1 88  ? 12.742  2.042   -4.174  1.00 0.00 ? 795 LEU A HA   1  
ATOM 1467  H HB2  . LEU A 1 88  ? 14.002  3.084   -6.692  1.00 0.00 ? 795 LEU A HB2  1  
ATOM 1468  H HB3  . LEU A 1 88  ? 12.517  3.608   -5.930  1.00 0.00 ? 795 LEU A HB3  1  
ATOM 1469  H HG   . LEU A 1 88  ? 15.335  4.165   -5.105  1.00 0.00 ? 795 LEU A HG   1  
ATOM 1470  H HD11 . LEU A 1 88  ? 14.590  5.643   -6.738  1.00 0.00 ? 795 LEU A HD11 1  
ATOM 1471  H HD12 . LEU A 1 88  ? 14.530  6.511   -5.203  1.00 0.00 ? 795 LEU A HD12 1  
ATOM 1472  H HD13 . LEU A 1 88  ? 13.051  5.892   -5.941  1.00 0.00 ? 795 LEU A HD13 1  
ATOM 1473  H HD21 . LEU A 1 88  ? 14.360  5.408   -3.174  1.00 0.00 ? 795 LEU A HD21 1  
ATOM 1474  H HD22 . LEU A 1 88  ? 14.312  3.660   -3.076  1.00 0.00 ? 795 LEU A HD22 1  
ATOM 1475  H HD23 . LEU A 1 88  ? 12.839  4.533   -3.453  1.00 0.00 ? 795 LEU A HD23 1  
ATOM 1476  N N    . LYS A 1 89  ? 13.781  0.543   -6.918  1.00 0.00 ? 796 LYS A N    1  
ATOM 1477  C CA   . LYS A 1 89  ? 13.436  -0.451  -7.905  1.00 0.00 ? 796 LYS A CA   1  
ATOM 1478  C C    . LYS A 1 89  ? 13.536  -1.843  -7.318  1.00 0.00 ? 796 LYS A C    1  
ATOM 1479  O O    . LYS A 1 89  ? 12.589  -2.637  -7.406  1.00 0.00 ? 796 LYS A O    1  
ATOM 1480  C CB   . LYS A 1 89  ? 14.339  -0.343  -9.145  1.00 0.00 ? 796 LYS A CB   1  
ATOM 1481  C CG   . LYS A 1 89  ? 14.217  0.964   -9.929  1.00 0.00 ? 796 LYS A CG   1  
ATOM 1482  C CD   . LYS A 1 89  ? 12.800  1.180   -10.444 1.00 0.00 ? 796 LYS A CD   1  
ATOM 1483  C CE   . LYS A 1 89  ? 12.707  2.394   -11.360 1.00 0.00 ? 796 LYS A CE   1  
ATOM 1484  N NZ   . LYS A 1 89  ? 13.144  3.639   -10.711 1.00 0.00 ? 796 LYS A NZ   1  
ATOM 1485  H H    . LYS A 1 89  ? 14.654  0.988   -6.956  1.00 0.00 ? 796 LYS A H    1  
ATOM 1486  H HA   . LYS A 1 89  ? 12.414  -0.278  -8.209  1.00 0.00 ? 796 LYS A HA   1  
ATOM 1487  H HB2  . LYS A 1 89  ? 15.366  -0.443  -8.825  1.00 0.00 ? 796 LYS A HB2  1  
ATOM 1488  H HB3  . LYS A 1 89  ? 14.107  -1.161  -9.809  1.00 0.00 ? 796 LYS A HB3  1  
ATOM 1489  H HG2  . LYS A 1 89  ? 14.479  1.787   -9.280  1.00 0.00 ? 796 LYS A HG2  1  
ATOM 1490  H HG3  . LYS A 1 89  ? 14.899  0.938   -10.767 1.00 0.00 ? 796 LYS A HG3  1  
ATOM 1491  H HD2  . LYS A 1 89  ? 12.494  0.305   -10.997 1.00 0.00 ? 796 LYS A HD2  1  
ATOM 1492  H HD3  . LYS A 1 89  ? 12.139  1.323   -9.603  1.00 0.00 ? 796 LYS A HD3  1  
ATOM 1493  H HE2  . LYS A 1 89  ? 13.349  2.222   -12.210 1.00 0.00 ? 796 LYS A HE2  1  
ATOM 1494  H HE3  . LYS A 1 89  ? 11.686  2.504   -11.694 1.00 0.00 ? 796 LYS A HE3  1  
ATOM 1495  H HZ1  . LYS A 1 89  ? 14.148  3.604   -10.447 1.00 0.00 ? 796 LYS A HZ1  1  
ATOM 1496  H HZ2  . LYS A 1 89  ? 12.599  3.855   -9.853  1.00 0.00 ? 796 LYS A HZ2  1  
ATOM 1497  H HZ3  . LYS A 1 89  ? 13.029  4.449   -11.351 1.00 0.00 ? 796 LYS A HZ3  1  
ATOM 1498  N N    . GLY A 1 90  ? 14.663  -2.121  -6.682  1.00 0.00 ? 797 GLY A N    1  
ATOM 1499  C CA   . GLY A 1 90  ? 14.902  -3.447  -6.153  1.00 0.00 ? 797 GLY A CA   1  
ATOM 1500  C C    . GLY A 1 90  ? 15.077  -4.445  -7.280  1.00 0.00 ? 797 GLY A C    1  
ATOM 1501  O O    . GLY A 1 90  ? 14.443  -5.492  -7.305  1.00 0.00 ? 797 GLY A O    1  
ATOM 1502  H H    . GLY A 1 90  ? 15.333  -1.415  -6.553  1.00 0.00 ? 797 GLY A H    1  
ATOM 1503  H HA2  . GLY A 1 90  ? 15.795  -3.432  -5.547  1.00 0.00 ? 797 GLY A HA2  1  
ATOM 1504  H HA3  . GLY A 1 90  ? 14.058  -3.747  -5.550  1.00 0.00 ? 797 GLY A HA3  1  
ATOM 1505  N N    . SER A 1 91  ? 15.914  -4.101  -8.222  1.00 0.00 ? 798 SER A N    1  
ATOM 1506  C CA   . SER A 1 91  ? 16.147  -4.937  -9.372  1.00 0.00 ? 798 SER A CA   1  
ATOM 1507  C C    . SER A 1 91  ? 17.554  -5.521  -9.295  1.00 0.00 ? 798 SER A C    1  
ATOM 1508  O O    . SER A 1 91  ? 17.961  -6.327  -10.135 1.00 0.00 ? 798 SER A O    1  
ATOM 1509  C CB   . SER A 1 91  ? 15.957  -4.112  -10.664 1.00 0.00 ? 798 SER A CB   1  
ATOM 1510  O OG   . SER A 1 91  ? 16.074  -4.916  -11.837 1.00 0.00 ? 798 SER A OG   1  
ATOM 1511  H H    . SER A 1 91  ? 16.407  -3.258  -8.130  1.00 0.00 ? 798 SER A H    1  
ATOM 1512  H HA   . SER A 1 91  ? 15.427  -5.742  -9.357  1.00 0.00 ? 798 SER A HA   1  
ATOM 1513  H HB2  . SER A 1 91  ? 14.979  -3.656  -10.655 1.00 0.00 ? 798 SER A HB2  1  
ATOM 1514  H HB3  . SER A 1 91  ? 16.711  -3.339  -10.697 1.00 0.00 ? 798 SER A HB3  1  
ATOM 1515  H HG   . SER A 1 91  ? 16.825  -5.513  -11.703 1.00 0.00 ? 798 SER A HG   1  
ATOM 1516  N N    . THR A 1 92  ? 18.293  -5.097  -8.315  1.00 0.00 ? 799 THR A N    1  
ATOM 1517  C CA   . THR A 1 92  ? 19.632  -5.553  -8.107  1.00 0.00 ? 799 THR A CA   1  
ATOM 1518  C C    . THR A 1 92  ? 19.827  -5.768  -6.612  1.00 0.00 ? 799 THR A C    1  
ATOM 1519  O O    . THR A 1 92  ? 19.330  -4.979  -5.792  1.00 0.00 ? 799 THR A O    1  
ATOM 1520  C CB   . THR A 1 92  ? 20.636  -4.497  -8.638  1.00 0.00 ? 799 THR A CB   1  
ATOM 1521  O OG1  . THR A 1 92  ? 20.325  -4.201  -10.014 1.00 0.00 ? 799 THR A OG1  1  
ATOM 1522  C CG2  . THR A 1 92  ? 22.076  -4.993  -8.553  1.00 0.00 ? 799 THR A CG2  1  
ATOM 1523  H H    . THR A 1 92  ? 17.944  -4.436  -7.679  1.00 0.00 ? 799 THR A H    1  
ATOM 1524  H HA   . THR A 1 92  ? 19.776  -6.483  -8.637  1.00 0.00 ? 799 THR A HA   1  
ATOM 1525  H HB   . THR A 1 92  ? 20.525  -3.604  -8.043  1.00 0.00 ? 799 THR A HB   1  
ATOM 1526  H HG1  . THR A 1 92  ? 19.820  -4.943  -10.366 1.00 0.00 ? 799 THR A HG1  1  
ATOM 1527  H HG21 . THR A 1 92  ? 22.314  -5.220  -7.524  1.00 0.00 ? 799 THR A HG21 1  
ATOM 1528  H HG22 . THR A 1 92  ? 22.744  -4.227  -8.915  1.00 0.00 ? 799 THR A HG22 1  
ATOM 1529  H HG23 . THR A 1 92  ? 22.189  -5.883  -9.154  1.00 0.00 ? 799 THR A HG23 1  
ATOM 1530  N N    . GLU A 1 93  ? 20.477  -6.841  -6.256  1.00 0.00 ? 800 GLU A N    1  
ATOM 1531  C CA   . GLU A 1 93  ? 20.724  -7.158  -4.876  1.00 0.00 ? 800 GLU A CA   1  
ATOM 1532  C C    . GLU A 1 93  ? 21.790  -6.261  -4.295  1.00 0.00 ? 800 GLU A C    1  
ATOM 1533  O O    . GLU A 1 93  ? 22.686  -5.776  -5.015  1.00 0.00 ? 800 GLU A O    1  
ATOM 1534  C CB   . GLU A 1 93  ? 21.103  -8.626  -4.712  1.00 0.00 ? 800 GLU A CB   1  
ATOM 1535  C CG   . GLU A 1 93  ? 19.974  -9.571  -5.060  1.00 0.00 ? 800 GLU A CG   1  
ATOM 1536  C CD   . GLU A 1 93  ? 18.747  -9.286  -4.234  1.00 0.00 ? 800 GLU A CD   1  
ATOM 1537  O OE1  . GLU A 1 93  ? 18.719  -9.652  -3.044  1.00 0.00 ? 800 GLU A OE1  1  
ATOM 1538  O OE2  . GLU A 1 93  ? 17.801  -8.664  -4.737  1.00 0.00 ? 800 GLU A OE2  1  
ATOM 1539  H H    . GLU A 1 93  ? 20.812  -7.450  -6.949  1.00 0.00 ? 800 GLU A H    1  
ATOM 1540  H HA   . GLU A 1 93  ? 19.808  -6.981  -4.334  1.00 0.00 ? 800 GLU A HA   1  
ATOM 1541  H HB2  . GLU A 1 93  ? 21.946  -8.846  -5.351  1.00 0.00 ? 800 GLU A HB2  1  
ATOM 1542  H HB3  . GLU A 1 93  ? 21.391  -8.800  -3.687  1.00 0.00 ? 800 GLU A HB3  1  
ATOM 1543  H HG2  . GLU A 1 93  ? 19.726  -9.454  -6.105  1.00 0.00 ? 800 GLU A HG2  1  
ATOM 1544  H HG3  . GLU A 1 93  ? 20.293  -10.586 -4.874  1.00 0.00 ? 800 GLU A HG3  1  
ATOM 1545  N N    . GLY A 1 94  ? 21.694  -6.025  -3.019  1.00 0.00 ? 801 GLY A N    1  
ATOM 1546  C CA   . GLY A 1 94  ? 22.643  -5.192  -2.372  1.00 0.00 ? 801 GLY A CA   1  
ATOM 1547  C C    . GLY A 1 94  ? 22.217  -3.753  -2.379  1.00 0.00 ? 801 GLY A C    1  
ATOM 1548  O O    . GLY A 1 94  ? 22.973  -2.876  -2.787  1.00 0.00 ? 801 GLY A O    1  
ATOM 1549  H H    . GLY A 1 94  ? 20.965  -6.429  -2.498  1.00 0.00 ? 801 GLY A H    1  
ATOM 1550  H HA2  . GLY A 1 94  ? 22.764  -5.522  -1.350  1.00 0.00 ? 801 GLY A HA2  1  
ATOM 1551  H HA3  . GLY A 1 94  ? 23.587  -5.279  -2.886  1.00 0.00 ? 801 GLY A HA3  1  
ATOM 1552  N N    . SER A 1 95  ? 20.999  -3.508  -1.985  1.00 0.00 ? 802 SER A N    1  
ATOM 1553  C CA   . SER A 1 95  ? 20.530  -2.162  -1.834  1.00 0.00 ? 802 SER A CA   1  
ATOM 1554  C C    . SER A 1 95  ? 20.989  -1.711  -0.452  1.00 0.00 ? 802 SER A C    1  
ATOM 1555  O O    . SER A 1 95  ? 20.636  -2.334  0.561   1.00 0.00 ? 802 SER A O    1  
ATOM 1556  C CB   . SER A 1 95  ? 19.009  -2.132  -1.953  1.00 0.00 ? 802 SER A CB   1  
ATOM 1557  O OG   . SER A 1 95  ? 18.579  -2.794  -3.148  1.00 0.00 ? 802 SER A OG   1  
ATOM 1558  H H    . SER A 1 95  ? 20.401  -4.251  -1.754  1.00 0.00 ? 802 SER A H    1  
ATOM 1559  H HA   . SER A 1 95  ? 20.987  -1.546  -2.594  1.00 0.00 ? 802 SER A HA   1  
ATOM 1560  H HB2  . SER A 1 95  ? 18.580  -2.636  -1.100  1.00 0.00 ? 802 SER A HB2  1  
ATOM 1561  H HB3  . SER A 1 95  ? 18.670  -1.107  -1.980  1.00 0.00 ? 802 SER A HB3  1  
ATOM 1562  H HG   . SER A 1 95  ? 19.351  -2.931  -3.709  1.00 0.00 ? 802 SER A HG   1  
ATOM 1563  N N    . GLU A 1 96  ? 21.820  -0.709  -0.408  1.00 0.00 ? 803 GLU A N    1  
ATOM 1564  C CA   . GLU A 1 96  ? 22.442  -0.303  0.829   1.00 0.00 ? 803 GLU A CA   1  
ATOM 1565  C C    . GLU A 1 96  ? 21.615  0.732   1.562   1.00 0.00 ? 803 GLU A C    1  
ATOM 1566  O O    . GLU A 1 96  ? 21.073  1.663   0.959   1.00 0.00 ? 803 GLU A O    1  
ATOM 1567  C CB   . GLU A 1 96  ? 23.828  0.242   0.569   1.00 0.00 ? 803 GLU A CB   1  
ATOM 1568  C CG   . GLU A 1 96  ? 24.730  -0.690  -0.215  1.00 0.00 ? 803 GLU A CG   1  
ATOM 1569  C CD   . GLU A 1 96  ? 24.976  -2.022  0.449   1.00 0.00 ? 803 GLU A CD   1  
ATOM 1570  O OE1  . GLU A 1 96  ? 25.815  -2.104  1.363   1.00 0.00 ? 803 GLU A OE1  1  
ATOM 1571  O OE2  . GLU A 1 96  ? 24.383  -3.027  0.043   1.00 0.00 ? 803 GLU A OE2  1  
ATOM 1572  H H    . GLU A 1 96  ? 22.010  -0.206  -1.229  1.00 0.00 ? 803 GLU A H    1  
ATOM 1573  H HA   . GLU A 1 96  ? 22.537  -1.182  1.449   1.00 0.00 ? 803 GLU A HA   1  
ATOM 1574  H HB2  . GLU A 1 96  ? 23.733  1.164   0.014   1.00 0.00 ? 803 GLU A HB2  1  
ATOM 1575  H HB3  . GLU A 1 96  ? 24.301  0.454   1.516   1.00 0.00 ? 803 GLU A HB3  1  
ATOM 1576  H HG2  . GLU A 1 96  ? 24.264  -0.874  -1.170  1.00 0.00 ? 803 GLU A HG2  1  
ATOM 1577  H HG3  . GLU A 1 96  ? 25.674  -0.187  -0.354  1.00 0.00 ? 803 GLU A HG3  1  
ATOM 1578  N N    . SER A 1 97  ? 21.573  0.583   2.848   1.00 0.00 ? 804 SER A N    1  
ATOM 1579  C CA   . SER A 1 97  ? 20.808  1.441   3.725   1.00 0.00 ? 804 SER A CA   1  
ATOM 1580  C C    . SER A 1 97  ? 21.629  2.686   4.110   1.00 0.00 ? 804 SER A C    1  
ATOM 1581  O O    . SER A 1 97  ? 21.074  3.751   4.399   1.00 0.00 ? 804 SER A O    1  
ATOM 1582  C CB   . SER A 1 97  ? 20.438  0.648   4.974   1.00 0.00 ? 804 SER A CB   1  
ATOM 1583  O OG   . SER A 1 97  ? 19.948  -0.644  4.613   1.00 0.00 ? 804 SER A OG   1  
ATOM 1584  H H    . SER A 1 97  ? 22.083  -0.157  3.240   1.00 0.00 ? 804 SER A H    1  
ATOM 1585  H HA   . SER A 1 97  ? 19.903  1.739   3.220   1.00 0.00 ? 804 SER A HA   1  
ATOM 1586  H HB2  . SER A 1 97  ? 21.312  0.532   5.599   1.00 0.00 ? 804 SER A HB2  1  
ATOM 1587  H HB3  . SER A 1 97  ? 19.669  1.171   5.524   1.00 0.00 ? 804 SER A HB3  1  
ATOM 1588  H HG   . SER A 1 97  ? 19.003  -0.574  4.432   1.00 0.00 ? 804 SER A HG   1  
ATOM 1589  N N    . TYR A 1 98  ? 22.970  2.564   4.063   1.00 0.00 ? 805 TYR A N    1  
ATOM 1590  C CA   . TYR A 1 98  ? 23.855  3.688   4.420   1.00 0.00 ? 805 TYR A CA   1  
ATOM 1591  C C    . TYR A 1 98  ? 23.725  4.833   3.424   1.00 0.00 ? 805 TYR A C    1  
ATOM 1592  O O    . TYR A 1 98  ? 24.136  5.954   3.689   1.00 0.00 ? 805 TYR A O    1  
ATOM 1593  C CB   . TYR A 1 98  ? 25.342  3.261   4.563   1.00 0.00 ? 805 TYR A CB   1  
ATOM 1594  C CG   . TYR A 1 98  ? 26.079  2.846   3.279   1.00 0.00 ? 805 TYR A CG   1  
ATOM 1595  C CD1  . TYR A 1 98  ? 26.554  3.802   2.377   1.00 0.00 ? 805 TYR A CD1  1  
ATOM 1596  C CD2  . TYR A 1 98  ? 26.321  1.515   2.990   1.00 0.00 ? 805 TYR A CD2  1  
ATOM 1597  C CE1  . TYR A 1 98  ? 27.237  3.437   1.236   1.00 0.00 ? 805 TYR A CE1  1  
ATOM 1598  C CE2  . TYR A 1 98  ? 27.011  1.144   1.851   1.00 0.00 ? 805 TYR A CE2  1  
ATOM 1599  C CZ   . TYR A 1 98  ? 27.463  2.110   0.979   1.00 0.00 ? 805 TYR A CZ   1  
ATOM 1600  O OH   . TYR A 1 98  ? 28.150  1.741   -0.158  1.00 0.00 ? 805 TYR A OH   1  
ATOM 1601  H H    . TYR A 1 98  ? 23.361  1.694   3.829   1.00 0.00 ? 805 TYR A H    1  
ATOM 1602  H HA   . TYR A 1 98  ? 23.507  4.054   5.375   1.00 0.00 ? 805 TYR A HA   1  
ATOM 1603  H HB2  . TYR A 1 98  ? 25.890  4.090   4.978   1.00 0.00 ? 805 TYR A HB2  1  
ATOM 1604  H HB3  . TYR A 1 98  ? 25.390  2.434   5.256   1.00 0.00 ? 805 TYR A HB3  1  
ATOM 1605  H HD1  . TYR A 1 98  ? 26.369  4.847   2.579   1.00 0.00 ? 805 TYR A HD1  1  
ATOM 1606  H HD2  . TYR A 1 98  ? 25.964  0.757   3.671   1.00 0.00 ? 805 TYR A HD2  1  
ATOM 1607  H HE1  . TYR A 1 98  ? 27.592  4.195   0.554   1.00 0.00 ? 805 TYR A HE1  1  
ATOM 1608  H HE2  . TYR A 1 98  ? 27.187  0.098   1.647   1.00 0.00 ? 805 TYR A HE2  1  
ATOM 1609  H HH   . TYR A 1 98  ? 27.604  1.081   -0.606  1.00 0.00 ? 805 TYR A HH   1  
ATOM 1610  N N    . GLU A 1 99  ? 23.123  4.530   2.292   1.00 0.00 ? 806 GLU A N    1  
ATOM 1611  C CA   . GLU A 1 99  ? 22.914  5.491   1.237   1.00 0.00 ? 806 GLU A CA   1  
ATOM 1612  C C    . GLU A 1 99  ? 21.677  6.347   1.479   1.00 0.00 ? 806 GLU A C    1  
ATOM 1613  O O    . GLU A 1 99  ? 21.255  7.097   0.603   1.00 0.00 ? 806 GLU A O    1  
ATOM 1614  C CB   . GLU A 1 99  ? 22.835  4.800   -0.094  1.00 0.00 ? 806 GLU A CB   1  
ATOM 1615  C CG   . GLU A 1 99  ? 24.145  4.171   -0.534  1.00 0.00 ? 806 GLU A CG   1  
ATOM 1616  C CD   . GLU A 1 99  ? 24.081  3.610   -1.919  1.00 0.00 ? 806 GLU A CD   1  
ATOM 1617  O OE1  . GLU A 1 99  ? 24.132  4.392   -2.879  1.00 0.00 ? 806 GLU A OE1  1  
ATOM 1618  O OE2  . GLU A 1 99  ? 23.975  2.376   -2.082  1.00 0.00 ? 806 GLU A OE2  1  
ATOM 1619  H H    . GLU A 1 99  ? 22.810  3.610   2.180   1.00 0.00 ? 806 GLU A H    1  
ATOM 1620  H HA   . GLU A 1 99  ? 23.772  6.146   1.229   1.00 0.00 ? 806 GLU A HA   1  
ATOM 1621  H HB2  . GLU A 1 99  ? 22.090  4.021   -0.020  1.00 0.00 ? 806 GLU A HB2  1  
ATOM 1622  H HB3  . GLU A 1 99  ? 22.523  5.539   -0.812  1.00 0.00 ? 806 GLU A HB3  1  
ATOM 1623  H HG2  . GLU A 1 99  ? 24.916  4.927   -0.510  1.00 0.00 ? 806 GLU A HG2  1  
ATOM 1624  H HG3  . GLU A 1 99  ? 24.404  3.381   0.154   1.00 0.00 ? 806 GLU A HG3  1  
ATOM 1625  N N    . GLU A 1 100 ? 21.089  6.179   2.664   1.00 0.00 ? 807 GLU A N    1  
ATOM 1626  C CA   . GLU A 1 100 ? 19.975  6.999   3.194   1.00 0.00 ? 807 GLU A CA   1  
ATOM 1627  C C    . GLU A 1 100 ? 18.670  6.784   2.457   1.00 0.00 ? 807 GLU A C    1  
ATOM 1628  O O    . GLU A 1 100 ? 17.683  7.500   2.668   1.00 0.00 ? 807 GLU A O    1  
ATOM 1629  C CB   . GLU A 1 100 ? 20.343  8.450   3.151   1.00 0.00 ? 807 GLU A CB   1  
ATOM 1630  C CG   . GLU A 1 100 ? 21.589  8.790   3.927   1.00 0.00 ? 807 GLU A CG   1  
ATOM 1631  C CD   . GLU A 1 100 ? 21.463  8.534   5.402   1.00 0.00 ? 807 GLU A CD   1  
ATOM 1632  O OE1  . GLU A 1 100 ? 21.003  9.432   6.134   1.00 0.00 ? 807 GLU A OE1  1  
ATOM 1633  O OE2  . GLU A 1 100 ? 21.837  7.448   5.864   1.00 0.00 ? 807 GLU A OE2  1  
ATOM 1634  H H    . GLU A 1 100 ? 21.437  5.455   3.218   1.00 0.00 ? 807 GLU A H    1  
ATOM 1635  H HA   . GLU A 1 100 ? 19.837  6.719   4.228   1.00 0.00 ? 807 GLU A HA   1  
ATOM 1636  H HB2  . GLU A 1 100 ? 20.512  8.694   2.113   1.00 0.00 ? 807 GLU A HB2  1  
ATOM 1637  H HB3  . GLU A 1 100 ? 19.499  8.996   3.534   1.00 0.00 ? 807 GLU A HB3  1  
ATOM 1638  H HG2  . GLU A 1 100 ? 22.361  8.145   3.535   1.00 0.00 ? 807 GLU A HG2  1  
ATOM 1639  H HG3  . GLU A 1 100 ? 21.834  9.825   3.750   1.00 0.00 ? 807 GLU A HG3  1  
ATOM 1640  N N    . ASP A 1 101 ? 18.675  5.822   1.626   1.00 0.00 ? 808 ASP A N    1  
ATOM 1641  C CA   . ASP A 1 101 ? 17.518  5.490   0.818   1.00 0.00 ? 808 ASP A CA   1  
ATOM 1642  C C    . ASP A 1 101 ? 16.448  4.806   1.663   1.00 0.00 ? 808 ASP A C    1  
ATOM 1643  O O    . ASP A 1 101 ? 16.747  3.859   2.397   1.00 0.00 ? 808 ASP A O    1  
ATOM 1644  C CB   . ASP A 1 101 ? 17.903  4.603   -0.351  1.00 0.00 ? 808 ASP A CB   1  
ATOM 1645  C CG   . ASP A 1 101 ? 16.766  4.453   -1.321  1.00 0.00 ? 808 ASP A CG   1  
ATOM 1646  O OD1  . ASP A 1 101 ? 16.528  5.410   -2.102  1.00 0.00 ? 808 ASP A OD1  1  
ATOM 1647  O OD2  . ASP A 1 101 ? 16.112  3.415   -1.338  1.00 0.00 ? 808 ASP A OD2  1  
ATOM 1648  H H    . ASP A 1 101 ? 19.532  5.355   1.574   1.00 0.00 ? 808 ASP A H    1  
ATOM 1649  H HA   . ASP A 1 101 ? 17.124  6.419   0.436   1.00 0.00 ? 808 ASP A HA   1  
ATOM 1650  H HB2  . ASP A 1 101 ? 18.745  5.040   -0.869  1.00 0.00 ? 808 ASP A HB2  1  
ATOM 1651  H HB3  . ASP A 1 101 ? 18.177  3.625   0.015   1.00 0.00 ? 808 ASP A HB3  1  
ATOM 1652  N N    . PRO A 1 102 ? 15.202  5.306   1.619   1.00 0.00 ? 809 PRO A N    1  
ATOM 1653  C CA   . PRO A 1 102 ? 14.104  4.753   2.388   1.00 0.00 ? 809 PRO A CA   1  
ATOM 1654  C C    . PRO A 1 102 ? 13.270  3.745   1.600   1.00 0.00 ? 809 PRO A C    1  
ATOM 1655  O O    . PRO A 1 102 ? 12.271  3.233   2.120   1.00 0.00 ? 809 PRO A O    1  
ATOM 1656  C CB   . PRO A 1 102 ? 13.273  5.994   2.673   1.00 0.00 ? 809 PRO A CB   1  
ATOM 1657  C CG   . PRO A 1 102 ? 13.413  6.821   1.435   1.00 0.00 ? 809 PRO A CG   1  
ATOM 1658  C CD   . PRO A 1 102 ? 14.764  6.484   0.847   1.00 0.00 ? 809 PRO A CD   1  
ATOM 1659  H HA   . PRO A 1 102 ? 14.425  4.320   3.324   1.00 0.00 ? 809 PRO A HA   1  
ATOM 1660  H HB2  . PRO A 1 102 ? 12.244  5.714   2.853   1.00 0.00 ? 809 PRO A HB2  1  
ATOM 1661  H HB3  . PRO A 1 102 ? 13.669  6.511   3.533   1.00 0.00 ? 809 PRO A HB3  1  
ATOM 1662  H HG2  . PRO A 1 102 ? 12.627  6.567   0.739   1.00 0.00 ? 809 PRO A HG2  1  
ATOM 1663  H HG3  . PRO A 1 102 ? 13.363  7.872   1.684   1.00 0.00 ? 809 PRO A HG3  1  
ATOM 1664  H HD2  . PRO A 1 102 ? 14.676  6.250   -0.204  1.00 0.00 ? 809 PRO A HD2  1  
ATOM 1665  H HD3  . PRO A 1 102 ? 15.438  7.312   0.996   1.00 0.00 ? 809 PRO A HD3  1  
ATOM 1666  N N    . TYR A 1 103 ? 13.673  3.471   0.352   1.00 0.00 ? 810 TYR A N    1  
ATOM 1667  C CA   . TYR A 1 103 ? 12.978  2.569   -0.527  1.00 0.00 ? 810 TYR A CA   1  
ATOM 1668  C C    . TYR A 1 103 ? 11.629  3.163   -0.930  1.00 0.00 ? 810 TYR A C    1  
ATOM 1669  O O    . TYR A 1 103 ? 11.578  4.152   -1.653  1.00 0.00 ? 810 TYR A O    1  
ATOM 1670  C CB   . TYR A 1 103 ? 12.804  1.154   0.063   1.00 0.00 ? 810 TYR A CB   1  
ATOM 1671  C CG   . TYR A 1 103 ? 14.055  0.324   0.299   1.00 0.00 ? 810 TYR A CG   1  
ATOM 1672  C CD1  . TYR A 1 103 ? 15.188  0.843   0.918   1.00 0.00 ? 810 TYR A CD1  1  
ATOM 1673  C CD2  . TYR A 1 103 ? 14.072  -1.011  -0.069  1.00 0.00 ? 810 TYR A CD2  1  
ATOM 1674  C CE1  . TYR A 1 103 ? 16.292  0.053   1.154   1.00 0.00 ? 810 TYR A CE1  1  
ATOM 1675  C CE2  . TYR A 1 103 ? 15.168  -1.801  0.158   1.00 0.00 ? 810 TYR A CE2  1  
ATOM 1676  C CZ   . TYR A 1 103 ? 16.276  -1.267  0.766   1.00 0.00 ? 810 TYR A CZ   1  
ATOM 1677  O OH   . TYR A 1 103 ? 17.363  -2.068  1.009   1.00 0.00 ? 810 TYR A OH   1  
ATOM 1678  H H    . TYR A 1 103 ? 14.469  3.892   -0.041  1.00 0.00 ? 810 TYR A H    1  
ATOM 1679  H HA   . TYR A 1 103 ? 13.577  2.504   -1.424  1.00 0.00 ? 810 TYR A HA   1  
ATOM 1680  H HB2  . TYR A 1 103 ? 12.288  1.226   1.009   1.00 0.00 ? 810 TYR A HB2  1  
ATOM 1681  H HB3  . TYR A 1 103 ? 12.176  0.622   -0.632  1.00 0.00 ? 810 TYR A HB3  1  
ATOM 1682  H HD1  . TYR A 1 103 ? 15.192  1.882   1.213   1.00 0.00 ? 810 TYR A HD1  1  
ATOM 1683  H HD2  . TYR A 1 103 ? 13.200  -1.433  -0.549  1.00 0.00 ? 810 TYR A HD2  1  
ATOM 1684  H HE1  . TYR A 1 103 ? 17.163  0.473   1.637   1.00 0.00 ? 810 TYR A HE1  1  
ATOM 1685  H HE2  . TYR A 1 103 ? 15.156  -2.837  -0.145  1.00 0.00 ? 810 TYR A HE2  1  
ATOM 1686  H HH   . TYR A 1 103 ? 17.445  -2.706  0.289   1.00 0.00 ? 810 TYR A HH   1  
ATOM 1687  N N    . LEU A 1 104 ? 10.550  2.629   -0.407  1.00 0.00 ? 811 LEU A N    1  
ATOM 1688  C CA   . LEU A 1 104 ? 9.246   3.105   -0.783  1.00 0.00 ? 811 LEU A CA   1  
ATOM 1689  C C    . LEU A 1 104 ? 8.503   3.587   0.408   1.00 0.00 ? 811 LEU A C    1  
ATOM 1690  O O    . LEU A 1 104 ? 8.291   2.853   1.362   1.00 0.00 ? 811 LEU A O    1  
ATOM 1691  C CB   . LEU A 1 104 ? 8.415   2.048   -1.533  1.00 0.00 ? 811 LEU A CB   1  
ATOM 1692  C CG   . LEU A 1 104 ? 8.935   1.578   -2.900  1.00 0.00 ? 811 LEU A CG   1  
ATOM 1693  C CD1  . LEU A 1 104 ? 9.375   2.748   -3.765  1.00 0.00 ? 811 LEU A CD1  1  
ATOM 1694  C CD2  . LEU A 1 104 ? 10.028  0.535   -2.765  1.00 0.00 ? 811 LEU A CD2  1  
ATOM 1695  H H    . LEU A 1 104 ? 10.617  1.918   0.266   1.00 0.00 ? 811 LEU A H    1  
ATOM 1696  H HA   . LEU A 1 104 ? 9.391   3.953   -1.437  1.00 0.00 ? 811 LEU A HA   1  
ATOM 1697  H HB2  . LEU A 1 104 ? 8.353   1.180   -0.893  1.00 0.00 ? 811 LEU A HB2  1  
ATOM 1698  H HB3  . LEU A 1 104 ? 7.414   2.433   -1.659  1.00 0.00 ? 811 LEU A HB3  1  
ATOM 1699  H HG   . LEU A 1 104 ? 8.097   1.130   -3.410  1.00 0.00 ? 811 LEU A HG   1  
ATOM 1700  H HD11 . LEU A 1 104 ? 9.688   2.395   -4.736  1.00 0.00 ? 811 LEU A HD11 1  
ATOM 1701  H HD12 . LEU A 1 104 ? 10.203  3.238   -3.273  1.00 0.00 ? 811 LEU A HD12 1  
ATOM 1702  H HD13 . LEU A 1 104 ? 8.566   3.453   -3.864  1.00 0.00 ? 811 LEU A HD13 1  
ATOM 1703  H HD21 . LEU A 1 104 ? 9.645   -0.316  -2.224  1.00 0.00 ? 811 LEU A HD21 1  
ATOM 1704  H HD22 . LEU A 1 104 ? 10.849  0.971   -2.214  1.00 0.00 ? 811 LEU A HD22 1  
ATOM 1705  H HD23 . LEU A 1 104 ? 10.368  0.230   -3.744  1.00 0.00 ? 811 LEU A HD23 1  
ATOM 1706  N N    . VAL A 1 105 ? 8.107   4.808   0.357   1.00 0.00 ? 812 VAL A N    1  
ATOM 1707  C CA   . VAL A 1 105 ? 7.411   5.405   1.450   1.00 0.00 ? 812 VAL A CA   1  
ATOM 1708  C C    . VAL A 1 105 ? 6.028   5.806   0.982   1.00 0.00 ? 812 VAL A C    1  
ATOM 1709  O O    . VAL A 1 105 ? 5.869   6.256   -0.152  1.00 0.00 ? 812 VAL A O    1  
ATOM 1710  C CB   . VAL A 1 105 ? 8.149   6.666   1.958   1.00 0.00 ? 812 VAL A CB   1  
ATOM 1711  C CG1  . VAL A 1 105 ? 7.504   7.253   3.202   1.00 0.00 ? 812 VAL A CG1  1  
ATOM 1712  C CG2  . VAL A 1 105 ? 9.628   6.413   2.172   1.00 0.00 ? 812 VAL A CG2  1  
ATOM 1713  H H    . VAL A 1 105 ? 8.276   5.330   -0.458  1.00 0.00 ? 812 VAL A H    1  
ATOM 1714  H HA   . VAL A 1 105 ? 7.381   4.664   2.231   1.00 0.00 ? 812 VAL A HA   1  
ATOM 1715  H HB   . VAL A 1 105 ? 8.044   7.384   1.164   1.00 0.00 ? 812 VAL A HB   1  
ATOM 1716  H HG11 . VAL A 1 105 ? 7.500   6.512   3.988   1.00 0.00 ? 812 VAL A HG11 1  
ATOM 1717  H HG12 . VAL A 1 105 ? 6.491   7.551   2.977   1.00 0.00 ? 812 VAL A HG12 1  
ATOM 1718  H HG13 . VAL A 1 105 ? 8.072   8.113   3.525   1.00 0.00 ? 812 VAL A HG13 1  
ATOM 1719  H HG21 . VAL A 1 105 ? 10.065  6.095   1.236   1.00 0.00 ? 812 VAL A HG21 1  
ATOM 1720  H HG22 . VAL A 1 105 ? 9.772   5.653   2.925   1.00 0.00 ? 812 VAL A HG22 1  
ATOM 1721  H HG23 . VAL A 1 105 ? 10.093  7.337   2.479   1.00 0.00 ? 812 VAL A HG23 1  
ATOM 1722  N N    . VAL A 1 106 ? 5.046   5.654   1.829   1.00 0.00 ? 813 VAL A N    1  
ATOM 1723  C CA   . VAL A 1 106 ? 3.700   6.032   1.498   1.00 0.00 ? 813 VAL A CA   1  
ATOM 1724  C C    . VAL A 1 106 ? 3.258   7.207   2.373   1.00 0.00 ? 813 VAL A C    1  
ATOM 1725  O O    . VAL A 1 106 ? 3.565   7.250   3.570   1.00 0.00 ? 813 VAL A O    1  
ATOM 1726  C CB   . VAL A 1 106 ? 2.711   4.824   1.607   1.00 0.00 ? 813 VAL A CB   1  
ATOM 1727  C CG1  . VAL A 1 106 ? 2.670   4.238   3.021   1.00 0.00 ? 813 VAL A CG1  1  
ATOM 1728  C CG2  . VAL A 1 106 ? 1.313   5.210   1.134   1.00 0.00 ? 813 VAL A CG2  1  
ATOM 1729  H H    . VAL A 1 106 ? 5.224   5.299   2.723   1.00 0.00 ? 813 VAL A H    1  
ATOM 1730  H HA   . VAL A 1 106 ? 3.719   6.375   0.473   1.00 0.00 ? 813 VAL A HA   1  
ATOM 1731  H HB   . VAL A 1 106 ? 3.090   4.055   0.948   1.00 0.00 ? 813 VAL A HB   1  
ATOM 1732  H HG11 . VAL A 1 106 ? 2.348   5.002   3.715   1.00 0.00 ? 813 VAL A HG11 1  
ATOM 1733  H HG12 . VAL A 1 106 ? 3.652   3.887   3.296   1.00 0.00 ? 813 VAL A HG12 1  
ATOM 1734  H HG13 . VAL A 1 106 ? 1.972   3.413   3.046   1.00 0.00 ? 813 VAL A HG13 1  
ATOM 1735  H HG21 . VAL A 1 106 ? 0.656   4.355   1.210   1.00 0.00 ? 813 VAL A HG21 1  
ATOM 1736  H HG22 . VAL A 1 106 ? 1.360   5.545   0.108   1.00 0.00 ? 813 VAL A HG22 1  
ATOM 1737  H HG23 . VAL A 1 106 ? 0.934   6.009   1.753   1.00 0.00 ? 813 VAL A HG23 1  
ATOM 1738  N N    . ASN A 1 107 ? 2.630   8.178   1.748   1.00 0.00 ? 814 ASN A N    1  
ATOM 1739  C CA   . ASN A 1 107 ? 2.107   9.360   2.419   1.00 0.00 ? 814 ASN A CA   1  
ATOM 1740  C C    . ASN A 1 107 ? 0.976   8.947   3.355   1.00 0.00 ? 814 ASN A C    1  
ATOM 1741  O O    . ASN A 1 107 ? 0.102   8.171   2.955   1.00 0.00 ? 814 ASN A O    1  
ATOM 1742  C CB   . ASN A 1 107 ? 1.560   10.349  1.355   1.00 0.00 ? 814 ASN A CB   1  
ATOM 1743  C CG   . ASN A 1 107 ? 1.146   11.728  1.872   1.00 0.00 ? 814 ASN A CG   1  
ATOM 1744  O OD1  . ASN A 1 107 ? 0.704   11.897  2.991   1.00 0.00 ? 814 ASN A OD1  1  
ATOM 1745  N ND2  . ASN A 1 107 ? 1.325   12.734  1.056   1.00 0.00 ? 814 ASN A ND2  1  
ATOM 1746  H H    . ASN A 1 107 ? 2.522   8.108   0.774   1.00 0.00 ? 814 ASN A H    1  
ATOM 1747  H HA   . ASN A 1 107 ? 2.910   9.833   2.962   1.00 0.00 ? 814 ASN A HA   1  
ATOM 1748  H HB2  . ASN A 1 107 ? 2.305   10.513  0.597   1.00 0.00 ? 814 ASN A HB2  1  
ATOM 1749  H HB3  . ASN A 1 107 ? 0.692   9.894   0.901   1.00 0.00 ? 814 ASN A HB3  1  
ATOM 1750  H HD21 . ASN A 1 107 ? 1.715   12.562  0.172   1.00 0.00 ? 814 ASN A HD21 1  
ATOM 1751  H HD22 . ASN A 1 107 ? 1.048   13.622  1.371   1.00 0.00 ? 814 ASN A HD22 1  
ATOM 1752  N N    . PRO A 1 108 ? 0.985   9.432   4.618   1.00 0.00 ? 815 PRO A N    1  
ATOM 1753  C CA   . PRO A 1 108 ? -0.095  9.176   5.573   1.00 0.00 ? 815 PRO A CA   1  
ATOM 1754  C C    . PRO A 1 108 ? -1.478  9.625   5.056   1.00 0.00 ? 815 PRO A C    1  
ATOM 1755  O O    . PRO A 1 108 ? -2.513  9.154   5.548   1.00 0.00 ? 815 PRO A O    1  
ATOM 1756  C CB   . PRO A 1 108 ? 0.289   10.011  6.814   1.00 0.00 ? 815 PRO A CB   1  
ATOM 1757  C CG   . PRO A 1 108 ? 1.396   10.908  6.373   1.00 0.00 ? 815 PRO A CG   1  
ATOM 1758  C CD   . PRO A 1 108 ? 2.079   10.209  5.238   1.00 0.00 ? 815 PRO A CD   1  
ATOM 1759  H HA   . PRO A 1 108 ? -0.139  8.132   5.842   1.00 0.00 ? 815 PRO A HA   1  
ATOM 1760  H HB2  . PRO A 1 108 ? -0.571  10.579  7.138   1.00 0.00 ? 815 PRO A HB2  1  
ATOM 1761  H HB3  . PRO A 1 108 ? 0.604   9.358   7.614   1.00 0.00 ? 815 PRO A HB3  1  
ATOM 1762  H HG2  . PRO A 1 108 ? 0.991   11.853  6.042   1.00 0.00 ? 815 PRO A HG2  1  
ATOM 1763  H HG3  . PRO A 1 108 ? 2.088   11.066  7.188   1.00 0.00 ? 815 PRO A HG3  1  
ATOM 1764  H HD2  . PRO A 1 108 ? 2.477   10.939  4.549   1.00 0.00 ? 815 PRO A HD2  1  
ATOM 1765  H HD3  . PRO A 1 108 ? 2.858   9.556   5.603   1.00 0.00 ? 815 PRO A HD3  1  
ATOM 1766  N N    . ASN A 1 109 ? -1.499  10.509  4.067   1.00 0.00 ? 816 ASN A N    1  
ATOM 1767  C CA   . ASN A 1 109 ? -2.743  11.014  3.537   1.00 0.00 ? 816 ASN A CA   1  
ATOM 1768  C C    . ASN A 1 109 ? -3.031  10.409  2.193   1.00 0.00 ? 816 ASN A C    1  
ATOM 1769  O O    . ASN A 1 109 ? -2.628  10.940  1.148   1.00 0.00 ? 816 ASN A O    1  
ATOM 1770  C CB   . ASN A 1 109 ? -2.781  12.543  3.447   1.00 0.00 ? 816 ASN A CB   1  
ATOM 1771  C CG   . ASN A 1 109 ? -2.670  13.225  4.789   1.00 0.00 ? 816 ASN A CG   1  
ATOM 1772  O OD1  . ASN A 1 109 ? -1.578  13.587  5.227   1.00 0.00 ? 816 ASN A OD1  1  
ATOM 1773  N ND2  . ASN A 1 109 ? -3.779  13.381  5.462   1.00 0.00 ? 816 ASN A ND2  1  
ATOM 1774  H H    . ASN A 1 109 ? -0.651  10.795  3.655   1.00 0.00 ? 816 ASN A H    1  
ATOM 1775  H HA   . ASN A 1 109 ? -3.516  10.693  4.219   1.00 0.00 ? 816 ASN A HA   1  
ATOM 1776  H HB2  . ASN A 1 109 ? -1.954  12.872  2.837   1.00 0.00 ? 816 ASN A HB2  1  
ATOM 1777  H HB3  . ASN A 1 109 ? -3.708  12.845  2.983   1.00 0.00 ? 816 ASN A HB3  1  
ATOM 1778  H HD21 . ASN A 1 109 ? -4.609  13.044  5.063   1.00 0.00 ? 816 ASN A HD21 1  
ATOM 1779  H HD22 . ASN A 1 109 ? -3.752  13.823  6.338   1.00 0.00 ? 816 ASN A HD22 1  
ATOM 1780  N N    . TYR A 1 110 ? -3.679  9.285   2.221   1.00 0.00 ? 817 TYR A N    1  
ATOM 1781  C CA   . TYR A 1 110 ? -4.043  8.572   1.017   1.00 0.00 ? 817 TYR A CA   1  
ATOM 1782  C C    . TYR A 1 110 ? -5.456  9.023   0.600   1.00 0.00 ? 817 TYR A C    1  
ATOM 1783  O O    . TYR A 1 110 ? -6.175  9.630   1.402   1.00 0.00 ? 817 TYR A O    1  
ATOM 1784  C CB   . TYR A 1 110 ? -3.989  7.048   1.272   1.00 0.00 ? 817 TYR A CB   1  
ATOM 1785  C CG   . TYR A 1 110 ? -3.813  6.219   0.012   1.00 0.00 ? 817 TYR A CG   1  
ATOM 1786  C CD1  . TYR A 1 110 ? -4.896  5.780   -0.736  1.00 0.00 ? 817 TYR A CD1  1  
ATOM 1787  C CD2  . TYR A 1 110 ? -2.546  5.899   -0.436  1.00 0.00 ? 817 TYR A CD2  1  
ATOM 1788  C CE1  . TYR A 1 110 ? -4.713  5.049   -1.890  1.00 0.00 ? 817 TYR A CE1  1  
ATOM 1789  C CE2  . TYR A 1 110 ? -2.361  5.176   -1.589  1.00 0.00 ? 817 TYR A CE2  1  
ATOM 1790  C CZ   . TYR A 1 110 ? -3.441  4.751   -2.310  1.00 0.00 ? 817 TYR A CZ   1  
ATOM 1791  O OH   . TYR A 1 110 ? -3.247  4.054   -3.479  1.00 0.00 ? 817 TYR A OH   1  
ATOM 1792  H H    . TYR A 1 110 ? -3.925  8.934   3.103   1.00 0.00 ? 817 TYR A H    1  
ATOM 1793  H HA   . TYR A 1 110 ? -3.341  8.839   0.240   1.00 0.00 ? 817 TYR A HA   1  
ATOM 1794  H HB2  . TYR A 1 110 ? -3.159  6.832   1.927   1.00 0.00 ? 817 TYR A HB2  1  
ATOM 1795  H HB3  . TYR A 1 110 ? -4.907  6.738   1.751   1.00 0.00 ? 817 TYR A HB3  1  
ATOM 1796  H HD1  . TYR A 1 110 ? -5.896  6.020   -0.408  1.00 0.00 ? 817 TYR A HD1  1  
ATOM 1797  H HD2  . TYR A 1 110 ? -1.687  6.230   0.130   1.00 0.00 ? 817 TYR A HD2  1  
ATOM 1798  H HE1  . TYR A 1 110 ? -5.567  4.715   -2.461  1.00 0.00 ? 817 TYR A HE1  1  
ATOM 1799  H HE2  . TYR A 1 110 ? -1.360  4.940   -1.917  1.00 0.00 ? 817 TYR A HE2  1  
ATOM 1800  H HH   . TYR A 1 110 ? -3.658  4.552   -4.195  1.00 0.00 ? 817 TYR A HH   1  
ATOM 1801  N N    . LEU A 1 111 ? -5.843  8.759   -0.633  1.00 0.00 ? 818 LEU A N    1  
ATOM 1802  C CA   . LEU A 1 111 ? -7.134  9.188   -1.140  1.00 0.00 ? 818 LEU A CA   1  
ATOM 1803  C C    . LEU A 1 111 ? -7.723  8.175   -2.124  1.00 0.00 ? 818 LEU A C    1  
ATOM 1804  O O    . LEU A 1 111 ? -7.083  7.190   -2.475  1.00 0.00 ? 818 LEU A O    1  
ATOM 1805  C CB   . LEU A 1 111 ? -7.067  10.638  -1.771  1.00 0.00 ? 818 LEU A CB   1  
ATOM 1806  C CG   . LEU A 1 111 ? -5.984  10.990  -2.874  1.00 0.00 ? 818 LEU A CG   1  
ATOM 1807  C CD1  . LEU A 1 111 ? -4.561  10.990  -2.333  1.00 0.00 ? 818 LEU A CD1  1  
ATOM 1808  C CD2  . LEU A 1 111 ? -6.080  10.092  -4.105  1.00 0.00 ? 818 LEU A CD2  1  
ATOM 1809  H H    . LEU A 1 111 ? -5.268  8.251   -1.242  1.00 0.00 ? 818 LEU A H    1  
ATOM 1810  H HA   . LEU A 1 111 ? -7.795  9.226   -0.288  1.00 0.00 ? 818 LEU A HA   1  
ATOM 1811  H HB2  . LEU A 1 111 ? -8.033  10.837  -2.211  1.00 0.00 ? 818 LEU A HB2  1  
ATOM 1812  H HB3  . LEU A 1 111 ? -6.941  11.331  -0.952  1.00 0.00 ? 818 LEU A HB3  1  
ATOM 1813  H HG   . LEU A 1 111 ? -6.175  12.005  -3.189  1.00 0.00 ? 818 LEU A HG   1  
ATOM 1814  H HD11 . LEU A 1 111 ? -3.873  11.237  -3.128  1.00 0.00 ? 818 LEU A HD11 1  
ATOM 1815  H HD12 . LEU A 1 111 ? -4.322  10.010  -1.944  1.00 0.00 ? 818 LEU A HD12 1  
ATOM 1816  H HD13 . LEU A 1 111 ? -4.477  11.720  -1.543  1.00 0.00 ? 818 LEU A HD13 1  
ATOM 1817  H HD21 . LEU A 1 111 ? -5.319  10.366  -4.819  1.00 0.00 ? 818 LEU A HD21 1  
ATOM 1818  H HD22 . LEU A 1 111 ? -7.056  10.200  -4.554  1.00 0.00 ? 818 LEU A HD22 1  
ATOM 1819  H HD23 . LEU A 1 111 ? -5.936  9.066   -3.798  1.00 0.00 ? 818 LEU A HD23 1  
ATOM 1820  N N    . LEU A 1 112 ? -8.934  8.410   -2.544  1.00 0.00 ? 819 LEU A N    1  
ATOM 1821  C CA   . LEU A 1 112 ? -9.574  7.600   -3.556  1.00 0.00 ? 819 LEU A CA   1  
ATOM 1822  C C    . LEU A 1 112 ? -9.632  8.395   -4.845  1.00 0.00 ? 819 LEU A C    1  
ATOM 1823  O O    . LEU A 1 112 ? -9.446  9.617   -4.829  1.00 0.00 ? 819 LEU A O    1  
ATOM 1824  C CB   . LEU A 1 112 ? -10.997 7.135   -3.148  1.00 0.00 ? 819 LEU A CB   1  
ATOM 1825  C CG   . LEU A 1 112 ? -11.127 6.072   -2.025  1.00 0.00 ? 819 LEU A CG   1  
ATOM 1826  C CD1  . LEU A 1 112 ? -10.313 4.822   -2.339  1.00 0.00 ? 819 LEU A CD1  1  
ATOM 1827  C CD2  . LEU A 1 112 ? -10.772 6.630   -0.653  1.00 0.00 ? 819 LEU A CD2  1  
ATOM 1828  H H    . LEU A 1 112 ? -9.432  9.169   -2.168  1.00 0.00 ? 819 LEU A H    1  
ATOM 1829  H HA   . LEU A 1 112 ? -8.946  6.738   -3.723  1.00 0.00 ? 819 LEU A HA   1  
ATOM 1830  H HB2  . LEU A 1 112 ? -11.546 8.009   -2.834  1.00 0.00 ? 819 LEU A HB2  1  
ATOM 1831  H HB3  . LEU A 1 112 ? -11.476 6.745   -4.034  1.00 0.00 ? 819 LEU A HB3  1  
ATOM 1832  H HG   . LEU A 1 112 ? -12.159 5.755   -2.004  1.00 0.00 ? 819 LEU A HG   1  
ATOM 1833  H HD11 . LEU A 1 112 ? -9.268  5.078   -2.418  1.00 0.00 ? 819 LEU A HD11 1  
ATOM 1834  H HD12 . LEU A 1 112 ? -10.652 4.399   -3.275  1.00 0.00 ? 819 LEU A HD12 1  
ATOM 1835  H HD13 . LEU A 1 112 ? -10.449 4.097   -1.550  1.00 0.00 ? 819 LEU A HD13 1  
ATOM 1836  H HD21 . LEU A 1 112 ? -9.756  6.995   -0.665  1.00 0.00 ? 819 LEU A HD21 1  
ATOM 1837  H HD22 . LEU A 1 112 ? -10.864 5.852   0.091   1.00 0.00 ? 819 LEU A HD22 1  
ATOM 1838  H HD23 . LEU A 1 112 ? -11.442 7.441   -0.409  1.00 0.00 ? 819 LEU A HD23 1  
ATOM 1839  N N    . GLU A 1 113 ? -9.911  7.726   -5.940  1.00 0.00 ? 820 GLU A N    1  
ATOM 1840  C CA   . GLU A 1 113 ? -9.929  8.363   -7.256  1.00 0.00 ? 820 GLU A CA   1  
ATOM 1841  C C    . GLU A 1 113 ? -11.216 9.128   -7.509  1.00 0.00 ? 820 GLU A C    1  
ATOM 1842  O O    . GLU A 1 113 ? -11.360 9.805   -8.530  1.00 0.00 ? 820 GLU A O    1  
ATOM 1843  C CB   . GLU A 1 113 ? -9.762  7.316   -8.323  1.00 0.00 ? 820 GLU A CB   1  
ATOM 1844  C CG   . GLU A 1 113 ? -8.429  6.614   -8.288  1.00 0.00 ? 820 GLU A CG   1  
ATOM 1845  C CD   . GLU A 1 113 ? -8.378  5.451   -9.231  1.00 0.00 ? 820 GLU A CD   1  
ATOM 1846  O OE1  . GLU A 1 113 ? -8.791  4.343   -8.822  1.00 0.00 ? 820 GLU A OE1  1  
ATOM 1847  O OE2  . GLU A 1 113 ? -7.905  5.615   -10.385 1.00 0.00 ? 820 GLU A OE2  1  
ATOM 1848  H H    . GLU A 1 113 ? -10.115 6.767   -5.892  1.00 0.00 ? 820 GLU A H    1  
ATOM 1849  H HA   . GLU A 1 113 ? -9.091  9.042   -7.315  1.00 0.00 ? 820 GLU A HA   1  
ATOM 1850  H HB2  . GLU A 1 113 ? -10.546 6.582   -8.201  1.00 0.00 ? 820 GLU A HB2  1  
ATOM 1851  H HB3  . GLU A 1 113 ? -9.886  7.799   -9.279  1.00 0.00 ? 820 GLU A HB3  1  
ATOM 1852  H HG2  . GLU A 1 113 ? -7.655  7.314   -8.559  1.00 0.00 ? 820 GLU A HG2  1  
ATOM 1853  H HG3  . GLU A 1 113 ? -8.250  6.255   -7.284  1.00 0.00 ? 820 GLU A HG3  1  
ATOM 1854  N N    . ASP A 1 114 ? -12.142 9.003   -6.623  1.00 0.00 ? 821 ASP A N    1  
ATOM 1855  C CA   . ASP A 1 114 ? -13.415 9.648   -6.756  1.00 0.00 ? 821 ASP A CA   1  
ATOM 1856  C C    . ASP A 1 114 ? -13.879 10.013  -5.377  1.00 0.00 ? 821 ASP A C    1  
ATOM 1857  O O    . ASP A 1 114 ? -14.175 11.180  -5.129  1.00 0.00 ? 821 ASP A O    1  
ATOM 1858  C CB   . ASP A 1 114 ? -14.414 8.730   -7.456  1.00 0.00 ? 821 ASP A CB   1  
ATOM 1859  C CG   . ASP A 1 114 ? -15.677 9.435   -7.882  1.00 0.00 ? 821 ASP A CG   1  
ATOM 1860  O OD1  . ASP A 1 114 ? -15.677 10.054  -8.984  1.00 0.00 ? 821 ASP A OD1  1  
ATOM 1861  O OD2  . ASP A 1 114 ? -16.682 9.375   -7.173  1.00 0.00 ? 821 ASP A OD2  1  
ATOM 1862  O OXT  . ASP A 1 114 ? -13.770 9.156   -4.481  1.00 0.00 ? 821 ASP A OXT  1  
ATOM 1863  H H    . ASP A 1 114 ? -11.997 8.480   -5.809  1.00 0.00 ? 821 ASP A H    1  
ATOM 1864  H HA   . ASP A 1 114 ? -13.279 10.551  -7.331  1.00 0.00 ? 821 ASP A HA   1  
ATOM 1865  H HB2  . ASP A 1 114 ? -13.954 8.301   -8.333  1.00 0.00 ? 821 ASP A HB2  1  
ATOM 1866  H HB3  . ASP A 1 114 ? -14.678 7.937   -6.774  1.00 0.00 ? 821 ASP A HB3  1  
ATOM 1867  N N    . ALA A 1 1   ? -15.273 9.428   -12.048 1.00 0.00 ? 708 ALA A N    2  
ATOM 1868  C CA   . ALA A 1 1   ? -14.477 9.631   -10.882 1.00 0.00 ? 708 ALA A CA   2  
ATOM 1869  C C    . ALA A 1 1   ? -14.638 8.466   -9.928  1.00 0.00 ? 708 ALA A C    2  
ATOM 1870  O O    . ALA A 1 1   ? -15.727 7.874   -9.834  1.00 0.00 ? 708 ALA A O    2  
ATOM 1871  C CB   . ALA A 1 1   ? -14.864 10.943  -10.207 1.00 0.00 ? 708 ALA A CB   2  
ATOM 1872  H H1   . ALA A 1 1   ? -16.166 9.829   -12.096 1.00 0.00 ? 708 ALA A H1   2  
ATOM 1873  H HA   . ALA A 1 1   ? -13.444 9.702   -11.191 1.00 0.00 ? 708 ALA A HA   2  
ATOM 1874  H HB1  . ALA A 1 1   ? -14.736 11.758  -10.906 1.00 0.00 ? 708 ALA A HB1  2  
ATOM 1875  H HB2  . ALA A 1 1   ? -14.235 11.104  -9.344  1.00 0.00 ? 708 ALA A HB2  2  
ATOM 1876  H HB3  . ALA A 1 1   ? -15.897 10.894  -9.897  1.00 0.00 ? 708 ALA A HB3  2  
ATOM 1877  N N    . PRO A 1 2   ? -13.557 8.074   -9.251  1.00 0.00 ? 709 PRO A N    2  
ATOM 1878  C CA   . PRO A 1 2   ? -13.622 7.038   -8.247  1.00 0.00 ? 709 PRO A CA   2  
ATOM 1879  C C    . PRO A 1 2   ? -14.340 7.564   -7.004  1.00 0.00 ? 709 PRO A C    2  
ATOM 1880  O O    . PRO A 1 2   ? -13.724 8.146   -6.095  1.00 0.00 ? 709 PRO A O    2  
ATOM 1881  C CB   . PRO A 1 2   ? -12.158 6.710   -7.954  1.00 0.00 ? 709 PRO A CB   2  
ATOM 1882  C CG   . PRO A 1 2   ? -11.388 7.923   -8.358  1.00 0.00 ? 709 PRO A CG   2  
ATOM 1883  C CD   . PRO A 1 2   ? -12.190 8.608   -9.427  1.00 0.00 ? 709 PRO A CD   2  
ATOM 1884  H HA   . PRO A 1 2   ? -14.143 6.168   -8.618  1.00 0.00 ? 709 PRO A HA   2  
ATOM 1885  H HB2  . PRO A 1 2   ? -12.039 6.499   -6.901  1.00 0.00 ? 709 PRO A HB2  2  
ATOM 1886  H HB3  . PRO A 1 2   ? -11.859 5.847   -8.532  1.00 0.00 ? 709 PRO A HB3  2  
ATOM 1887  H HG2  . PRO A 1 2   ? -11.266 8.579   -7.508  1.00 0.00 ? 709 PRO A HG2  2  
ATOM 1888  H HG3  . PRO A 1 2   ? -10.421 7.635   -8.743  1.00 0.00 ? 709 PRO A HG3  2  
ATOM 1889  H HD2  . PRO A 1 2   ? -12.175 9.678   -9.278  1.00 0.00 ? 709 PRO A HD2  2  
ATOM 1890  H HD3  . PRO A 1 2   ? -11.804 8.360   -10.406 1.00 0.00 ? 709 PRO A HD3  2  
ATOM 1891  N N    . LYS A 1 3   ? -15.645 7.417   -7.013  1.00 0.00 ? 710 LYS A N    2  
ATOM 1892  C CA   . LYS A 1 3   ? -16.496 7.943   -5.985  1.00 0.00 ? 710 LYS A CA   2  
ATOM 1893  C C    . LYS A 1 3   ? -16.373 7.137   -4.708  1.00 0.00 ? 710 LYS A C    2  
ATOM 1894  O O    . LYS A 1 3   ? -16.964 6.053   -4.569  1.00 0.00 ? 710 LYS A O    2  
ATOM 1895  C CB   . LYS A 1 3   ? -17.955 7.997   -6.466  1.00 0.00 ? 710 LYS A CB   2  
ATOM 1896  C CG   . LYS A 1 3   ? -18.925 8.647   -5.483  1.00 0.00 ? 710 LYS A CG   2  
ATOM 1897  C CD   . LYS A 1 3   ? -18.627 10.123  -5.285  1.00 0.00 ? 710 LYS A CD   2  
ATOM 1898  C CE   . LYS A 1 3   ? -19.584 10.740  -4.288  1.00 0.00 ? 710 LYS A CE   2  
ATOM 1899  N NZ   . LYS A 1 3   ? -19.373 12.191  -4.143  1.00 0.00 ? 710 LYS A NZ   2  
ATOM 1900  H H    . LYS A 1 3   ? -16.047 6.932   -7.765  1.00 0.00 ? 710 LYS A H    2  
ATOM 1901  H HA   . LYS A 1 3   ? -16.167 8.952   -5.792  1.00 0.00 ? 710 LYS A HA   2  
ATOM 1902  H HB2  . LYS A 1 3   ? -17.992 8.555   -7.390  1.00 0.00 ? 710 LYS A HB2  2  
ATOM 1903  H HB3  . LYS A 1 3   ? -18.289 6.987   -6.657  1.00 0.00 ? 710 LYS A HB3  2  
ATOM 1904  H HG2  . LYS A 1 3   ? -19.928 8.544   -5.866  1.00 0.00 ? 710 LYS A HG2  2  
ATOM 1905  H HG3  . LYS A 1 3   ? -18.846 8.141   -4.531  1.00 0.00 ? 710 LYS A HG3  2  
ATOM 1906  H HD2  . LYS A 1 3   ? -17.620 10.238  -4.912  1.00 0.00 ? 710 LYS A HD2  2  
ATOM 1907  H HD3  . LYS A 1 3   ? -18.727 10.631  -6.232  1.00 0.00 ? 710 LYS A HD3  2  
ATOM 1908  H HE2  . LYS A 1 3   ? -20.593 10.552  -4.619  1.00 0.00 ? 710 LYS A HE2  2  
ATOM 1909  H HE3  . LYS A 1 3   ? -19.433 10.264  -3.331  1.00 0.00 ? 710 LYS A HE3  2  
ATOM 1910  H HZ1  . LYS A 1 3   ? -18.410 12.402  -3.812  1.00 0.00 ? 710 LYS A HZ1  2  
ATOM 1911  H HZ2  . LYS A 1 3   ? -20.042 12.604  -3.464  1.00 0.00 ? 710 LYS A HZ2  2  
ATOM 1912  H HZ3  . LYS A 1 3   ? -19.496 12.667  -5.059  1.00 0.00 ? 710 LYS A HZ3  2  
ATOM 1913  N N    . ALA A 1 4   ? -15.588 7.648   -3.802  1.00 0.00 ? 711 ALA A N    2  
ATOM 1914  C CA   . ALA A 1 4   ? -15.382 7.032   -2.537  1.00 0.00 ? 711 ALA A CA   2  
ATOM 1915  C C    . ALA A 1 4   ? -16.415 7.546   -1.559  1.00 0.00 ? 711 ALA A C    2  
ATOM 1916  O O    . ALA A 1 4   ? -16.251 8.617   -0.957  1.00 0.00 ? 711 ALA A O    2  
ATOM 1917  C CB   . ALA A 1 4   ? -13.971 7.302   -2.038  1.00 0.00 ? 711 ALA A CB   2  
ATOM 1918  H H    . ALA A 1 4   ? -15.126 8.492   -4.003  1.00 0.00 ? 711 ALA A H    2  
ATOM 1919  H HA   . ALA A 1 4   ? -15.508 5.965   -2.657  1.00 0.00 ? 711 ALA A HA   2  
ATOM 1920  H HB1  . ALA A 1 4   ? -13.254 6.917   -2.749  1.00 0.00 ? 711 ALA A HB1  2  
ATOM 1921  H HB2  . ALA A 1 4   ? -13.830 6.810   -1.087  1.00 0.00 ? 711 ALA A HB2  2  
ATOM 1922  H HB3  . ALA A 1 4   ? -13.829 8.365   -1.920  1.00 0.00 ? 711 ALA A HB3  2  
ATOM 1923  N N    . SER A 1 5   ? -17.501 6.833   -1.463  1.00 0.00 ? 712 SER A N    2  
ATOM 1924  C CA   . SER A 1 5   ? -18.570 7.188   -0.571  1.00 0.00 ? 712 SER A CA   2  
ATOM 1925  C C    . SER A 1 5   ? -18.442 6.422   0.744   1.00 0.00 ? 712 SER A C    2  
ATOM 1926  O O    . SER A 1 5   ? -19.175 6.697   1.710   1.00 0.00 ? 712 SER A O    2  
ATOM 1927  C CB   . SER A 1 5   ? -19.920 6.918   -1.257  1.00 0.00 ? 712 SER A CB   2  
ATOM 1928  O OG   . SER A 1 5   ? -19.959 5.606   -1.827  1.00 0.00 ? 712 SER A OG   2  
ATOM 1929  H H    . SER A 1 5   ? -17.606 6.032   -2.021  1.00 0.00 ? 712 SER A H    2  
ATOM 1930  H HA   . SER A 1 5   ? -18.492 8.245   -0.366  1.00 0.00 ? 712 SER A HA   2  
ATOM 1931  H HB2  . SER A 1 5   ? -20.716 7.000   -0.531  1.00 0.00 ? 712 SER A HB2  2  
ATOM 1932  H HB3  . SER A 1 5   ? -20.076 7.642   -2.043  1.00 0.00 ? 712 SER A HB3  2  
ATOM 1933  H HG   . SER A 1 5   ? -20.877 5.418   -2.065  1.00 0.00 ? 712 SER A HG   2  
ATOM 1934  N N    . LEU A 1 6   ? -17.478 5.482   0.767   1.00 0.00 ? 713 LEU A N    2  
ATOM 1935  C CA   . LEU A 1 6   ? -17.210 4.611   1.913   1.00 0.00 ? 713 LEU A CA   2  
ATOM 1936  C C    . LEU A 1 6   ? -18.456 3.808   2.251   1.00 0.00 ? 713 LEU A C    2  
ATOM 1937  O O    . LEU A 1 6   ? -19.318 4.246   3.025   1.00 0.00 ? 713 LEU A O    2  
ATOM 1938  C CB   . LEU A 1 6   ? -16.640 5.370   3.152   1.00 0.00 ? 713 LEU A CB   2  
ATOM 1939  C CG   . LEU A 1 6   ? -15.203 5.966   3.043   1.00 0.00 ? 713 LEU A CG   2  
ATOM 1940  C CD1  . LEU A 1 6   ? -14.207 4.931   2.605   1.00 0.00 ? 713 LEU A CD1  2  
ATOM 1941  C CD2  . LEU A 1 6   ? -15.121 7.190   2.146   1.00 0.00 ? 713 LEU A CD2  2  
ATOM 1942  H H    . LEU A 1 6   ? -16.948 5.362   -0.046  1.00 0.00 ? 713 LEU A H    2  
ATOM 1943  H HA   . LEU A 1 6   ? -16.480 3.894   1.568   1.00 0.00 ? 713 LEU A HA   2  
ATOM 1944  H HB2  . LEU A 1 6   ? -17.314 6.185   3.372   1.00 0.00 ? 713 LEU A HB2  2  
ATOM 1945  H HB3  . LEU A 1 6   ? -16.655 4.690   3.991   1.00 0.00 ? 713 LEU A HB3  2  
ATOM 1946  H HG   . LEU A 1 6   ? -14.896 6.257   4.037   1.00 0.00 ? 713 LEU A HG   2  
ATOM 1947  H HD11 . LEU A 1 6   ? -13.224 5.381   2.568   1.00 0.00 ? 713 LEU A HD11 2  
ATOM 1948  H HD12 . LEU A 1 6   ? -14.464 4.564   1.622   1.00 0.00 ? 713 LEU A HD12 2  
ATOM 1949  H HD13 . LEU A 1 6   ? -14.193 4.113   3.310   1.00 0.00 ? 713 LEU A HD13 2  
ATOM 1950  H HD21 . LEU A 1 6   ? -14.094 7.535   2.139   1.00 0.00 ? 713 LEU A HD21 2  
ATOM 1951  H HD22 . LEU A 1 6   ? -15.764 7.970   2.522   1.00 0.00 ? 713 LEU A HD22 2  
ATOM 1952  H HD23 . LEU A 1 6   ? -15.412 6.925   1.140   1.00 0.00 ? 713 LEU A HD23 2  
ATOM 1953  N N    . ARG A 1 7   ? -18.557 2.657   1.642   1.00 0.00 ? 714 ARG A N    2  
ATOM 1954  C CA   . ARG A 1 7   ? -19.748 1.856   1.703   1.00 0.00 ? 714 ARG A CA   2  
ATOM 1955  C C    . ARG A 1 7   ? -19.381 0.384   1.505   1.00 0.00 ? 714 ARG A C    2  
ATOM 1956  O O    . ARG A 1 7   ? -18.280 0.073   1.039   1.00 0.00 ? 714 ARG A O    2  
ATOM 1957  C CB   . ARG A 1 7   ? -20.696 2.326   0.574   1.00 0.00 ? 714 ARG A CB   2  
ATOM 1958  C CG   . ARG A 1 7   ? -22.021 1.595   0.492   1.00 0.00 ? 714 ARG A CG   2  
ATOM 1959  C CD   . ARG A 1 7   ? -22.865 2.108   -0.650  1.00 0.00 ? 714 ARG A CD   2  
ATOM 1960  N NE   . ARG A 1 7   ? -24.134 1.382   -0.740  1.00 0.00 ? 714 ARG A NE   2  
ATOM 1961  C CZ   . ARG A 1 7   ? -25.279 1.891   -1.201  1.00 0.00 ? 714 ARG A CZ   2  
ATOM 1962  N NH1  . ARG A 1 7   ? -25.321 3.135   -1.661  1.00 0.00 ? 714 ARG A NH1  2  
ATOM 1963  N NH2  . ARG A 1 7   ? -26.377 1.151   -1.203  1.00 0.00 ? 714 ARG A NH2  2  
ATOM 1964  H H    . ARG A 1 7   ? -17.784 2.292   1.160   1.00 0.00 ? 714 ARG A H    2  
ATOM 1965  H HA   . ARG A 1 7   ? -20.237 2.006   2.653   1.00 0.00 ? 714 ARG A HA   2  
ATOM 1966  H HB2  . ARG A 1 7   ? -20.906 3.375   0.713   1.00 0.00 ? 714 ARG A HB2  2  
ATOM 1967  H HB3  . ARG A 1 7   ? -20.184 2.203   -0.369  1.00 0.00 ? 714 ARG A HB3  2  
ATOM 1968  H HG2  . ARG A 1 7   ? -21.828 0.543   0.344   1.00 0.00 ? 714 ARG A HG2  2  
ATOM 1969  H HG3  . ARG A 1 7   ? -22.555 1.733   1.419   1.00 0.00 ? 714 ARG A HG3  2  
ATOM 1970  H HD2  . ARG A 1 7   ? -23.066 3.157   -0.492  1.00 0.00 ? 714 ARG A HD2  2  
ATOM 1971  H HD3  . ARG A 1 7   ? -22.320 1.980   -1.574  1.00 0.00 ? 714 ARG A HD3  2  
ATOM 1972  H HE   . ARG A 1 7   ? -24.093 0.452   -0.419  1.00 0.00 ? 714 ARG A HE   2  
ATOM 1973  H HH11 . ARG A 1 7   ? -24.506 3.719   -1.678  1.00 0.00 ? 714 ARG A HH11 2  
ATOM 1974  H HH12 . ARG A 1 7   ? -26.165 3.554   -2.010  1.00 0.00 ? 714 ARG A HH12 2  
ATOM 1975  H HH21 . ARG A 1 7   ? -26.414 0.204   -0.869  1.00 0.00 ? 714 ARG A HH21 2  
ATOM 1976  H HH22 . ARG A 1 7   ? -27.246 1.511   -1.553  1.00 0.00 ? 714 ARG A HH22 2  
ATOM 1977  N N    . LEU A 1 8   ? -20.280 -0.507  1.892   1.00 0.00 ? 715 LEU A N    2  
ATOM 1978  C CA   . LEU A 1 8   ? -20.128 -1.930  1.663   1.00 0.00 ? 715 LEU A CA   2  
ATOM 1979  C C    . LEU A 1 8   ? -19.956 -2.180  0.161   1.00 0.00 ? 715 LEU A C    2  
ATOM 1980  O O    . LEU A 1 8   ? -20.762 -1.704  -0.653  1.00 0.00 ? 715 LEU A O    2  
ATOM 1981  C CB   . LEU A 1 8   ? -21.359 -2.673  2.188   1.00 0.00 ? 715 LEU A CB   2  
ATOM 1982  C CG   . LEU A 1 8   ? -21.334 -4.195  2.071   1.00 0.00 ? 715 LEU A CG   2  
ATOM 1983  C CD1  . LEU A 1 8   ? -20.229 -4.791  2.933   1.00 0.00 ? 715 LEU A CD1  2  
ATOM 1984  C CD2  . LEU A 1 8   ? -22.681 -4.772  2.444   1.00 0.00 ? 715 LEU A CD2  2  
ATOM 1985  H H    . LEU A 1 8   ? -21.072 -0.185  2.374   1.00 0.00 ? 715 LEU A H    2  
ATOM 1986  H HA   . LEU A 1 8   ? -19.249 -2.265  2.192   1.00 0.00 ? 715 LEU A HA   2  
ATOM 1987  H HB2  . LEU A 1 8   ? -21.485 -2.421  3.230   1.00 0.00 ? 715 LEU A HB2  2  
ATOM 1988  H HB3  . LEU A 1 8   ? -22.222 -2.310  1.651   1.00 0.00 ? 715 LEU A HB3  2  
ATOM 1989  H HG   . LEU A 1 8   ? -21.125 -4.461  1.046   1.00 0.00 ? 715 LEU A HG   2  
ATOM 1990  H HD11 . LEU A 1 8   ? -20.245 -5.866  2.840   1.00 0.00 ? 715 LEU A HD11 2  
ATOM 1991  H HD12 . LEU A 1 8   ? -20.388 -4.513  3.965   1.00 0.00 ? 715 LEU A HD12 2  
ATOM 1992  H HD13 . LEU A 1 8   ? -19.270 -4.418  2.604   1.00 0.00 ? 715 LEU A HD13 2  
ATOM 1993  H HD21 . LEU A 1 8   ? -22.937 -4.481  3.452   1.00 0.00 ? 715 LEU A HD21 2  
ATOM 1994  H HD22 . LEU A 1 8   ? -22.632 -5.849  2.384   1.00 0.00 ? 715 LEU A HD22 2  
ATOM 1995  H HD23 . LEU A 1 8   ? -23.433 -4.411  1.758   1.00 0.00 ? 715 LEU A HD23 2  
ATOM 1996  N N    . GLY A 1 9   ? -18.906 -2.880  -0.200  1.00 0.00 ? 716 GLY A N    2  
ATOM 1997  C CA   . GLY A 1 9   ? -18.604 -3.101  -1.606  1.00 0.00 ? 716 GLY A CA   2  
ATOM 1998  C C    . GLY A 1 9   ? -17.433 -2.243  -2.025  1.00 0.00 ? 716 GLY A C    2  
ATOM 1999  O O    . GLY A 1 9   ? -16.942 -2.315  -3.162  1.00 0.00 ? 716 GLY A O    2  
ATOM 2000  H H    . GLY A 1 9   ? -18.323 -3.262  0.492   1.00 0.00 ? 716 GLY A H    2  
ATOM 2001  H HA2  . GLY A 1 9   ? -18.364 -4.142  -1.760  1.00 0.00 ? 716 GLY A HA2  2  
ATOM 2002  H HA3  . GLY A 1 9   ? -19.463 -2.835  -2.204  1.00 0.00 ? 716 GLY A HA3  2  
ATOM 2003  N N    . PHE A 1 10  ? -17.034 -1.393  -1.111  1.00 0.00 ? 717 PHE A N    2  
ATOM 2004  C CA   . PHE A 1 10  ? -15.881 -0.541  -1.248  1.00 0.00 ? 717 PHE A CA   2  
ATOM 2005  C C    . PHE A 1 10  ? -15.102 -0.649  0.070   1.00 0.00 ? 717 PHE A C    2  
ATOM 2006  O O    . PHE A 1 10  ? -14.099 0.026   0.302   1.00 0.00 ? 717 PHE A O    2  
ATOM 2007  C CB   . PHE A 1 10  ? -16.361 0.901   -1.504  1.00 0.00 ? 717 PHE A CB   2  
ATOM 2008  C CG   . PHE A 1 10  ? -15.284 1.897   -1.830  1.00 0.00 ? 717 PHE A CG   2  
ATOM 2009  C CD1  . PHE A 1 10  ? -14.686 1.900   -3.075  1.00 0.00 ? 717 PHE A CD1  2  
ATOM 2010  C CD2  . PHE A 1 10  ? -14.890 2.846   -0.899  1.00 0.00 ? 717 PHE A CD2  2  
ATOM 2011  C CE1  . PHE A 1 10  ? -13.715 2.824   -3.388  1.00 0.00 ? 717 PHE A CE1  2  
ATOM 2012  C CE2  . PHE A 1 10  ? -13.917 3.770   -1.205  1.00 0.00 ? 717 PHE A CE2  2  
ATOM 2013  C CZ   . PHE A 1 10  ? -13.329 3.760   -2.454  1.00 0.00 ? 717 PHE A CZ   2  
ATOM 2014  H H    . PHE A 1 10  ? -17.564 -1.293  -0.291  1.00 0.00 ? 717 PHE A H    2  
ATOM 2015  H HA   . PHE A 1 10  ? -15.276 -0.891  -2.071  1.00 0.00 ? 717 PHE A HA   2  
ATOM 2016  H HB2  . PHE A 1 10  ? -17.052 0.896   -2.334  1.00 0.00 ? 717 PHE A HB2  2  
ATOM 2017  H HB3  . PHE A 1 10  ? -16.883 1.251   -0.626  1.00 0.00 ? 717 PHE A HB3  2  
ATOM 2018  H HD1  . PHE A 1 10  ? -14.985 1.166   -3.808  1.00 0.00 ? 717 PHE A HD1  2  
ATOM 2019  H HD2  . PHE A 1 10  ? -15.350 2.850   0.077   1.00 0.00 ? 717 PHE A HD2  2  
ATOM 2020  H HE1  . PHE A 1 10  ? -13.256 2.812   -4.364  1.00 0.00 ? 717 PHE A HE1  2  
ATOM 2021  H HE2  . PHE A 1 10  ? -13.615 4.503   -0.472  1.00 0.00 ? 717 PHE A HE2  2  
ATOM 2022  H HZ   . PHE A 1 10  ? -12.568 4.486   -2.699  1.00 0.00 ? 717 PHE A HZ   2  
ATOM 2023  N N    . SER A 1 11  ? -15.542 -1.603  0.876   1.00 0.00 ? 718 SER A N    2  
ATOM 2024  C CA   . SER A 1 11  ? -15.044 -1.844  2.213   1.00 0.00 ? 718 SER A CA   2  
ATOM 2025  C C    . SER A 1 11  ? -13.603 -2.317  2.145   1.00 0.00 ? 718 SER A C    2  
ATOM 2026  O O    . SER A 1 11  ? -12.785 -2.016  3.009   1.00 0.00 ? 718 SER A O    2  
ATOM 2027  C CB   . SER A 1 11  ? -15.927 -2.910  2.833   1.00 0.00 ? 718 SER A CB   2  
ATOM 2028  O OG   . SER A 1 11  ? -17.289 -2.600  2.565   1.00 0.00 ? 718 SER A OG   2  
ATOM 2029  H H    . SER A 1 11  ? -16.213 -2.227  0.530   1.00 0.00 ? 718 SER A H    2  
ATOM 2030  H HA   . SER A 1 11  ? -15.117 -0.941  2.801   1.00 0.00 ? 718 SER A HA   2  
ATOM 2031  H HB2  . SER A 1 11  ? -15.690 -3.874  2.405   1.00 0.00 ? 718 SER A HB2  2  
ATOM 2032  H HB3  . SER A 1 11  ? -15.780 -2.938  3.902   1.00 0.00 ? 718 SER A HB3  2  
ATOM 2033  H HG   . SER A 1 11  ? -17.395 -1.667  2.784   1.00 0.00 ? 718 SER A HG   2  
ATOM 2034  N N    . GLU A 1 12  ? -13.308 -3.037  1.087   1.00 0.00 ? 719 GLU A N    2  
ATOM 2035  C CA   . GLU A 1 12  ? -11.988 -3.511  0.800   1.00 0.00 ? 719 GLU A CA   2  
ATOM 2036  C C    . GLU A 1 12  ? -11.002 -2.365  0.650   1.00 0.00 ? 719 GLU A C    2  
ATOM 2037  O O    . GLU A 1 12  ? -9.887  -2.451  1.136   1.00 0.00 ? 719 GLU A O    2  
ATOM 2038  C CB   . GLU A 1 12  ? -11.960 -4.427  -0.436  1.00 0.00 ? 719 GLU A CB   2  
ATOM 2039  C CG   . GLU A 1 12  ? -12.972 -4.086  -1.551  1.00 0.00 ? 719 GLU A CG   2  
ATOM 2040  C CD   . GLU A 1 12  ? -14.352 -4.673  -1.291  1.00 0.00 ? 719 GLU A CD   2  
ATOM 2041  O OE1  . GLU A 1 12  ? -15.154 -4.070  -0.553  1.00 0.00 ? 719 GLU A OE1  2  
ATOM 2042  O OE2  . GLU A 1 12  ? -14.624 -5.782  -1.784  1.00 0.00 ? 719 GLU A OE2  2  
ATOM 2043  H H    . GLU A 1 12  ? -14.049 -3.266  0.474   1.00 0.00 ? 719 GLU A H    2  
ATOM 2044  H HA   . GLU A 1 12  ? -11.677 -4.092  1.655   1.00 0.00 ? 719 GLU A HA   2  
ATOM 2045  H HB2  . GLU A 1 12  ? -10.965 -4.377  -0.851  1.00 0.00 ? 719 GLU A HB2  2  
ATOM 2046  H HB3  . GLU A 1 12  ? -12.135 -5.442  -0.113  1.00 0.00 ? 719 GLU A HB3  2  
ATOM 2047  H HG2  . GLU A 1 12  ? -13.067 -3.012  -1.615  1.00 0.00 ? 719 GLU A HG2  2  
ATOM 2048  H HG3  . GLU A 1 12  ? -12.608 -4.470  -2.493  1.00 0.00 ? 719 GLU A HG3  2  
ATOM 2049  N N    . TYR A 1 13  ? -11.437 -1.274  0.036   1.00 0.00 ? 720 TYR A N    2  
ATOM 2050  C CA   . TYR A 1 13  ? -10.574 -0.123  -0.169  1.00 0.00 ? 720 TYR A CA   2  
ATOM 2051  C C    . TYR A 1 13  ? -10.183 0.449   1.187   1.00 0.00 ? 720 TYR A C    2  
ATOM 2052  O O    . TYR A 1 13  ? -9.001  0.720   1.447   1.00 0.00 ? 720 TYR A O    2  
ATOM 2053  C CB   . TYR A 1 13  ? -11.286 0.940   -1.022  1.00 0.00 ? 720 TYR A CB   2  
ATOM 2054  C CG   . TYR A 1 13  ? -10.432 2.144   -1.383  1.00 0.00 ? 720 TYR A CG   2  
ATOM 2055  C CD1  . TYR A 1 13  ? -10.281 3.212   -0.503  1.00 0.00 ? 720 TYR A CD1  2  
ATOM 2056  C CD2  . TYR A 1 13  ? -9.784  2.214   -2.609  1.00 0.00 ? 720 TYR A CD2  2  
ATOM 2057  C CE1  . TYR A 1 13  ? -9.513  4.302   -0.832  1.00 0.00 ? 720 TYR A CE1  2  
ATOM 2058  C CE2  . TYR A 1 13  ? -9.012  3.307   -2.944  1.00 0.00 ? 720 TYR A CE2  2  
ATOM 2059  C CZ   . TYR A 1 13  ? -8.881  4.346   -2.051  1.00 0.00 ? 720 TYR A CZ   2  
ATOM 2060  O OH   . TYR A 1 13  ? -8.102  5.432   -2.373  1.00 0.00 ? 720 TYR A OH   2  
ATOM 2061  H H    . TYR A 1 13  ? -12.375 -1.229  -0.247  1.00 0.00 ? 720 TYR A H    2  
ATOM 2062  H HA   . TYR A 1 13  ? -9.682  -0.456  -0.678  1.00 0.00 ? 720 TYR A HA   2  
ATOM 2063  H HB2  . TYR A 1 13  ? -11.613 0.485   -1.945  1.00 0.00 ? 720 TYR A HB2  2  
ATOM 2064  H HB3  . TYR A 1 13  ? -12.152 1.296   -0.482  1.00 0.00 ? 720 TYR A HB3  2  
ATOM 2065  H HD1  . TYR A 1 13  ? -10.778 3.175   0.454   1.00 0.00 ? 720 TYR A HD1  2  
ATOM 2066  H HD2  . TYR A 1 13  ? -9.887  1.396   -3.308  1.00 0.00 ? 720 TYR A HD2  2  
ATOM 2067  H HE1  . TYR A 1 13  ? -9.407  5.119   -0.134  1.00 0.00 ? 720 TYR A HE1  2  
ATOM 2068  H HE2  . TYR A 1 13  ? -8.515  3.348   -3.902  1.00 0.00 ? 720 TYR A HE2  2  
ATOM 2069  H HH   . TYR A 1 13  ? -7.463  5.519   -1.648  1.00 0.00 ? 720 TYR A HH   2  
ATOM 2070  N N    . SER A 1 14  ? -11.169 0.591   2.044   1.00 0.00 ? 721 SER A N    2  
ATOM 2071  C CA   . SER A 1 14  ? -10.971 1.064   3.383   1.00 0.00 ? 721 SER A CA   2  
ATOM 2072  C C    . SER A 1 14  ? -10.078 0.109   4.173   1.00 0.00 ? 721 SER A C    2  
ATOM 2073  O O    . SER A 1 14  ? -9.170  0.540   4.862   1.00 0.00 ? 721 SER A O    2  
ATOM 2074  C CB   . SER A 1 14  ? -12.322 1.236   4.054   1.00 0.00 ? 721 SER A CB   2  
ATOM 2075  O OG   . SER A 1 14  ? -13.106 2.141   3.308   1.00 0.00 ? 721 SER A OG   2  
ATOM 2076  H H    . SER A 1 14  ? -12.089 0.392   1.768   1.00 0.00 ? 721 SER A H    2  
ATOM 2077  H HA   . SER A 1 14  ? -10.489 2.029   3.329   1.00 0.00 ? 721 SER A HA   2  
ATOM 2078  H HB2  . SER A 1 14  ? -12.831 0.284   4.099   1.00 0.00 ? 721 SER A HB2  2  
ATOM 2079  H HB3  . SER A 1 14  ? -12.195 1.628   5.051   1.00 0.00 ? 721 SER A HB3  2  
ATOM 2080  H HG   . SER A 1 14  ? -12.595 2.970   3.331   1.00 0.00 ? 721 SER A HG   2  
ATOM 2081  N N    . ARG A 1 15  ? -10.308 -1.189  4.026   1.00 0.00 ? 722 ARG A N    2  
ATOM 2082  C CA   . ARG A 1 15  ? -9.515  -2.189  4.730   1.00 0.00 ? 722 ARG A CA   2  
ATOM 2083  C C    . ARG A 1 15  ? -8.047  -2.141  4.352   1.00 0.00 ? 722 ARG A C    2  
ATOM 2084  O O    . ARG A 1 15  ? -7.171  -2.301  5.217   1.00 0.00 ? 722 ARG A O    2  
ATOM 2085  C CB   . ARG A 1 15  ? -10.064 -3.589  4.548   1.00 0.00 ? 722 ARG A CB   2  
ATOM 2086  C CG   . ARG A 1 15  ? -11.392 -3.814  5.225   1.00 0.00 ? 722 ARG A CG   2  
ATOM 2087  C CD   . ARG A 1 15  ? -11.688 -5.283  5.345   1.00 0.00 ? 722 ARG A CD   2  
ATOM 2088  N NE   . ARG A 1 15  ? -10.703 -5.972  6.206   1.00 0.00 ? 722 ARG A NE   2  
ATOM 2089  C CZ   . ARG A 1 15  ? -10.880 -7.187  6.740   1.00 0.00 ? 722 ARG A CZ   2  
ATOM 2090  N NH1  . ARG A 1 15  ? -11.998 -7.851  6.519   1.00 0.00 ? 722 ARG A NH1  2  
ATOM 2091  N NH2  . ARG A 1 15  ? -9.946  -7.723  7.510   1.00 0.00 ? 722 ARG A NH2  2  
ATOM 2092  H H    . ARG A 1 15  ? -11.056 -1.466  3.449   1.00 0.00 ? 722 ARG A H    2  
ATOM 2093  H HA   . ARG A 1 15  ? -9.575  -1.937  5.778   1.00 0.00 ? 722 ARG A HA   2  
ATOM 2094  H HB2  . ARG A 1 15  ? -10.202 -3.755  3.489   1.00 0.00 ? 722 ARG A HB2  2  
ATOM 2095  H HB3  . ARG A 1 15  ? -9.361  -4.317  4.918   1.00 0.00 ? 722 ARG A HB3  2  
ATOM 2096  H HG2  . ARG A 1 15  ? -11.362 -3.381  6.213   1.00 0.00 ? 722 ARG A HG2  2  
ATOM 2097  H HG3  . ARG A 1 15  ? -12.168 -3.340  4.643   1.00 0.00 ? 722 ARG A HG3  2  
ATOM 2098  H HD2  . ARG A 1 15  ? -12.678 -5.417  5.752   1.00 0.00 ? 722 ARG A HD2  2  
ATOM 2099  H HD3  . ARG A 1 15  ? -11.639 -5.719  4.359   1.00 0.00 ? 722 ARG A HD3  2  
ATOM 2100  H HE   . ARG A 1 15  ? -9.873  -5.471  6.385   1.00 0.00 ? 722 ARG A HE   2  
ATOM 2101  H HH11 . ARG A 1 15  ? -12.752 -7.491  5.966   1.00 0.00 ? 722 ARG A HH11 2  
ATOM 2102  H HH12 . ARG A 1 15  ? -12.139 -8.780  6.893   1.00 0.00 ? 722 ARG A HH12 2  
ATOM 2103  H HH21 . ARG A 1 15  ? -9.083  -7.264  7.739   1.00 0.00 ? 722 ARG A HH21 2  
ATOM 2104  H HH22 . ARG A 1 15  ? -10.083 -8.644  7.910   1.00 0.00 ? 722 ARG A HH22 2  
ATOM 2105  N N    . ILE A 1 16  ? -7.774  -1.925  3.087   1.00 0.00 ? 723 ILE A N    2  
ATOM 2106  C CA   . ILE A 1 16  ? -6.409  -1.796  2.616   1.00 0.00 ? 723 ILE A CA   2  
ATOM 2107  C C    . ILE A 1 16  ? -5.792  -0.485  3.124   1.00 0.00 ? 723 ILE A C    2  
ATOM 2108  O O    . ILE A 1 16  ? -4.676  -0.460  3.636   1.00 0.00 ? 723 ILE A O    2  
ATOM 2109  C CB   . ILE A 1 16  ? -6.309  -1.887  1.053   1.00 0.00 ? 723 ILE A CB   2  
ATOM 2110  C CG1  . ILE A 1 16  ? -6.260  -3.341  0.550   1.00 0.00 ? 723 ILE A CG1  2  
ATOM 2111  C CG2  . ILE A 1 16  ? -5.108  -1.127  0.519   1.00 0.00 ? 723 ILE A CG2  2  
ATOM 2112  C CD1  . ILE A 1 16  ? -7.456  -4.206  0.860   1.00 0.00 ? 723 ILE A CD1  2  
ATOM 2113  H H    . ILE A 1 16  ? -8.517  -1.859  2.445   1.00 0.00 ? 723 ILE A H    2  
ATOM 2114  H HA   . ILE A 1 16  ? -5.867  -2.627  3.045   1.00 0.00 ? 723 ILE A HA   2  
ATOM 2115  H HB   . ILE A 1 16  ? -7.192  -1.414  0.648   1.00 0.00 ? 723 ILE A HB   2  
ATOM 2116  H HG12 . ILE A 1 16  ? -6.190  -3.286  -0.524  1.00 0.00 ? 723 ILE A HG12 2  
ATOM 2117  H HG13 . ILE A 1 16  ? -5.373  -3.822  0.936   1.00 0.00 ? 723 ILE A HG13 2  
ATOM 2118  H HG21 . ILE A 1 16  ? -4.210  -1.539  0.953   1.00 0.00 ? 723 ILE A HG21 2  
ATOM 2119  H HG22 . ILE A 1 16  ? -5.192  -0.086  0.793   1.00 0.00 ? 723 ILE A HG22 2  
ATOM 2120  H HG23 . ILE A 1 16  ? -5.068  -1.218  -0.556  1.00 0.00 ? 723 ILE A HG23 2  
ATOM 2121  H HD11 . ILE A 1 16  ? -7.308  -5.188  0.440   1.00 0.00 ? 723 ILE A HD11 2  
ATOM 2122  H HD12 . ILE A 1 16  ? -8.344  -3.763  0.434   1.00 0.00 ? 723 ILE A HD12 2  
ATOM 2123  H HD13 . ILE A 1 16  ? -7.569  -4.288  1.931   1.00 0.00 ? 723 ILE A HD13 2  
ATOM 2124  N N    . SER A 1 17  ? -6.531  0.584   2.995   1.00 0.00 ? 724 SER A N    2  
ATOM 2125  C CA   . SER A 1 17  ? -6.076  1.893   3.438   1.00 0.00 ? 724 SER A CA   2  
ATOM 2126  C C    . SER A 1 17  ? -5.873  1.929   4.968   1.00 0.00 ? 724 SER A C    2  
ATOM 2127  O O    . SER A 1 17  ? -4.989  2.634   5.483   1.00 0.00 ? 724 SER A O    2  
ATOM 2128  C CB   . SER A 1 17  ? -7.061  2.949   2.970   1.00 0.00 ? 724 SER A CB   2  
ATOM 2129  O OG   . SER A 1 17  ? -7.227  2.849   1.557   1.00 0.00 ? 724 SER A OG   2  
ATOM 2130  H H    . SER A 1 17  ? -7.407  0.501   2.558   1.00 0.00 ? 724 SER A H    2  
ATOM 2131  H HA   . SER A 1 17  ? -5.120  2.075   2.969   1.00 0.00 ? 724 SER A HA   2  
ATOM 2132  H HB2  . SER A 1 17  ? -8.014  2.795   3.454   1.00 0.00 ? 724 SER A HB2  2  
ATOM 2133  H HB3  . SER A 1 17  ? -6.682  3.933   3.206   1.00 0.00 ? 724 SER A HB3  2  
ATOM 2134  H HG   . SER A 1 17  ? -8.048  2.360   1.413   1.00 0.00 ? 724 SER A HG   2  
ATOM 2135  N N    . ASN A 1 18  ? -6.673  1.154   5.676   1.00 0.00 ? 725 ASN A N    2  
ATOM 2136  C CA   . ASN A 1 18  ? -6.559  1.025   7.121   1.00 0.00 ? 725 ASN A CA   2  
ATOM 2137  C C    . ASN A 1 18  ? -5.281  0.267   7.436   1.00 0.00 ? 725 ASN A C    2  
ATOM 2138  O O    . ASN A 1 18  ? -4.533  0.636   8.320   1.00 0.00 ? 725 ASN A O    2  
ATOM 2139  C CB   . ASN A 1 18  ? -7.772  0.284   7.684   1.00 0.00 ? 725 ASN A CB   2  
ATOM 2140  C CG   . ASN A 1 18  ? -7.922  0.437   9.183   1.00 0.00 ? 725 ASN A CG   2  
ATOM 2141  O OD1  . ASN A 1 18  ? -7.498  1.427   9.760   1.00 0.00 ? 725 ASN A OD1  2  
ATOM 2142  N ND2  . ASN A 1 18  ? -8.574  -0.507  9.813   1.00 0.00 ? 725 ASN A ND2  2  
ATOM 2143  H H    . ASN A 1 18  ? -7.403  0.684   5.213   1.00 0.00 ? 725 ASN A H    2  
ATOM 2144  H HA   . ASN A 1 18  ? -6.504  2.016   7.546   1.00 0.00 ? 725 ASN A HA   2  
ATOM 2145  H HB2  . ASN A 1 18  ? -8.662  0.646   7.199   1.00 0.00 ? 725 ASN A HB2  2  
ATOM 2146  H HB3  . ASN A 1 18  ? -7.663  -0.767  7.459   1.00 0.00 ? 725 ASN A HB3  2  
ATOM 2147  H HD21 . ASN A 1 18  ? -8.934  -1.264  9.301   1.00 0.00 ? 725 ASN A HD21 2  
ATOM 2148  H HD22 . ASN A 1 18  ? -8.690  -0.409  10.781  1.00 0.00 ? 725 ASN A HD22 2  
ATOM 2149  N N    . LEU A 1 19  ? -5.031  -0.778  6.653   1.00 0.00 ? 726 LEU A N    2  
ATOM 2150  C CA   . LEU A 1 19  ? -3.799  -1.564  6.712   1.00 0.00 ? 726 LEU A CA   2  
ATOM 2151  C C    . LEU A 1 19  ? -2.584  -0.654  6.550   1.00 0.00 ? 726 LEU A C    2  
ATOM 2152  O O    . LEU A 1 19  ? -1.612  -0.776  7.291   1.00 0.00 ? 726 LEU A O    2  
ATOM 2153  C CB   . LEU A 1 19  ? -3.902  -2.723  5.644   1.00 0.00 ? 726 LEU A CB   2  
ATOM 2154  C CG   . LEU A 1 19  ? -2.646  -3.374  4.996   1.00 0.00 ? 726 LEU A CG   2  
ATOM 2155  C CD1  . LEU A 1 19  ? -2.001  -2.512  3.928   1.00 0.00 ? 726 LEU A CD1  2  
ATOM 2156  C CD2  . LEU A 1 19  ? -1.648  -3.740  6.012   1.00 0.00 ? 726 LEU A CD2  2  
ATOM 2157  H H    . LEU A 1 19  ? -5.707  -1.038  5.991   1.00 0.00 ? 726 LEU A H    2  
ATOM 2158  H HA   . LEU A 1 19  ? -3.721  -2.007  7.696   1.00 0.00 ? 726 LEU A HA   2  
ATOM 2159  H HB2  . LEU A 1 19  ? -4.372  -3.542  6.170   1.00 0.00 ? 726 LEU A HB2  2  
ATOM 2160  H HB3  . LEU A 1 19  ? -4.560  -2.379  4.859   1.00 0.00 ? 726 LEU A HB3  2  
ATOM 2161  H HG   . LEU A 1 19  ? -2.969  -4.287  4.519   1.00 0.00 ? 726 LEU A HG   2  
ATOM 2162  H HD11 . LEU A 1 19  ? -2.706  -2.324  3.133   1.00 0.00 ? 726 LEU A HD11 2  
ATOM 2163  H HD12 . LEU A 1 19  ? -1.133  -3.023  3.537   1.00 0.00 ? 726 LEU A HD12 2  
ATOM 2164  H HD13 . LEU A 1 19  ? -1.697  -1.576  4.373   1.00 0.00 ? 726 LEU A HD13 2  
ATOM 2165  H HD21 . LEU A 1 19  ? -0.786  -4.178  5.532   1.00 0.00 ? 726 LEU A HD21 2  
ATOM 2166  H HD22 . LEU A 1 19  ? -2.083  -4.458  6.691   1.00 0.00 ? 726 LEU A HD22 2  
ATOM 2167  H HD23 . LEU A 1 19  ? -1.347  -2.858  6.558   1.00 0.00 ? 726 LEU A HD23 2  
ATOM 2168  N N    . ILE A 1 20  ? -2.673  0.275   5.624   1.00 0.00 ? 727 ILE A N    2  
ATOM 2169  C CA   . ILE A 1 20  ? -1.613  1.223   5.384   1.00 0.00 ? 727 ILE A CA   2  
ATOM 2170  C C    . ILE A 1 20  ? -1.309  2.063   6.615   1.00 0.00 ? 727 ILE A C    2  
ATOM 2171  O O    . ILE A 1 20  ? -0.158  2.103   7.067   1.00 0.00 ? 727 ILE A O    2  
ATOM 2172  C CB   . ILE A 1 20  ? -1.903  2.101   4.126   1.00 0.00 ? 727 ILE A CB   2  
ATOM 2173  C CG1  . ILE A 1 20  ? -1.649  1.291   2.845   1.00 0.00 ? 727 ILE A CG1  2  
ATOM 2174  C CG2  . ILE A 1 20  ? -1.106  3.410   4.115   1.00 0.00 ? 727 ILE A CG2  2  
ATOM 2175  C CD1  . ILE A 1 20  ? -0.211  0.796   2.719   1.00 0.00 ? 727 ILE A CD1  2  
ATOM 2176  H H    . ILE A 1 20  ? -3.486  0.307   5.073   1.00 0.00 ? 727 ILE A H    2  
ATOM 2177  H HA   . ILE A 1 20  ? -0.726  0.641   5.190   1.00 0.00 ? 727 ILE A HA   2  
ATOM 2178  H HB   . ILE A 1 20  ? -2.954  2.349   4.156   1.00 0.00 ? 727 ILE A HB   2  
ATOM 2179  H HG12 . ILE A 1 20  ? -2.296  0.428   2.842   1.00 0.00 ? 727 ILE A HG12 2  
ATOM 2180  H HG13 . ILE A 1 20  ? -1.868  1.906   1.986   1.00 0.00 ? 727 ILE A HG13 2  
ATOM 2181  H HG21 . ILE A 1 20  ? -1.369  3.989   4.988   1.00 0.00 ? 727 ILE A HG21 2  
ATOM 2182  H HG22 . ILE A 1 20  ? -1.341  3.968   3.221   1.00 0.00 ? 727 ILE A HG22 2  
ATOM 2183  H HG23 . ILE A 1 20  ? -0.051  3.183   4.136   1.00 0.00 ? 727 ILE A HG23 2  
ATOM 2184  H HD11 . ILE A 1 20  ? 0.011   0.098   3.512   1.00 0.00 ? 727 ILE A HD11 2  
ATOM 2185  H HD12 . ILE A 1 20  ? 0.450   1.642   2.834   1.00 0.00 ? 727 ILE A HD12 2  
ATOM 2186  H HD13 . ILE A 1 20  ? -0.056  0.330   1.758   1.00 0.00 ? 727 ILE A HD13 2  
ATOM 2187  N N    . VAL A 1 21  ? -2.325  2.671   7.194   1.00 0.00 ? 728 VAL A N    2  
ATOM 2188  C CA   . VAL A 1 21  ? -2.093  3.516   8.344   1.00 0.00 ? 728 VAL A CA   2  
ATOM 2189  C C    . VAL A 1 21  ? -1.705  2.702   9.590   1.00 0.00 ? 728 VAL A C    2  
ATOM 2190  O O    . VAL A 1 21  ? -0.801  3.080   10.308  1.00 0.00 ? 728 VAL A O    2  
ATOM 2191  C CB   . VAL A 1 21  ? -3.261  4.512   8.642   1.00 0.00 ? 728 VAL A CB   2  
ATOM 2192  C CG1  . VAL A 1 21  ? -3.472  5.450   7.464   1.00 0.00 ? 728 VAL A CG1  2  
ATOM 2193  C CG2  . VAL A 1 21  ? -4.555  3.790   8.970   1.00 0.00 ? 728 VAL A CG2  2  
ATOM 2194  H H    . VAL A 1 21  ? -3.234  2.550   6.840   1.00 0.00 ? 728 VAL A H    2  
ATOM 2195  H HA   . VAL A 1 21  ? -1.220  4.088   8.063   1.00 0.00 ? 728 VAL A HA   2  
ATOM 2196  H HB   . VAL A 1 21  ? -2.971  5.112   9.493   1.00 0.00 ? 728 VAL A HB   2  
ATOM 2197  H HG11 . VAL A 1 21  ? -2.567  6.011   7.284   1.00 0.00 ? 728 VAL A HG11 2  
ATOM 2198  H HG12 . VAL A 1 21  ? -4.281  6.132   7.688   1.00 0.00 ? 728 VAL A HG12 2  
ATOM 2199  H HG13 . VAL A 1 21  ? -3.720  4.874   6.586   1.00 0.00 ? 728 VAL A HG13 2  
ATOM 2200  H HG21 . VAL A 1 21  ? -4.408  3.173   9.844   1.00 0.00 ? 728 VAL A HG21 2  
ATOM 2201  H HG22 . VAL A 1 21  ? -4.832  3.167   8.133   1.00 0.00 ? 728 VAL A HG22 2  
ATOM 2202  H HG23 . VAL A 1 21  ? -5.337  4.511   9.156   1.00 0.00 ? 728 VAL A HG23 2  
ATOM 2203  N N    . LEU A 1 22  ? -2.347  1.555   9.795   1.00 0.00 ? 729 LEU A N    2  
ATOM 2204  C CA   . LEU A 1 22  ? -2.057  0.690   10.943  1.00 0.00 ? 729 LEU A CA   2  
ATOM 2205  C C    . LEU A 1 22  ? -0.651  0.126   10.891  1.00 0.00 ? 729 LEU A C    2  
ATOM 2206  O O    . LEU A 1 22  ? 0.071   0.118   11.906  1.00 0.00 ? 729 LEU A O    2  
ATOM 2207  C CB   . LEU A 1 22  ? -3.058  -0.448  11.025  1.00 0.00 ? 729 LEU A CB   2  
ATOM 2208  C CG   . LEU A 1 22  ? -4.479  -0.054  11.381  1.00 0.00 ? 729 LEU A CG   2  
ATOM 2209  C CD1  . LEU A 1 22  ? -5.405  -1.214  11.114  1.00 0.00 ? 729 LEU A CD1  2  
ATOM 2210  C CD2  . LEU A 1 22  ? -4.571  0.327   12.842  1.00 0.00 ? 729 LEU A CD2  2  
ATOM 2211  H H    . LEU A 1 22  ? -3.055  1.286   9.165   1.00 0.00 ? 729 LEU A H    2  
ATOM 2212  H HA   . LEU A 1 22  ? -2.157  1.290   11.834  1.00 0.00 ? 729 LEU A HA   2  
ATOM 2213  H HB2  . LEU A 1 22  ? -3.077  -0.940  10.063  1.00 0.00 ? 729 LEU A HB2  2  
ATOM 2214  H HB3  . LEU A 1 22  ? -2.709  -1.155  11.763  1.00 0.00 ? 729 LEU A HB3  2  
ATOM 2215  H HG   . LEU A 1 22  ? -4.744  0.814   10.793  1.00 0.00 ? 729 LEU A HG   2  
ATOM 2216  H HD11 . LEU A 1 22  ? -6.415  -0.935  11.375  1.00 0.00 ? 729 LEU A HD11 2  
ATOM 2217  H HD12 . LEU A 1 22  ? -5.087  -2.059  11.706  1.00 0.00 ? 729 LEU A HD12 2  
ATOM 2218  H HD13 . LEU A 1 22  ? -5.356  -1.459  10.063  1.00 0.00 ? 729 LEU A HD13 2  
ATOM 2219  H HD21 . LEU A 1 22  ? -4.264  -0.507  13.456  1.00 0.00 ? 729 LEU A HD21 2  
ATOM 2220  H HD22 . LEU A 1 22  ? -5.591  0.590   13.081  1.00 0.00 ? 729 LEU A HD22 2  
ATOM 2221  H HD23 . LEU A 1 22  ? -3.929  1.172   13.039  1.00 0.00 ? 729 LEU A HD23 2  
ATOM 2222  N N    . HIS A 1 23  ? -0.248  -0.337  9.734   1.00 0.00 ? 730 HIS A N    2  
ATOM 2223  C CA   . HIS A 1 23  ? 1.062   -0.916  9.603   1.00 0.00 ? 730 HIS A CA   2  
ATOM 2224  C C    . HIS A 1 23  ? 2.115   0.152   9.763   1.00 0.00 ? 730 HIS A C    2  
ATOM 2225  O O    . HIS A 1 23  ? 3.020   -0.001  10.573  1.00 0.00 ? 730 HIS A O    2  
ATOM 2226  C CB   . HIS A 1 23  ? 1.231   -1.655  8.272   1.00 0.00 ? 730 HIS A CB   2  
ATOM 2227  C CG   . HIS A 1 23  ? 2.514   -2.442  8.178   1.00 0.00 ? 730 HIS A CG   2  
ATOM 2228  N ND1  . HIS A 1 23  ? 3.413   -2.347  7.137   1.00 0.00 ? 730 HIS A ND1  2  
ATOM 2229  C CD2  . HIS A 1 23  ? 3.013   -3.378  9.011   1.00 0.00 ? 730 HIS A CD2  2  
ATOM 2230  C CE1  . HIS A 1 23  ? 4.407   -3.212  7.367   1.00 0.00 ? 730 HIS A CE1  2  
ATOM 2231  N NE2  . HIS A 1 23  ? 4.211   -3.866  8.495   1.00 0.00 ? 730 HIS A NE2  2  
ATOM 2232  H H    . HIS A 1 23  ? -0.846  -0.293  8.953   1.00 0.00 ? 730 HIS A H    2  
ATOM 2233  H HA   . HIS A 1 23  ? 1.179   -1.622  10.412  1.00 0.00 ? 730 HIS A HA   2  
ATOM 2234  H HB2  . HIS A 1 23  ? 0.397   -2.327  8.147   1.00 0.00 ? 730 HIS A HB2  2  
ATOM 2235  H HB3  . HIS A 1 23  ? 1.213   -0.939  7.465   1.00 0.00 ? 730 HIS A HB3  2  
ATOM 2236  H HD1  . HIS A 1 23  ? 3.351   -1.740  6.372   1.00 0.00 ? 730 HIS A HD1  2  
ATOM 2237  H HD2  . HIS A 1 23  ? 2.561   -3.700  9.937   1.00 0.00 ? 730 HIS A HD2  2  
ATOM 2238  H HE1  . HIS A 1 23  ? 5.253   -3.361  6.714   1.00 0.00 ? 730 HIS A HE1  2  
ATOM 2239  N N    . LEU A 1 24  ? 1.968   1.248   9.029   1.00 0.00 ? 731 LEU A N    2  
ATOM 2240  C CA   . LEU A 1 24  ? 2.938   2.320   9.084   1.00 0.00 ? 731 LEU A CA   2  
ATOM 2241  C C    . LEU A 1 24  ? 3.018   2.894   10.500  1.00 0.00 ? 731 LEU A C    2  
ATOM 2242  O O    . LEU A 1 24  ? 4.121   3.081   11.009  1.00 0.00 ? 731 LEU A O    2  
ATOM 2243  C CB   . LEU A 1 24  ? 2.575   3.404   8.070   1.00 0.00 ? 731 LEU A CB   2  
ATOM 2244  C CG   . LEU A 1 24  ? 3.681   4.372   7.594   1.00 0.00 ? 731 LEU A CG   2  
ATOM 2245  C CD1  . LEU A 1 24  ? 3.116   5.253   6.536   1.00 0.00 ? 731 LEU A CD1  2  
ATOM 2246  C CD2  . LEU A 1 24  ? 4.259   5.232   8.710   1.00 0.00 ? 731 LEU A CD2  2  
ATOM 2247  H H    . LEU A 1 24  ? 1.201   1.343   8.415   1.00 0.00 ? 731 LEU A H    2  
ATOM 2248  H HA   . LEU A 1 24  ? 3.900   1.904   8.826   1.00 0.00 ? 731 LEU A HA   2  
ATOM 2249  H HB2  . LEU A 1 24  ? 2.200   2.892   7.196   1.00 0.00 ? 731 LEU A HB2  2  
ATOM 2250  H HB3  . LEU A 1 24  ? 1.771   3.989   8.492   1.00 0.00 ? 731 LEU A HB3  2  
ATOM 2251  H HG   . LEU A 1 24  ? 4.477   3.795   7.144   1.00 0.00 ? 731 LEU A HG   2  
ATOM 2252  H HD11 . LEU A 1 24  ? 3.879   5.926   6.171   1.00 0.00 ? 731 LEU A HD11 2  
ATOM 2253  H HD12 . LEU A 1 24  ? 2.291   5.820   6.942   1.00 0.00 ? 731 LEU A HD12 2  
ATOM 2254  H HD13 . LEU A 1 24  ? 2.771   4.628   5.727   1.00 0.00 ? 731 LEU A HD13 2  
ATOM 2255  H HD21 . LEU A 1 24  ? 4.692   4.585   9.460   1.00 0.00 ? 731 LEU A HD21 2  
ATOM 2256  H HD22 . LEU A 1 24  ? 3.477   5.830   9.153   1.00 0.00 ? 731 LEU A HD22 2  
ATOM 2257  H HD23 . LEU A 1 24  ? 5.027   5.876   8.307   1.00 0.00 ? 731 LEU A HD23 2  
ATOM 2258  N N    . ARG A 1 25  ? 1.857   3.110   11.151  1.00 0.00 ? 732 ARG A N    2  
ATOM 2259  C CA   . ARG A 1 25  ? 1.828   3.697   12.496  1.00 0.00 ? 732 ARG A CA   2  
ATOM 2260  C C    . ARG A 1 25  ? 2.657   2.848   13.455  1.00 0.00 ? 732 ARG A C    2  
ATOM 2261  O O    . ARG A 1 25  ? 3.355   3.377   14.319  1.00 0.00 ? 732 ARG A O    2  
ATOM 2262  C CB   . ARG A 1 25  ? 0.381   3.897   13.038  1.00 0.00 ? 732 ARG A CB   2  
ATOM 2263  C CG   . ARG A 1 25  ? -0.287  2.652   13.600  1.00 0.00 ? 732 ARG A CG   2  
ATOM 2264  C CD   . ARG A 1 25  ? -1.728  2.889   14.017  1.00 0.00 ? 732 ARG A CD   2  
ATOM 2265  N NE   . ARG A 1 25  ? -2.200  1.784   14.866  1.00 0.00 ? 732 ARG A NE   2  
ATOM 2266  C CZ   . ARG A 1 25  ? -3.273  1.821   15.661  1.00 0.00 ? 732 ARG A CZ   2  
ATOM 2267  N NH1  . ARG A 1 25  ? -4.132  2.827   15.579  1.00 0.00 ? 732 ARG A NH1  2  
ATOM 2268  N NH2  . ARG A 1 25  ? -3.513  0.822   16.490  1.00 0.00 ? 732 ARG A NH2  2  
ATOM 2269  H H    . ARG A 1 25  ? 1.001   2.896   10.715  1.00 0.00 ? 732 ARG A H    2  
ATOM 2270  H HA   . ARG A 1 25  ? 2.316   4.657   12.419  1.00 0.00 ? 732 ARG A HA   2  
ATOM 2271  H HB2  . ARG A 1 25  ? 0.394   4.647   13.815  1.00 0.00 ? 732 ARG A HB2  2  
ATOM 2272  H HB3  . ARG A 1 25  ? -0.224  4.260   12.221  1.00 0.00 ? 732 ARG A HB3  2  
ATOM 2273  H HG2  . ARG A 1 25  ? -0.268  1.881   12.844  1.00 0.00 ? 732 ARG A HG2  2  
ATOM 2274  H HG3  . ARG A 1 25  ? 0.277   2.320   14.460  1.00 0.00 ? 732 ARG A HG3  2  
ATOM 2275  H HD2  . ARG A 1 25  ? -1.809  3.819   14.557  1.00 0.00 ? 732 ARG A HD2  2  
ATOM 2276  H HD3  . ARG A 1 25  ? -2.353  2.917   13.132  1.00 0.00 ? 732 ARG A HD3  2  
ATOM 2277  H HE   . ARG A 1 25  ? -1.629  0.981   14.856  1.00 0.00 ? 732 ARG A HE   2  
ATOM 2278  H HH11 . ARG A 1 25  ? -4.010  3.580   14.925  1.00 0.00 ? 732 ARG A HH11 2  
ATOM 2279  H HH12 . ARG A 1 25  ? -4.944  2.876   16.165  1.00 0.00 ? 732 ARG A HH12 2  
ATOM 2280  H HH21 . ARG A 1 25  ? -2.917  0.016   16.558  1.00 0.00 ? 732 ARG A HH21 2  
ATOM 2281  H HH22 . ARG A 1 25  ? -4.297  0.818   17.117  1.00 0.00 ? 732 ARG A HH22 2  
ATOM 2282  N N    . LYS A 1 26  ? 2.571   1.528   13.316  1.00 0.00 ? 733 LYS A N    2  
ATOM 2283  C CA   . LYS A 1 26  ? 3.404   0.668   14.105  1.00 0.00 ? 733 LYS A CA   2  
ATOM 2284  C C    . LYS A 1 26  ? 4.851   0.679   13.656  1.00 0.00 ? 733 LYS A C    2  
ATOM 2285  O O    . LYS A 1 26  ? 5.734   0.825   14.471  1.00 0.00 ? 733 LYS A O    2  
ATOM 2286  C CB   . LYS A 1 26  ? 2.861   -0.749  14.279  1.00 0.00 ? 733 LYS A CB   2  
ATOM 2287  C CG   . LYS A 1 26  ? 2.193   -0.979  15.635  1.00 0.00 ? 733 LYS A CG   2  
ATOM 2288  C CD   . LYS A 1 26  ? 3.184   -0.705  16.770  1.00 0.00 ? 733 LYS A CD   2  
ATOM 2289  C CE   . LYS A 1 26  ? 2.609   -1.006  18.131  1.00 0.00 ? 733 LYS A CE   2  
ATOM 2290  N NZ   . LYS A 1 26  ? 3.551   -0.605  19.201  1.00 0.00 ? 733 LYS A NZ   2  
ATOM 2291  H H    . LYS A 1 26  ? 1.937   1.143   12.667  1.00 0.00 ? 733 LYS A H    2  
ATOM 2292  H HA   . LYS A 1 26  ? 3.401   1.150   15.071  1.00 0.00 ? 733 LYS A HA   2  
ATOM 2293  H HB2  . LYS A 1 26  ? 2.133   -0.939  13.503  1.00 0.00 ? 733 LYS A HB2  2  
ATOM 2294  H HB3  . LYS A 1 26  ? 3.675   -1.453  14.180  1.00 0.00 ? 733 LYS A HB3  2  
ATOM 2295  H HG2  . LYS A 1 26  ? 1.353   -0.308  15.733  1.00 0.00 ? 733 LYS A HG2  2  
ATOM 2296  H HG3  . LYS A 1 26  ? 1.858   -2.005  15.698  1.00 0.00 ? 733 LYS A HG3  2  
ATOM 2297  H HD2  . LYS A 1 26  ? 4.058   -1.324  16.631  1.00 0.00 ? 733 LYS A HD2  2  
ATOM 2298  H HD3  . LYS A 1 26  ? 3.490   0.331   16.755  1.00 0.00 ? 733 LYS A HD3  2  
ATOM 2299  H HE2  . LYS A 1 26  ? 1.685   -0.459  18.249  1.00 0.00 ? 733 LYS A HE2  2  
ATOM 2300  H HE3  . LYS A 1 26  ? 2.419   -2.066  18.208  1.00 0.00 ? 733 LYS A HE3  2  
ATOM 2301  H HZ1  . LYS A 1 26  ? 4.502   -1.020  19.061  1.00 0.00 ? 733 LYS A HZ1  2  
ATOM 2302  H HZ2  . LYS A 1 26  ? 3.194   -0.900  20.129  1.00 0.00 ? 733 LYS A HZ2  2  
ATOM 2303  H HZ3  . LYS A 1 26  ? 3.650   0.436   19.214  1.00 0.00 ? 733 LYS A HZ3  2  
ATOM 2304  N N    . VAL A 1 27  ? 5.084   0.579   12.368  1.00 0.00 ? 734 VAL A N    2  
ATOM 2305  C CA   . VAL A 1 27  ? 6.429   0.523   11.830  1.00 0.00 ? 734 VAL A CA   2  
ATOM 2306  C C    . VAL A 1 27  ? 7.257   1.768   12.179  1.00 0.00 ? 734 VAL A C    2  
ATOM 2307  O O    . VAL A 1 27  ? 8.417   1.645   12.586  1.00 0.00 ? 734 VAL A O    2  
ATOM 2308  C CB   . VAL A 1 27  ? 6.434   0.278   10.307  1.00 0.00 ? 734 VAL A CB   2  
ATOM 2309  C CG1  . VAL A 1 27  ? 7.832   0.356   9.771   1.00 0.00 ? 734 VAL A CG1  2  
ATOM 2310  C CG2  . VAL A 1 27  ? 5.849   -1.078  9.991   1.00 0.00 ? 734 VAL A CG2  2  
ATOM 2311  H H    . VAL A 1 27  ? 4.328   0.536   11.739  1.00 0.00 ? 734 VAL A H    2  
ATOM 2312  H HA   . VAL A 1 27  ? 6.908   -0.322  12.303  1.00 0.00 ? 734 VAL A HA   2  
ATOM 2313  H HB   . VAL A 1 27  ? 5.826   1.029   9.827   1.00 0.00 ? 734 VAL A HB   2  
ATOM 2314  H HG11 . VAL A 1 27  ? 7.826   0.145   8.713   1.00 0.00 ? 734 VAL A HG11 2  
ATOM 2315  H HG12 . VAL A 1 27  ? 8.478   -0.328  10.299  1.00 0.00 ? 734 VAL A HG12 2  
ATOM 2316  H HG13 . VAL A 1 27  ? 8.164   1.376   9.914   1.00 0.00 ? 734 VAL A HG13 2  
ATOM 2317  H HG21 . VAL A 1 27  ? 4.835   -1.115  10.358  1.00 0.00 ? 734 VAL A HG21 2  
ATOM 2318  H HG22 . VAL A 1 27  ? 6.438   -1.851  10.461  1.00 0.00 ? 734 VAL A HG22 2  
ATOM 2319  H HG23 . VAL A 1 27  ? 5.841   -1.221  8.920   1.00 0.00 ? 734 VAL A HG23 2  
ATOM 2320  N N    . GLU A 1 28  ? 6.670   2.947   12.061  1.00 0.00 ? 735 GLU A N    2  
ATOM 2321  C CA   . GLU A 1 28  ? 7.391   4.163   12.390  1.00 0.00 ? 735 GLU A CA   2  
ATOM 2322  C C    . GLU A 1 28  ? 7.642   4.242   13.895  1.00 0.00 ? 735 GLU A C    2  
ATOM 2323  O O    . GLU A 1 28  ? 8.627   4.798   14.336  1.00 0.00 ? 735 GLU A O    2  
ATOM 2324  C CB   . GLU A 1 28  ? 6.674   5.428   11.908  1.00 0.00 ? 735 GLU A CB   2  
ATOM 2325  C CG   . GLU A 1 28  ? 5.315   5.668   12.538  1.00 0.00 ? 735 GLU A CG   2  
ATOM 2326  C CD   . GLU A 1 28  ? 4.828   7.068   12.309  1.00 0.00 ? 735 GLU A CD   2  
ATOM 2327  O OE1  . GLU A 1 28  ? 5.398   7.997   12.922  1.00 0.00 ? 735 GLU A OE1  2  
ATOM 2328  O OE2  . GLU A 1 28  ? 3.887   7.283   11.522  1.00 0.00 ? 735 GLU A OE2  2  
ATOM 2329  H H    . GLU A 1 28  ? 5.741   3.004   11.742  1.00 0.00 ? 735 GLU A H    2  
ATOM 2330  H HA   . GLU A 1 28  ? 8.349   4.090   11.897  1.00 0.00 ? 735 GLU A HA   2  
ATOM 2331  H HB2  . GLU A 1 28  ? 7.298   6.280   12.126  1.00 0.00 ? 735 GLU A HB2  2  
ATOM 2332  H HB3  . GLU A 1 28  ? 6.544   5.362   10.837  1.00 0.00 ? 735 GLU A HB3  2  
ATOM 2333  H HG2  . GLU A 1 28  ? 4.610   4.973   12.104  1.00 0.00 ? 735 GLU A HG2  2  
ATOM 2334  H HG3  . GLU A 1 28  ? 5.392   5.488   13.600  1.00 0.00 ? 735 GLU A HG3  2  
ATOM 2335  N N    . GLU A 1 29  ? 6.758   3.644   14.660  1.00 0.00 ? 736 GLU A N    2  
ATOM 2336  C CA   . GLU A 1 29  ? 6.855   3.647   16.100  1.00 0.00 ? 736 GLU A CA   2  
ATOM 2337  C C    . GLU A 1 29  ? 7.905   2.630   16.559  1.00 0.00 ? 736 GLU A C    2  
ATOM 2338  O O    . GLU A 1 29  ? 8.670   2.880   17.479  1.00 0.00 ? 736 GLU A O    2  
ATOM 2339  C CB   . GLU A 1 29  ? 5.480   3.328   16.694  1.00 0.00 ? 736 GLU A CB   2  
ATOM 2340  C CG   . GLU A 1 29  ? 5.385   3.407   18.204  1.00 0.00 ? 736 GLU A CG   2  
ATOM 2341  C CD   . GLU A 1 29  ? 3.985   3.150   18.692  1.00 0.00 ? 736 GLU A CD   2  
ATOM 2342  O OE1  . GLU A 1 29  ? 3.126   4.039   18.559  1.00 0.00 ? 736 GLU A OE1  2  
ATOM 2343  O OE2  . GLU A 1 29  ? 3.707   2.047   19.201  1.00 0.00 ? 736 GLU A OE2  2  
ATOM 2344  H H    . GLU A 1 29  ? 6.006   3.185   14.230  1.00 0.00 ? 736 GLU A H    2  
ATOM 2345  H HA   . GLU A 1 29  ? 7.152   4.637   16.413  1.00 0.00 ? 736 GLU A HA   2  
ATOM 2346  H HB2  . GLU A 1 29  ? 4.758   4.018   16.281  1.00 0.00 ? 736 GLU A HB2  2  
ATOM 2347  H HB3  . GLU A 1 29  ? 5.208   2.328   16.393  1.00 0.00 ? 736 GLU A HB3  2  
ATOM 2348  H HG2  . GLU A 1 29  ? 6.045   2.669   18.634  1.00 0.00 ? 736 GLU A HG2  2  
ATOM 2349  H HG3  . GLU A 1 29  ? 5.687   4.394   18.525  1.00 0.00 ? 736 GLU A HG3  2  
ATOM 2350  N N    . GLU A 1 30  ? 7.937   1.503   15.897  1.00 0.00 ? 737 GLU A N    2  
ATOM 2351  C CA   . GLU A 1 30  ? 8.844   0.430   16.242  1.00 0.00 ? 737 GLU A CA   2  
ATOM 2352  C C    . GLU A 1 30  ? 10.241  0.627   15.654  1.00 0.00 ? 737 GLU A C    2  
ATOM 2353  O O    . GLU A 1 30  ? 11.226  0.644   16.382  1.00 0.00 ? 737 GLU A O    2  
ATOM 2354  C CB   . GLU A 1 30  ? 8.284   -0.914  15.775  1.00 0.00 ? 737 GLU A CB   2  
ATOM 2355  C CG   . GLU A 1 30  ? 6.968   -1.330  16.424  1.00 0.00 ? 737 GLU A CG   2  
ATOM 2356  C CD   . GLU A 1 30  ? 7.066   -1.560  17.915  1.00 0.00 ? 737 GLU A CD   2  
ATOM 2357  O OE1  . GLU A 1 30  ? 8.160   -1.887  18.415  1.00 0.00 ? 737 GLU A OE1  2  
ATOM 2358  O OE2  . GLU A 1 30  ? 6.029   -1.453  18.618  1.00 0.00 ? 737 GLU A OE2  2  
ATOM 2359  H H    . GLU A 1 30  ? 7.302   1.378   15.157  1.00 0.00 ? 737 GLU A H    2  
ATOM 2360  H HA   . GLU A 1 30  ? 8.922   0.400   17.318  1.00 0.00 ? 737 GLU A HA   2  
ATOM 2361  H HB2  . GLU A 1 30  ? 8.126   -0.866  14.709  1.00 0.00 ? 737 GLU A HB2  2  
ATOM 2362  H HB3  . GLU A 1 30  ? 9.019   -1.680  15.978  1.00 0.00 ? 737 GLU A HB3  2  
ATOM 2363  H HG2  . GLU A 1 30  ? 6.243   -0.549  16.251  1.00 0.00 ? 737 GLU A HG2  2  
ATOM 2364  H HG3  . GLU A 1 30  ? 6.626   -2.239  15.952  1.00 0.00 ? 737 GLU A HG3  2  
ATOM 2365  N N    . GLU A 1 31  ? 10.331  0.775   14.343  1.00 0.00 ? 738 GLU A N    2  
ATOM 2366  C CA   . GLU A 1 31  ? 11.637  0.808   13.684  1.00 0.00 ? 738 GLU A CA   2  
ATOM 2367  C C    . GLU A 1 31  ? 11.904  2.113   12.935  1.00 0.00 ? 738 GLU A C    2  
ATOM 2368  O O    . GLU A 1 31  ? 12.958  2.268   12.326  1.00 0.00 ? 738 GLU A O    2  
ATOM 2369  C CB   . GLU A 1 31  ? 11.772  -0.390  12.746  1.00 0.00 ? 738 GLU A CB   2  
ATOM 2370  C CG   . GLU A 1 31  ? 11.618  -1.722  13.459  1.00 0.00 ? 738 GLU A CG   2  
ATOM 2371  C CD   . GLU A 1 31  ? 11.771  -2.891  12.544  1.00 0.00 ? 738 GLU A CD   2  
ATOM 2372  O OE1  . GLU A 1 31  ? 10.769  -3.335  11.957  1.00 0.00 ? 738 GLU A OE1  2  
ATOM 2373  O OE2  . GLU A 1 31  ? 12.901  -3.404  12.411  1.00 0.00 ? 738 GLU A OE2  2  
ATOM 2374  H H    . GLU A 1 31  ? 9.515   0.865   13.801  1.00 0.00 ? 738 GLU A H    2  
ATOM 2375  H HA   . GLU A 1 31  ? 12.384  0.706   14.457  1.00 0.00 ? 738 GLU A HA   2  
ATOM 2376  H HB2  . GLU A 1 31  ? 11.013  -0.322  11.981  1.00 0.00 ? 738 GLU A HB2  2  
ATOM 2377  H HB3  . GLU A 1 31  ? 12.749  -0.364  12.283  1.00 0.00 ? 738 GLU A HB3  2  
ATOM 2378  H HG2  . GLU A 1 31  ? 12.368  -1.794  14.232  1.00 0.00 ? 738 GLU A HG2  2  
ATOM 2379  H HG3  . GLU A 1 31  ? 10.636  -1.759  13.910  1.00 0.00 ? 738 GLU A HG3  2  
ATOM 2380  N N    . ASP A 1 32  ? 10.938  3.032   12.970  1.00 0.00 ? 739 ASP A N    2  
ATOM 2381  C CA   . ASP A 1 32  ? 11.054  4.386   12.347  1.00 0.00 ? 739 ASP A CA   2  
ATOM 2382  C C    . ASP A 1 32  ? 11.181  4.310   10.821  1.00 0.00 ? 739 ASP A C    2  
ATOM 2383  O O    . ASP A 1 32  ? 11.661  5.253   10.182  1.00 0.00 ? 739 ASP A O    2  
ATOM 2384  C CB   . ASP A 1 32  ? 12.266  5.186   12.898  1.00 0.00 ? 739 ASP A CB   2  
ATOM 2385  C CG   . ASP A 1 32  ? 12.258  5.417   14.393  1.00 0.00 ? 739 ASP A CG   2  
ATOM 2386  O OD1  . ASP A 1 32  ? 11.501  6.276   14.878  1.00 0.00 ? 739 ASP A OD1  2  
ATOM 2387  O OD2  . ASP A 1 32  ? 13.076  4.792   15.099  1.00 0.00 ? 739 ASP A OD2  2  
ATOM 2388  H H    . ASP A 1 32  ? 10.109  2.801   13.440  1.00 0.00 ? 739 ASP A H    2  
ATOM 2389  H HA   . ASP A 1 32  ? 10.149  4.925   12.587  1.00 0.00 ? 739 ASP A HA   2  
ATOM 2390  H HB2  . ASP A 1 32  ? 13.169  4.644   12.661  1.00 0.00 ? 739 ASP A HB2  2  
ATOM 2391  H HB3  . ASP A 1 32  ? 12.297  6.144   12.400  1.00 0.00 ? 739 ASP A HB3  2  
ATOM 2392  N N    . GLU A 1 33  ? 10.700  3.241   10.228  1.00 0.00 ? 740 GLU A N    2  
ATOM 2393  C CA   . GLU A 1 33  ? 10.852  3.043   8.808   1.00 0.00 ? 740 GLU A CA   2  
ATOM 2394  C C    . GLU A 1 33  ? 9.563   3.321   8.085   1.00 0.00 ? 740 GLU A C    2  
ATOM 2395  O O    . GLU A 1 33  ? 8.731   2.464   7.931   1.00 0.00 ? 740 GLU A O    2  
ATOM 2396  C CB   . GLU A 1 33  ? 11.330  1.633   8.461   1.00 0.00 ? 740 GLU A CB   2  
ATOM 2397  C CG   . GLU A 1 33  ? 12.666  1.247   9.050   1.00 0.00 ? 740 GLU A CG   2  
ATOM 2398  C CD   . GLU A 1 33  ? 13.158  -0.060  8.493   1.00 0.00 ? 740 GLU A CD   2  
ATOM 2399  O OE1  . GLU A 1 33  ? 12.761  -1.132  8.986   1.00 0.00 ? 740 GLU A OE1  2  
ATOM 2400  O OE2  . GLU A 1 33  ? 13.952  -0.038  7.525   1.00 0.00 ? 740 GLU A OE2  2  
ATOM 2401  H H    . GLU A 1 33  ? 10.193  2.584   10.740  1.00 0.00 ? 740 GLU A H    2  
ATOM 2402  H HA   . GLU A 1 33  ? 11.594  3.749   8.469   1.00 0.00 ? 740 GLU A HA   2  
ATOM 2403  H HB2  . GLU A 1 33  ? 10.594  0.928   8.816   1.00 0.00 ? 740 GLU A HB2  2  
ATOM 2404  H HB3  . GLU A 1 33  ? 11.396  1.551   7.386   1.00 0.00 ? 740 GLU A HB3  2  
ATOM 2405  H HG2  . GLU A 1 33  ? 13.387  2.018   8.824   1.00 0.00 ? 740 GLU A HG2  2  
ATOM 2406  H HG3  . GLU A 1 33  ? 12.563  1.151   10.122  1.00 0.00 ? 740 GLU A HG3  2  
ATOM 2407  N N    . SER A 1 34  ? 9.387   4.512   7.682   1.00 0.00 ? 741 SER A N    2  
ATOM 2408  C CA   . SER A 1 34  ? 8.196   4.866   6.950   1.00 0.00 ? 741 SER A CA   2  
ATOM 2409  C C    . SER A 1 34  ? 8.335   4.480   5.456   1.00 0.00 ? 741 SER A C    2  
ATOM 2410  O O    . SER A 1 34  ? 7.367   4.560   4.695   1.00 0.00 ? 741 SER A O    2  
ATOM 2411  C CB   . SER A 1 34  ? 7.868   6.348   7.153   1.00 0.00 ? 741 SER A CB   2  
ATOM 2412  O OG   . SER A 1 34  ? 6.628   6.719   6.552   1.00 0.00 ? 741 SER A OG   2  
ATOM 2413  H H    . SER A 1 34  ? 10.074  5.170   7.919   1.00 0.00 ? 741 SER A H    2  
ATOM 2414  H HA   . SER A 1 34  ? 7.396   4.269   7.366   1.00 0.00 ? 741 SER A HA   2  
ATOM 2415  H HB2  . SER A 1 34  ? 7.793   6.501   8.220   1.00 0.00 ? 741 SER A HB2  2  
ATOM 2416  H HB3  . SER A 1 34  ? 8.667   6.949   6.747   1.00 0.00 ? 741 SER A HB3  2  
ATOM 2417  H HG   . SER A 1 34  ? 6.473   6.146   5.790   1.00 0.00 ? 741 SER A HG   2  
ATOM 2418  N N    . ALA A 1 35  ? 9.534   4.054   5.063   1.00 0.00 ? 742 ALA A N    2  
ATOM 2419  C CA   . ALA A 1 35  ? 9.799   3.581   3.716   1.00 0.00 ? 742 ALA A CA   2  
ATOM 2420  C C    . ALA A 1 35  ? 10.014  2.085   3.766   1.00 0.00 ? 742 ALA A C    2  
ATOM 2421  O O    . ALA A 1 35  ? 10.907  1.617   4.473   1.00 0.00 ? 742 ALA A O    2  
ATOM 2422  C CB   . ALA A 1 35  ? 11.026  4.265   3.129   1.00 0.00 ? 742 ALA A CB   2  
ATOM 2423  H H    . ALA A 1 35  ? 10.271  4.024   5.712   1.00 0.00 ? 742 ALA A H    2  
ATOM 2424  H HA   . ALA A 1 35  ? 8.938   3.793   3.098   1.00 0.00 ? 742 ALA A HA   2  
ATOM 2425  H HB1  . ALA A 1 35  ? 11.907  3.949   3.664   1.00 0.00 ? 742 ALA A HB1  2  
ATOM 2426  H HB2  . ALA A 1 35  ? 10.932  5.335   3.230   1.00 0.00 ? 742 ALA A HB2  2  
ATOM 2427  H HB3  . ALA A 1 35  ? 11.125  4.004   2.086   1.00 0.00 ? 742 ALA A HB3  2  
ATOM 2428  N N    . LEU A 1 36  ? 9.226   1.345   3.036   1.00 0.00 ? 743 LEU A N    2  
ATOM 2429  C CA   . LEU A 1 36  ? 9.283   -0.100  3.094   1.00 0.00 ? 743 LEU A CA   2  
ATOM 2430  C C    . LEU A 1 36  ? 9.198   -0.722  1.712   1.00 0.00 ? 743 LEU A C    2  
ATOM 2431  O O    . LEU A 1 36  ? 9.003   -0.028  0.696   1.00 0.00 ? 743 LEU A O    2  
ATOM 2432  C CB   . LEU A 1 36  ? 8.133   -0.647  3.958   1.00 0.00 ? 743 LEU A CB   2  
ATOM 2433  C CG   . LEU A 1 36  ? 8.133   -0.276  5.444   1.00 0.00 ? 743 LEU A CG   2  
ATOM 2434  C CD1  . LEU A 1 36  ? 6.853   -0.759  6.092   1.00 0.00 ? 743 LEU A CD1  2  
ATOM 2435  C CD2  . LEU A 1 36  ? 9.341   -0.883  6.156   1.00 0.00 ? 743 LEU A CD2  2  
ATOM 2436  H H    . LEU A 1 36  ? 8.600   1.777   2.409   1.00 0.00 ? 743 LEU A H    2  
ATOM 2437  H HA   . LEU A 1 36  ? 10.215  -0.387  3.555   1.00 0.00 ? 743 LEU A HA   2  
ATOM 2438  H HB2  . LEU A 1 36  ? 7.206   -0.294  3.532   1.00 0.00 ? 743 LEU A HB2  2  
ATOM 2439  H HB3  . LEU A 1 36  ? 8.149   -1.724  3.881   1.00 0.00 ? 743 LEU A HB3  2  
ATOM 2440  H HG   . LEU A 1 36  ? 8.179   0.799   5.543   1.00 0.00 ? 743 LEU A HG   2  
ATOM 2441  H HD11 . LEU A 1 36  ? 6.009   -0.307  5.592   1.00 0.00 ? 743 LEU A HD11 2  
ATOM 2442  H HD12 . LEU A 1 36  ? 6.840   -0.480  7.133   1.00 0.00 ? 743 LEU A HD12 2  
ATOM 2443  H HD13 . LEU A 1 36  ? 6.789   -1.833  6.003   1.00 0.00 ? 743 LEU A HD13 2  
ATOM 2444  H HD21 . LEU A 1 36  ? 10.252  -0.515  5.708   1.00 0.00 ? 743 LEU A HD21 2  
ATOM 2445  H HD22 . LEU A 1 36  ? 9.308   -1.958  6.069   1.00 0.00 ? 743 LEU A HD22 2  
ATOM 2446  H HD23 . LEU A 1 36  ? 9.319   -0.610  7.201   1.00 0.00 ? 743 LEU A HD23 2  
ATOM 2447  N N    . LYS A 1 37  ? 9.354   -2.028  1.695   1.00 0.00 ? 744 LYS A N    2  
ATOM 2448  C CA   . LYS A 1 37  ? 9.230   -2.847  0.500   1.00 0.00 ? 744 LYS A CA   2  
ATOM 2449  C C    . LYS A 1 37  ? 7.750   -2.885  0.135   1.00 0.00 ? 744 LYS A C    2  
ATOM 2450  O O    . LYS A 1 37  ? 6.905   -3.079  1.024   1.00 0.00 ? 744 LYS A O    2  
ATOM 2451  C CB   . LYS A 1 37  ? 9.639   -4.275  0.841   1.00 0.00 ? 744 LYS A CB   2  
ATOM 2452  C CG   . LYS A 1 37  ? 10.894  -4.404  1.681   1.00 0.00 ? 744 LYS A CG   2  
ATOM 2453  C CD   . LYS A 1 37  ? 11.013  -5.809  2.231   1.00 0.00 ? 744 LYS A CD   2  
ATOM 2454  C CE   . LYS A 1 37  ? 12.089  -5.923  3.286   1.00 0.00 ? 744 LYS A CE   2  
ATOM 2455  N NZ   . LYS A 1 37  ? 12.088  -7.274  3.893   1.00 0.00 ? 744 LYS A NZ   2  
ATOM 2456  H H    . LYS A 1 37  ? 9.567   -2.456  2.551   1.00 0.00 ? 744 LYS A H    2  
ATOM 2457  H HA   . LYS A 1 37  ? 9.839   -2.465  -0.306  1.00 0.00 ? 744 LYS A HA   2  
ATOM 2458  H HB2  . LYS A 1 37  ? 8.822   -4.721  1.387   1.00 0.00 ? 744 LYS A HB2  2  
ATOM 2459  H HB3  . LYS A 1 37  ? 9.780   -4.826  -0.076  1.00 0.00 ? 744 LYS A HB3  2  
ATOM 2460  H HG2  . LYS A 1 37  ? 11.756  -4.187  1.070   1.00 0.00 ? 744 LYS A HG2  2  
ATOM 2461  H HG3  . LYS A 1 37  ? 10.841  -3.708  2.505   1.00 0.00 ? 744 LYS A HG3  2  
ATOM 2462  H HD2  . LYS A 1 37  ? 10.080  -6.090  2.692   1.00 0.00 ? 744 LYS A HD2  2  
ATOM 2463  H HD3  . LYS A 1 37  ? 11.236  -6.486  1.421   1.00 0.00 ? 744 LYS A HD3  2  
ATOM 2464  H HE2  . LYS A 1 37  ? 13.050  -5.735  2.831   1.00 0.00 ? 744 LYS A HE2  2  
ATOM 2465  H HE3  . LYS A 1 37  ? 11.901  -5.188  4.053   1.00 0.00 ? 744 LYS A HE3  2  
ATOM 2466  H HZ1  . LYS A 1 37  ? 11.132  -7.512  4.243   1.00 0.00 ? 744 LYS A HZ1  2  
ATOM 2467  H HZ2  . LYS A 1 37  ? 12.744  -7.306  4.699   1.00 0.00 ? 744 LYS A HZ2  2  
ATOM 2468  H HZ3  . LYS A 1 37  ? 12.383  -7.979  3.186   1.00 0.00 ? 744 LYS A HZ3  2  
ATOM 2469  N N    . ARG A 1 38  ? 7.427   -2.754  -1.130  1.00 0.00 ? 745 ARG A N    2  
ATOM 2470  C CA   . ARG A 1 38  ? 6.026   -2.737  -1.531  1.00 0.00 ? 745 ARG A CA   2  
ATOM 2471  C C    . ARG A 1 38  ? 5.415   -4.128  -1.394  1.00 0.00 ? 745 ARG A C    2  
ATOM 2472  O O    . ARG A 1 38  ? 4.259   -4.276  -0.999  1.00 0.00 ? 745 ARG A O    2  
ATOM 2473  C CB   . ARG A 1 38  ? 5.859   -2.211  -2.967  1.00 0.00 ? 745 ARG A CB   2  
ATOM 2474  C CG   . ARG A 1 38  ? 6.339   -3.152  -4.076  1.00 0.00 ? 745 ARG A CG   2  
ATOM 2475  C CD   . ARG A 1 38  ? 6.323   -2.477  -5.426  1.00 0.00 ? 745 ARG A CD   2  
ATOM 2476  N NE   . ARG A 1 38  ? 7.309   -1.402  -5.478  1.00 0.00 ? 745 ARG A NE   2  
ATOM 2477  C CZ   . ARG A 1 38  ? 7.454   -0.520  -6.464  1.00 0.00 ? 745 ARG A CZ   2  
ATOM 2478  N NH1  . ARG A 1 38  ? 6.610   -0.502  -7.494  1.00 0.00 ? 745 ARG A NH1  2  
ATOM 2479  N NH2  . ARG A 1 38  ? 8.442   0.353   -6.413  1.00 0.00 ? 745 ARG A NH2  2  
ATOM 2480  H H    . ARG A 1 38  ? 8.142   -2.672  -1.799  1.00 0.00 ? 745 ARG A H    2  
ATOM 2481  H HA   . ARG A 1 38  ? 5.509   -2.076  -0.852  1.00 0.00 ? 745 ARG A HA   2  
ATOM 2482  H HB2  . ARG A 1 38  ? 4.810   -2.017  -3.131  1.00 0.00 ? 745 ARG A HB2  2  
ATOM 2483  H HB3  . ARG A 1 38  ? 6.409   -1.286  -3.044  1.00 0.00 ? 745 ARG A HB3  2  
ATOM 2484  H HG2  . ARG A 1 38  ? 7.352   -3.458  -3.860  1.00 0.00 ? 745 ARG A HG2  2  
ATOM 2485  H HG3  . ARG A 1 38  ? 5.697   -4.020  -4.102  1.00 0.00 ? 745 ARG A HG3  2  
ATOM 2486  H HD2  . ARG A 1 38  ? 6.555   -3.207  -6.187  1.00 0.00 ? 745 ARG A HD2  2  
ATOM 2487  H HD3  . ARG A 1 38  ? 5.340   -2.062  -5.605  1.00 0.00 ? 745 ARG A HD3  2  
ATOM 2488  H HE   . ARG A 1 38  ? 7.920   -1.388  -4.708  1.00 0.00 ? 745 ARG A HE   2  
ATOM 2489  H HH11 . ARG A 1 38  ? 5.843   -1.142  -7.582  1.00 0.00 ? 745 ARG A HH11 2  
ATOM 2490  H HH12 . ARG A 1 38  ? 6.698   0.182   -8.227  1.00 0.00 ? 745 ARG A HH12 2  
ATOM 2491  H HH21 . ARG A 1 38  ? 9.111   0.418   -5.662  1.00 0.00 ? 745 ARG A HH21 2  
ATOM 2492  H HH22 . ARG A 1 38  ? 8.610   0.994   -7.180  1.00 0.00 ? 745 ARG A HH22 2  
ATOM 2493  N N    . SER A 1 39  ? 6.222   -5.139  -1.665  1.00 0.00 ? 746 SER A N    2  
ATOM 2494  C CA   . SER A 1 39  ? 5.776   -6.502  -1.649  1.00 0.00 ? 746 SER A CA   2  
ATOM 2495  C C    . SER A 1 39  ? 5.500   -6.951  -0.221  1.00 0.00 ? 746 SER A C    2  
ATOM 2496  O O    . SER A 1 39  ? 4.554   -7.656  0.020   1.00 0.00 ? 746 SER A O    2  
ATOM 2497  C CB   . SER A 1 39  ? 6.825   -7.406  -2.327  1.00 0.00 ? 746 SER A CB   2  
ATOM 2498  O OG   . SER A 1 39  ? 6.364   -8.738  -2.478  1.00 0.00 ? 746 SER A OG   2  
ATOM 2499  H H    . SER A 1 39  ? 7.161   -4.952  -1.888  1.00 0.00 ? 746 SER A H    2  
ATOM 2500  H HA   . SER A 1 39  ? 4.857   -6.556  -2.216  1.00 0.00 ? 746 SER A HA   2  
ATOM 2501  H HB2  . SER A 1 39  ? 7.053   -7.011  -3.305  1.00 0.00 ? 746 SER A HB2  2  
ATOM 2502  H HB3  . SER A 1 39  ? 7.725   -7.413  -1.731  1.00 0.00 ? 746 SER A HB3  2  
ATOM 2503  H HG   . SER A 1 39  ? 7.138   -9.312  -2.542  1.00 0.00 ? 746 SER A HG   2  
ATOM 2504  N N    . GLU A 1 40  ? 6.292   -6.443  0.717   1.00 0.00 ? 747 GLU A N    2  
ATOM 2505  C CA   . GLU A 1 40  ? 6.218   -6.837  2.126   1.00 0.00 ? 747 GLU A CA   2  
ATOM 2506  C C    . GLU A 1 40  ? 4.853   -6.503  2.713   1.00 0.00 ? 747 GLU A C    2  
ATOM 2507  O O    . GLU A 1 40  ? 4.261   -7.316  3.428   1.00 0.00 ? 747 GLU A O    2  
ATOM 2508  C CB   . GLU A 1 40  ? 7.282   -6.105  2.922   1.00 0.00 ? 747 GLU A CB   2  
ATOM 2509  C CG   . GLU A 1 40  ? 7.473   -6.623  4.331   1.00 0.00 ? 747 GLU A CG   2  
ATOM 2510  C CD   . GLU A 1 40  ? 8.288   -7.896  4.369   1.00 0.00 ? 747 GLU A CD   2  
ATOM 2511  O OE1  . GLU A 1 40  ? 7.754   -8.984  4.048   1.00 0.00 ? 747 GLU A OE1  2  
ATOM 2512  O OE2  . GLU A 1 40  ? 9.500   -7.827  4.702   1.00 0.00 ? 747 GLU A OE2  2  
ATOM 2513  H H    . GLU A 1 40  ? 6.944   -5.777  0.427   1.00 0.00 ? 747 GLU A H    2  
ATOM 2514  H HA   . GLU A 1 40  ? 6.393   -7.900  2.202   1.00 0.00 ? 747 GLU A HA   2  
ATOM 2515  H HB2  . GLU A 1 40  ? 8.210   -6.254  2.395   1.00 0.00 ? 747 GLU A HB2  2  
ATOM 2516  H HB3  . GLU A 1 40  ? 7.046   -5.052  2.959   1.00 0.00 ? 747 GLU A HB3  2  
ATOM 2517  H HG2  . GLU A 1 40  ? 7.954   -5.869  4.936   1.00 0.00 ? 747 GLU A HG2  2  
ATOM 2518  H HG3  . GLU A 1 40  ? 6.486   -6.839  4.712   1.00 0.00 ? 747 GLU A HG3  2  
ATOM 2519  N N    . LEU A 1 41  ? 4.365   -5.305  2.384   1.00 0.00 ? 748 LEU A N    2  
ATOM 2520  C CA   . LEU A 1 41  ? 3.072   -4.811  2.862   1.00 0.00 ? 748 LEU A CA   2  
ATOM 2521  C C    . LEU A 1 41  ? 1.986   -5.792  2.449   1.00 0.00 ? 748 LEU A C    2  
ATOM 2522  O O    . LEU A 1 41  ? 1.276   -6.375  3.286   1.00 0.00 ? 748 LEU A O    2  
ATOM 2523  C CB   . LEU A 1 41  ? 2.773   -3.445  2.214   1.00 0.00 ? 748 LEU A CB   2  
ATOM 2524  C CG   . LEU A 1 41  ? 3.840   -2.355  2.367   1.00 0.00 ? 748 LEU A CG   2  
ATOM 2525  C CD1  . LEU A 1 41  ? 3.441   -1.110  1.591   1.00 0.00 ? 748 LEU A CD1  2  
ATOM 2526  C CD2  . LEU A 1 41  ? 4.060   -2.013  3.827   1.00 0.00 ? 748 LEU A CD2  2  
ATOM 2527  H H    . LEU A 1 41  ? 4.905   -4.743  1.789   1.00 0.00 ? 748 LEU A H    2  
ATOM 2528  H HA   . LEU A 1 41  ? 3.098   -4.704  3.935   1.00 0.00 ? 748 LEU A HA   2  
ATOM 2529  H HB2  . LEU A 1 41  ? 2.612   -3.608  1.160   1.00 0.00 ? 748 LEU A HB2  2  
ATOM 2530  H HB3  . LEU A 1 41  ? 1.851   -3.074  2.638   1.00 0.00 ? 748 LEU A HB3  2  
ATOM 2531  H HG   . LEU A 1 41  ? 4.772   -2.715  1.955   1.00 0.00 ? 748 LEU A HG   2  
ATOM 2532  H HD11 . LEU A 1 41  ? 3.335   -1.359  0.545   1.00 0.00 ? 748 LEU A HD11 2  
ATOM 2533  H HD12 . LEU A 1 41  ? 4.204   -0.355  1.705   1.00 0.00 ? 748 LEU A HD12 2  
ATOM 2534  H HD13 . LEU A 1 41  ? 2.502   -0.734  1.968   1.00 0.00 ? 748 LEU A HD13 2  
ATOM 2535  H HD21 . LEU A 1 41  ? 4.393   -2.893  4.357   1.00 0.00 ? 748 LEU A HD21 2  
ATOM 2536  H HD22 . LEU A 1 41  ? 3.135   -1.660  4.260   1.00 0.00 ? 748 LEU A HD22 2  
ATOM 2537  H HD23 . LEU A 1 41  ? 4.811   -1.242  3.904   1.00 0.00 ? 748 LEU A HD23 2  
ATOM 2538  N N    . VAL A 1 42  ? 1.914   -5.995  1.148   1.00 0.00 ? 749 VAL A N    2  
ATOM 2539  C CA   . VAL A 1 42  ? 0.961   -6.890  0.538   1.00 0.00 ? 749 VAL A CA   2  
ATOM 2540  C C    . VAL A 1 42  ? 1.146   -8.321  1.061   1.00 0.00 ? 749 VAL A C    2  
ATOM 2541  O O    . VAL A 1 42  ? 0.177   -9.003  1.358   1.00 0.00 ? 749 VAL A O    2  
ATOM 2542  C CB   . VAL A 1 42  ? 1.137   -6.898  -1.005  1.00 0.00 ? 749 VAL A CB   2  
ATOM 2543  C CG1  . VAL A 1 42  ? 0.028   -7.675  -1.671  1.00 0.00 ? 749 VAL A CG1  2  
ATOM 2544  C CG2  . VAL A 1 42  ? 1.201   -5.489  -1.559  1.00 0.00 ? 749 VAL A CG2  2  
ATOM 2545  H H    . VAL A 1 42  ? 2.523   -5.498  0.560   1.00 0.00 ? 749 VAL A H    2  
ATOM 2546  H HA   . VAL A 1 42  ? -0.035  -6.545  0.767   1.00 0.00 ? 749 VAL A HA   2  
ATOM 2547  H HB   . VAL A 1 42  ? 2.071   -7.392  -1.228  1.00 0.00 ? 749 VAL A HB   2  
ATOM 2548  H HG11 . VAL A 1 42  ? 0.156   -7.646  -2.743  1.00 0.00 ? 749 VAL A HG11 2  
ATOM 2549  H HG12 . VAL A 1 42  ? -0.911  -7.216  -1.404  1.00 0.00 ? 749 VAL A HG12 2  
ATOM 2550  H HG13 . VAL A 1 42  ? 0.045   -8.696  -1.320  1.00 0.00 ? 749 VAL A HG13 2  
ATOM 2551  H HG21 . VAL A 1 42  ? 2.058   -4.975  -1.152  1.00 0.00 ? 749 VAL A HG21 2  
ATOM 2552  H HG22 . VAL A 1 42  ? 0.302   -4.964  -1.275  1.00 0.00 ? 749 VAL A HG22 2  
ATOM 2553  H HG23 . VAL A 1 42  ? 1.272   -5.523  -2.636  1.00 0.00 ? 749 VAL A HG23 2  
ATOM 2554  N N    . ASN A 1 43  ? 2.398   -8.716  1.224   1.00 0.00 ? 750 ASN A N    2  
ATOM 2555  C CA   . ASN A 1 43  ? 2.784   -10.075 1.603   1.00 0.00 ? 750 ASN A CA   2  
ATOM 2556  C C    . ASN A 1 43  ? 2.131   -10.501 2.891   1.00 0.00 ? 750 ASN A C    2  
ATOM 2557  O O    . ASN A 1 43  ? 1.296   -11.431 2.905   1.00 0.00 ? 750 ASN A O    2  
ATOM 2558  C CB   . ASN A 1 43  ? 4.312   -10.173 1.764   1.00 0.00 ? 750 ASN A CB   2  
ATOM 2559  C CG   . ASN A 1 43  ? 4.774   -11.569 2.144   1.00 0.00 ? 750 ASN A CG   2  
ATOM 2560  O OD1  . ASN A 1 43  ? 4.164   -12.561 1.773   1.00 0.00 ? 750 ASN A OD1  2  
ATOM 2561  N ND2  . ASN A 1 43  ? 5.829   -11.652 2.908   1.00 0.00 ? 750 ASN A ND2  2  
ATOM 2562  H H    . ASN A 1 43  ? 3.118   -8.058  1.090   1.00 0.00 ? 750 ASN A H    2  
ATOM 2563  H HA   . ASN A 1 43  ? 2.482   -10.758 0.825   1.00 0.00 ? 750 ASN A HA   2  
ATOM 2564  H HB2  . ASN A 1 43  ? 4.816   -9.836  0.867   1.00 0.00 ? 750 ASN A HB2  2  
ATOM 2565  H HB3  . ASN A 1 43  ? 4.593   -9.504  2.563   1.00 0.00 ? 750 ASN A HB3  2  
ATOM 2566  H HD21 . ASN A 1 43  ? 6.274   -10.829 3.203   1.00 0.00 ? 750 ASN A HD21 2  
ATOM 2567  H HD22 . ASN A 1 43  ? 6.126   -12.556 3.150   1.00 0.00 ? 750 ASN A HD22 2  
ATOM 2568  N N    . TRP A 1 44  ? 2.423   -9.787  3.965   1.00 0.00 ? 751 TRP A N    2  
ATOM 2569  C CA   . TRP A 1 44  ? 1.888   -10.198 5.228   1.00 0.00 ? 751 TRP A CA   2  
ATOM 2570  C C    . TRP A 1 44  ? 0.396   -9.976  5.239   1.00 0.00 ? 751 TRP A C    2  
ATOM 2571  O O    . TRP A 1 44  ? -0.315  -10.729 5.850   1.00 0.00 ? 751 TRP A O    2  
ATOM 2572  C CB   . TRP A 1 44  ? 2.583   -9.545  6.455   1.00 0.00 ? 751 TRP A CB   2  
ATOM 2573  C CG   . TRP A 1 44  ? 2.299   -8.091  6.662   1.00 0.00 ? 751 TRP A CG   2  
ATOM 2574  C CD1  . TRP A 1 44  ? 3.060   -7.044  6.264   1.00 0.00 ? 751 TRP A CD1  2  
ATOM 2575  C CD2  . TRP A 1 44  ? 1.158   -7.527  7.332   1.00 0.00 ? 751 TRP A CD2  2  
ATOM 2576  N NE1  . TRP A 1 44  ? 2.460   -5.870  6.625   1.00 0.00 ? 751 TRP A NE1  2  
ATOM 2577  C CE2  . TRP A 1 44  ? 1.294   -6.146  7.278   1.00 0.00 ? 751 TRP A CE2  2  
ATOM 2578  C CE3  . TRP A 1 44  ? 0.025   -8.069  7.960   1.00 0.00 ? 751 TRP A CE3  2  
ATOM 2579  C CZ2  . TRP A 1 44  ? 0.360   -5.293  7.823   1.00 0.00 ? 751 TRP A CZ2  2  
ATOM 2580  C CZ3  . TRP A 1 44  ? -0.910  -7.211  8.498   1.00 0.00 ? 751 TRP A CZ3  2  
ATOM 2581  C CH2  . TRP A 1 44  ? -0.738  -5.833  8.421   1.00 0.00 ? 751 TRP A CH2  2  
ATOM 2582  H H    . TRP A 1 44  ? 2.987   -8.987  3.888   1.00 0.00 ? 751 TRP A H    2  
ATOM 2583  H HA   . TRP A 1 44  ? 2.037   -11.268 5.267   1.00 0.00 ? 751 TRP A HA   2  
ATOM 2584  H HB2  . TRP A 1 44  ? 2.267   -10.059 7.351   1.00 0.00 ? 751 TRP A HB2  2  
ATOM 2585  H HB3  . TRP A 1 44  ? 3.651   -9.665  6.346   1.00 0.00 ? 751 TRP A HB3  2  
ATOM 2586  H HD1  . TRP A 1 44  ? 3.996   -7.136  5.732   1.00 0.00 ? 751 TRP A HD1  2  
ATOM 2587  H HE1  . TRP A 1 44  ? 2.812   -4.973  6.446   1.00 0.00 ? 751 TRP A HE1  2  
ATOM 2588  H HE3  . TRP A 1 44  ? -0.117  -9.137  8.022   1.00 0.00 ? 751 TRP A HE3  2  
ATOM 2589  H HZ2  . TRP A 1 44  ? 0.465   -4.221  7.770   1.00 0.00 ? 751 TRP A HZ2  2  
ATOM 2590  H HZ3  . TRP A 1 44  ? -1.792  -7.605  8.980   1.00 0.00 ? 751 TRP A HZ3  2  
ATOM 2591  H HH2  . TRP A 1 44  ? -1.492  -5.168  8.820   1.00 0.00 ? 751 TRP A HH2  2  
ATOM 2592  N N    . TYR A 1 45  ? -0.070  -8.967  4.482   1.00 0.00 ? 752 TYR A N    2  
ATOM 2593  C CA   . TYR A 1 45  ? -1.485  -8.627  4.437   1.00 0.00 ? 752 TYR A CA   2  
ATOM 2594  C C    . TYR A 1 45  ? -2.299  -9.796  3.912   1.00 0.00 ? 752 TYR A C    2  
ATOM 2595  O O    . TYR A 1 45  ? -3.310  -10.169 4.497   1.00 0.00 ? 752 TYR A O    2  
ATOM 2596  C CB   . TYR A 1 45  ? -1.734  -7.381  3.573   1.00 0.00 ? 752 TYR A CB   2  
ATOM 2597  C CG   . TYR A 1 45  ? -3.180  -6.929  3.587   1.00 0.00 ? 752 TYR A CG   2  
ATOM 2598  C CD1  . TYR A 1 45  ? -3.805  -6.641  4.792   1.00 0.00 ? 752 TYR A CD1  2  
ATOM 2599  C CD2  . TYR A 1 45  ? -3.930  -6.819  2.413   1.00 0.00 ? 752 TYR A CD2  2  
ATOM 2600  C CE1  . TYR A 1 45  ? -5.118  -6.253  4.840   1.00 0.00 ? 752 TYR A CE1  2  
ATOM 2601  C CE2  . TYR A 1 45  ? -5.242  -6.437  2.455   1.00 0.00 ? 752 TYR A CE2  2  
ATOM 2602  C CZ   . TYR A 1 45  ? -5.838  -6.152  3.679   1.00 0.00 ? 752 TYR A CZ   2  
ATOM 2603  O OH   . TYR A 1 45  ? -7.164  -5.782  3.741   1.00 0.00 ? 752 TYR A OH   2  
ATOM 2604  H H    . TYR A 1 45  ? 0.564   -8.446  3.939   1.00 0.00 ? 752 TYR A H    2  
ATOM 2605  H HA   . TYR A 1 45  ? -1.798  -8.419  5.449   1.00 0.00 ? 752 TYR A HA   2  
ATOM 2606  H HB2  . TYR A 1 45  ? -1.103  -6.571  3.910   1.00 0.00 ? 752 TYR A HB2  2  
ATOM 2607  H HB3  . TYR A 1 45  ? -1.473  -7.618  2.552   1.00 0.00 ? 752 TYR A HB3  2  
ATOM 2608  H HD1  . TYR A 1 45  ? -3.238  -6.720  5.707   1.00 0.00 ? 752 TYR A HD1  2  
ATOM 2609  H HD2  . TYR A 1 45  ? -3.513  -7.028  1.438   1.00 0.00 ? 752 TYR A HD2  2  
ATOM 2610  H HE1  . TYR A 1 45  ? -5.578  -6.031  5.790   1.00 0.00 ? 752 TYR A HE1  2  
ATOM 2611  H HE2  . TYR A 1 45  ? -5.771  -6.364  1.517   1.00 0.00 ? 752 TYR A HE2  2  
ATOM 2612  H HH   . TYR A 1 45  ? -7.252  -5.127  4.441   1.00 0.00 ? 752 TYR A HH   2  
ATOM 2613  N N    . LEU A 1 46  ? -1.830  -10.381 2.835   1.00 0.00 ? 753 LEU A N    2  
ATOM 2614  C CA   . LEU A 1 46  ? -2.489  -11.518 2.218   1.00 0.00 ? 753 LEU A CA   2  
ATOM 2615  C C    . LEU A 1 46  ? -2.474  -12.708 3.137   1.00 0.00 ? 753 LEU A C    2  
ATOM 2616  O O    . LEU A 1 46  ? -3.445  -13.428 3.242   1.00 0.00 ? 753 LEU A O    2  
ATOM 2617  C CB   . LEU A 1 46  ? -1.786  -11.885 0.940   1.00 0.00 ? 753 LEU A CB   2  
ATOM 2618  C CG   . LEU A 1 46  ? -1.708  -10.801 -0.105  1.00 0.00 ? 753 LEU A CG   2  
ATOM 2619  C CD1  . LEU A 1 46  ? -0.804  -11.248 -1.213  1.00 0.00 ? 753 LEU A CD1  2  
ATOM 2620  C CD2  . LEU A 1 46  ? -3.091  -10.444 -0.628  1.00 0.00 ? 753 LEU A CD2  2  
ATOM 2621  H H    . LEU A 1 46  ? -1.011  -10.021 2.424   1.00 0.00 ? 753 LEU A H    2  
ATOM 2622  H HA   . LEU A 1 46  ? -3.509  -11.249 1.986   1.00 0.00 ? 753 LEU A HA   2  
ATOM 2623  H HB2  . LEU A 1 46  ? -0.781  -12.192 1.187   1.00 0.00 ? 753 LEU A HB2  2  
ATOM 2624  H HB3  . LEU A 1 46  ? -2.303  -12.731 0.511   1.00 0.00 ? 753 LEU A HB3  2  
ATOM 2625  H HG   . LEU A 1 46  ? -1.273  -9.920  0.343   1.00 0.00 ? 753 LEU A HG   2  
ATOM 2626  H HD11 . LEU A 1 46  ? -0.742  -10.495 -1.981  1.00 0.00 ? 753 LEU A HD11 2  
ATOM 2627  H HD12 . LEU A 1 46  ? -1.164  -12.180 -1.620  1.00 0.00 ? 753 LEU A HD12 2  
ATOM 2628  H HD13 . LEU A 1 46  ? 0.168   -11.390 -0.759  1.00 0.00 ? 753 LEU A HD13 2  
ATOM 2629  H HD21 . LEU A 1 46  ? -3.000  -9.670  -1.375  1.00 0.00 ? 753 LEU A HD21 2  
ATOM 2630  H HD22 . LEU A 1 46  ? -3.703  -10.084 0.185   1.00 0.00 ? 753 LEU A HD22 2  
ATOM 2631  H HD23 . LEU A 1 46  ? -3.552  -11.317 -1.066  1.00 0.00 ? 753 LEU A HD23 2  
ATOM 2632  N N    . LYS A 1 47  ? -1.381  -12.869 3.833   1.00 0.00 ? 754 LYS A N    2  
ATOM 2633  C CA   . LYS A 1 47  ? -1.201  -14.022 4.723   1.00 0.00 ? 754 LYS A CA   2  
ATOM 2634  C C    . LYS A 1 47  ? -2.063  -13.862 5.973   1.00 0.00 ? 754 LYS A C    2  
ATOM 2635  O O    . LYS A 1 47  ? -2.623  -14.815 6.504   1.00 0.00 ? 754 LYS A O    2  
ATOM 2636  C CB   . LYS A 1 47  ? 0.296   -14.208 5.065   1.00 0.00 ? 754 LYS A CB   2  
ATOM 2637  C CG   . LYS A 1 47  ? 1.118   -15.010 4.019   1.00 0.00 ? 754 LYS A CG   2  
ATOM 2638  C CD   . LYS A 1 47  ? 1.016   -14.436 2.607   1.00 0.00 ? 754 LYS A CD   2  
ATOM 2639  C CE   . LYS A 1 47  ? 1.799   -15.247 1.576   1.00 0.00 ? 754 LYS A CE   2  
ATOM 2640  N NZ   . LYS A 1 47  ? 3.274   -15.142 1.733   1.00 0.00 ? 754 LYS A NZ   2  
ATOM 2641  H H    . LYS A 1 47  ? -0.701  -12.159 3.761   1.00 0.00 ? 754 LYS A H    2  
ATOM 2642  H HA   . LYS A 1 47  ? -1.554  -14.889 4.186   1.00 0.00 ? 754 LYS A HA   2  
ATOM 2643  H HB2  . LYS A 1 47  ? 0.731   -13.219 5.139   1.00 0.00 ? 754 LYS A HB2  2  
ATOM 2644  H HB3  . LYS A 1 47  ? 0.378   -14.699 6.023   1.00 0.00 ? 754 LYS A HB3  2  
ATOM 2645  H HG2  . LYS A 1 47  ? 2.156   -14.998 4.313   1.00 0.00 ? 754 LYS A HG2  2  
ATOM 2646  H HG3  . LYS A 1 47  ? 0.762   -16.030 4.012   1.00 0.00 ? 754 LYS A HG3  2  
ATOM 2647  H HD2  . LYS A 1 47  ? -0.024  -14.417 2.316   1.00 0.00 ? 754 LYS A HD2  2  
ATOM 2648  H HD3  . LYS A 1 47  ? 1.395   -13.425 2.623   1.00 0.00 ? 754 LYS A HD3  2  
ATOM 2649  H HE2  . LYS A 1 47  ? 1.519   -16.285 1.674   1.00 0.00 ? 754 LYS A HE2  2  
ATOM 2650  H HE3  . LYS A 1 47  ? 1.522   -14.897 0.593   1.00 0.00 ? 754 LYS A HE3  2  
ATOM 2651  H HZ1  . LYS A 1 47  ? 3.731   -15.710 0.990   1.00 0.00 ? 754 LYS A HZ1  2  
ATOM 2652  H HZ2  . LYS A 1 47  ? 3.617   -15.485 2.652   1.00 0.00 ? 754 LYS A HZ2  2  
ATOM 2653  H HZ3  . LYS A 1 47  ? 3.601   -14.158 1.602   1.00 0.00 ? 754 LYS A HZ3  2  
ATOM 2654  N N    . GLU A 1 48  ? -2.173  -12.640 6.388   1.00 0.00 ? 755 GLU A N    2  
ATOM 2655  C CA   . GLU A 1 48  ? -2.976  -12.188 7.501   1.00 0.00 ? 755 GLU A CA   2  
ATOM 2656  C C    . GLU A 1 48  ? -4.479  -12.385 7.228   1.00 0.00 ? 755 GLU A C    2  
ATOM 2657  O O    . GLU A 1 48  ? -5.176  -13.069 7.992   1.00 0.00 ? 755 GLU A O    2  
ATOM 2658  C CB   . GLU A 1 48  ? -2.604  -10.713 7.704   1.00 0.00 ? 755 GLU A CB   2  
ATOM 2659  C CG   . GLU A 1 48  ? -3.660  -9.779  8.212   1.00 0.00 ? 755 GLU A CG   2  
ATOM 2660  C CD   . GLU A 1 48  ? -4.043  -9.982  9.657   1.00 0.00 ? 755 GLU A CD   2  
ATOM 2661  O OE1  . GLU A 1 48  ? -3.315  -9.514  10.555  1.00 0.00 ? 755 GLU A OE1  2  
ATOM 2662  O OE2  . GLU A 1 48  ? -5.098  -10.565 9.928   1.00 0.00 ? 755 GLU A OE2  2  
ATOM 2663  H H    . GLU A 1 48  ? -1.644  -11.961 5.911   1.00 0.00 ? 755 GLU A H    2  
ATOM 2664  H HA   . GLU A 1 48  ? -2.692  -12.733 8.387   1.00 0.00 ? 755 GLU A HA   2  
ATOM 2665  H HB2  . GLU A 1 48  ? -1.779  -10.663 8.396   1.00 0.00 ? 755 GLU A HB2  2  
ATOM 2666  H HB3  . GLU A 1 48  ? -2.260  -10.345 6.748   1.00 0.00 ? 755 GLU A HB3  2  
ATOM 2667  H HG2  . GLU A 1 48  ? -3.287  -8.784  8.029   1.00 0.00 ? 755 GLU A HG2  2  
ATOM 2668  H HG3  . GLU A 1 48  ? -4.496  -9.974  7.556   1.00 0.00 ? 755 GLU A HG3  2  
ATOM 2669  N N    . ILE A 1 49  ? -4.957  -11.848 6.106   1.00 0.00 ? 756 ILE A N    2  
ATOM 2670  C CA   . ILE A 1 49  ? -6.387  -11.885 5.777   1.00 0.00 ? 756 ILE A CA   2  
ATOM 2671  C C    . ILE A 1 49  ? -6.882  -13.296 5.601   1.00 0.00 ? 756 ILE A C    2  
ATOM 2672  O O    . ILE A 1 49  ? -8.066  -13.568 5.797   1.00 0.00 ? 756 ILE A O    2  
ATOM 2673  C CB   . ILE A 1 49  ? -6.749  -11.070 4.516   1.00 0.00 ? 756 ILE A CB   2  
ATOM 2674  C CG1  . ILE A 1 49  ? -5.932  -11.564 3.317   1.00 0.00 ? 756 ILE A CG1  2  
ATOM 2675  C CG2  . ILE A 1 49  ? -6.547  -9.583  4.764   1.00 0.00 ? 756 ILE A CG2  2  
ATOM 2676  C CD1  . ILE A 1 49  ? -6.257  -10.908 2.010   1.00 0.00 ? 756 ILE A CD1  2  
ATOM 2677  H H    . ILE A 1 49  ? -4.327  -11.419 5.484   1.00 0.00 ? 756 ILE A H    2  
ATOM 2678  H HA   . ILE A 1 49  ? -6.912  -11.455 6.619   1.00 0.00 ? 756 ILE A HA   2  
ATOM 2679  H HB   . ILE A 1 49  ? -7.798  -11.227 4.312   1.00 0.00 ? 756 ILE A HB   2  
ATOM 2680  H HG12 . ILE A 1 49  ? -4.885  -11.392 3.519   1.00 0.00 ? 756 ILE A HG12 2  
ATOM 2681  H HG13 . ILE A 1 49  ? -6.092  -12.627 3.209   1.00 0.00 ? 756 ILE A HG13 2  
ATOM 2682  H HG21 . ILE A 1 49  ? -5.512  -9.399  5.012   1.00 0.00 ? 756 ILE A HG21 2  
ATOM 2683  H HG22 . ILE A 1 49  ? -7.171  -9.261  5.583   1.00 0.00 ? 756 ILE A HG22 2  
ATOM 2684  H HG23 . ILE A 1 49  ? -6.805  -9.029  3.873   1.00 0.00 ? 756 ILE A HG23 2  
ATOM 2685  H HD11 . ILE A 1 49  ? -7.283  -11.126 1.754   1.00 0.00 ? 756 ILE A HD11 2  
ATOM 2686  H HD12 . ILE A 1 49  ? -5.606  -11.291 1.238   1.00 0.00 ? 756 ILE A HD12 2  
ATOM 2687  H HD13 . ILE A 1 49  ? -6.131  -9.839  2.103   1.00 0.00 ? 756 ILE A HD13 2  
ATOM 2688  N N    . GLU A 1 50  ? -5.966  -14.203 5.268   1.00 0.00 ? 757 GLU A N    2  
ATOM 2689  C CA   . GLU A 1 50  ? -6.277  -15.619 5.082   1.00 0.00 ? 757 GLU A CA   2  
ATOM 2690  C C    . GLU A 1 50  ? -7.013  -16.231 6.273   1.00 0.00 ? 757 GLU A C    2  
ATOM 2691  O O    . GLU A 1 50  ? -7.704  -17.234 6.125   1.00 0.00 ? 757 GLU A O    2  
ATOM 2692  C CB   . GLU A 1 50  ? -5.026  -16.421 4.832   1.00 0.00 ? 757 GLU A CB   2  
ATOM 2693  C CG   . GLU A 1 50  ? -4.439  -16.309 3.453   1.00 0.00 ? 757 GLU A CG   2  
ATOM 2694  C CD   . GLU A 1 50  ? -3.312  -17.278 3.289   1.00 0.00 ? 757 GLU A CD   2  
ATOM 2695  O OE1  . GLU A 1 50  ? -3.580  -18.499 3.285   1.00 0.00 ? 757 GLU A OE1  2  
ATOM 2696  O OE2  . GLU A 1 50  ? -2.147  -16.868 3.221   1.00 0.00 ? 757 GLU A OE2  2  
ATOM 2697  H H    . GLU A 1 50  ? -5.040  -13.896 5.140   1.00 0.00 ? 757 GLU A H    2  
ATOM 2698  H HA   . GLU A 1 50  ? -6.907  -15.702 4.210   1.00 0.00 ? 757 GLU A HA   2  
ATOM 2699  H HB2  . GLU A 1 50  ? -4.272  -16.048 5.509   1.00 0.00 ? 757 GLU A HB2  2  
ATOM 2700  H HB3  . GLU A 1 50  ? -5.221  -17.462 5.039   1.00 0.00 ? 757 GLU A HB3  2  
ATOM 2701  H HG2  . GLU A 1 50  ? -5.205  -16.526 2.722   1.00 0.00 ? 757 GLU A HG2  2  
ATOM 2702  H HG3  . GLU A 1 50  ? -4.065  -15.306 3.306   1.00 0.00 ? 757 GLU A HG3  2  
ATOM 2703  N N    . SER A 1 51  ? -6.872  -15.633 7.439   1.00 0.00 ? 758 SER A N    2  
ATOM 2704  C CA   . SER A 1 51  ? -7.508  -16.132 8.624   1.00 0.00 ? 758 SER A CA   2  
ATOM 2705  C C    . SER A 1 51  ? -9.050  -15.927 8.549   1.00 0.00 ? 758 SER A C    2  
ATOM 2706  O O    . SER A 1 51  ? -9.813  -16.664 9.185   1.00 0.00 ? 758 SER A O    2  
ATOM 2707  C CB   . SER A 1 51  ? -6.895  -15.450 9.864   1.00 0.00 ? 758 SER A CB   2  
ATOM 2708  O OG   . SER A 1 51  ? -7.194  -16.146 11.080  1.00 0.00 ? 758 SER A OG   2  
ATOM 2709  H H    . SER A 1 51  ? -6.307  -14.828 7.501   1.00 0.00 ? 758 SER A H    2  
ATOM 2710  H HA   . SER A 1 51  ? -7.305  -17.192 8.673   1.00 0.00 ? 758 SER A HA   2  
ATOM 2711  H HB2  . SER A 1 51  ? -5.823  -15.394 9.753   1.00 0.00 ? 758 SER A HB2  2  
ATOM 2712  H HB3  . SER A 1 51  ? -7.293  -14.448 9.932   1.00 0.00 ? 758 SER A HB3  2  
ATOM 2713  H HG   . SER A 1 51  ? -8.082  -16.524 11.011  1.00 0.00 ? 758 SER A HG   2  
ATOM 2714  N N    . GLU A 1 52  ? -9.508  -14.957 7.745   1.00 0.00 ? 759 GLU A N    2  
ATOM 2715  C CA   . GLU A 1 52  ? -10.947 -14.707 7.630   1.00 0.00 ? 759 GLU A CA   2  
ATOM 2716  C C    . GLU A 1 52  ? -11.460 -14.915 6.198   1.00 0.00 ? 759 GLU A C    2  
ATOM 2717  O O    . GLU A 1 52  ? -12.672 -14.875 5.957   1.00 0.00 ? 759 GLU A O    2  
ATOM 2718  C CB   . GLU A 1 52  ? -11.319 -13.296 8.098   1.00 0.00 ? 759 GLU A CB   2  
ATOM 2719  C CG   . GLU A 1 52  ? -10.750 -12.184 7.240   1.00 0.00 ? 759 GLU A CG   2  
ATOM 2720  C CD   . GLU A 1 52  ? -11.271 -10.840 7.638   1.00 0.00 ? 759 GLU A CD   2  
ATOM 2721  O OE1  . GLU A 1 52  ? -12.363 -10.433 7.159   1.00 0.00 ? 759 GLU A OE1  2  
ATOM 2722  O OE2  . GLU A 1 52  ? -10.611 -10.143 8.427   1.00 0.00 ? 759 GLU A OE2  2  
ATOM 2723  H H    . GLU A 1 52  ? -8.880  -14.407 7.225   1.00 0.00 ? 759 GLU A H    2  
ATOM 2724  H HA   . GLU A 1 52  ? -11.439 -15.420 8.272   1.00 0.00 ? 759 GLU A HA   2  
ATOM 2725  H HB2  . GLU A 1 52  ? -12.395 -13.205 8.089   1.00 0.00 ? 759 GLU A HB2  2  
ATOM 2726  H HB3  . GLU A 1 52  ? -10.965 -13.158 9.109   1.00 0.00 ? 759 GLU A HB3  2  
ATOM 2727  H HG2  . GLU A 1 52  ? -9.674  -12.186 7.336   1.00 0.00 ? 759 GLU A HG2  2  
ATOM 2728  H HG3  . GLU A 1 52  ? -11.015 -12.373 6.210   1.00 0.00 ? 759 GLU A HG3  2  
ATOM 2729  N N    . ILE A 1 53  ? -10.554 -15.111 5.248   1.00 0.00 ? 760 ILE A N    2  
ATOM 2730  C CA   . ILE A 1 53  ? -10.958 -15.294 3.856   1.00 0.00 ? 760 ILE A CA   2  
ATOM 2731  C C    . ILE A 1 53  ? -11.674 -16.624 3.671   1.00 0.00 ? 760 ILE A C    2  
ATOM 2732  O O    . ILE A 1 53  ? -11.107 -17.700 3.914   1.00 0.00 ? 760 ILE A O    2  
ATOM 2733  C CB   . ILE A 1 53  ? -9.765  -15.205 2.854   1.00 0.00 ? 760 ILE A CB   2  
ATOM 2734  C CG1  . ILE A 1 53  ? -9.059  -13.843 2.923   1.00 0.00 ? 760 ILE A CG1  2  
ATOM 2735  C CG2  . ILE A 1 53  ? -10.226 -15.483 1.434   1.00 0.00 ? 760 ILE A CG2  2  
ATOM 2736  C CD1  . ILE A 1 53  ? -9.939  -12.647 2.605   1.00 0.00 ? 760 ILE A CD1  2  
ATOM 2737  H H    . ILE A 1 53  ? -9.604  -15.127 5.488   1.00 0.00 ? 760 ILE A H    2  
ATOM 2738  H HA   . ILE A 1 53  ? -11.665 -14.510 3.623   1.00 0.00 ? 760 ILE A HA   2  
ATOM 2739  H HB   . ILE A 1 53  ? -9.065  -15.981 3.114   1.00 0.00 ? 760 ILE A HB   2  
ATOM 2740  H HG12 . ILE A 1 53  ? -8.677  -13.700 3.923   1.00 0.00 ? 760 ILE A HG12 2  
ATOM 2741  H HG13 . ILE A 1 53  ? -8.230  -13.842 2.229   1.00 0.00 ? 760 ILE A HG13 2  
ATOM 2742  H HG21 . ILE A 1 53  ? -10.972 -14.757 1.148   1.00 0.00 ? 760 ILE A HG21 2  
ATOM 2743  H HG22 . ILE A 1 53  ? -10.651 -16.473 1.376   1.00 0.00 ? 760 ILE A HG22 2  
ATOM 2744  H HG23 . ILE A 1 53  ? -9.379  -15.410 0.769   1.00 0.00 ? 760 ILE A HG23 2  
ATOM 2745  H HD11 . ILE A 1 53  ? -10.763 -12.595 3.300   1.00 0.00 ? 760 ILE A HD11 2  
ATOM 2746  H HD12 . ILE A 1 53  ? -10.315 -12.756 1.599   1.00 0.00 ? 760 ILE A HD12 2  
ATOM 2747  H HD13 . ILE A 1 53  ? -9.351  -11.743 2.668   1.00 0.00 ? 760 ILE A HD13 2  
ATOM 2748  N N    . ASP A 1 54  ? -12.914 -16.534 3.283   1.00 0.00 ? 761 ASP A N    2  
ATOM 2749  C CA   . ASP A 1 54  ? -13.746 -17.695 3.024   1.00 0.00 ? 761 ASP A CA   2  
ATOM 2750  C C    . ASP A 1 54  ? -13.872 -17.925 1.535   1.00 0.00 ? 761 ASP A C    2  
ATOM 2751  O O    . ASP A 1 54  ? -14.021 -19.060 1.065   1.00 0.00 ? 761 ASP A O    2  
ATOM 2752  C CB   . ASP A 1 54  ? -15.144 -17.470 3.617   1.00 0.00 ? 761 ASP A CB   2  
ATOM 2753  C CG   . ASP A 1 54  ? -16.117 -18.576 3.282   1.00 0.00 ? 761 ASP A CG   2  
ATOM 2754  O OD1  . ASP A 1 54  ? -16.113 -19.607 3.970   1.00 0.00 ? 761 ASP A OD1  2  
ATOM 2755  O OD2  . ASP A 1 54  ? -16.902 -18.440 2.317   1.00 0.00 ? 761 ASP A OD2  2  
ATOM 2756  H H    . ASP A 1 54  ? -13.306 -15.638 3.190   1.00 0.00 ? 761 ASP A H    2  
ATOM 2757  H HA   . ASP A 1 54  ? -13.307 -18.562 3.494   1.00 0.00 ? 761 ASP A HA   2  
ATOM 2758  H HB2  . ASP A 1 54  ? -15.056 -17.415 4.690   1.00 0.00 ? 761 ASP A HB2  2  
ATOM 2759  H HB3  . ASP A 1 54  ? -15.542 -16.536 3.246   1.00 0.00 ? 761 ASP A HB3  2  
ATOM 2760  N N    . SER A 1 55  ? -13.736 -16.864 0.794   1.00 0.00 ? 762 SER A N    2  
ATOM 2761  C CA   . SER A 1 55  ? -14.014 -16.890 -0.610  1.00 0.00 ? 762 SER A CA   2  
ATOM 2762  C C    . SER A 1 55  ? -12.747 -16.625 -1.395  1.00 0.00 ? 762 SER A C    2  
ATOM 2763  O O    . SER A 1 55  ? -11.996 -15.707 -1.064  1.00 0.00 ? 762 SER A O    2  
ATOM 2764  C CB   . SER A 1 55  ? -15.046 -15.807 -0.917  1.00 0.00 ? 762 SER A CB   2  
ATOM 2765  O OG   . SER A 1 55  ? -16.171 -15.911 -0.049  1.00 0.00 ? 762 SER A OG   2  
ATOM 2766  H H    . SER A 1 55  ? -13.383 -16.038 1.185   1.00 0.00 ? 762 SER A H    2  
ATOM 2767  H HA   . SER A 1 55  ? -14.431 -17.848 -0.877  1.00 0.00 ? 762 SER A HA   2  
ATOM 2768  H HB2  . SER A 1 55  ? -14.594 -14.835 -0.788  1.00 0.00 ? 762 SER A HB2  2  
ATOM 2769  H HB3  . SER A 1 55  ? -15.381 -15.918 -1.937  1.00 0.00 ? 762 SER A HB3  2  
ATOM 2770  H HG   . SER A 1 55  ? -16.481 -16.825 -0.060  1.00 0.00 ? 762 SER A HG   2  
ATOM 2771  N N    . GLU A 1 56  ? -12.513 -17.410 -2.430  1.00 0.00 ? 763 GLU A N    2  
ATOM 2772  C CA   . GLU A 1 56  ? -11.352 -17.227 -3.296  1.00 0.00 ? 763 GLU A CA   2  
ATOM 2773  C C    . GLU A 1 56  ? -11.440 -15.852 -3.954  1.00 0.00 ? 763 GLU A C    2  
ATOM 2774  O O    . GLU A 1 56  ? -10.428 -15.178 -4.156  1.00 0.00 ? 763 GLU A O    2  
ATOM 2775  C CB   . GLU A 1 56  ? -11.294 -18.345 -4.347  1.00 0.00 ? 763 GLU A CB   2  
ATOM 2776  C CG   . GLU A 1 56  ? -10.045 -18.324 -5.215  1.00 0.00 ? 763 GLU A CG   2  
ATOM 2777  C CD   . GLU A 1 56  ? -9.999  -19.466 -6.200  1.00 0.00 ? 763 GLU A CD   2  
ATOM 2778  O OE1  . GLU A 1 56  ? -9.615  -20.603 -5.811  1.00 0.00 ? 763 GLU A OE1  2  
ATOM 2779  O OE2  . GLU A 1 56  ? -10.328 -19.261 -7.383  1.00 0.00 ? 763 GLU A OE2  2  
ATOM 2780  H H    . GLU A 1 56  ? -13.136 -18.143 -2.627  1.00 0.00 ? 763 GLU A H    2  
ATOM 2781  H HA   . GLU A 1 56  ? -10.458 -17.246 -2.689  1.00 0.00 ? 763 GLU A HA   2  
ATOM 2782  H HB2  . GLU A 1 56  ? -11.334 -19.299 -3.842  1.00 0.00 ? 763 GLU A HB2  2  
ATOM 2783  H HB3  . GLU A 1 56  ? -12.155 -18.256 -4.992  1.00 0.00 ? 763 GLU A HB3  2  
ATOM 2784  H HG2  . GLU A 1 56  ? -10.025 -17.397 -5.767  1.00 0.00 ? 763 GLU A HG2  2  
ATOM 2785  H HG3  . GLU A 1 56  ? -9.177  -18.376 -4.575  1.00 0.00 ? 763 GLU A HG3  2  
ATOM 2786  N N    . GLU A 1 57  ? -12.679 -15.423 -4.195  1.00 0.00 ? 764 GLU A N    2  
ATOM 2787  C CA   . GLU A 1 57  ? -12.996 -14.121 -4.764  1.00 0.00 ? 764 GLU A CA   2  
ATOM 2788  C C    . GLU A 1 57  ? -12.372 -13.032 -3.918  1.00 0.00 ? 764 GLU A C    2  
ATOM 2789  O O    . GLU A 1 57  ? -11.758 -12.128 -4.434  1.00 0.00 ? 764 GLU A O    2  
ATOM 2790  C CB   . GLU A 1 57  ? -14.520 -13.879 -4.805  1.00 0.00 ? 764 GLU A CB   2  
ATOM 2791  C CG   . GLU A 1 57  ? -15.343 -14.847 -5.658  1.00 0.00 ? 764 GLU A CG   2  
ATOM 2792  C CD   . GLU A 1 57  ? -15.300 -16.280 -5.179  1.00 0.00 ? 764 GLU A CD   2  
ATOM 2793  O OE1  . GLU A 1 57  ? -15.176 -16.518 -3.954  1.00 0.00 ? 764 GLU A OE1  2  
ATOM 2794  O OE2  . GLU A 1 57  ? -15.360 -17.198 -6.013  1.00 0.00 ? 764 GLU A OE2  2  
ATOM 2795  H H    . GLU A 1 57  ? -13.437 -16.020 -3.987  1.00 0.00 ? 764 GLU A H    2  
ATOM 2796  H HA   . GLU A 1 57  ? -12.603 -14.071 -5.768  1.00 0.00 ? 764 GLU A HA   2  
ATOM 2797  H HB2  . GLU A 1 57  ? -14.899 -13.942 -3.795  1.00 0.00 ? 764 GLU A HB2  2  
ATOM 2798  H HB3  . GLU A 1 57  ? -14.690 -12.875 -5.168  1.00 0.00 ? 764 GLU A HB3  2  
ATOM 2799  H HG2  . GLU A 1 57  ? -16.372 -14.521 -5.647  1.00 0.00 ? 764 GLU A HG2  2  
ATOM 2800  H HG3  . GLU A 1 57  ? -14.968 -14.805 -6.671  1.00 0.00 ? 764 GLU A HG3  2  
ATOM 2801  N N    . GLU A 1 58  ? -12.518 -13.164 -2.604  1.00 0.00 ? 765 GLU A N    2  
ATOM 2802  C CA   . GLU A 1 58  ? -11.981 -12.214 -1.656  1.00 0.00 ? 765 GLU A CA   2  
ATOM 2803  C C    . GLU A 1 58  ? -10.503 -12.145 -1.667  1.00 0.00 ? 765 GLU A C    2  
ATOM 2804  O O    . GLU A 1 58  ? -9.947  -11.060 -1.618  1.00 0.00 ? 765 GLU A O    2  
ATOM 2805  C CB   . GLU A 1 58  ? -12.451 -12.513 -0.274  1.00 0.00 ? 765 GLU A CB   2  
ATOM 2806  C CG   . GLU A 1 58  ? -13.781 -11.950 -0.005  1.00 0.00 ? 765 GLU A CG   2  
ATOM 2807  C CD   . GLU A 1 58  ? -13.747 -10.431 -0.056  1.00 0.00 ? 765 GLU A CD   2  
ATOM 2808  O OE1  . GLU A 1 58  ? -12.692 -9.835  0.260   1.00 0.00 ? 765 GLU A OE1  2  
ATOM 2809  O OE2  . GLU A 1 58  ? -14.778 -9.798  -0.382  1.00 0.00 ? 765 GLU A OE2  2  
ATOM 2810  H H    . GLU A 1 58  ? -13.002 -13.938 -2.253  1.00 0.00 ? 765 GLU A H    2  
ATOM 2811  H HA   . GLU A 1 58  ? -12.366 -11.242 -1.924  1.00 0.00 ? 765 GLU A HA   2  
ATOM 2812  H HB2  . GLU A 1 58  ? -12.487 -13.582 -0.129  1.00 0.00 ? 765 GLU A HB2  2  
ATOM 2813  H HB3  . GLU A 1 58  ? -11.755 -12.075 0.427   1.00 0.00 ? 765 GLU A HB3  2  
ATOM 2814  H HG2  . GLU A 1 58  ? -14.425 -12.339 -0.780  1.00 0.00 ? 765 GLU A HG2  2  
ATOM 2815  H HG3  . GLU A 1 58  ? -14.097 -12.300 0.965   1.00 0.00 ? 765 GLU A HG3  2  
ATOM 2816  N N    . LEU A 1 59  ? -9.870  -13.285 -1.714  1.00 0.00 ? 766 LEU A N    2  
ATOM 2817  C CA   . LEU A 1 59  ? -8.417  -13.330 -1.733  1.00 0.00 ? 766 LEU A CA   2  
ATOM 2818  C C    . LEU A 1 59  ? -7.905  -12.596 -2.966  1.00 0.00 ? 766 LEU A C    2  
ATOM 2819  O O    . LEU A 1 59  ? -7.044  -11.717 -2.869  1.00 0.00 ? 766 LEU A O    2  
ATOM 2820  C CB   . LEU A 1 59  ? -7.902  -14.770 -1.711  1.00 0.00 ? 766 LEU A CB   2  
ATOM 2821  C CG   . LEU A 1 59  ? -6.371  -14.922 -1.640  1.00 0.00 ? 766 LEU A CG   2  
ATOM 2822  C CD1  . LEU A 1 59  ? -5.812  -14.347 -0.338  1.00 0.00 ? 766 LEU A CD1  2  
ATOM 2823  C CD2  . LEU A 1 59  ? -5.966  -16.374 -1.807  1.00 0.00 ? 766 LEU A CD2  2  
ATOM 2824  H H    . LEU A 1 59  ? -10.420 -14.099 -1.733  1.00 0.00 ? 766 LEU A H    2  
ATOM 2825  H HA   . LEU A 1 59  ? -8.066  -12.807 -0.854  1.00 0.00 ? 766 LEU A HA   2  
ATOM 2826  H HB2  . LEU A 1 59  ? -8.351  -15.276 -0.870  1.00 0.00 ? 766 LEU A HB2  2  
ATOM 2827  H HB3  . LEU A 1 59  ? -8.247  -15.253 -2.613  1.00 0.00 ? 766 LEU A HB3  2  
ATOM 2828  H HG   . LEU A 1 59  ? -5.940  -14.351 -2.449  1.00 0.00 ? 766 LEU A HG   2  
ATOM 2829  H HD11 . LEU A 1 59  ? -4.742  -14.484 -0.315  1.00 0.00 ? 766 LEU A HD11 2  
ATOM 2830  H HD12 . LEU A 1 59  ? -6.253  -14.849 0.511   1.00 0.00 ? 766 LEU A HD12 2  
ATOM 2831  H HD13 . LEU A 1 59  ? -6.033  -13.290 -0.292  1.00 0.00 ? 766 LEU A HD13 2  
ATOM 2832  H HD21 . LEU A 1 59  ? -4.890  -16.448 -1.755  1.00 0.00 ? 766 LEU A HD21 2  
ATOM 2833  H HD22 . LEU A 1 59  ? -6.309  -16.734 -2.766  1.00 0.00 ? 766 LEU A HD22 2  
ATOM 2834  H HD23 . LEU A 1 59  ? -6.405  -16.965 -1.016  1.00 0.00 ? 766 LEU A HD23 2  
ATOM 2835  N N    . ILE A 1 60  ? -8.492  -12.925 -4.108  1.00 0.00 ? 767 ILE A N    2  
ATOM 2836  C CA   . ILE A 1 60  ? -8.159  -12.277 -5.370  1.00 0.00 ? 767 ILE A CA   2  
ATOM 2837  C C    . ILE A 1 60  ? -8.487  -10.779 -5.289  1.00 0.00 ? 767 ILE A C    2  
ATOM 2838  O O    . ILE A 1 60  ? -7.670  -9.938  -5.645  1.00 0.00 ? 767 ILE A O    2  
ATOM 2839  C CB   . ILE A 1 60  ? -8.938  -12.924 -6.550  1.00 0.00 ? 767 ILE A CB   2  
ATOM 2840  C CG1  . ILE A 1 60  ? -8.605  -14.421 -6.647  1.00 0.00 ? 767 ILE A CG1  2  
ATOM 2841  C CG2  . ILE A 1 60  ? -8.612  -12.217 -7.869  1.00 0.00 ? 767 ILE A CG2  2  
ATOM 2842  C CD1  . ILE A 1 60  ? -9.429  -15.170 -7.671  1.00 0.00 ? 767 ILE A CD1  2  
ATOM 2843  H H    . ILE A 1 60  ? -9.169  -13.639 -4.093  1.00 0.00 ? 767 ILE A H    2  
ATOM 2844  H HA   . ILE A 1 60  ? -7.099  -12.396 -5.538  1.00 0.00 ? 767 ILE A HA   2  
ATOM 2845  H HB   . ILE A 1 60  ? -9.996  -12.814 -6.360  1.00 0.00 ? 767 ILE A HB   2  
ATOM 2846  H HG12 . ILE A 1 60  ? -7.565  -14.535 -6.915  1.00 0.00 ? 767 ILE A HG12 2  
ATOM 2847  H HG13 . ILE A 1 60  ? -8.773  -14.878 -5.683  1.00 0.00 ? 767 ILE A HG13 2  
ATOM 2848  H HG21 . ILE A 1 60  ? -7.551  -12.292 -8.065  1.00 0.00 ? 767 ILE A HG21 2  
ATOM 2849  H HG22 . ILE A 1 60  ? -8.893  -11.177 -7.798  1.00 0.00 ? 767 ILE A HG22 2  
ATOM 2850  H HG23 . ILE A 1 60  ? -9.161  -12.687 -8.671  1.00 0.00 ? 767 ILE A HG23 2  
ATOM 2851  H HD11 . ILE A 1 60  ? -9.277  -14.733 -8.647  1.00 0.00 ? 767 ILE A HD11 2  
ATOM 2852  H HD12 . ILE A 1 60  ? -10.473 -15.108 -7.406  1.00 0.00 ? 767 ILE A HD12 2  
ATOM 2853  H HD13 . ILE A 1 60  ? -9.119  -16.205 -7.690  1.00 0.00 ? 767 ILE A HD13 2  
ATOM 2854  N N    . ASN A 1 61  ? -9.672  -10.472 -4.777  1.00 0.00 ? 768 ASN A N    2  
ATOM 2855  C CA   . ASN A 1 61  ? -10.145 -9.101  -4.609  1.00 0.00 ? 768 ASN A CA   2  
ATOM 2856  C C    . ASN A 1 61  ? -9.201  -8.268  -3.778  1.00 0.00 ? 768 ASN A C    2  
ATOM 2857  O O    . ASN A 1 61  ? -8.830  -7.183  -4.184  1.00 0.00 ? 768 ASN A O    2  
ATOM 2858  C CB   . ASN A 1 61  ? -11.564 -9.068  -4.005  1.00 0.00 ? 768 ASN A CB   2  
ATOM 2859  C CG   . ASN A 1 61  ? -11.905 -7.722  -3.396  1.00 0.00 ? 768 ASN A CG   2  
ATOM 2860  O OD1  . ASN A 1 61  ? -12.343 -6.810  -4.084  1.00 0.00 ? 768 ASN A OD1  2  
ATOM 2861  N ND2  . ASN A 1 61  ? -11.761 -7.621  -2.091  1.00 0.00 ? 768 ASN A ND2  2  
ATOM 2862  H H    . ASN A 1 61  ? -10.273 -11.200 -4.504  1.00 0.00 ? 768 ASN A H    2  
ATOM 2863  H HA   . ASN A 1 61  ? -10.193 -8.662  -5.594  1.00 0.00 ? 768 ASN A HA   2  
ATOM 2864  H HB2  . ASN A 1 61  ? -12.283 -9.281  -4.782  1.00 0.00 ? 768 ASN A HB2  2  
ATOM 2865  H HB3  . ASN A 1 61  ? -11.636 -9.822  -3.238  1.00 0.00 ? 768 ASN A HB3  2  
ATOM 2866  H HD21 . ASN A 1 61  ? -11.467 -8.409  -1.585  1.00 0.00 ? 768 ASN A HD21 2  
ATOM 2867  H HD22 . ASN A 1 61  ? -11.927 -6.750  -1.680  1.00 0.00 ? 768 ASN A HD22 2  
ATOM 2868  N N    . LYS A 1 62  ? -8.809  -8.788  -2.627  1.00 0.00 ? 769 LYS A N    2  
ATOM 2869  C CA   . LYS A 1 62  ? -7.902  -8.091  -1.739  1.00 0.00 ? 769 LYS A CA   2  
ATOM 2870  C C    . LYS A 1 62  ? -6.598  -7.787  -2.456  1.00 0.00 ? 769 LYS A C    2  
ATOM 2871  O O    . LYS A 1 62  ? -6.085  -6.690  -2.339  1.00 0.00 ? 769 LYS A O    2  
ATOM 2872  C CB   . LYS A 1 62  ? -7.652  -8.900  -0.472  1.00 0.00 ? 769 LYS A CB   2  
ATOM 2873  C CG   . LYS A 1 62  ? -8.836  -8.980  0.511   1.00 0.00 ? 769 LYS A CG   2  
ATOM 2874  C CD   . LYS A 1 62  ? -9.139  -7.632  1.165   1.00 0.00 ? 769 LYS A CD   2  
ATOM 2875  C CE   . LYS A 1 62  ? -10.110 -7.784  2.343   1.00 0.00 ? 769 LYS A CE   2  
ATOM 2876  N NZ   . LYS A 1 62  ? -11.469 -8.226  1.944   1.00 0.00 ? 769 LYS A NZ   2  
ATOM 2877  H H    . LYS A 1 62  ? -9.133  -9.683  -2.378  1.00 0.00 ? 769 LYS A H    2  
ATOM 2878  H HA   . LYS A 1 62  ? -8.373  -7.155  -1.467  1.00 0.00 ? 769 LYS A HA   2  
ATOM 2879  H HB2  . LYS A 1 62  ? -7.406  -9.911  -0.766  1.00 0.00 ? 769 LYS A HB2  2  
ATOM 2880  H HB3  . LYS A 1 62  ? -6.807  -8.474  0.049   1.00 0.00 ? 769 LYS A HB3  2  
ATOM 2881  H HG2  . LYS A 1 62  ? -9.715  -9.304  -0.025  1.00 0.00 ? 769 LYS A HG2  2  
ATOM 2882  H HG3  . LYS A 1 62  ? -8.613  -9.701  1.284   1.00 0.00 ? 769 LYS A HG3  2  
ATOM 2883  H HD2  . LYS A 1 62  ? -8.219  -7.192  1.526   1.00 0.00 ? 769 LYS A HD2  2  
ATOM 2884  H HD3  . LYS A 1 62  ? -9.581  -6.975  0.432   1.00 0.00 ? 769 LYS A HD3  2  
ATOM 2885  H HE2  . LYS A 1 62  ? -9.705  -8.511  3.032   1.00 0.00 ? 769 LYS A HE2  2  
ATOM 2886  H HE3  . LYS A 1 62  ? -10.184 -6.831  2.846   1.00 0.00 ? 769 LYS A HE3  2  
ATOM 2887  H HZ1  . LYS A 1 62  ? -11.520 -9.087  1.353   1.00 0.00 ? 769 LYS A HZ1  2  
ATOM 2888  H HZ2  . LYS A 1 62  ? -12.002 -7.489  1.443   1.00 0.00 ? 769 LYS A HZ2  2  
ATOM 2889  H HZ3  . LYS A 1 62  ? -12.019 -8.435  2.803   1.00 0.00 ? 769 LYS A HZ3  2  
ATOM 2890  N N    . LYS A 1 63  ? -6.104  -8.758  -3.238  1.00 0.00 ? 770 LYS A N    2  
ATOM 2891  C CA   . LYS A 1 63  ? -4.902  -8.576  -4.054  1.00 0.00 ? 770 LYS A CA   2  
ATOM 2892  C C    . LYS A 1 63  ? -5.090  -7.437  -5.066  1.00 0.00 ? 770 LYS A C    2  
ATOM 2893  O O    . LYS A 1 63  ? -4.221  -6.566  -5.208  1.00 0.00 ? 770 LYS A O    2  
ATOM 2894  C CB   . LYS A 1 63  ? -4.545  -9.864  -4.803  1.00 0.00 ? 770 LYS A CB   2  
ATOM 2895  C CG   . LYS A 1 63  ? -4.170  -11.038 -3.926  1.00 0.00 ? 770 LYS A CG   2  
ATOM 2896  C CD   . LYS A 1 63  ? -3.854  -12.283 -4.752  1.00 0.00 ? 770 LYS A CD   2  
ATOM 2897  C CE   . LYS A 1 63  ? -2.633  -12.076 -5.647  1.00 0.00 ? 770 LYS A CE   2  
ATOM 2898  N NZ   . LYS A 1 63  ? -2.284  -13.291 -6.403  1.00 0.00 ? 770 LYS A NZ   2  
ATOM 2899  H H    . LYS A 1 63  ? -6.552  -9.633  -3.255  1.00 0.00 ? 770 LYS A H    2  
ATOM 2900  H HA   . LYS A 1 63  ? -4.093  -8.320  -3.386  1.00 0.00 ? 770 LYS A HA   2  
ATOM 2901  H HB2  . LYS A 1 63  ? -5.406  -10.164 -5.381  1.00 0.00 ? 770 LYS A HB2  2  
ATOM 2902  H HB3  . LYS A 1 63  ? -3.725  -9.656  -5.471  1.00 0.00 ? 770 LYS A HB3  2  
ATOM 2903  H HG2  . LYS A 1 63  ? -3.295  -10.775 -3.351  1.00 0.00 ? 770 LYS A HG2  2  
ATOM 2904  H HG3  . LYS A 1 63  ? -4.994  -11.255 -3.263  1.00 0.00 ? 770 LYS A HG3  2  
ATOM 2905  H HD2  . LYS A 1 63  ? -3.674  -13.111 -4.085  1.00 0.00 ? 770 LYS A HD2  2  
ATOM 2906  H HD3  . LYS A 1 63  ? -4.709  -12.505 -5.372  1.00 0.00 ? 770 LYS A HD3  2  
ATOM 2907  H HE2  . LYS A 1 63  ? -2.847  -11.289 -6.353  1.00 0.00 ? 770 LYS A HE2  2  
ATOM 2908  H HE3  . LYS A 1 63  ? -1.796  -11.788 -5.028  1.00 0.00 ? 770 LYS A HE3  2  
ATOM 2909  H HZ1  . LYS A 1 63  ? -3.072  -13.614 -6.998  1.00 0.00 ? 770 LYS A HZ1  2  
ATOM 2910  H HZ2  . LYS A 1 63  ? -2.016  -14.060 -5.756  1.00 0.00 ? 770 LYS A HZ2  2  
ATOM 2911  H HZ3  . LYS A 1 63  ? -1.466  -13.100 -7.015  1.00 0.00 ? 770 LYS A HZ3  2  
ATOM 2912  N N    . ARG A 1 64  ? -6.230  -7.445  -5.744  1.00 0.00 ? 771 ARG A N    2  
ATOM 2913  C CA   . ARG A 1 64  ? -6.561  -6.421  -6.734  1.00 0.00 ? 771 ARG A CA   2  
ATOM 2914  C C    . ARG A 1 64  ? -6.628  -5.052  -6.065  1.00 0.00 ? 771 ARG A C    2  
ATOM 2915  O O    . ARG A 1 64  ? -6.066  -4.080  -6.555  1.00 0.00 ? 771 ARG A O    2  
ATOM 2916  C CB   . ARG A 1 64  ? -7.917  -6.716  -7.405  1.00 0.00 ? 771 ARG A CB   2  
ATOM 2917  C CG   . ARG A 1 64  ? -8.012  -8.074  -8.086  1.00 0.00 ? 771 ARG A CG   2  
ATOM 2918  C CD   . ARG A 1 64  ? -9.396  -8.318  -8.678  1.00 0.00 ? 771 ARG A CD   2  
ATOM 2919  N NE   . ARG A 1 64  ? -9.698  -7.423  -9.813  1.00 0.00 ? 771 ARG A NE   2  
ATOM 2920  C CZ   . ARG A 1 64  ? -10.902 -7.326  -10.418 1.00 0.00 ? 771 ARG A CZ   2  
ATOM 2921  N NH1  . ARG A 1 64  ? -11.952 -8.004  -9.950  1.00 0.00 ? 771 ARG A NH1  2  
ATOM 2922  N NH2  . ARG A 1 64  ? -11.051 -6.539  -11.480 1.00 0.00 ? 771 ARG A NH2  2  
ATOM 2923  H H    . ARG A 1 64  ? -6.866  -8.175  -5.568  1.00 0.00 ? 771 ARG A H    2  
ATOM 2924  H HA   . ARG A 1 64  ? -5.787  -6.414  -7.488  1.00 0.00 ? 771 ARG A HA   2  
ATOM 2925  H HB2  . ARG A 1 64  ? -8.689  -6.667  -6.652  1.00 0.00 ? 771 ARG A HB2  2  
ATOM 2926  H HB3  . ARG A 1 64  ? -8.109  -5.951  -8.143  1.00 0.00 ? 771 ARG A HB3  2  
ATOM 2927  H HG2  . ARG A 1 64  ? -7.282  -8.127  -8.879  1.00 0.00 ? 771 ARG A HG2  2  
ATOM 2928  H HG3  . ARG A 1 64  ? -7.803  -8.843  -7.357  1.00 0.00 ? 771 ARG A HG3  2  
ATOM 2929  H HD2  . ARG A 1 64  ? -9.460  -9.343  -9.015  1.00 0.00 ? 771 ARG A HD2  2  
ATOM 2930  H HD3  . ARG A 1 64  ? -10.134 -8.156  -7.905  1.00 0.00 ? 771 ARG A HD3  2  
ATOM 2931  H HE   . ARG A 1 64  ? -8.926  -6.906  -10.136 1.00 0.00 ? 771 ARG A HE   2  
ATOM 2932  H HH11 . ARG A 1 64  ? -11.884 -8.600  -9.145  1.00 0.00 ? 771 ARG A HH11 2  
ATOM 2933  H HH12 . ARG A 1 64  ? -12.855 -7.948  -10.385 1.00 0.00 ? 771 ARG A HH12 2  
ATOM 2934  H HH21 . ARG A 1 64  ? -10.287 -6.010  -11.861 1.00 0.00 ? 771 ARG A HH21 2  
ATOM 2935  H HH22 . ARG A 1 64  ? -11.931 -6.436  -11.953 1.00 0.00 ? 771 ARG A HH22 2  
ATOM 2936  N N    . ILE A 1 65  ? -7.293  -5.002  -4.930  1.00 0.00 ? 772 ILE A N    2  
ATOM 2937  C CA   . ILE A 1 65  ? -7.490  -3.772  -4.188  1.00 0.00 ? 772 ILE A CA   2  
ATOM 2938  C C    . ILE A 1 65  ? -6.183  -3.239  -3.605  1.00 0.00 ? 772 ILE A C    2  
ATOM 2939  O O    . ILE A 1 65  ? -5.900  -2.051  -3.726  1.00 0.00 ? 772 ILE A O    2  
ATOM 2940  C CB   . ILE A 1 65  ? -8.541  -3.938  -3.057  1.00 0.00 ? 772 ILE A CB   2  
ATOM 2941  C CG1  . ILE A 1 65  ? -9.909  -4.360  -3.628  1.00 0.00 ? 772 ILE A CG1  2  
ATOM 2942  C CG2  . ILE A 1 65  ? -8.682  -2.648  -2.244  1.00 0.00 ? 772 ILE A CG2  2  
ATOM 2943  C CD1  . ILE A 1 65  ? -10.556 -3.351  -4.560  1.00 0.00 ? 772 ILE A CD1  2  
ATOM 2944  H H    . ILE A 1 65  ? -7.679  -5.843  -4.591  1.00 0.00 ? 772 ILE A H    2  
ATOM 2945  H HA   . ILE A 1 65  ? -7.862  -3.037  -4.885  1.00 0.00 ? 772 ILE A HA   2  
ATOM 2946  H HB   . ILE A 1 65  ? -8.180  -4.721  -2.404  1.00 0.00 ? 772 ILE A HB   2  
ATOM 2947  H HG12 . ILE A 1 65  ? -9.784  -5.276  -4.187  1.00 0.00 ? 772 ILE A HG12 2  
ATOM 2948  H HG13 . ILE A 1 65  ? -10.588 -4.544  -2.810  1.00 0.00 ? 772 ILE A HG13 2  
ATOM 2949  H HG21 . ILE A 1 65  ? -9.414  -2.789  -1.461  1.00 0.00 ? 772 ILE A HG21 2  
ATOM 2950  H HG22 . ILE A 1 65  ? -8.999  -1.847  -2.896  1.00 0.00 ? 772 ILE A HG22 2  
ATOM 2951  H HG23 . ILE A 1 65  ? -7.726  -2.395  -1.806  1.00 0.00 ? 772 ILE A HG23 2  
ATOM 2952  H HD11 . ILE A 1 65  ? -11.516 -3.724  -4.884  1.00 0.00 ? 772 ILE A HD11 2  
ATOM 2953  H HD12 . ILE A 1 65  ? -9.924  -3.197  -5.421  1.00 0.00 ? 772 ILE A HD12 2  
ATOM 2954  H HD13 . ILE A 1 65  ? -10.690 -2.415  -4.038  1.00 0.00 ? 772 ILE A HD13 2  
ATOM 2955  N N    . ILE A 1 66  ? -5.384  -4.106  -3.002  1.00 0.00 ? 773 ILE A N    2  
ATOM 2956  C CA   . ILE A 1 66  ? -4.141  -3.676  -2.377  1.00 0.00 ? 773 ILE A CA   2  
ATOM 2957  C C    . ILE A 1 66  ? -3.203  -3.032  -3.408  1.00 0.00 ? 773 ILE A C    2  
ATOM 2958  O O    . ILE A 1 66  ? -2.673  -1.951  -3.168  1.00 0.00 ? 773 ILE A O    2  
ATOM 2959  C CB   . ILE A 1 66  ? -3.440  -4.822  -1.542  1.00 0.00 ? 773 ILE A CB   2  
ATOM 2960  C CG1  . ILE A 1 66  ? -2.184  -4.337  -0.813  1.00 0.00 ? 773 ILE A CG1  2  
ATOM 2961  C CG2  . ILE A 1 66  ? -3.087  -6.008  -2.397  1.00 0.00 ? 773 ILE A CG2  2  
ATOM 2962  C CD1  . ILE A 1 66  ? -2.410  -3.241  0.190   1.00 0.00 ? 773 ILE A CD1  2  
ATOM 2963  H H    . ILE A 1 66  ? -5.636  -5.058  -2.968  1.00 0.00 ? 773 ILE A H    2  
ATOM 2964  H HA   . ILE A 1 66  ? -4.427  -2.884  -1.700  1.00 0.00 ? 773 ILE A HA   2  
ATOM 2965  H HB   . ILE A 1 66  ? -4.152  -5.161  -0.804  1.00 0.00 ? 773 ILE A HB   2  
ATOM 2966  H HG12 . ILE A 1 66  ? -1.785  -5.177  -0.263  1.00 0.00 ? 773 ILE A HG12 2  
ATOM 2967  H HG13 . ILE A 1 66  ? -1.465  -3.992  -1.541  1.00 0.00 ? 773 ILE A HG13 2  
ATOM 2968  H HG21 . ILE A 1 66  ? -2.760  -6.825  -1.775  1.00 0.00 ? 773 ILE A HG21 2  
ATOM 2969  H HG22 . ILE A 1 66  ? -2.291  -5.733  -3.073  1.00 0.00 ? 773 ILE A HG22 2  
ATOM 2970  H HG23 . ILE A 1 66  ? -3.956  -6.307  -2.965  1.00 0.00 ? 773 ILE A HG23 2  
ATOM 2971  H HD11 . ILE A 1 66  ? -2.810  -2.376  -0.318  1.00 0.00 ? 773 ILE A HD11 2  
ATOM 2972  H HD12 . ILE A 1 66  ? -1.473  -2.985  0.665   1.00 0.00 ? 773 ILE A HD12 2  
ATOM 2973  H HD13 . ILE A 1 66  ? -3.116  -3.581  0.932   1.00 0.00 ? 773 ILE A HD13 2  
ATOM 2974  N N    . GLU A 1 67  ? -3.082  -3.636  -4.592  1.00 0.00 ? 774 GLU A N    2  
ATOM 2975  C CA   . GLU A 1 67  ? -2.231  -3.049  -5.617  1.00 0.00 ? 774 GLU A CA   2  
ATOM 2976  C C    . GLU A 1 67  ? -2.899  -1.816  -6.245  1.00 0.00 ? 774 GLU A C    2  
ATOM 2977  O O    . GLU A 1 67  ? -2.219  -0.896  -6.684  1.00 0.00 ? 774 GLU A O    2  
ATOM 2978  C CB   . GLU A 1 67  ? -1.814  -4.061  -6.695  1.00 0.00 ? 774 GLU A CB   2  
ATOM 2979  C CG   . GLU A 1 67  ? -2.963  -4.714  -7.432  1.00 0.00 ? 774 GLU A CG   2  
ATOM 2980  C CD   . GLU A 1 67  ? -2.505  -5.510  -8.612  1.00 0.00 ? 774 GLU A CD   2  
ATOM 2981  O OE1  . GLU A 1 67  ? -2.163  -6.695  -8.466  1.00 0.00 ? 774 GLU A OE1  2  
ATOM 2982  O OE2  . GLU A 1 67  ? -2.472  -4.954  -9.724  1.00 0.00 ? 774 GLU A OE2  2  
ATOM 2983  H H    . GLU A 1 67  ? -3.572  -4.473  -4.765  1.00 0.00 ? 774 GLU A H    2  
ATOM 2984  H HA   . GLU A 1 67  ? -1.347  -2.698  -5.102  1.00 0.00 ? 774 GLU A HA   2  
ATOM 2985  H HB2  . GLU A 1 67  ? -1.198  -3.558  -7.425  1.00 0.00 ? 774 GLU A HB2  2  
ATOM 2986  H HB3  . GLU A 1 67  ? -1.230  -4.838  -6.224  1.00 0.00 ? 774 GLU A HB3  2  
ATOM 2987  H HG2  . GLU A 1 67  ? -3.484  -5.375  -6.755  1.00 0.00 ? 774 GLU A HG2  2  
ATOM 2988  H HG3  . GLU A 1 67  ? -3.639  -3.944  -7.771  1.00 0.00 ? 774 GLU A HG3  2  
ATOM 2989  N N    . LYS A 1 68  ? -4.234  -1.812  -6.271  1.00 0.00 ? 775 LYS A N    2  
ATOM 2990  C CA   . LYS A 1 68  ? -5.019  -0.685  -6.785  1.00 0.00 ? 775 LYS A CA   2  
ATOM 2991  C C    . LYS A 1 68  ? -4.761  0.550   -5.943  1.00 0.00 ? 775 LYS A C    2  
ATOM 2992  O O    . LYS A 1 68  ? -4.516  1.639   -6.468  1.00 0.00 ? 775 LYS A O    2  
ATOM 2993  C CB   . LYS A 1 68  ? -6.512  -0.995  -6.710  1.00 0.00 ? 775 LYS A CB   2  
ATOM 2994  C CG   . LYS A 1 68  ? -7.414  0.131   -7.208  1.00 0.00 ? 775 LYS A CG   2  
ATOM 2995  C CD   . LYS A 1 68  ? -8.874  -0.101  -6.833  1.00 0.00 ? 775 LYS A CD   2  
ATOM 2996  C CE   . LYS A 1 68  ? -9.410  -1.412  -7.383  1.00 0.00 ? 775 LYS A CE   2  
ATOM 2997  N NZ   . LYS A 1 68  ? -9.386  -1.453  -8.849  1.00 0.00 ? 775 LYS A NZ   2  
ATOM 2998  H H    . LYS A 1 68  ? -4.708  -2.608  -5.940  1.00 0.00 ? 775 LYS A H    2  
ATOM 2999  H HA   . LYS A 1 68  ? -4.746  -0.500  -7.814  1.00 0.00 ? 775 LYS A HA   2  
ATOM 3000  H HB2  . LYS A 1 68  ? -6.710  -1.875  -7.304  1.00 0.00 ? 775 LYS A HB2  2  
ATOM 3001  H HB3  . LYS A 1 68  ? -6.764  -1.200  -5.679  1.00 0.00 ? 775 LYS A HB3  2  
ATOM 3002  H HG2  . LYS A 1 68  ? -7.083  1.062   -6.772  1.00 0.00 ? 775 LYS A HG2  2  
ATOM 3003  H HG3  . LYS A 1 68  ? -7.330  0.190   -8.283  1.00 0.00 ? 775 LYS A HG3  2  
ATOM 3004  H HD2  . LYS A 1 68  ? -8.962  -0.114  -5.757  1.00 0.00 ? 775 LYS A HD2  2  
ATOM 3005  H HD3  . LYS A 1 68  ? -9.467  0.710   -7.228  1.00 0.00 ? 775 LYS A HD3  2  
ATOM 3006  H HE2  . LYS A 1 68  ? -8.807  -2.225  -7.006  1.00 0.00 ? 775 LYS A HE2  2  
ATOM 3007  H HE3  . LYS A 1 68  ? -10.428 -1.538  -7.044  1.00 0.00 ? 775 LYS A HE3  2  
ATOM 3008  H HZ1  . LYS A 1 68  ? -9.755  -2.370  -9.172  1.00 0.00 ? 775 LYS A HZ1  2  
ATOM 3009  H HZ2  . LYS A 1 68  ? -8.418  -1.378  -9.219  1.00 0.00 ? 775 LYS A HZ2  2  
ATOM 3010  H HZ3  . LYS A 1 68  ? -9.976  -0.702  -9.263  1.00 0.00 ? 775 LYS A HZ3  2  
ATOM 3011  N N    . VAL A 1 69  ? -4.844  0.373   -4.638  1.00 0.00 ? 776 VAL A N    2  
ATOM 3012  C CA   . VAL A 1 69  ? -4.630  1.454   -3.710  1.00 0.00 ? 776 VAL A CA   2  
ATOM 3013  C C    . VAL A 1 69  ? -3.208  1.937   -3.793  1.00 0.00 ? 776 VAL A C    2  
ATOM 3014  O O    . VAL A 1 69  ? -2.996  3.121   -3.944  1.00 0.00 ? 776 VAL A O    2  
ATOM 3015  C CB   . VAL A 1 69  ? -4.997  1.066   -2.261  1.00 0.00 ? 776 VAL A CB   2  
ATOM 3016  C CG1  . VAL A 1 69  ? -4.685  2.200   -1.284  1.00 0.00 ? 776 VAL A CG1  2  
ATOM 3017  C CG2  . VAL A 1 69  ? -6.470  0.697   -2.177  1.00 0.00 ? 776 VAL A CG2  2  
ATOM 3018  H H    . VAL A 1 69  ? -5.057  -0.525  -4.294  1.00 0.00 ? 776 VAL A H    2  
ATOM 3019  H HA   . VAL A 1 69  ? -5.274  2.264   -4.023  1.00 0.00 ? 776 VAL A HA   2  
ATOM 3020  H HB   . VAL A 1 69  ? -4.413  0.197   -2.005  1.00 0.00 ? 776 VAL A HB   2  
ATOM 3021  H HG11 . VAL A 1 69  ? -4.949  1.895   -0.282  1.00 0.00 ? 776 VAL A HG11 2  
ATOM 3022  H HG12 . VAL A 1 69  ? -5.255  3.076   -1.555  1.00 0.00 ? 776 VAL A HG12 2  
ATOM 3023  H HG13 . VAL A 1 69  ? -3.631  2.430   -1.326  1.00 0.00 ? 776 VAL A HG13 2  
ATOM 3024  H HG21 . VAL A 1 69  ? -6.670  -0.139  -2.831  1.00 0.00 ? 776 VAL A HG21 2  
ATOM 3025  H HG22 . VAL A 1 69  ? -7.070  1.543   -2.477  1.00 0.00 ? 776 VAL A HG22 2  
ATOM 3026  H HG23 . VAL A 1 69  ? -6.717  0.424   -1.161  1.00 0.00 ? 776 VAL A HG23 2  
ATOM 3027  N N    . ILE A 1 70  ? -2.238  1.001   -3.755  1.00 0.00 ? 777 ILE A N    2  
ATOM 3028  C CA   . ILE A 1 70  ? -0.814  1.352   -3.887  1.00 0.00 ? 777 ILE A CA   2  
ATOM 3029  C C    . ILE A 1 70  ? -0.590  2.174   -5.176  1.00 0.00 ? 777 ILE A C    2  
ATOM 3030  O O    . ILE A 1 70  ? 0.117   3.183   -5.165  1.00 0.00 ? 777 ILE A O    2  
ATOM 3031  C CB   . ILE A 1 70  ? 0.121   0.080   -3.861  1.00 0.00 ? 777 ILE A CB   2  
ATOM 3032  C CG1  . ILE A 1 70  ? 0.034   -0.635  -2.484  1.00 0.00 ? 777 ILE A CG1  2  
ATOM 3033  C CG2  . ILE A 1 70  ? 1.574   0.457   -4.173  1.00 0.00 ? 777 ILE A CG2  2  
ATOM 3034  C CD1  . ILE A 1 70  ? 0.832   -1.942  -2.385  1.00 0.00 ? 777 ILE A CD1  2  
ATOM 3035  H H    . ILE A 1 70  ? -2.488  0.060   -3.625  1.00 0.00 ? 777 ILE A H    2  
ATOM 3036  H HA   . ILE A 1 70  ? -0.574  1.989   -3.047  1.00 0.00 ? 777 ILE A HA   2  
ATOM 3037  H HB   . ILE A 1 70  ? -0.222  -0.599  -4.628  1.00 0.00 ? 777 ILE A HB   2  
ATOM 3038  H HG12 . ILE A 1 70  ? 0.405   0.031   -1.721  1.00 0.00 ? 777 ILE A HG12 2  
ATOM 3039  H HG13 . ILE A 1 70  ? -1.003  -0.859  -2.277  1.00 0.00 ? 777 ILE A HG13 2  
ATOM 3040  H HG21 . ILE A 1 70  ? 1.929   1.164   -3.438  1.00 0.00 ? 777 ILE A HG21 2  
ATOM 3041  H HG22 . ILE A 1 70  ? 1.625   0.903   -5.156  1.00 0.00 ? 777 ILE A HG22 2  
ATOM 3042  H HG23 . ILE A 1 70  ? 2.187   -0.433  -4.147  1.00 0.00 ? 777 ILE A HG23 2  
ATOM 3043  H HD11 . ILE A 1 70  ? 1.875   -1.752  -2.586  1.00 0.00 ? 777 ILE A HD11 2  
ATOM 3044  H HD12 . ILE A 1 70  ? 0.456   -2.661  -3.099  1.00 0.00 ? 777 ILE A HD12 2  
ATOM 3045  H HD13 . ILE A 1 70  ? 0.739   -2.378  -1.399  1.00 0.00 ? 777 ILE A HD13 2  
ATOM 3046  N N    . HIS A 1 71  ? -1.256  1.763   -6.253  1.00 0.00 ? 778 HIS A N    2  
ATOM 3047  C CA   . HIS A 1 71  ? -1.201  2.471   -7.524  1.00 0.00 ? 778 HIS A CA   2  
ATOM 3048  C C    . HIS A 1 71  ? -1.799  3.885   -7.414  1.00 0.00 ? 778 HIS A C    2  
ATOM 3049  O O    . HIS A 1 71  ? -1.125  4.860   -7.711  1.00 0.00 ? 778 HIS A O    2  
ATOM 3050  C CB   . HIS A 1 71  ? -1.919  1.641   -8.622  1.00 0.00 ? 778 HIS A CB   2  
ATOM 3051  C CG   . HIS A 1 71  ? -2.155  2.354   -9.934  1.00 0.00 ? 778 HIS A CG   2  
ATOM 3052  N ND1  . HIS A 1 71  ? -1.171  2.671   -10.841 1.00 0.00 ? 778 HIS A ND1  2  
ATOM 3053  C CD2  . HIS A 1 71  ? -3.315  2.820   -10.466 1.00 0.00 ? 778 HIS A CD2  2  
ATOM 3054  C CE1  . HIS A 1 71  ? -1.745  3.307   -11.868 1.00 0.00 ? 778 HIS A CE1  2  
ATOM 3055  N NE2  . HIS A 1 71  ? -3.051  3.422   -11.690 1.00 0.00 ? 778 HIS A NE2  2  
ATOM 3056  H H    . HIS A 1 71  ? -1.794  0.943   -6.196  1.00 0.00 ? 778 HIS A H    2  
ATOM 3057  H HA   . HIS A 1 71  ? -0.159  2.564   -7.795  1.00 0.00 ? 778 HIS A HA   2  
ATOM 3058  H HB2  . HIS A 1 71  ? -1.331  0.762   -8.836  1.00 0.00 ? 778 HIS A HB2  2  
ATOM 3059  H HB3  . HIS A 1 71  ? -2.878  1.326   -8.238  1.00 0.00 ? 778 HIS A HB3  2  
ATOM 3060  H HD1  . HIS A 1 71  ? -0.209  2.484   -10.750 1.00 0.00 ? 778 HIS A HD1  2  
ATOM 3061  H HD2  . HIS A 1 71  ? -4.293  2.745   -10.016 1.00 0.00 ? 778 HIS A HD2  2  
ATOM 3062  H HE1  . HIS A 1 71  ? -1.218  3.689   -12.730 1.00 0.00 ? 778 HIS A HE1  2  
ATOM 3063  N N    . ARG A 1 72  ? -3.030  3.991   -6.920  1.00 0.00 ? 779 ARG A N    2  
ATOM 3064  C CA   . ARG A 1 72  ? -3.726  5.286   -6.853  1.00 0.00 ? 779 ARG A CA   2  
ATOM 3065  C C    . ARG A 1 72  ? -2.958  6.258   -5.943  1.00 0.00 ? 779 ARG A C    2  
ATOM 3066  O O    . ARG A 1 72  ? -2.745  7.444   -6.285  1.00 0.00 ? 779 ARG A O    2  
ATOM 3067  C CB   . ARG A 1 72  ? -5.171  5.084   -6.365  1.00 0.00 ? 779 ARG A CB   2  
ATOM 3068  C CG   . ARG A 1 72  ? -6.019  6.351   -6.346  1.00 0.00 ? 779 ARG A CG   2  
ATOM 3069  C CD   . ARG A 1 72  ? -7.446  6.065   -5.888  1.00 0.00 ? 779 ARG A CD   2  
ATOM 3070  N NE   . ARG A 1 72  ? -8.153  5.118   -6.784  1.00 0.00 ? 779 ARG A NE   2  
ATOM 3071  C CZ   . ARG A 1 72  ? -9.441  4.742   -6.653  1.00 0.00 ? 779 ARG A CZ   2  
ATOM 3072  N NH1  . ARG A 1 72  ? -10.188 5.202   -5.650  1.00 0.00 ? 779 ARG A NH1  2  
ATOM 3073  N NH2  . ARG A 1 72  ? -9.980  3.916   -7.541  1.00 0.00 ? 779 ARG A NH2  2  
ATOM 3074  H H    . ARG A 1 72  ? -3.479  3.180   -6.586  1.00 0.00 ? 779 ARG A H    2  
ATOM 3075  H HA   . ARG A 1 72  ? -3.739  5.689   -7.855  1.00 0.00 ? 779 ARG A HA   2  
ATOM 3076  H HB2  . ARG A 1 72  ? -5.654  4.367   -7.011  1.00 0.00 ? 779 ARG A HB2  2  
ATOM 3077  H HB3  . ARG A 1 72  ? -5.140  4.681   -5.363  1.00 0.00 ? 779 ARG A HB3  2  
ATOM 3078  H HG2  . ARG A 1 72  ? -5.566  7.061   -5.671  1.00 0.00 ? 779 ARG A HG2  2  
ATOM 3079  H HG3  . ARG A 1 72  ? -6.044  6.762   -7.344  1.00 0.00 ? 779 ARG A HG3  2  
ATOM 3080  H HD2  . ARG A 1 72  ? -7.418  5.649   -4.892  1.00 0.00 ? 779 ARG A HD2  2  
ATOM 3081  H HD3  . ARG A 1 72  ? -7.993  6.996   -5.870  1.00 0.00 ? 779 ARG A HD3  2  
ATOM 3082  H HE   . ARG A 1 72  ? -7.622  4.764   -7.533  1.00 0.00 ? 779 ARG A HE   2  
ATOM 3083  H HH11 . ARG A 1 72  ? -9.816  5.838   -4.967  1.00 0.00 ? 779 ARG A HH11 2  
ATOM 3084  H HH12 . ARG A 1 72  ? -11.149 4.933   -5.551  1.00 0.00 ? 779 ARG A HH12 2  
ATOM 3085  H HH21 . ARG A 1 72  ? -9.449  3.564   -8.317  1.00 0.00 ? 779 ARG A HH21 2  
ATOM 3086  H HH22 . ARG A 1 72  ? -10.936 3.614   -7.481  1.00 0.00 ? 779 ARG A HH22 2  
ATOM 3087  N N    . LEU A 1 73  ? -2.488  5.698   -4.854  1.00 0.00 ? 780 LEU A N    2  
ATOM 3088  C CA   . LEU A 1 73  ? -1.717  6.335   -3.807  1.00 0.00 ? 780 LEU A CA   2  
ATOM 3089  C C    . LEU A 1 73  ? -0.534  7.141   -4.365  1.00 0.00 ? 780 LEU A C    2  
ATOM 3090  O O    . LEU A 1 73  ? -0.369  8.335   -4.067  1.00 0.00 ? 780 LEU A O    2  
ATOM 3091  C CB   . LEU A 1 73  ? -1.169  5.202   -2.964  1.00 0.00 ? 780 LEU A CB   2  
ATOM 3092  C CG   . LEU A 1 73  ? -0.527  5.522   -1.657  1.00 0.00 ? 780 LEU A CG   2  
ATOM 3093  C CD1  . LEU A 1 73  ? -1.563  6.031   -0.719  1.00 0.00 ? 780 LEU A CD1  2  
ATOM 3094  C CD2  . LEU A 1 73  ? 0.110   4.279   -1.109  1.00 0.00 ? 780 LEU A CD2  2  
ATOM 3095  H H    . LEU A 1 73  ? -2.685  4.743   -4.706  1.00 0.00 ? 780 LEU A H    2  
ATOM 3096  H HA   . LEU A 1 73  ? -2.353  6.936   -3.178  1.00 0.00 ? 780 LEU A HA   2  
ATOM 3097  H HB2  . LEU A 1 73  ? -1.983  4.521   -2.765  1.00 0.00 ? 780 LEU A HB2  2  
ATOM 3098  H HB3  . LEU A 1 73  ? -0.448  4.678   -3.575  1.00 0.00 ? 780 LEU A HB3  2  
ATOM 3099  H HG   . LEU A 1 73  ? 0.237   6.272   -1.787  1.00 0.00 ? 780 LEU A HG   2  
ATOM 3100  H HD11 . LEU A 1 73  ? -1.117  6.236   0.242   1.00 0.00 ? 780 LEU A HD11 2  
ATOM 3101  H HD12 . LEU A 1 73  ? -2.328  5.276   -0.636  1.00 0.00 ? 780 LEU A HD12 2  
ATOM 3102  H HD13 . LEU A 1 73  ? -1.972  6.942   -1.132  1.00 0.00 ? 780 LEU A HD13 2  
ATOM 3103  H HD21 . LEU A 1 73  ? 0.669   4.521   -0.218  1.00 0.00 ? 780 LEU A HD21 2  
ATOM 3104  H HD22 . LEU A 1 73  ? 0.761   3.878   -1.873  1.00 0.00 ? 780 LEU A HD22 2  
ATOM 3105  H HD23 . LEU A 1 73  ? -0.665  3.563   -0.880  1.00 0.00 ? 780 LEU A HD23 2  
ATOM 3106  N N    . THR A 1 74  ? 0.273   6.491   -5.167  1.00 0.00 ? 781 THR A N    2  
ATOM 3107  C CA   . THR A 1 74  ? 1.474   7.100   -5.679  1.00 0.00 ? 781 THR A CA   2  
ATOM 3108  C C    . THR A 1 74  ? 1.233   7.793   -7.024  1.00 0.00 ? 781 THR A C    2  
ATOM 3109  O O    . THR A 1 74  ? 1.995   8.683   -7.419  1.00 0.00 ? 781 THR A O    2  
ATOM 3110  C CB   . THR A 1 74  ? 2.625   6.042   -5.795  1.00 0.00 ? 781 THR A CB   2  
ATOM 3111  O OG1  . THR A 1 74  ? 3.844   6.641   -6.258  1.00 0.00 ? 781 THR A OG1  2  
ATOM 3112  C CG2  . THR A 1 74  ? 2.249   4.890   -6.717  1.00 0.00 ? 781 THR A CG2  2  
ATOM 3113  H H    . THR A 1 74  ? 0.060   5.565   -5.419  1.00 0.00 ? 781 THR A H    2  
ATOM 3114  H HA   . THR A 1 74  ? 1.784   7.849   -4.966  1.00 0.00 ? 781 THR A HA   2  
ATOM 3115  H HB   . THR A 1 74  ? 2.786   5.648   -4.803  1.00 0.00 ? 781 THR A HB   2  
ATOM 3116  H HG1  . THR A 1 74  ? 3.763   6.708   -7.219  1.00 0.00 ? 781 THR A HG1  2  
ATOM 3117  H HG21 . THR A 1 74  ? 3.081   4.207   -6.802  1.00 0.00 ? 781 THR A HG21 2  
ATOM 3118  H HG22 . THR A 1 74  ? 1.977   5.270   -7.690  1.00 0.00 ? 781 THR A HG22 2  
ATOM 3119  H HG23 . THR A 1 74  ? 1.407   4.369   -6.283  1.00 0.00 ? 781 THR A HG23 2  
ATOM 3120  N N    . HIS A 1 75  ? 0.154   7.446   -7.684  1.00 0.00 ? 782 HIS A N    2  
ATOM 3121  C CA   . HIS A 1 75  ? -0.063  7.951   -9.038  1.00 0.00 ? 782 HIS A CA   2  
ATOM 3122  C C    . HIS A 1 75  ? -0.783  9.276   -9.021  1.00 0.00 ? 782 HIS A C    2  
ATOM 3123  O O    . HIS A 1 75  ? -0.301  10.255  -9.567  1.00 0.00 ? 782 HIS A O    2  
ATOM 3124  C CB   . HIS A 1 75  ? -0.846  6.943   -9.909  1.00 0.00 ? 782 HIS A CB   2  
ATOM 3125  C CG   . HIS A 1 75  ? -0.950  7.299   -11.385 1.00 0.00 ? 782 HIS A CG   2  
ATOM 3126  N ND1  . HIS A 1 75  ? -1.637  8.397   -11.886 1.00 0.00 ? 782 HIS A ND1  2  
ATOM 3127  C CD2  . HIS A 1 75  ? -0.438  6.665   -12.468 1.00 0.00 ? 782 HIS A CD2  2  
ATOM 3128  C CE1  . HIS A 1 75  ? -1.525  8.386   -13.213 1.00 0.00 ? 782 HIS A CE1  2  
ATOM 3129  N NE2  . HIS A 1 75  ? -0.806  7.356   -13.623 1.00 0.00 ? 782 HIS A NE2  2  
ATOM 3130  H H    . HIS A 1 75  ? -0.495  6.856   -7.237  1.00 0.00 ? 782 HIS A H    2  
ATOM 3131  H HA   . HIS A 1 75  ? 0.911   8.098   -9.479  1.00 0.00 ? 782 HIS A HA   2  
ATOM 3132  H HB2  . HIS A 1 75  ? -0.368  5.976   -9.843  1.00 0.00 ? 782 HIS A HB2  2  
ATOM 3133  H HB3  . HIS A 1 75  ? -1.849  6.857   -9.516  1.00 0.00 ? 782 HIS A HB3  2  
ATOM 3134  H HD1  . HIS A 1 75  ? -2.085  9.102   -11.371 1.00 0.00 ? 782 HIS A HD1  2  
ATOM 3135  H HD2  . HIS A 1 75  ? 0.160   5.766   -12.452 1.00 0.00 ? 782 HIS A HD2  2  
ATOM 3136  H HE1  . HIS A 1 75  ? -1.971  9.118   -13.871 1.00 0.00 ? 782 HIS A HE1  2  
ATOM 3137  N N    . TYR A 1 76  ? -1.938  9.299   -8.411  1.00 0.00 ? 783 TYR A N    2  
ATOM 3138  C CA   . TYR A 1 76  ? -2.777  10.477  -8.456  1.00 0.00 ? 783 TYR A CA   2  
ATOM 3139  C C    . TYR A 1 76  ? -2.626  11.306  -7.213  1.00 0.00 ? 783 TYR A C    2  
ATOM 3140  O O    . TYR A 1 76  ? -2.674  12.530  -7.256  1.00 0.00 ? 783 TYR A O    2  
ATOM 3141  C CB   . TYR A 1 76  ? -4.253  10.082  -8.590  1.00 0.00 ? 783 TYR A CB   2  
ATOM 3142  C CG   . TYR A 1 76  ? -4.592  9.248   -9.802  1.00 0.00 ? 783 TYR A CG   2  
ATOM 3143  C CD1  . TYR A 1 76  ? -4.917  9.847   -11.009 1.00 0.00 ? 783 TYR A CD1  2  
ATOM 3144  C CD2  . TYR A 1 76  ? -4.608  7.862   -9.730  1.00 0.00 ? 783 TYR A CD2  2  
ATOM 3145  C CE1  . TYR A 1 76  ? -5.248  9.087   -12.110 1.00 0.00 ? 783 TYR A CE1  2  
ATOM 3146  C CE2  . TYR A 1 76  ? -4.932  7.095   -10.828 1.00 0.00 ? 783 TYR A CE2  2  
ATOM 3147  C CZ   . TYR A 1 76  ? -5.253  7.713   -12.013 1.00 0.00 ? 783 TYR A CZ   2  
ATOM 3148  O OH   . TYR A 1 76  ? -5.587  6.957   -13.105 1.00 0.00 ? 783 TYR A OH   2  
ATOM 3149  H H    . TYR A 1 76  ? -2.235  8.512   -7.902  1.00 0.00 ? 783 TYR A H    2  
ATOM 3150  H HA   . TYR A 1 76  ? -2.508  11.062  -9.323  1.00 0.00 ? 783 TYR A HA   2  
ATOM 3151  H HB2  . TYR A 1 76  ? -4.540  9.512   -7.719  1.00 0.00 ? 783 TYR A HB2  2  
ATOM 3152  H HB3  . TYR A 1 76  ? -4.851  10.981  -8.625  1.00 0.00 ? 783 TYR A HB3  2  
ATOM 3153  H HD1  . TYR A 1 76  ? -4.906  10.924  -11.080 1.00 0.00 ? 783 TYR A HD1  2  
ATOM 3154  H HD2  . TYR A 1 76  ? -4.356  7.386   -8.794  1.00 0.00 ? 783 TYR A HD2  2  
ATOM 3155  H HE1  . TYR A 1 76  ? -5.497  9.567   -13.045 1.00 0.00 ? 783 TYR A HE1  2  
ATOM 3156  H HE2  . TYR A 1 76  ? -4.934  6.017   -10.758 1.00 0.00 ? 783 TYR A HE2  2  
ATOM 3157  H HH   . TYR A 1 76  ? -5.109  7.315   -13.865 1.00 0.00 ? 783 TYR A HH   2  
ATOM 3158  N N    . ASP A 1 77  ? -2.455  10.650  -6.107  1.00 0.00 ? 784 ASP A N    2  
ATOM 3159  C CA   . ASP A 1 77  ? -2.478  11.338  -4.841  1.00 0.00 ? 784 ASP A CA   2  
ATOM 3160  C C    . ASP A 1 77  ? -1.160  11.847  -4.365  1.00 0.00 ? 784 ASP A C    2  
ATOM 3161  O O    . ASP A 1 77  ? -1.119  12.829  -3.613  1.00 0.00 ? 784 ASP A O    2  
ATOM 3162  C CB   . ASP A 1 77  ? -3.207  10.531  -3.799  1.00 0.00 ? 784 ASP A CB   2  
ATOM 3163  C CG   . ASP A 1 77  ? -4.686  10.551  -4.077  1.00 0.00 ? 784 ASP A CG   2  
ATOM 3164  O OD1  . ASP A 1 77  ? -5.328  11.599  -3.819  1.00 0.00 ? 784 ASP A OD1  2  
ATOM 3165  O OD2  . ASP A 1 77  ? -5.228  9.572   -4.602  1.00 0.00 ? 784 ASP A OD2  2  
ATOM 3166  H H    . ASP A 1 77  ? -2.345  9.675   -6.134  1.00 0.00 ? 784 ASP A H    2  
ATOM 3167  H HA   . ASP A 1 77  ? -3.075  12.221  -5.016  1.00 0.00 ? 784 ASP A HA   2  
ATOM 3168  H HB2  . ASP A 1 77  ? -2.849  9.511   -3.865  1.00 0.00 ? 784 ASP A HB2  2  
ATOM 3169  H HB3  . ASP A 1 77  ? -3.021  10.931  -2.814  1.00 0.00 ? 784 ASP A HB3  2  
ATOM 3170  N N    . HIS A 1 78  ? -0.083  11.183  -4.770  1.00 0.00 ? 785 HIS A N    2  
ATOM 3171  C CA   . HIS A 1 78  ? 1.296   11.606  -4.439  1.00 0.00 ? 785 HIS A CA   2  
ATOM 3172  C C    . HIS A 1 78  ? 1.565   11.608  -2.936  1.00 0.00 ? 785 HIS A C    2  
ATOM 3173  O O    . HIS A 1 78  ? 2.536   12.200  -2.470  1.00 0.00 ? 785 HIS A O    2  
ATOM 3174  C CB   . HIS A 1 78  ? 1.630   12.987  -5.034  1.00 0.00 ? 785 HIS A CB   2  
ATOM 3175  C CG   . HIS A 1 78  ? 1.769   13.014  -6.524  1.00 0.00 ? 785 HIS A CG   2  
ATOM 3176  N ND1  . HIS A 1 78  ? 2.962   13.220  -7.177  1.00 0.00 ? 785 HIS A ND1  2  
ATOM 3177  C CD2  . HIS A 1 78  ? 0.832   12.888  -7.494  1.00 0.00 ? 785 HIS A CD2  2  
ATOM 3178  C CE1  . HIS A 1 78  ? 2.726   13.212  -8.479  1.00 0.00 ? 785 HIS A CE1  2  
ATOM 3179  N NE2  . HIS A 1 78  ? 1.443   13.016  -8.732  1.00 0.00 ? 785 HIS A NE2  2  
ATOM 3180  H H    . HIS A 1 78  ? -0.216  10.371  -5.302  1.00 0.00 ? 785 HIS A H    2  
ATOM 3181  H HA   . HIS A 1 78  ? 1.958   10.878  -4.887  1.00 0.00 ? 785 HIS A HA   2  
ATOM 3182  H HB2  . HIS A 1 78  ? 0.841   13.676  -4.773  1.00 0.00 ? 785 HIS A HB2  2  
ATOM 3183  H HB3  . HIS A 1 78  ? 2.555   13.334  -4.601  1.00 0.00 ? 785 HIS A HB3  2  
ATOM 3184  H HD1  . HIS A 1 78  ? 3.845   13.372  -6.769  1.00 0.00 ? 785 HIS A HD1  2  
ATOM 3185  H HD2  . HIS A 1 78  ? -0.224  12.717  -7.339  1.00 0.00 ? 785 HIS A HD2  2  
ATOM 3186  H HE1  . HIS A 1 78  ? 3.483   13.345  -9.238  1.00 0.00 ? 785 HIS A HE1  2  
ATOM 3187  N N    . VAL A 1 79  ? 0.747   10.899  -2.187  1.00 0.00 ? 786 VAL A N    2  
ATOM 3188  C CA   . VAL A 1 79  ? 0.939   10.818  -0.750  1.00 0.00 ? 786 VAL A CA   2  
ATOM 3189  C C    . VAL A 1 79  ? 2.002   9.738   -0.456  1.00 0.00 ? 786 VAL A C    2  
ATOM 3190  O O    . VAL A 1 79  ? 2.465   9.560   0.673   1.00 0.00 ? 786 VAL A O    2  
ATOM 3191  C CB   . VAL A 1 79  ? -0.415  10.581  0.003   1.00 0.00 ? 786 VAL A CB   2  
ATOM 3192  C CG1  . VAL A 1 79  ? -1.057  9.274   -0.372  1.00 0.00 ? 786 VAL A CG1  2  
ATOM 3193  C CG2  . VAL A 1 79  ? -0.275  10.722  1.514   1.00 0.00 ? 786 VAL A CG2  2  
ATOM 3194  H H    . VAL A 1 79  ? 0.003   10.429  -2.619  1.00 0.00 ? 786 VAL A H    2  
ATOM 3195  H HA   . VAL A 1 79  ? 1.360   11.769  -0.453  1.00 0.00 ? 786 VAL A HA   2  
ATOM 3196  H HB   . VAL A 1 79  ? -1.091  11.351  -0.340  1.00 0.00 ? 786 VAL A HB   2  
ATOM 3197  H HG11 . VAL A 1 79  ? -1.272  9.261   -1.430  1.00 0.00 ? 786 VAL A HG11 2  
ATOM 3198  H HG12 . VAL A 1 79  ? -1.973  9.127   0.183   1.00 0.00 ? 786 VAL A HG12 2  
ATOM 3199  H HG13 . VAL A 1 79  ? -0.381  8.464   -0.142  1.00 0.00 ? 786 VAL A HG13 2  
ATOM 3200  H HG21 . VAL A 1 79  ? 0.445   10.000  1.873   1.00 0.00 ? 786 VAL A HG21 2  
ATOM 3201  H HG22 . VAL A 1 79  ? -1.230  10.536  1.982   1.00 0.00 ? 786 VAL A HG22 2  
ATOM 3202  H HG23 . VAL A 1 79  ? 0.060   11.718  1.763   1.00 0.00 ? 786 VAL A HG23 2  
ATOM 3203  N N    . LEU A 1 80  ? 2.368   9.025   -1.512  1.00 0.00 ? 787 LEU A N    2  
ATOM 3204  C CA   . LEU A 1 80  ? 3.465   8.102   -1.484  1.00 0.00 ? 787 LEU A CA   2  
ATOM 3205  C C    . LEU A 1 80  ? 4.651   8.737   -2.219  1.00 0.00 ? 787 LEU A C    2  
ATOM 3206  O O    . LEU A 1 80  ? 4.482   9.415   -3.247  1.00 0.00 ? 787 LEU A O    2  
ATOM 3207  C CB   . LEU A 1 80  ? 3.049   6.732   -2.085  1.00 0.00 ? 787 LEU A CB   2  
ATOM 3208  C CG   . LEU A 1 80  ? 4.086   5.578   -2.071  1.00 0.00 ? 787 LEU A CG   2  
ATOM 3209  C CD1  . LEU A 1 80  ? 3.381   4.255   -2.245  1.00 0.00 ? 787 LEU A CD1  2  
ATOM 3210  C CD2  . LEU A 1 80  ? 5.109   5.724   -3.186  1.00 0.00 ? 787 LEU A CD2  2  
ATOM 3211  H H    . LEU A 1 80  ? 1.862   9.138   -2.341  1.00 0.00 ? 787 LEU A H    2  
ATOM 3212  H HA   . LEU A 1 80  ? 3.746   7.975   -0.451  1.00 0.00 ? 787 LEU A HA   2  
ATOM 3213  H HB2  . LEU A 1 80  ? 2.197   6.392   -1.519  1.00 0.00 ? 787 LEU A HB2  2  
ATOM 3214  H HB3  . LEU A 1 80  ? 2.740   6.903   -3.105  1.00 0.00 ? 787 LEU A HB3  2  
ATOM 3215  H HG   . LEU A 1 80  ? 4.606   5.566   -1.124  1.00 0.00 ? 787 LEU A HG   2  
ATOM 3216  H HD11 . LEU A 1 80  ? 4.102   3.453   -2.252  1.00 0.00 ? 787 LEU A HD11 2  
ATOM 3217  H HD12 . LEU A 1 80  ? 2.824   4.249   -3.170  1.00 0.00 ? 787 LEU A HD12 2  
ATOM 3218  H HD13 . LEU A 1 80  ? 2.707   4.110   -1.415  1.00 0.00 ? 787 LEU A HD13 2  
ATOM 3219  H HD21 . LEU A 1 80  ? 4.642   5.631   -4.153  1.00 0.00 ? 787 LEU A HD21 2  
ATOM 3220  H HD22 . LEU A 1 80  ? 5.870   4.970   -3.071  1.00 0.00 ? 787 LEU A HD22 2  
ATOM 3221  H HD23 . LEU A 1 80  ? 5.573   6.697   -3.108  1.00 0.00 ? 787 LEU A HD23 2  
ATOM 3222  N N    . ILE A 1 81  ? 5.812   8.514   -1.692  1.00 0.00 ? 788 ILE A N    2  
ATOM 3223  C CA   . ILE A 1 81  ? 7.045   9.041   -2.168  1.00 0.00 ? 788 ILE A CA   2  
ATOM 3224  C C    . ILE A 1 81  ? 7.943   7.826   -2.449  1.00 0.00 ? 788 ILE A C    2  
ATOM 3225  O O    . ILE A 1 81  ? 7.886   6.839   -1.715  1.00 0.00 ? 788 ILE A O    2  
ATOM 3226  C CB   . ILE A 1 81  ? 7.748   9.944   -1.067  1.00 0.00 ? 788 ILE A CB   2  
ATOM 3227  C CG1  . ILE A 1 81  ? 6.825   11.054  -0.483  1.00 0.00 ? 788 ILE A CG1  2  
ATOM 3228  C CG2  . ILE A 1 81  ? 9.040   10.552  -1.572  1.00 0.00 ? 788 ILE A CG2  2  
ATOM 3229  C CD1  . ILE A 1 81  ? 5.857   10.582  0.604   1.00 0.00 ? 788 ILE A CD1  2  
ATOM 3230  H H    . ILE A 1 81  ? 5.881   7.904   -0.924  1.00 0.00 ? 788 ILE A H    2  
ATOM 3231  H HA   . ILE A 1 81  ? 6.872   9.619   -3.063  1.00 0.00 ? 788 ILE A HA   2  
ATOM 3232  H HB   . ILE A 1 81  ? 8.034   9.287   -0.261  1.00 0.00 ? 788 ILE A HB   2  
ATOM 3233  H HG12 . ILE A 1 81  ? 7.437   11.826  -0.045  1.00 0.00 ? 788 ILE A HG12 2  
ATOM 3234  H HG13 . ILE A 1 81  ? 6.238   11.482  -1.283  1.00 0.00 ? 788 ILE A HG13 2  
ATOM 3235  H HG21 . ILE A 1 81  ? 8.838   11.193  -2.417  1.00 0.00 ? 788 ILE A HG21 2  
ATOM 3236  H HG22 . ILE A 1 81  ? 9.710   9.758   -1.864  1.00 0.00 ? 788 ILE A HG22 2  
ATOM 3237  H HG23 . ILE A 1 81  ? 9.489   11.126  -0.774  1.00 0.00 ? 788 ILE A HG23 2  
ATOM 3238  H HD11 . ILE A 1 81  ? 5.260   11.408  0.962   1.00 0.00 ? 788 ILE A HD11 2  
ATOM 3239  H HD12 . ILE A 1 81  ? 6.414   10.165  1.431   1.00 0.00 ? 788 ILE A HD12 2  
ATOM 3240  H HD13 . ILE A 1 81  ? 5.209   9.819   0.198   1.00 0.00 ? 788 ILE A HD13 2  
ATOM 3241  N N    . GLU A 1 82  ? 8.700   7.853   -3.503  1.00 0.00 ? 789 GLU A N    2  
ATOM 3242  C CA   . GLU A 1 82  ? 9.613   6.759   -3.791  1.00 0.00 ? 789 GLU A CA   2  
ATOM 3243  C C    . GLU A 1 82  ? 11.042  7.209   -3.610  1.00 0.00 ? 789 GLU A C    2  
ATOM 3244  O O    . GLU A 1 82  ? 11.421  8.317   -4.019  1.00 0.00 ? 789 GLU A O    2  
ATOM 3245  C CB   . GLU A 1 82  ? 9.399   6.193   -5.199  1.00 0.00 ? 789 GLU A CB   2  
ATOM 3246  C CG   . GLU A 1 82  ? 9.432   7.235   -6.292  1.00 0.00 ? 789 GLU A CG   2  
ATOM 3247  C CD   . GLU A 1 82  ? 9.459   6.634   -7.677  1.00 0.00 ? 789 GLU A CD   2  
ATOM 3248  O OE1  . GLU A 1 82  ? 8.380   6.286   -8.204  1.00 0.00 ? 789 GLU A OE1  2  
ATOM 3249  O OE2  . GLU A 1 82  ? 10.554  6.535   -8.274  1.00 0.00 ? 789 GLU A OE2  2  
ATOM 3250  H H    . GLU A 1 82  ? 8.665   8.626   -4.107  1.00 0.00 ? 789 GLU A H    2  
ATOM 3251  H HA   . GLU A 1 82  ? 9.449   5.968   -3.070  1.00 0.00 ? 789 GLU A HA   2  
ATOM 3252  H HB2  . GLU A 1 82  ? 10.174  5.469   -5.405  1.00 0.00 ? 789 GLU A HB2  2  
ATOM 3253  H HB3  . GLU A 1 82  ? 8.441   5.697   -5.230  1.00 0.00 ? 789 GLU A HB3  2  
ATOM 3254  H HG2  . GLU A 1 82  ? 8.538   7.830   -6.176  1.00 0.00 ? 789 GLU A HG2  2  
ATOM 3255  H HG3  . GLU A 1 82  ? 10.296  7.866   -6.148  1.00 0.00 ? 789 GLU A HG3  2  
ATOM 3256  N N    . LEU A 1 83  ? 11.818  6.389   -2.976  1.00 0.00 ? 790 LEU A N    2  
ATOM 3257  C CA   . LEU A 1 83  ? 13.201  6.677   -2.763  1.00 0.00 ? 790 LEU A CA   2  
ATOM 3258  C C    . LEU A 1 83  ? 13.992  5.930   -3.779  1.00 0.00 ? 790 LEU A C    2  
ATOM 3259  O O    . LEU A 1 83  ? 14.025  4.713   -3.734  1.00 0.00 ? 790 LEU A O    2  
ATOM 3260  C CB   . LEU A 1 83  ? 13.638  6.250   -1.366  1.00 0.00 ? 790 LEU A CB   2  
ATOM 3261  C CG   . LEU A 1 83  ? 12.900  6.909   -0.201  1.00 0.00 ? 790 LEU A CG   2  
ATOM 3262  C CD1  . LEU A 1 83  ? 13.403  6.366   1.114   1.00 0.00 ? 790 LEU A CD1  2  
ATOM 3263  C CD2  . LEU A 1 83  ? 13.060  8.418   -0.244  1.00 0.00 ? 790 LEU A CD2  2  
ATOM 3264  H H    . LEU A 1 83  ? 11.465  5.534   -2.648  1.00 0.00 ? 790 LEU A H    2  
ATOM 3265  H HA   . LEU A 1 83  ? 13.364  7.738   -2.880  1.00 0.00 ? 790 LEU A HA   2  
ATOM 3266  H HB2  . LEU A 1 83  ? 13.519  5.178   -1.299  1.00 0.00 ? 790 LEU A HB2  2  
ATOM 3267  H HB3  . LEU A 1 83  ? 14.691  6.473   -1.273  1.00 0.00 ? 790 LEU A HB3  2  
ATOM 3268  H HG   . LEU A 1 83  ? 11.847  6.677   -0.279  1.00 0.00 ? 790 LEU A HG   2  
ATOM 3269  H HD11 . LEU A 1 83  ? 14.460  6.571   1.204   1.00 0.00 ? 790 LEU A HD11 2  
ATOM 3270  H HD12 . LEU A 1 83  ? 13.233  5.301   1.147   1.00 0.00 ? 790 LEU A HD12 2  
ATOM 3271  H HD13 . LEU A 1 83  ? 12.875  6.837   1.930   1.00 0.00 ? 790 LEU A HD13 2  
ATOM 3272  H HD21 . LEU A 1 83  ? 12.535  8.846   0.596   1.00 0.00 ? 790 LEU A HD21 2  
ATOM 3273  H HD22 . LEU A 1 83  ? 12.644  8.805   -1.162  1.00 0.00 ? 790 LEU A HD22 2  
ATOM 3274  H HD23 . LEU A 1 83  ? 14.108  8.674   -0.182  1.00 0.00 ? 790 LEU A HD23 2  
ATOM 3275  N N    . THR A 1 84  ? 14.578  6.660   -4.708  1.00 0.00 ? 791 THR A N    2  
ATOM 3276  C CA   . THR A 1 84  ? 15.382  6.105   -5.786  1.00 0.00 ? 791 THR A CA   2  
ATOM 3277  C C    . THR A 1 84  ? 16.416  5.096   -5.268  1.00 0.00 ? 791 THR A C    2  
ATOM 3278  O O    . THR A 1 84  ? 17.064  5.323   -4.247  1.00 0.00 ? 791 THR A O    2  
ATOM 3279  C CB   . THR A 1 84  ? 16.095  7.236   -6.585  1.00 0.00 ? 791 THR A CB   2  
ATOM 3280  O OG1  . THR A 1 84  ? 17.006  6.683   -7.545  1.00 0.00 ? 791 THR A OG1  2  
ATOM 3281  C CG2  . THR A 1 84  ? 16.836  8.194   -5.654  1.00 0.00 ? 791 THR A CG2  2  
ATOM 3282  H H    . THR A 1 84  ? 14.465  7.630   -4.664  1.00 0.00 ? 791 THR A H    2  
ATOM 3283  H HA   . THR A 1 84  ? 14.716  5.588   -6.461  1.00 0.00 ? 791 THR A HA   2  
ATOM 3284  H HB   . THR A 1 84  ? 15.334  7.788   -7.118  1.00 0.00 ? 791 THR A HB   2  
ATOM 3285  H HG1  . THR A 1 84  ? 16.846  7.148   -8.379  1.00 0.00 ? 791 THR A HG1  2  
ATOM 3286  H HG21 . THR A 1 84  ? 16.126  8.617   -4.960  1.00 0.00 ? 791 THR A HG21 2  
ATOM 3287  H HG22 . THR A 1 84  ? 17.299  8.984   -6.229  1.00 0.00 ? 791 THR A HG22 2  
ATOM 3288  H HG23 . THR A 1 84  ? 17.593  7.651   -5.109  1.00 0.00 ? 791 THR A HG23 2  
ATOM 3289  N N    . GLN A 1 85  ? 16.569  3.995   -5.999  1.00 0.00 ? 792 GLN A N    2  
ATOM 3290  C CA   . GLN A 1 85  ? 17.480  2.908   -5.637  1.00 0.00 ? 792 GLN A CA   2  
ATOM 3291  C C    . GLN A 1 85  ? 18.947  3.332   -5.550  1.00 0.00 ? 792 GLN A C    2  
ATOM 3292  O O    . GLN A 1 85  ? 19.780  2.621   -4.983  1.00 0.00 ? 792 GLN A O    2  
ATOM 3293  C CB   . GLN A 1 85  ? 17.326  1.664   -6.531  1.00 0.00 ? 792 GLN A CB   2  
ATOM 3294  C CG   . GLN A 1 85  ? 17.524  1.874   -8.022  1.00 0.00 ? 792 GLN A CG   2  
ATOM 3295  C CD   . GLN A 1 85  ? 16.360  2.573   -8.691  1.00 0.00 ? 792 GLN A CD   2  
ATOM 3296  O OE1  . GLN A 1 85  ? 15.411  1.934   -9.099  1.00 0.00 ? 792 GLN A OE1  2  
ATOM 3297  N NE2  . GLN A 1 85  ? 16.441  3.869   -8.864  1.00 0.00 ? 792 GLN A NE2  2  
ATOM 3298  H H    . GLN A 1 85  ? 16.034  3.924   -6.817  1.00 0.00 ? 792 GLN A H    2  
ATOM 3299  H HA   . GLN A 1 85  ? 17.173  2.627   -4.645  1.00 0.00 ? 792 GLN A HA   2  
ATOM 3300  H HB2  . GLN A 1 85  ? 18.047  0.928   -6.210  1.00 0.00 ? 792 GLN A HB2  2  
ATOM 3301  H HB3  . GLN A 1 85  ? 16.337  1.260   -6.376  1.00 0.00 ? 792 GLN A HB3  2  
ATOM 3302  H HG2  . GLN A 1 85  ? 18.394  2.505   -8.120  1.00 0.00 ? 792 GLN A HG2  2  
ATOM 3303  H HG3  . GLN A 1 85  ? 17.702  0.920   -8.494  1.00 0.00 ? 792 GLN A HG3  2  
ATOM 3304  H HE21 . GLN A 1 85  ? 17.231  4.376   -8.577  1.00 0.00 ? 792 GLN A HE21 2  
ATOM 3305  H HE22 . GLN A 1 85  ? 15.689  4.304   -9.324  1.00 0.00 ? 792 GLN A HE22 2  
ATOM 3306  N N    . ALA A 1 86  ? 19.251  4.490   -6.084  1.00 0.00 ? 793 ALA A N    2  
ATOM 3307  C CA   . ALA A 1 86  ? 20.593  5.010   -6.047  1.00 0.00 ? 793 ALA A CA   2  
ATOM 3308  C C    . ALA A 1 86  ? 20.795  5.849   -4.802  1.00 0.00 ? 793 ALA A C    2  
ATOM 3309  O O    . ALA A 1 86  ? 21.918  6.095   -4.379  1.00 0.00 ? 793 ALA A O    2  
ATOM 3310  C CB   . ALA A 1 86  ? 20.845  5.839   -7.270  1.00 0.00 ? 793 ALA A CB   2  
ATOM 3311  H H    . ALA A 1 86  ? 18.552  5.026   -6.514  1.00 0.00 ? 793 ALA A H    2  
ATOM 3312  H HA   . ALA A 1 86  ? 21.285  4.181   -6.043  1.00 0.00 ? 793 ALA A HA   2  
ATOM 3313  H HB1  . ALA A 1 86  ? 20.674  5.235   -8.147  1.00 0.00 ? 793 ALA A HB1  2  
ATOM 3314  H HB2  . ALA A 1 86  ? 21.867  6.190   -7.257  1.00 0.00 ? 793 ALA A HB2  2  
ATOM 3315  H HB3  . ALA A 1 86  ? 20.167  6.678   -7.270  1.00 0.00 ? 793 ALA A HB3  2  
ATOM 3316  N N    . GLY A 1 87  ? 19.699  6.252   -4.203  1.00 0.00 ? 794 GLY A N    2  
ATOM 3317  C CA   . GLY A 1 87  ? 19.749  7.103   -3.053  1.00 0.00 ? 794 GLY A CA   2  
ATOM 3318  C C    . GLY A 1 87  ? 19.155  6.437   -1.850  1.00 0.00 ? 794 GLY A C    2  
ATOM 3319  O O    . GLY A 1 87  ? 18.636  7.105   -0.956  1.00 0.00 ? 794 GLY A O    2  
ATOM 3320  H H    . GLY A 1 87  ? 18.819  5.951   -4.520  1.00 0.00 ? 794 GLY A H    2  
ATOM 3321  H HA2  . GLY A 1 87  ? 20.777  7.358   -2.843  1.00 0.00 ? 794 GLY A HA2  2  
ATOM 3322  H HA3  . GLY A 1 87  ? 19.194  8.003   -3.262  1.00 0.00 ? 794 GLY A HA3  2  
ATOM 3323  N N    . LEU A 1 88  ? 19.205  5.111   -1.834  1.00 0.00 ? 795 LEU A N    2  
ATOM 3324  C CA   . LEU A 1 88  ? 18.718  4.342   -0.687  1.00 0.00 ? 795 LEU A CA   2  
ATOM 3325  C C    . LEU A 1 88  ? 19.786  4.368   0.361   1.00 0.00 ? 795 LEU A C    2  
ATOM 3326  O O    . LEU A 1 88  ? 19.517  4.255   1.560   1.00 0.00 ? 795 LEU A O    2  
ATOM 3327  C CB   . LEU A 1 88  ? 18.459  2.886   -1.065  1.00 0.00 ? 795 LEU A CB   2  
ATOM 3328  C CG   . LEU A 1 88  ? 17.554  2.648   -2.249  1.00 0.00 ? 795 LEU A CG   2  
ATOM 3329  C CD1  . LEU A 1 88  ? 17.468  1.161   -2.565  1.00 0.00 ? 795 LEU A CD1  2  
ATOM 3330  C CD2  . LEU A 1 88  ? 16.176  3.231   -2.009  1.00 0.00 ? 795 LEU A CD2  2  
ATOM 3331  H H    . LEU A 1 88  ? 19.573  4.642   -2.610  1.00 0.00 ? 795 LEU A H    2  
ATOM 3332  H HA   . LEU A 1 88  ? 17.812  4.794   -0.311  1.00 0.00 ? 795 LEU A HA   2  
ATOM 3333  H HB2  . LEU A 1 88  ? 19.405  2.404   -1.256  1.00 0.00 ? 795 LEU A HB2  2  
ATOM 3334  H HB3  . LEU A 1 88  ? 18.012  2.405   -0.208  1.00 0.00 ? 795 LEU A HB3  2  
ATOM 3335  H HG   . LEU A 1 88  ? 18.003  3.164   -3.083  1.00 0.00 ? 795 LEU A HG   2  
ATOM 3336  H HD11 . LEU A 1 88  ? 17.109  0.627   -1.697  1.00 0.00 ? 795 LEU A HD11 2  
ATOM 3337  H HD12 . LEU A 1 88  ? 18.446  0.798   -2.841  1.00 0.00 ? 795 LEU A HD12 2  
ATOM 3338  H HD13 . LEU A 1 88  ? 16.785  1.007   -3.387  1.00 0.00 ? 795 LEU A HD13 2  
ATOM 3339  H HD21 . LEU A 1 88  ? 15.736  2.786   -1.129  1.00 0.00 ? 795 LEU A HD21 2  
ATOM 3340  H HD22 . LEU A 1 88  ? 15.554  3.031   -2.869  1.00 0.00 ? 795 LEU A HD22 2  
ATOM 3341  H HD23 . LEU A 1 88  ? 16.255  4.300   -1.877  1.00 0.00 ? 795 LEU A HD23 2  
ATOM 3342  N N    . LYS A 1 89  ? 21.014  4.532   -0.132  1.00 0.00 ? 796 LYS A N    2  
ATOM 3343  C CA   . LYS A 1 89  ? 22.213  4.592   0.640   1.00 0.00 ? 796 LYS A CA   2  
ATOM 3344  C C    . LYS A 1 89  ? 22.486  3.246   1.323   1.00 0.00 ? 796 LYS A C    2  
ATOM 3345  O O    . LYS A 1 89  ? 23.077  3.172   2.410   1.00 0.00 ? 796 LYS A O    2  
ATOM 3346  C CB   . LYS A 1 89  ? 22.141  5.775   1.592   1.00 0.00 ? 796 LYS A CB   2  
ATOM 3347  C CG   . LYS A 1 89  ? 23.470  6.246   2.132   1.00 0.00 ? 796 LYS A CG   2  
ATOM 3348  C CD   . LYS A 1 89  ? 23.335  7.660   2.630   1.00 0.00 ? 796 LYS A CD   2  
ATOM 3349  C CE   . LYS A 1 89  ? 22.382  7.764   3.806   1.00 0.00 ? 796 LYS A CE   2  
ATOM 3350  N NZ   . LYS A 1 89  ? 22.122  9.159   4.177   1.00 0.00 ? 796 LYS A NZ   2  
ATOM 3351  H H    . LYS A 1 89  ? 21.105  4.661   -1.097  1.00 0.00 ? 796 LYS A H    2  
ATOM 3352  H HA   . LYS A 1 89  ? 23.017  4.760   -0.063  1.00 0.00 ? 796 LYS A HA   2  
ATOM 3353  H HB2  . LYS A 1 89  ? 21.668  6.599   1.079   1.00 0.00 ? 796 LYS A HB2  2  
ATOM 3354  H HB3  . LYS A 1 89  ? 21.515  5.488   2.423   1.00 0.00 ? 796 LYS A HB3  2  
ATOM 3355  H HG2  . LYS A 1 89  ? 23.777  5.603   2.944   1.00 0.00 ? 796 LYS A HG2  2  
ATOM 3356  H HG3  . LYS A 1 89  ? 24.203  6.218   1.340   1.00 0.00 ? 796 LYS A HG3  2  
ATOM 3357  H HD2  . LYS A 1 89  ? 24.304  8.051   2.898   1.00 0.00 ? 796 LYS A HD2  2  
ATOM 3358  H HD3  . LYS A 1 89  ? 22.924  8.210   1.795   1.00 0.00 ? 796 LYS A HD3  2  
ATOM 3359  H HE2  . LYS A 1 89  ? 21.446  7.291   3.548   1.00 0.00 ? 796 LYS A HE2  2  
ATOM 3360  H HE3  . LYS A 1 89  ? 22.822  7.251   4.647   1.00 0.00 ? 796 LYS A HE3  2  
ATOM 3361  H HZ1  . LYS A 1 89  ? 21.634  9.667   3.412   1.00 0.00 ? 796 LYS A HZ1  2  
ATOM 3362  H HZ2  . LYS A 1 89  ? 23.009  9.664   4.380   1.00 0.00 ? 796 LYS A HZ2  2  
ATOM 3363  H HZ3  . LYS A 1 89  ? 21.527  9.207   5.026   1.00 0.00 ? 796 LYS A HZ3  2  
ATOM 3364  N N    . GLY A 1 90  ? 22.061  2.175   0.649   1.00 0.00 ? 797 GLY A N    2  
ATOM 3365  C CA   . GLY A 1 90  ? 22.424  0.826   1.067   1.00 0.00 ? 797 GLY A CA   2  
ATOM 3366  C C    . GLY A 1 90  ? 23.882  0.626   0.727   1.00 0.00 ? 797 GLY A C    2  
ATOM 3367  O O    . GLY A 1 90  ? 24.613  -0.129  1.375   1.00 0.00 ? 797 GLY A O    2  
ATOM 3368  H H    . GLY A 1 90  ? 21.487  2.318   -0.135  1.00 0.00 ? 797 GLY A H    2  
ATOM 3369  H HA2  . GLY A 1 90  ? 22.272  0.722   2.131   1.00 0.00 ? 797 GLY A HA2  2  
ATOM 3370  H HA3  . GLY A 1 90  ? 21.835  0.099   0.532   1.00 0.00 ? 797 GLY A HA3  2  
ATOM 3371  N N    . SER A 1 91  ? 24.273  1.324   -0.307  1.00 0.00 ? 798 SER A N    2  
ATOM 3372  C CA   . SER A 1 91  ? 25.616  1.477   -0.732  1.00 0.00 ? 798 SER A CA   2  
ATOM 3373  C C    . SER A 1 91  ? 25.652  2.855   -1.348  1.00 0.00 ? 798 SER A C    2  
ATOM 3374  O O    . SER A 1 91  ? 25.071  3.066   -2.417  1.00 0.00 ? 798 SER A O    2  
ATOM 3375  C CB   . SER A 1 91  ? 25.992  0.418   -1.772  1.00 0.00 ? 798 SER A CB   2  
ATOM 3376  O OG   . SER A 1 91  ? 27.385  0.429   -2.073  1.00 0.00 ? 798 SER A OG   2  
ATOM 3377  H H    . SER A 1 91  ? 23.592  1.786   -0.841  1.00 0.00 ? 798 SER A H    2  
ATOM 3378  H HA   . SER A 1 91  ? 26.263  1.424   0.131   1.00 0.00 ? 798 SER A HA   2  
ATOM 3379  H HB2  . SER A 1 91  ? 25.724  -0.564  -1.411  1.00 0.00 ? 798 SER A HB2  2  
ATOM 3380  H HB3  . SER A 1 91  ? 25.446  0.625   -2.681  1.00 0.00 ? 798 SER A HB3  2  
ATOM 3381  H HG   . SER A 1 91  ? 27.575  1.114   -2.731  1.00 0.00 ? 798 SER A HG   2  
ATOM 3382  N N    . THR A 1 92  ? 26.248  3.799   -0.650  1.00 0.00 ? 799 THR A N    2  
ATOM 3383  C CA   . THR A 1 92  ? 26.272  5.179   -1.094  1.00 0.00 ? 799 THR A CA   2  
ATOM 3384  C C    . THR A 1 92  ? 27.120  5.315   -2.362  1.00 0.00 ? 799 THR A C    2  
ATOM 3385  O O    . THR A 1 92  ? 26.901  6.200   -3.182  1.00 0.00 ? 799 THR A O    2  
ATOM 3386  C CB   . THR A 1 92  ? 26.769  6.138   0.042   1.00 0.00 ? 799 THR A CB   2  
ATOM 3387  O OG1  . THR A 1 92  ? 26.520  7.515   -0.296  1.00 0.00 ? 799 THR A OG1  2  
ATOM 3388  C CG2  . THR A 1 92  ? 28.261  5.961   0.329   1.00 0.00 ? 799 THR A CG2  2  
ATOM 3389  H H    . THR A 1 92  ? 26.680  3.563   0.204   1.00 0.00 ? 799 THR A H    2  
ATOM 3390  H HA   . THR A 1 92  ? 25.254  5.441   -1.349  1.00 0.00 ? 799 THR A HA   2  
ATOM 3391  H HB   . THR A 1 92  ? 26.213  5.892   0.934   1.00 0.00 ? 799 THR A HB   2  
ATOM 3392  H HG1  . THR A 1 92  ? 25.988  7.548   -1.102  1.00 0.00 ? 799 THR A HG1  2  
ATOM 3393  H HG21 . THR A 1 92  ? 28.819  6.214   -0.560  1.00 0.00 ? 799 THR A HG21 2  
ATOM 3394  H HG22 . THR A 1 92  ? 28.461  4.935   0.599   1.00 0.00 ? 799 THR A HG22 2  
ATOM 3395  H HG23 . THR A 1 92  ? 28.556  6.612   1.139   1.00 0.00 ? 799 THR A HG23 2  
ATOM 3396  N N    . GLU A 1 93  ? 28.060  4.407   -2.519  1.00 0.00 ? 800 GLU A N    2  
ATOM 3397  C CA   . GLU A 1 93  ? 28.889  4.372   -3.686  1.00 0.00 ? 800 GLU A CA   2  
ATOM 3398  C C    . GLU A 1 93  ? 28.456  3.227   -4.567  1.00 0.00 ? 800 GLU A C    2  
ATOM 3399  O O    . GLU A 1 93  ? 28.013  2.177   -4.066  1.00 0.00 ? 800 GLU A O    2  
ATOM 3400  C CB   . GLU A 1 93  ? 30.342  4.162   -3.320  1.00 0.00 ? 800 GLU A CB   2  
ATOM 3401  C CG   . GLU A 1 93  ? 30.940  5.217   -2.431  1.00 0.00 ? 800 GLU A CG   2  
ATOM 3402  C CD   . GLU A 1 93  ? 32.389  4.953   -2.203  1.00 0.00 ? 800 GLU A CD   2  
ATOM 3403  O OE1  . GLU A 1 93  ? 32.716  4.069   -1.389  1.00 0.00 ? 800 GLU A OE1  2  
ATOM 3404  O OE2  . GLU A 1 93  ? 33.229  5.609   -2.850  1.00 0.00 ? 800 GLU A OE2  2  
ATOM 3405  H H    . GLU A 1 93  ? 28.176  3.735   -1.817  1.00 0.00 ? 800 GLU A H    2  
ATOM 3406  H HA   . GLU A 1 93  ? 28.788  5.307   -4.215  1.00 0.00 ? 800 GLU A HA   2  
ATOM 3407  H HB2  . GLU A 1 93  ? 30.425  3.216   -2.806  1.00 0.00 ? 800 GLU A HB2  2  
ATOM 3408  H HB3  . GLU A 1 93  ? 30.923  4.112   -4.228  1.00 0.00 ? 800 GLU A HB3  2  
ATOM 3409  H HG2  . GLU A 1 93  ? 30.826  6.183   -2.898  1.00 0.00 ? 800 GLU A HG2  2  
ATOM 3410  H HG3  . GLU A 1 93  ? 30.433  5.207   -1.479  1.00 0.00 ? 800 GLU A HG3  2  
ATOM 3411  N N    . GLY A 1 94  ? 28.514  3.437   -5.853  1.00 0.00 ? 801 GLY A N    2  
ATOM 3412  C CA   . GLY A 1 94  ? 28.262  2.385   -6.806  1.00 0.00 ? 801 GLY A CA   2  
ATOM 3413  C C    . GLY A 1 94  ? 26.806  2.174   -7.135  1.00 0.00 ? 801 GLY A C    2  
ATOM 3414  O O    . GLY A 1 94  ? 26.471  1.999   -8.305  1.00 0.00 ? 801 GLY A O    2  
ATOM 3415  H H    . GLY A 1 94  ? 28.719  4.344   -6.172  1.00 0.00 ? 801 GLY A H    2  
ATOM 3416  H HA2  . GLY A 1 94  ? 28.774  2.627   -7.725  1.00 0.00 ? 801 GLY A HA2  2  
ATOM 3417  H HA3  . GLY A 1 94  ? 28.666  1.463   -6.416  1.00 0.00 ? 801 GLY A HA3  2  
ATOM 3418  N N    . SER A 1 95  ? 25.951  2.202   -6.107  1.00 0.00 ? 802 SER A N    2  
ATOM 3419  C CA   . SER A 1 95  ? 24.516  1.931   -6.221  1.00 0.00 ? 802 SER A CA   2  
ATOM 3420  C C    . SER A 1 95  ? 24.294  0.459   -6.579  1.00 0.00 ? 802 SER A C    2  
ATOM 3421  O O    . SER A 1 95  ? 24.635  0.001   -7.677  1.00 0.00 ? 802 SER A O    2  
ATOM 3422  C CB   . SER A 1 95  ? 23.810  2.879   -7.224  1.00 0.00 ? 802 SER A CB   2  
ATOM 3423  O OG   . SER A 1 95  ? 22.414  2.615   -7.295  1.00 0.00 ? 802 SER A OG   2  
ATOM 3424  H H    . SER A 1 95  ? 26.323  2.410   -5.223  1.00 0.00 ? 802 SER A H    2  
ATOM 3425  H HA   . SER A 1 95  ? 24.106  2.083   -5.234  1.00 0.00 ? 802 SER A HA   2  
ATOM 3426  H HB2  . SER A 1 95  ? 23.952  3.902   -6.910  1.00 0.00 ? 802 SER A HB2  2  
ATOM 3427  H HB3  . SER A 1 95  ? 24.244  2.739   -8.202  1.00 0.00 ? 802 SER A HB3  2  
ATOM 3428  H HG   . SER A 1 95  ? 22.087  2.878   -8.164  1.00 0.00 ? 802 SER A HG   2  
ATOM 3429  N N    . GLU A 1 96  ? 23.756  -0.285  -5.637  1.00 0.00 ? 803 GLU A N    2  
ATOM 3430  C CA   . GLU A 1 96  ? 23.547  -1.712  -5.812  1.00 0.00 ? 803 GLU A CA   2  
ATOM 3431  C C    . GLU A 1 96  ? 22.426  -1.966  -6.812  1.00 0.00 ? 803 GLU A C    2  
ATOM 3432  O O    . GLU A 1 96  ? 22.554  -2.807  -7.694  1.00 0.00 ? 803 GLU A O    2  
ATOM 3433  C CB   . GLU A 1 96  ? 23.228  -2.350  -4.473  1.00 0.00 ? 803 GLU A CB   2  
ATOM 3434  C CG   . GLU A 1 96  ? 24.276  -2.051  -3.426  1.00 0.00 ? 803 GLU A CG   2  
ATOM 3435  C CD   . GLU A 1 96  ? 23.941  -2.589  -2.065  1.00 0.00 ? 803 GLU A CD   2  
ATOM 3436  O OE1  . GLU A 1 96  ? 23.067  -2.031  -1.393  1.00 0.00 ? 803 GLU A OE1  2  
ATOM 3437  O OE2  . GLU A 1 96  ? 24.586  -3.548  -1.622  1.00 0.00 ? 803 GLU A OE2  2  
ATOM 3438  H H    . GLU A 1 96  ? 23.495  0.142   -4.793  1.00 0.00 ? 803 GLU A H    2  
ATOM 3439  H HA   . GLU A 1 96  ? 24.463  -2.135  -6.196  1.00 0.00 ? 803 GLU A HA   2  
ATOM 3440  H HB2  . GLU A 1 96  ? 22.270  -1.995  -4.125  1.00 0.00 ? 803 GLU A HB2  2  
ATOM 3441  H HB3  . GLU A 1 96  ? 23.185  -3.421  -4.608  1.00 0.00 ? 803 GLU A HB3  2  
ATOM 3442  H HG2  . GLU A 1 96  ? 25.214  -2.482  -3.742  1.00 0.00 ? 803 GLU A HG2  2  
ATOM 3443  H HG3  . GLU A 1 96  ? 24.383  -0.979  -3.360  1.00 0.00 ? 803 GLU A HG3  2  
ATOM 3444  N N    . SER A 1 97  ? 21.328  -1.220  -6.654  1.00 0.00 ? 804 SER A N    2  
ATOM 3445  C CA   . SER A 1 97  ? 20.163  -1.288  -7.547  1.00 0.00 ? 804 SER A CA   2  
ATOM 3446  C C    . SER A 1 97  ? 19.567  -2.720  -7.609  1.00 0.00 ? 804 SER A C    2  
ATOM 3447  O O    . SER A 1 97  ? 18.914  -3.087  -8.588  1.00 0.00 ? 804 SER A O    2  
ATOM 3448  C CB   . SER A 1 97  ? 20.542  -0.762  -8.968  1.00 0.00 ? 804 SER A CB   2  
ATOM 3449  O OG   . SER A 1 97  ? 19.412  -0.716  -9.836  1.00 0.00 ? 804 SER A OG   2  
ATOM 3450  H H    . SER A 1 97  ? 21.322  -0.575  -5.918  1.00 0.00 ? 804 SER A H    2  
ATOM 3451  H HA   . SER A 1 97  ? 19.411  -0.637  -7.129  1.00 0.00 ? 804 SER A HA   2  
ATOM 3452  H HB2  . SER A 1 97  ? 20.950  0.235   -8.883  1.00 0.00 ? 804 SER A HB2  2  
ATOM 3453  H HB3  . SER A 1 97  ? 21.287  -1.415  -9.399  1.00 0.00 ? 804 SER A HB3  2  
ATOM 3454  H HG   . SER A 1 97  ? 19.035  -1.605  -9.792  1.00 0.00 ? 804 SER A HG   2  
ATOM 3455  N N    . TYR A 1 98  ? 19.740  -3.496  -6.530  1.00 0.00 ? 805 TYR A N    2  
ATOM 3456  C CA   . TYR A 1 98  ? 19.206  -4.861  -6.479  1.00 0.00 ? 805 TYR A CA   2  
ATOM 3457  C C    . TYR A 1 98  ? 17.678  -4.857  -6.402  1.00 0.00 ? 805 TYR A C    2  
ATOM 3458  O O    . TYR A 1 98  ? 17.017  -5.879  -6.635  1.00 0.00 ? 805 TYR A O    2  
ATOM 3459  C CB   . TYR A 1 98  ? 19.827  -5.689  -5.331  1.00 0.00 ? 805 TYR A CB   2  
ATOM 3460  C CG   . TYR A 1 98  ? 19.666  -5.104  -3.936  1.00 0.00 ? 805 TYR A CG   2  
ATOM 3461  C CD1  . TYR A 1 98  ? 18.433  -5.079  -3.308  1.00 0.00 ? 805 TYR A CD1  2  
ATOM 3462  C CD2  . TYR A 1 98  ? 20.746  -4.586  -3.254  1.00 0.00 ? 805 TYR A CD2  2  
ATOM 3463  C CE1  . TYR A 1 98  ? 18.276  -4.558  -2.054  1.00 0.00 ? 805 TYR A CE1  2  
ATOM 3464  C CE2  . TYR A 1 98  ? 20.604  -4.063  -1.989  1.00 0.00 ? 805 TYR A CE2  2  
ATOM 3465  C CZ   . TYR A 1 98  ? 19.367  -4.050  -1.390  1.00 0.00 ? 805 TYR A CZ   2  
ATOM 3466  O OH   . TYR A 1 98  ? 19.224  -3.530  -0.118  1.00 0.00 ? 805 TYR A OH   2  
ATOM 3467  H H    . TYR A 1 98  ? 20.259  -3.151  -5.777  1.00 0.00 ? 805 TYR A H    2  
ATOM 3468  H HA   . TYR A 1 98  ? 19.471  -5.319  -7.422  1.00 0.00 ? 805 TYR A HA   2  
ATOM 3469  H HB2  . TYR A 1 98  ? 19.360  -6.661  -5.324  1.00 0.00 ? 805 TYR A HB2  2  
ATOM 3470  H HB3  . TYR A 1 98  ? 20.883  -5.812  -5.526  1.00 0.00 ? 805 TYR A HB3  2  
ATOM 3471  H HD1  . TYR A 1 98  ? 17.577  -5.477  -3.832  1.00 0.00 ? 805 TYR A HD1  2  
ATOM 3472  H HD2  . TYR A 1 98  ? 21.716  -4.598  -3.727  1.00 0.00 ? 805 TYR A HD2  2  
ATOM 3473  H HE1  . TYR A 1 98  ? 17.285  -4.561  -1.621  1.00 0.00 ? 805 TYR A HE1  2  
ATOM 3474  H HE2  . TYR A 1 98  ? 21.468  -3.664  -1.477  1.00 0.00 ? 805 TYR A HE2  2  
ATOM 3475  H HH   . TYR A 1 98  ? 18.686  -4.159  0.379   1.00 0.00 ? 805 TYR A HH   2  
ATOM 3476  N N    . GLU A 1 99  ? 17.126  -3.722  -6.034  1.00 0.00 ? 806 GLU A N    2  
ATOM 3477  C CA   . GLU A 1 99  ? 15.709  -3.565  -6.030  1.00 0.00 ? 806 GLU A CA   2  
ATOM 3478  C C    . GLU A 1 99  ? 15.236  -3.323  -7.444  1.00 0.00 ? 806 GLU A C    2  
ATOM 3479  O O    . GLU A 1 99  ? 15.901  -2.612  -8.208  1.00 0.00 ? 806 GLU A O    2  
ATOM 3480  C CB   . GLU A 1 99  ? 15.257  -2.444  -5.099  1.00 0.00 ? 806 GLU A CB   2  
ATOM 3481  C CG   . GLU A 1 99  ? 15.361  -2.815  -3.634  1.00 0.00 ? 806 GLU A CG   2  
ATOM 3482  C CD   . GLU A 1 99  ? 14.580  -4.081  -3.334  1.00 0.00 ? 806 GLU A CD   2  
ATOM 3483  O OE1  . GLU A 1 99  ? 13.345  -4.075  -3.462  1.00 0.00 ? 806 GLU A OE1  2  
ATOM 3484  O OE2  . GLU A 1 99  ? 15.187  -5.114  -3.028  1.00 0.00 ? 806 GLU A OE2  2  
ATOM 3485  H H    . GLU A 1 99  ? 17.702  -2.973  -5.788  1.00 0.00 ? 806 GLU A H    2  
ATOM 3486  H HA   . GLU A 1 99  ? 15.329  -4.506  -5.656  1.00 0.00 ? 806 GLU A HA   2  
ATOM 3487  H HB2  . GLU A 1 99  ? 15.873  -1.575  -5.279  1.00 0.00 ? 806 GLU A HB2  2  
ATOM 3488  H HB3  . GLU A 1 99  ? 14.228  -2.202  -5.319  1.00 0.00 ? 806 GLU A HB3  2  
ATOM 3489  H HG2  . GLU A 1 99  ? 16.400  -2.977  -3.386  1.00 0.00 ? 806 GLU A HG2  2  
ATOM 3490  H HG3  . GLU A 1 99  ? 14.963  -2.010  -3.034  1.00 0.00 ? 806 GLU A HG3  2  
ATOM 3491  N N    . GLU A 1 100 ? 14.135  -3.942  -7.792  1.00 0.00 ? 807 GLU A N    2  
ATOM 3492  C CA   . GLU A 1 100 ? 13.565  -3.857  -9.116  1.00 0.00 ? 807 GLU A CA   2  
ATOM 3493  C C    . GLU A 1 100 ? 13.155  -2.428  -9.396  1.00 0.00 ? 807 GLU A C    2  
ATOM 3494  O O    . GLU A 1 100 ? 13.714  -1.747  -10.253 1.00 0.00 ? 807 GLU A O    2  
ATOM 3495  C CB   . GLU A 1 100 ? 12.386  -4.810  -9.196  1.00 0.00 ? 807 GLU A CB   2  
ATOM 3496  C CG   . GLU A 1 100 ? 11.783  -4.973  -10.562 1.00 0.00 ? 807 GLU A CG   2  
ATOM 3497  C CD   . GLU A 1 100 ? 10.648  -5.938  -10.520 1.00 0.00 ? 807 GLU A CD   2  
ATOM 3498  O OE1  . GLU A 1 100 ? 10.893  -7.146  -10.435 1.00 0.00 ? 807 GLU A OE1  2  
ATOM 3499  O OE2  . GLU A 1 100 ? 9.479   -5.496  -10.533 1.00 0.00 ? 807 GLU A OE2  2  
ATOM 3500  H H    . GLU A 1 100 ? 13.677  -4.485  -7.115  1.00 0.00 ? 807 GLU A H    2  
ATOM 3501  H HA   . GLU A 1 100 ? 14.303  -4.140  -9.841  1.00 0.00 ? 807 GLU A HA   2  
ATOM 3502  H HB2  . GLU A 1 100 ? 12.708  -5.785  -8.863  1.00 0.00 ? 807 GLU A HB2  2  
ATOM 3503  H HB3  . GLU A 1 100 ? 11.616  -4.460  -8.527  1.00 0.00 ? 807 GLU A HB3  2  
ATOM 3504  H HG2  . GLU A 1 100 ? 11.420  -4.015  -10.904 1.00 0.00 ? 807 GLU A HG2  2  
ATOM 3505  H HG3  . GLU A 1 100 ? 12.535  -5.345  -11.243 1.00 0.00 ? 807 GLU A HG3  2  
ATOM 3506  N N    . ASP A 1 101 ? 12.217  -2.002  -8.677  1.00 0.00 ? 808 ASP A N    2  
ATOM 3507  C CA   . ASP A 1 101 ? 11.785  -0.634  -8.679  1.00 0.00 ? 808 ASP A CA   2  
ATOM 3508  C C    . ASP A 1 101 ? 12.063  -0.190  -7.247  1.00 0.00 ? 808 ASP A C    2  
ATOM 3509  O O    . ASP A 1 101 ? 12.120  -1.061  -6.365  1.00 0.00 ? 808 ASP A O    2  
ATOM 3510  C CB   . ASP A 1 101 ? 10.280  -0.553  -9.059  1.00 0.00 ? 808 ASP A CB   2  
ATOM 3511  C CG   . ASP A 1 101 ? 9.804   0.845   -9.458  1.00 0.00 ? 808 ASP A CG   2  
ATOM 3512  O OD1  . ASP A 1 101 ? 10.054  1.267   -10.616 1.00 0.00 ? 808 ASP A OD1  2  
ATOM 3513  O OD2  . ASP A 1 101 ? 9.154   1.532   -8.642  1.00 0.00 ? 808 ASP A OD2  2  
ATOM 3514  H H    . ASP A 1 101 ? 11.808  -2.658  -8.079  1.00 0.00 ? 808 ASP A H    2  
ATOM 3515  H HA   . ASP A 1 101 ? 12.406  -0.075  -9.364  1.00 0.00 ? 808 ASP A HA   2  
ATOM 3516  H HB2  . ASP A 1 101 ? 10.102  -1.216  -9.892  1.00 0.00 ? 808 ASP A HB2  2  
ATOM 3517  H HB3  . ASP A 1 101 ? 9.693   -0.886  -8.215  1.00 0.00 ? 808 ASP A HB3  2  
ATOM 3518  N N    . PRO A 1 102 ? 12.320  1.092   -6.967  1.00 0.00 ? 809 PRO A N    2  
ATOM 3519  C CA   . PRO A 1 102 ? 12.707  1.556   -5.616  1.00 0.00 ? 809 PRO A CA   2  
ATOM 3520  C C    . PRO A 1 102 ? 11.673  1.256   -4.504  1.00 0.00 ? 809 PRO A C    2  
ATOM 3521  O O    . PRO A 1 102 ? 10.577  0.710   -4.754  1.00 0.00 ? 809 PRO A O    2  
ATOM 3522  C CB   . PRO A 1 102 ? 12.858  3.060   -5.808  1.00 0.00 ? 809 PRO A CB   2  
ATOM 3523  C CG   . PRO A 1 102 ? 12.043  3.366   -6.989  1.00 0.00 ? 809 PRO A CG   2  
ATOM 3524  C CD   . PRO A 1 102 ? 12.274  2.220   -7.908  1.00 0.00 ? 809 PRO A CD   2  
ATOM 3525  H HA   . PRO A 1 102 ? 13.660  1.141   -5.323  1.00 0.00 ? 809 PRO A HA   2  
ATOM 3526  H HB2  . PRO A 1 102 ? 12.500  3.576   -4.929  1.00 0.00 ? 809 PRO A HB2  2  
ATOM 3527  H HB3  . PRO A 1 102 ? 13.898  3.305   -5.972  1.00 0.00 ? 809 PRO A HB3  2  
ATOM 3528  H HG2  . PRO A 1 102 ? 11.011  3.411   -6.673  1.00 0.00 ? 809 PRO A HG2  2  
ATOM 3529  H HG3  . PRO A 1 102 ? 12.360  4.298   -7.433  1.00 0.00 ? 809 PRO A HG3  2  
ATOM 3530  H HD2  . PRO A 1 102 ? 11.454  2.120   -8.604  1.00 0.00 ? 809 PRO A HD2  2  
ATOM 3531  H HD3  . PRO A 1 102 ? 13.215  2.324   -8.429  1.00 0.00 ? 809 PRO A HD3  2  
ATOM 3532  N N    . TYR A 1 103 ? 11.993  1.632   -3.282  1.00 0.00 ? 810 TYR A N    2  
ATOM 3533  C CA   . TYR A 1 103 ? 11.090  1.351   -2.209  1.00 0.00 ? 810 TYR A CA   2  
ATOM 3534  C C    . TYR A 1 103 ? 10.263  2.536   -1.857  1.00 0.00 ? 810 TYR A C    2  
ATOM 3535  O O    . TYR A 1 103 ? 10.655  3.689   -2.123  1.00 0.00 ? 810 TYR A O    2  
ATOM 3536  C CB   . TYR A 1 103 ? 11.649  0.538   -1.007  1.00 0.00 ? 810 TYR A CB   2  
ATOM 3537  C CG   . TYR A 1 103 ? 12.893  1.029   -0.295  1.00 0.00 ? 810 TYR A CG   2  
ATOM 3538  C CD1  . TYR A 1 103 ? 12.875  2.155   0.518   1.00 0.00 ? 810 TYR A CD1  2  
ATOM 3539  C CD2  . TYR A 1 103 ? 14.080  0.317   -0.400  1.00 0.00 ? 810 TYR A CD2  2  
ATOM 3540  C CE1  . TYR A 1 103 ? 14.014  2.561   1.199   1.00 0.00 ? 810 TYR A CE1  2  
ATOM 3541  C CE2  . TYR A 1 103 ? 15.212  0.707   0.281   1.00 0.00 ? 810 TYR A CE2  2  
ATOM 3542  C CZ   . TYR A 1 103 ? 15.178  1.828   1.076   1.00 0.00 ? 810 TYR A CZ   2  
ATOM 3543  O OH   . TYR A 1 103 ? 16.315  2.213   1.759   1.00 0.00 ? 810 TYR A OH   2  
ATOM 3544  H H    . TYR A 1 103 ? 12.779  2.200   -3.143  1.00 0.00 ? 810 TYR A H    2  
ATOM 3545  H HA   . TYR A 1 103 ? 10.364  0.731   -2.718  1.00 0.00 ? 810 TYR A HA   2  
ATOM 3546  H HB2  . TYR A 1 103 ? 10.878  0.484   -0.254  1.00 0.00 ? 810 TYR A HB2  2  
ATOM 3547  H HB3  . TYR A 1 103 ? 11.841  -0.469  -1.348  1.00 0.00 ? 810 TYR A HB3  2  
ATOM 3548  H HD1  . TYR A 1 103 ? 11.960  2.722   0.605   1.00 0.00 ? 810 TYR A HD1  2  
ATOM 3549  H HD2  . TYR A 1 103 ? 14.109  -0.562  -1.027  1.00 0.00 ? 810 TYR A HD2  2  
ATOM 3550  H HE1  . TYR A 1 103 ? 13.990  3.440   1.825   1.00 0.00 ? 810 TYR A HE1  2  
ATOM 3551  H HE2  . TYR A 1 103 ? 16.122  0.134   0.183   1.00 0.00 ? 810 TYR A HE2  2  
ATOM 3552  H HH   . TYR A 1 103 ? 16.059  2.351   2.680   1.00 0.00 ? 810 TYR A HH   2  
ATOM 3553  N N    . LEU A 1 104 ? 9.138   2.274   -1.280  1.00 0.00 ? 811 LEU A N    2  
ATOM 3554  C CA   . LEU A 1 104 ? 8.118   3.259   -1.192  1.00 0.00 ? 811 LEU A CA   2  
ATOM 3555  C C    . LEU A 1 104 ? 7.879   3.704   0.212   1.00 0.00 ? 811 LEU A C    2  
ATOM 3556  O O    . LEU A 1 104 ? 7.941   2.914   1.149   1.00 0.00 ? 811 LEU A O    2  
ATOM 3557  C CB   . LEU A 1 104 ? 6.832   2.675   -1.767  1.00 0.00 ? 811 LEU A CB   2  
ATOM 3558  C CG   . LEU A 1 104 ? 6.943   2.042   -3.163  1.00 0.00 ? 811 LEU A CG   2  
ATOM 3559  C CD1  . LEU A 1 104 ? 5.600   1.527   -3.623  1.00 0.00 ? 811 LEU A CD1  2  
ATOM 3560  C CD2  . LEU A 1 104 ? 7.519   3.023   -4.174  1.00 0.00 ? 811 LEU A CD2  2  
ATOM 3561  H H    . LEU A 1 104 ? 8.986   1.405   -0.845  1.00 0.00 ? 811 LEU A H    2  
ATOM 3562  H HA   . LEU A 1 104 ? 8.383   4.107   -1.804  1.00 0.00 ? 811 LEU A HA   2  
ATOM 3563  H HB2  . LEU A 1 104 ? 6.484   1.914   -1.083  1.00 0.00 ? 811 LEU A HB2  2  
ATOM 3564  H HB3  . LEU A 1 104 ? 6.091   3.458   -1.802  1.00 0.00 ? 811 LEU A HB3  2  
ATOM 3565  H HG   . LEU A 1 104 ? 7.609   1.193   -3.097  1.00 0.00 ? 811 LEU A HG   2  
ATOM 3566  H HD11 . LEU A 1 104 ? 4.924   2.361   -3.735  1.00 0.00 ? 811 LEU A HD11 2  
ATOM 3567  H HD12 . LEU A 1 104 ? 5.209   0.857   -2.871  1.00 0.00 ? 811 LEU A HD12 2  
ATOM 3568  H HD13 . LEU A 1 104 ? 5.702   1.008   -4.564  1.00 0.00 ? 811 LEU A HD13 2  
ATOM 3569  H HD21 . LEU A 1 104 ? 7.644   2.527   -5.125  1.00 0.00 ? 811 LEU A HD21 2  
ATOM 3570  H HD22 . LEU A 1 104 ? 8.473   3.381   -3.811  1.00 0.00 ? 811 LEU A HD22 2  
ATOM 3571  H HD23 . LEU A 1 104 ? 6.851   3.861   -4.291  1.00 0.00 ? 811 LEU A HD23 2  
ATOM 3572  N N    . VAL A 1 105 ? 7.617   4.957   0.347   1.00 0.00 ? 812 VAL A N    2  
ATOM 3573  C CA   . VAL A 1 105 ? 7.253   5.539   1.596   1.00 0.00 ? 812 VAL A CA   2  
ATOM 3574  C C    . VAL A 1 105 ? 5.955   6.285   1.402   1.00 0.00 ? 812 VAL A C    2  
ATOM 3575  O O    . VAL A 1 105 ? 5.760   6.922   0.393   1.00 0.00 ? 812 VAL A O    2  
ATOM 3576  C CB   . VAL A 1 105 ? 8.407   6.454   2.198   1.00 0.00 ? 812 VAL A CB   2  
ATOM 3577  C CG1  . VAL A 1 105 ? 9.203   7.140   1.111   1.00 0.00 ? 812 VAL A CG1  2  
ATOM 3578  C CG2  . VAL A 1 105 ? 7.875   7.515   3.164   1.00 0.00 ? 812 VAL A CG2  2  
ATOM 3579  H H    . VAL A 1 105 ? 7.635   5.549   -0.439  1.00 0.00 ? 812 VAL A H    2  
ATOM 3580  H HA   . VAL A 1 105 ? 7.073   4.701   2.248   1.00 0.00 ? 812 VAL A HA   2  
ATOM 3581  H HB   . VAL A 1 105 ? 9.083   5.811   2.742   1.00 0.00 ? 812 VAL A HB   2  
ATOM 3582  H HG11 . VAL A 1 105 ? 8.518   7.659   0.461   1.00 0.00 ? 812 VAL A HG11 2  
ATOM 3583  H HG12 . VAL A 1 105 ? 9.752   6.402   0.543   1.00 0.00 ? 812 VAL A HG12 2  
ATOM 3584  H HG13 . VAL A 1 105 ? 9.891   7.847   1.549   1.00 0.00 ? 812 VAL A HG13 2  
ATOM 3585  H HG21 . VAL A 1 105 ? 7.183   8.152   2.632   1.00 0.00 ? 812 VAL A HG21 2  
ATOM 3586  H HG22 . VAL A 1 105 ? 8.701   8.116   3.519   1.00 0.00 ? 812 VAL A HG22 2  
ATOM 3587  H HG23 . VAL A 1 105 ? 7.374   7.042   3.995   1.00 0.00 ? 812 VAL A HG23 2  
ATOM 3588  N N    . VAL A 1 106 ? 5.070   6.169   2.327   1.00 0.00 ? 813 VAL A N    2  
ATOM 3589  C CA   . VAL A 1 106 ? 3.800   6.831   2.241   1.00 0.00 ? 813 VAL A CA   2  
ATOM 3590  C C    . VAL A 1 106 ? 3.580   7.615   3.511   1.00 0.00 ? 813 VAL A C    2  
ATOM 3591  O O    . VAL A 1 106 ? 4.171   7.296   4.534   1.00 0.00 ? 813 VAL A O    2  
ATOM 3592  C CB   . VAL A 1 106 ? 2.625   5.808   1.954   1.00 0.00 ? 813 VAL A CB   2  
ATOM 3593  C CG1  . VAL A 1 106 ? 2.501   4.758   3.043   1.00 0.00 ? 813 VAL A CG1  2  
ATOM 3594  C CG2  . VAL A 1 106 ? 1.282   6.514   1.730   1.00 0.00 ? 813 VAL A CG2  2  
ATOM 3595  H H    . VAL A 1 106 ? 5.271   5.644   3.132   1.00 0.00 ? 813 VAL A H    2  
ATOM 3596  H HA   . VAL A 1 106 ? 3.861   7.537   1.429   1.00 0.00 ? 813 VAL A HA   2  
ATOM 3597  H HB   . VAL A 1 106 ? 2.884   5.284   1.044   1.00 0.00 ? 813 VAL A HB   2  
ATOM 3598  H HG11 . VAL A 1 106 ? 1.731   4.048   2.781   1.00 0.00 ? 813 VAL A HG11 2  
ATOM 3599  H HG12 . VAL A 1 106 ? 2.221   5.248   3.961   1.00 0.00 ? 813 VAL A HG12 2  
ATOM 3600  H HG13 . VAL A 1 106 ? 3.442   4.244   3.174   1.00 0.00 ? 813 VAL A HG13 2  
ATOM 3601  H HG21 . VAL A 1 106 ? 1.036   7.107   2.599   1.00 0.00 ? 813 VAL A HG21 2  
ATOM 3602  H HG22 . VAL A 1 106 ? 0.499   5.784   1.575   1.00 0.00 ? 813 VAL A HG22 2  
ATOM 3603  H HG23 . VAL A 1 106 ? 1.345   7.158   0.866   1.00 0.00 ? 813 VAL A HG23 2  
ATOM 3604  N N    . ASN A 1 107 ? 2.830   8.671   3.431   1.00 0.00 ? 814 ASN A N    2  
ATOM 3605  C CA   . ASN A 1 107 ? 2.475   9.415   4.609   1.00 0.00 ? 814 ASN A CA   2  
ATOM 3606  C C    . ASN A 1 107 ? 1.116   8.926   5.098   1.00 0.00 ? 814 ASN A C    2  
ATOM 3607  O O    . ASN A 1 107 ? 0.164   8.853   4.313   1.00 0.00 ? 814 ASN A O    2  
ATOM 3608  C CB   . ASN A 1 107 ? 2.455   10.924  4.331   1.00 0.00 ? 814 ASN A CB   2  
ATOM 3609  C CG   . ASN A 1 107 ? 3.816   11.502  3.938   1.00 0.00 ? 814 ASN A CG   2  
ATOM 3610  O OD1  . ASN A 1 107 ? 3.885   12.467  3.173   1.00 0.00 ? 814 ASN A OD1  2  
ATOM 3611  N ND2  . ASN A 1 107 ? 4.893   10.963  4.467   1.00 0.00 ? 814 ASN A ND2  2  
ATOM 3612  H H    . ASN A 1 107 ? 2.514   8.964   2.546   1.00 0.00 ? 814 ASN A H    2  
ATOM 3613  H HA   . ASN A 1 107 ? 3.211   9.192   5.366   1.00 0.00 ? 814 ASN A HA   2  
ATOM 3614  H HB2  . ASN A 1 107 ? 1.765   11.121  3.524   1.00 0.00 ? 814 ASN A HB2  2  
ATOM 3615  H HB3  . ASN A 1 107 ? 2.112   11.442  5.213   1.00 0.00 ? 814 ASN A HB3  2  
ATOM 3616  H HD21 . ASN A 1 107 ? 4.812   10.213  5.098   1.00 0.00 ? 814 ASN A HD21 2  
ATOM 3617  H HD22 . ASN A 1 107 ? 5.767   11.332  4.211   1.00 0.00 ? 814 ASN A HD22 2  
ATOM 3618  N N    . PRO A 1 108 ? 0.987   8.598   6.399   1.00 0.00 ? 815 PRO A N    2  
ATOM 3619  C CA   . PRO A 1 108 ? -0.240  7.997   6.976   1.00 0.00 ? 815 PRO A CA   2  
ATOM 3620  C C    . PRO A 1 108 ? -1.427  8.966   7.065   1.00 0.00 ? 815 PRO A C    2  
ATOM 3621  O O    . PRO A 1 108 ? -2.486  8.615   7.583   1.00 0.00 ? 815 PRO A O    2  
ATOM 3622  C CB   . PRO A 1 108 ? 0.207   7.572   8.376   1.00 0.00 ? 815 PRO A CB   2  
ATOM 3623  C CG   . PRO A 1 108 ? 1.302   8.515   8.717   1.00 0.00 ? 815 PRO A CG   2  
ATOM 3624  C CD   . PRO A 1 108 ? 2.033   8.777   7.433   1.00 0.00 ? 815 PRO A CD   2  
ATOM 3625  H HA   . PRO A 1 108 ? -0.542  7.125   6.416   1.00 0.00 ? 815 PRO A HA   2  
ATOM 3626  H HB2  . PRO A 1 108 ? -0.624  7.659   9.060   1.00 0.00 ? 815 PRO A HB2  2  
ATOM 3627  H HB3  . PRO A 1 108 ? 0.556   6.549   8.355   1.00 0.00 ? 815 PRO A HB3  2  
ATOM 3628  H HG2  . PRO A 1 108 ? 0.885   9.433   9.103   1.00 0.00 ? 815 PRO A HG2  2  
ATOM 3629  H HG3  . PRO A 1 108 ? 1.964   8.068   9.444   1.00 0.00 ? 815 PRO A HG3  2  
ATOM 3630  H HD2  . PRO A 1 108 ? 2.424   9.783   7.415   1.00 0.00 ? 815 PRO A HD2  2  
ATOM 3631  H HD3  . PRO A 1 108 ? 2.825   8.054   7.301   1.00 0.00 ? 815 PRO A HD3  2  
ATOM 3632  N N    . ASN A 1 109 ? -1.231  10.176  6.570   1.00 0.00 ? 816 ASN A N    2  
ATOM 3633  C CA   . ASN A 1 109 ? -2.273  11.201  6.526   1.00 0.00 ? 816 ASN A CA   2  
ATOM 3634  C C    . ASN A 1 109 ? -3.396  10.696  5.655   1.00 0.00 ? 816 ASN A C    2  
ATOM 3635  O O    . ASN A 1 109 ? -4.571  10.734  6.028   1.00 0.00 ? 816 ASN A O    2  
ATOM 3636  C CB   . ASN A 1 109 ? -1.742  12.514  5.905   1.00 0.00 ? 816 ASN A CB   2  
ATOM 3637  C CG   . ASN A 1 109 ? -0.531  13.113  6.603   1.00 0.00 ? 816 ASN A CG   2  
ATOM 3638  O OD1  . ASN A 1 109 ? 0.314   12.402  7.153   1.00 0.00 ? 816 ASN A OD1  2  
ATOM 3639  N ND2  . ASN A 1 109 ? -0.432  14.409  6.575   1.00 0.00 ? 816 ASN A ND2  2  
ATOM 3640  H H    . ASN A 1 109 ? -0.333  10.383  6.242   1.00 0.00 ? 816 ASN A H    2  
ATOM 3641  H HA   . ASN A 1 109 ? -2.630  11.390  7.528   1.00 0.00 ? 816 ASN A HA   2  
ATOM 3642  H HB2  . ASN A 1 109 ? -1.470  12.328  4.877   1.00 0.00 ? 816 ASN A HB2  2  
ATOM 3643  H HB3  . ASN A 1 109 ? -2.542  13.239  5.922   1.00 0.00 ? 816 ASN A HB3  2  
ATOM 3644  H HD21 . ASN A 1 109 ? -1.141  14.905  6.107   1.00 0.00 ? 816 ASN A HD21 2  
ATOM 3645  H HD22 . ASN A 1 109 ? 0.336   14.828  7.019   1.00 0.00 ? 816 ASN A HD22 2  
ATOM 3646  N N    . TYR A 1 110 ? -2.995  10.211  4.490   1.00 0.00 ? 817 TYR A N    2  
ATOM 3647  C CA   . TYR A 1 110 ? -3.871  9.637   3.475   1.00 0.00 ? 817 TYR A CA   2  
ATOM 3648  C C    . TYR A 1 110 ? -4.842  10.708  2.908   1.00 0.00 ? 817 TYR A C    2  
ATOM 3649  O O    . TYR A 1 110 ? -4.773  11.880  3.269   1.00 0.00 ? 817 TYR A O    2  
ATOM 3650  C CB   . TYR A 1 110 ? -4.602  8.367   4.014   1.00 0.00 ? 817 TYR A CB   2  
ATOM 3651  C CG   . TYR A 1 110 ? -5.082  7.443   2.917   1.00 0.00 ? 817 TYR A CG   2  
ATOM 3652  C CD1  . TYR A 1 110 ? -4.165  6.769   2.131   1.00 0.00 ? 817 TYR A CD1  2  
ATOM 3653  C CD2  . TYR A 1 110 ? -6.431  7.265   2.650   1.00 0.00 ? 817 TYR A CD2  2  
ATOM 3654  C CE1  . TYR A 1 110 ? -4.568  5.948   1.106   1.00 0.00 ? 817 TYR A CE1  2  
ATOM 3655  C CE2  . TYR A 1 110 ? -6.851  6.439   1.628   1.00 0.00 ? 817 TYR A CE2  2  
ATOM 3656  C CZ   . TYR A 1 110 ? -5.917  5.782   0.857   1.00 0.00 ? 817 TYR A CZ   2  
ATOM 3657  O OH   . TYR A 1 110 ? -6.337  4.978   -0.177  1.00 0.00 ? 817 TYR A OH   2  
ATOM 3658  H H    . TYR A 1 110 ? -2.033  10.257  4.313   1.00 0.00 ? 817 TYR A H    2  
ATOM 3659  H HA   . TYR A 1 110 ? -3.245  9.352   2.642   1.00 0.00 ? 817 TYR A HA   2  
ATOM 3660  H HB2  . TYR A 1 110 ? -3.924  7.809   4.643   1.00 0.00 ? 817 TYR A HB2  2  
ATOM 3661  H HB3  . TYR A 1 110 ? -5.458  8.674   4.597   1.00 0.00 ? 817 TYR A HB3  2  
ATOM 3662  H HD1  . TYR A 1 110 ? -3.111  6.899   2.328   1.00 0.00 ? 817 TYR A HD1  2  
ATOM 3663  H HD2  . TYR A 1 110 ? -7.160  7.783   3.257   1.00 0.00 ? 817 TYR A HD2  2  
ATOM 3664  H HE1  . TYR A 1 110 ? -3.807  5.454   0.519   1.00 0.00 ? 817 TYR A HE1  2  
ATOM 3665  H HE2  . TYR A 1 110 ? -7.904  6.311   1.433   1.00 0.00 ? 817 TYR A HE2  2  
ATOM 3666  H HH   . TYR A 1 110 ? -6.107  4.069   0.060   1.00 0.00 ? 817 TYR A HH   2  
ATOM 3667  N N    . LEU A 1 111 ? -5.709  10.305  2.017   1.00 0.00 ? 818 LEU A N    2  
ATOM 3668  C CA   . LEU A 1 111 ? -6.608  11.220  1.342   1.00 0.00 ? 818 LEU A CA   2  
ATOM 3669  C C    . LEU A 1 111 ? -8.075  10.902  1.614   1.00 0.00 ? 818 LEU A C    2  
ATOM 3670  O O    . LEU A 1 111 ? -8.976  11.489  1.000   1.00 0.00 ? 818 LEU A O    2  
ATOM 3671  C CB   . LEU A 1 111 ? -6.308  11.291  -0.198  1.00 0.00 ? 818 LEU A CB   2  
ATOM 3672  C CG   . LEU A 1 111 ? -6.150  9.962   -1.039  1.00 0.00 ? 818 LEU A CG   2  
ATOM 3673  C CD1  . LEU A 1 111 ? -4.860  9.216   -0.725  1.00 0.00 ? 818 LEU A CD1  2  
ATOM 3674  C CD2  . LEU A 1 111 ? -7.343  9.029   -0.891  1.00 0.00 ? 818 LEU A CD2  2  
ATOM 3675  H H    . LEU A 1 111 ? -5.757  9.355   1.789   1.00 0.00 ? 818 LEU A H    2  
ATOM 3676  H HA   . LEU A 1 111 ? -6.406  12.194  1.762   1.00 0.00 ? 818 LEU A HA   2  
ATOM 3677  H HB2  . LEU A 1 111 ? -7.106  11.857  -0.652  1.00 0.00 ? 818 LEU A HB2  2  
ATOM 3678  H HB3  . LEU A 1 111 ? -5.400  11.863  -0.316  1.00 0.00 ? 818 LEU A HB3  2  
ATOM 3679  H HG   . LEU A 1 111 ? -6.079  10.251  -2.078  1.00 0.00 ? 818 LEU A HG   2  
ATOM 3680  H HD11 . LEU A 1 111 ? -4.016  9.858   -0.928  1.00 0.00 ? 818 LEU A HD11 2  
ATOM 3681  H HD12 . LEU A 1 111 ? -4.793  8.336   -1.346  1.00 0.00 ? 818 LEU A HD12 2  
ATOM 3682  H HD13 . LEU A 1 111 ? -4.848  8.923   0.313   1.00 0.00 ? 818 LEU A HD13 2  
ATOM 3683  H HD21 . LEU A 1 111 ? -7.192  8.147   -1.493  1.00 0.00 ? 818 LEU A HD21 2  
ATOM 3684  H HD22 . LEU A 1 111 ? -8.247  9.537   -1.194  1.00 0.00 ? 818 LEU A HD22 2  
ATOM 3685  H HD23 . LEU A 1 111 ? -7.416  8.746   0.149   1.00 0.00 ? 818 LEU A HD23 2  
ATOM 3686  N N    . LEU A 1 112 ? -8.311  10.000  2.538   1.00 0.00 ? 819 LEU A N    2  
ATOM 3687  C CA   . LEU A 1 112 ? -9.653  9.580   2.856   1.00 0.00 ? 819 LEU A CA   2  
ATOM 3688  C C    . LEU A 1 112 ? -9.663  9.235   4.327   1.00 0.00 ? 819 LEU A C    2  
ATOM 3689  O O    . LEU A 1 112 ? -8.608  8.914   4.887   1.00 0.00 ? 819 LEU A O    2  
ATOM 3690  C CB   . LEU A 1 112 ? -10.046 8.356   2.004   1.00 0.00 ? 819 LEU A CB   2  
ATOM 3691  C CG   . LEU A 1 112 ? -11.525 8.085   1.811   1.00 0.00 ? 819 LEU A CG   2  
ATOM 3692  C CD1  . LEU A 1 112 ? -12.200 9.276   1.134   1.00 0.00 ? 819 LEU A CD1  2  
ATOM 3693  C CD2  . LEU A 1 112 ? -11.685 6.839   0.961   1.00 0.00 ? 819 LEU A CD2  2  
ATOM 3694  H H    . LEU A 1 112 ? -7.583  9.629   3.079   1.00 0.00 ? 819 LEU A H    2  
ATOM 3695  H HA   . LEU A 1 112 ? -10.328 10.400  2.664   1.00 0.00 ? 819 LEU A HA   2  
ATOM 3696  H HB2  . LEU A 1 112 ? -9.631  8.438   1.013   1.00 0.00 ? 819 LEU A HB2  2  
ATOM 3697  H HB3  . LEU A 1 112 ? -9.653  7.470   2.480   1.00 0.00 ? 819 LEU A HB3  2  
ATOM 3698  H HG   . LEU A 1 112 ? -11.995 7.907   2.766   1.00 0.00 ? 819 LEU A HG   2  
ATOM 3699  H HD11 . LEU A 1 112 ? -13.238 9.042   0.948   1.00 0.00 ? 819 LEU A HD11 2  
ATOM 3700  H HD12 . LEU A 1 112 ? -11.705 9.487   0.197   1.00 0.00 ? 819 LEU A HD12 2  
ATOM 3701  H HD13 . LEU A 1 112 ? -12.140 10.142  1.776   1.00 0.00 ? 819 LEU A HD13 2  
ATOM 3702  H HD21 . LEU A 1 112 ? -11.202 6.993   0.007   1.00 0.00 ? 819 LEU A HD21 2  
ATOM 3703  H HD22 . LEU A 1 112 ? -12.733 6.632   0.802   1.00 0.00 ? 819 LEU A HD22 2  
ATOM 3704  H HD23 . LEU A 1 112 ? -11.223 6.000   1.460   1.00 0.00 ? 819 LEU A HD23 2  
ATOM 3705  N N    . GLU A 1 113 ? -10.815 9.302   4.943   1.00 0.00 ? 820 GLU A N    2  
ATOM 3706  C CA   . GLU A 1 113 ? -10.944 9.079   6.377   1.00 0.00 ? 820 GLU A CA   2  
ATOM 3707  C C    . GLU A 1 113 ? -10.914 7.598   6.732   1.00 0.00 ? 820 GLU A C    2  
ATOM 3708  O O    . GLU A 1 113 ? -10.587 7.229   7.875   1.00 0.00 ? 820 GLU A O    2  
ATOM 3709  C CB   . GLU A 1 113 ? -12.228 9.713   6.863   1.00 0.00 ? 820 GLU A CB   2  
ATOM 3710  C CG   . GLU A 1 113 ? -12.276 11.206  6.633   1.00 0.00 ? 820 GLU A CG   2  
ATOM 3711  C CD   . GLU A 1 113 ? -13.649 11.765  6.812   1.00 0.00 ? 820 GLU A CD   2  
ATOM 3712  O OE1  . GLU A 1 113 ? -14.053 12.059  7.944   1.00 0.00 ? 820 GLU A OE1  2  
ATOM 3713  O OE2  . GLU A 1 113 ? -14.349 11.935  5.799   1.00 0.00 ? 820 GLU A OE2  2  
ATOM 3714  H H    . GLU A 1 113 ? -11.625 9.511   4.430   1.00 0.00 ? 820 GLU A H    2  
ATOM 3715  H HA   . GLU A 1 113 ? -10.117 9.572   6.868   1.00 0.00 ? 820 GLU A HA   2  
ATOM 3716  H HB2  . GLU A 1 113 ? -13.056 9.258   6.341   1.00 0.00 ? 820 GLU A HB2  2  
ATOM 3717  H HB3  . GLU A 1 113 ? -12.333 9.528   7.922   1.00 0.00 ? 820 GLU A HB3  2  
ATOM 3718  H HG2  . GLU A 1 113 ? -11.611 11.693  7.330   1.00 0.00 ? 820 GLU A HG2  2  
ATOM 3719  H HG3  . GLU A 1 113 ? -11.946 11.410  5.624   1.00 0.00 ? 820 GLU A HG3  2  
ATOM 3720  N N    . ASP A 1 114 ? -11.229 6.760   5.771   1.00 0.00 ? 821 ASP A N    2  
ATOM 3721  C CA   . ASP A 1 114 ? -11.270 5.323   5.974   1.00 0.00 ? 821 ASP A CA   2  
ATOM 3722  C C    . ASP A 1 114 ? -10.591 4.617   4.832   1.00 0.00 ? 821 ASP A C    2  
ATOM 3723  O O    . ASP A 1 114 ? -11.267 4.286   3.851   1.00 0.00 ? 821 ASP A O    2  
ATOM 3724  C CB   . ASP A 1 114 ? -12.713 4.807   6.132   1.00 0.00 ? 821 ASP A CB   2  
ATOM 3725  C CG   . ASP A 1 114 ? -13.365 5.237   7.416   1.00 0.00 ? 821 ASP A CG   2  
ATOM 3726  O OD1  . ASP A 1 114 ? -13.186 4.547   8.448   1.00 0.00 ? 821 ASP A OD1  2  
ATOM 3727  O OD2  . ASP A 1 114 ? -14.087 6.265   7.433   1.00 0.00 ? 821 ASP A OD2  2  
ATOM 3728  O OXT  . ASP A 1 114 ? -9.365  4.408   4.921   1.00 0.00 ? 821 ASP A OXT  2  
ATOM 3729  H H    . ASP A 1 114 ? -11.424 7.083   4.868   1.00 0.00 ? 821 ASP A H    2  
ATOM 3730  H HA   . ASP A 1 114 ? -10.726 5.111   6.880   1.00 0.00 ? 821 ASP A HA   2  
ATOM 3731  H HB2  . ASP A 1 114 ? -13.307 5.184   5.313   1.00 0.00 ? 821 ASP A HB2  2  
ATOM 3732  H HB3  . ASP A 1 114 ? -12.704 3.728   6.091   1.00 0.00 ? 821 ASP A HB3  2  
ATOM 3733  N N    . ALA A 1 1   ? -18.781 12.115  -9.880  1.00 0.00 ? 708 ALA A N    3  
ATOM 3734  C CA   . ALA A 1 1   ? -17.517 11.662  -10.391 1.00 0.00 ? 708 ALA A CA   3  
ATOM 3735  C C    . ALA A 1 1   ? -17.467 10.141  -10.316 1.00 0.00 ? 708 ALA A C    3  
ATOM 3736  O O    . ALA A 1 1   ? -18.155 9.548   -9.487  1.00 0.00 ? 708 ALA A O    3  
ATOM 3737  C CB   . ALA A 1 1   ? -16.387 12.270  -9.561  1.00 0.00 ? 708 ALA A CB   3  
ATOM 3738  H H1   . ALA A 1 1   ? -18.896 12.225  -8.912  1.00 0.00 ? 708 ALA A H1   3  
ATOM 3739  H HA   . ALA A 1 1   ? -17.409 11.981  -11.417 1.00 0.00 ? 708 ALA A HA   3  
ATOM 3740  H HB1  . ALA A 1 1   ? -16.429 13.348  -9.620  1.00 0.00 ? 708 ALA A HB1  3  
ATOM 3741  H HB2  . ALA A 1 1   ? -15.437 11.926  -9.940  1.00 0.00 ? 708 ALA A HB2  3  
ATOM 3742  H HB3  . ALA A 1 1   ? -16.491 11.963  -8.531  1.00 0.00 ? 708 ALA A HB3  3  
ATOM 3743  N N    . PRO A 1 2   ? -16.676 9.482   -11.177 1.00 0.00 ? 709 PRO A N    3  
ATOM 3744  C CA   . PRO A 1 2   ? -16.495 8.018   -11.137 1.00 0.00 ? 709 PRO A CA   3  
ATOM 3745  C C    . PRO A 1 2   ? -15.430 7.627   -10.099 1.00 0.00 ? 709 PRO A C    3  
ATOM 3746  O O    . PRO A 1 2   ? -14.885 6.529   -10.117 1.00 0.00 ? 709 PRO A O    3  
ATOM 3747  C CB   . PRO A 1 2   ? -16.003 7.706   -12.550 1.00 0.00 ? 709 PRO A CB   3  
ATOM 3748  C CG   . PRO A 1 2   ? -15.223 8.914   -12.942 1.00 0.00 ? 709 PRO A CG   3  
ATOM 3749  C CD   . PRO A 1 2   ? -15.918 10.089  -12.302 1.00 0.00 ? 709 PRO A CD   3  
ATOM 3750  H HA   . PRO A 1 2   ? -17.421 7.501   -10.932 1.00 0.00 ? 709 PRO A HA   3  
ATOM 3751  H HB2  . PRO A 1 2   ? -15.388 6.818   -12.528 1.00 0.00 ? 709 PRO A HB2  3  
ATOM 3752  H HB3  . PRO A 1 2   ? -16.848 7.552   -13.203 1.00 0.00 ? 709 PRO A HB3  3  
ATOM 3753  H HG2  . PRO A 1 2   ? -14.210 8.829   -12.573 1.00 0.00 ? 709 PRO A HG2  3  
ATOM 3754  H HG3  . PRO A 1 2   ? -15.221 9.018   -14.016 1.00 0.00 ? 709 PRO A HG3  3  
ATOM 3755  H HD2  . PRO A 1 2   ? -15.198 10.803  -11.933 1.00 0.00 ? 709 PRO A HD2  3  
ATOM 3756  H HD3  . PRO A 1 2   ? -16.591 10.556  -13.006 1.00 0.00 ? 709 PRO A HD3  3  
ATOM 3757  N N    . LYS A 1 3   ? -15.154 8.549   -9.215  1.00 0.00 ? 710 LYS A N    3  
ATOM 3758  C CA   . LYS A 1 3   ? -14.188 8.374   -8.175  1.00 0.00 ? 710 LYS A CA   3  
ATOM 3759  C C    . LYS A 1 3   ? -14.875 7.919   -6.916  1.00 0.00 ? 710 LYS A C    3  
ATOM 3760  O O    . LYS A 1 3   ? -16.110 8.007   -6.809  1.00 0.00 ? 710 LYS A O    3  
ATOM 3761  C CB   . LYS A 1 3   ? -13.461 9.695   -7.899  1.00 0.00 ? 710 LYS A CB   3  
ATOM 3762  C CG   . LYS A 1 3   ? -12.581 10.193  -9.030  1.00 0.00 ? 710 LYS A CG   3  
ATOM 3763  C CD   . LYS A 1 3   ? -11.402 9.262   -9.263  1.00 0.00 ? 710 LYS A CD   3  
ATOM 3764  C CE   . LYS A 1 3   ? -10.450 9.824   -10.298 1.00 0.00 ? 710 LYS A CE   3  
ATOM 3765  N NZ   . LYS A 1 3   ? -9.306  8.923   -10.552 1.00 0.00 ? 710 LYS A NZ   3  
ATOM 3766  H H    . LYS A 1 3   ? -15.670 9.377   -9.262  1.00 0.00 ? 710 LYS A H    3  
ATOM 3767  H HA   . LYS A 1 3   ? -13.461 7.638   -8.484  1.00 0.00 ? 710 LYS A HA   3  
ATOM 3768  H HB2  . LYS A 1 3   ? -14.200 10.456  -7.694  1.00 0.00 ? 710 LYS A HB2  3  
ATOM 3769  H HB3  . LYS A 1 3   ? -12.846 9.568   -7.021  1.00 0.00 ? 710 LYS A HB3  3  
ATOM 3770  H HG2  . LYS A 1 3   ? -13.174 10.239  -9.932  1.00 0.00 ? 710 LYS A HG2  3  
ATOM 3771  H HG3  . LYS A 1 3   ? -12.217 11.180  -8.788  1.00 0.00 ? 710 LYS A HG3  3  
ATOM 3772  H HD2  . LYS A 1 3   ? -10.868 9.127   -8.335  1.00 0.00 ? 710 LYS A HD2  3  
ATOM 3773  H HD3  . LYS A 1 3   ? -11.771 8.307   -9.609  1.00 0.00 ? 710 LYS A HD3  3  
ATOM 3774  H HE2  . LYS A 1 3   ? -11.000 9.967   -11.214 1.00 0.00 ? 710 LYS A HE2  3  
ATOM 3775  H HE3  . LYS A 1 3   ? -10.081 10.778  -9.952  1.00 0.00 ? 710 LYS A HE3  3  
ATOM 3776  H HZ1  . LYS A 1 3   ? -8.655  9.365   -11.231 1.00 0.00 ? 710 LYS A HZ1  3  
ATOM 3777  H HZ2  . LYS A 1 3   ? -9.614  8.008   -10.940 1.00 0.00 ? 710 LYS A HZ2  3  
ATOM 3778  H HZ3  . LYS A 1 3   ? -8.770  8.733   -9.681  1.00 0.00 ? 710 LYS A HZ3  3  
ATOM 3779  N N    . ALA A 1 4   ? -14.075 7.447   -5.988  1.00 0.00 ? 711 ALA A N    3  
ATOM 3780  C CA   . ALA A 1 4   ? -14.501 7.004   -4.678  1.00 0.00 ? 711 ALA A CA   3  
ATOM 3781  C C    . ALA A 1 4   ? -15.274 5.700   -4.716  1.00 0.00 ? 711 ALA A C    3  
ATOM 3782  O O    . ALA A 1 4   ? -16.496 5.669   -4.924  1.00 0.00 ? 711 ALA A O    3  
ATOM 3783  C CB   . ALA A 1 4   ? -15.230 8.091   -3.883  1.00 0.00 ? 711 ALA A CB   3  
ATOM 3784  H H    . ALA A 1 4   ? -13.125 7.356   -6.211  1.00 0.00 ? 711 ALA A H    3  
ATOM 3785  H HA   . ALA A 1 4   ? -13.583 6.780   -4.153  1.00 0.00 ? 711 ALA A HA   3  
ATOM 3786  H HB1  . ALA A 1 4   ? -14.644 8.998   -3.889  1.00 0.00 ? 711 ALA A HB1  3  
ATOM 3787  H HB2  . ALA A 1 4   ? -15.365 7.761   -2.862  1.00 0.00 ? 711 ALA A HB2  3  
ATOM 3788  H HB3  . ALA A 1 4   ? -16.194 8.277   -4.332  1.00 0.00 ? 711 ALA A HB3  3  
ATOM 3789  N N    . SER A 1 5   ? -14.547 4.625   -4.548  1.00 0.00 ? 712 SER A N    3  
ATOM 3790  C CA   . SER A 1 5   ? -15.125 3.327   -4.419  1.00 0.00 ? 712 SER A CA   3  
ATOM 3791  C C    . SER A 1 5   ? -15.641 3.256   -2.994  1.00 0.00 ? 712 SER A C    3  
ATOM 3792  O O    . SER A 1 5   ? -16.736 2.722   -2.722  1.00 0.00 ? 712 SER A O    3  
ATOM 3793  C CB   . SER A 1 5   ? -14.061 2.243   -4.687  1.00 0.00 ? 712 SER A CB   3  
ATOM 3794  O OG   . SER A 1 5   ? -14.611 0.928   -4.636  1.00 0.00 ? 712 SER A OG   3  
ATOM 3795  H H    . SER A 1 5   ? -13.568 4.709   -4.468  1.00 0.00 ? 712 SER A H    3  
ATOM 3796  H HA   . SER A 1 5   ? -15.945 3.237   -5.116  1.00 0.00 ? 712 SER A HA   3  
ATOM 3797  H HB2  . SER A 1 5   ? -13.637 2.400   -5.668  1.00 0.00 ? 712 SER A HB2  3  
ATOM 3798  H HB3  . SER A 1 5   ? -13.277 2.326   -3.948  1.00 0.00 ? 712 SER A HB3  3  
ATOM 3799  H HG   . SER A 1 5   ? -15.486 0.975   -4.230  1.00 0.00 ? 712 SER A HG   3  
ATOM 3800  N N    . LEU A 1 6   ? -14.860 3.848   -2.083  1.00 0.00 ? 713 LEU A N    3  
ATOM 3801  C CA   . LEU A 1 6   ? -15.246 4.013   -0.717  1.00 0.00 ? 713 LEU A CA   3  
ATOM 3802  C C    . LEU A 1 6   ? -16.243 5.156   -0.672  1.00 0.00 ? 713 LEU A C    3  
ATOM 3803  O O    . LEU A 1 6   ? -15.897 6.319   -0.445  1.00 0.00 ? 713 LEU A O    3  
ATOM 3804  C CB   . LEU A 1 6   ? -14.007 4.237   0.203   1.00 0.00 ? 713 LEU A CB   3  
ATOM 3805  C CG   . LEU A 1 6   ? -14.201 4.026   1.731   1.00 0.00 ? 713 LEU A CG   3  
ATOM 3806  C CD1  . LEU A 1 6   ? -12.867 3.909   2.425   1.00 0.00 ? 713 LEU A CD1  3  
ATOM 3807  C CD2  . LEU A 1 6   ? -14.990 5.151   2.375   1.00 0.00 ? 713 LEU A CD2  3  
ATOM 3808  H H    . LEU A 1 6   ? -13.967 4.167   -2.368  1.00 0.00 ? 713 LEU A H    3  
ATOM 3809  H HA   . LEU A 1 6   ? -15.773 3.121   -0.416  1.00 0.00 ? 713 LEU A HA   3  
ATOM 3810  H HB2  . LEU A 1 6   ? -13.223 3.572   -0.128  1.00 0.00 ? 713 LEU A HB2  3  
ATOM 3811  H HB3  . LEU A 1 6   ? -13.668 5.251   0.050   1.00 0.00 ? 713 LEU A HB3  3  
ATOM 3812  H HG   . LEU A 1 6   ? -14.733 3.100   1.891   1.00 0.00 ? 713 LEU A HG   3  
ATOM 3813  H HD11 . LEU A 1 6   ? -12.293 4.807   2.259   1.00 0.00 ? 713 LEU A HD11 3  
ATOM 3814  H HD12 . LEU A 1 6   ? -12.335 3.049   2.046   1.00 0.00 ? 713 LEU A HD12 3  
ATOM 3815  H HD13 . LEU A 1 6   ? -13.051 3.787   3.483   1.00 0.00 ? 713 LEU A HD13 3  
ATOM 3816  H HD21 . LEU A 1 6   ? -15.084 4.965   3.436   1.00 0.00 ? 713 LEU A HD21 3  
ATOM 3817  H HD22 . LEU A 1 6   ? -15.973 5.188   1.929   1.00 0.00 ? 713 LEU A HD22 3  
ATOM 3818  H HD23 . LEU A 1 6   ? -14.483 6.090   2.214   1.00 0.00 ? 713 LEU A HD23 3  
ATOM 3819  N N    . ARG A 1 7   ? -17.450 4.794   -1.021  1.00 0.00 ? 714 ARG A N    3  
ATOM 3820  C CA   . ARG A 1 7   ? -18.599 5.650   -1.125  1.00 0.00 ? 714 ARG A CA   3  
ATOM 3821  C C    . ARG A 1 7   ? -19.785 4.760   -1.506  1.00 0.00 ? 714 ARG A C    3  
ATOM 3822  O O    . ARG A 1 7   ? -20.885 4.950   -1.032  1.00 0.00 ? 714 ARG A O    3  
ATOM 3823  C CB   . ARG A 1 7   ? -18.380 6.728   -2.208  1.00 0.00 ? 714 ARG A CB   3  
ATOM 3824  C CG   . ARG A 1 7   ? -19.545 7.690   -2.412  1.00 0.00 ? 714 ARG A CG   3  
ATOM 3825  C CD   . ARG A 1 7   ? -19.776 8.604   -1.217  1.00 0.00 ? 714 ARG A CD   3  
ATOM 3826  N NE   . ARG A 1 7   ? -20.926 9.483   -1.453  1.00 0.00 ? 714 ARG A NE   3  
ATOM 3827  C CZ   . ARG A 1 7   ? -21.013 10.782  -1.128  1.00 0.00 ? 714 ARG A CZ   3  
ATOM 3828  N NH1  . ARG A 1 7   ? -20.034 11.394  -0.474  1.00 0.00 ? 714 ARG A NH1  3  
ATOM 3829  N NH2  . ARG A 1 7   ? -22.090 11.469  -1.466  1.00 0.00 ? 714 ARG A NH2  3  
ATOM 3830  H H    . ARG A 1 7   ? -17.565 3.845   -1.241  1.00 0.00 ? 714 ARG A H    3  
ATOM 3831  H HA   . ARG A 1 7   ? -18.778 6.114   -0.166  1.00 0.00 ? 714 ARG A HA   3  
ATOM 3832  H HB2  . ARG A 1 7   ? -17.513 7.312   -1.938  1.00 0.00 ? 714 ARG A HB2  3  
ATOM 3833  H HB3  . ARG A 1 7   ? -18.178 6.236   -3.149  1.00 0.00 ? 714 ARG A HB3  3  
ATOM 3834  H HG2  . ARG A 1 7   ? -19.350 8.306   -3.277  1.00 0.00 ? 714 ARG A HG2  3  
ATOM 3835  H HG3  . ARG A 1 7   ? -20.437 7.109   -2.586  1.00 0.00 ? 714 ARG A HG3  3  
ATOM 3836  H HD2  . ARG A 1 7   ? -19.966 7.996   -0.346  1.00 0.00 ? 714 ARG A HD2  3  
ATOM 3837  H HD3  . ARG A 1 7   ? -18.895 9.209   -1.056  1.00 0.00 ? 714 ARG A HD3  3  
ATOM 3838  H HE   . ARG A 1 7   ? -21.671 9.031   -1.914  1.00 0.00 ? 714 ARG A HE   3  
ATOM 3839  H HH11 . ARG A 1 7   ? -19.183 10.928  -0.190  1.00 0.00 ? 714 ARG A HH11 3  
ATOM 3840  H HH12 . ARG A 1 7   ? -20.072 12.363  -0.224  1.00 0.00 ? 714 ARG A HH12 3  
ATOM 3841  H HH21 . ARG A 1 7   ? -22.851 11.044  -1.966  1.00 0.00 ? 714 ARG A HH21 3  
ATOM 3842  H HH22 . ARG A 1 7   ? -22.192 12.444  -1.258  1.00 0.00 ? 714 ARG A HH22 3  
ATOM 3843  N N    . LEU A 1 8   ? -19.529 3.761   -2.365  1.00 0.00 ? 715 LEU A N    3  
ATOM 3844  C CA   . LEU A 1 8   ? -20.582 2.835   -2.798  1.00 0.00 ? 715 LEU A CA   3  
ATOM 3845  C C    . LEU A 1 8   ? -20.408 1.451   -2.155  1.00 0.00 ? 715 LEU A C    3  
ATOM 3846  O O    . LEU A 1 8   ? -21.078 1.137   -1.170  1.00 0.00 ? 715 LEU A O    3  
ATOM 3847  C CB   . LEU A 1 8   ? -20.681 2.710   -4.345  1.00 0.00 ? 715 LEU A CB   3  
ATOM 3848  C CG   . LEU A 1 8   ? -21.164 3.943   -5.148  1.00 0.00 ? 715 LEU A CG   3  
ATOM 3849  C CD1  . LEU A 1 8   ? -20.160 5.079   -5.122  1.00 0.00 ? 715 LEU A CD1  3  
ATOM 3850  C CD2  . LEU A 1 8   ? -21.475 3.553   -6.580  1.00 0.00 ? 715 LEU A CD2  3  
ATOM 3851  H H    . LEU A 1 8   ? -18.626 3.636   -2.729  1.00 0.00 ? 715 LEU A H    3  
ATOM 3852  H HA   . LEU A 1 8   ? -21.509 3.243   -2.422  1.00 0.00 ? 715 LEU A HA   3  
ATOM 3853  H HB2  . LEU A 1 8   ? -19.700 2.455   -4.712  1.00 0.00 ? 715 LEU A HB2  3  
ATOM 3854  H HB3  . LEU A 1 8   ? -21.348 1.889   -4.565  1.00 0.00 ? 715 LEU A HB3  3  
ATOM 3855  H HG   . LEU A 1 8   ? -22.078 4.308   -4.702  1.00 0.00 ? 715 LEU A HG   3  
ATOM 3856  H HD11 . LEU A 1 8   ? -20.008 5.395   -4.101  1.00 0.00 ? 715 LEU A HD11 3  
ATOM 3857  H HD12 . LEU A 1 8   ? -20.527 5.905   -5.713  1.00 0.00 ? 715 LEU A HD12 3  
ATOM 3858  H HD13 . LEU A 1 8   ? -19.222 4.734   -5.532  1.00 0.00 ? 715 LEU A HD13 3  
ATOM 3859  H HD21 . LEU A 1 8   ? -22.247 2.801   -6.592  1.00 0.00 ? 715 LEU A HD21 3  
ATOM 3860  H HD22 . LEU A 1 8   ? -20.582 3.158   -7.042  1.00 0.00 ? 715 LEU A HD22 3  
ATOM 3861  H HD23 . LEU A 1 8   ? -21.811 4.422   -7.128  1.00 0.00 ? 715 LEU A HD23 3  
ATOM 3862  N N    . GLY A 1 9   ? -19.509 0.647   -2.693  1.00 0.00 ? 716 GLY A N    3  
ATOM 3863  C CA   . GLY A 1 9   ? -19.234 -0.675  -2.149  1.00 0.00 ? 716 GLY A CA   3  
ATOM 3864  C C    . GLY A 1 9   ? -17.779 -0.762  -1.806  1.00 0.00 ? 716 GLY A C    3  
ATOM 3865  O O    . GLY A 1 9   ? -16.926 -0.724  -2.704  1.00 0.00 ? 716 GLY A O    3  
ATOM 3866  H H    . GLY A 1 9   ? -18.987 0.925   -3.480  1.00 0.00 ? 716 GLY A H    3  
ATOM 3867  H HA2  . GLY A 1 9   ? -19.829 -0.829  -1.261  1.00 0.00 ? 716 GLY A HA2  3  
ATOM 3868  H HA3  . GLY A 1 9   ? -19.470 -1.429  -2.884  1.00 0.00 ? 716 GLY A HA3  3  
ATOM 3869  N N    . PHE A 1 10  ? -17.464 -0.858  -0.534  1.00 0.00 ? 717 PHE A N    3  
ATOM 3870  C CA   . PHE A 1 10  ? -16.084 -0.721  -0.129  1.00 0.00 ? 717 PHE A CA   3  
ATOM 3871  C C    . PHE A 1 10  ? -15.713 -1.471  1.142   1.00 0.00 ? 717 PHE A C    3  
ATOM 3872  O O    . PHE A 1 10  ? -14.693 -1.146  1.752   1.00 0.00 ? 717 PHE A O    3  
ATOM 3873  C CB   . PHE A 1 10  ? -15.801 0.768   0.069   1.00 0.00 ? 717 PHE A CB   3  
ATOM 3874  C CG   . PHE A 1 10  ? -16.736 1.475   1.058   1.00 0.00 ? 717 PHE A CG   3  
ATOM 3875  C CD1  . PHE A 1 10  ? -16.423 1.541   2.403   1.00 0.00 ? 717 PHE A CD1  3  
ATOM 3876  C CD2  . PHE A 1 10  ? -17.903 2.084   0.628   1.00 0.00 ? 717 PHE A CD2  3  
ATOM 3877  C CE1  . PHE A 1 10  ? -17.241 2.193   3.296   1.00 0.00 ? 717 PHE A CE1  3  
ATOM 3878  C CE2  . PHE A 1 10  ? -18.732 2.736   1.521   1.00 0.00 ? 717 PHE A CE2  3  
ATOM 3879  C CZ   . PHE A 1 10  ? -18.393 2.791   2.857   1.00 0.00 ? 717 PHE A CZ   3  
ATOM 3880  H H    . PHE A 1 10  ? -18.165 -0.999  0.141   1.00 0.00 ? 717 PHE A H    3  
ATOM 3881  H HA   . PHE A 1 10  ? -15.454 -1.046  -0.941  1.00 0.00 ? 717 PHE A HA   3  
ATOM 3882  H HB2  . PHE A 1 10  ? -14.788 0.895   0.418   1.00 0.00 ? 717 PHE A HB2  3  
ATOM 3883  H HB3  . PHE A 1 10  ? -15.911 1.245   -0.895  1.00 0.00 ? 717 PHE A HB3  3  
ATOM 3884  H HD1  . PHE A 1 10  ? -15.518 1.073   2.757   1.00 0.00 ? 717 PHE A HD1  3  
ATOM 3885  H HD2  . PHE A 1 10  ? -18.170 2.043   -0.418  1.00 0.00 ? 717 PHE A HD2  3  
ATOM 3886  H HE1  . PHE A 1 10  ? -16.976 2.232   4.341   1.00 0.00 ? 717 PHE A HE1  3  
ATOM 3887  H HE2  . PHE A 1 10  ? -19.639 3.208   1.173   1.00 0.00 ? 717 PHE A HE2  3  
ATOM 3888  H HZ   . PHE A 1 10  ? -19.022 3.303   3.567   1.00 0.00 ? 717 PHE A HZ   3  
ATOM 3889  N N    . SER A 1 11  ? -16.470 -2.471  1.526   1.00 0.00 ? 718 SER A N    3  
ATOM 3890  C CA   . SER A 1 11  ? -16.186 -3.189  2.766   1.00 0.00 ? 718 SER A CA   3  
ATOM 3891  C C    . SER A 1 11  ? -14.768 -3.816  2.776   1.00 0.00 ? 718 SER A C    3  
ATOM 3892  O O    . SER A 1 11  ? -14.026 -3.698  3.763   1.00 0.00 ? 718 SER A O    3  
ATOM 3893  C CB   . SER A 1 11  ? -17.286 -4.210  3.049   1.00 0.00 ? 718 SER A CB   3  
ATOM 3894  O OG   . SER A 1 11  ? -17.635 -4.937  1.873   1.00 0.00 ? 718 SER A OG   3  
ATOM 3895  H H    . SER A 1 11  ? -17.226 -2.767  0.978   1.00 0.00 ? 718 SER A H    3  
ATOM 3896  H HA   . SER A 1 11  ? -16.200 -2.444  3.548   1.00 0.00 ? 718 SER A HA   3  
ATOM 3897  H HB2  . SER A 1 11  ? -16.941 -4.907  3.798   1.00 0.00 ? 718 SER A HB2  3  
ATOM 3898  H HB3  . SER A 1 11  ? -18.161 -3.694  3.415   1.00 0.00 ? 718 SER A HB3  3  
ATOM 3899  H HG   . SER A 1 11  ? -18.500 -5.318  2.078   1.00 0.00 ? 718 SER A HG   3  
ATOM 3900  N N    . GLU A 1 12  ? -14.389 -4.419  1.673   1.00 0.00 ? 719 GLU A N    3  
ATOM 3901  C CA   . GLU A 1 12  ? -13.063 -5.002  1.520   1.00 0.00 ? 719 GLU A CA   3  
ATOM 3902  C C    . GLU A 1 12  ? -12.025 -3.918  1.285   1.00 0.00 ? 719 GLU A C    3  
ATOM 3903  O O    . GLU A 1 12  ? -10.943 -3.963  1.862   1.00 0.00 ? 719 GLU A O    3  
ATOM 3904  C CB   . GLU A 1 12  ? -13.026 -6.087  0.413   1.00 0.00 ? 719 GLU A CB   3  
ATOM 3905  C CG   . GLU A 1 12  ? -13.225 -5.598  -1.033  1.00 0.00 ? 719 GLU A CG   3  
ATOM 3906  C CD   . GLU A 1 12  ? -14.516 -4.858  -1.251  1.00 0.00 ? 719 GLU A CD   3  
ATOM 3907  O OE1  . GLU A 1 12  ? -15.531 -5.494  -1.548  1.00 0.00 ? 719 GLU A OE1  3  
ATOM 3908  O OE2  . GLU A 1 12  ? -14.533 -3.629  -1.103  1.00 0.00 ? 719 GLU A OE2  3  
ATOM 3909  H H    . GLU A 1 12  ? -15.019 -4.450  0.919   1.00 0.00 ? 719 GLU A H    3  
ATOM 3910  H HA   . GLU A 1 12  ? -12.762 -5.441  2.459   1.00 0.00 ? 719 GLU A HA   3  
ATOM 3911  H HB2  . GLU A 1 12  ? -12.073 -6.590  0.459   1.00 0.00 ? 719 GLU A HB2  3  
ATOM 3912  H HB3  . GLU A 1 12  ? -13.803 -6.806  0.634   1.00 0.00 ? 719 GLU A HB3  3  
ATOM 3913  H HG2  . GLU A 1 12  ? -12.411 -4.933  -1.285  1.00 0.00 ? 719 GLU A HG2  3  
ATOM 3914  H HG3  . GLU A 1 12  ? -13.198 -6.453  -1.692  1.00 0.00 ? 719 GLU A HG3  3  
ATOM 3915  N N    . TYR A 1 13  ? -12.382 -2.927  0.466   1.00 0.00 ? 720 TYR A N    3  
ATOM 3916  C CA   . TYR A 1 13  ? -11.506 -1.802  0.145   1.00 0.00 ? 720 TYR A CA   3  
ATOM 3917  C C    . TYR A 1 13  ? -11.078 -1.085  1.426   1.00 0.00 ? 720 TYR A C    3  
ATOM 3918  O O    . TYR A 1 13  ? -9.934  -0.613  1.550   1.00 0.00 ? 720 TYR A O    3  
ATOM 3919  C CB   . TYR A 1 13  ? -12.216 -0.824  -0.817  1.00 0.00 ? 720 TYR A CB   3  
ATOM 3920  C CG   . TYR A 1 13  ? -11.357 0.351   -1.247  1.00 0.00 ? 720 TYR A CG   3  
ATOM 3921  C CD1  . TYR A 1 13  ? -10.496 0.243   -2.326  1.00 0.00 ? 720 TYR A CD1  3  
ATOM 3922  C CD2  . TYR A 1 13  ? -11.397 1.559   -0.561  1.00 0.00 ? 720 TYR A CD2  3  
ATOM 3923  C CE1  . TYR A 1 13  ? -9.697  1.300   -2.709  1.00 0.00 ? 720 TYR A CE1  3  
ATOM 3924  C CE2  . TYR A 1 13  ? -10.598 2.617   -0.934  1.00 0.00 ? 720 TYR A CE2  3  
ATOM 3925  C CZ   . TYR A 1 13  ? -9.750  2.483   -2.010  1.00 0.00 ? 720 TYR A CZ   3  
ATOM 3926  O OH   . TYR A 1 13  ? -8.940  3.533   -2.380  1.00 0.00 ? 720 TYR A OH   3  
ATOM 3927  H H    . TYR A 1 13  ? -13.270 -2.980  0.037   1.00 0.00 ? 720 TYR A H    3  
ATOM 3928  H HA   . TYR A 1 13  ? -10.625 -2.195  -0.339  1.00 0.00 ? 720 TYR A HA   3  
ATOM 3929  H HB2  . TYR A 1 13  ? -12.512 -1.359  -1.707  1.00 0.00 ? 720 TYR A HB2  3  
ATOM 3930  H HB3  . TYR A 1 13  ? -13.098 -0.435  -0.329  1.00 0.00 ? 720 TYR A HB3  3  
ATOM 3931  H HD1  . TYR A 1 13  ? -10.457 -0.687  -2.875  1.00 0.00 ? 720 TYR A HD1  3  
ATOM 3932  H HD2  . TYR A 1 13  ? -12.063 1.658   0.283   1.00 0.00 ? 720 TYR A HD2  3  
ATOM 3933  H HE1  . TYR A 1 13  ? -9.033  1.193   -3.554  1.00 0.00 ? 720 TYR A HE1  3  
ATOM 3934  H HE2  . TYR A 1 13  ? -10.642 3.548   -0.388  1.00 0.00 ? 720 TYR A HE2  3  
ATOM 3935  H HH   . TYR A 1 13  ? -8.528  3.891   -1.588  1.00 0.00 ? 720 TYR A HH   3  
ATOM 3936  N N    . SER A 1 14  ? -11.987 -1.040  2.380   1.00 0.00 ? 721 SER A N    3  
ATOM 3937  C CA   . SER A 1 14  ? -11.729 -0.442  3.659   1.00 0.00 ? 721 SER A CA   3  
ATOM 3938  C C    . SER A 1 14  ? -10.667 -1.206  4.427   1.00 0.00 ? 721 SER A C    3  
ATOM 3939  O O    . SER A 1 14  ? -9.883  -0.607  5.120   1.00 0.00 ? 721 SER A O    3  
ATOM 3940  C CB   . SER A 1 14  ? -12.998 -0.355  4.474   1.00 0.00 ? 721 SER A CB   3  
ATOM 3941  O OG   . SER A 1 14  ? -13.963 0.432   3.815   1.00 0.00 ? 721 SER A OG   3  
ATOM 3942  H H    . SER A 1 14  ? -12.878 -1.410  2.198   1.00 0.00 ? 721 SER A H    3  
ATOM 3943  H HA   . SER A 1 14  ? -11.372 0.561   3.478   1.00 0.00 ? 721 SER A HA   3  
ATOM 3944  H HB2  . SER A 1 14  ? -13.397 -1.348  4.621   1.00 0.00 ? 721 SER A HB2  3  
ATOM 3945  H HB3  . SER A 1 14  ? -12.769 0.092   5.429   1.00 0.00 ? 721 SER A HB3  3  
ATOM 3946  H HG   . SER A 1 14  ? -14.252 -0.049  3.028   1.00 0.00 ? 721 SER A HG   3  
ATOM 3947  N N    . ARG A 1 15  ? -10.621 -2.525  4.268   1.00 0.00 ? 722 ARG A N    3  
ATOM 3948  C CA   . ARG A 1 15  ? -9.620  -3.326  4.964   1.00 0.00 ? 722 ARG A CA   3  
ATOM 3949  C C    . ARG A 1 15  ? -8.251  -3.048  4.384   1.00 0.00 ? 722 ARG A C    3  
ATOM 3950  O O    . ARG A 1 15  ? -7.264  -2.932  5.121   1.00 0.00 ? 722 ARG A O    3  
ATOM 3951  C CB   . ARG A 1 15  ? -9.934  -4.828  4.913   1.00 0.00 ? 722 ARG A CB   3  
ATOM 3952  C CG   . ARG A 1 15  ? -11.230 -5.233  5.604   1.00 0.00 ? 722 ARG A CG   3  
ATOM 3953  C CD   . ARG A 1 15  ? -11.272 -4.779  7.065   1.00 0.00 ? 722 ARG A CD   3  
ATOM 3954  N NE   . ARG A 1 15  ? -10.118 -5.251  7.855   1.00 0.00 ? 722 ARG A NE   3  
ATOM 3955  C CZ   . ARG A 1 15  ? -10.053 -5.248  9.194   1.00 0.00 ? 722 ARG A CZ   3  
ATOM 3956  N NH1  . ARG A 1 15  ? -11.104 -4.850  9.917   1.00 0.00 ? 722 ARG A NH1  3  
ATOM 3957  N NH2  . ARG A 1 15  ? -8.934  -5.645  9.804   1.00 0.00 ? 722 ARG A NH2  3  
ATOM 3958  H H    . ARG A 1 15  ? -11.249 -2.960  3.655   1.00 0.00 ? 722 ARG A H    3  
ATOM 3959  H HA   . ARG A 1 15  ? -9.611  -2.996  5.992   1.00 0.00 ? 722 ARG A HA   3  
ATOM 3960  H HB2  . ARG A 1 15  ? -10.001 -5.130  3.879   1.00 0.00 ? 722 ARG A HB2  3  
ATOM 3961  H HB3  . ARG A 1 15  ? -9.122  -5.368  5.376   1.00 0.00 ? 722 ARG A HB3  3  
ATOM 3962  H HG2  . ARG A 1 15  ? -12.060 -4.781  5.080   1.00 0.00 ? 722 ARG A HG2  3  
ATOM 3963  H HG3  . ARG A 1 15  ? -11.325 -6.308  5.567   1.00 0.00 ? 722 ARG A HG3  3  
ATOM 3964  H HD2  . ARG A 1 15  ? -11.302 -3.700  7.102   1.00 0.00 ? 722 ARG A HD2  3  
ATOM 3965  H HD3  . ARG A 1 15  ? -12.174 -5.173  7.509   1.00 0.00 ? 722 ARG A HD3  3  
ATOM 3966  H HE   . ARG A 1 15  ? -9.340  -5.559  7.334   1.00 0.00 ? 722 ARG A HE   3  
ATOM 3967  H HH11 . ARG A 1 15  ? -11.965 -4.549  9.492   1.00 0.00 ? 722 ARG A HH11 3  
ATOM 3968  H HH12 . ARG A 1 15  ? -11.087 -4.827  10.921  1.00 0.00 ? 722 ARG A HH12 3  
ATOM 3969  H HH21 . ARG A 1 15  ? -8.132  -5.948  9.276   1.00 0.00 ? 722 ARG A HH21 3  
ATOM 3970  H HH22 . ARG A 1 15  ? -8.825  -5.664  10.802  1.00 0.00 ? 722 ARG A HH22 3  
ATOM 3971  N N    . ILE A 1 16  ? -8.199  -2.913  3.068   1.00 0.00 ? 723 ILE A N    3  
ATOM 3972  C CA   . ILE A 1 16  ? -6.948  -2.546  2.396   1.00 0.00 ? 723 ILE A CA   3  
ATOM 3973  C C    . ILE A 1 16  ? -6.474  -1.137  2.868   1.00 0.00 ? 723 ILE A C    3  
ATOM 3974  O O    . ILE A 1 16  ? -5.321  -0.940  3.305   1.00 0.00 ? 723 ILE A O    3  
ATOM 3975  C CB   . ILE A 1 16  ? -7.063  -2.568  0.820   1.00 0.00 ? 723 ILE A CB   3  
ATOM 3976  C CG1  . ILE A 1 16  ? -7.081  -4.000  0.242   1.00 0.00 ? 723 ILE A CG1  3  
ATOM 3977  C CG2  . ILE A 1 16  ? -5.949  -1.771  0.162   1.00 0.00 ? 723 ILE A CG2  3  
ATOM 3978  C CD1  . ILE A 1 16  ? -8.343  -4.790  0.471   1.00 0.00 ? 723 ILE A CD1  3  
ATOM 3979  H H    . ILE A 1 16  ? -9.026  -3.096  2.565   1.00 0.00 ? 723 ILE A H    3  
ATOM 3980  H HA   . ILE A 1 16  ? -6.236  -3.300  2.705   1.00 0.00 ? 723 ILE A HA   3  
ATOM 3981  H HB   . ILE A 1 16  ? -7.994  -2.083  0.565   1.00 0.00 ? 723 ILE A HB   3  
ATOM 3982  H HG12 . ILE A 1 16  ? -6.938  -3.930  -0.824  1.00 0.00 ? 723 ILE A HG12 3  
ATOM 3983  H HG13 . ILE A 1 16  ? -6.255  -4.552  0.666   1.00 0.00 ? 723 ILE A HG13 3  
ATOM 3984  H HG21 . ILE A 1 16  ? -6.037  -1.842  -0.912  1.00 0.00 ? 723 ILE A HG21 3  
ATOM 3985  H HG22 . ILE A 1 16  ? -4.999  -2.169  0.481   1.00 0.00 ? 723 ILE A HG22 3  
ATOM 3986  H HG23 . ILE A 1 16  ? -6.025  -0.736  0.465   1.00 0.00 ? 723 ILE A HG23 3  
ATOM 3987  H HD11 . ILE A 1 16  ? -8.505  -4.905  1.532   1.00 0.00 ? 723 ILE A HD11 3  
ATOM 3988  H HD12 . ILE A 1 16  ? -8.250  -5.764  0.013   1.00 0.00 ? 723 ILE A HD12 3  
ATOM 3989  H HD13 . ILE A 1 16  ? -9.180  -4.264  0.035   1.00 0.00 ? 723 ILE A HD13 3  
ATOM 3990  N N    . SER A 1 17  ? -7.383  -0.187  2.816   1.00 0.00 ? 724 SER A N    3  
ATOM 3991  C CA   . SER A 1 17  ? -7.094  1.192   3.202   1.00 0.00 ? 724 SER A CA   3  
ATOM 3992  C C    . SER A 1 17  ? -6.761  1.293   4.703   1.00 0.00 ? 724 SER A C    3  
ATOM 3993  O O    . SER A 1 17  ? -5.915  2.096   5.116   1.00 0.00 ? 724 SER A O    3  
ATOM 3994  C CB   . SER A 1 17  ? -8.285  2.067   2.838   1.00 0.00 ? 724 SER A CB   3  
ATOM 3995  O OG   . SER A 1 17  ? -8.620  1.880   1.469   1.00 0.00 ? 724 SER A OG   3  
ATOM 3996  H H    . SER A 1 17  ? -8.277  -0.416  2.480   1.00 0.00 ? 724 SER A H    3  
ATOM 3997  H HA   . SER A 1 17  ? -6.233  1.518   2.636   1.00 0.00 ? 724 SER A HA   3  
ATOM 3998  H HB2  . SER A 1 17  ? -9.131  1.782   3.444   1.00 0.00 ? 724 SER A HB2  3  
ATOM 3999  H HB3  . SER A 1 17  ? -8.046  3.107   3.003   1.00 0.00 ? 724 SER A HB3  3  
ATOM 4000  H HG   . SER A 1 17  ? -9.178  1.097   1.396   1.00 0.00 ? 724 SER A HG   3  
ATOM 4001  N N    . ASN A 1 18  ? -7.396  0.440   5.495   1.00 0.00 ? 725 ASN A N    3  
ATOM 4002  C CA   . ASN A 1 18  ? -7.176  0.374   6.937   1.00 0.00 ? 725 ASN A CA   3  
ATOM 4003  C C    . ASN A 1 18  ? -5.756  -0.106  7.192   1.00 0.00 ? 725 ASN A C    3  
ATOM 4004  O O    . ASN A 1 18  ? -5.098  0.366   8.104   1.00 0.00 ? 725 ASN A O    3  
ATOM 4005  C CB   . ASN A 1 18  ? -8.181  -0.591  7.578   1.00 0.00 ? 725 ASN A CB   3  
ATOM 4006  C CG   . ASN A 1 18  ? -8.278  -0.477  9.081   1.00 0.00 ? 725 ASN A CG   3  
ATOM 4007  O OD1  . ASN A 1 18  ? -8.091  0.598   9.652   1.00 0.00 ? 725 ASN A OD1  3  
ATOM 4008  N ND2  . ASN A 1 18  ? -8.593  -1.571  9.731   1.00 0.00 ? 725 ASN A ND2  3  
ATOM 4009  H H    . ASN A 1 18  ? -8.063  -0.163  5.099   1.00 0.00 ? 725 ASN A H    3  
ATOM 4010  H HA   . ASN A 1 18  ? -7.285  1.360   7.372   1.00 0.00 ? 725 ASN A HA   3  
ATOM 4011  H HB2  . ASN A 1 18  ? -9.162  -0.409  7.166   1.00 0.00 ? 725 ASN A HB2  3  
ATOM 4012  H HB3  . ASN A 1 18  ? -7.878  -1.598  7.331   1.00 0.00 ? 725 ASN A HB3  3  
ATOM 4013  H HD21 . ASN A 1 18  ? -8.746  -2.389  9.216   1.00 0.00 ? 725 ASN A HD21 3  
ATOM 4014  H HD22 . ASN A 1 18  ? -8.670  -1.530  10.707  1.00 0.00 ? 725 ASN A HD22 3  
ATOM 4015  N N    . LEU A 1 19  ? -5.273  -1.028  6.338   1.00 0.00 ? 726 LEU A N    3  
ATOM 4016  C CA   . LEU A 1 19  ? -3.896  -1.483  6.402   1.00 0.00 ? 726 LEU A CA   3  
ATOM 4017  C C    . LEU A 1 19  ? -2.966  -0.317  6.242   1.00 0.00 ? 726 LEU A C    3  
ATOM 4018  O O    . LEU A 1 19  ? -2.039  -0.168  7.003   1.00 0.00 ? 726 LEU A O    3  
ATOM 4019  C CB   . LEU A 1 19  ? -3.599  -2.599  5.344   1.00 0.00 ? 726 LEU A CB   3  
ATOM 4020  C CG   . LEU A 1 19  ? -2.108  -2.794  4.901   1.00 0.00 ? 726 LEU A CG   3  
ATOM 4021  C CD1  . LEU A 1 19  ? -1.887  -4.175  4.401   1.00 0.00 ? 726 LEU A CD1  3  
ATOM 4022  C CD2  . LEU A 1 19  ? -1.739  -1.853  3.766   1.00 0.00 ? 726 LEU A CD2  3  
ATOM 4023  H H    . LEU A 1 19  ? -5.852  -1.406  5.642   1.00 0.00 ? 726 LEU A H    3  
ATOM 4024  H HA   . LEU A 1 19  ? -3.745  -1.893  7.390   1.00 0.00 ? 726 LEU A HA   3  
ATOM 4025  H HB2  . LEU A 1 19  ? -3.939  -3.536  5.760   1.00 0.00 ? 726 LEU A HB2  3  
ATOM 4026  H HB3  . LEU A 1 19  ? -4.190  -2.401  4.462   1.00 0.00 ? 726 LEU A HB3  3  
ATOM 4027  H HG   . LEU A 1 19  ? -1.441  -2.602  5.727   1.00 0.00 ? 726 LEU A HG   3  
ATOM 4028  H HD11 . LEU A 1 19  ? -2.550  -4.367  3.571   1.00 0.00 ? 726 LEU A HD11 3  
ATOM 4029  H HD12 . LEU A 1 19  ? -2.087  -4.878  5.196   1.00 0.00 ? 726 LEU A HD12 3  
ATOM 4030  H HD13 . LEU A 1 19  ? -0.863  -4.280  4.073   1.00 0.00 ? 726 LEU A HD13 3  
ATOM 4031  H HD21 . LEU A 1 19  ? -1.842  -0.835  4.111   1.00 0.00 ? 726 LEU A HD21 3  
ATOM 4032  H HD22 . LEU A 1 19  ? -2.419  -2.015  2.943   1.00 0.00 ? 726 LEU A HD22 3  
ATOM 4033  H HD23 . LEU A 1 19  ? -0.723  -2.031  3.445   1.00 0.00 ? 726 LEU A HD23 3  
ATOM 4034  N N    . ILE A 1 20  ? -3.252  0.522   5.269   1.00 0.00 ? 727 ILE A N    3  
ATOM 4035  C CA   . ILE A 1 20  ? -2.407  1.667   4.979   1.00 0.00 ? 727 ILE A CA   3  
ATOM 4036  C C    . ILE A 1 20  ? -2.298  2.604   6.162   1.00 0.00 ? 727 ILE A C    3  
ATOM 4037  O O    . ILE A 1 20  ? -1.185  2.924   6.610   1.00 0.00 ? 727 ILE A O    3  
ATOM 4038  C CB   . ILE A 1 20  ? -2.855  2.421   3.685   1.00 0.00 ? 727 ILE A CB   3  
ATOM 4039  C CG1  . ILE A 1 20  ? -2.426  1.645   2.434   1.00 0.00 ? 727 ILE A CG1  3  
ATOM 4040  C CG2  . ILE A 1 20  ? -2.319  3.846   3.637   1.00 0.00 ? 727 ILE A CG2  3  
ATOM 4041  C CD1  . ILE A 1 20  ? -0.912  1.537   2.286   1.00 0.00 ? 727 ILE A CD1  3  
ATOM 4042  H H    . ILE A 1 20  ? -4.065  0.342   4.743   1.00 0.00 ? 727 ILE A H    3  
ATOM 4043  H HA   . ILE A 1 20  ? -1.415  1.275   4.815   1.00 0.00 ? 727 ILE A HA   3  
ATOM 4044  H HB   . ILE A 1 20  ? -3.932  2.476   3.695   1.00 0.00 ? 727 ILE A HB   3  
ATOM 4045  H HG12 . ILE A 1 20  ? -2.830  0.644   2.478   1.00 0.00 ? 727 ILE A HG12 3  
ATOM 4046  H HG13 . ILE A 1 20  ? -2.810  2.146   1.558   1.00 0.00 ? 727 ILE A HG13 3  
ATOM 4047  H HG21 . ILE A 1 20  ? -2.659  4.328   2.733   1.00 0.00 ? 727 ILE A HG21 3  
ATOM 4048  H HG22 . ILE A 1 20  ? -1.240  3.820   3.663   1.00 0.00 ? 727 ILE A HG22 3  
ATOM 4049  H HG23 . ILE A 1 20  ? -2.693  4.379   4.499   1.00 0.00 ? 727 ILE A HG23 3  
ATOM 4050  H HD11 . ILE A 1 20  ? -0.505  2.538   2.255   1.00 0.00 ? 727 ILE A HD11 3  
ATOM 4051  H HD12 . ILE A 1 20  ? -0.662  1.008   1.379   1.00 0.00 ? 727 ILE A HD12 3  
ATOM 4052  H HD13 . ILE A 1 20  ? -0.499  1.020   3.141   1.00 0.00 ? 727 ILE A HD13 3  
ATOM 4053  N N    . VAL A 1 21  ? -3.426  2.994   6.695   1.00 0.00 ? 728 VAL A N    3  
ATOM 4054  C CA   . VAL A 1 21  ? -3.437  3.911   7.798   1.00 0.00 ? 728 VAL A CA   3  
ATOM 4055  C C    . VAL A 1 21  ? -2.815  3.280   9.072   1.00 0.00 ? 728 VAL A C    3  
ATOM 4056  O O    . VAL A 1 21  ? -1.996  3.910   9.744   1.00 0.00 ? 728 VAL A O    3  
ATOM 4057  C CB   . VAL A 1 21  ? -4.863  4.522   8.047   1.00 0.00 ? 728 VAL A CB   3  
ATOM 4058  C CG1  . VAL A 1 21  ? -5.917  3.455   8.247   1.00 0.00 ? 728 VAL A CG1  3  
ATOM 4059  C CG2  . VAL A 1 21  ? -4.871  5.466   9.221   1.00 0.00 ? 728 VAL A CG2  3  
ATOM 4060  H H    . VAL A 1 21  ? -4.270  2.657   6.322   1.00 0.00 ? 728 VAL A H    3  
ATOM 4061  H HA   . VAL A 1 21  ? -2.776  4.701   7.464   1.00 0.00 ? 728 VAL A HA   3  
ATOM 4062  H HB   . VAL A 1 21  ? -5.135  5.082   7.164   1.00 0.00 ? 728 VAL A HB   3  
ATOM 4063  H HG11 . VAL A 1 21  ? -6.878  3.915   8.423   1.00 0.00 ? 728 VAL A HG11 3  
ATOM 4064  H HG12 . VAL A 1 21  ? -5.652  2.837   9.091   1.00 0.00 ? 728 VAL A HG12 3  
ATOM 4065  H HG13 . VAL A 1 21  ? -5.966  2.849   7.355   1.00 0.00 ? 728 VAL A HG13 3  
ATOM 4066  H HG21 . VAL A 1 21  ? -5.880  5.832   9.336   1.00 0.00 ? 728 VAL A HG21 3  
ATOM 4067  H HG22 . VAL A 1 21  ? -4.185  6.283   9.050   1.00 0.00 ? 728 VAL A HG22 3  
ATOM 4068  H HG23 . VAL A 1 21  ? -4.592  4.913   10.106  1.00 0.00 ? 728 VAL A HG23 3  
ATOM 4069  N N    . LEU A 1 22  ? -3.160  2.024   9.353   1.00 0.00 ? 729 LEU A N    3  
ATOM 4070  C CA   . LEU A 1 22  ? -2.640  1.315   10.522  1.00 0.00 ? 729 LEU A CA   3  
ATOM 4071  C C    . LEU A 1 22  ? -1.168  1.039   10.427  1.00 0.00 ? 729 LEU A C    3  
ATOM 4072  O O    . LEU A 1 22  ? -0.431  1.325   11.356  1.00 0.00 ? 729 LEU A O    3  
ATOM 4073  C CB   . LEU A 1 22  ? -3.366  0.010   10.729  1.00 0.00 ? 729 LEU A CB   3  
ATOM 4074  C CG   . LEU A 1 22  ? -4.752  0.112   11.304  1.00 0.00 ? 729 LEU A CG   3  
ATOM 4075  C CD1  . LEU A 1 22  ? -5.480  -1.186  11.060  1.00 0.00 ? 729 LEU A CD1  3  
ATOM 4076  C CD2  . LEU A 1 22  ? -4.670  0.380   12.799  1.00 0.00 ? 729 LEU A CD2  3  
ATOM 4077  H H    . LEU A 1 22  ? -3.789  1.552   8.761   1.00 0.00 ? 729 LEU A H    3  
ATOM 4078  H HA   . LEU A 1 22  ? -2.825  1.936   11.384  1.00 0.00 ? 729 LEU A HA   3  
ATOM 4079  H HB2  . LEU A 1 22  ? -3.434  -0.488  9.773   1.00 0.00 ? 729 LEU A HB2  3  
ATOM 4080  H HB3  . LEU A 1 22  ? -2.769  -0.602  11.389  1.00 0.00 ? 729 LEU A HB3  3  
ATOM 4081  H HG   . LEU A 1 22  ? -5.260  0.947   10.842  1.00 0.00 ? 729 LEU A HG   3  
ATOM 4082  H HD11 . LEU A 1 22  ? -5.529  -1.343  9.991   1.00 0.00 ? 729 LEU A HD11 3  
ATOM 4083  H HD12 . LEU A 1 22  ? -6.480  -1.130  11.465  1.00 0.00 ? 729 LEU A HD12 3  
ATOM 4084  H HD13 . LEU A 1 22  ? -4.938  -2.002  11.513  1.00 0.00 ? 729 LEU A HD13 3  
ATOM 4085  H HD21 . LEU A 1 22  ? -4.157  1.314   12.972  1.00 0.00 ? 729 LEU A HD21 3  
ATOM 4086  H HD22 . LEU A 1 22  ? -4.133  -0.422  13.282  1.00 0.00 ? 729 LEU A HD22 3  
ATOM 4087  H HD23 . LEU A 1 22  ? -5.668  0.439   13.206  1.00 0.00 ? 729 LEU A HD23 3  
ATOM 4088  N N    . HIS A 1 23  ? -0.739  0.490   9.311   1.00 0.00 ? 730 HIS A N    3  
ATOM 4089  C CA   . HIS A 1 23  ? 0.646   0.104   9.137   1.00 0.00 ? 730 HIS A CA   3  
ATOM 4090  C C    . HIS A 1 23  ? 1.543   1.302   9.293   1.00 0.00 ? 730 HIS A C    3  
ATOM 4091  O O    . HIS A 1 23  ? 2.445   1.274   10.099  1.00 0.00 ? 730 HIS A O    3  
ATOM 4092  C CB   . HIS A 1 23  ? 0.864   -0.590  7.782   1.00 0.00 ? 730 HIS A CB   3  
ATOM 4093  C CG   . HIS A 1 23  ? 2.254   -1.122  7.559   1.00 0.00 ? 730 HIS A CG   3  
ATOM 4094  N ND1  . HIS A 1 23  ? 2.690   -2.341  8.019   1.00 0.00 ? 730 HIS A ND1  3  
ATOM 4095  C CD2  . HIS A 1 23  ? 3.300   -0.584  6.889   1.00 0.00 ? 730 HIS A CD2  3  
ATOM 4096  C CE1  . HIS A 1 23  ? 3.952   -2.507  7.627   1.00 0.00 ? 730 HIS A CE1  3  
ATOM 4097  N NE2  . HIS A 1 23  ? 4.370   -1.469  6.932   1.00 0.00 ? 730 HIS A NE2  3  
ATOM 4098  H H    . HIS A 1 23  ? -1.368  0.344   8.569   1.00 0.00 ? 730 HIS A H    3  
ATOM 4099  H HA   . HIS A 1 23  ? 0.883   -0.593  9.926   1.00 0.00 ? 730 HIS A HA   3  
ATOM 4100  H HB2  . HIS A 1 23  ? 0.179   -1.419  7.716   1.00 0.00 ? 730 HIS A HB2  3  
ATOM 4101  H HB3  . HIS A 1 23  ? 0.637   0.108   6.990   1.00 0.00 ? 730 HIS A HB3  3  
ATOM 4102  H HD1  . HIS A 1 23  ? 2.167   -2.976  8.557   1.00 0.00 ? 730 HIS A HD1  3  
ATOM 4103  H HD2  . HIS A 1 23  ? 3.312   0.377   6.396   1.00 0.00 ? 730 HIS A HD2  3  
ATOM 4104  H HE1  . HIS A 1 23  ? 4.552   -3.377  7.848   1.00 0.00 ? 730 HIS A HE1  3  
ATOM 4105  N N    . LEU A 1 24  ? 1.238   2.365   8.576   1.00 0.00 ? 731 LEU A N    3  
ATOM 4106  C CA   . LEU A 1 24  ? 2.033   3.579   8.636   1.00 0.00 ? 731 LEU A CA   3  
ATOM 4107  C C    . LEU A 1 24  ? 2.105   4.131   10.078  1.00 0.00 ? 731 LEU A C    3  
ATOM 4108  O O    . LEU A 1 24  ? 3.203   4.428   10.575  1.00 0.00 ? 731 LEU A O    3  
ATOM 4109  C CB   . LEU A 1 24  ? 1.474   4.602   7.612   1.00 0.00 ? 731 LEU A CB   3  
ATOM 4110  C CG   . LEU A 1 24  ? 2.180   5.974   7.419   1.00 0.00 ? 731 LEU A CG   3  
ATOM 4111  C CD1  . LEU A 1 24  ? 1.988   6.918   8.605   1.00 0.00 ? 731 LEU A CD1  3  
ATOM 4112  C CD2  . LEU A 1 24  ? 3.654   5.777   7.114   1.00 0.00 ? 731 LEU A CD2  3  
ATOM 4113  H H    . LEU A 1 24  ? 0.459   2.339   7.974   1.00 0.00 ? 731 LEU A H    3  
ATOM 4114  H HA   . LEU A 1 24  ? 3.034   3.307   8.342   1.00 0.00 ? 731 LEU A HA   3  
ATOM 4115  H HB2  . LEU A 1 24  ? 1.543   4.089   6.665   1.00 0.00 ? 731 LEU A HB2  3  
ATOM 4116  H HB3  . LEU A 1 24  ? 0.434   4.767   7.848   1.00 0.00 ? 731 LEU A HB3  3  
ATOM 4117  H HG   . LEU A 1 24  ? 1.733   6.461   6.564   1.00 0.00 ? 731 LEU A HG   3  
ATOM 4118  H HD11 . LEU A 1 24  ? 2.383   6.455   9.497   1.00 0.00 ? 731 LEU A HD11 3  
ATOM 4119  H HD12 . LEU A 1 24  ? 0.935   7.114   8.745   1.00 0.00 ? 731 LEU A HD12 3  
ATOM 4120  H HD13 . LEU A 1 24  ? 2.511   7.844   8.423   1.00 0.00 ? 731 LEU A HD13 3  
ATOM 4121  H HD21 . LEU A 1 24  ? 3.759   5.211   6.200   1.00 0.00 ? 731 LEU A HD21 3  
ATOM 4122  H HD22 . LEU A 1 24  ? 4.122   5.241   7.926   1.00 0.00 ? 731 LEU A HD22 3  
ATOM 4123  H HD23 . LEU A 1 24  ? 4.137   6.736   6.998   1.00 0.00 ? 731 LEU A HD23 3  
ATOM 4124  N N    . ARG A 1 25  ? 0.958   4.217   10.759  1.00 0.00 ? 732 ARG A N    3  
ATOM 4125  C CA   . ARG A 1 25  ? 0.940   4.770   12.111  1.00 0.00 ? 732 ARG A CA   3  
ATOM 4126  C C    . ARG A 1 25  ? 1.670   3.855   13.104  1.00 0.00 ? 732 ARG A C    3  
ATOM 4127  O O    . ARG A 1 25  ? 2.237   4.324   14.096  1.00 0.00 ? 732 ARG A O    3  
ATOM 4128  C CB   . ARG A 1 25  ? -0.480  5.094   12.593  1.00 0.00 ? 732 ARG A CB   3  
ATOM 4129  C CG   . ARG A 1 25  ? -1.386  3.896   12.798  1.00 0.00 ? 732 ARG A CG   3  
ATOM 4130  C CD   . ARG A 1 25  ? -2.755  4.324   13.289  1.00 0.00 ? 732 ARG A CD   3  
ATOM 4131  N NE   . ARG A 1 25  ? -2.643  5.126   14.525  1.00 0.00 ? 732 ARG A NE   3  
ATOM 4132  C CZ   . ARG A 1 25  ? -3.528  6.038   14.945  1.00 0.00 ? 732 ARG A CZ   3  
ATOM 4133  N NH1  . ARG A 1 25  ? -4.710  6.156   14.353  1.00 0.00 ? 732 ARG A NH1  3  
ATOM 4134  N NH2  . ARG A 1 25  ? -3.232  6.809   15.980  1.00 0.00 ? 732 ARG A NH2  3  
ATOM 4135  H H    . ARG A 1 25  ? 0.124   3.910   10.341  1.00 0.00 ? 732 ARG A H    3  
ATOM 4136  H HA   . ARG A 1 25  ? 1.505   5.689   12.058  1.00 0.00 ? 732 ARG A HA   3  
ATOM 4137  H HB2  . ARG A 1 25  ? -0.417  5.622   13.533  1.00 0.00 ? 732 ARG A HB2  3  
ATOM 4138  H HB3  . ARG A 1 25  ? -0.943  5.744   11.865  1.00 0.00 ? 732 ARG A HB3  3  
ATOM 4139  H HG2  . ARG A 1 25  ? -1.489  3.387   11.852  1.00 0.00 ? 732 ARG A HG2  3  
ATOM 4140  H HG3  . ARG A 1 25  ? -0.931  3.235   13.519  1.00 0.00 ? 732 ARG A HG3  3  
ATOM 4141  H HD2  . ARG A 1 25  ? -3.227  4.906   12.510  1.00 0.00 ? 732 ARG A HD2  3  
ATOM 4142  H HD3  . ARG A 1 25  ? -3.352  3.441   13.475  1.00 0.00 ? 732 ARG A HD3  3  
ATOM 4143  H HE   . ARG A 1 25  ? -1.803  4.992   15.023  1.00 0.00 ? 732 ARG A HE   3  
ATOM 4144  H HH11 . ARG A 1 25  ? -4.984  5.572   13.585  1.00 0.00 ? 732 ARG A HH11 3  
ATOM 4145  H HH12 . ARG A 1 25  ? -5.369  6.862   14.636  1.00 0.00 ? 732 ARG A HH12 3  
ATOM 4146  H HH21 . ARG A 1 25  ? -2.356  6.748   16.470  1.00 0.00 ? 732 ARG A HH21 3  
ATOM 4147  H HH22 . ARG A 1 25  ? -3.867  7.510   16.322  1.00 0.00 ? 732 ARG A HH22 3  
ATOM 4148  N N    . LYS A 1 26  ? 1.651   2.565   12.845  1.00 0.00 ? 733 LYS A N    3  
ATOM 4149  C CA   . LYS A 1 26  ? 2.390   1.627   13.659  1.00 0.00 ? 733 LYS A CA   3  
ATOM 4150  C C    . LYS A 1 26  ? 3.869   1.765   13.394  1.00 0.00 ? 733 LYS A C    3  
ATOM 4151  O O    . LYS A 1 26  ? 4.653   1.906   14.313  1.00 0.00 ? 733 LYS A O    3  
ATOM 4152  C CB   . LYS A 1 26  ? 1.964   0.190   13.393  1.00 0.00 ? 733 LYS A CB   3  
ATOM 4153  C CG   . LYS A 1 26  ? 0.584   -0.185  13.915  1.00 0.00 ? 733 LYS A CG   3  
ATOM 4154  C CD   . LYS A 1 26  ? 0.207   -1.603  13.501  1.00 0.00 ? 733 LYS A CD   3  
ATOM 4155  C CE   . LYS A 1 26  ? 1.248   -2.616  13.955  1.00 0.00 ? 733 LYS A CE   3  
ATOM 4156  N NZ   . LYS A 1 26  ? 0.921   -3.978  13.528  1.00 0.00 ? 733 LYS A NZ   3  
ATOM 4157  H H    . LYS A 1 26  ? 1.120   2.234   12.086  1.00 0.00 ? 733 LYS A H    3  
ATOM 4158  H HA   . LYS A 1 26  ? 2.198   1.863   14.695  1.00 0.00 ? 733 LYS A HA   3  
ATOM 4159  H HB2  . LYS A 1 26  ? 1.980   0.016   12.328  1.00 0.00 ? 733 LYS A HB2  3  
ATOM 4160  H HB3  . LYS A 1 26  ? 2.693   -0.453  13.864  1.00 0.00 ? 733 LYS A HB3  3  
ATOM 4161  H HG2  . LYS A 1 26  ? 0.587   -0.124  14.993  1.00 0.00 ? 733 LYS A HG2  3  
ATOM 4162  H HG3  . LYS A 1 26  ? -0.141  0.507   13.515  1.00 0.00 ? 733 LYS A HG3  3  
ATOM 4163  H HD2  . LYS A 1 26  ? -0.743  -1.856  13.948  1.00 0.00 ? 733 LYS A HD2  3  
ATOM 4164  H HD3  . LYS A 1 26  ? 0.121   -1.645  12.425  1.00 0.00 ? 733 LYS A HD3  3  
ATOM 4165  H HE2  . LYS A 1 26  ? 2.201   -2.356  13.522  1.00 0.00 ? 733 LYS A HE2  3  
ATOM 4166  H HE3  . LYS A 1 26  ? 1.325   -2.588  15.031  1.00 0.00 ? 733 LYS A HE3  3  
ATOM 4167  H HZ1  . LYS A 1 26  ? 0.052   -4.323  13.981  1.00 0.00 ? 733 LYS A HZ1  3  
ATOM 4168  H HZ2  . LYS A 1 26  ? 1.683   -4.647  13.754  1.00 0.00 ? 733 LYS A HZ2  3  
ATOM 4169  H HZ3  . LYS A 1 26  ? 0.753   -4.003  12.500  1.00 0.00 ? 733 LYS A HZ3  3  
ATOM 4170  N N    . VAL A 1 27  ? 4.228   1.769   12.130  1.00 0.00 ? 734 VAL A N    3  
ATOM 4171  C CA   . VAL A 1 27  ? 5.606   1.830   11.690  1.00 0.00 ? 734 VAL A CA   3  
ATOM 4172  C C    . VAL A 1 27  ? 6.339   3.059   12.224  1.00 0.00 ? 734 VAL A C    3  
ATOM 4173  O O    . VAL A 1 27  ? 7.415   2.917   12.778  1.00 0.00 ? 734 VAL A O    3  
ATOM 4174  C CB   . VAL A 1 27  ? 5.717   1.719   10.142  1.00 0.00 ? 734 VAL A CB   3  
ATOM 4175  C CG1  . VAL A 1 27  ? 7.116   1.981   9.659   1.00 0.00 ? 734 VAL A CG1  3  
ATOM 4176  C CG2  . VAL A 1 27  ? 5.301   0.338   9.698   1.00 0.00 ? 734 VAL A CG2  3  
ATOM 4177  H H    . VAL A 1 27  ? 3.534   1.725   11.433  1.00 0.00 ? 734 VAL A H    3  
ATOM 4178  H HA   . VAL A 1 27  ? 6.091   0.965   12.118  1.00 0.00 ? 734 VAL A HA   3  
ATOM 4179  H HB   . VAL A 1 27  ? 5.042   2.427   9.686   1.00 0.00 ? 734 VAL A HB   3  
ATOM 4180  H HG11 . VAL A 1 27  ? 7.794   1.252   10.077  1.00 0.00 ? 734 VAL A HG11 3  
ATOM 4181  H HG12 . VAL A 1 27  ? 7.398   2.976   9.970   1.00 0.00 ? 734 VAL A HG12 3  
ATOM 4182  H HG13 . VAL A 1 27  ? 7.115   1.918   8.581   1.00 0.00 ? 734 VAL A HG13 3  
ATOM 4183  H HG21 . VAL A 1 27  ? 4.277   0.165   9.999   1.00 0.00 ? 734 VAL A HG21 3  
ATOM 4184  H HG22 . VAL A 1 27  ? 5.944   -0.404  10.148  1.00 0.00 ? 734 VAL A HG22 3  
ATOM 4185  H HG23 . VAL A 1 27  ? 5.367   0.276   8.621   1.00 0.00 ? 734 VAL A HG23 3  
ATOM 4186  N N    . GLU A 1 28  ? 5.732   4.238   12.125  1.00 0.00 ? 735 GLU A N    3  
ATOM 4187  C CA   . GLU A 1 28  ? 6.378   5.479   12.603  1.00 0.00 ? 735 GLU A CA   3  
ATOM 4188  C C    . GLU A 1 28  ? 6.651   5.432   14.128  1.00 0.00 ? 735 GLU A C    3  
ATOM 4189  O O    . GLU A 1 28  ? 7.618   6.015   14.619  1.00 0.00 ? 735 GLU A O    3  
ATOM 4190  C CB   . GLU A 1 28  ? 5.530   6.722   12.245  1.00 0.00 ? 735 GLU A CB   3  
ATOM 4191  C CG   . GLU A 1 28  ? 4.157   6.740   12.898  1.00 0.00 ? 735 GLU A CG   3  
ATOM 4192  C CD   . GLU A 1 28  ? 3.343   7.983   12.604  1.00 0.00 ? 735 GLU A CD   3  
ATOM 4193  O OE1  . GLU A 1 28  ? 3.894   8.989   12.111  1.00 0.00 ? 735 GLU A OE1  3  
ATOM 4194  O OE2  . GLU A 1 28  ? 2.128   7.993   12.916  1.00 0.00 ? 735 GLU A OE2  3  
ATOM 4195  H H    . GLU A 1 28  ? 4.840   4.285   11.711  1.00 0.00 ? 735 GLU A H    3  
ATOM 4196  H HA   . GLU A 1 28  ? 7.331   5.549   12.099  1.00 0.00 ? 735 GLU A HA   3  
ATOM 4197  H HB2  . GLU A 1 28  ? 6.064   7.607   12.560  1.00 0.00 ? 735 GLU A HB2  3  
ATOM 4198  H HB3  . GLU A 1 28  ? 5.399   6.754   11.173  1.00 0.00 ? 735 GLU A HB3  3  
ATOM 4199  H HG2  . GLU A 1 28  ? 3.606   5.880   12.547  1.00 0.00 ? 735 GLU A HG2  3  
ATOM 4200  H HG3  . GLU A 1 28  ? 4.294   6.656   13.967  1.00 0.00 ? 735 GLU A HG3  3  
ATOM 4201  N N    . GLU A 1 29  ? 5.815   4.698   14.840  1.00 0.00 ? 736 GLU A N    3  
ATOM 4202  C CA   . GLU A 1 29  ? 5.884   4.589   16.292  1.00 0.00 ? 736 GLU A CA   3  
ATOM 4203  C C    . GLU A 1 29  ? 6.828   3.447   16.702  1.00 0.00 ? 736 GLU A C    3  
ATOM 4204  O O    . GLU A 1 29  ? 7.822   3.641   17.410  1.00 0.00 ? 736 GLU A O    3  
ATOM 4205  C CB   . GLU A 1 29  ? 4.466   4.290   16.814  1.00 0.00 ? 736 GLU A CB   3  
ATOM 4206  C CG   . GLU A 1 29  ? 4.319   4.183   18.325  1.00 0.00 ? 736 GLU A CG   3  
ATOM 4207  C CD   . GLU A 1 29  ? 2.928   3.731   18.722  1.00 0.00 ? 736 GLU A CD   3  
ATOM 4208  O OE1  . GLU A 1 29  ? 1.947   4.441   18.416  1.00 0.00 ? 736 GLU A OE1  3  
ATOM 4209  O OE2  . GLU A 1 29  ? 2.785   2.649   19.349  1.00 0.00 ? 736 GLU A OE2  3  
ATOM 4210  H H    . GLU A 1 29  ? 5.120   4.198   14.363  1.00 0.00 ? 736 GLU A H    3  
ATOM 4211  H HA   . GLU A 1 29  ? 6.221   5.524   16.712  1.00 0.00 ? 736 GLU A HA   3  
ATOM 4212  H HB2  . GLU A 1 29  ? 3.805   5.075   16.479  1.00 0.00 ? 736 GLU A HB2  3  
ATOM 4213  H HB3  . GLU A 1 29  ? 4.134   3.359   16.375  1.00 0.00 ? 736 GLU A HB3  3  
ATOM 4214  H HG2  . GLU A 1 29  ? 5.037   3.468   18.696  1.00 0.00 ? 736 GLU A HG2  3  
ATOM 4215  H HG3  . GLU A 1 29  ? 4.510   5.150   18.766  1.00 0.00 ? 736 GLU A HG3  3  
ATOM 4216  N N    . GLU A 1 30  ? 6.517   2.279   16.212  1.00 0.00 ? 737 GLU A N    3  
ATOM 4217  C CA   . GLU A 1 30  ? 7.171   1.052   16.586  1.00 0.00 ? 737 GLU A CA   3  
ATOM 4218  C C    . GLU A 1 30  ? 8.502   0.841   15.882  1.00 0.00 ? 737 GLU A C    3  
ATOM 4219  O O    . GLU A 1 30  ? 9.529   0.760   16.525  1.00 0.00 ? 737 GLU A O    3  
ATOM 4220  C CB   . GLU A 1 30  ? 6.237   -0.105  16.276  1.00 0.00 ? 737 GLU A CB   3  
ATOM 4221  C CG   . GLU A 1 30  ? 4.943   -0.088  17.073  1.00 0.00 ? 737 GLU A CG   3  
ATOM 4222  C CD   . GLU A 1 30  ? 5.104   -0.590  18.487  1.00 0.00 ? 737 GLU A CD   3  
ATOM 4223  O OE1  . GLU A 1 30  ? 6.019   -0.152  19.208  1.00 0.00 ? 737 GLU A OE1  3  
ATOM 4224  O OE2  . GLU A 1 30  ? 4.317   -1.479  18.889  1.00 0.00 ? 737 GLU A OE2  3  
ATOM 4225  H H    . GLU A 1 30  ? 5.785   2.229   15.555  1.00 0.00 ? 737 GLU A H    3  
ATOM 4226  H HA   . GLU A 1 30  ? 7.326   1.063   17.653  1.00 0.00 ? 737 GLU A HA   3  
ATOM 4227  H HB2  . GLU A 1 30  ? 5.989   -0.068  15.226  1.00 0.00 ? 737 GLU A HB2  3  
ATOM 4228  H HB3  . GLU A 1 30  ? 6.756   -1.027  16.488  1.00 0.00 ? 737 GLU A HB3  3  
ATOM 4229  H HG2  . GLU A 1 30  ? 4.584   0.929   17.111  1.00 0.00 ? 737 GLU A HG2  3  
ATOM 4230  H HG3  . GLU A 1 30  ? 4.216   -0.702  16.564  1.00 0.00 ? 737 GLU A HG3  3  
ATOM 4231  N N    . GLU A 1 31  ? 8.480   0.780   14.574  1.00 0.00 ? 738 GLU A N    3  
ATOM 4232  C CA   . GLU A 1 31  ? 9.672   0.417   13.814  1.00 0.00 ? 738 GLU A CA   3  
ATOM 4233  C C    . GLU A 1 31  ? 10.541  1.633   13.446  1.00 0.00 ? 738 GLU A C    3  
ATOM 4234  O O    . GLU A 1 31  ? 11.703  1.487   13.027  1.00 0.00 ? 738 GLU A O    3  
ATOM 4235  C CB   . GLU A 1 31  ? 9.269   -0.458  12.623  1.00 0.00 ? 738 GLU A CB   3  
ATOM 4236  C CG   . GLU A 1 31  ? 8.642   -1.773  13.102  1.00 0.00 ? 738 GLU A CG   3  
ATOM 4237  C CD   . GLU A 1 31  ? 8.075   -2.655  12.014  1.00 0.00 ? 738 GLU A CD   3  
ATOM 4238  O OE1  . GLU A 1 31  ? 8.854   -3.305  11.287  1.00 0.00 ? 738 GLU A OE1  3  
ATOM 4239  O OE2  . GLU A 1 31  ? 6.824   -2.753  11.920  1.00 0.00 ? 738 GLU A OE2  3  
ATOM 4240  H H    . GLU A 1 31  ? 7.650   0.991   14.098  1.00 0.00 ? 738 GLU A H    3  
ATOM 4241  H HA   . GLU A 1 31  ? 10.266  -0.184  14.487  1.00 0.00 ? 738 GLU A HA   3  
ATOM 4242  H HB2  . GLU A 1 31  ? 8.555   0.078   12.013  1.00 0.00 ? 738 GLU A HB2  3  
ATOM 4243  H HB3  . GLU A 1 31  ? 10.145  -0.693  12.035  1.00 0.00 ? 738 GLU A HB3  3  
ATOM 4244  H HG2  . GLU A 1 31  ? 9.398   -2.338  13.625  1.00 0.00 ? 738 GLU A HG2  3  
ATOM 4245  H HG3  . GLU A 1 31  ? 7.853   -1.528  13.798  1.00 0.00 ? 738 GLU A HG3  3  
ATOM 4246  N N    . ASP A 1 32  ? 9.958   2.821   13.612  1.00 0.00 ? 739 ASP A N    3  
ATOM 4247  C CA   . ASP A 1 32  ? 10.625  4.149   13.484  1.00 0.00 ? 739 ASP A CA   3  
ATOM 4248  C C    . ASP A 1 32  ? 10.983  4.537   12.045  1.00 0.00 ? 739 ASP A C    3  
ATOM 4249  O O    . ASP A 1 32  ? 10.606  5.615   11.568  1.00 0.00 ? 739 ASP A O    3  
ATOM 4250  C CB   . ASP A 1 32  ? 11.845  4.252   14.406  1.00 0.00 ? 739 ASP A CB   3  
ATOM 4251  C CG   . ASP A 1 32  ? 12.515  5.596   14.356  1.00 0.00 ? 739 ASP A CG   3  
ATOM 4252  O OD1  . ASP A 1 32  ? 11.975  6.560   14.932  1.00 0.00 ? 739 ASP A OD1  3  
ATOM 4253  O OD2  . ASP A 1 32  ? 13.622  5.708   13.795  1.00 0.00 ? 739 ASP A OD2  3  
ATOM 4254  H H    . ASP A 1 32  ? 8.994   2.812   13.795  1.00 0.00 ? 739 ASP A H    3  
ATOM 4255  H HA   . ASP A 1 32  ? 9.896   4.871   13.821  1.00 0.00 ? 739 ASP A HA   3  
ATOM 4256  H HB2  . ASP A 1 32  ? 11.525  4.080   15.422  1.00 0.00 ? 739 ASP A HB2  3  
ATOM 4257  H HB3  . ASP A 1 32  ? 12.561  3.494   14.125  1.00 0.00 ? 739 ASP A HB3  3  
ATOM 4258  N N    . GLU A 1 33  ? 11.682  3.669   11.355  1.00 0.00 ? 740 GLU A N    3  
ATOM 4259  C CA   . GLU A 1 33  ? 12.077  3.908   9.999   1.00 0.00 ? 740 GLU A CA   3  
ATOM 4260  C C    . GLU A 1 33  ? 10.949  3.553   9.092   1.00 0.00 ? 740 GLU A C    3  
ATOM 4261  O O    . GLU A 1 33  ? 10.798  2.411   8.641   1.00 0.00 ? 740 GLU A O    3  
ATOM 4262  C CB   . GLU A 1 33  ? 13.346  3.161   9.614   1.00 0.00 ? 740 GLU A CB   3  
ATOM 4263  C CG   . GLU A 1 33  ? 14.553  3.577   10.415  1.00 0.00 ? 740 GLU A CG   3  
ATOM 4264  C CD   . GLU A 1 33  ? 15.801  2.849   10.004  1.00 0.00 ? 740 GLU A CD   3  
ATOM 4265  O OE1  . GLU A 1 33  ? 15.998  1.699   10.434  1.00 0.00 ? 740 GLU A OE1  3  
ATOM 4266  O OE2  . GLU A 1 33  ? 16.621  3.415   9.248   1.00 0.00 ? 740 GLU A OE2  3  
ATOM 4267  H H    . GLU A 1 33  ? 11.902  2.815   11.776  1.00 0.00 ? 740 GLU A H    3  
ATOM 4268  H HA   . GLU A 1 33  ? 12.252  4.971   9.910   1.00 0.00 ? 740 GLU A HA   3  
ATOM 4269  H HB2  . GLU A 1 33  ? 13.187  2.103   9.756   1.00 0.00 ? 740 GLU A HB2  3  
ATOM 4270  H HB3  . GLU A 1 33  ? 13.553  3.342   8.569   1.00 0.00 ? 740 GLU A HB3  3  
ATOM 4271  H HG2  . GLU A 1 33  ? 14.700  4.637   10.264  1.00 0.00 ? 740 GLU A HG2  3  
ATOM 4272  H HG3  . GLU A 1 33  ? 14.349  3.382   11.457  1.00 0.00 ? 740 GLU A HG3  3  
ATOM 4273  N N    . SER A 1 34  ? 10.134  4.508   8.900   1.00 0.00 ? 741 SER A N    3  
ATOM 4274  C CA   . SER A 1 34  ? 8.981   4.422   8.103   1.00 0.00 ? 741 SER A CA   3  
ATOM 4275  C C    . SER A 1 34  ? 9.361   4.582   6.650   1.00 0.00 ? 741 SER A C    3  
ATOM 4276  O O    . SER A 1 34  ? 9.263   5.660   6.079   1.00 0.00 ? 741 SER A O    3  
ATOM 4277  C CB   . SER A 1 34  ? 7.936   5.461   8.554   1.00 0.00 ? 741 SER A CB   3  
ATOM 4278  O OG   . SER A 1 34  ? 6.741   5.348   7.825   1.00 0.00 ? 741 SER A OG   3  
ATOM 4279  H H    . SER A 1 34  ? 10.357  5.338   9.356   1.00 0.00 ? 741 SER A H    3  
ATOM 4280  H HA   . SER A 1 34  ? 8.566   3.435   8.236   1.00 0.00 ? 741 SER A HA   3  
ATOM 4281  H HB2  . SER A 1 34  ? 7.714   5.313   9.600   1.00 0.00 ? 741 SER A HB2  3  
ATOM 4282  H HB3  . SER A 1 34  ? 8.341   6.453   8.415   1.00 0.00 ? 741 SER A HB3  3  
ATOM 4283  H HG   . SER A 1 34  ? 6.779   6.003   7.123   1.00 0.00 ? 741 SER A HG   3  
ATOM 4284  N N    . ALA A 1 35  ? 9.964   3.547   6.154   1.00 0.00 ? 742 ALA A N    3  
ATOM 4285  C CA   . ALA A 1 35  ? 10.313  3.389   4.754   1.00 0.00 ? 742 ALA A CA   3  
ATOM 4286  C C    . ALA A 1 35  ? 10.570  1.915   4.485   1.00 0.00 ? 742 ALA A C    3  
ATOM 4287  O O    . ALA A 1 35  ? 11.582  1.373   4.931   1.00 0.00 ? 742 ALA A O    3  
ATOM 4288  C CB   . ALA A 1 35  ? 11.546  4.217   4.422   1.00 0.00 ? 742 ALA A CB   3  
ATOM 4289  H H    . ALA A 1 35  ? 10.240  2.885   6.829   1.00 0.00 ? 742 ALA A H    3  
ATOM 4290  H HA   . ALA A 1 35  ? 9.479   3.726   4.155   1.00 0.00 ? 742 ALA A HA   3  
ATOM 4291  H HB1  . ALA A 1 35  ? 11.334  5.252   4.647   1.00 0.00 ? 742 ALA A HB1  3  
ATOM 4292  H HB2  . ALA A 1 35  ? 11.781  4.121   3.373   1.00 0.00 ? 742 ALA A HB2  3  
ATOM 4293  H HB3  . ALA A 1 35  ? 12.380  3.881   5.018   1.00 0.00 ? 742 ALA A HB3  3  
ATOM 4294  N N    . LEU A 1 36  ? 9.656   1.257   3.792   1.00 0.00 ? 743 LEU A N    3  
ATOM 4295  C CA   . LEU A 1 36  ? 9.760   -0.188  3.578   1.00 0.00 ? 743 LEU A CA   3  
ATOM 4296  C C    . LEU A 1 36  ? 9.555   -0.565  2.111   1.00 0.00 ? 743 LEU A C    3  
ATOM 4297  O O    . LEU A 1 36  ? 9.195   0.286   1.279   1.00 0.00 ? 743 LEU A O    3  
ATOM 4298  C CB   . LEU A 1 36  ? 8.735   -0.937  4.457   1.00 0.00 ? 743 LEU A CB   3  
ATOM 4299  C CG   . LEU A 1 36  ? 8.875   -0.777  5.982   1.00 0.00 ? 743 LEU A CG   3  
ATOM 4300  C CD1  . LEU A 1 36  ? 7.769   -1.527  6.698   1.00 0.00 ? 743 LEU A CD1  3  
ATOM 4301  C CD2  . LEU A 1 36  ? 10.232  -1.273  6.461   1.00 0.00 ? 743 LEU A CD2  3  
ATOM 4302  H H    . LEU A 1 36  ? 8.899   1.735   3.386   1.00 0.00 ? 743 LEU A H    3  
ATOM 4303  H HA   . LEU A 1 36  ? 10.750  -0.496  3.879   1.00 0.00 ? 743 LEU A HA   3  
ATOM 4304  H HB2  . LEU A 1 36  ? 7.750   -0.593  4.177   1.00 0.00 ? 743 LEU A HB2  3  
ATOM 4305  H HB3  . LEU A 1 36  ? 8.800   -1.989  4.221   1.00 0.00 ? 743 LEU A HB3  3  
ATOM 4306  H HG   . LEU A 1 36  ? 8.785   0.269   6.235   1.00 0.00 ? 743 LEU A HG   3  
ATOM 4307  H HD11 . LEU A 1 36  ? 6.810   -1.135  6.395   1.00 0.00 ? 743 LEU A HD11 3  
ATOM 4308  H HD12 . LEU A 1 36  ? 7.885   -1.406  7.765   1.00 0.00 ? 743 LEU A HD12 3  
ATOM 4309  H HD13 . LEU A 1 36  ? 7.823   -2.576  6.446   1.00 0.00 ? 743 LEU A HD13 3  
ATOM 4310  H HD21 . LEU A 1 36  ? 10.352  -2.310  6.184   1.00 0.00 ? 743 LEU A HD21 3  
ATOM 4311  H HD22 . LEU A 1 36  ? 10.286  -1.180  7.536   1.00 0.00 ? 743 LEU A HD22 3  
ATOM 4312  H HD23 . LEU A 1 36  ? 11.016  -0.683  6.011   1.00 0.00 ? 743 LEU A HD23 3  
ATOM 4313  N N    . LYS A 1 37  ? 9.782   -1.836  1.810   1.00 0.00 ? 744 LYS A N    3  
ATOM 4314  C CA   . LYS A 1 37  ? 9.599   -2.391  0.478   1.00 0.00 ? 744 LYS A CA   3  
ATOM 4315  C C    . LYS A 1 37  ? 8.096   -2.558  0.249   1.00 0.00 ? 744 LYS A C    3  
ATOM 4316  O O    . LYS A 1 37  ? 7.407   -3.140  1.095   1.00 0.00 ? 744 LYS A O    3  
ATOM 4317  C CB   . LYS A 1 37  ? 10.300  -3.770  0.406   1.00 0.00 ? 744 LYS A CB   3  
ATOM 4318  C CG   . LYS A 1 37  ? 10.348  -4.424  -0.983  1.00 0.00 ? 744 LYS A CG   3  
ATOM 4319  C CD   . LYS A 1 37  ? 11.269  -3.676  -1.957  1.00 0.00 ? 744 LYS A CD   3  
ATOM 4320  C CE   . LYS A 1 37  ? 12.740  -3.688  -1.505  1.00 0.00 ? 744 LYS A CE   3  
ATOM 4321  N NZ   . LYS A 1 37  ? 13.314  -5.055  -1.445  1.00 0.00 ? 744 LYS A NZ   3  
ATOM 4322  H H    . LYS A 1 37  ? 10.072  -2.439  2.530   1.00 0.00 ? 744 LYS A H    3  
ATOM 4323  H HA   . LYS A 1 37  ? 10.022  -1.721  -0.255  1.00 0.00 ? 744 LYS A HA   3  
ATOM 4324  H HB2  . LYS A 1 37  ? 11.311  -3.663  0.767   1.00 0.00 ? 744 LYS A HB2  3  
ATOM 4325  H HB3  . LYS A 1 37  ? 9.775   -4.438  1.073   1.00 0.00 ? 744 LYS A HB3  3  
ATOM 4326  H HG2  . LYS A 1 37  ? 10.708  -5.436  -0.877  1.00 0.00 ? 744 LYS A HG2  3  
ATOM 4327  H HG3  . LYS A 1 37  ? 9.347   -4.443  -1.388  1.00 0.00 ? 744 LYS A HG3  3  
ATOM 4328  H HD2  . LYS A 1 37  ? 11.207  -4.151  -2.926  1.00 0.00 ? 744 LYS A HD2  3  
ATOM 4329  H HD3  . LYS A 1 37  ? 10.936  -2.652  -2.044  1.00 0.00 ? 744 LYS A HD3  3  
ATOM 4330  H HE2  . LYS A 1 37  ? 13.319  -3.107  -2.208  1.00 0.00 ? 744 LYS A HE2  3  
ATOM 4331  H HE3  . LYS A 1 37  ? 12.815  -3.227  -0.532  1.00 0.00 ? 744 LYS A HE3  3  
ATOM 4332  H HZ1  . LYS A 1 37  ? 12.774  -5.709  -0.843  1.00 0.00 ? 744 LYS A HZ1  3  
ATOM 4333  H HZ2  . LYS A 1 37  ? 14.271  -5.013  -1.038  1.00 0.00 ? 744 LYS A HZ2  3  
ATOM 4334  H HZ3  . LYS A 1 37  ? 13.417  -5.480  -2.398  1.00 0.00 ? 744 LYS A HZ3  3  
ATOM 4335  N N    . ARG A 1 38  ? 7.591   -2.079  -0.890  1.00 0.00 ? 745 ARG A N    3  
ATOM 4336  C CA   . ARG A 1 38  ? 6.137   -2.082  -1.151  1.00 0.00 ? 745 ARG A CA   3  
ATOM 4337  C C    . ARG A 1 38  ? 5.527   -3.496  -1.125  1.00 0.00 ? 745 ARG A C    3  
ATOM 4338  O O    . ARG A 1 38  ? 4.379   -3.678  -0.729  1.00 0.00 ? 745 ARG A O    3  
ATOM 4339  C CB   . ARG A 1 38  ? 5.780   -1.406  -2.490  1.00 0.00 ? 745 ARG A CB   3  
ATOM 4340  C CG   . ARG A 1 38  ? 6.123   -2.228  -3.730  1.00 0.00 ? 745 ARG A CG   3  
ATOM 4341  C CD   . ARG A 1 38  ? 5.467   -1.657  -4.972  1.00 0.00 ? 745 ARG A CD   3  
ATOM 4342  N NE   . ARG A 1 38  ? 5.501   -2.615  -6.078  1.00 0.00 ? 745 ARG A NE   3  
ATOM 4343  C CZ   . ARG A 1 38  ? 4.431   -3.049  -6.774  1.00 0.00 ? 745 ARG A CZ   3  
ATOM 4344  N NH1  . ARG A 1 38  ? 3.209   -2.622  -6.472  1.00 0.00 ? 745 ARG A NH1  3  
ATOM 4345  N NH2  . ARG A 1 38  ? 4.603   -3.927  -7.749  1.00 0.00 ? 745 ARG A NH2  3  
ATOM 4346  H H    . ARG A 1 38  ? 8.212   -1.694  -1.544  1.00 0.00 ? 745 ARG A H    3  
ATOM 4347  H HA   . ARG A 1 38  ? 5.685   -1.511  -0.354  1.00 0.00 ? 745 ARG A HA   3  
ATOM 4348  H HB2  . ARG A 1 38  ? 4.717   -1.219  -2.495  1.00 0.00 ? 745 ARG A HB2  3  
ATOM 4349  H HB3  . ARG A 1 38  ? 6.308   -0.466  -2.544  1.00 0.00 ? 745 ARG A HB3  3  
ATOM 4350  H HG2  . ARG A 1 38  ? 7.194   -2.234  -3.866  1.00 0.00 ? 745 ARG A HG2  3  
ATOM 4351  H HG3  . ARG A 1 38  ? 5.776   -3.241  -3.582  1.00 0.00 ? 745 ARG A HG3  3  
ATOM 4352  H HD2  . ARG A 1 38  ? 4.441   -1.405  -4.748  1.00 0.00 ? 745 ARG A HD2  3  
ATOM 4353  H HD3  . ARG A 1 38  ? 6.001   -0.766  -5.267  1.00 0.00 ? 745 ARG A HD3  3  
ATOM 4354  H HE   . ARG A 1 38  ? 6.389   -2.972  -6.327  1.00 0.00 ? 745 ARG A HE   3  
ATOM 4355  H HH11 . ARG A 1 38  ? 3.027   -1.968  -5.742  1.00 0.00 ? 745 ARG A HH11 3  
ATOM 4356  H HH12 . ARG A 1 38  ? 2.386   -2.967  -6.959  1.00 0.00 ? 745 ARG A HH12 3  
ATOM 4357  H HH21 . ARG A 1 38  ? 5.535   -4.260  -7.943  1.00 0.00 ? 745 ARG A HH21 3  
ATOM 4358  H HH22 . ARG A 1 38  ? 3.856   -4.284  -8.317  1.00 0.00 ? 745 ARG A HH22 3  
ATOM 4359  N N    . SER A 1 39  ? 6.306   -4.474  -1.534  1.00 0.00 ? 746 SER A N    3  
ATOM 4360  C CA   . SER A 1 39  ? 5.851   -5.838  -1.654  1.00 0.00 ? 746 SER A CA   3  
ATOM 4361  C C    . SER A 1 39  ? 5.496   -6.451  -0.295  1.00 0.00 ? 746 SER A C    3  
ATOM 4362  O O    . SER A 1 39  ? 4.596   -7.284  -0.205  1.00 0.00 ? 746 SER A O    3  
ATOM 4363  C CB   . SER A 1 39  ? 6.937   -6.634  -2.346  1.00 0.00 ? 746 SER A CB   3  
ATOM 4364  O OG   . SER A 1 39  ? 7.346   -5.944  -3.518  1.00 0.00 ? 746 SER A OG   3  
ATOM 4365  H H    . SER A 1 39  ? 7.232   -4.292  -1.799  1.00 0.00 ? 746 SER A H    3  
ATOM 4366  H HA   . SER A 1 39  ? 4.975   -5.847  -2.285  1.00 0.00 ? 746 SER A HA   3  
ATOM 4367  H HB2  . SER A 1 39  ? 7.783   -6.741  -1.682  1.00 0.00 ? 746 SER A HB2  3  
ATOM 4368  H HB3  . SER A 1 39  ? 6.564   -7.608  -2.623  1.00 0.00 ? 746 SER A HB3  3  
ATOM 4369  H HG   . SER A 1 39  ? 6.744   -6.189  -4.232  1.00 0.00 ? 746 SER A HG   3  
ATOM 4370  N N    . GLU A 1 40  ? 6.156   -5.983  0.760   1.00 0.00 ? 747 GLU A N    3  
ATOM 4371  C CA   . GLU A 1 40  ? 5.945   -6.516  2.089   1.00 0.00 ? 747 GLU A CA   3  
ATOM 4372  C C    . GLU A 1 40  ? 4.547   -6.172  2.575   1.00 0.00 ? 747 GLU A C    3  
ATOM 4373  O O    . GLU A 1 40  ? 3.930   -6.961  3.261   1.00 0.00 ? 747 GLU A O    3  
ATOM 4374  C CB   . GLU A 1 40  ? 6.993   -5.994  3.071   1.00 0.00 ? 747 GLU A CB   3  
ATOM 4375  C CG   . GLU A 1 40  ? 6.961   -6.703  4.419   1.00 0.00 ? 747 GLU A CG   3  
ATOM 4376  C CD   . GLU A 1 40  ? 7.186   -8.196  4.280   1.00 0.00 ? 747 GLU A CD   3  
ATOM 4377  O OE1  . GLU A 1 40  ? 8.330   -8.609  4.011   1.00 0.00 ? 747 GLU A OE1  3  
ATOM 4378  O OE2  . GLU A 1 40  ? 6.234   -8.979  4.412   1.00 0.00 ? 747 GLU A OE2  3  
ATOM 4379  H H    . GLU A 1 40  ? 6.796   -5.254  0.637   1.00 0.00 ? 747 GLU A H    3  
ATOM 4380  H HA   . GLU A 1 40  ? 6.028   -7.592  2.025   1.00 0.00 ? 747 GLU A HA   3  
ATOM 4381  H HB2  . GLU A 1 40  ? 7.976   -6.114  2.640   1.00 0.00 ? 747 GLU A HB2  3  
ATOM 4382  H HB3  . GLU A 1 40  ? 6.815   -4.942  3.240   1.00 0.00 ? 747 GLU A HB3  3  
ATOM 4383  H HG2  . GLU A 1 40  ? 7.725   -6.291  5.060   1.00 0.00 ? 747 GLU A HG2  3  
ATOM 4384  H HG3  . GLU A 1 40  ? 5.987   -6.541  4.858   1.00 0.00 ? 747 GLU A HG3  3  
ATOM 4385  N N    . LEU A 1 41  ? 4.042   -5.004  2.161   1.00 0.00 ? 748 LEU A N    3  
ATOM 4386  C CA   . LEU A 1 41  ? 2.686   -4.557  2.519   1.00 0.00 ? 748 LEU A CA   3  
ATOM 4387  C C    . LEU A 1 41  ? 1.677   -5.612  2.125   1.00 0.00 ? 748 LEU A C    3  
ATOM 4388  O O    . LEU A 1 41  ? 0.886   -6.077  2.946   1.00 0.00 ? 748 LEU A O    3  
ATOM 4389  C CB   . LEU A 1 41  ? 2.328   -3.215  1.830   1.00 0.00 ? 748 LEU A CB   3  
ATOM 4390  C CG   . LEU A 1 41  ? 2.912   -1.911  2.417   1.00 0.00 ? 748 LEU A CG   3  
ATOM 4391  C CD1  . LEU A 1 41  ? 2.390   -1.680  3.814   1.00 0.00 ? 748 LEU A CD1  3  
ATOM 4392  C CD2  . LEU A 1 41  ? 4.436   -1.898  2.409   1.00 0.00 ? 748 LEU A CD2  3  
ATOM 4393  H H    . LEU A 1 41  ? 4.602   -4.439  1.590   1.00 0.00 ? 748 LEU A H    3  
ATOM 4394  H HA   . LEU A 1 41  ? 2.652   -4.428  3.590   1.00 0.00 ? 748 LEU A HA   3  
ATOM 4395  H HB2  . LEU A 1 41  ? 2.653   -3.280  0.803   1.00 0.00 ? 748 LEU A HB2  3  
ATOM 4396  H HB3  . LEU A 1 41  ? 1.251   -3.130  1.829   1.00 0.00 ? 748 LEU A HB3  3  
ATOM 4397  H HG   . LEU A 1 41  ? 2.559   -1.088  1.813   1.00 0.00 ? 748 LEU A HG   3  
ATOM 4398  H HD11 . LEU A 1 41  ? 2.803   -0.761  4.200   1.00 0.00 ? 748 LEU A HD11 3  
ATOM 4399  H HD12 . LEU A 1 41  ? 2.687   -2.498  4.454   1.00 0.00 ? 748 LEU A HD12 3  
ATOM 4400  H HD13 . LEU A 1 41  ? 1.313   -1.608  3.795   1.00 0.00 ? 748 LEU A HD13 3  
ATOM 4401  H HD21 . LEU A 1 41  ? 4.790   -2.015  1.397   1.00 0.00 ? 748 LEU A HD21 3  
ATOM 4402  H HD22 . LEU A 1 41  ? 4.805   -2.712  3.017   1.00 0.00 ? 748 LEU A HD22 3  
ATOM 4403  H HD23 . LEU A 1 41  ? 4.793   -0.961  2.811   1.00 0.00 ? 748 LEU A HD23 3  
ATOM 4404  N N    . VAL A 1 42  ? 1.763   -6.025  0.876   1.00 0.00 ? 749 VAL A N    3  
ATOM 4405  C CA   . VAL A 1 42  ? 0.890   -7.043  0.339   1.00 0.00 ? 749 VAL A CA   3  
ATOM 4406  C C    . VAL A 1 42  ? 1.182   -8.355  1.042   1.00 0.00 ? 749 VAL A C    3  
ATOM 4407  O O    . VAL A 1 42  ? 0.283   -9.040  1.491   1.00 0.00 ? 749 VAL A O    3  
ATOM 4408  C CB   . VAL A 1 42  ? 1.129   -7.249  -1.185  1.00 0.00 ? 749 VAL A CB   3  
ATOM 4409  C CG1  . VAL A 1 42  ? 0.127   -8.228  -1.762  1.00 0.00 ? 749 VAL A CG1  3  
ATOM 4410  C CG2  . VAL A 1 42  ? 1.066   -5.935  -1.934  1.00 0.00 ? 749 VAL A CG2  3  
ATOM 4411  H H    . VAL A 1 42  ? 2.456   -5.633  0.305   1.00 0.00 ? 749 VAL A H    3  
ATOM 4412  H HA   . VAL A 1 42  ? -0.136  -6.750  0.499   1.00 0.00 ? 749 VAL A HA   3  
ATOM 4413  H HB   . VAL A 1 42  ? 2.115   -7.669  -1.311  1.00 0.00 ? 749 VAL A HB   3  
ATOM 4414  H HG11 . VAL A 1 42  ? 0.346   -8.413  -2.803  1.00 0.00 ? 749 VAL A HG11 3  
ATOM 4415  H HG12 . VAL A 1 42  ? -0.847  -7.770  -1.684  1.00 0.00 ? 749 VAL A HG12 3  
ATOM 4416  H HG13 . VAL A 1 42  ? 0.135   -9.150  -1.198  1.00 0.00 ? 749 VAL A HG13 3  
ATOM 4417  H HG21 . VAL A 1 42  ? 0.091   -5.495  -1.790  1.00 0.00 ? 749 VAL A HG21 3  
ATOM 4418  H HG22 . VAL A 1 42  ? 1.230   -6.113  -2.987  1.00 0.00 ? 749 VAL A HG22 3  
ATOM 4419  H HG23 . VAL A 1 42  ? 1.825   -5.266  -1.556  1.00 0.00 ? 749 VAL A HG23 3  
ATOM 4420  N N    . ASN A 1 43  ? 2.458   -8.632  1.185   1.00 0.00 ? 750 ASN A N    3  
ATOM 4421  C CA   . ASN A 1 43  ? 2.961   -9.886  1.720   1.00 0.00 ? 750 ASN A CA   3  
ATOM 4422  C C    . ASN A 1 43  ? 2.410   -10.181 3.128   1.00 0.00 ? 750 ASN A C    3  
ATOM 4423  O O    . ASN A 1 43  ? 1.756   -11.229 3.347   1.00 0.00 ? 750 ASN A O    3  
ATOM 4424  C CB   . ASN A 1 43  ? 4.501   -9.876  1.702   1.00 0.00 ? 750 ASN A CB   3  
ATOM 4425  C CG   . ASN A 1 43  ? 5.102   -11.226 2.027   1.00 0.00 ? 750 ASN A CG   3  
ATOM 4426  O OD1  . ASN A 1 43  ? 5.230   -12.087 1.154   1.00 0.00 ? 750 ASN A OD1  3  
ATOM 4427  N ND2  . ASN A 1 43  ? 5.567   -11.384 3.230   1.00 0.00 ? 750 ASN A ND2  3  
ATOM 4428  H H    . ASN A 1 43  ? 3.111   -7.946  0.925   1.00 0.00 ? 750 ASN A H    3  
ATOM 4429  H HA   . ASN A 1 43  ? 2.622   -10.671 1.059   1.00 0.00 ? 750 ASN A HA   3  
ATOM 4430  H HB2  . ASN A 1 43  ? 4.899   -9.479  0.779   1.00 0.00 ? 750 ASN A HB2  3  
ATOM 4431  H HB3  . ASN A 1 43  ? 4.804   -9.198  2.486   1.00 0.00 ? 750 ASN A HB3  3  
ATOM 4432  H HD21 . ASN A 1 43  ? 5.515   -10.603 3.835   1.00 0.00 ? 750 ASN A HD21 3  
ATOM 4433  H HD22 . ASN A 1 43  ? 5.926   -12.253 3.504   1.00 0.00 ? 750 ASN A HD22 3  
ATOM 4434  N N    . TRP A 1 44  ? 2.603   -9.254  4.067   1.00 0.00 ? 751 TRP A N    3  
ATOM 4435  C CA   . TRP A 1 44  ? 2.111   -9.472  5.416   1.00 0.00 ? 751 TRP A CA   3  
ATOM 4436  C C    . TRP A 1 44  ? 0.586   -9.410  5.441   1.00 0.00 ? 751 TRP A C    3  
ATOM 4437  O O    . TRP A 1 44  ? -0.049  -10.084 6.258   1.00 0.00 ? 751 TRP A O    3  
ATOM 4438  C CB   . TRP A 1 44  ? 2.740   -8.520  6.487   1.00 0.00 ? 751 TRP A CB   3  
ATOM 4439  C CG   . TRP A 1 44  ? 2.280   -7.075  6.464   1.00 0.00 ? 751 TRP A CG   3  
ATOM 4440  C CD1  . TRP A 1 44  ? 2.909   -6.021  5.884   1.00 0.00 ? 751 TRP A CD1  3  
ATOM 4441  C CD2  . TRP A 1 44  ? 1.099   -6.532  7.089   1.00 0.00 ? 751 TRP A CD2  3  
ATOM 4442  N NE1  . TRP A 1 44  ? 2.186   -4.872  6.077   1.00 0.00 ? 751 TRP A NE1  3  
ATOM 4443  C CE2  . TRP A 1 44  ? 1.075   -5.161  6.813   1.00 0.00 ? 751 TRP A CE2  3  
ATOM 4444  C CE3  . TRP A 1 44  ? 0.056   -7.079  7.837   1.00 0.00 ? 751 TRP A CE3  3  
ATOM 4445  C CZ2  . TRP A 1 44  ? 0.059   -4.330  7.259   1.00 0.00 ? 751 TRP A CZ2  3  
ATOM 4446  C CZ3  . TRP A 1 44  ? -0.955  -6.251  8.278   1.00 0.00 ? 751 TRP A CZ3  3  
ATOM 4447  C CH2  . TRP A 1 44  ? -0.947  -4.893  7.986   1.00 0.00 ? 751 TRP A CH2  3  
ATOM 4448  H H    . TRP A 1 44  ? 3.088   -8.426  3.844   1.00 0.00 ? 751 TRP A H    3  
ATOM 4449  H HA   . TRP A 1 44  ? 2.380   -10.492 5.654   1.00 0.00 ? 751 TRP A HA   3  
ATOM 4450  H HB2  . TRP A 1 44  ? 2.512   -8.907  7.469   1.00 0.00 ? 751 TRP A HB2  3  
ATOM 4451  H HB3  . TRP A 1 44  ? 3.813   -8.530  6.357   1.00 0.00 ? 751 TRP A HB3  3  
ATOM 4452  H HD1  . TRP A 1 44  ? 3.838   -6.094  5.338   1.00 0.00 ? 751 TRP A HD1  3  
ATOM 4453  H HE1  . TRP A 1 44  ? 2.434   -3.984  5.742   1.00 0.00 ? 751 TRP A HE1  3  
ATOM 4454  H HE3  . TRP A 1 44  ? 0.035   -8.134  8.072   1.00 0.00 ? 751 TRP A HE3  3  
ATOM 4455  H HZ2  . TRP A 1 44  ? 0.058   -3.274  7.037   1.00 0.00 ? 751 TRP A HZ2  3  
ATOM 4456  H HZ3  . TRP A 1 44  ? -1.772  -6.651  8.857   1.00 0.00 ? 751 TRP A HZ3  3  
ATOM 4457  H HH2  . TRP A 1 44  ? -1.767  -4.289  8.344   1.00 0.00 ? 751 TRP A HH2  3  
ATOM 4458  N N    . TYR A 1 45  ? 0.001   -8.619  4.522   1.00 0.00 ? 752 TYR A N    3  
ATOM 4459  C CA   . TYR A 1 45  ? -1.446  -8.463  4.445   1.00 0.00 ? 752 TYR A CA   3  
ATOM 4460  C C    . TYR A 1 45  ? -2.088  -9.794  4.154   1.00 0.00 ? 752 TYR A C    3  
ATOM 4461  O O    . TYR A 1 45  ? -3.051  -10.194 4.823   1.00 0.00 ? 752 TYR A O    3  
ATOM 4462  C CB   . TYR A 1 45  ? -1.824  -7.466  3.353   1.00 0.00 ? 752 TYR A CB   3  
ATOM 4463  C CG   . TYR A 1 45  ? -3.298  -7.141  3.286   1.00 0.00 ? 752 TYR A CG   3  
ATOM 4464  C CD1  . TYR A 1 45  ? -3.973  -6.682  4.417   1.00 0.00 ? 752 TYR A CD1  3  
ATOM 4465  C CD2  . TYR A 1 45  ? -4.012  -7.264  2.098   1.00 0.00 ? 752 TYR A CD2  3  
ATOM 4466  C CE1  . TYR A 1 45  ? -5.304  -6.365  4.367   1.00 0.00 ? 752 TYR A CE1  3  
ATOM 4467  C CE2  . TYR A 1 45  ? -5.343  -6.948  2.046   1.00 0.00 ? 752 TYR A CE2  3  
ATOM 4468  C CZ   . TYR A 1 45  ? -5.987  -6.496  3.189   1.00 0.00 ? 752 TYR A CZ   3  
ATOM 4469  O OH   . TYR A 1 45  ? -7.319  -6.186  3.152   1.00 0.00 ? 752 TYR A OH   3  
ATOM 4470  H H    . TYR A 1 45  ? 0.560   -8.130  3.874   1.00 0.00 ? 752 TYR A H    3  
ATOM 4471  H HA   . TYR A 1 45  ? -1.799  -8.095  5.396   1.00 0.00 ? 752 TYR A HA   3  
ATOM 4472  H HB2  . TYR A 1 45  ? -1.277  -6.547  3.504   1.00 0.00 ? 752 TYR A HB2  3  
ATOM 4473  H HB3  . TYR A 1 45  ? -1.532  -7.883  2.399   1.00 0.00 ? 752 TYR A HB3  3  
ATOM 4474  H HD1  . TYR A 1 45  ? -3.435  -6.572  5.349   1.00 0.00 ? 752 TYR A HD1  3  
ATOM 4475  H HD2  . TYR A 1 45  ? -3.528  -7.612  1.195   1.00 0.00 ? 752 TYR A HD2  3  
ATOM 4476  H HE1  . TYR A 1 45  ? -5.805  -6.009  5.255   1.00 0.00 ? 752 TYR A HE1  3  
ATOM 4477  H HE2  . TYR A 1 45  ? -5.860  -7.055  1.104   1.00 0.00 ? 752 TYR A HE2  3  
ATOM 4478  H HH   . TYR A 1 45  ? -7.786  -6.920  2.749   1.00 0.00 ? 752 TYR A HH   3  
ATOM 4479  N N    . LEU A 1 46  ? -1.532  -10.487 3.176   1.00 0.00 ? 753 LEU A N    3  
ATOM 4480  C CA   . LEU A 1 46  ? -2.008  -11.791 2.777   1.00 0.00 ? 753 LEU A CA   3  
ATOM 4481  C C    . LEU A 1 46  ? -1.924  -12.735 3.953   1.00 0.00 ? 753 LEU A C    3  
ATOM 4482  O O    . LEU A 1 46  ? -2.880  -13.408 4.269   1.00 0.00 ? 753 LEU A O    3  
ATOM 4483  C CB   . LEU A 1 46  ? -1.178  -12.319 1.619   1.00 0.00 ? 753 LEU A CB   3  
ATOM 4484  C CG   . LEU A 1 46  ? -1.059  -11.386 0.420   1.00 0.00 ? 753 LEU A CG   3  
ATOM 4485  C CD1  . LEU A 1 46  ? -0.149  -11.971 -0.620  1.00 0.00 ? 753 LEU A CD1  3  
ATOM 4486  C CD2  . LEU A 1 46  ? -2.422  -11.021 -0.164  1.00 0.00 ? 753 LEU A CD2  3  
ATOM 4487  H H    . LEU A 1 46  ? -0.772  -10.083 2.694   1.00 0.00 ? 753 LEU A H    3  
ATOM 4488  H HA   . LEU A 1 46  ? -3.037  -11.702 2.466   1.00 0.00 ? 753 LEU A HA   3  
ATOM 4489  H HB2  . LEU A 1 46  ? -0.186  -12.530 1.990   1.00 0.00 ? 753 LEU A HB2  3  
ATOM 4490  H HB3  . LEU A 1 46  ? -1.622  -13.243 1.280   1.00 0.00 ? 753 LEU A HB3  3  
ATOM 4491  H HG   . LEU A 1 46  ? -0.587  -10.476 0.762   1.00 0.00 ? 753 LEU A HG   3  
ATOM 4492  H HD11 . LEU A 1 46  ? -0.538  -12.917 -0.965  1.00 0.00 ? 753 LEU A HD11 3  
ATOM 4493  H HD12 . LEU A 1 46  ? 0.820   -12.109 -0.162  1.00 0.00 ? 753 LEU A HD12 3  
ATOM 4494  H HD13 . LEU A 1 46  ? -0.068  -11.272 -1.440  1.00 0.00 ? 753 LEU A HD13 3  
ATOM 4495  H HD21 . LEU A 1 46  ? -2.285  -10.364 -1.011  1.00 0.00 ? 753 LEU A HD21 3  
ATOM 4496  H HD22 . LEU A 1 46  ? -3.001  -10.494 0.581   1.00 0.00 ? 753 LEU A HD22 3  
ATOM 4497  H HD23 . LEU A 1 46  ? -2.943  -11.914 -0.478  1.00 0.00 ? 753 LEU A HD23 3  
ATOM 4498  N N    . LYS A 1 47  ? -0.797  -12.700 4.644   1.00 0.00 ? 754 LYS A N    3  
ATOM 4499  C CA   . LYS A 1 47  ? -0.570  -13.548 5.830   1.00 0.00 ? 754 LYS A CA   3  
ATOM 4500  C C    . LYS A 1 47  ? -1.563  -13.288 6.969   1.00 0.00 ? 754 LYS A C    3  
ATOM 4501  O O    . LYS A 1 47  ? -1.803  -14.153 7.815   1.00 0.00 ? 754 LYS A O    3  
ATOM 4502  C CB   . LYS A 1 47  ? 0.884   -13.444 6.319   1.00 0.00 ? 754 LYS A CB   3  
ATOM 4503  C CG   . LYS A 1 47  ? 1.826   -14.432 5.638   1.00 0.00 ? 754 LYS A CG   3  
ATOM 4504  C CD   . LYS A 1 47  ? 1.803   -14.297 4.125   1.00 0.00 ? 754 LYS A CD   3  
ATOM 4505  C CE   . LYS A 1 47  ? 2.450   -15.476 3.449   1.00 0.00 ? 754 LYS A CE   3  
ATOM 4506  N NZ   . LYS A 1 47  ? 1.820   -16.750 3.866   1.00 0.00 ? 754 LYS A NZ   3  
ATOM 4507  H H    . LYS A 1 47  ? -0.082  -12.098 4.329   1.00 0.00 ? 754 LYS A H    3  
ATOM 4508  H HA   . LYS A 1 47  ? -0.736  -14.563 5.499   1.00 0.00 ? 754 LYS A HA   3  
ATOM 4509  H HB2  . LYS A 1 47  ? 1.231   -12.441 6.107   1.00 0.00 ? 754 LYS A HB2  3  
ATOM 4510  H HB3  . LYS A 1 47  ? 0.912   -13.612 7.385   1.00 0.00 ? 754 LYS A HB3  3  
ATOM 4511  H HG2  . LYS A 1 47  ? 2.830   -14.241 5.984   1.00 0.00 ? 754 LYS A HG2  3  
ATOM 4512  H HG3  . LYS A 1 47  ? 1.539   -15.437 5.909   1.00 0.00 ? 754 LYS A HG3  3  
ATOM 4513  H HD2  . LYS A 1 47  ? 0.776   -14.236 3.798   1.00 0.00 ? 754 LYS A HD2  3  
ATOM 4514  H HD3  . LYS A 1 47  ? 2.327   -13.394 3.846   1.00 0.00 ? 754 LYS A HD3  3  
ATOM 4515  H HE2  . LYS A 1 47  ? 2.338   -15.363 2.381   1.00 0.00 ? 754 LYS A HE2  3  
ATOM 4516  H HE3  . LYS A 1 47  ? 3.500   -15.494 3.701   1.00 0.00 ? 754 LYS A HE3  3  
ATOM 4517  H HZ1  . LYS A 1 47  ? 0.780   -16.640 3.912   1.00 0.00 ? 754 LYS A HZ1  3  
ATOM 4518  H HZ2  . LYS A 1 47  ? 2.164   -17.084 4.788   1.00 0.00 ? 754 LYS A HZ2  3  
ATOM 4519  H HZ3  . LYS A 1 47  ? 2.010   -17.484 3.155   1.00 0.00 ? 754 LYS A HZ3  3  
ATOM 4520  N N    . GLU A 1 48  ? -2.124  -12.120 6.992   1.00 0.00 ? 755 GLU A N    3  
ATOM 4521  C CA   . GLU A 1 48  ? -3.098  -11.762 8.006   1.00 0.00 ? 755 GLU A CA   3  
ATOM 4522  C C    . GLU A 1 48  ? -4.476  -12.229 7.630   1.00 0.00 ? 755 GLU A C    3  
ATOM 4523  O O    . GLU A 1 48  ? -5.192  -12.856 8.428   1.00 0.00 ? 755 GLU A O    3  
ATOM 4524  C CB   . GLU A 1 48  ? -3.122  -10.262 8.249   1.00 0.00 ? 755 GLU A CB   3  
ATOM 4525  C CG   . GLU A 1 48  ? -1.914  -9.747  8.980   1.00 0.00 ? 755 GLU A CG   3  
ATOM 4526  C CD   . GLU A 1 48  ? -1.761  -10.392 10.324  1.00 0.00 ? 755 GLU A CD   3  
ATOM 4527  O OE1  . GLU A 1 48  ? -2.599  -10.149 11.212  1.00 0.00 ? 755 GLU A OE1  3  
ATOM 4528  O OE2  . GLU A 1 48  ? -0.814  -11.175 10.510  1.00 0.00 ? 755 GLU A OE2  3  
ATOM 4529  H H    . GLU A 1 48  ? -1.891  -11.498 6.271   1.00 0.00 ? 755 GLU A H    3  
ATOM 4530  H HA   . GLU A 1 48  ? -2.808  -12.251 8.925   1.00 0.00 ? 755 GLU A HA   3  
ATOM 4531  H HB2  . GLU A 1 48  ? -3.179  -9.758  7.296   1.00 0.00 ? 755 GLU A HB2  3  
ATOM 4532  H HB3  . GLU A 1 48  ? -4.001  -10.023 8.827   1.00 0.00 ? 755 GLU A HB3  3  
ATOM 4533  H HG2  . GLU A 1 48  ? -1.037  -9.967  8.389   1.00 0.00 ? 755 GLU A HG2  3  
ATOM 4534  H HG3  . GLU A 1 48  ? -2.010  -8.679  9.114   1.00 0.00 ? 755 GLU A HG3  3  
ATOM 4535  N N    . ILE A 1 49  ? -4.841  -11.944 6.410   1.00 0.00 ? 756 ILE A N    3  
ATOM 4536  C CA   . ILE A 1 49  ? -6.168  -12.228 5.925   1.00 0.00 ? 756 ILE A CA   3  
ATOM 4537  C C    . ILE A 1 49  ? -6.342  -13.688 5.571   1.00 0.00 ? 756 ILE A C    3  
ATOM 4538  O O    . ILE A 1 49  ? -7.450  -14.175 5.544   1.00 0.00 ? 756 ILE A O    3  
ATOM 4539  C CB   . ILE A 1 49  ? -6.533  -11.356 4.693   1.00 0.00 ? 756 ILE A CB   3  
ATOM 4540  C CG1  . ILE A 1 49  ? -5.555  -11.624 3.537   1.00 0.00 ? 756 ILE A CG1  3  
ATOM 4541  C CG2  . ILE A 1 49  ? -6.540  -9.882  5.077   1.00 0.00 ? 756 ILE A CG2  3  
ATOM 4542  C CD1  . ILE A 1 49  ? -5.817  -10.823 2.288   1.00 0.00 ? 756 ILE A CD1  3  
ATOM 4543  H H    . ILE A 1 49  ? -4.186  -11.518 5.811   1.00 0.00 ? 756 ILE A H    3  
ATOM 4544  H HA   . ILE A 1 49  ? -6.862  -11.985 6.716   1.00 0.00 ? 756 ILE A HA   3  
ATOM 4545  H HB   . ILE A 1 49  ? -7.531  -11.627 4.381   1.00 0.00 ? 756 ILE A HB   3  
ATOM 4546  H HG12 . ILE A 1 49  ? -4.557  -11.386 3.871   1.00 0.00 ? 756 ILE A HG12 3  
ATOM 4547  H HG13 . ILE A 1 49  ? -5.598  -12.673 3.280   1.00 0.00 ? 756 ILE A HG13 3  
ATOM 4548  H HG21 . ILE A 1 49  ? -5.562  -9.600  5.439   1.00 0.00 ? 756 ILE A HG21 3  
ATOM 4549  H HG22 . ILE A 1 49  ? -7.273  -9.720  5.853   1.00 0.00 ? 756 ILE A HG22 3  
ATOM 4550  H HG23 . ILE A 1 49  ? -6.791  -9.285  4.213   1.00 0.00 ? 756 ILE A HG23 3  
ATOM 4551  H HD11 . ILE A 1 49  ? -5.077  -11.067 1.541   1.00 0.00 ? 756 ILE A HD11 3  
ATOM 4552  H HD12 . ILE A 1 49  ? -5.763  -9.768  2.520   1.00 0.00 ? 756 ILE A HD12 3  
ATOM 4553  H HD13 . ILE A 1 49  ? -6.801  -11.057 1.910   1.00 0.00 ? 756 ILE A HD13 3  
ATOM 4554  N N    . GLU A 1 50  ? -5.241  -14.396 5.348   1.00 0.00 ? 757 GLU A N    3  
ATOM 4555  C CA   . GLU A 1 50  ? -5.285  -15.782 4.882   1.00 0.00 ? 757 GLU A CA   3  
ATOM 4556  C C    . GLU A 1 50  ? -6.010  -16.733 5.837   1.00 0.00 ? 757 GLU A C    3  
ATOM 4557  O O    . GLU A 1 50  ? -6.438  -17.822 5.438   1.00 0.00 ? 757 GLU A O    3  
ATOM 4558  C CB   . GLU A 1 50  ? -3.898  -16.297 4.496   1.00 0.00 ? 757 GLU A CB   3  
ATOM 4559  C CG   . GLU A 1 50  ? -2.885  -16.463 5.618   1.00 0.00 ? 757 GLU A CG   3  
ATOM 4560  C CD   . GLU A 1 50  ? -1.582  -17.064 5.104   1.00 0.00 ? 757 GLU A CD   3  
ATOM 4561  O OE1  . GLU A 1 50  ? -0.791  -16.365 4.438   1.00 0.00 ? 757 GLU A OE1  3  
ATOM 4562  O OE2  . GLU A 1 50  ? -1.348  -18.271 5.315   1.00 0.00 ? 757 GLU A OE2  3  
ATOM 4563  H H    . GLU A 1 50  ? -4.362  -13.969 5.455   1.00 0.00 ? 757 GLU A H    3  
ATOM 4564  H HA   . GLU A 1 50  ? -5.887  -15.756 3.985   1.00 0.00 ? 757 GLU A HA   3  
ATOM 4565  H HB2  . GLU A 1 50  ? -3.984  -17.236 3.975   1.00 0.00 ? 757 GLU A HB2  3  
ATOM 4566  H HB3  . GLU A 1 50  ? -3.497  -15.546 3.829   1.00 0.00 ? 757 GLU A HB3  3  
ATOM 4567  H HG2  . GLU A 1 50  ? -2.683  -15.499 6.060   1.00 0.00 ? 757 GLU A HG2  3  
ATOM 4568  H HG3  . GLU A 1 50  ? -3.298  -17.125 6.364   1.00 0.00 ? 757 GLU A HG3  3  
ATOM 4569  N N    . SER A 1 51  ? -6.170  -16.308 7.067   1.00 0.00 ? 758 SER A N    3  
ATOM 4570  C CA   . SER A 1 51  ? -6.881  -17.066 8.061   1.00 0.00 ? 758 SER A CA   3  
ATOM 4571  C C    . SER A 1 51  ? -8.403  -16.953 7.853   1.00 0.00 ? 758 SER A C    3  
ATOM 4572  O O    . SER A 1 51  ? -9.155  -17.874 8.179   1.00 0.00 ? 758 SER A O    3  
ATOM 4573  C CB   . SER A 1 51  ? -6.502  -16.525 9.418   1.00 0.00 ? 758 SER A CB   3  
ATOM 4574  O OG   . SER A 1 51  ? -5.090  -16.413 9.513   1.00 0.00 ? 758 SER A OG   3  
ATOM 4575  H H    . SER A 1 51  ? -5.763  -15.456 7.330   1.00 0.00 ? 758 SER A H    3  
ATOM 4576  H HA   . SER A 1 51  ? -6.583  -18.100 8.003   1.00 0.00 ? 758 SER A HA   3  
ATOM 4577  H HB2  . SER A 1 51  ? -6.947  -15.550 9.553   1.00 0.00 ? 758 SER A HB2  3  
ATOM 4578  H HB3  . SER A 1 51  ? -6.852  -17.195 10.190  1.00 0.00 ? 758 SER A HB3  3  
ATOM 4579  H HG   . SER A 1 51  ? -4.727  -17.302 9.632   1.00 0.00 ? 758 SER A HG   3  
ATOM 4580  N N    . GLU A 1 52  ? -8.837  -15.844 7.272   1.00 0.00 ? 759 GLU A N    3  
ATOM 4581  C CA   . GLU A 1 52  ? -10.258 -15.582 7.077   1.00 0.00 ? 759 GLU A CA   3  
ATOM 4582  C C    . GLU A 1 52  ? -10.632 -15.707 5.601   1.00 0.00 ? 759 GLU A C    3  
ATOM 4583  O O    . GLU A 1 52  ? -11.768 -15.453 5.198   1.00 0.00 ? 759 GLU A O    3  
ATOM 4584  C CB   . GLU A 1 52  ? -10.649 -14.198 7.645   1.00 0.00 ? 759 GLU A CB   3  
ATOM 4585  C CG   . GLU A 1 52  ? -9.913  -13.023 7.017   1.00 0.00 ? 759 GLU A CG   3  
ATOM 4586  C CD   . GLU A 1 52  ? -10.304 -11.695 7.616   1.00 0.00 ? 759 GLU A CD   3  
ATOM 4587  O OE1  . GLU A 1 52  ? -11.350 -11.137 7.228   1.00 0.00 ? 759 GLU A OE1  3  
ATOM 4588  O OE2  . GLU A 1 52  ? -9.563  -11.163 8.470   1.00 0.00 ? 759 GLU A OE2  3  
ATOM 4589  H H    . GLU A 1 52  ? -8.195  -15.180 6.931   1.00 0.00 ? 759 GLU A H    3  
ATOM 4590  H HA   . GLU A 1 52  ? -10.791 -16.347 7.620   1.00 0.00 ? 759 GLU A HA   3  
ATOM 4591  H HB2  . GLU A 1 52  ? -11.707 -14.046 7.495   1.00 0.00 ? 759 GLU A HB2  3  
ATOM 4592  H HB3  . GLU A 1 52  ? -10.446 -14.193 8.705   1.00 0.00 ? 759 GLU A HB3  3  
ATOM 4593  H HG2  . GLU A 1 52  ? -8.851  -13.165 7.152   1.00 0.00 ? 759 GLU A HG2  3  
ATOM 4594  H HG3  . GLU A 1 52  ? -10.137 -13.012 5.960   1.00 0.00 ? 759 GLU A HG3  3  
ATOM 4595  N N    . ILE A 1 53  ? -9.668  -16.109 4.799   1.00 0.00 ? 760 ILE A N    3  
ATOM 4596  C CA   . ILE A 1 53  ? -9.903  -16.316 3.395   1.00 0.00 ? 760 ILE A CA   3  
ATOM 4597  C C    . ILE A 1 53  ? -10.611 -17.643 3.185   1.00 0.00 ? 760 ILE A C    3  
ATOM 4598  O O    . ILE A 1 53  ? -10.016 -18.720 3.313   1.00 0.00 ? 760 ILE A O    3  
ATOM 4599  C CB   . ILE A 1 53  ? -8.600  -16.267 2.553   1.00 0.00 ? 760 ILE A CB   3  
ATOM 4600  C CG1  . ILE A 1 53  ? -7.945  -14.878 2.603   1.00 0.00 ? 760 ILE A CG1  3  
ATOM 4601  C CG2  . ILE A 1 53  ? -8.867  -16.673 1.122   1.00 0.00 ? 760 ILE A CG2  3  
ATOM 4602  C CD1  . ILE A 1 53  ? -8.807  -13.739 2.082   1.00 0.00 ? 760 ILE A CD1  3  
ATOM 4603  H H    . ILE A 1 53  ? -8.785  -16.272 5.185   1.00 0.00 ? 760 ILE A H    3  
ATOM 4604  H HA   . ILE A 1 53  ? -10.569 -15.536 3.059   1.00 0.00 ? 760 ILE A HA   3  
ATOM 4605  H HB   . ILE A 1 53  ? -7.917  -16.990 2.969   1.00 0.00 ? 760 ILE A HB   3  
ATOM 4606  H HG12 . ILE A 1 53  ? -7.701  -14.643 3.629   1.00 0.00 ? 760 ILE A HG12 3  
ATOM 4607  H HG13 . ILE A 1 53  ? -7.035  -14.899 2.021   1.00 0.00 ? 760 ILE A HG13 3  
ATOM 4608  H HG21 . ILE A 1 53  ? -9.531  -15.954 0.658   1.00 0.00 ? 760 ILE A HG21 3  
ATOM 4609  H HG22 . ILE A 1 53  ? -9.351  -17.640 1.123   1.00 0.00 ? 760 ILE A HG22 3  
ATOM 4610  H HG23 . ILE A 1 53  ? -7.942  -16.737 0.573   1.00 0.00 ? 760 ILE A HG23 3  
ATOM 4611  H HD11 . ILE A 1 53  ? -9.069  -13.932 1.053   1.00 0.00 ? 760 ILE A HD11 3  
ATOM 4612  H HD12 . ILE A 1 53  ? -8.258  -12.811 2.143   1.00 0.00 ? 760 ILE A HD12 3  
ATOM 4613  H HD13 . ILE A 1 53  ? -9.706  -13.656 2.674   1.00 0.00 ? 760 ILE A HD13 3  
ATOM 4614  N N    . ASP A 1 54  ? -11.879 -17.547 2.916   1.00 0.00 ? 761 ASP A N    3  
ATOM 4615  C CA   . ASP A 1 54  ? -12.732 -18.701 2.673   1.00 0.00 ? 761 ASP A CA   3  
ATOM 4616  C C    . ASP A 1 54  ? -12.484 -19.309 1.298   1.00 0.00 ? 761 ASP A C    3  
ATOM 4617  O O    . ASP A 1 54  ? -12.543 -20.517 1.124   1.00 0.00 ? 761 ASP A O    3  
ATOM 4618  C CB   . ASP A 1 54  ? -14.201 -18.287 2.808   1.00 0.00 ? 761 ASP A CB   3  
ATOM 4619  C CG   . ASP A 1 54  ? -15.181 -19.393 2.464   1.00 0.00 ? 761 ASP A CG   3  
ATOM 4620  O OD1  . ASP A 1 54  ? -15.499 -20.225 3.341   1.00 0.00 ? 761 ASP A OD1  3  
ATOM 4621  O OD2  . ASP A 1 54  ? -15.681 -19.423 1.311   1.00 0.00 ? 761 ASP A OD2  3  
ATOM 4622  H H    . ASP A 1 54  ? -12.274 -16.650 2.930   1.00 0.00 ? 761 ASP A H    3  
ATOM 4623  H HA   . ASP A 1 54  ? -12.518 -19.442 3.427   1.00 0.00 ? 761 ASP A HA   3  
ATOM 4624  H HB2  . ASP A 1 54  ? -14.383 -17.988 3.829   1.00 0.00 ? 761 ASP A HB2  3  
ATOM 4625  H HB3  . ASP A 1 54  ? -14.387 -17.446 2.158   1.00 0.00 ? 761 ASP A HB3  3  
ATOM 4626  N N    . SER A 1 55  ? -12.144 -18.480 0.347   1.00 0.00 ? 762 SER A N    3  
ATOM 4627  C CA   . SER A 1 55  ? -12.007 -18.924 -1.016  1.00 0.00 ? 762 SER A CA   3  
ATOM 4628  C C    . SER A 1 55  ? -10.831 -18.228 -1.671  1.00 0.00 ? 762 SER A C    3  
ATOM 4629  O O    . SER A 1 55  ? -10.526 -17.077 -1.325  1.00 0.00 ? 762 SER A O    3  
ATOM 4630  C CB   . SER A 1 55  ? -13.303 -18.625 -1.782  1.00 0.00 ? 762 SER A CB   3  
ATOM 4631  O OG   . SER A 1 55  ? -13.204 -19.013 -3.129  1.00 0.00 ? 762 SER A OG   3  
ATOM 4632  H H    . SER A 1 55  ? -11.929 -17.547 0.556   1.00 0.00 ? 762 SER A H    3  
ATOM 4633  H HA   . SER A 1 55  ? -11.842 -19.991 -1.015  1.00 0.00 ? 762 SER A HA   3  
ATOM 4634  H HB2  . SER A 1 55  ? -14.125 -19.155 -1.328  1.00 0.00 ? 762 SER A HB2  3  
ATOM 4635  H HB3  . SER A 1 55  ? -13.492 -17.563 -1.742  1.00 0.00 ? 762 SER A HB3  3  
ATOM 4636  H HG   . SER A 1 55  ? -14.086 -19.103 -3.509  1.00 0.00 ? 762 SER A HG   3  
ATOM 4637  N N    . GLU A 1 56  ? -10.199 -18.910 -2.626  1.00 0.00 ? 763 GLU A N    3  
ATOM 4638  C CA   . GLU A 1 56  ? -9.032  -18.409 -3.343  1.00 0.00 ? 763 GLU A CA   3  
ATOM 4639  C C    . GLU A 1 56  ? -9.364  -17.078 -3.994  1.00 0.00 ? 763 GLU A C    3  
ATOM 4640  O O    . GLU A 1 56  ? -8.544  -16.162 -3.980  1.00 0.00 ? 763 GLU A O    3  
ATOM 4641  C CB   . GLU A 1 56  ? -8.585  -19.424 -4.408  1.00 0.00 ? 763 GLU A CB   3  
ATOM 4642  C CG   . GLU A 1 56  ? -7.239  -19.124 -5.057  1.00 0.00 ? 763 GLU A CG   3  
ATOM 4643  C CD   . GLU A 1 56  ? -6.087  -19.249 -4.087  1.00 0.00 ? 763 GLU A CD   3  
ATOM 4644  O OE1  . GLU A 1 56  ? -5.812  -18.295 -3.335  1.00 0.00 ? 763 GLU A OE1  3  
ATOM 4645  O OE2  . GLU A 1 56  ? -5.429  -20.308 -4.055  1.00 0.00 ? 763 GLU A OE2  3  
ATOM 4646  H H    . GLU A 1 56  ? -10.548 -19.795 -2.875  1.00 0.00 ? 763 GLU A H    3  
ATOM 4647  H HA   . GLU A 1 56  ? -8.224  -18.245 -2.646  1.00 0.00 ? 763 GLU A HA   3  
ATOM 4648  H HB2  . GLU A 1 56  ? -8.524  -20.403 -3.958  1.00 0.00 ? 763 GLU A HB2  3  
ATOM 4649  H HB3  . GLU A 1 56  ? -9.332  -19.445 -5.188  1.00 0.00 ? 763 GLU A HB3  3  
ATOM 4650  H HG2  . GLU A 1 56  ? -7.077  -19.816 -5.870  1.00 0.00 ? 763 GLU A HG2  3  
ATOM 4651  H HG3  . GLU A 1 56  ? -7.258  -18.115 -5.443  1.00 0.00 ? 763 GLU A HG3  3  
ATOM 4652  N N    . GLU A 1 57  ? -10.607 -16.961 -4.491  1.00 0.00 ? 764 GLU A N    3  
ATOM 4653  C CA   . GLU A 1 57  ? -11.093 -15.744 -5.139  1.00 0.00 ? 764 GLU A CA   3  
ATOM 4654  C C    . GLU A 1 57  ? -10.908 -14.522 -4.249  1.00 0.00 ? 764 GLU A C    3  
ATOM 4655  O O    . GLU A 1 57  ? -10.463 -13.482 -4.709  1.00 0.00 ? 764 GLU A O    3  
ATOM 4656  C CB   . GLU A 1 57  ? -12.555 -15.886 -5.548  1.00 0.00 ? 764 GLU A CB   3  
ATOM 4657  C CG   . GLU A 1 57  ? -12.790 -16.964 -6.586  1.00 0.00 ? 764 GLU A CG   3  
ATOM 4658  C CD   . GLU A 1 57  ? -14.200 -16.978 -7.111  1.00 0.00 ? 764 GLU A CD   3  
ATOM 4659  O OE1  . GLU A 1 57  ? -14.502 -16.203 -8.042  1.00 0.00 ? 764 GLU A OE1  3  
ATOM 4660  O OE2  . GLU A 1 57  ? -15.035 -17.771 -6.622  1.00 0.00 ? 764 GLU A OE2  3  
ATOM 4661  H H    . GLU A 1 57  ? -11.207 -17.736 -4.413  1.00 0.00 ? 764 GLU A H    3  
ATOM 4662  H HA   . GLU A 1 57  ? -10.499 -15.601 -6.030  1.00 0.00 ? 764 GLU A HA   3  
ATOM 4663  H HB2  . GLU A 1 57  ? -13.133 -16.130 -4.668  1.00 0.00 ? 764 GLU A HB2  3  
ATOM 4664  H HB3  . GLU A 1 57  ? -12.896 -14.941 -5.940  1.00 0.00 ? 764 GLU A HB3  3  
ATOM 4665  H HG2  . GLU A 1 57  ? -12.121 -16.797 -7.415  1.00 0.00 ? 764 GLU A HG2  3  
ATOM 4666  H HG3  . GLU A 1 57  ? -12.576 -17.926 -6.144  1.00 0.00 ? 764 GLU A HG3  3  
ATOM 4667  N N    . GLU A 1 58  ? -11.215 -14.677 -2.971  1.00 0.00 ? 765 GLU A N    3  
ATOM 4668  C CA   . GLU A 1 58  ? -11.023 -13.626 -1.992  1.00 0.00 ? 765 GLU A CA   3  
ATOM 4669  C C    . GLU A 1 58  ? -9.598  -13.206 -1.882  1.00 0.00 ? 765 GLU A C    3  
ATOM 4670  O O    . GLU A 1 58  ? -9.309  -12.024 -1.862  1.00 0.00 ? 765 GLU A O    3  
ATOM 4671  C CB   . GLU A 1 58  ? -11.515 -14.052 -0.641  1.00 0.00 ? 765 GLU A CB   3  
ATOM 4672  C CG   . GLU A 1 58  ? -12.964 -13.827 -0.466  1.00 0.00 ? 765 GLU A CG   3  
ATOM 4673  C CD   . GLU A 1 58  ? -13.282 -12.340 -0.536  1.00 0.00 ? 765 GLU A CD   3  
ATOM 4674  O OE1  . GLU A 1 58  ? -12.682 -11.559 0.238   1.00 0.00 ? 765 GLU A OE1  3  
ATOM 4675  O OE2  . GLU A 1 58  ? -14.083 -11.916 -1.414  1.00 0.00 ? 765 GLU A OE2  3  
ATOM 4676  H H    . GLU A 1 58  ? -11.596 -15.530 -2.677  1.00 0.00 ? 765 GLU A H    3  
ATOM 4677  H HA   . GLU A 1 58  ? -11.610 -12.775 -2.303  1.00 0.00 ? 765 GLU A HA   3  
ATOM 4678  H HB2  . GLU A 1 58  ? -11.311 -15.105 -0.511  1.00 0.00 ? 765 GLU A HB2  3  
ATOM 4679  H HB3  . GLU A 1 58  ? -10.989 -13.492 0.117   1.00 0.00 ? 765 GLU A HB3  3  
ATOM 4680  H HG2  . GLU A 1 58  ? -13.445 -14.366 -1.268  1.00 0.00 ? 765 GLU A HG2  3  
ATOM 4681  H HG3  . GLU A 1 58  ? -13.234 -14.243 0.489   1.00 0.00 ? 765 GLU A HG3  3  
ATOM 4682  N N    . LEU A 1 59  ? -8.716  -14.164 -1.817  1.00 0.00 ? 766 LEU A N    3  
ATOM 4683  C CA   . LEU A 1 59  ? -7.300  -13.869 -1.693  1.00 0.00 ? 766 LEU A CA   3  
ATOM 4684  C C    . LEU A 1 59  ? -6.795  -13.178 -2.954  1.00 0.00 ? 766 LEU A C    3  
ATOM 4685  O O    . LEU A 1 59  ? -6.052  -12.198 -2.869  1.00 0.00 ? 766 LEU A O    3  
ATOM 4686  C CB   . LEU A 1 59  ? -6.485  -15.127 -1.387  1.00 0.00 ? 766 LEU A CB   3  
ATOM 4687  C CG   . LEU A 1 59  ? -4.984  -14.921 -1.127  1.00 0.00 ? 766 LEU A CG   3  
ATOM 4688  C CD1  . LEU A 1 59  ? -4.759  -14.011 0.072   1.00 0.00 ? 766 LEU A CD1  3  
ATOM 4689  C CD2  . LEU A 1 59  ? -4.309  -16.251 -0.896  1.00 0.00 ? 766 LEU A CD2  3  
ATOM 4690  H H    . LEU A 1 59  ? -9.057  -15.083 -1.865  1.00 0.00 ? 766 LEU A H    3  
ATOM 4691  H HA   . LEU A 1 59  ? -7.201  -13.172 -0.873  1.00 0.00 ? 766 LEU A HA   3  
ATOM 4692  H HB2  . LEU A 1 59  ? -6.913  -15.580 -0.506  1.00 0.00 ? 766 LEU A HB2  3  
ATOM 4693  H HB3  . LEU A 1 59  ? -6.597  -15.814 -2.212  1.00 0.00 ? 766 LEU A HB3  3  
ATOM 4694  H HG   . LEU A 1 59  ? -4.533  -14.456 -1.992  1.00 0.00 ? 766 LEU A HG   3  
ATOM 4695  H HD11 . LEU A 1 59  ? -3.698  -13.899 0.240   1.00 0.00 ? 766 LEU A HD11 3  
ATOM 4696  H HD12 . LEU A 1 59  ? -5.214  -14.447 0.949   1.00 0.00 ? 766 LEU A HD12 3  
ATOM 4697  H HD13 . LEU A 1 59  ? -5.194  -13.041 -0.116  1.00 0.00 ? 766 LEU A HD13 3  
ATOM 4698  H HD21 . LEU A 1 59  ? -4.491  -16.894 -1.746  1.00 0.00 ? 766 LEU A HD21 3  
ATOM 4699  H HD22 . LEU A 1 59  ? -4.713  -16.710 -0.005  1.00 0.00 ? 766 LEU A HD22 3  
ATOM 4700  H HD23 . LEU A 1 59  ? -3.246  -16.105 -0.777  1.00 0.00 ? 766 LEU A HD23 3  
ATOM 4701  N N    . ILE A 1 60  ? -7.238  -13.665 -4.112  1.00 0.00 ? 767 ILE A N    3  
ATOM 4702  C CA   . ILE A 1 60  ? -6.876  -13.061 -5.387  1.00 0.00 ? 767 ILE A CA   3  
ATOM 4703  C C    . ILE A 1 60  ? -7.404  -11.621 -5.426  1.00 0.00 ? 767 ILE A C    3  
ATOM 4704  O O    . ILE A 1 60  ? -6.671  -10.696 -5.731  1.00 0.00 ? 767 ILE A O    3  
ATOM 4705  C CB   . ILE A 1 60  ? -7.455  -13.847 -6.600  1.00 0.00 ? 767 ILE A CB   3  
ATOM 4706  C CG1  . ILE A 1 60  ? -7.054  -15.328 -6.539  1.00 0.00 ? 767 ILE A CG1  3  
ATOM 4707  C CG2  . ILE A 1 60  ? -6.946  -13.234 -7.903  1.00 0.00 ? 767 ILE A CG2  3  
ATOM 4708  C CD1  . ILE A 1 60  ? -7.665  -16.184 -7.635  1.00 0.00 ? 767 ILE A CD1  3  
ATOM 4709  H H    . ILE A 1 60  ? -7.816  -14.464 -4.098  1.00 0.00 ? 767 ILE A H    3  
ATOM 4710  H HA   . ILE A 1 60  ? -5.799  -13.041 -5.454  1.00 0.00 ? 767 ILE A HA   3  
ATOM 4711  H HB   . ILE A 1 60  ? -8.532  -13.768 -6.581  1.00 0.00 ? 767 ILE A HB   3  
ATOM 4712  H HG12 . ILE A 1 60  ? -5.981  -15.412 -6.623  1.00 0.00 ? 767 ILE A HG12 3  
ATOM 4713  H HG13 . ILE A 1 60  ? -7.362  -15.736 -5.587  1.00 0.00 ? 767 ILE A HG13 3  
ATOM 4714  H HG21 . ILE A 1 60  ? -5.868  -13.280 -7.926  1.00 0.00 ? 767 ILE A HG21 3  
ATOM 4715  H HG22 . ILE A 1 60  ? -7.264  -12.203 -7.962  1.00 0.00 ? 767 ILE A HG22 3  
ATOM 4716  H HG23 . ILE A 1 60  ? -7.349  -13.782 -8.741  1.00 0.00 ? 767 ILE A HG23 3  
ATOM 4717  H HD11 . ILE A 1 60  ? -7.363  -15.801 -8.599  1.00 0.00 ? 767 ILE A HD11 3  
ATOM 4718  H HD12 . ILE A 1 60  ? -8.742  -16.154 -7.561  1.00 0.00 ? 767 ILE A HD12 3  
ATOM 4719  H HD13 . ILE A 1 60  ? -7.321  -17.202 -7.530  1.00 0.00 ? 767 ILE A HD13 3  
ATOM 4720  N N    . ASN A 1 61  ? -8.664  -11.454 -5.058  1.00 0.00 ? 768 ASN A N    3  
ATOM 4721  C CA   . ASN A 1 61  ? -9.321  -10.148 -5.002  1.00 0.00 ? 768 ASN A CA   3  
ATOM 4722  C C    . ASN A 1 61  ? -8.624  -9.195  -4.038  1.00 0.00 ? 768 ASN A C    3  
ATOM 4723  O O    . ASN A 1 61  ? -8.338  -8.053  -4.387  1.00 0.00 ? 768 ASN A O    3  
ATOM 4724  C CB   . ASN A 1 61  ? -10.808 -10.304 -4.625  1.00 0.00 ? 768 ASN A CB   3  
ATOM 4725  C CG   . ASN A 1 61  ? -11.435 -9.001  -4.161  1.00 0.00 ? 768 ASN A CG   3  
ATOM 4726  O OD1  . ASN A 1 61  ? -11.936 -8.206  -4.959  1.00 0.00 ? 768 ASN A OD1  3  
ATOM 4727  N ND2  . ASN A 1 61  ? -11.445 -8.799  -2.861  1.00 0.00 ? 768 ASN A ND2  3  
ATOM 4728  H H    . ASN A 1 61  ? -9.196  -12.248 -4.817  1.00 0.00 ? 768 ASN A H    3  
ATOM 4729  H HA   . ASN A 1 61  ? -9.267  -9.723  -5.995  1.00 0.00 ? 768 ASN A HA   3  
ATOM 4730  H HB2  . ASN A 1 61  ? -11.356 -10.656 -5.486  1.00 0.00 ? 768 ASN A HB2  3  
ATOM 4731  H HB3  . ASN A 1 61  ? -10.894 -11.029 -3.828  1.00 0.00 ? 768 ASN A HB3  3  
ATOM 4732  H HD21 . ASN A 1 61  ? -11.067 -9.502  -2.292  1.00 0.00 ? 768 ASN A HD21 3  
ATOM 4733  H HD22 . ASN A 1 61  ? -11.809 -7.965  -2.506  1.00 0.00 ? 768 ASN A HD22 3  
ATOM 4734  N N    . LYS A 1 62  ? -8.350  -9.667  -2.833  1.00 0.00 ? 769 LYS A N    3  
ATOM 4735  C CA   . LYS A 1 62  ? -7.699  -8.857  -1.820  1.00 0.00 ? 769 LYS A CA   3  
ATOM 4736  C C    . LYS A 1 62  ? -6.318  -8.432  -2.291  1.00 0.00 ? 769 LYS A C    3  
ATOM 4737  O O    . LYS A 1 62  ? -5.944  -7.271  -2.150  1.00 0.00 ? 769 LYS A O    3  
ATOM 4738  C CB   . LYS A 1 62  ? -7.578  -9.612  -0.491  1.00 0.00 ? 769 LYS A CB   3  
ATOM 4739  C CG   . LYS A 1 62  ? -8.874  -9.804  0.311   1.00 0.00 ? 769 LYS A CG   3  
ATOM 4740  C CD   . LYS A 1 62  ? -9.411  -8.485  0.860   1.00 0.00 ? 769 LYS A CD   3  
ATOM 4741  C CE   . LYS A 1 62  ? -10.499 -8.712  1.919   1.00 0.00 ? 769 LYS A CE   3  
ATOM 4742  N NZ   . LYS A 1 62  ? -11.733 -9.368  1.401   1.00 0.00 ? 769 LYS A NZ   3  
ATOM 4743  H H    . LYS A 1 62  ? -8.579  -10.602 -2.631  1.00 0.00 ? 769 LYS A H    3  
ATOM 4744  H HA   . LYS A 1 62  ? -8.327  -7.988  -1.673  1.00 0.00 ? 769 LYS A HA   3  
ATOM 4745  H HB2  . LYS A 1 62  ? -7.182  -10.596 -0.701  1.00 0.00 ? 769 LYS A HB2  3  
ATOM 4746  H HB3  . LYS A 1 62  ? -6.868  -9.088  0.132   1.00 0.00 ? 769 LYS A HB3  3  
ATOM 4747  H HG2  . LYS A 1 62  ? -9.623  -10.237 -0.336  1.00 0.00 ? 769 LYS A HG2  3  
ATOM 4748  H HG3  . LYS A 1 62  ? -8.684  -10.478 1.133   1.00 0.00 ? 769 LYS A HG3  3  
ATOM 4749  H HD2  . LYS A 1 62  ? -8.604  -7.916  1.303   1.00 0.00 ? 769 LYS A HD2  3  
ATOM 4750  H HD3  . LYS A 1 62  ? -9.833  -7.909  0.050   1.00 0.00 ? 769 LYS A HD3  3  
ATOM 4751  H HE2  . LYS A 1 62  ? -10.088 -9.338  2.696   1.00 0.00 ? 769 LYS A HE2  3  
ATOM 4752  H HE3  . LYS A 1 62  ? -10.760 -7.753  2.343   1.00 0.00 ? 769 LYS A HE3  3  
ATOM 4753  H HZ1  . LYS A 1 62  ? -11.637 -10.334 1.013   1.00 0.00 ? 769 LYS A HZ1  3  
ATOM 4754  H HZ2  . LYS A 1 62  ? -12.184 -8.809  0.654   1.00 0.00 ? 769 LYS A HZ2  3  
ATOM 4755  H HZ3  . LYS A 1 62  ? -12.433 -9.426  2.170   1.00 0.00 ? 769 LYS A HZ3  3  
ATOM 4756  N N    . LYS A 1 63  ? -5.584  -9.378  -2.883  1.00 0.00 ? 770 LYS A N    3  
ATOM 4757  C CA   . LYS A 1 63  ? -4.249  -9.120  -3.390  1.00 0.00 ? 770 LYS A CA   3  
ATOM 4758  C C    . LYS A 1 63  ? -4.295  -8.184  -4.593  1.00 0.00 ? 770 LYS A C    3  
ATOM 4759  O O    . LYS A 1 63  ? -3.417  -7.354  -4.781  1.00 0.00 ? 770 LYS A O    3  
ATOM 4760  C CB   . LYS A 1 63  ? -3.519  -10.433 -3.714  1.00 0.00 ? 770 LYS A CB   3  
ATOM 4761  C CG   . LYS A 1 63  ? -2.078  -10.261 -4.198  1.00 0.00 ? 770 LYS A CG   3  
ATOM 4762  C CD   . LYS A 1 63  ? -1.287  -11.564 -4.086  1.00 0.00 ? 770 LYS A CD   3  
ATOM 4763  C CE   . LYS A 1 63  ? -1.865  -12.688 -4.926  1.00 0.00 ? 770 LYS A CE   3  
ATOM 4764  N NZ   . LYS A 1 63  ? -1.717  -12.462 -6.382  1.00 0.00 ? 770 LYS A NZ   3  
ATOM 4765  H H    . LYS A 1 63  ? -5.951  -10.287 -2.978  1.00 0.00 ? 770 LYS A H    3  
ATOM 4766  H HA   . LYS A 1 63  ? -3.721  -8.627  -2.588  1.00 0.00 ? 770 LYS A HA   3  
ATOM 4767  H HB2  . LYS A 1 63  ? -3.508  -11.053 -2.830  1.00 0.00 ? 770 LYS A HB2  3  
ATOM 4768  H HB3  . LYS A 1 63  ? -4.077  -10.942 -4.486  1.00 0.00 ? 770 LYS A HB3  3  
ATOM 4769  H HG2  . LYS A 1 63  ? -2.089  -9.949  -5.231  1.00 0.00 ? 770 LYS A HG2  3  
ATOM 4770  H HG3  . LYS A 1 63  ? -1.598  -9.504  -3.594  1.00 0.00 ? 770 LYS A HG3  3  
ATOM 4771  H HD2  . LYS A 1 63  ? -0.269  -11.391 -4.394  1.00 0.00 ? 770 LYS A HD2  3  
ATOM 4772  H HD3  . LYS A 1 63  ? -1.291  -11.870 -3.050  1.00 0.00 ? 770 LYS A HD3  3  
ATOM 4773  H HE2  . LYS A 1 63  ? -1.363  -13.603 -4.653  1.00 0.00 ? 770 LYS A HE2  3  
ATOM 4774  H HE3  . LYS A 1 63  ? -2.913  -12.769 -4.681  1.00 0.00 ? 770 LYS A HE3  3  
ATOM 4775  H HZ1  . LYS A 1 63  ? -2.155  -13.251 -6.903  1.00 0.00 ? 770 LYS A HZ1  3  
ATOM 4776  H HZ2  . LYS A 1 63  ? -0.713  -12.437 -6.651  1.00 0.00 ? 770 LYS A HZ2  3  
ATOM 4777  H HZ3  . LYS A 1 63  ? -2.168  -11.579 -6.695  1.00 0.00 ? 770 LYS A HZ3  3  
ATOM 4778  N N    . ARG A 1 64  ? -5.339  -8.310  -5.374  1.00 0.00 ? 771 ARG A N    3  
ATOM 4779  C CA   . ARG A 1 64  ? -5.559  -7.465  -6.525  1.00 0.00 ? 771 ARG A CA   3  
ATOM 4780  C C    . ARG A 1 64  ? -5.794  -6.029  -6.065  1.00 0.00 ? 771 ARG A C    3  
ATOM 4781  O O    . ARG A 1 64  ? -5.183  -5.102  -6.578  1.00 0.00 ? 771 ARG A O    3  
ATOM 4782  C CB   . ARG A 1 64  ? -6.780  -7.961  -7.277  1.00 0.00 ? 771 ARG A CB   3  
ATOM 4783  C CG   . ARG A 1 64  ? -7.018  -7.320  -8.629  1.00 0.00 ? 771 ARG A CG   3  
ATOM 4784  C CD   . ARG A 1 64  ? -8.327  -7.817  -9.212  1.00 0.00 ? 771 ARG A CD   3  
ATOM 4785  N NE   . ARG A 1 64  ? -8.408  -9.288  -9.243  1.00 0.00 ? 771 ARG A NE   3  
ATOM 4786  C CZ   . ARG A 1 64  ? -9.461  -10.011 -8.817  1.00 0.00 ? 771 ARG A CZ   3  
ATOM 4787  N NH1  . ARG A 1 64  ? -10.484 -9.410  -8.205  1.00 0.00 ? 771 ARG A NH1  3  
ATOM 4788  N NH2  . ARG A 1 64  ? -9.467  -11.330 -8.973  1.00 0.00 ? 771 ARG A NH2  3  
ATOM 4789  H H    . ARG A 1 64  ? -5.984  -9.028  -5.186  1.00 0.00 ? 771 ARG A H    3  
ATOM 4790  H HA   . ARG A 1 64  ? -4.697  -7.511  -7.174  1.00 0.00 ? 771 ARG A HA   3  
ATOM 4791  H HB2  . ARG A 1 64  ? -6.684  -9.028  -7.424  1.00 0.00 ? 771 ARG A HB2  3  
ATOM 4792  H HB3  . ARG A 1 64  ? -7.648  -7.781  -6.661  1.00 0.00 ? 771 ARG A HB3  3  
ATOM 4793  H HG2  . ARG A 1 64  ? -7.068  -6.248  -8.506  1.00 0.00 ? 771 ARG A HG2  3  
ATOM 4794  H HG3  . ARG A 1 64  ? -6.210  -7.577  -9.299  1.00 0.00 ? 771 ARG A HG3  3  
ATOM 4795  H HD2  . ARG A 1 64  ? -9.134  -7.434  -8.609  1.00 0.00 ? 771 ARG A HD2  3  
ATOM 4796  H HD3  . ARG A 1 64  ? -8.425  -7.438  -10.219 1.00 0.00 ? 771 ARG A HD3  3  
ATOM 4797  H HE   . ARG A 1 64  ? -7.621  -9.742  -9.631  1.00 0.00 ? 771 ARG A HE   3  
ATOM 4798  H HH11 . ARG A 1 64  ? -10.517 -8.421  -8.034  1.00 0.00 ? 771 ARG A HH11 3  
ATOM 4799  H HH12 . ARG A 1 64  ? -11.283 -9.938  -7.900  1.00 0.00 ? 771 ARG A HH12 3  
ATOM 4800  H HH21 . ARG A 1 64  ? -8.700  -11.812 -9.407  1.00 0.00 ? 771 ARG A HH21 3  
ATOM 4801  H HH22 . ARG A 1 64  ? -10.223 -11.926 -8.679  1.00 0.00 ? 771 ARG A HH22 3  
ATOM 4802  N N    . ILE A 1 65  ? -6.671  -5.863  -5.080  1.00 0.00 ? 772 ILE A N    3  
ATOM 4803  C CA   . ILE A 1 65  ? -6.997  -4.544  -4.562  1.00 0.00 ? 772 ILE A CA   3  
ATOM 4804  C C    . ILE A 1 65  ? -5.813  -3.913  -3.859  1.00 0.00 ? 772 ILE A C    3  
ATOM 4805  O O    . ILE A 1 65  ? -5.496  -2.771  -4.129  1.00 0.00 ? 772 ILE A O    3  
ATOM 4806  C CB   . ILE A 1 65  ? -8.238  -4.541  -3.624  1.00 0.00 ? 772 ILE A CB   3  
ATOM 4807  C CG1  . ILE A 1 65  ? -9.480  -4.994  -4.399  1.00 0.00 ? 772 ILE A CG1  3  
ATOM 4808  C CG2  . ILE A 1 65  ? -8.471  -3.144  -3.021  1.00 0.00 ? 772 ILE A CG2  3  
ATOM 4809  C CD1  . ILE A 1 65  ? -10.747 -4.964  -3.584  1.00 0.00 ? 772 ILE A CD1  3  
ATOM 4810  H H    . ILE A 1 65  ? -7.113  -6.657  -4.700  1.00 0.00 ? 772 ILE A H    3  
ATOM 4811  H HA   . ILE A 1 65  ? -7.223  -3.930  -5.422  1.00 0.00 ? 772 ILE A HA   3  
ATOM 4812  H HB   . ILE A 1 65  ? -8.054  -5.239  -2.821  1.00 0.00 ? 772 ILE A HB   3  
ATOM 4813  H HG12 . ILE A 1 65  ? -9.624  -4.339  -5.246  1.00 0.00 ? 772 ILE A HG12 3  
ATOM 4814  H HG13 . ILE A 1 65  ? -9.330  -6.003  -4.754  1.00 0.00 ? 772 ILE A HG13 3  
ATOM 4815  H HG21 . ILE A 1 65  ? -9.319  -3.175  -2.354  1.00 0.00 ? 772 ILE A HG21 3  
ATOM 4816  H HG22 . ILE A 1 65  ? -8.658  -2.433  -3.812  1.00 0.00 ? 772 ILE A HG22 3  
ATOM 4817  H HG23 . ILE A 1 65  ? -7.591  -2.840  -2.470  1.00 0.00 ? 772 ILE A HG23 3  
ATOM 4818  H HD11 . ILE A 1 65  ? -10.652 -5.641  -2.749  1.00 0.00 ? 772 ILE A HD11 3  
ATOM 4819  H HD12 . ILE A 1 65  ? -11.591 -5.246  -4.197  1.00 0.00 ? 772 ILE A HD12 3  
ATOM 4820  H HD13 . ILE A 1 65  ? -10.879 -3.958  -3.210  1.00 0.00 ? 772 ILE A HD13 3  
ATOM 4821  N N    . ILE A 1 66  ? -5.136  -4.666  -2.987  1.00 0.00 ? 773 ILE A N    3  
ATOM 4822  C CA   . ILE A 1 66  ? -3.981  -4.124  -2.267  1.00 0.00 ? 773 ILE A CA   3  
ATOM 4823  C C    . ILE A 1 66  ? -2.909  -3.660  -3.277  1.00 0.00 ? 773 ILE A C    3  
ATOM 4824  O O    . ILE A 1 66  ? -2.337  -2.585  -3.127  1.00 0.00 ? 773 ILE A O    3  
ATOM 4825  C CB   . ILE A 1 66  ? -3.399  -5.131  -1.195  1.00 0.00 ? 773 ILE A CB   3  
ATOM 4826  C CG1  . ILE A 1 66  ? -2.274  -4.519  -0.364  1.00 0.00 ? 773 ILE A CG1  3  
ATOM 4827  C CG2  . ILE A 1 66  ? -2.924  -6.397  -1.818  1.00 0.00 ? 773 ILE A CG2  3  
ATOM 4828  C CD1  . ILE A 1 66  ? -2.714  -3.375  0.509   1.00 0.00 ? 773 ILE A CD1  3  
ATOM 4829  H H    . ILE A 1 66  ? -5.422  -5.594  -2.823  1.00 0.00 ? 773 ILE A H    3  
ATOM 4830  H HA   . ILE A 1 66  ? -4.351  -3.245  -1.759  1.00 0.00 ? 773 ILE A HA   3  
ATOM 4831  H HB   . ILE A 1 66  ? -4.210  -5.388  -0.530  1.00 0.00 ? 773 ILE A HB   3  
ATOM 4832  H HG12 . ILE A 1 66  ? -1.871  -5.294  0.272   1.00 0.00 ? 773 ILE A HG12 3  
ATOM 4833  H HG13 . ILE A 1 66  ? -1.499  -4.163  -1.026  1.00 0.00 ? 773 ILE A HG13 3  
ATOM 4834  H HG21 . ILE A 1 66  ? -3.740  -6.780  -2.411  1.00 0.00 ? 773 ILE A HG21 3  
ATOM 4835  H HG22 . ILE A 1 66  ? -2.664  -7.108  -1.047  1.00 0.00 ? 773 ILE A HG22 3  
ATOM 4836  H HG23 . ILE A 1 66  ? -2.075  -6.200  -2.457  1.00 0.00 ? 773 ILE A HG23 3  
ATOM 4837  H HD11 . ILE A 1 66  ? -1.877  -3.026  1.092   1.00 0.00 ? 773 ILE A HD11 3  
ATOM 4838  H HD12 . ILE A 1 66  ? -3.504  -3.717  1.162   1.00 0.00 ? 773 ILE A HD12 3  
ATOM 4839  H HD13 . ILE A 1 66  ? -3.080  -2.574  -0.117  1.00 0.00 ? 773 ILE A HD13 3  
ATOM 4840  N N    . GLU A 1 67  ? -2.729  -4.443  -4.348  1.00 0.00 ? 774 GLU A N    3  
ATOM 4841  C CA   . GLU A 1 67  ? -1.820  -4.097  -5.428  1.00 0.00 ? 774 GLU A CA   3  
ATOM 4842  C C    . GLU A 1 67  ? -2.297  -2.818  -6.113  1.00 0.00 ? 774 GLU A C    3  
ATOM 4843  O O    . GLU A 1 67  ? -1.542  -1.873  -6.250  1.00 0.00 ? 774 GLU A O    3  
ATOM 4844  C CB   . GLU A 1 67  ? -1.739  -5.254  -6.438  1.00 0.00 ? 774 GLU A CB   3  
ATOM 4845  C CG   . GLU A 1 67  ? -0.874  -4.993  -7.669  1.00 0.00 ? 774 GLU A CG   3  
ATOM 4846  C CD   . GLU A 1 67  ? 0.566   -4.680  -7.341  1.00 0.00 ? 774 GLU A CD   3  
ATOM 4847  O OE1  . GLU A 1 67  ? 1.316   -5.605  -6.964  1.00 0.00 ? 774 GLU A OE1  3  
ATOM 4848  O OE2  . GLU A 1 67  ? 0.989   -3.524  -7.512  1.00 0.00 ? 774 GLU A OE2  3  
ATOM 4849  H H    . GLU A 1 67  ? -3.223  -5.290  -4.413  1.00 0.00 ? 774 GLU A H    3  
ATOM 4850  H HA   . GLU A 1 67  ? -0.841  -3.927  -5.003  1.00 0.00 ? 774 GLU A HA   3  
ATOM 4851  H HB2  . GLU A 1 67  ? -1.342  -6.123  -5.934  1.00 0.00 ? 774 GLU A HB2  3  
ATOM 4852  H HB3  . GLU A 1 67  ? -2.740  -5.482  -6.771  1.00 0.00 ? 774 GLU A HB3  3  
ATOM 4853  H HG2  . GLU A 1 67  ? -0.894  -5.867  -8.301  1.00 0.00 ? 774 GLU A HG2  3  
ATOM 4854  H HG3  . GLU A 1 67  ? -1.296  -4.155  -8.206  1.00 0.00 ? 774 GLU A HG3  3  
ATOM 4855  N N    . LYS A 1 68  ? -3.572  -2.786  -6.492  1.00 0.00 ? 775 LYS A N    3  
ATOM 4856  C CA   . LYS A 1 68  ? -4.154  -1.634  -7.169  1.00 0.00 ? 775 LYS A CA   3  
ATOM 4857  C C    . LYS A 1 68  ? -4.134  -0.370  -6.327  1.00 0.00 ? 775 LYS A C    3  
ATOM 4858  O O    . LYS A 1 68  ? -3.964  0.704   -6.861  1.00 0.00 ? 775 LYS A O    3  
ATOM 4859  C CB   . LYS A 1 68  ? -5.567  -1.913  -7.678  1.00 0.00 ? 775 LYS A CB   3  
ATOM 4860  C CG   . LYS A 1 68  ? -5.620  -2.872  -8.858  1.00 0.00 ? 775 LYS A CG   3  
ATOM 4861  C CD   . LYS A 1 68  ? -7.055  -3.151  -9.306  1.00 0.00 ? 775 LYS A CD   3  
ATOM 4862  C CE   . LYS A 1 68  ? -7.773  -1.890  -9.800  1.00 0.00 ? 775 LYS A CE   3  
ATOM 4863  N NZ   . LYS A 1 68  ? -7.140  -1.313  -11.003 1.00 0.00 ? 775 LYS A NZ   3  
ATOM 4864  H H    . LYS A 1 68  ? -4.135  -3.573  -6.318  1.00 0.00 ? 775 LYS A H    3  
ATOM 4865  H HA   . LYS A 1 68  ? -3.526  -1.453  -8.029  1.00 0.00 ? 775 LYS A HA   3  
ATOM 4866  H HB2  . LYS A 1 68  ? -6.148  -2.332  -6.869  1.00 0.00 ? 775 LYS A HB2  3  
ATOM 4867  H HB3  . LYS A 1 68  ? -6.009  -0.976  -7.979  1.00 0.00 ? 775 LYS A HB3  3  
ATOM 4868  H HG2  . LYS A 1 68  ? -5.076  -2.421  -9.675  1.00 0.00 ? 775 LYS A HG2  3  
ATOM 4869  H HG3  . LYS A 1 68  ? -5.143  -3.799  -8.578  1.00 0.00 ? 775 LYS A HG3  3  
ATOM 4870  H HD2  . LYS A 1 68  ? -7.031  -3.872  -10.109 1.00 0.00 ? 775 LYS A HD2  3  
ATOM 4871  H HD3  . LYS A 1 68  ? -7.602  -3.565  -8.471  1.00 0.00 ? 775 LYS A HD3  3  
ATOM 4872  H HE2  . LYS A 1 68  ? -8.794  -2.147  -10.044 1.00 0.00 ? 775 LYS A HE2  3  
ATOM 4873  H HE3  . LYS A 1 68  ? -7.771  -1.152  -9.013  1.00 0.00 ? 775 LYS A HE3  3  
ATOM 4874  H HZ1  . LYS A 1 68  ? -6.146  -1.052  -10.843 1.00 0.00 ? 775 LYS A HZ1  3  
ATOM 4875  H HZ2  . LYS A 1 68  ? -7.643  -0.453  -11.297 1.00 0.00 ? 775 LYS A HZ2  3  
ATOM 4876  H HZ3  . LYS A 1 68  ? -7.167  -1.994  -11.789 1.00 0.00 ? 775 LYS A HZ3  3  
ATOM 4877  N N    . VAL A 1 69  ? -4.299  -0.496  -5.029  1.00 0.00 ? 776 VAL A N    3  
ATOM 4878  C CA   . VAL A 1 69  ? -4.254  0.660   -4.147  1.00 0.00 ? 776 VAL A CA   3  
ATOM 4879  C C    . VAL A 1 69  ? -2.815  1.177   -4.017  1.00 0.00 ? 776 VAL A C    3  
ATOM 4880  O O    . VAL A 1 69  ? -2.578  2.392   -4.048  1.00 0.00 ? 776 VAL A O    3  
ATOM 4881  C CB   . VAL A 1 69  ? -4.898  0.372   -2.756  1.00 0.00 ? 776 VAL A CB   3  
ATOM 4882  C CG1  . VAL A 1 69  ? -4.777  1.576   -1.825  1.00 0.00 ? 776 VAL A CG1  3  
ATOM 4883  C CG2  . VAL A 1 69  ? -6.370  0.007   -2.934  1.00 0.00 ? 776 VAL A CG2  3  
ATOM 4884  H H    . VAL A 1 69  ? -4.483  -1.391  -4.659  1.00 0.00 ? 776 VAL A H    3  
ATOM 4885  H HA   . VAL A 1 69  ? -4.822  1.433   -4.645  1.00 0.00 ? 776 VAL A HA   3  
ATOM 4886  H HB   . VAL A 1 69  ? -4.395  -0.470  -2.305  1.00 0.00 ? 776 VAL A HB   3  
ATOM 4887  H HG11 . VAL A 1 69  ? -3.733  1.813   -1.677  1.00 0.00 ? 776 VAL A HG11 3  
ATOM 4888  H HG12 . VAL A 1 69  ? -5.234  1.343   -0.874  1.00 0.00 ? 776 VAL A HG12 3  
ATOM 4889  H HG13 . VAL A 1 69  ? -5.282  2.423   -2.267  1.00 0.00 ? 776 VAL A HG13 3  
ATOM 4890  H HG21 . VAL A 1 69  ? -6.462  -0.899  -3.518  1.00 0.00 ? 776 VAL A HG21 3  
ATOM 4891  H HG22 . VAL A 1 69  ? -6.880  0.805   -3.452  1.00 0.00 ? 776 VAL A HG22 3  
ATOM 4892  H HG23 . VAL A 1 69  ? -6.837  -0.144  -1.972  1.00 0.00 ? 776 VAL A HG23 3  
ATOM 4893  N N    . ILE A 1 70  ? -1.855  0.258   -3.927  1.00 0.00 ? 777 ILE A N    3  
ATOM 4894  C CA   . ILE A 1 70  ? -0.438  0.630   -3.905  1.00 0.00 ? 777 ILE A CA   3  
ATOM 4895  C C    . ILE A 1 70  ? -0.064  1.256   -5.263  1.00 0.00 ? 777 ILE A C    3  
ATOM 4896  O O    . ILE A 1 70  ? 0.654   2.258   -5.332  1.00 0.00 ? 777 ILE A O    3  
ATOM 4897  C CB   . ILE A 1 70  ? 0.482   -0.602  -3.598  1.00 0.00 ? 777 ILE A CB   3  
ATOM 4898  C CG1  . ILE A 1 70  ? 0.190   -1.149  -2.187  1.00 0.00 ? 777 ILE A CG1  3  
ATOM 4899  C CG2  . ILE A 1 70  ? 1.963   -0.231  -3.730  1.00 0.00 ? 777 ILE A CG2  3  
ATOM 4900  C CD1  . ILE A 1 70  ? 0.923   -2.440  -1.848  1.00 0.00 ? 777 ILE A CD1  3  
ATOM 4901  H H    . ILE A 1 70  ? -2.102  -0.693  -3.868  1.00 0.00 ? 777 ILE A H    3  
ATOM 4902  H HA   . ILE A 1 70  ? -0.311  1.379   -3.137  1.00 0.00 ? 777 ILE A HA   3  
ATOM 4903  H HB   . ILE A 1 70  ? 0.264   -1.374  -4.322  1.00 0.00 ? 777 ILE A HB   3  
ATOM 4904  H HG12 . ILE A 1 70  ? 0.479   -0.409  -1.456  1.00 0.00 ? 777 ILE A HG12 3  
ATOM 4905  H HG13 . ILE A 1 70  ? -0.869  -1.337  -2.100  1.00 0.00 ? 777 ILE A HG13 3  
ATOM 4906  H HG21 . ILE A 1 70  ? 2.200   0.562   -3.036  1.00 0.00 ? 777 ILE A HG21 3  
ATOM 4907  H HG22 . ILE A 1 70  ? 2.165   0.099   -4.737  1.00 0.00 ? 777 ILE A HG22 3  
ATOM 4908  H HG23 . ILE A 1 70  ? 2.569   -1.098  -3.506  1.00 0.00 ? 777 ILE A HG23 3  
ATOM 4909  H HD11 . ILE A 1 70  ? 0.611   -3.233  -2.515  1.00 0.00 ? 777 ILE A HD11 3  
ATOM 4910  H HD12 . ILE A 1 70  ? 0.691   -2.741  -0.837  1.00 0.00 ? 777 ILE A HD12 3  
ATOM 4911  H HD13 . ILE A 1 70  ? 1.989   -2.295  -1.945  1.00 0.00 ? 777 ILE A HD13 3  
ATOM 4912  N N    . HIS A 1 71  ? -0.588  0.668   -6.321  1.00 0.00 ? 778 HIS A N    3  
ATOM 4913  C CA   . HIS A 1 71  ? -0.420  1.145   -7.690  1.00 0.00 ? 778 HIS A CA   3  
ATOM 4914  C C    . HIS A 1 71  ? -1.009  2.550   -7.829  1.00 0.00 ? 778 HIS A C    3  
ATOM 4915  O O    . HIS A 1 71  ? -0.368  3.452   -8.353  1.00 0.00 ? 778 HIS A O    3  
ATOM 4916  C CB   . HIS A 1 71  ? -1.113  0.158   -8.657  1.00 0.00 ? 778 HIS A CB   3  
ATOM 4917  C CG   . HIS A 1 71  ? -1.106  0.547   -10.108 1.00 0.00 ? 778 HIS A CG   3  
ATOM 4918  N ND1  . HIS A 1 71  ? -0.049  0.346   -10.962 1.00 0.00 ? 778 HIS A ND1  3  
ATOM 4919  C CD2  . HIS A 1 71  ? -2.071  1.142   -10.844 1.00 0.00 ? 778 HIS A CD2  3  
ATOM 4920  C CE1  . HIS A 1 71  ? -0.388  0.826   -12.159 1.00 0.00 ? 778 HIS A CE1  3  
ATOM 4921  N NE2  . HIS A 1 71  ? -1.611  1.320   -12.142 1.00 0.00 ? 778 HIS A NE2  3  
ATOM 4922  H H    . HIS A 1 71  ? -1.108  -0.157  -6.181  1.00 0.00 ? 778 HIS A H    3  
ATOM 4923  H HA   . HIS A 1 71  ? 0.636   1.175   -7.912  1.00 0.00 ? 778 HIS A HA   3  
ATOM 4924  H HB2  . HIS A 1 71  ? -0.640  -0.809  -8.571  1.00 0.00 ? 778 HIS A HB2  3  
ATOM 4925  H HB3  . HIS A 1 71  ? -2.142  0.062   -8.343  1.00 0.00 ? 778 HIS A HB3  3  
ATOM 4926  H HD1  . HIS A 1 71  ? 0.797   -0.107  -10.743 1.00 0.00 ? 778 HIS A HD1  3  
ATOM 4927  H HD2  . HIS A 1 71  ? -3.053  1.415   -10.488 1.00 0.00 ? 778 HIS A HD2  3  
ATOM 4928  H HE1  . HIS A 1 71  ? 0.246   0.815   -13.031 1.00 0.00 ? 778 HIS A HE1  3  
ATOM 4929  N N    . ARG A 1 72  ? -2.211  2.715   -7.329  1.00 0.00 ? 779 ARG A N    3  
ATOM 4930  C CA   . ARG A 1 72  ? -2.920  3.974   -7.346  1.00 0.00 ? 779 ARG A CA   3  
ATOM 4931  C C    . ARG A 1 72  ? -2.105  5.050   -6.635  1.00 0.00 ? 779 ARG A C    3  
ATOM 4932  O O    . ARG A 1 72  ? -1.850  6.131   -7.177  1.00 0.00 ? 779 ARG A O    3  
ATOM 4933  C CB   . ARG A 1 72  ? -4.265  3.792   -6.669  1.00 0.00 ? 779 ARG A CB   3  
ATOM 4934  C CG   . ARG A 1 72  ? -5.140  5.010   -6.655  1.00 0.00 ? 779 ARG A CG   3  
ATOM 4935  C CD   . ARG A 1 72  ? -6.432  4.680   -5.955  1.00 0.00 ? 779 ARG A CD   3  
ATOM 4936  N NE   . ARG A 1 72  ? -7.286  5.839   -5.754  1.00 0.00 ? 779 ARG A NE   3  
ATOM 4937  C CZ   . ARG A 1 72  ? -8.559  5.763   -5.395  1.00 0.00 ? 779 ARG A CZ   3  
ATOM 4938  N NH1  . ARG A 1 72  ? -9.161  4.583   -5.293  1.00 0.00 ? 779 ARG A NH1  3  
ATOM 4939  N NH2  . ARG A 1 72  ? -9.241  6.860   -5.129  1.00 0.00 ? 779 ARG A NH2  3  
ATOM 4940  H H    . ARG A 1 72  ? -2.669  1.934   -6.939  1.00 0.00 ? 779 ARG A H    3  
ATOM 4941  H HA   . ARG A 1 72  ? -3.086  4.235   -8.379  1.00 0.00 ? 779 ARG A HA   3  
ATOM 4942  H HB2  . ARG A 1 72  ? -4.798  2.998   -7.169  1.00 0.00 ? 779 ARG A HB2  3  
ATOM 4943  H HB3  . ARG A 1 72  ? -4.092  3.492   -5.646  1.00 0.00 ? 779 ARG A HB3  3  
ATOM 4944  H HG2  . ARG A 1 72  ? -4.628  5.814   -6.145  1.00 0.00 ? 779 ARG A HG2  3  
ATOM 4945  H HG3  . ARG A 1 72  ? -5.339  5.280   -7.684  1.00 0.00 ? 779 ARG A HG3  3  
ATOM 4946  H HD2  . ARG A 1 72  ? -6.972  3.959   -6.550  1.00 0.00 ? 779 ARG A HD2  3  
ATOM 4947  H HD3  . ARG A 1 72  ? -6.202  4.244   -4.994  1.00 0.00 ? 779 ARG A HD3  3  
ATOM 4948  H HE   . ARG A 1 72  ? -6.844  6.714   -5.854  1.00 0.00 ? 779 ARG A HE   3  
ATOM 4949  H HH11 . ARG A 1 72  ? -8.698  3.713   -5.474  1.00 0.00 ? 779 ARG A HH11 3  
ATOM 4950  H HH12 . ARG A 1 72  ? -10.121 4.542   -4.989  1.00 0.00 ? 779 ARG A HH12 3  
ATOM 4951  H HH21 . ARG A 1 72  ? -8.840  7.778   -5.171  1.00 0.00 ? 779 ARG A HH21 3  
ATOM 4952  H HH22 . ARG A 1 72  ? -10.204 6.772   -4.850  1.00 0.00 ? 779 ARG A HH22 3  
ATOM 4953  N N    . LEU A 1 73  ? -1.658  4.708   -5.453  1.00 0.00 ? 780 LEU A N    3  
ATOM 4954  C CA   . LEU A 1 73  ? -0.835  5.554   -4.623  1.00 0.00 ? 780 LEU A CA   3  
ATOM 4955  C C    . LEU A 1 73  ? 0.436   6.024   -5.357  1.00 0.00 ? 780 LEU A C    3  
ATOM 4956  O O    . LEU A 1 73  ? 0.739   7.224   -5.397  1.00 0.00 ? 780 LEU A O    3  
ATOM 4957  C CB   . LEU A 1 73  ? -0.464  4.764   -3.362  1.00 0.00 ? 780 LEU A CB   3  
ATOM 4958  C CG   . LEU A 1 73  ? 0.537   5.394   -2.405  1.00 0.00 ? 780 LEU A CG   3  
ATOM 4959  C CD1  . LEU A 1 73  ? 0.046   6.735   -1.934  1.00 0.00 ? 780 LEU A CD1  3  
ATOM 4960  C CD2  . LEU A 1 73  ? 0.759   4.476   -1.225  1.00 0.00 ? 780 LEU A CD2  3  
ATOM 4961  H H    . LEU A 1 73  ? -1.913  3.828   -5.092  1.00 0.00 ? 780 LEU A H    3  
ATOM 4962  H HA   . LEU A 1 73  ? -1.420  6.409   -4.320  1.00 0.00 ? 780 LEU A HA   3  
ATOM 4963  H HB2  . LEU A 1 73  ? -1.372  4.571   -2.811  1.00 0.00 ? 780 LEU A HB2  3  
ATOM 4964  H HB3  . LEU A 1 73  ? -0.065  3.812   -3.683  1.00 0.00 ? 780 LEU A HB3  3  
ATOM 4965  H HG   . LEU A 1 73  ? 1.483   5.527   -2.909  1.00 0.00 ? 780 LEU A HG   3  
ATOM 4966  H HD11 . LEU A 1 73  ? 0.775   7.173   -1.268  1.00 0.00 ? 780 LEU A HD11 3  
ATOM 4967  H HD12 . LEU A 1 73  ? -0.889  6.607   -1.412  1.00 0.00 ? 780 LEU A HD12 3  
ATOM 4968  H HD13 . LEU A 1 73  ? -0.095  7.379   -2.788  1.00 0.00 ? 780 LEU A HD13 3  
ATOM 4969  H HD21 . LEU A 1 73  ? 1.105   3.514   -1.573  1.00 0.00 ? 780 LEU A HD21 3  
ATOM 4970  H HD22 . LEU A 1 73  ? -0.175  4.367   -0.692  1.00 0.00 ? 780 LEU A HD22 3  
ATOM 4971  H HD23 . LEU A 1 73  ? 1.496   4.912   -0.567  1.00 0.00 ? 780 LEU A HD23 3  
ATOM 4972  N N    . THR A 1 74  ? 1.120   5.098   -5.972  1.00 0.00 ? 781 THR A N    3  
ATOM 4973  C CA   . THR A 1 74  ? 2.401   5.363   -6.593  1.00 0.00 ? 781 THR A CA   3  
ATOM 4974  C C    . THR A 1 74  ? 2.303   6.017   -7.983  1.00 0.00 ? 781 THR A C    3  
ATOM 4975  O O    . THR A 1 74  ? 3.263   6.636   -8.443  1.00 0.00 ? 781 THR A O    3  
ATOM 4976  C CB   . THR A 1 74  ? 3.208   4.052   -6.695  1.00 0.00 ? 781 THR A CB   3  
ATOM 4977  O OG1  . THR A 1 74  ? 2.367   3.013   -7.234  1.00 0.00 ? 781 THR A OG1  3  
ATOM 4978  C CG2  . THR A 1 74  ? 3.728   3.622   -5.335  1.00 0.00 ? 781 THR A CG2  3  
ATOM 4979  H H    . THR A 1 74  ? 0.768   4.182   -6.021  1.00 0.00 ? 781 THR A H    3  
ATOM 4980  H HA   . THR A 1 74  ? 2.945   6.022   -5.931  1.00 0.00 ? 781 THR A HA   3  
ATOM 4981  H HB   . THR A 1 74  ? 4.041   4.211   -7.365  1.00 0.00 ? 781 THR A HB   3  
ATOM 4982  H HG1  . THR A 1 74  ? 1.906   2.594   -6.494  1.00 0.00 ? 781 THR A HG1  3  
ATOM 4983  H HG21 . THR A 1 74  ? 2.905   3.535   -4.641  1.00 0.00 ? 781 THR A HG21 3  
ATOM 4984  H HG22 . THR A 1 74  ? 4.447   4.341   -4.976  1.00 0.00 ? 781 THR A HG22 3  
ATOM 4985  H HG23 . THR A 1 74  ? 4.211   2.661   -5.430  1.00 0.00 ? 781 THR A HG23 3  
ATOM 4986  N N    . HIS A 1 75  ? 1.154   5.910   -8.624  1.00 0.00 ? 782 HIS A N    3  
ATOM 4987  C CA   . HIS A 1 75  ? 1.028   6.359   -10.023 1.00 0.00 ? 782 HIS A CA   3  
ATOM 4988  C C    . HIS A 1 75  ? 0.012   7.472   -10.231 1.00 0.00 ? 782 HIS A C    3  
ATOM 4989  O O    . HIS A 1 75  ? 0.160   8.281   -11.135 1.00 0.00 ? 782 HIS A O    3  
ATOM 4990  C CB   . HIS A 1 75  ? 0.658   5.180   -10.931 1.00 0.00 ? 782 HIS A CB   3  
ATOM 4991  C CG   . HIS A 1 75  ? 1.721   4.133   -11.077 1.00 0.00 ? 782 HIS A CG   3  
ATOM 4992  N ND1  . HIS A 1 75  ? 2.011   3.180   -10.125 1.00 0.00 ? 782 HIS A ND1  3  
ATOM 4993  C CD2  . HIS A 1 75  ? 2.558   3.894   -12.105 1.00 0.00 ? 782 HIS A CD2  3  
ATOM 4994  C CE1  . HIS A 1 75  ? 2.986   2.407   -10.591 1.00 0.00 ? 782 HIS A CE1  3  
ATOM 4995  N NE2  . HIS A 1 75  ? 3.360   2.798   -11.799 1.00 0.00 ? 782 HIS A NE2  3  
ATOM 4996  H H    . HIS A 1 75  ? 0.390   5.509   -8.156  1.00 0.00 ? 782 HIS A H    3  
ATOM 4997  H HA   . HIS A 1 75  ? 1.995   6.718   -10.340 1.00 0.00 ? 782 HIS A HA   3  
ATOM 4998  H HB2  . HIS A 1 75  ? -0.221  4.701   -10.525 1.00 0.00 ? 782 HIS A HB2  3  
ATOM 4999  H HB3  . HIS A 1 75  ? 0.428   5.565   -11.914 1.00 0.00 ? 782 HIS A HB3  3  
ATOM 5000  H HD1  . HIS A 1 75  ? 1.603   3.098   -9.232  1.00 0.00 ? 782 HIS A HD1  3  
ATOM 5001  H HD2  . HIS A 1 75  ? 2.606   4.460   -13.023 1.00 0.00 ? 782 HIS A HD2  3  
ATOM 5002  H HE1  . HIS A 1 75  ? 3.418   1.572   -10.060 1.00 0.00 ? 782 HIS A HE1  3  
ATOM 5003  N N    . TYR A 1 76  ? -1.017  7.495   -9.434  1.00 0.00 ? 783 TYR A N    3  
ATOM 5004  C CA   . TYR A 1 76  ? -2.089  8.462   -9.618  1.00 0.00 ? 783 TYR A CA   3  
ATOM 5005  C C    . TYR A 1 76  ? -1.968  9.569   -8.602  1.00 0.00 ? 783 TYR A C    3  
ATOM 5006  O O    . TYR A 1 76  ? -2.139  10.751  -8.919  1.00 0.00 ? 783 TYR A O    3  
ATOM 5007  C CB   . TYR A 1 76  ? -3.461  7.792   -9.441  1.00 0.00 ? 783 TYR A CB   3  
ATOM 5008  C CG   . TYR A 1 76  ? -3.767  6.633   -10.370 1.00 0.00 ? 783 TYR A CG   3  
ATOM 5009  C CD1  . TYR A 1 76  ? -3.076  5.451   -10.266 1.00 0.00 ? 783 TYR A CD1  3  
ATOM 5010  C CD2  . TYR A 1 76  ? -4.772  6.713   -11.314 1.00 0.00 ? 783 TYR A CD2  3  
ATOM 5011  C CE1  . TYR A 1 76  ? -3.356  4.381   -11.059 1.00 0.00 ? 783 TYR A CE1  3  
ATOM 5012  C CE2  . TYR A 1 76  ? -5.072  5.631   -12.119 1.00 0.00 ? 783 TYR A CE2  3  
ATOM 5013  C CZ   . TYR A 1 76  ? -4.358  4.467   -11.982 1.00 0.00 ? 783 TYR A CZ   3  
ATOM 5014  O OH   . TYR A 1 76  ? -4.657  3.376   -12.765 1.00 0.00 ? 783 TYR A OH   3  
ATOM 5015  H H    . TYR A 1 76  ? -1.092  6.848   -8.701  1.00 0.00 ? 783 TYR A H    3  
ATOM 5016  H HA   . TYR A 1 76  ? -2.027  8.869   -10.615 1.00 0.00 ? 783 TYR A HA   3  
ATOM 5017  H HB2  . TYR A 1 76  ? -3.525  7.407   -8.435  1.00 0.00 ? 783 TYR A HB2  3  
ATOM 5018  H HB3  . TYR A 1 76  ? -4.235  8.533   -9.570  1.00 0.00 ? 783 TYR A HB3  3  
ATOM 5019  H HD1  . TYR A 1 76  ? -2.275  5.399   -9.543  1.00 0.00 ? 783 TYR A HD1  3  
ATOM 5020  H HD2  . TYR A 1 76  ? -5.332  7.631   -11.416 1.00 0.00 ? 783 TYR A HD2  3  
ATOM 5021  H HE1  . TYR A 1 76  ? -2.790  3.472   -10.935 1.00 0.00 ? 783 TYR A HE1  3  
ATOM 5022  H HE2  . TYR A 1 76  ? -5.858  5.705   -12.853 1.00 0.00 ? 783 TYR A HE2  3  
ATOM 5023  H HH   . TYR A 1 76  ? -4.627  3.647   -13.690 1.00 0.00 ? 783 TYR A HH   3  
ATOM 5024  N N    . ASP A 1 77  ? -1.696  9.183   -7.373  1.00 0.00 ? 784 ASP A N    3  
ATOM 5025  C CA   . ASP A 1 77  ? -1.612  10.140  -6.279  1.00 0.00 ? 784 ASP A CA   3  
ATOM 5026  C C    . ASP A 1 77  ? -0.272  10.806  -6.179  1.00 0.00 ? 784 ASP A C    3  
ATOM 5027  O O    . ASP A 1 77  ? -0.200  12.028  -6.102  1.00 0.00 ? 784 ASP A O    3  
ATOM 5028  C CB   . ASP A 1 77  ? -1.994  9.528   -4.931  1.00 0.00 ? 784 ASP A CB   3  
ATOM 5029  C CG   . ASP A 1 77  ? -3.486  9.412   -4.742  1.00 0.00 ? 784 ASP A CG   3  
ATOM 5030  O OD1  . ASP A 1 77  ? -4.141  10.453  -4.490  1.00 0.00 ? 784 ASP A OD1  3  
ATOM 5031  O OD2  . ASP A 1 77  ? -4.032  8.297   -4.830  1.00 0.00 ? 784 ASP A OD2  3  
ATOM 5032  H H    . ASP A 1 77  ? -1.571  8.223   -7.204  1.00 0.00 ? 784 ASP A H    3  
ATOM 5033  H HA   . ASP A 1 77  ? -2.333  10.911  -6.503  1.00 0.00 ? 784 ASP A HA   3  
ATOM 5034  H HB2  . ASP A 1 77  ? -1.565  8.536   -4.879  1.00 0.00 ? 784 ASP A HB2  3  
ATOM 5035  H HB3  . ASP A 1 77  ? -1.586  10.136  -4.138  1.00 0.00 ? 784 ASP A HB3  3  
ATOM 5036  N N    . HIS A 1 78  ? 0.791   10.001  -6.153  1.00 0.00 ? 785 HIS A N    3  
ATOM 5037  C CA   . HIS A 1 78  ? 2.180   10.497  -6.019  1.00 0.00 ? 785 HIS A CA   3  
ATOM 5038  C C    . HIS A 1 78  ? 2.400   11.139  -4.652  1.00 0.00 ? 785 HIS A C    3  
ATOM 5039  O O    . HIS A 1 78  ? 3.323   11.912  -4.461  1.00 0.00 ? 785 HIS A O    3  
ATOM 5040  C CB   . HIS A 1 78  ? 2.581   11.485  -7.146  1.00 0.00 ? 785 HIS A CB   3  
ATOM 5041  C CG   . HIS A 1 78  ? 2.663   10.883  -8.517  1.00 0.00 ? 785 HIS A CG   3  
ATOM 5042  N ND1  . HIS A 1 78  ? 1.837   11.232  -9.559  1.00 0.00 ? 785 HIS A ND1  3  
ATOM 5043  C CD2  . HIS A 1 78  ? 3.531   9.971   -9.019  1.00 0.00 ? 785 HIS A CD2  3  
ATOM 5044  C CE1  . HIS A 1 78  ? 2.215   10.541  -10.638 1.00 0.00 ? 785 HIS A CE1  3  
ATOM 5045  N NE2  . HIS A 1 78  ? 3.246   9.756   -10.364 1.00 0.00 ? 785 HIS A NE2  3  
ATOM 5046  H H    . HIS A 1 78  ? 0.644   9.032   -6.215  1.00 0.00 ? 785 HIS A H    3  
ATOM 5047  H HA   . HIS A 1 78  ? 2.819   9.627   -6.070  1.00 0.00 ? 785 HIS A HA   3  
ATOM 5048  H HB2  . HIS A 1 78  ? 1.849   12.277  -7.188  1.00 0.00 ? 785 HIS A HB2  3  
ATOM 5049  H HB3  . HIS A 1 78  ? 3.545   11.914  -6.910  1.00 0.00 ? 785 HIS A HB3  3  
ATOM 5050  H HD1  . HIS A 1 78  ? 1.095   11.878  -9.518  1.00 0.00 ? 785 HIS A HD1  3  
ATOM 5051  H HD2  . HIS A 1 78  ? 4.323   9.484   -8.469  1.00 0.00 ? 785 HIS A HD2  3  
ATOM 5052  H HE1  . HIS A 1 78  ? 1.741   10.613  -11.606 1.00 0.00 ? 785 HIS A HE1  3  
ATOM 5053  N N    . VAL A 1 79  ? 1.588   10.743  -3.683  1.00 0.00 ? 786 VAL A N    3  
ATOM 5054  C CA   . VAL A 1 79  ? 1.682   11.289  -2.330  1.00 0.00 ? 786 VAL A CA   3  
ATOM 5055  C C    . VAL A 1 79  ? 2.594   10.388  -1.475  1.00 0.00 ? 786 VAL A C    3  
ATOM 5056  O O    . VAL A 1 79  ? 2.733   10.541  -0.257  1.00 0.00 ? 786 VAL A O    3  
ATOM 5057  C CB   . VAL A 1 79  ? 0.261   11.446  -1.689  1.00 0.00 ? 786 VAL A CB   3  
ATOM 5058  C CG1  . VAL A 1 79  ? -0.418  10.113  -1.471  1.00 0.00 ? 786 VAL A CG1  3  
ATOM 5059  C CG2  . VAL A 1 79  ? 0.311   12.235  -0.397  1.00 0.00 ? 786 VAL A CG2  3  
ATOM 5060  H H    . VAL A 1 79  ? 0.910   10.068  -3.888  1.00 0.00 ? 786 VAL A H    3  
ATOM 5061  H HA   . VAL A 1 79  ? 2.147   12.262  -2.413  1.00 0.00 ? 786 VAL A HA   3  
ATOM 5062  H HB   . VAL A 1 79  ? -0.349  11.994  -2.391  1.00 0.00 ? 786 VAL A HB   3  
ATOM 5063  H HG11 . VAL A 1 79  ? -0.506  9.591   -2.412  1.00 0.00 ? 786 VAL A HG11 3  
ATOM 5064  H HG12 . VAL A 1 79  ? -1.398  10.266  -1.045  1.00 0.00 ? 786 VAL A HG12 3  
ATOM 5065  H HG13 . VAL A 1 79  ? 0.181   9.525   -0.791  1.00 0.00 ? 786 VAL A HG13 3  
ATOM 5066  H HG21 . VAL A 1 79  ? -0.700  12.372  -0.043  1.00 0.00 ? 786 VAL A HG21 3  
ATOM 5067  H HG22 . VAL A 1 79  ? 0.790   13.188  -0.557  1.00 0.00 ? 786 VAL A HG22 3  
ATOM 5068  H HG23 . VAL A 1 79  ? 0.872   11.671  0.339   1.00 0.00 ? 786 VAL A HG23 3  
ATOM 5069  N N    . LEU A 1 80  ? 3.217   9.460   -2.134  1.00 0.00 ? 787 LEU A N    3  
ATOM 5070  C CA   . LEU A 1 80  ? 4.112   8.584   -1.480  1.00 0.00 ? 787 LEU A CA   3  
ATOM 5071  C C    . LEU A 1 80  ? 5.512   9.167   -1.542  1.00 0.00 ? 787 LEU A C    3  
ATOM 5072  O O    . LEU A 1 80  ? 5.936   9.711   -2.578  1.00 0.00 ? 787 LEU A O    3  
ATOM 5073  C CB   . LEU A 1 80  ? 4.015   7.129   -2.056  1.00 0.00 ? 787 LEU A CB   3  
ATOM 5074  C CG   . LEU A 1 80  ? 4.560   6.793   -3.486  1.00 0.00 ? 787 LEU A CG   3  
ATOM 5075  C CD1  . LEU A 1 80  ? 4.092   7.747   -4.575  1.00 0.00 ? 787 LEU A CD1  3  
ATOM 5076  C CD2  . LEU A 1 80  ? 6.065   6.607   -3.503  1.00 0.00 ? 787 LEU A CD2  3  
ATOM 5077  H H    . LEU A 1 80  ? 3.088   9.383   -3.101  1.00 0.00 ? 787 LEU A H    3  
ATOM 5078  H HA   . LEU A 1 80  ? 3.816   8.566   -0.441  1.00 0.00 ? 787 LEU A HA   3  
ATOM 5079  H HB2  . LEU A 1 80  ? 4.513   6.467   -1.364  1.00 0.00 ? 787 LEU A HB2  3  
ATOM 5080  H HB3  . LEU A 1 80  ? 2.962   6.883   -2.042  1.00 0.00 ? 787 LEU A HB3  3  
ATOM 5081  H HG   . LEU A 1 80  ? 4.115   5.843   -3.743  1.00 0.00 ? 787 LEU A HG   3  
ATOM 5082  H HD11 . LEU A 1 80  ? 4.429   8.747   -4.342  1.00 0.00 ? 787 LEU A HD11 3  
ATOM 5083  H HD12 . LEU A 1 80  ? 3.013   7.739   -4.626  1.00 0.00 ? 787 LEU A HD12 3  
ATOM 5084  H HD13 . LEU A 1 80  ? 4.508   7.441   -5.523  1.00 0.00 ? 787 LEU A HD13 3  
ATOM 5085  H HD21 . LEU A 1 80  ? 6.546   7.520   -3.188  1.00 0.00 ? 787 LEU A HD21 3  
ATOM 5086  H HD22 . LEU A 1 80  ? 6.387   6.342   -4.498  1.00 0.00 ? 787 LEU A HD22 3  
ATOM 5087  H HD23 . LEU A 1 80  ? 6.314   5.815   -2.812  1.00 0.00 ? 787 LEU A HD23 3  
ATOM 5088  N N    . ILE A 1 81  ? 6.189   9.091   -0.456  1.00 0.00 ? 788 ILE A N    3  
ATOM 5089  C CA   . ILE A 1 81  ? 7.511   9.571   -0.336  1.00 0.00 ? 788 ILE A CA   3  
ATOM 5090  C C    . ILE A 1 81  ? 8.439   8.424   -0.701  1.00 0.00 ? 788 ILE A C    3  
ATOM 5091  O O    . ILE A 1 81  ? 8.252   7.288   -0.238  1.00 0.00 ? 788 ILE A O    3  
ATOM 5092  C CB   . ILE A 1 81  ? 7.839   10.088  1.116   1.00 0.00 ? 788 ILE A CB   3  
ATOM 5093  C CG1  . ILE A 1 81  ? 6.911   11.244  1.585   1.00 0.00 ? 788 ILE A CG1  3  
ATOM 5094  C CG2  . ILE A 1 81  ? 9.296   10.508  1.249   1.00 0.00 ? 788 ILE A CG2  3  
ATOM 5095  C CD1  . ILE A 1 81  ? 5.507   10.830  2.015   1.00 0.00 ? 788 ILE A CD1  3  
ATOM 5096  H H    . ILE A 1 81  ? 5.803   8.635   0.328   1.00 0.00 ? 788 ILE A H    3  
ATOM 5097  H HA   . ILE A 1 81  ? 7.632   10.381  -1.037  1.00 0.00 ? 788 ILE A HA   3  
ATOM 5098  H HB   . ILE A 1 81  ? 7.683   9.242   1.760   1.00 0.00 ? 788 ILE A HB   3  
ATOM 5099  H HG12 . ILE A 1 81  ? 7.369   11.740  2.427   1.00 0.00 ? 788 ILE A HG12 3  
ATOM 5100  H HG13 . ILE A 1 81  ? 6.815   11.956  0.777   1.00 0.00 ? 788 ILE A HG13 3  
ATOM 5101  H HG21 . ILE A 1 81  ? 9.497   11.314  0.560   1.00 0.00 ? 788 ILE A HG21 3  
ATOM 5102  H HG22 . ILE A 1 81  ? 9.940   9.671   1.017   1.00 0.00 ? 788 ILE A HG22 3  
ATOM 5103  H HG23 . ILE A 1 81  ? 9.485   10.842  2.260   1.00 0.00 ? 788 ILE A HG23 3  
ATOM 5104  H HD11 . ILE A 1 81  ? 4.950   11.701  2.330   1.00 0.00 ? 788 ILE A HD11 3  
ATOM 5105  H HD12 . ILE A 1 81  ? 5.571   10.133  2.839   1.00 0.00 ? 788 ILE A HD12 3  
ATOM 5106  H HD13 . ILE A 1 81  ? 4.998   10.356  1.189   1.00 0.00 ? 788 ILE A HD13 3  
ATOM 5107  N N    . GLU A 1 82  ? 9.366   8.695   -1.556  1.00 0.00 ? 789 GLU A N    3  
ATOM 5108  C CA   . GLU A 1 82  ? 10.328  7.727   -1.999  1.00 0.00 ? 789 GLU A CA   3  
ATOM 5109  C C    . GLU A 1 82  ? 11.705  8.251   -1.650  1.00 0.00 ? 789 GLU A C    3  
ATOM 5110  O O    . GLU A 1 82  ? 12.046  9.402   -1.975  1.00 0.00 ? 789 GLU A O    3  
ATOM 5111  C CB   . GLU A 1 82  ? 10.143  7.460   -3.500  1.00 0.00 ? 789 GLU A CB   3  
ATOM 5112  C CG   . GLU A 1 82  ? 10.057  8.719   -4.336  1.00 0.00 ? 789 GLU A CG   3  
ATOM 5113  C CD   . GLU A 1 82  ? 9.768   8.454   -5.786  1.00 0.00 ? 789 GLU A CD   3  
ATOM 5114  O OE1  . GLU A 1 82  ? 8.577   8.370   -6.158  1.00 0.00 ? 789 GLU A OE1  3  
ATOM 5115  O OE2  . GLU A 1 82  ? 10.721  8.353   -6.592  1.00 0.00 ? 789 GLU A OE2  3  
ATOM 5116  H H    . GLU A 1 82  ? 9.450   9.608   -1.907  1.00 0.00 ? 789 GLU A H    3  
ATOM 5117  H HA   . GLU A 1 82  ? 10.156  6.817   -1.441  1.00 0.00 ? 789 GLU A HA   3  
ATOM 5118  H HB2  . GLU A 1 82  ? 10.970  6.867   -3.863  1.00 0.00 ? 789 GLU A HB2  3  
ATOM 5119  H HB3  . GLU A 1 82  ? 9.229   6.903   -3.640  1.00 0.00 ? 789 GLU A HB3  3  
ATOM 5120  H HG2  . GLU A 1 82  ? 9.257   9.315   -3.923  1.00 0.00 ? 789 GLU A HG2  3  
ATOM 5121  H HG3  . GLU A 1 82  ? 10.991  9.252   -4.242  1.00 0.00 ? 789 GLU A HG3  3  
ATOM 5122  N N    . LEU A 1 83  ? 12.484  7.445   -0.970  1.00 0.00 ? 790 LEU A N    3  
ATOM 5123  C CA   . LEU A 1 83  ? 13.738  7.928   -0.432  1.00 0.00 ? 790 LEU A CA   3  
ATOM 5124  C C    . LEU A 1 83  ? 14.852  7.938   -1.444  1.00 0.00 ? 790 LEU A C    3  
ATOM 5125  O O    . LEU A 1 83  ? 15.037  8.911   -2.184  1.00 0.00 ? 790 LEU A O    3  
ATOM 5126  C CB   . LEU A 1 83  ? 14.178  7.185   0.850   1.00 0.00 ? 790 LEU A CB   3  
ATOM 5127  C CG   . LEU A 1 83  ? 13.367  7.437   2.139   1.00 0.00 ? 790 LEU A CG   3  
ATOM 5128  C CD1  . LEU A 1 83  ? 11.941  6.915   2.035   1.00 0.00 ? 790 LEU A CD1  3  
ATOM 5129  C CD2  . LEU A 1 83  ? 14.077  6.834   3.342   1.00 0.00 ? 790 LEU A CD2  3  
ATOM 5130  H H    . LEU A 1 83  ? 12.225  6.498   -0.875  1.00 0.00 ? 790 LEU A H    3  
ATOM 5131  H HA   . LEU A 1 83  ? 13.558  8.959   -0.162  1.00 0.00 ? 790 LEU A HA   3  
ATOM 5132  H HB2  . LEU A 1 83  ? 14.148  6.127   0.630   1.00 0.00 ? 790 LEU A HB2  3  
ATOM 5133  H HB3  . LEU A 1 83  ? 15.209  7.448   1.032   1.00 0.00 ? 790 LEU A HB3  3  
ATOM 5134  H HG   . LEU A 1 83  ? 13.302  8.504   2.295   1.00 0.00 ? 790 LEU A HG   3  
ATOM 5135  H HD11 . LEU A 1 83  ? 11.961  5.849   1.854   1.00 0.00 ? 790 LEU A HD11 3  
ATOM 5136  H HD12 . LEU A 1 83  ? 11.436  7.408   1.217   1.00 0.00 ? 790 LEU A HD12 3  
ATOM 5137  H HD13 . LEU A 1 83  ? 11.417  7.114   2.957   1.00 0.00 ? 790 LEU A HD13 3  
ATOM 5138  H HD21 . LEU A 1 83  ? 13.492  7.017   4.231   1.00 0.00 ? 790 LEU A HD21 3  
ATOM 5139  H HD22 . LEU A 1 83  ? 15.052  7.287   3.454   1.00 0.00 ? 790 LEU A HD22 3  
ATOM 5140  H HD23 . LEU A 1 83  ? 14.190  5.770   3.199   1.00 0.00 ? 790 LEU A HD23 3  
ATOM 5141  N N    . THR A 1 84  ? 15.564  6.867   -1.516  1.00 0.00 ? 791 THR A N    3  
ATOM 5142  C CA   . THR A 1 84  ? 16.696  6.786   -2.351  1.00 0.00 ? 791 THR A CA   3  
ATOM 5143  C C    . THR A 1 84  ? 16.615  5.583   -3.260  1.00 0.00 ? 791 THR A C    3  
ATOM 5144  O O    . THR A 1 84  ? 15.802  4.686   -3.051  1.00 0.00 ? 791 THR A O    3  
ATOM 5145  C CB   . THR A 1 84  ? 17.990  6.753   -1.490  1.00 0.00 ? 791 THR A CB   3  
ATOM 5146  O OG1  . THR A 1 84  ? 17.860  5.785   -0.432  1.00 0.00 ? 791 THR A OG1  3  
ATOM 5147  C CG2  . THR A 1 84  ? 18.277  8.111   -0.871  1.00 0.00 ? 791 THR A CG2  3  
ATOM 5148  H H    . THR A 1 84  ? 15.338  6.068   -0.998  1.00 0.00 ? 791 THR A H    3  
ATOM 5149  H HA   . THR A 1 84  ? 16.737  7.665   -2.973  1.00 0.00 ? 791 THR A HA   3  
ATOM 5150  H HB   . THR A 1 84  ? 18.819  6.472   -2.123  1.00 0.00 ? 791 THR A HB   3  
ATOM 5151  H HG1  . THR A 1 84  ? 18.757  5.584   -0.132  1.00 0.00 ? 791 THR A HG1  3  
ATOM 5152  H HG21 . THR A 1 84  ? 18.396  8.843   -1.654  1.00 0.00 ? 791 THR A HG21 3  
ATOM 5153  H HG22 . THR A 1 84  ? 19.180  8.057   -0.282  1.00 0.00 ? 791 THR A HG22 3  
ATOM 5154  H HG23 . THR A 1 84  ? 17.450  8.396   -0.237  1.00 0.00 ? 791 THR A HG23 3  
ATOM 5155  N N    . GLN A 1 85  ? 17.376  5.628   -4.299  1.00 0.00 ? 792 GLN A N    3  
ATOM 5156  C CA   . GLN A 1 85  ? 17.552  4.510   -5.203  1.00 0.00 ? 792 GLN A CA   3  
ATOM 5157  C C    . GLN A 1 85  ? 19.032  4.408   -5.532  1.00 0.00 ? 792 GLN A C    3  
ATOM 5158  O O    . GLN A 1 85  ? 19.571  3.330   -5.772  1.00 0.00 ? 792 GLN A O    3  
ATOM 5159  C CB   . GLN A 1 85  ? 16.694  4.671   -6.473  1.00 0.00 ? 792 GLN A CB   3  
ATOM 5160  C CG   . GLN A 1 85  ? 17.008  5.908   -7.292  1.00 0.00 ? 792 GLN A CG   3  
ATOM 5161  C CD   . GLN A 1 85  ? 16.080  6.080   -8.469  1.00 0.00 ? 792 GLN A CD   3  
ATOM 5162  O OE1  . GLN A 1 85  ? 15.038  6.721   -8.362  1.00 0.00 ? 792 GLN A OE1  3  
ATOM 5163  N NE2  . GLN A 1 85  ? 16.440  5.526   -9.594  1.00 0.00 ? 792 GLN A NE2  3  
ATOM 5164  H H    . GLN A 1 85  ? 17.819  6.484   -4.471  1.00 0.00 ? 792 GLN A H    3  
ATOM 5165  H HA   . GLN A 1 85  ? 17.257  3.619   -4.669  1.00 0.00 ? 792 GLN A HA   3  
ATOM 5166  H HB2  . GLN A 1 85  ? 16.844  3.807   -7.103  1.00 0.00 ? 792 GLN A HB2  3  
ATOM 5167  H HB3  . GLN A 1 85  ? 15.654  4.711   -6.183  1.00 0.00 ? 792 GLN A HB3  3  
ATOM 5168  H HG2  . GLN A 1 85  ? 16.920  6.769   -6.646  1.00 0.00 ? 792 GLN A HG2  3  
ATOM 5169  H HG3  . GLN A 1 85  ? 18.023  5.830   -7.650  1.00 0.00 ? 792 GLN A HG3  3  
ATOM 5170  H HE21 . GLN A 1 85  ? 17.284  5.028   -9.632  1.00 0.00 ? 792 GLN A HE21 3  
ATOM 5171  H HE22 . GLN A 1 85  ? 15.856  5.639   -10.372 1.00 0.00 ? 792 GLN A HE22 3  
ATOM 5172  N N    . ALA A 1 86  ? 19.684  5.552   -5.509  1.00 0.00 ? 793 ALA A N    3  
ATOM 5173  C CA   . ALA A 1 86  ? 21.097  5.634   -5.708  1.00 0.00 ? 793 ALA A CA   3  
ATOM 5174  C C    . ALA A 1 86  ? 21.805  5.357   -4.390  1.00 0.00 ? 793 ALA A C    3  
ATOM 5175  O O    . ALA A 1 86  ? 22.519  4.353   -4.240  1.00 0.00 ? 793 ALA A O    3  
ATOM 5176  C CB   . ALA A 1 86  ? 21.457  7.014   -6.240  1.00 0.00 ? 793 ALA A CB   3  
ATOM 5177  H H    . ALA A 1 86  ? 19.191  6.389   -5.386  1.00 0.00 ? 793 ALA A H    3  
ATOM 5178  H HA   . ALA A 1 86  ? 21.389  4.892   -6.438  1.00 0.00 ? 793 ALA A HA   3  
ATOM 5179  H HB1  . ALA A 1 86  ? 22.515  7.079   -6.438  1.00 0.00 ? 793 ALA A HB1  3  
ATOM 5180  H HB2  . ALA A 1 86  ? 21.186  7.751   -5.499  1.00 0.00 ? 793 ALA A HB2  3  
ATOM 5181  H HB3  . ALA A 1 86  ? 20.902  7.200   -7.147  1.00 0.00 ? 793 ALA A HB3  3  
ATOM 5182  N N    . GLY A 1 87  ? 21.564  6.213   -3.420  1.00 0.00 ? 794 GLY A N    3  
ATOM 5183  C CA   . GLY A 1 87  ? 22.177  6.071   -2.125  1.00 0.00 ? 794 GLY A CA   3  
ATOM 5184  C C    . GLY A 1 87  ? 21.359  5.213   -1.202  1.00 0.00 ? 794 GLY A C    3  
ATOM 5185  O O    . GLY A 1 87  ? 20.769  5.700   -0.242  1.00 0.00 ? 794 GLY A O    3  
ATOM 5186  H H    . GLY A 1 87  ? 20.962  6.974   -3.574  1.00 0.00 ? 794 GLY A H    3  
ATOM 5187  H HA2  . GLY A 1 87  ? 23.150  5.618   -2.242  1.00 0.00 ? 794 GLY A HA2  3  
ATOM 5188  H HA3  . GLY A 1 87  ? 22.291  7.050   -1.683  1.00 0.00 ? 794 GLY A HA3  3  
ATOM 5189  N N    . LEU A 1 88  ? 21.292  3.944   -1.502  1.00 0.00 ? 795 LEU A N    3  
ATOM 5190  C CA   . LEU A 1 88  ? 20.554  3.016   -0.672  1.00 0.00 ? 795 LEU A CA   3  
ATOM 5191  C C    . LEU A 1 88  ? 21.405  2.461   0.450   1.00 0.00 ? 795 LEU A C    3  
ATOM 5192  O O    . LEU A 1 88  ? 20.888  1.889   1.405   1.00 0.00 ? 795 LEU A O    3  
ATOM 5193  C CB   . LEU A 1 88  ? 19.902  1.915   -1.509  1.00 0.00 ? 795 LEU A CB   3  
ATOM 5194  C CG   . LEU A 1 88  ? 18.690  2.361   -2.323  1.00 0.00 ? 795 LEU A CG   3  
ATOM 5195  C CD1  . LEU A 1 88  ? 18.219  1.273   -3.261  1.00 0.00 ? 795 LEU A CD1  3  
ATOM 5196  C CD2  . LEU A 1 88  ? 17.565  2.747   -1.394  1.00 0.00 ? 795 LEU A CD2  3  
ATOM 5197  H H    . LEU A 1 88  ? 21.737  3.623   -2.316  1.00 0.00 ? 795 LEU A H    3  
ATOM 5198  H HA   . LEU A 1 88  ? 19.771  3.595   -0.207  1.00 0.00 ? 795 LEU A HA   3  
ATOM 5199  H HB2  . LEU A 1 88  ? 20.645  1.539   -2.195  1.00 0.00 ? 795 LEU A HB2  3  
ATOM 5200  H HB3  . LEU A 1 88  ? 19.593  1.114   -0.852  1.00 0.00 ? 795 LEU A HB3  3  
ATOM 5201  H HG   . LEU A 1 88  ? 18.945  3.230   -2.911  1.00 0.00 ? 795 LEU A HG   3  
ATOM 5202  H HD11 . LEU A 1 88  ? 17.369  1.658   -3.804  1.00 0.00 ? 795 LEU A HD11 3  
ATOM 5203  H HD12 . LEU A 1 88  ? 17.931  0.400   -2.695  1.00 0.00 ? 795 LEU A HD12 3  
ATOM 5204  H HD13 . LEU A 1 88  ? 19.008  1.029   -3.956  1.00 0.00 ? 795 LEU A HD13 3  
ATOM 5205  H HD21 . LEU A 1 88  ? 16.699  3.011   -1.982  1.00 0.00 ? 795 LEU A HD21 3  
ATOM 5206  H HD22 . LEU A 1 88  ? 17.861  3.609   -0.815  1.00 0.00 ? 795 LEU A HD22 3  
ATOM 5207  H HD23 . LEU A 1 88  ? 17.325  1.922   -0.740  1.00 0.00 ? 795 LEU A HD23 3  
ATOM 5208  N N    . LYS A 1 89  ? 22.701  2.640   0.355   1.00 0.00 ? 796 LYS A N    3  
ATOM 5209  C CA   . LYS A 1 89  ? 23.568  2.206   1.413   1.00 0.00 ? 796 LYS A CA   3  
ATOM 5210  C C    . LYS A 1 89  ? 24.409  3.386   1.886   1.00 0.00 ? 796 LYS A C    3  
ATOM 5211  O O    . LYS A 1 89  ? 24.260  3.850   3.009   1.00 0.00 ? 796 LYS A O    3  
ATOM 5212  C CB   . LYS A 1 89  ? 24.459  1.042   0.970   1.00 0.00 ? 796 LYS A CB   3  
ATOM 5213  C CG   . LYS A 1 89  ? 25.169  0.344   2.124   1.00 0.00 ? 796 LYS A CG   3  
ATOM 5214  C CD   . LYS A 1 89  ? 24.172  -0.375  3.019   1.00 0.00 ? 796 LYS A CD   3  
ATOM 5215  C CE   . LYS A 1 89  ? 24.843  -1.044  4.203   1.00 0.00 ? 796 LYS A CE   3  
ATOM 5216  N NZ   . LYS A 1 89  ? 23.876  -1.850  4.981   1.00 0.00 ? 796 LYS A NZ   3  
ATOM 5217  H H    . LYS A 1 89  ? 23.080  3.072   -0.436  1.00 0.00 ? 796 LYS A H    3  
ATOM 5218  H HA   . LYS A 1 89  ? 22.933  1.886   2.225   1.00 0.00 ? 796 LYS A HA   3  
ATOM 5219  H HB2  . LYS A 1 89  ? 23.850  0.317   0.453   1.00 0.00 ? 796 LYS A HB2  3  
ATOM 5220  H HB3  . LYS A 1 89  ? 25.207  1.419   0.290   1.00 0.00 ? 796 LYS A HB3  3  
ATOM 5221  H HG2  . LYS A 1 89  ? 25.872  -0.374  1.729   1.00 0.00 ? 796 LYS A HG2  3  
ATOM 5222  H HG3  . LYS A 1 89  ? 25.689  1.086   2.709   1.00 0.00 ? 796 LYS A HG3  3  
ATOM 5223  H HD2  . LYS A 1 89  ? 23.453  0.336   3.397   1.00 0.00 ? 796 LYS A HD2  3  
ATOM 5224  H HD3  . LYS A 1 89  ? 23.662  -1.124  2.434   1.00 0.00 ? 796 LYS A HD3  3  
ATOM 5225  H HE2  . LYS A 1 89  ? 25.633  -1.685  3.842   1.00 0.00 ? 796 LYS A HE2  3  
ATOM 5226  H HE3  . LYS A 1 89  ? 25.262  -0.282  4.842   1.00 0.00 ? 796 LYS A HE3  3  
ATOM 5227  H HZ1  . LYS A 1 89  ? 24.297  -2.220  5.855   1.00 0.00 ? 796 LYS A HZ1  3  
ATOM 5228  H HZ2  . LYS A 1 89  ? 23.555  -2.666  4.420   1.00 0.00 ? 796 LYS A HZ2  3  
ATOM 5229  H HZ3  . LYS A 1 89  ? 23.027  -1.305  5.233   1.00 0.00 ? 796 LYS A HZ3  3  
ATOM 5230  N N    . GLY A 1 90  ? 25.251  3.884   1.019   1.00 0.00 ? 797 GLY A N    3  
ATOM 5231  C CA   . GLY A 1 90  ? 26.088  5.009   1.354   1.00 0.00 ? 797 GLY A CA   3  
ATOM 5232  C C    . GLY A 1 90  ? 27.232  5.116   0.391   1.00 0.00 ? 797 GLY A C    3  
ATOM 5233  O O    . GLY A 1 90  ? 28.029  4.170   0.279   1.00 0.00 ? 797 GLY A O    3  
ATOM 5234  H H    . GLY A 1 90  ? 25.354  3.478   0.128   1.00 0.00 ? 797 GLY A H    3  
ATOM 5235  H HA2  . GLY A 1 90  ? 25.495  5.910   1.318   1.00 0.00 ? 797 GLY A HA2  3  
ATOM 5236  H HA3  . GLY A 1 90  ? 26.480  4.878   2.351   1.00 0.00 ? 797 GLY A HA3  3  
ATOM 5237  N N    . SER A 1 91  ? 27.289  6.241   -0.349  1.00 0.00 ? 798 SER A N    3  
ATOM 5238  C CA   . SER A 1 91  ? 28.326  6.485   -1.375  1.00 0.00 ? 798 SER A CA   3  
ATOM 5239  C C    . SER A 1 91  ? 28.248  5.383   -2.455  1.00 0.00 ? 798 SER A C    3  
ATOM 5240  O O    . SER A 1 91  ? 29.239  5.031   -3.097  1.00 0.00 ? 798 SER A O    3  
ATOM 5241  C CB   . SER A 1 91  ? 29.715  6.502   -0.700  1.00 0.00 ? 798 SER A CB   3  
ATOM 5242  O OG   . SER A 1 91  ? 29.743  7.441   0.385   1.00 0.00 ? 798 SER A OG   3  
ATOM 5243  H H    . SER A 1 91  ? 26.622  6.944   -0.191  1.00 0.00 ? 798 SER A H    3  
ATOM 5244  H HA   . SER A 1 91  ? 28.131  7.443   -1.834  1.00 0.00 ? 798 SER A HA   3  
ATOM 5245  H HB2  . SER A 1 91  ? 29.931  5.518   -0.311  1.00 0.00 ? 798 SER A HB2  3  
ATOM 5246  H HB3  . SER A 1 91  ? 30.468  6.779   -1.424  1.00 0.00 ? 798 SER A HB3  3  
ATOM 5247  H HG   . SER A 1 91  ? 29.350  8.258   0.047   1.00 0.00 ? 798 SER A HG   3  
ATOM 5248  N N    . THR A 1 92  ? 27.043  4.906   -2.680  1.00 0.00 ? 799 THR A N    3  
ATOM 5249  C CA   . THR A 1 92  ? 26.801  3.774   -3.524  1.00 0.00 ? 799 THR A CA   3  
ATOM 5250  C C    . THR A 1 92  ? 26.547  4.196   -4.974  1.00 0.00 ? 799 THR A C    3  
ATOM 5251  O O    . THR A 1 92  ? 27.281  3.792   -5.881  1.00 0.00 ? 799 THR A O    3  
ATOM 5252  C CB   . THR A 1 92  ? 25.569  3.006   -2.996  1.00 0.00 ? 799 THR A CB   3  
ATOM 5253  O OG1  . THR A 1 92  ? 25.678  2.871   -1.565  1.00 0.00 ? 799 THR A OG1  3  
ATOM 5254  C CG2  . THR A 1 92  ? 25.485  1.619   -3.623  1.00 0.00 ? 799 THR A CG2  3  
ATOM 5255  H H    . THR A 1 92  ? 26.278  5.364   -2.274  1.00 0.00 ? 799 THR A H    3  
ATOM 5256  H HA   . THR A 1 92  ? 27.649  3.109   -3.478  1.00 0.00 ? 799 THR A HA   3  
ATOM 5257  H HB   . THR A 1 92  ? 24.677  3.567   -3.238  1.00 0.00 ? 799 THR A HB   3  
ATOM 5258  H HG1  . THR A 1 92  ? 26.540  2.460   -1.402  1.00 0.00 ? 799 THR A HG1  3  
ATOM 5259  H HG21 . THR A 1 92  ? 26.373  1.054   -3.381  1.00 0.00 ? 799 THR A HG21 3  
ATOM 5260  H HG22 . THR A 1 92  ? 25.407  1.714   -4.697  1.00 0.00 ? 799 THR A HG22 3  
ATOM 5261  H HG23 . THR A 1 92  ? 24.615  1.103   -3.242  1.00 0.00 ? 799 THR A HG23 3  
ATOM 5262  N N    . GLU A 1 93  ? 25.510  5.021   -5.167  1.00 0.00 ? 800 GLU A N    3  
ATOM 5263  C CA   . GLU A 1 93  ? 25.003  5.458   -6.478  1.00 0.00 ? 800 GLU A CA   3  
ATOM 5264  C C    . GLU A 1 93  ? 24.355  4.295   -7.263  1.00 0.00 ? 800 GLU A C    3  
ATOM 5265  O O    . GLU A 1 93  ? 23.195  4.380   -7.684  1.00 0.00 ? 800 GLU A O    3  
ATOM 5266  C CB   . GLU A 1 93  ? 26.059  6.198   -7.320  1.00 0.00 ? 800 GLU A CB   3  
ATOM 5267  C CG   . GLU A 1 93  ? 26.576  7.488   -6.686  1.00 0.00 ? 800 GLU A CG   3  
ATOM 5268  C CD   . GLU A 1 93  ? 25.485  8.512   -6.436  1.00 0.00 ? 800 GLU A CD   3  
ATOM 5269  O OE1  . GLU A 1 93  ? 25.185  9.322   -7.342  1.00 0.00 ? 800 GLU A OE1  3  
ATOM 5270  O OE2  . GLU A 1 93  ? 24.936  8.549   -5.314  1.00 0.00 ? 800 GLU A OE2  3  
ATOM 5271  H H    . GLU A 1 93  ? 25.056  5.390   -4.381  1.00 0.00 ? 800 GLU A H    3  
ATOM 5272  H HA   . GLU A 1 93  ? 24.205  6.145   -6.238  1.00 0.00 ? 800 GLU A HA   3  
ATOM 5273  H HB2  . GLU A 1 93  ? 26.898  5.540   -7.485  1.00 0.00 ? 800 GLU A HB2  3  
ATOM 5274  H HB3  . GLU A 1 93  ? 25.609  6.444   -8.268  1.00 0.00 ? 800 GLU A HB3  3  
ATOM 5275  H HG2  . GLU A 1 93  ? 27.039  7.250   -5.740  1.00 0.00 ? 800 GLU A HG2  3  
ATOM 5276  H HG3  . GLU A 1 93  ? 27.315  7.924   -7.343  1.00 0.00 ? 800 GLU A HG3  3  
ATOM 5277  N N    . GLY A 1 94  ? 25.081  3.220   -7.416  1.00 0.00 ? 801 GLY A N    3  
ATOM 5278  C CA   . GLY A 1 94  ? 24.583  2.076   -8.118  1.00 0.00 ? 801 GLY A CA   3  
ATOM 5279  C C    . GLY A 1 94  ? 24.160  0.976   -7.176  1.00 0.00 ? 801 GLY A C    3  
ATOM 5280  O O    . GLY A 1 94  ? 24.983  0.132   -6.778  1.00 0.00 ? 801 GLY A O    3  
ATOM 5281  H H    . GLY A 1 94  ? 25.988  3.216   -7.034  1.00 0.00 ? 801 GLY A H    3  
ATOM 5282  H HA2  . GLY A 1 94  ? 23.733  2.375   -8.715  1.00 0.00 ? 801 GLY A HA2  3  
ATOM 5283  H HA3  . GLY A 1 94  ? 25.355  1.695   -8.768  1.00 0.00 ? 801 GLY A HA3  3  
ATOM 5284  N N    . SER A 1 95  ? 22.911  1.002   -6.794  1.00 0.00 ? 802 SER A N    3  
ATOM 5285  C CA   . SER A 1 95  ? 22.332  -0.022  -5.956  1.00 0.00 ? 802 SER A CA   3  
ATOM 5286  C C    . SER A 1 95  ? 21.561  -0.995  -6.849  1.00 0.00 ? 802 SER A C    3  
ATOM 5287  O O    . SER A 1 95  ? 21.303  -0.683  -8.017  1.00 0.00 ? 802 SER A O    3  
ATOM 5288  C CB   . SER A 1 95  ? 21.408  0.621   -4.925  1.00 0.00 ? 802 SER A CB   3  
ATOM 5289  O OG   . SER A 1 95  ? 22.125  1.530   -4.083  1.00 0.00 ? 802 SER A OG   3  
ATOM 5290  H H    . SER A 1 95  ? 22.333  1.729   -7.109  1.00 0.00 ? 802 SER A H    3  
ATOM 5291  H HA   . SER A 1 95  ? 23.131  -0.549  -5.456  1.00 0.00 ? 802 SER A HA   3  
ATOM 5292  H HB2  . SER A 1 95  ? 20.632  1.169   -5.441  1.00 0.00 ? 802 SER A HB2  3  
ATOM 5293  H HB3  . SER A 1 95  ? 20.963  -0.148  -4.313  1.00 0.00 ? 802 SER A HB3  3  
ATOM 5294  H HG   . SER A 1 95  ? 22.165  2.380   -4.540  1.00 0.00 ? 802 SER A HG   3  
ATOM 5295  N N    . GLU A 1 96  ? 21.217  -2.155  -6.345  1.00 0.00 ? 803 GLU A N    3  
ATOM 5296  C CA   . GLU A 1 96  ? 20.516  -3.135  -7.144  1.00 0.00 ? 803 GLU A CA   3  
ATOM 5297  C C    . GLU A 1 96  ? 18.989  -3.004  -7.032  1.00 0.00 ? 803 GLU A C    3  
ATOM 5298  O O    . GLU A 1 96  ? 18.307  -3.716  -6.279  1.00 0.00 ? 803 GLU A O    3  
ATOM 5299  C CB   . GLU A 1 96  ? 21.012  -4.581  -6.902  1.00 0.00 ? 803 GLU A CB   3  
ATOM 5300  C CG   . GLU A 1 96  ? 20.927  -5.095  -5.464  1.00 0.00 ? 803 GLU A CG   3  
ATOM 5301  C CD   . GLU A 1 96  ? 21.939  -4.497  -4.516  1.00 0.00 ? 803 GLU A CD   3  
ATOM 5302  O OE1  . GLU A 1 96  ? 21.721  -3.381  -4.017  1.00 0.00 ? 803 GLU A OE1  3  
ATOM 5303  O OE2  . GLU A 1 96  ? 22.971  -5.141  -4.241  1.00 0.00 ? 803 GLU A OE2  3  
ATOM 5304  H H    . GLU A 1 96  ? 21.429  -2.390  -5.410  1.00 0.00 ? 803 GLU A H    3  
ATOM 5305  H HA   . GLU A 1 96  ? 20.753  -2.864  -8.163  1.00 0.00 ? 803 GLU A HA   3  
ATOM 5306  H HB2  . GLU A 1 96  ? 20.426  -5.245  -7.516  1.00 0.00 ? 803 GLU A HB2  3  
ATOM 5307  H HB3  . GLU A 1 96  ? 22.035  -4.643  -7.236  1.00 0.00 ? 803 GLU A HB3  3  
ATOM 5308  H HG2  . GLU A 1 96  ? 19.950  -4.794  -5.120  1.00 0.00 ? 803 GLU A HG2  3  
ATOM 5309  H HG3  . GLU A 1 96  ? 21.006  -6.172  -5.461  1.00 0.00 ? 803 GLU A HG3  3  
ATOM 5310  N N    . SER A 1 97  ? 18.478  -2.077  -7.777  1.00 0.00 ? 804 SER A N    3  
ATOM 5311  C CA   . SER A 1 97  ? 17.066  -1.750  -7.815  1.00 0.00 ? 804 SER A CA   3  
ATOM 5312  C C    . SER A 1 97  ? 16.348  -2.489  -8.963  1.00 0.00 ? 804 SER A C    3  
ATOM 5313  O O    . SER A 1 97  ? 15.306  -2.059  -9.435  1.00 0.00 ? 804 SER A O    3  
ATOM 5314  C CB   . SER A 1 97  ? 16.955  -0.237  -7.983  1.00 0.00 ? 804 SER A CB   3  
ATOM 5315  O OG   . SER A 1 97  ? 17.813  0.208   -9.035  1.00 0.00 ? 804 SER A OG   3  
ATOM 5316  H H    . SER A 1 97  ? 19.086  -1.543  -8.331  1.00 0.00 ? 804 SER A H    3  
ATOM 5317  H HA   . SER A 1 97  ? 16.619  -2.023  -6.871  1.00 0.00 ? 804 SER A HA   3  
ATOM 5318  H HB2  . SER A 1 97  ? 15.936  0.025   -8.228  1.00 0.00 ? 804 SER A HB2  3  
ATOM 5319  H HB3  . SER A 1 97  ? 17.246  0.253   -7.066  1.00 0.00 ? 804 SER A HB3  3  
ATOM 5320  H HG   . SER A 1 97  ? 17.234  0.452   -9.771  1.00 0.00 ? 804 SER A HG   3  
ATOM 5321  N N    . TYR A 1 98  ? 16.892  -3.634  -9.357  1.00 0.00 ? 805 TYR A N    3  
ATOM 5322  C CA   . TYR A 1 98  ? 16.342  -4.425  -10.479 1.00 0.00 ? 805 TYR A CA   3  
ATOM 5323  C C    . TYR A 1 98  ? 15.010  -5.102  -10.123 1.00 0.00 ? 805 TYR A C    3  
ATOM 5324  O O    . TYR A 1 98  ? 14.310  -5.617  -10.993 1.00 0.00 ? 805 TYR A O    3  
ATOM 5325  C CB   . TYR A 1 98  ? 17.346  -5.505  -10.909 1.00 0.00 ? 805 TYR A CB   3  
ATOM 5326  C CG   . TYR A 1 98  ? 17.629  -6.565  -9.846  1.00 0.00 ? 805 TYR A CG   3  
ATOM 5327  C CD1  . TYR A 1 98  ? 18.605  -6.371  -8.895  1.00 0.00 ? 805 TYR A CD1  3  
ATOM 5328  C CD2  . TYR A 1 98  ? 16.915  -7.756  -9.811  1.00 0.00 ? 805 TYR A CD2  3  
ATOM 5329  C CE1  . TYR A 1 98  ? 18.874  -7.328  -7.937  1.00 0.00 ? 805 TYR A CE1  3  
ATOM 5330  C CE2  . TYR A 1 98  ? 17.172  -8.712  -8.855  1.00 0.00 ? 805 TYR A CE2  3  
ATOM 5331  C CZ   . TYR A 1 98  ? 18.153  -8.495  -7.922  1.00 0.00 ? 805 TYR A CZ   3  
ATOM 5332  O OH   . TYR A 1 98  ? 18.430  -9.463  -6.980  1.00 0.00 ? 805 TYR A OH   3  
ATOM 5333  H H    . TYR A 1 98  ? 17.702  -3.943  -8.892  1.00 0.00 ? 805 TYR A H    3  
ATOM 5334  H HA   . TYR A 1 98  ? 16.183  -3.758  -11.314 1.00 0.00 ? 805 TYR A HA   3  
ATOM 5335  H HB2  . TYR A 1 98  ? 16.958  -6.012  -11.779 1.00 0.00 ? 805 TYR A HB2  3  
ATOM 5336  H HB3  . TYR A 1 98  ? 18.281  -5.028  -11.161 1.00 0.00 ? 805 TYR A HB3  3  
ATOM 5337  H HD1  . TYR A 1 98  ? 19.154  -5.443  -8.922  1.00 0.00 ? 805 TYR A HD1  3  
ATOM 5338  H HD2  . TYR A 1 98  ? 16.141  -7.923  -10.545 1.00 0.00 ? 805 TYR A HD2  3  
ATOM 5339  H HE1  . TYR A 1 98  ? 19.644  -7.162  -7.198  1.00 0.00 ? 805 TYR A HE1  3  
ATOM 5340  H HE2  . TYR A 1 98  ? 16.602  -9.629  -8.843  1.00 0.00 ? 805 TYR A HE2  3  
ATOM 5341  H HH   . TYR A 1 98  ? 18.516  -9.058  -6.109  1.00 0.00 ? 805 TYR A HH   3  
ATOM 5342  N N    . GLU A 1 99  ? 14.695  -5.129  -8.859  1.00 0.00 ? 806 GLU A N    3  
ATOM 5343  C CA   . GLU A 1 99  ? 13.518  -5.820  -8.388  1.00 0.00 ? 806 GLU A CA   3  
ATOM 5344  C C    . GLU A 1 99  ? 12.252  -4.938  -8.379  1.00 0.00 ? 806 GLU A C    3  
ATOM 5345  O O    . GLU A 1 99  ? 11.564  -4.803  -9.406  1.00 0.00 ? 806 GLU A O    3  
ATOM 5346  C CB   . GLU A 1 99  ? 13.793  -6.495  -7.029  1.00 0.00 ? 806 GLU A CB   3  
ATOM 5347  C CG   . GLU A 1 99  ? 14.594  -5.628  -6.047  1.00 0.00 ? 806 GLU A CG   3  
ATOM 5348  C CD   . GLU A 1 99  ? 14.741  -6.268  -4.697  1.00 0.00 ? 806 GLU A CD   3  
ATOM 5349  O OE1  . GLU A 1 99  ? 15.717  -6.998  -4.490  1.00 0.00 ? 806 GLU A OE1  3  
ATOM 5350  O OE2  . GLU A 1 99  ? 13.892  -6.050  -3.819  1.00 0.00 ? 806 GLU A OE2  3  
ATOM 5351  H H    . GLU A 1 99  ? 15.271  -4.641  -8.239  1.00 0.00 ? 806 GLU A H    3  
ATOM 5352  H HA   . GLU A 1 99  ? 13.342  -6.603  -9.112  1.00 0.00 ? 806 GLU A HA   3  
ATOM 5353  H HB2  . GLU A 1 99  ? 12.849  -6.743  -6.565  1.00 0.00 ? 806 GLU A HB2  3  
ATOM 5354  H HB3  . GLU A 1 99  ? 14.346  -7.407  -7.196  1.00 0.00 ? 806 GLU A HB3  3  
ATOM 5355  H HG2  . GLU A 1 99  ? 15.583  -5.499  -6.466  1.00 0.00 ? 806 GLU A HG2  3  
ATOM 5356  H HG3  . GLU A 1 99  ? 14.134  -4.658  -5.935  1.00 0.00 ? 806 GLU A HG3  3  
ATOM 5357  N N    . GLU A 1 100 ? 11.985  -4.328  -7.256  1.00 0.00 ? 807 GLU A N    3  
ATOM 5358  C CA   . GLU A 1 100 ? 10.839  -3.490  -7.050  1.00 0.00 ? 807 GLU A CA   3  
ATOM 5359  C C    . GLU A 1 100 ? 11.313  -2.112  -6.675  1.00 0.00 ? 807 GLU A C    3  
ATOM 5360  O O    . GLU A 1 100 ? 12.524  -1.867  -6.617  1.00 0.00 ? 807 GLU A O    3  
ATOM 5361  C CB   . GLU A 1 100 ? 9.980   -4.061  -5.918  1.00 0.00 ? 807 GLU A CB   3  
ATOM 5362  C CG   . GLU A 1 100 ? 9.287   -5.367  -6.255  1.00 0.00 ? 807 GLU A CG   3  
ATOM 5363  C CD   . GLU A 1 100 ? 8.219   -5.189  -7.302  1.00 0.00 ? 807 GLU A CD   3  
ATOM 5364  O OE1  . GLU A 1 100 ? 7.111   -4.767  -6.958  1.00 0.00 ? 807 GLU A OE1  3  
ATOM 5365  O OE2  . GLU A 1 100 ? 8.453   -5.493  -8.484  1.00 0.00 ? 807 GLU A OE2  3  
ATOM 5366  H H    . GLU A 1 100 ? 12.597  -4.411  -6.499  1.00 0.00 ? 807 GLU A H    3  
ATOM 5367  H HA   . GLU A 1 100 ? 10.252  -3.454  -7.955  1.00 0.00 ? 807 GLU A HA   3  
ATOM 5368  H HB2  . GLU A 1 100 ? 10.613  -4.232  -5.060  1.00 0.00 ? 807 GLU A HB2  3  
ATOM 5369  H HB3  . GLU A 1 100 ? 9.228   -3.333  -5.655  1.00 0.00 ? 807 GLU A HB3  3  
ATOM 5370  H HG2  . GLU A 1 100 ? 10.022  -6.064  -6.629  1.00 0.00 ? 807 GLU A HG2  3  
ATOM 5371  H HG3  . GLU A 1 100 ? 8.832   -5.766  -5.359  1.00 0.00 ? 807 GLU A HG3  3  
ATOM 5372  N N    . ASP A 1 101 ? 10.382  -1.232  -6.422  1.00 0.00 ? 808 ASP A N    3  
ATOM 5373  C CA   . ASP A 1 101 ? 10.691  0.116   -6.006  1.00 0.00 ? 808 ASP A CA   3  
ATOM 5374  C C    . ASP A 1 101 ? 11.189  0.047   -4.547  1.00 0.00 ? 808 ASP A C    3  
ATOM 5375  O O    . ASP A 1 101 ? 10.517  -0.553  -3.694  1.00 0.00 ? 808 ASP A O    3  
ATOM 5376  C CB   . ASP A 1 101 ? 9.438   0.983   -6.159  1.00 0.00 ? 808 ASP A CB   3  
ATOM 5377  C CG   . ASP A 1 101 ? 9.736   2.448   -6.371  1.00 0.00 ? 808 ASP A CG   3  
ATOM 5378  O OD1  . ASP A 1 101 ? 10.743  2.775   -7.045  1.00 0.00 ? 808 ASP A OD1  3  
ATOM 5379  O OD2  . ASP A 1 101 ? 8.914   3.290   -5.991  1.00 0.00 ? 808 ASP A OD2  3  
ATOM 5380  H H    . ASP A 1 101 ? 9.442   -1.492  -6.530  1.00 0.00 ? 808 ASP A H    3  
ATOM 5381  H HA   . ASP A 1 101 ? 11.481  0.483   -6.643  1.00 0.00 ? 808 ASP A HA   3  
ATOM 5382  H HB2  . ASP A 1 101 ? 8.874   0.636   -7.012  1.00 0.00 ? 808 ASP A HB2  3  
ATOM 5383  H HB3  . ASP A 1 101 ? 8.832   0.882   -5.270  1.00 0.00 ? 808 ASP A HB3  3  
ATOM 5384  N N    . PRO A 1 102 ? 12.389  0.620   -4.273  1.00 0.00 ? 809 PRO A N    3  
ATOM 5385  C CA   . PRO A 1 102 ? 13.144  0.468   -3.005  1.00 0.00 ? 809 PRO A CA   3  
ATOM 5386  C C    . PRO A 1 102 ? 12.375  0.636   -1.685  1.00 0.00 ? 809 PRO A C    3  
ATOM 5387  O O    . PRO A 1 102 ? 11.938  -0.358  -1.088  1.00 0.00 ? 809 PRO A O    3  
ATOM 5388  C CB   . PRO A 1 102 ? 14.284  1.497   -3.120  1.00 0.00 ? 809 PRO A CB   3  
ATOM 5389  C CG   . PRO A 1 102 ? 13.878  2.374   -4.255  1.00 0.00 ? 809 PRO A CG   3  
ATOM 5390  C CD   . PRO A 1 102 ? 13.122  1.491   -5.190  1.00 0.00 ? 809 PRO A CD   3  
ATOM 5391  H HA   . PRO A 1 102 ? 13.594  -0.512  -2.972  1.00 0.00 ? 809 PRO A HA   3  
ATOM 5392  H HB2  . PRO A 1 102 ? 14.366  2.051   -2.197  1.00 0.00 ? 809 PRO A HB2  3  
ATOM 5393  H HB3  . PRO A 1 102 ? 15.215  0.991   -3.327  1.00 0.00 ? 809 PRO A HB3  3  
ATOM 5394  H HG2  . PRO A 1 102 ? 13.237  3.165   -3.889  1.00 0.00 ? 809 PRO A HG2  3  
ATOM 5395  H HG3  . PRO A 1 102 ? 14.749  2.785   -4.743  1.00 0.00 ? 809 PRO A HG3  3  
ATOM 5396  H HD2  . PRO A 1 102 ? 12.445  2.078   -5.791  1.00 0.00 ? 809 PRO A HD2  3  
ATOM 5397  H HD3  . PRO A 1 102 ? 13.794  0.922   -5.815  1.00 0.00 ? 809 PRO A HD3  3  
ATOM 5398  N N    . TYR A 1 103 ? 12.238  1.861   -1.213  1.00 0.00 ? 810 TYR A N    3  
ATOM 5399  C CA   . TYR A 1 103 ? 11.605  2.107   0.064   1.00 0.00 ? 810 TYR A CA   3  
ATOM 5400  C C    . TYR A 1 103 ? 10.625  3.223   -0.068  1.00 0.00 ? 810 TYR A C    3  
ATOM 5401  O O    . TYR A 1 103 ? 11.001  4.364   -0.372  1.00 0.00 ? 810 TYR A O    3  
ATOM 5402  C CB   . TYR A 1 103 ? 12.644  2.431   1.149   1.00 0.00 ? 810 TYR A CB   3  
ATOM 5403  C CG   . TYR A 1 103 ? 13.635  1.318   1.395   1.00 0.00 ? 810 TYR A CG   3  
ATOM 5404  C CD1  . TYR A 1 103 ? 13.304  0.236   2.191   1.00 0.00 ? 810 TYR A CD1  3  
ATOM 5405  C CD2  . TYR A 1 103 ? 14.893  1.342   0.812   1.00 0.00 ? 810 TYR A CD2  3  
ATOM 5406  C CE1  . TYR A 1 103 ? 14.195  -0.790  2.405   1.00 0.00 ? 810 TYR A CE1  3  
ATOM 5407  C CE2  . TYR A 1 103 ? 15.789  0.318   1.016   1.00 0.00 ? 810 TYR A CE2  3  
ATOM 5408  C CZ   . TYR A 1 103 ? 15.436  -0.747  1.814   1.00 0.00 ? 810 TYR A CZ   3  
ATOM 5409  O OH   . TYR A 1 103 ? 16.329  -1.776  2.022   1.00 0.00 ? 810 TYR A OH   3  
ATOM 5410  H H    . TYR A 1 103 ? 12.543  2.639   -1.728  1.00 0.00 ? 810 TYR A H    3  
ATOM 5411  H HA   . TYR A 1 103 ? 11.075  1.210   0.348   1.00 0.00 ? 810 TYR A HA   3  
ATOM 5412  H HB2  . TYR A 1 103 ? 13.196  3.315   0.867   1.00 0.00 ? 810 TYR A HB2  3  
ATOM 5413  H HB3  . TYR A 1 103 ? 12.121  2.617   2.074   1.00 0.00 ? 810 TYR A HB3  3  
ATOM 5414  H HD1  . TYR A 1 103 ? 12.328  0.207   2.651   1.00 0.00 ? 810 TYR A HD1  3  
ATOM 5415  H HD2  . TYR A 1 103 ? 15.167  2.179   0.187   1.00 0.00 ? 810 TYR A HD2  3  
ATOM 5416  H HE1  . TYR A 1 103 ? 13.917  -1.626  3.030   1.00 0.00 ? 810 TYR A HE1  3  
ATOM 5417  H HE2  . TYR A 1 103 ? 16.762  0.358   0.549   1.00 0.00 ? 810 TYR A HE2  3  
ATOM 5418  H HH   . TYR A 1 103 ? 15.806  -2.590  1.984   1.00 0.00 ? 810 TYR A HH   3  
ATOM 5419  N N    . LEU A 1 104 ? 9.384   2.907   0.145   1.00 0.00 ? 811 LEU A N    3  
ATOM 5420  C CA   . LEU A 1 104 ? 8.320   3.850   -0.026  1.00 0.00 ? 811 LEU A CA   3  
ATOM 5421  C C    . LEU A 1 104 ? 7.620   4.067   1.285   1.00 0.00 ? 811 LEU A C    3  
ATOM 5422  O O    . LEU A 1 104 ? 7.594   3.175   2.150   1.00 0.00 ? 811 LEU A O    3  
ATOM 5423  C CB   . LEU A 1 104 ? 7.314   3.326   -1.050  1.00 0.00 ? 811 LEU A CB   3  
ATOM 5424  C CG   . LEU A 1 104 ? 7.883   2.940   -2.412  1.00 0.00 ? 811 LEU A CG   3  
ATOM 5425  C CD1  . LEU A 1 104 ? 6.768   2.523   -3.348  1.00 0.00 ? 811 LEU A CD1  3  
ATOM 5426  C CD2  . LEU A 1 104 ? 8.696   4.082   -3.000  1.00 0.00 ? 811 LEU A CD2  3  
ATOM 5427  H H    . LEU A 1 104 ? 9.165   1.998   0.456   1.00 0.00 ? 811 LEU A H    3  
ATOM 5428  H HA   . LEU A 1 104 ? 8.724   4.786   -0.390  1.00 0.00 ? 811 LEU A HA   3  
ATOM 5429  H HB2  . LEU A 1 104 ? 6.832   2.455   -0.629  1.00 0.00 ? 811 LEU A HB2  3  
ATOM 5430  H HB3  . LEU A 1 104 ? 6.565   4.088   -1.204  1.00 0.00 ? 811 LEU A HB3  3  
ATOM 5431  H HG   . LEU A 1 104 ? 8.535   2.088   -2.285  1.00 0.00 ? 811 LEU A HG   3  
ATOM 5432  H HD11 . LEU A 1 104 ? 6.091   3.354   -3.479  1.00 0.00 ? 811 LEU A HD11 3  
ATOM 5433  H HD12 . LEU A 1 104 ? 6.230   1.693   -2.914  1.00 0.00 ? 811 LEU A HD12 3  
ATOM 5434  H HD13 . LEU A 1 104 ? 7.180   2.237   -4.305  1.00 0.00 ? 811 LEU A HD13 3  
ATOM 5435  H HD21 . LEU A 1 104 ? 9.074   3.800   -3.972  1.00 0.00 ? 811 LEU A HD21 3  
ATOM 5436  H HD22 . LEU A 1 104 ? 9.527   4.293   -2.342  1.00 0.00 ? 811 LEU A HD22 3  
ATOM 5437  H HD23 . LEU A 1 104 ? 8.081   4.964   -3.086  1.00 0.00 ? 811 LEU A HD23 3  
ATOM 5438  N N    . VAL A 1 105 ? 7.100   5.241   1.450   1.00 0.00 ? 812 VAL A N    3  
ATOM 5439  C CA   . VAL A 1 105 ? 6.353   5.614   2.618   1.00 0.00 ? 812 VAL A CA   3  
ATOM 5440  C C    . VAL A 1 105 ? 5.271   6.622   2.245   1.00 0.00 ? 812 VAL A C    3  
ATOM 5441  O O    . VAL A 1 105 ? 5.489   7.460   1.424   1.00 0.00 ? 812 VAL A O    3  
ATOM 5442  C CB   . VAL A 1 105 ? 7.300   6.127   3.765   1.00 0.00 ? 812 VAL A CB   3  
ATOM 5443  C CG1  . VAL A 1 105 ? 8.458   6.933   3.215   1.00 0.00 ? 812 VAL A CG1  3  
ATOM 5444  C CG2  . VAL A 1 105 ? 6.559   6.980   4.770   1.00 0.00 ? 812 VAL A CG2  3  
ATOM 5445  H H    . VAL A 1 105 ? 7.236   5.925   0.754   1.00 0.00 ? 812 VAL A H    3  
ATOM 5446  H HA   . VAL A 1 105 ? 5.867   4.707   2.944   1.00 0.00 ? 812 VAL A HA   3  
ATOM 5447  H HB   . VAL A 1 105 ? 7.694   5.264   4.278   1.00 0.00 ? 812 VAL A HB   3  
ATOM 5448  H HG11 . VAL A 1 105 ? 9.121   7.205   4.024   1.00 0.00 ? 812 VAL A HG11 3  
ATOM 5449  H HG12 . VAL A 1 105 ? 8.064   7.828   2.769   1.00 0.00 ? 812 VAL A HG12 3  
ATOM 5450  H HG13 . VAL A 1 105 ? 8.993   6.353   2.477   1.00 0.00 ? 812 VAL A HG13 3  
ATOM 5451  H HG21 . VAL A 1 105 ? 5.747   6.419   5.207   1.00 0.00 ? 812 VAL A HG21 3  
ATOM 5452  H HG22 . VAL A 1 105 ? 6.182   7.845   4.241   1.00 0.00 ? 812 VAL A HG22 3  
ATOM 5453  H HG23 . VAL A 1 105 ? 7.254   7.295   5.533   1.00 0.00 ? 812 VAL A HG23 3  
ATOM 5454  N N    . VAL A 1 106 ? 4.106   6.506   2.812   1.00 0.00 ? 813 VAL A N    3  
ATOM 5455  C CA   . VAL A 1 106 ? 3.033   7.426   2.499   1.00 0.00 ? 813 VAL A CA   3  
ATOM 5456  C C    . VAL A 1 106 ? 2.541   8.132   3.762   1.00 0.00 ? 813 VAL A C    3  
ATOM 5457  O O    . VAL A 1 106 ? 1.786   7.564   4.552   1.00 0.00 ? 813 VAL A O    3  
ATOM 5458  C CB   . VAL A 1 106 ? 1.859   6.721   1.733   1.00 0.00 ? 813 VAL A CB   3  
ATOM 5459  C CG1  . VAL A 1 106 ? 1.348   5.466   2.461   1.00 0.00 ? 813 VAL A CG1  3  
ATOM 5460  C CG2  . VAL A 1 106 ? 0.720   7.694   1.493   1.00 0.00 ? 813 VAL A CG2  3  
ATOM 5461  H H    . VAL A 1 106 ? 3.950   5.803   3.477   1.00 0.00 ? 813 VAL A H    3  
ATOM 5462  H HA   . VAL A 1 106 ? 3.457   8.182   1.855   1.00 0.00 ? 813 VAL A HA   3  
ATOM 5463  H HB   . VAL A 1 106 ? 2.241   6.411   0.771   1.00 0.00 ? 813 VAL A HB   3  
ATOM 5464  H HG11 . VAL A 1 106 ? 0.977   5.737   3.440   1.00 0.00 ? 813 VAL A HG11 3  
ATOM 5465  H HG12 . VAL A 1 106 ? 2.153   4.757   2.577   1.00 0.00 ? 813 VAL A HG12 3  
ATOM 5466  H HG13 . VAL A 1 106 ? 0.549   5.015   1.892   1.00 0.00 ? 813 VAL A HG13 3  
ATOM 5467  H HG21 . VAL A 1 106 ? 1.068   8.521   0.895   1.00 0.00 ? 813 VAL A HG21 3  
ATOM 5468  H HG22 . VAL A 1 106 ? 0.368   8.060   2.446   1.00 0.00 ? 813 VAL A HG22 3  
ATOM 5469  H HG23 . VAL A 1 106 ? -0.075  7.175   0.979   1.00 0.00 ? 813 VAL A HG23 3  
ATOM 5470  N N    . ASN A 1 107 ? 2.978   9.361   3.989   1.00 0.00 ? 814 ASN A N    3  
ATOM 5471  C CA   . ASN A 1 107 ? 2.559   10.009  5.219   1.00 0.00 ? 814 ASN A CA   3  
ATOM 5472  C C    . ASN A 1 107 ? 2.264   11.496  5.214   1.00 0.00 ? 814 ASN A C    3  
ATOM 5473  O O    . ASN A 1 107 ? 3.059   12.309  5.694   1.00 0.00 ? 814 ASN A O    3  
ATOM 5474  C CB   . ASN A 1 107 ? 3.293   9.573   6.497   1.00 0.00 ? 814 ASN A CB   3  
ATOM 5475  C CG   . ASN A 1 107 ? 4.769   9.922   6.569   1.00 0.00 ? 814 ASN A CG   3  
ATOM 5476  O OD1  . ASN A 1 107 ? 5.465   10.010  5.557   1.00 0.00 ? 814 ASN A OD1  3  
ATOM 5477  N ND2  . ASN A 1 107 ? 5.249   10.135  7.766   1.00 0.00 ? 814 ASN A ND2  3  
ATOM 5478  H H    . ASN A 1 107 ? 3.517   9.839   3.320   1.00 0.00 ? 814 ASN A H    3  
ATOM 5479  H HA   . ASN A 1 107 ? 1.564   9.598   5.320   1.00 0.00 ? 814 ASN A HA   3  
ATOM 5480  H HB2  . ASN A 1 107 ? 2.784   10.059  7.316   1.00 0.00 ? 814 ASN A HB2  3  
ATOM 5481  H HB3  . ASN A 1 107 ? 3.166   8.505   6.587   1.00 0.00 ? 814 ASN A HB3  3  
ATOM 5482  H HD21 . ASN A 1 107 ? 4.643   10.072  8.537   1.00 0.00 ? 814 ASN A HD21 3  
ATOM 5483  H HD22 . ASN A 1 107 ? 6.205   10.331  7.873   1.00 0.00 ? 814 ASN A HD22 3  
ATOM 5484  N N    . PRO A 1 108 ? 1.150   11.882  4.605   1.00 0.00 ? 815 PRO A N    3  
ATOM 5485  C CA   . PRO A 1 108 ? 0.490   13.151  4.905   1.00 0.00 ? 815 PRO A CA   3  
ATOM 5486  C C    . PRO A 1 108 ? -0.701  12.786  5.801   1.00 0.00 ? 815 PRO A C    3  
ATOM 5487  O O    . PRO A 1 108 ? -1.633  13.552  6.007   1.00 0.00 ? 815 PRO A O    3  
ATOM 5488  C CB   . PRO A 1 108 ? -0.012  13.554  3.537   1.00 0.00 ? 815 PRO A CB   3  
ATOM 5489  C CG   . PRO A 1 108 ? -0.475  12.262  2.944   1.00 0.00 ? 815 PRO A CG   3  
ATOM 5490  C CD   . PRO A 1 108 ? 0.477   11.200  3.457   1.00 0.00 ? 815 PRO A CD   3  
ATOM 5491  H HA   . PRO A 1 108 ? 1.135   13.890  5.357   1.00 0.00 ? 815 PRO A HA   3  
ATOM 5492  H HB2  . PRO A 1 108 ? -0.819  14.262  3.653   1.00 0.00 ? 815 PRO A HB2  3  
ATOM 5493  H HB3  . PRO A 1 108 ? 0.797   13.983  2.965   1.00 0.00 ? 815 PRO A HB3  3  
ATOM 5494  H HG2  . PRO A 1 108 ? -1.483  12.054  3.270   1.00 0.00 ? 815 PRO A HG2  3  
ATOM 5495  H HG3  . PRO A 1 108 ? -0.432  12.319  1.869   1.00 0.00 ? 815 PRO A HG3  3  
ATOM 5496  H HD2  . PRO A 1 108 ? -0.067  10.327  3.787   1.00 0.00 ? 815 PRO A HD2  3  
ATOM 5497  H HD3  . PRO A 1 108 ? 1.198   10.935  2.698   1.00 0.00 ? 815 PRO A HD3  3  
ATOM 5498  N N    . ASN A 1 109 ? -0.589  11.542  6.302   1.00 0.00 ? 816 ASN A N    3  
ATOM 5499  C CA   . ASN A 1 109 ? -1.602  10.797  6.991   1.00 0.00 ? 816 ASN A CA   3  
ATOM 5500  C C    . ASN A 1 109 ? -2.706  10.512  5.993   1.00 0.00 ? 816 ASN A C    3  
ATOM 5501  O O    . ASN A 1 109 ? -3.619  11.310  5.792   1.00 0.00 ? 816 ASN A O    3  
ATOM 5502  C CB   . ASN A 1 109 ? -2.075  11.470  8.267   1.00 0.00 ? 816 ASN A CB   3  
ATOM 5503  C CG   . ASN A 1 109 ? -3.025  10.602  9.066   1.00 0.00 ? 816 ASN A CG   3  
ATOM 5504  O OD1  . ASN A 1 109 ? -4.241  10.645  8.881   1.00 0.00 ? 816 ASN A OD1  3  
ATOM 5505  N ND2  . ASN A 1 109 ? -2.489  9.821   9.972   1.00 0.00 ? 816 ASN A ND2  3  
ATOM 5506  H H    . ASN A 1 109 ? 0.286   11.143  6.139   1.00 0.00 ? 816 ASN A H    3  
ATOM 5507  H HA   . ASN A 1 109 ? -1.143  9.843   7.217   1.00 0.00 ? 816 ASN A HA   3  
ATOM 5508  H HB2  . ASN A 1 109 ? -1.177  11.620  8.851   1.00 0.00 ? 816 ASN A HB2  3  
ATOM 5509  H HB3  . ASN A 1 109 ? -2.537  12.420  8.040   1.00 0.00 ? 816 ASN A HB3  3  
ATOM 5510  H HD21 . ASN A 1 109 ? -1.514  9.833   10.100  1.00 0.00 ? 816 ASN A HD21 3  
ATOM 5511  H HD22 . ASN A 1 109 ? -3.080  9.237   10.496  1.00 0.00 ? 816 ASN A HD22 3  
ATOM 5512  N N    . TYR A 1 110 ? -2.516  9.389   5.289   1.00 0.00 ? 817 TYR A N    3  
ATOM 5513  C CA   . TYR A 1 110 ? -3.322  8.981   4.134   1.00 0.00 ? 817 TYR A CA   3  
ATOM 5514  C C    . TYR A 1 110 ? -4.811  9.067   4.416   1.00 0.00 ? 817 TYR A C    3  
ATOM 5515  O O    . TYR A 1 110 ? -5.309  8.542   5.414   1.00 0.00 ? 817 TYR A O    3  
ATOM 5516  C CB   . TYR A 1 110 ? -2.919  7.562   3.690   1.00 0.00 ? 817 TYR A CB   3  
ATOM 5517  C CG   . TYR A 1 110 ? -3.472  7.101   2.337   1.00 0.00 ? 817 TYR A CG   3  
ATOM 5518  C CD1  . TYR A 1 110 ? -2.831  7.450   1.151   1.00 0.00 ? 817 TYR A CD1  3  
ATOM 5519  C CD2  . TYR A 1 110 ? -4.603  6.293   2.249   1.00 0.00 ? 817 TYR A CD2  3  
ATOM 5520  C CE1  . TYR A 1 110 ? -3.301  7.013   -0.078  1.00 0.00 ? 817 TYR A CE1  3  
ATOM 5521  C CE2  . TYR A 1 110 ? -5.076  5.849   1.022   1.00 0.00 ? 817 TYR A CE2  3  
ATOM 5522  C CZ   . TYR A 1 110 ? -4.419  6.214   -0.137  1.00 0.00 ? 817 TYR A CZ   3  
ATOM 5523  O OH   . TYR A 1 110 ? -4.876  5.769   -1.364  1.00 0.00 ? 817 TYR A OH   3  
ATOM 5524  H H    . TYR A 1 110 ? -1.801  8.787   5.580   1.00 0.00 ? 817 TYR A H    3  
ATOM 5525  H HA   . TYR A 1 110 ? -3.094  9.662   3.328   1.00 0.00 ? 817 TYR A HA   3  
ATOM 5526  H HB2  . TYR A 1 110 ? -1.843  7.514   3.629   1.00 0.00 ? 817 TYR A HB2  3  
ATOM 5527  H HB3  . TYR A 1 110 ? -3.250  6.863   4.442   1.00 0.00 ? 817 TYR A HB3  3  
ATOM 5528  H HD1  . TYR A 1 110 ? -1.957  8.083   1.195   1.00 0.00 ? 817 TYR A HD1  3  
ATOM 5529  H HD2  . TYR A 1 110 ? -5.119  6.013   3.155   1.00 0.00 ? 817 TYR A HD2  3  
ATOM 5530  H HE1  . TYR A 1 110 ? -2.789  7.288   -0.987  1.00 0.00 ? 817 TYR A HE1  3  
ATOM 5531  H HE2  . TYR A 1 110 ? -5.955  5.223   0.973   1.00 0.00 ? 817 TYR A HE2  3  
ATOM 5532  H HH   . TYR A 1 110 ? -4.136  5.378   -1.838  1.00 0.00 ? 817 TYR A HH   3  
ATOM 5533  N N    . LEU A 1 111 ? -5.487  9.752   3.547   1.00 0.00 ? 818 LEU A N    3  
ATOM 5534  C CA   . LEU A 1 111 ? -6.896  9.977   3.658   1.00 0.00 ? 818 LEU A CA   3  
ATOM 5535  C C    . LEU A 1 111 ? -7.664  8.967   2.832   1.00 0.00 ? 818 LEU A C    3  
ATOM 5536  O O    . LEU A 1 111 ? -7.078  8.239   2.035   1.00 0.00 ? 818 LEU A O    3  
ATOM 5537  C CB   . LEU A 1 111 ? -7.294  11.459  3.296   1.00 0.00 ? 818 LEU A CB   3  
ATOM 5538  C CG   . LEU A 1 111 ? -6.713  12.154  2.004   1.00 0.00 ? 818 LEU A CG   3  
ATOM 5539  C CD1  . LEU A 1 111 ? -5.244  12.549  2.155   1.00 0.00 ? 818 LEU A CD1  3  
ATOM 5540  C CD2  . LEU A 1 111 ? -6.909  11.309  0.750   1.00 0.00 ? 818 LEU A CD2  3  
ATOM 5541  H H    . LEU A 1 111 ? -5.029  10.099  2.757   1.00 0.00 ? 818 LEU A H    3  
ATOM 5542  H HA   . LEU A 1 111 ? -7.151  9.803   4.693   1.00 0.00 ? 818 LEU A HA   3  
ATOM 5543  H HB2  . LEU A 1 111 ? -8.368  11.487  3.201   1.00 0.00 ? 818 LEU A HB2  3  
ATOM 5544  H HB3  . LEU A 1 111 ? -7.030  12.072  4.144   1.00 0.00 ? 818 LEU A HB3  3  
ATOM 5545  H HG   . LEU A 1 111 ? -7.255  13.081  1.870   1.00 0.00 ? 818 LEU A HG   3  
ATOM 5546  H HD11 . LEU A 1 111 ? -4.913  13.035  1.250   1.00 0.00 ? 818 LEU A HD11 3  
ATOM 5547  H HD12 . LEU A 1 111 ? -4.634  11.676  2.331   1.00 0.00 ? 818 LEU A HD12 3  
ATOM 5548  H HD13 . LEU A 1 111 ? -5.137  13.233  2.984   1.00 0.00 ? 818 LEU A HD13 3  
ATOM 5549  H HD21 . LEU A 1 111 ? -6.485  11.813  -0.105  1.00 0.00 ? 818 LEU A HD21 3  
ATOM 5550  H HD22 . LEU A 1 111 ? -7.964  11.137  0.594   1.00 0.00 ? 818 LEU A HD22 3  
ATOM 5551  H HD23 . LEU A 1 111 ? -6.421  10.353  0.889   1.00 0.00 ? 818 LEU A HD23 3  
ATOM 5552  N N    . LEU A 1 112 ? -8.952  8.934   3.003   1.00 0.00 ? 819 LEU A N    3  
ATOM 5553  C CA   . LEU A 1 112 ? -9.771  8.023   2.252   1.00 0.00 ? 819 LEU A CA   3  
ATOM 5554  C C    . LEU A 1 112 ? -10.248 8.720   0.990   1.00 0.00 ? 819 LEU A C    3  
ATOM 5555  O O    . LEU A 1 112 ? -10.030 9.924   0.833   1.00 0.00 ? 819 LEU A O    3  
ATOM 5556  C CB   . LEU A 1 112 ? -10.957 7.540   3.098   1.00 0.00 ? 819 LEU A CB   3  
ATOM 5557  C CG   . LEU A 1 112 ? -10.599 6.828   4.417   1.00 0.00 ? 819 LEU A CG   3  
ATOM 5558  C CD1  . LEU A 1 112 ? -11.853 6.449   5.182   1.00 0.00 ? 819 LEU A CD1  3  
ATOM 5559  C CD2  . LEU A 1 112 ? -9.738  5.594   4.160   1.00 0.00 ? 819 LEU A CD2  3  
ATOM 5560  H H    . LEU A 1 112 ? -9.378  9.560   3.626   1.00 0.00 ? 819 LEU A H    3  
ATOM 5561  H HA   . LEU A 1 112 ? -9.158  7.182   1.969   1.00 0.00 ? 819 LEU A HA   3  
ATOM 5562  H HB2  . LEU A 1 112 ? -11.566 8.401   3.329   1.00 0.00 ? 819 LEU A HB2  3  
ATOM 5563  H HB3  . LEU A 1 112 ? -11.542 6.861   2.497   1.00 0.00 ? 819 LEU A HB3  3  
ATOM 5564  H HG   . LEU A 1 112 ? -10.035 7.513   5.033   1.00 0.00 ? 819 LEU A HG   3  
ATOM 5565  H HD11 . LEU A 1 112 ? -11.576 5.938   6.093   1.00 0.00 ? 819 LEU A HD11 3  
ATOM 5566  H HD12 . LEU A 1 112 ? -12.466 5.801   4.574   1.00 0.00 ? 819 LEU A HD12 3  
ATOM 5567  H HD13 . LEU A 1 112 ? -12.407 7.342   5.428   1.00 0.00 ? 819 LEU A HD13 3  
ATOM 5568  H HD21 . LEU A 1 112 ? -8.815  5.887   3.683   1.00 0.00 ? 819 LEU A HD21 3  
ATOM 5569  H HD22 . LEU A 1 112 ? -10.271 4.910   3.517   1.00 0.00 ? 819 LEU A HD22 3  
ATOM 5570  H HD23 . LEU A 1 112 ? -9.520  5.107   5.099   1.00 0.00 ? 819 LEU A HD23 3  
ATOM 5571  N N    . GLU A 1 113 ? -10.885 7.987   0.103   1.00 0.00 ? 820 GLU A N    3  
ATOM 5572  C CA   . GLU A 1 113 ? -11.364 8.555   -1.152  1.00 0.00 ? 820 GLU A CA   3  
ATOM 5573  C C    . GLU A 1 113 ? -12.384 9.648   -0.900  1.00 0.00 ? 820 GLU A C    3  
ATOM 5574  O O    . GLU A 1 113 ? -12.214 10.790  -1.339  1.00 0.00 ? 820 GLU A O    3  
ATOM 5575  C CB   . GLU A 1 113 ? -11.982 7.490   -2.016  1.00 0.00 ? 820 GLU A CB   3  
ATOM 5576  C CG   . GLU A 1 113 ? -11.059 6.356   -2.356  1.00 0.00 ? 820 GLU A CG   3  
ATOM 5577  C CD   . GLU A 1 113 ? -11.724 5.391   -3.269  1.00 0.00 ? 820 GLU A CD   3  
ATOM 5578  O OE1  . GLU A 1 113 ? -12.403 4.503   -2.798  1.00 0.00 ? 820 GLU A OE1  3  
ATOM 5579  O OE2  . GLU A 1 113 ? -11.615 5.550   -4.499  1.00 0.00 ? 820 GLU A OE2  3  
ATOM 5580  H H    . GLU A 1 113 ? -11.026 7.034   0.283   1.00 0.00 ? 820 GLU A H    3  
ATOM 5581  H HA   . GLU A 1 113 ? -10.516 8.978   -1.671  1.00 0.00 ? 820 GLU A HA   3  
ATOM 5582  H HB2  . GLU A 1 113 ? -12.841 7.083   -1.504  1.00 0.00 ? 820 GLU A HB2  3  
ATOM 5583  H HB3  . GLU A 1 113 ? -12.311 7.948   -2.937  1.00 0.00 ? 820 GLU A HB3  3  
ATOM 5584  H HG2  . GLU A 1 113 ? -10.178 6.750   -2.840  1.00 0.00 ? 820 GLU A HG2  3  
ATOM 5585  H HG3  . GLU A 1 113 ? -10.779 5.842   -1.448  1.00 0.00 ? 820 GLU A HG3  3  
ATOM 5586  N N    . ASP A 1 114 ? -13.417 9.302   -0.179  1.00 0.00 ? 821 ASP A N    3  
ATOM 5587  C CA   . ASP A 1 114 ? -14.452 10.230  0.151   1.00 0.00 ? 821 ASP A CA   3  
ATOM 5588  C C    . ASP A 1 114 ? -14.630 10.233  1.641   1.00 0.00 ? 821 ASP A C    3  
ATOM 5589  O O    . ASP A 1 114 ? -13.994 11.058  2.308   1.00 0.00 ? 821 ASP A O    3  
ATOM 5590  C CB   . ASP A 1 114 ? -15.757 9.862   -0.539  1.00 0.00 ? 821 ASP A CB   3  
ATOM 5591  C CG   . ASP A 1 114 ? -16.836 10.872  -0.277  1.00 0.00 ? 821 ASP A CG   3  
ATOM 5592  O OD1  . ASP A 1 114 ? -16.858 11.901  -0.955  1.00 0.00 ? 821 ASP A OD1  3  
ATOM 5593  O OD2  . ASP A 1 114 ? -17.699 10.660  0.596   1.00 0.00 ? 821 ASP A OD2  3  
ATOM 5594  O OXT  . ASP A 1 114 ? -15.333 9.348   2.175   1.00 0.00 ? 821 ASP A OXT  3  
ATOM 5595  H H    . ASP A 1 114 ? -13.497 8.391   0.169   1.00 0.00 ? 821 ASP A H    3  
ATOM 5596  H HA   . ASP A 1 114 ? -14.139 11.211  -0.174  1.00 0.00 ? 821 ASP A HA   3  
ATOM 5597  H HB2  . ASP A 1 114 ? -15.585 9.817   -1.605  1.00 0.00 ? 821 ASP A HB2  3  
ATOM 5598  H HB3  . ASP A 1 114 ? -16.091 8.897   -0.191  1.00 0.00 ? 821 ASP A HB3  3  
ATOM 5599  N N    . ALA A 1 1   ? -23.468 17.478  -6.084  1.00 0.00 ? 708 ALA A N    4  
ATOM 5600  C CA   . ALA A 1 1   ? -23.201 16.242  -6.774  1.00 0.00 ? 708 ALA A CA   4  
ATOM 5601  C C    . ALA A 1 1   ? -22.749 15.157  -5.805  1.00 0.00 ? 708 ALA A C    4  
ATOM 5602  O O    . ALA A 1 1   ? -21.842 15.377  -4.996  1.00 0.00 ? 708 ALA A O    4  
ATOM 5603  C CB   . ALA A 1 1   ? -22.132 16.468  -7.835  1.00 0.00 ? 708 ALA A CB   4  
ATOM 5604  H H1   . ALA A 1 1   ? -22.878 18.247  -6.221  1.00 0.00 ? 708 ALA A H1   4  
ATOM 5605  H HA   . ALA A 1 1   ? -24.109 15.950  -7.278  1.00 0.00 ? 708 ALA A HA   4  
ATOM 5606  H HB1  . ALA A 1 1   ? -22.457 17.242  -8.516  1.00 0.00 ? 708 ALA A HB1  4  
ATOM 5607  H HB2  . ALA A 1 1   ? -21.968 15.552  -8.382  1.00 0.00 ? 708 ALA A HB2  4  
ATOM 5608  H HB3  . ALA A 1 1   ? -21.211 16.772  -7.361  1.00 0.00 ? 708 ALA A HB3  4  
ATOM 5609  N N    . PRO A 1 2   ? -23.365 13.975  -5.866  1.00 0.00 ? 709 PRO A N    4  
ATOM 5610  C CA   . PRO A 1 2   ? -22.948 12.854  -5.081  1.00 0.00 ? 709 PRO A CA   4  
ATOM 5611  C C    . PRO A 1 2   ? -21.913 12.058  -5.853  1.00 0.00 ? 709 PRO A C    4  
ATOM 5612  O O    . PRO A 1 2   ? -22.205 11.504  -6.923  1.00 0.00 ? 709 PRO A O    4  
ATOM 5613  C CB   . PRO A 1 2   ? -24.233 12.027  -4.888  1.00 0.00 ? 709 PRO A CB   4  
ATOM 5614  C CG   . PRO A 1 2   ? -25.259 12.612  -5.822  1.00 0.00 ? 709 PRO A CG   4  
ATOM 5615  C CD   . PRO A 1 2   ? -24.563 13.653  -6.659  1.00 0.00 ? 709 PRO A CD   4  
ATOM 5616  H HA   . PRO A 1 2   ? -22.543 13.154  -4.125  1.00 0.00 ? 709 PRO A HA   4  
ATOM 5617  H HB2  . PRO A 1 2   ? -24.031 10.993  -5.125  1.00 0.00 ? 709 PRO A HB2  4  
ATOM 5618  H HB3  . PRO A 1 2   ? -24.554 12.101  -3.859  1.00 0.00 ? 709 PRO A HB3  4  
ATOM 5619  H HG2  . PRO A 1 2   ? -25.657 11.837  -6.459  1.00 0.00 ? 709 PRO A HG2  4  
ATOM 5620  H HG3  . PRO A 1 2   ? -26.056 13.065  -5.250  1.00 0.00 ? 709 PRO A HG3  4  
ATOM 5621  H HD2  . PRO A 1 2   ? -24.299 13.251  -7.626  1.00 0.00 ? 709 PRO A HD2  4  
ATOM 5622  H HD3  . PRO A 1 2   ? -25.214 14.509  -6.756  1.00 0.00 ? 709 PRO A HD3  4  
ATOM 5623  N N    . LYS A 1 3   ? -20.715 12.043  -5.371  1.00 0.00 ? 710 LYS A N    4  
ATOM 5624  C CA   . LYS A 1 3   ? -19.663 11.327  -6.040  1.00 0.00 ? 710 LYS A CA   4  
ATOM 5625  C C    . LYS A 1 3   ? -19.667 9.895   -5.569  1.00 0.00 ? 710 LYS A C    4  
ATOM 5626  O O    . LYS A 1 3   ? -19.539 8.971   -6.369  1.00 0.00 ? 710 LYS A O    4  
ATOM 5627  C CB   . LYS A 1 3   ? -18.275 11.949  -5.795  1.00 0.00 ? 710 LYS A CB   4  
ATOM 5628  C CG   . LYS A 1 3   ? -18.090 13.400  -6.233  1.00 0.00 ? 710 LYS A CG   4  
ATOM 5629  C CD   . LYS A 1 3   ? -18.724 14.388  -5.258  1.00 0.00 ? 710 LYS A CD   4  
ATOM 5630  C CE   . LYS A 1 3   ? -18.462 15.816  -5.677  1.00 0.00 ? 710 LYS A CE   4  
ATOM 5631  N NZ   . LYS A 1 3   ? -17.018 16.127  -5.689  1.00 0.00 ? 710 LYS A NZ   4  
ATOM 5632  H H    . LYS A 1 3   ? -20.530 12.517  -4.532  1.00 0.00 ? 710 LYS A H    4  
ATOM 5633  H HA   . LYS A 1 3   ? -19.878 11.343  -7.098  1.00 0.00 ? 710 LYS A HA   4  
ATOM 5634  H HB2  . LYS A 1 3   ? -18.078 11.913  -4.735  1.00 0.00 ? 710 LYS A HB2  4  
ATOM 5635  H HB3  . LYS A 1 3   ? -17.540 11.340  -6.300  1.00 0.00 ? 710 LYS A HB3  4  
ATOM 5636  H HG2  . LYS A 1 3   ? -17.036 13.616  -6.314  1.00 0.00 ? 710 LYS A HG2  4  
ATOM 5637  H HG3  . LYS A 1 3   ? -18.550 13.523  -7.202  1.00 0.00 ? 710 LYS A HG3  4  
ATOM 5638  H HD2  . LYS A 1 3   ? -19.792 14.223  -5.230  1.00 0.00 ? 710 LYS A HD2  4  
ATOM 5639  H HD3  . LYS A 1 3   ? -18.308 14.225  -4.275  1.00 0.00 ? 710 LYS A HD3  4  
ATOM 5640  H HE2  . LYS A 1 3   ? -18.863 15.966  -6.667  1.00 0.00 ? 710 LYS A HE2  4  
ATOM 5641  H HE3  . LYS A 1 3   ? -18.960 16.479  -4.985  1.00 0.00 ? 710 LYS A HE3  4  
ATOM 5642  H HZ1  . LYS A 1 3   ? -16.860 17.068  -6.105  1.00 0.00 ? 710 LYS A HZ1  4  
ATOM 5643  H HZ2  . LYS A 1 3   ? -16.469 15.446  -6.249  1.00 0.00 ? 710 LYS A HZ2  4  
ATOM 5644  H HZ3  . LYS A 1 3   ? -16.626 16.159  -4.726  1.00 0.00 ? 710 LYS A HZ3  4  
ATOM 5645  N N    . ALA A 1 4   ? -19.809 9.736   -4.246  1.00 0.00 ? 711 ALA A N    4  
ATOM 5646  C CA   . ALA A 1 4   ? -19.856 8.440   -3.568  1.00 0.00 ? 711 ALA A CA   4  
ATOM 5647  C C    . ALA A 1 4   ? -18.568 7.643   -3.802  1.00 0.00 ? 711 ALA A C    4  
ATOM 5648  O O    . ALA A 1 4   ? -18.559 6.432   -3.653  1.00 0.00 ? 711 ALA A O    4  
ATOM 5649  C CB   . ALA A 1 4   ? -21.093 7.646   -4.015  1.00 0.00 ? 711 ALA A CB   4  
ATOM 5650  H H    . ALA A 1 4   ? -19.878 10.538  -3.684  1.00 0.00 ? 711 ALA A H    4  
ATOM 5651  H HA   . ALA A 1 4   ? -19.944 8.640   -2.510  1.00 0.00 ? 711 ALA A HA   4  
ATOM 5652  H HB1  . ALA A 1 4   ? -21.151 6.721   -3.462  1.00 0.00 ? 711 ALA A HB1  4  
ATOM 5653  H HB2  . ALA A 1 4   ? -21.014 7.427   -5.070  1.00 0.00 ? 711 ALA A HB2  4  
ATOM 5654  H HB3  . ALA A 1 4   ? -21.982 8.232   -3.836  1.00 0.00 ? 711 ALA A HB3  4  
ATOM 5655  N N    . SER A 1 5   ? -17.476 8.364   -4.064  1.00 0.00 ? 712 SER A N    4  
ATOM 5656  C CA   . SER A 1 5   ? -16.182 7.786   -4.430  1.00 0.00 ? 712 SER A CA   4  
ATOM 5657  C C    . SER A 1 5   ? -15.686 6.797   -3.368  1.00 0.00 ? 712 SER A C    4  
ATOM 5658  O O    . SER A 1 5   ? -15.127 5.766   -3.682  1.00 0.00 ? 712 SER A O    4  
ATOM 5659  C CB   . SER A 1 5   ? -15.168 8.908   -4.590  1.00 0.00 ? 712 SER A CB   4  
ATOM 5660  O OG   . SER A 1 5   ? -15.748 10.031  -5.252  1.00 0.00 ? 712 SER A OG   4  
ATOM 5661  H H    . SER A 1 5   ? -17.543 9.341   -4.005  1.00 0.00 ? 712 SER A H    4  
ATOM 5662  H HA   . SER A 1 5   ? -16.287 7.279   -5.378  1.00 0.00 ? 712 SER A HA   4  
ATOM 5663  H HB2  . SER A 1 5   ? -14.814 9.218   -3.619  1.00 0.00 ? 712 SER A HB2  4  
ATOM 5664  H HB3  . SER A 1 5   ? -14.333 8.555   -5.176  1.00 0.00 ? 712 SER A HB3  4  
ATOM 5665  H HG   . SER A 1 5   ? -15.664 10.779  -4.648  1.00 0.00 ? 712 SER A HG   4  
ATOM 5666  N N    . LEU A 1 6   ? -15.886 7.135   -2.117  1.00 0.00 ? 713 LEU A N    4  
ATOM 5667  C CA   . LEU A 1 6   ? -15.527 6.265   -1.026  1.00 0.00 ? 713 LEU A CA   4  
ATOM 5668  C C    . LEU A 1 6   ? -16.741 6.022   -0.177  1.00 0.00 ? 713 LEU A C    4  
ATOM 5669  O O    . LEU A 1 6   ? -17.743 6.725   -0.326  1.00 0.00 ? 713 LEU A O    4  
ATOM 5670  C CB   . LEU A 1 6   ? -14.338 6.797   -0.182  1.00 0.00 ? 713 LEU A CB   4  
ATOM 5671  C CG   . LEU A 1 6   ? -12.899 6.430   -0.648  1.00 0.00 ? 713 LEU A CG   4  
ATOM 5672  C CD1  . LEU A 1 6   ? -12.702 4.927   -0.663  1.00 0.00 ? 713 LEU A CD1  4  
ATOM 5673  C CD2  . LEU A 1 6   ? -12.546 7.024   -2.009  1.00 0.00 ? 713 LEU A CD2  4  
ATOM 5674  H H    . LEU A 1 6   ? -16.336 7.985   -1.921  1.00 0.00 ? 713 LEU A H    4  
ATOM 5675  H HA   . LEU A 1 6   ? -15.255 5.319   -1.470  1.00 0.00 ? 713 LEU A HA   4  
ATOM 5676  H HB2  . LEU A 1 6   ? -14.412 7.873   -0.160  1.00 0.00 ? 713 LEU A HB2  4  
ATOM 5677  H HB3  . LEU A 1 6   ? -14.464 6.434   0.828   1.00 0.00 ? 713 LEU A HB3  4  
ATOM 5678  H HG   . LEU A 1 6   ? -12.208 6.819   0.086   1.00 0.00 ? 713 LEU A HG   4  
ATOM 5679  H HD11 . LEU A 1 6   ? -13.382 4.475   -1.371  1.00 0.00 ? 713 LEU A HD11 4  
ATOM 5680  H HD12 . LEU A 1 6   ? -12.903 4.544   0.327   1.00 0.00 ? 713 LEU A HD12 4  
ATOM 5681  H HD13 . LEU A 1 6   ? -11.683 4.701   -0.938  1.00 0.00 ? 713 LEU A HD13 4  
ATOM 5682  H HD21 . LEU A 1 6   ? -11.567 6.680   -2.307  1.00 0.00 ? 713 LEU A HD21 4  
ATOM 5683  H HD22 . LEU A 1 6   ? -12.533 8.101   -1.950  1.00 0.00 ? 713 LEU A HD22 4  
ATOM 5684  H HD23 . LEU A 1 6   ? -13.277 6.707   -2.739  1.00 0.00 ? 713 LEU A HD23 4  
ATOM 5685  N N    . ARG A 1 7   ? -16.662 5.002   0.682   1.00 0.00 ? 714 ARG A N    4  
ATOM 5686  C CA   . ARG A 1 7   ? -17.757 4.564   1.570   1.00 0.00 ? 714 ARG A CA   4  
ATOM 5687  C C    . ARG A 1 7   ? -18.862 3.839   0.765   1.00 0.00 ? 714 ARG A C    4  
ATOM 5688  O O    . ARG A 1 7   ? -19.908 3.434   1.289   1.00 0.00 ? 714 ARG A O    4  
ATOM 5689  C CB   . ARG A 1 7   ? -18.270 5.734   2.444   1.00 0.00 ? 714 ARG A CB   4  
ATOM 5690  C CG   . ARG A 1 7   ? -19.288 5.365   3.506   1.00 0.00 ? 714 ARG A CG   4  
ATOM 5691  C CD   . ARG A 1 7   ? -19.455 6.499   4.490   1.00 0.00 ? 714 ARG A CD   4  
ATOM 5692  N NE   . ARG A 1 7   ? -18.197 6.749   5.221   1.00 0.00 ? 714 ARG A NE   4  
ATOM 5693  C CZ   . ARG A 1 7   ? -17.755 7.948   5.610   1.00 0.00 ? 714 ARG A CZ   4  
ATOM 5694  N NH1  . ARG A 1 7   ? -18.452 9.038   5.334   1.00 0.00 ? 714 ARG A NH1  4  
ATOM 5695  N NH2  . ARG A 1 7   ? -16.615 8.050   6.279   1.00 0.00 ? 714 ARG A NH2  4  
ATOM 5696  H H    . ARG A 1 7   ? -15.814 4.516   0.759   1.00 0.00 ? 714 ARG A H    4  
ATOM 5697  H HA   . ARG A 1 7   ? -17.318 3.808   2.206   1.00 0.00 ? 714 ARG A HA   4  
ATOM 5698  H HB2  . ARG A 1 7   ? -17.427 6.186   2.946   1.00 0.00 ? 714 ARG A HB2  4  
ATOM 5699  H HB3  . ARG A 1 7   ? -18.714 6.472   1.793   1.00 0.00 ? 714 ARG A HB3  4  
ATOM 5700  H HG2  . ARG A 1 7   ? -20.236 5.160   3.033   1.00 0.00 ? 714 ARG A HG2  4  
ATOM 5701  H HG3  . ARG A 1 7   ? -18.946 4.486   4.032   1.00 0.00 ? 714 ARG A HG3  4  
ATOM 5702  H HD2  . ARG A 1 7   ? -19.739 7.391   3.951   1.00 0.00 ? 714 ARG A HD2  4  
ATOM 5703  H HD3  . ARG A 1 7   ? -20.224 6.242   5.201   1.00 0.00 ? 714 ARG A HD3  4  
ATOM 5704  H HE   . ARG A 1 7   ? -17.679 5.935   5.421   1.00 0.00 ? 714 ARG A HE   4  
ATOM 5705  H HH11 . ARG A 1 7   ? -19.320 9.012   4.832   1.00 0.00 ? 714 ARG A HH11 4  
ATOM 5706  H HH12 . ARG A 1 7   ? -18.144 9.947   5.629   1.00 0.00 ? 714 ARG A HH12 4  
ATOM 5707  H HH21 . ARG A 1 7   ? -16.038 7.271   6.535   1.00 0.00 ? 714 ARG A HH21 4  
ATOM 5708  H HH22 . ARG A 1 7   ? -16.263 8.960   6.555   1.00 0.00 ? 714 ARG A HH22 4  
ATOM 5709  N N    . LEU A 1 8   ? -18.571 3.630   -0.499  1.00 0.00 ? 715 LEU A N    4  
ATOM 5710  C CA   . LEU A 1 8   ? -19.411 2.886   -1.407  1.00 0.00 ? 715 LEU A CA   4  
ATOM 5711  C C    . LEU A 1 8   ? -19.058 1.402   -1.193  1.00 0.00 ? 715 LEU A C    4  
ATOM 5712  O O    . LEU A 1 8   ? -18.222 1.097   -0.320  1.00 0.00 ? 715 LEU A O    4  
ATOM 5713  C CB   . LEU A 1 8   ? -19.111 3.406   -2.859  1.00 0.00 ? 715 LEU A CB   4  
ATOM 5714  C CG   . LEU A 1 8   ? -19.958 2.920   -4.078  1.00 0.00 ? 715 LEU A CG   4  
ATOM 5715  C CD1  . LEU A 1 8   ? -19.944 3.993   -5.149  1.00 0.00 ? 715 LEU A CD1  4  
ATOM 5716  C CD2  . LEU A 1 8   ? -19.382 1.651   -4.700  1.00 0.00 ? 715 LEU A CD2  4  
ATOM 5717  H H    . LEU A 1 8   ? -17.726 3.994   -0.833  1.00 0.00 ? 715 LEU A H    4  
ATOM 5718  H HA   . LEU A 1 8   ? -20.444 3.065   -1.147  1.00 0.00 ? 715 LEU A HA   4  
ATOM 5719  H HB2  . LEU A 1 8   ? -19.187 4.482   -2.838  1.00 0.00 ? 715 LEU A HB2  4  
ATOM 5720  H HB3  . LEU A 1 8   ? -18.077 3.166   -3.061  1.00 0.00 ? 715 LEU A HB3  4  
ATOM 5721  H HG   . LEU A 1 8   ? -20.979 2.739   -3.781  1.00 0.00 ? 715 LEU A HG   4  
ATOM 5722  H HD11 . LEU A 1 8   ? -18.924 4.189   -5.446  1.00 0.00 ? 715 LEU A HD11 4  
ATOM 5723  H HD12 . LEU A 1 8   ? -20.388 4.898   -4.761  1.00 0.00 ? 715 LEU A HD12 4  
ATOM 5724  H HD13 . LEU A 1 8   ? -20.508 3.657   -6.006  1.00 0.00 ? 715 LEU A HD13 4  
ATOM 5725  H HD21 . LEU A 1 8   ? -19.345 0.866   -3.958  1.00 0.00 ? 715 LEU A HD21 4  
ATOM 5726  H HD22 . LEU A 1 8   ? -18.382 1.847   -5.059  1.00 0.00 ? 715 LEU A HD22 4  
ATOM 5727  H HD23 . LEU A 1 8   ? -20.006 1.339   -5.523  1.00 0.00 ? 715 LEU A HD23 4  
ATOM 5728  N N    . GLY A 1 9   ? -19.699 0.509   -1.906  1.00 0.00 ? 716 GLY A N    4  
ATOM 5729  C CA   . GLY A 1 9   ? -19.413 -0.919  -1.827  1.00 0.00 ? 716 GLY A CA   4  
ATOM 5730  C C    . GLY A 1 9   ? -18.013 -1.301  -2.317  1.00 0.00 ? 716 GLY A C    4  
ATOM 5731  O O    . GLY A 1 9   ? -17.855 -1.922  -3.373  1.00 0.00 ? 716 GLY A O    4  
ATOM 5732  H H    . GLY A 1 9   ? -20.420 0.820   -2.493  1.00 0.00 ? 716 GLY A H    4  
ATOM 5733  H HA2  . GLY A 1 9   ? -19.515 -1.235  -0.801  1.00 0.00 ? 716 GLY A HA2  4  
ATOM 5734  H HA3  . GLY A 1 9   ? -20.144 -1.440  -2.427  1.00 0.00 ? 716 GLY A HA3  4  
ATOM 5735  N N    . PHE A 1 10  ? -17.021 -0.901  -1.563  1.00 0.00 ? 717 PHE A N    4  
ATOM 5736  C CA   . PHE A 1 10  ? -15.646 -1.236  -1.798  1.00 0.00 ? 717 PHE A CA   4  
ATOM 5737  C C    . PHE A 1 10  ? -15.091 -1.841  -0.522  1.00 0.00 ? 717 PHE A C    4  
ATOM 5738  O O    . PHE A 1 10  ? -14.216 -1.251  0.123   1.00 0.00 ? 717 PHE A O    4  
ATOM 5739  C CB   . PHE A 1 10  ? -14.778 -0.012  -2.133  1.00 0.00 ? 717 PHE A CB   4  
ATOM 5740  C CG   . PHE A 1 10  ? -15.155 0.821   -3.317  1.00 0.00 ? 717 PHE A CG   4  
ATOM 5741  C CD1  . PHE A 1 10  ? -14.963 0.362   -4.608  1.00 0.00 ? 717 PHE A CD1  4  
ATOM 5742  C CD2  . PHE A 1 10  ? -15.635 2.100   -3.133  1.00 0.00 ? 717 PHE A CD2  4  
ATOM 5743  C CE1  . PHE A 1 10  ? -15.248 1.169   -5.692  1.00 0.00 ? 717 PHE A CE1  4  
ATOM 5744  C CE2  . PHE A 1 10  ? -15.931 2.901   -4.206  1.00 0.00 ? 717 PHE A CE2  4  
ATOM 5745  C CZ   . PHE A 1 10  ? -15.736 2.443   -5.484  1.00 0.00 ? 717 PHE A CZ   4  
ATOM 5746  H H    . PHE A 1 10  ? -17.249 -0.335  -0.791  1.00 0.00 ? 717 PHE A H    4  
ATOM 5747  H HA   . PHE A 1 10  ? -15.590 -1.955  -2.599  1.00 0.00 ? 717 PHE A HA   4  
ATOM 5748  H HB2  . PHE A 1 10  ? -14.746 0.648   -1.279  1.00 0.00 ? 717 PHE A HB2  4  
ATOM 5749  H HB3  . PHE A 1 10  ? -13.783 -0.388  -2.305  1.00 0.00 ? 717 PHE A HB3  4  
ATOM 5750  H HD1  . PHE A 1 10  ? -14.584 -0.637  -4.765  1.00 0.00 ? 717 PHE A HD1  4  
ATOM 5751  H HD2  . PHE A 1 10  ? -15.793 2.469   -2.131  1.00 0.00 ? 717 PHE A HD2  4  
ATOM 5752  H HE1  . PHE A 1 10  ? -15.096 0.803   -6.696  1.00 0.00 ? 717 PHE A HE1  4  
ATOM 5753  H HE2  . PHE A 1 10  ? -16.310 3.900   -4.045  1.00 0.00 ? 717 PHE A HE2  4  
ATOM 5754  H HZ   . PHE A 1 10  ? -15.959 3.099   -6.311  1.00 0.00 ? 717 PHE A HZ   4  
ATOM 5755  N N    . SER A 1 11  ? -15.614 -2.970  -0.133  1.00 0.00 ? 718 SER A N    4  
ATOM 5756  C CA   . SER A 1 11  ? -15.188 -3.630  1.081   1.00 0.00 ? 718 SER A CA   4  
ATOM 5757  C C    . SER A 1 11  ? -13.724 -4.055  0.954   1.00 0.00 ? 718 SER A C    4  
ATOM 5758  O O    . SER A 1 11  ? -12.929 -3.889  1.898   1.00 0.00 ? 718 SER A O    4  
ATOM 5759  C CB   . SER A 1 11  ? -16.095 -4.839  1.381   1.00 0.00 ? 718 SER A CB   4  
ATOM 5760  O OG   . SER A 1 11  ? -15.770 -5.457  2.628   1.00 0.00 ? 718 SER A OG   4  
ATOM 5761  H H    . SER A 1 11  ? -16.307 -3.388  -0.688  1.00 0.00 ? 718 SER A H    4  
ATOM 5762  H HA   . SER A 1 11  ? -15.270 -2.918  1.889   1.00 0.00 ? 718 SER A HA   4  
ATOM 5763  H HB2  . SER A 1 11  ? -17.124 -4.513  1.415   1.00 0.00 ? 718 SER A HB2  4  
ATOM 5764  H HB3  . SER A 1 11  ? -15.973 -5.566  0.593   1.00 0.00 ? 718 SER A HB3  4  
ATOM 5765  H HG   . SER A 1 11  ? -15.290 -6.273  2.422   1.00 0.00 ? 718 SER A HG   4  
ATOM 5766  N N    . GLU A 1 12  ? -13.350 -4.511  -0.233  1.00 0.00 ? 719 GLU A N    4  
ATOM 5767  C CA   . GLU A 1 12  ? -12.001 -4.964  -0.471  1.00 0.00 ? 719 GLU A CA   4  
ATOM 5768  C C    . GLU A 1 12  ? -11.032 -3.799  -0.437  1.00 0.00 ? 719 GLU A C    4  
ATOM 5769  O O    . GLU A 1 12  ? -10.031 -3.857  0.269   1.00 0.00 ? 719 GLU A O    4  
ATOM 5770  C CB   . GLU A 1 12  ? -11.853 -5.823  -1.758  1.00 0.00 ? 719 GLU A CB   4  
ATOM 5771  C CG   . GLU A 1 12  ? -12.174 -5.140  -3.091  1.00 0.00 ? 719 GLU A CG   4  
ATOM 5772  C CD   . GLU A 1 12  ? -13.591 -4.689  -3.199  1.00 0.00 ? 719 GLU A CD   4  
ATOM 5773  O OE1  . GLU A 1 12  ? -14.471 -5.516  -3.480  1.00 0.00 ? 719 GLU A OE1  4  
ATOM 5774  O OE2  . GLU A 1 12  ? -13.863 -3.516  -2.953  1.00 0.00 ? 719 GLU A OE2  4  
ATOM 5775  H H    . GLU A 1 12  ? -14.000 -4.507  -0.970  1.00 0.00 ? 719 GLU A H    4  
ATOM 5776  H HA   . GLU A 1 12  ? -11.750 -5.577  0.382   1.00 0.00 ? 719 GLU A HA   4  
ATOM 5777  H HB2  . GLU A 1 12  ? -10.833 -6.174  -1.810  1.00 0.00 ? 719 GLU A HB2  4  
ATOM 5778  H HB3  . GLU A 1 12  ? -12.497 -6.684  -1.657  1.00 0.00 ? 719 GLU A HB3  4  
ATOM 5779  H HG2  . GLU A 1 12  ? -11.537 -4.274  -3.200  1.00 0.00 ? 719 GLU A HG2  4  
ATOM 5780  H HG3  . GLU A 1 12  ? -11.967 -5.834  -3.893  1.00 0.00 ? 719 GLU A HG3  4  
ATOM 5781  N N    . TYR A 1 13  ? -11.367 -2.710  -1.129  1.00 0.00 ? 720 TYR A N    4  
ATOM 5782  C CA   . TYR A 1 13  ? -10.508 -1.530  -1.112  1.00 0.00 ? 720 TYR A CA   4  
ATOM 5783  C C    . TYR A 1 13  ? -10.418 -0.946  0.279   1.00 0.00 ? 720 TYR A C    4  
ATOM 5784  O O    . TYR A 1 13  ? -9.380  -0.452  0.661   1.00 0.00 ? 720 TYR A O    4  
ATOM 5785  C CB   . TYR A 1 13  ? -10.951 -0.445  -2.090  1.00 0.00 ? 720 TYR A CB   4  
ATOM 5786  C CG   . TYR A 1 13  ? -10.774 -0.782  -3.551  1.00 0.00 ? 720 TYR A CG   4  
ATOM 5787  C CD1  . TYR A 1 13  ? -9.593  -0.468  -4.207  1.00 0.00 ? 720 TYR A CD1  4  
ATOM 5788  C CD2  . TYR A 1 13  ? -11.786 -1.381  -4.279  1.00 0.00 ? 720 TYR A CD2  4  
ATOM 5789  C CE1  . TYR A 1 13  ? -9.429  -0.740  -5.548  1.00 0.00 ? 720 TYR A CE1  4  
ATOM 5790  C CE2  . TYR A 1 13  ? -11.627 -1.663  -5.617  1.00 0.00 ? 720 TYR A CE2  4  
ATOM 5791  C CZ   . TYR A 1 13  ? -10.448 -1.338  -6.247  1.00 0.00 ? 720 TYR A CZ   4  
ATOM 5792  O OH   . TYR A 1 13  ? -10.297 -1.598  -7.586  1.00 0.00 ? 720 TYR A OH   4  
ATOM 5793  H H    . TYR A 1 13  ? -12.199 -2.721  -1.655  1.00 0.00 ? 720 TYR A H    4  
ATOM 5794  H HA   . TYR A 1 13  ? -9.520  -1.866  -1.388  1.00 0.00 ? 720 TYR A HA   4  
ATOM 5795  H HB2  . TYR A 1 13  ? -11.985 -0.207  -1.911  1.00 0.00 ? 720 TYR A HB2  4  
ATOM 5796  H HB3  . TYR A 1 13  ? -10.369 0.442   -1.887  1.00 0.00 ? 720 TYR A HB3  4  
ATOM 5797  H HD1  . TYR A 1 13  ? -8.791  -0.001  -3.654  1.00 0.00 ? 720 TYR A HD1  4  
ATOM 5798  H HD2  . TYR A 1 13  ? -12.712 -1.637  -3.785  1.00 0.00 ? 720 TYR A HD2  4  
ATOM 5799  H HE1  . TYR A 1 13  ? -8.503  -0.489  -6.043  1.00 0.00 ? 720 TYR A HE1  4  
ATOM 5800  H HE2  . TYR A 1 13  ? -12.425 -2.134  -6.169  1.00 0.00 ? 720 TYR A HE2  4  
ATOM 5801  H HH   . TYR A 1 13  ? -11.065 -1.211  -8.026  1.00 0.00 ? 720 TYR A HH   4  
ATOM 5802  N N    . SER A 1 14  ? -11.497 -1.033  1.039   1.00 0.00 ? 721 SER A N    4  
ATOM 5803  C CA   . SER A 1 14  ? -11.501 -0.533  2.393   1.00 0.00 ? 721 SER A CA   4  
ATOM 5804  C C    . SER A 1 14  ? -10.555 -1.329  3.286   1.00 0.00 ? 721 SER A C    4  
ATOM 5805  O O    . SER A 1 14  ? -9.843  -0.754  4.085   1.00 0.00 ? 721 SER A O    4  
ATOM 5806  C CB   . SER A 1 14  ? -12.908 -0.515  2.964   1.00 0.00 ? 721 SER A CB   4  
ATOM 5807  O OG   . SER A 1 14  ? -13.753 0.348   2.202   1.00 0.00 ? 721 SER A OG   4  
ATOM 5808  H H    . SER A 1 14  ? -12.318 -1.431  0.676   1.00 0.00 ? 721 SER A H    4  
ATOM 5809  H HA   . SER A 1 14  ? -11.137 0.483   2.348   1.00 0.00 ? 721 SER A HA   4  
ATOM 5810  H HB2  . SER A 1 14  ? -13.315 -1.515  2.947   1.00 0.00 ? 721 SER A HB2  4  
ATOM 5811  H HB3  . SER A 1 14  ? -12.866 -0.156  3.980   1.00 0.00 ? 721 SER A HB3  4  
ATOM 5812  H HG   . SER A 1 14  ? -13.999 -0.129  1.395   1.00 0.00 ? 721 SER A HG   4  
ATOM 5813  N N    . ARG A 1 15  ? -10.513 -2.651  3.114   1.00 0.00 ? 722 ARG A N    4  
ATOM 5814  C CA   . ARG A 1 15  ? -9.603  -3.476  3.910   1.00 0.00 ? 722 ARG A CA   4  
ATOM 5815  C C    . ARG A 1 15  ? -8.148  -3.223  3.557   1.00 0.00 ? 722 ARG A C    4  
ATOM 5816  O O    . ARG A 1 15  ? -7.278  -3.227  4.433   1.00 0.00 ? 722 ARG A O    4  
ATOM 5817  C CB   . ARG A 1 15  ? -9.958  -4.976  3.880   1.00 0.00 ? 722 ARG A CB   4  
ATOM 5818  C CG   . ARG A 1 15  ? -10.933 -5.383  4.981   1.00 0.00 ? 722 ARG A CG   4  
ATOM 5819  C CD   . ARG A 1 15  ? -12.264 -4.680  4.860   1.00 0.00 ? 722 ARG A CD   4  
ATOM 5820  N NE   . ARG A 1 15  ? -12.968 -4.628  6.135   1.00 0.00 ? 722 ARG A NE   4  
ATOM 5821  C CZ   . ARG A 1 15  ? -14.171 -4.085  6.313   1.00 0.00 ? 722 ARG A CZ   4  
ATOM 5822  N NH1  . ARG A 1 15  ? -14.966 -3.857  5.267   1.00 0.00 ? 722 ARG A NH1  4  
ATOM 5823  N NH2  . ARG A 1 15  ? -14.605 -3.832  7.537   1.00 0.00 ? 722 ARG A NH2  4  
ATOM 5824  H H    . ARG A 1 15  ? -11.104 -3.067  2.448   1.00 0.00 ? 722 ARG A H    4  
ATOM 5825  H HA   . ARG A 1 15  ? -9.722  -3.118  4.922   1.00 0.00 ? 722 ARG A HA   4  
ATOM 5826  H HB2  . ARG A 1 15  ? -10.403 -5.209  2.924   1.00 0.00 ? 722 ARG A HB2  4  
ATOM 5827  H HB3  . ARG A 1 15  ? -9.053  -5.553  3.999   1.00 0.00 ? 722 ARG A HB3  4  
ATOM 5828  H HG2  . ARG A 1 15  ? -11.099 -6.448  4.922   1.00 0.00 ? 722 ARG A HG2  4  
ATOM 5829  H HG3  . ARG A 1 15  ? -10.493 -5.143  5.937   1.00 0.00 ? 722 ARG A HG3  4  
ATOM 5830  H HD2  . ARG A 1 15  ? -12.094 -3.670  4.516   1.00 0.00 ? 722 ARG A HD2  4  
ATOM 5831  H HD3  . ARG A 1 15  ? -12.877 -5.207  4.142   1.00 0.00 ? 722 ARG A HD3  4  
ATOM 5832  H HE   . ARG A 1 15  ? -12.431 -4.934  6.905   1.00 0.00 ? 722 ARG A HE   4  
ATOM 5833  H HH11 . ARG A 1 15  ? -14.703 -4.083  4.328   1.00 0.00 ? 722 ARG A HH11 4  
ATOM 5834  H HH12 . ARG A 1 15  ? -15.873 -3.442  5.391   1.00 0.00 ? 722 ARG A HH12 4  
ATOM 5835  H HH21 . ARG A 1 15  ? -14.047 -4.041  8.346   1.00 0.00 ? 722 ARG A HH21 4  
ATOM 5836  H HH22 . ARG A 1 15  ? -15.502 -3.418  7.704   1.00 0.00 ? 722 ARG A HH22 4  
ATOM 5837  N N    . ILE A 1 16  ? -7.893  -2.966  2.296   1.00 0.00 ? 723 ILE A N    4  
ATOM 5838  C CA   . ILE A 1 16  ? -6.554  -2.621  1.854   1.00 0.00 ? 723 ILE A CA   4  
ATOM 5839  C C    . ILE A 1 16  ? -6.189  -1.196  2.322   1.00 0.00 ? 723 ILE A C    4  
ATOM 5840  O O    . ILE A 1 16  ? -5.080  -0.943  2.785   1.00 0.00 ? 723 ILE A O    4  
ATOM 5841  C CB   . ILE A 1 16  ? -6.387  -2.767  0.306   1.00 0.00 ? 723 ILE A CB   4  
ATOM 5842  C CG1  . ILE A 1 16  ? -6.148  -4.223  -0.128  1.00 0.00 ? 723 ILE A CG1  4  
ATOM 5843  C CG2  . ILE A 1 16  ? -5.277  -1.901  -0.222  1.00 0.00 ? 723 ILE A CG2  4  
ATOM 5844  C CD1  . ILE A 1 16  ? -7.282  -5.192  0.099   1.00 0.00 ? 723 ILE A CD1  4  
ATOM 5845  H H    . ILE A 1 16  ? -8.624  -3.022  1.642   1.00 0.00 ? 723 ILE A H    4  
ATOM 5846  H HA   . ILE A 1 16  ? -5.889  -3.317  2.346   1.00 0.00 ? 723 ILE A HA   4  
ATOM 5847  H HB   . ILE A 1 16  ? -7.307  -2.427  -0.148  1.00 0.00 ? 723 ILE A HB   4  
ATOM 5848  H HG12 . ILE A 1 16  ? -5.981  -4.183  -1.191  1.00 0.00 ? 723 ILE A HG12 4  
ATOM 5849  H HG13 . ILE A 1 16  ? -5.260  -4.603  0.355   1.00 0.00 ? 723 ILE A HG13 4  
ATOM 5850  H HG21 . ILE A 1 16  ? -5.497  -0.864  -0.017  1.00 0.00 ? 723 ILE A HG21 4  
ATOM 5851  H HG22 . ILE A 1 16  ? -5.195  -2.054  -1.287  1.00 0.00 ? 723 ILE A HG22 4  
ATOM 5852  H HG23 . ILE A 1 16  ? -4.348  -2.175  0.258   1.00 0.00 ? 723 ILE A HG23 4  
ATOM 5853  H HD11 . ILE A 1 16  ? -6.996  -6.172  -0.254  1.00 0.00 ? 723 ILE A HD11 4  
ATOM 5854  H HD12 . ILE A 1 16  ? -8.158  -4.858  -0.435  1.00 0.00 ? 723 ILE A HD12 4  
ATOM 5855  H HD13 . ILE A 1 16  ? -7.505  -5.242  1.154   1.00 0.00 ? 723 ILE A HD13 4  
ATOM 5856  N N    . SER A 1 17  ? -7.133  -0.288  2.197   1.00 0.00 ? 724 SER A N    4  
ATOM 5857  C CA   . SER A 1 17  ? -6.974  1.086   2.679   1.00 0.00 ? 724 SER A CA   4  
ATOM 5858  C C    . SER A 1 17  ? -6.701  1.070   4.185   1.00 0.00 ? 724 SER A C    4  
ATOM 5859  O O    . SER A 1 17  ? -5.871  1.841   4.689   1.00 0.00 ? 724 SER A O    4  
ATOM 5860  C CB   . SER A 1 17  ? -8.238  1.916   2.366   1.00 0.00 ? 724 SER A CB   4  
ATOM 5861  O OG   . SER A 1 17  ? -8.135  3.258   2.832   1.00 0.00 ? 724 SER A OG   4  
ATOM 5862  H H    . SER A 1 17  ? -7.954  -0.552  1.723   1.00 0.00 ? 724 SER A H    4  
ATOM 5863  H HA   . SER A 1 17  ? -6.124  1.521   2.175   1.00 0.00 ? 724 SER A HA   4  
ATOM 5864  H HB2  . SER A 1 17  ? -8.394  1.937   1.298   1.00 0.00 ? 724 SER A HB2  4  
ATOM 5865  H HB3  . SER A 1 17  ? -9.088  1.446   2.839   1.00 0.00 ? 724 SER A HB3  4  
ATOM 5866  H HG   . SER A 1 17  ? -7.204  3.479   2.939   1.00 0.00 ? 724 SER A HG   4  
ATOM 5867  N N    . ASN A 1 18  ? -7.388  0.172   4.877   1.00 0.00 ? 725 ASN A N    4  
ATOM 5868  C CA   . ASN A 1 18  ? -7.213  -0.043  6.300   1.00 0.00 ? 725 ASN A CA   4  
ATOM 5869  C C    . ASN A 1 18  ? -5.783  -0.474  6.569   1.00 0.00 ? 725 ASN A C    4  
ATOM 5870  O O    . ASN A 1 18  ? -5.147  0.021   7.485   1.00 0.00 ? 725 ASN A O    4  
ATOM 5871  C CB   . ASN A 1 18  ? -8.175  -1.116  6.789   1.00 0.00 ? 725 ASN A CB   4  
ATOM 5872  C CG   . ASN A 1 18  ? -8.160  -1.282  8.284   1.00 0.00 ? 725 ASN A CG   4  
ATOM 5873  O OD1  . ASN A 1 18  ? -7.932  -0.332  9.022   1.00 0.00 ? 725 ASN A OD1  4  
ATOM 5874  N ND2  . ASN A 1 18  ? -8.394  -2.482  8.746   1.00 0.00 ? 725 ASN A ND2  4  
ATOM 5875  H H    . ASN A 1 18  ? -8.077  -0.357  4.415   1.00 0.00 ? 725 ASN A H    4  
ATOM 5876  H HA   . ASN A 1 18  ? -7.421  0.884   6.813   1.00 0.00 ? 725 ASN A HA   4  
ATOM 5877  H HB2  . ASN A 1 18  ? -9.178  -0.863  6.479   1.00 0.00 ? 725 ASN A HB2  4  
ATOM 5878  H HB3  . ASN A 1 18  ? -7.878  -2.051  6.338   1.00 0.00 ? 725 ASN A HB3  4  
ATOM 5879  H HD21 . ASN A 1 18  ? -8.567  -3.214  8.112   1.00 0.00 ? 725 ASN A HD21 4  
ATOM 5880  H HD22 . ASN A 1 18  ? -8.396  -2.608  9.718   1.00 0.00 ? 725 ASN A HD22 4  
ATOM 5881  N N    . LEU A 1 19  ? -5.271  -1.381  5.729   1.00 0.00 ? 726 LEU A N    4  
ATOM 5882  C CA   . LEU A 1 19  ? -3.884  -1.805  5.798   1.00 0.00 ? 726 LEU A CA   4  
ATOM 5883  C C    . LEU A 1 19  ? -2.952  -0.617  5.699   1.00 0.00 ? 726 LEU A C    4  
ATOM 5884  O O    . LEU A 1 19  ? -2.032  -0.516  6.459   1.00 0.00 ? 726 LEU A O    4  
ATOM 5885  C CB   . LEU A 1 19  ? -3.557  -2.888  4.721   1.00 0.00 ? 726 LEU A CB   4  
ATOM 5886  C CG   . LEU A 1 19  ? -2.064  -3.049  4.295   1.00 0.00 ? 726 LEU A CG   4  
ATOM 5887  C CD1  . LEU A 1 19  ? -1.805  -4.427  3.793   1.00 0.00 ? 726 LEU A CD1  4  
ATOM 5888  C CD2  . LEU A 1 19  ? -1.724  -2.085  3.169   1.00 0.00 ? 726 LEU A CD2  4  
ATOM 5889  H H    . LEU A 1 19  ? -5.846  -1.776  5.039   1.00 0.00 ? 726 LEU A H    4  
ATOM 5890  H HA   . LEU A 1 19  ? -3.744  -2.242  6.775   1.00 0.00 ? 726 LEU A HA   4  
ATOM 5891  H HB2  . LEU A 1 19  ? -3.899  -3.843  5.093   1.00 0.00 ? 726 LEU A HB2  4  
ATOM 5892  H HB3  . LEU A 1 19  ? -4.132  -2.651  3.838   1.00 0.00 ? 726 LEU A HB3  4  
ATOM 5893  H HG   . LEU A 1 19  ? -1.407  -2.841  5.126   1.00 0.00 ? 726 LEU A HG   4  
ATOM 5894  H HD11 . LEU A 1 19  ? -2.437  -4.624  2.939   1.00 0.00 ? 726 LEU A HD11 4  
ATOM 5895  H HD12 . LEU A 1 19  ? -2.026  -5.138  4.575   1.00 0.00 ? 726 LEU A HD12 4  
ATOM 5896  H HD13 . LEU A 1 19  ? -0.769  -4.518  3.501   1.00 0.00 ? 726 LEU A HD13 4  
ATOM 5897  H HD21 . LEU A 1 19  ? -0.699  -2.222  2.862   1.00 0.00 ? 726 LEU A HD21 4  
ATOM 5898  H HD22 . LEU A 1 19  ? -1.869  -1.075  3.519   1.00 0.00 ? 726 LEU A HD22 4  
ATOM 5899  H HD23 . LEU A 1 19  ? -2.384  -2.268  2.334   1.00 0.00 ? 726 LEU A HD23 4  
ATOM 5900  N N    . ILE A 1 20  ? -3.234  0.284   4.777   1.00 0.00 ? 727 ILE A N    4  
ATOM 5901  C CA   . ILE A 1 20  ? -2.402  1.451   4.557   1.00 0.00 ? 727 ILE A CA   4  
ATOM 5902  C C    . ILE A 1 20  ? -2.339  2.338   5.774   1.00 0.00 ? 727 ILE A C    4  
ATOM 5903  O O    . ILE A 1 20  ? -1.237  2.705   6.229   1.00 0.00 ? 727 ILE A O    4  
ATOM 5904  C CB   . ILE A 1 20  ? -2.817  2.240   3.272   1.00 0.00 ? 727 ILE A CB   4  
ATOM 5905  C CG1  . ILE A 1 20  ? -2.317  1.510   2.019   1.00 0.00 ? 727 ILE A CG1  4  
ATOM 5906  C CG2  . ILE A 1 20  ? -2.330  3.692   3.287   1.00 0.00 ? 727 ILE A CG2  4  
ATOM 5907  C CD1  . ILE A 1 20  ? -0.797  1.388   1.959   1.00 0.00 ? 727 ILE A CD1  4  
ATOM 5908  H H    . ILE A 1 20  ? -4.040  0.145   4.236   1.00 0.00 ? 727 ILE A H    4  
ATOM 5909  H HA   . ILE A 1 20  ? -1.401  1.076   4.410   1.00 0.00 ? 727 ILE A HA   4  
ATOM 5910  H HB   . ILE A 1 20  ? -3.896  2.261   3.240   1.00 0.00 ? 727 ILE A HB   4  
ATOM 5911  H HG12 . ILE A 1 20  ? -2.732  0.513   1.999   1.00 0.00 ? 727 ILE A HG12 4  
ATOM 5912  H HG13 . ILE A 1 20  ? -2.643  2.049   1.142   1.00 0.00 ? 727 ILE A HG13 4  
ATOM 5913  H HG21 . ILE A 1 20  ? -2.753  4.191   4.146   1.00 0.00 ? 727 ILE A HG21 4  
ATOM 5914  H HG22 . ILE A 1 20  ? -2.646  4.186   2.381   1.00 0.00 ? 727 ILE A HG22 4  
ATOM 5915  H HG23 . ILE A 1 20  ? -1.252  3.704   3.352   1.00 0.00 ? 727 ILE A HG23 4  
ATOM 5916  H HD11 . ILE A 1 20  ? -0.374  2.382   2.003   1.00 0.00 ? 727 ILE A HD11 4  
ATOM 5917  H HD12 . ILE A 1 20  ? -0.499  0.902   1.043   1.00 0.00 ? 727 ILE A HD12 4  
ATOM 5918  H HD13 . ILE A 1 20  ? -0.436  0.818   2.804   1.00 0.00 ? 727 ILE A HD13 4  
ATOM 5919  N N    . VAL A 1 21  ? -3.485  2.642   6.332   1.00 0.00 ? 728 VAL A N    4  
ATOM 5920  C CA   . VAL A 1 21  ? -3.509  3.495   7.481   1.00 0.00 ? 728 VAL A CA   4  
ATOM 5921  C C    . VAL A 1 21  ? -2.905  2.794   8.701   1.00 0.00 ? 728 VAL A C    4  
ATOM 5922  O O    . VAL A 1 21  ? -2.077  3.380   9.390   1.00 0.00 ? 728 VAL A O    4  
ATOM 5923  C CB   . VAL A 1 21  ? -4.909  4.123   7.780   1.00 0.00 ? 728 VAL A CB   4  
ATOM 5924  C CG1  . VAL A 1 21  ? -5.356  4.993   6.615   1.00 0.00 ? 728 VAL A CG1  4  
ATOM 5925  C CG2  . VAL A 1 21  ? -5.965  3.068   8.081   1.00 0.00 ? 728 VAL A CG2  4  
ATOM 5926  H H    . VAL A 1 21  ? -4.317  2.283   5.953   1.00 0.00 ? 728 VAL A H    4  
ATOM 5927  H HA   . VAL A 1 21  ? -2.824  4.288   7.220   1.00 0.00 ? 728 VAL A HA   4  
ATOM 5928  H HB   . VAL A 1 21  ? -4.798  4.764   8.642   1.00 0.00 ? 728 VAL A HB   4  
ATOM 5929  H HG11 . VAL A 1 21  ? -6.323  5.420   6.837   1.00 0.00 ? 728 VAL A HG11 4  
ATOM 5930  H HG12 . VAL A 1 21  ? -5.428  4.389   5.722   1.00 0.00 ? 728 VAL A HG12 4  
ATOM 5931  H HG13 . VAL A 1 21  ? -4.641  5.786   6.455   1.00 0.00 ? 728 VAL A HG13 4  
ATOM 5932  H HG21 . VAL A 1 21  ? -6.916  3.545   8.263   1.00 0.00 ? 728 VAL A HG21 4  
ATOM 5933  H HG22 . VAL A 1 21  ? -5.667  2.499   8.949   1.00 0.00 ? 728 VAL A HG22 4  
ATOM 5934  H HG23 . VAL A 1 21  ? -6.048  2.405   7.234   1.00 0.00 ? 728 VAL A HG23 4  
ATOM 5935  N N    . LEU A 1 22  ? -3.263  1.510   8.908   1.00 0.00 ? 729 LEU A N    4  
ATOM 5936  C CA   . LEU A 1 22  ? -2.723  0.708   10.013  1.00 0.00 ? 729 LEU A CA   4  
ATOM 5937  C C    . LEU A 1 22  ? -1.230  0.554   9.919   1.00 0.00 ? 729 LEU A C    4  
ATOM 5938  O O    . LEU A 1 22  ? -0.532  0.744   10.904  1.00 0.00 ? 729 LEU A O    4  
ATOM 5939  C CB   . LEU A 1 22  ? -3.352  -0.672  10.057  1.00 0.00 ? 729 LEU A CB   4  
ATOM 5940  C CG   . LEU A 1 22  ? -4.790  -0.746  10.524  1.00 0.00 ? 729 LEU A CG   4  
ATOM 5941  C CD1  . LEU A 1 22  ? -5.322  -2.128  10.249  1.00 0.00 ? 729 LEU A CD1  4  
ATOM 5942  C CD2  . LEU A 1 22  ? -4.883  -0.446  12.015  1.00 0.00 ? 729 LEU A CD2  4  
ATOM 5943  H H    . LEU A 1 22  ? -3.917  1.084   8.304   1.00 0.00 ? 729 LEU A H    4  
ATOM 5944  H HA   . LEU A 1 22  ? -2.963  1.215   10.935  1.00 0.00 ? 729 LEU A HA   4  
ATOM 5945  H HB2  . LEU A 1 22  ? -3.304  -1.089  9.062   1.00 0.00 ? 729 LEU A HB2  4  
ATOM 5946  H HB3  . LEU A 1 22  ? -2.755  -1.291  10.711  1.00 0.00 ? 729 LEU A HB3  4  
ATOM 5947  H HG   . LEU A 1 22  ? -5.372  -0.008  9.991   1.00 0.00 ? 729 LEU A HG   4  
ATOM 5948  H HD11 . LEU A 1 22  ? -5.262  -2.306  9.184   1.00 0.00 ? 729 LEU A HD11 4  
ATOM 5949  H HD12 . LEU A 1 22  ? -6.351  -2.188  10.573  1.00 0.00 ? 729 LEU A HD12 4  
ATOM 5950  H HD13 . LEU A 1 22  ? -4.725  -2.860  10.772  1.00 0.00 ? 729 LEU A HD13 4  
ATOM 5951  H HD21 . LEU A 1 22  ? -5.914  -0.517  12.329  1.00 0.00 ? 729 LEU A HD21 4  
ATOM 5952  H HD22 . LEU A 1 22  ? -4.520  0.550   12.210  1.00 0.00 ? 729 LEU A HD22 4  
ATOM 5953  H HD23 . LEU A 1 22  ? -4.292  -1.160  12.568  1.00 0.00 ? 729 LEU A HD23 4  
ATOM 5954  N N    . HIS A 1 23  ? -0.754  0.226   8.729   1.00 0.00 ? 730 HIS A N    4  
ATOM 5955  C CA   . HIS A 1 23  ? 0.658   0.032   8.469   1.00 0.00 ? 730 HIS A CA   4  
ATOM 5956  C C    . HIS A 1 23  ? 1.427   1.248   8.872   1.00 0.00 ? 730 HIS A C    4  
ATOM 5957  O O    . HIS A 1 23  ? 2.304   1.167   9.714   1.00 0.00 ? 730 HIS A O    4  
ATOM 5958  C CB   . HIS A 1 23  ? 0.915   -0.284  6.977   1.00 0.00 ? 730 HIS A CB   4  
ATOM 5959  C CG   . HIS A 1 23  ? 2.367   -0.421  6.592   1.00 0.00 ? 730 HIS A CG   4  
ATOM 5960  N ND1  . HIS A 1 23  ? 3.060   0.525   5.860   1.00 0.00 ? 730 HIS A ND1  4  
ATOM 5961  C CD2  . HIS A 1 23  ? 3.246   -1.420  6.829   1.00 0.00 ? 730 HIS A CD2  4  
ATOM 5962  C CE1  . HIS A 1 23  ? 4.303   0.078   5.679   1.00 0.00 ? 730 HIS A CE1  4  
ATOM 5963  N NE2  . HIS A 1 23  ? 4.471   -1.100  6.246   1.00 0.00 ? 730 HIS A NE2  4  
ATOM 5964  H H    . HIS A 1 23  ? -1.383  0.103   7.984   1.00 0.00 ? 730 HIS A H    4  
ATOM 5965  H HA   . HIS A 1 23  ? 0.989   -0.806  9.061   1.00 0.00 ? 730 HIS A HA   4  
ATOM 5966  H HB2  . HIS A 1 23  ? 0.422   -1.212  6.724   1.00 0.00 ? 730 HIS A HB2  4  
ATOM 5967  H HB3  . HIS A 1 23  ? 0.485   0.506   6.379   1.00 0.00 ? 730 HIS A HB3  4  
ATOM 5968  H HD1  . HIS A 1 23  ? 2.709   1.378   5.531   1.00 0.00 ? 730 HIS A HD1  4  
ATOM 5969  H HD2  . HIS A 1 23  ? 3.042   -2.328  7.377   1.00 0.00 ? 730 HIS A HD2  4  
ATOM 5970  H HE1  . HIS A 1 23  ? 5.071   0.613   5.141   1.00 0.00 ? 730 HIS A HE1  4  
ATOM 5971  N N    . LEU A 1 24  ? 1.062   2.383   8.308   1.00 0.00 ? 731 LEU A N    4  
ATOM 5972  C CA   . LEU A 1 24  ? 1.777   3.599   8.592   1.00 0.00 ? 731 LEU A CA   4  
ATOM 5973  C C    . LEU A 1 24  ? 1.714   3.979   10.070  1.00 0.00 ? 731 LEU A C    4  
ATOM 5974  O O    . LEU A 1 24  ? 2.753   4.240   10.682  1.00 0.00 ? 731 LEU A O    4  
ATOM 5975  C CB   . LEU A 1 24  ? 1.308   4.744   7.721   1.00 0.00 ? 731 LEU A CB   4  
ATOM 5976  C CG   . LEU A 1 24  ? 2.061   6.054   7.920   1.00 0.00 ? 731 LEU A CG   4  
ATOM 5977  C CD1  . LEU A 1 24  ? 3.548   5.874   7.632   1.00 0.00 ? 731 LEU A CD1  4  
ATOM 5978  C CD2  . LEU A 1 24  ? 1.475   7.116   7.045   1.00 0.00 ? 731 LEU A CD2  4  
ATOM 5979  H H    . LEU A 1 24  ? 0.300   2.388   7.682   1.00 0.00 ? 731 LEU A H    4  
ATOM 5980  H HA   . LEU A 1 24  ? 2.809   3.396   8.351   1.00 0.00 ? 731 LEU A HA   4  
ATOM 5981  H HB2  . LEU A 1 24  ? 1.403   4.444   6.687   1.00 0.00 ? 731 LEU A HB2  4  
ATOM 5982  H HB3  . LEU A 1 24  ? 0.264   4.923   7.933   1.00 0.00 ? 731 LEU A HB3  4  
ATOM 5983  H HG   . LEU A 1 24  ? 1.961   6.365   8.949   1.00 0.00 ? 731 LEU A HG   4  
ATOM 5984  H HD11 . LEU A 1 24  ? 3.684   5.532   6.617   1.00 0.00 ? 731 LEU A HD11 4  
ATOM 5985  H HD12 . LEU A 1 24  ? 3.950   5.142   8.318   1.00 0.00 ? 731 LEU A HD12 4  
ATOM 5986  H HD13 . LEU A 1 24  ? 4.058   6.817   7.770   1.00 0.00 ? 731 LEU A HD13 4  
ATOM 5987  H HD21 . LEU A 1 24  ? 2.006   8.043   7.201   1.00 0.00 ? 731 LEU A HD21 4  
ATOM 5988  H HD22 . LEU A 1 24  ? 0.435   7.235   7.308   1.00 0.00 ? 731 LEU A HD22 4  
ATOM 5989  H HD23 . LEU A 1 24  ? 1.554   6.818   6.010   1.00 0.00 ? 731 LEU A HD23 4  
ATOM 5990  N N    . ARG A 1 25  ? 0.518   3.967   10.650  1.00 0.00 ? 732 ARG A N    4  
ATOM 5991  C CA   . ARG A 1 25  ? 0.363   4.344   12.055  1.00 0.00 ? 732 ARG A CA   4  
ATOM 5992  C C    . ARG A 1 25  ? 1.133   3.420   12.983  1.00 0.00 ? 732 ARG A C    4  
ATOM 5993  O O    . ARG A 1 25  ? 1.691   3.869   13.985  1.00 0.00 ? 732 ARG A O    4  
ATOM 5994  C CB   . ARG A 1 25  ? -1.110  4.459   12.496  1.00 0.00 ? 732 ARG A CB   4  
ATOM 5995  C CG   . ARG A 1 25  ? -1.928  3.186   12.366  1.00 0.00 ? 732 ARG A CG   4  
ATOM 5996  C CD   . ARG A 1 25  ? -3.311  3.339   12.970  1.00 0.00 ? 732 ARG A CD   4  
ATOM 5997  N NE   . ARG A 1 25  ? -3.246  3.389   14.430  1.00 0.00 ? 732 ARG A NE   4  
ATOM 5998  C CZ   . ARG A 1 25  ? -3.402  4.486   15.187  1.00 0.00 ? 732 ARG A CZ   4  
ATOM 5999  N NH1  . ARG A 1 25  ? -3.710  5.657   14.633  1.00 0.00 ? 732 ARG A NH1  4  
ATOM 6000  N NH2  . ARG A 1 25  ? -3.264  4.399   16.503  1.00 0.00 ? 732 ARG A NH2  4  
ATOM 6001  H H    . ARG A 1 25  ? -0.266  3.707   10.118  1.00 0.00 ? 732 ARG A H    4  
ATOM 6002  H HA   . ARG A 1 25  ? 0.825   5.315   12.147  1.00 0.00 ? 732 ARG A HA   4  
ATOM 6003  H HB2  . ARG A 1 25  ? -1.152  4.768   13.529  1.00 0.00 ? 732 ARG A HB2  4  
ATOM 6004  H HB3  . ARG A 1 25  ? -1.583  5.224   11.897  1.00 0.00 ? 732 ARG A HB3  4  
ATOM 6005  H HG2  . ARG A 1 25  ? -2.024  2.959   11.314  1.00 0.00 ? 732 ARG A HG2  4  
ATOM 6006  H HG3  . ARG A 1 25  ? -1.404  2.382   12.862  1.00 0.00 ? 732 ARG A HG3  4  
ATOM 6007  H HD2  . ARG A 1 25  ? -3.737  4.261   12.606  1.00 0.00 ? 732 ARG A HD2  4  
ATOM 6008  H HD3  . ARG A 1 25  ? -3.928  2.506   12.662  1.00 0.00 ? 732 ARG A HD3  4  
ATOM 6009  H HE   . ARG A 1 25  ? -3.055  2.522   14.857  1.00 0.00 ? 732 ARG A HE   4  
ATOM 6010  H HH11 . ARG A 1 25  ? -3.854  5.796   13.650  1.00 0.00 ? 732 ARG A HH11 4  
ATOM 6011  H HH12 . ARG A 1 25  ? -3.804  6.491   15.184  1.00 0.00 ? 732 ARG A HH12 4  
ATOM 6012  H HH21 . ARG A 1 25  ? -3.052  3.540   16.977  1.00 0.00 ? 732 ARG A HH21 4  
ATOM 6013  H HH22 . ARG A 1 25  ? -3.362  5.199   17.100  1.00 0.00 ? 732 ARG A HH22 4  
ATOM 6014  N N    . LYS A 1 26  ? 1.170   2.145   12.655  1.00 0.00 ? 733 LYS A N    4  
ATOM 6015  C CA   . LYS A 1 26  ? 1.889   1.195   13.454  1.00 0.00 ? 733 LYS A CA   4  
ATOM 6016  C C    . LYS A 1 26  ? 3.383   1.367   13.294  1.00 0.00 ? 733 LYS A C    4  
ATOM 6017  O O    . LYS A 1 26  ? 4.117   1.425   14.292  1.00 0.00 ? 733 LYS A O    4  
ATOM 6018  C CB   . LYS A 1 26  ? 1.483   -0.246  13.130  1.00 0.00 ? 733 LYS A CB   4  
ATOM 6019  C CG   . LYS A 1 26  ? 2.262   -1.284  13.920  1.00 0.00 ? 733 LYS A CG   4  
ATOM 6020  C CD   . LYS A 1 26  ? 1.823   -2.689  13.597  1.00 0.00 ? 733 LYS A CD   4  
ATOM 6021  C CE   . LYS A 1 26  ? 2.634   -3.689  14.391  1.00 0.00 ? 733 LYS A CE   4  
ATOM 6022  N NZ   . LYS A 1 26  ? 2.213   -5.077  14.136  1.00 0.00 ? 733 LYS A NZ   4  
ATOM 6023  H H    . LYS A 1 26  ? 0.697   1.829   11.851  1.00 0.00 ? 733 LYS A H    4  
ATOM 6024  H HA   . LYS A 1 26  ? 1.644   1.396   14.485  1.00 0.00 ? 733 LYS A HA   4  
ATOM 6025  H HB2  . LYS A 1 26  ? 0.431   -0.370  13.343  1.00 0.00 ? 733 LYS A HB2  4  
ATOM 6026  H HB3  . LYS A 1 26  ? 1.651   -0.425  12.078  1.00 0.00 ? 733 LYS A HB3  4  
ATOM 6027  H HG2  . LYS A 1 26  ? 3.311   -1.189  13.680  1.00 0.00 ? 733 LYS A HG2  4  
ATOM 6028  H HG3  . LYS A 1 26  ? 2.124   -1.103  14.976  1.00 0.00 ? 733 LYS A HG3  4  
ATOM 6029  H HD2  . LYS A 1 26  ? 0.778   -2.800  13.843  1.00 0.00 ? 733 LYS A HD2  4  
ATOM 6030  H HD3  . LYS A 1 26  ? 1.970   -2.874  12.544  1.00 0.00 ? 733 LYS A HD3  4  
ATOM 6031  H HE2  . LYS A 1 26  ? 3.675   -3.580  14.129  1.00 0.00 ? 733 LYS A HE2  4  
ATOM 6032  H HE3  . LYS A 1 26  ? 2.505   -3.465  15.438  1.00 0.00 ? 733 LYS A HE3  4  
ATOM 6033  H HZ1  . LYS A 1 26  ? 1.215   -5.189  14.412  1.00 0.00 ? 733 LYS A HZ1  4  
ATOM 6034  H HZ2  . LYS A 1 26  ? 2.798   -5.740  14.681  1.00 0.00 ? 733 LYS A HZ2  4  
ATOM 6035  H HZ3  . LYS A 1 26  ? 2.299   -5.306  13.126  1.00 0.00 ? 733 LYS A HZ3  4  
ATOM 6036  N N    . VAL A 1 27  ? 3.843   1.493   12.060  1.00 0.00 ? 734 VAL A N    4  
ATOM 6037  C CA   . VAL A 1 27  ? 5.258   1.531   11.833  1.00 0.00 ? 734 VAL A CA   4  
ATOM 6038  C C    . VAL A 1 27  ? 5.908   2.779   12.391  1.00 0.00 ? 734 VAL A C    4  
ATOM 6039  O O    . VAL A 1 27  ? 6.855   2.660   13.119  1.00 0.00 ? 734 VAL A O    4  
ATOM 6040  C CB   . VAL A 1 27  ? 5.707   1.254   10.366  1.00 0.00 ? 734 VAL A CB   4  
ATOM 6041  C CG1  . VAL A 1 27  ? 5.279   -0.129  9.914   1.00 0.00 ? 734 VAL A CG1  4  
ATOM 6042  C CG2  . VAL A 1 27  ? 5.182   2.299   9.412   1.00 0.00 ? 734 VAL A CG2  4  
ATOM 6043  H H    . VAL A 1 27  ? 3.230   1.568   11.291  1.00 0.00 ? 734 VAL A H    4  
ATOM 6044  H HA   . VAL A 1 27  ? 5.623   0.723   12.451  1.00 0.00 ? 734 VAL A HA   4  
ATOM 6045  H HB   . VAL A 1 27  ? 6.787   1.287   10.349  1.00 0.00 ? 734 VAL A HB   4  
ATOM 6046  H HG11 . VAL A 1 27  ? 5.602   -0.293  8.896   1.00 0.00 ? 734 VAL A HG11 4  
ATOM 6047  H HG12 . VAL A 1 27  ? 4.202   -0.201  9.963   1.00 0.00 ? 734 VAL A HG12 4  
ATOM 6048  H HG13 . VAL A 1 27  ? 5.720   -0.876  10.557  1.00 0.00 ? 734 VAL A HG13 4  
ATOM 6049  H HG21 . VAL A 1 27  ? 5.503   3.273   9.748   1.00 0.00 ? 734 VAL A HG21 4  
ATOM 6050  H HG22 . VAL A 1 27  ? 4.104   2.245   9.424   1.00 0.00 ? 734 VAL A HG22 4  
ATOM 6051  H HG23 . VAL A 1 27  ? 5.554   2.104   8.418   1.00 0.00 ? 734 VAL A HG23 4  
ATOM 6052  N N    . GLU A 1 28  ? 5.349   3.963   12.142  1.00 0.00 ? 735 GLU A N    4  
ATOM 6053  C CA   . GLU A 1 28  ? 6.006   5.178   12.621  1.00 0.00 ? 735 GLU A CA   4  
ATOM 6054  C C    . GLU A 1 28  ? 5.946   5.318   14.136  1.00 0.00 ? 735 GLU A C    4  
ATOM 6055  O O    . GLU A 1 28  ? 6.865   5.880   14.750  1.00 0.00 ? 735 GLU A O    4  
ATOM 6056  C CB   . GLU A 1 28  ? 5.505   6.463   11.928  1.00 0.00 ? 735 GLU A CB   4  
ATOM 6057  C CG   . GLU A 1 28  ? 4.014   6.737   12.027  1.00 0.00 ? 735 GLU A CG   4  
ATOM 6058  C CD   . GLU A 1 28  ? 3.652   8.113   11.512  1.00 0.00 ? 735 GLU A CD   4  
ATOM 6059  O OE1  . GLU A 1 28  ? 4.188   8.540   10.465  1.00 0.00 ? 735 GLU A OE1  4  
ATOM 6060  O OE2  . GLU A 1 28  ? 2.870   8.831   12.194  1.00 0.00 ? 735 GLU A OE2  4  
ATOM 6061  H H    . GLU A 1 28  ? 4.506   4.014   11.638  1.00 0.00 ? 735 GLU A H    4  
ATOM 6062  H HA   . GLU A 1 28  ? 7.049   5.048   12.374  1.00 0.00 ? 735 GLU A HA   4  
ATOM 6063  H HB2  . GLU A 1 28  ? 6.020   7.308   12.360  1.00 0.00 ? 735 GLU A HB2  4  
ATOM 6064  H HB3  . GLU A 1 28  ? 5.768   6.405   10.881  1.00 0.00 ? 735 GLU A HB3  4  
ATOM 6065  H HG2  . GLU A 1 28  ? 3.482   5.997   11.448  1.00 0.00 ? 735 GLU A HG2  4  
ATOM 6066  H HG3  . GLU A 1 28  ? 3.714   6.663   13.062  1.00 0.00 ? 735 GLU A HG3  4  
ATOM 6067  N N    . GLU A 1 29  ? 4.908   4.774   14.741  1.00 0.00 ? 736 GLU A N    4  
ATOM 6068  C CA   . GLU A 1 29  ? 4.737   4.914   16.164  1.00 0.00 ? 736 GLU A CA   4  
ATOM 6069  C C    . GLU A 1 29  ? 5.491   3.823   16.941  1.00 0.00 ? 736 GLU A C    4  
ATOM 6070  O O    . GLU A 1 29  ? 6.114   4.108   17.963  1.00 0.00 ? 736 GLU A O    4  
ATOM 6071  C CB   . GLU A 1 29  ? 3.253   4.916   16.533  1.00 0.00 ? 736 GLU A CB   4  
ATOM 6072  C CG   . GLU A 1 29  ? 2.974   5.241   17.990  1.00 0.00 ? 736 GLU A CG   4  
ATOM 6073  C CD   . GLU A 1 29  ? 1.524   5.094   18.357  1.00 0.00 ? 736 GLU A CD   4  
ATOM 6074  O OE1  . GLU A 1 29  ? 0.735   6.039   18.150  1.00 0.00 ? 736 GLU A OE1  4  
ATOM 6075  O OE2  . GLU A 1 29  ? 1.135   4.029   18.850  1.00 0.00 ? 736 GLU A OE2  4  
ATOM 6076  H H    . GLU A 1 29  ? 4.246   4.276   14.214  1.00 0.00 ? 736 GLU A H    4  
ATOM 6077  H HA   . GLU A 1 29  ? 5.160   5.867   16.447  1.00 0.00 ? 736 GLU A HA   4  
ATOM 6078  H HB2  . GLU A 1 29  ? 2.748   5.654   15.927  1.00 0.00 ? 736 GLU A HB2  4  
ATOM 6079  H HB3  . GLU A 1 29  ? 2.838   3.943   16.316  1.00 0.00 ? 736 GLU A HB3  4  
ATOM 6080  H HG2  . GLU A 1 29  ? 3.549   4.557   18.594  1.00 0.00 ? 736 GLU A HG2  4  
ATOM 6081  H HG3  . GLU A 1 29  ? 3.290   6.254   18.191  1.00 0.00 ? 736 GLU A HG3  4  
ATOM 6082  N N    . GLU A 1 30  ? 5.450   2.587   16.462  1.00 0.00 ? 737 GLU A N    4  
ATOM 6083  C CA   . GLU A 1 30  ? 6.056   1.497   17.214  1.00 0.00 ? 737 GLU A CA   4  
ATOM 6084  C C    . GLU A 1 30  ? 7.429   1.088   16.689  1.00 0.00 ? 737 GLU A C    4  
ATOM 6085  O O    . GLU A 1 30  ? 8.395   1.016   17.451  1.00 0.00 ? 737 GLU A O    4  
ATOM 6086  C CB   . GLU A 1 30  ? 5.142   0.267   17.268  1.00 0.00 ? 737 GLU A CB   4  
ATOM 6087  C CG   . GLU A 1 30  ? 3.741   0.559   17.768  1.00 0.00 ? 737 GLU A CG   4  
ATOM 6088  C CD   . GLU A 1 30  ? 3.029   -0.676  18.264  1.00 0.00 ? 737 GLU A CD   4  
ATOM 6089  O OE1  . GLU A 1 30  ? 3.194   -1.017  19.458  1.00 0.00 ? 737 GLU A OE1  4  
ATOM 6090  O OE2  . GLU A 1 30  ? 2.290   -1.329  17.495  1.00 0.00 ? 737 GLU A OE2  4  
ATOM 6091  H H    . GLU A 1 30  ? 4.999   2.391   15.610  1.00 0.00 ? 737 GLU A H    4  
ATOM 6092  H HA   . GLU A 1 30  ? 6.185   1.852   18.226  1.00 0.00 ? 737 GLU A HA   4  
ATOM 6093  H HB2  . GLU A 1 30  ? 5.066   -0.148  16.275  1.00 0.00 ? 737 GLU A HB2  4  
ATOM 6094  H HB3  . GLU A 1 30  ? 5.592   -0.469  17.918  1.00 0.00 ? 737 GLU A HB3  4  
ATOM 6095  H HG2  . GLU A 1 30  ? 3.790   1.290   18.561  1.00 0.00 ? 737 GLU A HG2  4  
ATOM 6096  H HG3  . GLU A 1 30  ? 3.196   0.964   16.925  1.00 0.00 ? 737 GLU A HG3  4  
ATOM 6097  N N    . GLU A 1 31  ? 7.525   0.839   15.404  1.00 0.00 ? 738 GLU A N    4  
ATOM 6098  C CA   . GLU A 1 31  ? 8.759   0.290   14.837  1.00 0.00 ? 738 GLU A CA   4  
ATOM 6099  C C    . GLU A 1 31  ? 9.701   1.398   14.374  1.00 0.00 ? 738 GLU A C    4  
ATOM 6100  O O    . GLU A 1 31  ? 10.844  1.135   13.997  1.00 0.00 ? 738 GLU A O    4  
ATOM 6101  C CB   . GLU A 1 31  ? 8.425   -0.628  13.666  1.00 0.00 ? 738 GLU A CB   4  
ATOM 6102  C CG   . GLU A 1 31  ? 7.305   -1.613  13.964  1.00 0.00 ? 738 GLU A CG   4  
ATOM 6103  C CD   . GLU A 1 31  ? 7.110   -2.620  12.868  1.00 0.00 ? 738 GLU A CD   4  
ATOM 6104  O OE1  . GLU A 1 31  ? 6.689   -2.240  11.778  1.00 0.00 ? 738 GLU A OE1  4  
ATOM 6105  O OE2  . GLU A 1 31  ? 7.352   -3.822  13.091  1.00 0.00 ? 738 GLU A OE2  4  
ATOM 6106  H H    . GLU A 1 31  ? 6.766   1.023   14.810  1.00 0.00 ? 738 GLU A H    4  
ATOM 6107  H HA   . GLU A 1 31  ? 9.248   -0.294  15.603  1.00 0.00 ? 738 GLU A HA   4  
ATOM 6108  H HB2  . GLU A 1 31  ? 8.129   -0.019  12.823  1.00 0.00 ? 738 GLU A HB2  4  
ATOM 6109  H HB3  . GLU A 1 31  ? 9.311   -1.189  13.403  1.00 0.00 ? 738 GLU A HB3  4  
ATOM 6110  H HG2  . GLU A 1 31  ? 7.500   -2.127  14.892  1.00 0.00 ? 738 GLU A HG2  4  
ATOM 6111  H HG3  . GLU A 1 31  ? 6.396   -1.034  14.051  1.00 0.00 ? 738 GLU A HG3  4  
ATOM 6112  N N    . ASP A 1 32  ? 9.169   2.618   14.357  1.00 0.00 ? 739 ASP A N    4  
ATOM 6113  C CA   . ASP A 1 32  ? 9.845   3.872   13.940  1.00 0.00 ? 739 ASP A CA   4  
ATOM 6114  C C    . ASP A 1 32  ? 10.115  3.939   12.427  1.00 0.00 ? 739 ASP A C    4  
ATOM 6115  O O    . ASP A 1 32  ? 9.975   4.998   11.802  1.00 0.00 ? 739 ASP A O    4  
ATOM 6116  C CB   . ASP A 1 32  ? 11.124  4.156   14.734  1.00 0.00 ? 739 ASP A CB   4  
ATOM 6117  C CG   . ASP A 1 32  ? 11.817  5.410   14.253  1.00 0.00 ? 739 ASP A CG   4  
ATOM 6118  O OD1  . ASP A 1 32  ? 11.373  6.538   14.613  1.00 0.00 ? 739 ASP A OD1  4  
ATOM 6119  O OD2  . ASP A 1 32  ? 12.802  5.306   13.493  1.00 0.00 ? 739 ASP A OD2  4  
ATOM 6120  H H    . ASP A 1 32  ? 8.224   2.679   14.609  1.00 0.00 ? 739 ASP A H    4  
ATOM 6121  H HA   . ASP A 1 32  ? 9.132   4.658   14.151  1.00 0.00 ? 739 ASP A HA   4  
ATOM 6122  H HB2  . ASP A 1 32  ? 10.878  4.270   15.780  1.00 0.00 ? 739 ASP A HB2  4  
ATOM 6123  H HB3  . ASP A 1 32  ? 11.801  3.322   14.617  1.00 0.00 ? 739 ASP A HB3  4  
ATOM 6124  N N    . GLU A 1 33  ? 10.472  2.816   11.860  1.00 0.00 ? 740 GLU A N    4  
ATOM 6125  C CA   . GLU A 1 33  ? 10.802  2.679   10.503  1.00 0.00 ? 740 GLU A CA   4  
ATOM 6126  C C    . GLU A 1 33  ? 9.548   2.671   9.677   1.00 0.00 ? 740 GLU A C    4  
ATOM 6127  O O    . GLU A 1 33  ? 8.868   1.647   9.527   1.00 0.00 ? 740 GLU A O    4  
ATOM 6128  C CB   . GLU A 1 33  ? 11.569  1.397   10.298  1.00 0.00 ? 740 GLU A CB   4  
ATOM 6129  C CG   . GLU A 1 33  ? 12.260  1.296   8.972   1.00 0.00 ? 740 GLU A CG   4  
ATOM 6130  C CD   . GLU A 1 33  ? 13.303  2.367   8.798   1.00 0.00 ? 740 GLU A CD   4  
ATOM 6131  O OE1  . GLU A 1 33  ? 14.353  2.304   9.469   1.00 0.00 ? 740 GLU A OE1  4  
ATOM 6132  O OE2  . GLU A 1 33  ? 13.101  3.290   7.984   1.00 0.00 ? 740 GLU A OE2  4  
ATOM 6133  H H    . GLU A 1 33  ? 10.519  2.004   12.396  1.00 0.00 ? 740 GLU A H    4  
ATOM 6134  H HA   . GLU A 1 33  ? 11.432  3.505   10.215  1.00 0.00 ? 740 GLU A HA   4  
ATOM 6135  H HB2  . GLU A 1 33  ? 12.308  1.310   11.078  1.00 0.00 ? 740 GLU A HB2  4  
ATOM 6136  H HB3  . GLU A 1 33  ? 10.869  0.579   10.379  1.00 0.00 ? 740 GLU A HB3  4  
ATOM 6137  H HG2  . GLU A 1 33  ? 12.724  0.324   8.908   1.00 0.00 ? 740 GLU A HG2  4  
ATOM 6138  H HG3  . GLU A 1 33  ? 11.509  1.402   8.204   1.00 0.00 ? 740 GLU A HG3  4  
ATOM 6139  N N    . SER A 1 34  ? 9.214   3.825   9.248   1.00 0.00 ? 741 SER A N    4  
ATOM 6140  C CA   . SER A 1 34  ? 8.108   4.055   8.366   1.00 0.00 ? 741 SER A CA   4  
ATOM 6141  C C    . SER A 1 34  ? 8.429   3.511   6.970   1.00 0.00 ? 741 SER A C    4  
ATOM 6142  O O    . SER A 1 34  ? 7.529   3.138   6.205   1.00 0.00 ? 741 SER A O    4  
ATOM 6143  C CB   . SER A 1 34  ? 7.855   5.549   8.287   1.00 0.00 ? 741 SER A CB   4  
ATOM 6144  O OG   . SER A 1 34  ? 7.752   6.113   9.587   1.00 0.00 ? 741 SER A OG   4  
ATOM 6145  H H    . SER A 1 34  ? 9.741   4.565   9.619   1.00 0.00 ? 741 SER A H    4  
ATOM 6146  H HA   . SER A 1 34  ? 7.231   3.571   8.763   1.00 0.00 ? 741 SER A HA   4  
ATOM 6147  H HB2  . SER A 1 34  ? 8.673   6.019   7.763   1.00 0.00 ? 741 SER A HB2  4  
ATOM 6148  H HB3  . SER A 1 34  ? 6.934   5.732   7.753   1.00 0.00 ? 741 SER A HB3  4  
ATOM 6149  H HG   . SER A 1 34  ? 7.094   6.816   9.515   1.00 0.00 ? 741 SER A HG   4  
ATOM 6150  N N    . ALA A 1 35  ? 9.711   3.449   6.663   1.00 0.00 ? 742 ALA A N    4  
ATOM 6151  C CA   . ALA A 1 35  ? 10.157  3.009   5.378   1.00 0.00 ? 742 ALA A CA   4  
ATOM 6152  C C    . ALA A 1 35  ? 10.395  1.508   5.381   1.00 0.00 ? 742 ALA A C    4  
ATOM 6153  O O    . ALA A 1 35  ? 11.495  1.021   5.700   1.00 0.00 ? 742 ALA A O    4  
ATOM 6154  C CB   . ALA A 1 35  ? 11.387  3.778   4.946   1.00 0.00 ? 742 ALA A CB   4  
ATOM 6155  H H    . ALA A 1 35  ? 10.375  3.682   7.347   1.00 0.00 ? 742 ALA A H    4  
ATOM 6156  H HA   . ALA A 1 35  ? 9.360   3.217   4.678   1.00 0.00 ? 742 ALA A HA   4  
ATOM 6157  H HB1  . ALA A 1 35  ? 12.209  3.549   5.607   1.00 0.00 ? 742 ALA A HB1  4  
ATOM 6158  H HB2  . ALA A 1 35  ? 11.176  4.837   4.995   1.00 0.00 ? 742 ALA A HB2  4  
ATOM 6159  H HB3  . ALA A 1 35  ? 11.644  3.511   3.933   1.00 0.00 ? 742 ALA A HB3  4  
ATOM 6160  N N    . LEU A 1 36  ? 9.361   0.785   5.056   1.00 0.00 ? 743 LEU A N    4  
ATOM 6161  C CA   . LEU A 1 36  ? 9.390   -0.652  5.063   1.00 0.00 ? 743 LEU A CA   4  
ATOM 6162  C C    . LEU A 1 36  ? 9.363   -1.146  3.596   1.00 0.00 ? 743 LEU A C    4  
ATOM 6163  O O    . LEU A 1 36  ? 9.838   -0.427  2.710   1.00 0.00 ? 743 LEU A O    4  
ATOM 6164  C CB   . LEU A 1 36  ? 8.222   -1.178  5.938   1.00 0.00 ? 743 LEU A CB   4  
ATOM 6165  C CG   . LEU A 1 36  ? 8.288   -2.652  6.404   1.00 0.00 ? 743 LEU A CG   4  
ATOM 6166  C CD1  . LEU A 1 36  ? 9.645   -2.959  7.016   1.00 0.00 ? 743 LEU A CD1  4  
ATOM 6167  C CD2  . LEU A 1 36  ? 7.214   -2.908  7.447   1.00 0.00 ? 743 LEU A CD2  4  
ATOM 6168  H H    . LEU A 1 36  ? 8.550   1.260   4.768   1.00 0.00 ? 743 LEU A H    4  
ATOM 6169  H HA   . LEU A 1 36  ? 10.334  -0.936  5.503   1.00 0.00 ? 743 LEU A HA   4  
ATOM 6170  H HB2  . LEU A 1 36  ? 8.163   -0.556  6.819   1.00 0.00 ? 743 LEU A HB2  4  
ATOM 6171  H HB3  . LEU A 1 36  ? 7.308   -1.047  5.378   1.00 0.00 ? 743 LEU A HB3  4  
ATOM 6172  H HG   . LEU A 1 36  ? 8.123   -3.327  5.578   1.00 0.00 ? 743 LEU A HG   4  
ATOM 6173  H HD11 . LEU A 1 36  ? 10.417  -2.832  6.272   1.00 0.00 ? 743 LEU A HD11 4  
ATOM 6174  H HD12 . LEU A 1 36  ? 9.658   -3.976  7.377   1.00 0.00 ? 743 LEU A HD12 4  
ATOM 6175  H HD13 . LEU A 1 36  ? 9.829   -2.285  7.840   1.00 0.00 ? 743 LEU A HD13 4  
ATOM 6176  H HD21 . LEU A 1 36  ? 7.420   -2.313  8.325   1.00 0.00 ? 743 LEU A HD21 4  
ATOM 6177  H HD22 . LEU A 1 36  ? 7.201   -3.955  7.712   1.00 0.00 ? 743 LEU A HD22 4  
ATOM 6178  H HD23 . LEU A 1 36  ? 6.252   -2.623  7.051   1.00 0.00 ? 743 LEU A HD23 4  
ATOM 6179  N N    . LYS A 1 37  ? 8.838   -2.327  3.315   1.00 0.00 ? 744 LYS A N    4  
ATOM 6180  C CA   . LYS A 1 37  ? 8.947   -2.858  1.976   1.00 0.00 ? 744 LYS A CA   4  
ATOM 6181  C C    . LYS A 1 37  ? 7.621   -3.501  1.524   1.00 0.00 ? 744 LYS A C    4  
ATOM 6182  O O    . LYS A 1 37  ? 6.922   -4.133  2.316   1.00 0.00 ? 744 LYS A O    4  
ATOM 6183  C CB   . LYS A 1 37  ? 10.122  -3.826  1.954   1.00 0.00 ? 744 LYS A CB   4  
ATOM 6184  C CG   . LYS A 1 37  ? 10.636  -4.200  0.579   1.00 0.00 ? 744 LYS A CG   4  
ATOM 6185  C CD   . LYS A 1 37  ? 11.940  -4.984  0.691   1.00 0.00 ? 744 LYS A CD   4  
ATOM 6186  C CE   . LYS A 1 37  ? 13.084  -4.119  1.228   1.00 0.00 ? 744 LYS A CE   4  
ATOM 6187  N NZ   . LYS A 1 37  ? 14.293  -4.919  1.486   1.00 0.00 ? 744 LYS A NZ   4  
ATOM 6188  H H    . LYS A 1 37  ? 8.346   -2.841  3.988   1.00 0.00 ? 744 LYS A H    4  
ATOM 6189  H HA   . LYS A 1 37  ? 9.166   -2.030  1.317   1.00 0.00 ? 744 LYS A HA   4  
ATOM 6190  H HB2  . LYS A 1 37  ? 10.925  -3.371  2.513   1.00 0.00 ? 744 LYS A HB2  4  
ATOM 6191  H HB3  . LYS A 1 37  ? 9.826   -4.729  2.467   1.00 0.00 ? 744 LYS A HB3  4  
ATOM 6192  H HG2  . LYS A 1 37  ? 9.892   -4.810  0.092   1.00 0.00 ? 744 LYS A HG2  4  
ATOM 6193  H HG3  . LYS A 1 37  ? 10.808  -3.300  0.006   1.00 0.00 ? 744 LYS A HG3  4  
ATOM 6194  H HD2  . LYS A 1 37  ? 11.794  -5.815  1.364   1.00 0.00 ? 744 LYS A HD2  4  
ATOM 6195  H HD3  . LYS A 1 37  ? 12.210  -5.358  -0.286  1.00 0.00 ? 744 LYS A HD3  4  
ATOM 6196  H HE2  . LYS A 1 37  ? 13.325  -3.365  0.495   1.00 0.00 ? 744 LYS A HE2  4  
ATOM 6197  H HE3  . LYS A 1 37  ? 12.787  -3.637  2.147   1.00 0.00 ? 744 LYS A HE3  4  
ATOM 6198  H HZ1  . LYS A 1 37  ? 14.170  -5.536  2.311   1.00 0.00 ? 744 LYS A HZ1  4  
ATOM 6199  H HZ2  . LYS A 1 37  ? 15.156  -4.359  1.625   1.00 0.00 ? 744 LYS A HZ2  4  
ATOM 6200  H HZ3  . LYS A 1 37  ? 14.456  -5.563  0.678   1.00 0.00 ? 744 LYS A HZ3  4  
ATOM 6201  N N    . ARG A 1 38  ? 7.308   -3.342  0.245   1.00 0.00 ? 745 ARG A N    4  
ATOM 6202  C CA   . ARG A 1 38  ? 5.994   -3.713  -0.334  1.00 0.00 ? 745 ARG A CA   4  
ATOM 6203  C C    . ARG A 1 38  ? 5.683   -5.210  -0.410  1.00 0.00 ? 745 ARG A C    4  
ATOM 6204  O O    . ARG A 1 38  ? 4.547   -5.606  -0.150  1.00 0.00 ? 745 ARG A O    4  
ATOM 6205  C CB   . ARG A 1 38  ? 5.790   -3.062  -1.697  1.00 0.00 ? 745 ARG A CB   4  
ATOM 6206  C CG   . ARG A 1 38  ? 6.926   -3.308  -2.661  1.00 0.00 ? 745 ARG A CG   4  
ATOM 6207  C CD   . ARG A 1 38  ? 6.696   -2.656  -3.998  1.00 0.00 ? 745 ARG A CD   4  
ATOM 6208  N NE   . ARG A 1 38  ? 7.910   -2.694  -4.808  1.00 0.00 ? 745 ARG A NE   4  
ATOM 6209  C CZ   . ARG A 1 38  ? 7.961   -2.785  -6.139  1.00 0.00 ? 745 ARG A CZ   4  
ATOM 6210  N NH1  . ARG A 1 38  ? 6.873   -3.108  -6.839  1.00 0.00 ? 745 ARG A NH1  4  
ATOM 6211  N NH2  . ARG A 1 38  ? 9.114   -2.622  -6.748  1.00 0.00 ? 745 ARG A NH2  4  
ATOM 6212  H H    . ARG A 1 38  ? 7.995   -2.959  -0.341  1.00 0.00 ? 745 ARG A H    4  
ATOM 6213  H HA   . ARG A 1 38  ? 5.257   -3.283  0.328   1.00 0.00 ? 745 ARG A HA   4  
ATOM 6214  H HB2  . ARG A 1 38  ? 4.890   -3.473  -2.128  1.00 0.00 ? 745 ARG A HB2  4  
ATOM 6215  H HB3  . ARG A 1 38  ? 5.672   -1.998  -1.566  1.00 0.00 ? 745 ARG A HB3  4  
ATOM 6216  H HG2  . ARG A 1 38  ? 7.839   -2.911  -2.242  1.00 0.00 ? 745 ARG A HG2  4  
ATOM 6217  H HG3  . ARG A 1 38  ? 7.026   -4.374  -2.801  1.00 0.00 ? 745 ARG A HG3  4  
ATOM 6218  H HD2  . ARG A 1 38  ? 5.901   -3.175  -4.513  1.00 0.00 ? 745 ARG A HD2  4  
ATOM 6219  H HD3  . ARG A 1 38  ? 6.413   -1.625  -3.843  1.00 0.00 ? 745 ARG A HD3  4  
ATOM 6220  H HE   . ARG A 1 38  ? 8.747   -2.585  -4.282  1.00 0.00 ? 745 ARG A HE   4  
ATOM 6221  H HH11 . ARG A 1 38  ? 5.995   -3.307  -6.400  1.00 0.00 ? 745 ARG A HH11 4  
ATOM 6222  H HH12 . ARG A 1 38  ? 6.891   -3.158  -7.843  1.00 0.00 ? 745 ARG A HH12 4  
ATOM 6223  H HH21 . ARG A 1 38  ? 9.941   -2.430  -6.202  1.00 0.00 ? 745 ARG A HH21 4  
ATOM 6224  H HH22 . ARG A 1 38  ? 9.235   -2.673  -7.744  1.00 0.00 ? 745 ARG A HH22 4  
ATOM 6225  N N    . SER A 1 39  ? 6.643   -6.039  -0.766  1.00 0.00 ? 746 SER A N    4  
ATOM 6226  C CA   . SER A 1 39  ? 6.358   -7.461  -0.874  1.00 0.00 ? 746 SER A CA   4  
ATOM 6227  C C    . SER A 1 39  ? 6.050   -8.064  0.500   1.00 0.00 ? 746 SER A C    4  
ATOM 6228  O O    . SER A 1 39  ? 5.198   -8.945  0.628   1.00 0.00 ? 746 SER A O    4  
ATOM 6229  C CB   . SER A 1 39  ? 7.484   -8.195  -1.603  1.00 0.00 ? 746 SER A CB   4  
ATOM 6230  O OG   . SER A 1 39  ? 7.646   -7.661  -2.917  1.00 0.00 ? 746 SER A OG   4  
ATOM 6231  H H    . SER A 1 39  ? 7.547   -5.714  -0.971  1.00 0.00 ? 746 SER A H    4  
ATOM 6232  H HA   . SER A 1 39  ? 5.452   -7.538  -1.459  1.00 0.00 ? 746 SER A HA   4  
ATOM 6233  H HB2  . SER A 1 39  ? 8.414   -8.081  -1.070  1.00 0.00 ? 746 SER A HB2  4  
ATOM 6234  H HB3  . SER A 1 39  ? 7.241   -9.243  -1.686  1.00 0.00 ? 746 SER A HB3  4  
ATOM 6235  H HG   . SER A 1 39  ? 8.335   -6.987  -2.888  1.00 0.00 ? 746 SER A HG   4  
ATOM 6236  N N    . GLU A 1 40  ? 6.697   -7.526  1.515   1.00 0.00 ? 747 GLU A N    4  
ATOM 6237  C CA   . GLU A 1 40  ? 6.485   -7.913  2.892   1.00 0.00 ? 747 GLU A CA   4  
ATOM 6238  C C    . GLU A 1 40  ? 5.108   -7.427  3.348   1.00 0.00 ? 747 GLU A C    4  
ATOM 6239  O O    . GLU A 1 40  ? 4.408   -8.125  4.068   1.00 0.00 ? 747 GLU A O    4  
ATOM 6240  C CB   . GLU A 1 40  ? 7.586   -7.316  3.771   1.00 0.00 ? 747 GLU A CB   4  
ATOM 6241  C CG   . GLU A 1 40  ? 7.531   -7.737  5.227   1.00 0.00 ? 747 GLU A CG   4  
ATOM 6242  C CD   . GLU A 1 40  ? 7.694   -9.227  5.412   1.00 0.00 ? 747 GLU A CD   4  
ATOM 6243  O OE1  . GLU A 1 40  ? 8.807   -9.752  5.202   1.00 0.00 ? 747 GLU A OE1  4  
ATOM 6244  O OE2  . GLU A 1 40  ? 6.727   -9.897  5.813   1.00 0.00 ? 747 GLU A OE2  4  
ATOM 6245  H H    . GLU A 1 40  ? 7.377   -6.851  1.316   1.00 0.00 ? 747 GLU A H    4  
ATOM 6246  H HA   . GLU A 1 40  ? 6.523   -8.991  2.952   1.00 0.00 ? 747 GLU A HA   4  
ATOM 6247  H HB2  . GLU A 1 40  ? 8.546   -7.614  3.377   1.00 0.00 ? 747 GLU A HB2  4  
ATOM 6248  H HB3  . GLU A 1 40  ? 7.512   -6.238  3.727   1.00 0.00 ? 747 GLU A HB3  4  
ATOM 6249  H HG2  . GLU A 1 40  ? 8.309   -7.231  5.779   1.00 0.00 ? 747 GLU A HG2  4  
ATOM 6250  H HG3  . GLU A 1 40  ? 6.562   -7.451  5.610   1.00 0.00 ? 747 GLU A HG3  4  
ATOM 6251  N N    . LEU A 1 41  ? 4.731   -6.235  2.888   1.00 0.00 ? 748 LEU A N    4  
ATOM 6252  C CA   . LEU A 1 41  ? 3.417   -5.639  3.168   1.00 0.00 ? 748 LEU A CA   4  
ATOM 6253  C C    . LEU A 1 41  ? 2.310   -6.608  2.758   1.00 0.00 ? 748 LEU A C    4  
ATOM 6254  O O    . LEU A 1 41  ? 1.429   -6.960  3.556   1.00 0.00 ? 748 LEU A O    4  
ATOM 6255  C CB   . LEU A 1 41  ? 3.284   -4.316  2.393   1.00 0.00 ? 748 LEU A CB   4  
ATOM 6256  C CG   . LEU A 1 41  ? 1.986   -3.531  2.559   1.00 0.00 ? 748 LEU A CG   4  
ATOM 6257  C CD1  . LEU A 1 41  ? 1.825   -3.059  3.990   1.00 0.00 ? 748 LEU A CD1  4  
ATOM 6258  C CD2  . LEU A 1 41  ? 1.959   -2.355  1.595   1.00 0.00 ? 748 LEU A CD2  4  
ATOM 6259  H H    . LEU A 1 41  ? 5.373   -5.718  2.358   1.00 0.00 ? 748 LEU A H    4  
ATOM 6260  H HA   . LEU A 1 41  ? 3.340   -5.444  4.227   1.00 0.00 ? 748 LEU A HA   4  
ATOM 6261  H HB2  . LEU A 1 41  ? 4.099   -3.672  2.689   1.00 0.00 ? 748 LEU A HB2  4  
ATOM 6262  H HB3  . LEU A 1 41  ? 3.404   -4.543  1.343   1.00 0.00 ? 748 LEU A HB3  4  
ATOM 6263  H HG   . LEU A 1 41  ? 1.153   -4.177  2.326   1.00 0.00 ? 748 LEU A HG   4  
ATOM 6264  H HD11 . LEU A 1 41  ? 2.661   -2.430  4.258   1.00 0.00 ? 748 LEU A HD11 4  
ATOM 6265  H HD12 . LEU A 1 41  ? 1.791   -3.912  4.653   1.00 0.00 ? 748 LEU A HD12 4  
ATOM 6266  H HD13 . LEU A 1 41  ? 0.911   -2.495  4.090   1.00 0.00 ? 748 LEU A HD13 4  
ATOM 6267  H HD21 . LEU A 1 41  ? 1.039   -1.802  1.718   1.00 0.00 ? 748 LEU A HD21 4  
ATOM 6268  H HD22 . LEU A 1 41  ? 2.028   -2.720  0.581   1.00 0.00 ? 748 LEU A HD22 4  
ATOM 6269  H HD23 . LEU A 1 41  ? 2.799   -1.708  1.801   1.00 0.00 ? 748 LEU A HD23 4  
ATOM 6270  N N    . VAL A 1 42  ? 2.385   -7.061  1.518   1.00 0.00 ? 749 VAL A N    4  
ATOM 6271  C CA   . VAL A 1 42  ? 1.439   -8.030  0.995   1.00 0.00 ? 749 VAL A CA   4  
ATOM 6272  C C    . VAL A 1 42  ? 1.553   -9.342  1.772   1.00 0.00 ? 749 VAL A C    4  
ATOM 6273  O O    . VAL A 1 42  ? 0.549   -9.953  2.119   1.00 0.00 ? 749 VAL A O    4  
ATOM 6274  C CB   . VAL A 1 42  ? 1.691   -8.306  -0.509  1.00 0.00 ? 749 VAL A CB   4  
ATOM 6275  C CG1  . VAL A 1 42  ? 0.671   -9.278  -1.073  1.00 0.00 ? 749 VAL A CG1  4  
ATOM 6276  C CG2  . VAL A 1 42  ? 1.665   -7.023  -1.292  1.00 0.00 ? 749 VAL A CG2  4  
ATOM 6277  H H    . VAL A 1 42  ? 3.093   -6.710  0.935   1.00 0.00 ? 749 VAL A H    4  
ATOM 6278  H HA   . VAL A 1 42  ? 0.444   -7.630  1.118   1.00 0.00 ? 749 VAL A HA   4  
ATOM 6279  H HB   . VAL A 1 42  ? 2.673   -8.744  -0.613  1.00 0.00 ? 749 VAL A HB   4  
ATOM 6280  H HG11 . VAL A 1 42  ? 0.847   -9.416  -2.129  1.00 0.00 ? 749 VAL A HG11 4  
ATOM 6281  H HG12 . VAL A 1 42  ? -0.320  -8.879  -0.916  1.00 0.00 ? 749 VAL A HG12 4  
ATOM 6282  H HG13 . VAL A 1 42  ? 0.765   -10.224 -0.560  1.00 0.00 ? 749 VAL A HG13 4  
ATOM 6283  H HG21 . VAL A 1 42  ? 2.446   -6.367  -0.937  1.00 0.00 ? 749 VAL A HG21 4  
ATOM 6284  H HG22 . VAL A 1 42  ? 0.706   -6.549  -1.150  1.00 0.00 ? 749 VAL A HG22 4  
ATOM 6285  H HG23 . VAL A 1 42  ? 1.813   -7.234  -2.339  1.00 0.00 ? 749 VAL A HG23 4  
ATOM 6286  N N    . ASN A 1 43  ? 2.788   -9.709  2.090   1.00 0.00 ? 750 ASN A N    4  
ATOM 6287  C CA   . ASN A 1 43  ? 3.115   -10.963 2.775   1.00 0.00 ? 750 ASN A CA   4  
ATOM 6288  C C    . ASN A 1 43  ? 2.352   -11.076 4.083   1.00 0.00 ? 750 ASN A C    4  
ATOM 6289  O O    . ASN A 1 43  ? 1.540   -12.002 4.272   1.00 0.00 ? 750 ASN A O    4  
ATOM 6290  C CB   . ASN A 1 43  ? 4.623   -11.031 3.064   1.00 0.00 ? 750 ASN A CB   4  
ATOM 6291  C CG   . ASN A 1 43  ? 5.060   -12.340 3.716   1.00 0.00 ? 750 ASN A CG   4  
ATOM 6292  O OD1  . ASN A 1 43  ? 4.484   -13.405 3.478   1.00 0.00 ? 750 ASN A OD1  4  
ATOM 6293  N ND2  . ASN A 1 43  ? 6.036   -12.262 4.577   1.00 0.00 ? 750 ASN A ND2  4  
ATOM 6294  H H    . ASN A 1 43  ? 3.523   -9.093  1.881   1.00 0.00 ? 750 ASN A H    4  
ATOM 6295  H HA   . ASN A 1 43  ? 2.849   -11.784 2.128   1.00 0.00 ? 750 ASN A HA   4  
ATOM 6296  H HB2  . ASN A 1 43  ? 5.203   -10.834 2.173   1.00 0.00 ? 750 ASN A HB2  4  
ATOM 6297  H HB3  . ASN A 1 43  ? 4.837   -10.233 3.762   1.00 0.00 ? 750 ASN A HB3  4  
ATOM 6298  H HD21 . ASN A 1 43  ? 6.421   -11.373 4.774   1.00 0.00 ? 750 ASN A HD21 4  
ATOM 6299  H HD22 . ASN A 1 43  ? 6.370   -13.082 4.994   1.00 0.00 ? 750 ASN A HD22 4  
ATOM 6300  N N    . TRP A 1 44  ? 2.550   -10.103 4.967   1.00 0.00 ? 751 TRP A N    4  
ATOM 6301  C CA   . TRP A 1 44  ? 1.904   -10.157 6.253   1.00 0.00 ? 751 TRP A CA   4  
ATOM 6302  C C    . TRP A 1 44  ? 0.407   -9.984  6.118   1.00 0.00 ? 751 TRP A C    4  
ATOM 6303  O O    . TRP A 1 44  ? -0.347  -10.568 6.892   1.00 0.00 ? 751 TRP A O    4  
ATOM 6304  C CB   . TRP A 1 44  ? 2.505   -9.181  7.314   1.00 0.00 ? 751 TRP A CB   4  
ATOM 6305  C CG   . TRP A 1 44  ? 2.323   -7.703  7.068   1.00 0.00 ? 751 TRP A CG   4  
ATOM 6306  C CD1  . TRP A 1 44  ? 3.240   -6.852  6.550   1.00 0.00 ? 751 TRP A CD1  4  
ATOM 6307  C CD2  . TRP A 1 44  ? 1.163   -6.898  7.375   1.00 0.00 ? 751 TRP A CD2  4  
ATOM 6308  N NE1  . TRP A 1 44  ? 2.731   -5.585  6.483   1.00 0.00 ? 751 TRP A NE1  4  
ATOM 6309  C CE2  . TRP A 1 44  ? 1.458   -5.583  6.982   1.00 0.00 ? 751 TRP A CE2  4  
ATOM 6310  C CE3  . TRP A 1 44  ? -0.096  -7.168  7.930   1.00 0.00 ? 751 TRP A CE3  4  
ATOM 6311  C CZ2  . TRP A 1 44  ? 0.548   -4.539  7.126   1.00 0.00 ? 751 TRP A CZ2  4  
ATOM 6312  C CZ3  . TRP A 1 44  ? -0.998  -6.132  8.070   1.00 0.00 ? 751 TRP A CZ3  4  
ATOM 6313  C CH2  . TRP A 1 44  ? -0.674  -4.832  7.670   1.00 0.00 ? 751 TRP A CH2  4  
ATOM 6314  H H    . TRP A 1 44  ? 3.140   -9.350  4.729   1.00 0.00 ? 751 TRP A H    4  
ATOM 6315  H HA   . TRP A 1 44  ? 2.055   -11.170 6.596   1.00 0.00 ? 751 TRP A HA   4  
ATOM 6316  H HB2  . TRP A 1 44  ? 2.042   -9.387  8.268   1.00 0.00 ? 751 TRP A HB2  4  
ATOM 6317  H HB3  . TRP A 1 44  ? 3.564   -9.380  7.396   1.00 0.00 ? 751 TRP A HB3  4  
ATOM 6318  H HD1  . TRP A 1 44  ? 4.224   -7.151  6.225   1.00 0.00 ? 751 TRP A HD1  4  
ATOM 6319  H HE1  . TRP A 1 44  ? 3.218   -4.810  6.128   1.00 0.00 ? 751 TRP A HE1  4  
ATOM 6320  H HE3  . TRP A 1 44  ? -0.365  -8.166  8.245   1.00 0.00 ? 751 TRP A HE3  4  
ATOM 6321  H HZ2  . TRP A 1 44  ? 0.783   -3.529  6.821   1.00 0.00 ? 751 TRP A HZ2  4  
ATOM 6322  H HZ3  . TRP A 1 44  ? -1.972  -6.323  8.497   1.00 0.00 ? 751 TRP A HZ3  4  
ATOM 6323  H HH2  . TRP A 1 44  ? -1.413  -4.056  7.800   1.00 0.00 ? 751 TRP A HH2  4  
ATOM 6324  N N    . TYR A 1 45  ? -0.015  -9.239  5.096   1.00 0.00 ? 752 TYR A N    4  
ATOM 6325  C CA   . TYR A 1 45  ? -1.419  -8.966  4.876   1.00 0.00 ? 752 TYR A CA   4  
ATOM 6326  C C    . TYR A 1 45  ? -2.164  -10.253 4.607   1.00 0.00 ? 752 TYR A C    4  
ATOM 6327  O O    . TYR A 1 45  ? -3.124  -10.574 5.303   1.00 0.00 ? 752 TYR A O    4  
ATOM 6328  C CB   . TYR A 1 45  ? -1.607  -7.994  3.704   1.00 0.00 ? 752 TYR A CB   4  
ATOM 6329  C CG   . TYR A 1 45  ? -3.039  -7.525  3.522   1.00 0.00 ? 752 TYR A CG   4  
ATOM 6330  C CD1  . TYR A 1 45  ? -3.742  -6.989  4.600   1.00 0.00 ? 752 TYR A CD1  4  
ATOM 6331  C CD2  . TYR A 1 45  ? -3.688  -7.599  2.284   1.00 0.00 ? 752 TYR A CD2  4  
ATOM 6332  C CE1  . TYR A 1 45  ? -5.033  -6.554  4.463   1.00 0.00 ? 752 TYR A CE1  4  
ATOM 6333  C CE2  . TYR A 1 45  ? -4.978  -7.162  2.148   1.00 0.00 ? 752 TYR A CE2  4  
ATOM 6334  C CZ   . TYR A 1 45  ? -5.648  -6.639  3.246   1.00 0.00 ? 752 TYR A CZ   4  
ATOM 6335  O OH   . TYR A 1 45  ? -6.944  -6.219  3.120   1.00 0.00 ? 752 TYR A OH   4  
ATOM 6336  H H    . TYR A 1 45  ? 0.647   -8.863  4.475   1.00 0.00 ? 752 TYR A H    4  
ATOM 6337  H HA   . TYR A 1 45  ? -1.811  -8.512  5.773   1.00 0.00 ? 752 TYR A HA   4  
ATOM 6338  H HB2  . TYR A 1 45  ? -0.972  -7.132  3.845   1.00 0.00 ? 752 TYR A HB2  4  
ATOM 6339  H HB3  . TYR A 1 45  ? -1.308  -8.495  2.795   1.00 0.00 ? 752 TYR A HB3  4  
ATOM 6340  H HD1  . TYR A 1 45  ? -3.253  -6.916  5.561   1.00 0.00 ? 752 TYR A HD1  4  
ATOM 6341  H HD2  . TYR A 1 45  ? -3.207  -7.990  1.398   1.00 0.00 ? 752 TYR A HD2  4  
ATOM 6342  H HE1  . TYR A 1 45  ? -5.558  -6.143  5.312   1.00 0.00 ? 752 TYR A HE1  4  
ATOM 6343  H HE2  . TYR A 1 45  ? -5.443  -7.238  1.176   1.00 0.00 ? 752 TYR A HE2  4  
ATOM 6344  H HH   . TYR A 1 45  ? -7.421  -6.917  2.669   1.00 0.00 ? 752 TYR A HH   4  
ATOM 6345  N N    . LEU A 1 46  ? -1.665  -11.011 3.647   1.00 0.00 ? 753 LEU A N    4  
ATOM 6346  C CA   . LEU A 1 46  ? -2.269  -12.271 3.231   1.00 0.00 ? 753 LEU A CA   4  
ATOM 6347  C C    . LEU A 1 46  ? -2.340  -13.241 4.399   1.00 0.00 ? 753 LEU A C    4  
ATOM 6348  O O    . LEU A 1 46  ? -3.364  -13.858 4.637   1.00 0.00 ? 753 LEU A O    4  
ATOM 6349  C CB   . LEU A 1 46  ? -1.446  -12.888 2.108   1.00 0.00 ? 753 LEU A CB   4  
ATOM 6350  C CG   . LEU A 1 46  ? -1.223  -12.011 0.879   1.00 0.00 ? 753 LEU A CG   4  
ATOM 6351  C CD1  . LEU A 1 46  ? -0.246  -12.676 -0.062  1.00 0.00 ? 753 LEU A CD1  4  
ATOM 6352  C CD2  . LEU A 1 46  ? -2.538  -11.676 0.171   1.00 0.00 ? 753 LEU A CD2  4  
ATOM 6353  H H    . LEU A 1 46  ? -0.849  -10.701 3.191   1.00 0.00 ? 753 LEU A H    4  
ATOM 6354  H HA   . LEU A 1 46  ? -3.265  -12.072 2.865   1.00 0.00 ? 753 LEU A HA   4  
ATOM 6355  H HB2  . LEU A 1 46  ? -0.479  -13.150 2.513   1.00 0.00 ? 753 LEU A HB2  4  
ATOM 6356  H HB3  . LEU A 1 46  ? -1.938  -13.794 1.788   1.00 0.00 ? 753 LEU A HB3  4  
ATOM 6357  H HG   . LEU A 1 46  ? -0.766  -11.089 1.207   1.00 0.00 ? 753 LEU A HG   4  
ATOM 6358  H HD11 . LEU A 1 46  ? -0.141  -12.087 -0.960  1.00 0.00 ? 753 LEU A HD11 4  
ATOM 6359  H HD12 . LEU A 1 46  ? -0.577  -13.674 -0.301  1.00 0.00 ? 753 LEU A HD12 4  
ATOM 6360  H HD13 . LEU A 1 46  ? 0.707   -12.715 0.449   1.00 0.00 ? 753 LEU A HD13 4  
ATOM 6361  H HD21 . LEU A 1 46  ? -3.036  -12.583 -0.135  1.00 0.00 ? 753 LEU A HD21 4  
ATOM 6362  H HD22 . LEU A 1 46  ? -2.326  -11.065 -0.694  1.00 0.00 ? 753 LEU A HD22 4  
ATOM 6363  H HD23 . LEU A 1 46  ? -3.177  -11.112 0.837   1.00 0.00 ? 753 LEU A HD23 4  
ATOM 6364  N N    . LYS A 1 47  ? -1.251  -13.318 5.140   1.00 0.00 ? 754 LYS A N    4  
ATOM 6365  C CA   . LYS A 1 47  ? -1.140  -14.208 6.302   1.00 0.00 ? 754 LYS A CA   4  
ATOM 6366  C C    . LYS A 1 47  ? -2.121  -13.843 7.427   1.00 0.00 ? 754 LYS A C    4  
ATOM 6367  O O    . LYS A 1 47  ? -2.556  -14.699 8.196   1.00 0.00 ? 754 LYS A O    4  
ATOM 6368  C CB   . LYS A 1 47  ? 0.302   -14.226 6.830   1.00 0.00 ? 754 LYS A CB   4  
ATOM 6369  C CG   . LYS A 1 47  ? 1.245   -15.233 6.154   1.00 0.00 ? 754 LYS A CG   4  
ATOM 6370  C CD   . LYS A 1 47  ? 1.358   -15.045 4.647   1.00 0.00 ? 754 LYS A CD   4  
ATOM 6371  C CE   . LYS A 1 47  ? 2.336   -16.032 4.029   1.00 0.00 ? 754 LYS A CE   4  
ATOM 6372  N NZ   . LYS A 1 47  ? 3.711   -15.854 4.550   1.00 0.00 ? 754 LYS A NZ   4  
ATOM 6373  H H    . LYS A 1 47  ? -0.488  -12.753 4.886   1.00 0.00 ? 754 LYS A H    4  
ATOM 6374  H HA   . LYS A 1 47  ? -1.383  -15.203 5.961   1.00 0.00 ? 754 LYS A HA   4  
ATOM 6375  H HB2  . LYS A 1 47  ? 0.715   -13.239 6.678   1.00 0.00 ? 754 LYS A HB2  4  
ATOM 6376  H HB3  . LYS A 1 47  ? 0.281   -14.432 7.890   1.00 0.00 ? 754 LYS A HB3  4  
ATOM 6377  H HG2  . LYS A 1 47  ? 2.231   -15.118 6.583   1.00 0.00 ? 754 LYS A HG2  4  
ATOM 6378  H HG3  . LYS A 1 47  ? 0.883   -16.229 6.361   1.00 0.00 ? 754 LYS A HG3  4  
ATOM 6379  H HD2  . LYS A 1 47  ? 0.384   -15.190 4.202   1.00 0.00 ? 754 LYS A HD2  4  
ATOM 6380  H HD3  . LYS A 1 47  ? 1.697   -14.039 4.446   1.00 0.00 ? 754 LYS A HD3  4  
ATOM 6381  H HE2  . LYS A 1 47  ? 2.007   -17.037 4.248   1.00 0.00 ? 754 LYS A HE2  4  
ATOM 6382  H HE3  . LYS A 1 47  ? 2.343   -15.885 2.959   1.00 0.00 ? 754 LYS A HE3  4  
ATOM 6383  H HZ1  . LYS A 1 47  ? 4.344   -16.556 4.117   1.00 0.00 ? 754 LYS A HZ1  4  
ATOM 6384  H HZ2  . LYS A 1 47  ? 3.758   -15.997 5.578   1.00 0.00 ? 754 LYS A HZ2  4  
ATOM 6385  H HZ3  . LYS A 1 47  ? 4.077   -14.909 4.302   1.00 0.00 ? 754 LYS A HZ3  4  
ATOM 6386  N N    . GLU A 1 48  ? -2.458  -12.593 7.523   1.00 0.00 ? 755 GLU A N    4  
ATOM 6387  C CA   . GLU A 1 48  ? -3.381  -12.150 8.545   1.00 0.00 ? 755 GLU A CA   4  
ATOM 6388  C C    . GLU A 1 48  ? -4.817  -12.339 8.104   1.00 0.00 ? 755 GLU A C    4  
ATOM 6389  O O    . GLU A 1 48  ? -5.631  -12.925 8.817   1.00 0.00 ? 755 GLU A O    4  
ATOM 6390  C CB   . GLU A 1 48  ? -3.139  -10.701 8.948   1.00 0.00 ? 755 GLU A CB   4  
ATOM 6391  C CG   . GLU A 1 48  ? -1.819  -10.451 9.649   1.00 0.00 ? 755 GLU A CG   4  
ATOM 6392  C CD   . GLU A 1 48  ? -1.632  -11.309 10.877  1.00 0.00 ? 755 GLU A CD   4  
ATOM 6393  O OE1  . GLU A 1 48  ? -2.494  -11.299 11.775  1.00 0.00 ? 755 GLU A OE1  4  
ATOM 6394  O OE2  . GLU A 1 48  ? -0.588  -11.995 10.988  1.00 0.00 ? 755 GLU A OE2  4  
ATOM 6395  H H    . GLU A 1 48  ? -2.099  -11.962 6.863   1.00 0.00 ? 755 GLU A H    4  
ATOM 6396  H HA   . GLU A 1 48  ? -3.211  -12.779 9.407   1.00 0.00 ? 755 GLU A HA   4  
ATOM 6397  H HB2  . GLU A 1 48  ? -3.165  -10.090 8.057   1.00 0.00 ? 755 GLU A HB2  4  
ATOM 6398  H HB3  . GLU A 1 48  ? -3.937  -10.387 9.604   1.00 0.00 ? 755 GLU A HB3  4  
ATOM 6399  H HG2  . GLU A 1 48  ? -1.023  -10.667 8.952   1.00 0.00 ? 755 GLU A HG2  4  
ATOM 6400  H HG3  . GLU A 1 48  ? -1.765  -9.412  9.935   1.00 0.00 ? 755 GLU A HG3  4  
ATOM 6401  N N    . ILE A 1 49  ? -5.103  -11.900 6.898   1.00 0.00 ? 756 ILE A N    4  
ATOM 6402  C CA   . ILE A 1 49  ? -6.462  -11.906 6.385   1.00 0.00 ? 756 ILE A CA   4  
ATOM 6403  C C    . ILE A 1 49  ? -6.900  -13.276 5.932   1.00 0.00 ? 756 ILE A C    4  
ATOM 6404  O O    . ILE A 1 49  ? -8.059  -13.470 5.612   1.00 0.00 ? 756 ILE A O    4  
ATOM 6405  C CB   . ILE A 1 49  ? -6.649  -10.929 5.213   1.00 0.00 ? 756 ILE A CB   4  
ATOM 6406  C CG1  . ILE A 1 49  ? -5.791  -11.368 4.014   1.00 0.00 ? 756 ILE A CG1  4  
ATOM 6407  C CG2  . ILE A 1 49  ? -6.297  -9.523  5.663   1.00 0.00 ? 756 ILE A CG2  4  
ATOM 6408  C CD1  . ILE A 1 49  ? -5.947  -10.518 2.790   1.00 0.00 ? 756 ILE A CD1  4  
ATOM 6409  H H    . ILE A 1 49  ? -4.379  -11.549 6.332   1.00 0.00 ? 756 ILE A H    4  
ATOM 6410  H HA   . ILE A 1 49  ? -7.112  -11.587 7.185   1.00 0.00 ? 756 ILE A HA   4  
ATOM 6411  H HB   . ILE A 1 49  ? -7.690  -10.941 4.925   1.00 0.00 ? 756 ILE A HB   4  
ATOM 6412  H HG12 . ILE A 1 49  ? -4.751  -11.333 4.303   1.00 0.00 ? 756 ILE A HG12 4  
ATOM 6413  H HG13 . ILE A 1 49  ? -6.048  -12.385 3.755   1.00 0.00 ? 756 ILE A HG13 4  
ATOM 6414  H HG21 . ILE A 1 49  ? -6.456  -8.831  4.849   1.00 0.00 ? 756 ILE A HG21 4  
ATOM 6415  H HG22 . ILE A 1 49  ? -5.260  -9.493  5.962   1.00 0.00 ? 756 ILE A HG22 4  
ATOM 6416  H HG23 . ILE A 1 49  ? -6.917  -9.244  6.502   1.00 0.00 ? 756 ILE A HG23 4  
ATOM 6417  H HD11 . ILE A 1 49  ? -6.976  -10.541 2.463   1.00 0.00 ? 756 ILE A HD11 4  
ATOM 6418  H HD12 . ILE A 1 49  ? -5.310  -10.898 2.006   1.00 0.00 ? 756 ILE A HD12 4  
ATOM 6419  H HD13 . ILE A 1 49  ? -5.667  -9.501  3.020   1.00 0.00 ? 756 ILE A HD13 4  
ATOM 6420  N N    . GLU A 1 50  ? -5.988  -14.233 5.912   1.00 0.00 ? 757 GLU A N    4  
ATOM 6421  C CA   . GLU A 1 50  ? -6.319  -15.578 5.478   1.00 0.00 ? 757 GLU A CA   4  
ATOM 6422  C C    . GLU A 1 50  ? -7.428  -16.214 6.351   1.00 0.00 ? 757 GLU A C    4  
ATOM 6423  O O    . GLU A 1 50  ? -8.105  -17.152 5.933   1.00 0.00 ? 757 GLU A O    4  
ATOM 6424  C CB   . GLU A 1 50  ? -5.077  -16.459 5.401   1.00 0.00 ? 757 GLU A CB   4  
ATOM 6425  C CG   . GLU A 1 50  ? -4.436  -16.804 6.723   1.00 0.00 ? 757 GLU A CG   4  
ATOM 6426  C CD   . GLU A 1 50  ? -3.275  -17.744 6.542   1.00 0.00 ? 757 GLU A CD   4  
ATOM 6427  O OE1  . GLU A 1 50  ? -3.503  -18.967 6.432   1.00 0.00 ? 757 GLU A OE1  4  
ATOM 6428  O OE2  . GLU A 1 50  ? -2.123  -17.297 6.502   1.00 0.00 ? 757 GLU A OE2  4  
ATOM 6429  H H    . GLU A 1 50  ? -5.058  -14.016 6.151   1.00 0.00 ? 757 GLU A H    4  
ATOM 6430  H HA   . GLU A 1 50  ? -6.724  -15.470 4.483   1.00 0.00 ? 757 GLU A HA   4  
ATOM 6431  H HB2  . GLU A 1 50  ? -5.303  -17.373 4.876   1.00 0.00 ? 757 GLU A HB2  4  
ATOM 6432  H HB3  . GLU A 1 50  ? -4.351  -15.887 4.838   1.00 0.00 ? 757 GLU A HB3  4  
ATOM 6433  H HG2  . GLU A 1 50  ? -4.083  -15.896 7.189   1.00 0.00 ? 757 GLU A HG2  4  
ATOM 6434  H HG3  . GLU A 1 50  ? -5.172  -17.276 7.358   1.00 0.00 ? 757 GLU A HG3  4  
ATOM 6435  N N    . SER A 1 51  ? -7.642  -15.652 7.523   1.00 0.00 ? 758 SER A N    4  
ATOM 6436  C CA   . SER A 1 51  ? -8.657  -16.106 8.427   1.00 0.00 ? 758 SER A CA   4  
ATOM 6437  C C    . SER A 1 51  ? -10.058 -15.538 8.055   1.00 0.00 ? 758 SER A C    4  
ATOM 6438  O O    . SER A 1 51  ? -11.083 -16.092 8.455   1.00 0.00 ? 758 SER A O    4  
ATOM 6439  C CB   . SER A 1 51  ? -8.252  -15.706 9.838   1.00 0.00 ? 758 SER A CB   4  
ATOM 6440  O OG   . SER A 1 51  ? -7.890  -14.330 9.867   1.00 0.00 ? 758 SER A OG   4  
ATOM 6441  H H    . SER A 1 51  ? -7.089  -14.890 7.804   1.00 0.00 ? 758 SER A H    4  
ATOM 6442  H HA   . SER A 1 51  ? -8.692  -17.184 8.376   1.00 0.00 ? 758 SER A HA   4  
ATOM 6443  H HB2  . SER A 1 51  ? -9.080  -15.869 10.512  1.00 0.00 ? 758 SER A HB2  4  
ATOM 6444  H HB3  . SER A 1 51  ? -7.404  -16.296 10.151  1.00 0.00 ? 758 SER A HB3  4  
ATOM 6445  H HG   . SER A 1 51  ? -6.933  -14.250 9.986   1.00 0.00 ? 758 SER A HG   4  
ATOM 6446  N N    . GLU A 1 52  ? -10.100 -14.450 7.265   1.00 0.00 ? 759 GLU A N    4  
ATOM 6447  C CA   . GLU A 1 52  ? -11.394 -13.849 6.883   1.00 0.00 ? 759 GLU A CA   4  
ATOM 6448  C C    . GLU A 1 52  ? -11.831 -14.392 5.533   1.00 0.00 ? 759 GLU A C    4  
ATOM 6449  O O    . GLU A 1 52  ? -12.972 -14.200 5.096   1.00 0.00 ? 759 GLU A O    4  
ATOM 6450  C CB   . GLU A 1 52  ? -11.330 -12.295 6.809   1.00 0.00 ? 759 GLU A CB   4  
ATOM 6451  C CG   . GLU A 1 52  ? -10.546 -11.734 5.612   1.00 0.00 ? 759 GLU A CG   4  
ATOM 6452  C CD   . GLU A 1 52  ? -10.639 -10.227 5.471   1.00 0.00 ? 759 GLU A CD   4  
ATOM 6453  O OE1  . GLU A 1 52  ? -11.647 -9.644  5.888   1.00 0.00 ? 759 GLU A OE1  4  
ATOM 6454  O OE2  . GLU A 1 52  ? -9.733  -9.607  4.866   1.00 0.00 ? 759 GLU A OE2  4  
ATOM 6455  H H    . GLU A 1 52  ? -9.260  -14.062 6.928   1.00 0.00 ? 759 GLU A H    4  
ATOM 6456  H HA   . GLU A 1 52  ? -12.123 -14.142 7.626   1.00 0.00 ? 759 GLU A HA   4  
ATOM 6457  H HB2  . GLU A 1 52  ? -12.338 -11.910 6.753   1.00 0.00 ? 759 GLU A HB2  4  
ATOM 6458  H HB3  . GLU A 1 52  ? -10.872 -11.927 7.716   1.00 0.00 ? 759 GLU A HB3  4  
ATOM 6459  H HG2  . GLU A 1 52  ? -9.505  -11.999 5.725   1.00 0.00 ? 759 GLU A HG2  4  
ATOM 6460  H HG3  . GLU A 1 52  ? -10.927 -12.191 4.711   1.00 0.00 ? 759 GLU A HG3  4  
ATOM 6461  N N    . ILE A 1 53  ? -10.900 -15.058 4.884   1.00 0.00 ? 760 ILE A N    4  
ATOM 6462  C CA   . ILE A 1 53  ? -11.075 -15.583 3.553   1.00 0.00 ? 760 ILE A CA   4  
ATOM 6463  C C    . ILE A 1 53  ? -12.184 -16.629 3.489   1.00 0.00 ? 760 ILE A C    4  
ATOM 6464  O O    . ILE A 1 53  ? -12.062 -17.745 4.025   1.00 0.00 ? 760 ILE A O    4  
ATOM 6465  C CB   . ILE A 1 53  ? -9.739  -16.147 2.999   1.00 0.00 ? 760 ILE A CB   4  
ATOM 6466  C CG1  . ILE A 1 53  ? -8.664  -15.049 2.945   1.00 0.00 ? 760 ILE A CG1  4  
ATOM 6467  C CG2  . ILE A 1 53  ? -9.913  -16.792 1.645   1.00 0.00 ? 760 ILE A CG2  4  
ATOM 6468  C CD1  . ILE A 1 53  ? -9.032  -13.825 2.119   1.00 0.00 ? 760 ILE A CD1  4  
ATOM 6469  H H    . ILE A 1 53  ? -10.048 -15.197 5.347   1.00 0.00 ? 760 ILE A H    4  
ATOM 6470  H HA   . ILE A 1 53  ? -11.371 -14.757 2.924   1.00 0.00 ? 760 ILE A HA   4  
ATOM 6471  H HB   . ILE A 1 53  ? -9.403  -16.914 3.678   1.00 0.00 ? 760 ILE A HB   4  
ATOM 6472  H HG12 . ILE A 1 53  ? -8.486  -14.696 3.950   1.00 0.00 ? 760 ILE A HG12 4  
ATOM 6473  H HG13 . ILE A 1 53  ? -7.754  -15.466 2.541   1.00 0.00 ? 760 ILE A HG13 4  
ATOM 6474  H HG21 . ILE A 1 53  ? -10.257 -16.053 0.937   1.00 0.00 ? 760 ILE A HG21 4  
ATOM 6475  H HG22 . ILE A 1 53  ? -10.647 -17.582 1.717   1.00 0.00 ? 760 ILE A HG22 4  
ATOM 6476  H HG23 . ILE A 1 53  ? -8.972  -17.204 1.312   1.00 0.00 ? 760 ILE A HG23 4  
ATOM 6477  H HD11 . ILE A 1 53  ? -8.197  -13.141 2.107   1.00 0.00 ? 760 ILE A HD11 4  
ATOM 6478  H HD12 . ILE A 1 53  ? -9.887  -13.333 2.561   1.00 0.00 ? 760 ILE A HD12 4  
ATOM 6479  H HD13 . ILE A 1 53  ? -9.270  -14.125 1.109   1.00 0.00 ? 760 ILE A HD13 4  
ATOM 6480  N N    . ASP A 1 54  ? -13.269 -16.229 2.858   1.00 0.00 ? 761 ASP A N    4  
ATOM 6481  C CA   . ASP A 1 54  ? -14.444 -17.065 2.664   1.00 0.00 ? 761 ASP A CA   4  
ATOM 6482  C C    . ASP A 1 54  ? -14.195 -18.085 1.570   1.00 0.00 ? 761 ASP A C    4  
ATOM 6483  O O    . ASP A 1 54  ? -14.633 -19.230 1.649   1.00 0.00 ? 761 ASP A O    4  
ATOM 6484  C CB   . ASP A 1 54  ? -15.638 -16.182 2.275   1.00 0.00 ? 761 ASP A CB   4  
ATOM 6485  C CG   . ASP A 1 54  ? -16.921 -16.964 2.064   1.00 0.00 ? 761 ASP A CG   4  
ATOM 6486  O OD1  . ASP A 1 54  ? -17.602 -17.275 3.071   1.00 0.00 ? 761 ASP A OD1  4  
ATOM 6487  O OD2  . ASP A 1 54  ? -17.276 -17.255 0.905   1.00 0.00 ? 761 ASP A OD2  4  
ATOM 6488  H H    . ASP A 1 54  ? -13.290 -15.304 2.537   1.00 0.00 ? 761 ASP A H    4  
ATOM 6489  H HA   . ASP A 1 54  ? -14.675 -17.568 3.591   1.00 0.00 ? 761 ASP A HA   4  
ATOM 6490  H HB2  . ASP A 1 54  ? -15.807 -15.452 3.052   1.00 0.00 ? 761 ASP A HB2  4  
ATOM 6491  H HB3  . ASP A 1 54  ? -15.398 -15.663 1.359   1.00 0.00 ? 761 ASP A HB3  4  
ATOM 6492  N N    . SER A 1 55  ? -13.442 -17.679 0.590   1.00 0.00 ? 762 SER A N    4  
ATOM 6493  C CA   . SER A 1 55  ? -13.190 -18.483 -0.563  1.00 0.00 ? 762 SER A CA   4  
ATOM 6494  C C    . SER A 1 55  ? -11.874 -18.053 -1.163  1.00 0.00 ? 762 SER A C    4  
ATOM 6495  O O    . SER A 1 55  ? -11.447 -16.927 -0.934  1.00 0.00 ? 762 SER A O    4  
ATOM 6496  C CB   . SER A 1 55  ? -14.329 -18.278 -1.572  1.00 0.00 ? 762 SER A CB   4  
ATOM 6497  O OG   . SER A 1 55  ? -14.140 -19.020 -2.775  1.00 0.00 ? 762 SER A OG   4  
ATOM 6498  H H    . SER A 1 55  ? -12.998 -16.808 0.646   1.00 0.00 ? 762 SER A H    4  
ATOM 6499  H HA   . SER A 1 55  ? -13.156 -19.520 -0.272  1.00 0.00 ? 762 SER A HA   4  
ATOM 6500  H HB2  . SER A 1 55  ? -15.261 -18.581 -1.120  1.00 0.00 ? 762 SER A HB2  4  
ATOM 6501  H HB3  . SER A 1 55  ? -14.374 -17.227 -1.816  1.00 0.00 ? 762 SER A HB3  4  
ATOM 6502  H HG   . SER A 1 55  ? -14.757 -18.628 -3.420  1.00 0.00 ? 762 SER A HG   4  
ATOM 6503  N N    . GLU A 1 56  ? -11.255 -18.937 -1.927  1.00 0.00 ? 763 GLU A N    4  
ATOM 6504  C CA   . GLU A 1 56  ? -9.990  -18.689 -2.630  1.00 0.00 ? 763 GLU A CA   4  
ATOM 6505  C C    . GLU A 1 56  ? -10.092 -17.400 -3.453  1.00 0.00 ? 763 GLU A C    4  
ATOM 6506  O O    . GLU A 1 56  ? -9.143  -16.628 -3.539  1.00 0.00 ? 763 GLU A O    4  
ATOM 6507  C CB   . GLU A 1 56  ? -9.704  -19.880 -3.541  1.00 0.00 ? 763 GLU A CB   4  
ATOM 6508  C CG   . GLU A 1 56  ? -8.424  -19.791 -4.343  1.00 0.00 ? 763 GLU A CG   4  
ATOM 6509  C CD   . GLU A 1 56  ? -8.292  -20.946 -5.293  1.00 0.00 ? 763 GLU A CD   4  
ATOM 6510  O OE1  . GLU A 1 56  ? -8.888  -20.894 -6.392  1.00 0.00 ? 763 GLU A OE1  4  
ATOM 6511  O OE2  . GLU A 1 56  ? -7.613  -21.937 -4.959  1.00 0.00 ? 763 GLU A OE2  4  
ATOM 6512  H H    . GLU A 1 56  ? -11.669 -19.824 -2.014  1.00 0.00 ? 763 GLU A H    4  
ATOM 6513  H HA   . GLU A 1 56  ? -9.191  -18.587 -1.910  1.00 0.00 ? 763 GLU A HA   4  
ATOM 6514  H HB2  . GLU A 1 56  ? -9.650  -20.772 -2.936  1.00 0.00 ? 763 GLU A HB2  4  
ATOM 6515  H HB3  . GLU A 1 56  ? -10.528 -19.986 -4.231  1.00 0.00 ? 763 GLU A HB3  4  
ATOM 6516  H HG2  . GLU A 1 56  ? -8.433  -18.872 -4.910  1.00 0.00 ? 763 GLU A HG2  4  
ATOM 6517  H HG3  . GLU A 1 56  ? -7.580  -19.794 -3.669  1.00 0.00 ? 763 GLU A HG3  4  
ATOM 6518  N N    . GLU A 1 57  ? -11.286 -17.170 -3.989  1.00 0.00 ? 764 GLU A N    4  
ATOM 6519  C CA   . GLU A 1 57  ? -11.630 -15.975 -4.762  1.00 0.00 ? 764 GLU A CA   4  
ATOM 6520  C C    . GLU A 1 57  ? -11.303 -14.722 -3.953  1.00 0.00 ? 764 GLU A C    4  
ATOM 6521  O O    . GLU A 1 57  ? -10.680 -13.813 -4.445  1.00 0.00 ? 764 GLU A O    4  
ATOM 6522  C CB   . GLU A 1 57  ? -13.121 -16.001 -5.041  1.00 0.00 ? 764 GLU A CB   4  
ATOM 6523  C CG   . GLU A 1 57  ? -13.592 -17.256 -5.739  1.00 0.00 ? 764 GLU A CG   4  
ATOM 6524  C CD   . GLU A 1 57  ? -15.083 -17.399 -5.693  1.00 0.00 ? 764 GLU A CD   4  
ATOM 6525  O OE1  . GLU A 1 57  ? -15.607 -17.813 -4.641  1.00 0.00 ? 764 GLU A OE1  4  
ATOM 6526  O OE2  . GLU A 1 57  ? -15.760 -17.110 -6.692  1.00 0.00 ? 764 GLU A OE2  4  
ATOM 6527  H H    . GLU A 1 57  ? -11.977 -17.852 -3.852  1.00 0.00 ? 764 GLU A H    4  
ATOM 6528  H HA   . GLU A 1 57  ? -11.092 -15.975 -5.698  1.00 0.00 ? 764 GLU A HA   4  
ATOM 6529  H HB2  . GLU A 1 57  ? -13.643 -15.924 -4.099  1.00 0.00 ? 764 GLU A HB2  4  
ATOM 6530  H HB3  . GLU A 1 57  ? -13.376 -15.150 -5.654  1.00 0.00 ? 764 GLU A HB3  4  
ATOM 6531  H HG2  . GLU A 1 57  ? -13.280 -17.219 -6.772  1.00 0.00 ? 764 GLU A HG2  4  
ATOM 6532  H HG3  . GLU A 1 57  ? -13.145 -18.114 -5.260  1.00 0.00 ? 764 GLU A HG3  4  
ATOM 6533  N N    . GLU A 1 58  ? -11.696 -14.734 -2.685  1.00 0.00 ? 765 GLU A N    4  
ATOM 6534  C CA   . GLU A 1 58  ? -11.462 -13.628 -1.767  1.00 0.00 ? 765 GLU A CA   4  
ATOM 6535  C C    . GLU A 1 58  ? -9.989  -13.385 -1.561  1.00 0.00 ? 765 GLU A C    4  
ATOM 6536  O O    . GLU A 1 58  ? -9.548  -12.243 -1.515  1.00 0.00 ? 765 GLU A O    4  
ATOM 6537  C CB   . GLU A 1 58  ? -12.117 -13.903 -0.419  1.00 0.00 ? 765 GLU A CB   4  
ATOM 6538  C CG   . GLU A 1 58  ? -13.618 -13.924 -0.467  1.00 0.00 ? 765 GLU A CG   4  
ATOM 6539  C CD   . GLU A 1 58  ? -14.163 -12.588 -0.881  1.00 0.00 ? 765 GLU A CD   4  
ATOM 6540  O OE1  . GLU A 1 58  ? -14.228 -11.679 -0.028  1.00 0.00 ? 765 GLU A OE1  4  
ATOM 6541  O OE2  . GLU A 1 58  ? -14.504 -12.408 -2.050  1.00 0.00 ? 765 GLU A OE2  4  
ATOM 6542  H H    . GLU A 1 58  ? -12.160 -15.529 -2.350  1.00 0.00 ? 765 GLU A H    4  
ATOM 6543  H HA   . GLU A 1 58  ? -11.914 -12.742 -2.188  1.00 0.00 ? 765 GLU A HA   4  
ATOM 6544  H HB2  . GLU A 1 58  ? -11.779 -14.865 -0.063  1.00 0.00 ? 765 GLU A HB2  4  
ATOM 6545  H HB3  . GLU A 1 58  ? -11.806 -13.142 0.281   1.00 0.00 ? 765 GLU A HB3  4  
ATOM 6546  H HG2  . GLU A 1 58  ? -13.927 -14.675 -1.177  1.00 0.00 ? 765 GLU A HG2  4  
ATOM 6547  H HG3  . GLU A 1 58  ? -13.992 -14.169 0.516   1.00 0.00 ? 765 GLU A HG3  4  
ATOM 6548  N N    . LEU A 1 59  ? -9.234  -14.460 -1.451  1.00 0.00 ? 766 LEU A N    4  
ATOM 6549  C CA   . LEU A 1 59  ? -7.801  -14.370 -1.233  1.00 0.00 ? 766 LEU A CA   4  
ATOM 6550  C C    . LEU A 1 59  ? -7.136  -13.767 -2.452  1.00 0.00 ? 766 LEU A C    4  
ATOM 6551  O O    . LEU A 1 59  ? -6.348  -12.821 -2.337  1.00 0.00 ? 766 LEU A O    4  
ATOM 6552  C CB   . LEU A 1 59  ? -7.209  -15.751 -0.917  1.00 0.00 ? 766 LEU A CB   4  
ATOM 6553  C CG   . LEU A 1 59  ? -5.699  -15.800 -0.637  1.00 0.00 ? 766 LEU A CG   4  
ATOM 6554  C CD1  . LEU A 1 59  ? -5.338  -14.968 0.589   1.00 0.00 ? 766 LEU A CD1  4  
ATOM 6555  C CD2  . LEU A 1 59  ? -5.249  -17.236 -0.459  1.00 0.00 ? 766 LEU A CD2  4  
ATOM 6556  H H    . LEU A 1 59  ? -9.660  -15.339 -1.539  1.00 0.00 ? 766 LEU A H    4  
ATOM 6557  H HA   . LEU A 1 59  ? -7.636  -13.714 -0.391  1.00 0.00 ? 766 LEU A HA   4  
ATOM 6558  H HB2  . LEU A 1 59  ? -7.722  -16.141 -0.051  1.00 0.00 ? 766 LEU A HB2  4  
ATOM 6559  H HB3  . LEU A 1 59  ? -7.415  -16.401 -1.755  1.00 0.00 ? 766 LEU A HB3  4  
ATOM 6560  H HG   . LEU A 1 59  ? -5.175  -15.383 -1.485  1.00 0.00 ? 766 LEU A HG   4  
ATOM 6561  H HD11 . LEU A 1 59  ? -5.860  -15.351 1.454   1.00 0.00 ? 766 LEU A HD11 4  
ATOM 6562  H HD12 . LEU A 1 59  ? -5.615  -13.938 0.428   1.00 0.00 ? 766 LEU A HD12 4  
ATOM 6563  H HD13 . LEU A 1 59  ? -4.273  -15.029 0.758   1.00 0.00 ? 766 LEU A HD13 4  
ATOM 6564  H HD21 . LEU A 1 59  ? -4.188  -17.259 -0.258  1.00 0.00 ? 766 LEU A HD21 4  
ATOM 6565  H HD22 . LEU A 1 59  ? -5.455  -17.794 -1.361  1.00 0.00 ? 766 LEU A HD22 4  
ATOM 6566  H HD23 . LEU A 1 59  ? -5.780  -17.682 0.367   1.00 0.00 ? 766 LEU A HD23 4  
ATOM 6567  N N    . ILE A 1 60  ? -7.493  -14.288 -3.612  1.00 0.00 ? 767 ILE A N    4  
ATOM 6568  C CA   . ILE A 1 60  ? -6.975  -13.794 -4.875  1.00 0.00 ? 767 ILE A CA   4  
ATOM 6569  C C    . ILE A 1 60  ? -7.404  -12.339 -5.082  1.00 0.00 ? 767 ILE A C    4  
ATOM 6570  O O    . ILE A 1 60  ? -6.609  -11.513 -5.506  1.00 0.00 ? 767 ILE A O    4  
ATOM 6571  C CB   . ILE A 1 60  ? -7.446  -14.674 -6.061  1.00 0.00 ? 767 ILE A CB   4  
ATOM 6572  C CG1  . ILE A 1 60  ? -6.988  -16.122 -5.844  1.00 0.00 ? 767 ILE A CG1  4  
ATOM 6573  C CG2  . ILE A 1 60  ? -6.899  -14.135 -7.382  1.00 0.00 ? 767 ILE A CG2  4  
ATOM 6574  C CD1  . ILE A 1 60  ? -7.500  -17.091 -6.882  1.00 0.00 ? 767 ILE A CD1  4  
ATOM 6575  H H    . ILE A 1 60  ? -8.124  -15.043 -3.615  1.00 0.00 ? 767 ILE A H    4  
ATOM 6576  H HA   . ILE A 1 60  ? -5.897  -13.825 -4.818  1.00 0.00 ? 767 ILE A HA   4  
ATOM 6577  H HB   . ILE A 1 60  ? -8.525  -14.653 -6.099  1.00 0.00 ? 767 ILE A HB   4  
ATOM 6578  H HG12 . ILE A 1 60  ? -5.910  -16.158 -5.873  1.00 0.00 ? 767 ILE A HG12 4  
ATOM 6579  H HG13 . ILE A 1 60  ? -7.327  -16.458 -4.875  1.00 0.00 ? 767 ILE A HG13 4  
ATOM 6580  H HG21 . ILE A 1 60  ? -7.234  -14.768 -8.189  1.00 0.00 ? 767 ILE A HG21 4  
ATOM 6581  H HG22 . ILE A 1 60  ? -5.819  -14.129 -7.353  1.00 0.00 ? 767 ILE A HG22 4  
ATOM 6582  H HG23 . ILE A 1 60  ? -7.264  -13.131 -7.536  1.00 0.00 ? 767 ILE A HG23 4  
ATOM 6583  H HD11 . ILE A 1 60  ? -8.579  -17.085 -6.881  1.00 0.00 ? 767 ILE A HD11 4  
ATOM 6584  H HD12 . ILE A 1 60  ? -7.150  -18.084 -6.645  1.00 0.00 ? 767 ILE A HD12 4  
ATOM 6585  H HD13 . ILE A 1 60  ? -7.137  -16.802 -7.857  1.00 0.00 ? 767 ILE A HD13 4  
ATOM 6586  N N    . ASN A 1 61  ? -8.646  -12.036 -4.745  1.00 0.00 ? 768 ASN A N    4  
ATOM 6587  C CA   . ASN A 1 61  ? -9.173  -10.679 -4.802  1.00 0.00 ? 768 ASN A CA   4  
ATOM 6588  C C    . ASN A 1 61  ? -8.381  -9.740  -3.908  1.00 0.00 ? 768 ASN A C    4  
ATOM 6589  O O    . ASN A 1 61  ? -7.933  -8.697  -4.350  1.00 0.00 ? 768 ASN A O    4  
ATOM 6590  C CB   . ASN A 1 61  ? -10.673 -10.641 -4.437  1.00 0.00 ? 768 ASN A CB   4  
ATOM 6591  C CG   . ASN A 1 61  ? -11.138 -9.255  -4.030  1.00 0.00 ? 768 ASN A CG   4  
ATOM 6592  O OD1  . ASN A 1 61  ? -11.503 -8.430  -4.860  1.00 0.00 ? 768 ASN A OD1  4  
ATOM 6593  N ND2  . ASN A 1 61  ? -11.169 -9.011  -2.740  1.00 0.00 ? 768 ASN A ND2  4  
ATOM 6594  H H    . ASN A 1 61  ? -9.261  -12.758 -4.476  1.00 0.00 ? 768 ASN A H    4  
ATOM 6595  H HA   . ASN A 1 61  ? -9.061  -10.339 -5.822  1.00 0.00 ? 768 ASN A HA   4  
ATOM 6596  H HB2  . ASN A 1 61  ? -11.259 -10.958 -5.286  1.00 0.00 ? 768 ASN A HB2  4  
ATOM 6597  H HB3  . ASN A 1 61  ? -10.844 -11.318 -3.613  1.00 0.00 ? 768 ASN A HB3  4  
ATOM 6598  H HD21 . ASN A 1 61  ? -10.909 -9.735  -2.133  1.00 0.00 ? 768 ASN A HD21 4  
ATOM 6599  H HD22 . ASN A 1 61  ? -11.422 -8.118  -2.433  1.00 0.00 ? 768 ASN A HD22 4  
ATOM 6600  N N    . LYS A 1 62  ? -8.183  -10.131 -2.658  1.00 0.00 ? 769 LYS A N    4  
ATOM 6601  C CA   . LYS A 1 62  ? -7.438  -9.321  -1.702  1.00 0.00 ? 769 LYS A CA   4  
ATOM 6602  C C    . LYS A 1 62  ? -6.009  -9.111  -2.185  1.00 0.00 ? 769 LYS A C    4  
ATOM 6603  O O    . LYS A 1 62  ? -5.453  -8.024  -2.049  1.00 0.00 ? 769 LYS A O    4  
ATOM 6604  C CB   . LYS A 1 62  ? -7.471  -9.964  -0.307  1.00 0.00 ? 769 LYS A CB   4  
ATOM 6605  C CG   . LYS A 1 62  ? -8.831  -9.863  0.400   1.00 0.00 ? 769 LYS A CG   4  
ATOM 6606  C CD   . LYS A 1 62  ? -9.090  -8.450  0.917   1.00 0.00 ? 769 LYS A CD   4  
ATOM 6607  C CE   . LYS A 1 62  ? -10.518 -8.274  1.432   1.00 0.00 ? 769 LYS A CE   4  
ATOM 6608  N NZ   . LYS A 1 62  ? -10.900 -9.248  2.482   1.00 0.00 ? 769 LYS A NZ   4  
ATOM 6609  H H    . LYS A 1 62  ? -8.540  -11.005 -2.379  1.00 0.00 ? 769 LYS A H    4  
ATOM 6610  H HA   . LYS A 1 62  ? -7.933  -8.360  -1.656  1.00 0.00 ? 769 LYS A HA   4  
ATOM 6611  H HB2  . LYS A 1 62  ? -7.223  -11.011 -0.408  1.00 0.00 ? 769 LYS A HB2  4  
ATOM 6612  H HB3  . LYS A 1 62  ? -6.728  -9.485  0.315   1.00 0.00 ? 769 LYS A HB3  4  
ATOM 6613  H HG2  . LYS A 1 62  ? -9.610  -10.125 -0.300  1.00 0.00 ? 769 LYS A HG2  4  
ATOM 6614  H HG3  . LYS A 1 62  ? -8.852  -10.552 1.231   1.00 0.00 ? 769 LYS A HG3  4  
ATOM 6615  H HD2  . LYS A 1 62  ? -8.404  -8.244  1.726   1.00 0.00 ? 769 LYS A HD2  4  
ATOM 6616  H HD3  . LYS A 1 62  ? -8.915  -7.744  0.119   1.00 0.00 ? 769 LYS A HD3  4  
ATOM 6617  H HE2  . LYS A 1 62  ? -10.609 -7.280  1.845   1.00 0.00 ? 769 LYS A HE2  4  
ATOM 6618  H HE3  . LYS A 1 62  ? -11.188 -8.370  0.592   1.00 0.00 ? 769 LYS A HE3  4  
ATOM 6619  H HZ1  . LYS A 1 62  ? -11.857 -9.018  2.817   1.00 0.00 ? 769 LYS A HZ1  4  
ATOM 6620  H HZ2  . LYS A 1 62  ? -10.292 -9.255  3.334   1.00 0.00 ? 769 LYS A HZ2  4  
ATOM 6621  H HZ3  . LYS A 1 62  ? -10.967 -10.217 2.109   1.00 0.00 ? 769 LYS A HZ3  4  
ATOM 6622  N N    . LYS A 1 63  ? -5.452  -10.145 -2.794  1.00 0.00 ? 770 LYS A N    4  
ATOM 6623  C CA   . LYS A 1 63  ? -4.124  -10.095 -3.368  1.00 0.00 ? 770 LYS A CA   4  
ATOM 6624  C C    . LYS A 1 63  ? -4.107  -9.179  -4.602  1.00 0.00 ? 770 LYS A C    4  
ATOM 6625  O O    . LYS A 1 63  ? -3.162  -8.435  -4.821  1.00 0.00 ? 770 LYS A O    4  
ATOM 6626  C CB   . LYS A 1 63  ? -3.656  -11.506 -3.743  1.00 0.00 ? 770 LYS A CB   4  
ATOM 6627  C CG   . LYS A 1 63  ? -2.241  -11.578 -4.309  1.00 0.00 ? 770 LYS A CG   4  
ATOM 6628  C CD   . LYS A 1 63  ? -1.844  -13.006 -4.678  1.00 0.00 ? 770 LYS A CD   4  
ATOM 6629  C CE   . LYS A 1 63  ? -1.851  -13.929 -3.468  1.00 0.00 ? 770 LYS A CE   4  
ATOM 6630  N NZ   . LYS A 1 63  ? -1.423  -15.298 -3.806  1.00 0.00 ? 770 LYS A NZ   4  
ATOM 6631  H H    . LYS A 1 63  ? -5.956  -10.989 -2.848  1.00 0.00 ? 770 LYS A H    4  
ATOM 6632  H HA   . LYS A 1 63  ? -3.460  -9.695  -2.615  1.00 0.00 ? 770 LYS A HA   4  
ATOM 6633  H HB2  . LYS A 1 63  ? -3.698  -12.118 -2.854  1.00 0.00 ? 770 LYS A HB2  4  
ATOM 6634  H HB3  . LYS A 1 63  ? -4.338  -11.911 -4.476  1.00 0.00 ? 770 LYS A HB3  4  
ATOM 6635  H HG2  . LYS A 1 63  ? -2.188  -10.961 -5.194  1.00 0.00 ? 770 LYS A HG2  4  
ATOM 6636  H HG3  . LYS A 1 63  ? -1.550  -11.200 -3.568  1.00 0.00 ? 770 LYS A HG3  4  
ATOM 6637  H HD2  . LYS A 1 63  ? -2.543  -13.386 -5.408  1.00 0.00 ? 770 LYS A HD2  4  
ATOM 6638  H HD3  . LYS A 1 63  ? -0.852  -12.991 -5.104  1.00 0.00 ? 770 LYS A HD3  4  
ATOM 6639  H HE2  . LYS A 1 63  ? -1.182  -13.532 -2.718  1.00 0.00 ? 770 LYS A HE2  4  
ATOM 6640  H HE3  . LYS A 1 63  ? -2.853  -13.968 -3.068  1.00 0.00 ? 770 LYS A HE3  4  
ATOM 6641  H HZ1  . LYS A 1 63  ? -2.040  -15.718 -4.529  1.00 0.00 ? 770 LYS A HZ1  4  
ATOM 6642  H HZ2  . LYS A 1 63  ? -1.499  -15.910 -2.967  1.00 0.00 ? 770 LYS A HZ2  4  
ATOM 6643  H HZ3  . LYS A 1 63  ? -0.442  -15.331 -4.145  1.00 0.00 ? 770 LYS A HZ3  4  
ATOM 6644  N N    . ARG A 1 64  ? -5.164  -9.228  -5.381  1.00 0.00 ? 771 ARG A N    4  
ATOM 6645  C CA   . ARG A 1 64  ? -5.278  -8.424  -6.585  1.00 0.00 ? 771 ARG A CA   4  
ATOM 6646  C C    . ARG A 1 64  ? -5.432  -6.952  -6.225  1.00 0.00 ? 771 ARG A C    4  
ATOM 6647  O O    . ARG A 1 64  ? -4.843  -6.083  -6.864  1.00 0.00 ? 771 ARG A O    4  
ATOM 6648  C CB   . ARG A 1 64  ? -6.481  -8.876  -7.425  1.00 0.00 ? 771 ARG A CB   4  
ATOM 6649  C CG   . ARG A 1 64  ? -6.527  -8.281  -8.829  1.00 0.00 ? 771 ARG A CG   4  
ATOM 6650  C CD   . ARG A 1 64  ? -5.339  -8.762  -9.652  1.00 0.00 ? 771 ARG A CD   4  
ATOM 6651  N NE   . ARG A 1 64  ? -5.302  -10.224 -9.716  1.00 0.00 ? 771 ARG A NE   4  
ATOM 6652  C CZ   . ARG A 1 64  ? -4.199  -10.976 -9.686  1.00 0.00 ? 771 ARG A CZ   4  
ATOM 6653  N NH1  . ARG A 1 64  ? -2.989  -10.415 -9.686  1.00 0.00 ? 771 ARG A NH1  4  
ATOM 6654  N NH2  . ARG A 1 64  ? -4.316  -12.300 -9.674  1.00 0.00 ? 771 ARG A NH2  4  
ATOM 6655  H H    . ARG A 1 64  ? -5.890  -9.853  -5.154  1.00 0.00 ? 771 ARG A H    4  
ATOM 6656  H HA   . ARG A 1 64  ? -4.377  -8.557  -7.164  1.00 0.00 ? 771 ARG A HA   4  
ATOM 6657  H HB2  . ARG A 1 64  ? -6.457  -9.953  -7.513  1.00 0.00 ? 771 ARG A HB2  4  
ATOM 6658  H HB3  . ARG A 1 64  ? -7.386  -8.592  -6.906  1.00 0.00 ? 771 ARG A HB3  4  
ATOM 6659  H HG2  . ARG A 1 64  ? -7.444  -8.585  -9.314  1.00 0.00 ? 771 ARG A HG2  4  
ATOM 6660  H HG3  . ARG A 1 64  ? -6.494  -7.204  -8.759  1.00 0.00 ? 771 ARG A HG3  4  
ATOM 6661  H HD2  . ARG A 1 64  ? -5.429  -8.369  -10.653 1.00 0.00 ? 771 ARG A HD2  4  
ATOM 6662  H HD3  . ARG A 1 64  ? -4.423  -8.403  -9.207  1.00 0.00 ? 771 ARG A HD3  4  
ATOM 6663  H HE   . ARG A 1 64  ? -6.187  -10.655 -9.759  1.00 0.00 ? 771 ARG A HE   4  
ATOM 6664  H HH11 . ARG A 1 64  ? -2.832  -9.416  -9.709  1.00 0.00 ? 771 ARG A HH11 4  
ATOM 6665  H HH12 . ARG A 1 64  ? -2.149  -10.961 -9.670  1.00 0.00 ? 771 ARG A HH12 4  
ATOM 6666  H HH21 . ARG A 1 64  ? -5.221  -12.735 -9.699  1.00 0.00 ? 771 ARG A HH21 4  
ATOM 6667  H HH22 . ARG A 1 64  ? -3.511  -12.899 -9.610  1.00 0.00 ? 771 ARG A HH22 4  
ATOM 6668  N N    . ILE A 1 65  ? -6.213  -6.685  -5.200  1.00 0.00 ? 772 ILE A N    4  
ATOM 6669  C CA   . ILE A 1 65  ? -6.452  -5.327  -4.757  1.00 0.00 ? 772 ILE A CA   4  
ATOM 6670  C C    . ILE A 1 65  ? -5.188  -4.741  -4.144  1.00 0.00 ? 772 ILE A C    4  
ATOM 6671  O O    . ILE A 1 65  ? -4.811  -3.612  -4.467  1.00 0.00 ? 772 ILE A O    4  
ATOM 6672  C CB   . ILE A 1 65  ? -7.634  -5.230  -3.750  1.00 0.00 ? 772 ILE A CB   4  
ATOM 6673  C CG1  . ILE A 1 65  ? -8.923  -5.792  -4.370  1.00 0.00 ? 772 ILE A CG1  4  
ATOM 6674  C CG2  . ILE A 1 65  ? -7.858  -3.779  -3.304  1.00 0.00 ? 772 ILE A CG2  4  
ATOM 6675  C CD1  . ILE A 1 65  ? -9.410  -5.061  -5.609  1.00 0.00 ? 772 ILE A CD1  4  
ATOM 6676  H H    . ILE A 1 65  ? -6.653  -7.439  -4.744  1.00 0.00 ? 772 ILE A H    4  
ATOM 6677  H HA   . ILE A 1 65  ? -6.695  -4.745  -5.634  1.00 0.00 ? 772 ILE A HA   4  
ATOM 6678  H HB   . ILE A 1 65  ? -7.378  -5.819  -2.882  1.00 0.00 ? 772 ILE A HB   4  
ATOM 6679  H HG12 . ILE A 1 65  ? -8.756  -6.823  -4.649  1.00 0.00 ? 772 ILE A HG12 4  
ATOM 6680  H HG13 . ILE A 1 65  ? -9.708  -5.757  -3.629  1.00 0.00 ? 772 ILE A HG13 4  
ATOM 6681  H HG21 . ILE A 1 65  ? -8.667  -3.742  -2.590  1.00 0.00 ? 772 ILE A HG21 4  
ATOM 6682  H HG22 . ILE A 1 65  ? -8.118  -3.181  -4.165  1.00 0.00 ? 772 ILE A HG22 4  
ATOM 6683  H HG23 . ILE A 1 65  ? -6.954  -3.392  -2.858  1.00 0.00 ? 772 ILE A HG23 4  
ATOM 6684  H HD11 . ILE A 1 65  ? -9.588  -4.026  -5.360  1.00 0.00 ? 772 ILE A HD11 4  
ATOM 6685  H HD12 . ILE A 1 65  ? -10.335 -5.510  -5.941  1.00 0.00 ? 772 ILE A HD12 4  
ATOM 6686  H HD13 . ILE A 1 65  ? -8.673  -5.128  -6.394  1.00 0.00 ? 772 ILE A HD13 4  
ATOM 6687  N N    . ILE A 1 66  ? -4.506  -5.522  -3.293  1.00 0.00 ? 773 ILE A N    4  
ATOM 6688  C CA   . ILE A 1 66  ? -3.280  -5.045  -2.672  1.00 0.00 ? 773 ILE A CA   4  
ATOM 6689  C C    . ILE A 1 66  ? -2.208  -4.790  -3.762  1.00 0.00 ? 773 ILE A C    4  
ATOM 6690  O O    . ILE A 1 66  ? -1.453  -3.835  -3.689  1.00 0.00 ? 773 ILE A O    4  
ATOM 6691  C CB   . ILE A 1 66  ? -2.758  -6.000  -1.529  1.00 0.00 ? 773 ILE A CB   4  
ATOM 6692  C CG1  . ILE A 1 66  ? -1.617  -5.361  -0.743  1.00 0.00 ? 773 ILE A CG1  4  
ATOM 6693  C CG2  . ILE A 1 66  ? -2.315  -7.337  -2.057  1.00 0.00 ? 773 ILE A CG2  4  
ATOM 6694  C CD1  . ILE A 1 66  ? -2.002  -4.094  -0.016  1.00 0.00 ? 773 ILE A CD1  4  
ATOM 6695  H H    . ILE A 1 66  ? -4.839  -6.423  -3.080  1.00 0.00 ? 773 ILE A H    4  
ATOM 6696  H HA   . ILE A 1 66  ? -3.552  -4.095  -2.234  1.00 0.00 ? 773 ILE A HA   4  
ATOM 6697  H HB   . ILE A 1 66  ? -3.580  -6.171  -0.849  1.00 0.00 ? 773 ILE A HB   4  
ATOM 6698  H HG12 . ILE A 1 66  ? -1.271  -6.076  -0.010  1.00 0.00 ? 773 ILE A HG12 4  
ATOM 6699  H HG13 . ILE A 1 66  ? -0.814  -5.128  -1.426  1.00 0.00 ? 773 ILE A HG13 4  
ATOM 6700  H HG21 . ILE A 1 66  ? -1.442  -7.219  -2.681  1.00 0.00 ? 773 ILE A HG21 4  
ATOM 6701  H HG22 . ILE A 1 66  ? -3.118  -7.739  -2.657  1.00 0.00 ? 773 ILE A HG22 4  
ATOM 6702  H HG23 . ILE A 1 66  ? -2.104  -8.006  -1.237  1.00 0.00 ? 773 ILE A HG23 4  
ATOM 6703  H HD11 . ILE A 1 66  ? -1.146  -3.728  0.533   1.00 0.00 ? 773 ILE A HD11 4  
ATOM 6704  H HD12 . ILE A 1 66  ? -2.812  -4.299  0.667   1.00 0.00 ? 773 ILE A HD12 4  
ATOM 6705  H HD13 . ILE A 1 66  ? -2.312  -3.346  -0.730  1.00 0.00 ? 773 ILE A HD13 4  
ATOM 6706  N N    . GLU A 1 67  ? -2.225  -5.618  -4.800  1.00 0.00 ? 774 GLU A N    4  
ATOM 6707  C CA   . GLU A 1 67  ? -1.355  -5.456  -5.953  1.00 0.00 ? 774 GLU A CA   4  
ATOM 6708  C C    . GLU A 1 67  ? -1.690  -4.159  -6.706  1.00 0.00 ? 774 GLU A C    4  
ATOM 6709  O O    . GLU A 1 67  ? -0.802  -3.338  -6.995  1.00 0.00 ? 774 GLU A O    4  
ATOM 6710  C CB   . GLU A 1 67  ? -1.515  -6.660  -6.887  1.00 0.00 ? 774 GLU A CB   4  
ATOM 6711  C CG   . GLU A 1 67  ? -0.790  -6.532  -8.206  1.00 0.00 ? 774 GLU A CG   4  
ATOM 6712  C CD   . GLU A 1 67  ? -0.975  -7.732  -9.083  1.00 0.00 ? 774 GLU A CD   4  
ATOM 6713  O OE1  . GLU A 1 67  ? -2.039  -7.855  -9.743  1.00 0.00 ? 774 GLU A OE1  4  
ATOM 6714  O OE2  . GLU A 1 67  ? -0.069  -8.579  -9.140  1.00 0.00 ? 774 GLU A OE2  4  
ATOM 6715  H H    . GLU A 1 67  ? -2.837  -6.386  -4.783  1.00 0.00 ? 774 GLU A H    4  
ATOM 6716  H HA   . GLU A 1 67  ? -0.335  -5.417  -5.603  1.00 0.00 ? 774 GLU A HA   4  
ATOM 6717  H HB2  . GLU A 1 67  ? -1.145  -7.541  -6.384  1.00 0.00 ? 774 GLU A HB2  4  
ATOM 6718  H HB3  . GLU A 1 67  ? -2.567  -6.794  -7.090  1.00 0.00 ? 774 GLU A HB3  4  
ATOM 6719  H HG2  . GLU A 1 67  ? -1.173  -5.664  -8.722  1.00 0.00 ? 774 GLU A HG2  4  
ATOM 6720  H HG3  . GLU A 1 67  ? 0.263   -6.394  -8.007  1.00 0.00 ? 774 GLU A HG3  4  
ATOM 6721  N N    . LYS A 1 68  ? -2.974  -3.972  -6.998  1.00 0.00 ? 775 LYS A N    4  
ATOM 6722  C CA   . LYS A 1 68  ? -3.442  -2.806  -7.733  1.00 0.00 ? 775 LYS A CA   4  
ATOM 6723  C C    . LYS A 1 68  ? -3.124  -1.521  -6.987  1.00 0.00 ? 775 LYS A C    4  
ATOM 6724  O O    . LYS A 1 68  ? -2.708  -0.537  -7.601  1.00 0.00 ? 775 LYS A O    4  
ATOM 6725  C CB   . LYS A 1 68  ? -4.954  -2.893  -8.025  1.00 0.00 ? 775 LYS A CB   4  
ATOM 6726  C CG   . LYS A 1 68  ? -5.514  -1.707  -8.833  1.00 0.00 ? 775 LYS A CG   4  
ATOM 6727  C CD   . LYS A 1 68  ? -4.876  -1.589  -10.226 1.00 0.00 ? 775 LYS A CD   4  
ATOM 6728  C CE   . LYS A 1 68  ? -5.218  -2.775  -11.118 1.00 0.00 ? 775 LYS A CE   4  
ATOM 6729  N NZ   . LYS A 1 68  ? -6.665  -2.843  -11.424 1.00 0.00 ? 775 LYS A NZ   4  
ATOM 6730  H H    . LYS A 1 68  ? -3.622  -4.656  -6.715  1.00 0.00 ? 775 LYS A H    4  
ATOM 6731  H HA   . LYS A 1 68  ? -2.914  -2.769  -8.675  1.00 0.00 ? 775 LYS A HA   4  
ATOM 6732  H HB2  . LYS A 1 68  ? -5.158  -3.805  -8.563  1.00 0.00 ? 775 LYS A HB2  4  
ATOM 6733  H HB3  . LYS A 1 68  ? -5.478  -2.931  -7.082  1.00 0.00 ? 775 LYS A HB3  4  
ATOM 6734  H HG2  . LYS A 1 68  ? -6.579  -1.828  -8.954  1.00 0.00 ? 775 LYS A HG2  4  
ATOM 6735  H HG3  . LYS A 1 68  ? -5.319  -0.796  -8.287  1.00 0.00 ? 775 LYS A HG3  4  
ATOM 6736  H HD2  . LYS A 1 68  ? -5.244  -0.689  -10.696 1.00 0.00 ? 775 LYS A HD2  4  
ATOM 6737  H HD3  . LYS A 1 68  ? -3.804  -1.521  -10.118 1.00 0.00 ? 775 LYS A HD3  4  
ATOM 6738  H HE2  . LYS A 1 68  ? -4.670  -2.686  -12.045 1.00 0.00 ? 775 LYS A HE2  4  
ATOM 6739  H HE3  . LYS A 1 68  ? -4.920  -3.684  -10.620 1.00 0.00 ? 775 LYS A HE3  4  
ATOM 6740  H HZ1  . LYS A 1 68  ? -6.955  -2.011  -11.978 1.00 0.00 ? 775 LYS A HZ1  4  
ATOM 6741  H HZ2  . LYS A 1 68  ? -7.247  -2.846  -10.561 1.00 0.00 ? 775 LYS A HZ2  4  
ATOM 6742  H HZ3  . LYS A 1 68  ? -6.890  -3.692  -11.975 1.00 0.00 ? 775 LYS A HZ3  4  
ATOM 6743  N N    . VAL A 1 69  ? -3.288  -1.523  -5.672  1.00 0.00 ? 776 VAL A N    4  
ATOM 6744  C CA   . VAL A 1 69  ? -2.998  -0.322  -4.918  1.00 0.00 ? 776 VAL A CA   4  
ATOM 6745  C C    . VAL A 1 69  ? -1.514  -0.039  -4.877  1.00 0.00 ? 776 VAL A C    4  
ATOM 6746  O O    . VAL A 1 69  ? -1.142  1.085   -4.911  1.00 0.00 ? 776 VAL A O    4  
ATOM 6747  C CB   . VAL A 1 69  ? -3.598  -0.271  -3.497  1.00 0.00 ? 776 VAL A CB   4  
ATOM 6748  C CG1  . VAL A 1 69  ? -5.111  -0.444  -3.537  1.00 0.00 ? 776 VAL A CG1  4  
ATOM 6749  C CG2  . VAL A 1 69  ? -2.936  -1.274  -2.574  1.00 0.00 ? 776 VAL A CG2  4  
ATOM 6750  H H    . VAL A 1 69  ? -3.618  -2.332  -5.217  1.00 0.00 ? 776 VAL A H    4  
ATOM 6751  H HA   . VAL A 1 69  ? -3.433  0.478   -5.501  1.00 0.00 ? 776 VAL A HA   4  
ATOM 6752  H HB   . VAL A 1 69  ? -3.409  0.723   -3.115  1.00 0.00 ? 776 VAL A HB   4  
ATOM 6753  H HG11 . VAL A 1 69  ? -5.544  0.328   -4.157  1.00 0.00 ? 776 VAL A HG11 4  
ATOM 6754  H HG12 . VAL A 1 69  ? -5.510  -0.360  -2.538  1.00 0.00 ? 776 VAL A HG12 4  
ATOM 6755  H HG13 . VAL A 1 69  ? -5.354  -1.414  -3.947  1.00 0.00 ? 776 VAL A HG13 4  
ATOM 6756  H HG21 . VAL A 1 69  ? -1.877  -1.064  -2.527  1.00 0.00 ? 776 VAL A HG21 4  
ATOM 6757  H HG22 . VAL A 1 69  ? -3.083  -2.268  -2.967  1.00 0.00 ? 776 VAL A HG22 4  
ATOM 6758  H HG23 . VAL A 1 69  ? -3.361  -1.197  -1.585  1.00 0.00 ? 776 VAL A HG23 4  
ATOM 6759  N N    . ILE A 1 70  ? -0.667  -1.076  -4.843  1.00 0.00 ? 777 ILE A N    4  
ATOM 6760  C CA   . ILE A 1 70  ? 0.780   -0.856  -4.890  1.00 0.00 ? 777 ILE A CA   4  
ATOM 6761  C C    . ILE A 1 70  ? 1.141   -0.172  -6.207  1.00 0.00 ? 777 ILE A C    4  
ATOM 6762  O O    . ILE A 1 70  ? 1.938   0.775   -6.243  1.00 0.00 ? 777 ILE A O    4  
ATOM 6763  C CB   . ILE A 1 70  ? 1.586   -2.182  -4.714  1.00 0.00 ? 777 ILE A CB   4  
ATOM 6764  C CG1  . ILE A 1 70  ? 1.380   -2.734  -3.298  1.00 0.00 ? 777 ILE A CG1  4  
ATOM 6765  C CG2  . ILE A 1 70  ? 3.081   -1.972  -4.998  1.00 0.00 ? 777 ILE A CG2  4  
ATOM 6766  C CD1  . ILE A 1 70  ? 2.020   -4.084  -3.059  1.00 0.00 ? 777 ILE A CD1  4  
ATOM 6767  H H    . ILE A 1 70  ? -1.018  -1.991  -4.777  1.00 0.00 ? 777 ILE A H    4  
ATOM 6768  H HA   . ILE A 1 70  ? 1.022   -0.177  -4.084  1.00 0.00 ? 777 ILE A HA   4  
ATOM 6769  H HB   . ILE A 1 70  ? 1.206   -2.901  -5.424  1.00 0.00 ? 777 ILE A HB   4  
ATOM 6770  H HG12 . ILE A 1 70  ? 1.805   -2.042  -2.586  1.00 0.00 ? 777 ILE A HG12 4  
ATOM 6771  H HG13 . ILE A 1 70  ? 0.320   -2.828  -3.108  1.00 0.00 ? 777 ILE A HG13 4  
ATOM 6772  H HG21 . ILE A 1 70  ? 3.477   -1.240  -4.309  1.00 0.00 ? 777 ILE A HG21 4  
ATOM 6773  H HG22 . ILE A 1 70  ? 3.211   -1.621  -6.011  1.00 0.00 ? 777 ILE A HG22 4  
ATOM 6774  H HG23 . ILE A 1 70  ? 3.605   -2.908  -4.870  1.00 0.00 ? 777 ILE A HG23 4  
ATOM 6775  H HD11 . ILE A 1 70  ? 3.081   -4.027  -3.249  1.00 0.00 ? 777 ILE A HD11 4  
ATOM 6776  H HD12 . ILE A 1 70  ? 1.570   -4.815  -3.715  1.00 0.00 ? 777 ILE A HD12 4  
ATOM 6777  H HD13 . ILE A 1 70  ? 1.855   -4.389  -2.035  1.00 0.00 ? 777 ILE A HD13 4  
ATOM 6778  N N    . HIS A 1 71  ? 0.510   -0.622  -7.268  1.00 0.00 ? 778 HIS A N    4  
ATOM 6779  C CA   . HIS A 1 71  ? 0.679   -0.022  -8.574  1.00 0.00 ? 778 HIS A CA   4  
ATOM 6780  C C    . HIS A 1 71  ? 0.150   1.432   -8.589  1.00 0.00 ? 778 HIS A C    4  
ATOM 6781  O O    . HIS A 1 71  ? 0.851   2.357   -8.995  1.00 0.00 ? 778 HIS A O    4  
ATOM 6782  C CB   . HIS A 1 71  ? -0.010  -0.893  -9.649  1.00 0.00 ? 778 HIS A CB   4  
ATOM 6783  C CG   . HIS A 1 71  ? -0.074  -0.270  -11.013 1.00 0.00 ? 778 HIS A CG   4  
ATOM 6784  N ND1  . HIS A 1 71  ? 1.028   0.037   -11.770 1.00 0.00 ? 778 HIS A ND1  4  
ATOM 6785  C CD2  . HIS A 1 71  ? -1.146  0.144   -11.719 1.00 0.00 ? 778 HIS A CD2  4  
ATOM 6786  C CE1  . HIS A 1 71  ? 0.611   0.626   -12.889 1.00 0.00 ? 778 HIS A CE1  4  
ATOM 6787  N NE2  . HIS A 1 71  ? -0.710  0.718   -12.913 1.00 0.00 ? 778 HIS A NE2  4  
ATOM 6788  H H    . HIS A 1 71  ? -0.083  -1.400  -7.160  1.00 0.00 ? 778 HIS A H    4  
ATOM 6789  H HA   . HIS A 1 71  ? 1.739   0.006   -8.777  1.00 0.00 ? 778 HIS A HA   4  
ATOM 6790  H HB2  . HIS A 1 71  ? 0.526   -1.825  -9.743  1.00 0.00 ? 778 HIS A HB2  4  
ATOM 6791  H HB3  . HIS A 1 71  ? -1.020  -1.101  -9.328  1.00 0.00 ? 778 HIS A HB3  4  
ATOM 6792  H HD1  . HIS A 1 71  ? 1.960   -0.155  -11.517 1.00 0.00 ? 778 HIS A HD1  4  
ATOM 6793  H HD2  . HIS A 1 71  ? -2.173  0.032   -11.402 1.00 0.00 ? 778 HIS A HD2  4  
ATOM 6794  H HE1  . HIS A 1 71  ? 1.264   0.980   -13.673 1.00 0.00 ? 778 HIS A HE1  4  
ATOM 6795  N N    . ARG A 1 72  ? -1.054  1.622   -8.112  1.00 0.00 ? 779 ARG A N    4  
ATOM 6796  C CA   . ARG A 1 72  ? -1.683  2.930   -8.117  1.00 0.00 ? 779 ARG A CA   4  
ATOM 6797  C C    . ARG A 1 72  ? -0.942  3.931   -7.213  1.00 0.00 ? 779 ARG A C    4  
ATOM 6798  O O    . ARG A 1 72  ? -0.670  5.063   -7.625  1.00 0.00 ? 779 ARG A O    4  
ATOM 6799  C CB   . ARG A 1 72  ? -3.150  2.826   -7.713  1.00 0.00 ? 779 ARG A CB   4  
ATOM 6800  C CG   . ARG A 1 72  ? -3.849  4.160   -7.701  1.00 0.00 ? 779 ARG A CG   4  
ATOM 6801  C CD   . ARG A 1 72  ? -5.247  4.063   -7.157  1.00 0.00 ? 779 ARG A CD   4  
ATOM 6802  N NE   . ARG A 1 72  ? -5.804  5.390   -6.920  1.00 0.00 ? 779 ARG A NE   4  
ATOM 6803  C CZ   . ARG A 1 72  ? -7.095  5.719   -7.006  1.00 0.00 ? 779 ARG A CZ   4  
ATOM 6804  N NH1  . ARG A 1 72  ? -7.991  4.854   -7.533  1.00 0.00 ? 779 ARG A NH1  4  
ATOM 6805  N NH2  . ARG A 1 72  ? -7.479  6.930   -6.622  1.00 0.00 ? 779 ARG A NH2  4  
ATOM 6806  H H    . ARG A 1 72  ? -1.545  0.847   -7.755  1.00 0.00 ? 779 ARG A H    4  
ATOM 6807  H HA   . ARG A 1 72  ? -1.628  3.294   -9.129  1.00 0.00 ? 779 ARG A HA   4  
ATOM 6808  H HB2  . ARG A 1 72  ? -3.661  2.174   -8.404  1.00 0.00 ? 779 ARG A HB2  4  
ATOM 6809  H HB3  . ARG A 1 72  ? -3.209  2.402   -6.722  1.00 0.00 ? 779 ARG A HB3  4  
ATOM 6810  H HG2  . ARG A 1 72  ? -3.281  4.861   -7.108  1.00 0.00 ? 779 ARG A HG2  4  
ATOM 6811  H HG3  . ARG A 1 72  ? -3.896  4.505   -8.725  1.00 0.00 ? 779 ARG A HG3  4  
ATOM 6812  H HD2  . ARG A 1 72  ? -5.867  3.528   -7.860  1.00 0.00 ? 779 ARG A HD2  4  
ATOM 6813  H HD3  . ARG A 1 72  ? -5.223  3.523   -6.222  1.00 0.00 ? 779 ARG A HD3  4  
ATOM 6814  H HE   . ARG A 1 72  ? -5.124  6.052   -6.613  1.00 0.00 ? 779 ARG A HE   4  
ATOM 6815  H HH11 . ARG A 1 72  ? -7.711  3.956   -7.883  1.00 0.00 ? 779 ARG A HH11 4  
ATOM 6816  H HH12 . ARG A 1 72  ? -8.974  5.060   -7.578  1.00 0.00 ? 779 ARG A HH12 4  
ATOM 6817  H HH21 . ARG A 1 72  ? -6.802  7.588   -6.282  1.00 0.00 ? 779 ARG A HH21 4  
ATOM 6818  H HH22 . ARG A 1 72  ? -8.435  7.237   -6.615  1.00 0.00 ? 779 ARG A HH22 4  
ATOM 6819  N N    . LEU A 1 73  ? -0.594  3.484   -6.029  1.00 0.00 ? 780 LEU A N    4  
ATOM 6820  C CA   . LEU A 1 73  ? 0.089   4.277   -5.010  1.00 0.00 ? 780 LEU A CA   4  
ATOM 6821  C C    . LEU A 1 73  ? 1.406   4.816   -5.559  1.00 0.00 ? 780 LEU A C    4  
ATOM 6822  O O    . LEU A 1 73  ? 1.758   5.992   -5.343  1.00 0.00 ? 780 LEU A O    4  
ATOM 6823  C CB   . LEU A 1 73  ? 0.307   3.372   -3.754  1.00 0.00 ? 780 LEU A CB   4  
ATOM 6824  C CG   . LEU A 1 73  ? 0.891   3.969   -2.458  1.00 0.00 ? 780 LEU A CG   4  
ATOM 6825  C CD1  . LEU A 1 73  ? 0.636   3.020   -1.301  1.00 0.00 ? 780 LEU A CD1  4  
ATOM 6826  C CD2  . LEU A 1 73  ? 2.380   4.178   -2.566  1.00 0.00 ? 780 LEU A CD2  4  
ATOM 6827  H H    . LEU A 1 73  ? -0.823  2.559   -5.793  1.00 0.00 ? 780 LEU A H    4  
ATOM 6828  H HA   . LEU A 1 73  ? -0.555  5.099   -4.736  1.00 0.00 ? 780 LEU A HA   4  
ATOM 6829  H HB2  . LEU A 1 73  ? -0.654  2.953   -3.497  1.00 0.00 ? 780 LEU A HB2  4  
ATOM 6830  H HB3  . LEU A 1 73  ? 0.942   2.553   -4.058  1.00 0.00 ? 780 LEU A HB3  4  
ATOM 6831  H HG   . LEU A 1 73  ? 0.422   4.921   -2.260  1.00 0.00 ? 780 LEU A HG   4  
ATOM 6832  H HD11 . LEU A 1 73  ? 1.025   3.446   -0.388  1.00 0.00 ? 780 LEU A HD11 4  
ATOM 6833  H HD12 . LEU A 1 73  ? 1.132   2.080   -1.496  1.00 0.00 ? 780 LEU A HD12 4  
ATOM 6834  H HD13 . LEU A 1 73  ? -0.425  2.850   -1.197  1.00 0.00 ? 780 LEU A HD13 4  
ATOM 6835  H HD21 . LEU A 1 73  ? 2.869   3.230   -2.733  1.00 0.00 ? 780 LEU A HD21 4  
ATOM 6836  H HD22 . LEU A 1 73  ? 2.739   4.629   -1.654  1.00 0.00 ? 780 LEU A HD22 4  
ATOM 6837  H HD23 . LEU A 1 73  ? 2.567   4.836   -3.402  1.00 0.00 ? 780 LEU A HD23 4  
ATOM 6838  N N    . THR A 1 74  ? 2.107   3.979   -6.296  1.00 0.00 ? 781 THR A N    4  
ATOM 6839  C CA   . THR A 1 74  ? 3.391   4.347   -6.812  1.00 0.00 ? 781 THR A CA   4  
ATOM 6840  C C    . THR A 1 74  ? 3.286   5.130   -8.134  1.00 0.00 ? 781 THR A C    4  
ATOM 6841  O O    . THR A 1 74  ? 4.162   5.935   -8.460  1.00 0.00 ? 781 THR A O    4  
ATOM 6842  C CB   . THR A 1 74  ? 4.322   3.109   -6.961  1.00 0.00 ? 781 THR A CB   4  
ATOM 6843  O OG1  . THR A 1 74  ? 3.707   2.123   -7.809  1.00 0.00 ? 781 THR A OG1  4  
ATOM 6844  C CG2  . THR A 1 74  ? 4.572   2.472   -5.601  1.00 0.00 ? 781 THR A CG2  4  
ATOM 6845  H H    . THR A 1 74  ? 1.745   3.090   -6.497  1.00 0.00 ? 781 THR A H    4  
ATOM 6846  H HA   . THR A 1 74  ? 3.834   5.008   -6.082  1.00 0.00 ? 781 THR A HA   4  
ATOM 6847  H HB   . THR A 1 74  ? 5.267   3.414   -7.385  1.00 0.00 ? 781 THR A HB   4  
ATOM 6848  H HG1  . THR A 1 74  ? 3.087   1.603   -7.278  1.00 0.00 ? 781 THR A HG1  4  
ATOM 6849  H HG21 . THR A 1 74  ? 5.369   1.747   -5.663  1.00 0.00 ? 781 THR A HG21 4  
ATOM 6850  H HG22 . THR A 1 74  ? 3.666   1.964   -5.302  1.00 0.00 ? 781 THR A HG22 4  
ATOM 6851  H HG23 . THR A 1 74  ? 4.796   3.232   -4.871  1.00 0.00 ? 781 THR A HG23 4  
ATOM 6852  N N    . HIS A 1 75  ? 2.206   4.939   -8.864  1.00 0.00 ? 782 HIS A N    4  
ATOM 6853  C CA   . HIS A 1 75  ? 2.053   5.599   -10.150 1.00 0.00 ? 782 HIS A CA   4  
ATOM 6854  C C    . HIS A 1 75  ? 1.050   6.751   -10.129 1.00 0.00 ? 782 HIS A C    4  
ATOM 6855  O O    . HIS A 1 75  ? 1.442   7.914   -10.093 1.00 0.00 ? 782 HIS A O    4  
ATOM 6856  C CB   . HIS A 1 75  ? 1.719   4.600   -11.274 1.00 0.00 ? 782 HIS A CB   4  
ATOM 6857  C CG   . HIS A 1 75  ? 2.865   3.720   -11.688 1.00 0.00 ? 782 HIS A CG   4  
ATOM 6858  N ND1  . HIS A 1 75  ? 3.561   3.878   -12.868 1.00 0.00 ? 782 HIS A ND1  4  
ATOM 6859  C CD2  . HIS A 1 75  ? 3.425   2.652   -11.071 1.00 0.00 ? 782 HIS A CD2  4  
ATOM 6860  C CE1  . HIS A 1 75  ? 4.496   2.936   -12.932 1.00 0.00 ? 782 HIS A CE1  4  
ATOM 6861  N NE2  . HIS A 1 75  ? 4.460   2.158   -11.864 1.00 0.00 ? 782 HIS A NE2  4  
ATOM 6862  H H    . HIS A 1 75  ? 1.509   4.331   -8.536  1.00 0.00 ? 782 HIS A H    4  
ATOM 6863  H HA   . HIS A 1 75  ? 3.019   6.028   -10.374 1.00 0.00 ? 782 HIS A HA   4  
ATOM 6864  H HB2  . HIS A 1 75  ? 0.919   3.955   -10.944 1.00 0.00 ? 782 HIS A HB2  4  
ATOM 6865  H HB3  . HIS A 1 75  ? 1.387   5.147   -12.143 1.00 0.00 ? 782 HIS A HB3  4  
ATOM 6866  H HD1  . HIS A 1 75  ? 3.398   4.556   -13.559 1.00 0.00 ? 782 HIS A HD1  4  
ATOM 6867  H HD2  . HIS A 1 75  ? 3.125   2.239   -10.118 1.00 0.00 ? 782 HIS A HD2  4  
ATOM 6868  H HE1  . HIS A 1 75  ? 5.190   2.821   -13.750 1.00 0.00 ? 782 HIS A HE1  4  
ATOM 6869  N N    . TYR A 1 76  ? -0.230  6.425   -10.100 1.00 0.00 ? 783 TYR A N    4  
ATOM 6870  C CA   . TYR A 1 76  ? -1.296  7.428   -10.244 1.00 0.00 ? 783 TYR A CA   4  
ATOM 6871  C C    . TYR A 1 76  ? -1.391  8.356   -9.054  1.00 0.00 ? 783 TYR A C    4  
ATOM 6872  O O    . TYR A 1 76  ? -1.567  9.568   -9.214  1.00 0.00 ? 783 TYR A O    4  
ATOM 6873  C CB   . TYR A 1 76  ? -2.658  6.764   -10.469 1.00 0.00 ? 783 TYR A CB   4  
ATOM 6874  C CG   . TYR A 1 76  ? -2.691  5.832   -11.643 1.00 0.00 ? 783 TYR A CG   4  
ATOM 6875  C CD1  . TYR A 1 76  ? -2.650  6.314   -12.938 1.00 0.00 ? 783 TYR A CD1  4  
ATOM 6876  C CD2  . TYR A 1 76  ? -2.759  4.466   -11.453 1.00 0.00 ? 783 TYR A CD2  4  
ATOM 6877  C CE1  . TYR A 1 76  ? -2.668  5.455   -14.010 1.00 0.00 ? 783 TYR A CE1  4  
ATOM 6878  C CE2  . TYR A 1 76  ? -2.783  3.601   -12.510 1.00 0.00 ? 783 TYR A CE2  4  
ATOM 6879  C CZ   . TYR A 1 76  ? -2.733  4.099   -13.793 1.00 0.00 ? 783 TYR A CZ   4  
ATOM 6880  O OH   . TYR A 1 76  ? -2.740  3.242   -14.859 1.00 0.00 ? 783 TYR A OH   4  
ATOM 6881  H H    . TYR A 1 76  ? -0.473  5.488   -9.958  1.00 0.00 ? 783 TYR A H    4  
ATOM 6882  H HA   . TYR A 1 76  ? -1.064  8.016   -11.120 1.00 0.00 ? 783 TYR A HA   4  
ATOM 6883  H HB2  . TYR A 1 76  ? -2.924  6.202   -9.587  1.00 0.00 ? 783 TYR A HB2  4  
ATOM 6884  H HB3  . TYR A 1 76  ? -3.399  7.532   -10.629 1.00 0.00 ? 783 TYR A HB3  4  
ATOM 6885  H HD1  . TYR A 1 76  ? -2.596  7.380   -13.105 1.00 0.00 ? 783 TYR A HD1  4  
ATOM 6886  H HD2  . TYR A 1 76  ? -2.800  4.079   -10.447 1.00 0.00 ? 783 TYR A HD2  4  
ATOM 6887  H HE1  . TYR A 1 76  ? -2.635  5.844   -15.016 1.00 0.00 ? 783 TYR A HE1  4  
ATOM 6888  H HE2  . TYR A 1 76  ? -2.835  2.540   -12.315 1.00 0.00 ? 783 TYR A HE2  4  
ATOM 6889  H HH   . TYR A 1 76  ? -2.057  3.551   -15.468 1.00 0.00 ? 783 TYR A HH   4  
ATOM 6890  N N    . ASP A 1 77  ? -1.274  7.799   -7.874  1.00 0.00 ? 784 ASP A N    4  
ATOM 6891  C CA   . ASP A 1 77  ? -1.422  8.580   -6.658  1.00 0.00 ? 784 ASP A CA   4  
ATOM 6892  C C    . ASP A 1 77  ? -0.151  9.349   -6.359  1.00 0.00 ? 784 ASP A C    4  
ATOM 6893  O O    . ASP A 1 77  ? -0.201  10.516  -5.950  1.00 0.00 ? 784 ASP A O    4  
ATOM 6894  C CB   . ASP A 1 77  ? -1.789  7.698   -5.449  1.00 0.00 ? 784 ASP A CB   4  
ATOM 6895  C CG   . ASP A 1 77  ? -3.116  6.954   -5.581  1.00 0.00 ? 784 ASP A CG   4  
ATOM 6896  O OD1  . ASP A 1 77  ? -4.066  7.471   -6.218  1.00 0.00 ? 784 ASP A OD1  4  
ATOM 6897  O OD2  . ASP A 1 77  ? -3.235  5.854   -5.035  1.00 0.00 ? 784 ASP A OD2  4  
ATOM 6898  H H    . ASP A 1 77  ? -1.095  6.834   -7.815  1.00 0.00 ? 784 ASP A H    4  
ATOM 6899  H HA   . ASP A 1 77  ? -2.218  9.291   -6.820  1.00 0.00 ? 784 ASP A HA   4  
ATOM 6900  H HB2  . ASP A 1 77  ? -1.008  6.958   -5.345  1.00 0.00 ? 784 ASP A HB2  4  
ATOM 6901  H HB3  . ASP A 1 77  ? -1.812  8.308   -4.559  1.00 0.00 ? 784 ASP A HB3  4  
ATOM 6902  N N    . HIS A 1 78  ? 1.000   8.680   -6.565  1.00 0.00 ? 785 HIS A N    4  
ATOM 6903  C CA   . HIS A 1 78  ? 2.343   9.253   -6.311  1.00 0.00 ? 785 HIS A CA   4  
ATOM 6904  C C    . HIS A 1 78  ? 2.426   9.659   -4.821  1.00 0.00 ? 785 HIS A C    4  
ATOM 6905  O O    . HIS A 1 78  ? 3.059   10.643  -4.423  1.00 0.00 ? 785 HIS A O    4  
ATOM 6906  C CB   . HIS A 1 78  ? 2.613   10.457  -7.267  1.00 0.00 ? 785 HIS A CB   4  
ATOM 6907  C CG   . HIS A 1 78  ? 4.036   10.969  -7.256  1.00 0.00 ? 785 HIS A CG   4  
ATOM 6908  N ND1  . HIS A 1 78  ? 4.442   12.116  -6.604  1.00 0.00 ? 785 HIS A ND1  4  
ATOM 6909  C CD2  . HIS A 1 78  ? 5.148   10.459  -7.834  1.00 0.00 ? 785 HIS A CD2  4  
ATOM 6910  C CE1  . HIS A 1 78  ? 5.750   12.265  -6.796  1.00 0.00 ? 785 HIS A CE1  4  
ATOM 6911  N NE2  . HIS A 1 78  ? 6.235   11.282  -7.540  1.00 0.00 ? 785 HIS A NE2  4  
ATOM 6912  H H    . HIS A 1 78  ? 0.931   7.762   -6.901  1.00 0.00 ? 785 HIS A H    4  
ATOM 6913  H HA   . HIS A 1 78  ? 3.064   8.467   -6.484  1.00 0.00 ? 785 HIS A HA   4  
ATOM 6914  H HB2  . HIS A 1 78  ? 2.386   10.156  -8.279  1.00 0.00 ? 785 HIS A HB2  4  
ATOM 6915  H HB3  . HIS A 1 78  ? 1.962   11.274  -6.992  1.00 0.00 ? 785 HIS A HB3  4  
ATOM 6916  H HD1  . HIS A 1 78  ? 3.868   12.713  -6.074  1.00 0.00 ? 785 HIS A HD1  4  
ATOM 6917  H HD2  . HIS A 1 78  ? 5.198   9.560   -8.430  1.00 0.00 ? 785 HIS A HD2  4  
ATOM 6918  H HE1  . HIS A 1 78  ? 6.339   13.077  -6.396  1.00 0.00 ? 785 HIS A HE1  4  
ATOM 6919  N N    . VAL A 1 79  ? 1.823   8.846   -4.003  1.00 0.00 ? 786 VAL A N    4  
ATOM 6920  C CA   . VAL A 1 79  ? 1.723   9.113   -2.580  1.00 0.00 ? 786 VAL A CA   4  
ATOM 6921  C C    . VAL A 1 79  ? 2.835   8.349   -1.823  1.00 0.00 ? 786 VAL A C    4  
ATOM 6922  O O    . VAL A 1 79  ? 2.882   8.294   -0.592  1.00 0.00 ? 786 VAL A O    4  
ATOM 6923  C CB   . VAL A 1 79  ? 0.290   8.755   -2.088  1.00 0.00 ? 786 VAL A CB   4  
ATOM 6924  C CG1  . VAL A 1 79  ? 0.017   7.286   -2.211  1.00 0.00 ? 786 VAL A CG1  4  
ATOM 6925  C CG2  . VAL A 1 79  ? -0.002  9.266   -0.691  1.00 0.00 ? 786 VAL A CG2  4  
ATOM 6926  H H    . VAL A 1 79  ? 1.430   8.027   -4.373  1.00 0.00 ? 786 VAL A H    4  
ATOM 6927  H HA   . VAL A 1 79  ? 1.898   10.167  -2.430  1.00 0.00 ? 786 VAL A HA   4  
ATOM 6928  H HB   . VAL A 1 79  ? -0.390  9.242   -2.772  1.00 0.00 ? 786 VAL A HB   4  
ATOM 6929  H HG11 . VAL A 1 79  ? -0.977  7.068   -1.850  1.00 0.00 ? 786 VAL A HG11 4  
ATOM 6930  H HG12 . VAL A 1 79  ? 0.747   6.755   -1.619  1.00 0.00 ? 786 VAL A HG12 4  
ATOM 6931  H HG13 . VAL A 1 79  ? 0.104   6.986   -3.244  1.00 0.00 ? 786 VAL A HG13 4  
ATOM 6932  H HG21 . VAL A 1 79  ? 0.080   10.342  -0.675  1.00 0.00 ? 786 VAL A HG21 4  
ATOM 6933  H HG22 . VAL A 1 79  ? 0.709   8.839   0.001   1.00 0.00 ? 786 VAL A HG22 4  
ATOM 6934  H HG23 . VAL A 1 79  ? -1.001  8.974   -0.406  1.00 0.00 ? 786 VAL A HG23 4  
ATOM 6935  N N    . LEU A 1 80  ? 3.744   7.812   -2.601  1.00 0.00 ? 787 LEU A N    4  
ATOM 6936  C CA   . LEU A 1 80  ? 4.886   7.084   -2.102  1.00 0.00 ? 787 LEU A CA   4  
ATOM 6937  C C    . LEU A 1 80  ? 6.077   8.004   -1.897  1.00 0.00 ? 787 LEU A C    4  
ATOM 6938  O O    . LEU A 1 80  ? 6.294   8.950   -2.669  1.00 0.00 ? 787 LEU A O    4  
ATOM 6939  C CB   . LEU A 1 80  ? 5.315   6.022   -3.121  1.00 0.00 ? 787 LEU A CB   4  
ATOM 6940  C CG   . LEU A 1 80  ? 6.583   5.248   -2.777  1.00 0.00 ? 787 LEU A CG   4  
ATOM 6941  C CD1  . LEU A 1 80  ? 6.333   4.283   -1.640  1.00 0.00 ? 787 LEU A CD1  4  
ATOM 6942  C CD2  . LEU A 1 80  ? 7.160   4.551   -3.998  1.00 0.00 ? 787 LEU A CD2  4  
ATOM 6943  H H    . LEU A 1 80  ? 3.631   7.908   -3.567  1.00 0.00 ? 787 LEU A H    4  
ATOM 6944  H HA   . LEU A 1 80  ? 4.626   6.582   -1.182  1.00 0.00 ? 787 LEU A HA   4  
ATOM 6945  H HB2  . LEU A 1 80  ? 4.520   5.297   -3.197  1.00 0.00 ? 787 LEU A HB2  4  
ATOM 6946  H HB3  . LEU A 1 80  ? 5.459   6.499   -4.078  1.00 0.00 ? 787 LEU A HB3  4  
ATOM 6947  H HG   . LEU A 1 80  ? 7.313   5.960   -2.417  1.00 0.00 ? 787 LEU A HG   4  
ATOM 6948  H HD11 . LEU A 1 80  ? 5.609   3.539   -1.937  1.00 0.00 ? 787 LEU A HD11 4  
ATOM 6949  H HD12 . LEU A 1 80  ? 5.959   4.828   -0.786  1.00 0.00 ? 787 LEU A HD12 4  
ATOM 6950  H HD13 . LEU A 1 80  ? 7.264   3.808   -1.374  1.00 0.00 ? 787 LEU A HD13 4  
ATOM 6951  H HD21 . LEU A 1 80  ? 6.485   3.790   -4.349  1.00 0.00 ? 787 LEU A HD21 4  
ATOM 6952  H HD22 . LEU A 1 80  ? 8.106   4.098   -3.750  1.00 0.00 ? 787 LEU A HD22 4  
ATOM 6953  H HD23 . LEU A 1 80  ? 7.312   5.278   -4.782  1.00 0.00 ? 787 LEU A HD23 4  
ATOM 6954  N N    . ILE A 1 81  ? 6.813   7.737   -0.861  1.00 0.00 ? 788 ILE A N    4  
ATOM 6955  C CA   . ILE A 1 81  ? 8.082   8.321   -0.632  1.00 0.00 ? 788 ILE A CA   4  
ATOM 6956  C C    . ILE A 1 81  ? 9.063   7.163   -0.625  1.00 0.00 ? 788 ILE A C    4  
ATOM 6957  O O    . ILE A 1 81  ? 8.994   6.295   0.248   1.00 0.00 ? 788 ILE A O    4  
ATOM 6958  C CB   . ILE A 1 81  ? 8.202   9.095   0.719   1.00 0.00 ? 788 ILE A CB   4  
ATOM 6959  C CG1  . ILE A 1 81  ? 7.176   10.233  0.868   1.00 0.00 ? 788 ILE A CG1  4  
ATOM 6960  C CG2  . ILE A 1 81  ? 9.615   9.641   0.914   1.00 0.00 ? 788 ILE A CG2  4  
ATOM 6961  C CD1  . ILE A 1 81  ? 5.769   9.780   1.194   1.00 0.00 ? 788 ILE A CD1  4  
ATOM 6962  H H    . ILE A 1 81  ? 6.491   7.097   -0.181  1.00 0.00 ? 788 ILE A H    4  
ATOM 6963  H HA   . ILE A 1 81  ? 8.287   8.981   -1.454  1.00 0.00 ? 788 ILE A HA   4  
ATOM 6964  H HB   . ILE A 1 81  ? 8.017   8.350   1.468   1.00 0.00 ? 788 ILE A HB   4  
ATOM 6965  H HG12 . ILE A 1 81  ? 7.497   10.891  1.660   1.00 0.00 ? 788 ILE A HG12 4  
ATOM 6966  H HG13 . ILE A 1 81  ? 7.143   10.789  -0.058  1.00 0.00 ? 788 ILE A HG13 4  
ATOM 6967  H HG21 . ILE A 1 81  ? 9.856   10.316  0.106   1.00 0.00 ? 788 ILE A HG21 4  
ATOM 6968  H HG22 . ILE A 1 81  ? 10.320  8.823   0.926   1.00 0.00 ? 788 ILE A HG22 4  
ATOM 6969  H HG23 . ILE A 1 81  ? 9.669   10.171  1.855   1.00 0.00 ? 788 ILE A HG23 4  
ATOM 6970  H HD11 . ILE A 1 81  ? 5.125   10.642  1.282   1.00 0.00 ? 788 ILE A HD11 4  
ATOM 6971  H HD12 . ILE A 1 81  ? 5.771   9.235   2.126   1.00 0.00 ? 788 ILE A HD12 4  
ATOM 6972  H HD13 . ILE A 1 81  ? 5.405   9.140   0.403   1.00 0.00 ? 788 ILE A HD13 4  
ATOM 6973  N N    . GLU A 1 82  ? 9.883   7.081   -1.621  1.00 0.00 ? 789 GLU A N    4  
ATOM 6974  C CA   . GLU A 1 82  ? 10.868  6.021   -1.682  1.00 0.00 ? 789 GLU A CA   4  
ATOM 6975  C C    . GLU A 1 82  ? 12.228  6.576   -1.351  1.00 0.00 ? 789 GLU A C    4  
ATOM 6976  O O    . GLU A 1 82  ? 12.697  7.506   -1.992  1.00 0.00 ? 789 GLU A O    4  
ATOM 6977  C CB   . GLU A 1 82  ? 10.856  5.291   -3.038  1.00 0.00 ? 789 GLU A CB   4  
ATOM 6978  C CG   . GLU A 1 82  ? 11.012  6.181   -4.257  1.00 0.00 ? 789 GLU A CG   4  
ATOM 6979  C CD   . GLU A 1 82  ? 11.042  5.398   -5.541  1.00 0.00 ? 789 GLU A CD   4  
ATOM 6980  O OE1  . GLU A 1 82  ? 12.129  4.931   -5.939  1.00 0.00 ? 789 GLU A OE1  4  
ATOM 6981  O OE2  . GLU A 1 82  ? 9.979   5.234   -6.182  1.00 0.00 ? 789 GLU A OE2  4  
ATOM 6982  H H    . GLU A 1 82  ? 9.844   7.764   -2.325  1.00 0.00 ? 789 GLU A H    4  
ATOM 6983  H HA   . GLU A 1 82  ? 10.605  5.321   -0.901  1.00 0.00 ? 789 GLU A HA   4  
ATOM 6984  H HB2  . GLU A 1 82  ? 11.666  4.577   -3.050  1.00 0.00 ? 789 GLU A HB2  4  
ATOM 6985  H HB3  . GLU A 1 82  ? 9.925   4.752   -3.127  1.00 0.00 ? 789 GLU A HB3  4  
ATOM 6986  H HG2  . GLU A 1 82  ? 10.177  6.864   -4.289  1.00 0.00 ? 789 GLU A HG2  4  
ATOM 6987  H HG3  . GLU A 1 82  ? 11.932  6.737   -4.160  1.00 0.00 ? 789 GLU A HG3  4  
ATOM 6988  N N    . LEU A 1 83  ? 12.837  6.037   -0.337  1.00 0.00 ? 790 LEU A N    4  
ATOM 6989  C CA   . LEU A 1 83  ? 14.106  6.529   0.137   1.00 0.00 ? 790 LEU A CA   4  
ATOM 6990  C C    . LEU A 1 83  ? 15.245  5.997   -0.688  1.00 0.00 ? 790 LEU A C    4  
ATOM 6991  O O    . LEU A 1 83  ? 15.402  4.783   -0.837  1.00 0.00 ? 790 LEU A O    4  
ATOM 6992  C CB   . LEU A 1 83  ? 14.334  6.161   1.615   1.00 0.00 ? 790 LEU A CB   4  
ATOM 6993  C CG   . LEU A 1 83  ? 13.464  6.852   2.681   1.00 0.00 ? 790 LEU A CG   4  
ATOM 6994  C CD1  . LEU A 1 83  ? 13.630  8.360   2.651   1.00 0.00 ? 790 LEU A CD1  4  
ATOM 6995  C CD2  . LEU A 1 83  ? 12.006  6.470   2.570   1.00 0.00 ? 790 LEU A CD2  4  
ATOM 6996  H H    . LEU A 1 83  ? 12.433  5.273   0.130   1.00 0.00 ? 790 LEU A H    4  
ATOM 6997  H HA   . LEU A 1 83  ? 14.095  7.605   0.059   1.00 0.00 ? 790 LEU A HA   4  
ATOM 6998  H HB2  . LEU A 1 83  ? 14.178  5.096   1.709   1.00 0.00 ? 790 LEU A HB2  4  
ATOM 6999  H HB3  . LEU A 1 83  ? 15.370  6.362   1.844   1.00 0.00 ? 790 LEU A HB3  4  
ATOM 7000  H HG   . LEU A 1 83  ? 13.827  6.502   3.634   1.00 0.00 ? 790 LEU A HG   4  
ATOM 7001  H HD11 . LEU A 1 83  ? 14.666  8.613   2.815   1.00 0.00 ? 790 LEU A HD11 4  
ATOM 7002  H HD12 . LEU A 1 83  ? 13.028  8.796   3.433   1.00 0.00 ? 790 LEU A HD12 4  
ATOM 7003  H HD13 . LEU A 1 83  ? 13.308  8.745   1.694   1.00 0.00 ? 790 LEU A HD13 4  
ATOM 7004  H HD21 . LEU A 1 83  ? 11.636  6.750   1.594   1.00 0.00 ? 790 LEU A HD21 4  
ATOM 7005  H HD22 . LEU A 1 83  ? 11.442  6.985   3.331   1.00 0.00 ? 790 LEU A HD22 4  
ATOM 7006  H HD23 . LEU A 1 83  ? 11.902  5.403   2.700   1.00 0.00 ? 790 LEU A HD23 4  
ATOM 7007  N N    . THR A 1 84  ? 16.034  6.892   -1.212  1.00 0.00 ? 791 THR A N    4  
ATOM 7008  C CA   . THR A 1 84  ? 17.201  6.528   -1.929  1.00 0.00 ? 791 THR A CA   4  
ATOM 7009  C C    . THR A 1 84  ? 18.362  6.476   -0.995  1.00 0.00 ? 791 THR A C    4  
ATOM 7010  O O    . THR A 1 84  ? 18.952  7.503   -0.672  1.00 0.00 ? 791 THR A O    4  
ATOM 7011  C CB   . THR A 1 84  ? 17.521  7.477   -3.101  1.00 0.00 ? 791 THR A CB   4  
ATOM 7012  O OG1  . THR A 1 84  ? 17.320  8.858   -2.721  1.00 0.00 ? 791 THR A OG1  4  
ATOM 7013  C CG2  . THR A 1 84  ? 16.703  7.144   -4.326  1.00 0.00 ? 791 THR A CG2  4  
ATOM 7014  H H    . THR A 1 84  ? 15.837  7.841   -1.076  1.00 0.00 ? 791 THR A H    4  
ATOM 7015  H HA   . THR A 1 84  ? 17.037  5.537   -2.326  1.00 0.00 ? 791 THR A HA   4  
ATOM 7016  H HB   . THR A 1 84  ? 18.571  7.323   -3.317  1.00 0.00 ? 791 THR A HB   4  
ATOM 7017  H HG1  . THR A 1 84  ? 16.402  8.980   -2.449  1.00 0.00 ? 791 THR A HG1  4  
ATOM 7018  H HG21 . THR A 1 84  ? 15.653  7.198   -4.075  1.00 0.00 ? 791 THR A HG21 4  
ATOM 7019  H HG22 . THR A 1 84  ? 16.944  6.150   -4.671  1.00 0.00 ? 791 THR A HG22 4  
ATOM 7020  H HG23 . THR A 1 84  ? 16.921  7.860   -5.104  1.00 0.00 ? 791 THR A HG23 4  
ATOM 7021  N N    . GLN A 1 85  ? 18.636  5.294   -0.494  1.00 0.00 ? 792 GLN A N    4  
ATOM 7022  C CA   . GLN A 1 85  ? 19.763  5.090   0.369   1.00 0.00 ? 792 GLN A CA   4  
ATOM 7023  C C    . GLN A 1 85  ? 21.006  5.460   -0.416  1.00 0.00 ? 792 GLN A C    4  
ATOM 7024  O O    . GLN A 1 85  ? 21.712  6.394   -0.052  1.00 0.00 ? 792 GLN A O    4  
ATOM 7025  C CB   . GLN A 1 85  ? 19.808  3.648   0.844   1.00 0.00 ? 792 GLN A CB   4  
ATOM 7026  C CG   . GLN A 1 85  ? 20.684  3.420   2.062   1.00 0.00 ? 792 GLN A CG   4  
ATOM 7027  C CD   . GLN A 1 85  ? 20.714  1.969   2.490   1.00 0.00 ? 792 GLN A CD   4  
ATOM 7028  O OE1  . GLN A 1 85  ? 20.816  1.664   3.679   1.00 0.00 ? 792 GLN A OE1  4  
ATOM 7029  N NE2  . GLN A 1 85  ? 20.691  1.080   1.543   1.00 0.00 ? 792 GLN A NE2  4  
ATOM 7030  H H    . GLN A 1 85  ? 18.024  4.556   -0.693  1.00 0.00 ? 792 GLN A H    4  
ATOM 7031  H HA   . GLN A 1 85  ? 19.666  5.753   1.209   1.00 0.00 ? 792 GLN A HA   4  
ATOM 7032  H HB2  . GLN A 1 85  ? 18.804  3.333   1.089   1.00 0.00 ? 792 GLN A HB2  4  
ATOM 7033  H HB3  . GLN A 1 85  ? 20.179  3.035   0.036   1.00 0.00 ? 792 GLN A HB3  4  
ATOM 7034  H HG2  . GLN A 1 85  ? 21.690  3.730   1.825   1.00 0.00 ? 792 GLN A HG2  4  
ATOM 7035  H HG3  . GLN A 1 85  ? 20.307  4.016   2.880   1.00 0.00 ? 792 GLN A HG3  4  
ATOM 7036  H HE21 . GLN A 1 85  ? 20.663  1.376   0.608   1.00 0.00 ? 792 GLN A HE21 4  
ATOM 7037  H HE22 . GLN A 1 85  ? 20.733  0.117   1.743   1.00 0.00 ? 792 GLN A HE22 4  
ATOM 7038  N N    . ALA A 1 86  ? 21.229  4.741   -1.519  1.00 0.00 ? 793 ALA A N    4  
ATOM 7039  C CA   . ALA A 1 86  ? 22.262  5.064   -2.484  1.00 0.00 ? 793 ALA A CA   4  
ATOM 7040  C C    . ALA A 1 86  ? 22.184  4.130   -3.666  1.00 0.00 ? 793 ALA A C    4  
ATOM 7041  O O    . ALA A 1 86  ? 22.222  2.905   -3.510  1.00 0.00 ? 793 ALA A O    4  
ATOM 7042  C CB   . ALA A 1 86  ? 23.635  5.041   -1.878  1.00 0.00 ? 793 ALA A CB   4  
ATOM 7043  H H    . ALA A 1 86  ? 20.705  3.929   -1.682  1.00 0.00 ? 793 ALA A H    4  
ATOM 7044  H HA   . ALA A 1 86  ? 22.055  6.061   -2.842  1.00 0.00 ? 793 ALA A HA   4  
ATOM 7045  H HB1  . ALA A 1 86  ? 24.347  5.374   -2.618  1.00 0.00 ? 793 ALA A HB1  4  
ATOM 7046  H HB2  . ALA A 1 86  ? 23.864  4.037   -1.555  1.00 0.00 ? 793 ALA A HB2  4  
ATOM 7047  H HB3  . ALA A 1 86  ? 23.627  5.723   -1.042  1.00 0.00 ? 793 ALA A HB3  4  
ATOM 7048  N N    . GLY A 1 87  ? 22.009  4.706   -4.831  1.00 0.00 ? 794 GLY A N    4  
ATOM 7049  C CA   . GLY A 1 87  ? 21.932  3.954   -6.060  1.00 0.00 ? 794 GLY A CA   4  
ATOM 7050  C C    . GLY A 1 87  ? 20.621  3.236   -6.208  1.00 0.00 ? 794 GLY A C    4  
ATOM 7051  O O    . GLY A 1 87  ? 20.508  2.308   -6.990  1.00 0.00 ? 794 GLY A O    4  
ATOM 7052  H H    . GLY A 1 87  ? 21.923  5.683   -4.861  1.00 0.00 ? 794 GLY A H    4  
ATOM 7053  H HA2  . GLY A 1 87  ? 22.050  4.634   -6.890  1.00 0.00 ? 794 GLY A HA2  4  
ATOM 7054  H HA3  . GLY A 1 87  ? 22.735  3.233   -6.087  1.00 0.00 ? 794 GLY A HA3  4  
ATOM 7055  N N    . LEU A 1 88  ? 19.610  3.692   -5.486  1.00 0.00 ? 795 LEU A N    4  
ATOM 7056  C CA   . LEU A 1 88  ? 18.318  3.014   -5.519  1.00 0.00 ? 795 LEU A CA   4  
ATOM 7057  C C    . LEU A 1 88  ? 17.430  3.606   -6.605  1.00 0.00 ? 795 LEU A C    4  
ATOM 7058  O O    . LEU A 1 88  ? 16.368  3.076   -6.917  1.00 0.00 ? 795 LEU A O    4  
ATOM 7059  C CB   . LEU A 1 88  ? 17.595  3.080   -4.163  1.00 0.00 ? 795 LEU A CB   4  
ATOM 7060  C CG   . LEU A 1 88  ? 18.365  2.608   -2.916  1.00 0.00 ? 795 LEU A CG   4  
ATOM 7061  C CD1  . LEU A 1 88  ? 17.442  2.552   -1.723  1.00 0.00 ? 795 LEU A CD1  4  
ATOM 7062  C CD2  . LEU A 1 88  ? 19.027  1.260   -3.124  1.00 0.00 ? 795 LEU A CD2  4  
ATOM 7063  H H    . LEU A 1 88  ? 19.753  4.491   -4.936  1.00 0.00 ? 795 LEU A H    4  
ATOM 7064  H HA   . LEU A 1 88  ? 18.506  1.980   -5.766  1.00 0.00 ? 795 LEU A HA   4  
ATOM 7065  H HB2  . LEU A 1 88  ? 17.299  4.104   -3.998  1.00 0.00 ? 795 LEU A HB2  4  
ATOM 7066  H HB3  . LEU A 1 88  ? 16.698  2.484   -4.245  1.00 0.00 ? 795 LEU A HB3  4  
ATOM 7067  H HG   . LEU A 1 88  ? 19.131  3.337   -2.693  1.00 0.00 ? 795 LEU A HG   4  
ATOM 7068  H HD11 . LEU A 1 88  ? 16.683  1.802   -1.888  1.00 0.00 ? 795 LEU A HD11 4  
ATOM 7069  H HD12 . LEU A 1 88  ? 16.964  3.513   -1.596  1.00 0.00 ? 795 LEU A HD12 4  
ATOM 7070  H HD13 . LEU A 1 88  ? 18.009  2.306   -0.838  1.00 0.00 ? 795 LEU A HD13 4  
ATOM 7071  H HD21 . LEU A 1 88  ? 19.735  1.330   -3.937  1.00 0.00 ? 795 LEU A HD21 4  
ATOM 7072  H HD22 . LEU A 1 88  ? 18.277  0.514   -3.337  1.00 0.00 ? 795 LEU A HD22 4  
ATOM 7073  H HD23 . LEU A 1 88  ? 19.548  1.012   -2.211  1.00 0.00 ? 795 LEU A HD23 4  
ATOM 7074  N N    . LYS A 1 89  ? 17.845  4.725   -7.145  1.00 0.00 ? 796 LYS A N    4  
ATOM 7075  C CA   . LYS A 1 89  ? 17.117  5.359   -8.225  1.00 0.00 ? 796 LYS A CA   4  
ATOM 7076  C C    . LYS A 1 89  ? 17.370  4.599   -9.521  1.00 0.00 ? 796 LYS A C    4  
ATOM 7077  O O    . LYS A 1 89  ? 16.439  4.231   -10.249 1.00 0.00 ? 796 LYS A O    4  
ATOM 7078  C CB   . LYS A 1 89  ? 17.564  6.809   -8.359  1.00 0.00 ? 796 LYS A CB   4  
ATOM 7079  C CG   . LYS A 1 89  ? 16.913  7.563   -9.495  1.00 0.00 ? 796 LYS A CG   4  
ATOM 7080  C CD   . LYS A 1 89  ? 17.372  8.994   -9.503  1.00 0.00 ? 796 LYS A CD   4  
ATOM 7081  C CE   . LYS A 1 89  ? 16.812  9.754   -10.688 1.00 0.00 ? 796 LYS A CE   4  
ATOM 7082  N NZ   . LYS A 1 89  ? 17.224  11.172  -10.684 1.00 0.00 ? 796 LYS A NZ   4  
ATOM 7083  H H    . LYS A 1 89  ? 18.661  5.134   -6.792  1.00 0.00 ? 796 LYS A H    4  
ATOM 7084  H HA   . LYS A 1 89  ? 16.062  5.338   -7.995  1.00 0.00 ? 796 LYS A HA   4  
ATOM 7085  H HB2  . LYS A 1 89  ? 17.329  7.325   -7.440  1.00 0.00 ? 796 LYS A HB2  4  
ATOM 7086  H HB3  . LYS A 1 89  ? 18.634  6.825   -8.504  1.00 0.00 ? 796 LYS A HB3  4  
ATOM 7087  H HG2  . LYS A 1 89  ? 17.184  7.096   -10.430 1.00 0.00 ? 796 LYS A HG2  4  
ATOM 7088  H HG3  . LYS A 1 89  ? 15.840  7.536   -9.373  1.00 0.00 ? 796 LYS A HG3  4  
ATOM 7089  H HD2  . LYS A 1 89  ? 17.032  9.446   -8.584  1.00 0.00 ? 796 LYS A HD2  4  
ATOM 7090  H HD3  . LYS A 1 89  ? 18.451  8.999   -9.536  1.00 0.00 ? 796 LYS A HD3  4  
ATOM 7091  H HE2  . LYS A 1 89  ? 17.159  9.290   -11.599 1.00 0.00 ? 796 LYS A HE2  4  
ATOM 7092  H HE3  . LYS A 1 89  ? 15.735  9.698   -10.646 1.00 0.00 ? 796 LYS A HE3  4  
ATOM 7093  H HZ1  . LYS A 1 89  ? 18.259  11.258  -10.677 1.00 0.00 ? 796 LYS A HZ1  4  
ATOM 7094  H HZ2  . LYS A 1 89  ? 16.847  11.674  -9.855  1.00 0.00 ? 796 LYS A HZ2  4  
ATOM 7095  H HZ3  . LYS A 1 89  ? 16.869  11.644  -11.541 1.00 0.00 ? 796 LYS A HZ3  4  
ATOM 7096  N N    . GLY A 1 90  ? 18.626  4.339   -9.765  1.00 0.00 ? 797 GLY A N    4  
ATOM 7097  C CA   . GLY A 1 90  ? 19.046  3.637   -10.932 1.00 0.00 ? 797 GLY A CA   4  
ATOM 7098  C C    . GLY A 1 90  ? 20.464  3.198   -10.764 1.00 0.00 ? 797 GLY A C    4  
ATOM 7099  O O    . GLY A 1 90  ? 20.730  2.096   -10.328 1.00 0.00 ? 797 GLY A O    4  
ATOM 7100  H H    . GLY A 1 90  ? 19.308  4.607   -9.119  1.00 0.00 ? 797 GLY A H    4  
ATOM 7101  H HA2  . GLY A 1 90  ? 18.409  2.777   -11.073 1.00 0.00 ? 797 GLY A HA2  4  
ATOM 7102  H HA3  . GLY A 1 90  ? 18.976  4.288   -11.791 1.00 0.00 ? 797 GLY A HA3  4  
ATOM 7103  N N    . SER A 1 91  ? 21.368  4.068   -11.071 1.00 0.00 ? 798 SER A N    4  
ATOM 7104  C CA   . SER A 1 91  ? 22.764  3.810   -10.902 1.00 0.00 ? 798 SER A CA   4  
ATOM 7105  C C    . SER A 1 91  ? 23.419  5.046   -10.317 1.00 0.00 ? 798 SER A C    4  
ATOM 7106  O O    . SER A 1 91  ? 22.820  6.124   -10.317 1.00 0.00 ? 798 SER A O    4  
ATOM 7107  C CB   . SER A 1 91  ? 23.402  3.446   -12.245 1.00 0.00 ? 798 SER A CB   4  
ATOM 7108  O OG   . SER A 1 91  ? 22.795  2.280   -12.811 1.00 0.00 ? 798 SER A OG   4  
ATOM 7109  H H    . SER A 1 91  ? 21.124  4.950   -11.430 1.00 0.00 ? 798 SER A H    4  
ATOM 7110  H HA   . SER A 1 91  ? 22.878  2.984   -10.216 1.00 0.00 ? 798 SER A HA   4  
ATOM 7111  H HB2  . SER A 1 91  ? 23.285  4.269   -12.933 1.00 0.00 ? 798 SER A HB2  4  
ATOM 7112  H HB3  . SER A 1 91  ? 24.455  3.251   -12.097 1.00 0.00 ? 798 SER A HB3  4  
ATOM 7113  H HG   . SER A 1 91  ? 21.842  2.316   -12.647 1.00 0.00 ? 798 SER A HG   4  
ATOM 7114  N N    . THR A 1 92  ? 24.596  4.879   -9.793  1.00 0.00 ? 799 THR A N    4  
ATOM 7115  C CA   . THR A 1 92  ? 25.361  5.958   -9.251  1.00 0.00 ? 799 THR A CA   4  
ATOM 7116  C C    . THR A 1 92  ? 26.797  5.463   -9.154  1.00 0.00 ? 799 THR A C    4  
ATOM 7117  O O    . THR A 1 92  ? 27.046  4.273   -9.396  1.00 0.00 ? 799 THR A O    4  
ATOM 7118  C CB   . THR A 1 92  ? 24.812  6.398   -7.848  1.00 0.00 ? 799 THR A CB   4  
ATOM 7119  O OG1  . THR A 1 92  ? 25.485  7.574   -7.376  1.00 0.00 ? 799 THR A OG1  4  
ATOM 7120  C CG2  . THR A 1 92  ? 24.978  5.292   -6.827  1.00 0.00 ? 799 THR A CG2  4  
ATOM 7121  H H    . THR A 1 92  ? 25.012  3.990   -9.741  1.00 0.00 ? 799 THR A H    4  
ATOM 7122  H HA   . THR A 1 92  ? 25.315  6.787   -9.943  1.00 0.00 ? 799 THR A HA   4  
ATOM 7123  H HB   . THR A 1 92  ? 23.760  6.620   -7.953  1.00 0.00 ? 799 THR A HB   4  
ATOM 7124  H HG1  . THR A 1 92  ? 25.739  7.417   -6.456  1.00 0.00 ? 799 THR A HG1  4  
ATOM 7125  H HG21 . THR A 1 92  ? 24.590  5.615   -5.872  1.00 0.00 ? 799 THR A HG21 4  
ATOM 7126  H HG22 . THR A 1 92  ? 26.028  5.056   -6.730  1.00 0.00 ? 799 THR A HG22 4  
ATOM 7127  H HG23 . THR A 1 92  ? 24.440  4.417   -7.159  1.00 0.00 ? 799 THR A HG23 4  
ATOM 7128  N N    . GLU A 1 93  ? 27.716  6.323   -8.827  1.00 0.00 ? 800 GLU A N    4  
ATOM 7129  C CA   . GLU A 1 93  ? 29.094  5.951   -8.745  1.00 0.00 ? 800 GLU A CA   4  
ATOM 7130  C C    . GLU A 1 93  ? 29.475  5.828   -7.276  1.00 0.00 ? 800 GLU A C    4  
ATOM 7131  O O    . GLU A 1 93  ? 29.186  6.732   -6.479  1.00 0.00 ? 800 GLU A O    4  
ATOM 7132  C CB   . GLU A 1 93  ? 29.945  7.028   -9.413  1.00 0.00 ? 800 GLU A CB   4  
ATOM 7133  C CG   . GLU A 1 93  ? 31.381  6.622   -9.694  1.00 0.00 ? 800 GLU A CG   4  
ATOM 7134  C CD   . GLU A 1 93  ? 31.464  5.544   -10.749 1.00 0.00 ? 800 GLU A CD   4  
ATOM 7135  O OE1  . GLU A 1 93  ? 31.355  5.869   -11.964 1.00 0.00 ? 800 GLU A OE1  4  
ATOM 7136  O OE2  . GLU A 1 93  ? 31.646  4.367   -10.401 1.00 0.00 ? 800 GLU A OE2  4  
ATOM 7137  H H    . GLU A 1 93  ? 27.469  7.247   -8.607  1.00 0.00 ? 800 GLU A H    4  
ATOM 7138  H HA   . GLU A 1 93  ? 29.244  5.009   -9.251  1.00 0.00 ? 800 GLU A HA   4  
ATOM 7139  H HB2  . GLU A 1 93  ? 29.485  7.300   -10.350 1.00 0.00 ? 800 GLU A HB2  4  
ATOM 7140  H HB3  . GLU A 1 93  ? 29.959  7.896   -8.769  1.00 0.00 ? 800 GLU A HB3  4  
ATOM 7141  H HG2  . GLU A 1 93  ? 31.931  7.488   -10.029 1.00 0.00 ? 800 GLU A HG2  4  
ATOM 7142  H HG3  . GLU A 1 93  ? 31.817  6.249   -8.779  1.00 0.00 ? 800 GLU A HG3  4  
ATOM 7143  N N    . GLY A 1 94  ? 30.053  4.713   -6.911  1.00 0.00 ? 801 GLY A N    4  
ATOM 7144  C CA   . GLY A 1 94  ? 30.531  4.536   -5.565  1.00 0.00 ? 801 GLY A CA   4  
ATOM 7145  C C    . GLY A 1 94  ? 29.482  3.990   -4.626  1.00 0.00 ? 801 GLY A C    4  
ATOM 7146  O O    . GLY A 1 94  ? 29.428  4.372   -3.458  1.00 0.00 ? 801 GLY A O    4  
ATOM 7147  H H    . GLY A 1 94  ? 30.153  3.979   -7.557  1.00 0.00 ? 801 GLY A H    4  
ATOM 7148  H HA2  . GLY A 1 94  ? 31.367  3.853   -5.582  1.00 0.00 ? 801 GLY A HA2  4  
ATOM 7149  H HA3  . GLY A 1 94  ? 30.868  5.490   -5.190  1.00 0.00 ? 801 GLY A HA3  4  
ATOM 7150  N N    . SER A 1 95  ? 28.657  3.110   -5.105  1.00 0.00 ? 802 SER A N    4  
ATOM 7151  C CA   . SER A 1 95  ? 27.656  2.512   -4.274  1.00 0.00 ? 802 SER A CA   4  
ATOM 7152  C C    . SER A 1 95  ? 27.379  1.108   -4.759  1.00 0.00 ? 802 SER A C    4  
ATOM 7153  O O    . SER A 1 95  ? 27.403  0.849   -5.968  1.00 0.00 ? 802 SER A O    4  
ATOM 7154  C CB   . SER A 1 95  ? 26.380  3.359   -4.260  1.00 0.00 ? 802 SER A CB   4  
ATOM 7155  O OG   . SER A 1 95  ? 25.433  2.848   -3.342  1.00 0.00 ? 802 SER A OG   4  
ATOM 7156  H H    . SER A 1 95  ? 28.716  2.836   -6.047  1.00 0.00 ? 802 SER A H    4  
ATOM 7157  H HA   . SER A 1 95  ? 28.055  2.454   -3.272  1.00 0.00 ? 802 SER A HA   4  
ATOM 7158  H HB2  . SER A 1 95  ? 26.627  4.371   -3.974  1.00 0.00 ? 802 SER A HB2  4  
ATOM 7159  H HB3  . SER A 1 95  ? 25.943  3.362   -5.247  1.00 0.00 ? 802 SER A HB3  4  
ATOM 7160  H HG   . SER A 1 95  ? 25.706  3.110   -2.454  1.00 0.00 ? 802 SER A HG   4  
ATOM 7161  N N    . GLU A 1 96  ? 27.127  0.211   -3.840  1.00 0.00 ? 803 GLU A N    4  
ATOM 7162  C CA   . GLU A 1 96  ? 26.908  -1.162  -4.173  1.00 0.00 ? 803 GLU A CA   4  
ATOM 7163  C C    . GLU A 1 96  ? 25.512  -1.416  -4.679  1.00 0.00 ? 803 GLU A C    4  
ATOM 7164  O O    . GLU A 1 96  ? 24.522  -1.192  -3.984  1.00 0.00 ? 803 GLU A O    4  
ATOM 7165  C CB   . GLU A 1 96  ? 27.257  -2.068  -3.028  1.00 0.00 ? 803 GLU A CB   4  
ATOM 7166  C CG   . GLU A 1 96  ? 28.740  -2.156  -2.764  1.00 0.00 ? 803 GLU A CG   4  
ATOM 7167  C CD   . GLU A 1 96  ? 29.500  -2.629  -3.982  1.00 0.00 ? 803 GLU A CD   4  
ATOM 7168  O OE1  . GLU A 1 96  ? 29.275  -3.768  -4.438  1.00 0.00 ? 803 GLU A OE1  4  
ATOM 7169  O OE2  . GLU A 1 96  ? 30.317  -1.856  -4.531  1.00 0.00 ? 803 GLU A OE2  4  
ATOM 7170  H H    . GLU A 1 96  ? 27.050  0.485   -2.901  1.00 0.00 ? 803 GLU A H    4  
ATOM 7171  H HA   . GLU A 1 96  ? 27.592  -1.371  -4.980  1.00 0.00 ? 803 GLU A HA   4  
ATOM 7172  H HB2  . GLU A 1 96  ? 26.775  -1.702  -2.134  1.00 0.00 ? 803 GLU A HB2  4  
ATOM 7173  H HB3  . GLU A 1 96  ? 26.891  -3.060  -3.244  1.00 0.00 ? 803 GLU A HB3  4  
ATOM 7174  H HG2  . GLU A 1 96  ? 29.096  -1.172  -2.502  1.00 0.00 ? 803 GLU A HG2  4  
ATOM 7175  H HG3  . GLU A 1 96  ? 28.916  -2.843  -1.951  1.00 0.00 ? 803 GLU A HG3  4  
ATOM 7176  N N    . SER A 1 97  ? 25.446  -1.925  -5.870  1.00 0.00 ? 804 SER A N    4  
ATOM 7177  C CA   . SER A 1 97  ? 24.200  -2.137  -6.569  1.00 0.00 ? 804 SER A CA   4  
ATOM 7178  C C    . SER A 1 97  ? 23.580  -3.518  -6.291  1.00 0.00 ? 804 SER A C    4  
ATOM 7179  O O    . SER A 1 97  ? 22.715  -3.969  -7.029  1.00 0.00 ? 804 SER A O    4  
ATOM 7180  C CB   . SER A 1 97  ? 24.457  -1.938  -8.062  1.00 0.00 ? 804 SER A CB   4  
ATOM 7181  O OG   . SER A 1 97  ? 25.633  -2.649  -8.466  1.00 0.00 ? 804 SER A OG   4  
ATOM 7182  H H    . SER A 1 97  ? 26.280  -2.174  -6.326  1.00 0.00 ? 804 SER A H    4  
ATOM 7183  H HA   . SER A 1 97  ? 23.501  -1.378  -6.255  1.00 0.00 ? 804 SER A HA   4  
ATOM 7184  H HB2  . SER A 1 97  ? 23.615  -2.311  -8.625  1.00 0.00 ? 804 SER A HB2  4  
ATOM 7185  H HB3  . SER A 1 97  ? 24.598  -0.887  -8.269  1.00 0.00 ? 804 SER A HB3  4  
ATOM 7186  H HG   . SER A 1 97  ? 26.239  -1.995  -8.841  1.00 0.00 ? 804 SER A HG   4  
ATOM 7187  N N    . TYR A 1 98  ? 23.984  -4.172  -5.212  1.00 0.00 ? 805 TYR A N    4  
ATOM 7188  C CA   . TYR A 1 98  ? 23.443  -5.497  -4.908  1.00 0.00 ? 805 TYR A CA   4  
ATOM 7189  C C    . TYR A 1 98  ? 22.133  -5.410  -4.148  1.00 0.00 ? 805 TYR A C    4  
ATOM 7190  O O    . TYR A 1 98  ? 21.457  -6.416  -3.930  1.00 0.00 ? 805 TYR A O    4  
ATOM 7191  C CB   . TYR A 1 98  ? 24.441  -6.357  -4.120  1.00 0.00 ? 805 TYR A CB   4  
ATOM 7192  C CG   . TYR A 1 98  ? 24.843  -5.831  -2.744  1.00 0.00 ? 805 TYR A CG   4  
ATOM 7193  C CD1  . TYR A 1 98  ? 23.995  -5.945  -1.641  1.00 0.00 ? 805 TYR A CD1  4  
ATOM 7194  C CD2  . TYR A 1 98  ? 26.070  -5.242  -2.548  1.00 0.00 ? 805 TYR A CD2  4  
ATOM 7195  C CE1  . TYR A 1 98  ? 24.367  -5.475  -0.405  1.00 0.00 ? 805 TYR A CE1  4  
ATOM 7196  C CE2  . TYR A 1 98  ? 26.445  -4.775  -1.311  1.00 0.00 ? 805 TYR A CE2  4  
ATOM 7197  C CZ   . TYR A 1 98  ? 25.594  -4.890  -0.250  1.00 0.00 ? 805 TYR A CZ   4  
ATOM 7198  O OH   . TYR A 1 98  ? 25.972  -4.413  0.973   1.00 0.00 ? 805 TYR A OH   4  
ATOM 7199  H H    . TYR A 1 98  ? 24.656  -3.768  -4.626  1.00 0.00 ? 805 TYR A H    4  
ATOM 7200  H HA   . TYR A 1 98  ? 23.248  -5.981  -5.853  1.00 0.00 ? 805 TYR A HA   4  
ATOM 7201  H HB2  . TYR A 1 98  ? 23.980  -7.318  -3.965  1.00 0.00 ? 805 TYR A HB2  4  
ATOM 7202  H HB3  . TYR A 1 98  ? 25.331  -6.472  -4.717  1.00 0.00 ? 805 TYR A HB3  4  
ATOM 7203  H HD1  . TYR A 1 98  ? 23.025  -6.401  -1.773  1.00 0.00 ? 805 TYR A HD1  4  
ATOM 7204  H HD2  . TYR A 1 98  ? 26.747  -5.150  -3.383  1.00 0.00 ? 805 TYR A HD2  4  
ATOM 7205  H HE1  . TYR A 1 98  ? 23.698  -5.572  0.437   1.00 0.00 ? 805 TYR A HE1  4  
ATOM 7206  H HE2  . TYR A 1 98  ? 27.412  -4.311  -1.180  1.00 0.00 ? 805 TYR A HE2  4  
ATOM 7207  H HH   . TYR A 1 98  ? 25.779  -5.111  1.611   1.00 0.00 ? 805 TYR A HH   4  
ATOM 7208  N N    . GLU A 1 99  ? 21.797  -4.227  -3.728  1.00 0.00 ? 806 GLU A N    4  
ATOM 7209  C CA   . GLU A 1 99  ? 20.621  -4.018  -2.920  1.00 0.00 ? 806 GLU A CA   4  
ATOM 7210  C C    . GLU A 1 99  ? 19.330  -4.112  -3.718  1.00 0.00 ? 806 GLU A C    4  
ATOM 7211  O O    . GLU A 1 99  ? 19.300  -3.853  -4.921  1.00 0.00 ? 806 GLU A O    4  
ATOM 7212  C CB   . GLU A 1 99  ? 20.731  -2.744  -2.101  1.00 0.00 ? 806 GLU A CB   4  
ATOM 7213  C CG   . GLU A 1 99  ? 21.864  -2.821  -1.090  1.00 0.00 ? 806 GLU A CG   4  
ATOM 7214  C CD   . GLU A 1 99  ? 21.940  -1.635  -0.184  1.00 0.00 ? 806 GLU A CD   4  
ATOM 7215  O OE1  . GLU A 1 99  ? 21.125  -1.546  0.762   1.00 0.00 ? 806 GLU A OE1  4  
ATOM 7216  O OE2  . GLU A 1 99  ? 22.827  -0.780  -0.380  1.00 0.00 ? 806 GLU A OE2  4  
ATOM 7217  H H    . GLU A 1 99  ? 22.365  -3.474  -3.986  1.00 0.00 ? 806 GLU A H    4  
ATOM 7218  H HA   . GLU A 1 99  ? 20.603  -4.853  -2.234  1.00 0.00 ? 806 GLU A HA   4  
ATOM 7219  H HB2  . GLU A 1 99  ? 20.910  -1.914  -2.769  1.00 0.00 ? 806 GLU A HB2  4  
ATOM 7220  H HB3  . GLU A 1 99  ? 19.806  -2.585  -1.568  1.00 0.00 ? 806 GLU A HB3  4  
ATOM 7221  H HG2  . GLU A 1 99  ? 21.726  -3.700  -0.479  1.00 0.00 ? 806 GLU A HG2  4  
ATOM 7222  H HG3  . GLU A 1 99  ? 22.798  -2.910  -1.624  1.00 0.00 ? 806 GLU A HG3  4  
ATOM 7223  N N    . GLU A 1 100 ? 18.296  -4.514  -3.037  1.00 0.00 ? 807 GLU A N    4  
ATOM 7224  C CA   . GLU A 1 100 ? 16.999  -4.802  -3.621  1.00 0.00 ? 807 GLU A CA   4  
ATOM 7225  C C    . GLU A 1 100 ? 16.067  -3.582  -3.588  1.00 0.00 ? 807 GLU A C    4  
ATOM 7226  O O    . GLU A 1 100 ? 16.533  -2.441  -3.487  1.00 0.00 ? 807 GLU A O    4  
ATOM 7227  C CB   . GLU A 1 100 ? 16.392  -5.979  -2.861  1.00 0.00 ? 807 GLU A CB   4  
ATOM 7228  C CG   . GLU A 1 100 ? 16.385  -5.783  -1.354  1.00 0.00 ? 807 GLU A CG   4  
ATOM 7229  C CD   . GLU A 1 100 ? 15.774  -6.930  -0.626  1.00 0.00 ? 807 GLU A CD   4  
ATOM 7230  O OE1  . GLU A 1 100 ? 16.458  -7.914  -0.365  1.00 0.00 ? 807 GLU A OE1  4  
ATOM 7231  O OE2  . GLU A 1 100 ? 14.587  -6.849  -0.280  1.00 0.00 ? 807 GLU A OE2  4  
ATOM 7232  H H    . GLU A 1 100 ? 18.396  -4.612  -2.068  1.00 0.00 ? 807 GLU A H    4  
ATOM 7233  H HA   . GLU A 1 100 ? 17.150  -5.106  -4.646  1.00 0.00 ? 807 GLU A HA   4  
ATOM 7234  H HB2  . GLU A 1 100 ? 15.377  -6.144  -3.188  1.00 0.00 ? 807 GLU A HB2  4  
ATOM 7235  H HB3  . GLU A 1 100 ? 16.971  -6.864  -3.077  1.00 0.00 ? 807 GLU A HB3  4  
ATOM 7236  H HG2  . GLU A 1 100 ? 17.401  -5.668  -1.007  1.00 0.00 ? 807 GLU A HG2  4  
ATOM 7237  H HG3  . GLU A 1 100 ? 15.826  -4.888  -1.125  1.00 0.00 ? 807 GLU A HG3  4  
ATOM 7238  N N    . ASP A 1 101 ? 14.758  -3.856  -3.710  1.00 0.00 ? 808 ASP A N    4  
ATOM 7239  C CA   . ASP A 1 101 ? 13.675  -2.851  -3.720  1.00 0.00 ? 808 ASP A CA   4  
ATOM 7240  C C    . ASP A 1 101 ? 13.837  -1.885  -2.546  1.00 0.00 ? 808 ASP A C    4  
ATOM 7241  O O    . ASP A 1 101 ? 14.065  -2.327  -1.406  1.00 0.00 ? 808 ASP A O    4  
ATOM 7242  C CB   . ASP A 1 101 ? 12.314  -3.588  -3.660  1.00 0.00 ? 808 ASP A CB   4  
ATOM 7243  C CG   . ASP A 1 101 ? 11.088  -2.709  -3.877  1.00 0.00 ? 808 ASP A CG   4  
ATOM 7244  O OD1  . ASP A 1 101 ? 11.011  -2.016  -4.933  1.00 0.00 ? 808 ASP A OD1  4  
ATOM 7245  O OD2  . ASP A 1 101 ? 10.132  -2.789  -3.080  1.00 0.00 ? 808 ASP A OD2  4  
ATOM 7246  H H    . ASP A 1 101 ? 14.490  -4.793  -3.803  1.00 0.00 ? 808 ASP A H    4  
ATOM 7247  H HA   . ASP A 1 101 ? 13.739  -2.301  -4.646  1.00 0.00 ? 808 ASP A HA   4  
ATOM 7248  H HB2  . ASP A 1 101 ? 12.300  -4.353  -4.422  1.00 0.00 ? 808 ASP A HB2  4  
ATOM 7249  H HB3  . ASP A 1 101 ? 12.226  -4.067  -2.696  1.00 0.00 ? 808 ASP A HB3  4  
ATOM 7250  N N    . PRO A 1 102 ? 13.764  -0.565  -2.812  1.00 0.00 ? 809 PRO A N    4  
ATOM 7251  C CA   . PRO A 1 102 ? 14.025  0.467   -1.812  1.00 0.00 ? 809 PRO A CA   4  
ATOM 7252  C C    . PRO A 1 102 ? 13.035  0.487   -0.654  1.00 0.00 ? 809 PRO A C    4  
ATOM 7253  O O    . PRO A 1 102 ? 12.041  -0.250  -0.622  1.00 0.00 ? 809 PRO A O    4  
ATOM 7254  C CB   . PRO A 1 102 ? 13.938  1.775   -2.605  1.00 0.00 ? 809 PRO A CB   4  
ATOM 7255  C CG   . PRO A 1 102 ? 13.052  1.447   -3.734  1.00 0.00 ? 809 PRO A CG   4  
ATOM 7256  C CD   . PRO A 1 102 ? 13.407  0.037   -4.111  1.00 0.00 ? 809 PRO A CD   4  
ATOM 7257  H HA   . PRO A 1 102 ? 15.023  0.370   -1.411  1.00 0.00 ? 809 PRO A HA   4  
ATOM 7258  H HB2  . PRO A 1 102 ? 13.523  2.556   -1.985  1.00 0.00 ? 809 PRO A HB2  4  
ATOM 7259  H HB3  . PRO A 1 102 ? 14.920  2.063   -2.950  1.00 0.00 ? 809 PRO A HB3  4  
ATOM 7260  H HG2  . PRO A 1 102 ? 12.032  1.518   -3.385  1.00 0.00 ? 809 PRO A HG2  4  
ATOM 7261  H HG3  . PRO A 1 102 ? 13.222  2.127   -4.555  1.00 0.00 ? 809 PRO A HG3  4  
ATOM 7262  H HD2  . PRO A 1 102 ? 12.558  -0.465  -4.552  1.00 0.00 ? 809 PRO A HD2  4  
ATOM 7263  H HD3  . PRO A 1 102 ? 14.250  0.022   -4.786  1.00 0.00 ? 809 PRO A HD3  4  
ATOM 7264  N N    . TYR A 1 103 ? 13.303  1.364   0.268   1.00 0.00 ? 810 TYR A N    4  
ATOM 7265  C CA   . TYR A 1 103 ? 12.513  1.487   1.451   1.00 0.00 ? 810 TYR A CA   4  
ATOM 7266  C C    . TYR A 1 103 ? 11.374  2.431   1.152   1.00 0.00 ? 810 TYR A C    4  
ATOM 7267  O O    . TYR A 1 103 ? 11.595  3.568   0.694   1.00 0.00 ? 810 TYR A O    4  
ATOM 7268  C CB   . TYR A 1 103 ? 13.389  1.972   2.605   1.00 0.00 ? 810 TYR A CB   4  
ATOM 7269  C CG   . TYR A 1 103 ? 14.643  1.130   2.778   1.00 0.00 ? 810 TYR A CG   4  
ATOM 7270  C CD1  . TYR A 1 103 ? 14.556  -0.227  3.070   1.00 0.00 ? 810 TYR A CD1  4  
ATOM 7271  C CD2  . TYR A 1 103 ? 15.907  1.690   2.637   1.00 0.00 ? 810 TYR A CD2  4  
ATOM 7272  C CE1  . TYR A 1 103 ? 15.691  -1.001  3.211   1.00 0.00 ? 810 TYR A CE1  4  
ATOM 7273  C CE2  . TYR A 1 103 ? 17.047  0.922   2.781   1.00 0.00 ? 810 TYR A CE2  4  
ATOM 7274  C CZ   . TYR A 1 103 ? 16.933  -0.423  3.063   1.00 0.00 ? 810 TYR A CZ   4  
ATOM 7275  O OH   . TYR A 1 103 ? 18.066  -1.194  3.199   1.00 0.00 ? 810 TYR A OH   4  
ATOM 7276  H H    . TYR A 1 103 ? 14.045  1.984   0.123   1.00 0.00 ? 810 TYR A H    4  
ATOM 7277  H HA   . TYR A 1 103 ? 12.109  0.512   1.685   1.00 0.00 ? 810 TYR A HA   4  
ATOM 7278  H HB2  . TYR A 1 103 ? 13.687  2.995   2.430   1.00 0.00 ? 810 TYR A HB2  4  
ATOM 7279  H HB3  . TYR A 1 103 ? 12.827  1.909   3.526   1.00 0.00 ? 810 TYR A HB3  4  
ATOM 7280  H HD1  . TYR A 1 103 ? 13.580  -0.675  3.181   1.00 0.00 ? 810 TYR A HD1  4  
ATOM 7281  H HD2  . TYR A 1 103 ? 15.994  2.743   2.415   1.00 0.00 ? 810 TYR A HD2  4  
ATOM 7282  H HE1  . TYR A 1 103 ? 15.602  -2.053  3.438   1.00 0.00 ? 810 TYR A HE1  4  
ATOM 7283  H HE2  . TYR A 1 103 ? 18.022  1.372   2.666   1.00 0.00 ? 810 TYR A HE2  4  
ATOM 7284  H HH   . TYR A 1 103 ? 18.620  -0.812  3.892   1.00 0.00 ? 810 TYR A HH   4  
ATOM 7285  N N    . LEU A 1 104 ? 10.179  1.961   1.375   1.00 0.00 ? 811 LEU A N    4  
ATOM 7286  C CA   . LEU A 1 104 ? 8.990   2.652   0.954   1.00 0.00 ? 811 LEU A CA   4  
ATOM 7287  C C    . LEU A 1 104 ? 8.177   3.152   2.123   1.00 0.00 ? 811 LEU A C    4  
ATOM 7288  O O    . LEU A 1 104 ? 8.025   2.465   3.131   1.00 0.00 ? 811 LEU A O    4  
ATOM 7289  C CB   . LEU A 1 104 ? 8.130   1.694   0.134   1.00 0.00 ? 811 LEU A CB   4  
ATOM 7290  C CG   . LEU A 1 104 ? 8.804   1.042   -1.071  1.00 0.00 ? 811 LEU A CG   4  
ATOM 7291  C CD1  . LEU A 1 104 ? 7.827   0.150   -1.792  1.00 0.00 ? 811 LEU A CD1  4  
ATOM 7292  C CD2  . LEU A 1 104 ? 9.374   2.080   -2.016  1.00 0.00 ? 811 LEU A CD2  4  
ATOM 7293  H H    . LEU A 1 104 ? 10.072  1.108   1.854   1.00 0.00 ? 811 LEU A H    4  
ATOM 7294  H HA   . LEU A 1 104 ? 9.264   3.475   0.313   1.00 0.00 ? 811 LEU A HA   4  
ATOM 7295  H HB2  . LEU A 1 104 ? 7.807   0.907   0.800   1.00 0.00 ? 811 LEU A HB2  4  
ATOM 7296  H HB3  . LEU A 1 104 ? 7.252   2.219   -0.209  1.00 0.00 ? 811 LEU A HB3  4  
ATOM 7297  H HG   . LEU A 1 104 ? 9.616   0.426   -0.708  1.00 0.00 ? 811 LEU A HG   4  
ATOM 7298  H HD11 . LEU A 1 104 ? 8.312   -0.307  -2.642  1.00 0.00 ? 811 LEU A HD11 4  
ATOM 7299  H HD12 . LEU A 1 104 ? 6.983   0.736   -2.121  1.00 0.00 ? 811 LEU A HD12 4  
ATOM 7300  H HD13 . LEU A 1 104 ? 7.484   -0.620  -1.116  1.00 0.00 ? 811 LEU A HD13 4  
ATOM 7301  H HD21 . LEU A 1 104 ? 8.571   2.700   -2.383  1.00 0.00 ? 811 LEU A HD21 4  
ATOM 7302  H HD22 . LEU A 1 104 ? 9.859   1.589   -2.846  1.00 0.00 ? 811 LEU A HD22 4  
ATOM 7303  H HD23 . LEU A 1 104 ? 10.087  2.695   -1.486  1.00 0.00 ? 811 LEU A HD23 4  
ATOM 7304  N N    . VAL A 1 105 ? 7.652   4.332   1.970   1.00 0.00 ? 812 VAL A N    4  
ATOM 7305  C CA   . VAL A 1 105 ? 6.781   4.946   2.946   1.00 0.00 ? 812 VAL A CA   4  
ATOM 7306  C C    . VAL A 1 105 ? 5.698   5.753   2.218   1.00 0.00 ? 812 VAL A C    4  
ATOM 7307  O O    . VAL A 1 105 ? 5.915   6.205   1.107   1.00 0.00 ? 812 VAL A O    4  
ATOM 7308  C CB   . VAL A 1 105 ? 7.581   5.781   4.044   1.00 0.00 ? 812 VAL A CB   4  
ATOM 7309  C CG1  . VAL A 1 105 ? 8.680   6.595   3.437   1.00 0.00 ? 812 VAL A CG1  4  
ATOM 7310  C CG2  . VAL A 1 105 ? 6.679   6.726   4.810   1.00 0.00 ? 812 VAL A CG2  4  
ATOM 7311  H H    . VAL A 1 105 ? 7.845   4.846   1.152   1.00 0.00 ? 812 VAL A H    4  
ATOM 7312  H HA   . VAL A 1 105 ? 6.285   4.111   3.420   1.00 0.00 ? 812 VAL A HA   4  
ATOM 7313  H HB   . VAL A 1 105 ? 8.014   5.086   4.745   1.00 0.00 ? 812 VAL A HB   4  
ATOM 7314  H HG11 . VAL A 1 105 ? 9.344   6.945   4.214   1.00 0.00 ? 812 VAL A HG11 4  
ATOM 7315  H HG12 . VAL A 1 105 ? 8.218   7.462   3.000   1.00 0.00 ? 812 VAL A HG12 4  
ATOM 7316  H HG13 . VAL A 1 105 ? 9.222   6.027   2.695   1.00 0.00 ? 812 VAL A HG13 4  
ATOM 7317  H HG21 . VAL A 1 105 ? 6.292   7.427   4.081   1.00 0.00 ? 812 VAL A HG21 4  
ATOM 7318  H HG22 . VAL A 1 105 ? 7.255   7.260   5.551   1.00 0.00 ? 812 VAL A HG22 4  
ATOM 7319  H HG23 . VAL A 1 105 ? 5.863   6.187   5.265   1.00 0.00 ? 812 VAL A HG23 4  
ATOM 7320  N N    . VAL A 1 106 ? 4.538   5.863   2.810   1.00 0.00 ? 813 VAL A N    4  
ATOM 7321  C CA   . VAL A 1 106 ? 3.413   6.534   2.199   1.00 0.00 ? 813 VAL A CA   4  
ATOM 7322  C C    . VAL A 1 106 ? 3.073   7.803   3.006   1.00 0.00 ? 813 VAL A C    4  
ATOM 7323  O O    . VAL A 1 106 ? 3.386   7.877   4.200   1.00 0.00 ? 813 VAL A O    4  
ATOM 7324  C CB   . VAL A 1 106 ? 2.184   5.555   2.127   1.00 0.00 ? 813 VAL A CB   4  
ATOM 7325  C CG1  . VAL A 1 106 ? 1.717   5.116   3.511   1.00 0.00 ? 813 VAL A CG1  4  
ATOM 7326  C CG2  . VAL A 1 106 ? 1.033   6.134   1.325   1.00 0.00 ? 813 VAL A CG2  4  
ATOM 7327  H H    . VAL A 1 106 ? 4.427   5.519   3.720   1.00 0.00 ? 813 VAL A H    4  
ATOM 7328  H HA   . VAL A 1 106 ? 3.696   6.817   1.196   1.00 0.00 ? 813 VAL A HA   4  
ATOM 7329  H HB   . VAL A 1 106 ? 2.531   4.662   1.627   1.00 0.00 ? 813 VAL A HB   4  
ATOM 7330  H HG11 . VAL A 1 106 ? 2.528   4.627   4.029   1.00 0.00 ? 813 VAL A HG11 4  
ATOM 7331  H HG12 . VAL A 1 106 ? 0.887   4.433   3.412   1.00 0.00 ? 813 VAL A HG12 4  
ATOM 7332  H HG13 . VAL A 1 106 ? 1.404   5.985   4.070   1.00 0.00 ? 813 VAL A HG13 4  
ATOM 7333  H HG21 . VAL A 1 106 ? 0.225   5.417   1.291   1.00 0.00 ? 813 VAL A HG21 4  
ATOM 7334  H HG22 . VAL A 1 106 ? 1.370   6.345   0.321   1.00 0.00 ? 813 VAL A HG22 4  
ATOM 7335  H HG23 . VAL A 1 106 ? 0.688   7.047   1.788   1.00 0.00 ? 813 VAL A HG23 4  
ATOM 7336  N N    . ASN A 1 107 ? 2.495   8.803   2.340   1.00 0.00 ? 814 ASN A N    4  
ATOM 7337  C CA   . ASN A 1 107 ? 2.065   10.050  2.999   1.00 0.00 ? 814 ASN A CA   4  
ATOM 7338  C C    . ASN A 1 107 ? 1.020   9.751   4.053   1.00 0.00 ? 814 ASN A C    4  
ATOM 7339  O O    . ASN A 1 107 ? 0.104   8.945   3.812   1.00 0.00 ? 814 ASN A O    4  
ATOM 7340  C CB   . ASN A 1 107 ? 1.465   11.044  1.997   1.00 0.00 ? 814 ASN A CB   4  
ATOM 7341  C CG   . ASN A 1 107 ? 2.484   11.744  1.086   1.00 0.00 ? 814 ASN A CG   4  
ATOM 7342  O OD1  . ASN A 1 107 ? 2.214   11.991  -0.101  1.00 0.00 ? 814 ASN A OD1  4  
ATOM 7343  N ND2  . ASN A 1 107 ? 3.614   12.141  1.632   1.00 0.00 ? 814 ASN A ND2  4  
ATOM 7344  H H    . ASN A 1 107 ? 2.349   8.692   1.377   1.00 0.00 ? 814 ASN A H    4  
ATOM 7345  H HA   . ASN A 1 107 ? 2.929   10.496  3.466   1.00 0.00 ? 814 ASN A HA   4  
ATOM 7346  H HB2  . ASN A 1 107 ? 0.743   10.509  1.399   1.00 0.00 ? 814 ASN A HB2  4  
ATOM 7347  H HB3  . ASN A 1 107 ? 0.928   11.781  2.578   1.00 0.00 ? 814 ASN A HB3  4  
ATOM 7348  H HD21 . ASN A 1 107 ? 3.770   11.987  2.590   1.00 0.00 ? 814 ASN A HD21 4  
ATOM 7349  H HD22 . ASN A 1 107 ? 4.293   12.584  1.077   1.00 0.00 ? 814 ASN A HD22 4  
ATOM 7350  N N    . PRO A 1 108 ? 1.110   10.393  5.222   1.00 0.00 ? 815 PRO A N    4  
ATOM 7351  C CA   . PRO A 1 108 ? 0.198   10.150  6.322   1.00 0.00 ? 815 PRO A CA   4  
ATOM 7352  C C    . PRO A 1 108 ? -1.195  10.733  6.132   1.00 0.00 ? 815 PRO A C    4  
ATOM 7353  O O    . PRO A 1 108 ? -1.520  11.783  6.695   1.00 0.00 ? 815 PRO A O    4  
ATOM 7354  C CB   . PRO A 1 108 ? 0.876   10.778  7.516   1.00 0.00 ? 815 PRO A CB   4  
ATOM 7355  C CG   . PRO A 1 108 ? 1.710   11.870  6.936   1.00 0.00 ? 815 PRO A CG   4  
ATOM 7356  C CD   . PRO A 1 108 ? 2.138   11.389  5.582   1.00 0.00 ? 815 PRO A CD   4  
ATOM 7357  H HA   . PRO A 1 108 ? 0.097   9.090   6.499   1.00 0.00 ? 815 PRO A HA   4  
ATOM 7358  H HB2  . PRO A 1 108 ? 0.091   11.155  8.153   1.00 0.00 ? 815 PRO A HB2  4  
ATOM 7359  H HB3  . PRO A 1 108 ? 1.465   10.034  8.029   1.00 0.00 ? 815 PRO A HB3  4  
ATOM 7360  H HG2  . PRO A 1 108 ? 1.114   12.765  6.842   1.00 0.00 ? 815 PRO A HG2  4  
ATOM 7361  H HG3  . PRO A 1 108 ? 2.571   12.057  7.559   1.00 0.00 ? 815 PRO A HG3  4  
ATOM 7362  H HD2  . PRO A 1 108 ? 2.152   12.202  4.872   1.00 0.00 ? 815 PRO A HD2  4  
ATOM 7363  H HD3  . PRO A 1 108 ? 3.109   10.921  5.647   1.00 0.00 ? 815 PRO A HD3  4  
ATOM 7364  N N    . ASN A 1 109 ? -1.934  10.119  5.237   1.00 0.00 ? 816 ASN A N    4  
ATOM 7365  C CA   . ASN A 1 109 ? -3.387  10.373  5.049   1.00 0.00 ? 816 ASN A CA   4  
ATOM 7366  C C    . ASN A 1 109 ? -3.905  9.583   3.873   1.00 0.00 ? 816 ASN A C    4  
ATOM 7367  O O    . ASN A 1 109 ? -4.974  8.991   3.951   1.00 0.00 ? 816 ASN A O    4  
ATOM 7368  C CB   . ASN A 1 109 ? -3.727  11.871  4.834   1.00 0.00 ? 816 ASN A CB   4  
ATOM 7369  C CG   . ASN A 1 109 ? -5.225  12.200  4.894   1.00 0.00 ? 816 ASN A CG   4  
ATOM 7370  O OD1  . ASN A 1 109 ? -5.689  13.113  4.216   1.00 0.00 ? 816 ASN A OD1  4  
ATOM 7371  N ND2  . ASN A 1 109 ? -5.975  11.512  5.733   1.00 0.00 ? 816 ASN A ND2  4  
ATOM 7372  H H    . ASN A 1 109 ? -1.423  9.494   4.672   1.00 0.00 ? 816 ASN A H    4  
ATOM 7373  H HA   . ASN A 1 109 ? -3.888  10.019  5.937   1.00 0.00 ? 816 ASN A HA   4  
ATOM 7374  H HB2  . ASN A 1 109 ? -3.232  12.452  5.598   1.00 0.00 ? 816 ASN A HB2  4  
ATOM 7375  H HB3  . ASN A 1 109 ? -3.352  12.173  3.867   1.00 0.00 ? 816 ASN A HB3  4  
ATOM 7376  H HD21 . ASN A 1 109 ? -5.580  10.814  6.294   1.00 0.00 ? 816 ASN A HD21 4  
ATOM 7377  H HD22 . ASN A 1 109 ? -6.932  11.735  5.767   1.00 0.00 ? 816 ASN A HD22 4  
ATOM 7378  N N    . TYR A 1 110 ? -3.101  9.558   2.786   1.00 0.00 ? 817 TYR A N    4  
ATOM 7379  C CA   . TYR A 1 110 ? -3.478  8.944   1.502   1.00 0.00 ? 817 TYR A CA   4  
ATOM 7380  C C    . TYR A 1 110 ? -4.611  9.813   0.931   1.00 0.00 ? 817 TYR A C    4  
ATOM 7381  O O    . TYR A 1 110 ? -4.771  10.957  1.349   1.00 0.00 ? 817 TYR A O    4  
ATOM 7382  C CB   . TYR A 1 110 ? -3.898  7.439   1.684   1.00 0.00 ? 817 TYR A CB   4  
ATOM 7383  C CG   . TYR A 1 110 ? -3.741  6.563   0.436   1.00 0.00 ? 817 TYR A CG   4  
ATOM 7384  C CD1  . TYR A 1 110 ? -2.523  5.975   0.152   1.00 0.00 ? 817 TYR A CD1  4  
ATOM 7385  C CD2  . TYR A 1 110 ? -4.793  6.335   -0.450  1.00 0.00 ? 817 TYR A CD2  4  
ATOM 7386  C CE1  . TYR A 1 110 ? -2.344  5.189   -0.970  1.00 0.00 ? 817 TYR A CE1  4  
ATOM 7387  C CE2  . TYR A 1 110 ? -4.620  5.554   -1.583  1.00 0.00 ? 817 TYR A CE2  4  
ATOM 7388  C CZ   . TYR A 1 110 ? -3.389  4.986   -1.836  1.00 0.00 ? 817 TYR A CZ   4  
ATOM 7389  O OH   . TYR A 1 110 ? -3.201  4.215   -2.955  1.00 0.00 ? 817 TYR A OH   4  
ATOM 7390  H H    . TYR A 1 110 ? -2.235  10.009  2.845   1.00 0.00 ? 817 TYR A H    4  
ATOM 7391  H HA   . TYR A 1 110 ? -2.652  9.036   0.810   1.00 0.00 ? 817 TYR A HA   4  
ATOM 7392  H HB2  . TYR A 1 110 ? -3.296  7.002   2.467   1.00 0.00 ? 817 TYR A HB2  4  
ATOM 7393  H HB3  . TYR A 1 110 ? -4.933  7.415   1.989   1.00 0.00 ? 817 TYR A HB3  4  
ATOM 7394  H HD1  . TYR A 1 110 ? -1.701  6.133   0.833   1.00 0.00 ? 817 TYR A HD1  4  
ATOM 7395  H HD2  . TYR A 1 110 ? -5.755  6.781   -0.248  1.00 0.00 ? 817 TYR A HD2  4  
ATOM 7396  H HE1  . TYR A 1 110 ? -1.378  4.746   -1.166  1.00 0.00 ? 817 TYR A HE1  4  
ATOM 7397  H HE2  . TYR A 1 110 ? -5.446  5.391   -2.259  1.00 0.00 ? 817 TYR A HE2  4  
ATOM 7398  H HH   . TYR A 1 110 ? -3.366  4.769   -3.740  1.00 0.00 ? 817 TYR A HH   4  
ATOM 7399  N N    . LEU A 1 111 ? -5.334  9.338   -0.016  1.00 0.00 ? 818 LEU A N    4  
ATOM 7400  C CA   . LEU A 1 111 ? -6.426  10.086  -0.549  1.00 0.00 ? 818 LEU A CA   4  
ATOM 7401  C C    . LEU A 1 111 ? -7.729  9.327   -0.419  1.00 0.00 ? 818 LEU A C    4  
ATOM 7402  O O    . LEU A 1 111 ? -7.827  8.159   -0.794  1.00 0.00 ? 818 LEU A O    4  
ATOM 7403  C CB   . LEU A 1 111 ? -6.169  10.659  -1.994  1.00 0.00 ? 818 LEU A CB   4  
ATOM 7404  C CG   . LEU A 1 111 ? -5.536  9.761   -3.112  1.00 0.00 ? 818 LEU A CG   4  
ATOM 7405  C CD1  . LEU A 1 111 ? -4.058  9.487   -2.862  1.00 0.00 ? 818 LEU A CD1  4  
ATOM 7406  C CD2  . LEU A 1 111 ? -6.289  8.459   -3.281  1.00 0.00 ? 818 LEU A CD2  4  
ATOM 7407  H H    . LEU A 1 111 ? -5.170  8.444   -0.379  1.00 0.00 ? 818 LEU A H    4  
ATOM 7408  H HA   . LEU A 1 111 ? -6.522  10.922  0.129   1.00 0.00 ? 818 LEU A HA   4  
ATOM 7409  H HB2  . LEU A 1 111 ? -7.122  10.997  -2.372  1.00 0.00 ? 818 LEU A HB2  4  
ATOM 7410  H HB3  . LEU A 1 111 ? -5.544  11.532  -1.878  1.00 0.00 ? 818 LEU A HB3  4  
ATOM 7411  H HG   . LEU A 1 111 ? -5.594  10.307  -4.043  1.00 0.00 ? 818 LEU A HG   4  
ATOM 7412  H HD11 . LEU A 1 111 ? -3.514  10.419  -2.849  1.00 0.00 ? 818 LEU A HD11 4  
ATOM 7413  H HD12 . LEU A 1 111 ? -3.678  8.858   -3.653  1.00 0.00 ? 818 LEU A HD12 4  
ATOM 7414  H HD13 . LEU A 1 111 ? -3.942  8.985   -1.912  1.00 0.00 ? 818 LEU A HD13 4  
ATOM 7415  H HD21 . LEU A 1 111 ? -5.857  7.856   -4.065  1.00 0.00 ? 818 LEU A HD21 4  
ATOM 7416  H HD22 . LEU A 1 111 ? -7.332  8.671   -3.468  1.00 0.00 ? 818 LEU A HD22 4  
ATOM 7417  H HD23 . LEU A 1 111 ? -6.229  7.934   -2.336  1.00 0.00 ? 818 LEU A HD23 4  
ATOM 7418  N N    . LEU A 1 112 ? -8.680  9.938   0.206   1.00 0.00 ? 819 LEU A N    4  
ATOM 7419  C CA   . LEU A 1 112 ? -9.987  9.358   0.364   1.00 0.00 ? 819 LEU A CA   4  
ATOM 7420  C C    . LEU A 1 112 ? -10.999 10.486  0.319   1.00 0.00 ? 819 LEU A C    4  
ATOM 7421  O O    . LEU A 1 112 ? -10.637 11.622  0.032   1.00 0.00 ? 819 LEU A O    4  
ATOM 7422  C CB   . LEU A 1 112 ? -10.150 8.569   1.694   1.00 0.00 ? 819 LEU A CB   4  
ATOM 7423  C CG   . LEU A 1 112 ? -9.239  7.346   1.975   1.00 0.00 ? 819 LEU A CG   4  
ATOM 7424  C CD1  . LEU A 1 112 ? -7.876  7.757   2.521   1.00 0.00 ? 819 LEU A CD1  4  
ATOM 7425  C CD2  . LEU A 1 112 ? -9.921  6.378   2.922   1.00 0.00 ? 819 LEU A CD2  4  
ATOM 7426  H H    . LEU A 1 112 ? -8.532  10.838  0.578   1.00 0.00 ? 819 LEU A H    4  
ATOM 7427  H HA   . LEU A 1 112 ? -10.160 8.701   -0.475  1.00 0.00 ? 819 LEU A HA   4  
ATOM 7428  H HB2  . LEU A 1 112 ? -9.971  9.277   2.487   1.00 0.00 ? 819 LEU A HB2  4  
ATOM 7429  H HB3  . LEU A 1 112 ? -11.176 8.240   1.727   1.00 0.00 ? 819 LEU A HB3  4  
ATOM 7430  H HG   . LEU A 1 112 ? -9.068  6.832   1.041   1.00 0.00 ? 819 LEU A HG   4  
ATOM 7431  H HD11 . LEU A 1 112 ? -7.277  6.875   2.697   1.00 0.00 ? 819 LEU A HD11 4  
ATOM 7432  H HD12 . LEU A 1 112 ? -8.007  8.296   3.447   1.00 0.00 ? 819 LEU A HD12 4  
ATOM 7433  H HD13 . LEU A 1 112 ? -7.379  8.392   1.803   1.00 0.00 ? 819 LEU A HD13 4  
ATOM 7434  H HD21 . LEU A 1 112 ? -9.265  5.540   3.106   1.00 0.00 ? 819 LEU A HD21 4  
ATOM 7435  H HD22 . LEU A 1 112 ? -10.840 6.021   2.480   1.00 0.00 ? 819 LEU A HD22 4  
ATOM 7436  H HD23 . LEU A 1 112 ? -10.137 6.875   3.856   1.00 0.00 ? 819 LEU A HD23 4  
ATOM 7437  N N    . GLU A 1 113 ? -12.249 10.189  0.582   1.00 0.00 ? 820 GLU A N    4  
ATOM 7438  C CA   . GLU A 1 113 ? -13.274 11.219  0.587   1.00 0.00 ? 820 GLU A CA   4  
ATOM 7439  C C    . GLU A 1 113 ? -13.476 11.759  1.981   1.00 0.00 ? 820 GLU A C    4  
ATOM 7440  O O    . GLU A 1 113 ? -13.546 12.972  2.188   1.00 0.00 ? 820 GLU A O    4  
ATOM 7441  C CB   . GLU A 1 113 ? -14.591 10.674  0.063   1.00 0.00 ? 820 GLU A CB   4  
ATOM 7442  C CG   . GLU A 1 113 ? -14.549 10.266  -1.384  1.00 0.00 ? 820 GLU A CG   4  
ATOM 7443  C CD   . GLU A 1 113 ? -14.294 11.424  -2.312  1.00 0.00 ? 820 GLU A CD   4  
ATOM 7444  O OE1  . GLU A 1 113 ? -15.265 12.119  -2.681  1.00 0.00 ? 820 GLU A OE1  4  
ATOM 7445  O OE2  . GLU A 1 113 ? -13.152 11.632  -2.714  1.00 0.00 ? 820 GLU A OE2  4  
ATOM 7446  H H    . GLU A 1 113 ? -12.485 9.260   0.774   1.00 0.00 ? 820 GLU A H    4  
ATOM 7447  H HA   . GLU A 1 113 ? -12.946 12.019  -0.061  1.00 0.00 ? 820 GLU A HA   4  
ATOM 7448  H HB2  . GLU A 1 113 ? -14.871 9.814   0.653   1.00 0.00 ? 820 GLU A HB2  4  
ATOM 7449  H HB3  . GLU A 1 113 ? -15.350 11.434  0.178   1.00 0.00 ? 820 GLU A HB3  4  
ATOM 7450  H HG2  . GLU A 1 113 ? -13.748 9.554   -1.508  1.00 0.00 ? 820 GLU A HG2  4  
ATOM 7451  H HG3  . GLU A 1 113 ? -15.487 9.802   -1.644  1.00 0.00 ? 820 GLU A HG3  4  
ATOM 7452  N N    . ASP A 1 114 ? -13.573 10.870  2.922   1.00 0.00 ? 821 ASP A N    4  
ATOM 7453  C CA   . ASP A 1 114 ? -13.826 11.224  4.293   1.00 0.00 ? 821 ASP A CA   4  
ATOM 7454  C C    . ASP A 1 114 ? -13.101 10.270  5.158   1.00 0.00 ? 821 ASP A C    4  
ATOM 7455  O O    . ASP A 1 114 ? -13.342 9.060   5.014   1.00 0.00 ? 821 ASP A O    4  
ATOM 7456  C CB   . ASP A 1 114 ? -15.318 11.192  4.614   1.00 0.00 ? 821 ASP A CB   4  
ATOM 7457  C CG   . ASP A 1 114 ? -15.605 11.491  6.068   1.00 0.00 ? 821 ASP A CG   4  
ATOM 7458  O OD1  . ASP A 1 114 ? -15.530 12.663  6.477   1.00 0.00 ? 821 ASP A OD1  4  
ATOM 7459  O OD2  . ASP A 1 114 ? -15.942 10.560  6.833   1.00 0.00 ? 821 ASP A OD2  4  
ATOM 7460  O OXT  . ASP A 1 114 ? -12.280 10.693  5.967   1.00 0.00 ? 821 ASP A OXT  4  
ATOM 7461  H H    . ASP A 1 114 ? -13.450 9.914   2.745   1.00 0.00 ? 821 ASP A H    4  
ATOM 7462  H HA   . ASP A 1 114 ? -13.446 12.220  4.457   1.00 0.00 ? 821 ASP A HA   4  
ATOM 7463  H HB2  . ASP A 1 114 ? -15.820 11.935  4.015   1.00 0.00 ? 821 ASP A HB2  4  
ATOM 7464  H HB3  . ASP A 1 114 ? -15.714 10.215  4.379   1.00 0.00 ? 821 ASP A HB3  4  
ATOM 7465  N N    . ALA A 1 1   ? -25.266 6.292   -12.045 1.00 0.00 ? 708 ALA A N    5  
ATOM 7466  C CA   . ALA A 1 1   ? -24.926 5.695   -10.791 1.00 0.00 ? 708 ALA A CA   5  
ATOM 7467  C C    . ALA A 1 1   ? -24.417 6.780   -9.861  1.00 0.00 ? 708 ALA A C    5  
ATOM 7468  O O    . ALA A 1 1   ? -23.551 7.572   -10.243 1.00 0.00 ? 708 ALA A O    5  
ATOM 7469  C CB   . ALA A 1 1   ? -23.867 4.616   -10.989 1.00 0.00 ? 708 ALA A CB   5  
ATOM 7470  H H1   . ALA A 1 1   ? -24.582 6.376   -12.740 1.00 0.00 ? 708 ALA A H1   5  
ATOM 7471  H HA   . ALA A 1 1   ? -25.815 5.241   -10.381 1.00 0.00 ? 708 ALA A HA   5  
ATOM 7472  H HB1  . ALA A 1 1   ? -23.625 4.172   -10.034 1.00 0.00 ? 708 ALA A HB1  5  
ATOM 7473  H HB2  . ALA A 1 1   ? -22.977 5.056   -11.415 1.00 0.00 ? 708 ALA A HB2  5  
ATOM 7474  H HB3  . ALA A 1 1   ? -24.247 3.856   -11.654 1.00 0.00 ? 708 ALA A HB3  5  
ATOM 7475  N N    . PRO A 1 2   ? -24.949 6.848   -8.646  1.00 0.00 ? 709 PRO A N    5  
ATOM 7476  C CA   . PRO A 1 2   ? -24.515 7.814   -7.670  1.00 0.00 ? 709 PRO A CA   5  
ATOM 7477  C C    . PRO A 1 2   ? -23.369 7.275   -6.838  1.00 0.00 ? 709 PRO A C    5  
ATOM 7478  O O    . PRO A 1 2   ? -23.449 6.164   -6.271  1.00 0.00 ? 709 PRO A O    5  
ATOM 7479  C CB   . PRO A 1 2   ? -25.753 8.020   -6.806  1.00 0.00 ? 709 PRO A CB   5  
ATOM 7480  C CG   . PRO A 1 2   ? -26.534 6.742   -6.902  1.00 0.00 ? 709 PRO A CG   5  
ATOM 7481  C CD   . PRO A 1 2   ? -26.062 6.018   -8.141  1.00 0.00 ? 709 PRO A CD   5  
ATOM 7482  H HA   . PRO A 1 2   ? -24.227 8.747   -8.130  1.00 0.00 ? 709 PRO A HA   5  
ATOM 7483  H HB2  . PRO A 1 2   ? -25.443 8.217   -5.789  1.00 0.00 ? 709 PRO A HB2  5  
ATOM 7484  H HB3  . PRO A 1 2   ? -26.317 8.861   -7.180  1.00 0.00 ? 709 PRO A HB3  5  
ATOM 7485  H HG2  . PRO A 1 2   ? -26.348 6.137   -6.027  1.00 0.00 ? 709 PRO A HG2  5  
ATOM 7486  H HG3  . PRO A 1 2   ? -27.588 6.968   -6.977  1.00 0.00 ? 709 PRO A HG3  5  
ATOM 7487  H HD2  . PRO A 1 2   ? -25.723 5.021   -7.896  1.00 0.00 ? 709 PRO A HD2  5  
ATOM 7488  H HD3  . PRO A 1 2   ? -26.870 5.981   -8.858  1.00 0.00 ? 709 PRO A HD3  5  
ATOM 7489  N N    . LYS A 1 3   ? -22.316 8.023   -6.749  1.00 0.00 ? 710 LYS A N    5  
ATOM 7490  C CA   . LYS A 1 3   ? -21.193 7.586   -5.988  1.00 0.00 ? 710 LYS A CA   5  
ATOM 7491  C C    . LYS A 1 3   ? -21.265 8.097   -4.581  1.00 0.00 ? 710 LYS A C    5  
ATOM 7492  O O    . LYS A 1 3   ? -20.602 9.065   -4.221  1.00 0.00 ? 710 LYS A O    5  
ATOM 7493  C CB   . LYS A 1 3   ? -19.850 7.931   -6.634  1.00 0.00 ? 710 LYS A CB   5  
ATOM 7494  C CG   . LYS A 1 3   ? -19.581 7.202   -7.934  1.00 0.00 ? 710 LYS A CG   5  
ATOM 7495  C CD   . LYS A 1 3   ? -18.178 7.474   -8.429  1.00 0.00 ? 710 LYS A CD   5  
ATOM 7496  C CE   . LYS A 1 3   ? -17.867 6.667   -9.670  1.00 0.00 ? 710 LYS A CE   5  
ATOM 7497  N NZ   . LYS A 1 3   ? -16.470 6.847   -10.101 1.00 0.00 ? 710 LYS A NZ   5  
ATOM 7498  H H    . LYS A 1 3   ? -22.314 8.911   -7.169  1.00 0.00 ? 710 LYS A H    5  
ATOM 7499  H HA   . LYS A 1 3   ? -21.277 6.512   -5.934  1.00 0.00 ? 710 LYS A HA   5  
ATOM 7500  H HB2  . LYS A 1 3   ? -19.821 8.992   -6.830  1.00 0.00 ? 710 LYS A HB2  5  
ATOM 7501  H HB3  . LYS A 1 3   ? -19.061 7.686   -5.938  1.00 0.00 ? 710 LYS A HB3  5  
ATOM 7502  H HG2  . LYS A 1 3   ? -19.688 6.141   -7.769  1.00 0.00 ? 710 LYS A HG2  5  
ATOM 7503  H HG3  . LYS A 1 3   ? -20.292 7.531   -8.679  1.00 0.00 ? 710 LYS A HG3  5  
ATOM 7504  H HD2  . LYS A 1 3   ? -18.091 8.524   -8.670  1.00 0.00 ? 710 LYS A HD2  5  
ATOM 7505  H HD3  . LYS A 1 3   ? -17.473 7.216   -7.652  1.00 0.00 ? 710 LYS A HD3  5  
ATOM 7506  H HE2  . LYS A 1 3   ? -18.035 5.621   -9.457  1.00 0.00 ? 710 LYS A HE2  5  
ATOM 7507  H HE3  . LYS A 1 3   ? -18.528 6.985   -10.463 1.00 0.00 ? 710 LYS A HE3  5  
ATOM 7508  H HZ1  . LYS A 1 3   ? -16.258 7.845   -10.296 1.00 0.00 ? 710 LYS A HZ1  5  
ATOM 7509  H HZ2  . LYS A 1 3   ? -16.291 6.297   -10.966 1.00 0.00 ? 710 LYS A HZ2  5  
ATOM 7510  H HZ3  . LYS A 1 3   ? -15.826 6.507   -9.360  1.00 0.00 ? 710 LYS A HZ3  5  
ATOM 7511  N N    . ALA A 1 4   ? -22.127 7.495   -3.808  1.00 0.00 ? 711 ALA A N    5  
ATOM 7512  C CA   . ALA A 1 4   ? -22.232 7.808   -2.415  1.00 0.00 ? 711 ALA A CA   5  
ATOM 7513  C C    . ALA A 1 4   ? -21.279 6.896   -1.686  1.00 0.00 ? 711 ALA A C    5  
ATOM 7514  O O    . ALA A 1 4   ? -21.626 5.777   -1.305  1.00 0.00 ? 711 ALA A O    5  
ATOM 7515  C CB   . ALA A 1 4   ? -23.662 7.634   -1.919  1.00 0.00 ? 711 ALA A CB   5  
ATOM 7516  H H    . ALA A 1 4   ? -22.708 6.809   -4.203  1.00 0.00 ? 711 ALA A H    5  
ATOM 7517  H HA   . ALA A 1 4   ? -21.919 8.832   -2.278  1.00 0.00 ? 711 ALA A HA   5  
ATOM 7518  H HB1  . ALA A 1 4   ? -23.975 6.610   -2.064  1.00 0.00 ? 711 ALA A HB1  5  
ATOM 7519  H HB2  . ALA A 1 4   ? -24.317 8.291   -2.474  1.00 0.00 ? 711 ALA A HB2  5  
ATOM 7520  H HB3  . ALA A 1 4   ? -23.710 7.880   -0.868  1.00 0.00 ? 711 ALA A HB3  5  
ATOM 7521  N N    . SER A 1 5   ? -20.050 7.310   -1.615  1.00 0.00 ? 712 SER A N    5  
ATOM 7522  C CA   . SER A 1 5   ? -19.000 6.507   -1.063  1.00 0.00 ? 712 SER A CA   5  
ATOM 7523  C C    . SER A 1 5   ? -17.931 7.427   -0.474  1.00 0.00 ? 712 SER A C    5  
ATOM 7524  O O    . SER A 1 5   ? -18.120 8.639   -0.461  1.00 0.00 ? 712 SER A O    5  
ATOM 7525  C CB   . SER A 1 5   ? -18.400 5.640   -2.186  1.00 0.00 ? 712 SER A CB   5  
ATOM 7526  O OG   . SER A 1 5   ? -19.407 4.872   -2.850  1.00 0.00 ? 712 SER A OG   5  
ATOM 7527  H H    . SER A 1 5   ? -19.817 8.207   -1.942  1.00 0.00 ? 712 SER A H    5  
ATOM 7528  H HA   . SER A 1 5   ? -19.407 5.863   -0.298  1.00 0.00 ? 712 SER A HA   5  
ATOM 7529  H HB2  . SER A 1 5   ? -17.920 6.280   -2.912  1.00 0.00 ? 712 SER A HB2  5  
ATOM 7530  H HB3  . SER A 1 5   ? -17.670 4.966   -1.763  1.00 0.00 ? 712 SER A HB3  5  
ATOM 7531  H HG   . SER A 1 5   ? -20.183 4.861   -2.270  1.00 0.00 ? 712 SER A HG   5  
ATOM 7532  N N    . LEU A 1 6   ? -16.860 6.829   0.065   1.00 0.00 ? 713 LEU A N    5  
ATOM 7533  C CA   . LEU A 1 6   ? -15.668 7.523   0.626   1.00 0.00 ? 713 LEU A CA   5  
ATOM 7534  C C    . LEU A 1 6   ? -16.005 8.376   1.847   1.00 0.00 ? 713 LEU A C    5  
ATOM 7535  O O    . LEU A 1 6   ? -15.631 8.042   2.967   1.00 0.00 ? 713 LEU A O    5  
ATOM 7536  C CB   . LEU A 1 6   ? -14.949 8.365   -0.434  1.00 0.00 ? 713 LEU A CB   5  
ATOM 7537  C CG   . LEU A 1 6   ? -13.620 8.971   -0.001  1.00 0.00 ? 713 LEU A CG   5  
ATOM 7538  C CD1  . LEU A 1 6   ? -12.594 7.879   0.285   1.00 0.00 ? 713 LEU A CD1  5  
ATOM 7539  C CD2  . LEU A 1 6   ? -13.114 9.932   -1.050  1.00 0.00 ? 713 LEU A CD2  5  
ATOM 7540  H H    . LEU A 1 6   ? -16.871 5.845   0.105   1.00 0.00 ? 713 LEU A H    5  
ATOM 7541  H HA   . LEU A 1 6   ? -14.998 6.745   0.960   1.00 0.00 ? 713 LEU A HA   5  
ATOM 7542  H HB2  . LEU A 1 6   ? -14.771 7.739   -1.296  1.00 0.00 ? 713 LEU A HB2  5  
ATOM 7543  H HB3  . LEU A 1 6   ? -15.607 9.170   -0.725  1.00 0.00 ? 713 LEU A HB3  5  
ATOM 7544  H HG   . LEU A 1 6   ? -13.776 9.518   0.917   1.00 0.00 ? 713 LEU A HG   5  
ATOM 7545  H HD11 . LEU A 1 6   ? -12.940 7.249   1.092   1.00 0.00 ? 713 LEU A HD11 5  
ATOM 7546  H HD12 . LEU A 1 6   ? -11.655 8.333   0.562   1.00 0.00 ? 713 LEU A HD12 5  
ATOM 7547  H HD13 . LEU A 1 6   ? -12.451 7.276   -0.600  1.00 0.00 ? 713 LEU A HD13 5  
ATOM 7548  H HD21 . LEU A 1 6   ? -13.044 9.421   -1.998  1.00 0.00 ? 713 LEU A HD21 5  
ATOM 7549  H HD22 . LEU A 1 6   ? -12.138 10.295  -0.763  1.00 0.00 ? 713 LEU A HD22 5  
ATOM 7550  H HD23 . LEU A 1 6   ? -13.802 10.761  -1.137  1.00 0.00 ? 713 LEU A HD23 5  
ATOM 7551  N N    . ARG A 1 7   ? -16.715 9.460   1.617   1.00 0.00 ? 714 ARG A N    5  
ATOM 7552  C CA   . ARG A 1 7   ? -17.165 10.332  2.677   1.00 0.00 ? 714 ARG A CA   5  
ATOM 7553  C C    . ARG A 1 7   ? -18.269 9.599   3.420   1.00 0.00 ? 714 ARG A C    5  
ATOM 7554  O O    . ARG A 1 7   ? -18.444 9.742   4.634   1.00 0.00 ? 714 ARG A O    5  
ATOM 7555  C CB   . ARG A 1 7   ? -17.682 11.655  2.099   1.00 0.00 ? 714 ARG A CB   5  
ATOM 7556  C CG   . ARG A 1 7   ? -16.684 12.355  1.184   1.00 0.00 ? 714 ARG A CG   5  
ATOM 7557  C CD   . ARG A 1 7   ? -17.211 13.691  0.694   1.00 0.00 ? 714 ARG A CD   5  
ATOM 7558  N NE   . ARG A 1 7   ? -16.315 14.311  -0.302  1.00 0.00 ? 714 ARG A NE   5  
ATOM 7559  C CZ   . ARG A 1 7   ? -15.933 15.597  -0.313  1.00 0.00 ? 714 ARG A CZ   5  
ATOM 7560  N NH1  . ARG A 1 7   ? -16.240 16.393  0.701   1.00 0.00 ? 714 ARG A NH1  5  
ATOM 7561  N NH2  . ARG A 1 7   ? -15.229 16.072  -1.341  1.00 0.00 ? 714 ARG A NH2  5  
ATOM 7562  H H    . ARG A 1 7   ? -16.958 9.659   0.686   1.00 0.00 ? 714 ARG A H    5  
ATOM 7563  H HA   . ARG A 1 7   ? -16.335 10.513  3.344   1.00 0.00 ? 714 ARG A HA   5  
ATOM 7564  H HB2  . ARG A 1 7   ? -18.580 11.457  1.532   1.00 0.00 ? 714 ARG A HB2  5  
ATOM 7565  H HB3  . ARG A 1 7   ? -17.920 12.322  2.914   1.00 0.00 ? 714 ARG A HB3  5  
ATOM 7566  H HG2  . ARG A 1 7   ? -15.766 12.517  1.728   1.00 0.00 ? 714 ARG A HG2  5  
ATOM 7567  H HG3  . ARG A 1 7   ? -16.486 11.721  0.332   1.00 0.00 ? 714 ARG A HG3  5  
ATOM 7568  H HD2  . ARG A 1 7   ? -18.179 13.537  0.243   1.00 0.00 ? 714 ARG A HD2  5  
ATOM 7569  H HD3  . ARG A 1 7   ? -17.308 14.355  1.540   1.00 0.00 ? 714 ARG A HD3  5  
ATOM 7570  H HE   . ARG A 1 7   ? -16.027 13.711  -1.028  1.00 0.00 ? 714 ARG A HE   5  
ATOM 7571  H HH11 . ARG A 1 7   ? -16.748 16.079  1.506   1.00 0.00 ? 714 ARG A HH11 5  
ATOM 7572  H HH12 . ARG A 1 7   ? -15.978 17.361  0.713   1.00 0.00 ? 714 ARG A HH12 5  
ATOM 7573  H HH21 . ARG A 1 7   ? -14.973 15.485  -2.117  1.00 0.00 ? 714 ARG A HH21 5  
ATOM 7574  H HH22 . ARG A 1 7   ? -14.908 17.020  -1.398  1.00 0.00 ? 714 ARG A HH22 5  
ATOM 7575  N N    . LEU A 1 8   ? -19.017 8.800   2.666   1.00 0.00 ? 715 LEU A N    5  
ATOM 7576  C CA   . LEU A 1 8   ? -20.005 7.914   3.240   1.00 0.00 ? 715 LEU A CA   5  
ATOM 7577  C C    . LEU A 1 8   ? -19.305 6.631   3.673   1.00 0.00 ? 715 LEU A C    5  
ATOM 7578  O O    . LEU A 1 8   ? -19.530 6.130   4.776   1.00 0.00 ? 715 LEU A O    5  
ATOM 7579  C CB   . LEU A 1 8   ? -21.128 7.597   2.243   1.00 0.00 ? 715 LEU A CB   5  
ATOM 7580  C CG   . LEU A 1 8   ? -22.251 6.685   2.772   1.00 0.00 ? 715 LEU A CG   5  
ATOM 7581  C CD1  . LEU A 1 8   ? -22.980 7.334   3.943   1.00 0.00 ? 715 LEU A CD1  5  
ATOM 7582  C CD2  . LEU A 1 8   ? -23.230 6.331   1.666   1.00 0.00 ? 715 LEU A CD2  5  
ATOM 7583  H H    . LEU A 1 8   ? -18.891 8.842   1.696   1.00 0.00 ? 715 LEU A H    5  
ATOM 7584  H HA   . LEU A 1 8   ? -20.414 8.402   4.113   1.00 0.00 ? 715 LEU A HA   5  
ATOM 7585  H HB2  . LEU A 1 8   ? -21.563 8.532   1.924   1.00 0.00 ? 715 LEU A HB2  5  
ATOM 7586  H HB3  . LEU A 1 8   ? -20.685 7.119   1.381   1.00 0.00 ? 715 LEU A HB3  5  
ATOM 7587  H HG   . LEU A 1 8   ? -21.804 5.771   3.133   1.00 0.00 ? 715 LEU A HG   5  
ATOM 7588  H HD11 . LEU A 1 8   ? -22.285 7.506   4.751   1.00 0.00 ? 715 LEU A HD11 5  
ATOM 7589  H HD12 . LEU A 1 8   ? -23.769 6.679   4.283   1.00 0.00 ? 715 LEU A HD12 5  
ATOM 7590  H HD13 . LEU A 1 8   ? -23.405 8.276   3.630   1.00 0.00 ? 715 LEU A HD13 5  
ATOM 7591  H HD21 . LEU A 1 8   ? -23.686 7.231   1.284   1.00 0.00 ? 715 LEU A HD21 5  
ATOM 7592  H HD22 . LEU A 1 8   ? -23.995 5.678   2.058   1.00 0.00 ? 715 LEU A HD22 5  
ATOM 7593  H HD23 . LEU A 1 8   ? -22.703 5.828   0.868   1.00 0.00 ? 715 LEU A HD23 5  
ATOM 7594  N N    . GLY A 1 9   ? -18.437 6.122   2.811   1.00 0.00 ? 716 GLY A N    5  
ATOM 7595  C CA   . GLY A 1 9   ? -17.673 4.950   3.144   1.00 0.00 ? 716 GLY A CA   5  
ATOM 7596  C C    . GLY A 1 9   ? -17.189 4.176   1.926   1.00 0.00 ? 716 GLY A C    5  
ATOM 7597  O O    . GLY A 1 9   ? -17.778 4.262   0.848   1.00 0.00 ? 716 GLY A O    5  
ATOM 7598  H H    . GLY A 1 9   ? -18.312 6.537   1.935   1.00 0.00 ? 716 GLY A H    5  
ATOM 7599  H HA2  . GLY A 1 9   ? -16.816 5.260   3.722   1.00 0.00 ? 716 GLY A HA2  5  
ATOM 7600  H HA3  . GLY A 1 9   ? -18.287 4.302   3.753   1.00 0.00 ? 716 GLY A HA3  5  
ATOM 7601  N N    . PHE A 1 10  ? -16.070 3.533   2.094   1.00 0.00 ? 717 PHE A N    5  
ATOM 7602  C CA   . PHE A 1 10  ? -15.480 2.583   1.165   1.00 0.00 ? 717 PHE A CA   5  
ATOM 7603  C C    . PHE A 1 10  ? -14.882 1.502   2.008   1.00 0.00 ? 717 PHE A C    5  
ATOM 7604  O O    . PHE A 1 10  ? -13.714 1.588   2.391   1.00 0.00 ? 717 PHE A O    5  
ATOM 7605  C CB   . PHE A 1 10  ? -14.359 3.168   0.280   1.00 0.00 ? 717 PHE A CB   5  
ATOM 7606  C CG   . PHE A 1 10  ? -14.759 3.685   -1.075  1.00 0.00 ? 717 PHE A CG   5  
ATOM 7607  C CD1  . PHE A 1 10  ? -15.349 2.844   -2.005  1.00 0.00 ? 717 PHE A CD1  5  
ATOM 7608  C CD2  . PHE A 1 10  ? -14.482 4.983   -1.440  1.00 0.00 ? 717 PHE A CD2  5  
ATOM 7609  C CE1  . PHE A 1 10  ? -15.663 3.299   -3.271  1.00 0.00 ? 717 PHE A CE1  5  
ATOM 7610  C CE2  . PHE A 1 10  ? -14.800 5.448   -2.701  1.00 0.00 ? 717 PHE A CE2  5  
ATOM 7611  C CZ   . PHE A 1 10  ? -15.388 4.605   -3.618  1.00 0.00 ? 717 PHE A CZ   5  
ATOM 7612  H H    . PHE A 1 10  ? -15.586 3.678   2.937   1.00 0.00 ? 717 PHE A H    5  
ATOM 7613  H HA   . PHE A 1 10  ? -16.269 2.166   0.557   1.00 0.00 ? 717 PHE A HA   5  
ATOM 7614  H HB2  . PHE A 1 10  ? -13.878 3.978   0.805   1.00 0.00 ? 717 PHE A HB2  5  
ATOM 7615  H HB3  . PHE A 1 10  ? -13.637 2.379   0.127   1.00 0.00 ? 717 PHE A HB3  5  
ATOM 7616  H HD1  . PHE A 1 10  ? -15.573 1.823   -1.729  1.00 0.00 ? 717 PHE A HD1  5  
ATOM 7617  H HD2  . PHE A 1 10  ? -14.020 5.647   -0.726  1.00 0.00 ? 717 PHE A HD2  5  
ATOM 7618  H HE1  . PHE A 1 10  ? -16.123 2.635   -3.988  1.00 0.00 ? 717 PHE A HE1  5  
ATOM 7619  H HE2  . PHE A 1 10  ? -14.583 6.470   -2.974  1.00 0.00 ? 717 PHE A HE2  5  
ATOM 7620  H HZ   . PHE A 1 10  ? -15.628 4.975   -4.603  1.00 0.00 ? 717 PHE A HZ   5  
ATOM 7621  N N    . SER A 1 11  ? -15.680 0.530   2.335   1.00 0.00 ? 718 SER A N    5  
ATOM 7622  C CA   . SER A 1 11  ? -15.320 -0.510  3.255   1.00 0.00 ? 718 SER A CA   5  
ATOM 7623  C C    . SER A 1 11  ? -14.011 -1.224  2.891   1.00 0.00 ? 718 SER A C    5  
ATOM 7624  O O    . SER A 1 11  ? -13.113 -1.317  3.729   1.00 0.00 ? 718 SER A O    5  
ATOM 7625  C CB   . SER A 1 11  ? -16.469 -1.467  3.342   1.00 0.00 ? 718 SER A CB   5  
ATOM 7626  O OG   . SER A 1 11  ? -17.658 -0.748  3.600   1.00 0.00 ? 718 SER A OG   5  
ATOM 7627  H H    . SER A 1 11  ? -16.583 0.481   1.957   1.00 0.00 ? 718 SER A H    5  
ATOM 7628  H HA   . SER A 1 11  ? -15.202 -0.054  4.226   1.00 0.00 ? 718 SER A HA   5  
ATOM 7629  H HB2  . SER A 1 11  ? -16.568 -2.014  2.417   1.00 0.00 ? 718 SER A HB2  5  
ATOM 7630  H HB3  . SER A 1 11  ? -16.294 -2.147  4.162   1.00 0.00 ? 718 SER A HB3  5  
ATOM 7631  H HG   . SER A 1 11  ? -18.072 -1.173  4.362   1.00 0.00 ? 718 SER A HG   5  
ATOM 7632  N N    . GLU A 1 12  ? -13.863 -1.650  1.648   1.00 0.00 ? 719 GLU A N    5  
ATOM 7633  C CA   . GLU A 1 12  ? -12.647 -2.351  1.251   1.00 0.00 ? 719 GLU A CA   5  
ATOM 7634  C C    . GLU A 1 12  ? -11.467 -1.414  1.232   1.00 0.00 ? 719 GLU A C    5  
ATOM 7635  O O    . GLU A 1 12  ? -10.390 -1.757  1.723   1.00 0.00 ? 719 GLU A O    5  
ATOM 7636  C CB   . GLU A 1 12  ? -12.792 -3.054  -0.090  1.00 0.00 ? 719 GLU A CB   5  
ATOM 7637  C CG   . GLU A 1 12  ? -13.929 -4.056  -0.154  1.00 0.00 ? 719 GLU A CG   5  
ATOM 7638  C CD   . GLU A 1 12  ? -13.902 -5.099  0.954   1.00 0.00 ? 719 GLU A CD   5  
ATOM 7639  O OE1  . GLU A 1 12  ? -13.041 -5.977  0.933   1.00 0.00 ? 719 GLU A OE1  5  
ATOM 7640  O OE2  . GLU A 1 12  ? -14.769 -5.057  1.856   1.00 0.00 ? 719 GLU A OE2  5  
ATOM 7641  H H    . GLU A 1 12  ? -14.588 -1.495  1.002   1.00 0.00 ? 719 GLU A H    5  
ATOM 7642  H HA   . GLU A 1 12  ? -12.403 -3.086  2.004   1.00 0.00 ? 719 GLU A HA   5  
ATOM 7643  H HB2  . GLU A 1 12  ? -12.956 -2.308  -0.853  1.00 0.00 ? 719 GLU A HB2  5  
ATOM 7644  H HB3  . GLU A 1 12  ? -11.869 -3.574  -0.305  1.00 0.00 ? 719 GLU A HB3  5  
ATOM 7645  H HG2  . GLU A 1 12  ? -14.865 -3.521  -0.102  1.00 0.00 ? 719 GLU A HG2  5  
ATOM 7646  H HG3  . GLU A 1 12  ? -13.833 -4.556  -1.106  1.00 0.00 ? 719 GLU A HG3  5  
ATOM 7647  N N    . TYR A 1 13  ? -11.674 -0.202  0.742   1.00 0.00 ? 720 TYR A N    5  
ATOM 7648  C CA   . TYR A 1 13  ? -10.582 0.738   0.687   1.00 0.00 ? 720 TYR A CA   5  
ATOM 7649  C C    . TYR A 1 13  ? -10.125 1.111   2.086   1.00 0.00 ? 720 TYR A C    5  
ATOM 7650  O O    . TYR A 1 13  ? -8.939  1.256   2.319   1.00 0.00 ? 720 TYR A O    5  
ATOM 7651  C CB   . TYR A 1 13  ? -10.880 1.989   -0.150  1.00 0.00 ? 720 TYR A CB   5  
ATOM 7652  C CG   . TYR A 1 13  ? -9.685  2.909   -0.209  1.00 0.00 ? 720 TYR A CG   5  
ATOM 7653  C CD1  . TYR A 1 13  ? -8.508  2.504   -0.833  1.00 0.00 ? 720 TYR A CD1  5  
ATOM 7654  C CD2  . TYR A 1 13  ? -9.707  4.149   0.403   1.00 0.00 ? 720 TYR A CD2  5  
ATOM 7655  C CE1  . TYR A 1 13  ? -7.398  3.318   -0.849  1.00 0.00 ? 720 TYR A CE1  5  
ATOM 7656  C CE2  . TYR A 1 13  ? -8.599  4.958   0.394   1.00 0.00 ? 720 TYR A CE2  5  
ATOM 7657  C CZ   . TYR A 1 13  ? -7.449  4.539   -0.234  1.00 0.00 ? 720 TYR A CZ   5  
ATOM 7658  O OH   . TYR A 1 13  ? -6.346  5.347   -0.238  1.00 0.00 ? 720 TYR A OH   5  
ATOM 7659  H H    . TYR A 1 13  ? -12.569 0.050   0.429   1.00 0.00 ? 720 TYR A H    5  
ATOM 7660  H HA   . TYR A 1 13  ? -9.761  0.204   0.231   1.00 0.00 ? 720 TYR A HA   5  
ATOM 7661  H HB2  . TYR A 1 13  ? -11.147 1.711   -1.157  1.00 0.00 ? 720 TYR A HB2  5  
ATOM 7662  H HB3  . TYR A 1 13  ? -11.688 2.548   0.300   1.00 0.00 ? 720 TYR A HB3  5  
ATOM 7663  H HD1  . TYR A 1 13  ? -8.475  1.540   -1.317  1.00 0.00 ? 720 TYR A HD1  5  
ATOM 7664  H HD2  . TYR A 1 13  ? -10.612 4.479   0.892   1.00 0.00 ? 720 TYR A HD2  5  
ATOM 7665  H HE1  . TYR A 1 13  ? -6.493  2.993   -1.340  1.00 0.00 ? 720 TYR A HE1  5  
ATOM 7666  H HE2  . TYR A 1 13  ? -8.634  5.924   0.873   1.00 0.00 ? 720 TYR A HE2  5  
ATOM 7667  H HH   . TYR A 1 13  ? -6.046  5.463   -1.146  1.00 0.00 ? 720 TYR A HH   5  
ATOM 7668  N N    . SER A 1 14  ? -11.058 1.224   3.023   1.00 0.00 ? 721 SER A N    5  
ATOM 7669  C CA   . SER A 1 14  ? -10.695 1.526   4.390   1.00 0.00 ? 721 SER A CA   5  
ATOM 7670  C C    . SER A 1 14  ? -9.863  0.399   5.021   1.00 0.00 ? 721 SER A C    5  
ATOM 7671  O O    . SER A 1 14  ? -9.036  0.656   5.878   1.00 0.00 ? 721 SER A O    5  
ATOM 7672  C CB   . SER A 1 14  ? -11.922 1.912   5.247   1.00 0.00 ? 721 SER A CB   5  
ATOM 7673  O OG   . SER A 1 14  ? -12.952 0.922   5.219   1.00 0.00 ? 721 SER A OG   5  
ATOM 7674  H H    . SER A 1 14  ? -12.010 1.144   2.785   1.00 0.00 ? 721 SER A H    5  
ATOM 7675  H HA   . SER A 1 14  ? -10.043 2.385   4.320   1.00 0.00 ? 721 SER A HA   5  
ATOM 7676  H HB2  . SER A 1 14  ? -11.606 2.047   6.271   1.00 0.00 ? 721 SER A HB2  5  
ATOM 7677  H HB3  . SER A 1 14  ? -12.324 2.847   4.884   1.00 0.00 ? 721 SER A HB3  5  
ATOM 7678  H HG   . SER A 1 14  ? -12.732 0.203   4.611   1.00 0.00 ? 721 SER A HG   5  
ATOM 7679  N N    . ARG A 1 15  ? -10.036 -0.843  4.529   1.00 0.00 ? 722 ARG A N    5  
ATOM 7680  C CA   . ARG A 1 15  ? -9.265  -1.982  5.046   1.00 0.00 ? 722 ARG A CA   5  
ATOM 7681  C C    . ARG A 1 15  ? -7.814  -1.797  4.618   1.00 0.00 ? 722 ARG A C    5  
ATOM 7682  O O    . ARG A 1 15  ? -6.875  -1.982  5.396   1.00 0.00 ? 722 ARG A O    5  
ATOM 7683  C CB   . ARG A 1 15  ? -9.748  -3.326  4.464   1.00 0.00 ? 722 ARG A CB   5  
ATOM 7684  C CG   . ARG A 1 15  ? -11.239 -3.589  4.490   1.00 0.00 ? 722 ARG A CG   5  
ATOM 7685  C CD   . ARG A 1 15  ? -11.832 -3.656  5.879   1.00 0.00 ? 722 ARG A CD   5  
ATOM 7686  N NE   . ARG A 1 15  ? -13.276 -3.941  5.795   1.00 0.00 ? 722 ARG A NE   5  
ATOM 7687  C CZ   . ARG A 1 15  ? -14.126 -3.982  6.825   1.00 0.00 ? 722 ARG A CZ   5  
ATOM 7688  N NH1  . ARG A 1 15  ? -13.689 -3.799  8.065   1.00 0.00 ? 722 ARG A NH1  5  
ATOM 7689  N NH2  . ARG A 1 15  ? -15.411 -4.230  6.603   1.00 0.00 ? 722 ARG A NH2  5  
ATOM 7690  H H    . ARG A 1 15  ? -10.672 -0.981  3.795   1.00 0.00 ? 722 ARG A H    5  
ATOM 7691  H HA   . ARG A 1 15  ? -9.339  -1.989  6.121   1.00 0.00 ? 722 ARG A HA   5  
ATOM 7692  H HB2  . ARG A 1 15  ? -9.435  -3.377  3.433   1.00 0.00 ? 722 ARG A HB2  5  
ATOM 7693  H HB3  . ARG A 1 15  ? -9.255  -4.122  5.004   1.00 0.00 ? 722 ARG A HB3  5  
ATOM 7694  H HG2  . ARG A 1 15  ? -11.729 -2.783  3.964   1.00 0.00 ? 722 ARG A HG2  5  
ATOM 7695  H HG3  . ARG A 1 15  ? -11.435 -4.516  3.974   1.00 0.00 ? 722 ARG A HG3  5  
ATOM 7696  H HD2  . ARG A 1 15  ? -11.339 -4.441  6.434   1.00 0.00 ? 722 ARG A HD2  5  
ATOM 7697  H HD3  . ARG A 1 15  ? -11.690 -2.708  6.377   1.00 0.00 ? 722 ARG A HD3  5  
ATOM 7698  H HE   . ARG A 1 15  ? -13.601 -4.109  4.883   1.00 0.00 ? 722 ARG A HE   5  
ATOM 7699  H HH11 . ARG A 1 15  ? -12.722 -3.632  8.275   1.00 0.00 ? 722 ARG A HH11 5  
ATOM 7700  H HH12 . ARG A 1 15  ? -14.289 -3.814  8.871   1.00 0.00 ? 722 ARG A HH12 5  
ATOM 7701  H HH21 . ARG A 1 15  ? -15.783 -4.395  5.683   1.00 0.00 ? 722 ARG A HH21 5  
ATOM 7702  H HH22 . ARG A 1 15  ? -16.091 -4.265  7.341   1.00 0.00 ? 722 ARG A HH22 5  
ATOM 7703  N N    . ILE A 1 16  ? -7.645  -1.444  3.359   1.00 0.00 ? 723 ILE A N    5  
ATOM 7704  C CA   . ILE A 1 16  ? -6.315  -1.193  2.798   1.00 0.00 ? 723 ILE A CA   5  
ATOM 7705  C C    . ILE A 1 16  ? -5.696  0.076   3.417   1.00 0.00 ? 723 ILE A C    5  
ATOM 7706  O O    . ILE A 1 16  ? -4.513  0.102   3.769   1.00 0.00 ? 723 ILE A O    5  
ATOM 7707  C CB   . ILE A 1 16  ? -6.335  -1.111  1.230   1.00 0.00 ? 723 ILE A CB   5  
ATOM 7708  C CG1  . ILE A 1 16  ? -6.519  -2.501  0.574   1.00 0.00 ? 723 ILE A CG1  5  
ATOM 7709  C CG2  . ILE A 1 16  ? -5.074  -0.450  0.682   1.00 0.00 ? 723 ILE A CG2  5  
ATOM 7710  C CD1  . ILE A 1 16  ? -7.853  -3.200  0.802   1.00 0.00 ? 723 ILE A CD1  5  
ATOM 7711  H H    . ILE A 1 16  ? -8.452  -1.371  2.797   1.00 0.00 ? 723 ILE A H    5  
ATOM 7712  H HA   . ILE A 1 16  ? -5.700  -2.030  3.098   1.00 0.00 ? 723 ILE A HA   5  
ATOM 7713  H HB   . ILE A 1 16  ? -7.173  -0.489  0.954   1.00 0.00 ? 723 ILE A HB   5  
ATOM 7714  H HG12 . ILE A 1 16  ? -6.423  -2.351  -0.488  1.00 0.00 ? 723 ILE A HG12 5  
ATOM 7715  H HG13 . ILE A 1 16  ? -5.726  -3.154  0.906   1.00 0.00 ? 723 ILE A HG13 5  
ATOM 7716  H HG21 . ILE A 1 16  ? -5.009  0.561   1.057   1.00 0.00 ? 723 ILE A HG21 5  
ATOM 7717  H HG22 . ILE A 1 16  ? -5.112  -0.435  -0.398  1.00 0.00 ? 723 ILE A HG22 5  
ATOM 7718  H HG23 . ILE A 1 16  ? -4.209  -1.009  1.004   1.00 0.00 ? 723 ILE A HG23 5  
ATOM 7719  H HD11 . ILE A 1 16  ? -7.988  -3.415  1.850   1.00 0.00 ? 723 ILE A HD11 5  
ATOM 7720  H HD12 . ILE A 1 16  ? -7.893  -4.117  0.235   1.00 0.00 ? 723 ILE A HD12 5  
ATOM 7721  H HD13 . ILE A 1 16  ? -8.675  -2.578  0.469   1.00 0.00 ? 723 ILE A HD13 5  
ATOM 7722  N N    . SER A 1 17  ? -6.508  1.101   3.548   1.00 0.00 ? 724 SER A N    5  
ATOM 7723  C CA   . SER A 1 17  ? -6.110  2.353   4.199   1.00 0.00 ? 724 SER A CA   5  
ATOM 7724  C C    . SER A 1 17  ? -5.622  2.076   5.629   1.00 0.00 ? 724 SER A C    5  
ATOM 7725  O O    . SER A 1 17  ? -4.612  2.655   6.070   1.00 0.00 ? 724 SER A O    5  
ATOM 7726  C CB   . SER A 1 17  ? -7.277  3.362   4.201   1.00 0.00 ? 724 SER A CB   5  
ATOM 7727  O OG   . SER A 1 17  ? -6.923  4.601   4.817   1.00 0.00 ? 724 SER A OG   5  
ATOM 7728  H H    . SER A 1 17  ? -7.400  1.004   3.142   1.00 0.00 ? 724 SER A H    5  
ATOM 7729  H HA   . SER A 1 17  ? -5.286  2.763   3.634   1.00 0.00 ? 724 SER A HA   5  
ATOM 7730  H HB2  . SER A 1 17  ? -7.584  3.559   3.185   1.00 0.00 ? 724 SER A HB2  5  
ATOM 7731  H HB3  . SER A 1 17  ? -8.102  2.929   4.745   1.00 0.00 ? 724 SER A HB3  5  
ATOM 7732  H HG   . SER A 1 17  ? -5.964  4.685   4.864   1.00 0.00 ? 724 SER A HG   5  
ATOM 7733  N N    . ASN A 1 18  ? -6.328  1.180   6.340   1.00 0.00 ? 725 ASN A N    5  
ATOM 7734  C CA   . ASN A 1 18  ? -5.911  0.762   7.670   1.00 0.00 ? 725 ASN A CA   5  
ATOM 7735  C C    . ASN A 1 18  ? -4.544  0.154   7.627   1.00 0.00 ? 725 ASN A C    5  
ATOM 7736  O O    . ASN A 1 18  ? -3.701  0.500   8.438   1.00 0.00 ? 725 ASN A O    5  
ATOM 7737  C CB   . ASN A 1 18  ? -6.894  -0.207  8.339   1.00 0.00 ? 725 ASN A CB   5  
ATOM 7738  C CG   . ASN A 1 18  ? -8.095  0.469   8.971   1.00 0.00 ? 725 ASN A CG   5  
ATOM 7739  O OD1  . ASN A 1 18  ? -8.043  1.638   9.366   1.00 0.00 ? 725 ASN A OD1  5  
ATOM 7740  N ND2  . ASN A 1 18  ? -9.164  -0.255  9.108   1.00 0.00 ? 725 ASN A ND2  5  
ATOM 7741  H H    . ASN A 1 18  ? -7.161  0.804   5.979   1.00 0.00 ? 725 ASN A H    5  
ATOM 7742  H HA   . ASN A 1 18  ? -5.849  1.659   8.269   1.00 0.00 ? 725 ASN A HA   5  
ATOM 7743  H HB2  . ASN A 1 18  ? -7.256  -0.896  7.590   1.00 0.00 ? 725 ASN A HB2  5  
ATOM 7744  H HB3  . ASN A 1 18  ? -6.372  -0.765  9.102   1.00 0.00 ? 725 ASN A HB3  5  
ATOM 7745  H HD21 . ASN A 1 18  ? -9.145  -1.185  8.789   1.00 0.00 ? 725 ASN A HD21 5  
ATOM 7746  H HD22 . ASN A 1 18  ? -9.939  0.131   9.562   1.00 0.00 ? 725 ASN A HD22 5  
ATOM 7747  N N    . LEU A 1 19  ? -4.300  -0.710  6.639   1.00 0.00 ? 726 LEU A N    5  
ATOM 7748  C CA   . LEU A 1 19  ? -2.997  -1.326  6.465   1.00 0.00 ? 726 LEU A CA   5  
ATOM 7749  C C    . LEU A 1 19  ? -1.897  -0.285  6.394   1.00 0.00 ? 726 LEU A C    5  
ATOM 7750  O O    . LEU A 1 19  ? -0.911  -0.414  7.068   1.00 0.00 ? 726 LEU A O    5  
ATOM 7751  C CB   . LEU A 1 19  ? -2.980  -2.296  5.236   1.00 0.00 ? 726 LEU A CB   5  
ATOM 7752  C CG   . LEU A 1 19  ? -1.599  -2.636  4.600   1.00 0.00 ? 726 LEU A CG   5  
ATOM 7753  C CD1  . LEU A 1 19  ? -1.661  -3.948  3.883   1.00 0.00 ? 726 LEU A CD1  5  
ATOM 7754  C CD2  . LEU A 1 19  ? -1.211  -1.580  3.579   1.00 0.00 ? 726 LEU A CD2  5  
ATOM 7755  H H    . LEU A 1 19  ? -5.019  -0.942  6.009   1.00 0.00 ? 726 LEU A H    5  
ATOM 7756  H HA   . LEU A 1 19  ? -2.817  -1.909  7.359   1.00 0.00 ? 726 LEU A HA   5  
ATOM 7757  H HB2  . LEU A 1 19  ? -3.436  -3.226  5.543   1.00 0.00 ? 726 LEU A HB2  5  
ATOM 7758  H HB3  . LEU A 1 19  ? -3.601  -1.860  4.469   1.00 0.00 ? 726 LEU A HB3  5  
ATOM 7759  H HG   . LEU A 1 19  ? -0.829  -2.675  5.357   1.00 0.00 ? 726 LEU A HG   5  
ATOM 7760  H HD11 . LEU A 1 19  ? -1.917  -4.729  4.583   1.00 0.00 ? 726 LEU A HD11 5  
ATOM 7761  H HD12 . LEU A 1 19  ? -0.701  -4.162  3.438   1.00 0.00 ? 726 LEU A HD12 5  
ATOM 7762  H HD13 . LEU A 1 19  ? -2.416  -3.897  3.113   1.00 0.00 ? 726 LEU A HD13 5  
ATOM 7763  H HD21 . LEU A 1 19  ? -0.259  -1.822  3.132   1.00 0.00 ? 726 LEU A HD21 5  
ATOM 7764  H HD22 . LEU A 1 19  ? -1.152  -0.624  4.079   1.00 0.00 ? 726 LEU A HD22 5  
ATOM 7765  H HD23 . LEU A 1 19  ? -1.974  -1.532  2.815   1.00 0.00 ? 726 LEU A HD23 5  
ATOM 7766  N N    . ILE A 1 20  ? -2.110  0.765   5.626   1.00 0.00 ? 727 ILE A N    5  
ATOM 7767  C CA   . ILE A 1 20  ? -1.103  1.799   5.461   1.00 0.00 ? 727 ILE A CA   5  
ATOM 7768  C C    . ILE A 1 20  ? -0.764  2.487   6.770   1.00 0.00 ? 727 ILE A C    5  
ATOM 7769  O O    . ILE A 1 20  ? 0.420   2.548   7.162   1.00 0.00 ? 727 ILE A O    5  
ATOM 7770  C CB   . ILE A 1 20  ? -1.482  2.824   4.345   1.00 0.00 ? 727 ILE A CB   5  
ATOM 7771  C CG1  . ILE A 1 20  ? -1.264  2.203   2.958   1.00 0.00 ? 727 ILE A CG1  5  
ATOM 7772  C CG2  . ILE A 1 20  ? -0.716  4.141   4.478   1.00 0.00 ? 727 ILE A CG2  5  
ATOM 7773  C CD1  . ILE A 1 20  ? 0.187   1.800   2.701   1.00 0.00 ? 727 ILE A CD1  5  
ATOM 7774  H H    . ILE A 1 20  ? -2.973  0.845   5.167   1.00 0.00 ? 727 ILE A H    5  
ATOM 7775  H HA   . ILE A 1 20  ? -0.203  1.289   5.157   1.00 0.00 ? 727 ILE A HA   5  
ATOM 7776  H HB   . ILE A 1 20  ? -2.533  3.046   4.451   1.00 0.00 ? 727 ILE A HB   5  
ATOM 7777  H HG12 . ILE A 1 20  ? -1.881  1.323   2.862   1.00 0.00 ? 727 ILE A HG12 5  
ATOM 7778  H HG13 . ILE A 1 20  ? -1.549  2.921   2.202   1.00 0.00 ? 727 ILE A HG13 5  
ATOM 7779  H HG21 . ILE A 1 20  ? -1.011  4.815   3.689   1.00 0.00 ? 727 ILE A HG21 5  
ATOM 7780  H HG22 . ILE A 1 20  ? 0.343   3.938   4.420   1.00 0.00 ? 727 ILE A HG22 5  
ATOM 7781  H HG23 . ILE A 1 20  ? -0.946  4.577   5.439   1.00 0.00 ? 727 ILE A HG23 5  
ATOM 7782  H HD11 . ILE A 1 20  ? 0.303   1.431   1.694   1.00 0.00 ? 727 ILE A HD11 5  
ATOM 7783  H HD12 . ILE A 1 20  ? 0.479   1.033   3.404   1.00 0.00 ? 727 ILE A HD12 5  
ATOM 7784  H HD13 . ILE A 1 20  ? 0.821   2.661   2.855   1.00 0.00 ? 727 ILE A HD13 5  
ATOM 7785  N N    . VAL A 1 21  ? -1.771  2.942   7.468   1.00 0.00 ? 728 VAL A N    5  
ATOM 7786  C CA   . VAL A 1 21  ? -1.529  3.655   8.693   1.00 0.00 ? 728 VAL A CA   5  
ATOM 7787  C C    . VAL A 1 21  ? -1.008  2.741   9.802   1.00 0.00 ? 728 VAL A C    5  
ATOM 7788  O O    . VAL A 1 21  ? -0.054  3.094   10.490  1.00 0.00 ? 728 VAL A O    5  
ATOM 7789  C CB   . VAL A 1 21  ? -2.741  4.506   9.170   1.00 0.00 ? 728 VAL A CB   5  
ATOM 7790  C CG1  . VAL A 1 21  ? -3.018  5.622   8.182   1.00 0.00 ? 728 VAL A CG1  5  
ATOM 7791  C CG2  . VAL A 1 21  ? -3.992  3.654   9.357   1.00 0.00 ? 728 VAL A CG2  5  
ATOM 7792  H H    . VAL A 1 21  ? -2.685  2.779   7.144   1.00 0.00 ? 728 VAL A H    5  
ATOM 7793  H HA   . VAL A 1 21  ? -0.722  4.331   8.445   1.00 0.00 ? 728 VAL A HA   5  
ATOM 7794  H HB   . VAL A 1 21  ? -2.483  4.954   10.119  1.00 0.00 ? 728 VAL A HB   5  
ATOM 7795  H HG11 . VAL A 1 21  ? -3.247  5.195   7.216   1.00 0.00 ? 728 VAL A HG11 5  
ATOM 7796  H HG12 . VAL A 1 21  ? -2.147  6.256   8.102   1.00 0.00 ? 728 VAL A HG12 5  
ATOM 7797  H HG13 . VAL A 1 21  ? -3.857  6.207   8.526   1.00 0.00 ? 728 VAL A HG13 5  
ATOM 7798  H HG21 . VAL A 1 21  ? -4.238  3.175   8.421   1.00 0.00 ? 728 VAL A HG21 5  
ATOM 7799  H HG22 . VAL A 1 21  ? -4.815  4.279   9.663   1.00 0.00 ? 728 VAL A HG22 5  
ATOM 7800  H HG23 . VAL A 1 21  ? -3.807  2.902   10.109  1.00 0.00 ? 728 VAL A HG23 5  
ATOM 7801  N N    . LEU A 1 22  ? -1.595  1.554   9.916   1.00 0.00 ? 729 LEU A N    5  
ATOM 7802  C CA   . LEU A 1 22  ? -1.238  0.583   10.946  1.00 0.00 ? 729 LEU A CA   5  
ATOM 7803  C C    . LEU A 1 22  ? 0.147   0.001   10.722  1.00 0.00 ? 729 LEU A C    5  
ATOM 7804  O O    . LEU A 1 22  ? 0.925   -0.124  11.661  1.00 0.00 ? 729 LEU A O    5  
ATOM 7805  C CB   . LEU A 1 22  ? -2.293  -0.518  11.012  1.00 0.00 ? 729 LEU A CB   5  
ATOM 7806  C CG   . LEU A 1 22  ? -3.677  -0.055  11.472  1.00 0.00 ? 729 LEU A CG   5  
ATOM 7807  C CD1  . LEU A 1 22  ? -4.712  -1.112  11.168  1.00 0.00 ? 729 LEU A CD1  5  
ATOM 7808  C CD2  . LEU A 1 22  ? -3.675  0.249   12.958  1.00 0.00 ? 729 LEU A CD2  5  
ATOM 7809  H H    . LEU A 1 22  ? -2.302  1.306   9.276   1.00 0.00 ? 729 LEU A H    5  
ATOM 7810  H HA   . LEU A 1 22  ? -1.243  1.106   11.889  1.00 0.00 ? 729 LEU A HA   5  
ATOM 7811  H HB2  . LEU A 1 22  ? -2.389  -0.938  10.021  1.00 0.00 ? 729 LEU A HB2  5  
ATOM 7812  H HB3  . LEU A 1 22  ? -1.951  -1.298  11.674  1.00 0.00 ? 729 LEU A HB3  5  
ATOM 7813  H HG   . LEU A 1 22  ? -3.924  0.856   10.948  1.00 0.00 ? 729 LEU A HG   5  
ATOM 7814  H HD11 . LEU A 1 22  ? -4.645  -1.334  10.113  1.00 0.00 ? 729 LEU A HD11 5  
ATOM 7815  H HD12 . LEU A 1 22  ? -5.703  -0.734  11.383  1.00 0.00 ? 729 LEU A HD12 5  
ATOM 7816  H HD13 . LEU A 1 22  ? -4.503  -2.002  11.740  1.00 0.00 ? 729 LEU A HD13 5  
ATOM 7817  H HD21 . LEU A 1 22  ? -2.955  1.021   13.173  1.00 0.00 ? 729 LEU A HD21 5  
ATOM 7818  H HD22 . LEU A 1 22  ? -3.428  -0.648  13.506  1.00 0.00 ? 729 LEU A HD22 5  
ATOM 7819  H HD23 . LEU A 1 22  ? -4.658  0.587   13.250  1.00 0.00 ? 729 LEU A HD23 5  
ATOM 7820  N N    . HIS A 1 23  ? 0.460   -0.321  9.479   1.00 0.00 ? 730 HIS A N    5  
ATOM 7821  C CA   . HIS A 1 23  ? 1.765   -0.881  9.136   1.00 0.00 ? 730 HIS A CA   5  
ATOM 7822  C C    . HIS A 1 23  ? 2.860   0.116   9.463   1.00 0.00 ? 730 HIS A C    5  
ATOM 7823  O O    . HIS A 1 23  ? 3.743   -0.180  10.245  1.00 0.00 ? 730 HIS A O    5  
ATOM 7824  C CB   . HIS A 1 23  ? 1.825   -1.267  7.646   1.00 0.00 ? 730 HIS A CB   5  
ATOM 7825  C CG   . HIS A 1 23  ? 3.083   -1.957  7.192   1.00 0.00 ? 730 HIS A CG   5  
ATOM 7826  N ND1  . HIS A 1 23  ? 3.967   -1.424  6.273   1.00 0.00 ? 730 HIS A ND1  5  
ATOM 7827  C CD2  . HIS A 1 23  ? 3.557   -3.189  7.490   1.00 0.00 ? 730 HIS A CD2  5  
ATOM 7828  C CE1  . HIS A 1 23  ? 4.917   -2.332  6.040   1.00 0.00 ? 730 HIS A CE1  5  
ATOM 7829  N NE2  . HIS A 1 23  ? 4.715   -3.427  6.757   1.00 0.00 ? 730 HIS A NE2  5  
ATOM 7830  H H    . HIS A 1 23  ? -0.210  -0.196  8.769   1.00 0.00 ? 730 HIS A H    5  
ATOM 7831  H HA   . HIS A 1 23  ? 1.915   -1.768  9.736   1.00 0.00 ? 730 HIS A HA   5  
ATOM 7832  H HB2  . HIS A 1 23  ? 0.996   -1.924  7.426   1.00 0.00 ? 730 HIS A HB2  5  
ATOM 7833  H HB3  . HIS A 1 23  ? 1.710   -0.366  7.059   1.00 0.00 ? 730 HIS A HB3  5  
ATOM 7834  H HD1  . HIS A 1 23  ? 3.915   -0.539  5.857   1.00 0.00 ? 730 HIS A HD1  5  
ATOM 7835  H HD2  . HIS A 1 23  ? 3.114   -3.886  8.186   1.00 0.00 ? 730 HIS A HD2  5  
ATOM 7836  H HE1  . HIS A 1 23  ? 5.737   -2.189  5.352   1.00 0.00 ? 730 HIS A HE1  5  
ATOM 7837  N N    . LEU A 1 24  ? 2.763   1.317   8.900   1.00 0.00 ? 731 LEU A N    5  
ATOM 7838  C CA   . LEU A 1 24  ? 3.790   2.332   9.098   1.00 0.00 ? 731 LEU A CA   5  
ATOM 7839  C C    . LEU A 1 24  ? 4.018   2.659   10.588  1.00 0.00 ? 731 LEU A C    5  
ATOM 7840  O O    . LEU A 1 24  ? 5.167   2.671   11.035  1.00 0.00 ? 731 LEU A O    5  
ATOM 7841  C CB   . LEU A 1 24  ? 3.498   3.572   8.212   1.00 0.00 ? 731 LEU A CB   5  
ATOM 7842  C CG   . LEU A 1 24  ? 4.489   4.776   8.213   1.00 0.00 ? 731 LEU A CG   5  
ATOM 7843  C CD1  . LEU A 1 24  ? 4.360   5.649   9.458   1.00 0.00 ? 731 LEU A CD1  5  
ATOM 7844  C CD2  . LEU A 1 24  ? 5.928   4.294   8.044   1.00 0.00 ? 731 LEU A CD2  5  
ATOM 7845  H H    . LEU A 1 24  ? 1.984   1.527   8.333   1.00 0.00 ? 731 LEU A H    5  
ATOM 7846  H HA   . LEU A 1 24  ? 4.707   1.877   8.750   1.00 0.00 ? 731 LEU A HA   5  
ATOM 7847  H HB2  . LEU A 1 24  ? 3.486   3.184   7.204   1.00 0.00 ? 731 LEU A HB2  5  
ATOM 7848  H HB3  . LEU A 1 24  ? 2.509   3.929   8.457   1.00 0.00 ? 731 LEU A HB3  5  
ATOM 7849  H HG   . LEU A 1 24  ? 4.253   5.406   7.368   1.00 0.00 ? 731 LEU A HG   5  
ATOM 7850  H HD11 . LEU A 1 24  ? 4.563   5.053   10.336  1.00 0.00 ? 731 LEU A HD11 5  
ATOM 7851  H HD12 . LEU A 1 24  ? 3.358   6.048   9.519   1.00 0.00 ? 731 LEU A HD12 5  
ATOM 7852  H HD13 . LEU A 1 24  ? 5.070   6.461   9.402   1.00 0.00 ? 731 LEU A HD13 5  
ATOM 7853  H HD21 . LEU A 1 24  ? 6.181   3.629   8.856   1.00 0.00 ? 731 LEU A HD21 5  
ATOM 7854  H HD22 . LEU A 1 24  ? 6.595   5.142   8.054   1.00 0.00 ? 731 LEU A HD22 5  
ATOM 7855  H HD23 . LEU A 1 24  ? 6.023   3.768   7.105   1.00 0.00 ? 731 LEU A HD23 5  
ATOM 7856  N N    . ARG A 1 25  ? 2.935   2.864   11.356  1.00 0.00 ? 732 ARG A N    5  
ATOM 7857  C CA   . ARG A 1 25  ? 3.074   3.185   12.792  1.00 0.00 ? 732 ARG A CA   5  
ATOM 7858  C C    . ARG A 1 25  ? 3.759   2.054   13.558  1.00 0.00 ? 732 ARG A C    5  
ATOM 7859  O O    . ARG A 1 25  ? 4.583   2.301   14.437  1.00 0.00 ? 732 ARG A O    5  
ATOM 7860  C CB   . ARG A 1 25  ? 1.720   3.552   13.455  1.00 0.00 ? 732 ARG A CB   5  
ATOM 7861  C CG   . ARG A 1 25  ? 0.636   2.491   13.311  1.00 0.00 ? 732 ARG A CG   5  
ATOM 7862  C CD   . ARG A 1 25  ? -0.643  2.841   14.055  1.00 0.00 ? 732 ARG A CD   5  
ATOM 7863  N NE   . ARG A 1 25  ? -0.469  2.725   15.499  1.00 0.00 ? 732 ARG A NE   5  
ATOM 7864  C CZ   . ARG A 1 25  ? -1.416  2.915   16.426  1.00 0.00 ? 732 ARG A CZ   5  
ATOM 7865  N NH1  . ARG A 1 25  ? -2.636  3.337   16.081  1.00 0.00 ? 732 ARG A NH1  5  
ATOM 7866  N NH2  . ARG A 1 25  ? -1.134  2.684   17.702  1.00 0.00 ? 732 ARG A NH2  5  
ATOM 7867  H H    . ARG A 1 25  ? 2.041   2.794   10.957  1.00 0.00 ? 732 ARG A H    5  
ATOM 7868  H HA   . ARG A 1 25  ? 3.729   4.042   12.843  1.00 0.00 ? 732 ARG A HA   5  
ATOM 7869  H HB2  . ARG A 1 25  ? 1.887   3.712   14.509  1.00 0.00 ? 732 ARG A HB2  5  
ATOM 7870  H HB3  . ARG A 1 25  ? 1.356   4.470   13.020  1.00 0.00 ? 732 ARG A HB3  5  
ATOM 7871  H HG2  . ARG A 1 25  ? 0.403   2.388   12.263  1.00 0.00 ? 732 ARG A HG2  5  
ATOM 7872  H HG3  . ARG A 1 25  ? 1.020   1.551   13.682  1.00 0.00 ? 732 ARG A HG3  5  
ATOM 7873  H HD2  . ARG A 1 25  ? -0.917  3.858   13.814  1.00 0.00 ? 732 ARG A HD2  5  
ATOM 7874  H HD3  . ARG A 1 25  ? -1.431  2.174   13.735  1.00 0.00 ? 732 ARG A HD3  5  
ATOM 7875  H HE   . ARG A 1 25  ? 0.438   2.441   15.763  1.00 0.00 ? 732 ARG A HE   5  
ATOM 7876  H HH11 . ARG A 1 25  ? -2.903  3.531   15.134  1.00 0.00 ? 732 ARG A HH11 5  
ATOM 7877  H HH12 . ARG A 1 25  ? -3.346  3.474   16.778  1.00 0.00 ? 732 ARG A HH12 5  
ATOM 7878  H HH21 . ARG A 1 25  ? -0.227  2.367   17.995  1.00 0.00 ? 732 ARG A HH21 5  
ATOM 7879  H HH22 . ARG A 1 25  ? -1.815  2.810   18.428  1.00 0.00 ? 732 ARG A HH22 5  
ATOM 7880  N N    . LYS A 1 26  ? 3.445   0.832   13.189  1.00 0.00 ? 733 LYS A N    5  
ATOM 7881  C CA   . LYS A 1 26  ? 4.001   -0.339  13.831  1.00 0.00 ? 733 LYS A CA   5  
ATOM 7882  C C    . LYS A 1 26  ? 5.476   -0.501  13.454  1.00 0.00 ? 733 LYS A C    5  
ATOM 7883  O O    . LYS A 1 26  ? 6.348   -0.665  14.320  1.00 0.00 ? 733 LYS A O    5  
ATOM 7884  C CB   . LYS A 1 26  ? 3.207   -1.569  13.399  1.00 0.00 ? 733 LYS A CB   5  
ATOM 7885  C CG   . LYS A 1 26  ? 3.649   -2.868  14.026  1.00 0.00 ? 733 LYS A CG   5  
ATOM 7886  C CD   . LYS A 1 26  ? 2.881   -4.036  13.445  1.00 0.00 ? 733 LYS A CD   5  
ATOM 7887  C CE   . LYS A 1 26  ? 3.328   -5.356  14.046  1.00 0.00 ? 733 LYS A CE   5  
ATOM 7888  N NZ   . LYS A 1 26  ? 4.777   -5.574  13.868  1.00 0.00 ? 733 LYS A NZ   5  
ATOM 7889  H H    . LYS A 1 26  ? 2.807   0.705   12.454  1.00 0.00 ? 733 LYS A H    5  
ATOM 7890  H HA   . LYS A 1 26  ? 3.913   -0.221  14.901  1.00 0.00 ? 733 LYS A HA   5  
ATOM 7891  H HB2  . LYS A 1 26  ? 2.168   -1.416  13.650  1.00 0.00 ? 733 LYS A HB2  5  
ATOM 7892  H HB3  . LYS A 1 26  ? 3.291   -1.666  12.326  1.00 0.00 ? 733 LYS A HB3  5  
ATOM 7893  H HG2  . LYS A 1 26  ? 4.702   -3.008  13.838  1.00 0.00 ? 733 LYS A HG2  5  
ATOM 7894  H HG3  . LYS A 1 26  ? 3.472   -2.823  15.090  1.00 0.00 ? 733 LYS A HG3  5  
ATOM 7895  H HD2  . LYS A 1 26  ? 1.830   -3.897  13.647  1.00 0.00 ? 733 LYS A HD2  5  
ATOM 7896  H HD3  . LYS A 1 26  ? 3.042   -4.061  12.376  1.00 0.00 ? 733 LYS A HD3  5  
ATOM 7897  H HE2  . LYS A 1 26  ? 3.101   -5.353  15.102  1.00 0.00 ? 733 LYS A HE2  5  
ATOM 7898  H HE3  . LYS A 1 26  ? 2.786   -6.159  13.568  1.00 0.00 ? 733 LYS A HE3  5  
ATOM 7899  H HZ1  . LYS A 1 26  ? 5.048   -6.550  14.096  1.00 0.00 ? 733 LYS A HZ1  5  
ATOM 7900  H HZ2  . LYS A 1 26  ? 5.298   -4.964  14.539  1.00 0.00 ? 733 LYS A HZ2  5  
ATOM 7901  H HZ3  . LYS A 1 26  ? 5.098   -5.346  12.905  1.00 0.00 ? 733 LYS A HZ3  5  
ATOM 7902  N N    . VAL A 1 27  ? 5.740   -0.402  12.169  1.00 0.00 ? 734 VAL A N    5  
ATOM 7903  C CA   . VAL A 1 27  ? 7.059   -0.592  11.611  1.00 0.00 ? 734 VAL A CA   5  
ATOM 7904  C C    . VAL A 1 27  ? 8.072   0.431   12.135  1.00 0.00 ? 734 VAL A C    5  
ATOM 7905  O O    . VAL A 1 27  ? 9.154   0.043   12.605  1.00 0.00 ? 734 VAL A O    5  
ATOM 7906  C CB   . VAL A 1 27  ? 7.012   -0.593  10.056  1.00 0.00 ? 734 VAL A CB   5  
ATOM 7907  C CG1  . VAL A 1 27  ? 8.389   -0.633  9.458   1.00 0.00 ? 734 VAL A CG1  5  
ATOM 7908  C CG2  . VAL A 1 27  ? 6.222   -1.783  9.557   1.00 0.00 ? 734 VAL A CG2  5  
ATOM 7909  H H    . VAL A 1 27  ? 5.002   -0.198  11.551  1.00 0.00 ? 734 VAL A H    5  
ATOM 7910  H HA   . VAL A 1 27  ? 7.395   -1.568  11.931  1.00 0.00 ? 734 VAL A HA   5  
ATOM 7911  H HB   . VAL A 1 27  ? 6.509   0.301   9.720   1.00 0.00 ? 734 VAL A HB   5  
ATOM 7912  H HG11 . VAL A 1 27  ? 8.899   -1.524  9.790   1.00 0.00 ? 734 VAL A HG11 5  
ATOM 7913  H HG12 . VAL A 1 27  ? 8.928   0.246   9.778   1.00 0.00 ? 734 VAL A HG12 5  
ATOM 7914  H HG13 . VAL A 1 27  ? 8.281   -0.648  8.384   1.00 0.00 ? 734 VAL A HG13 5  
ATOM 7915  H HG21 . VAL A 1 27  ? 6.688   -2.701  9.881   1.00 0.00 ? 734 VAL A HG21 5  
ATOM 7916  H HG22 . VAL A 1 27  ? 6.179   -1.749  8.478   1.00 0.00 ? 734 VAL A HG22 5  
ATOM 7917  H HG23 . VAL A 1 27  ? 5.215   -1.727  9.947   1.00 0.00 ? 734 VAL A HG23 5  
ATOM 7918  N N    . GLU A 1 28  ? 7.723   1.721   12.109  1.00 0.00 ? 735 GLU A N    5  
ATOM 7919  C CA   . GLU A 1 28  ? 8.658   2.754   12.566  1.00 0.00 ? 735 GLU A CA   5  
ATOM 7920  C C    . GLU A 1 28  ? 8.946   2.631   14.061  1.00 0.00 ? 735 GLU A C    5  
ATOM 7921  O O    . GLU A 1 28  ? 10.029  2.988   14.521  1.00 0.00 ? 735 GLU A O    5  
ATOM 7922  C CB   . GLU A 1 28  ? 8.187   4.191   12.249  1.00 0.00 ? 735 GLU A CB   5  
ATOM 7923  C CG   . GLU A 1 28  ? 6.869   4.591   12.894  1.00 0.00 ? 735 GLU A CG   5  
ATOM 7924  C CD   . GLU A 1 28  ? 6.693   6.089   12.969  1.00 0.00 ? 735 GLU A CD   5  
ATOM 7925  O OE1  . GLU A 1 28  ? 6.349   6.730   11.963  1.00 0.00 ? 735 GLU A OE1  5  
ATOM 7926  O OE2  . GLU A 1 28  ? 6.922   6.663   14.058  1.00 0.00 ? 735 GLU A OE2  5  
ATOM 7927  H H    . GLU A 1 28  ? 6.832   1.979   11.778  1.00 0.00 ? 735 GLU A H    5  
ATOM 7928  H HA   . GLU A 1 28  ? 9.587   2.572   12.045  1.00 0.00 ? 735 GLU A HA   5  
ATOM 7929  H HB2  . GLU A 1 28  ? 8.945   4.881   12.589  1.00 0.00 ? 735 GLU A HB2  5  
ATOM 7930  H HB3  . GLU A 1 28  ? 8.083   4.291   11.179  1.00 0.00 ? 735 GLU A HB3  5  
ATOM 7931  H HG2  . GLU A 1 28  ? 6.057   4.175   12.317  1.00 0.00 ? 735 GLU A HG2  5  
ATOM 7932  H HG3  . GLU A 1 28  ? 6.837   4.186   13.896  1.00 0.00 ? 735 GLU A HG3  5  
ATOM 7933  N N    . GLU A 1 29  ? 7.986   2.118   14.794  1.00 0.00 ? 736 GLU A N    5  
ATOM 7934  C CA   . GLU A 1 29  ? 8.092   1.997   16.224  1.00 0.00 ? 736 GLU A CA   5  
ATOM 7935  C C    . GLU A 1 29  ? 8.957   0.798   16.612  1.00 0.00 ? 736 GLU A C    5  
ATOM 7936  O O    . GLU A 1 29  ? 9.787   0.888   17.522  1.00 0.00 ? 736 GLU A O    5  
ATOM 7937  C CB   . GLU A 1 29  ? 6.699   1.859   16.812  1.00 0.00 ? 736 GLU A CB   5  
ATOM 7938  C CG   . GLU A 1 29  ? 6.637   1.856   18.322  1.00 0.00 ? 736 GLU A CG   5  
ATOM 7939  C CD   . GLU A 1 29  ? 5.238   1.653   18.807  1.00 0.00 ? 736 GLU A CD   5  
ATOM 7940  O OE1  . GLU A 1 29  ? 4.492   2.655   18.973  1.00 0.00 ? 736 GLU A OE1  5  
ATOM 7941  O OE2  . GLU A 1 29  ? 4.837   0.488   19.005  1.00 0.00 ? 736 GLU A OE2  5  
ATOM 7942  H H    . GLU A 1 29  ? 7.163   1.816   14.354  1.00 0.00 ? 736 GLU A H    5  
ATOM 7943  H HA   . GLU A 1 29  ? 8.539   2.901   16.609  1.00 0.00 ? 736 GLU A HA   5  
ATOM 7944  H HB2  . GLU A 1 29  ? 6.097   2.680   16.456  1.00 0.00 ? 736 GLU A HB2  5  
ATOM 7945  H HB3  . GLU A 1 29  ? 6.263   0.938   16.454  1.00 0.00 ? 736 GLU A HB3  5  
ATOM 7946  H HG2  . GLU A 1 29  ? 7.256   1.054   18.696  1.00 0.00 ? 736 GLU A HG2  5  
ATOM 7947  H HG3  . GLU A 1 29  ? 7.003   2.802   18.692  1.00 0.00 ? 736 GLU A HG3  5  
ATOM 7948  N N    . GLU A 1 30  ? 8.764   -0.318  15.936  1.00 0.00 ? 737 GLU A N    5  
ATOM 7949  C CA   . GLU A 1 30  ? 9.509   -1.521  16.263  1.00 0.00 ? 737 GLU A CA   5  
ATOM 7950  C C    . GLU A 1 30  ? 10.853  -1.612  15.569  1.00 0.00 ? 737 GLU A C    5  
ATOM 7951  O O    . GLU A 1 30  ? 11.903  -1.510  16.209  1.00 0.00 ? 737 GLU A O    5  
ATOM 7952  C CB   . GLU A 1 30  ? 8.712   -2.774  15.955  1.00 0.00 ? 737 GLU A CB   5  
ATOM 7953  C CG   . GLU A 1 30  ? 7.523   -3.006  16.847  1.00 0.00 ? 737 GLU A CG   5  
ATOM 7954  C CD   . GLU A 1 30  ? 6.888   -4.332  16.563  1.00 0.00 ? 737 GLU A CD   5  
ATOM 7955  O OE1  . GLU A 1 30  ? 7.468   -5.370  16.917  1.00 0.00 ? 737 GLU A OE1  5  
ATOM 7956  O OE2  . GLU A 1 30  ? 5.798   -4.371  15.992  1.00 0.00 ? 737 GLU A OE2  5  
ATOM 7957  H H    . GLU A 1 30  ? 8.088   -0.335  15.222  1.00 0.00 ? 737 GLU A H    5  
ATOM 7958  H HA   . GLU A 1 30  ? 9.688   -1.505  17.327  1.00 0.00 ? 737 GLU A HA   5  
ATOM 7959  H HB2  . GLU A 1 30  ? 8.356   -2.712  14.937  1.00 0.00 ? 737 GLU A HB2  5  
ATOM 7960  H HB3  . GLU A 1 30  ? 9.369   -3.628  16.033  1.00 0.00 ? 737 GLU A HB3  5  
ATOM 7961  H HG2  . GLU A 1 30  ? 7.843   -2.984  17.877  1.00 0.00 ? 737 GLU A HG2  5  
ATOM 7962  H HG3  . GLU A 1 30  ? 6.793   -2.228  16.677  1.00 0.00 ? 737 GLU A HG3  5  
ATOM 7963  N N    . GLU A 1 31  ? 10.820  -1.784  14.271  1.00 0.00 ? 738 GLU A N    5  
ATOM 7964  C CA   . GLU A 1 31  ? 12.016  -2.072  13.511  1.00 0.00 ? 738 GLU A CA   5  
ATOM 7965  C C    . GLU A 1 31  ? 12.672  -0.820  12.938  1.00 0.00 ? 738 GLU A C    5  
ATOM 7966  O O    . GLU A 1 31  ? 13.804  -0.887  12.431  1.00 0.00 ? 738 GLU A O    5  
ATOM 7967  C CB   . GLU A 1 31  ? 11.713  -3.129  12.443  1.00 0.00 ? 738 GLU A CB   5  
ATOM 7968  C CG   . GLU A 1 31  ? 10.575  -2.777  11.492  1.00 0.00 ? 738 GLU A CG   5  
ATOM 7969  C CD   . GLU A 1 31  ? 10.170  -3.944  10.616  1.00 0.00 ? 738 GLU A CD   5  
ATOM 7970  O OE1  . GLU A 1 31  ? 10.879  -4.245  9.647   1.00 0.00 ? 738 GLU A OE1  5  
ATOM 7971  O OE2  . GLU A 1 31  ? 9.151   -4.610  10.924  1.00 0.00 ? 738 GLU A OE2  5  
ATOM 7972  H H    . GLU A 1 31  ? 9.963   -1.705  13.799  1.00 0.00 ? 738 GLU A H    5  
ATOM 7973  H HA   . GLU A 1 31  ? 12.717  -2.504  14.211  1.00 0.00 ? 738 GLU A HA   5  
ATOM 7974  H HB2  . GLU A 1 31  ? 12.608  -3.273  11.856  1.00 0.00 ? 738 GLU A HB2  5  
ATOM 7975  H HB3  . GLU A 1 31  ? 11.470  -4.059  12.936  1.00 0.00 ? 738 GLU A HB3  5  
ATOM 7976  H HG2  . GLU A 1 31  ? 9.718   -2.466  12.069  1.00 0.00 ? 738 GLU A HG2  5  
ATOM 7977  H HG3  . GLU A 1 31  ? 10.896  -1.963  10.858  1.00 0.00 ? 738 GLU A HG3  5  
ATOM 7978  N N    . ASP A 1 32  ? 11.951  0.307   13.004  1.00 0.00 ? 739 ASP A N    5  
ATOM 7979  C CA   . ASP A 1 32  ? 12.431  1.661   12.582  1.00 0.00 ? 739 ASP A CA   5  
ATOM 7980  C C    . ASP A 1 32  ? 12.547  1.819   11.066  1.00 0.00 ? 739 ASP A C    5  
ATOM 7981  O O    . ASP A 1 32  ? 12.016  2.779   10.486  1.00 0.00 ? 739 ASP A O    5  
ATOM 7982  C CB   . ASP A 1 32  ? 13.751  2.064   13.275  1.00 0.00 ? 739 ASP A CB   5  
ATOM 7983  C CG   . ASP A 1 32  ? 14.268  3.412   12.803  1.00 0.00 ? 739 ASP A CG   5  
ATOM 7984  O OD1  . ASP A 1 32  ? 13.680  4.443   13.165  1.00 0.00 ? 739 ASP A OD1  5  
ATOM 7985  O OD2  . ASP A 1 32  ? 15.274  3.462   12.052  1.00 0.00 ? 739 ASP A OD2  5  
ATOM 7986  H H    . ASP A 1 32  ? 11.029  0.222   13.331  1.00 0.00 ? 739 ASP A H    5  
ATOM 7987  H HA   . ASP A 1 32  ? 11.660  2.348   12.900  1.00 0.00 ? 739 ASP A HA   5  
ATOM 7988  H HB2  . ASP A 1 32  ? 13.590  2.116   14.342  1.00 0.00 ? 739 ASP A HB2  5  
ATOM 7989  H HB3  . ASP A 1 32  ? 14.502  1.315   13.067  1.00 0.00 ? 739 ASP A HB3  5  
ATOM 7990  N N    . GLU A 1 33  ? 13.207  0.872   10.442  1.00 0.00 ? 740 GLU A N    5  
ATOM 7991  C CA   . GLU A 1 33  ? 13.448  0.839   9.030   1.00 0.00 ? 740 GLU A CA   5  
ATOM 7992  C C    . GLU A 1 33  ? 12.170  0.514   8.307   1.00 0.00 ? 740 GLU A C    5  
ATOM 7993  O O    . GLU A 1 33  ? 11.837  -0.646  8.059   1.00 0.00 ? 740 GLU A O    5  
ATOM 7994  C CB   . GLU A 1 33  ? 14.524  -0.177  8.693   1.00 0.00 ? 740 GLU A CB   5  
ATOM 7995  C CG   . GLU A 1 33  ? 15.882  0.126   9.281   1.00 0.00 ? 740 GLU A CG   5  
ATOM 7996  C CD   . GLU A 1 33  ? 16.864  -0.971  8.993   1.00 0.00 ? 740 GLU A CD   5  
ATOM 7997  O OE1  . GLU A 1 33  ? 17.083  -1.294  7.801   1.00 0.00 ? 740 GLU A OE1  5  
ATOM 7998  O OE2  . GLU A 1 33  ? 17.450  -1.530  9.943   1.00 0.00 ? 740 GLU A OE2  5  
ATOM 7999  H H    . GLU A 1 33  ? 13.533  0.129   10.981  1.00 0.00 ? 740 GLU A H    5  
ATOM 8000  H HA   . GLU A 1 33  ? 13.789  1.820   8.735   1.00 0.00 ? 740 GLU A HA   5  
ATOM 8001  H HB2  . GLU A 1 33  ? 14.211  -1.146  9.051   1.00 0.00 ? 740 GLU A HB2  5  
ATOM 8002  H HB3  . GLU A 1 33  ? 14.626  -0.218  7.618   1.00 0.00 ? 740 GLU A HB3  5  
ATOM 8003  H HG2  . GLU A 1 33  ? 16.254  1.047   8.856   1.00 0.00 ? 740 GLU A HG2  5  
ATOM 8004  H HG3  . GLU A 1 33  ? 15.785  0.233   10.352  1.00 0.00 ? 740 GLU A HG3  5  
ATOM 8005  N N    . SER A 1 34  ? 11.457  1.544   8.043   1.00 0.00 ? 741 SER A N    5  
ATOM 8006  C CA   . SER A 1 34  ? 10.160  1.491   7.422   1.00 0.00 ? 741 SER A CA   5  
ATOM 8007  C C    . SER A 1 34  ? 10.225  1.147   5.932   1.00 0.00 ? 741 SER A C    5  
ATOM 8008  O O    . SER A 1 34  ? 9.208   0.805   5.337   1.00 0.00 ? 741 SER A O    5  
ATOM 8009  C CB   . SER A 1 34  ? 9.452   2.814   7.640   1.00 0.00 ? 741 SER A CB   5  
ATOM 8010  O OG   . SER A 1 34  ? 9.468   3.170   9.023   1.00 0.00 ? 741 SER A OG   5  
ATOM 8011  H H    . SER A 1 34  ? 11.869  2.385   8.335   1.00 0.00 ? 741 SER A H    5  
ATOM 8012  H HA   . SER A 1 34  ? 9.592   0.725   7.924   1.00 0.00 ? 741 SER A HA   5  
ATOM 8013  H HB2  . SER A 1 34  ? 9.955   3.584   7.073   1.00 0.00 ? 741 SER A HB2  5  
ATOM 8014  H HB3  . SER A 1 34  ? 8.426   2.732   7.312   1.00 0.00 ? 741 SER A HB3  5  
ATOM 8015  H HG   . SER A 1 34  ? 10.063  2.556   9.472   1.00 0.00 ? 741 SER A HG   5  
ATOM 8016  N N    . ALA A 1 35  ? 11.406  1.262   5.341   1.00 0.00 ? 742 ALA A N    5  
ATOM 8017  C CA   . ALA A 1 35  ? 11.597  0.934   3.944   1.00 0.00 ? 742 ALA A CA   5  
ATOM 8018  C C    . ALA A 1 35  ? 11.576  -0.580  3.745   1.00 0.00 ? 742 ALA A C    5  
ATOM 8019  O O    . ALA A 1 35  ? 12.594  -1.262  3.902   1.00 0.00 ? 742 ALA A O    5  
ATOM 8020  C CB   . ALA A 1 35  ? 12.890  1.543   3.417   1.00 0.00 ? 742 ALA A CB   5  
ATOM 8021  H H    . ALA A 1 35  ? 12.174  1.581   5.862   1.00 0.00 ? 742 ALA A H    5  
ATOM 8022  H HA   . ALA A 1 35  ? 10.766  1.358   3.398   1.00 0.00 ? 742 ALA A HA   5  
ATOM 8023  H HB1  . ALA A 1 35  ? 13.732  1.100   3.928   1.00 0.00 ? 742 ALA A HB1  5  
ATOM 8024  H HB2  . ALA A 1 35  ? 12.882  2.609   3.599   1.00 0.00 ? 742 ALA A HB2  5  
ATOM 8025  H HB3  . ALA A 1 35  ? 12.971  1.362   2.356   1.00 0.00 ? 742 ALA A HB3  5  
ATOM 8026  N N    . LEU A 1 36  ? 10.417  -1.098  3.457   1.00 0.00 ? 743 LEU A N    5  
ATOM 8027  C CA   . LEU A 1 36  ? 10.226  -2.522  3.312   1.00 0.00 ? 743 LEU A CA   5  
ATOM 8028  C C    . LEU A 1 36  ? 9.955   -2.897  1.863   1.00 0.00 ? 743 LEU A C    5  
ATOM 8029  O O    . LEU A 1 36  ? 10.079  -2.056  0.958   1.00 0.00 ? 743 LEU A O    5  
ATOM 8030  C CB   . LEU A 1 36  ? 9.118   -3.025  4.260   1.00 0.00 ? 743 LEU A CB   5  
ATOM 8031  C CG   . LEU A 1 36  ? 9.424   -2.921  5.769   1.00 0.00 ? 743 LEU A CG   5  
ATOM 8032  C CD1  . LEU A 1 36  ? 8.266   -3.449  6.589   1.00 0.00 ? 743 LEU A CD1  5  
ATOM 8033  C CD2  . LEU A 1 36  ? 10.691  -3.684  6.124   1.00 0.00 ? 743 LEU A CD2  5  
ATOM 8034  H H    . LEU A 1 36  ? 9.659   -0.483  3.323   1.00 0.00 ? 743 LEU A H    5  
ATOM 8035  H HA   . LEU A 1 36  ? 11.157  -2.992  3.593   1.00 0.00 ? 743 LEU A HA   5  
ATOM 8036  H HB2  . LEU A 1 36  ? 8.226   -2.450  4.057   1.00 0.00 ? 743 LEU A HB2  5  
ATOM 8037  H HB3  . LEU A 1 36  ? 8.910   -4.059  4.031   1.00 0.00 ? 743 LEU A HB3  5  
ATOM 8038  H HG   . LEU A 1 36  ? 9.570   -1.882  6.029   1.00 0.00 ? 743 LEU A HG   5  
ATOM 8039  H HD11 . LEU A 1 36  ? 8.508   -3.378  7.639   1.00 0.00 ? 743 LEU A HD11 5  
ATOM 8040  H HD12 . LEU A 1 36  ? 8.076   -4.480  6.333   1.00 0.00 ? 743 LEU A HD12 5  
ATOM 8041  H HD13 . LEU A 1 36  ? 7.383   -2.861  6.387   1.00 0.00 ? 743 LEU A HD13 5  
ATOM 8042  H HD21 . LEU A 1 36  ? 10.878  -3.595  7.184   1.00 0.00 ? 743 LEU A HD21 5  
ATOM 8043  H HD22 . LEU A 1 36  ? 11.525  -3.272  5.579   1.00 0.00 ? 743 LEU A HD22 5  
ATOM 8044  H HD23 . LEU A 1 36  ? 10.574  -4.726  5.867   1.00 0.00 ? 743 LEU A HD23 5  
ATOM 8045  N N    . LYS A 1 37  ? 9.616   -4.142  1.636   1.00 0.00 ? 744 LYS A N    5  
ATOM 8046  C CA   . LYS A 1 37  ? 9.421   -4.641  0.301   1.00 0.00 ? 744 LYS A CA   5  
ATOM 8047  C C    . LYS A 1 37  ? 7.948   -4.663  -0.113  1.00 0.00 ? 744 LYS A C    5  
ATOM 8048  O O    . LYS A 1 37  ? 7.049   -4.633  0.730   1.00 0.00 ? 744 LYS A O    5  
ATOM 8049  C CB   . LYS A 1 37  ? 10.070  -6.014  0.152   1.00 0.00 ? 744 LYS A CB   5  
ATOM 8050  C CG   . LYS A 1 37  ? 11.594  -6.020  0.379   1.00 0.00 ? 744 LYS A CG   5  
ATOM 8051  C CD   . LYS A 1 37  ? 12.324  -5.053  -0.557  1.00 0.00 ? 744 LYS A CD   5  
ATOM 8052  C CE   . LYS A 1 37  ? 12.017  -5.359  -2.008  1.00 0.00 ? 744 LYS A CE   5  
ATOM 8053  N NZ   . LYS A 1 37  ? 12.634  -4.399  -2.922  1.00 0.00 ? 744 LYS A NZ   5  
ATOM 8054  H H    . LYS A 1 37  ? 9.483   -4.754  2.393   1.00 0.00 ? 744 LYS A H    5  
ATOM 8055  H HA   . LYS A 1 37  ? 9.930   -3.960  -0.365  1.00 0.00 ? 744 LYS A HA   5  
ATOM 8056  H HB2  . LYS A 1 37  ? 9.622   -6.674  0.880   1.00 0.00 ? 744 LYS A HB2  5  
ATOM 8057  H HB3  . LYS A 1 37  ? 9.865   -6.400  -0.834  1.00 0.00 ? 744 LYS A HB3  5  
ATOM 8058  H HG2  . LYS A 1 37  ? 11.797  -5.729  1.399   1.00 0.00 ? 744 LYS A HG2  5  
ATOM 8059  H HG3  . LYS A 1 37  ? 11.967  -7.018  0.208   1.00 0.00 ? 744 LYS A HG3  5  
ATOM 8060  H HD2  . LYS A 1 37  ? 12.020  -4.041  -0.338  1.00 0.00 ? 744 LYS A HD2  5  
ATOM 8061  H HD3  . LYS A 1 37  ? 13.387  -5.149  -0.395  1.00 0.00 ? 744 LYS A HD3  5  
ATOM 8062  H HE2  . LYS A 1 37  ? 12.366  -6.352  -2.247  1.00 0.00 ? 744 LYS A HE2  5  
ATOM 8063  H HE3  . LYS A 1 37  ? 10.946  -5.316  -2.135  1.00 0.00 ? 744 LYS A HE3  5  
ATOM 8064  H HZ1  . LYS A 1 37  ? 12.455  -3.408  -2.659  1.00 0.00 ? 744 LYS A HZ1  5  
ATOM 8065  H HZ2  . LYS A 1 37  ? 12.155  -4.492  -3.847  1.00 0.00 ? 744 LYS A HZ2  5  
ATOM 8066  H HZ3  . LYS A 1 37  ? 13.653  -4.547  -3.070  1.00 0.00 ? 744 LYS A HZ3  5  
ATOM 8067  N N    . ARG A 1 38  ? 7.725   -4.756  -1.420  1.00 0.00 ? 745 ARG A N    5  
ATOM 8068  C CA   . ARG A 1 38  ? 6.390   -4.666  -2.030  1.00 0.00 ? 745 ARG A CA   5  
ATOM 8069  C C    . ARG A 1 38  ? 5.570   -5.906  -1.753  1.00 0.00 ? 745 ARG A C    5  
ATOM 8070  O O    . ARG A 1 38  ? 4.502   -5.838  -1.136  1.00 0.00 ? 745 ARG A O    5  
ATOM 8071  C CB   . ARG A 1 38  ? 6.535   -4.497  -3.542  1.00 0.00 ? 745 ARG A CB   5  
ATOM 8072  C CG   . ARG A 1 38  ? 7.329   -3.276  -3.944  1.00 0.00 ? 745 ARG A CG   5  
ATOM 8073  C CD   . ARG A 1 38  ? 7.772   -3.324  -5.393  1.00 0.00 ? 745 ARG A CD   5  
ATOM 8074  N NE   . ARG A 1 38  ? 6.669   -3.396  -6.345  1.00 0.00 ? 745 ARG A NE   5  
ATOM 8075  C CZ   . ARG A 1 38  ? 6.831   -3.455  -7.671  1.00 0.00 ? 745 ARG A CZ   5  
ATOM 8076  N NH1  . ARG A 1 38  ? 8.052   -3.523  -8.190  1.00 0.00 ? 745 ARG A NH1  5  
ATOM 8077  N NH2  . ARG A 1 38  ? 5.777   -3.463  -8.477  1.00 0.00 ? 745 ARG A NH2  5  
ATOM 8078  H H    . ARG A 1 38  ? 8.485   -4.915  -2.021  1.00 0.00 ? 745 ARG A H    5  
ATOM 8079  H HA   . ARG A 1 38  ? 5.884   -3.798  -1.637  1.00 0.00 ? 745 ARG A HA   5  
ATOM 8080  H HB2  . ARG A 1 38  ? 7.003   -5.376  -3.958  1.00 0.00 ? 745 ARG A HB2  5  
ATOM 8081  H HB3  . ARG A 1 38  ? 5.544   -4.408  -3.961  1.00 0.00 ? 745 ARG A HB3  5  
ATOM 8082  H HG2  . ARG A 1 38  ? 6.706   -2.405  -3.810  1.00 0.00 ? 745 ARG A HG2  5  
ATOM 8083  H HG3  . ARG A 1 38  ? 8.200   -3.201  -3.309  1.00 0.00 ? 745 ARG A HG3  5  
ATOM 8084  H HD2  . ARG A 1 38  ? 8.343   -2.432  -5.607  1.00 0.00 ? 745 ARG A HD2  5  
ATOM 8085  H HD3  . ARG A 1 38  ? 8.411   -4.184  -5.532  1.00 0.00 ? 745 ARG A HD3  5  
ATOM 8086  H HE   . ARG A 1 38  ? 5.760   -3.392  -5.964  1.00 0.00 ? 745 ARG A HE   5  
ATOM 8087  H HH11 . ARG A 1 38  ? 8.889   -3.546  -7.625  1.00 0.00 ? 745 ARG A HH11 5  
ATOM 8088  H HH12 . ARG A 1 38  ? 8.192   -3.544  -9.183  1.00 0.00 ? 745 ARG A HH12 5  
ATOM 8089  H HH21 . ARG A 1 38  ? 4.835   -3.434  -8.131  1.00 0.00 ? 745 ARG A HH21 5  
ATOM 8090  H HH22 . ARG A 1 38  ? 5.899   -3.503  -9.473  1.00 0.00 ? 745 ARG A HH22 5  
ATOM 8091  N N    . SER A 1 39  ? 6.091   -7.038  -2.190  1.00 0.00 ? 746 SER A N    5  
ATOM 8092  C CA   . SER A 1 39  ? 5.407   -8.298  -2.077  1.00 0.00 ? 746 SER A CA   5  
ATOM 8093  C C    . SER A 1 39  ? 5.107   -8.656  -0.612  1.00 0.00 ? 746 SER A C    5  
ATOM 8094  O O    . SER A 1 39  ? 4.046   -9.169  -0.321  1.00 0.00 ? 746 SER A O    5  
ATOM 8095  C CB   . SER A 1 39  ? 6.227   -9.372  -2.784  1.00 0.00 ? 746 SER A CB   5  
ATOM 8096  O OG   . SER A 1 39  ? 6.530   -8.949  -4.123  1.00 0.00 ? 746 SER A OG   5  
ATOM 8097  H H    . SER A 1 39  ? 6.971   -7.033  -2.623  1.00 0.00 ? 746 SER A H    5  
ATOM 8098  H HA   . SER A 1 39  ? 4.466   -8.195  -2.597  1.00 0.00 ? 746 SER A HA   5  
ATOM 8099  H HB2  . SER A 1 39  ? 7.150   -9.536  -2.248  1.00 0.00 ? 746 SER A HB2  5  
ATOM 8100  H HB3  . SER A 1 39  ? 5.661   -10.290 -2.831  1.00 0.00 ? 746 SER A HB3  5  
ATOM 8101  H HG   . SER A 1 39  ? 5.688   -8.857  -4.587  1.00 0.00 ? 746 SER A HG   5  
ATOM 8102  N N    . GLU A 1 40  ? 6.032   -8.319  0.298   1.00 0.00 ? 747 GLU A N    5  
ATOM 8103  C CA   . GLU A 1 40  ? 5.862   -8.554  1.738   1.00 0.00 ? 747 GLU A CA   5  
ATOM 8104  C C    . GLU A 1 40  ? 4.579   -7.912  2.275   1.00 0.00 ? 747 GLU A C    5  
ATOM 8105  O O    . GLU A 1 40  ? 3.839   -8.541  3.029   1.00 0.00 ? 747 GLU A O    5  
ATOM 8106  C CB   . GLU A 1 40  ? 7.055   -8.007  2.523   1.00 0.00 ? 747 GLU A CB   5  
ATOM 8107  C CG   . GLU A 1 40  ? 6.910   -8.162  4.036   1.00 0.00 ? 747 GLU A CG   5  
ATOM 8108  C CD   . GLU A 1 40  ? 6.884   -9.603  4.479   1.00 0.00 ? 747 GLU A CD   5  
ATOM 8109  O OE1  . GLU A 1 40  ? 7.968   -10.200 4.637   1.00 0.00 ? 747 GLU A OE1  5  
ATOM 8110  O OE2  . GLU A 1 40  ? 5.794   -10.173 4.673   1.00 0.00 ? 747 GLU A OE2  5  
ATOM 8111  H H    . GLU A 1 40  ? 6.872   -7.926  -0.011  1.00 0.00 ? 747 GLU A H    5  
ATOM 8112  H HA   . GLU A 1 40  ? 5.815   -9.622  1.892   1.00 0.00 ? 747 GLU A HA   5  
ATOM 8113  H HB2  . GLU A 1 40  ? 7.950   -8.524  2.212   1.00 0.00 ? 747 GLU A HB2  5  
ATOM 8114  H HB3  . GLU A 1 40  ? 7.162   -6.955  2.301   1.00 0.00 ? 747 GLU A HB3  5  
ATOM 8115  H HG2  . GLU A 1 40  ? 7.709   -7.647  4.547   1.00 0.00 ? 747 GLU A HG2  5  
ATOM 8116  H HG3  . GLU A 1 40  ? 5.960   -7.717  4.296   1.00 0.00 ? 747 GLU A HG3  5  
ATOM 8117  N N    . LEU A 1 41  ? 4.317   -6.680  1.860   1.00 0.00 ? 748 LEU A N    5  
ATOM 8118  C CA   . LEU A 1 41  ? 3.163   -5.928  2.338   1.00 0.00 ? 748 LEU A CA   5  
ATOM 8119  C C    . LEU A 1 41  ? 1.873   -6.693  2.037   1.00 0.00 ? 748 LEU A C    5  
ATOM 8120  O O    . LEU A 1 41  ? 1.036   -6.936  2.923   1.00 0.00 ? 748 LEU A O    5  
ATOM 8121  C CB   . LEU A 1 41  ? 3.146   -4.540  1.682   1.00 0.00 ? 748 LEU A CB   5  
ATOM 8122  C CG   . LEU A 1 41  ? 2.063   -3.568  2.154   1.00 0.00 ? 748 LEU A CG   5  
ATOM 8123  C CD1  . LEU A 1 41  ? 2.222   -3.272  3.637   1.00 0.00 ? 748 LEU A CD1  5  
ATOM 8124  C CD2  . LEU A 1 41  ? 2.120   -2.283  1.343   1.00 0.00 ? 748 LEU A CD2  5  
ATOM 8125  H H    . LEU A 1 41  ? 4.915   -6.270  1.199   1.00 0.00 ? 748 LEU A H    5  
ATOM 8126  H HA   . LEU A 1 41  ? 3.263   -5.813  3.408   1.00 0.00 ? 748 LEU A HA   5  
ATOM 8127  H HB2  . LEU A 1 41  ? 4.106   -4.078  1.855   1.00 0.00 ? 748 LEU A HB2  5  
ATOM 8128  H HB3  . LEU A 1 41  ? 3.027   -4.683  0.617   1.00 0.00 ? 748 LEU A HB3  5  
ATOM 8129  H HG   . LEU A 1 41  ? 1.093   -4.021  2.005   1.00 0.00 ? 748 LEU A HG   5  
ATOM 8130  H HD11 . LEU A 1 41  ? 1.474   -2.559  3.954   1.00 0.00 ? 748 LEU A HD11 5  
ATOM 8131  H HD12 . LEU A 1 41  ? 3.205   -2.867  3.824   1.00 0.00 ? 748 LEU A HD12 5  
ATOM 8132  H HD13 . LEU A 1 41  ? 2.101   -4.186  4.200   1.00 0.00 ? 748 LEU A HD13 5  
ATOM 8133  H HD21 . LEU A 1 41  ? 3.090   -1.824  1.468   1.00 0.00 ? 748 LEU A HD21 5  
ATOM 8134  H HD22 . LEU A 1 41  ? 1.355   -1.602  1.686   1.00 0.00 ? 748 LEU A HD22 5  
ATOM 8135  H HD23 . LEU A 1 41  ? 1.962   -2.508  0.298   1.00 0.00 ? 748 LEU A HD23 5  
ATOM 8136  N N    . VAL A 1 42  ? 1.756   -7.121  0.802   1.00 0.00 ? 749 VAL A N    5  
ATOM 8137  C CA   . VAL A 1 42  ? 0.611   -7.879  0.360   1.00 0.00 ? 749 VAL A CA   5  
ATOM 8138  C C    . VAL A 1 42  ? 0.635   -9.252  1.033   1.00 0.00 ? 749 VAL A C    5  
ATOM 8139  O O    . VAL A 1 42  ? -0.378  -9.730  1.507   1.00 0.00 ? 749 VAL A O    5  
ATOM 8140  C CB   . VAL A 1 42  ? 0.612   -8.054  -1.183  1.00 0.00 ? 749 VAL A CB   5  
ATOM 8141  C CG1  . VAL A 1 42  ? -0.676  -8.700  -1.663  1.00 0.00 ? 749 VAL A CG1  5  
ATOM 8142  C CG2  . VAL A 1 42  ? 0.825   -6.726  -1.875  1.00 0.00 ? 749 VAL A CG2  5  
ATOM 8143  H H    . VAL A 1 42  ? 2.477   -6.919  0.169   1.00 0.00 ? 749 VAL A H    5  
ATOM 8144  H HA   . VAL A 1 42  ? -0.281  -7.348  0.658   1.00 0.00 ? 749 VAL A HA   5  
ATOM 8145  H HB   . VAL A 1 42  ? 1.432   -8.708  -1.442  1.00 0.00 ? 749 VAL A HB   5  
ATOM 8146  H HG11 . VAL A 1 42  ? -0.783  -9.667  -1.196  1.00 0.00 ? 749 VAL A HG11 5  
ATOM 8147  H HG12 . VAL A 1 42  ? -0.650  -8.812  -2.736  1.00 0.00 ? 749 VAL A HG12 5  
ATOM 8148  H HG13 . VAL A 1 42  ? -1.511  -8.073  -1.385  1.00 0.00 ? 749 VAL A HG13 5  
ATOM 8149  H HG21 . VAL A 1 42  ? 1.779   -6.314  -1.584  1.00 0.00 ? 749 VAL A HG21 5  
ATOM 8150  H HG22 . VAL A 1 42  ? 0.037   -6.046  -1.586  1.00 0.00 ? 749 VAL A HG22 5  
ATOM 8151  H HG23 . VAL A 1 42  ? 0.801   -6.863  -2.946  1.00 0.00 ? 749 VAL A HG23 5  
ATOM 8152  N N    . ASN A 1 43  ? 1.827   -9.812  1.135   1.00 0.00 ? 750 ASN A N    5  
ATOM 8153  C CA   . ASN A 1 43  ? 2.085   -11.132 1.712   1.00 0.00 ? 750 ASN A CA   5  
ATOM 8154  C C    . ASN A 1 43  ? 1.468   -11.277 3.093   1.00 0.00 ? 750 ASN A C    5  
ATOM 8155  O O    . ASN A 1 43  ? 0.607   -12.160 3.315   1.00 0.00 ? 750 ASN A O    5  
ATOM 8156  C CB   . ASN A 1 43  ? 3.613   -11.385 1.747   1.00 0.00 ? 750 ASN A CB   5  
ATOM 8157  C CG   . ASN A 1 43  ? 4.037   -12.623 2.506   1.00 0.00 ? 750 ASN A CG   5  
ATOM 8158  O OD1  . ASN A 1 43  ? 4.025   -13.724 1.974   1.00 0.00 ? 750 ASN A OD1  5  
ATOM 8159  N ND2  . ASN A 1 43  ? 4.545   -12.435 3.695   1.00 0.00 ? 750 ASN A ND2  5  
ATOM 8160  H H    . ASN A 1 43  ? 2.604   -9.301  0.812   1.00 0.00 ? 750 ASN A H    5  
ATOM 8161  H HA   . ASN A 1 43  ? 1.638   -11.866 1.058   1.00 0.00 ? 750 ASN A HA   5  
ATOM 8162  H HB2  . ASN A 1 43  ? 4.017   -11.425 0.747   1.00 0.00 ? 750 ASN A HB2  5  
ATOM 8163  H HB3  . ASN A 1 43  ? 4.050   -10.530 2.240   1.00 0.00 ? 750 ASN A HB3  5  
ATOM 8164  H HD21 . ASN A 1 43  ? 4.649   -11.512 4.039   1.00 0.00 ? 750 ASN A HD21 5  
ATOM 8165  H HD22 . ASN A 1 43  ? 4.796   -13.214 4.236   1.00 0.00 ? 750 ASN A HD22 5  
ATOM 8166  N N    . TRP A 1 44  ? 1.836   -10.393 4.009   1.00 0.00 ? 751 TRP A N    5  
ATOM 8167  C CA   . TRP A 1 44  ? 1.301   -10.499 5.349   1.00 0.00 ? 751 TRP A CA   5  
ATOM 8168  C C    . TRP A 1 44  ? -0.165  -10.093 5.371   1.00 0.00 ? 751 TRP A C    5  
ATOM 8169  O O    . TRP A 1 44  ? -0.943  -10.639 6.147   1.00 0.00 ? 751 TRP A O    5  
ATOM 8170  C CB   . TRP A 1 44  ? 2.126   -9.724  6.421   1.00 0.00 ? 751 TRP A CB   5  
ATOM 8171  C CG   . TRP A 1 44  ? 2.080   -8.216  6.347   1.00 0.00 ? 751 TRP A CG   5  
ATOM 8172  C CD1  . TRP A 1 44  ? 2.982   -7.397  5.752   1.00 0.00 ? 751 TRP A CD1  5  
ATOM 8173  C CD2  . TRP A 1 44  ? 1.082   -7.352  6.926   1.00 0.00 ? 751 TRP A CD2  5  
ATOM 8174  N NE1  . TRP A 1 44  ? 2.602   -6.088  5.904   1.00 0.00 ? 751 TRP A NE1  5  
ATOM 8175  C CE2  . TRP A 1 44  ? 1.438   -6.038  6.619   1.00 0.00 ? 751 TRP A CE2  5  
ATOM 8176  C CE3  . TRP A 1 44  ? -0.082  -7.575  7.667   1.00 0.00 ? 751 TRP A CE3  5  
ATOM 8177  C CZ2  . TRP A 1 44  ? 0.675   -4.944  7.021   1.00 0.00 ? 751 TRP A CZ2  5  
ATOM 8178  C CZ3  . TRP A 1 44  ? -0.838  -6.494  8.068   1.00 0.00 ? 751 TRP A CZ3  5  
ATOM 8179  C CH2  . TRP A 1 44  ? -0.457  -5.192  7.745   1.00 0.00 ? 751 TRP A CH2  5  
ATOM 8180  H H    . TRP A 1 44  ? 2.461   -9.673  3.760   1.00 0.00 ? 751 TRP A H    5  
ATOM 8181  H HA   . TRP A 1 44  ? 1.328   -11.554 5.584   1.00 0.00 ? 751 TRP A HA   5  
ATOM 8182  H HB2  . TRP A 1 44  ? 1.768   -10.000 7.402   1.00 0.00 ? 751 TRP A HB2  5  
ATOM 8183  H HB3  . TRP A 1 44  ? 3.160   -10.028 6.335   1.00 0.00 ? 751 TRP A HB3  5  
ATOM 8184  H HD1  . TRP A 1 44  ? 3.863   -7.741  5.230   1.00 0.00 ? 751 TRP A HD1  5  
ATOM 8185  H HE1  . TRP A 1 44  ? 3.088   -5.312  5.556   1.00 0.00 ? 751 TRP A HE1  5  
ATOM 8186  H HE3  . TRP A 1 44  ? -0.385  -8.580  7.923   1.00 0.00 ? 751 TRP A HE3  5  
ATOM 8187  H HZ2  . TRP A 1 44  ? 0.960   -3.932  6.774   1.00 0.00 ? 751 TRP A HZ2  5  
ATOM 8188  H HZ3  . TRP A 1 44  ? -1.740  -6.652  8.641   1.00 0.00 ? 751 TRP A HZ3  5  
ATOM 8189  H HH2  . TRP A 1 44  ? -1.076  -4.373  8.080   1.00 0.00 ? 751 TRP A HH2  5  
ATOM 8190  N N    . TYR A 1 45  ? -0.547  -9.177  4.466   1.00 0.00 ? 752 TYR A N    5  
ATOM 8191  C CA   . TYR A 1 45  ? -1.918  -8.683  4.414   1.00 0.00 ? 752 TYR A CA   5  
ATOM 8192  C C    . TYR A 1 45  ? -2.859  -9.824  4.137   1.00 0.00 ? 752 TYR A C    5  
ATOM 8193  O O    . TYR A 1 45  ? -3.877  -9.984  4.808   1.00 0.00 ? 752 TYR A O    5  
ATOM 8194  C CB   . TYR A 1 45  ? -2.082  -7.608  3.334   1.00 0.00 ? 752 TYR A CB   5  
ATOM 8195  C CG   . TYR A 1 45  ? -3.415  -6.887  3.387   1.00 0.00 ? 752 TYR A CG   5  
ATOM 8196  C CD1  . TYR A 1 45  ? -3.852  -6.330  4.586   1.00 0.00 ? 752 TYR A CD1  5  
ATOM 8197  C CD2  . TYR A 1 45  ? -4.227  -6.721  2.251   1.00 0.00 ? 752 TYR A CD2  5  
ATOM 8198  C CE1  . TYR A 1 45  ? -5.031  -5.644  4.666   1.00 0.00 ? 752 TYR A CE1  5  
ATOM 8199  C CE2  . TYR A 1 45  ? -5.404  -6.040  2.339   1.00 0.00 ? 752 TYR A CE2  5  
ATOM 8200  C CZ   . TYR A 1 45  ? -5.804  -5.499  3.549   1.00 0.00 ? 752 TYR A CZ   5  
ATOM 8201  O OH   . TYR A 1 45  ? -6.978  -4.805  3.637   1.00 0.00 ? 752 TYR A OH   5  
ATOM 8202  H H    . TYR A 1 45  ? 0.109   -8.826  3.822   1.00 0.00 ? 752 TYR A H    5  
ATOM 8203  H HA   . TYR A 1 45  ? -2.153  -8.257  5.377   1.00 0.00 ? 752 TYR A HA   5  
ATOM 8204  H HB2  . TYR A 1 45  ? -1.291  -6.878  3.424   1.00 0.00 ? 752 TYR A HB2  5  
ATOM 8205  H HB3  . TYR A 1 45  ? -2.002  -8.083  2.366   1.00 0.00 ? 752 TYR A HB3  5  
ATOM 8206  H HD1  . TYR A 1 45  ? -3.241  -6.442  5.469   1.00 0.00 ? 752 TYR A HD1  5  
ATOM 8207  H HD2  . TYR A 1 45  ? -3.983  -7.116  1.274   1.00 0.00 ? 752 TYR A HD2  5  
ATOM 8208  H HE1  . TYR A 1 45  ? -5.347  -5.221  5.608   1.00 0.00 ? 752 TYR A HE1  5  
ATOM 8209  H HE2  . TYR A 1 45  ? -5.996  -5.941  1.442   1.00 0.00 ? 752 TYR A HE2  5  
ATOM 8210  H HH   . TYR A 1 45  ? -6.805  -4.045  4.205   1.00 0.00 ? 752 TYR A HH   5  
ATOM 8211  N N    . LEU A 1 46  ? -2.482  -10.635 3.182   1.00 0.00 ? 753 LEU A N    5  
ATOM 8212  C CA   . LEU A 1 46  ? -3.268  -11.765 2.777   1.00 0.00 ? 753 LEU A CA   5  
ATOM 8213  C C    . LEU A 1 46  ? -3.366  -12.767 3.906   1.00 0.00 ? 753 LEU A C    5  
ATOM 8214  O O    . LEU A 1 46  ? -4.447  -13.207 4.253   1.00 0.00 ? 753 LEU A O    5  
ATOM 8215  C CB   . LEU A 1 46  ? -2.667  -12.390 1.547   1.00 0.00 ? 753 LEU A CB   5  
ATOM 8216  C CG   . LEU A 1 46  ? -2.452  -11.426 0.389   1.00 0.00 ? 753 LEU A CG   5  
ATOM 8217  C CD1  . LEU A 1 46  ? -1.808  -12.127 -0.761  1.00 0.00 ? 753 LEU A CD1  5  
ATOM 8218  C CD2  . LEU A 1 46  ? -3.739  -10.707 -0.023  1.00 0.00 ? 753 LEU A CD2  5  
ATOM 8219  H H    . LEU A 1 46  ? -1.631  -10.443 2.726   1.00 0.00 ? 753 LEU A H    5  
ATOM 8220  H HA   . LEU A 1 46  ? -4.250  -11.397 2.527   1.00 0.00 ? 753 LEU A HA   5  
ATOM 8221  H HB2  . LEU A 1 46  ? -1.717  -12.827 1.817   1.00 0.00 ? 753 LEU A HB2  5  
ATOM 8222  H HB3  . LEU A 1 46  ? -3.328  -13.175 1.211   1.00 0.00 ? 753 LEU A HB3  5  
ATOM 8223  H HG   . LEU A 1 46  ? -1.746  -10.680 0.723   1.00 0.00 ? 753 LEU A HG   5  
ATOM 8224  H HD11 . LEU A 1 46  ? -0.832  -12.432 -0.414  1.00 0.00 ? 753 LEU A HD11 5  
ATOM 8225  H HD12 . LEU A 1 46  ? -1.726  -11.447 -1.595  1.00 0.00 ? 753 LEU A HD12 5  
ATOM 8226  H HD13 . LEU A 1 46  ? -2.390  -12.997 -1.024  1.00 0.00 ? 753 LEU A HD13 5  
ATOM 8227  H HD21 . LEU A 1 46  ? -3.528  -10.044 -0.848  1.00 0.00 ? 753 LEU A HD21 5  
ATOM 8228  H HD22 . LEU A 1 46  ? -4.104  -10.101 0.796   1.00 0.00 ? 753 LEU A HD22 5  
ATOM 8229  H HD23 . LEU A 1 46  ? -4.492  -11.423 -0.318  1.00 0.00 ? 753 LEU A HD23 5  
ATOM 8230  N N    . LYS A 1 47  ? -2.236  -13.059 4.523   1.00 0.00 ? 754 LYS A N    5  
ATOM 8231  C CA   . LYS A 1 47  ? -2.194  -13.981 5.678   1.00 0.00 ? 754 LYS A CA   5  
ATOM 8232  C C    . LYS A 1 47  ? -3.121  -13.526 6.823   1.00 0.00 ? 754 LYS A C    5  
ATOM 8233  O O    . LYS A 1 47  ? -3.731  -14.348 7.514   1.00 0.00 ? 754 LYS A O    5  
ATOM 8234  C CB   . LYS A 1 47  ? -0.757  -14.141 6.184   1.00 0.00 ? 754 LYS A CB   5  
ATOM 8235  C CG   . LYS A 1 47  ? 0.106   -15.259 5.537   1.00 0.00 ? 754 LYS A CG   5  
ATOM 8236  C CD   . LYS A 1 47  ? 0.233   -15.193 4.008   1.00 0.00 ? 754 LYS A CD   5  
ATOM 8237  C CE   . LYS A 1 47  ? -0.949  -15.842 3.289   1.00 0.00 ? 754 LYS A CE   5  
ATOM 8238  N NZ   . LYS A 1 47  ? -0.763  -15.893 1.824   1.00 0.00 ? 754 LYS A NZ   5  
ATOM 8239  H H    . LYS A 1 47  ? -1.412  -12.636 4.188   1.00 0.00 ? 754 LYS A H    5  
ATOM 8240  H HA   . LYS A 1 47  ? -2.551  -14.943 5.342   1.00 0.00 ? 754 LYS A HA   5  
ATOM 8241  H HB2  . LYS A 1 47  ? -0.247  -13.204 6.014   1.00 0.00 ? 754 LYS A HB2  5  
ATOM 8242  H HB3  . LYS A 1 47  ? -0.796  -14.317 7.249   1.00 0.00 ? 754 LYS A HB3  5  
ATOM 8243  H HG2  . LYS A 1 47  ? 1.102   -15.198 5.949   1.00 0.00 ? 754 LYS A HG2  5  
ATOM 8244  H HG3  . LYS A 1 47  ? -0.322  -16.211 5.815   1.00 0.00 ? 754 LYS A HG3  5  
ATOM 8245  H HD2  . LYS A 1 47  ? 0.250   -14.145 3.741   1.00 0.00 ? 754 LYS A HD2  5  
ATOM 8246  H HD3  . LYS A 1 47  ? 1.154   -15.670 3.710   1.00 0.00 ? 754 LYS A HD3  5  
ATOM 8247  H HE2  . LYS A 1 47  ? -1.078  -16.850 3.654   1.00 0.00 ? 754 LYS A HE2  5  
ATOM 8248  H HE3  . LYS A 1 47  ? -1.838  -15.267 3.503   1.00 0.00 ? 754 LYS A HE3  5  
ATOM 8249  H HZ1  . LYS A 1 47  ? -1.606  -16.314 1.383   1.00 0.00 ? 754 LYS A HZ1  5  
ATOM 8250  H HZ2  . LYS A 1 47  ? 0.042   -16.508 1.591   1.00 0.00 ? 754 LYS A HZ2  5  
ATOM 8251  H HZ3  . LYS A 1 47  ? -0.599  -14.959 1.401   1.00 0.00 ? 754 LYS A HZ3  5  
ATOM 8252  N N    . GLU A 1 48  ? -3.239  -12.232 6.993   1.00 0.00 ? 755 GLU A N    5  
ATOM 8253  C CA   . GLU A 1 48  ? -4.083  -11.667 8.045   1.00 0.00 ? 755 GLU A CA   5  
ATOM 8254  C C    . GLU A 1 48  ? -5.558  -11.647 7.640   1.00 0.00 ? 755 GLU A C    5  
ATOM 8255  O O    . GLU A 1 48  ? -6.434  -11.977 8.446   1.00 0.00 ? 755 GLU A O    5  
ATOM 8256  C CB   . GLU A 1 48  ? -3.627  -10.257 8.427   1.00 0.00 ? 755 GLU A CB   5  
ATOM 8257  C CG   . GLU A 1 48  ? -2.204  -10.178 8.968   1.00 0.00 ? 755 GLU A CG   5  
ATOM 8258  C CD   . GLU A 1 48  ? -1.997  -10.904 10.276  1.00 0.00 ? 755 GLU A CD   5  
ATOM 8259  O OE1  . GLU A 1 48  ? -2.120  -12.143 10.326  1.00 0.00 ? 755 GLU A OE1  5  
ATOM 8260  O OE2  . GLU A 1 48  ? -1.636  -10.254 11.268  1.00 0.00 ? 755 GLU A OE2  5  
ATOM 8261  H H    . GLU A 1 48  ? -2.727  -11.655 6.385   1.00 0.00 ? 755 GLU A H    5  
ATOM 8262  H HA   . GLU A 1 48  ? -3.981  -12.306 8.911   1.00 0.00 ? 755 GLU A HA   5  
ATOM 8263  H HB2  . GLU A 1 48  ? -3.693  -9.626  7.553   1.00 0.00 ? 755 GLU A HB2  5  
ATOM 8264  H HB3  . GLU A 1 48  ? -4.297  -9.875  9.182   1.00 0.00 ? 755 GLU A HB3  5  
ATOM 8265  H HG2  . GLU A 1 48  ? -1.530  -10.600 8.238   1.00 0.00 ? 755 GLU A HG2  5  
ATOM 8266  H HG3  . GLU A 1 48  ? -1.963  -9.136  9.115   1.00 0.00 ? 755 GLU A HG3  5  
ATOM 8267  N N    . ILE A 1 49  ? -5.839  -11.282 6.391   1.00 0.00 ? 756 ILE A N    5  
ATOM 8268  C CA   . ILE A 1 49  ? -7.227  -11.195 5.922   1.00 0.00 ? 756 ILE A CA   5  
ATOM 8269  C C    . ILE A 1 49  ? -7.835  -12.569 5.766   1.00 0.00 ? 756 ILE A C    5  
ATOM 8270  O O    . ILE A 1 49  ? -9.042  -12.717 5.810   1.00 0.00 ? 756 ILE A O    5  
ATOM 8271  C CB   . ILE A 1 49  ? -7.389  -10.447 4.572   1.00 0.00 ? 756 ILE A CB   5  
ATOM 8272  C CG1  . ILE A 1 49  ? -6.653  -11.217 3.480   1.00 0.00 ? 756 ILE A CG1  5  
ATOM 8273  C CG2  . ILE A 1 49  ? -6.891  -9.013  4.690   1.00 0.00 ? 756 ILE A CG2  5  
ATOM 8274  C CD1  . ILE A 1 49  ? -6.767  -10.663 2.094   1.00 0.00 ? 756 ILE A CD1  5  
ATOM 8275  H H    . ILE A 1 49  ? -5.101  -11.061 5.777   1.00 0.00 ? 756 ILE A H    5  
ATOM 8276  H HA   . ILE A 1 49  ? -7.787  -10.663 6.677   1.00 0.00 ? 756 ILE A HA   5  
ATOM 8277  H HB   . ILE A 1 49  ? -8.442  -10.416 4.331   1.00 0.00 ? 756 ILE A HB   5  
ATOM 8278  H HG12 . ILE A 1 49  ? -5.613  -11.235 3.761   1.00 0.00 ? 756 ILE A HG12 5  
ATOM 8279  H HG13 . ILE A 1 49  ? -7.018  -12.234 3.477   1.00 0.00 ? 756 ILE A HG13 5  
ATOM 8280  H HG21 . ILE A 1 49  ? -7.031  -8.500  3.751   1.00 0.00 ? 756 ILE A HG21 5  
ATOM 8281  H HG22 . ILE A 1 49  ? -5.840  -9.025  4.938   1.00 0.00 ? 756 ILE A HG22 5  
ATOM 8282  H HG23 . ILE A 1 49  ? -7.437  -8.505  5.472   1.00 0.00 ? 756 ILE A HG23 5  
ATOM 8283  H HD11 . ILE A 1 49  ? -6.228  -11.300 1.407   1.00 0.00 ? 756 ILE A HD11 5  
ATOM 8284  H HD12 . ILE A 1 49  ? -6.340  -9.671  2.067   1.00 0.00 ? 756 ILE A HD12 5  
ATOM 8285  H HD13 . ILE A 1 49  ? -7.806  -10.623 1.805   1.00 0.00 ? 756 ILE A HD13 5  
ATOM 8286  N N    . GLU A 1 50  ? -6.995  -13.586 5.601   1.00 0.00 ? 757 GLU A N    5  
ATOM 8287  C CA   . GLU A 1 50  ? -7.463  -14.959 5.435   1.00 0.00 ? 757 GLU A CA   5  
ATOM 8288  C C    . GLU A 1 50  ? -8.227  -15.492 6.647   1.00 0.00 ? 757 GLU A C    5  
ATOM 8289  O O    . GLU A 1 50  ? -8.845  -16.549 6.588   1.00 0.00 ? 757 GLU A O    5  
ATOM 8290  C CB   . GLU A 1 50  ? -6.352  -15.888 4.956   1.00 0.00 ? 757 GLU A CB   5  
ATOM 8291  C CG   . GLU A 1 50  ? -6.055  -15.706 3.472   1.00 0.00 ? 757 GLU A CG   5  
ATOM 8292  C CD   . GLU A 1 50  ? -4.969  -16.607 2.958   1.00 0.00 ? 757 GLU A CD   5  
ATOM 8293  O OE1  . GLU A 1 50  ? -5.175  -17.831 2.903   1.00 0.00 ? 757 GLU A OE1  5  
ATOM 8294  O OE2  . GLU A 1 50  ? -3.895  -16.114 2.565   1.00 0.00 ? 757 GLU A OE2  5  
ATOM 8295  H H    . GLU A 1 50  ? -6.028  -13.405 5.558   1.00 0.00 ? 757 GLU A H    5  
ATOM 8296  H HA   . GLU A 1 50  ? -8.203  -14.893 4.650   1.00 0.00 ? 757 GLU A HA   5  
ATOM 8297  H HB2  . GLU A 1 50  ? -5.453  -15.633 5.501   1.00 0.00 ? 757 GLU A HB2  5  
ATOM 8298  H HB3  . GLU A 1 50  ? -6.623  -16.917 5.132   1.00 0.00 ? 757 GLU A HB3  5  
ATOM 8299  H HG2  . GLU A 1 50  ? -6.955  -15.907 2.911   1.00 0.00 ? 757 GLU A HG2  5  
ATOM 8300  H HG3  . GLU A 1 50  ? -5.761  -14.679 3.307   1.00 0.00 ? 757 GLU A HG3  5  
ATOM 8301  N N    . SER A 1 51  ? -8.229  -14.722 7.709   1.00 0.00 ? 758 SER A N    5  
ATOM 8302  C CA   . SER A 1 51  ? -9.006  -15.008 8.879   1.00 0.00 ? 758 SER A CA   5  
ATOM 8303  C C    . SER A 1 51  ? -10.515 -14.749 8.583   1.00 0.00 ? 758 SER A C    5  
ATOM 8304  O O    . SER A 1 51  ? -11.394 -15.371 9.183   1.00 0.00 ? 758 SER A O    5  
ATOM 8305  C CB   . SER A 1 51  ? -8.518  -14.107 10.025  1.00 0.00 ? 758 SER A CB   5  
ATOM 8306  O OG   . SER A 1 51  ? -9.204  -14.367 11.239  1.00 0.00 ? 758 SER A OG   5  
ATOM 8307  H H    . SER A 1 51  ? -7.661  -13.920 7.700   1.00 0.00 ? 758 SER A H    5  
ATOM 8308  H HA   . SER A 1 51  ? -8.857  -16.042 9.152   1.00 0.00 ? 758 SER A HA   5  
ATOM 8309  H HB2  . SER A 1 51  ? -7.461  -14.264 10.177  1.00 0.00 ? 758 SER A HB2  5  
ATOM 8310  H HB3  . SER A 1 51  ? -8.680  -13.077 9.747   1.00 0.00 ? 758 SER A HB3  5  
ATOM 8311  H HG   . SER A 1 51  ? -8.619  -14.869 11.819  1.00 0.00 ? 758 SER A HG   5  
ATOM 8312  N N    . GLU A 1 52  ? -10.800 -13.847 7.640   1.00 0.00 ? 759 GLU A N    5  
ATOM 8313  C CA   . GLU A 1 52  ? -12.181 -13.486 7.311   1.00 0.00 ? 759 GLU A CA   5  
ATOM 8314  C C    . GLU A 1 52  ? -12.559 -13.947 5.889   1.00 0.00 ? 759 GLU A C    5  
ATOM 8315  O O    . GLU A 1 52  ? -13.708 -13.783 5.447   1.00 0.00 ? 759 GLU A O    5  
ATOM 8316  C CB   . GLU A 1 52  ? -12.388 -11.961 7.445   1.00 0.00 ? 759 GLU A CB   5  
ATOM 8317  C CG   . GLU A 1 52  ? -11.540 -11.139 6.481   1.00 0.00 ? 759 GLU A CG   5  
ATOM 8318  C CD   . GLU A 1 52  ? -11.767 -9.656  6.583   1.00 0.00 ? 759 GLU A CD   5  
ATOM 8319  O OE1  . GLU A 1 52  ? -12.731 -9.158  5.997   1.00 0.00 ? 759 GLU A OE1  5  
ATOM 8320  O OE2  . GLU A 1 52  ? -10.955 -8.950  7.224   1.00 0.00 ? 759 GLU A OE2  5  
ATOM 8321  H H    . GLU A 1 52  ? -10.071 -13.403 7.150   1.00 0.00 ? 759 GLU A H    5  
ATOM 8322  H HA   . GLU A 1 52  ? -12.825 -13.986 8.019   1.00 0.00 ? 759 GLU A HA   5  
ATOM 8323  H HB2  . GLU A 1 52  ? -13.428 -11.735 7.259   1.00 0.00 ? 759 GLU A HB2  5  
ATOM 8324  H HB3  . GLU A 1 52  ? -12.141 -11.663 8.454   1.00 0.00 ? 759 GLU A HB3  5  
ATOM 8325  H HG2  . GLU A 1 52  ? -10.498 -11.338 6.685   1.00 0.00 ? 759 GLU A HG2  5  
ATOM 8326  H HG3  . GLU A 1 52  ? -11.769 -11.459 5.474   1.00 0.00 ? 759 GLU A HG3  5  
ATOM 8327  N N    . ILE A 1 53  ? -11.605 -14.524 5.180   1.00 0.00 ? 760 ILE A N    5  
ATOM 8328  C CA   . ILE A 1 53  ? -11.839 -14.950 3.807   1.00 0.00 ? 760 ILE A CA   5  
ATOM 8329  C C    . ILE A 1 53  ? -12.557 -16.284 3.787   1.00 0.00 ? 760 ILE A C    5  
ATOM 8330  O O    . ILE A 1 53  ? -11.990 -17.311 4.178   1.00 0.00 ? 760 ILE A O    5  
ATOM 8331  C CB   . ILE A 1 53  ? -10.517 -15.069 2.989   1.00 0.00 ? 760 ILE A CB   5  
ATOM 8332  C CG1  . ILE A 1 53  ? -9.742  -13.743 2.969   1.00 0.00 ? 760 ILE A CG1  5  
ATOM 8333  C CG2  . ILE A 1 53  ? -10.781 -15.559 1.571   1.00 0.00 ? 760 ILE A CG2  5  
ATOM 8334  C CD1  . ILE A 1 53  ? -10.505 -12.565 2.411   1.00 0.00 ? 760 ILE A CD1  5  
ATOM 8335  H H    . ILE A 1 53  ? -10.735 -14.682 5.601   1.00 0.00 ? 760 ILE A H    5  
ATOM 8336  H HA   . ILE A 1 53  ? -12.475 -14.214 3.335   1.00 0.00 ? 760 ILE A HA   5  
ATOM 8337  H HB   . ILE A 1 53  ? -9.914  -15.823 3.468   1.00 0.00 ? 760 ILE A HB   5  
ATOM 8338  H HG12 . ILE A 1 53  ? -9.474  -13.478 3.981   1.00 0.00 ? 760 ILE A HG12 5  
ATOM 8339  H HG13 . ILE A 1 53  ? -8.843  -13.869 2.384   1.00 0.00 ? 760 ILE A HG13 5  
ATOM 8340  H HG21 . ILE A 1 53  ? -9.844  -15.656 1.046   1.00 0.00 ? 760 ILE A HG21 5  
ATOM 8341  H HG22 . ILE A 1 53  ? -11.416 -14.849 1.059   1.00 0.00 ? 760 ILE A HG22 5  
ATOM 8342  H HG23 . ILE A 1 53  ? -11.275 -16.518 1.608   1.00 0.00 ? 760 ILE A HG23 5  
ATOM 8343  H HD11 . ILE A 1 53  ? -11.403 -12.416 2.993   1.00 0.00 ? 760 ILE A HD11 5  
ATOM 8344  H HD12 . ILE A 1 53  ? -10.775 -12.767 1.385   1.00 0.00 ? 760 ILE A HD12 5  
ATOM 8345  H HD13 . ILE A 1 53  ? -9.892  -11.676 2.459   1.00 0.00 ? 760 ILE A HD13 5  
ATOM 8346  N N    . ASP A 1 54  ? -13.799 -16.260 3.373   1.00 0.00 ? 761 ASP A N    5  
ATOM 8347  C CA   . ASP A 1 54  ? -14.600 -17.485 3.272   1.00 0.00 ? 761 ASP A CA   5  
ATOM 8348  C C    . ASP A 1 54  ? -14.785 -17.868 1.806   1.00 0.00 ? 761 ASP A C    5  
ATOM 8349  O O    . ASP A 1 54  ? -15.134 -18.998 1.470   1.00 0.00 ? 761 ASP A O    5  
ATOM 8350  C CB   . ASP A 1 54  ? -15.962 -17.296 3.959   1.00 0.00 ? 761 ASP A CB   5  
ATOM 8351  C CG   . ASP A 1 54  ? -16.796 -18.560 3.989   1.00 0.00 ? 761 ASP A CG   5  
ATOM 8352  O OD1  . ASP A 1 54  ? -16.508 -19.444 4.816   1.00 0.00 ? 761 ASP A OD1  5  
ATOM 8353  O OD2  . ASP A 1 54  ? -17.746 -18.697 3.188   1.00 0.00 ? 761 ASP A OD2  5  
ATOM 8354  H H    . ASP A 1 54  ? -14.204 -15.393 3.149   1.00 0.00 ? 761 ASP A H    5  
ATOM 8355  H HA   . ASP A 1 54  ? -14.056 -18.274 3.766   1.00 0.00 ? 761 ASP A HA   5  
ATOM 8356  H HB2  . ASP A 1 54  ? -15.801 -16.976 4.977   1.00 0.00 ? 761 ASP A HB2  5  
ATOM 8357  H HB3  . ASP A 1 54  ? -16.522 -16.531 3.445   1.00 0.00 ? 761 ASP A HB3  5  
ATOM 8358  N N    . SER A 1 55  ? -14.477 -16.945 0.940   1.00 0.00 ? 762 SER A N    5  
ATOM 8359  C CA   . SER A 1 55  ? -14.659 -17.138 -0.471  1.00 0.00 ? 762 SER A CA   5  
ATOM 8360  C C    . SER A 1 55  ? -13.478 -16.551 -1.209  1.00 0.00 ? 762 SER A C    5  
ATOM 8361  O O    . SER A 1 55  ? -12.884 -15.566 -0.738  1.00 0.00 ? 762 SER A O    5  
ATOM 8362  C CB   . SER A 1 55  ? -15.975 -16.465 -0.928  1.00 0.00 ? 762 SER A CB   5  
ATOM 8363  O OG   . SER A 1 55  ? -16.185 -16.604 -2.329  1.00 0.00 ? 762 SER A OG   5  
ATOM 8364  H H    . SER A 1 55  ? -14.077 -16.106 1.249   1.00 0.00 ? 762 SER A H    5  
ATOM 8365  H HA   . SER A 1 55  ? -14.719 -18.197 -0.669  1.00 0.00 ? 762 SER A HA   5  
ATOM 8366  H HB2  . SER A 1 55  ? -16.805 -16.920 -0.409  1.00 0.00 ? 762 SER A HB2  5  
ATOM 8367  H HB3  . SER A 1 55  ? -15.933 -15.413 -0.683  1.00 0.00 ? 762 SER A HB3  5  
ATOM 8368  H HG   . SER A 1 55  ? -16.271 -17.546 -2.527  1.00 0.00 ? 762 SER A HG   5  
ATOM 8369  N N    . GLU A 1 56  ? -13.147 -17.127 -2.366  1.00 0.00 ? 763 GLU A N    5  
ATOM 8370  C CA   . GLU A 1 56  ? -12.043 -16.642 -3.182  1.00 0.00 ? 763 GLU A CA   5  
ATOM 8371  C C    . GLU A 1 56  ? -12.322 -15.208 -3.643  1.00 0.00 ? 763 GLU A C    5  
ATOM 8372  O O    . GLU A 1 56  ? -11.406 -14.413 -3.806  1.00 0.00 ? 763 GLU A O    5  
ATOM 8373  C CB   . GLU A 1 56  ? -11.787 -17.576 -4.376  1.00 0.00 ? 763 GLU A CB   5  
ATOM 8374  C CG   . GLU A 1 56  ? -10.608 -17.151 -5.232  1.00 0.00 ? 763 GLU A CG   5  
ATOM 8375  C CD   . GLU A 1 56  ? -10.286 -18.107 -6.350  1.00 0.00 ? 763 GLU A CD   5  
ATOM 8376  O OE1  . GLU A 1 56  ? -10.965 -18.086 -7.378  1.00 0.00 ? 763 GLU A OE1  5  
ATOM 8377  O OE2  . GLU A 1 56  ? -9.299  -18.870 -6.225  1.00 0.00 ? 763 GLU A OE2  5  
ATOM 8378  H H    . GLU A 1 56  ? -13.670 -17.901 -2.676  1.00 0.00 ? 763 GLU A H    5  
ATOM 8379  H HA   . GLU A 1 56  ? -11.167 -16.622 -2.551  1.00 0.00 ? 763 GLU A HA   5  
ATOM 8380  H HB2  . GLU A 1 56  ? -11.593 -18.567 -3.999  1.00 0.00 ? 763 GLU A HB2  5  
ATOM 8381  H HB3  . GLU A 1 56  ? -12.669 -17.599 -5.000  1.00 0.00 ? 763 GLU A HB3  5  
ATOM 8382  H HG2  . GLU A 1 56  ? -10.839 -16.192 -5.672  1.00 0.00 ? 763 GLU A HG2  5  
ATOM 8383  H HG3  . GLU A 1 56  ? -9.740  -17.049 -4.598  1.00 0.00 ? 763 GLU A HG3  5  
ATOM 8384  N N    . GLU A 1 57  ? -13.608 -14.885 -3.772  1.00 0.00 ? 764 GLU A N    5  
ATOM 8385  C CA   . GLU A 1 57  ? -14.076 -13.547 -4.134  1.00 0.00 ? 764 GLU A CA   5  
ATOM 8386  C C    . GLU A 1 57  ? -13.500 -12.481 -3.215  1.00 0.00 ? 764 GLU A C    5  
ATOM 8387  O O    . GLU A 1 57  ? -13.014 -11.456 -3.676  1.00 0.00 ? 764 GLU A O    5  
ATOM 8388  C CB   . GLU A 1 57  ? -15.591 -13.513 -4.061  1.00 0.00 ? 764 GLU A CB   5  
ATOM 8389  C CG   . GLU A 1 57  ? -16.272 -14.133 -5.252  1.00 0.00 ? 764 GLU A CG   5  
ATOM 8390  C CD   . GLU A 1 57  ? -16.201 -13.227 -6.449  1.00 0.00 ? 764 GLU A CD   5  
ATOM 8391  O OE1  . GLU A 1 57  ? -15.225 -13.289 -7.221  1.00 0.00 ? 764 GLU A OE1  5  
ATOM 8392  O OE2  . GLU A 1 57  ? -17.122 -12.410 -6.618  1.00 0.00 ? 764 GLU A OE2  5  
ATOM 8393  H H    . GLU A 1 57  ? -14.272 -15.589 -3.611  1.00 0.00 ? 764 GLU A H    5  
ATOM 8394  H HA   . GLU A 1 57  ? -13.776 -13.340 -5.151  1.00 0.00 ? 764 GLU A HA   5  
ATOM 8395  H HB2  . GLU A 1 57  ? -15.906 -14.047 -3.177  1.00 0.00 ? 764 GLU A HB2  5  
ATOM 8396  H HB3  . GLU A 1 57  ? -15.912 -12.485 -3.981  1.00 0.00 ? 764 GLU A HB3  5  
ATOM 8397  H HG2  . GLU A 1 57  ? -15.780 -15.063 -5.496  1.00 0.00 ? 764 GLU A HG2  5  
ATOM 8398  H HG3  . GLU A 1 57  ? -17.309 -14.311 -5.009  1.00 0.00 ? 764 GLU A HG3  5  
ATOM 8399  N N    . GLU A 1 58  ? -13.522 -12.752 -1.920  1.00 0.00 ? 765 GLU A N    5  
ATOM 8400  C CA   . GLU A 1 58  ? -13.022 -11.810 -0.939  1.00 0.00 ? 765 GLU A CA   5  
ATOM 8401  C C    . GLU A 1 58  ? -11.530 -11.651 -1.074  1.00 0.00 ? 765 GLU A C    5  
ATOM 8402  O O    . GLU A 1 58  ? -10.996 -10.542 -0.962  1.00 0.00 ? 765 GLU A O    5  
ATOM 8403  C CB   . GLU A 1 58  ? -13.352 -12.263 0.475   1.00 0.00 ? 765 GLU A CB   5  
ATOM 8404  C CG   . GLU A 1 58  ? -14.820 -12.391 0.763   1.00 0.00 ? 765 GLU A CG   5  
ATOM 8405  C CD   . GLU A 1 58  ? -15.576 -11.134 0.431   1.00 0.00 ? 765 GLU A CD   5  
ATOM 8406  O OE1  . GLU A 1 58  ? -15.242 -10.048 0.951   1.00 0.00 ? 765 GLU A OE1  5  
ATOM 8407  O OE2  . GLU A 1 58  ? -16.542 -11.207 -0.333  1.00 0.00 ? 765 GLU A OE2  5  
ATOM 8408  H H    . GLU A 1 58  ? -13.878 -13.615 -1.621  1.00 0.00 ? 765 GLU A H    5  
ATOM 8409  H HA   . GLU A 1 58  ? -13.499 -10.858 -1.118  1.00 0.00 ? 765 GLU A HA   5  
ATOM 8410  H HB2  . GLU A 1 58  ? -12.900 -13.230 0.638   1.00 0.00 ? 765 GLU A HB2  5  
ATOM 8411  H HB3  . GLU A 1 58  ? -12.926 -11.557 1.173   1.00 0.00 ? 765 GLU A HB3  5  
ATOM 8412  H HG2  . GLU A 1 58  ? -15.214 -13.205 0.171   1.00 0.00 ? 765 GLU A HG2  5  
ATOM 8413  H HG3  . GLU A 1 58  ? -14.951 -12.613 1.812   1.00 0.00 ? 765 GLU A HG3  5  
ATOM 8414  N N    . LEU A 1 59  ? -10.863 -12.756 -1.343  1.00 0.00 ? 766 LEU A N    5  
ATOM 8415  C CA   . LEU A 1 59  ? -9.432  -12.771 -1.485  1.00 0.00 ? 766 LEU A CA   5  
ATOM 8416  C C    . LEU A 1 59  ? -9.032  -11.962 -2.715  1.00 0.00 ? 766 LEU A C    5  
ATOM 8417  O O    . LEU A 1 59  ? -8.272  -11.011 -2.599  1.00 0.00 ? 766 LEU A O    5  
ATOM 8418  C CB   . LEU A 1 59  ? -8.918  -14.217 -1.569  1.00 0.00 ? 766 LEU A CB   5  
ATOM 8419  C CG   . LEU A 1 59  ? -7.396  -14.413 -1.568  1.00 0.00 ? 766 LEU A CG   5  
ATOM 8420  C CD1  . LEU A 1 59  ? -6.775  -13.859 -0.289  1.00 0.00 ? 766 LEU A CD1  5  
ATOM 8421  C CD2  . LEU A 1 59  ? -7.059  -15.889 -1.715  1.00 0.00 ? 766 LEU A CD2  5  
ATOM 8422  H H    . LEU A 1 59  ? -11.370 -13.586 -1.471  1.00 0.00 ? 766 LEU A H    5  
ATOM 8423  H HA   . LEU A 1 59  ? -9.017  -12.295 -0.608  1.00 0.00 ? 766 LEU A HA   5  
ATOM 8424  H HB2  . LEU A 1 59  ? -9.324  -14.763 -0.731  1.00 0.00 ? 766 LEU A HB2  5  
ATOM 8425  H HB3  . LEU A 1 59  ? -9.308  -14.654 -2.475  1.00 0.00 ? 766 LEU A HB3  5  
ATOM 8426  H HG   . LEU A 1 59  ? -6.971  -13.883 -2.407  1.00 0.00 ? 766 LEU A HG   5  
ATOM 8427  H HD11 . LEU A 1 59  ? -5.707  -14.025 -0.312  1.00 0.00 ? 766 LEU A HD11 5  
ATOM 8428  H HD12 . LEU A 1 59  ? -7.198  -14.362 0.567   1.00 0.00 ? 766 LEU A HD12 5  
ATOM 8429  H HD13 . LEU A 1 59  ? -6.969  -12.799 -0.220  1.00 0.00 ? 766 LEU A HD13 5  
ATOM 8430  H HD21 . LEU A 1 59  ? -7.486  -16.441 -0.892  1.00 0.00 ? 766 LEU A HD21 5  
ATOM 8431  H HD22 . LEU A 1 59  ? -5.987  -16.015 -1.710  1.00 0.00 ? 766 LEU A HD22 5  
ATOM 8432  H HD23 . LEU A 1 59  ? -7.459  -16.265 -2.646  1.00 0.00 ? 766 LEU A HD23 5  
ATOM 8433  N N    . ILE A 1 60  ? -9.619  -12.301 -3.865  1.00 0.00 ? 767 ILE A N    5  
ATOM 8434  C CA   . ILE A 1 60  ? -9.338  -11.621 -5.140  1.00 0.00 ? 767 ILE A CA   5  
ATOM 8435  C C    . ILE A 1 60  ? -9.627  -10.128 -5.038  1.00 0.00 ? 767 ILE A C    5  
ATOM 8436  O O    . ILE A 1 60  ? -8.814  -9.304  -5.453  1.00 0.00 ? 767 ILE A O    5  
ATOM 8437  C CB   . ILE A 1 60  ? -10.155 -12.238 -6.310  1.00 0.00 ? 767 ILE A CB   5  
ATOM 8438  C CG1  . ILE A 1 60  ? -9.740  -13.692 -6.528  1.00 0.00 ? 767 ILE A CG1  5  
ATOM 8439  C CG2  . ILE A 1 60  ? -9.988  -11.429 -7.603  1.00 0.00 ? 767 ILE A CG2  5  
ATOM 8440  C CD1  . ILE A 1 60  ? -10.525 -14.394 -7.605  1.00 0.00 ? 767 ILE A CD1  5  
ATOM 8441  H H    . ILE A 1 60  ? -10.270 -13.039 -3.861  1.00 0.00 ? 767 ILE A H    5  
ATOM 8442  H HA   . ILE A 1 60  ? -8.286  -11.751 -5.347  1.00 0.00 ? 767 ILE A HA   5  
ATOM 8443  H HB   . ILE A 1 60  ? -11.200 -12.216 -6.038  1.00 0.00 ? 767 ILE A HB   5  
ATOM 8444  H HG12 . ILE A 1 60  ? -8.698  -13.725 -6.811  1.00 0.00 ? 767 ILE A HG12 5  
ATOM 8445  H HG13 . ILE A 1 60  ? -9.872  -14.236 -5.606  1.00 0.00 ? 767 ILE A HG13 5  
ATOM 8446  H HG21 . ILE A 1 60  ? -10.581 -11.884 -8.383  1.00 0.00 ? 767 ILE A HG21 5  
ATOM 8447  H HG22 . ILE A 1 60  ? -8.948  -11.429 -7.896  1.00 0.00 ? 767 ILE A HG22 5  
ATOM 8448  H HG23 . ILE A 1 60  ? -10.325 -10.416 -7.437  1.00 0.00 ? 767 ILE A HG23 5  
ATOM 8449  H HD11 . ILE A 1 60  ? -11.573 -14.405 -7.343  1.00 0.00 ? 767 ILE A HD11 5  
ATOM 8450  H HD12 . ILE A 1 60  ? -10.168 -15.408 -7.711  1.00 0.00 ? 767 ILE A HD12 5  
ATOM 8451  H HD13 . ILE A 1 60  ? -10.393 -13.872 -8.540  1.00 0.00 ? 767 ILE A HD13 5  
ATOM 8452  N N    . ASN A 1 61  ? -10.771 -9.794  -4.463  1.00 0.00 ? 768 ASN A N    5  
ATOM 8453  C CA   . ASN A 1 61  ? -11.162 -8.412  -4.256  1.00 0.00 ? 768 ASN A CA   5  
ATOM 8454  C C    . ASN A 1 61  ? -10.116 -7.664  -3.447  1.00 0.00 ? 768 ASN A C    5  
ATOM 8455  O O    . ASN A 1 61  ? -9.634  -6.612  -3.860  1.00 0.00 ? 768 ASN A O    5  
ATOM 8456  C CB   . ASN A 1 61  ? -12.529 -8.344  -3.550  1.00 0.00 ? 768 ASN A CB   5  
ATOM 8457  C CG   . ASN A 1 61  ? -12.824 -6.977  -2.969  1.00 0.00 ? 768 ASN A CG   5  
ATOM 8458  O OD1  . ASN A 1 61  ? -13.363 -6.094  -3.643  1.00 0.00 ? 768 ASN A OD1  5  
ATOM 8459  N ND2  . ASN A 1 61  ? -12.495 -6.810  -1.712  1.00 0.00 ? 768 ASN A ND2  5  
ATOM 8460  H H    . ASN A 1 61  ? -11.386 -10.500 -4.162  1.00 0.00 ? 768 ASN A H    5  
ATOM 8461  H HA   . ASN A 1 61  ? -11.254 -7.942  -5.224  1.00 0.00 ? 768 ASN A HA   5  
ATOM 8462  H HB2  . ASN A 1 61  ? -13.312 -8.590  -4.250  1.00 0.00 ? 768 ASN A HB2  5  
ATOM 8463  H HB3  . ASN A 1 61  ? -12.538 -9.065  -2.745  1.00 0.00 ? 768 ASN A HB3  5  
ATOM 8464  H HD21 . ASN A 1 61  ? -12.092 -7.559  -1.227  1.00 0.00 ? 768 ASN A HD21 5  
ATOM 8465  H HD22 . ASN A 1 61  ? -12.640 -5.956  -1.259  1.00 0.00 ? 768 ASN A HD22 5  
ATOM 8466  N N    . LYS A 1 62  ? -9.736  -8.243  -2.324  1.00 0.00 ? 769 LYS A N    5  
ATOM 8467  C CA   . LYS A 1 62  ? -8.806  -7.629  -1.405  1.00 0.00 ? 769 LYS A CA   5  
ATOM 8468  C C    . LYS A 1 62  ? -7.435  -7.476  -2.056  1.00 0.00 ? 769 LYS A C    5  
ATOM 8469  O O    . LYS A 1 62  ? -6.793  -6.435  -1.914  1.00 0.00 ? 769 LYS A O    5  
ATOM 8470  C CB   . LYS A 1 62  ? -8.732  -8.472  -0.143  1.00 0.00 ? 769 LYS A CB   5  
ATOM 8471  C CG   . LYS A 1 62  ? -8.087  -7.786  1.047   1.00 0.00 ? 769 LYS A CG   5  
ATOM 8472  C CD   . LYS A 1 62  ? -8.845  -6.541  1.502   1.00 0.00 ? 769 LYS A CD   5  
ATOM 8473  C CE   . LYS A 1 62  ? -10.292 -6.828  1.860   1.00 0.00 ? 769 LYS A CE   5  
ATOM 8474  N NZ   . LYS A 1 62  ? -10.443 -7.865  2.903   1.00 0.00 ? 769 LYS A NZ   5  
ATOM 8475  H H    . LYS A 1 62  ? -10.093 -9.136  -2.115  1.00 0.00 ? 769 LYS A H    5  
ATOM 8476  H HA   . LYS A 1 62  ? -9.145  -6.639  -1.138  1.00 0.00 ? 769 LYS A HA   5  
ATOM 8477  H HB2  . LYS A 1 62  ? -9.734  -8.761  0.135   1.00 0.00 ? 769 LYS A HB2  5  
ATOM 8478  H HB3  . LYS A 1 62  ? -8.167  -9.366  -0.365  1.00 0.00 ? 769 LYS A HB3  5  
ATOM 8479  H HG2  . LYS A 1 62  ? -8.068  -8.481  1.873   1.00 0.00 ? 769 LYS A HG2  5  
ATOM 8480  H HG3  . LYS A 1 62  ? -7.080  -7.513  0.775   1.00 0.00 ? 769 LYS A HG3  5  
ATOM 8481  H HD2  . LYS A 1 62  ? -8.353  -6.129  2.370   1.00 0.00 ? 769 LYS A HD2  5  
ATOM 8482  H HD3  . LYS A 1 62  ? -8.821  -5.812  0.706   1.00 0.00 ? 769 LYS A HD3  5  
ATOM 8483  H HE2  . LYS A 1 62  ? -10.741 -5.914  2.220   1.00 0.00 ? 769 LYS A HE2  5  
ATOM 8484  H HE3  . LYS A 1 62  ? -10.813 -7.141  0.969   1.00 0.00 ? 769 LYS A HE3  5  
ATOM 8485  H HZ1  . LYS A 1 62  ? -9.980  -7.585  3.791   1.00 0.00 ? 769 LYS A HZ1  5  
ATOM 8486  H HZ2  . LYS A 1 62  ? -10.105 -8.792  2.580   1.00 0.00 ? 769 LYS A HZ2  5  
ATOM 8487  H HZ3  . LYS A 1 62  ? -11.463 -7.961  3.091   1.00 0.00 ? 769 LYS A HZ3  5  
ATOM 8488  N N    . LYS A 1 63  ? -7.024  -8.501  -2.804  1.00 0.00 ? 770 LYS A N    5  
ATOM 8489  C CA   . LYS A 1 63  ? -5.761  -8.486  -3.531  1.00 0.00 ? 770 LYS A CA   5  
ATOM 8490  C C    . LYS A 1 63  ? -5.771  -7.413  -4.599  1.00 0.00 ? 770 LYS A C    5  
ATOM 8491  O O    . LYS A 1 63  ? -4.801  -6.684  -4.762  1.00 0.00 ? 770 LYS A O    5  
ATOM 8492  C CB   . LYS A 1 63  ? -5.480  -9.842  -4.176  1.00 0.00 ? 770 LYS A CB   5  
ATOM 8493  C CG   . LYS A 1 63  ? -5.269  -10.968 -3.183  1.00 0.00 ? 770 LYS A CG   5  
ATOM 8494  C CD   . LYS A 1 63  ? -5.075  -12.307 -3.869  1.00 0.00 ? 770 LYS A CD   5  
ATOM 8495  C CE   . LYS A 1 63  ? -3.835  -12.318 -4.743  1.00 0.00 ? 770 LYS A CE   5  
ATOM 8496  N NZ   . LYS A 1 63  ? -3.661  -13.606 -5.421  1.00 0.00 ? 770 LYS A NZ   5  
ATOM 8497  H H    . LYS A 1 63  ? -7.591  -9.303  -2.861  1.00 0.00 ? 770 LYS A H    5  
ATOM 8498  H HA   . LYS A 1 63  ? -4.979  -8.272  -2.820  1.00 0.00 ? 770 LYS A HA   5  
ATOM 8499  H HB2  . LYS A 1 63  ? -6.312  -10.100 -4.814  1.00 0.00 ? 770 LYS A HB2  5  
ATOM 8500  H HB3  . LYS A 1 63  ? -4.591  -9.747  -4.782  1.00 0.00 ? 770 LYS A HB3  5  
ATOM 8501  H HG2  . LYS A 1 63  ? -4.387  -10.755 -2.599  1.00 0.00 ? 770 LYS A HG2  5  
ATOM 8502  H HG3  . LYS A 1 63  ? -6.130  -11.025 -2.532  1.00 0.00 ? 770 LYS A HG3  5  
ATOM 8503  H HD2  . LYS A 1 63  ? -4.974  -13.074 -3.116  1.00 0.00 ? 770 LYS A HD2  5  
ATOM 8504  H HD3  . LYS A 1 63  ? -5.940  -12.518 -4.481  1.00 0.00 ? 770 LYS A HD3  5  
ATOM 8505  H HE2  . LYS A 1 63  ? -3.928  -11.545 -5.491  1.00 0.00 ? 770 LYS A HE2  5  
ATOM 8506  H HE3  . LYS A 1 63  ? -2.970  -12.118 -4.127  1.00 0.00 ? 770 LYS A HE3  5  
ATOM 8507  H HZ1  . LYS A 1 63  ? -2.829  -13.611 -6.046  1.00 0.00 ? 770 LYS A HZ1  5  
ATOM 8508  H HZ2  . LYS A 1 63  ? -4.496  -13.838 -5.996  1.00 0.00 ? 770 LYS A HZ2  5  
ATOM 8509  H HZ3  . LYS A 1 63  ? -3.558  -14.376 -4.728  1.00 0.00 ? 770 LYS A HZ3  5  
ATOM 8510  N N    . ARG A 1 64  ? -6.876  -7.312  -5.311  1.00 0.00 ? 771 ARG A N    5  
ATOM 8511  C CA   . ARG A 1 64  ? -7.030  -6.322  -6.356  1.00 0.00 ? 771 ARG A CA   5  
ATOM 8512  C C    . ARG A 1 64  ? -6.936  -4.913  -5.787  1.00 0.00 ? 771 ARG A C    5  
ATOM 8513  O O    . ARG A 1 64  ? -6.250  -4.063  -6.345  1.00 0.00 ? 771 ARG A O    5  
ATOM 8514  C CB   . ARG A 1 64  ? -8.358  -6.508  -7.088  1.00 0.00 ? 771 ARG A CB   5  
ATOM 8515  C CG   . ARG A 1 64  ? -8.601  -5.498  -8.198  1.00 0.00 ? 771 ARG A CG   5  
ATOM 8516  C CD   . ARG A 1 64  ? -9.928  -5.734  -8.881  1.00 0.00 ? 771 ARG A CD   5  
ATOM 8517  N NE   . ARG A 1 64  ? -9.983  -7.050  -9.534  1.00 0.00 ? 771 ARG A NE   5  
ATOM 8518  C CZ   . ARG A 1 64  ? -11.079 -7.810  -9.628  1.00 0.00 ? 771 ARG A CZ   5  
ATOM 8519  N NH1  . ARG A 1 64  ? -12.221 -7.412  -9.082  1.00 0.00 ? 771 ARG A NH1  5  
ATOM 8520  N NH2  . ARG A 1 64  ? -11.027 -8.969  -10.271 1.00 0.00 ? 771 ARG A NH2  5  
ATOM 8521  H H    . ARG A 1 64  ? -7.612  -7.943  -5.140  1.00 0.00 ? 771 ARG A H    5  
ATOM 8522  H HA   . ARG A 1 64  ? -6.224  -6.460  -7.061  1.00 0.00 ? 771 ARG A HA   5  
ATOM 8523  H HB2  . ARG A 1 64  ? -8.381  -7.498  -7.519  1.00 0.00 ? 771 ARG A HB2  5  
ATOM 8524  H HB3  . ARG A 1 64  ? -9.162  -6.424  -6.371  1.00 0.00 ? 771 ARG A HB3  5  
ATOM 8525  H HG2  . ARG A 1 64  ? -8.593  -4.502  -7.778  1.00 0.00 ? 771 ARG A HG2  5  
ATOM 8526  H HG3  . ARG A 1 64  ? -7.808  -5.591  -8.925  1.00 0.00 ? 771 ARG A HG3  5  
ATOM 8527  H HD2  . ARG A 1 64  ? -10.712 -5.674  -8.141  1.00 0.00 ? 771 ARG A HD2  5  
ATOM 8528  H HD3  . ARG A 1 64  ? -10.076 -4.968  -9.627  1.00 0.00 ? 771 ARG A HD3  5  
ATOM 8529  H HE   . ARG A 1 64  ? -9.135  -7.351  -9.930  1.00 0.00 ? 771 ARG A HE   5  
ATOM 8530  H HH11 . ARG A 1 64  ? -12.321 -6.547  -8.587  1.00 0.00 ? 771 ARG A HH11 5  
ATOM 8531  H HH12 . ARG A 1 64  ? -13.041 -7.991  -9.130  1.00 0.00 ? 771 ARG A HH12 5  
ATOM 8532  H HH21 . ARG A 1 64  ? -10.188 -9.309  -10.704 1.00 0.00 ? 771 ARG A HH21 5  
ATOM 8533  H HH22 . ARG A 1 64  ? -11.839 -9.558  -10.345 1.00 0.00 ? 771 ARG A HH22 5  
ATOM 8534  N N    . ILE A 1 65  ? -7.598  -4.685  -4.657  1.00 0.00 ? 772 ILE A N    5  
ATOM 8535  C CA   . ILE A 1 65  ? -7.590  -3.374  -4.035  1.00 0.00 ? 772 ILE A CA   5  
ATOM 8536  C C    . ILE A 1 65  ? -6.188  -3.039  -3.565  1.00 0.00 ? 772 ILE A C    5  
ATOM 8537  O O    . ILE A 1 65  ? -5.649  -2.017  -3.956  1.00 0.00 ? 772 ILE A O    5  
ATOM 8538  C CB   . ILE A 1 65  ? -8.581  -3.235  -2.830  1.00 0.00 ? 772 ILE A CB   5  
ATOM 8539  C CG1  . ILE A 1 65  ? -10.022 -3.635  -3.215  1.00 0.00 ? 772 ILE A CG1  5  
ATOM 8540  C CG2  . ILE A 1 65  ? -8.570  -1.788  -2.293  1.00 0.00 ? 772 ILE A CG2  5  
ATOM 8541  C CD1  . ILE A 1 65  ? -10.673 -2.768  -4.274  1.00 0.00 ? 772 ILE A CD1  5  
ATOM 8542  H H    . ILE A 1 65  ? -8.091  -5.428  -4.247  1.00 0.00 ? 772 ILE A H    5  
ATOM 8543  H HA   . ILE A 1 65  ? -7.862  -2.662  -4.799  1.00 0.00 ? 772 ILE A HA   5  
ATOM 8544  H HB   . ILE A 1 65  ? -8.227  -3.886  -2.044  1.00 0.00 ? 772 ILE A HB   5  
ATOM 8545  H HG12 . ILE A 1 65  ? -10.011 -4.647  -3.592  1.00 0.00 ? 772 ILE A HG12 5  
ATOM 8546  H HG13 . ILE A 1 65  ? -10.638 -3.602  -2.328  1.00 0.00 ? 772 ILE A HG13 5  
ATOM 8547  H HG21 . ILE A 1 65  ? -8.892  -1.109  -3.068  1.00 0.00 ? 772 ILE A HG21 5  
ATOM 8548  H HG22 . ILE A 1 65  ? -7.569  -1.523  -1.981  1.00 0.00 ? 772 ILE A HG22 5  
ATOM 8549  H HG23 . ILE A 1 65  ? -9.230  -1.702  -1.442  1.00 0.00 ? 772 ILE A HG23 5  
ATOM 8550  H HD11 . ILE A 1 65  ? -10.712 -1.750  -3.916  1.00 0.00 ? 772 ILE A HD11 5  
ATOM 8551  H HD12 . ILE A 1 65  ? -11.676 -3.124  -4.450  1.00 0.00 ? 772 ILE A HD12 5  
ATOM 8552  H HD13 . ILE A 1 65  ? -10.103 -2.812  -5.190  1.00 0.00 ? 772 ILE A HD13 5  
ATOM 8553  N N    . ILE A 1 66  ? -5.575  -3.935  -2.779  1.00 0.00 ? 773 ILE A N    5  
ATOM 8554  C CA   . ILE A 1 66  ? -4.247  -3.670  -2.236  1.00 0.00 ? 773 ILE A CA   5  
ATOM 8555  C C    . ILE A 1 66  ? -3.215  -3.450  -3.357  1.00 0.00 ? 773 ILE A C    5  
ATOM 8556  O O    . ILE A 1 66  ? -2.446  -2.498  -3.311  1.00 0.00 ? 773 ILE A O    5  
ATOM 8557  C CB   . ILE A 1 66  ? -3.756  -4.763  -1.198  1.00 0.00 ? 773 ILE A CB   5  
ATOM 8558  C CG1  . ILE A 1 66  ? -2.417  -4.373  -0.558  1.00 0.00 ? 773 ILE A CG1  5  
ATOM 8559  C CG2  . ILE A 1 66  ? -3.645  -6.142  -1.812  1.00 0.00 ? 773 ILE A CG2  5  
ATOM 8560  C CD1  . ILE A 1 66  ? -2.479  -3.104  0.260   1.00 0.00 ? 773 ILE A CD1  5  
ATOM 8561  H H    . ILE A 1 66  ? -6.024  -4.787  -2.571  1.00 0.00 ? 773 ILE A H    5  
ATOM 8562  H HA   . ILE A 1 66  ? -4.345  -2.728  -1.714  1.00 0.00 ? 773 ILE A HA   5  
ATOM 8563  H HB   . ILE A 1 66  ? -4.498  -4.822  -0.415  1.00 0.00 ? 773 ILE A HB   5  
ATOM 8564  H HG12 . ILE A 1 66  ? -2.086  -5.177  0.084   1.00 0.00 ? 773 ILE A HG12 5  
ATOM 8565  H HG13 . ILE A 1 66  ? -1.688  -4.228  -1.342  1.00 0.00 ? 773 ILE A HG13 5  
ATOM 8566  H HG21 . ILE A 1 66  ? -2.916  -6.127  -2.607  1.00 0.00 ? 773 ILE A HG21 5  
ATOM 8567  H HG22 . ILE A 1 66  ? -4.609  -6.412  -2.215  1.00 0.00 ? 773 ILE A HG22 5  
ATOM 8568  H HG23 . ILE A 1 66  ? -3.355  -6.859  -1.058  1.00 0.00 ? 773 ILE A HG23 5  
ATOM 8569  H HD11 . ILE A 1 66  ? -3.208  -3.226  1.048   1.00 0.00 ? 773 ILE A HD11 5  
ATOM 8570  H HD12 . ILE A 1 66  ? -2.771  -2.281  -0.374  1.00 0.00 ? 773 ILE A HD12 5  
ATOM 8571  H HD13 . ILE A 1 66  ? -1.509  -2.902  0.691   1.00 0.00 ? 773 ILE A HD13 5  
ATOM 8572  N N    . GLU A 1 67  ? -3.276  -4.270  -4.393  1.00 0.00 ? 774 GLU A N    5  
ATOM 8573  C CA   . GLU A 1 67  ? -2.334  -4.181  -5.486  1.00 0.00 ? 774 GLU A CA   5  
ATOM 8574  C C    . GLU A 1 67  ? -2.567  -2.909  -6.319  1.00 0.00 ? 774 GLU A C    5  
ATOM 8575  O O    . GLU A 1 67  ? -1.609  -2.211  -6.676  1.00 0.00 ? 774 GLU A O    5  
ATOM 8576  C CB   . GLU A 1 67  ? -2.379  -5.457  -6.334  1.00 0.00 ? 774 GLU A CB   5  
ATOM 8577  C CG   . GLU A 1 67  ? -1.360  -5.520  -7.452  1.00 0.00 ? 774 GLU A CG   5  
ATOM 8578  C CD   . GLU A 1 67  ? -1.331  -6.869  -8.120  1.00 0.00 ? 774 GLU A CD   5  
ATOM 8579  O OE1  . GLU A 1 67  ? -2.196  -7.151  -8.985  1.00 0.00 ? 774 GLU A OE1  5  
ATOM 8580  O OE2  . GLU A 1 67  ? -0.437  -7.682  -7.797  1.00 0.00 ? 774 GLU A OE2  5  
ATOM 8581  H H    . GLU A 1 67  ? -3.976  -4.959  -4.423  1.00 0.00 ? 774 GLU A H    5  
ATOM 8582  H HA   . GLU A 1 67  ? -1.354  -4.095  -5.040  1.00 0.00 ? 774 GLU A HA   5  
ATOM 8583  H HB2  . GLU A 1 67  ? -2.215  -6.305  -5.686  1.00 0.00 ? 774 GLU A HB2  5  
ATOM 8584  H HB3  . GLU A 1 67  ? -3.366  -5.543  -6.767  1.00 0.00 ? 774 GLU A HB3  5  
ATOM 8585  H HG2  . GLU A 1 67  ? -1.601  -4.769  -8.190  1.00 0.00 ? 774 GLU A HG2  5  
ATOM 8586  H HG3  . GLU A 1 67  ? -0.383  -5.315  -7.039  1.00 0.00 ? 774 GLU A HG3  5  
ATOM 8587  N N    . LYS A 1 68  ? -3.835  -2.571  -6.585  1.00 0.00 ? 775 LYS A N    5  
ATOM 8588  C CA   . LYS A 1 68  ? -4.139  -1.347  -7.332  1.00 0.00 ? 775 LYS A CA   5  
ATOM 8589  C C    . LYS A 1 68  ? -3.762  -0.116  -6.509  1.00 0.00 ? 775 LYS A C    5  
ATOM 8590  O O    . LYS A 1 68  ? -3.290  0.889   -7.055  1.00 0.00 ? 775 LYS A O    5  
ATOM 8591  C CB   . LYS A 1 68  ? -5.622  -1.295  -7.785  1.00 0.00 ? 775 LYS A CB   5  
ATOM 8592  C CG   . LYS A 1 68  ? -6.041  0.002   -8.516  1.00 0.00 ? 775 LYS A CG   5  
ATOM 8593  C CD   . LYS A 1 68  ? -5.219  0.275   -9.794  1.00 0.00 ? 775 LYS A CD   5  
ATOM 8594  C CE   . LYS A 1 68  ? -5.490  -0.730  -10.914 1.00 0.00 ? 775 LYS A CE   5  
ATOM 8595  N NZ   . LYS A 1 68  ? -6.871  -0.629  -11.445 1.00 0.00 ? 775 LYS A NZ   5  
ATOM 8596  H H    . LYS A 1 68  ? -4.573  -3.151  -6.284  1.00 0.00 ? 775 LYS A H    5  
ATOM 8597  H HA   . LYS A 1 68  ? -3.501  -1.347  -8.204  1.00 0.00 ? 775 LYS A HA   5  
ATOM 8598  H HB2  . LYS A 1 68  ? -5.814  -2.130  -8.442  1.00 0.00 ? 775 LYS A HB2  5  
ATOM 8599  H HB3  . LYS A 1 68  ? -6.246  -1.402  -6.910  1.00 0.00 ? 775 LYS A HB3  5  
ATOM 8600  H HG2  . LYS A 1 68  ? -7.080  -0.082  -8.790  1.00 0.00 ? 775 LYS A HG2  5  
ATOM 8601  H HG3  . LYS A 1 68  ? -5.920  0.832   -7.836  1.00 0.00 ? 775 LYS A HG3  5  
ATOM 8602  H HD2  . LYS A 1 68  ? -5.466  1.261   -10.157 1.00 0.00 ? 775 LYS A HD2  5  
ATOM 8603  H HD3  . LYS A 1 68  ? -4.169  0.247   -9.540  1.00 0.00 ? 775 LYS A HD3  5  
ATOM 8604  H HE2  . LYS A 1 68  ? -4.798  -0.542  -11.721 1.00 0.00 ? 775 LYS A HE2  5  
ATOM 8605  H HE3  . LYS A 1 68  ? -5.325  -1.726  -10.534 1.00 0.00 ? 775 LYS A HE3  5  
ATOM 8606  H HZ1  . LYS A 1 68  ? -7.598  -0.788  -10.719 1.00 0.00 ? 775 LYS A HZ1  5  
ATOM 8607  H HZ2  . LYS A 1 68  ? -7.034  -1.338  -12.185 1.00 0.00 ? 775 LYS A HZ2  5  
ATOM 8608  H HZ3  . LYS A 1 68  ? -7.062  0.293   -11.882 1.00 0.00 ? 775 LYS A HZ3  5  
ATOM 8609  N N    . VAL A 1 69  ? -3.937  -0.199  -5.203  1.00 0.00 ? 776 VAL A N    5  
ATOM 8610  C CA   . VAL A 1 69  ? -3.553  0.888   -4.325  1.00 0.00 ? 776 VAL A CA   5  
ATOM 8611  C C    . VAL A 1 69  ? -2.038  1.052   -4.304  1.00 0.00 ? 776 VAL A C    5  
ATOM 8612  O O    . VAL A 1 69  ? -1.556  2.164   -4.362  1.00 0.00 ? 776 VAL A O    5  
ATOM 8613  C CB   . VAL A 1 69  ? -4.138  0.751   -2.885  1.00 0.00 ? 776 VAL A CB   5  
ATOM 8614  C CG1  . VAL A 1 69  ? -3.585  1.830   -1.957  1.00 0.00 ? 776 VAL A CG1  5  
ATOM 8615  C CG2  . VAL A 1 69  ? -5.655  0.866   -2.930  1.00 0.00 ? 776 VAL A CG2  5  
ATOM 8616  H H    . VAL A 1 69  ? -4.353  -1.005  -4.819  1.00 0.00 ? 776 VAL A H    5  
ATOM 8617  H HA   . VAL A 1 69  ? -3.954  1.784   -4.777  1.00 0.00 ? 776 VAL A HA   5  
ATOM 8618  H HB   . VAL A 1 69  ? -3.882  -0.223  -2.500  1.00 0.00 ? 776 VAL A HB   5  
ATOM 8619  H HG11 . VAL A 1 69  ? -3.852  2.805   -2.342  1.00 0.00 ? 776 VAL A HG11 5  
ATOM 8620  H HG12 . VAL A 1 69  ? -2.510  1.747   -1.908  1.00 0.00 ? 776 VAL A HG12 5  
ATOM 8621  H HG13 . VAL A 1 69  ? -4.002  1.710   -0.968  1.00 0.00 ? 776 VAL A HG13 5  
ATOM 8622  H HG21 . VAL A 1 69  ? -5.931  1.822   -3.350  1.00 0.00 ? 776 VAL A HG21 5  
ATOM 8623  H HG22 . VAL A 1 69  ? -6.056  0.785   -1.930  1.00 0.00 ? 776 VAL A HG22 5  
ATOM 8624  H HG23 . VAL A 1 69  ? -6.054  0.073   -3.545  1.00 0.00 ? 776 VAL A HG23 5  
ATOM 8625  N N    . ILE A 1 70  ? -1.296  -0.054  -4.269  1.00 0.00 ? 777 ILE A N    5  
ATOM 8626  C CA   . ILE A 1 70  ? 0.170   0.013   -4.322  1.00 0.00 ? 777 ILE A CA   5  
ATOM 8627  C C    . ILE A 1 70  ? 0.620   0.627   -5.653  1.00 0.00 ? 777 ILE A C    5  
ATOM 8628  O O    . ILE A 1 70  ? 1.526   1.472   -5.685  1.00 0.00 ? 777 ILE A O    5  
ATOM 8629  C CB   . ILE A 1 70  ? 0.843   -1.372  -4.094  1.00 0.00 ? 777 ILE A CB   5  
ATOM 8630  C CG1  . ILE A 1 70  ? 0.503   -1.892  -2.691  1.00 0.00 ? 777 ILE A CG1  5  
ATOM 8631  C CG2  . ILE A 1 70  ? 2.365   -1.277  -4.266  1.00 0.00 ? 777 ILE A CG2  5  
ATOM 8632  C CD1  . ILE A 1 70  ? 1.007   -3.287  -2.411  1.00 0.00 ? 777 ILE A CD1  5  
ATOM 8633  H H    . ILE A 1 70  ? -1.738  -0.930  -4.187  1.00 0.00 ? 777 ILE A H    5  
ATOM 8634  H HA   . ILE A 1 70  ? 0.472   0.690   -3.534  1.00 0.00 ? 777 ILE A HA   5  
ATOM 8635  H HB   . ILE A 1 70  ? 0.459   -2.067  -4.826  1.00 0.00 ? 777 ILE A HB   5  
ATOM 8636  H HG12 . ILE A 1 70  ? 0.940   -1.233  -1.955  1.00 0.00 ? 777 ILE A HG12 5  
ATOM 8637  H HG13 . ILE A 1 70  ? -0.570  -1.893  -2.566  1.00 0.00 ? 777 ILE A HG13 5  
ATOM 8638  H HG21 . ILE A 1 70  ? 2.810   -2.244  -4.085  1.00 0.00 ? 777 ILE A HG21 5  
ATOM 8639  H HG22 . ILE A 1 70  ? 2.759   -0.562  -3.559  1.00 0.00 ? 777 ILE A HG22 5  
ATOM 8640  H HG23 . ILE A 1 70  ? 2.593   -0.951  -5.270  1.00 0.00 ? 777 ILE A HG23 5  
ATOM 8641  H HD11 . ILE A 1 70  ? 0.747   -3.569  -1.402  1.00 0.00 ? 777 ILE A HD11 5  
ATOM 8642  H HD12 . ILE A 1 70  ? 2.079   -3.322  -2.536  1.00 0.00 ? 777 ILE A HD12 5  
ATOM 8643  H HD13 . ILE A 1 70  ? 0.539   -3.975  -3.102  1.00 0.00 ? 777 ILE A HD13 5  
ATOM 8644  N N    . HIS A 1 71  ? -0.035  0.225   -6.737  1.00 0.00 ? 778 HIS A N    5  
ATOM 8645  C CA   . HIS A 1 71  ? 0.206   0.806   -8.061  1.00 0.00 ? 778 HIS A CA   5  
ATOM 8646  C C    . HIS A 1 71  ? -0.065  2.320   -8.041  1.00 0.00 ? 778 HIS A C    5  
ATOM 8647  O O    . HIS A 1 71  ? 0.729   3.104   -8.536  1.00 0.00 ? 778 HIS A O    5  
ATOM 8648  C CB   . HIS A 1 71  ? -0.656  0.084   -9.129  1.00 0.00 ? 778 HIS A CB   5  
ATOM 8649  C CG   . HIS A 1 71  ? -0.700  0.746   -10.489 1.00 0.00 ? 778 HIS A CG   5  
ATOM 8650  N ND1  . HIS A 1 71  ? 0.329   0.736   -11.407 1.00 0.00 ? 778 HIS A ND1  5  
ATOM 8651  C CD2  . HIS A 1 71  ? -1.697  1.457   -11.060 1.00 0.00 ? 778 HIS A CD2  5  
ATOM 8652  C CE1  . HIS A 1 71  ? -0.065  1.426   -12.480 1.00 0.00 ? 778 HIS A CE1  5  
ATOM 8653  N NE2  . HIS A 1 71  ? -1.298  1.888   -12.320 1.00 0.00 ? 778 HIS A NE2  5  
ATOM 8654  H H    . HIS A 1 71  ? -0.688  -0.507  -6.648  1.00 0.00 ? 778 HIS A H    5  
ATOM 8655  H HA   . HIS A 1 71  ? 1.250   0.658   -8.292  1.00 0.00 ? 778 HIS A HA   5  
ATOM 8656  H HB2  . HIS A 1 71  ? -0.267  -0.913  -9.269  1.00 0.00 ? 778 HIS A HB2  5  
ATOM 8657  H HB3  . HIS A 1 71  ? -1.669  0.010   -8.759  1.00 0.00 ? 778 HIS A HB3  5  
ATOM 8658  H HD1  . HIS A 1 71  ? 1.211   0.313   -11.307 1.00 0.00 ? 778 HIS A HD1  5  
ATOM 8659  H HD2  . HIS A 1 71  ? -2.658  1.664   -10.611 1.00 0.00 ? 778 HIS A HD2  5  
ATOM 8660  H HE1  . HIS A 1 71  ? 0.538   1.586   -13.362 1.00 0.00 ? 778 HIS A HE1  5  
ATOM 8661  N N    . ARG A 1 72  ? -1.175  2.711   -7.439  1.00 0.00 ? 779 ARG A N    5  
ATOM 8662  C CA   . ARG A 1 72  ? -1.527  4.119   -7.310  1.00 0.00 ? 779 ARG A CA   5  
ATOM 8663  C C    . ARG A 1 72  ? -0.462  4.855   -6.484  1.00 0.00 ? 779 ARG A C    5  
ATOM 8664  O O    . ARG A 1 72  ? 0.063   5.901   -6.883  1.00 0.00 ? 779 ARG A O    5  
ATOM 8665  C CB   . ARG A 1 72  ? -2.877  4.257   -6.617  1.00 0.00 ? 779 ARG A CB   5  
ATOM 8666  C CG   . ARG A 1 72  ? -3.297  5.693   -6.393  1.00 0.00 ? 779 ARG A CG   5  
ATOM 8667  C CD   . ARG A 1 72  ? -4.456  5.793   -5.428  1.00 0.00 ? 779 ARG A CD   5  
ATOM 8668  N NE   . ARG A 1 72  ? -5.676  5.184   -5.948  1.00 0.00 ? 779 ARG A NE   5  
ATOM 8669  C CZ   . ARG A 1 72  ? -6.797  5.039   -5.249  1.00 0.00 ? 779 ARG A CZ   5  
ATOM 8670  N NH1  . ARG A 1 72  ? -6.809  5.322   -3.966  1.00 0.00 ? 779 ARG A NH1  5  
ATOM 8671  N NH2  . ARG A 1 72  ? -7.907  4.608   -5.841  1.00 0.00 ? 779 ARG A NH2  5  
ATOM 8672  H H    . ARG A 1 72  ? -1.778  2.025   -7.074  1.00 0.00 ? 779 ARG A H    5  
ATOM 8673  H HA   . ARG A 1 72  ? -1.588  4.549   -8.297  1.00 0.00 ? 779 ARG A HA   5  
ATOM 8674  H HB2  . ARG A 1 72  ? -3.624  3.768   -7.228  1.00 0.00 ? 779 ARG A HB2  5  
ATOM 8675  H HB3  . ARG A 1 72  ? -2.829  3.760   -5.660  1.00 0.00 ? 779 ARG A HB3  5  
ATOM 8676  H HG2  . ARG A 1 72  ? -2.458  6.249   -6.003  1.00 0.00 ? 779 ARG A HG2  5  
ATOM 8677  H HG3  . ARG A 1 72  ? -3.592  6.105   -7.349  1.00 0.00 ? 779 ARG A HG3  5  
ATOM 8678  H HD2  . ARG A 1 72  ? -4.185  5.287   -4.512  1.00 0.00 ? 779 ARG A HD2  5  
ATOM 8679  H HD3  . ARG A 1 72  ? -4.646  6.834   -5.210  1.00 0.00 ? 779 ARG A HD3  5  
ATOM 8680  H HE   . ARG A 1 72  ? -5.645  4.933   -6.898  1.00 0.00 ? 779 ARG A HE   5  
ATOM 8681  H HH11 . ARG A 1 72  ? -5.999  5.658   -3.478  1.00 0.00 ? 779 ARG A HH11 5  
ATOM 8682  H HH12 . ARG A 1 72  ? -7.665  5.196   -3.432  1.00 0.00 ? 779 ARG A HH12 5  
ATOM 8683  H HH21 . ARG A 1 72  ? -7.934  4.378   -6.817  1.00 0.00 ? 779 ARG A HH21 5  
ATOM 8684  H HH22 . ARG A 1 72  ? -8.774  4.531   -5.325  1.00 0.00 ? 779 ARG A HH22 5  
ATOM 8685  N N    . LEU A 1 73  ? -0.143  4.261   -5.369  1.00 0.00 ? 780 LEU A N    5  
ATOM 8686  C CA   . LEU A 1 73  ? 0.809   4.748   -4.398  1.00 0.00 ? 780 LEU A CA   5  
ATOM 8687  C C    . LEU A 1 73  ? 2.182   5.010   -5.033  1.00 0.00 ? 780 LEU A C    5  
ATOM 8688  O O    . LEU A 1 73  ? 2.804   6.041   -4.773  1.00 0.00 ? 780 LEU A O    5  
ATOM 8689  C CB   . LEU A 1 73  ? 0.903   3.698   -3.282  1.00 0.00 ? 780 LEU A CB   5  
ATOM 8690  C CG   . LEU A 1 73  ? 1.820   3.972   -2.109  1.00 0.00 ? 780 LEU A CG   5  
ATOM 8691  C CD1  . LEU A 1 73  ? 1.408   5.232   -1.389  1.00 0.00 ? 780 LEU A CD1  5  
ATOM 8692  C CD2  . LEU A 1 73  ? 1.808   2.790   -1.155  1.00 0.00 ? 780 LEU A CD2  5  
ATOM 8693  H H    . LEU A 1 73  ? -0.599  3.415   -5.156  1.00 0.00 ? 780 LEU A H    5  
ATOM 8694  H HA   . LEU A 1 73  ? 0.427   5.662   -3.970  1.00 0.00 ? 780 LEU A HA   5  
ATOM 8695  H HB2  . LEU A 1 73  ? -0.091  3.547   -2.887  1.00 0.00 ? 780 LEU A HB2  5  
ATOM 8696  H HB3  . LEU A 1 73  ? 1.217   2.773   -3.744  1.00 0.00 ? 780 LEU A HB3  5  
ATOM 8697  H HG   . LEU A 1 73  ? 2.824   4.090   -2.484  1.00 0.00 ? 780 LEU A HG   5  
ATOM 8698  H HD11 . LEU A 1 73  ? 2.071   5.407   -0.556  1.00 0.00 ? 780 LEU A HD11 5  
ATOM 8699  H HD12 . LEU A 1 73  ? 0.395   5.127   -1.030  1.00 0.00 ? 780 LEU A HD12 5  
ATOM 8700  H HD13 . LEU A 1 73  ? 1.464   6.063   -2.077  1.00 0.00 ? 780 LEU A HD13 5  
ATOM 8701  H HD21 . LEU A 1 73  ? 2.458   2.995   -0.318  1.00 0.00 ? 780 LEU A HD21 5  
ATOM 8702  H HD22 . LEU A 1 73  ? 2.155   1.909   -1.674  1.00 0.00 ? 780 LEU A HD22 5  
ATOM 8703  H HD23 . LEU A 1 73  ? 0.802   2.625   -0.797  1.00 0.00 ? 780 LEU A HD23 5  
ATOM 8704  N N    . THR A 1 74  ? 2.615   4.116   -5.900  1.00 0.00 ? 781 THR A N    5  
ATOM 8705  C CA   . THR A 1 74  ? 3.921   4.230   -6.533  1.00 0.00 ? 781 THR A CA   5  
ATOM 8706  C C    . THR A 1 74  ? 3.882   4.979   -7.872  1.00 0.00 ? 781 THR A C    5  
ATOM 8707  O O    . THR A 1 74  ? 4.929   5.198   -8.490  1.00 0.00 ? 781 THR A O    5  
ATOM 8708  C CB   . THR A 1 74  ? 4.556   2.830   -6.753  1.00 0.00 ? 781 THR A CB   5  
ATOM 8709  O OG1  . THR A 1 74  ? 3.587   1.921   -7.313  1.00 0.00 ? 781 THR A OG1  5  
ATOM 8710  C CG2  . THR A 1 74  ? 5.099   2.260   -5.464  1.00 0.00 ? 781 THR A CG2  5  
ATOM 8711  H H    . THR A 1 74  ? 2.055   3.341   -6.129  1.00 0.00 ? 781 THR A H    5  
ATOM 8712  H HA   . THR A 1 74  ? 4.562   4.775   -5.856  1.00 0.00 ? 781 THR A HA   5  
ATOM 8713  H HB   . THR A 1 74  ? 5.365   2.939   -7.462  1.00 0.00 ? 781 THR A HB   5  
ATOM 8714  H HG1  . THR A 1 74  ? 2.928   1.706   -6.636  1.00 0.00 ? 781 THR A HG1  5  
ATOM 8715  H HG21 . THR A 1 74  ? 5.870   2.915   -5.089  1.00 0.00 ? 781 THR A HG21 5  
ATOM 8716  H HG22 . THR A 1 74  ? 5.513   1.280   -5.647  1.00 0.00 ? 781 THR A HG22 5  
ATOM 8717  H HG23 . THR A 1 74  ? 4.304   2.189   -4.738  1.00 0.00 ? 781 THR A HG23 5  
ATOM 8718  N N    . HIS A 1 75  ? 2.715   5.415   -8.305  1.00 0.00 ? 782 HIS A N    5  
ATOM 8719  C CA   . HIS A 1 75  ? 2.636   5.991   -9.639  1.00 0.00 ? 782 HIS A CA   5  
ATOM 8720  C C    . HIS A 1 75  ? 1.825   7.283   -9.692  1.00 0.00 ? 782 HIS A C    5  
ATOM 8721  O O    . HIS A 1 75  ? 2.319   8.309   -10.164 1.00 0.00 ? 782 HIS A O    5  
ATOM 8722  C CB   . HIS A 1 75  ? 2.108   4.934   -10.636 1.00 0.00 ? 782 HIS A CB   5  
ATOM 8723  C CG   . HIS A 1 75  ? 2.043   5.383   -12.061 1.00 0.00 ? 782 HIS A CG   5  
ATOM 8724  N ND1  . HIS A 1 75  ? 3.138   5.774   -12.784 1.00 0.00 ? 782 HIS A ND1  5  
ATOM 8725  C CD2  . HIS A 1 75  ? 0.980   5.511   -12.890 1.00 0.00 ? 782 HIS A CD2  5  
ATOM 8726  C CE1  . HIS A 1 75  ? 2.733   6.122   -13.993 1.00 0.00 ? 782 HIS A CE1  5  
ATOM 8727  N NE2  . HIS A 1 75  ? 1.423   5.980   -14.120 1.00 0.00 ? 782 HIS A NE2  5  
ATOM 8728  H H    . HIS A 1 75  ? 1.927   5.350   -7.722  1.00 0.00 ? 782 HIS A H    5  
ATOM 8729  H HA   . HIS A 1 75  ? 3.651   6.226   -9.924  1.00 0.00 ? 782 HIS A HA   5  
ATOM 8730  H HB2  . HIS A 1 75  ? 2.750   4.067   -10.600 1.00 0.00 ? 782 HIS A HB2  5  
ATOM 8731  H HB3  . HIS A 1 75  ? 1.114   4.640   -10.331 1.00 0.00 ? 782 HIS A HB3  5  
ATOM 8732  H HD1  . HIS A 1 75  ? 4.069   5.799   -12.467 1.00 0.00 ? 782 HIS A HD1  5  
ATOM 8733  H HD2  . HIS A 1 75  ? -0.048  5.289   -12.647 1.00 0.00 ? 782 HIS A HD2  5  
ATOM 8734  H HE1  . HIS A 1 75  ? 3.386   6.479   -14.776 1.00 0.00 ? 782 HIS A HE1  5  
ATOM 8735  N N    . TYR A 1 76  ? 0.612   7.229   -9.204  1.00 0.00 ? 783 TYR A N    5  
ATOM 8736  C CA   . TYR A 1 76  ? -0.311  8.370   -9.242  1.00 0.00 ? 783 TYR A CA   5  
ATOM 8737  C C    . TYR A 1 76  ? 0.084   9.413   -8.224  1.00 0.00 ? 783 TYR A C    5  
ATOM 8738  O O    . TYR A 1 76  ? 0.192   10.599  -8.524  1.00 0.00 ? 783 TYR A O    5  
ATOM 8739  C CB   . TYR A 1 76  ? -1.744  7.933   -8.893  1.00 0.00 ? 783 TYR A CB   5  
ATOM 8740  C CG   . TYR A 1 76  ? -2.463  7.034   -9.878  1.00 0.00 ? 783 TYR A CG   5  
ATOM 8741  C CD1  . TYR A 1 76  ? -1.928  5.826   -10.296 1.00 0.00 ? 783 TYR A CD1  5  
ATOM 8742  C CD2  . TYR A 1 76  ? -3.710  7.397   -10.363 1.00 0.00 ? 783 TYR A CD2  5  
ATOM 8743  C CE1  . TYR A 1 76  ? -2.608  5.011   -11.166 1.00 0.00 ? 783 TYR A CE1  5  
ATOM 8744  C CE2  . TYR A 1 76  ? -4.400  6.586   -11.228 1.00 0.00 ? 783 TYR A CE2  5  
ATOM 8745  C CZ   . TYR A 1 76  ? -3.848  5.394   -11.626 1.00 0.00 ? 783 TYR A CZ   5  
ATOM 8746  O OH   . TYR A 1 76  ? -4.538  4.577   -12.490 1.00 0.00 ? 783 TYR A OH   5  
ATOM 8747  H H    . TYR A 1 76  ? 0.310   6.400   -8.774  1.00 0.00 ? 783 TYR A H    5  
ATOM 8748  H HA   . TYR A 1 76  ? -0.315  8.796   -10.233 1.00 0.00 ? 783 TYR A HA   5  
ATOM 8749  H HB2  . TYR A 1 76  ? -1.710  7.399   -7.956  1.00 0.00 ? 783 TYR A HB2  5  
ATOM 8750  H HB3  . TYR A 1 76  ? -2.340  8.821   -8.751  1.00 0.00 ? 783 TYR A HB3  5  
ATOM 8751  H HD1  . TYR A 1 76  ? -0.954  5.529   -9.936  1.00 0.00 ? 783 TYR A HD1  5  
ATOM 8752  H HD2  . TYR A 1 76  ? -4.144  8.334   -10.049 1.00 0.00 ? 783 TYR A HD2  5  
ATOM 8753  H HE1  . TYR A 1 76  ? -2.174  4.072   -11.472 1.00 0.00 ? 783 TYR A HE1  5  
ATOM 8754  H HE2  . TYR A 1 76  ? -5.369  6.891   -11.586 1.00 0.00 ? 783 TYR A HE2  5  
ATOM 8755  H HH   . TYR A 1 76  ? -4.980  5.136   -13.139 1.00 0.00 ? 783 TYR A HH   5  
ATOM 8756  N N    . ASP A 1 77  ? 0.266   8.968   -7.015  1.00 0.00 ? 784 ASP A N    5  
ATOM 8757  C CA   . ASP A 1 77  ? 0.508   9.873   -5.910  1.00 0.00 ? 784 ASP A CA   5  
ATOM 8758  C C    . ASP A 1 77  ? 1.956   10.026  -5.599  1.00 0.00 ? 784 ASP A C    5  
ATOM 8759  O O    . ASP A 1 77  ? 2.419   11.137  -5.339  1.00 0.00 ? 784 ASP A O    5  
ATOM 8760  C CB   . ASP A 1 77  ? -0.281  9.441   -4.690  1.00 0.00 ? 784 ASP A CB   5  
ATOM 8761  C CG   . ASP A 1 77  ? -1.756  9.557   -4.944  1.00 0.00 ? 784 ASP A CG   5  
ATOM 8762  O OD1  . ASP A 1 77  ? -2.280  10.692  -4.923  1.00 0.00 ? 784 ASP A OD1  5  
ATOM 8763  O OD2  . ASP A 1 77  ? -2.396  8.541   -5.234  1.00 0.00 ? 784 ASP A OD2  5  
ATOM 8764  H H    . ASP A 1 77  ? 0.209   7.999   -6.862  1.00 0.00 ? 784 ASP A H    5  
ATOM 8765  H HA   . ASP A 1 77  ? 0.138   10.841  -6.214  1.00 0.00 ? 784 ASP A HA   5  
ATOM 8766  H HB2  . ASP A 1 77  ? -0.044  8.407   -4.480  1.00 0.00 ? 784 ASP A HB2  5  
ATOM 8767  H HB3  . ASP A 1 77  ? -0.018  10.059  -3.845  1.00 0.00 ? 784 ASP A HB3  5  
ATOM 8768  N N    . HIS A 1 78  ? 2.668   8.908   -5.584  1.00 0.00 ? 785 HIS A N    5  
ATOM 8769  C CA   . HIS A 1 78  ? 4.113   8.882   -5.364  1.00 0.00 ? 785 HIS A CA   5  
ATOM 8770  C C    . HIS A 1 78  ? 4.458   9.412   -3.946  1.00 0.00 ? 785 HIS A C    5  
ATOM 8771  O O    . HIS A 1 78  ? 5.537   9.942   -3.693  1.00 0.00 ? 785 HIS A O    5  
ATOM 8772  C CB   . HIS A 1 78  ? 4.835   9.675   -6.491  1.00 0.00 ? 785 HIS A CB   5  
ATOM 8773  C CG   . HIS A 1 78  ? 6.322   9.481   -6.545  1.00 0.00 ? 785 HIS A CG   5  
ATOM 8774  N ND1  . HIS A 1 78  ? 7.236   10.506  -6.512  1.00 0.00 ? 785 HIS A ND1  5  
ATOM 8775  C CD2  . HIS A 1 78  ? 7.040   8.347   -6.680  1.00 0.00 ? 785 HIS A CD2  5  
ATOM 8776  C CE1  . HIS A 1 78  ? 8.450   9.979   -6.628  1.00 0.00 ? 785 HIS A CE1  5  
ATOM 8777  N NE2  . HIS A 1 78  ? 8.390   8.662   -6.733  1.00 0.00 ? 785 HIS A NE2  5  
ATOM 8778  H H    . HIS A 1 78  ? 2.209   8.052   -5.719  1.00 0.00 ? 785 HIS A H    5  
ATOM 8779  H HA   . HIS A 1 78  ? 4.418   7.846   -5.411  1.00 0.00 ? 785 HIS A HA   5  
ATOM 8780  H HB2  . HIS A 1 78  ? 4.435   9.371   -7.447  1.00 0.00 ? 785 HIS A HB2  5  
ATOM 8781  H HB3  . HIS A 1 78  ? 4.637   10.728  -6.352  1.00 0.00 ? 785 HIS A HB3  5  
ATOM 8782  H HD1  . HIS A 1 78  ? 7.042   11.463  -6.396  1.00 0.00 ? 785 HIS A HD1  5  
ATOM 8783  H HD2  . HIS A 1 78  ? 6.631   7.350   -6.740  1.00 0.00 ? 785 HIS A HD2  5  
ATOM 8784  H HE1  . HIS A 1 78  ? 9.368   10.548  -6.638  1.00 0.00 ? 785 HIS A HE1  5  
ATOM 8785  N N    . VAL A 1 79  ? 3.544   9.198   -3.002  1.00 0.00 ? 786 VAL A N    5  
ATOM 8786  C CA   . VAL A 1 79  ? 3.782   9.594   -1.603  1.00 0.00 ? 786 VAL A CA   5  
ATOM 8787  C C    . VAL A 1 79  ? 4.604   8.525   -0.894  1.00 0.00 ? 786 VAL A C    5  
ATOM 8788  O O    . VAL A 1 79  ? 4.872   8.603   0.301   1.00 0.00 ? 786 VAL A O    5  
ATOM 8789  C CB   . VAL A 1 79  ? 2.468   9.858   -0.797  1.00 0.00 ? 786 VAL A CB   5  
ATOM 8790  C CG1  . VAL A 1 79  ? 1.663   10.979  -1.402  1.00 0.00 ? 786 VAL A CG1  5  
ATOM 8791  C CG2  . VAL A 1 79  ? 1.615   8.610   -0.671  1.00 0.00 ? 786 VAL A CG2  5  
ATOM 8792  H H    . VAL A 1 79  ? 2.697   8.778   -3.256  1.00 0.00 ? 786 VAL A H    5  
ATOM 8793  H HA   . VAL A 1 79  ? 4.371   10.499  -1.630  1.00 0.00 ? 786 VAL A HA   5  
ATOM 8794  H HB   . VAL A 1 79  ? 2.755   10.169  0.197   1.00 0.00 ? 786 VAL A HB   5  
ATOM 8795  H HG11 . VAL A 1 79  ? 0.751   11.076  -0.832  1.00 0.00 ? 786 VAL A HG11 5  
ATOM 8796  H HG12 . VAL A 1 79  ? 1.435   10.740  -2.430  1.00 0.00 ? 786 VAL A HG12 5  
ATOM 8797  H HG13 . VAL A 1 79  ? 2.223   11.900  -1.351  1.00 0.00 ? 786 VAL A HG13 5  
ATOM 8798  H HG21 . VAL A 1 79  ? 2.177   7.847   -0.152  1.00 0.00 ? 786 VAL A HG21 5  
ATOM 8799  H HG22 . VAL A 1 79  ? 1.346   8.258   -1.657  1.00 0.00 ? 786 VAL A HG22 5  
ATOM 8800  H HG23 . VAL A 1 79  ? 0.722   8.842   -0.109  1.00 0.00 ? 786 VAL A HG23 5  
ATOM 8801  N N    . LEU A 1 80  ? 4.990   7.536   -1.649  1.00 0.00 ? 787 LEU A N    5  
ATOM 8802  C CA   . LEU A 1 80  ? 5.775   6.470   -1.154  1.00 0.00 ? 787 LEU A CA   5  
ATOM 8803  C C    . LEU A 1 80  ? 7.222   6.793   -1.448  1.00 0.00 ? 787 LEU A C    5  
ATOM 8804  O O    . LEU A 1 80  ? 7.589   7.126   -2.588  1.00 0.00 ? 787 LEU A O    5  
ATOM 8805  C CB   . LEU A 1 80  ? 5.352   5.173   -1.825  1.00 0.00 ? 787 LEU A CB   5  
ATOM 8806  C CG   . LEU A 1 80  ? 5.881   3.871   -1.222  1.00 0.00 ? 787 LEU A CG   5  
ATOM 8807  C CD1  . LEU A 1 80  ? 5.431   3.717   0.208   1.00 0.00 ? 787 LEU A CD1  5  
ATOM 8808  C CD2  . LEU A 1 80  ? 5.391   2.700   -2.019  1.00 0.00 ? 787 LEU A CD2  5  
ATOM 8809  H H    . LEU A 1 80  ? 4.758   7.552   -2.599  1.00 0.00 ? 787 LEU A H    5  
ATOM 8810  H HA   . LEU A 1 80  ? 5.622   6.395   -0.088  1.00 0.00 ? 787 LEU A HA   5  
ATOM 8811  H HB2  . LEU A 1 80  ? 4.276   5.144   -1.789  1.00 0.00 ? 787 LEU A HB2  5  
ATOM 8812  H HB3  . LEU A 1 80  ? 5.662   5.218   -2.858  1.00 0.00 ? 787 LEU A HB3  5  
ATOM 8813  H HG   . LEU A 1 80  ? 6.960   3.868   -1.251  1.00 0.00 ? 787 LEU A HG   5  
ATOM 8814  H HD11 . LEU A 1 80  ? 4.353   3.759   0.253   1.00 0.00 ? 787 LEU A HD11 5  
ATOM 8815  H HD12 . LEU A 1 80  ? 5.856   4.504   0.813   1.00 0.00 ? 787 LEU A HD12 5  
ATOM 8816  H HD13 . LEU A 1 80  ? 5.764   2.761   0.584   1.00 0.00 ? 787 LEU A HD13 5  
ATOM 8817  H HD21 . LEU A 1 80  ? 5.822   2.715   -3.008  1.00 0.00 ? 787 LEU A HD21 5  
ATOM 8818  H HD22 . LEU A 1 80  ? 4.315   2.750   -2.093  1.00 0.00 ? 787 LEU A HD22 5  
ATOM 8819  H HD23 . LEU A 1 80  ? 5.663   1.789   -1.507  1.00 0.00 ? 787 LEU A HD23 5  
ATOM 8820  N N    . ILE A 1 81  ? 8.015   6.712   -0.444  1.00 0.00 ? 788 ILE A N    5  
ATOM 8821  C CA   . ILE A 1 81  ? 9.381   7.047   -0.504  1.00 0.00 ? 788 ILE A CA   5  
ATOM 8822  C C    . ILE A 1 81  ? 10.124  5.802   -0.875  1.00 0.00 ? 788 ILE A C    5  
ATOM 8823  O O    . ILE A 1 81  ? 10.064  4.801   -0.156  1.00 0.00 ? 788 ILE A O    5  
ATOM 8824  C CB   . ILE A 1 81  ? 9.860   7.504   0.886   1.00 0.00 ? 788 ILE A CB   5  
ATOM 8825  C CG1  . ILE A 1 81  ? 8.997   8.659   1.415   1.00 0.00 ? 788 ILE A CG1  5  
ATOM 8826  C CG2  . ILE A 1 81  ? 11.340  7.893   0.864   1.00 0.00 ? 788 ILE A CG2  5  
ATOM 8827  C CD1  . ILE A 1 81  ? 9.230   8.963   2.881   1.00 0.00 ? 788 ILE A CD1  5  
ATOM 8828  H H    . ILE A 1 81  ? 7.709   6.344   0.417   1.00 0.00 ? 788 ILE A H    5  
ATOM 8829  H HA   . ILE A 1 81  ? 9.541   7.844   -1.208  1.00 0.00 ? 788 ILE A HA   5  
ATOM 8830  H HB   . ILE A 1 81  ? 9.720   6.650   1.526   1.00 0.00 ? 788 ILE A HB   5  
ATOM 8831  H HG12 . ILE A 1 81  ? 9.224   9.553   0.853   1.00 0.00 ? 788 ILE A HG12 5  
ATOM 8832  H HG13 . ILE A 1 81  ? 7.953   8.414   1.287   1.00 0.00 ? 788 ILE A HG13 5  
ATOM 8833  H HG21 . ILE A 1 81  ? 11.643  8.206   1.853   1.00 0.00 ? 788 ILE A HG21 5  
ATOM 8834  H HG22 . ILE A 1 81  ? 11.488  8.705   0.168   1.00 0.00 ? 788 ILE A HG22 5  
ATOM 8835  H HG23 . ILE A 1 81  ? 11.932  7.042   0.560   1.00 0.00 ? 788 ILE A HG23 5  
ATOM 8836  H HD11 . ILE A 1 81  ? 10.259  9.250   3.033   1.00 0.00 ? 788 ILE A HD11 5  
ATOM 8837  H HD12 . ILE A 1 81  ? 9.018   8.070   3.454   1.00 0.00 ? 788 ILE A HD12 5  
ATOM 8838  H HD13 . ILE A 1 81  ? 8.573   9.760   3.197   1.00 0.00 ? 788 ILE A HD13 5  
ATOM 8839  N N    . GLU A 1 82  ? 10.755  5.822   -1.991  1.00 0.00 ? 789 GLU A N    5  
ATOM 8840  C CA   . GLU A 1 82  ? 11.537  4.711   -2.392  1.00 0.00 ? 789 GLU A CA   5  
ATOM 8841  C C    . GLU A 1 82  ? 12.988  5.040   -2.255  1.00 0.00 ? 789 GLU A C    5  
ATOM 8842  O O    . GLU A 1 82  ? 13.425  6.149   -2.603  1.00 0.00 ? 789 GLU A O    5  
ATOM 8843  C CB   . GLU A 1 82  ? 11.204  4.239   -3.805  1.00 0.00 ? 789 GLU A CB   5  
ATOM 8844  C CG   . GLU A 1 82  ? 11.274  5.297   -4.873  1.00 0.00 ? 789 GLU A CG   5  
ATOM 8845  C CD   . GLU A 1 82  ? 11.076  4.706   -6.240  1.00 0.00 ? 789 GLU A CD   5  
ATOM 8846  O OE1  . GLU A 1 82  ? 9.944   4.326   -6.568  1.00 0.00 ? 789 GLU A OE1  5  
ATOM 8847  O OE2  . GLU A 1 82  ? 12.058  4.587   -7.013  1.00 0.00 ? 789 GLU A OE2  5  
ATOM 8848  H H    . GLU A 1 82  ? 10.722  6.621   -2.556  1.00 0.00 ? 789 GLU A H    5  
ATOM 8849  H HA   . GLU A 1 82  ? 11.314  3.913   -1.700  1.00 0.00 ? 789 GLU A HA   5  
ATOM 8850  H HB2  . GLU A 1 82  ? 11.896  3.457   -4.077  1.00 0.00 ? 789 GLU A HB2  5  
ATOM 8851  H HB3  . GLU A 1 82  ? 10.205  3.829   -3.805  1.00 0.00 ? 789 GLU A HB3  5  
ATOM 8852  H HG2  . GLU A 1 82  ? 10.495  6.018   -4.671  1.00 0.00 ? 789 GLU A HG2  5  
ATOM 8853  H HG3  . GLU A 1 82  ? 12.240  5.777   -4.823  1.00 0.00 ? 789 GLU A HG3  5  
ATOM 8854  N N    . LEU A 1 83  ? 13.703  4.127   -1.698  1.00 0.00 ? 790 LEU A N    5  
ATOM 8855  C CA   . LEU A 1 83  ? 15.093  4.242   -1.529  1.00 0.00 ? 790 LEU A CA   5  
ATOM 8856  C C    . LEU A 1 83  ? 15.705  3.075   -2.227  1.00 0.00 ? 790 LEU A C    5  
ATOM 8857  O O    . LEU A 1 83  ? 15.212  1.938   -2.100  1.00 0.00 ? 790 LEU A O    5  
ATOM 8858  C CB   . LEU A 1 83  ? 15.477  4.205   -0.042  1.00 0.00 ? 790 LEU A CB   5  
ATOM 8859  C CG   . LEU A 1 83  ? 14.887  5.300   0.859   1.00 0.00 ? 790 LEU A CG   5  
ATOM 8860  C CD1  . LEU A 1 83  ? 15.296  5.067   2.304   1.00 0.00 ? 790 LEU A CD1  5  
ATOM 8861  C CD2  . LEU A 1 83  ? 15.339  6.683   0.404   1.00 0.00 ? 790 LEU A CD2  5  
ATOM 8862  H H    . LEU A 1 83  ? 13.291  3.293   -1.384  1.00 0.00 ? 790 LEU A H    5  
ATOM 8863  H HA   . LEU A 1 83  ? 15.428  5.168   -1.969  1.00 0.00 ? 790 LEU A HA   5  
ATOM 8864  H HB2  . LEU A 1 83  ? 15.177  3.245   0.352   1.00 0.00 ? 790 LEU A HB2  5  
ATOM 8865  H HB3  . LEU A 1 83  ? 16.554  4.262   0.013   1.00 0.00 ? 790 LEU A HB3  5  
ATOM 8866  H HG   . LEU A 1 83  ? 13.809  5.257   0.806   1.00 0.00 ? 790 LEU A HG   5  
ATOM 8867  H HD11 . LEU A 1 83  ? 14.932  4.104   2.631   1.00 0.00 ? 790 LEU A HD11 5  
ATOM 8868  H HD12 . LEU A 1 83  ? 14.873  5.841   2.926   1.00 0.00 ? 790 LEU A HD12 5  
ATOM 8869  H HD13 . LEU A 1 83  ? 16.372  5.088   2.384   1.00 0.00 ? 790 LEU A HD13 5  
ATOM 8870  H HD21 . LEU A 1 83  ? 14.920  7.433   1.060   1.00 0.00 ? 790 LEU A HD21 5  
ATOM 8871  H HD22 . LEU A 1 83  ? 14.996  6.864   -0.604  1.00 0.00 ? 790 LEU A HD22 5  
ATOM 8872  H HD23 . LEU A 1 83  ? 16.417  6.741   0.433   1.00 0.00 ? 790 LEU A HD23 5  
ATOM 8873  N N    . THR A 1 84  ? 16.698  3.329   -2.986  1.00 0.00 ? 791 THR A N    5  
ATOM 8874  C CA   . THR A 1 84  ? 17.398  2.283   -3.640  1.00 0.00 ? 791 THR A CA   5  
ATOM 8875  C C    . THR A 1 84  ? 18.422  1.725   -2.651  1.00 0.00 ? 791 THR A C    5  
ATOM 8876  O O    . THR A 1 84  ? 18.604  2.293   -1.565  1.00 0.00 ? 791 THR A O    5  
ATOM 8877  C CB   . THR A 1 84  ? 18.045  2.792   -4.962  1.00 0.00 ? 791 THR A CB   5  
ATOM 8878  O OG1  . THR A 1 84  ? 18.630  1.711   -5.703  1.00 0.00 ? 791 THR A OG1  5  
ATOM 8879  C CG2  . THR A 1 84  ? 19.080  3.865   -4.684  1.00 0.00 ? 791 THR A CG2  5  
ATOM 8880  H H    . THR A 1 84  ? 16.979  4.262   -3.108  1.00 0.00 ? 791 THR A H    5  
ATOM 8881  H HA   . THR A 1 84  ? 16.718  1.475   -3.856  1.00 0.00 ? 791 THR A HA   5  
ATOM 8882  H HB   . THR A 1 84  ? 17.260  3.220   -5.567  1.00 0.00 ? 791 THR A HB   5  
ATOM 8883  H HG1  . THR A 1 84  ? 19.599  1.734   -5.586  1.00 0.00 ? 791 THR A HG1  5  
ATOM 8884  H HG21 . THR A 1 84  ? 19.872  3.445   -4.082  1.00 0.00 ? 791 THR A HG21 5  
ATOM 8885  H HG22 . THR A 1 84  ? 18.586  4.643   -4.119  1.00 0.00 ? 791 THR A HG22 5  
ATOM 8886  H HG23 . THR A 1 84  ? 19.471  4.260   -5.609  1.00 0.00 ? 791 THR A HG23 5  
ATOM 8887  N N    . GLN A 1 85  ? 19.075  0.646   -3.018  1.00 0.00 ? 792 GLN A N    5  
ATOM 8888  C CA   . GLN A 1 85  ? 20.039  -0.060  -2.167  1.00 0.00 ? 792 GLN A CA   5  
ATOM 8889  C C    . GLN A 1 85  ? 21.102  0.898   -1.603  1.00 0.00 ? 792 GLN A C    5  
ATOM 8890  O O    . GLN A 1 85  ? 21.502  0.802   -0.438  1.00 0.00 ? 792 GLN A O    5  
ATOM 8891  C CB   . GLN A 1 85  ? 20.682  -1.199  -2.987  1.00 0.00 ? 792 GLN A CB   5  
ATOM 8892  C CG   . GLN A 1 85  ? 21.774  -1.997  -2.285  1.00 0.00 ? 792 GLN A CG   5  
ATOM 8893  C CD   . GLN A 1 85  ? 21.312  -2.645  -1.007  1.00 0.00 ? 792 GLN A CD   5  
ATOM 8894  O OE1  . GLN A 1 85  ? 20.808  -3.755  -1.008  1.00 0.00 ? 792 GLN A OE1  5  
ATOM 8895  N NE2  . GLN A 1 85  ? 21.494  -1.975  0.085   1.00 0.00 ? 792 GLN A NE2  5  
ATOM 8896  H H    . GLN A 1 85  ? 18.926  0.330   -3.934  1.00 0.00 ? 792 GLN A H    5  
ATOM 8897  H HA   . GLN A 1 85  ? 19.497  -0.495  -1.341  1.00 0.00 ? 792 GLN A HA   5  
ATOM 8898  H HB2  . GLN A 1 85  ? 19.906  -1.891  -3.276  1.00 0.00 ? 792 GLN A HB2  5  
ATOM 8899  H HB3  . GLN A 1 85  ? 21.100  -0.767  -3.885  1.00 0.00 ? 792 GLN A HB3  5  
ATOM 8900  H HG2  . GLN A 1 85  ? 22.128  -2.772  -2.948  1.00 0.00 ? 792 GLN A HG2  5  
ATOM 8901  H HG3  . GLN A 1 85  ? 22.588  -1.328  -2.051  1.00 0.00 ? 792 GLN A HG3  5  
ATOM 8902  H HE21 . GLN A 1 85  ? 21.911  -1.085  0.034   1.00 0.00 ? 792 GLN A HE21 5  
ATOM 8903  H HE22 . GLN A 1 85  ? 21.219  -2.396  0.929   1.00 0.00 ? 792 GLN A HE22 5  
ATOM 8904  N N    . ALA A 1 86  ? 21.497  1.829   -2.408  1.00 0.00 ? 793 ALA A N    5  
ATOM 8905  C CA   . ALA A 1 86  ? 22.503  2.803   -2.043  1.00 0.00 ? 793 ALA A CA   5  
ATOM 8906  C C    . ALA A 1 86  ? 21.950  3.916   -1.153  1.00 0.00 ? 793 ALA A C    5  
ATOM 8907  O O    . ALA A 1 86  ? 22.656  4.455   -0.300  1.00 0.00 ? 793 ALA A O    5  
ATOM 8908  C CB   . ALA A 1 86  ? 23.054  3.398   -3.288  1.00 0.00 ? 793 ALA A CB   5  
ATOM 8909  H H    . ALA A 1 86  ? 21.113  1.832   -3.321  1.00 0.00 ? 793 ALA A H    5  
ATOM 8910  H HA   . ALA A 1 86  ? 23.311  2.299   -1.533  1.00 0.00 ? 793 ALA A HA   5  
ATOM 8911  H HB1  . ALA A 1 86  ? 23.821  4.116   -3.042  1.00 0.00 ? 793 ALA A HB1  5  
ATOM 8912  H HB2  . ALA A 1 86  ? 22.226  3.871   -3.799  1.00 0.00 ? 793 ALA A HB2  5  
ATOM 8913  H HB3  . ALA A 1 86  ? 23.452  2.599   -3.894  1.00 0.00 ? 793 ALA A HB3  5  
ATOM 8914  N N    . GLY A 1 87  ? 20.683  4.216   -1.311  1.00 0.00 ? 794 GLY A N    5  
ATOM 8915  C CA   . GLY A 1 87  ? 20.092  5.346   -0.614  1.00 0.00 ? 794 GLY A CA   5  
ATOM 8916  C C    . GLY A 1 87  ? 19.578  4.999   0.764   1.00 0.00 ? 794 GLY A C    5  
ATOM 8917  O O    . GLY A 1 87  ? 19.001  5.847   1.443   1.00 0.00 ? 794 GLY A O    5  
ATOM 8918  H H    . GLY A 1 87  ? 20.126  3.653   -1.890  1.00 0.00 ? 794 GLY A H    5  
ATOM 8919  H HA2  . GLY A 1 87  ? 20.837  6.121   -0.516  1.00 0.00 ? 794 GLY A HA2  5  
ATOM 8920  H HA3  . GLY A 1 87  ? 19.273  5.728   -1.206  1.00 0.00 ? 794 GLY A HA3  5  
ATOM 8921  N N    . LEU A 1 88  ? 19.802  3.766   1.181   1.00 0.00 ? 795 LEU A N    5  
ATOM 8922  C CA   . LEU A 1 88  ? 19.325  3.277   2.470   1.00 0.00 ? 795 LEU A CA   5  
ATOM 8923  C C    . LEU A 1 88  ? 20.033  3.970   3.625   1.00 0.00 ? 795 LEU A C    5  
ATOM 8924  O O    . LEU A 1 88  ? 19.429  4.774   4.337   1.00 0.00 ? 795 LEU A O    5  
ATOM 8925  C CB   . LEU A 1 88  ? 19.486  1.762   2.560   1.00 0.00 ? 795 LEU A CB   5  
ATOM 8926  C CG   . LEU A 1 88  ? 18.822  0.968   1.441   1.00 0.00 ? 795 LEU A CG   5  
ATOM 8927  C CD1  . LEU A 1 88  ? 18.995  -0.513  1.649   1.00 0.00 ? 795 LEU A CD1  5  
ATOM 8928  C CD2  . LEU A 1 88  ? 17.361  1.334   1.306   1.00 0.00 ? 795 LEU A CD2  5  
ATOM 8929  H H    . LEU A 1 88  ? 20.298  3.166   0.583   1.00 0.00 ? 795 LEU A H    5  
ATOM 8930  H HA   . LEU A 1 88  ? 18.274  3.518   2.537   1.00 0.00 ? 795 LEU A HA   5  
ATOM 8931  H HB2  . LEU A 1 88  ? 20.542  1.539   2.551   1.00 0.00 ? 795 LEU A HB2  5  
ATOM 8932  H HB3  . LEU A 1 88  ? 19.069  1.430   3.500   1.00 0.00 ? 795 LEU A HB3  5  
ATOM 8933  H HG   . LEU A 1 88  ? 19.314  1.219   0.513   1.00 0.00 ? 795 LEU A HG   5  
ATOM 8934  H HD11 . LEU A 1 88  ? 18.550  -0.805  2.587   1.00 0.00 ? 795 LEU A HD11 5  
ATOM 8935  H HD12 . LEU A 1 88  ? 20.050  -0.743  1.649   1.00 0.00 ? 795 LEU A HD12 5  
ATOM 8936  H HD13 . LEU A 1 88  ? 18.515  -1.040  0.837   1.00 0.00 ? 795 LEU A HD13 5  
ATOM 8937  H HD21 . LEU A 1 88  ? 17.300  2.379   1.036   1.00 0.00 ? 795 LEU A HD21 5  
ATOM 8938  H HD22 . LEU A 1 88  ? 16.842  1.159   2.236   1.00 0.00 ? 795 LEU A HD22 5  
ATOM 8939  H HD23 . LEU A 1 88  ? 16.924  0.741   0.516   1.00 0.00 ? 795 LEU A HD23 5  
ATOM 8940  N N    . LYS A 1 89  ? 21.302  3.658   3.817   1.00 0.00 ? 796 LYS A N    5  
ATOM 8941  C CA   . LYS A 1 89  ? 22.079  4.329   4.839   1.00 0.00 ? 796 LYS A CA   5  
ATOM 8942  C C    . LYS A 1 89  ? 22.664  5.608   4.250   1.00 0.00 ? 796 LYS A C    5  
ATOM 8943  O O    . LYS A 1 89  ? 22.783  6.633   4.923   1.00 0.00 ? 796 LYS A O    5  
ATOM 8944  C CB   . LYS A 1 89  ? 23.189  3.408   5.390   1.00 0.00 ? 796 LYS A CB   5  
ATOM 8945  C CG   . LYS A 1 89  ? 23.986  3.985   6.570   1.00 0.00 ? 796 LYS A CG   5  
ATOM 8946  C CD   . LYS A 1 89  ? 23.080  4.297   7.761   1.00 0.00 ? 796 LYS A CD   5  
ATOM 8947  C CE   . LYS A 1 89  ? 23.858  4.877   8.944   1.00 0.00 ? 796 LYS A CE   5  
ATOM 8948  N NZ   . LYS A 1 89  ? 24.776  3.895   9.560   1.00 0.00 ? 796 LYS A NZ   5  
ATOM 8949  H H    . LYS A 1 89  ? 21.715  2.938   3.295   1.00 0.00 ? 796 LYS A H    5  
ATOM 8950  H HA   . LYS A 1 89  ? 21.396  4.592   5.633   1.00 0.00 ? 796 LYS A HA   5  
ATOM 8951  H HB2  . LYS A 1 89  ? 22.747  2.475   5.707   1.00 0.00 ? 796 LYS A HB2  5  
ATOM 8952  H HB3  . LYS A 1 89  ? 23.880  3.203   4.586   1.00 0.00 ? 796 LYS A HB3  5  
ATOM 8953  H HG2  . LYS A 1 89  ? 24.735  3.271   6.876   1.00 0.00 ? 796 LYS A HG2  5  
ATOM 8954  H HG3  . LYS A 1 89  ? 24.471  4.895   6.250   1.00 0.00 ? 796 LYS A HG3  5  
ATOM 8955  H HD2  . LYS A 1 89  ? 22.330  5.010   7.457   1.00 0.00 ? 796 LYS A HD2  5  
ATOM 8956  H HD3  . LYS A 1 89  ? 22.599  3.382   8.073   1.00 0.00 ? 796 LYS A HD3  5  
ATOM 8957  H HE2  . LYS A 1 89  ? 24.439  5.718   8.596   1.00 0.00 ? 796 LYS A HE2  5  
ATOM 8958  H HE3  . LYS A 1 89  ? 23.153  5.218   9.687   1.00 0.00 ? 796 LYS A HE3  5  
ATOM 8959  H HZ1  . LYS A 1 89  ? 24.244  3.088   9.942   1.00 0.00 ? 796 LYS A HZ1  5  
ATOM 8960  H HZ2  . LYS A 1 89  ? 25.297  4.317   10.356  1.00 0.00 ? 796 LYS A HZ2  5  
ATOM 8961  H HZ3  . LYS A 1 89  ? 25.475  3.534   8.880   1.00 0.00 ? 796 LYS A HZ3  5  
ATOM 8962  N N    . GLY A 1 90  ? 23.000  5.552   2.981   1.00 0.00 ? 797 GLY A N    5  
ATOM 8963  C CA   . GLY A 1 90  ? 23.537  6.702   2.304   1.00 0.00 ? 797 GLY A CA   5  
ATOM 8964  C C    . GLY A 1 90  ? 22.444  7.545   1.693   1.00 0.00 ? 797 GLY A C    5  
ATOM 8965  O O    . GLY A 1 90  ? 22.379  7.708   0.466   1.00 0.00 ? 797 GLY A O    5  
ATOM 8966  H H    . GLY A 1 90  ? 22.896  4.714   2.485   1.00 0.00 ? 797 GLY A H    5  
ATOM 8967  H HA2  . GLY A 1 90  ? 24.089  7.299   3.013   1.00 0.00 ? 797 GLY A HA2  5  
ATOM 8968  H HA3  . GLY A 1 90  ? 24.205  6.377   1.520   1.00 0.00 ? 797 GLY A HA3  5  
ATOM 8969  N N    . SER A 1 91  ? 21.584  8.081   2.539   1.00 0.00 ? 798 SER A N    5  
ATOM 8970  C CA   . SER A 1 91  ? 20.473  8.913   2.109   1.00 0.00 ? 798 SER A CA   5  
ATOM 8971  C C    . SER A 1 91  ? 20.957  10.348  1.818   1.00 0.00 ? 798 SER A C    5  
ATOM 8972  O O    . SER A 1 91  ? 20.532  11.308  2.460   1.00 0.00 ? 798 SER A O    5  
ATOM 8973  C CB   . SER A 1 91  ? 19.395  8.925   3.199   1.00 0.00 ? 798 SER A CB   5  
ATOM 8974  O OG   . SER A 1 91  ? 19.038  7.595   3.583   1.00 0.00 ? 798 SER A OG   5  
ATOM 8975  H H    . SER A 1 91  ? 21.700  7.907   3.499   1.00 0.00 ? 798 SER A H    5  
ATOM 8976  H HA   . SER A 1 91  ? 20.060  8.484   1.209   1.00 0.00 ? 798 SER A HA   5  
ATOM 8977  H HB2  . SER A 1 91  ? 19.767  9.447   4.067   1.00 0.00 ? 798 SER A HB2  5  
ATOM 8978  H HB3  . SER A 1 91  ? 18.514  9.428   2.829   1.00 0.00 ? 798 SER A HB3  5  
ATOM 8979  H HG   . SER A 1 91  ? 19.094  7.021   2.801   1.00 0.00 ? 798 SER A HG   5  
ATOM 8980  N N    . THR A 1 92  ? 21.870  10.468  0.891   1.00 0.00 ? 799 THR A N    5  
ATOM 8981  C CA   . THR A 1 92  ? 22.421  11.740  0.506   1.00 0.00 ? 799 THR A CA   5  
ATOM 8982  C C    . THR A 1 92  ? 21.503  12.400  -0.523  1.00 0.00 ? 799 THR A C    5  
ATOM 8983  O O    . THR A 1 92  ? 21.034  13.523  -0.340  1.00 0.00 ? 799 THR A O    5  
ATOM 8984  C CB   . THR A 1 92  ? 23.823  11.511  -0.090  1.00 0.00 ? 799 THR A CB   5  
ATOM 8985  O OG1  . THR A 1 92  ? 24.577  10.718  0.831   1.00 0.00 ? 799 THR A OG1  5  
ATOM 8986  C CG2  . THR A 1 92  ? 24.550  12.825  -0.324  1.00 0.00 ? 799 THR A CG2  5  
ATOM 8987  H H    . THR A 1 92  ? 22.202  9.653   0.454   1.00 0.00 ? 799 THR A H    5  
ATOM 8988  H HA   . THR A 1 92  ? 22.509  12.367  1.381   1.00 0.00 ? 799 THR A HA   5  
ATOM 8989  H HB   . THR A 1 92  ? 23.726  10.977  -1.023  1.00 0.00 ? 799 THR A HB   5  
ATOM 8990  H HG1  . THR A 1 92  ? 24.593  11.219  1.658   1.00 0.00 ? 799 THR A HG1  5  
ATOM 8991  H HG21 . THR A 1 92  ? 23.986  13.423  -1.023  1.00 0.00 ? 799 THR A HG21 5  
ATOM 8992  H HG22 . THR A 1 92  ? 25.533  12.627  -0.724  1.00 0.00 ? 799 THR A HG22 5  
ATOM 8993  H HG23 . THR A 1 92  ? 24.641  13.356  0.613   1.00 0.00 ? 799 THR A HG23 5  
ATOM 8994  N N    . GLU A 1 93  ? 21.227  11.671  -1.570  1.00 0.00 ? 800 GLU A N    5  
ATOM 8995  C CA   . GLU A 1 93  ? 20.390  12.099  -2.634  1.00 0.00 ? 800 GLU A CA   5  
ATOM 8996  C C    . GLU A 1 93  ? 19.995  10.834  -3.354  1.00 0.00 ? 800 GLU A C    5  
ATOM 8997  O O    . GLU A 1 93  ? 20.617  9.790   -3.104  1.00 0.00 ? 800 GLU A O    5  
ATOM 8998  C CB   . GLU A 1 93  ? 21.166  13.045  -3.571  1.00 0.00 ? 800 GLU A CB   5  
ATOM 8999  C CG   . GLU A 1 93  ? 20.326  13.643  -4.679  1.00 0.00 ? 800 GLU A CG   5  
ATOM 9000  C CD   . GLU A 1 93  ? 21.118  14.495  -5.620  1.00 0.00 ? 800 GLU A CD   5  
ATOM 9001  O OE1  . GLU A 1 93  ? 21.842  13.936  -6.474  1.00 0.00 ? 800 GLU A OE1  5  
ATOM 9002  O OE2  . GLU A 1 93  ? 21.011  15.727  -5.556  1.00 0.00 ? 800 GLU A OE2  5  
ATOM 9003  H H    . GLU A 1 93  ? 21.573  10.759  -1.677  1.00 0.00 ? 800 GLU A H    5  
ATOM 9004  H HA   . GLU A 1 93  ? 19.519  12.592  -2.230  1.00 0.00 ? 800 GLU A HA   5  
ATOM 9005  H HB2  . GLU A 1 93  ? 21.573  13.856  -2.985  1.00 0.00 ? 800 GLU A HB2  5  
ATOM 9006  H HB3  . GLU A 1 93  ? 21.981  12.496  -4.020  1.00 0.00 ? 800 GLU A HB3  5  
ATOM 9007  H HG2  . GLU A 1 93  ? 19.879  12.832  -5.234  1.00 0.00 ? 800 GLU A HG2  5  
ATOM 9008  H HG3  . GLU A 1 93  ? 19.548  14.241  -4.228  1.00 0.00 ? 800 GLU A HG3  5  
ATOM 9009  N N    . GLY A 1 94  ? 18.969  10.899  -4.178  1.00 0.00 ? 801 GLY A N    5  
ATOM 9010  C CA   . GLY A 1 94  ? 18.528  9.754   -4.931  1.00 0.00 ? 801 GLY A CA   5  
ATOM 9011  C C    . GLY A 1 94  ? 19.612  9.221   -5.834  1.00 0.00 ? 801 GLY A C    5  
ATOM 9012  O O    . GLY A 1 94  ? 19.955  9.841   -6.852  1.00 0.00 ? 801 GLY A O    5  
ATOM 9013  H H    . GLY A 1 94  ? 18.488  11.745  -4.287  1.00 0.00 ? 801 GLY A H    5  
ATOM 9014  H HA2  . GLY A 1 94  ? 18.229  8.976   -4.246  1.00 0.00 ? 801 GLY A HA2  5  
ATOM 9015  H HA3  . GLY A 1 94  ? 17.678  10.037  -5.536  1.00 0.00 ? 801 GLY A HA3  5  
ATOM 9016  N N    . SER A 1 95  ? 20.183  8.115   -5.437  1.00 0.00 ? 802 SER A N    5  
ATOM 9017  C CA   . SER A 1 95  ? 21.198  7.441   -6.192  1.00 0.00 ? 802 SER A CA   5  
ATOM 9018  C C    . SER A 1 95  ? 20.544  6.712   -7.387  1.00 0.00 ? 802 SER A C    5  
ATOM 9019  O O    . SER A 1 95  ? 19.320  6.785   -7.567  1.00 0.00 ? 802 SER A O    5  
ATOM 9020  C CB   . SER A 1 95  ? 21.921  6.466   -5.256  1.00 0.00 ? 802 SER A CB   5  
ATOM 9021  O OG   . SER A 1 95  ? 22.416  7.156   -4.098  1.00 0.00 ? 802 SER A OG   5  
ATOM 9022  H H    . SER A 1 95  ? 19.924  7.731   -4.573  1.00 0.00 ? 802 SER A H    5  
ATOM 9023  H HA   . SER A 1 95  ? 21.900  8.176   -6.557  1.00 0.00 ? 802 SER A HA   5  
ATOM 9024  H HB2  . SER A 1 95  ? 21.227  5.703   -4.937  1.00 0.00 ? 802 SER A HB2  5  
ATOM 9025  H HB3  . SER A 1 95  ? 22.751  6.003   -5.768  1.00 0.00 ? 802 SER A HB3  5  
ATOM 9026  H HG   . SER A 1 95  ? 22.637  8.059   -4.368  1.00 0.00 ? 802 SER A HG   5  
ATOM 9027  N N    . GLU A 1 96  ? 21.331  6.050   -8.199  1.00 0.00 ? 803 GLU A N    5  
ATOM 9028  C CA   . GLU A 1 96  ? 20.804  5.350   -9.361  1.00 0.00 ? 803 GLU A CA   5  
ATOM 9029  C C    . GLU A 1 96  ? 19.934  4.150   -8.944  1.00 0.00 ? 803 GLU A C    5  
ATOM 9030  O O    . GLU A 1 96  ? 20.398  3.231   -8.277  1.00 0.00 ? 803 GLU A O    5  
ATOM 9031  C CB   . GLU A 1 96  ? 21.939  4.938   -10.285 1.00 0.00 ? 803 GLU A CB   5  
ATOM 9032  C CG   . GLU A 1 96  ? 22.680  6.122   -10.892 1.00 0.00 ? 803 GLU A CG   5  
ATOM 9033  C CD   . GLU A 1 96  ? 23.892  5.728   -11.700 1.00 0.00 ? 803 GLU A CD   5  
ATOM 9034  O OE1  . GLU A 1 96  ? 23.767  5.485   -12.918 1.00 0.00 ? 803 GLU A OE1  5  
ATOM 9035  O OE2  . GLU A 1 96  ? 25.002  5.693   -11.132 1.00 0.00 ? 803 GLU A OE2  5  
ATOM 9036  H H    . GLU A 1 96  ? 22.296  6.018   -8.018  1.00 0.00 ? 803 GLU A H    5  
ATOM 9037  H HA   . GLU A 1 96  ? 20.167  6.050   -9.881  1.00 0.00 ? 803 GLU A HA   5  
ATOM 9038  H HB2  . GLU A 1 96  ? 22.645  4.339   -9.727  1.00 0.00 ? 803 GLU A HB2  5  
ATOM 9039  H HB3  . GLU A 1 96  ? 21.534  4.344   -11.090 1.00 0.00 ? 803 GLU A HB3  5  
ATOM 9040  H HG2  . GLU A 1 96  ? 22.003  6.659   -11.540 1.00 0.00 ? 803 GLU A HG2  5  
ATOM 9041  H HG3  . GLU A 1 96  ? 22.992  6.772   -10.086 1.00 0.00 ? 803 GLU A HG3  5  
ATOM 9042  N N    . SER A 1 97  ? 18.693  4.161   -9.388  1.00 0.00 ? 804 SER A N    5  
ATOM 9043  C CA   . SER A 1 97  ? 17.683  3.182   -8.994  1.00 0.00 ? 804 SER A CA   5  
ATOM 9044  C C    . SER A 1 97  ? 17.809  1.853   -9.774  1.00 0.00 ? 804 SER A C    5  
ATOM 9045  O O    . SER A 1 97  ? 16.937  0.980   -9.659  1.00 0.00 ? 804 SER A O    5  
ATOM 9046  C CB   . SER A 1 97  ? 16.289  3.781   -9.253  1.00 0.00 ? 804 SER A CB   5  
ATOM 9047  O OG   . SER A 1 97  ? 16.133  5.061   -8.636  1.00 0.00 ? 804 SER A OG   5  
ATOM 9048  H H    . SER A 1 97  ? 18.425  4.849   -10.032 1.00 0.00 ? 804 SER A H    5  
ATOM 9049  H HA   . SER A 1 97  ? 17.772  2.994   -7.936  1.00 0.00 ? 804 SER A HA   5  
ATOM 9050  H HB2  . SER A 1 97  ? 16.146  3.896   -10.317 1.00 0.00 ? 804 SER A HB2  5  
ATOM 9051  H HB3  . SER A 1 97  ? 15.535  3.113   -8.865  1.00 0.00 ? 804 SER A HB3  5  
ATOM 9052  H HG   . SER A 1 97  ? 15.593  5.569   -9.257  1.00 0.00 ? 804 SER A HG   5  
ATOM 9053  N N    . TYR A 1 98  ? 18.887  1.684   -10.539 1.00 0.00 ? 805 TYR A N    5  
ATOM 9054  C CA   . TYR A 1 98  ? 19.052  0.493   -11.372 1.00 0.00 ? 805 TYR A CA   5  
ATOM 9055  C C    . TYR A 1 98  ? 19.410  -0.734  -10.552 1.00 0.00 ? 805 TYR A C    5  
ATOM 9056  O O    . TYR A 1 98  ? 19.314  -1.852  -11.044 1.00 0.00 ? 805 TYR A O    5  
ATOM 9057  C CB   . TYR A 1 98  ? 20.119  0.700   -12.487 1.00 0.00 ? 805 TYR A CB   5  
ATOM 9058  C CG   . TYR A 1 98  ? 21.582  0.881   -12.023 1.00 0.00 ? 805 TYR A CG   5  
ATOM 9059  C CD1  . TYR A 1 98  ? 22.290  -0.163  -11.425 1.00 0.00 ? 805 TYR A CD1  5  
ATOM 9060  C CD2  . TYR A 1 98  ? 22.244  2.080   -12.193 1.00 0.00 ? 805 TYR A CD2  5  
ATOM 9061  C CE1  . TYR A 1 98  ? 23.586  -0.015  -11.014 1.00 0.00 ? 805 TYR A CE1  5  
ATOM 9062  C CE2  . TYR A 1 98  ? 23.560  2.233   -11.782 1.00 0.00 ? 805 TYR A CE2  5  
ATOM 9063  C CZ   . TYR A 1 98  ? 24.222  1.181   -11.194 1.00 0.00 ? 805 TYR A CZ   5  
ATOM 9064  O OH   . TYR A 1 98  ? 25.536  1.329   -10.777 1.00 0.00 ? 805 TYR A OH   5  
ATOM 9065  H H    . TYR A 1 98  ? 19.566  2.389   -10.550 1.00 0.00 ? 805 TYR A H    5  
ATOM 9066  H HA   . TYR A 1 98  ? 18.102  0.307   -11.850 1.00 0.00 ? 805 TYR A HA   5  
ATOM 9067  H HB2  . TYR A 1 98  ? 20.099  -0.168  -13.125 1.00 0.00 ? 805 TYR A HB2  5  
ATOM 9068  H HB3  . TYR A 1 98  ? 19.839  1.567   -13.067 1.00 0.00 ? 805 TYR A HB3  5  
ATOM 9069  H HD1  . TYR A 1 98  ? 21.792  -1.110  -11.275 1.00 0.00 ? 805 TYR A HD1  5  
ATOM 9070  H HD2  . TYR A 1 98  ? 21.722  2.906   -12.654 1.00 0.00 ? 805 TYR A HD2  5  
ATOM 9071  H HE1  . TYR A 1 98  ? 24.096  -0.845  -10.551 1.00 0.00 ? 805 TYR A HE1  5  
ATOM 9072  H HE2  . TYR A 1 98  ? 24.062  3.179   -11.924 1.00 0.00 ? 805 TYR A HE2  5  
ATOM 9073  H HH   . TYR A 1 98  ? 25.974  0.484   -10.945 1.00 0.00 ? 805 TYR A HH   5  
ATOM 9074  N N    . GLU A 1 99  ? 19.853  -0.501  -9.322  1.00 0.00 ? 806 GLU A N    5  
ATOM 9075  C CA   . GLU A 1 99  ? 20.366  -1.548  -8.437  1.00 0.00 ? 806 GLU A CA   5  
ATOM 9076  C C    . GLU A 1 99  ? 19.393  -2.718  -8.299  1.00 0.00 ? 806 GLU A C    5  
ATOM 9077  O O    . GLU A 1 99  ? 19.614  -3.805  -8.866  1.00 0.00 ? 806 GLU A O    5  
ATOM 9078  C CB   . GLU A 1 99  ? 20.680  -0.969  -7.058  1.00 0.00 ? 806 GLU A CB   5  
ATOM 9079  C CG   . GLU A 1 99  ? 21.635  0.210   -7.076  1.00 0.00 ? 806 GLU A CG   5  
ATOM 9080  C CD   . GLU A 1 99  ? 21.943  0.707   -5.687  1.00 0.00 ? 806 GLU A CD   5  
ATOM 9081  O OE1  . GLU A 1 99  ? 21.117  1.439   -5.107  1.00 0.00 ? 806 GLU A OE1  5  
ATOM 9082  O OE2  . GLU A 1 99  ? 23.010  0.358   -5.153  1.00 0.00 ? 806 GLU A OE2  5  
ATOM 9083  H H    . GLU A 1 99  ? 19.827  0.426   -9.010  1.00 0.00 ? 806 GLU A H    5  
ATOM 9084  H HA   . GLU A 1 99  ? 21.286  -1.914  -8.869  1.00 0.00 ? 806 GLU A HA   5  
ATOM 9085  H HB2  . GLU A 1 99  ? 19.756  -0.644  -6.602  1.00 0.00 ? 806 GLU A HB2  5  
ATOM 9086  H HB3  . GLU A 1 99  ? 21.115  -1.749  -6.450  1.00 0.00 ? 806 GLU A HB3  5  
ATOM 9087  H HG2  . GLU A 1 99  ? 22.557  -0.092  -7.550  1.00 0.00 ? 806 GLU A HG2  5  
ATOM 9088  H HG3  . GLU A 1 99  ? 21.188  1.014   -7.640  1.00 0.00 ? 806 GLU A HG3  5  
ATOM 9089  N N    . GLU A 1 100 ? 18.322  -2.490  -7.585  1.00 0.00 ? 807 GLU A N    5  
ATOM 9090  C CA   . GLU A 1 100 ? 17.321  -3.496  -7.345  1.00 0.00 ? 807 GLU A CA   5  
ATOM 9091  C C    . GLU A 1 100 ? 15.978  -2.844  -7.223  1.00 0.00 ? 807 GLU A C    5  
ATOM 9092  O O    . GLU A 1 100 ? 15.859  -1.607  -7.334  1.00 0.00 ? 807 GLU A O    5  
ATOM 9093  C CB   . GLU A 1 100 ? 17.594  -4.285  -6.043  1.00 0.00 ? 807 GLU A CB   5  
ATOM 9094  C CG   . GLU A 1 100 ? 18.829  -5.166  -6.050  1.00 0.00 ? 807 GLU A CG   5  
ATOM 9095  C CD   . GLU A 1 100 ? 18.943  -5.993  -4.798  1.00 0.00 ? 807 GLU A CD   5  
ATOM 9096  O OE1  . GLU A 1 100 ? 18.159  -6.963  -4.645  1.00 0.00 ? 807 GLU A OE1  5  
ATOM 9097  O OE2  . GLU A 1 100 ? 19.826  -5.717  -3.968  1.00 0.00 ? 807 GLU A OE2  5  
ATOM 9098  H H    . GLU A 1 100 ? 18.158  -1.599  -7.212  1.00 0.00 ? 807 GLU A H    5  
ATOM 9099  H HA   . GLU A 1 100 ? 17.315  -4.184  -8.176  1.00 0.00 ? 807 GLU A HA   5  
ATOM 9100  H HB2  . GLU A 1 100 ? 17.703  -3.579  -5.234  1.00 0.00 ? 807 GLU A HB2  5  
ATOM 9101  H HB3  . GLU A 1 100 ? 16.734  -4.905  -5.839  1.00 0.00 ? 807 GLU A HB3  5  
ATOM 9102  H HG2  . GLU A 1 100 ? 18.778  -5.836  -6.896  1.00 0.00 ? 807 GLU A HG2  5  
ATOM 9103  H HG3  . GLU A 1 100 ? 19.706  -4.542  -6.136  1.00 0.00 ? 807 GLU A HG3  5  
ATOM 9104  N N    . ASP A 1 101 ? 14.979  -3.674  -7.024  1.00 0.00 ? 808 ASP A N    5  
ATOM 9105  C CA   . ASP A 1 101 ? 13.644  -3.238  -6.686  1.00 0.00 ? 808 ASP A CA   5  
ATOM 9106  C C    . ASP A 1 101 ? 13.771  -2.447  -5.380  1.00 0.00 ? 808 ASP A C    5  
ATOM 9107  O O    . ASP A 1 101 ? 14.420  -2.923  -4.435  1.00 0.00 ? 808 ASP A O    5  
ATOM 9108  C CB   . ASP A 1 101 ? 12.750  -4.479  -6.507  1.00 0.00 ? 808 ASP A CB   5  
ATOM 9109  C CG   . ASP A 1 101 ? 11.321  -4.165  -6.143  1.00 0.00 ? 808 ASP A CG   5  
ATOM 9110  O OD1  . ASP A 1 101 ? 10.522  -3.829  -7.045  1.00 0.00 ? 808 ASP A OD1  5  
ATOM 9111  O OD2  . ASP A 1 101 ? 10.967  -4.290  -4.956  1.00 0.00 ? 808 ASP A OD2  5  
ATOM 9112  H H    . ASP A 1 101 ? 15.158  -4.635  -7.113  1.00 0.00 ? 808 ASP A H    5  
ATOM 9113  H HA   . ASP A 1 101 ? 13.265  -2.604  -7.475  1.00 0.00 ? 808 ASP A HA   5  
ATOM 9114  H HB2  . ASP A 1 101 ? 12.738  -5.037  -7.432  1.00 0.00 ? 808 ASP A HB2  5  
ATOM 9115  H HB3  . ASP A 1 101 ? 13.175  -5.100  -5.732  1.00 0.00 ? 808 ASP A HB3  5  
ATOM 9116  N N    . PRO A 1 102 ? 13.195  -1.251  -5.290  1.00 0.00 ? 809 PRO A N    5  
ATOM 9117  C CA   . PRO A 1 102 ? 13.469  -0.351  -4.183  1.00 0.00 ? 809 PRO A CA   5  
ATOM 9118  C C    . PRO A 1 102 ? 12.855  -0.779  -2.858  1.00 0.00 ? 809 PRO A C    5  
ATOM 9119  O O    . PRO A 1 102 ? 12.065  -1.741  -2.766  1.00 0.00 ? 809 PRO A O    5  
ATOM 9120  C CB   . PRO A 1 102 ? 12.873  0.967   -4.649  1.00 0.00 ? 809 PRO A CB   5  
ATOM 9121  C CG   . PRO A 1 102 ? 11.725  0.553   -5.480  1.00 0.00 ? 809 PRO A CG   5  
ATOM 9122  C CD   . PRO A 1 102 ? 12.186  -0.684  -6.211  1.00 0.00 ? 809 PRO A CD   5  
ATOM 9123  H HA   . PRO A 1 102 ? 14.532  -0.221  -4.046  1.00 0.00 ? 809 PRO A HA   5  
ATOM 9124  H HB2  . PRO A 1 102 ? 12.562  1.537   -3.785  1.00 0.00 ? 809 PRO A HB2  5  
ATOM 9125  H HB3  . PRO A 1 102 ? 13.600  1.525   -5.220  1.00 0.00 ? 809 PRO A HB3  5  
ATOM 9126  H HG2  . PRO A 1 102 ? 10.910  0.317   -4.813  1.00 0.00 ? 809 PRO A HG2  5  
ATOM 9127  H HG3  . PRO A 1 102 ? 11.458  1.340   -6.167  1.00 0.00 ? 809 PRO A HG3  5  
ATOM 9128  H HD2  . PRO A 1 102 ? 11.361  -1.368  -6.344  1.00 0.00 ? 809 PRO A HD2  5  
ATOM 9129  H HD3  . PRO A 1 102 ? 12.626  -0.429  -7.163  1.00 0.00 ? 809 PRO A HD3  5  
ATOM 9130  N N    . TYR A 1 103 ? 13.246  -0.087  -1.850  1.00 0.00 ? 810 TYR A N    5  
ATOM 9131  C CA   . TYR A 1 103 ? 12.774  -0.292  -0.518  1.00 0.00 ? 810 TYR A CA   5  
ATOM 9132  C C    . TYR A 1 103 ? 11.812  0.852   -0.255  1.00 0.00 ? 810 TYR A C    5  
ATOM 9133  O O    . TYR A 1 103 ? 12.168  2.018   -0.454  1.00 0.00 ? 810 TYR A O    5  
ATOM 9134  C CB   . TYR A 1 103 ? 13.964  -0.294  0.456   1.00 0.00 ? 810 TYR A CB   5  
ATOM 9135  C CG   . TYR A 1 103 ? 15.039  -1.344  0.126   1.00 0.00 ? 810 TYR A CG   5  
ATOM 9136  C CD1  . TYR A 1 103 ? 16.018  -1.094  -0.842  1.00 0.00 ? 810 TYR A CD1  5  
ATOM 9137  C CD2  . TYR A 1 103 ? 15.077  -2.568  0.780   1.00 0.00 ? 810 TYR A CD2  5  
ATOM 9138  C CE1  . TYR A 1 103 ? 16.990  -2.027  -1.144  1.00 0.00 ? 810 TYR A CE1  5  
ATOM 9139  C CE2  . TYR A 1 103 ? 16.055  -3.510  0.479   1.00 0.00 ? 810 TYR A CE2  5  
ATOM 9140  C CZ   . TYR A 1 103 ? 17.008  -3.231  -0.484  1.00 0.00 ? 810 TYR A CZ   5  
ATOM 9141  O OH   . TYR A 1 103 ? 17.982  -4.170  -0.788  1.00 0.00 ? 810 TYR A OH   5  
ATOM 9142  H H    . TYR A 1 103 ? 13.883  0.645   -2.015  1.00 0.00 ? 810 TYR A H    5  
ATOM 9143  H HA   . TYR A 1 103 ? 12.244  -1.233  -0.480  1.00 0.00 ? 810 TYR A HA   5  
ATOM 9144  H HB2  . TYR A 1 103 ? 14.433  0.678   0.440   1.00 0.00 ? 810 TYR A HB2  5  
ATOM 9145  H HB3  . TYR A 1 103 ? 13.601  -0.496  1.453   1.00 0.00 ? 810 TYR A HB3  5  
ATOM 9146  H HD1  . TYR A 1 103 ? 16.005  -0.148  -1.362  1.00 0.00 ? 810 TYR A HD1  5  
ATOM 9147  H HD2  . TYR A 1 103 ? 14.332  -2.787  1.530   1.00 0.00 ? 810 TYR A HD2  5  
ATOM 9148  H HE1  . TYR A 1 103 ? 17.733  -1.809  -1.896  1.00 0.00 ? 810 TYR A HE1  5  
ATOM 9149  H HE2  . TYR A 1 103 ? 16.069  -4.456  0.998   1.00 0.00 ? 810 TYR A HE2  5  
ATOM 9150  H HH   . TYR A 1 103 ? 18.859  -3.761  -0.775  1.00 0.00 ? 810 TYR A HH   5  
ATOM 9151  N N    . LEU A 1 104 ? 10.609  0.527   0.131   1.00 0.00 ? 811 LEU A N    5  
ATOM 9152  C CA   . LEU A 1 104 ? 9.526   1.492   0.164   1.00 0.00 ? 811 LEU A CA   5  
ATOM 9153  C C    . LEU A 1 104 ? 9.092   1.869   1.564   1.00 0.00 ? 811 LEU A C    5  
ATOM 9154  O O    . LEU A 1 104 ? 8.849   1.011   2.403   1.00 0.00 ? 811 LEU A O    5  
ATOM 9155  C CB   . LEU A 1 104 ? 8.339   0.913   -0.590  1.00 0.00 ? 811 LEU A CB   5  
ATOM 9156  C CG   . LEU A 1 104 ? 8.603   0.530   -2.045  1.00 0.00 ? 811 LEU A CG   5  
ATOM 9157  C CD1  . LEU A 1 104 ? 7.395   -0.148  -2.640  1.00 0.00 ? 811 LEU A CD1  5  
ATOM 9158  C CD2  . LEU A 1 104 ? 8.960   1.755   -2.852  1.00 0.00 ? 811 LEU A CD2  5  
ATOM 9159  H H    . LEU A 1 104 ? 10.418  -0.392  0.429   1.00 0.00 ? 811 LEU A H    5  
ATOM 9160  H HA   . LEU A 1 104 ? 9.836   2.382   -0.362  1.00 0.00 ? 811 LEU A HA   5  
ATOM 9161  H HB2  . LEU A 1 104 ? 8.005   0.033   -0.062  1.00 0.00 ? 811 LEU A HB2  5  
ATOM 9162  H HB3  . LEU A 1 104 ? 7.545   1.644   -0.573  1.00 0.00 ? 811 LEU A HB3  5  
ATOM 9163  H HG   . LEU A 1 104 ? 9.434   -0.159  -2.090  1.00 0.00 ? 811 LEU A HG   5  
ATOM 9164  H HD11 . LEU A 1 104 ? 7.623   -0.461  -3.647  1.00 0.00 ? 811 LEU A HD11 5  
ATOM 9165  H HD12 . LEU A 1 104 ? 6.568   0.543   -2.668  1.00 0.00 ? 811 LEU A HD12 5  
ATOM 9166  H HD13 . LEU A 1 104 ? 7.133   -1.007  -2.041  1.00 0.00 ? 811 LEU A HD13 5  
ATOM 9167  H HD21 . LEU A 1 104 ? 8.156   2.472   -2.779  1.00 0.00 ? 811 LEU A HD21 5  
ATOM 9168  H HD22 . LEU A 1 104 ? 9.116   1.480   -3.885  1.00 0.00 ? 811 LEU A HD22 5  
ATOM 9169  H HD23 . LEU A 1 104 ? 9.863   2.189   -2.450  1.00 0.00 ? 811 LEU A HD23 5  
ATOM 9170  N N    . VAL A 1 105 ? 8.977   3.153   1.791   1.00 0.00 ? 812 VAL A N    5  
ATOM 9171  C CA   . VAL A 1 105 ? 8.503   3.702   3.044   1.00 0.00 ? 812 VAL A CA   5  
ATOM 9172  C C    . VAL A 1 105 ? 7.462   4.786   2.776   1.00 0.00 ? 812 VAL A C    5  
ATOM 9173  O O    . VAL A 1 105 ? 7.608   5.549   1.862   1.00 0.00 ? 812 VAL A O    5  
ATOM 9174  C CB   . VAL A 1 105 ? 9.691   4.200   3.964   1.00 0.00 ? 812 VAL A CB   5  
ATOM 9175  C CG1  . VAL A 1 105 ? 10.812  4.850   3.167   1.00 0.00 ? 812 VAL A CG1  5  
ATOM 9176  C CG2  . VAL A 1 105 ? 9.213   5.190   5.013   1.00 0.00 ? 812 VAL A CG2  5  
ATOM 9177  H H    . VAL A 1 105 ? 9.221   3.783   1.074   1.00 0.00 ? 812 VAL A H    5  
ATOM 9178  H HA   . VAL A 1 105 ? 7.995   2.886   3.531   1.00 0.00 ? 812 VAL A HA   5  
ATOM 9179  H HB   . VAL A 1 105 ? 10.088  3.338   4.471   1.00 0.00 ? 812 VAL A HB   5  
ATOM 9180  H HG11 . VAL A 1 105 ? 11.699  4.904   3.780   1.00 0.00 ? 812 VAL A HG11 5  
ATOM 9181  H HG12 . VAL A 1 105 ? 10.526  5.865   2.951   1.00 0.00 ? 812 VAL A HG12 5  
ATOM 9182  H HG13 . VAL A 1 105 ? 11.012  4.300   2.260   1.00 0.00 ? 812 VAL A HG13 5  
ATOM 9183  H HG21 . VAL A 1 105 ? 8.450   4.741   5.631   1.00 0.00 ? 812 VAL A HG21 5  
ATOM 9184  H HG22 . VAL A 1 105 ? 8.804   6.043   4.489   1.00 0.00 ? 812 VAL A HG22 5  
ATOM 9185  H HG23 . VAL A 1 105 ? 10.048  5.511   5.618   1.00 0.00 ? 812 VAL A HG23 5  
ATOM 9186  N N    . VAL A 1 106 ? 6.402   4.827   3.548   1.00 0.00 ? 813 VAL A N    5  
ATOM 9187  C CA   . VAL A 1 106 ? 5.349   5.805   3.314   1.00 0.00 ? 813 VAL A CA   5  
ATOM 9188  C C    . VAL A 1 106 ? 5.274   6.766   4.495   1.00 0.00 ? 813 VAL A C    5  
ATOM 9189  O O    . VAL A 1 106 ? 5.768   6.457   5.582   1.00 0.00 ? 813 VAL A O    5  
ATOM 9190  C CB   . VAL A 1 106 ? 3.957   5.107   3.059   1.00 0.00 ? 813 VAL A CB   5  
ATOM 9191  C CG1  . VAL A 1 106 ? 3.420   4.409   4.303   1.00 0.00 ? 813 VAL A CG1  5  
ATOM 9192  C CG2  . VAL A 1 106 ? 2.919   6.067   2.444   1.00 0.00 ? 813 VAL A CG2  5  
ATOM 9193  H H    . VAL A 1 106 ? 6.327   4.222   4.315   1.00 0.00 ? 813 VAL A H    5  
ATOM 9194  H HA   . VAL A 1 106 ? 5.622   6.374   2.436   1.00 0.00 ? 813 VAL A HA   5  
ATOM 9195  H HB   . VAL A 1 106 ? 4.148   4.319   2.345   1.00 0.00 ? 813 VAL A HB   5  
ATOM 9196  H HG11 . VAL A 1 106 ? 4.126   3.660   4.629   1.00 0.00 ? 813 VAL A HG11 5  
ATOM 9197  H HG12 . VAL A 1 106 ? 2.477   3.937   4.070   1.00 0.00 ? 813 VAL A HG12 5  
ATOM 9198  H HG13 . VAL A 1 106 ? 3.276   5.136   5.089   1.00 0.00 ? 813 VAL A HG13 5  
ATOM 9199  H HG21 . VAL A 1 106 ? 1.989   5.550   2.264   1.00 0.00 ? 813 VAL A HG21 5  
ATOM 9200  H HG22 . VAL A 1 106 ? 3.287   6.461   1.506   1.00 0.00 ? 813 VAL A HG22 5  
ATOM 9201  H HG23 . VAL A 1 106 ? 2.742   6.891   3.120   1.00 0.00 ? 813 VAL A HG23 5  
ATOM 9202  N N    . ASN A 1 107 ? 4.710   7.920   4.267   1.00 0.00 ? 814 ASN A N    5  
ATOM 9203  C CA   . ASN A 1 107 ? 4.538   8.921   5.302   1.00 0.00 ? 814 ASN A CA   5  
ATOM 9204  C C    . ASN A 1 107 ? 3.064   8.981   5.698   1.00 0.00 ? 814 ASN A C    5  
ATOM 9205  O O    . ASN A 1 107 ? 2.199   8.555   4.923   1.00 0.00 ? 814 ASN A O    5  
ATOM 9206  C CB   . ASN A 1 107 ? 5.016   10.309  4.822   1.00 0.00 ? 814 ASN A CB   5  
ATOM 9207  C CG   . ASN A 1 107 ? 4.328   10.781  3.566   1.00 0.00 ? 814 ASN A CG   5  
ATOM 9208  O OD1  . ASN A 1 107 ? 3.271   11.374  3.623   1.00 0.00 ? 814 ASN A OD1  5  
ATOM 9209  N ND2  . ASN A 1 107 ? 4.943   10.568  2.439   1.00 0.00 ? 814 ASN A ND2  5  
ATOM 9210  H H    . ASN A 1 107 ? 4.359   8.111   3.372   1.00 0.00 ? 814 ASN A H    5  
ATOM 9211  H HA   . ASN A 1 107 ? 5.128   8.611   6.152   1.00 0.00 ? 814 ASN A HA   5  
ATOM 9212  H HB2  . ASN A 1 107 ? 4.817   11.033  5.598   1.00 0.00 ? 814 ASN A HB2  5  
ATOM 9213  H HB3  . ASN A 1 107 ? 6.076   10.281  4.641   1.00 0.00 ? 814 ASN A HB3  5  
ATOM 9214  H HD21 . ASN A 1 107 ? 5.816   10.123  2.451   1.00 0.00 ? 814 ASN A HD21 5  
ATOM 9215  H HD22 . ASN A 1 107 ? 4.516   10.858  1.608   1.00 0.00 ? 814 ASN A HD22 5  
ATOM 9216  N N    . PRO A 1 108 ? 2.733   9.518   6.892   1.00 0.00 ? 815 PRO A N    5  
ATOM 9217  C CA   . PRO A 1 108 ? 1.351   9.586   7.371   1.00 0.00 ? 815 PRO A CA   5  
ATOM 9218  C C    . PRO A 1 108 ? 0.503   10.680  6.686   1.00 0.00 ? 815 PRO A C    5  
ATOM 9219  O O    . PRO A 1 108 ? -0.656  10.901  7.062   1.00 0.00 ? 815 PRO A O    5  
ATOM 9220  C CB   . PRO A 1 108 ? 1.494   9.889   8.876   1.00 0.00 ? 815 PRO A CB   5  
ATOM 9221  C CG   . PRO A 1 108 ? 2.951   9.764   9.178   1.00 0.00 ? 815 PRO A CG   5  
ATOM 9222  C CD   . PRO A 1 108 ? 3.664   10.056  7.898   1.00 0.00 ? 815 PRO A CD   5  
ATOM 9223  H HA   . PRO A 1 108 ? 0.854   8.635   7.248   1.00 0.00 ? 815 PRO A HA   5  
ATOM 9224  H HB2  . PRO A 1 108 ? 1.138   10.890  9.071   1.00 0.00 ? 815 PRO A HB2  5  
ATOM 9225  H HB3  . PRO A 1 108 ? 0.911   9.179   9.445   1.00 0.00 ? 815 PRO A HB3  5  
ATOM 9226  H HG2  . PRO A 1 108 ? 3.237   10.476  9.939   1.00 0.00 ? 815 PRO A HG2  5  
ATOM 9227  H HG3  . PRO A 1 108 ? 3.170   8.758   9.506   1.00 0.00 ? 815 PRO A HG3  5  
ATOM 9228  H HD2  . PRO A 1 108 ? 3.803   11.121  7.776   1.00 0.00 ? 815 PRO A HD2  5  
ATOM 9229  H HD3  . PRO A 1 108 ? 4.612   9.541   7.871   1.00 0.00 ? 815 PRO A HD3  5  
ATOM 9230  N N    . ASN A 1 109 ? 1.049   11.339  5.661   1.00 0.00 ? 816 ASN A N    5  
ATOM 9231  C CA   . ASN A 1 109 ? 0.293   12.407  4.943   1.00 0.00 ? 816 ASN A CA   5  
ATOM 9232  C C    . ASN A 1 109 ? -0.488  11.779  3.794   1.00 0.00 ? 816 ASN A C    5  
ATOM 9233  O O    . ASN A 1 109 ? -0.912  12.453  2.851   1.00 0.00 ? 816 ASN A O    5  
ATOM 9234  C CB   . ASN A 1 109 ? 1.218   13.506  4.371   1.00 0.00 ? 816 ASN A CB   5  
ATOM 9235  C CG   . ASN A 1 109 ? 2.180   14.099  5.377   1.00 0.00 ? 816 ASN A CG   5  
ATOM 9236  O OD1  . ASN A 1 109 ? 1.861   15.040  6.106   1.00 0.00 ? 816 ASN A OD1  5  
ATOM 9237  N ND2  . ASN A 1 109 ? 3.381   13.591  5.387   1.00 0.00 ? 816 ASN A ND2  5  
ATOM 9238  H H    . ASN A 1 109 ? 1.959   11.104  5.365   1.00 0.00 ? 816 ASN A H    5  
ATOM 9239  H HA   . ASN A 1 109 ? -0.408  12.841  5.642   1.00 0.00 ? 816 ASN A HA   5  
ATOM 9240  H HB2  . ASN A 1 109 ? 1.804   13.083  3.568   1.00 0.00 ? 816 ASN A HB2  5  
ATOM 9241  H HB3  . ASN A 1 109 ? 0.606   14.300  3.970   1.00 0.00 ? 816 ASN A HB3  5  
ATOM 9242  H HD21 . ASN A 1 109 ? 3.564   12.873  4.743   1.00 0.00 ? 816 ASN A HD21 5  
ATOM 9243  H HD22 . ASN A 1 109 ? 4.053   13.941  6.011   1.00 0.00 ? 816 ASN A HD22 5  
ATOM 9244  N N    . TYR A 1 110 ? -0.671  10.481  3.906   1.00 0.00 ? 817 TYR A N    5  
ATOM 9245  C CA   . TYR A 1 110 ? -1.372  9.656   2.952   1.00 0.00 ? 817 TYR A CA   5  
ATOM 9246  C C    . TYR A 1 110 ? -2.815  10.148  2.729   1.00 0.00 ? 817 TYR A C    5  
ATOM 9247  O O    . TYR A 1 110 ? -3.498  10.616  3.664   1.00 0.00 ? 817 TYR A O    5  
ATOM 9248  C CB   . TYR A 1 110 ? -1.339  8.208   3.457   1.00 0.00 ? 817 TYR A CB   5  
ATOM 9249  C CG   . TYR A 1 110 ? -2.007  7.190   2.567   1.00 0.00 ? 817 TYR A CG   5  
ATOM 9250  C CD1  . TYR A 1 110 ? -1.447  6.825   1.348   1.00 0.00 ? 817 TYR A CD1  5  
ATOM 9251  C CD2  . TYR A 1 110 ? -3.183  6.571   2.964   1.00 0.00 ? 817 TYR A CD2  5  
ATOM 9252  C CE1  . TYR A 1 110 ? -2.049  5.874   0.550   1.00 0.00 ? 817 TYR A CE1  5  
ATOM 9253  C CE2  . TYR A 1 110 ? -3.790  5.625   2.173   1.00 0.00 ? 817 TYR A CE2  5  
ATOM 9254  C CZ   . TYR A 1 110 ? -3.222  5.279   0.971   1.00 0.00 ? 817 TYR A CZ   5  
ATOM 9255  O OH   . TYR A 1 110 ? -3.830  4.337   0.192   1.00 0.00 ? 817 TYR A OH   5  
ATOM 9256  H H    . TYR A 1 110 ? -0.297  10.056  4.704   1.00 0.00 ? 817 TYR A H    5  
ATOM 9257  H HA   . TYR A 1 110 ? -0.837  9.702   2.016   1.00 0.00 ? 817 TYR A HA   5  
ATOM 9258  H HB2  . TYR A 1 110 ? -0.309  7.905   3.572   1.00 0.00 ? 817 TYR A HB2  5  
ATOM 9259  H HB3  . TYR A 1 110 ? -1.816  8.173   4.425   1.00 0.00 ? 817 TYR A HB3  5  
ATOM 9260  H HD1  . TYR A 1 110 ? -0.533  7.303   1.022   1.00 0.00 ? 817 TYR A HD1  5  
ATOM 9261  H HD2  . TYR A 1 110 ? -3.628  6.845   3.909   1.00 0.00 ? 817 TYR A HD2  5  
ATOM 9262  H HE1  . TYR A 1 110 ? -1.599  5.601   -0.394  1.00 0.00 ? 817 TYR A HE1  5  
ATOM 9263  H HE2  . TYR A 1 110 ? -4.707  5.158   2.499   1.00 0.00 ? 817 TYR A HE2  5  
ATOM 9264  H HH   . TYR A 1 110 ? -4.769  4.566   0.169   1.00 0.00 ? 817 TYR A HH   5  
ATOM 9265  N N    . LEU A 1 111 ? -3.250  10.049  1.499   1.00 0.00 ? 818 LEU A N    5  
ATOM 9266  C CA   . LEU A 1 111 ? -4.552  10.500  1.083   1.00 0.00 ? 818 LEU A CA   5  
ATOM 9267  C C    . LEU A 1 111 ? -5.423  9.331   0.651   1.00 0.00 ? 818 LEU A C    5  
ATOM 9268  O O    . LEU A 1 111 ? -4.908  8.242   0.375   1.00 0.00 ? 818 LEU A O    5  
ATOM 9269  C CB   . LEU A 1 111 ? -4.478  11.627  -0.015  1.00 0.00 ? 818 LEU A CB   5  
ATOM 9270  C CG   . LEU A 1 111 ? -3.594  11.439  -1.307  1.00 0.00 ? 818 LEU A CG   5  
ATOM 9271  C CD1  . LEU A 1 111 ? -2.099  11.434  -1.012  1.00 0.00 ? 818 LEU A CD1  5  
ATOM 9272  C CD2  . LEU A 1 111 ? -3.987  10.206  -2.103  1.00 0.00 ? 818 LEU A CD2  5  
ATOM 9273  H H    . LEU A 1 111 ? -2.690  9.613   0.826   1.00 0.00 ? 818 LEU A H    5  
ATOM 9274  H HA   . LEU A 1 111 ? -5.006  10.923  1.967   1.00 0.00 ? 818 LEU A HA   5  
ATOM 9275  H HB2  . LEU A 1 111 ? -5.489  11.790  -0.359  1.00 0.00 ? 818 LEU A HB2  5  
ATOM 9276  H HB3  . LEU A 1 111 ? -4.160  12.533  0.479   1.00 0.00 ? 818 LEU A HB3  5  
ATOM 9277  H HG   . LEU A 1 111 ? -3.760  12.304  -1.934  1.00 0.00 ? 818 LEU A HG   5  
ATOM 9278  H HD11 . LEU A 1 111 ? -1.822  12.367  -0.543  1.00 0.00 ? 818 LEU A HD11 5  
ATOM 9279  H HD12 . LEU A 1 111 ? -1.552  11.324  -1.937  1.00 0.00 ? 818 LEU A HD12 5  
ATOM 9280  H HD13 . LEU A 1 111 ? -1.857  10.614  -0.353  1.00 0.00 ? 818 LEU A HD13 5  
ATOM 9281  H HD21 . LEU A 1 111 ? -3.862  9.332   -1.480  1.00 0.00 ? 818 LEU A HD21 5  
ATOM 9282  H HD22 . LEU A 1 111 ? -3.363  10.119  -2.980  1.00 0.00 ? 818 LEU A HD22 5  
ATOM 9283  H HD23 . LEU A 1 111 ? -5.022  10.283  -2.401  1.00 0.00 ? 818 LEU A HD23 5  
ATOM 9284  N N    . LEU A 1 112 ? -6.721  9.553   0.589   1.00 0.00 ? 819 LEU A N    5  
ATOM 9285  C CA   . LEU A 1 112 ? -7.662  8.510   0.207   1.00 0.00 ? 819 LEU A CA   5  
ATOM 9286  C C    . LEU A 1 112 ? -7.982  8.616   -1.295  1.00 0.00 ? 819 LEU A C    5  
ATOM 9287  O O    . LEU A 1 112 ? -7.167  9.131   -2.060  1.00 0.00 ? 819 LEU A O    5  
ATOM 9288  C CB   . LEU A 1 112 ? -8.947  8.626   1.047   1.00 0.00 ? 819 LEU A CB   5  
ATOM 9289  C CG   . LEU A 1 112 ? -8.783  8.596   2.578   1.00 0.00 ? 819 LEU A CG   5  
ATOM 9290  C CD1  . LEU A 1 112 ? -10.137 8.667   3.255   1.00 0.00 ? 819 LEU A CD1  5  
ATOM 9291  C CD2  . LEU A 1 112 ? -8.024  7.356   3.038   1.00 0.00 ? 819 LEU A CD2  5  
ATOM 9292  H H    . LEU A 1 112 ? -7.063  10.449  0.797   1.00 0.00 ? 819 LEU A H    5  
ATOM 9293  H HA   . LEU A 1 112 ? -7.192  7.558   0.397   1.00 0.00 ? 819 LEU A HA   5  
ATOM 9294  H HB2  . LEU A 1 112 ? -9.433  9.551   0.778   1.00 0.00 ? 819 LEU A HB2  5  
ATOM 9295  H HB3  . LEU A 1 112 ? -9.599  7.812   0.768   1.00 0.00 ? 819 LEU A HB3  5  
ATOM 9296  H HG   . LEU A 1 112 ? -8.228  9.471   2.881   1.00 0.00 ? 819 LEU A HG   5  
ATOM 9297  H HD11 . LEU A 1 112 ? -10.740 7.827   2.945   1.00 0.00 ? 819 LEU A HD11 5  
ATOM 9298  H HD12 . LEU A 1 112 ? -10.633 9.587   2.983   1.00 0.00 ? 819 LEU A HD12 5  
ATOM 9299  H HD13 . LEU A 1 112 ? -10.000 8.634   4.327   1.00 0.00 ? 819 LEU A HD13 5  
ATOM 9300  H HD21 . LEU A 1 112 ? -7.055  7.322   2.563   1.00 0.00 ? 819 LEU A HD21 5  
ATOM 9301  H HD22 . LEU A 1 112 ? -8.587  6.467   2.797   1.00 0.00 ? 819 LEU A HD22 5  
ATOM 9302  H HD23 . LEU A 1 112 ? -7.893  7.401   4.109   1.00 0.00 ? 819 LEU A HD23 5  
ATOM 9303  N N    . GLU A 1 113 ? -9.152  8.103   -1.708  1.00 0.00 ? 820 GLU A N    5  
ATOM 9304  C CA   . GLU A 1 113 ? -9.586  8.128   -3.124  1.00 0.00 ? 820 GLU A CA   5  
ATOM 9305  C C    . GLU A 1 113 ? -9.629  9.555   -3.674  1.00 0.00 ? 820 GLU A C    5  
ATOM 9306  O O    . GLU A 1 113 ? -9.238  9.813   -4.820  1.00 0.00 ? 820 GLU A O    5  
ATOM 9307  C CB   . GLU A 1 113 ? -10.992 7.517   -3.275  1.00 0.00 ? 820 GLU A CB   5  
ATOM 9308  C CG   . GLU A 1 113 ? -11.124 6.081   -2.807  1.00 0.00 ? 820 GLU A CG   5  
ATOM 9309  C CD   . GLU A 1 113 ? -10.168 5.173   -3.502  1.00 0.00 ? 820 GLU A CD   5  
ATOM 9310  O OE1  . GLU A 1 113 ? -10.427 4.754   -4.645  1.00 0.00 ? 820 GLU A OE1  5  
ATOM 9311  O OE2  . GLU A 1 113 ? -9.141  4.876   -2.939  1.00 0.00 ? 820 GLU A OE2  5  
ATOM 9312  H H    . GLU A 1 113 ? -9.739  7.680   -1.050  1.00 0.00 ? 820 GLU A H    5  
ATOM 9313  H HA   . GLU A 1 113 ? -8.891  7.539   -3.703  1.00 0.00 ? 820 GLU A HA   5  
ATOM 9314  H HB2  . GLU A 1 113 ? -11.688 8.113   -2.706  1.00 0.00 ? 820 GLU A HB2  5  
ATOM 9315  H HB3  . GLU A 1 113 ? -11.272 7.563   -4.317  1.00 0.00 ? 820 GLU A HB3  5  
ATOM 9316  H HG2  . GLU A 1 113 ? -10.929 6.039   -1.745  1.00 0.00 ? 820 GLU A HG2  5  
ATOM 9317  H HG3  . GLU A 1 113 ? -12.132 5.742   -3.000  1.00 0.00 ? 820 GLU A HG3  5  
ATOM 9318  N N    . ASP A 1 114 ? -10.115 10.455  -2.860  1.00 0.00 ? 821 ASP A N    5  
ATOM 9319  C CA   . ASP A 1 114 ? -10.274 11.837  -3.222  1.00 0.00 ? 821 ASP A CA   5  
ATOM 9320  C C    . ASP A 1 114 ? -9.853  12.674  -2.055  1.00 0.00 ? 821 ASP A C    5  
ATOM 9321  O O    . ASP A 1 114 ? -8.862  13.409  -2.162  1.00 0.00 ? 821 ASP A O    5  
ATOM 9322  C CB   . ASP A 1 114 ? -11.731 12.142  -3.588  1.00 0.00 ? 821 ASP A CB   5  
ATOM 9323  C CG   . ASP A 1 114 ? -11.965 13.595  -3.946  1.00 0.00 ? 821 ASP A CG   5  
ATOM 9324  O OD1  . ASP A 1 114 ? -11.828 13.955  -5.134  1.00 0.00 ? 821 ASP A OD1  5  
ATOM 9325  O OD2  . ASP A 1 114 ? -12.341 14.398  -3.064  1.00 0.00 ? 821 ASP A OD2  5  
ATOM 9326  O OXT  . ASP A 1 114 ? -10.464 12.535  -0.972  1.00 0.00 ? 821 ASP A OXT  5  
ATOM 9327  H H    . ASP A 1 114 ? -10.361 10.216  -1.944  1.00 0.00 ? 821 ASP A H    5  
ATOM 9328  H HA   . ASP A 1 114 ? -9.638  12.050  -4.067  1.00 0.00 ? 821 ASP A HA   5  
ATOM 9329  H HB2  . ASP A 1 114 ? -12.015 11.541  -4.437  1.00 0.00 ? 821 ASP A HB2  5  
ATOM 9330  H HB3  . ASP A 1 114 ? -12.363 11.888  -2.749  1.00 0.00 ? 821 ASP A HB3  5  
ATOM 9331  N N    . ALA A 1 1   ? -16.857 7.114   -12.741 1.00 0.00 ? 708 ALA A N    6  
ATOM 9332  C CA   . ALA A 1 1   ? -17.122 7.923   -11.591 1.00 0.00 ? 708 ALA A CA   6  
ATOM 9333  C C    . ALA A 1 1   ? -17.981 7.120   -10.634 1.00 0.00 ? 708 ALA A C    6  
ATOM 9334  O O    . ALA A 1 1   ? -18.968 6.504   -11.051 1.00 0.00 ? 708 ALA A O    6  
ATOM 9335  C CB   . ALA A 1 1   ? -17.838 9.203   -12.004 1.00 0.00 ? 708 ALA A CB   6  
ATOM 9336  H H1   . ALA A 1 1   ? -17.464 7.168   -13.509 1.00 0.00 ? 708 ALA A H1   6  
ATOM 9337  H HA   . ALA A 1 1   ? -16.183 8.176   -11.124 1.00 0.00 ? 708 ALA A HA   6  
ATOM 9338  H HB1  . ALA A 1 1   ? -17.216 9.762   -12.688 1.00 0.00 ? 708 ALA A HB1  6  
ATOM 9339  H HB2  . ALA A 1 1   ? -18.029 9.802   -11.126 1.00 0.00 ? 708 ALA A HB2  6  
ATOM 9340  H HB3  . ALA A 1 1   ? -18.774 8.955   -12.484 1.00 0.00 ? 708 ALA A HB3  6  
ATOM 9341  N N    . PRO A 1 2   ? -17.624 7.078   -9.363  1.00 0.00 ? 709 PRO A N    6  
ATOM 9342  C CA   . PRO A 1 2   ? -18.371 6.322   -8.381  1.00 0.00 ? 709 PRO A CA   6  
ATOM 9343  C C    . PRO A 1 2   ? -19.617 7.066   -7.898  1.00 0.00 ? 709 PRO A C    6  
ATOM 9344  O O    . PRO A 1 2   ? -19.560 8.252   -7.532  1.00 0.00 ? 709 PRO A O    6  
ATOM 9345  C CB   . PRO A 1 2   ? -17.376 6.140   -7.241  1.00 0.00 ? 709 PRO A CB   6  
ATOM 9346  C CG   . PRO A 1 2   ? -16.448 7.307   -7.335  1.00 0.00 ? 709 PRO A CG   6  
ATOM 9347  C CD   . PRO A 1 2   ? -16.445 7.751   -8.774  1.00 0.00 ? 709 PRO A CD   6  
ATOM 9348  H HA   . PRO A 1 2   ? -18.659 5.356   -8.769  1.00 0.00 ? 709 PRO A HA   6  
ATOM 9349  H HB2  . PRO A 1 2   ? -17.915 6.145   -6.305  1.00 0.00 ? 709 PRO A HB2  6  
ATOM 9350  H HB3  . PRO A 1 2   ? -16.851 5.203   -7.358  1.00 0.00 ? 709 PRO A HB3  6  
ATOM 9351  H HG2  . PRO A 1 2   ? -16.806 8.105   -6.704  1.00 0.00 ? 709 PRO A HG2  6  
ATOM 9352  H HG3  . PRO A 1 2   ? -15.454 7.011   -7.033  1.00 0.00 ? 709 PRO A HG3  6  
ATOM 9353  H HD2  . PRO A 1 2   ? -16.546 8.824   -8.841  1.00 0.00 ? 709 PRO A HD2  6  
ATOM 9354  H HD3  . PRO A 1 2   ? -15.537 7.429   -9.260  1.00 0.00 ? 709 PRO A HD3  6  
ATOM 9355  N N    . LYS A 1 3   ? -20.739 6.394   -7.927  1.00 0.00 ? 710 LYS A N    6  
ATOM 9356  C CA   . LYS A 1 3   ? -21.975 6.956   -7.439  1.00 0.00 ? 710 LYS A CA   6  
ATOM 9357  C C    . LYS A 1 3   ? -22.111 6.677   -5.945  1.00 0.00 ? 710 LYS A C    6  
ATOM 9358  O O    . LYS A 1 3   ? -22.707 7.455   -5.208  1.00 0.00 ? 710 LYS A O    6  
ATOM 9359  C CB   . LYS A 1 3   ? -23.194 6.395   -8.215  1.00 0.00 ? 710 LYS A CB   6  
ATOM 9360  C CG   . LYS A 1 3   ? -24.543 6.846   -7.654  1.00 0.00 ? 710 LYS A CG   6  
ATOM 9361  C CD   . LYS A 1 3   ? -24.712 8.358   -7.729  1.00 0.00 ? 710 LYS A CD   6  
ATOM 9362  C CE   . LYS A 1 3   ? -25.791 8.841   -6.779  1.00 0.00 ? 710 LYS A CE   6  
ATOM 9363  N NZ   . LYS A 1 3   ? -27.104 8.213   -7.022  1.00 0.00 ? 710 LYS A NZ   6  
ATOM 9364  H H    . LYS A 1 3   ? -20.733 5.477   -8.281  1.00 0.00 ? 710 LYS A H    6  
ATOM 9365  H HA   . LYS A 1 3   ? -21.919 8.023   -7.589  1.00 0.00 ? 710 LYS A HA   6  
ATOM 9366  H HB2  . LYS A 1 3   ? -23.131 6.717   -9.244  1.00 0.00 ? 710 LYS A HB2  6  
ATOM 9367  H HB3  . LYS A 1 3   ? -23.157 5.317   -8.183  1.00 0.00 ? 710 LYS A HB3  6  
ATOM 9368  H HG2  . LYS A 1 3   ? -25.338 6.378   -8.216  1.00 0.00 ? 710 LYS A HG2  6  
ATOM 9369  H HG3  . LYS A 1 3   ? -24.609 6.537   -6.620  1.00 0.00 ? 710 LYS A HG3  6  
ATOM 9370  H HD2  . LYS A 1 3   ? -23.781 8.833   -7.461  1.00 0.00 ? 710 LYS A HD2  6  
ATOM 9371  H HD3  . LYS A 1 3   ? -24.982 8.633   -8.736  1.00 0.00 ? 710 LYS A HD3  6  
ATOM 9372  H HE2  . LYS A 1 3   ? -25.482 8.608   -5.771  1.00 0.00 ? 710 LYS A HE2  6  
ATOM 9373  H HE3  . LYS A 1 3   ? -25.885 9.913   -6.877  1.00 0.00 ? 710 LYS A HE3  6  
ATOM 9374  H HZ1  . LYS A 1 3   ? -27.450 8.417   -7.979  1.00 0.00 ? 710 LYS A HZ1  6  
ATOM 9375  H HZ2  . LYS A 1 3   ? -27.795 8.587   -6.342  1.00 0.00 ? 710 LYS A HZ2  6  
ATOM 9376  H HZ3  . LYS A 1 3   ? -27.076 7.183   -6.891  1.00 0.00 ? 710 LYS A HZ3  6  
ATOM 9377  N N    . ALA A 1 4   ? -21.531 5.592   -5.513  1.00 0.00 ? 711 ALA A N    6  
ATOM 9378  C CA   . ALA A 1 4   ? -21.609 5.178   -4.133  1.00 0.00 ? 711 ALA A CA   6  
ATOM 9379  C C    . ALA A 1 4   ? -20.657 5.977   -3.261  1.00 0.00 ? 711 ALA A C    6  
ATOM 9380  O O    . ALA A 1 4   ? -19.481 6.137   -3.599  1.00 0.00 ? 711 ALA A O    6  
ATOM 9381  C CB   . ALA A 1 4   ? -21.300 3.702   -4.026  1.00 0.00 ? 711 ALA A CB   6  
ATOM 9382  H H    . ALA A 1 4   ? -21.021 5.046   -6.149  1.00 0.00 ? 711 ALA A H    6  
ATOM 9383  H HA   . ALA A 1 4   ? -22.621 5.333   -3.791  1.00 0.00 ? 711 ALA A HA   6  
ATOM 9384  H HB1  . ALA A 1 4   ? -22.010 3.143   -4.621  1.00 0.00 ? 711 ALA A HB1  6  
ATOM 9385  H HB2  . ALA A 1 4   ? -21.363 3.393   -2.994  1.00 0.00 ? 711 ALA A HB2  6  
ATOM 9386  H HB3  . ALA A 1 4   ? -20.302 3.518   -4.394  1.00 0.00 ? 711 ALA A HB3  6  
ATOM 9387  N N    . SER A 1 5   ? -21.168 6.482   -2.159  1.00 0.00 ? 712 SER A N    6  
ATOM 9388  C CA   . SER A 1 5   ? -20.370 7.208   -1.205  1.00 0.00 ? 712 SER A CA   6  
ATOM 9389  C C    . SER A 1 5   ? -19.406 6.243   -0.518  1.00 0.00 ? 712 SER A C    6  
ATOM 9390  O O    . SER A 1 5   ? -19.828 5.250   0.106   1.00 0.00 ? 712 SER A O    6  
ATOM 9391  C CB   . SER A 1 5   ? -21.288 7.880   -0.189  1.00 0.00 ? 712 SER A CB   6  
ATOM 9392  O OG   . SER A 1 5   ? -22.228 8.722   -0.850  1.00 0.00 ? 712 SER A OG   6  
ATOM 9393  H H    . SER A 1 5   ? -22.123 6.357   -1.974  1.00 0.00 ? 712 SER A H    6  
ATOM 9394  H HA   . SER A 1 5   ? -19.809 7.962   -1.734  1.00 0.00 ? 712 SER A HA   6  
ATOM 9395  H HB2  . SER A 1 5   ? -21.829 7.125   0.362   1.00 0.00 ? 712 SER A HB2  6  
ATOM 9396  H HB3  . SER A 1 5   ? -20.707 8.479   0.495   1.00 0.00 ? 712 SER A HB3  6  
ATOM 9397  H HG   . SER A 1 5   ? -22.085 8.633   -1.803  1.00 0.00 ? 712 SER A HG   6  
ATOM 9398  N N    . LEU A 1 6   ? -18.136 6.500   -0.670  1.00 0.00 ? 713 LEU A N    6  
ATOM 9399  C CA   . LEU A 1 6   ? -17.116 5.649   -0.137  1.00 0.00 ? 713 LEU A CA   6  
ATOM 9400  C C    . LEU A 1 6   ? -16.821 6.055   1.295   1.00 0.00 ? 713 LEU A C    6  
ATOM 9401  O O    . LEU A 1 6   ? -16.088 7.020   1.530   1.00 0.00 ? 713 LEU A O    6  
ATOM 9402  C CB   . LEU A 1 6   ? -15.837 5.735   -1.022  1.00 0.00 ? 713 LEU A CB   6  
ATOM 9403  C CG   . LEU A 1 6   ? -14.741 4.642   -0.858  1.00 0.00 ? 713 LEU A CG   6  
ATOM 9404  C CD1  . LEU A 1 6   ? -13.646 4.849   -1.881  1.00 0.00 ? 713 LEU A CD1  6  
ATOM 9405  C CD2  . LEU A 1 6   ? -14.123 4.638   0.527   1.00 0.00 ? 713 LEU A CD2  6  
ATOM 9406  H H    . LEU A 1 6   ? -17.868 7.308   -1.158  1.00 0.00 ? 713 LEU A H    6  
ATOM 9407  H HA   . LEU A 1 6   ? -17.480 4.632   -0.149  1.00 0.00 ? 713 LEU A HA   6  
ATOM 9408  H HB2  . LEU A 1 6   ? -16.149 5.723   -2.054  1.00 0.00 ? 713 LEU A HB2  6  
ATOM 9409  H HB3  . LEU A 1 6   ? -15.378 6.695   -0.831  1.00 0.00 ? 713 LEU A HB3  6  
ATOM 9410  H HG   . LEU A 1 6   ? -15.184 3.675   -1.045  1.00 0.00 ? 713 LEU A HG   6  
ATOM 9411  H HD11 . LEU A 1 6   ? -13.178 5.810   -1.719  1.00 0.00 ? 713 LEU A HD11 6  
ATOM 9412  H HD12 . LEU A 1 6   ? -14.058 4.813   -2.878  1.00 0.00 ? 713 LEU A HD12 6  
ATOM 9413  H HD13 . LEU A 1 6   ? -12.901 4.075   -1.769  1.00 0.00 ? 713 LEU A HD13 6  
ATOM 9414  H HD21 . LEU A 1 6   ? -14.895 4.467   1.263   1.00 0.00 ? 713 LEU A HD21 6  
ATOM 9415  H HD22 . LEU A 1 6   ? -13.636 5.585   0.708   1.00 0.00 ? 713 LEU A HD22 6  
ATOM 9416  H HD23 . LEU A 1 6   ? -13.392 3.845   0.581   1.00 0.00 ? 713 LEU A HD23 6  
ATOM 9417  N N    . ARG A 1 7   ? -17.445 5.355   2.236   1.00 0.00 ? 714 ARG A N    6  
ATOM 9418  C CA   . ARG A 1 7   ? -17.175 5.526   3.670   1.00 0.00 ? 714 ARG A CA   6  
ATOM 9419  C C    . ARG A 1 7   ? -17.907 4.483   4.504   1.00 0.00 ? 714 ARG A C    6  
ATOM 9420  O O    . ARG A 1 7   ? -17.310 3.843   5.368   1.00 0.00 ? 714 ARG A O    6  
ATOM 9421  C CB   . ARG A 1 7   ? -17.451 6.964   4.187   1.00 0.00 ? 714 ARG A CB   6  
ATOM 9422  C CG   . ARG A 1 7   ? -18.842 7.497   3.928   1.00 0.00 ? 714 ARG A CG   6  
ATOM 9423  C CD   . ARG A 1 7   ? -18.967 8.920   4.411   1.00 0.00 ? 714 ARG A CD   6  
ATOM 9424  N NE   . ARG A 1 7   ? -20.287 9.481   4.125   1.00 0.00 ? 714 ARG A NE   6  
ATOM 9425  C CZ   . ARG A 1 7   ? -20.588 10.780  4.179   1.00 0.00 ? 714 ARG A CZ   6  
ATOM 9426  N NH1  . ARG A 1 7   ? -19.651 11.678  4.500   1.00 0.00 ? 714 ARG A NH1  6  
ATOM 9427  N NH2  . ARG A 1 7   ? -21.820 11.178  3.895   1.00 0.00 ? 714 ARG A NH2  6  
ATOM 9428  H H    . ARG A 1 7   ? -18.119 4.705   1.946   1.00 0.00 ? 714 ARG A H    6  
ATOM 9429  H HA   . ARG A 1 7   ? -16.121 5.316   3.785   1.00 0.00 ? 714 ARG A HA   6  
ATOM 9430  H HB2  . ARG A 1 7   ? -17.287 6.982   5.255   1.00 0.00 ? 714 ARG A HB2  6  
ATOM 9431  H HB3  . ARG A 1 7   ? -16.740 7.631   3.724   1.00 0.00 ? 714 ARG A HB3  6  
ATOM 9432  H HG2  . ARG A 1 7   ? -19.040 7.467   2.867   1.00 0.00 ? 714 ARG A HG2  6  
ATOM 9433  H HG3  . ARG A 1 7   ? -19.559 6.880   4.450   1.00 0.00 ? 714 ARG A HG3  6  
ATOM 9434  H HD2  . ARG A 1 7   ? -18.808 8.941   5.478   1.00 0.00 ? 714 ARG A HD2  6  
ATOM 9435  H HD3  . ARG A 1 7   ? -18.217 9.523   3.921   1.00 0.00 ? 714 ARG A HD3  6  
ATOM 9436  H HE   . ARG A 1 7   ? -20.974 8.820   3.874   1.00 0.00 ? 714 ARG A HE   6  
ATOM 9437  H HH11 . ARG A 1 7   ? -18.706 11.416  4.708   1.00 0.00 ? 714 ARG A HH11 6  
ATOM 9438  H HH12 . ARG A 1 7   ? -19.846 12.662  4.537   1.00 0.00 ? 714 ARG A HH12 6  
ATOM 9439  H HH21 . ARG A 1 7   ? -22.530 10.517  3.638   1.00 0.00 ? 714 ARG A HH21 6  
ATOM 9440  H HH22 . ARG A 1 7   ? -22.099 12.143  3.915   1.00 0.00 ? 714 ARG A HH22 6  
ATOM 9441  N N    . LEU A 1 8   ? -19.179 4.287   4.235   1.00 0.00 ? 715 LEU A N    6  
ATOM 9442  C CA   . LEU A 1 8   ? -19.964 3.320   4.974   1.00 0.00 ? 715 LEU A CA   6  
ATOM 9443  C C    . LEU A 1 8   ? -20.378 2.189   4.052   1.00 0.00 ? 715 LEU A C    6  
ATOM 9444  O O    . LEU A 1 8   ? -21.004 2.421   3.016   1.00 0.00 ? 715 LEU A O    6  
ATOM 9445  C CB   . LEU A 1 8   ? -21.195 3.995   5.601   1.00 0.00 ? 715 LEU A CB   6  
ATOM 9446  C CG   . LEU A 1 8   ? -22.118 3.100   6.445   1.00 0.00 ? 715 LEU A CG   6  
ATOM 9447  C CD1  . LEU A 1 8   ? -21.372 2.513   7.637   1.00 0.00 ? 715 LEU A CD1  6  
ATOM 9448  C CD2  . LEU A 1 8   ? -23.332 3.888   6.911   1.00 0.00 ? 715 LEU A CD2  6  
ATOM 9449  H H    . LEU A 1 8   ? -19.635 4.800   3.532   1.00 0.00 ? 715 LEU A H    6  
ATOM 9450  H HA   . LEU A 1 8   ? -19.340 2.920   5.759   1.00 0.00 ? 715 LEU A HA   6  
ATOM 9451  H HB2  . LEU A 1 8   ? -20.852 4.807   6.226   1.00 0.00 ? 715 LEU A HB2  6  
ATOM 9452  H HB3  . LEU A 1 8   ? -21.783 4.417   4.801   1.00 0.00 ? 715 LEU A HB3  6  
ATOM 9453  H HG   . LEU A 1 8   ? -22.463 2.278   5.834   1.00 0.00 ? 715 LEU A HG   6  
ATOM 9454  H HD11 . LEU A 1 8   ? -22.045 1.904   8.222   1.00 0.00 ? 715 LEU A HD11 6  
ATOM 9455  H HD12 . LEU A 1 8   ? -20.990 3.313   8.252   1.00 0.00 ? 715 LEU A HD12 6  
ATOM 9456  H HD13 . LEU A 1 8   ? -20.553 1.904   7.284   1.00 0.00 ? 715 LEU A HD13 6  
ATOM 9457  H HD21 . LEU A 1 8   ? -23.970 3.250   7.505   1.00 0.00 ? 715 LEU A HD21 6  
ATOM 9458  H HD22 . LEU A 1 8   ? -23.880 4.246   6.053   1.00 0.00 ? 715 LEU A HD22 6  
ATOM 9459  H HD23 . LEU A 1 8   ? -23.008 4.728   7.508   1.00 0.00 ? 715 LEU A HD23 6  
ATOM 9460  N N    . GLY A 1 9   ? -20.007 0.987   4.413   1.00 0.00 ? 716 GLY A N    6  
ATOM 9461  C CA   . GLY A 1 9   ? -20.334 -0.168  3.607   1.00 0.00 ? 716 GLY A CA   6  
ATOM 9462  C C    . GLY A 1 9   ? -19.126 -0.652  2.854   1.00 0.00 ? 716 GLY A C    6  
ATOM 9463  O O    . GLY A 1 9   ? -19.199 -1.587  2.052   1.00 0.00 ? 716 GLY A O    6  
ATOM 9464  H H    . GLY A 1 9   ? -19.489 0.868   5.240   1.00 0.00 ? 716 GLY A H    6  
ATOM 9465  H HA2  . GLY A 1 9   ? -20.697 -0.957  4.248   1.00 0.00 ? 716 GLY A HA2  6  
ATOM 9466  H HA3  . GLY A 1 9   ? -21.104 0.101   2.898   1.00 0.00 ? 716 GLY A HA3  6  
ATOM 9467  N N    . PHE A 1 10  ? -18.010 -0.025  3.122   1.00 0.00 ? 717 PHE A N    6  
ATOM 9468  C CA   . PHE A 1 10  ? -16.767 -0.355  2.482   1.00 0.00 ? 717 PHE A CA   6  
ATOM 9469  C C    . PHE A 1 10  ? -15.841 -1.023  3.460   1.00 0.00 ? 717 PHE A C    6  
ATOM 9470  O O    . PHE A 1 10  ? -14.846 -0.439  3.898   1.00 0.00 ? 717 PHE A O    6  
ATOM 9471  C CB   . PHE A 1 10  ? -16.106 0.869   1.834   1.00 0.00 ? 717 PHE A CB   6  
ATOM 9472  C CG   . PHE A 1 10  ? -16.767 1.338   0.568   1.00 0.00 ? 717 PHE A CG   6  
ATOM 9473  C CD1  . PHE A 1 10  ? -17.956 2.042   0.598   1.00 0.00 ? 717 PHE A CD1  6  
ATOM 9474  C CD2  . PHE A 1 10  ? -16.190 1.061   -0.661  1.00 0.00 ? 717 PHE A CD2  6  
ATOM 9475  C CE1  . PHE A 1 10  ? -18.553 2.461   -0.571  1.00 0.00 ? 717 PHE A CE1  6  
ATOM 9476  C CE2  . PHE A 1 10  ? -16.784 1.478   -1.831  1.00 0.00 ? 717 PHE A CE2  6  
ATOM 9477  C CZ   . PHE A 1 10  ? -17.968 2.180   -1.787  1.00 0.00 ? 717 PHE A CZ   6  
ATOM 9478  H H    . PHE A 1 10  ? -18.015 0.666   3.818   1.00 0.00 ? 717 PHE A H    6  
ATOM 9479  H HA   . PHE A 1 10  ? -16.993 -1.076  1.711   1.00 0.00 ? 717 PHE A HA   6  
ATOM 9480  H HB2  . PHE A 1 10  ? -16.124 1.690   2.536   1.00 0.00 ? 717 PHE A HB2  6  
ATOM 9481  H HB3  . PHE A 1 10  ? -15.080 0.621   1.605   1.00 0.00 ? 717 PHE A HB3  6  
ATOM 9482  H HD1  . PHE A 1 10  ? -18.418 2.263   1.549   1.00 0.00 ? 717 PHE A HD1  6  
ATOM 9483  H HD2  . PHE A 1 10  ? -15.261 0.511   -0.698  1.00 0.00 ? 717 PHE A HD2  6  
ATOM 9484  H HE1  . PHE A 1 10  ? -19.480 3.013   -0.534  1.00 0.00 ? 717 PHE A HE1  6  
ATOM 9485  H HE2  . PHE A 1 10  ? -16.321 1.254   -2.780  1.00 0.00 ? 717 PHE A HE2  6  
ATOM 9486  H HZ   . PHE A 1 10  ? -18.435 2.509   -2.702  1.00 0.00 ? 717 PHE A HZ   6  
ATOM 9487  N N    . SER A 1 11  ? -16.198 -2.231  3.824   1.00 0.00 ? 718 SER A N    6  
ATOM 9488  C CA   . SER A 1 11  ? -15.449 -3.012  4.760   1.00 0.00 ? 718 SER A CA   6  
ATOM 9489  C C    . SER A 1 11  ? -14.087 -3.334  4.164   1.00 0.00 ? 718 SER A C    6  
ATOM 9490  O O    . SER A 1 11  ? -13.053 -3.191  4.816   1.00 0.00 ? 718 SER A O    6  
ATOM 9491  C CB   . SER A 1 11  ? -16.223 -4.302  5.035   1.00 0.00 ? 718 SER A CB   6  
ATOM 9492  O OG   . SER A 1 11  ? -17.600 -4.011  5.290   1.00 0.00 ? 718 SER A OG   6  
ATOM 9493  H H    . SER A 1 11  ? -17.012 -2.634  3.454   1.00 0.00 ? 718 SER A H    6  
ATOM 9494  H HA   . SER A 1 11  ? -15.339 -2.464  5.683   1.00 0.00 ? 718 SER A HA   6  
ATOM 9495  H HB2  . SER A 1 11  ? -16.154 -4.949  4.173   1.00 0.00 ? 718 SER A HB2  6  
ATOM 9496  H HB3  . SER A 1 11  ? -15.806 -4.801  5.896   1.00 0.00 ? 718 SER A HB3  6  
ATOM 9497  H HG   . SER A 1 11  ? -18.128 -4.691  4.856   1.00 0.00 ? 718 SER A HG   6  
ATOM 9498  N N    . GLU A 1 12  ? -14.096 -3.662  2.884   1.00 0.00 ? 719 GLU A N    6  
ATOM 9499  C CA   . GLU A 1 12  ? -12.915 -4.099  2.200   1.00 0.00 ? 719 GLU A CA   6  
ATOM 9500  C C    . GLU A 1 12  ? -11.953 -2.964  1.970   1.00 0.00 ? 719 GLU A C    6  
ATOM 9501  O O    . GLU A 1 12  ? -10.773 -3.091  2.277   1.00 0.00 ? 719 GLU A O    6  
ATOM 9502  C CB   . GLU A 1 12  ? -13.230 -4.858  0.885   1.00 0.00 ? 719 GLU A CB   6  
ATOM 9503  C CG   . GLU A 1 12  ? -13.989 -4.075  -0.205  1.00 0.00 ? 719 GLU A CG   6  
ATOM 9504  C CD   . GLU A 1 12  ? -15.410 -3.759  0.143   1.00 0.00 ? 719 GLU A CD   6  
ATOM 9505  O OE1  . GLU A 1 12  ? -15.662 -2.712  0.739   1.00 0.00 ? 719 GLU A OE1  6  
ATOM 9506  O OE2  . GLU A 1 12  ? -16.301 -4.562  -0.167  1.00 0.00 ? 719 GLU A OE2  6  
ATOM 9507  H H    . GLU A 1 12  ? -14.936 -3.555  2.381   1.00 0.00 ? 719 GLU A H    6  
ATOM 9508  H HA   . GLU A 1 12  ? -12.391 -4.774  2.860   1.00 0.00 ? 719 GLU A HA   6  
ATOM 9509  H HB2  . GLU A 1 12  ? -12.300 -5.195  0.453   1.00 0.00 ? 719 GLU A HB2  6  
ATOM 9510  H HB3  . GLU A 1 12  ? -13.816 -5.729  1.141   1.00 0.00 ? 719 GLU A HB3  6  
ATOM 9511  H HG2  . GLU A 1 12  ? -13.478 -3.138  -0.368  1.00 0.00 ? 719 GLU A HG2  6  
ATOM 9512  H HG3  . GLU A 1 12  ? -13.982 -4.639  -1.126  1.00 0.00 ? 719 GLU A HG3  6  
ATOM 9513  N N    . TYR A 1 13  ? -12.460 -1.848  1.494   1.00 0.00 ? 720 TYR A N    6  
ATOM 9514  C CA   . TYR A 1 13  ? -11.611 -0.712  1.209   1.00 0.00 ? 720 TYR A CA   6  
ATOM 9515  C C    . TYR A 1 13  ? -11.013 -0.175  2.498   1.00 0.00 ? 720 TYR A C    6  
ATOM 9516  O O    . TYR A 1 13  ? -9.833  0.165   2.542   1.00 0.00 ? 720 TYR A O    6  
ATOM 9517  C CB   . TYR A 1 13  ? -12.387 0.373   0.475   1.00 0.00 ? 720 TYR A CB   6  
ATOM 9518  C CG   . TYR A 1 13  ? -11.545 1.550   0.037   1.00 0.00 ? 720 TYR A CG   6  
ATOM 9519  C CD1  . TYR A 1 13  ? -10.897 1.547   -1.187  1.00 0.00 ? 720 TYR A CD1  6  
ATOM 9520  C CD2  . TYR A 1 13  ? -11.414 2.672   0.840   1.00 0.00 ? 720 TYR A CD2  6  
ATOM 9521  C CE1  . TYR A 1 13  ? -10.152 2.629   -1.598  1.00 0.00 ? 720 TYR A CE1  6  
ATOM 9522  C CE2  . TYR A 1 13  ? -10.666 3.753   0.438   1.00 0.00 ? 720 TYR A CE2  6  
ATOM 9523  C CZ   . TYR A 1 13  ? -10.040 3.731   -0.782  1.00 0.00 ? 720 TYR A CZ   6  
ATOM 9524  O OH   . TYR A 1 13  ? -9.314  4.823   -1.211  1.00 0.00 ? 720 TYR A OH   6  
ATOM 9525  H H    . TYR A 1 13  ? -13.428 -1.795  1.338   1.00 0.00 ? 720 TYR A H    6  
ATOM 9526  H HA   . TYR A 1 13  ? -10.805 -1.059  0.579   1.00 0.00 ? 720 TYR A HA   6  
ATOM 9527  H HB2  . TYR A 1 13  ? -12.850 -0.047  -0.405  1.00 0.00 ? 720 TYR A HB2  6  
ATOM 9528  H HB3  . TYR A 1 13  ? -13.155 0.749   1.132   1.00 0.00 ? 720 TYR A HB3  6  
ATOM 9529  H HD1  . TYR A 1 13  ? -10.987 0.681   -1.827  1.00 0.00 ? 720 TYR A HD1  6  
ATOM 9530  H HD2  . TYR A 1 13  ? -11.907 2.687   1.801   1.00 0.00 ? 720 TYR A HD2  6  
ATOM 9531  H HE1  . TYR A 1 13  ? -9.654  2.609   -2.557  1.00 0.00 ? 720 TYR A HE1  6  
ATOM 9532  H HE2  . TYR A 1 13  ? -10.590 4.614   1.084   1.00 0.00 ? 720 TYR A HE2  6  
ATOM 9533  H HH   . TYR A 1 13  ? -9.740  5.004   -2.070  1.00 0.00 ? 720 TYR A HH   6  
ATOM 9534  N N    . SER A 1 14  ? -11.820 -0.170  3.559   1.00 0.00 ? 721 SER A N    6  
ATOM 9535  C CA   . SER A 1 14  ? -11.373 0.303   4.842   1.00 0.00 ? 721 SER A CA   6  
ATOM 9536  C C    . SER A 1 14  ? -10.216 -0.569  5.341   1.00 0.00 ? 721 SER A C    6  
ATOM 9537  O O    . SER A 1 14  ? -9.288  -0.063  5.918   1.00 0.00 ? 721 SER A O    6  
ATOM 9538  C CB   . SER A 1 14  ? -12.540 0.331   5.855   1.00 0.00 ? 721 SER A CB   6  
ATOM 9539  O OG   . SER A 1 14  ? -12.183 0.992   7.070   1.00 0.00 ? 721 SER A OG   6  
ATOM 9540  H H    . SER A 1 14  ? -12.745 -0.487  3.482   1.00 0.00 ? 721 SER A H    6  
ATOM 9541  H HA   . SER A 1 14  ? -11.002 1.309   4.703   1.00 0.00 ? 721 SER A HA   6  
ATOM 9542  H HB2  . SER A 1 14  ? -13.378 0.852   5.416   1.00 0.00 ? 721 SER A HB2  6  
ATOM 9543  H HB3  . SER A 1 14  ? -12.833 -0.683  6.083   1.00 0.00 ? 721 SER A HB3  6  
ATOM 9544  H HG   . SER A 1 14  ? -11.764 1.831   6.826   1.00 0.00 ? 721 SER A HG   6  
ATOM 9545  N N    . ARG A 1 15  ? -10.262 -1.878  5.054   1.00 0.00 ? 722 ARG A N    6  
ATOM 9546  C CA   . ARG A 1 15  ? -9.182  -2.790  5.449   1.00 0.00 ? 722 ARG A CA   6  
ATOM 9547  C C    . ARG A 1 15  ? -7.883  -2.471  4.711   1.00 0.00 ? 722 ARG A C    6  
ATOM 9548  O O    . ARG A 1 15  ? -6.798  -2.523  5.309   1.00 0.00 ? 722 ARG A O    6  
ATOM 9549  C CB   . ARG A 1 15  ? -9.566  -4.259  5.237   1.00 0.00 ? 722 ARG A CB   6  
ATOM 9550  C CG   . ARG A 1 15  ? -10.728 -4.739  6.080   1.00 0.00 ? 722 ARG A CG   6  
ATOM 9551  C CD   . ARG A 1 15  ? -10.437 -4.649  7.570   1.00 0.00 ? 722 ARG A CD   6  
ATOM 9552  N NE   . ARG A 1 15  ? -9.322  -5.515  7.978   1.00 0.00 ? 722 ARG A NE   6  
ATOM 9553  C CZ   . ARG A 1 15  ? -9.417  -6.490  8.894   1.00 0.00 ? 722 ARG A CZ   6  
ATOM 9554  N NH1  . ARG A 1 15  ? -10.580 -6.746  9.484   1.00 0.00 ? 722 ARG A NH1  6  
ATOM 9555  N NH2  . ARG A 1 15  ? -8.346  -7.202  9.217   1.00 0.00 ? 722 ARG A NH2  6  
ATOM 9556  H H    . ARG A 1 15  ? -11.042 -2.228  4.572   1.00 0.00 ? 722 ARG A H    6  
ATOM 9557  H HA   . ARG A 1 15  ? -9.002  -2.625  6.501   1.00 0.00 ? 722 ARG A HA   6  
ATOM 9558  H HB2  . ARG A 1 15  ? -9.824  -4.403  4.199   1.00 0.00 ? 722 ARG A HB2  6  
ATOM 9559  H HB3  . ARG A 1 15  ? -8.710  -4.875  5.467   1.00 0.00 ? 722 ARG A HB3  6  
ATOM 9560  H HG2  . ARG A 1 15  ? -11.593 -4.132  5.857   1.00 0.00 ? 722 ARG A HG2  6  
ATOM 9561  H HG3  . ARG A 1 15  ? -10.940 -5.768  5.824   1.00 0.00 ? 722 ARG A HG3  6  
ATOM 9562  H HD2  . ARG A 1 15  ? -10.201 -3.627  7.825   1.00 0.00 ? 722 ARG A HD2  6  
ATOM 9563  H HD3  . ARG A 1 15  ? -11.323 -4.947  8.107   1.00 0.00 ? 722 ARG A HD3  6  
ATOM 9564  H HE   . ARG A 1 15  ? -8.451  -5.337  7.557   1.00 0.00 ? 722 ARG A HE   6  
ATOM 9565  H HH11 . ARG A 1 15  ? -11.418 -6.237  9.283   1.00 0.00 ? 722 ARG A HH11 6  
ATOM 9566  H HH12 . ARG A 1 15  ? -10.653 -7.477  10.167  1.00 0.00 ? 722 ARG A HH12 6  
ATOM 9567  H HH21 . ARG A 1 15  ? -7.450  -7.037  8.800   1.00 0.00 ? 722 ARG A HH21 6  
ATOM 9568  H HH22 . ARG A 1 15  ? -8.399  -7.938  9.900   1.00 0.00 ? 722 ARG A HH22 6  
ATOM 9569  N N    . ILE A 1 16  ? -7.988  -2.140  3.427   1.00 0.00 ? 723 ILE A N    6  
ATOM 9570  C CA   . ILE A 1 16  ? -6.802  -1.748  2.653   1.00 0.00 ? 723 ILE A CA   6  
ATOM 9571  C C    . ILE A 1 16  ? -6.190  -0.440  3.218   1.00 0.00 ? 723 ILE A C    6  
ATOM 9572  O O    . ILE A 1 16  ? -4.979  -0.364  3.525   1.00 0.00 ? 723 ILE A O    6  
ATOM 9573  C CB   . ILE A 1 16  ? -7.083  -1.605  1.104   1.00 0.00 ? 723 ILE A CB   6  
ATOM 9574  C CG1  . ILE A 1 16  ? -7.123  -2.968  0.387   1.00 0.00 ? 723 ILE A CG1  6  
ATOM 9575  C CG2  . ILE A 1 16  ? -6.059  -0.706  0.419   1.00 0.00 ? 723 ILE A CG2  6  
ATOM 9576  C CD1  . ILE A 1 16  ? -8.268  -3.877  0.740   1.00 0.00 ? 723 ILE A CD1  6  
ATOM 9577  H H    . ILE A 1 16  ? -8.878  -2.175  3.009   1.00 0.00 ? 723 ILE A H    6  
ATOM 9578  H HA   . ILE A 1 16  ? -6.104  -2.559  2.808   1.00 0.00 ? 723 ILE A HA   6  
ATOM 9579  H HB   . ILE A 1 16  ? -8.050  -1.133  0.997   1.00 0.00 ? 723 ILE A HB   6  
ATOM 9580  H HG12 . ILE A 1 16  ? -7.194  -2.771  -0.669  1.00 0.00 ? 723 ILE A HG12 6  
ATOM 9581  H HG13 . ILE A 1 16  ? -6.198  -3.489  0.584   1.00 0.00 ? 723 ILE A HG13 6  
ATOM 9582  H HG21 . ILE A 1 16  ? -6.271  -0.666  -0.640  1.00 0.00 ? 723 ILE A HG21 6  
ATOM 9583  H HG22 . ILE A 1 16  ? -5.068  -1.103  0.576   1.00 0.00 ? 723 ILE A HG22 6  
ATOM 9584  H HG23 . ILE A 1 16  ? -6.119  0.288   0.836   1.00 0.00 ? 723 ILE A HG23 6  
ATOM 9585  H HD11 . ILE A 1 16  ? -8.193  -4.793  0.172   1.00 0.00 ? 723 ILE A HD11 6  
ATOM 9586  H HD12 . ILE A 1 16  ? -9.202  -3.384  0.515   1.00 0.00 ? 723 ILE A HD12 6  
ATOM 9587  H HD13 . ILE A 1 16  ? -8.230  -4.105  1.796   1.00 0.00 ? 723 ILE A HD13 6  
ATOM 9588  N N    . SER A 1 17  ? -7.025  0.565   3.379   1.00 0.00 ? 724 SER A N    6  
ATOM 9589  C CA   . SER A 1 17  ? -6.594  1.843   3.927   1.00 0.00 ? 724 SER A CA   6  
ATOM 9590  C C    . SER A 1 17  ? -6.103  1.681   5.380   1.00 0.00 ? 724 SER A C    6  
ATOM 9591  O O    . SER A 1 17  ? -5.177  2.383   5.826   1.00 0.00 ? 724 SER A O    6  
ATOM 9592  C CB   . SER A 1 17  ? -7.737  2.844   3.828   1.00 0.00 ? 724 SER A CB   6  
ATOM 9593  O OG   . SER A 1 17  ? -8.199  2.919   2.483   1.00 0.00 ? 724 SER A OG   6  
ATOM 9594  H H    . SER A 1 17  ? -7.961  0.466   3.090   1.00 0.00 ? 724 SER A H    6  
ATOM 9595  H HA   . SER A 1 17  ? -5.765  2.192   3.328   1.00 0.00 ? 724 SER A HA   6  
ATOM 9596  H HB2  . SER A 1 17  ? -8.551  2.532   4.466   1.00 0.00 ? 724 SER A HB2  6  
ATOM 9597  H HB3  . SER A 1 17  ? -7.391  3.821   4.130   1.00 0.00 ? 724 SER A HB3  6  
ATOM 9598  H HG   . SER A 1 17  ? -7.831  3.700   2.061   1.00 0.00 ? 724 SER A HG   6  
ATOM 9599  N N    . ASN A 1 18  ? -6.699  0.727   6.091   1.00 0.00 ? 725 ASN A N    6  
ATOM 9600  C CA   . ASN A 1 18  ? -6.317  0.397   7.461   1.00 0.00 ? 725 ASN A CA   6  
ATOM 9601  C C    . ASN A 1 18  ? -4.907  -0.158  7.465   1.00 0.00 ? 725 ASN A C    6  
ATOM 9602  O O    . ASN A 1 18  ? -4.125  0.153   8.351   1.00 0.00 ? 725 ASN A O    6  
ATOM 9603  C CB   . ASN A 1 18  ? -7.281  -0.627  8.062   1.00 0.00 ? 725 ASN A CB   6  
ATOM 9604  C CG   . ASN A 1 18  ? -7.100  -0.863  9.553   1.00 0.00 ? 725 ASN A CG   6  
ATOM 9605  O OD1  . ASN A 1 18  ? -7.305  -1.976  10.032  1.00 0.00 ? 725 ASN A OD1  6  
ATOM 9606  N ND2  . ASN A 1 18  ? -6.809  0.168   10.305  1.00 0.00 ? 725 ASN A ND2  6  
ATOM 9607  H H    . ASN A 1 18  ? -7.453  0.241   5.689   1.00 0.00 ? 725 ASN A H    6  
ATOM 9608  H HA   . ASN A 1 18  ? -6.340  1.303   8.050   1.00 0.00 ? 725 ASN A HA   6  
ATOM 9609  H HB2  . ASN A 1 18  ? -8.296  -0.299  7.894   1.00 0.00 ? 725 ASN A HB2  6  
ATOM 9610  H HB3  . ASN A 1 18  ? -7.136  -1.566  7.549   1.00 0.00 ? 725 ASN A HB3  6  
ATOM 9611  H HD21 . ASN A 1 18  ? -6.723  1.062   9.910   1.00 0.00 ? 725 ASN A HD21 6  
ATOM 9612  H HD22 . ASN A 1 18  ? -6.686  0.015   11.268  1.00 0.00 ? 725 ASN A HD22 6  
ATOM 9613  N N    . LEU A 1 19  ? -4.577  -0.966  6.443   1.00 0.00 ? 726 LEU A N    6  
ATOM 9614  C CA   . LEU A 1 19  ? -3.222  -1.470  6.262   1.00 0.00 ? 726 LEU A CA   6  
ATOM 9615  C C    . LEU A 1 19  ? -2.252  -0.323  6.183   1.00 0.00 ? 726 LEU A C    6  
ATOM 9616  O O    . LEU A 1 19  ? -1.233  -0.335  6.847   1.00 0.00 ? 726 LEU A O    6  
ATOM 9617  C CB   . LEU A 1 19  ? -3.120  -2.413  5.012   1.00 0.00 ? 726 LEU A CB   6  
ATOM 9618  C CG   . LEU A 1 19  ? -1.716  -2.592  4.346   1.00 0.00 ? 726 LEU A CG   6  
ATOM 9619  C CD1  . LEU A 1 19  ? -1.647  -3.891  3.607   1.00 0.00 ? 726 LEU A CD1  6  
ATOM 9620  C CD2  . LEU A 1 19  ? -1.451  -1.487  3.333   1.00 0.00 ? 726 LEU A CD2  6  
ATOM 9621  H H    . LEU A 1 19  ? -5.263  -1.222  5.789   1.00 0.00 ? 726 LEU A H    6  
ATOM 9622  H HA   . LEU A 1 19  ? -2.970  -2.039  7.145   1.00 0.00 ? 726 LEU A HA   6  
ATOM 9623  H HB2  . LEU A 1 19  ? -3.465  -3.393  5.309   1.00 0.00 ? 726 LEU A HB2  6  
ATOM 9624  H HB3  . LEU A 1 19  ? -3.803  -2.041  4.263   1.00 0.00 ? 726 LEU A HB3  6  
ATOM 9625  H HG   . LEU A 1 19  ? -0.935  -2.559  5.092   1.00 0.00 ? 726 LEU A HG   6  
ATOM 9626  H HD11 . LEU A 1 19  ? -1.808  -4.703  4.301   1.00 0.00 ? 726 LEU A HD11 6  
ATOM 9627  H HD12 . LEU A 1 19  ? -0.676  -3.996  3.147   1.00 0.00 ? 726 LEU A HD12 6  
ATOM 9628  H HD13 . LEU A 1 19  ? -2.415  -3.915  2.847   1.00 0.00 ? 726 LEU A HD13 6  
ATOM 9629  H HD21 . LEU A 1 19  ? -1.491  -0.535  3.842   1.00 0.00 ? 726 LEU A HD21 6  
ATOM 9630  H HD22 . LEU A 1 19  ? -2.218  -1.515  2.573   1.00 0.00 ? 726 LEU A HD22 6  
ATOM 9631  H HD23 . LEU A 1 19  ? -0.481  -1.621  2.880   1.00 0.00 ? 726 LEU A HD23 6  
ATOM 9632  N N    . ILE A 1 20  ? -2.608  0.680   5.401   1.00 0.00 ? 727 ILE A N    6  
ATOM 9633  C CA   . ILE A 1 20  ? -1.756  1.839   5.205   1.00 0.00 ? 727 ILE A CA   6  
ATOM 9634  C C    . ILE A 1 20  ? -1.446  2.548   6.508   1.00 0.00 ? 727 ILE A C    6  
ATOM 9635  O O    . ILE A 1 20  ? -0.271  2.755   6.845   1.00 0.00 ? 727 ILE A O    6  
ATOM 9636  C CB   . ILE A 1 20  ? -2.325  2.813   4.124   1.00 0.00 ? 727 ILE A CB   6  
ATOM 9637  C CG1  . ILE A 1 20  ? -2.102  2.233   2.724   1.00 0.00 ? 727 ILE A CG1  6  
ATOM 9638  C CG2  . ILE A 1 20  ? -1.729  4.214   4.231   1.00 0.00 ? 727 ILE A CG2  6  
ATOM 9639  C CD1  . ILE A 1 20  ? -0.628  2.049   2.377   1.00 0.00 ? 727 ILE A CD1  6  
ATOM 9640  H H    . ILE A 1 20  ? -3.480  0.614   4.950   1.00 0.00 ? 727 ILE A H    6  
ATOM 9641  H HA   . ILE A 1 20  ? -0.813  1.455   4.849   1.00 0.00 ? 727 ILE A HA   6  
ATOM 9642  H HB   . ILE A 1 20  ? -3.389  2.899   4.288   1.00 0.00 ? 727 ILE A HB   6  
ATOM 9643  H HG12 . ILE A 1 20  ? -2.579  1.267   2.660   1.00 0.00 ? 727 ILE A HG12 6  
ATOM 9644  H HG13 . ILE A 1 20  ? -2.536  2.894   1.989   1.00 0.00 ? 727 ILE A HG13 6  
ATOM 9645  H HG21 . ILE A 1 20  ? -1.965  4.615   5.205   1.00 0.00 ? 727 ILE A HG21 6  
ATOM 9646  H HG22 . ILE A 1 20  ? -2.149  4.841   3.458   1.00 0.00 ? 727 ILE A HG22 6  
ATOM 9647  H HG23 . ILE A 1 20  ? -0.658  4.149   4.112   1.00 0.00 ? 727 ILE A HG23 6  
ATOM 9648  H HD11 . ILE A 1 20  ? -0.169  1.353   3.067   1.00 0.00 ? 727 ILE A HD11 6  
ATOM 9649  H HD12 . ILE A 1 20  ? -0.127  2.998   2.492   1.00 0.00 ? 727 ILE A HD12 6  
ATOM 9650  H HD13 . ILE A 1 20  ? -0.523  1.688   1.364   1.00 0.00 ? 727 ILE A HD13 6  
ATOM 9651  N N    . VAL A 1 21  ? -2.464  2.866   7.257   1.00 0.00 ? 728 VAL A N    6  
ATOM 9652  C CA   . VAL A 1 21  ? -2.251  3.553   8.502   1.00 0.00 ? 728 VAL A CA   6  
ATOM 9653  C C    . VAL A 1 21  ? -1.563  2.663   9.544   1.00 0.00 ? 728 VAL A C    6  
ATOM 9654  O O    . VAL A 1 21  ? -0.624  3.100   10.187  1.00 0.00 ? 728 VAL A O    6  
ATOM 9655  C CB   . VAL A 1 21  ? -3.521  4.249   9.065   1.00 0.00 ? 728 VAL A CB   6  
ATOM 9656  C CG1  . VAL A 1 21  ? -3.903  5.434   8.191   1.00 0.00 ? 728 VAL A CG1  6  
ATOM 9657  C CG2  . VAL A 1 21  ? -4.688  3.284   9.147   1.00 0.00 ? 728 VAL A CG2  6  
ATOM 9658  H H    . VAL A 1 21  ? -3.369  2.632   6.954   1.00 0.00 ? 728 VAL A H    6  
ATOM 9659  H HA   . VAL A 1 21  ? -1.533  4.318   8.242   1.00 0.00 ? 728 VAL A HA   6  
ATOM 9660  H HB   . VAL A 1 21  ? -3.299  4.613   10.057  1.00 0.00 ? 728 VAL A HB   6  
ATOM 9661  H HG11 . VAL A 1 21  ? -4.790  5.903   8.590   1.00 0.00 ? 728 VAL A HG11 6  
ATOM 9662  H HG12 . VAL A 1 21  ? -4.101  5.092   7.186   1.00 0.00 ? 728 VAL A HG12 6  
ATOM 9663  H HG13 . VAL A 1 21  ? -3.093  6.149   8.176   1.00 0.00 ? 728 VAL A HG13 6  
ATOM 9664  H HG21 . VAL A 1 21  ? -5.558  3.801   9.523   1.00 0.00 ? 728 VAL A HG21 6  
ATOM 9665  H HG22 . VAL A 1 21  ? -4.439  2.466   9.808   1.00 0.00 ? 728 VAL A HG22 6  
ATOM 9666  H HG23 . VAL A 1 21  ? -4.900  2.896   8.161   1.00 0.00 ? 728 VAL A HG23 6  
ATOM 9667  N N    . LEU A 1 22  ? -1.987  1.400   9.650   1.00 0.00 ? 729 LEU A N    6  
ATOM 9668  C CA   . LEU A 1 22  ? -1.381  0.442   10.586  1.00 0.00 ? 729 LEU A CA   6  
ATOM 9669  C C    . LEU A 1 22  ? 0.077   0.202   10.297  1.00 0.00 ? 729 LEU A C    6  
ATOM 9670  O O    . LEU A 1 22  ? 0.909   0.267   11.201  1.00 0.00 ? 729 LEU A O    6  
ATOM 9671  C CB   . LEU A 1 22  ? -2.100  -0.890  10.550  1.00 0.00 ? 729 LEU A CB   6  
ATOM 9672  C CG   . LEU A 1 22  ? -3.410  -0.968  11.292  1.00 0.00 ? 729 LEU A CG   6  
ATOM 9673  C CD1  . LEU A 1 22  ? -4.131  -2.226  10.877  1.00 0.00 ? 729 LEU A CD1  6  
ATOM 9674  C CD2  . LEU A 1 22  ? -3.153  -0.998  12.790  1.00 0.00 ? 729 LEU A CD2  6  
ATOM 9675  H H    . LEU A 1 22  ? -2.734  1.091   9.087   1.00 0.00 ? 729 LEU A H    6  
ATOM 9676  H HA   . LEU A 1 22  ? -1.486  0.849   11.579  1.00 0.00 ? 729 LEU A HA   6  
ATOM 9677  H HB2  . LEU A 1 22  ? -2.283  -1.140  9.515   1.00 0.00 ? 729 LEU A HB2  6  
ATOM 9678  H HB3  . LEU A 1 22  ? -1.436  -1.636  10.961  1.00 0.00 ? 729 LEU A HB3  6  
ATOM 9679  H HG   . LEU A 1 22  ? -4.002  -0.091  11.068  1.00 0.00 ? 729 LEU A HG   6  
ATOM 9680  H HD11 . LEU A 1 22  ? -3.524  -3.087  11.111  1.00 0.00 ? 729 LEU A HD11 6  
ATOM 9681  H HD12 . LEU A 1 22  ? -4.299  -2.183  9.809   1.00 0.00 ? 729 LEU A HD12 6  
ATOM 9682  H HD13 . LEU A 1 22  ? -5.079  -2.289  11.388  1.00 0.00 ? 729 LEU A HD13 6  
ATOM 9683  H HD21 . LEU A 1 22  ? -4.092  -1.072  13.318  1.00 0.00 ? 729 LEU A HD21 6  
ATOM 9684  H HD22 . LEU A 1 22  ? -2.642  -0.096  13.093  1.00 0.00 ? 729 LEU A HD22 6  
ATOM 9685  H HD23 . LEU A 1 22  ? -2.541  -1.855  13.032  1.00 0.00 ? 729 LEU A HD23 6  
ATOM 9686  N N    . HIS A 1 23  ? 0.383   -0.067  9.047   1.00 0.00 ? 730 HIS A N    6  
ATOM 9687  C CA   . HIS A 1 23  ? 1.730   -0.377  8.640   1.00 0.00 ? 730 HIS A CA   6  
ATOM 9688  C C    . HIS A 1 23  ? 2.642   0.799   8.885   1.00 0.00 ? 730 HIS A C    6  
ATOM 9689  O O    . HIS A 1 23  ? 3.674   0.650   9.513   1.00 0.00 ? 730 HIS A O    6  
ATOM 9690  C CB   . HIS A 1 23  ? 1.779   -0.841  7.169   1.00 0.00 ? 730 HIS A CB   6  
ATOM 9691  C CG   . HIS A 1 23  ? 3.150   -1.195  6.662   1.00 0.00 ? 730 HIS A CG   6  
ATOM 9692  N ND1  . HIS A 1 23  ? 3.772   -2.407  6.882   1.00 0.00 ? 730 HIS A ND1  6  
ATOM 9693  C CD2  . HIS A 1 23  ? 4.018   -0.463  5.927   1.00 0.00 ? 730 HIS A CD2  6  
ATOM 9694  C CE1  . HIS A 1 23  ? 4.959   -2.372  6.291   1.00 0.00 ? 730 HIS A CE1  6  
ATOM 9695  N NE2  . HIS A 1 23  ? 5.162   -1.211  5.693   1.00 0.00 ? 730 HIS A NE2  6  
ATOM 9696  H H    . HIS A 1 23  ? -0.324  -0.050  8.362   1.00 0.00 ? 730 HIS A H    6  
ATOM 9697  H HA   . HIS A 1 23  ? 2.062   -1.191  9.267   1.00 0.00 ? 730 HIS A HA   6  
ATOM 9698  H HB2  . HIS A 1 23  ? 1.160   -1.720  7.065   1.00 0.00 ? 730 HIS A HB2  6  
ATOM 9699  H HB3  . HIS A 1 23  ? 1.379   -0.058  6.542   1.00 0.00 ? 730 HIS A HB3  6  
ATOM 9700  H HD1  . HIS A 1 23  ? 3.439   -3.174  7.402   1.00 0.00 ? 730 HIS A HD1  6  
ATOM 9701  H HD2  . HIS A 1 23  ? 3.857   0.545   5.575   1.00 0.00 ? 730 HIS A HD2  6  
ATOM 9702  H HE1  . HIS A 1 23  ? 5.666   -3.188  6.298   1.00 0.00 ? 730 HIS A HE1  6  
ATOM 9703  N N    . LEU A 1 24  ? 2.258   1.971   8.438   1.00 0.00 ? 731 LEU A N    6  
ATOM 9704  C CA   . LEU A 1 24  ? 3.124   3.103   8.637   1.00 0.00 ? 731 LEU A CA   6  
ATOM 9705  C C    . LEU A 1 24  ? 3.220   3.473   10.141  1.00 0.00 ? 731 LEU A C    6  
ATOM 9706  O O    . LEU A 1 24  ? 4.317   3.763   10.634  1.00 0.00 ? 731 LEU A O    6  
ATOM 9707  C CB   . LEU A 1 24  ? 2.711   4.288   7.735   1.00 0.00 ? 731 LEU A CB   6  
ATOM 9708  C CG   . LEU A 1 24  ? 3.791   5.367   7.423   1.00 0.00 ? 731 LEU A CG   6  
ATOM 9709  C CD1  . LEU A 1 24  ? 4.126   6.235   8.624   1.00 0.00 ? 731 LEU A CD1  6  
ATOM 9710  C CD2  . LEU A 1 24  ? 5.061   4.710   6.883   1.00 0.00 ? 731 LEU A CD2  6  
ATOM 9711  H H    . LEU A 1 24  ? 1.411   2.069   7.942   1.00 0.00 ? 731 LEU A H    6  
ATOM 9712  H HA   . LEU A 1 24  ? 4.104   2.761   8.339   1.00 0.00 ? 731 LEU A HA   6  
ATOM 9713  H HB2  . LEU A 1 24  ? 2.374   3.879   6.793   1.00 0.00 ? 731 LEU A HB2  6  
ATOM 9714  H HB3  . LEU A 1 24  ? 1.872   4.782   8.201   1.00 0.00 ? 731 LEU A HB3  6  
ATOM 9715  H HG   . LEU A 1 24  ? 3.414   6.021   6.651   1.00 0.00 ? 731 LEU A HG   6  
ATOM 9716  H HD11 . LEU A 1 24  ? 4.883   6.954   8.349   1.00 0.00 ? 731 LEU A HD11 6  
ATOM 9717  H HD12 . LEU A 1 24  ? 4.495   5.612   9.426   1.00 0.00 ? 731 LEU A HD12 6  
ATOM 9718  H HD13 . LEU A 1 24  ? 3.235   6.751   8.947   1.00 0.00 ? 731 LEU A HD13 6  
ATOM 9719  H HD21 . LEU A 1 24  ? 5.776   5.487   6.654   1.00 0.00 ? 731 LEU A HD21 6  
ATOM 9720  H HD22 . LEU A 1 24  ? 4.840   4.147   5.989   1.00 0.00 ? 731 LEU A HD22 6  
ATOM 9721  H HD23 . LEU A 1 24  ? 5.491   4.047   7.620   1.00 0.00 ? 731 LEU A HD23 6  
ATOM 9722  N N    . ARG A 1 25  ? 2.102   3.394   10.885  1.00 0.00 ? 732 ARG A N    6  
ATOM 9723  C CA   . ARG A 1 25  ? 2.138   3.754   12.311  1.00 0.00 ? 732 ARG A CA   6  
ATOM 9724  C C    . ARG A 1 25  ? 2.960   2.767   13.127  1.00 0.00 ? 732 ARG A C    6  
ATOM 9725  O O    . ARG A 1 25  ? 3.523   3.140   14.154  1.00 0.00 ? 732 ARG A O    6  
ATOM 9726  C CB   . ARG A 1 25  ? 0.744   3.959   12.947  1.00 0.00 ? 732 ARG A CB   6  
ATOM 9727  C CG   . ARG A 1 25  ? -0.073  2.702   13.182  1.00 0.00 ? 732 ARG A CG   6  
ATOM 9728  C CD   . ARG A 1 25  ? -1.448  3.035   13.757  1.00 0.00 ? 732 ARG A CD   6  
ATOM 9729  N NE   . ARG A 1 25  ? -1.361  3.711   15.078  1.00 0.00 ? 732 ARG A NE   6  
ATOM 9730  C CZ   . ARG A 1 25  ? -2.367  4.397   15.665  1.00 0.00 ? 732 ARG A CZ   6  
ATOM 9731  N NH1  . ARG A 1 25  ? -3.544  4.498   15.068  1.00 0.00 ? 732 ARG A NH1  6  
ATOM 9732  N NH2  . ARG A 1 25  ? -2.187  4.972   16.847  1.00 0.00 ? 732 ARG A NH2  6  
ATOM 9733  H H    . ARG A 1 25  ? 1.253   3.117   10.474  1.00 0.00 ? 732 ARG A H    6  
ATOM 9734  H HA   . ARG A 1 25  ? 2.668   4.695   12.347  1.00 0.00 ? 732 ARG A HA   6  
ATOM 9735  H HB2  . ARG A 1 25  ? 0.860   4.458   13.897  1.00 0.00 ? 732 ARG A HB2  6  
ATOM 9736  H HB3  . ARG A 1 25  ? 0.188   4.602   12.285  1.00 0.00 ? 732 ARG A HB3  6  
ATOM 9737  H HG2  . ARG A 1 25  ? -0.188  2.194   12.237  1.00 0.00 ? 732 ARG A HG2  6  
ATOM 9738  H HG3  . ARG A 1 25  ? 0.460   2.065   13.873  1.00 0.00 ? 732 ARG A HG3  6  
ATOM 9739  H HD2  . ARG A 1 25  ? -1.957  3.683   13.059  1.00 0.00 ? 732 ARG A HD2  6  
ATOM 9740  H HD3  . ARG A 1 25  ? -2.017  2.120   13.853  1.00 0.00 ? 732 ARG A HD3  6  
ATOM 9741  H HE   . ARG A 1 25  ? -0.490  3.630   15.529  1.00 0.00 ? 732 ARG A HE   6  
ATOM 9742  H HH11 . ARG A 1 25  ? -3.729  4.074   14.179  1.00 0.00 ? 732 ARG A HH11 6  
ATOM 9743  H HH12 . ARG A 1 25  ? -4.312  5.018   15.459  1.00 0.00 ? 732 ARG A HH12 6  
ATOM 9744  H HH21 . ARG A 1 25  ? -1.319  4.930   17.355  1.00 0.00 ? 732 ARG A HH21 6  
ATOM 9745  H HH22 . ARG A 1 25  ? -2.933  5.479   17.287  1.00 0.00 ? 732 ARG A HH22 6  
ATOM 9746  N N    . LYS A 1 26  ? 3.009   1.505   12.705  1.00 0.00 ? 733 LYS A N    6  
ATOM 9747  C CA   . LYS A 1 26  ? 3.843   0.542   13.399  1.00 0.00 ? 733 LYS A CA   6  
ATOM 9748  C C    . LYS A 1 26  ? 5.305   0.833   13.093  1.00 0.00 ? 733 LYS A C    6  
ATOM 9749  O O    . LYS A 1 26  ? 6.114   0.924   13.990  1.00 0.00 ? 733 LYS A O    6  
ATOM 9750  C CB   . LYS A 1 26  ? 3.451   -0.931  13.092  1.00 0.00 ? 733 LYS A CB   6  
ATOM 9751  C CG   . LYS A 1 26  ? 3.705   -1.420  11.674  1.00 0.00 ? 733 LYS A CG   6  
ATOM 9752  C CD   . LYS A 1 26  ? 3.118   -2.810  11.414  1.00 0.00 ? 733 LYS A CD   6  
ATOM 9753  C CE   . LYS A 1 26  ? 3.723   -3.893  12.308  1.00 0.00 ? 733 LYS A CE   6  
ATOM 9754  N NZ   . LYS A 1 26  ? 5.188   -3.999  12.158  1.00 0.00 ? 733 LYS A NZ   6  
ATOM 9755  H H    . LYS A 1 26  ? 2.470   1.226   11.931  1.00 0.00 ? 733 LYS A H    6  
ATOM 9756  H HA   . LYS A 1 26  ? 3.704   0.740   14.453  1.00 0.00 ? 733 LYS A HA   6  
ATOM 9757  H HB2  . LYS A 1 26  ? 4.015   -1.572  13.751  1.00 0.00 ? 733 LYS A HB2  6  
ATOM 9758  H HB3  . LYS A 1 26  ? 2.398   -1.037  13.300  1.00 0.00 ? 733 LYS A HB3  6  
ATOM 9759  H HG2  . LYS A 1 26  ? 3.262   -0.717  10.984  1.00 0.00 ? 733 LYS A HG2  6  
ATOM 9760  H HG3  . LYS A 1 26  ? 4.771   -1.451  11.508  1.00 0.00 ? 733 LYS A HG3  6  
ATOM 9761  H HD2  . LYS A 1 26  ? 2.053   -2.776  11.588  1.00 0.00 ? 733 LYS A HD2  6  
ATOM 9762  H HD3  . LYS A 1 26  ? 3.298   -3.066  10.382  1.00 0.00 ? 733 LYS A HD3  6  
ATOM 9763  H HE2  . LYS A 1 26  ? 3.496   -3.663  13.337  1.00 0.00 ? 733 LYS A HE2  6  
ATOM 9764  H HE3  . LYS A 1 26  ? 3.273   -4.840  12.051  1.00 0.00 ? 733 LYS A HE3  6  
ATOM 9765  H HZ1  . LYS A 1 26  ? 5.544   -4.839  12.657  1.00 0.00 ? 733 LYS A HZ1  6  
ATOM 9766  H HZ2  . LYS A 1 26  ? 5.652   -3.202  12.656  1.00 0.00 ? 733 LYS A HZ2  6  
ATOM 9767  H HZ3  . LYS A 1 26  ? 5.509   -4.027  11.171  1.00 0.00 ? 733 LYS A HZ3  6  
ATOM 9768  N N    . VAL A 1 27  ? 5.590   1.069   11.820  1.00 0.00 ? 734 VAL A N    6  
ATOM 9769  C CA   . VAL A 1 27  ? 6.928   1.388   11.340  1.00 0.00 ? 734 VAL A CA   6  
ATOM 9770  C C    . VAL A 1 27  ? 7.562   2.553   12.110  1.00 0.00 ? 734 VAL A C    6  
ATOM 9771  O O    . VAL A 1 27  ? 8.680   2.418   12.630  1.00 0.00 ? 734 VAL A O    6  
ATOM 9772  C CB   . VAL A 1 27  ? 6.911   1.691   9.814   1.00 0.00 ? 734 VAL A CB   6  
ATOM 9773  C CG1  . VAL A 1 27  ? 8.195   2.339   9.380   1.00 0.00 ? 734 VAL A CG1  6  
ATOM 9774  C CG2  . VAL A 1 27  ? 6.707   0.411   9.026   1.00 0.00 ? 734 VAL A CG2  6  
ATOM 9775  H H    . VAL A 1 27  ? 4.856   1.003   11.171  1.00 0.00 ? 734 VAL A H    6  
ATOM 9776  H HA   . VAL A 1 27  ? 7.551   0.519   11.499  1.00 0.00 ? 734 VAL A HA   6  
ATOM 9777  H HB   . VAL A 1 27  ? 6.087   2.354   9.596   1.00 0.00 ? 734 VAL A HB   6  
ATOM 9778  H HG11 . VAL A 1 27  ? 8.287   3.300   9.864   1.00 0.00 ? 734 VAL A HG11 6  
ATOM 9779  H HG12 . VAL A 1 27  ? 8.216   2.452   8.306   1.00 0.00 ? 734 VAL A HG12 6  
ATOM 9780  H HG13 . VAL A 1 27  ? 9.007   1.707   9.709   1.00 0.00 ? 734 VAL A HG13 6  
ATOM 9781  H HG21 . VAL A 1 27  ? 7.523   -0.264  9.240   1.00 0.00 ? 734 VAL A HG21 6  
ATOM 9782  H HG22 . VAL A 1 27  ? 6.692   0.634   7.968   1.00 0.00 ? 734 VAL A HG22 6  
ATOM 9783  H HG23 . VAL A 1 27  ? 5.774   -0.047  9.317   1.00 0.00 ? 734 VAL A HG23 6  
ATOM 9784  N N    . GLU A 1 28  ? 6.852   3.665   12.208  1.00 0.00 ? 735 GLU A N    6  
ATOM 9785  C CA   . GLU A 1 28  ? 7.372   4.845   12.901  1.00 0.00 ? 735 GLU A CA   6  
ATOM 9786  C C    . GLU A 1 28  ? 7.536   4.587   14.407  1.00 0.00 ? 735 GLU A C    6  
ATOM 9787  O O    . GLU A 1 28  ? 8.446   5.116   15.051  1.00 0.00 ? 735 GLU A O    6  
ATOM 9788  C CB   . GLU A 1 28  ? 6.469   6.065   12.655  1.00 0.00 ? 735 GLU A CB   6  
ATOM 9789  C CG   . GLU A 1 28  ? 5.018   5.840   13.034  1.00 0.00 ? 735 GLU A CG   6  
ATOM 9790  C CD   . GLU A 1 28  ? 4.175   7.079   12.951  1.00 0.00 ? 735 GLU A CD   6  
ATOM 9791  O OE1  . GLU A 1 28  ? 3.663   7.405   11.865  1.00 0.00 ? 735 GLU A OE1  6  
ATOM 9792  O OE2  . GLU A 1 28  ? 3.993   7.743   13.987  1.00 0.00 ? 735 GLU A OE2  6  
ATOM 9793  H H    . GLU A 1 28  ? 5.958   3.693   11.798  1.00 0.00 ? 735 GLU A H    6  
ATOM 9794  H HA   . GLU A 1 28  ? 8.349   5.049   12.488  1.00 0.00 ? 735 GLU A HA   6  
ATOM 9795  H HB2  . GLU A 1 28  ? 6.838   6.903   13.226  1.00 0.00 ? 735 GLU A HB2  6  
ATOM 9796  H HB3  . GLU A 1 28  ? 6.505   6.316   11.605  1.00 0.00 ? 735 GLU A HB3  6  
ATOM 9797  H HG2  . GLU A 1 28  ? 4.614   5.107   12.351  1.00 0.00 ? 735 GLU A HG2  6  
ATOM 9798  H HG3  . GLU A 1 28  ? 4.979   5.448   14.040  1.00 0.00 ? 735 GLU A HG3  6  
ATOM 9799  N N    . GLU A 1 29  ? 6.680   3.749   14.940  1.00 0.00 ? 736 GLU A N    6  
ATOM 9800  C CA   . GLU A 1 29  ? 6.668   3.435   16.350  1.00 0.00 ? 736 GLU A CA   6  
ATOM 9801  C C    . GLU A 1 29  ? 7.815   2.500   16.707  1.00 0.00 ? 736 GLU A C    6  
ATOM 9802  O O    . GLU A 1 29  ? 8.564   2.749   17.655  1.00 0.00 ? 736 GLU A O    6  
ATOM 9803  C CB   . GLU A 1 29  ? 5.335   2.782   16.694  1.00 0.00 ? 736 GLU A CB   6  
ATOM 9804  C CG   . GLU A 1 29  ? 5.152   2.409   18.145  1.00 0.00 ? 736 GLU A CG   6  
ATOM 9805  C CD   . GLU A 1 29  ? 3.835   1.730   18.377  1.00 0.00 ? 736 GLU A CD   6  
ATOM 9806  O OE1  . GLU A 1 29  ? 2.805   2.426   18.465  1.00 0.00 ? 736 GLU A OE1  6  
ATOM 9807  O OE2  . GLU A 1 29  ? 3.800   0.489   18.460  1.00 0.00 ? 736 GLU A OE2  6  
ATOM 9808  H H    . GLU A 1 29  ? 6.026   3.313   14.351  1.00 0.00 ? 736 GLU A H    6  
ATOM 9809  H HA   . GLU A 1 29  ? 6.755   4.354   16.910  1.00 0.00 ? 736 GLU A HA   6  
ATOM 9810  H HB2  . GLU A 1 29  ? 4.548   3.470   16.426  1.00 0.00 ? 736 GLU A HB2  6  
ATOM 9811  H HB3  . GLU A 1 29  ? 5.228   1.891   16.094  1.00 0.00 ? 736 GLU A HB3  6  
ATOM 9812  H HG2  . GLU A 1 29  ? 5.942   1.729   18.427  1.00 0.00 ? 736 GLU A HG2  6  
ATOM 9813  H HG3  . GLU A 1 29  ? 5.201   3.300   18.753  1.00 0.00 ? 736 GLU A HG3  6  
ATOM 9814  N N    . GLU A 1 30  ? 7.963   1.461   15.926  1.00 0.00 ? 737 GLU A N    6  
ATOM 9815  C CA   . GLU A 1 30  ? 8.941   0.428   16.178  1.00 0.00 ? 737 GLU A CA   6  
ATOM 9816  C C    . GLU A 1 30  ? 10.344  0.918   15.856  1.00 0.00 ? 737 GLU A C    6  
ATOM 9817  O O    . GLU A 1 30  ? 11.258  0.781   16.672  1.00 0.00 ? 737 GLU A O    6  
ATOM 9818  C CB   . GLU A 1 30  ? 8.571   -0.827  15.390  1.00 0.00 ? 737 GLU A CB   6  
ATOM 9819  C CG   . GLU A 1 30  ? 7.186   -1.358  15.774  1.00 0.00 ? 737 GLU A CG   6  
ATOM 9820  C CD   . GLU A 1 30  ? 6.707   -2.503  14.924  1.00 0.00 ? 737 GLU A CD   6  
ATOM 9821  O OE1  . GLU A 1 30  ? 6.385   -2.293  13.749  1.00 0.00 ? 737 GLU A OE1  6  
ATOM 9822  O OE2  . GLU A 1 30  ? 6.627   -3.645  15.426  1.00 0.00 ? 737 GLU A OE2  6  
ATOM 9823  H H    . GLU A 1 30  ? 7.385   1.376   15.132  1.00 0.00 ? 737 GLU A H    6  
ATOM 9824  H HA   . GLU A 1 30  ? 8.898   0.199   17.232  1.00 0.00 ? 737 GLU A HA   6  
ATOM 9825  H HB2  . GLU A 1 30  ? 8.581   -0.580  14.338  1.00 0.00 ? 737 GLU A HB2  6  
ATOM 9826  H HB3  . GLU A 1 30  ? 9.302   -1.598  15.583  1.00 0.00 ? 737 GLU A HB3  6  
ATOM 9827  H HG2  . GLU A 1 30  ? 7.218   -1.693  16.800  1.00 0.00 ? 737 GLU A HG2  6  
ATOM 9828  H HG3  . GLU A 1 30  ? 6.478   -0.546  15.693  1.00 0.00 ? 737 GLU A HG3  6  
ATOM 9829  N N    . GLU A 1 31  ? 10.515  1.529   14.705  1.00 0.00 ? 738 GLU A N    6  
ATOM 9830  C CA   . GLU A 1 31  ? 11.807  2.053   14.356  1.00 0.00 ? 738 GLU A CA   6  
ATOM 9831  C C    . GLU A 1 31  ? 11.744  3.534   13.953  1.00 0.00 ? 738 GLU A C    6  
ATOM 9832  O O    . GLU A 1 31  ? 12.088  4.403   14.766  1.00 0.00 ? 738 GLU A O    6  
ATOM 9833  C CB   . GLU A 1 31  ? 12.548  1.159   13.333  1.00 0.00 ? 738 GLU A CB   6  
ATOM 9834  C CG   . GLU A 1 31  ? 11.820  0.868   12.040  1.00 0.00 ? 738 GLU A CG   6  
ATOM 9835  C CD   . GLU A 1 31  ? 12.621  -0.033  11.146  1.00 0.00 ? 738 GLU A CD   6  
ATOM 9836  O OE1  . GLU A 1 31  ? 13.627  0.412   10.592  1.00 0.00 ? 738 GLU A OE1  6  
ATOM 9837  O OE2  . GLU A 1 31  ? 12.249  -1.209  10.981  1.00 0.00 ? 738 GLU A OE2  6  
ATOM 9838  H H    . GLU A 1 31  ? 9.758   1.645   14.089  1.00 0.00 ? 738 GLU A H    6  
ATOM 9839  H HA   . GLU A 1 31  ? 12.361  2.032   15.283  1.00 0.00 ? 738 GLU A HA   6  
ATOM 9840  H HB2  . GLU A 1 31  ? 13.475  1.637   13.057  1.00 0.00 ? 738 GLU A HB2  6  
ATOM 9841  H HB3  . GLU A 1 31  ? 12.768  0.215   13.806  1.00 0.00 ? 738 GLU A HB3  6  
ATOM 9842  H HG2  . GLU A 1 31  ? 10.879  0.392   12.269  1.00 0.00 ? 738 GLU A HG2  6  
ATOM 9843  H HG3  . GLU A 1 31  ? 11.639  1.796   11.521  1.00 0.00 ? 738 GLU A HG3  6  
ATOM 9844  N N    . ASP A 1 32  ? 11.220  3.812   12.758  1.00 0.00 ? 739 ASP A N    6  
ATOM 9845  C CA   . ASP A 1 32  ? 11.152  5.174   12.179  1.00 0.00 ? 739 ASP A CA   6  
ATOM 9846  C C    . ASP A 1 32  ? 10.684  5.090   10.734  1.00 0.00 ? 739 ASP A C    6  
ATOM 9847  O O    . ASP A 1 32  ? 9.624   5.602   10.382  1.00 0.00 ? 739 ASP A O    6  
ATOM 9848  C CB   . ASP A 1 32  ? 12.518  5.897   12.218  1.00 0.00 ? 739 ASP A CB   6  
ATOM 9849  C CG   . ASP A 1 32  ? 12.439  7.338   11.741  1.00 0.00 ? 739 ASP A CG   6  
ATOM 9850  O OD1  . ASP A 1 32  ? 11.651  8.119   12.311  1.00 0.00 ? 739 ASP A OD1  6  
ATOM 9851  O OD2  . ASP A 1 32  ? 13.177  7.721   10.814  1.00 0.00 ? 739 ASP A OD2  6  
ATOM 9852  H H    . ASP A 1 32  ? 10.798  3.071   12.271  1.00 0.00 ? 739 ASP A H    6  
ATOM 9853  H HA   . ASP A 1 32  ? 10.428  5.740   12.747  1.00 0.00 ? 739 ASP A HA   6  
ATOM 9854  H HB2  . ASP A 1 32  ? 12.890  5.896   13.232  1.00 0.00 ? 739 ASP A HB2  6  
ATOM 9855  H HB3  . ASP A 1 32  ? 13.211  5.363   11.586  1.00 0.00 ? 739 ASP A HB3  6  
ATOM 9856  N N    . GLU A 1 33  ? 11.473  4.419   9.904   1.00 0.00 ? 740 GLU A N    6  
ATOM 9857  C CA   . GLU A 1 33  ? 11.145  4.232   8.500   1.00 0.00 ? 740 GLU A CA   6  
ATOM 9858  C C    . GLU A 1 33  ? 11.785  2.957   7.932   1.00 0.00 ? 740 GLU A C    6  
ATOM 9859  O O    . GLU A 1 33  ? 12.936  2.955   7.470   1.00 0.00 ? 740 GLU A O    6  
ATOM 9860  C CB   . GLU A 1 33  ? 11.501  5.467   7.651   1.00 0.00 ? 740 GLU A CB   6  
ATOM 9861  C CG   . GLU A 1 33  ? 12.926  5.962   7.839   1.00 0.00 ? 740 GLU A CG   6  
ATOM 9862  C CD   . GLU A 1 33  ? 13.306  7.026   6.853   1.00 0.00 ? 740 GLU A CD   6  
ATOM 9863  O OE1  . GLU A 1 33  ? 13.105  8.228   7.142   1.00 0.00 ? 740 GLU A OE1  6  
ATOM 9864  O OE2  . GLU A 1 33  ? 13.828  6.689   5.767   1.00 0.00 ? 740 GLU A OE2  6  
ATOM 9865  H H    . GLU A 1 33  ? 12.319  4.046   10.241  1.00 0.00 ? 740 GLU A H    6  
ATOM 9866  H HA   . GLU A 1 33  ? 10.074  4.088   8.463   1.00 0.00 ? 740 GLU A HA   6  
ATOM 9867  H HB2  . GLU A 1 33  ? 11.364  5.208   6.611   1.00 0.00 ? 740 GLU A HB2  6  
ATOM 9868  H HB3  . GLU A 1 33  ? 10.822  6.269   7.902   1.00 0.00 ? 740 GLU A HB3  6  
ATOM 9869  H HG2  . GLU A 1 33  ? 13.019  6.363   8.838   1.00 0.00 ? 740 GLU A HG2  6  
ATOM 9870  H HG3  . GLU A 1 33  ? 13.592  5.119   7.733   1.00 0.00 ? 740 GLU A HG3  6  
ATOM 9871  N N    . SER A 1 34  ? 11.065  1.873   8.048   1.00 0.00 ? 741 SER A N    6  
ATOM 9872  C CA   . SER A 1 34  ? 11.483  0.590   7.534   1.00 0.00 ? 741 SER A CA   6  
ATOM 9873  C C    . SER A 1 34  ? 11.553  0.636   6.008   1.00 0.00 ? 741 SER A C    6  
ATOM 9874  O O    . SER A 1 34  ? 12.583  0.313   5.423   1.00 0.00 ? 741 SER A O    6  
ATOM 9875  C CB   . SER A 1 34  ? 10.448  -0.446  7.942   1.00 0.00 ? 741 SER A CB   6  
ATOM 9876  O OG   . SER A 1 34  ? 10.187  -0.401  9.331   1.00 0.00 ? 741 SER A OG   6  
ATOM 9877  H H    . SER A 1 34  ? 10.218  1.894   8.537   1.00 0.00 ? 741 SER A H    6  
ATOM 9878  H HA   . SER A 1 34  ? 12.437  0.317   7.957   1.00 0.00 ? 741 SER A HA   6  
ATOM 9879  H HB2  . SER A 1 34  ? 9.524   -0.212  7.432   1.00 0.00 ? 741 SER A HB2  6  
ATOM 9880  H HB3  . SER A 1 34  ? 10.781  -1.436  7.671   1.00 0.00 ? 741 SER A HB3  6  
ATOM 9881  H HG   . SER A 1 34  ? 10.951  -0.769  9.808   1.00 0.00 ? 741 SER A HG   6  
ATOM 9882  N N    . ALA A 1 35  ? 10.437  1.095   5.398   1.00 0.00 ? 742 ALA A N    6  
ATOM 9883  C CA   . ALA A 1 35  ? 10.246  1.137   3.946   1.00 0.00 ? 742 ALA A CA   6  
ATOM 9884  C C    . ALA A 1 35  ? 10.260  -0.281  3.343   1.00 0.00 ? 742 ALA A C    6  
ATOM 9885  O O    . ALA A 1 35  ? 11.303  -0.940  3.258   1.00 0.00 ? 742 ALA A O    6  
ATOM 9886  C CB   . ALA A 1 35  ? 11.242  2.075   3.268   1.00 0.00 ? 742 ALA A CB   6  
ATOM 9887  H H    . ALA A 1 35  ? 9.713   1.425   5.966   1.00 0.00 ? 742 ALA A H    6  
ATOM 9888  H HA   . ALA A 1 35  ? 9.247   1.522   3.794   1.00 0.00 ? 742 ALA A HA   6  
ATOM 9889  H HB1  . ALA A 1 35  ? 10.988  2.182   2.224   1.00 0.00 ? 742 ALA A HB1  6  
ATOM 9890  H HB2  . ALA A 1 35  ? 12.236  1.661   3.355   1.00 0.00 ? 742 ALA A HB2  6  
ATOM 9891  H HB3  . ALA A 1 35  ? 11.209  3.040   3.751   1.00 0.00 ? 742 ALA A HB3  6  
ATOM 9892  N N    . LEU A 1 36  ? 9.100   -0.748  2.946   1.00 0.00 ? 743 LEU A N    6  
ATOM 9893  C CA   . LEU A 1 36  ? 8.952   -2.114  2.466   1.00 0.00 ? 743 LEU A CA   6  
ATOM 9894  C C    . LEU A 1 36  ? 8.680   -2.159  0.989   1.00 0.00 ? 743 LEU A C    6  
ATOM 9895  O O    . LEU A 1 36  ? 8.484   -1.146  0.364   1.00 0.00 ? 743 LEU A O    6  
ATOM 9896  C CB   . LEU A 1 36  ? 7.878   -2.903  3.245   1.00 0.00 ? 743 LEU A CB   6  
ATOM 9897  C CG   . LEU A 1 36  ? 8.245   -3.389  4.662   1.00 0.00 ? 743 LEU A CG   6  
ATOM 9898  C CD1  . LEU A 1 36  ? 9.487   -4.252  4.631   1.00 0.00 ? 743 LEU A CD1  6  
ATOM 9899  C CD2  . LEU A 1 36  ? 8.424   -2.241  5.637   1.00 0.00 ? 743 LEU A CD2  6  
ATOM 9900  H H    . LEU A 1 36  ? 8.321   -0.150  2.915   1.00 0.00 ? 743 LEU A H    6  
ATOM 9901  H HA   . LEU A 1 36  ? 9.905   -2.595  2.626   1.00 0.00 ? 743 LEU A HA   6  
ATOM 9902  H HB2  . LEU A 1 36  ? 7.005   -2.271  3.328   1.00 0.00 ? 743 LEU A HB2  6  
ATOM 9903  H HB3  . LEU A 1 36  ? 7.607   -3.766  2.654   1.00 0.00 ? 743 LEU A HB3  6  
ATOM 9904  H HG   . LEU A 1 36  ? 7.439   -4.014  5.018   1.00 0.00 ? 743 LEU A HG   6  
ATOM 9905  H HD11 . LEU A 1 36  ? 9.679   -4.627  5.624   1.00 0.00 ? 743 LEU A HD11 6  
ATOM 9906  H HD12 . LEU A 1 36  ? 10.335  -3.664  4.310   1.00 0.00 ? 743 LEU A HD12 6  
ATOM 9907  H HD13 . LEU A 1 36  ? 9.339   -5.082  3.956   1.00 0.00 ? 743 LEU A HD13 6  
ATOM 9908  H HD21 . LEU A 1 36  ? 9.197   -1.582  5.269   1.00 0.00 ? 743 LEU A HD21 6  
ATOM 9909  H HD22 . LEU A 1 36  ? 8.720   -2.636  6.596   1.00 0.00 ? 743 LEU A HD22 6  
ATOM 9910  H HD23 . LEU A 1 36  ? 7.498   -1.695  5.738   1.00 0.00 ? 743 LEU A HD23 6  
ATOM 9911  N N    . LYS A 1 37  ? 8.663   -3.334  0.450   1.00 0.00 ? 744 LYS A N    6  
ATOM 9912  C CA   . LYS A 1 37  ? 8.486   -3.519  -0.964  1.00 0.00 ? 744 LYS A CA   6  
ATOM 9913  C C    . LYS A 1 37  ? 7.003   -3.504  -1.339  1.00 0.00 ? 744 LYS A C    6  
ATOM 9914  O O    . LYS A 1 37  ? 6.155   -3.957  -0.561  1.00 0.00 ? 744 LYS A O    6  
ATOM 9915  C CB   . LYS A 1 37  ? 9.180   -4.801  -1.381  1.00 0.00 ? 744 LYS A CB   6  
ATOM 9916  C CG   . LYS A 1 37  ? 10.682  -4.750  -1.158  1.00 0.00 ? 744 LYS A CG   6  
ATOM 9917  C CD   . LYS A 1 37  ? 11.344  -6.077  -1.459  1.00 0.00 ? 744 LYS A CD   6  
ATOM 9918  C CE   . LYS A 1 37  ? 12.853  -5.935  -1.487  1.00 0.00 ? 744 LYS A CE   6  
ATOM 9919  N NZ   . LYS A 1 37  ? 13.304  -5.041  -2.582  1.00 0.00 ? 744 LYS A NZ   6  
ATOM 9920  H H    . LYS A 1 37  ? 8.751   -4.123  1.025   1.00 0.00 ? 744 LYS A H    6  
ATOM 9921  H HA   . LYS A 1 37  ? 8.969   -2.688  -1.458  1.00 0.00 ? 744 LYS A HA   6  
ATOM 9922  H HB2  . LYS A 1 37  ? 8.777   -5.624  -0.811  1.00 0.00 ? 744 LYS A HB2  6  
ATOM 9923  H HB3  . LYS A 1 37  ? 9.003   -4.975  -2.431  1.00 0.00 ? 744 LYS A HB3  6  
ATOM 9924  H HG2  . LYS A 1 37  ? 11.104  -3.996  -1.804  1.00 0.00 ? 744 LYS A HG2  6  
ATOM 9925  H HG3  . LYS A 1 37  ? 10.869  -4.488  -0.127  1.00 0.00 ? 744 LYS A HG3  6  
ATOM 9926  H HD2  . LYS A 1 37  ? 11.068  -6.792  -0.700  1.00 0.00 ? 744 LYS A HD2  6  
ATOM 9927  H HD3  . LYS A 1 37  ? 11.006  -6.423  -2.424  1.00 0.00 ? 744 LYS A HD3  6  
ATOM 9928  H HE2  . LYS A 1 37  ? 13.184  -5.533  -0.542  1.00 0.00 ? 744 LYS A HE2  6  
ATOM 9929  H HE3  . LYS A 1 37  ? 13.295  -6.910  -1.631  1.00 0.00 ? 744 LYS A HE3  6  
ATOM 9930  H HZ1  . LYS A 1 37  ? 14.334  -4.868  -2.509  1.00 0.00 ? 744 LYS A HZ1  6  
ATOM 9931  H HZ2  . LYS A 1 37  ? 12.819  -4.123  -2.568  1.00 0.00 ? 744 LYS A HZ2  6  
ATOM 9932  H HZ3  . LYS A 1 37  ? 13.114  -5.465  -3.511  1.00 0.00 ? 744 LYS A HZ3  6  
ATOM 9933  N N    . ARG A 1 38  ? 6.709   -2.996  -2.532  1.00 0.00 ? 745 ARG A N    6  
ATOM 9934  C CA   . ARG A 1 38  ? 5.333   -2.787  -3.010  1.00 0.00 ? 745 ARG A CA   6  
ATOM 9935  C C    . ARG A 1 38  ? 4.531   -4.087  -3.055  1.00 0.00 ? 745 ARG A C    6  
ATOM 9936  O O    . ARG A 1 38  ? 3.444   -4.173  -2.482  1.00 0.00 ? 745 ARG A O    6  
ATOM 9937  C CB   . ARG A 1 38  ? 5.327   -2.130  -4.399  1.00 0.00 ? 745 ARG A CB   6  
ATOM 9938  C CG   . ARG A 1 38  ? 6.009   -0.769  -4.471  1.00 0.00 ? 745 ARG A CG   6  
ATOM 9939  C CD   . ARG A 1 38  ? 6.005   -0.233  -5.895  1.00 0.00 ? 745 ARG A CD   6  
ATOM 9940  N NE   . ARG A 1 38  ? 6.790   1.011   -6.045  1.00 0.00 ? 745 ARG A NE   6  
ATOM 9941  C CZ   . ARG A 1 38  ? 6.655   1.889   -7.065  1.00 0.00 ? 745 ARG A CZ   6  
ATOM 9942  N NH1  . ARG A 1 38  ? 5.685   1.724   -7.969  1.00 0.00 ? 745 ARG A NH1  6  
ATOM 9943  N NH2  . ARG A 1 38  ? 7.477   2.929   -7.172  1.00 0.00 ? 745 ARG A NH2  6  
ATOM 9944  H H    . ARG A 1 38  ? 7.458   -2.767  -3.127  1.00 0.00 ? 745 ARG A H    6  
ATOM 9945  H HA   . ARG A 1 38  ? 4.850   -2.115  -2.316  1.00 0.00 ? 745 ARG A HA   6  
ATOM 9946  H HB2  . ARG A 1 38  ? 5.832   -2.792  -5.085  1.00 0.00 ? 745 ARG A HB2  6  
ATOM 9947  H HB3  . ARG A 1 38  ? 4.302   -2.017  -4.720  1.00 0.00 ? 745 ARG A HB3  6  
ATOM 9948  H HG2  . ARG A 1 38  ? 5.465   -0.078  -3.844  1.00 0.00 ? 745 ARG A HG2  6  
ATOM 9949  H HG3  . ARG A 1 38  ? 7.026   -0.847  -4.120  1.00 0.00 ? 745 ARG A HG3  6  
ATOM 9950  H HD2  . ARG A 1 38  ? 6.426   -0.986  -6.543  1.00 0.00 ? 745 ARG A HD2  6  
ATOM 9951  H HD3  . ARG A 1 38  ? 4.984   -0.040  -6.189  1.00 0.00 ? 745 ARG A HD3  6  
ATOM 9952  H HE   . ARG A 1 38  ? 7.478   1.146   -5.357  1.00 0.00 ? 745 ARG A HE   6  
ATOM 9953  H HH11 . ARG A 1 38  ? 5.029   0.965   -7.930  1.00 0.00 ? 745 ARG A HH11 6  
ATOM 9954  H HH12 . ARG A 1 38  ? 5.582   2.350   -8.745  1.00 0.00 ? 745 ARG A HH12 6  
ATOM 9955  H HH21 . ARG A 1 38  ? 8.246   3.156   -6.560  1.00 0.00 ? 745 ARG A HH21 6  
ATOM 9956  H HH22 . ARG A 1 38  ? 7.367   3.606   -7.903  1.00 0.00 ? 745 ARG A HH22 6  
ATOM 9957  N N    . SER A 1 39  ? 5.075   -5.094  -3.700  1.00 0.00 ? 746 SER A N    6  
ATOM 9958  C CA   . SER A 1 39  ? 4.389   -6.357  -3.830  1.00 0.00 ? 746 SER A CA   6  
ATOM 9959  C C    . SER A 1 39  ? 4.391   -7.085  -2.485  1.00 0.00 ? 746 SER A C    6  
ATOM 9960  O O    . SER A 1 39  ? 3.433   -7.760  -2.140  1.00 0.00 ? 746 SER A O    6  
ATOM 9961  C CB   . SER A 1 39  ? 5.029   -7.208  -4.946  1.00 0.00 ? 746 SER A CB   6  
ATOM 9962  O OG   . SER A 1 39  ? 4.270   -8.378  -5.227  1.00 0.00 ? 746 SER A OG   6  
ATOM 9963  H H    . SER A 1 39  ? 5.966   -4.987  -4.099  1.00 0.00 ? 746 SER A H    6  
ATOM 9964  H HA   . SER A 1 39  ? 3.364   -6.140  -4.093  1.00 0.00 ? 746 SER A HA   6  
ATOM 9965  H HB2  . SER A 1 39  ? 5.089   -6.616  -5.846  1.00 0.00 ? 746 SER A HB2  6  
ATOM 9966  H HB3  . SER A 1 39  ? 6.026   -7.501  -4.653  1.00 0.00 ? 746 SER A HB3  6  
ATOM 9967  H HG   . SER A 1 39  ? 3.993   -8.311  -6.148  1.00 0.00 ? 746 SER A HG   6  
ATOM 9968  N N    . GLU A 1 40  ? 5.454   -6.888  -1.707  1.00 0.00 ? 747 GLU A N    6  
ATOM 9969  C CA   . GLU A 1 40  ? 5.586   -7.490  -0.387  1.00 0.00 ? 747 GLU A CA   6  
ATOM 9970  C C    . GLU A 1 40  ? 4.495   -6.961  0.556   1.00 0.00 ? 747 GLU A C    6  
ATOM 9971  O O    . GLU A 1 40  ? 4.003   -7.690  1.412   1.00 0.00 ? 747 GLU A O    6  
ATOM 9972  C CB   . GLU A 1 40  ? 6.980   -7.226  0.175   1.00 0.00 ? 747 GLU A CB   6  
ATOM 9973  C CG   . GLU A 1 40  ? 7.301   -7.976  1.449   1.00 0.00 ? 747 GLU A CG   6  
ATOM 9974  C CD   . GLU A 1 40  ? 8.718   -7.749  1.894   1.00 0.00 ? 747 GLU A CD   6  
ATOM 9975  O OE1  . GLU A 1 40  ? 9.636   -8.412  1.355   1.00 0.00 ? 747 GLU A OE1  6  
ATOM 9976  O OE2  . GLU A 1 40  ? 8.937   -6.933  2.806   1.00 0.00 ? 747 GLU A OE2  6  
ATOM 9977  H H    . GLU A 1 40  ? 6.186   -6.339  -2.052  1.00 0.00 ? 747 GLU A H    6  
ATOM 9978  H HA   . GLU A 1 40  ? 5.446   -8.556  -0.501  1.00 0.00 ? 747 GLU A HA   6  
ATOM 9979  H HB2  . GLU A 1 40  ? 7.717   -7.505  -0.563  1.00 0.00 ? 747 GLU A HB2  6  
ATOM 9980  H HB3  . GLU A 1 40  ? 7.068   -6.169  0.377   1.00 0.00 ? 747 GLU A HB3  6  
ATOM 9981  H HG2  . GLU A 1 40  ? 6.633   -7.645  2.231   1.00 0.00 ? 747 GLU A HG2  6  
ATOM 9982  H HG3  . GLU A 1 40  ? 7.158   -9.033  1.278   1.00 0.00 ? 747 GLU A HG3  6  
ATOM 9983  N N    . LEU A 1 41  ? 4.113   -5.703  0.363   1.00 0.00 ? 748 LEU A N    6  
ATOM 9984  C CA   . LEU A 1 41  ? 3.029   -5.079  1.117   1.00 0.00 ? 748 LEU A CA   6  
ATOM 9985  C C    . LEU A 1 41  ? 1.729   -5.869  0.888   1.00 0.00 ? 748 LEU A C    6  
ATOM 9986  O O    . LEU A 1 41  ? 1.028   -6.245  1.839   1.00 0.00 ? 748 LEU A O    6  
ATOM 9987  C CB   . LEU A 1 41  ? 2.862   -3.613  0.671   1.00 0.00 ? 748 LEU A CB   6  
ATOM 9988  C CG   . LEU A 1 41  ? 1.841   -2.756  1.435   1.00 0.00 ? 748 LEU A CG   6  
ATOM 9989  C CD1  . LEU A 1 41  ? 2.245   -2.604  2.891   1.00 0.00 ? 748 LEU A CD1  6  
ATOM 9990  C CD2  . LEU A 1 41  ? 1.703   -1.392  0.781   1.00 0.00 ? 748 LEU A CD2  6  
ATOM 9991  H H    . LEU A 1 41  ? 4.606   -5.162  -0.294  1.00 0.00 ? 748 LEU A H    6  
ATOM 9992  H HA   . LEU A 1 41  ? 3.285   -5.111  2.166   1.00 0.00 ? 748 LEU A HA   6  
ATOM 9993  H HB2  . LEU A 1 41  ? 3.826   -3.133  0.752   1.00 0.00 ? 748 LEU A HB2  6  
ATOM 9994  H HB3  . LEU A 1 41  ? 2.579   -3.616  -0.372  1.00 0.00 ? 748 LEU A HB3  6  
ATOM 9995  H HG   . LEU A 1 41  ? 0.880   -3.245  1.405   1.00 0.00 ? 748 LEU A HG   6  
ATOM 9996  H HD11 . LEU A 1 41  ? 3.231   -2.166  2.952   1.00 0.00 ? 748 LEU A HD11 6  
ATOM 9997  H HD12 . LEU A 1 41  ? 2.248   -3.571  3.369   1.00 0.00 ? 748 LEU A HD12 6  
ATOM 9998  H HD13 . LEU A 1 41  ? 1.539   -1.964  3.397   1.00 0.00 ? 748 LEU A HD13 6  
ATOM 9999  H HD21 . LEU A 1 41  ? 0.976   -0.804  1.319   1.00 0.00 ? 748 LEU A HD21 6  
ATOM 10000 H HD22 . LEU A 1 41  ? 1.384   -1.513  -0.244  1.00 0.00 ? 748 LEU A HD22 6  
ATOM 10001 H HD23 . LEU A 1 41  ? 2.658   -0.886  0.800   1.00 0.00 ? 748 LEU A HD23 6  
ATOM 10002 N N    . VAL A 1 42  ? 1.447   -6.163  -0.379  1.00 0.00 ? 749 VAL A N    6  
ATOM 10003 C CA   . VAL A 1 42  ? 0.277   -6.954  -0.749  1.00 0.00 ? 749 VAL A CA   6  
ATOM 10004 C C    . VAL A 1 42  ? 0.444   -8.359  -0.204  1.00 0.00 ? 749 VAL A C    6  
ATOM 10005 O O    . VAL A 1 42  ? -0.475  -8.942  0.357   1.00 0.00 ? 749 VAL A O    6  
ATOM 10006 C CB   . VAL A 1 42  ? 0.122   -7.077  -2.284  1.00 0.00 ? 749 VAL A CB   6  
ATOM 10007 C CG1  . VAL A 1 42  ? -1.140  -7.845  -2.639  1.00 0.00 ? 749 VAL A CG1  6  
ATOM 10008 C CG2  . VAL A 1 42  ? 0.133   -5.728  -2.959  1.00 0.00 ? 749 VAL A CG2  6  
ATOM 10009 H H    . VAL A 1 42  ? 2.052   -5.845  -1.083  1.00 0.00 ? 749 VAL A H    6  
ATOM 10010 H HA   . VAL A 1 42  ? -0.609  -6.498  -0.335  1.00 0.00 ? 749 VAL A HA   6  
ATOM 10011 H HB   . VAL A 1 42  ? 0.965   -7.649  -2.645  1.00 0.00 ? 749 VAL A HB   6  
ATOM 10012 H HG11 . VAL A 1 42  ? -1.249  -7.902  -3.711  1.00 0.00 ? 749 VAL A HG11 6  
ATOM 10013 H HG12 . VAL A 1 42  ? -1.991  -7.330  -2.221  1.00 0.00 ? 749 VAL A HG12 6  
ATOM 10014 H HG13 . VAL A 1 42  ? -1.082  -8.839  -2.224  1.00 0.00 ? 749 VAL A HG13 6  
ATOM 10015 H HG21 . VAL A 1 42  ? -0.005  -5.854  -4.021  1.00 0.00 ? 749 VAL A HG21 6  
ATOM 10016 H HG22 . VAL A 1 42  ? 1.081   -5.245  -2.775  1.00 0.00 ? 749 VAL A HG22 6  
ATOM 10017 H HG23 . VAL A 1 42  ? -0.668  -5.123  -2.562  1.00 0.00 ? 749 VAL A HG23 6  
ATOM 10018 N N    . ASN A 1 43  ? 1.646   -8.853  -0.360  1.00 0.00 ? 750 ASN A N    6  
ATOM 10019 C CA   . ASN A 1 43  ? 2.047   -10.191 0.030   1.00 0.00 ? 750 ASN A CA   6  
ATOM 10020 C C    . ASN A 1 43  ? 1.711   -10.476 1.481   1.00 0.00 ? 750 ASN A C    6  
ATOM 10021 O O    . ASN A 1 43  ? 1.008   -11.445 1.775   1.00 0.00 ? 750 ASN A O    6  
ATOM 10022 C CB   . ASN A 1 43  ? 3.545   -10.380 -0.222  1.00 0.00 ? 750 ASN A CB   6  
ATOM 10023 C CG   . ASN A 1 43  ? 4.041   -11.761 0.123   1.00 0.00 ? 750 ASN A CG   6  
ATOM 10024 O OD1  . ASN A 1 43  ? 3.966   -12.674 -0.692  1.00 0.00 ? 750 ASN A OD1  6  
ATOM 10025 N ND2  . ASN A 1 43  ? 4.597   -11.916 1.296   1.00 0.00 ? 750 ASN A ND2  6  
ATOM 10026 H H    . ASN A 1 43  ? 2.309   -8.264  -0.782  1.00 0.00 ? 750 ASN A H    6  
ATOM 10027 H HA   . ASN A 1 43  ? 1.509   -10.890 -0.593  1.00 0.00 ? 750 ASN A HA   6  
ATOM 10028 H HB2  . ASN A 1 43  ? 3.788   -10.153 -1.250  1.00 0.00 ? 750 ASN A HB2  6  
ATOM 10029 H HB3  . ASN A 1 43  ? 4.061   -9.676  0.412   1.00 0.00 ? 750 ASN A HB3  6  
ATOM 10030 H HD21 . ASN A 1 43  ? 4.676   -11.145 1.900   1.00 0.00 ? 750 ASN A HD21 6  
ATOM 10031 H HD22 . ASN A 1 43  ? 4.939   -12.802 1.539   1.00 0.00 ? 750 ASN A HD22 6  
ATOM 10032 N N    . TRP A 1 44  ? 2.169   -9.622  2.398   1.00 0.00 ? 751 TRP A N    6  
ATOM 10033 C CA   . TRP A 1 44  ? 1.875   -9.864  3.792   1.00 0.00 ? 751 TRP A CA   6  
ATOM 10034 C C    . TRP A 1 44  ? 0.406   -9.622  4.074   1.00 0.00 ? 751 TRP A C    6  
ATOM 10035 O O    . TRP A 1 44  ? -0.179  -10.292 4.910   1.00 0.00 ? 751 TRP A O    6  
ATOM 10036 C CB   . TRP A 1 44  ? 2.802   -9.093  4.788   1.00 0.00 ? 751 TRP A CB   6  
ATOM 10037 C CG   . TRP A 1 44  ? 2.659   -7.591  4.862   1.00 0.00 ? 751 TRP A CG   6  
ATOM 10038 C CD1  . TRP A 1 44  ? 3.476   -6.662  4.299   1.00 0.00 ? 751 TRP A CD1  6  
ATOM 10039 C CD2  . TRP A 1 44  ? 1.656   -6.850  5.588   1.00 0.00 ? 751 TRP A CD2  6  
ATOM 10040 N NE1  . TRP A 1 44  ? 3.038   -5.400  4.609   1.00 0.00 ? 751 TRP A NE1  6  
ATOM 10041 C CE2  . TRP A 1 44  ? 1.921   -5.491  5.396   1.00 0.00 ? 751 TRP A CE2  6  
ATOM 10042 C CE3  . TRP A 1 44  ? 0.559   -7.216  6.371   1.00 0.00 ? 751 TRP A CE3  6  
ATOM 10043 C CZ2  . TRP A 1 44  ? 1.121   -4.491  5.953   1.00 0.00 ? 751 TRP A CZ2  6  
ATOM 10044 C CZ3  . TRP A 1 44  ? -0.229  -6.230  6.920   1.00 0.00 ? 751 TRP A CZ3  6  
ATOM 10045 C CH2  . TRP A 1 44  ? 0.055   -4.884  6.712   1.00 0.00 ? 751 TRP A CH2  6  
ATOM 10046 H H    . TRP A 1 44  ? 2.696   -8.837  2.124   1.00 0.00 ? 751 TRP A H    6  
ATOM 10047 H HA   . TRP A 1 44  ? 2.035   -10.925 3.926   1.00 0.00 ? 751 TRP A HA   6  
ATOM 10048 H HB2  . TRP A 1 44  ? 2.615   -9.461  5.784   1.00 0.00 ? 751 TRP A HB2  6  
ATOM 10049 H HB3  . TRP A 1 44  ? 3.827   -9.316  4.538   1.00 0.00 ? 751 TRP A HB3  6  
ATOM 10050 H HD1  . TRP A 1 44  ? 4.338   -6.901  3.694   1.00 0.00 ? 751 TRP A HD1  6  
ATOM 10051 H HE1  . TRP A 1 44  ? 3.461   -4.569  4.309   1.00 0.00 ? 751 TRP A HE1  6  
ATOM 10052 H HE3  . TRP A 1 44  ? 0.327   -8.256  6.542   1.00 0.00 ? 751 TRP A HE3  6  
ATOM 10053 H HZ2  . TRP A 1 44  ? 1.324   -3.441  5.804   1.00 0.00 ? 751 TRP A HZ2  6  
ATOM 10054 H HZ3  . TRP A 1 44  ? -1.082  -6.500  7.526   1.00 0.00 ? 751 TRP A HZ3  6  
ATOM 10055 H HH2  . TRP A 1 44  ? -0.601  -4.152  7.160   1.00 0.00 ? 751 TRP A HH2  6  
ATOM 10056 N N    . TYR A 1 45  ? -0.205  -8.701  3.311   1.00 0.00 ? 752 TYR A N    6  
ATOM 10057 C CA   . TYR A 1 45  ? -1.612  -8.361  3.490   1.00 0.00 ? 752 TYR A CA   6  
ATOM 10058 C C    . TYR A 1 45  ? -2.470  -9.593  3.277   1.00 0.00 ? 752 TYR A C    6  
ATOM 10059 O O    . TYR A 1 45  ? -3.319  -9.934  4.116   1.00 0.00 ? 752 TYR A O    6  
ATOM 10060 C CB   . TYR A 1 45  ? -2.038  -7.251  2.514   1.00 0.00 ? 752 TYR A CB   6  
ATOM 10061 C CG   . TYR A 1 45  ? -3.457  -6.761  2.739   1.00 0.00 ? 752 TYR A CG   6  
ATOM 10062 C CD1  . TYR A 1 45  ? -3.864  -6.351  4.005   1.00 0.00 ? 752 TYR A CD1  6  
ATOM 10063 C CD2  . TYR A 1 45  ? -4.400  -6.725  1.705   1.00 0.00 ? 752 TYR A CD2  6  
ATOM 10064 C CE1  . TYR A 1 45  ? -5.141  -5.919  4.237   1.00 0.00 ? 752 TYR A CE1  6  
ATOM 10065 C CE2  . TYR A 1 45  ? -5.681  -6.297  1.943   1.00 0.00 ? 752 TYR A CE2  6  
ATOM 10066 C CZ   . TYR A 1 45  ? -6.044  -5.894  3.212   1.00 0.00 ? 752 TYR A CZ   6  
ATOM 10067 O OH   . TYR A 1 45  ? -7.324  -5.482  3.453   1.00 0.00 ? 752 TYR A OH   6  
ATOM 10068 H H    . TYR A 1 45  ? 0.308   -8.248  2.604   1.00 0.00 ? 752 TYR A H    6  
ATOM 10069 H HA   . TYR A 1 45  ? -1.744  -8.011  4.502   1.00 0.00 ? 752 TYR A HA   6  
ATOM 10070 H HB2  . TYR A 1 45  ? -1.349  -6.423  2.578   1.00 0.00 ? 752 TYR A HB2  6  
ATOM 10071 H HB3  . TYR A 1 45  ? -1.987  -7.653  1.513   1.00 0.00 ? 752 TYR A HB3  6  
ATOM 10072 H HD1  . TYR A 1 45  ? -3.152  -6.364  4.819   1.00 0.00 ? 752 TYR A HD1  6  
ATOM 10073 H HD2  . TYR A 1 45  ? -4.153  -7.024  0.696   1.00 0.00 ? 752 TYR A HD2  6  
ATOM 10074 H HE1  . TYR A 1 45  ? -5.432  -5.598  5.225   1.00 0.00 ? 752 TYR A HE1  6  
ATOM 10075 H HE2  . TYR A 1 45  ? -6.395  -6.277  1.134   1.00 0.00 ? 752 TYR A HE2  6  
ATOM 10076 H HH   . TYR A 1 45  ? -7.917  -6.086  3.003   1.00 0.00 ? 752 TYR A HH   6  
ATOM 10077 N N    . LEU A 1 46  ? -2.202  -10.271 2.180   1.00 0.00 ? 753 LEU A N    6  
ATOM 10078 C CA   . LEU A 1 46  ? -2.904  -11.476 1.806   1.00 0.00 ? 753 LEU A CA   6  
ATOM 10079 C C    . LEU A 1 46  ? -2.702  -12.540 2.865   1.00 0.00 ? 753 LEU A C    6  
ATOM 10080 O O    . LEU A 1 46  ? -3.650  -13.131 3.327   1.00 0.00 ? 753 LEU A O    6  
ATOM 10081 C CB   . LEU A 1 46  ? -2.393  -11.979 0.464   1.00 0.00 ? 753 LEU A CB   6  
ATOM 10082 C CG   . LEU A 1 46  ? -2.452  -10.980 -0.693  1.00 0.00 ? 753 LEU A CG   6  
ATOM 10083 C CD1  . LEU A 1 46  ? -1.790  -11.559 -1.917  1.00 0.00 ? 753 LEU A CD1  6  
ATOM 10084 C CD2  . LEU A 1 46  ? -3.886  -10.547 -0.995  1.00 0.00 ? 753 LEU A CD2  6  
ATOM 10085 H H    . LEU A 1 46  ? -1.489  -9.927  1.592   1.00 0.00 ? 753 LEU A H    6  
ATOM 10086 H HA   . LEU A 1 46  ? -3.958  -11.253 1.721   1.00 0.00 ? 753 LEU A HA   6  
ATOM 10087 H HB2  . LEU A 1 46  ? -1.366  -12.285 0.595   1.00 0.00 ? 753 LEU A HB2  6  
ATOM 10088 H HB3  . LEU A 1 46  ? -2.971  -12.849 0.188   1.00 0.00 ? 753 LEU A HB3  6  
ATOM 10089 H HG   . LEU A 1 46  ? -1.887  -10.103 -0.412  1.00 0.00 ? 753 LEU A HG   6  
ATOM 10090 H HD11 . LEU A 1 46  ? -2.283  -12.474 -2.211  1.00 0.00 ? 753 LEU A HD11 6  
ATOM 10091 H HD12 . LEU A 1 46  ? -0.756  -11.758 -1.668  1.00 0.00 ? 753 LEU A HD12 6  
ATOM 10092 H HD13 . LEU A 1 46  ? -1.830  -10.838 -2.718  1.00 0.00 ? 753 LEU A HD13 6  
ATOM 10093 H HD21 . LEU A 1 46  ? -4.304  -10.057 -0.127  1.00 0.00 ? 753 LEU A HD21 6  
ATOM 10094 H HD22 . LEU A 1 46  ? -4.487  -11.408 -1.251  1.00 0.00 ? 753 LEU A HD22 6  
ATOM 10095 H HD23 . LEU A 1 46  ? -3.879  -9.850  -1.822  1.00 0.00 ? 753 LEU A HD23 6  
ATOM 10096 N N    . LYS A 1 47  ? -1.459  -12.718 3.283   1.00 0.00 ? 754 LYS A N    6  
ATOM 10097 C CA   . LYS A 1 47  ? -1.094  -13.714 4.309   1.00 0.00 ? 754 LYS A CA   6  
ATOM 10098 C C    . LYS A 1 47  ? -1.767  -13.458 5.672   1.00 0.00 ? 754 LYS A C    6  
ATOM 10099 O O    . LYS A 1 47  ? -1.928  -14.378 6.486   1.00 0.00 ? 754 LYS A O    6  
ATOM 10100 C CB   . LYS A 1 47  ? 0.431   -13.799 4.476   1.00 0.00 ? 754 LYS A CB   6  
ATOM 10101 C CG   . LYS A 1 47  ? 1.145   -14.811 3.567   1.00 0.00 ? 754 LYS A CG   6  
ATOM 10102 C CD   . LYS A 1 47  ? 0.929   -14.557 2.087   1.00 0.00 ? 754 LYS A CD   6  
ATOM 10103 C CE   . LYS A 1 47  ? 1.680   -15.569 1.238   1.00 0.00 ? 754 LYS A CE   6  
ATOM 10104 N NZ   . LYS A 1 47  ? 1.229   -16.964 1.479   1.00 0.00 ? 754 LYS A NZ   6  
ATOM 10105 H H    . LYS A 1 47  ? -0.754  -12.161 2.884   1.00 0.00 ? 754 LYS A H    6  
ATOM 10106 H HA   . LYS A 1 47  ? -1.446  -14.671 3.949   1.00 0.00 ? 754 LYS A HA   6  
ATOM 10107 H HB2  . LYS A 1 47  ? 0.840   -12.821 4.265   1.00 0.00 ? 754 LYS A HB2  6  
ATOM 10108 H HB3  . LYS A 1 47  ? 0.647   -14.046 5.504   1.00 0.00 ? 754 LYS A HB3  6  
ATOM 10109 H HG2  . LYS A 1 47  ? 2.206   -14.762 3.763   1.00 0.00 ? 754 LYS A HG2  6  
ATOM 10110 H HG3  . LYS A 1 47  ? 0.789   -15.801 3.809   1.00 0.00 ? 754 LYS A HG3  6  
ATOM 10111 H HD2  . LYS A 1 47  ? -0.126  -14.619 1.866   1.00 0.00 ? 754 LYS A HD2  6  
ATOM 10112 H HD3  . LYS A 1 47  ? 1.287   -13.566 1.850   1.00 0.00 ? 754 LYS A HD3  6  
ATOM 10113 H HE2  . LYS A 1 47  ? 1.533   -15.326 0.197   1.00 0.00 ? 754 LYS A HE2  6  
ATOM 10114 H HE3  . LYS A 1 47  ? 2.731   -15.493 1.471   1.00 0.00 ? 754 LYS A HE3  6  
ATOM 10115 H HZ1  . LYS A 1 47  ? 1.752   -17.611 0.857   1.00 0.00 ? 754 LYS A HZ1  6  
ATOM 10116 H HZ2  . LYS A 1 47  ? 0.218   -17.088 1.277   1.00 0.00 ? 754 LYS A HZ2  6  
ATOM 10117 H HZ3  . LYS A 1 47  ? 1.400   -17.268 2.460   1.00 0.00 ? 754 LYS A HZ3  6  
ATOM 10118 N N    . GLU A 1 48  ? -2.144  -12.232 5.916   1.00 0.00 ? 755 GLU A N    6  
ATOM 10119 C CA   . GLU A 1 48  ? -2.806  -11.863 7.160   1.00 0.00 ? 755 GLU A CA   6  
ATOM 10120 C C    . GLU A 1 48  ? -4.284  -12.154 7.081   1.00 0.00 ? 755 GLU A C    6  
ATOM 10121 O O    . GLU A 1 48  ? -4.856  -12.846 7.924   1.00 0.00 ? 755 GLU A O    6  
ATOM 10122 C CB   . GLU A 1 48  ? -2.620  -10.374 7.462   1.00 0.00 ? 755 GLU A CB   6  
ATOM 10123 C CG   . GLU A 1 48  ? -1.209  -9.948  7.802   1.00 0.00 ? 755 GLU A CG   6  
ATOM 10124 C CD   . GLU A 1 48  ? -0.710  -10.565 9.069   1.00 0.00 ? 755 GLU A CD   6  
ATOM 10125 O OE1  . GLU A 1 48  ? -1.164  -10.145 10.168  1.00 0.00 ? 755 GLU A OE1  6  
ATOM 10126 O OE2  . GLU A 1 48  ? 0.140   -11.479 9.005   1.00 0.00 ? 755 GLU A OE2  6  
ATOM 10127 H H    . GLU A 1 48  ? -1.968  -11.556 5.228   1.00 0.00 ? 755 GLU A H    6  
ATOM 10128 H HA   . GLU A 1 48  ? -2.374  -12.439 7.963   1.00 0.00 ? 755 GLU A HA   6  
ATOM 10129 H HB2  . GLU A 1 48  ? -2.934  -9.811  6.597   1.00 0.00 ? 755 GLU A HB2  6  
ATOM 10130 H HB3  . GLU A 1 48  ? -3.262  -10.112 8.290   1.00 0.00 ? 755 GLU A HB3  6  
ATOM 10131 H HG2  . GLU A 1 48  ? -0.555  -10.243 6.995   1.00 0.00 ? 755 GLU A HG2  6  
ATOM 10132 H HG3  . GLU A 1 48  ? -1.188  -8.873  7.907   1.00 0.00 ? 755 GLU A HG3  6  
ATOM 10133 N N    . ILE A 1 49  ? -4.898  -11.640 6.052   1.00 0.00 ? 756 ILE A N    6  
ATOM 10134 C CA   . ILE A 1 49  ? -6.328  -11.723 5.920   1.00 0.00 ? 756 ILE A CA   6  
ATOM 10135 C C    . ILE A 1 49  ? -6.787  -13.060 5.375   1.00 0.00 ? 756 ILE A C    6  
ATOM 10136 O O    . ILE A 1 49  ? -7.950  -13.380 5.482   1.00 0.00 ? 756 ILE A O    6  
ATOM 10137 C CB   . ILE A 1 49  ? -6.899  -10.587 5.039   1.00 0.00 ? 756 ILE A CB   6  
ATOM 10138 C CG1  . ILE A 1 49  ? -6.310  -10.666 3.619   1.00 0.00 ? 756 ILE A CG1  6  
ATOM 10139 C CG2  . ILE A 1 49  ? -6.622  -9.226  5.684   1.00 0.00 ? 756 ILE A CG2  6  
ATOM 10140 C CD1  . ILE A 1 49  ? -6.816  -9.612  2.673   1.00 0.00 ? 756 ILE A CD1  6  
ATOM 10141 H H    . ILE A 1 49  ? -4.367  -11.188 5.358   1.00 0.00 ? 756 ILE A H    6  
ATOM 10142 H HA   . ILE A 1 49  ? -6.744  -11.606 6.908   1.00 0.00 ? 756 ILE A HA   6  
ATOM 10143 H HB   . ILE A 1 49  ? -7.970  -10.716 4.983   1.00 0.00 ? 756 ILE A HB   6  
ATOM 10144 H HG12 . ILE A 1 49  ? -5.237  -10.563 3.679   1.00 0.00 ? 756 ILE A HG12 6  
ATOM 10145 H HG13 . ILE A 1 49  ? -6.543  -11.634 3.197   1.00 0.00 ? 756 ILE A HG13 6  
ATOM 10146 H HG21 . ILE A 1 49  ? -5.556  -9.096  5.800   1.00 0.00 ? 756 ILE A HG21 6  
ATOM 10147 H HG22 . ILE A 1 49  ? -7.098  -9.186  6.653   1.00 0.00 ? 756 ILE A HG22 6  
ATOM 10148 H HG23 . ILE A 1 49  ? -7.017  -8.442  5.055   1.00 0.00 ? 756 ILE A HG23 6  
ATOM 10149 H HD11 . ILE A 1 49  ? -6.389  -9.765  1.693   1.00 0.00 ? 756 ILE A HD11 6  
ATOM 10150 H HD12 . ILE A 1 49  ? -6.527  -8.639  3.038   1.00 0.00 ? 756 ILE A HD12 6  
ATOM 10151 H HD13 . ILE A 1 49  ? -7.892  -9.673  2.614   1.00 0.00 ? 756 ILE A HD13 6  
ATOM 10152 N N    . GLU A 1 50  ? -5.873  -13.854 4.821   1.00 0.00 ? 757 GLU A N    6  
ATOM 10153 C CA   . GLU A 1 50  ? -6.247  -15.128 4.196   1.00 0.00 ? 757 GLU A CA   6  
ATOM 10154 C C    . GLU A 1 50  ? -6.969  -16.060 5.163   1.00 0.00 ? 757 GLU A C    6  
ATOM 10155 O O    . GLU A 1 50  ? -7.860  -16.797 4.771   1.00 0.00 ? 757 GLU A O    6  
ATOM 10156 C CB   . GLU A 1 50  ? -5.054  -15.835 3.555   1.00 0.00 ? 757 GLU A CB   6  
ATOM 10157 C CG   . GLU A 1 50  ? -4.024  -16.393 4.515   1.00 0.00 ? 757 GLU A CG   6  
ATOM 10158 C CD   . GLU A 1 50  ? -3.002  -17.202 3.786   1.00 0.00 ? 757 GLU A CD   6  
ATOM 10159 O OE1  . GLU A 1 50  ? -3.331  -18.301 3.324   1.00 0.00 ? 757 GLU A OE1  6  
ATOM 10160 O OE2  . GLU A 1 50  ? -1.853  -16.756 3.631   1.00 0.00 ? 757 GLU A OE2  6  
ATOM 10161 H H    . GLU A 1 50  ? -4.932  -13.568 4.790   1.00 0.00 ? 757 GLU A H    6  
ATOM 10162 H HA   . GLU A 1 50  ? -6.953  -14.883 3.417   1.00 0.00 ? 757 GLU A HA   6  
ATOM 10163 H HB2  . GLU A 1 50  ? -5.397  -16.639 2.923   1.00 0.00 ? 757 GLU A HB2  6  
ATOM 10164 H HB3  . GLU A 1 50  ? -4.552  -15.094 2.946   1.00 0.00 ? 757 GLU A HB3  6  
ATOM 10165 H HG2  . GLU A 1 50  ? -3.534  -15.573 5.020   1.00 0.00 ? 757 GLU A HG2  6  
ATOM 10166 H HG3  . GLU A 1 50  ? -4.520  -17.023 5.239   1.00 0.00 ? 757 GLU A HG3  6  
ATOM 10167 N N    . SER A 1 51  ? -6.639  -15.952 6.424   1.00 0.00 ? 758 SER A N    6  
ATOM 10168 C CA   . SER A 1 51  ? -7.214  -16.786 7.444   1.00 0.00 ? 758 SER A CA   6  
ATOM 10169 C C    . SER A 1 51  ? -8.662  -16.362 7.818   1.00 0.00 ? 758 SER A C    6  
ATOM 10170 O O    . SER A 1 51  ? -9.333  -17.031 8.617   1.00 0.00 ? 758 SER A O    6  
ATOM 10171 C CB   . SER A 1 51  ? -6.281  -16.783 8.631   1.00 0.00 ? 758 SER A CB   6  
ATOM 10172 O OG   . SER A 1 51  ? -4.976  -17.161 8.204   1.00 0.00 ? 758 SER A OG   6  
ATOM 10173 H H    . SER A 1 51  ? -5.959  -15.295 6.687   1.00 0.00 ? 758 SER A H    6  
ATOM 10174 H HA   . SER A 1 51  ? -7.259  -17.789 7.051   1.00 0.00 ? 758 SER A HA   6  
ATOM 10175 H HB2  . SER A 1 51  ? -6.240  -15.793 9.058   1.00 0.00 ? 758 SER A HB2  6  
ATOM 10176 H HB3  . SER A 1 51  ? -6.622  -17.490 9.370   1.00 0.00 ? 758 SER A HB3  6  
ATOM 10177 H HG   . SER A 1 51  ? -5.069  -18.018 7.763   1.00 0.00 ? 758 SER A HG   6  
ATOM 10178 N N    . GLU A 1 52  ? -9.134  -15.265 7.238   1.00 0.00 ? 759 GLU A N    6  
ATOM 10179 C CA   . GLU A 1 52  ? -10.515 -14.832 7.408   1.00 0.00 ? 759 GLU A CA   6  
ATOM 10180 C C    . GLU A 1 52  ? -11.182 -14.715 6.031   1.00 0.00 ? 759 GLU A C    6  
ATOM 10181 O O    . GLU A 1 52  ? -12.320 -14.262 5.898   1.00 0.00 ? 759 GLU A O    6  
ATOM 10182 C CB   . GLU A 1 52  ? -10.608 -13.503 8.193   1.00 0.00 ? 759 GLU A CB   6  
ATOM 10183 C CG   . GLU A 1 52  ? -9.864  -12.342 7.561   1.00 0.00 ? 759 GLU A CG   6  
ATOM 10184 C CD   . GLU A 1 52  ? -10.012 -11.060 8.323   1.00 0.00 ? 759 GLU A CD   6  
ATOM 10185 O OE1  . GLU A 1 52  ? -9.275  -10.855 9.307   1.00 0.00 ? 759 GLU A OE1  6  
ATOM 10186 O OE2  . GLU A 1 52  ? -10.843 -10.223 7.936   1.00 0.00 ? 759 GLU A OE2  6  
ATOM 10187 H H    . GLU A 1 52  ? -8.547  -14.712 6.677   1.00 0.00 ? 759 GLU A H    6  
ATOM 10188 H HA   . GLU A 1 52  ? -11.023 -15.613 7.956   1.00 0.00 ? 759 GLU A HA   6  
ATOM 10189 H HB2  . GLU A 1 52  ? -11.648 -13.226 8.277   1.00 0.00 ? 759 GLU A HB2  6  
ATOM 10190 H HB3  . GLU A 1 52  ? -10.211 -13.663 9.186   1.00 0.00 ? 759 GLU A HB3  6  
ATOM 10191 H HG2  . GLU A 1 52  ? -8.814  -12.597 7.517   1.00 0.00 ? 759 GLU A HG2  6  
ATOM 10192 H HG3  . GLU A 1 52  ? -10.234 -12.205 6.556   1.00 0.00 ? 759 GLU A HG3  6  
ATOM 10193 N N    . ILE A 1 53  ? -10.462 -15.151 5.005   1.00 0.00 ? 760 ILE A N    6  
ATOM 10194 C CA   . ILE A 1 53  ? -10.969 -15.131 3.649   1.00 0.00 ? 760 ILE A CA   6  
ATOM 10195 C C    . ILE A 1 53  ? -11.835 -16.355 3.446   1.00 0.00 ? 760 ILE A C    6  
ATOM 10196 O O    . ILE A 1 53  ? -11.342 -17.467 3.213   1.00 0.00 ? 760 ILE A O    6  
ATOM 10197 C CB   . ILE A 1 53  ? -9.820  -15.093 2.588   1.00 0.00 ? 760 ILE A CB   6  
ATOM 10198 C CG1  . ILE A 1 53  ? -8.995  -13.801 2.681   1.00 0.00 ? 760 ILE A CG1  6  
ATOM 10199 C CG2  . ILE A 1 53  ? -10.326 -15.300 1.179   1.00 0.00 ? 760 ILE A CG2  6  
ATOM 10200 C CD1  . ILE A 1 53  ? -9.766  -12.525 2.421   1.00 0.00 ? 760 ILE A CD1  6  
ATOM 10201 H H    . ILE A 1 53  ? -9.575  -15.533 5.174   1.00 0.00 ? 760 ILE A H    6  
ATOM 10202 H HA   . ILE A 1 53  ? -11.590 -14.254 3.537   1.00 0.00 ? 760 ILE A HA   6  
ATOM 10203 H HB   . ILE A 1 53  ? -9.178  -15.929 2.802   1.00 0.00 ? 760 ILE A HB   6  
ATOM 10204 H HG12 . ILE A 1 53  ? -8.593  -13.717 3.680   1.00 0.00 ? 760 ILE A HG12 6  
ATOM 10205 H HG13 . ILE A 1 53  ? -8.183  -13.850 1.969   1.00 0.00 ? 760 ILE A HG13 6  
ATOM 10206 H HG21 . ILE A 1 53  ? -10.878 -16.228 1.125   1.00 0.00 ? 760 ILE A HG21 6  
ATOM 10207 H HG22 . ILE A 1 53  ? -9.473  -15.353 0.520   1.00 0.00 ? 760 ILE A HG22 6  
ATOM 10208 H HG23 . ILE A 1 53  ? -10.959 -14.476 0.889   1.00 0.00 ? 760 ILE A HG23 6  
ATOM 10209 H HD11 . ILE A 1 53  ? -10.081 -12.522 1.389   1.00 0.00 ? 760 ILE A HD11 6  
ATOM 10210 H HD12 . ILE A 1 53  ? -9.135  -11.670 2.615   1.00 0.00 ? 760 ILE A HD12 6  
ATOM 10211 H HD13 . ILE A 1 53  ? -10.636 -12.489 3.061   1.00 0.00 ? 760 ILE A HD13 6  
ATOM 10212 N N    . ASP A 1 54  ? -13.109 -16.160 3.606   1.00 0.00 ? 761 ASP A N    6  
ATOM 10213 C CA   . ASP A 1 54  ? -14.068 -17.239 3.478   1.00 0.00 ? 761 ASP A CA   6  
ATOM 10214 C C    . ASP A 1 54  ? -14.350 -17.579 2.033   1.00 0.00 ? 761 ASP A C    6  
ATOM 10215 O O    . ASP A 1 54  ? -14.640 -18.725 1.707   1.00 0.00 ? 761 ASP A O    6  
ATOM 10216 C CB   . ASP A 1 54  ? -15.373 -16.896 4.205   1.00 0.00 ? 761 ASP A CB   6  
ATOM 10217 C CG   . ASP A 1 54  ? -16.469 -17.924 3.979   1.00 0.00 ? 761 ASP A CG   6  
ATOM 10218 O OD1  . ASP A 1 54  ? -16.407 -19.032 4.572   1.00 0.00 ? 761 ASP A OD1  6  
ATOM 10219 O OD2  . ASP A 1 54  ? -17.424 -17.633 3.223   1.00 0.00 ? 761 ASP A OD2  6  
ATOM 10220 H H    . ASP A 1 54  ? -13.402 -15.257 3.856   1.00 0.00 ? 761 ASP A H    6  
ATOM 10221 H HA   . ASP A 1 54  ? -13.638 -18.107 3.956   1.00 0.00 ? 761 ASP A HA   6  
ATOM 10222 H HB2  . ASP A 1 54  ? -15.180 -16.838 5.266   1.00 0.00 ? 761 ASP A HB2  6  
ATOM 10223 H HB3  . ASP A 1 54  ? -15.723 -15.936 3.855   1.00 0.00 ? 761 ASP A HB3  6  
ATOM 10224 N N    . SER A 1 55  ? -14.175 -16.633 1.163   1.00 0.00 ? 762 SER A N    6  
ATOM 10225 C CA   . SER A 1 55  ? -14.563 -16.831 -0.199  1.00 0.00 ? 762 SER A CA   6  
ATOM 10226 C C    . SER A 1 55  ? -13.442 -16.454 -1.145  1.00 0.00 ? 762 SER A C    6  
ATOM 10227 O O    . SER A 1 55  ? -12.571 -15.658 -0.798  1.00 0.00 ? 762 SER A O    6  
ATOM 10228 C CB   . SER A 1 55  ? -15.791 -15.973 -0.479  1.00 0.00 ? 762 SER A CB   6  
ATOM 10229 O OG   . SER A 1 55  ? -15.524 -14.607 -0.222  1.00 0.00 ? 762 SER A OG   6  
ATOM 10230 H H    . SER A 1 55  ? -13.734 -15.792 1.402   1.00 0.00 ? 762 SER A H    6  
ATOM 10231 H HA   . SER A 1 55  ? -14.836 -17.865 -0.343  1.00 0.00 ? 762 SER A HA   6  
ATOM 10232 H HB2  . SER A 1 55  ? -16.035 -16.060 -1.525  1.00 0.00 ? 762 SER A HB2  6  
ATOM 10233 H HB3  . SER A 1 55  ? -16.621 -16.296 0.132   1.00 0.00 ? 762 SER A HB3  6  
ATOM 10234 H HG   . SER A 1 55  ? -16.243 -14.234 0.302   1.00 0.00 ? 762 SER A HG   6  
ATOM 10235 N N    . GLU A 1 56  ? -13.472 -17.006 -2.340  1.00 0.00 ? 763 GLU A N    6  
ATOM 10236 C CA   . GLU A 1 56  ? -12.515 -16.661 -3.370  1.00 0.00 ? 763 GLU A CA   6  
ATOM 10237 C C    . GLU A 1 56  ? -12.755 -15.207 -3.769  1.00 0.00 ? 763 GLU A C    6  
ATOM 10238 O O    . GLU A 1 56  ? -11.820 -14.463 -4.086  1.00 0.00 ? 763 GLU A O    6  
ATOM 10239 C CB   . GLU A 1 56  ? -12.707 -17.574 -4.575  1.00 0.00 ? 763 GLU A CB   6  
ATOM 10240 C CG   . GLU A 1 56  ? -11.724 -17.341 -5.708  1.00 0.00 ? 763 GLU A CG   6  
ATOM 10241 C CD   . GLU A 1 56  ? -12.042 -18.182 -6.902  1.00 0.00 ? 763 GLU A CD   6  
ATOM 10242 O OE1  . GLU A 1 56  ? -11.572 -19.336 -6.984  1.00 0.00 ? 763 GLU A OE1  6  
ATOM 10243 O OE2  . GLU A 1 56  ? -12.792 -17.727 -7.777  1.00 0.00 ? 763 GLU A OE2  6  
ATOM 10244 H H    . GLU A 1 56  ? -14.165 -17.675 -2.536  1.00 0.00 ? 763 GLU A H    6  
ATOM 10245 H HA   . GLU A 1 56  ? -11.515 -16.770 -2.978  1.00 0.00 ? 763 GLU A HA   6  
ATOM 10246 H HB2  . GLU A 1 56  ? -12.602 -18.598 -4.248  1.00 0.00 ? 763 GLU A HB2  6  
ATOM 10247 H HB3  . GLU A 1 56  ? -13.706 -17.436 -4.959  1.00 0.00 ? 763 GLU A HB3  6  
ATOM 10248 H HG2  . GLU A 1 56  ? -11.767 -16.302 -6.000  1.00 0.00 ? 763 GLU A HG2  6  
ATOM 10249 H HG3  . GLU A 1 56  ? -10.727 -17.581 -5.368  1.00 0.00 ? 763 GLU A HG3  6  
ATOM 10250 N N    . GLU A 1 57  ? -14.024 -14.810 -3.695  1.00 0.00 ? 764 GLU A N    6  
ATOM 10251 C CA   . GLU A 1 57  ? -14.455 -13.463 -3.990  1.00 0.00 ? 764 GLU A CA   6  
ATOM 10252 C C    . GLU A 1 57  ? -13.747 -12.460 -3.096  1.00 0.00 ? 764 GLU A C    6  
ATOM 10253 O O    . GLU A 1 57  ? -13.296 -11.422 -3.571  1.00 0.00 ? 764 GLU A O    6  
ATOM 10254 C CB   . GLU A 1 57  ? -15.966 -13.344 -3.852  1.00 0.00 ? 764 GLU A CB   6  
ATOM 10255 C CG   . GLU A 1 57  ? -16.714 -14.225 -4.833  1.00 0.00 ? 764 GLU A CG   6  
ATOM 10256 C CD   . GLU A 1 57  ? -18.199 -14.002 -4.823  1.00 0.00 ? 764 GLU A CD   6  
ATOM 10257 O OE1  . GLU A 1 57  ? -18.662 -12.995 -5.397  1.00 0.00 ? 764 GLU A OE1  6  
ATOM 10258 O OE2  . GLU A 1 57  ? -18.937 -14.849 -4.292  1.00 0.00 ? 764 GLU A OE2  6  
ATOM 10259 H H    . GLU A 1 57  ? -14.693 -15.476 -3.430  1.00 0.00 ? 764 GLU A H    6  
ATOM 10260 H HA   . GLU A 1 57  ? -14.182 -13.250 -5.014  1.00 0.00 ? 764 GLU A HA   6  
ATOM 10261 H HB2  . GLU A 1 57  ? -16.243 -13.638 -2.850  1.00 0.00 ? 764 GLU A HB2  6  
ATOM 10262 H HB3  . GLU A 1 57  ? -16.261 -12.321 -4.013  1.00 0.00 ? 764 GLU A HB3  6  
ATOM 10263 H HG2  . GLU A 1 57  ? -16.350 -14.030 -5.830  1.00 0.00 ? 764 GLU A HG2  6  
ATOM 10264 H HG3  . GLU A 1 57  ? -16.518 -15.257 -4.582  1.00 0.00 ? 764 GLU A HG3  6  
ATOM 10265 N N    . GLU A 1 58  ? -13.654 -12.782 -1.809  1.00 0.00 ? 765 GLU A N    6  
ATOM 10266 C CA   . GLU A 1 58  ? -12.898 -11.991 -0.849  1.00 0.00 ? 765 GLU A CA   6  
ATOM 10267 C C    . GLU A 1 58  ? -11.473 -11.779 -1.303  1.00 0.00 ? 765 GLU A C    6  
ATOM 10268 O O    . GLU A 1 58  ? -11.011 -10.650 -1.388  1.00 0.00 ? 765 GLU A O    6  
ATOM 10269 C CB   . GLU A 1 58  ? -12.867 -12.688 0.498   1.00 0.00 ? 765 GLU A CB   6  
ATOM 10270 C CG   . GLU A 1 58  ? -14.033 -12.408 1.378   1.00 0.00 ? 765 GLU A CG   6  
ATOM 10271 C CD   . GLU A 1 58  ? -14.033 -10.985 1.833   1.00 0.00 ? 765 GLU A CD   6  
ATOM 10272 O OE1  . GLU A 1 58  ? -13.007 -10.515 2.361   1.00 0.00 ? 765 GLU A OE1  6  
ATOM 10273 O OE2  . GLU A 1 58  ? -15.047 -10.295 1.677   1.00 0.00 ? 765 GLU A OE2  6  
ATOM 10274 H H    . GLU A 1 58  ? -14.127 -13.579 -1.479  1.00 0.00 ? 765 GLU A H    6  
ATOM 10275 H HA   . GLU A 1 58  ? -13.384 -11.036 -0.725  1.00 0.00 ? 765 GLU A HA   6  
ATOM 10276 H HB2  . GLU A 1 58  ? -12.834 -13.754 0.332   1.00 0.00 ? 765 GLU A HB2  6  
ATOM 10277 H HB3  . GLU A 1 58  ? -11.974 -12.386 1.021   1.00 0.00 ? 765 GLU A HB3  6  
ATOM 10278 H HG2  . GLU A 1 58  ? -14.928 -12.602 0.805   1.00 0.00 ? 765 GLU A HG2  6  
ATOM 10279 H HG3  . GLU A 1 58  ? -13.995 -13.064 2.234   1.00 0.00 ? 765 GLU A HG3  6  
ATOM 10280 N N    . LEU A 1 59  ? -10.803 -12.869 -1.618  1.00 0.00 ? 766 LEU A N    6  
ATOM 10281 C CA   . LEU A 1 59  ? -9.389  -12.838 -1.988  1.00 0.00 ? 766 LEU A CA   6  
ATOM 10282 C C    . LEU A 1 59  ? -9.164  -11.998 -3.244  1.00 0.00 ? 766 LEU A C    6  
ATOM 10283 O O    . LEU A 1 59  ? -8.322  -11.088 -3.249  1.00 0.00 ? 766 LEU A O    6  
ATOM 10284 C CB   . LEU A 1 59  ? -8.853  -14.262 -2.189  1.00 0.00 ? 766 LEU A CB   6  
ATOM 10285 C CG   . LEU A 1 59  ? -7.337  -14.402 -2.398  1.00 0.00 ? 766 LEU A CG   6  
ATOM 10286 C CD1  . LEU A 1 59  ? -6.565  -13.899 -1.177  1.00 0.00 ? 766 LEU A CD1  6  
ATOM 10287 C CD2  . LEU A 1 59  ? -6.978  -15.847 -2.696  1.00 0.00 ? 766 LEU A CD2  6  
ATOM 10288 H H    . LEU A 1 59  ? -11.297 -13.718 -1.599  1.00 0.00 ? 766 LEU A H    6  
ATOM 10289 H HA   . LEU A 1 59  ? -8.854  -12.379 -1.170  1.00 0.00 ? 766 LEU A HA   6  
ATOM 10290 H HB2  . LEU A 1 59  ? -9.134  -14.855 -1.333  1.00 0.00 ? 766 LEU A HB2  6  
ATOM 10291 H HB3  . LEU A 1 59  ? -9.349  -14.678 -3.055  1.00 0.00 ? 766 LEU A HB3  6  
ATOM 10292 H HG   . LEU A 1 59  ? -7.044  -13.798 -3.244  1.00 0.00 ? 766 LEU A HG   6  
ATOM 10293 H HD11 . LEU A 1 59  ? -6.772  -12.851 -1.016  1.00 0.00 ? 766 LEU A HD11 6  
ATOM 10294 H HD12 . LEU A 1 59  ? -5.505  -14.033 -1.335  1.00 0.00 ? 766 LEU A HD12 6  
ATOM 10295 H HD13 . LEU A 1 59  ? -6.863  -14.457 -0.301  1.00 0.00 ? 766 LEU A HD13 6  
ATOM 10296 H HD21 . LEU A 1 59  ? -5.911  -15.932 -2.835  1.00 0.00 ? 766 LEU A HD21 6  
ATOM 10297 H HD22 . LEU A 1 59  ? -7.483  -16.167 -3.595  1.00 0.00 ? 766 LEU A HD22 6  
ATOM 10298 H HD23 . LEU A 1 59  ? -7.284  -16.472 -1.870  1.00 0.00 ? 766 LEU A HD23 6  
ATOM 10299 N N    . ILE A 1 60  ? -9.940  -12.285 -4.287  1.00 0.00 ? 767 ILE A N    6  
ATOM 10300 C CA   . ILE A 1 60  ? -9.845  -11.564 -5.555  1.00 0.00 ? 767 ILE A CA   6  
ATOM 10301 C C    . ILE A 1 60  ? -10.130 -10.073 -5.345  1.00 0.00 ? 767 ILE A C    6  
ATOM 10302 O O    . ILE A 1 60  ? -9.398  -9.204  -5.846  1.00 0.00 ? 767 ILE A O    6  
ATOM 10303 C CB   . ILE A 1 60  ? -10.830 -12.144 -6.620  1.00 0.00 ? 767 ILE A CB   6  
ATOM 10304 C CG1  . ILE A 1 60  ? -10.503 -13.621 -6.903  1.00 0.00 ? 767 ILE A CG1  6  
ATOM 10305 C CG2  . ILE A 1 60  ? -10.789 -11.326 -7.917  1.00 0.00 ? 767 ILE A CG2  6  
ATOM 10306 C CD1  . ILE A 1 60  ? -11.428 -14.282 -7.912  1.00 0.00 ? 767 ILE A CD1  6  
ATOM 10307 H H    . ILE A 1 60  ? -10.593 -13.016 -4.197  1.00 0.00 ? 767 ILE A H    6  
ATOM 10308 H HA   . ILE A 1 60  ? -8.834  -11.673 -5.920  1.00 0.00 ? 767 ILE A HA   6  
ATOM 10309 H HB   . ILE A 1 60  ? -11.831 -12.082 -6.219  1.00 0.00 ? 767 ILE A HB   6  
ATOM 10310 H HG12 . ILE A 1 60  ? -9.494  -13.696 -7.279  1.00 0.00 ? 767 ILE A HG12 6  
ATOM 10311 H HG13 . ILE A 1 60  ? -10.572 -14.175 -5.977  1.00 0.00 ? 767 ILE A HG13 6  
ATOM 10312 H HG21 . ILE A 1 60  ? -11.483 -11.749 -8.629  1.00 0.00 ? 767 ILE A HG21 6  
ATOM 10313 H HG22 . ILE A 1 60  ? -9.791  -11.352 -8.331  1.00 0.00 ? 767 ILE A HG22 6  
ATOM 10314 H HG23 . ILE A 1 60  ? -11.066 -10.304 -7.704  1.00 0.00 ? 767 ILE A HG23 6  
ATOM 10315 H HD11 . ILE A 1 60  ? -11.138 -15.313 -8.045  1.00 0.00 ? 767 ILE A HD11 6  
ATOM 10316 H HD12 . ILE A 1 60  ? -11.357 -13.762 -8.856  1.00 0.00 ? 767 ILE A HD12 6  
ATOM 10317 H HD13 . ILE A 1 60  ? -12.444 -14.235 -7.548  1.00 0.00 ? 767 ILE A HD13 6  
ATOM 10318 N N    . ASN A 1 61  ? -11.166 -9.785  -4.574  1.00 0.00 ? 768 ASN A N    6  
ATOM 10319 C CA   . ASN A 1 61  ? -11.550 -8.425  -4.292  1.00 0.00 ? 768 ASN A CA   6  
ATOM 10320 C C    . ASN A 1 61  ? -10.489 -7.689  -3.486  1.00 0.00 ? 768 ASN A C    6  
ATOM 10321 O O    . ASN A 1 61  ? -10.119 -6.563  -3.819  1.00 0.00 ? 768 ASN A O    6  
ATOM 10322 C CB   . ASN A 1 61  ? -12.904 -8.351  -3.579  1.00 0.00 ? 768 ASN A CB   6  
ATOM 10323 C CG   . ASN A 1 61  ? -13.158 -6.963  -3.049  1.00 0.00 ? 768 ASN A CG   6  
ATOM 10324 O OD1  . ASN A 1 61  ? -13.674 -6.097  -3.746  1.00 0.00 ? 768 ASN A OD1  6  
ATOM 10325 N ND2  . ASN A 1 61  ? -12.819 -6.757  -1.809  1.00 0.00 ? 768 ASN A ND2  6  
ATOM 10326 H H    . ASN A 1 61  ? -11.693 -10.514 -4.174  1.00 0.00 ? 768 ASN A H    6  
ATOM 10327 H HA   . ASN A 1 61  ? -11.650 -7.935  -5.249  1.00 0.00 ? 768 ASN A HA   6  
ATOM 10328 H HB2  . ASN A 1 61  ? -13.689 -8.616  -4.271  1.00 0.00 ? 768 ASN A HB2  6  
ATOM 10329 H HB3  . ASN A 1 61  ? -12.903 -9.048  -2.753  1.00 0.00 ? 768 ASN A HB3  6  
ATOM 10330 H HD21 . ASN A 1 61  ? -12.456 -7.516  -1.308  1.00 0.00 ? 768 ASN A HD21 6  
ATOM 10331 H HD22 . ASN A 1 61  ? -12.891 -5.858  -1.440  1.00 0.00 ? 768 ASN A HD22 6  
ATOM 10332 N N    . LYS A 1 62  ? -10.015 -8.314  -2.425  1.00 0.00 ? 769 LYS A N    6  
ATOM 10333 C CA   . LYS A 1 62  ? -9.017  -7.698  -1.579  1.00 0.00 ? 769 LYS A CA   6  
ATOM 10334 C C    . LYS A 1 62  ? -7.763  -7.394  -2.376  1.00 0.00 ? 769 LYS A C    6  
ATOM 10335 O O    . LYS A 1 62  ? -7.209  -6.301  -2.255  1.00 0.00 ? 769 LYS A O    6  
ATOM 10336 C CB   . LYS A 1 62  ? -8.686  -8.560  -0.350  1.00 0.00 ? 769 LYS A CB   6  
ATOM 10337 C CG   . LYS A 1 62  ? -9.791  -8.646  0.721   1.00 0.00 ? 769 LYS A CG   6  
ATOM 10338 C CD   . LYS A 1 62  ? -10.061 -7.292  1.377   1.00 0.00 ? 769 LYS A CD   6  
ATOM 10339 C CE   . LYS A 1 62  ? -10.932 -7.419  2.636   1.00 0.00 ? 769 LYS A CE   6  
ATOM 10340 N NZ   . LYS A 1 62  ? -12.271 -8.019  2.390   1.00 0.00 ? 769 LYS A NZ   6  
ATOM 10341 H H    . LYS A 1 62  ? -10.331 -9.224  -2.218  1.00 0.00 ? 769 LYS A H    6  
ATOM 10342 H HA   . LYS A 1 62  ? -9.437  -6.760  -1.242  1.00 0.00 ? 769 LYS A HA   6  
ATOM 10343 H HB2  . LYS A 1 62  ? -8.477  -9.565  -0.685  1.00 0.00 ? 769 LYS A HB2  6  
ATOM 10344 H HB3  . LYS A 1 62  ? -7.797  -8.161  0.115   1.00 0.00 ? 769 LYS A HB3  6  
ATOM 10345 H HG2  . LYS A 1 62  ? -10.702 -8.979  0.247   1.00 0.00 ? 769 LYS A HG2  6  
ATOM 10346 H HG3  . LYS A 1 62  ? -9.507  -9.359  1.480   1.00 0.00 ? 769 LYS A HG3  6  
ATOM 10347 H HD2  . LYS A 1 62  ? -9.122  -6.828  1.651   1.00 0.00 ? 769 LYS A HD2  6  
ATOM 10348 H HD3  . LYS A 1 62  ? -10.565 -6.653  0.669   1.00 0.00 ? 769 LYS A HD3  6  
ATOM 10349 H HE2  . LYS A 1 62  ? -10.411 -8.041  3.347   1.00 0.00 ? 769 LYS A HE2  6  
ATOM 10350 H HE3  . LYS A 1 62  ? -11.059 -6.434  3.061   1.00 0.00 ? 769 LYS A HE3  6  
ATOM 10351 H HZ1  . LYS A 1 62  ? -12.251 -9.028  2.113   1.00 0.00 ? 769 LYS A HZ1  6  
ATOM 10352 H HZ2  . LYS A 1 62  ? -12.846 -7.527  1.679   1.00 0.00 ? 769 LYS A HZ2  6  
ATOM 10353 H HZ3  . LYS A 1 62  ? -12.824 -7.990  3.270   1.00 0.00 ? 769 LYS A HZ3  6  
ATOM 10354 N N    . LYS A 1 63  ? -7.343  -8.344  -3.227  1.00 0.00 ? 770 LYS A N    6  
ATOM 10355 C CA   . LYS A 1 63  ? -6.197  -8.163  -4.038  1.00 0.00 ? 770 LYS A CA   6  
ATOM 10356 C C    . LYS A 1 63  ? -6.372  -7.018  -5.040  1.00 0.00 ? 770 LYS A C    6  
ATOM 10357 O O    . LYS A 1 63  ? -5.548  -6.127  -5.080  1.00 0.00 ? 770 LYS A O    6  
ATOM 10358 C CB   . LYS A 1 63  ? -5.861  -9.434  -4.762  1.00 0.00 ? 770 LYS A CB   6  
ATOM 10359 C CG   . LYS A 1 63  ? -4.461  -9.421  -5.277  1.00 0.00 ? 770 LYS A CG   6  
ATOM 10360 C CD   . LYS A 1 63  ? -4.107  -10.713 -5.929  1.00 0.00 ? 770 LYS A CD   6  
ATOM 10361 C CE   . LYS A 1 63  ? -2.633  -10.932 -5.819  1.00 0.00 ? 770 LYS A CE   6  
ATOM 10362 N NZ   . LYS A 1 63  ? -1.825  -9.881  -6.497  1.00 0.00 ? 770 LYS A NZ   6  
ATOM 10363 H H    . LYS A 1 63  ? -7.759  -9.231  -3.303  1.00 0.00 ? 770 LYS A H    6  
ATOM 10364 H HA   . LYS A 1 63  ? -5.374  -7.935  -3.378  1.00 0.00 ? 770 LYS A HA   6  
ATOM 10365 H HB2  . LYS A 1 63  ? -5.979  -10.264 -4.081  1.00 0.00 ? 770 LYS A HB2  6  
ATOM 10366 H HB3  . LYS A 1 63  ? -6.534  -9.556  -5.598  1.00 0.00 ? 770 LYS A HB3  6  
ATOM 10367 H HG2  . LYS A 1 63  ? -4.362  -8.627  -6.004  1.00 0.00 ? 770 LYS A HG2  6  
ATOM 10368 H HG3  . LYS A 1 63  ? -3.787  -9.238  -4.454  1.00 0.00 ? 770 LYS A HG3  6  
ATOM 10369 H HD2  . LYS A 1 63  ? -4.630  -11.517 -5.433  1.00 0.00 ? 770 LYS A HD2  6  
ATOM 10370 H HD3  . LYS A 1 63  ? -4.385  -10.676 -6.972  1.00 0.00 ? 770 LYS A HD3  6  
ATOM 10371 H HE2  . LYS A 1 63  ? -2.479  -10.872 -4.751  1.00 0.00 ? 770 LYS A HE2  6  
ATOM 10372 H HE3  . LYS A 1 63  ? -2.395  -11.919 -6.182  1.00 0.00 ? 770 LYS A HE3  6  
ATOM 10373 H HZ1  . LYS A 1 63  ? -0.811  -10.103 -6.412  1.00 0.00 ? 770 LYS A HZ1  6  
ATOM 10374 H HZ2  . LYS A 1 63  ? -1.953  -8.927  -6.091  1.00 0.00 ? 770 LYS A HZ2  6  
ATOM 10375 H HZ3  . LYS A 1 63  ? -2.039  -9.826  -7.514  1.00 0.00 ? 770 LYS A HZ3  6  
ATOM 10376 N N    . ARG A 1 64  ? -7.468  -7.030  -5.819  1.00 0.00 ? 771 ARG A N    6  
ATOM 10377 C CA   . ARG A 1 64  ? -7.682  -5.995  -6.861  1.00 0.00 ? 771 ARG A CA   6  
ATOM 10378 C C    . ARG A 1 64  ? -7.637  -4.584  -6.259  1.00 0.00 ? 771 ARG A C    6  
ATOM 10379 O O    . ARG A 1 64  ? -7.116  -3.654  -6.872  1.00 0.00 ? 771 ARG A O    6  
ATOM 10380 C CB   . ARG A 1 64  ? -9.016  -6.195  -7.628  1.00 0.00 ? 771 ARG A CB   6  
ATOM 10381 C CG   . ARG A 1 64  ? -10.255 -5.969  -6.776  1.00 0.00 ? 771 ARG A CG   6  
ATOM 10382 C CD   . ARG A 1 64  ? -11.551 -6.107  -7.542  1.00 0.00 ? 771 ARG A CD   6  
ATOM 10383 N NE   . ARG A 1 64  ? -12.708 -5.872  -6.664  1.00 0.00 ? 771 ARG A NE   6  
ATOM 10384 C CZ   . ARG A 1 64  ? -13.977 -5.665  -7.062  1.00 0.00 ? 771 ARG A CZ   6  
ATOM 10385 N NH1  . ARG A 1 64  ? -14.295 -5.652  -8.350  1.00 0.00 ? 771 ARG A NH1  6  
ATOM 10386 N NH2  . ARG A 1 64  ? -14.915 -5.479  -6.151  1.00 0.00 ? 771 ARG A NH2  6  
ATOM 10387 H H    . ARG A 1 64  ? -8.130  -7.747  -5.692  1.00 0.00 ? 771 ARG A H    6  
ATOM 10388 H HA   . ARG A 1 64  ? -6.861  -6.081  -7.555  1.00 0.00 ? 771 ARG A HA   6  
ATOM 10389 H HB2  . ARG A 1 64  ? -9.046  -5.505  -8.457  1.00 0.00 ? 771 ARG A HB2  6  
ATOM 10390 H HB3  . ARG A 1 64  ? -9.048  -7.200  -8.018  1.00 0.00 ? 771 ARG A HB3  6  
ATOM 10391 H HG2  . ARG A 1 64  ? -10.243 -6.685  -5.969  1.00 0.00 ? 771 ARG A HG2  6  
ATOM 10392 H HG3  . ARG A 1 64  ? -10.194 -4.975  -6.356  1.00 0.00 ? 771 ARG A HG3  6  
ATOM 10393 H HD2  . ARG A 1 64  ? -11.567 -5.381  -8.341  1.00 0.00 ? 771 ARG A HD2  6  
ATOM 10394 H HD3  . ARG A 1 64  ? -11.615 -7.107  -7.944  1.00 0.00 ? 771 ARG A HD3  6  
ATOM 10395 H HE   . ARG A 1 64  ? -12.505 -5.866  -5.702  1.00 0.00 ? 771 ARG A HE   6  
ATOM 10396 H HH11 . ARG A 1 64  ? -13.607 -5.800  -9.066  1.00 0.00 ? 771 ARG A HH11 6  
ATOM 10397 H HH12 . ARG A 1 64  ? -15.228 -5.482  -8.677  1.00 0.00 ? 771 ARG A HH12 6  
ATOM 10398 H HH21 . ARG A 1 64  ? -14.688 -5.491  -5.170  1.00 0.00 ? 771 ARG A HH21 6  
ATOM 10399 H HH22 . ARG A 1 64  ? -15.882 -5.322  -6.360  1.00 0.00 ? 771 ARG A HH22 6  
ATOM 10400 N N    . ILE A 1 65  ? -8.150  -4.447  -5.045  1.00 0.00 ? 772 ILE A N    6  
ATOM 10401 C CA   . ILE A 1 65  ? -8.176  -3.177  -4.383  1.00 0.00 ? 772 ILE A CA   6  
ATOM 10402 C C    . ILE A 1 65  ? -6.797  -2.810  -3.877  1.00 0.00 ? 772 ILE A C    6  
ATOM 10403 O O    . ILE A 1 65  ? -6.324  -1.730  -4.167  1.00 0.00 ? 772 ILE A O    6  
ATOM 10404 C CB   . ILE A 1 65  ? -9.227  -3.112  -3.236  1.00 0.00 ? 772 ILE A CB   6  
ATOM 10405 C CG1  . ILE A 1 65  ? -10.635 -3.318  -3.810  1.00 0.00 ? 772 ILE A CG1  6  
ATOM 10406 C CG2  . ILE A 1 65  ? -9.148  -1.769  -2.491  1.00 0.00 ? 772 ILE A CG2  6  
ATOM 10407 C CD1  . ILE A 1 65  ? -11.737 -3.231  -2.783  1.00 0.00 ? 772 ILE A CD1  6  
ATOM 10408 H H    . ILE A 1 65  ? -8.508  -5.241  -4.594  1.00 0.00 ? 772 ILE A H    6  
ATOM 10409 H HA   . ILE A 1 65  ? -8.447  -2.450  -5.135  1.00 0.00 ? 772 ILE A HA   6  
ATOM 10410 H HB   . ILE A 1 65  ? -9.019  -3.903  -2.531  1.00 0.00 ? 772 ILE A HB   6  
ATOM 10411 H HG12 . ILE A 1 65  ? -10.826 -2.560  -4.558  1.00 0.00 ? 772 ILE A HG12 6  
ATOM 10412 H HG13 . ILE A 1 65  ? -10.687 -4.292  -4.272  1.00 0.00 ? 772 ILE A HG13 6  
ATOM 10413 H HG21 . ILE A 1 65  ? -9.863  -1.758  -1.683  1.00 0.00 ? 772 ILE A HG21 6  
ATOM 10414 H HG22 . ILE A 1 65  ? -9.369  -0.966  -3.177  1.00 0.00 ? 772 ILE A HG22 6  
ATOM 10415 H HG23 . ILE A 1 65  ? -8.153  -1.632  -2.093  1.00 0.00 ? 772 ILE A HG23 6  
ATOM 10416 H HD11 . ILE A 1 65  ? -11.706 -2.255  -2.319  1.00 0.00 ? 772 ILE A HD11 6  
ATOM 10417 H HD12 . ILE A 1 65  ? -11.592 -3.993  -2.033  1.00 0.00 ? 772 ILE A HD12 6  
ATOM 10418 H HD13 . ILE A 1 65  ? -12.693 -3.371  -3.263  1.00 0.00 ? 772 ILE A HD13 6  
ATOM 10419 N N    . ILE A 1 66  ? -6.126  -3.730  -3.173  1.00 0.00 ? 773 ILE A N    6  
ATOM 10420 C CA   . ILE A 1 66  ? -4.804  -3.430  -2.629  1.00 0.00 ? 773 ILE A CA   6  
ATOM 10421 C C    . ILE A 1 66  ? -3.814  -3.073  -3.763  1.00 0.00 ? 773 ILE A C    6  
ATOM 10422 O O    . ILE A 1 66  ? -3.082  -2.097  -3.649  1.00 0.00 ? 773 ILE A O    6  
ATOM 10423 C CB   . ILE A 1 66  ? -4.247  -4.561  -1.675  1.00 0.00 ? 773 ILE A CB   6  
ATOM 10424 C CG1  . ILE A 1 66  ? -2.927  -4.159  -1.004  1.00 0.00 ? 773 ILE A CG1  6  
ATOM 10425 C CG2  . ILE A 1 66  ? -4.076  -5.870  -2.385  1.00 0.00 ? 773 ILE A CG2  6  
ATOM 10426 C CD1  . ILE A 1 66  ? -3.049  -2.996  -0.042  1.00 0.00 ? 773 ILE A CD1  6  
ATOM 10427 H H    . ILE A 1 66  ? -6.523  -4.619  -3.030  1.00 0.00 ? 773 ILE A H    6  
ATOM 10428 H HA   . ILE A 1 66  ? -4.944  -2.529  -2.050  1.00 0.00 ? 773 ILE A HA   6  
ATOM 10429 H HB   . ILE A 1 66  ? -4.984  -4.717  -0.900  1.00 0.00 ? 773 ILE A HB   6  
ATOM 10430 H HG12 . ILE A 1 66  ? -2.550  -5.012  -0.459  1.00 0.00 ? 773 ILE A HG12 6  
ATOM 10431 H HG13 . ILE A 1 66  ? -2.220  -3.885  -1.772  1.00 0.00 ? 773 ILE A HG13 6  
ATOM 10432 H HG21 . ILE A 1 66  ? -5.018  -6.121  -2.845  1.00 0.00 ? 773 ILE A HG21 6  
ATOM 10433 H HG22 . ILE A 1 66  ? -3.811  -6.636  -1.670  1.00 0.00 ? 773 ILE A HG22 6  
ATOM 10434 H HG23 . ILE A 1 66  ? -3.315  -5.782  -3.145  1.00 0.00 ? 773 ILE A HG23 6  
ATOM 10435 H HD11 . ILE A 1 66  ? -3.388  -2.118  -0.571  1.00 0.00 ? 773 ILE A HD11 6  
ATOM 10436 H HD12 . ILE A 1 66  ? -2.087  -2.795  0.408   1.00 0.00 ? 773 ILE A HD12 6  
ATOM 10437 H HD13 . ILE A 1 66  ? -3.760  -3.248  0.730   1.00 0.00 ? 773 ILE A HD13 6  
ATOM 10438 N N    . GLU A 1 67  ? -3.878  -3.814  -4.885  1.00 0.00 ? 774 GLU A N    6  
ATOM 10439 C CA   . GLU A 1 67  ? -3.036  -3.529  -6.058  1.00 0.00 ? 774 GLU A CA   6  
ATOM 10440 C C    . GLU A 1 67  ? -3.345  -2.119  -6.580  1.00 0.00 ? 774 GLU A C    6  
ATOM 10441 O O    . GLU A 1 67  ? -2.455  -1.266  -6.683  1.00 0.00 ? 774 GLU A O    6  
ATOM 10442 C CB   . GLU A 1 67  ? -3.327  -4.497  -7.212  1.00 0.00 ? 774 GLU A CB   6  
ATOM 10443 C CG   . GLU A 1 67  ? -3.203  -5.988  -6.931  1.00 0.00 ? 774 GLU A CG   6  
ATOM 10444 C CD   . GLU A 1 67  ? -1.805  -6.485  -6.663  1.00 0.00 ? 774 GLU A CD   6  
ATOM 10445 O OE1  . GLU A 1 67  ? -0.879  -6.170  -7.443  1.00 0.00 ? 774 GLU A OE1  6  
ATOM 10446 O OE2  . GLU A 1 67  ? -1.628  -7.303  -5.750  1.00 0.00 ? 774 GLU A OE2  6  
ATOM 10447 H H    . GLU A 1 67  ? -4.500  -4.574  -4.912  1.00 0.00 ? 774 GLU A H    6  
ATOM 10448 H HA   . GLU A 1 67  ? -1.996  -3.602  -5.777  1.00 0.00 ? 774 GLU A HA   6  
ATOM 10449 H HB2  . GLU A 1 67  ? -4.331  -4.313  -7.562  1.00 0.00 ? 774 GLU A HB2  6  
ATOM 10450 H HB3  . GLU A 1 67  ? -2.637  -4.246  -8.005  1.00 0.00 ? 774 GLU A HB3  6  
ATOM 10451 H HG2  . GLU A 1 67  ? -3.806  -6.217  -6.064  1.00 0.00 ? 774 GLU A HG2  6  
ATOM 10452 H HG3  . GLU A 1 67  ? -3.609  -6.518  -7.780  1.00 0.00 ? 774 GLU A HG3  6  
ATOM 10453 N N    . LYS A 1 68  ? -4.633  -1.868  -6.876  1.00 0.00 ? 775 LYS A N    6  
ATOM 10454 C CA   . LYS A 1 68  ? -5.053  -0.586  -7.456  1.00 0.00 ? 775 LYS A CA   6  
ATOM 10455 C C    . LYS A 1 68  ? -4.833  0.589   -6.520  1.00 0.00 ? 775 LYS A C    6  
ATOM 10456 O O    . LYS A 1 68  ? -4.562  1.695   -6.971  1.00 0.00 ? 775 LYS A O    6  
ATOM 10457 C CB   . LYS A 1 68  ? -6.498  -0.608  -7.971  1.00 0.00 ? 775 LYS A CB   6  
ATOM 10458 C CG   . LYS A 1 68  ? -6.699  -1.435  -9.233  1.00 0.00 ? 775 LYS A CG   6  
ATOM 10459 C CD   . LYS A 1 68  ? -8.136  -1.345  -9.724  1.00 0.00 ? 775 LYS A CD   6  
ATOM 10460 C CE   . LYS A 1 68  ? -8.324  -2.061  -11.053 1.00 0.00 ? 775 LYS A CE   6  
ATOM 10461 N NZ   . LYS A 1 68  ? -9.713  -1.956  -11.545 1.00 0.00 ? 775 LYS A NZ   6  
ATOM 10462 H H    . LYS A 1 68  ? -5.312  -2.559  -6.689  1.00 0.00 ? 775 LYS A H    6  
ATOM 10463 H HA   . LYS A 1 68  ? -4.399  -0.431  -8.302  1.00 0.00 ? 775 LYS A HA   6  
ATOM 10464 H HB2  . LYS A 1 68  ? -7.136  -1.011  -7.199  1.00 0.00 ? 775 LYS A HB2  6  
ATOM 10465 H HB3  . LYS A 1 68  ? -6.804  0.405   -8.180  1.00 0.00 ? 775 LYS A HB3  6  
ATOM 10466 H HG2  . LYS A 1 68  ? -6.043  -1.061  -10.005 1.00 0.00 ? 775 LYS A HG2  6  
ATOM 10467 H HG3  . LYS A 1 68  ? -6.459  -2.467  -9.023  1.00 0.00 ? 775 LYS A HG3  6  
ATOM 10468 H HD2  . LYS A 1 68  ? -8.787  -1.796  -8.990  1.00 0.00 ? 775 LYS A HD2  6  
ATOM 10469 H HD3  . LYS A 1 68  ? -8.400  -0.304  -9.845  1.00 0.00 ? 775 LYS A HD3  6  
ATOM 10470 H HE2  . LYS A 1 68  ? -7.660  -1.621  -11.781 1.00 0.00 ? 775 LYS A HE2  6  
ATOM 10471 H HE3  . LYS A 1 68  ? -8.073  -3.104  -10.926 1.00 0.00 ? 775 LYS A HE3  6  
ATOM 10472 H HZ1  . LYS A 1 68  ? -10.005 -0.961  -11.623 1.00 0.00 ? 775 LYS A HZ1  6  
ATOM 10473 H HZ2  . LYS A 1 68  ? -10.377 -2.437  -10.905 1.00 0.00 ? 775 LYS A HZ2  6  
ATOM 10474 H HZ3  . LYS A 1 68  ? -9.810  -2.392  -12.482 1.00 0.00 ? 775 LYS A HZ3  6  
ATOM 10475 N N    . VAL A 1 69  ? -4.946  0.360   -5.233  1.00 0.00 ? 776 VAL A N    6  
ATOM 10476 C CA   . VAL A 1 69  ? -4.696  1.401   -4.261  1.00 0.00 ? 776 VAL A CA   6  
ATOM 10477 C C    . VAL A 1 69  ? -3.213  1.756   -4.222  1.00 0.00 ? 776 VAL A C    6  
ATOM 10478 O O    . VAL A 1 69  ? -2.868  2.930   -4.216  1.00 0.00 ? 776 VAL A O    6  
ATOM 10479 C CB   . VAL A 1 69  ? -5.247  1.047   -2.850  1.00 0.00 ? 776 VAL A CB   6  
ATOM 10480 C CG1  . VAL A 1 69  ? -4.757  2.034   -1.803  1.00 0.00 ? 776 VAL A CG1  6  
ATOM 10481 C CG2  . VAL A 1 69  ? -6.772  1.056   -2.873  1.00 0.00 ? 776 VAL A CG2  6  
ATOM 10482 H H    . VAL A 1 69  ? -5.224  -0.532  -4.923  1.00 0.00 ? 776 VAL A H    6  
ATOM 10483 H HA   . VAL A 1 69  ? -5.217  2.275   -4.626  1.00 0.00 ? 776 VAL A HA   6  
ATOM 10484 H HB   . VAL A 1 69  ? -4.918  0.050   -2.597  1.00 0.00 ? 776 VAL A HB   6  
ATOM 10485 H HG11 . VAL A 1 69  ? -5.141  1.753   -0.833  1.00 0.00 ? 776 VAL A HG11 6  
ATOM 10486 H HG12 . VAL A 1 69  ? -5.102  3.026   -2.055  1.00 0.00 ? 776 VAL A HG12 6  
ATOM 10487 H HG13 . VAL A 1 69  ? -3.677  2.029   -1.778  1.00 0.00 ? 776 VAL A HG13 6  
ATOM 10488 H HG21 . VAL A 1 69  ? -7.156  0.832   -1.888  1.00 0.00 ? 776 VAL A HG21 6  
ATOM 10489 H HG22 . VAL A 1 69  ? -7.129  0.310   -3.567  1.00 0.00 ? 776 VAL A HG22 6  
ATOM 10490 H HG23 . VAL A 1 69  ? -7.126  2.028   -3.182  1.00 0.00 ? 776 VAL A HG23 6  
ATOM 10491 N N    . ILE A 1 70  ? -2.342  0.749   -4.249  1.00 0.00 ? 777 ILE A N    6  
ATOM 10492 C CA   . ILE A 1 70  ? -0.899  1.000   -4.279  1.00 0.00 ? 777 ILE A CA   6  
ATOM 10493 C C    . ILE A 1 70  ? -0.539  1.702   -5.585  1.00 0.00 ? 777 ILE A C    6  
ATOM 10494 O O    . ILE A 1 70  ? 0.246   2.657   -5.599  1.00 0.00 ? 777 ILE A O    6  
ATOM 10495 C CB   . ILE A 1 70  ? -0.074  -0.303  -4.124  1.00 0.00 ? 777 ILE A CB   6  
ATOM 10496 C CG1  . ILE A 1 70  ? -0.391  -0.954  -2.779  1.00 0.00 ? 777 ILE A CG1  6  
ATOM 10497 C CG2  . ILE A 1 70  ? 1.430   -0.011  -4.226  1.00 0.00 ? 777 ILE A CG2  6  
ATOM 10498 C CD1  . ILE A 1 70  ? 0.191   -2.330  -2.622  1.00 0.00 ? 777 ILE A CD1  6  
ATOM 10499 H H    . ILE A 1 70  ? -2.666  -0.181  -4.245  1.00 0.00 ? 777 ILE A H    6  
ATOM 10500 H HA   . ILE A 1 70  ? -0.672  1.671   -3.463  1.00 0.00 ? 777 ILE A HA   6  
ATOM 10501 H HB   . ILE A 1 70  ? -0.350  -0.985  -4.914  1.00 0.00 ? 777 ILE A HB   6  
ATOM 10502 H HG12 . ILE A 1 70  ? 0.000   -0.337  -1.984  1.00 0.00 ? 777 ILE A HG12 6  
ATOM 10503 H HG13 . ILE A 1 70  ? -1.463  -1.030  -2.670  1.00 0.00 ? 777 ILE A HG13 6  
ATOM 10504 H HG21 . ILE A 1 70  ? 1.647   0.425   -5.190  1.00 0.00 ? 777 ILE A HG21 6  
ATOM 10505 H HG22 . ILE A 1 70  ? 1.984   -0.930  -4.108  1.00 0.00 ? 777 ILE A HG22 6  
ATOM 10506 H HG23 . ILE A 1 70  ? 1.714   0.679   -3.444  1.00 0.00 ? 777 ILE A HG23 6  
ATOM 10507 H HD11 . ILE A 1 70  ? -0.074  -2.729  -1.655  1.00 0.00 ? 777 ILE A HD11 6  
ATOM 10508 H HD12 . ILE A 1 70  ? 1.266   -2.297  -2.723  1.00 0.00 ? 777 ILE A HD12 6  
ATOM 10509 H HD13 . ILE A 1 70  ? -0.225  -2.968  -3.390  1.00 0.00 ? 777 ILE A HD13 6  
ATOM 10510 N N    . HIS A 1 71  ? -1.150  1.249   -6.673  1.00 0.00 ? 778 HIS A N    6  
ATOM 10511 C CA   . HIS A 1 71  ? -0.985  1.892   -7.962  1.00 0.00 ? 778 HIS A CA   6  
ATOM 10512 C C    . HIS A 1 71  ? -1.413  3.357   -7.883  1.00 0.00 ? 778 HIS A C    6  
ATOM 10513 O O    . HIS A 1 71  ? -0.636  4.242   -8.245  1.00 0.00 ? 778 HIS A O    6  
ATOM 10514 C CB   . HIS A 1 71  ? -1.751  1.139   -9.079  1.00 0.00 ? 778 HIS A CB   6  
ATOM 10515 C CG   . HIS A 1 71  ? -1.820  1.878   -10.403 1.00 0.00 ? 778 HIS A CG   6  
ATOM 10516 N ND1  . HIS A 1 71  ? -0.748  2.074   -11.252 1.00 0.00 ? 778 HIS A ND1  6  
ATOM 10517 C CD2  . HIS A 1 71  ? -2.874  2.502   -10.988 1.00 0.00 ? 778 HIS A CD2  6  
ATOM 10518 C CE1  . HIS A 1 71  ? -1.172  2.796   -12.293 1.00 0.00 ? 778 HIS A CE1  6  
ATOM 10519 N NE2  . HIS A 1 71  ? -2.461  3.079   -12.182 1.00 0.00 ? 778 HIS A NE2  6  
ATOM 10520 H H    . HIS A 1 71  ? -1.706  0.439   -6.600  1.00 0.00 ? 778 HIS A H    6  
ATOM 10521 H HA   . HIS A 1 71  ? 0.072   1.869   -8.188  1.00 0.00 ? 778 HIS A HA   6  
ATOM 10522 H HB2  . HIS A 1 71  ? -1.270  0.189   -9.260  1.00 0.00 ? 778 HIS A HB2  6  
ATOM 10523 H HB3  . HIS A 1 71  ? -2.763  0.964   -8.741  1.00 0.00 ? 778 HIS A HB3  6  
ATOM 10524 H HD1  . HIS A 1 71  ? 0.177   1.756   -11.131 1.00 0.00 ? 778 HIS A HD1  6  
ATOM 10525 H HD2  . HIS A 1 71  ? -3.880  2.545   -10.598 1.00 0.00 ? 778 HIS A HD2  6  
ATOM 10526 H HE1  . HIS A 1 71  ? -0.548  3.106   -13.117 1.00 0.00 ? 778 HIS A HE1  6  
ATOM 10527 N N    . ARG A 1 72  ? -2.614  3.605   -7.352  1.00 0.00 ? 779 ARG A N    6  
ATOM 10528 C CA   . ARG A 1 72  ? -3.150  4.960   -7.250  1.00 0.00 ? 779 ARG A CA   6  
ATOM 10529 C C    . ARG A 1 72  ? -2.215  5.817   -6.405  1.00 0.00 ? 779 ARG A C    6  
ATOM 10530 O O    . ARG A 1 72  ? -1.861  6.931   -6.790  1.00 0.00 ? 779 ARG A O    6  
ATOM 10531 C CB   . ARG A 1 72  ? -4.544  4.971   -6.626  1.00 0.00 ? 779 ARG A CB   6  
ATOM 10532 C CG   . ARG A 1 72  ? -5.274  6.302   -6.771  1.00 0.00 ? 779 ARG A CG   6  
ATOM 10533 C CD   . ARG A 1 72  ? -6.367  6.466   -5.729  1.00 0.00 ? 779 ARG A CD   6  
ATOM 10534 N NE   . ARG A 1 72  ? -5.774  6.739   -4.424  1.00 0.00 ? 779 ARG A NE   6  
ATOM 10535 C CZ   . ARG A 1 72  ? -6.242  6.373   -3.237  1.00 0.00 ? 779 ARG A CZ   6  
ATOM 10536 N NH1  . ARG A 1 72  ? -7.457  5.822   -3.112  1.00 0.00 ? 779 ARG A NH1  6  
ATOM 10537 N NH2  . ARG A 1 72  ? -5.524  6.654   -2.171  1.00 0.00 ? 779 ARG A NH2  6  
ATOM 10538 H H    . ARG A 1 72  ? -3.163  2.851   -7.030  1.00 0.00 ? 779 ARG A H    6  
ATOM 10539 H HA   . ARG A 1 72  ? -3.200  5.339   -8.257  1.00 0.00 ? 779 ARG A HA   6  
ATOM 10540 H HB2  . ARG A 1 72  ? -5.134  4.216   -7.126  1.00 0.00 ? 779 ARG A HB2  6  
ATOM 10541 H HB3  . ARG A 1 72  ? -4.465  4.732   -5.575  1.00 0.00 ? 779 ARG A HB3  6  
ATOM 10542 H HG2  . ARG A 1 72  ? -4.557  7.099   -6.641  1.00 0.00 ? 779 ARG A HG2  6  
ATOM 10543 H HG3  . ARG A 1 72  ? -5.705  6.364   -7.759  1.00 0.00 ? 779 ARG A HG3  6  
ATOM 10544 H HD2  . ARG A 1 72  ? -7.000  7.293   -6.011  1.00 0.00 ? 779 ARG A HD2  6  
ATOM 10545 H HD3  . ARG A 1 72  ? -6.950  5.558   -5.671  1.00 0.00 ? 779 ARG A HD3  6  
ATOM 10546 H HE   . ARG A 1 72  ? -4.920  7.246   -4.475  1.00 0.00 ? 779 ARG A HE   6  
ATOM 10547 H HH11 . ARG A 1 72  ? -8.067  5.684   -3.906  1.00 0.00 ? 779 ARG A HH11 6  
ATOM 10548 H HH12 . ARG A 1 72  ? -7.823  5.498   -2.232  1.00 0.00 ? 779 ARG A HH12 6  
ATOM 10549 H HH21 . ARG A 1 72  ? -4.638  7.141   -2.278  1.00 0.00 ? 779 ARG A HH21 6  
ATOM 10550 H HH22 . ARG A 1 72  ? -5.789  6.423   -1.232  1.00 0.00 ? 779 ARG A HH22 6  
ATOM 10551 N N    . LEU A 1 73  ? -1.790  5.243   -5.288  1.00 0.00 ? 780 LEU A N    6  
ATOM 10552 C CA   . LEU A 1 73  ? -0.869  5.847   -4.337  1.00 0.00 ? 780 LEU A CA   6  
ATOM 10553 C C    . LEU A 1 73  ? 0.400   6.336   -5.028  1.00 0.00 ? 780 LEU A C    6  
ATOM 10554 O O    . LEU A 1 73  ? 0.826   7.485   -4.845  1.00 0.00 ? 780 LEU A O    6  
ATOM 10555 C CB   . LEU A 1 73  ? -0.502  4.799   -3.273  1.00 0.00 ? 780 LEU A CB   6  
ATOM 10556 C CG   . LEU A 1 73  ? 0.546   5.192   -2.241  1.00 0.00 ? 780 LEU A CG   6  
ATOM 10557 C CD1  . LEU A 1 73  ? 0.060   6.345   -1.409  1.00 0.00 ? 780 LEU A CD1  6  
ATOM 10558 C CD2  . LEU A 1 73  ? 0.902   4.006   -1.364  1.00 0.00 ? 780 LEU A CD2  6  
ATOM 10559 H H    . LEU A 1 73  ? -2.136  4.347   -5.072  1.00 0.00 ? 780 LEU A H    6  
ATOM 10560 H HA   . LEU A 1 73  ? -1.367  6.668   -3.845  1.00 0.00 ? 780 LEU A HA   6  
ATOM 10561 H HB2  . LEU A 1 73  ? -1.403  4.533   -2.742  1.00 0.00 ? 780 LEU A HB2  6  
ATOM 10562 H HB3  . LEU A 1 73  ? -0.148  3.918   -3.792  1.00 0.00 ? 780 LEU A HB3  6  
ATOM 10563 H HG   . LEU A 1 73  ? 1.439   5.510   -2.757  1.00 0.00 ? 780 LEU A HG   6  
ATOM 10564 H HD11 . LEU A 1 73  ? -0.146  7.186   -2.054  1.00 0.00 ? 780 LEU A HD11 6  
ATOM 10565 H HD12 . LEU A 1 73  ? 0.826   6.617   -0.697  1.00 0.00 ? 780 LEU A HD12 6  
ATOM 10566 H HD13 . LEU A 1 73  ? -0.839  6.062   -0.883  1.00 0.00 ? 780 LEU A HD13 6  
ATOM 10567 H HD21 . LEU A 1 73  ? 1.300   3.213   -1.981  1.00 0.00 ? 780 LEU A HD21 6  
ATOM 10568 H HD22 . LEU A 1 73  ? 0.015   3.656   -0.858  1.00 0.00 ? 780 LEU A HD22 6  
ATOM 10569 H HD23 . LEU A 1 73  ? 1.642   4.304   -0.637  1.00 0.00 ? 780 LEU A HD23 6  
ATOM 10570 N N    . THR A 1 74  ? 0.980   5.478   -5.831  1.00 0.00 ? 781 THR A N    6  
ATOM 10571 C CA   . THR A 1 74  ? 2.219   5.784   -6.498  1.00 0.00 ? 781 THR A CA   6  
ATOM 10572 C C    . THR A 1 74  ? 2.025   6.722   -7.707  1.00 0.00 ? 781 THR A C    6  
ATOM 10573 O O    . THR A 1 74  ? 2.941   7.450   -8.091  1.00 0.00 ? 781 THR A O    6  
ATOM 10574 C CB   . THR A 1 74  ? 2.937   4.471   -6.955  1.00 0.00 ? 781 THR A CB   6  
ATOM 10575 O OG1  . THR A 1 74  ? 2.077   3.701   -7.843  1.00 0.00 ? 781 THR A OG1  6  
ATOM 10576 C CG2  . THR A 1 74  ? 3.299   3.598   -5.751  1.00 0.00 ? 781 THR A CG2  6  
ATOM 10577 H H    . THR A 1 74  ? 0.569   4.593   -5.948  1.00 0.00 ? 781 THR A H    6  
ATOM 10578 H HA   . THR A 1 74  ? 2.857   6.275   -5.779  1.00 0.00 ? 781 THR A HA   6  
ATOM 10579 H HB   . THR A 1 74  ? 3.840   4.737   -7.484  1.00 0.00 ? 781 THR A HB   6  
ATOM 10580 H HG1  . THR A 1 74  ? 1.176   4.054   -7.819  1.00 0.00 ? 781 THR A HG1  6  
ATOM 10581 H HG21 . THR A 1 74  ? 2.393   3.305   -5.239  1.00 0.00 ? 781 THR A HG21 6  
ATOM 10582 H HG22 . THR A 1 74  ? 3.933   4.128   -5.057  1.00 0.00 ? 781 THR A HG22 6  
ATOM 10583 H HG23 . THR A 1 74  ? 3.810   2.709   -6.091  1.00 0.00 ? 781 THR A HG23 6  
ATOM 10584 N N    . HIS A 1 75  ? 0.826   6.744   -8.257  1.00 0.00 ? 782 HIS A N    6  
ATOM 10585 C CA   . HIS A 1 75  ? 0.611   7.421   -9.522  1.00 0.00 ? 782 HIS A CA   6  
ATOM 10586 C C    . HIS A 1 75  ? -0.151  8.747   -9.372  1.00 0.00 ? 782 HIS A C    6  
ATOM 10587 O O    . HIS A 1 75  ? 0.350   9.799   -9.755  1.00 0.00 ? 782 HIS A O    6  
ATOM 10588 C CB   . HIS A 1 75  ? -0.140  6.486   -10.480 1.00 0.00 ? 782 HIS A CB   6  
ATOM 10589 C CG   . HIS A 1 75  ? -0.015  6.849   -11.924 1.00 0.00 ? 782 HIS A CG   6  
ATOM 10590 N ND1  . HIS A 1 75  ? -0.770  7.806   -12.559 1.00 0.00 ? 782 HIS A ND1  6  
ATOM 10591 C CD2  . HIS A 1 75  ? 0.817   6.349   -12.864 1.00 0.00 ? 782 HIS A CD2  6  
ATOM 10592 C CE1  . HIS A 1 75  ? -0.386  7.851   -13.832 1.00 0.00 ? 782 HIS A CE1  6  
ATOM 10593 N NE2  . HIS A 1 75  ? 0.579   6.984   -14.071 1.00 0.00 ? 782 HIS A NE2  6  
ATOM 10594 H H    . HIS A 1 75  ? 0.078   6.307   -7.794  1.00 0.00 ? 782 HIS A H    6  
ATOM 10595 H HA   . HIS A 1 75  ? 1.579   7.626   -9.955  1.00 0.00 ? 782 HIS A HA   6  
ATOM 10596 H HB2  . HIS A 1 75  ? 0.243   5.483   -10.364 1.00 0.00 ? 782 HIS A HB2  6  
ATOM 10597 H HB3  . HIS A 1 75  ? -1.189  6.494   -10.222 1.00 0.00 ? 782 HIS A HB3  6  
ATOM 10598 H HD1  . HIS A 1 75  ? -1.450  8.398   -12.168 1.00 0.00 ? 782 HIS A HD1  6  
ATOM 10599 H HD2  . HIS A 1 75  ? 1.557   5.579   -12.705 1.00 0.00 ? 782 HIS A HD2  6  
ATOM 10600 H HE1  . HIS A 1 75  ? -0.805  8.516   -14.571 1.00 0.00 ? 782 HIS A HE1  6  
ATOM 10601 N N    . TYR A 1 76  ? -1.339  8.690   -8.806  1.00 0.00 ? 783 TYR A N    6  
ATOM 10602 C CA   . TYR A 1 76  ? -2.208  9.860   -8.724  1.00 0.00 ? 783 TYR A CA   6  
ATOM 10603 C C    . TYR A 1 76  ? -1.916  10.641  -7.466  1.00 0.00 ? 783 TYR A C    6  
ATOM 10604 O O    . TYR A 1 76  ? -1.626  11.834  -7.527  1.00 0.00 ? 783 TYR A O    6  
ATOM 10605 C CB   . TYR A 1 76  ? -3.695  9.454   -8.731  1.00 0.00 ? 783 TYR A CB   6  
ATOM 10606 C CG   . TYR A 1 76  ? -4.156  8.680   -9.950  1.00 0.00 ? 783 TYR A CG   6  
ATOM 10607 C CD1  . TYR A 1 76  ? -3.913  7.328   -10.055 1.00 0.00 ? 783 TYR A CD1  6  
ATOM 10608 C CD2  . TYR A 1 76  ? -4.853  9.298   -10.974 1.00 0.00 ? 783 TYR A CD2  6  
ATOM 10609 C CE1  . TYR A 1 76  ? -4.336  6.599   -11.136 1.00 0.00 ? 783 TYR A CE1  6  
ATOM 10610 C CE2  . TYR A 1 76  ? -5.286  8.579   -12.072 1.00 0.00 ? 783 TYR A CE2  6  
ATOM 10611 C CZ   . TYR A 1 76  ? -5.025  7.230   -12.148 1.00 0.00 ? 783 TYR A CZ   6  
ATOM 10612 O OH   . TYR A 1 76  ? -5.451  6.510   -13.245 1.00 0.00 ? 783 TYR A OH   6  
ATOM 10613 H H    . TYR A 1 76  ? -1.638  7.857   -8.379  1.00 0.00 ? 783 TYR A H    6  
ATOM 10614 H HA   . TYR A 1 76  ? -2.016  10.488  -9.582  1.00 0.00 ? 783 TYR A HA   6  
ATOM 10615 H HB2  . TYR A 1 76  ? -3.891  8.840   -7.864  1.00 0.00 ? 783 TYR A HB2  6  
ATOM 10616 H HB3  . TYR A 1 76  ? -4.292  10.352  -8.660  1.00 0.00 ? 783 TYR A HB3  6  
ATOM 10617 H HD1  . TYR A 1 76  ? -3.363  6.859   -9.256  1.00 0.00 ? 783 TYR A HD1  6  
ATOM 10618 H HD2  . TYR A 1 76  ? -5.051  10.356  -10.907 1.00 0.00 ? 783 TYR A HD2  6  
ATOM 10619 H HE1  . TYR A 1 76  ? -4.127  5.540   -11.175 1.00 0.00 ? 783 TYR A HE1  6  
ATOM 10620 H HE2  . TYR A 1 76  ? -5.824  9.077   -12.865 1.00 0.00 ? 783 TYR A HE2  6  
ATOM 10621 H HH   . TYR A 1 76  ? -5.183  7.001   -14.033 1.00 0.00 ? 783 TYR A HH   6  
ATOM 10622 N N    . ASP A 1 77  ? -2.006  9.948   -6.330  1.00 0.00 ? 784 ASP A N    6  
ATOM 10623 C CA   . ASP A 1 77  ? -1.759  10.523  -5.000  1.00 0.00 ? 784 ASP A CA   6  
ATOM 10624 C C    . ASP A 1 77  ? -0.396  11.172  -4.990  1.00 0.00 ? 784 ASP A C    6  
ATOM 10625 O O    . ASP A 1 77  ? -0.262  12.380  -4.772  1.00 0.00 ? 784 ASP A O    6  
ATOM 10626 C CB   . ASP A 1 77  ? -1.751  9.419   -3.903  1.00 0.00 ? 784 ASP A CB   6  
ATOM 10627 C CG   . ASP A 1 77  ? -3.031  8.605   -3.771  1.00 0.00 ? 784 ASP A CG   6  
ATOM 10628 O OD1  . ASP A 1 77  ? -3.727  8.392   -4.779  1.00 0.00 ? 784 ASP A OD1  6  
ATOM 10629 O OD2  . ASP A 1 77  ? -3.347  8.145   -2.656  1.00 0.00 ? 784 ASP A OD2  6  
ATOM 10630 H H    . ASP A 1 77  ? -2.284  9.007   -6.366  1.00 0.00 ? 784 ASP A H    6  
ATOM 10631 H HA   . ASP A 1 77  ? -2.526  11.247  -4.771  1.00 0.00 ? 784 ASP A HA   6  
ATOM 10632 H HB2  . ASP A 1 77  ? -0.943  8.733   -4.105  1.00 0.00 ? 784 ASP A HB2  6  
ATOM 10633 H HB3  . ASP A 1 77  ? -1.557  9.902   -2.957  1.00 0.00 ? 784 ASP A HB3  6  
ATOM 10634 N N    . HIS A 1 78  ? 0.607   10.329  -5.247  1.00 0.00 ? 785 HIS A N    6  
ATOM 10635 C CA   . HIS A 1 78  ? 2.025   10.679  -5.286  1.00 0.00 ? 785 HIS A CA   6  
ATOM 10636 C C    . HIS A 1 78  ? 2.489   11.118  -3.891  1.00 0.00 ? 785 HIS A C    6  
ATOM 10637 O O    . HIS A 1 78  ? 3.492   11.794  -3.723  1.00 0.00 ? 785 HIS A O    6  
ATOM 10638 C CB   . HIS A 1 78  ? 2.341   11.732  -6.383  1.00 0.00 ? 785 HIS A CB   6  
ATOM 10639 C CG   . HIS A 1 78  ? 3.812   11.795  -6.770  1.00 0.00 ? 785 HIS A CG   6  
ATOM 10640 N ND1  . HIS A 1 78  ? 4.617   12.901  -6.615  1.00 0.00 ? 785 HIS A ND1  6  
ATOM 10641 C CD2  . HIS A 1 78  ? 4.599   10.846  -7.343  1.00 0.00 ? 785 HIS A CD2  6  
ATOM 10642 C CE1  . HIS A 1 78  ? 5.835   12.600  -7.086  1.00 0.00 ? 785 HIS A CE1  6  
ATOM 10643 N NE2  . HIS A 1 78  ? 5.878   11.356  -7.543  1.00 0.00 ? 785 HIS A NE2  6  
ATOM 10644 H H    . HIS A 1 78  ? 0.370   9.391   -5.416  1.00 0.00 ? 785 HIS A H    6  
ATOM 10645 H HA   . HIS A 1 78  ? 2.542   9.758   -5.511  1.00 0.00 ? 785 HIS A HA   6  
ATOM 10646 H HB2  . HIS A 1 78  ? 1.778   11.496  -7.273  1.00 0.00 ? 785 HIS A HB2  6  
ATOM 10647 H HB3  . HIS A 1 78  ? 2.050   12.710  -6.029  1.00 0.00 ? 785 HIS A HB3  6  
ATOM 10648 H HD1  . HIS A 1 78  ? 4.349   13.769  -6.240  1.00 0.00 ? 785 HIS A HD1  6  
ATOM 10649 H HD2  . HIS A 1 78  ? 4.288   9.846   -7.607  1.00 0.00 ? 785 HIS A HD2  6  
ATOM 10650 H HE1  . HIS A 1 78  ? 6.673   13.280  -7.087  1.00 0.00 ? 785 HIS A HE1  6  
ATOM 10651 N N    . VAL A 1 79  ? 1.787   10.611  -2.888  1.00 0.00 ? 786 VAL A N    6  
ATOM 10652 C CA   . VAL A 1 79  ? 2.084   10.896  -1.487  1.00 0.00 ? 786 VAL A CA   6  
ATOM 10653 C C    . VAL A 1 79  ? 3.015   9.779   -0.934  1.00 0.00 ? 786 VAL A C    6  
ATOM 10654 O O    . VAL A 1 79  ? 3.141   9.541   0.276   1.00 0.00 ? 786 VAL A O    6  
ATOM 10655 C CB   . VAL A 1 79  ? 0.746   11.018  -0.666  1.00 0.00 ? 786 VAL A CB   6  
ATOM 10656 C CG1  . VAL A 1 79  ? -0.006  9.703   -0.570  1.00 0.00 ? 786 VAL A CG1  6  
ATOM 10657 C CG2  . VAL A 1 79  ? 0.966   11.634  0.704   1.00 0.00 ? 786 VAL A CG2  6  
ATOM 10658 H H    . VAL A 1 79  ? 1.036   10.023  -3.108  1.00 0.00 ? 786 VAL A H    6  
ATOM 10659 H HA   . VAL A 1 79  ? 2.619   11.835  -1.457  1.00 0.00 ? 786 VAL A HA   6  
ATOM 10660 H HB   . VAL A 1 79  ? 0.110   11.683  -1.230  1.00 0.00 ? 786 VAL A HB   6  
ATOM 10661 H HG11 . VAL A 1 79  ? -0.210  9.323   -1.560  1.00 0.00 ? 786 VAL A HG11 6  
ATOM 10662 H HG12 . VAL A 1 79  ? -0.941  9.849   -0.050  1.00 0.00 ? 786 VAL A HG12 6  
ATOM 10663 H HG13 . VAL A 1 79  ? 0.590   8.981   -0.030  1.00 0.00 ? 786 VAL A HG13 6  
ATOM 10664 H HG21 . VAL A 1 79  ? 0.027   11.676  1.237   1.00 0.00 ? 786 VAL A HG21 6  
ATOM 10665 H HG22 . VAL A 1 79  ? 1.362   12.632  0.591   1.00 0.00 ? 786 VAL A HG22 6  
ATOM 10666 H HG23 . VAL A 1 79  ? 1.668   11.019  1.248   1.00 0.00 ? 786 VAL A HG23 6  
ATOM 10667 N N    . LEU A 1 80  ? 3.676   9.120   -1.856  1.00 0.00 ? 787 LEU A N    6  
ATOM 10668 C CA   . LEU A 1 80  ? 4.599   8.058   -1.546  1.00 0.00 ? 787 LEU A CA   6  
ATOM 10669 C C    . LEU A 1 80  ? 6.001   8.628   -1.405  1.00 0.00 ? 787 LEU A C    6  
ATOM 10670 O O    . LEU A 1 80  ? 6.312   9.695   -1.942  1.00 0.00 ? 787 LEU A O    6  
ATOM 10671 C CB   . LEU A 1 80  ? 4.657   6.996   -2.678  1.00 0.00 ? 787 LEU A CB   6  
ATOM 10672 C CG   . LEU A 1 80  ? 5.447   7.392   -3.971  1.00 0.00 ? 787 LEU A CG   6  
ATOM 10673 C CD1  . LEU A 1 80  ? 5.708   6.192   -4.842  1.00 0.00 ? 787 LEU A CD1  6  
ATOM 10674 C CD2  . LEU A 1 80  ? 4.711   8.431   -4.784  1.00 0.00 ? 787 LEU A CD2  6  
ATOM 10675 H H    . LEU A 1 80  ? 3.545   9.383   -2.788  1.00 0.00 ? 787 LEU A H    6  
ATOM 10676 H HA   . LEU A 1 80  ? 4.296   7.575   -0.631  1.00 0.00 ? 787 LEU A HA   6  
ATOM 10677 H HB2  . LEU A 1 80  ? 5.108   6.103   -2.270  1.00 0.00 ? 787 LEU A HB2  6  
ATOM 10678 H HB3  . LEU A 1 80  ? 3.643   6.762   -2.966  1.00 0.00 ? 787 LEU A HB3  6  
ATOM 10679 H HG   . LEU A 1 80  ? 6.404   7.801   -3.684  1.00 0.00 ? 787 LEU A HG   6  
ATOM 10680 H HD11 . LEU A 1 80  ? 6.209   5.422   -4.276  1.00 0.00 ? 787 LEU A HD11 6  
ATOM 10681 H HD12 . LEU A 1 80  ? 6.342   6.491   -5.664  1.00 0.00 ? 787 LEU A HD12 6  
ATOM 10682 H HD13 . LEU A 1 80  ? 4.775   5.818   -5.234  1.00 0.00 ? 787 LEU A HD13 6  
ATOM 10683 H HD21 . LEU A 1 80  ? 5.272   8.645   -5.681  1.00 0.00 ? 787 LEU A HD21 6  
ATOM 10684 H HD22 . LEU A 1 80  ? 4.615   9.337   -4.205  1.00 0.00 ? 787 LEU A HD22 6  
ATOM 10685 H HD23 . LEU A 1 80  ? 3.733   8.057   -5.049  1.00 0.00 ? 787 LEU A HD23 6  
ATOM 10686 N N    . ILE A 1 81  ? 6.817   7.934   -0.690  1.00 0.00 ? 788 ILE A N    6  
ATOM 10687 C CA   . ILE A 1 81  ? 8.210   8.200   -0.618  1.00 0.00 ? 788 ILE A CA   6  
ATOM 10688 C C    . ILE A 1 81  ? 8.852   6.881   -0.985  1.00 0.00 ? 788 ILE A C    6  
ATOM 10689 O O    . ILE A 1 81  ? 8.542   5.857   -0.383  1.00 0.00 ? 788 ILE A O    6  
ATOM 10690 C CB   . ILE A 1 81  ? 8.708   8.632   0.819   1.00 0.00 ? 788 ILE A CB   6  
ATOM 10691 C CG1  . ILE A 1 81  ? 8.007   9.894   1.353   1.00 0.00 ? 788 ILE A CG1  6  
ATOM 10692 C CG2  . ILE A 1 81  ? 10.217  8.829   0.857   1.00 0.00 ? 788 ILE A CG2  6  
ATOM 10693 C CD1  . ILE A 1 81  ? 6.616   9.652   1.899   1.00 0.00 ? 788 ILE A CD1  6  
ATOM 10694 H H    . ILE A 1 81  ? 6.502   7.169   -0.150  1.00 0.00 ? 788 ILE A H    6  
ATOM 10695 H HA   . ILE A 1 81  ? 8.463   8.950   -1.354  1.00 0.00 ? 788 ILE A HA   6  
ATOM 10696 H HB   . ILE A 1 81  ? 8.480   7.811   1.479   1.00 0.00 ? 788 ILE A HB   6  
ATOM 10697 H HG12 . ILE A 1 81  ? 8.600   10.314  2.152   1.00 0.00 ? 788 ILE A HG12 6  
ATOM 10698 H HG13 . ILE A 1 81  ? 7.932   10.615  0.552   1.00 0.00 ? 788 ILE A HG13 6  
ATOM 10699 H HG21 . ILE A 1 81  ? 10.519  9.093   1.860   1.00 0.00 ? 788 ILE A HG21 6  
ATOM 10700 H HG22 . ILE A 1 81  ? 10.488  9.627   0.183   1.00 0.00 ? 788 ILE A HG22 6  
ATOM 10701 H HG23 . ILE A 1 81  ? 10.711  7.917   0.557   1.00 0.00 ? 788 ILE A HG23 6  
ATOM 10702 H HD11 . ILE A 1 81  ? 6.666   8.943   2.711   1.00 0.00 ? 788 ILE A HD11 6  
ATOM 10703 H HD12 . ILE A 1 81  ? 5.991   9.250   1.115   1.00 0.00 ? 788 ILE A HD12 6  
ATOM 10704 H HD13 . ILE A 1 81  ? 6.199   10.582  2.256   1.00 0.00 ? 788 ILE A HD13 6  
ATOM 10705 N N    . GLU A 1 82  ? 9.645   6.851   -1.995  1.00 0.00 ? 789 GLU A N    6  
ATOM 10706 C CA   . GLU A 1 82  ? 10.269  5.614   -2.350  1.00 0.00 ? 789 GLU A CA   6  
ATOM 10707 C C    . GLU A 1 82  ? 11.758  5.761   -2.328  1.00 0.00 ? 789 GLU A C    6  
ATOM 10708 O O    . GLU A 1 82  ? 12.301  6.761   -2.806  1.00 0.00 ? 789 GLU A O    6  
ATOM 10709 C CB   . GLU A 1 82  ? 9.747   5.047   -3.686  1.00 0.00 ? 789 GLU A CB   6  
ATOM 10710 C CG   . GLU A 1 82  ? 10.009  5.895   -4.918  1.00 0.00 ? 789 GLU A CG   6  
ATOM 10711 C CD   . GLU A 1 82  ? 9.442   5.260   -6.161  1.00 0.00 ? 789 GLU A CD   6  
ATOM 10712 O OE1  . GLU A 1 82  ? 9.915   4.174   -6.563  1.00 0.00 ? 789 GLU A OE1  6  
ATOM 10713 O OE2  . GLU A 1 82  ? 8.491   5.804   -6.739  1.00 0.00 ? 789 GLU A OE2  6  
ATOM 10714 H H    . GLU A 1 82  ? 9.840   7.663   -2.507  1.00 0.00 ? 789 GLU A H    6  
ATOM 10715 H HA   . GLU A 1 82  ? 10.015  4.919   -1.561  1.00 0.00 ? 789 GLU A HA   6  
ATOM 10716 H HB2  . GLU A 1 82  ? 10.201  4.081   -3.850  1.00 0.00 ? 789 GLU A HB2  6  
ATOM 10717 H HB3  . GLU A 1 82  ? 8.680   4.905   -3.595  1.00 0.00 ? 789 GLU A HB3  6  
ATOM 10718 H HG2  . GLU A 1 82  ? 9.549   6.862   -4.779  1.00 0.00 ? 789 GLU A HG2  6  
ATOM 10719 H HG3  . GLU A 1 82  ? 11.075  6.013   -5.041  1.00 0.00 ? 789 GLU A HG3  6  
ATOM 10720 N N    . LEU A 1 83  ? 12.411  4.800   -1.752  1.00 0.00 ? 790 LEU A N    6  
ATOM 10721 C CA   . LEU A 1 83  ? 13.838  4.831   -1.644  1.00 0.00 ? 790 LEU A CA   6  
ATOM 10722 C C    . LEU A 1 83  ? 14.407  4.383   -2.950  1.00 0.00 ? 790 LEU A C    6  
ATOM 10723 O O    . LEU A 1 83  ? 14.279  3.215   -3.319  1.00 0.00 ? 790 LEU A O    6  
ATOM 10724 C CB   . LEU A 1 83  ? 14.341  3.933   -0.508  1.00 0.00 ? 790 LEU A CB   6  
ATOM 10725 C CG   . LEU A 1 83  ? 13.802  4.235   0.899   1.00 0.00 ? 790 LEU A CG   6  
ATOM 10726 C CD1  . LEU A 1 83  ? 14.474  3.348   1.931   1.00 0.00 ? 790 LEU A CD1  6  
ATOM 10727 C CD2  . LEU A 1 83  ? 13.990  5.695   1.257   1.00 0.00 ? 790 LEU A CD2  6  
ATOM 10728 H H    . LEU A 1 83  ? 11.899  4.024   -1.431  1.00 0.00 ? 790 LEU A H    6  
ATOM 10729 H HA   . LEU A 1 83  ? 14.140  5.851   -1.459  1.00 0.00 ? 790 LEU A HA   6  
ATOM 10730 H HB2  . LEU A 1 83  ? 14.085  2.917   -0.766  1.00 0.00 ? 790 LEU A HB2  6  
ATOM 10731 H HB3  . LEU A 1 83  ? 15.416  4.009   -0.484  1.00 0.00 ? 790 LEU A HB3  6  
ATOM 10732 H HG   . LEU A 1 83  ? 12.745  4.013   0.919   1.00 0.00 ? 790 LEU A HG   6  
ATOM 10733 H HD11 . LEU A 1 83  ? 14.268  2.312   1.711   1.00 0.00 ? 790 LEU A HD11 6  
ATOM 10734 H HD12 . LEU A 1 83  ? 14.094  3.587   2.913   1.00 0.00 ? 790 LEU A HD12 6  
ATOM 10735 H HD13 . LEU A 1 83  ? 15.541  3.515   1.908   1.00 0.00 ? 790 LEU A HD13 6  
ATOM 10736 H HD21 . LEU A 1 83  ? 15.039  5.946   1.209   1.00 0.00 ? 790 LEU A HD21 6  
ATOM 10737 H HD22 . LEU A 1 83  ? 13.626  5.863   2.260   1.00 0.00 ? 790 LEU A HD22 6  
ATOM 10738 H HD23 . LEU A 1 83  ? 13.435  6.316   0.568   1.00 0.00 ? 790 LEU A HD23 6  
ATOM 10739 N N    . THR A 1 84  ? 14.972  5.306   -3.660  1.00 0.00 ? 791 THR A N    6  
ATOM 10740 C CA   . THR A 1 84  ? 15.514  5.053   -4.949  1.00 0.00 ? 791 THR A CA   6  
ATOM 10741 C C    . THR A 1 84  ? 16.815  4.289   -4.851  1.00 0.00 ? 791 THR A C    6  
ATOM 10742 O O    . THR A 1 84  ? 17.568  4.472   -3.912  1.00 0.00 ? 791 THR A O    6  
ATOM 10743 C CB   . THR A 1 84  ? 15.720  6.380   -5.685  1.00 0.00 ? 791 THR A CB   6  
ATOM 10744 O OG1  . THR A 1 84  ? 16.420  7.301   -4.820  1.00 0.00 ? 791 THR A OG1  6  
ATOM 10745 C CG2  . THR A 1 84  ? 14.388  6.985   -6.083  1.00 0.00 ? 791 THR A CG2  6  
ATOM 10746 H H    . THR A 1 84  ? 15.048  6.218   -3.312  1.00 0.00 ? 791 THR A H    6  
ATOM 10747 H HA   . THR A 1 84  ? 14.814  4.459   -5.512  1.00 0.00 ? 791 THR A HA   6  
ATOM 10748 H HB   . THR A 1 84  ? 16.308  6.186   -6.568  1.00 0.00 ? 791 THR A HB   6  
ATOM 10749 H HG1  . THR A 1 84  ? 16.946  7.897   -5.369  1.00 0.00 ? 791 THR A HG1  6  
ATOM 10750 H HG21 . THR A 1 84  ? 13.885  6.317   -6.765  1.00 0.00 ? 791 THR A HG21 6  
ATOM 10751 H HG22 . THR A 1 84  ? 14.546  7.942   -6.558  1.00 0.00 ? 791 THR A HG22 6  
ATOM 10752 H HG23 . THR A 1 84  ? 13.787  7.110   -5.195  1.00 0.00 ? 791 THR A HG23 6  
ATOM 10753 N N    . GLN A 1 85  ? 17.069  3.449   -5.836  1.00 0.00 ? 792 GLN A N    6  
ATOM 10754 C CA   . GLN A 1 85  ? 18.263  2.589   -5.919  1.00 0.00 ? 792 GLN A CA   6  
ATOM 10755 C C    . GLN A 1 85  ? 19.588  3.359   -5.728  1.00 0.00 ? 792 GLN A C    6  
ATOM 10756 O O    . GLN A 1 85  ? 20.588  2.781   -5.319  1.00 0.00 ? 792 GLN A O    6  
ATOM 10757 C CB   . GLN A 1 85  ? 18.255  1.856   -7.263  1.00 0.00 ? 792 GLN A CB   6  
ATOM 10758 C CG   . GLN A 1 85  ? 18.223  2.796   -8.456  1.00 0.00 ? 792 GLN A CG   6  
ATOM 10759 C CD   . GLN A 1 85  ? 17.952  2.100   -9.764  1.00 0.00 ? 792 GLN A CD   6  
ATOM 10760 O OE1  . GLN A 1 85  ? 18.311  0.943   -9.968  1.00 0.00 ? 792 GLN A OE1  6  
ATOM 10761 N NE2  . GLN A 1 85  ? 17.287  2.784   -10.648 1.00 0.00 ? 792 GLN A NE2  6  
ATOM 10762 H H    . GLN A 1 85  ? 16.397  3.378   -6.549  1.00 0.00 ? 792 GLN A H    6  
ATOM 10763 H HA   . GLN A 1 85  ? 18.186  1.849   -5.137  1.00 0.00 ? 792 GLN A HA   6  
ATOM 10764 H HB2  . GLN A 1 85  ? 19.146  1.249   -7.340  1.00 0.00 ? 792 GLN A HB2  6  
ATOM 10765 H HB3  . GLN A 1 85  ? 17.384  1.219   -7.318  1.00 0.00 ? 792 GLN A HB3  6  
ATOM 10766 H HG2  . GLN A 1 85  ? 17.457  3.537   -8.289  1.00 0.00 ? 792 GLN A HG2  6  
ATOM 10767 H HG3  . GLN A 1 85  ? 19.179  3.295   -8.519  1.00 0.00 ? 792 GLN A HG3  6  
ATOM 10768 H HE21 . GLN A 1 85  ? 17.011  3.694   -10.403 1.00 0.00 ? 792 GLN A HE21 6  
ATOM 10769 H HE22 . GLN A 1 85  ? 17.077  2.374   -11.514 1.00 0.00 ? 792 GLN A HE22 6  
ATOM 10770 N N    . ALA A 1 86  ? 19.572  4.652   -6.002  1.00 0.00 ? 793 ALA A N    6  
ATOM 10771 C CA   . ALA A 1 86  ? 20.751  5.489   -5.884  1.00 0.00 ? 793 ALA A CA   6  
ATOM 10772 C C    . ALA A 1 86  ? 20.652  6.430   -4.678  1.00 0.00 ? 793 ALA A C    6  
ATOM 10773 O O    . ALA A 1 86  ? 21.472  7.336   -4.507  1.00 0.00 ? 793 ALA A O    6  
ATOM 10774 C CB   . ALA A 1 86  ? 20.912  6.283   -7.144  1.00 0.00 ? 793 ALA A CB   6  
ATOM 10775 H H    . ALA A 1 86  ? 18.731  5.055   -6.298  1.00 0.00 ? 793 ALA A H    6  
ATOM 10776 H HA   . ALA A 1 86  ? 21.616  4.851   -5.769  1.00 0.00 ? 793 ALA A HA   6  
ATOM 10777 H HB1  . ALA A 1 86  ? 20.050  6.925   -7.241  1.00 0.00 ? 793 ALA A HB1  6  
ATOM 10778 H HB2  . ALA A 1 86  ? 20.948  5.596   -7.977  1.00 0.00 ? 793 ALA A HB2  6  
ATOM 10779 H HB3  . ALA A 1 86  ? 21.815  6.871   -7.094  1.00 0.00 ? 793 ALA A HB3  6  
ATOM 10780 N N    . GLY A 1 87  ? 19.659  6.219   -3.862  1.00 0.00 ? 794 GLY A N    6  
ATOM 10781 C CA   . GLY A 1 87  ? 19.452  7.036   -2.699  1.00 0.00 ? 794 GLY A CA   6  
ATOM 10782 C C    . GLY A 1 87  ? 18.737  6.249   -1.643  1.00 0.00 ? 794 GLY A C    6  
ATOM 10783 O O    . GLY A 1 87  ? 17.778  6.718   -1.044  1.00 0.00 ? 794 GLY A O    6  
ATOM 10784 H H    . GLY A 1 87  ? 19.028  5.481   -4.032  1.00 0.00 ? 794 GLY A H    6  
ATOM 10785 H HA2  . GLY A 1 87  ? 20.407  7.366   -2.319  1.00 0.00 ? 794 GLY A HA2  6  
ATOM 10786 H HA3  . GLY A 1 87  ? 18.853  7.894   -2.964  1.00 0.00 ? 794 GLY A HA3  6  
ATOM 10787 N N    . LEU A 1 88  ? 19.190  5.031   -1.446  1.00 0.00 ? 795 LEU A N    6  
ATOM 10788 C CA   . LEU A 1 88  ? 18.587  4.122   -0.482  1.00 0.00 ? 795 LEU A CA   6  
ATOM 10789 C C    . LEU A 1 88  ? 18.952  4.534   0.932   1.00 0.00 ? 795 LEU A C    6  
ATOM 10790 O O    . LEU A 1 88  ? 18.100  4.594   1.817   1.00 0.00 ? 795 LEU A O    6  
ATOM 10791 C CB   . LEU A 1 88  ? 19.021  2.677   -0.769  1.00 0.00 ? 795 LEU A CB   6  
ATOM 10792 C CG   . LEU A 1 88  ? 18.578  2.115   -2.129  1.00 0.00 ? 795 LEU A CG   6  
ATOM 10793 C CD1  . LEU A 1 88  ? 19.215  0.786   -2.411  1.00 0.00 ? 795 LEU A CD1  6  
ATOM 10794 C CD2  . LEU A 1 88  ? 17.073  1.971   -2.190  1.00 0.00 ? 795 LEU A CD2  6  
ATOM 10795 H H    . LEU A 1 88  ? 19.959  4.747   -1.985  1.00 0.00 ? 795 LEU A H    6  
ATOM 10796 H HA   . LEU A 1 88  ? 17.516  4.195   -0.593  1.00 0.00 ? 795 LEU A HA   6  
ATOM 10797 H HB2  . LEU A 1 88  ? 20.098  2.633   -0.715  1.00 0.00 ? 795 LEU A HB2  6  
ATOM 10798 H HB3  . LEU A 1 88  ? 18.615  2.044   0.006   1.00 0.00 ? 795 LEU A HB3  6  
ATOM 10799 H HG   . LEU A 1 88  ? 18.874  2.803   -2.907  1.00 0.00 ? 795 LEU A HG   6  
ATOM 10800 H HD11 . LEU A 1 88  ? 18.859  0.448   -3.372  1.00 0.00 ? 795 LEU A HD11 6  
ATOM 10801 H HD12 . LEU A 1 88  ? 18.941  0.075   -1.647  1.00 0.00 ? 795 LEU A HD12 6  
ATOM 10802 H HD13 . LEU A 1 88  ? 20.288  0.904   -2.450  1.00 0.00 ? 795 LEU A HD13 6  
ATOM 10803 H HD21 . LEU A 1 88  ? 16.719  1.330   -1.399  1.00 0.00 ? 795 LEU A HD21 6  
ATOM 10804 H HD22 . LEU A 1 88  ? 16.817  1.550   -3.152  1.00 0.00 ? 795 LEU A HD22 6  
ATOM 10805 H HD23 . LEU A 1 88  ? 16.618  2.949   -2.116  1.00 0.00 ? 795 LEU A HD23 6  
ATOM 10806 N N    . LYS A 1 89  ? 20.200  4.868   1.129   1.00 0.00 ? 796 LYS A N    6  
ATOM 10807 C CA   . LYS A 1 89  ? 20.674  5.287   2.426   1.00 0.00 ? 796 LYS A CA   6  
ATOM 10808 C C    . LYS A 1 89  ? 20.618  6.789   2.548   1.00 0.00 ? 796 LYS A C    6  
ATOM 10809 O O    . LYS A 1 89  ? 20.312  7.325   3.609   1.00 0.00 ? 796 LYS A O    6  
ATOM 10810 C CB   . LYS A 1 89  ? 22.107  4.804   2.657   1.00 0.00 ? 796 LYS A CB   6  
ATOM 10811 C CG   . LYS A 1 89  ? 22.255  3.302   2.845   1.00 0.00 ? 796 LYS A CG   6  
ATOM 10812 C CD   . LYS A 1 89  ? 21.630  2.829   4.155   1.00 0.00 ? 796 LYS A CD   6  
ATOM 10813 C CE   . LYS A 1 89  ? 22.355  3.412   5.366   1.00 0.00 ? 796 LYS A CE   6  
ATOM 10814 N NZ   . LYS A 1 89  ? 21.756  2.964   6.629   1.00 0.00 ? 796 LYS A NZ   6  
ATOM 10815 H H    . LYS A 1 89  ? 20.837  4.839   0.379   1.00 0.00 ? 796 LYS A H    6  
ATOM 10816 H HA   . LYS A 1 89  ? 20.036  4.849   3.177   1.00 0.00 ? 796 LYS A HA   6  
ATOM 10817 H HB2  . LYS A 1 89  ? 22.694  5.089   1.795   1.00 0.00 ? 796 LYS A HB2  6  
ATOM 10818 H HB3  . LYS A 1 89  ? 22.512  5.309   3.521   1.00 0.00 ? 796 LYS A HB3  6  
ATOM 10819 H HG2  . LYS A 1 89  ? 21.768  2.799   2.024   1.00 0.00 ? 796 LYS A HG2  6  
ATOM 10820 H HG3  . LYS A 1 89  ? 23.308  3.056   2.846   1.00 0.00 ? 796 LYS A HG3  6  
ATOM 10821 H HD2  . LYS A 1 89  ? 20.592  3.124   4.190   1.00 0.00 ? 796 LYS A HD2  6  
ATOM 10822 H HD3  . LYS A 1 89  ? 21.697  1.752   4.197   1.00 0.00 ? 796 LYS A HD3  6  
ATOM 10823 H HE2  . LYS A 1 89  ? 23.388  3.102   5.340   1.00 0.00 ? 796 LYS A HE2  6  
ATOM 10824 H HE3  . LYS A 1 89  ? 22.313  4.490   5.322   1.00 0.00 ? 796 LYS A HE3  6  
ATOM 10825 H HZ1  . LYS A 1 89  ? 21.735  1.926   6.676   1.00 0.00 ? 796 LYS A HZ1  6  
ATOM 10826 H HZ2  . LYS A 1 89  ? 20.787  3.328   6.728   1.00 0.00 ? 796 LYS A HZ2  6  
ATOM 10827 H HZ3  . LYS A 1 89  ? 22.317  3.311   7.433   1.00 0.00 ? 796 LYS A HZ3  6  
ATOM 10828 N N    . GLY A 1 90  ? 20.917  7.461   1.461   1.00 0.00 ? 797 GLY A N    6  
ATOM 10829 C CA   . GLY A 1 90  ? 20.963  8.900   1.464   1.00 0.00 ? 797 GLY A CA   6  
ATOM 10830 C C    . GLY A 1 90  ? 22.378  9.347   1.666   1.00 0.00 ? 797 GLY A C    6  
ATOM 10831 O O    . GLY A 1 90  ? 22.937  10.094  0.850   1.00 0.00 ? 797 GLY A O    6  
ATOM 10832 H H    . GLY A 1 90  ? 21.135  6.966   0.645   1.00 0.00 ? 797 GLY A H    6  
ATOM 10833 H HA2  . GLY A 1 90  ? 20.596  9.266   0.516   1.00 0.00 ? 797 GLY A HA2  6  
ATOM 10834 H HA3  . GLY A 1 90  ? 20.355  9.280   2.271   1.00 0.00 ? 797 GLY A HA3  6  
ATOM 10835 N N    . SER A 1 91  ? 22.940  8.897   2.748   1.00 0.00 ? 798 SER A N    6  
ATOM 10836 C CA   . SER A 1 91  ? 24.322  9.062   3.037   1.00 0.00 ? 798 SER A CA   6  
ATOM 10837 C C    . SER A 1 91  ? 25.052  7.874   2.409   1.00 0.00 ? 798 SER A C    6  
ATOM 10838 O O    . SER A 1 91  ? 24.461  6.796   2.291   1.00 0.00 ? 798 SER A O    6  
ATOM 10839 C CB   . SER A 1 91  ? 24.499  9.130   4.553   1.00 0.00 ? 798 SER A CB   6  
ATOM 10840 O OG   . SER A 1 91  ? 23.705  8.134   5.197   1.00 0.00 ? 798 SER A OG   6  
ATOM 10841 H H    . SER A 1 91  ? 22.402  8.408   3.407   1.00 0.00 ? 798 SER A H    6  
ATOM 10842 H HA   . SER A 1 91  ? 24.661  9.979   2.580   1.00 0.00 ? 798 SER A HA   6  
ATOM 10843 H HB2  . SER A 1 91  ? 25.539  8.979   4.803   1.00 0.00 ? 798 SER A HB2  6  
ATOM 10844 H HB3  . SER A 1 91  ? 24.188  10.104  4.901   1.00 0.00 ? 798 SER A HB3  6  
ATOM 10845 H HG   . SER A 1 91  ? 22.906  8.569   5.519   1.00 0.00 ? 798 SER A HG   6  
ATOM 10846 N N    . THR A 1 92  ? 26.298  8.079   1.988   1.00 0.00 ? 799 THR A N    6  
ATOM 10847 C CA   . THR A 1 92  ? 27.069  7.100   1.220   1.00 0.00 ? 799 THR A CA   6  
ATOM 10848 C C    . THR A 1 92  ? 26.599  7.171   -0.242  1.00 0.00 ? 799 THR A C    6  
ATOM 10849 O O    . THR A 1 92  ? 25.415  6.919   -0.561  1.00 0.00 ? 799 THR A O    6  
ATOM 10850 C CB   . THR A 1 92  ? 26.978  5.646   1.775   1.00 0.00 ? 799 THR A CB   6  
ATOM 10851 O OG1  . THR A 1 92  ? 27.333  5.631   3.181   1.00 0.00 ? 799 THR A OG1  6  
ATOM 10852 C CG2  . THR A 1 92  ? 27.910  4.709   1.019   1.00 0.00 ? 799 THR A CG2  6  
ATOM 10853 H H    . THR A 1 92  ? 26.717  8.952   2.148   1.00 0.00 ? 799 THR A H    6  
ATOM 10854 H HA   . THR A 1 92  ? 28.094  7.447   1.240   1.00 0.00 ? 799 THR A HA   6  
ATOM 10855 H HB   . THR A 1 92  ? 25.958  5.336   1.623   1.00 0.00 ? 799 THR A HB   6  
ATOM 10856 H HG1  . THR A 1 92  ? 26.812  6.323   3.611   1.00 0.00 ? 799 THR A HG1  6  
ATOM 10857 H HG21 . THR A 1 92  ? 27.809  3.706   1.405   1.00 0.00 ? 799 THR A HG21 6  
ATOM 10858 H HG22 . THR A 1 92  ? 28.930  5.037   1.156   1.00 0.00 ? 799 THR A HG22 6  
ATOM 10859 H HG23 . THR A 1 92  ? 27.663  4.722   -0.032  1.00 0.00 ? 799 THR A HG23 6  
ATOM 10860 N N    . GLU A 1 93  ? 27.528  7.506   -1.103  1.00 0.00 ? 800 GLU A N    6  
ATOM 10861 C CA   . GLU A 1 93  ? 27.250  7.830   -2.494  1.00 0.00 ? 800 GLU A CA   6  
ATOM 10862 C C    . GLU A 1 93  ? 26.659  6.650   -3.250  1.00 0.00 ? 800 GLU A C    6  
ATOM 10863 O O    . GLU A 1 93  ? 27.258  5.573   -3.319  1.00 0.00 ? 800 GLU A O    6  
ATOM 10864 C CB   . GLU A 1 93  ? 28.510  8.348   -3.184  1.00 0.00 ? 800 GLU A CB   6  
ATOM 10865 C CG   . GLU A 1 93  ? 28.281  8.818   -4.605  1.00 0.00 ? 800 GLU A CG   6  
ATOM 10866 C CD   . GLU A 1 93  ? 29.527  9.346   -5.248  1.00 0.00 ? 800 GLU A CD   6  
ATOM 10867 O OE1  . GLU A 1 93  ? 29.848  10.527  -5.064  1.00 0.00 ? 800 GLU A OE1  6  
ATOM 10868 O OE2  . GLU A 1 93  ? 30.202  8.586   -5.966  1.00 0.00 ? 800 GLU A OE2  6  
ATOM 10869 H H    . GLU A 1 93  ? 28.453  7.481   -0.787  1.00 0.00 ? 800 GLU A H    6  
ATOM 10870 H HA   . GLU A 1 93  ? 26.518  8.626   -2.489  1.00 0.00 ? 800 GLU A HA   6  
ATOM 10871 H HB2  . GLU A 1 93  ? 28.906  9.176   -2.614  1.00 0.00 ? 800 GLU A HB2  6  
ATOM 10872 H HB3  . GLU A 1 93  ? 29.242  7.554   -3.204  1.00 0.00 ? 800 GLU A HB3  6  
ATOM 10873 H HG2  . GLU A 1 93  ? 27.921  7.982   -5.187  1.00 0.00 ? 800 GLU A HG2  6  
ATOM 10874 H HG3  . GLU A 1 93  ? 27.531  9.595   -4.599  1.00 0.00 ? 800 GLU A HG3  6  
ATOM 10875 N N    . GLY A 1 94  ? 25.452  6.850   -3.748  1.00 0.00 ? 801 GLY A N    6  
ATOM 10876 C CA   . GLY A 1 94  ? 24.760  5.846   -4.518  1.00 0.00 ? 801 GLY A CA   6  
ATOM 10877 C C    . GLY A 1 94  ? 24.038  4.829   -3.654  1.00 0.00 ? 801 GLY A C    6  
ATOM 10878 O O    . GLY A 1 94  ? 23.025  4.271   -4.070  1.00 0.00 ? 801 GLY A O    6  
ATOM 10879 H H    . GLY A 1 94  ? 25.011  7.713   -3.597  1.00 0.00 ? 801 GLY A H    6  
ATOM 10880 H HA2  . GLY A 1 94  ? 24.039  6.335   -5.157  1.00 0.00 ? 801 GLY A HA2  6  
ATOM 10881 H HA3  . GLY A 1 94  ? 25.479  5.331   -5.138  1.00 0.00 ? 801 GLY A HA3  6  
ATOM 10882 N N    . SER A 1 95  ? 24.565  4.605   -2.440  1.00 0.00 ? 802 SER A N    6  
ATOM 10883 C CA   . SER A 1 95  ? 24.072  3.593   -1.511  1.00 0.00 ? 802 SER A CA   6  
ATOM 10884 C C    . SER A 1 95  ? 24.300  2.196   -2.125  1.00 0.00 ? 802 SER A C    6  
ATOM 10885 O O    . SER A 1 95  ? 24.966  2.073   -3.170  1.00 0.00 ? 802 SER A O    6  
ATOM 10886 C CB   . SER A 1 95  ? 22.589  3.835   -1.173  1.00 0.00 ? 802 SER A CB   6  
ATOM 10887 O OG   . SER A 1 95  ? 22.385  5.173   -0.700  1.00 0.00 ? 802 SER A OG   6  
ATOM 10888 H H    . SER A 1 95  ? 25.346  5.144   -2.194  1.00 0.00 ? 802 SER A H    6  
ATOM 10889 H HA   . SER A 1 95  ? 24.672  3.667   -0.615  1.00 0.00 ? 802 SER A HA   6  
ATOM 10890 H HB2  . SER A 1 95  ? 21.988  3.682   -2.056  1.00 0.00 ? 802 SER A HB2  6  
ATOM 10891 H HB3  . SER A 1 95  ? 22.284  3.144   -0.400  1.00 0.00 ? 802 SER A HB3  6  
ATOM 10892 H HG   . SER A 1 95  ? 23.231  5.622   -0.826  1.00 0.00 ? 802 SER A HG   6  
ATOM 10893 N N    . GLU A 1 96  ? 23.834  1.159   -1.487  1.00 0.00 ? 803 GLU A N    6  
ATOM 10894 C CA   . GLU A 1 96  ? 23.980  -0.157  -2.039  1.00 0.00 ? 803 GLU A CA   6  
ATOM 10895 C C    . GLU A 1 96  ? 22.982  -0.372  -3.160  1.00 0.00 ? 803 GLU A C    6  
ATOM 10896 O O    . GLU A 1 96  ? 21.858  -0.811  -2.932  1.00 0.00 ? 803 GLU A O    6  
ATOM 10897 C CB   . GLU A 1 96  ? 23.843  -1.257  -0.980  1.00 0.00 ? 803 GLU A CB   6  
ATOM 10898 C CG   . GLU A 1 96  ? 24.782  -1.115  0.203   1.00 0.00 ? 803 GLU A CG   6  
ATOM 10899 C CD   . GLU A 1 96  ? 24.228  -0.261  1.337   1.00 0.00 ? 803 GLU A CD   6  
ATOM 10900 O OE1  . GLU A 1 96  ? 23.489  0.712   1.086   1.00 0.00 ? 803 GLU A OE1  6  
ATOM 10901 O OE2  . GLU A 1 96  ? 24.520  -0.576  2.508   1.00 0.00 ? 803 GLU A OE2  6  
ATOM 10902 H H    . GLU A 1 96  ? 23.419  1.233   -0.592  1.00 0.00 ? 803 GLU A H    6  
ATOM 10903 H HA   . GLU A 1 96  ? 24.971  -0.210  -2.467  1.00 0.00 ? 803 GLU A HA   6  
ATOM 10904 H HB2  . GLU A 1 96  ? 22.830  -1.253  -0.604  1.00 0.00 ? 803 GLU A HB2  6  
ATOM 10905 H HB3  . GLU A 1 96  ? 24.034  -2.211  -1.450  1.00 0.00 ? 803 GLU A HB3  6  
ATOM 10906 H HG2  . GLU A 1 96  ? 24.982  -2.103  0.586   1.00 0.00 ? 803 GLU A HG2  6  
ATOM 10907 H HG3  . GLU A 1 96  ? 25.695  -0.668  -0.163  1.00 0.00 ? 803 GLU A HG3  6  
ATOM 10908 N N    . SER A 1 97  ? 23.370  -0.020  -4.355  1.00 0.00 ? 804 SER A N    6  
ATOM 10909 C CA   . SER A 1 97  ? 22.521  -0.186  -5.501  1.00 0.00 ? 804 SER A CA   6  
ATOM 10910 C C    . SER A 1 97  ? 22.499  -1.656  -5.948  1.00 0.00 ? 804 SER A C    6  
ATOM 10911 O O    . SER A 1 97  ? 23.185  -2.051  -6.894  1.00 0.00 ? 804 SER A O    6  
ATOM 10912 C CB   . SER A 1 97  ? 22.967  0.732   -6.647  1.00 0.00 ? 804 SER A CB   6  
ATOM 10913 O OG   . SER A 1 97  ? 23.044  2.097   -6.224  1.00 0.00 ? 804 SER A OG   6  
ATOM 10914 H H    . SER A 1 97  ? 24.258  0.387   -4.446  1.00 0.00 ? 804 SER A H    6  
ATOM 10915 H HA   . SER A 1 97  ? 21.521  0.092   -5.202  1.00 0.00 ? 804 SER A HA   6  
ATOM 10916 H HB2  . SER A 1 97  ? 23.942  0.421   -6.989  1.00 0.00 ? 804 SER A HB2  6  
ATOM 10917 H HB3  . SER A 1 97  ? 22.260  0.658   -7.460  1.00 0.00 ? 804 SER A HB3  6  
ATOM 10918 H HG   . SER A 1 97  ? 22.268  2.319   -5.685  1.00 0.00 ? 804 SER A HG   6  
ATOM 10919 N N    . TYR A 1 98  ? 21.825  -2.480  -5.176  1.00 0.00 ? 805 TYR A N    6  
ATOM 10920 C CA   . TYR A 1 98  ? 21.628  -3.865  -5.522  1.00 0.00 ? 805 TYR A CA   6  
ATOM 10921 C C    . TYR A 1 98  ? 20.163  -4.085  -5.831  1.00 0.00 ? 805 TYR A C    6  
ATOM 10922 O O    . TYR A 1 98  ? 19.778  -5.056  -6.477  1.00 0.00 ? 805 TYR A O    6  
ATOM 10923 C CB   . TYR A 1 98  ? 22.078  -4.793  -4.370  1.00 0.00 ? 805 TYR A CB   6  
ATOM 10924 C CG   . TYR A 1 98  ? 21.207  -4.777  -3.109  1.00 0.00 ? 805 TYR A CG   6  
ATOM 10925 C CD1  . TYR A 1 98  ? 21.327  -3.777  -2.154  1.00 0.00 ? 805 TYR A CD1  6  
ATOM 10926 C CD2  . TYR A 1 98  ? 20.270  -5.779  -2.885  1.00 0.00 ? 805 TYR A CD2  6  
ATOM 10927 C CE1  . TYR A 1 98  ? 20.540  -3.775  -1.014  1.00 0.00 ? 805 TYR A CE1  6  
ATOM 10928 C CE2  . TYR A 1 98  ? 19.484  -5.787  -1.756  1.00 0.00 ? 805 TYR A CE2  6  
ATOM 10929 C CZ   . TYR A 1 98  ? 19.619  -4.788  -0.822  1.00 0.00 ? 805 TYR A CZ   6  
ATOM 10930 O OH   . TYR A 1 98  ? 18.813  -4.795  0.311   1.00 0.00 ? 805 TYR A OH   6  
ATOM 10931 H H    . TYR A 1 98  ? 21.498  -2.158  -4.308  1.00 0.00 ? 805 TYR A H    6  
ATOM 10932 H HA   . TYR A 1 98  ? 22.217  -4.077  -6.402  1.00 0.00 ? 805 TYR A HA   6  
ATOM 10933 H HB2  . TYR A 1 98  ? 22.078  -5.803  -4.742  1.00 0.00 ? 805 TYR A HB2  6  
ATOM 10934 H HB3  . TYR A 1 98  ? 23.085  -4.528  -4.088  1.00 0.00 ? 805 TYR A HB3  6  
ATOM 10935 H HD1  . TYR A 1 98  ? 22.040  -2.984  -2.312  1.00 0.00 ? 805 TYR A HD1  6  
ATOM 10936 H HD2  . TYR A 1 98  ? 20.162  -6.563  -3.619  1.00 0.00 ? 805 TYR A HD2  6  
ATOM 10937 H HE1  . TYR A 1 98  ? 20.659  -2.984  -0.289  1.00 0.00 ? 805 TYR A HE1  6  
ATOM 10938 H HE2  . TYR A 1 98  ? 18.764  -6.578  -1.615  1.00 0.00 ? 805 TYR A HE2  6  
ATOM 10939 H HH   . TYR A 1 98  ? 18.375  -3.935  0.384   1.00 0.00 ? 805 TYR A HH   6  
ATOM 10940 N N    . GLU A 1 99  ? 19.365  -3.139  -5.394  1.00 0.00 ? 806 GLU A N    6  
ATOM 10941 C CA   . GLU A 1 99  ? 17.941  -3.214  -5.510  1.00 0.00 ? 806 GLU A CA   6  
ATOM 10942 C C    . GLU A 1 99  ? 17.452  -2.764  -6.854  1.00 0.00 ? 806 GLU A C    6  
ATOM 10943 O O    . GLU A 1 99  ? 17.800  -1.684  -7.339  1.00 0.00 ? 806 GLU A O    6  
ATOM 10944 C CB   . GLU A 1 99  ? 17.278  -2.394  -4.424  1.00 0.00 ? 806 GLU A CB   6  
ATOM 10945 C CG   . GLU A 1 99  ? 17.412  -2.985  -3.038  1.00 0.00 ? 806 GLU A CG   6  
ATOM 10946 C CD   . GLU A 1 99  ? 16.581  -4.239  -2.857  1.00 0.00 ? 806 GLU A CD   6  
ATOM 10947 O OE1  . GLU A 1 99  ? 16.738  -5.197  -3.619  1.00 0.00 ? 806 GLU A OE1  6  
ATOM 10948 O OE2  . GLU A 1 99  ? 15.736  -4.272  -1.956  1.00 0.00 ? 806 GLU A OE2  6  
ATOM 10949 H H    . GLU A 1 99  ? 19.753  -2.337  -4.993  1.00 0.00 ? 806 GLU A H    6  
ATOM 10950 H HA   . GLU A 1 99  ? 17.669  -4.246  -5.347  1.00 0.00 ? 806 GLU A HA   6  
ATOM 10951 H HB2  . GLU A 1 99  ? 17.761  -1.431  -4.437  1.00 0.00 ? 806 GLU A HB2  6  
ATOM 10952 H HB3  . GLU A 1 99  ? 16.231  -2.276  -4.660  1.00 0.00 ? 806 GLU A HB3  6  
ATOM 10953 H HG2  . GLU A 1 99  ? 18.449  -3.234  -2.864  1.00 0.00 ? 806 GLU A HG2  6  
ATOM 10954 H HG3  . GLU A 1 99  ? 17.094  -2.250  -2.314  1.00 0.00 ? 806 GLU A HG3  6  
ATOM 10955 N N    . GLU A 1 100 ? 16.684  -3.610  -7.448  1.00 0.00 ? 807 GLU A N    6  
ATOM 10956 C CA   . GLU A 1 100 ? 15.995  -3.337  -8.692  1.00 0.00 ? 807 GLU A CA   6  
ATOM 10957 C C    . GLU A 1 100 ? 14.566  -2.963  -8.329  1.00 0.00 ? 807 GLU A C    6  
ATOM 10958 O O    . GLU A 1 100 ? 13.852  -2.260  -9.050  1.00 0.00 ? 807 GLU A O    6  
ATOM 10959 C CB   . GLU A 1 100 ? 16.029  -4.593  -9.574  1.00 0.00 ? 807 GLU A CB   6  
ATOM 10960 C CG   . GLU A 1 100 ? 15.385  -4.433  -10.941 1.00 0.00 ? 807 GLU A CG   6  
ATOM 10961 C CD   . GLU A 1 100 ? 15.960  -3.274  -11.708 1.00 0.00 ? 807 GLU A CD   6  
ATOM 10962 O OE1  . GLU A 1 100 ? 17.141  -3.329  -12.090 1.00 0.00 ? 807 GLU A OE1  6  
ATOM 10963 O OE2  . GLU A 1 100 ? 15.248  -2.277  -11.909 1.00 0.00 ? 807 GLU A OE2  6  
ATOM 10964 H H    . GLU A 1 100 ? 16.582  -4.481  -7.009  1.00 0.00 ? 807 GLU A H    6  
ATOM 10965 H HA   . GLU A 1 100 ? 16.477  -2.511  -9.186  1.00 0.00 ? 807 GLU A HA   6  
ATOM 10966 H HB2  . GLU A 1 100 ? 17.058  -4.884  -9.717  1.00 0.00 ? 807 GLU A HB2  6  
ATOM 10967 H HB3  . GLU A 1 100 ? 15.519  -5.388  -9.050  1.00 0.00 ? 807 GLU A HB3  6  
ATOM 10968 H HG2  . GLU A 1 100 ? 15.543  -5.337  -11.509 1.00 0.00 ? 807 GLU A HG2  6  
ATOM 10969 H HG3  . GLU A 1 100 ? 14.324  -4.273  -10.809 1.00 0.00 ? 807 GLU A HG3  6  
ATOM 10970 N N    . ASP A 1 101 ? 14.195  -3.437  -7.190  1.00 0.00 ? 808 ASP A N    6  
ATOM 10971 C CA   . ASP A 1 101 ? 12.922  -3.199  -6.585  1.00 0.00 ? 808 ASP A CA   6  
ATOM 10972 C C    . ASP A 1 101 ? 13.142  -2.350  -5.338  1.00 0.00 ? 808 ASP A C    6  
ATOM 10973 O O    . ASP A 1 101 ? 13.779  -2.804  -4.381  1.00 0.00 ? 808 ASP A O    6  
ATOM 10974 C CB   . ASP A 1 101 ? 12.287  -4.543  -6.247  1.00 0.00 ? 808 ASP A CB   6  
ATOM 10975 C CG   . ASP A 1 101 ? 11.039  -4.432  -5.438  1.00 0.00 ? 808 ASP A CG   6  
ATOM 10976 O OD1  . ASP A 1 101 ? 10.054  -3.834  -5.902  1.00 0.00 ? 808 ASP A OD1  6  
ATOM 10977 O OD2  . ASP A 1 101 ? 11.018  -4.951  -4.323  1.00 0.00 ? 808 ASP A OD2  6  
ATOM 10978 H H    . ASP A 1 101 ? 14.847  -3.987  -6.707  1.00 0.00 ? 808 ASP A H    6  
ATOM 10979 H HA   . ASP A 1 101 ? 12.297  -2.667  -7.287  1.00 0.00 ? 808 ASP A HA   6  
ATOM 10980 H HB2  . ASP A 1 101 ? 12.044  -5.053  -7.166  1.00 0.00 ? 808 ASP A HB2  6  
ATOM 10981 H HB3  . ASP A 1 101 ? 13.003  -5.137  -5.697  1.00 0.00 ? 808 ASP A HB3  6  
ATOM 10982 N N    . PRO A 1 102 ? 12.654  -1.098  -5.341  1.00 0.00 ? 809 PRO A N    6  
ATOM 10983 C CA   . PRO A 1 102 ? 12.924  -0.141  -4.270  1.00 0.00 ? 809 PRO A CA   6  
ATOM 10984 C C    . PRO A 1 102 ? 12.079  -0.377  -3.015  1.00 0.00 ? 809 PRO A C    6  
ATOM 10985 O O    . PRO A 1 102 ? 11.395  -1.401  -2.872  1.00 0.00 ? 809 PRO A O    6  
ATOM 10986 C CB   . PRO A 1 102 ? 12.556  1.193   -4.921  1.00 0.00 ? 809 PRO A CB   6  
ATOM 10987 C CG   . PRO A 1 102 ? 11.438  0.854   -5.825  1.00 0.00 ? 809 PRO A CG   6  
ATOM 10988 C CD   . PRO A 1 102 ? 11.771  -0.511  -6.380  1.00 0.00 ? 809 PRO A CD   6  
ATOM 10989 H HA   . PRO A 1 102 ? 13.970  -0.129  -4.003  1.00 0.00 ? 809 PRO A HA   6  
ATOM 10990 H HB2  . PRO A 1 102 ? 12.257  1.896   -4.157  1.00 0.00 ? 809 PRO A HB2  6  
ATOM 10991 H HB3  . PRO A 1 102 ? 13.402  1.584   -5.468  1.00 0.00 ? 809 PRO A HB3  6  
ATOM 10992 H HG2  . PRO A 1 102 ? 10.526  0.834   -5.247  1.00 0.00 ? 809 PRO A HG2  6  
ATOM 10993 H HG3  . PRO A 1 102 ? 11.365  1.587   -6.614  1.00 0.00 ? 809 PRO A HG3  6  
ATOM 10994 H HD2  . PRO A 1 102 ? 10.875  -1.101  -6.507  1.00 0.00 ? 809 PRO A HD2  6  
ATOM 10995 H HD3  . PRO A 1 102 ? 12.303  -0.411  -7.315  1.00 0.00 ? 809 PRO A HD3  6  
ATOM 10996 N N    . TYR A 1 103 ? 12.134  0.563   -2.110  1.00 0.00 ? 810 TYR A N    6  
ATOM 10997 C CA   . TYR A 1 103 ? 11.388  0.477   -0.884  1.00 0.00 ? 810 TYR A CA   6  
ATOM 10998 C C    . TYR A 1 103 ? 10.358  1.579   -0.867  1.00 0.00 ? 810 TYR A C    6  
ATOM 10999 O O    . TYR A 1 103 ? 10.653  2.711   -1.250  1.00 0.00 ? 810 TYR A O    6  
ATOM 11000 C CB   . TYR A 1 103 ? 12.315  0.596   0.320   1.00 0.00 ? 810 TYR A CB   6  
ATOM 11001 C CG   . TYR A 1 103 ? 13.433  -0.416  0.337   1.00 0.00 ? 810 TYR A CG   6  
ATOM 11002 C CD1  . TYR A 1 103 ? 13.166  -1.768  0.473   1.00 0.00 ? 810 TYR A CD1  6  
ATOM 11003 C CD2  . TYR A 1 103 ? 14.757  -0.017  0.218   1.00 0.00 ? 810 TYR A CD2  6  
ATOM 11004 C CE1  . TYR A 1 103 ? 14.183  -2.691  0.484   1.00 0.00 ? 810 TYR A CE1  6  
ATOM 11005 C CE2  . TYR A 1 103 ? 15.780  -0.934  0.232   1.00 0.00 ? 810 TYR A CE2  6  
ATOM 11006 C CZ   . TYR A 1 103 ? 15.488  -2.269  0.362   1.00 0.00 ? 810 TYR A CZ   6  
ATOM 11007 O OH   . TYR A 1 103 ? 16.506  -3.197  0.366   1.00 0.00 ? 810 TYR A OH   6  
ATOM 11008 H H    . TYR A 1 103 ? 12.677  1.363   -2.277  1.00 0.00 ? 810 TYR A H    6  
ATOM 11009 H HA   . TYR A 1 103 ? 10.886  -0.479  -0.859  1.00 0.00 ? 810 TYR A HA   6  
ATOM 11010 H HB2  . TYR A 1 103 ? 12.751  1.583   0.335   1.00 0.00 ? 810 TYR A HB2  6  
ATOM 11011 H HB3  . TYR A 1 103 ? 11.732  0.457   1.219   1.00 0.00 ? 810 TYR A HB3  6  
ATOM 11012 H HD1  . TYR A 1 103 ? 12.142  -2.096  0.567   1.00 0.00 ? 810 TYR A HD1  6  
ATOM 11013 H HD2  . TYR A 1 103 ? 14.983  1.035   0.117   1.00 0.00 ? 810 TYR A HD2  6  
ATOM 11014 H HE1  . TYR A 1 103 ? 13.958  -3.741  0.591   1.00 0.00 ? 810 TYR A HE1  6  
ATOM 11015 H HE2  . TYR A 1 103 ? 16.804  -0.605  0.135   1.00 0.00 ? 810 TYR A HE2  6  
ATOM 11016 H HH   . TYR A 1 103 ? 16.279  -3.787  -0.377  1.00 0.00 ? 810 TYR A HH   6  
ATOM 11017 N N    . LEU A 1 104 ? 9.178   1.253   -0.444  1.00 0.00 ? 811 LEU A N    6  
ATOM 11018 C CA   . LEU A 1 104 ? 8.065   2.150   -0.457  1.00 0.00 ? 811 LEU A CA   6  
ATOM 11019 C C    . LEU A 1 104 ? 7.673   2.506   0.980   1.00 0.00 ? 811 LEU A C    6  
ATOM 11020 O O    . LEU A 1 104 ? 7.606   1.639   1.868   1.00 0.00 ? 811 LEU A O    6  
ATOM 11021 C CB   . LEU A 1 104 ? 6.891   1.459   -1.229  1.00 0.00 ? 811 LEU A CB   6  
ATOM 11022 C CG   . LEU A 1 104 ? 5.650   2.296   -1.659  1.00 0.00 ? 811 LEU A CG   6  
ATOM 11023 C CD1  . LEU A 1 104 ? 4.781   2.735   -0.487  1.00 0.00 ? 811 LEU A CD1  6  
ATOM 11024 C CD2  . LEU A 1 104 ? 6.076   3.491   -2.487  1.00 0.00 ? 811 LEU A CD2  6  
ATOM 11025 H H    . LEU A 1 104 ? 9.013   0.351   -0.081  1.00 0.00 ? 811 LEU A H    6  
ATOM 11026 H HA   . LEU A 1 104 ? 8.349   3.043   -0.991  1.00 0.00 ? 811 LEU A HA   6  
ATOM 11027 H HB2  . LEU A 1 104 ? 7.309   1.034   -2.130  1.00 0.00 ? 811 LEU A HB2  6  
ATOM 11028 H HB3  . LEU A 1 104 ? 6.546   0.640   -0.615  1.00 0.00 ? 811 LEU A HB3  6  
ATOM 11029 H HG   . LEU A 1 104 ? 5.030   1.672   -2.287  1.00 0.00 ? 811 LEU A HG   6  
ATOM 11030 H HD11 . LEU A 1 104 ? 5.371   3.341   0.187   1.00 0.00 ? 811 LEU A HD11 6  
ATOM 11031 H HD12 . LEU A 1 104 ? 4.414   1.864   0.036   1.00 0.00 ? 811 LEU A HD12 6  
ATOM 11032 H HD13 . LEU A 1 104 ? 3.947   3.314   -0.853  1.00 0.00 ? 811 LEU A HD13 6  
ATOM 11033 H HD21 . LEU A 1 104 ? 6.626   3.153   -3.353  1.00 0.00 ? 811 LEU A HD21 6  
ATOM 11034 H HD22 . LEU A 1 104 ? 6.695   4.150   -1.895  1.00 0.00 ? 811 LEU A HD22 6  
ATOM 11035 H HD23 . LEU A 1 104 ? 5.195   4.024   -2.813  1.00 0.00 ? 811 LEU A HD23 6  
ATOM 11036 N N    . VAL A 1 105 ? 7.480   3.770   1.193   1.00 0.00 ? 812 VAL A N    6  
ATOM 11037 C CA   . VAL A 1 105 ? 7.000   4.330   2.427   1.00 0.00 ? 812 VAL A CA   6  
ATOM 11038 C C    . VAL A 1 105 ? 6.000   5.447   2.070   1.00 0.00 ? 812 VAL A C    6  
ATOM 11039 O O    . VAL A 1 105 ? 6.081   6.006   0.992   1.00 0.00 ? 812 VAL A O    6  
ATOM 11040 C CB   . VAL A 1 105 ? 8.197   4.799   3.364   1.00 0.00 ? 812 VAL A CB   6  
ATOM 11041 C CG1  . VAL A 1 105 ? 9.335   5.416   2.582   1.00 0.00 ? 812 VAL A CG1  6  
ATOM 11042 C CG2  . VAL A 1 105 ? 7.749   5.747   4.465   1.00 0.00 ? 812 VAL A CG2  6  
ATOM 11043 H H    . VAL A 1 105 ? 7.674   4.416   0.476   1.00 0.00 ? 812 VAL A H    6  
ATOM 11044 H HA   . VAL A 1 105 ? 6.437   3.546   2.915   1.00 0.00 ? 812 VAL A HA   6  
ATOM 11045 H HB   . VAL A 1 105 ? 8.589   3.908   3.825   1.00 0.00 ? 812 VAL A HB   6  
ATOM 11046 H HG11 . VAL A 1 105 ? 9.860   4.629   2.059   1.00 0.00 ? 812 VAL A HG11 6  
ATOM 11047 H HG12 . VAL A 1 105 ? 10.010  5.949   3.233   1.00 0.00 ? 812 VAL A HG12 6  
ATOM 11048 H HG13 . VAL A 1 105 ? 8.918   6.081   1.844   1.00 0.00 ? 812 VAL A HG13 6  
ATOM 11049 H HG21 . VAL A 1 105 ? 7.323   6.631   4.012   1.00 0.00 ? 812 VAL A HG21 6  
ATOM 11050 H HG22 . VAL A 1 105 ? 8.596   6.020   5.079   1.00 0.00 ? 812 VAL A HG22 6  
ATOM 11051 H HG23 . VAL A 1 105 ? 7.003   5.258   5.072   1.00 0.00 ? 812 VAL A HG23 6  
ATOM 11052 N N    . VAL A 1 106 ? 5.030   5.700   2.909   1.00 0.00 ? 813 VAL A N    6  
ATOM 11053 C CA   . VAL A 1 106 ? 3.999   6.674   2.599   1.00 0.00 ? 813 VAL A CA   6  
ATOM 11054 C C    . VAL A 1 106 ? 3.889   7.698   3.729   1.00 0.00 ? 813 VAL A C    6  
ATOM 11055 O O    . VAL A 1 106 ? 4.262   7.398   4.867   1.00 0.00 ? 813 VAL A O    6  
ATOM 11056 C CB   . VAL A 1 106 ? 2.625   5.951   2.360   1.00 0.00 ? 813 VAL A CB   6  
ATOM 11057 C CG1  . VAL A 1 106 ? 2.173   5.176   3.592   1.00 0.00 ? 813 VAL A CG1  6  
ATOM 11058 C CG2  . VAL A 1 106 ? 1.539   6.915   1.898   1.00 0.00 ? 813 VAL A CG2  6  
ATOM 11059 H H    . VAL A 1 106 ? 5.001   5.264   3.783   1.00 0.00 ? 813 VAL A H    6  
ATOM 11060 H HA   . VAL A 1 106 ? 4.284   7.187   1.692   1.00 0.00 ? 813 VAL A HA   6  
ATOM 11061 H HB   . VAL A 1 106 ? 2.785   5.221   1.578   1.00 0.00 ? 813 VAL A HB   6  
ATOM 11062 H HG11 . VAL A 1 106 ? 1.234   4.687   3.384   1.00 0.00 ? 813 VAL A HG11 6  
ATOM 11063 H HG12 . VAL A 1 106 ? 2.048   5.858   4.421   1.00 0.00 ? 813 VAL A HG12 6  
ATOM 11064 H HG13 . VAL A 1 106 ? 2.914   4.434   3.847   1.00 0.00 ? 813 VAL A HG13 6  
ATOM 11065 H HG21 . VAL A 1 106 ? 1.372   7.657   2.665   1.00 0.00 ? 813 VAL A HG21 6  
ATOM 11066 H HG22 . VAL A 1 106 ? 0.622   6.376   1.715   1.00 0.00 ? 813 VAL A HG22 6  
ATOM 11067 H HG23 . VAL A 1 106 ? 1.864   7.407   0.993   1.00 0.00 ? 813 VAL A HG23 6  
ATOM 11068 N N    . ASN A 1 107 ? 3.448   8.912   3.411   1.00 0.00 ? 814 ASN A N    6  
ATOM 11069 C CA   . ASN A 1 107 ? 3.207   9.909   4.439   1.00 0.00 ? 814 ASN A CA   6  
ATOM 11070 C C    . ASN A 1 107 ? 2.016   9.473   5.275   1.00 0.00 ? 814 ASN A C    6  
ATOM 11071 O O    . ASN A 1 107 ? 1.035   8.962   4.724   1.00 0.00 ? 814 ASN A O    6  
ATOM 11072 C CB   . ASN A 1 107 ? 2.896   11.304  3.858   1.00 0.00 ? 814 ASN A CB   6  
ATOM 11073 C CG   . ASN A 1 107 ? 4.045   11.963  3.117   1.00 0.00 ? 814 ASN A CG   6  
ATOM 11074 O OD1  . ASN A 1 107 ? 4.201   11.800  1.915   1.00 0.00 ? 814 ASN A OD1  6  
ATOM 11075 N ND2  . ASN A 1 107 ? 4.842   12.730  3.817   1.00 0.00 ? 814 ASN A ND2  6  
ATOM 11076 H H    . ASN A 1 107 ? 3.270   9.136   2.471   1.00 0.00 ? 814 ASN A H    6  
ATOM 11077 H HA   . ASN A 1 107 ? 4.089   9.966   5.059   1.00 0.00 ? 814 ASN A HA   6  
ATOM 11078 H HB2  . ASN A 1 107 ? 2.060   11.225  3.183   1.00 0.00 ? 814 ASN A HB2  6  
ATOM 11079 H HB3  . ASN A 1 107 ? 2.607   11.945  4.678   1.00 0.00 ? 814 ASN A HB3  6  
ATOM 11080 H HD21 . ASN A 1 107 ? 4.675   12.847  4.777   1.00 0.00 ? 814 ASN A HD21 6  
ATOM 11081 H HD22 . ASN A 1 107 ? 5.577   13.173  3.343   1.00 0.00 ? 814 ASN A HD22 6  
ATOM 11082 N N    . PRO A 1 108 ? 2.080   9.659   6.614   1.00 0.00 ? 815 PRO A N    6  
ATOM 11083 C CA   . PRO A 1 108 ? 0.980   9.309   7.536   1.00 0.00 ? 815 PRO A CA   6  
ATOM 11084 C C    . PRO A 1 108 ? -0.354  9.971   7.171   1.00 0.00 ? 815 PRO A C    6  
ATOM 11085 O O    . PRO A 1 108 ? -1.407  9.497   7.579   1.00 0.00 ? 815 PRO A O    6  
ATOM 11086 C CB   . PRO A 1 108 ? 1.459   9.852   8.883   1.00 0.00 ? 815 PRO A CB   6  
ATOM 11087 C CG   . PRO A 1 108 ? 2.937   9.865   8.782   1.00 0.00 ? 815 PRO A CG   6  
ATOM 11088 C CD   . PRO A 1 108 ? 3.253   10.170  7.349   1.00 0.00 ? 815 PRO A CD   6  
ATOM 11089 H HA   . PRO A 1 108 ? 0.846   8.240   7.607   1.00 0.00 ? 815 PRO A HA   6  
ATOM 11090 H HB2  . PRO A 1 108 ? 1.062   10.845  9.031   1.00 0.00 ? 815 PRO A HB2  6  
ATOM 11091 H HB3  . PRO A 1 108 ? 1.124   9.204   9.680   1.00 0.00 ? 815 PRO A HB3  6  
ATOM 11092 H HG2  . PRO A 1 108 ? 3.346   10.626  9.431   1.00 0.00 ? 815 PRO A HG2  6  
ATOM 11093 H HG3  . PRO A 1 108 ? 3.331   8.897   9.054   1.00 0.00 ? 815 PRO A HG3  6  
ATOM 11094 H HD2  . PRO A 1 108 ? 3.355   11.234  7.208   1.00 0.00 ? 815 PRO A HD2  6  
ATOM 11095 H HD3  . PRO A 1 108 ? 4.152   9.650   7.053   1.00 0.00 ? 815 PRO A HD3  6  
ATOM 11096 N N    . ASN A 1 109 ? -0.287  11.070  6.418   1.00 0.00 ? 816 ASN A N    6  
ATOM 11097 C CA   . ASN A 1 109 ? -1.475  11.808  5.986   1.00 0.00 ? 816 ASN A CA   6  
ATOM 11098 C C    . ASN A 1 109 ? -2.375  10.921  5.128   1.00 0.00 ? 816 ASN A C    6  
ATOM 11099 O O    . ASN A 1 109 ? -3.388  10.406  5.622   1.00 0.00 ? 816 ASN A O    6  
ATOM 11100 C CB   . ASN A 1 109 ? -1.082  13.093  5.226   1.00 0.00 ? 816 ASN A CB   6  
ATOM 11101 C CG   . ASN A 1 109 ? -2.283  13.881  4.713   1.00 0.00 ? 816 ASN A CG   6  
ATOM 11102 O OD1  . ASN A 1 109 ? -2.742  13.684  3.591   1.00 0.00 ? 816 ASN A OD1  6  
ATOM 11103 N ND2  . ASN A 1 109 ? -2.793  14.760  5.517   1.00 0.00 ? 816 ASN A ND2  6  
ATOM 11104 H H    . ASN A 1 109 ? 0.605   11.364  6.142   1.00 0.00 ? 816 ASN A H    6  
ATOM 11105 H HA   . ASN A 1 109 ? -2.024  12.080  6.875   1.00 0.00 ? 816 ASN A HA   6  
ATOM 11106 H HB2  . ASN A 1 109 ? -0.517  13.736  5.886   1.00 0.00 ? 816 ASN A HB2  6  
ATOM 11107 H HB3  . ASN A 1 109 ? -0.461  12.830  4.383   1.00 0.00 ? 816 ASN A HB3  6  
ATOM 11108 H HD21 . ASN A 1 109 ? -2.397  14.883  6.407   1.00 0.00 ? 816 ASN A HD21 6  
ATOM 11109 H HD22 . ASN A 1 109 ? -3.567  15.274  5.207   1.00 0.00 ? 816 ASN A HD22 6  
ATOM 11110 N N    . TYR A 1 110 ? -1.987  10.729  3.857   1.00 0.00 ? 817 TYR A N    6  
ATOM 11111 C CA   . TYR A 1 110 ? -2.689  9.851   2.913   1.00 0.00 ? 817 TYR A CA   6  
ATOM 11112 C C    . TYR A 1 110 ? -4.147  10.334  2.603   1.00 0.00 ? 817 TYR A C    6  
ATOM 11113 O O    . TYR A 1 110 ? -4.736  11.138  3.334   1.00 0.00 ? 817 TYR A O    6  
ATOM 11114 C CB   . TYR A 1 110 ? -2.630  8.383   3.426   1.00 0.00 ? 817 TYR A CB   6  
ATOM 11115 C CG   . TYR A 1 110 ? -3.256  7.359   2.521   1.00 0.00 ? 817 TYR A CG   6  
ATOM 11116 C CD1  . TYR A 1 110 ? -2.777  7.161   1.234   1.00 0.00 ? 817 TYR A CD1  6  
ATOM 11117 C CD2  . TYR A 1 110 ? -4.324  6.585   2.952   1.00 0.00 ? 817 TYR A CD2  6  
ATOM 11118 C CE1  . TYR A 1 110 ? -3.343  6.232   0.404   1.00 0.00 ? 817 TYR A CE1  6  
ATOM 11119 C CE2  . TYR A 1 110 ? -4.897  5.649   2.127   1.00 0.00 ? 817 TYR A CE2  6  
ATOM 11120 C CZ   . TYR A 1 110 ? -4.405  5.477   0.854   1.00 0.00 ? 817 TYR A CZ   6  
ATOM 11121 O OH   . TYR A 1 110 ? -4.986  4.561   0.025   1.00 0.00 ? 817 TYR A OH   6  
ATOM 11122 H H    . TYR A 1 110 ? -1.200  11.212  3.533   1.00 0.00 ? 817 TYR A H    6  
ATOM 11123 H HA   . TYR A 1 110 ? -2.144  9.908   1.982   1.00 0.00 ? 817 TYR A HA   6  
ATOM 11124 H HB2  . TYR A 1 110 ? -1.596  8.101   3.563   1.00 0.00 ? 817 TYR A HB2  6  
ATOM 11125 H HB3  . TYR A 1 110 ? -3.129  8.335   4.384   1.00 0.00 ? 817 TYR A HB3  6  
ATOM 11126 H HD1  . TYR A 1 110 ? -1.949  7.757   0.880   1.00 0.00 ? 817 TYR A HD1  6  
ATOM 11127 H HD2  . TYR A 1 110 ? -4.705  6.728   3.952   1.00 0.00 ? 817 TYR A HD2  6  
ATOM 11128 H HE1  . TYR A 1 110 ? -2.946  6.105   -0.591  1.00 0.00 ? 817 TYR A HE1  6  
ATOM 11129 H HE2  . TYR A 1 110 ? -5.730  5.058   2.478   1.00 0.00 ? 817 TYR A HE2  6  
ATOM 11130 H HH   . TYR A 1 110 ? -4.302  4.057   -0.427  1.00 0.00 ? 817 TYR A HH   6  
ATOM 11131 N N    . LEU A 1 111 ? -4.705  9.864   1.509   1.00 0.00 ? 818 LEU A N    6  
ATOM 11132 C CA   . LEU A 1 111 ? -6.045  10.229  1.109   1.00 0.00 ? 818 LEU A CA   6  
ATOM 11133 C C    . LEU A 1 111 ? -6.778  9.039   0.501   1.00 0.00 ? 818 LEU A C    6  
ATOM 11134 O O    . LEU A 1 111 ? -6.176  8.003   0.256   1.00 0.00 ? 818 LEU A O    6  
ATOM 11135 C CB   . LEU A 1 111 ? -6.090  11.512  0.181   1.00 0.00 ? 818 LEU A CB   6  
ATOM 11136 C CG   . LEU A 1 111 ? -5.225  11.585  -1.133  1.00 0.00 ? 818 LEU A CG   6  
ATOM 11137 C CD1  . LEU A 1 111 ? -3.730  11.592  -0.857  1.00 0.00 ? 818 LEU A CD1  6  
ATOM 11138 C CD2  . LEU A 1 111 ? -5.577  10.490  -2.120  1.00 0.00 ? 818 LEU A CD2  6  
ATOM 11139 H H    . LEU A 1 111 ? -4.226  9.228   0.935   1.00 0.00 ? 818 LEU A H    6  
ATOM 11140 H HA   . LEU A 1 111 ? -6.562  10.460  2.030   1.00 0.00 ? 818 LEU A HA   6  
ATOM 11141 H HB2  . LEU A 1 111 ? -7.118  11.650  -0.120  1.00 0.00 ? 818 LEU A HB2  6  
ATOM 11142 H HB3  . LEU A 1 111 ? -5.826  12.359  0.798   1.00 0.00 ? 818 LEU A HB3  6  
ATOM 11143 H HG   . LEU A 1 111 ? -5.440  12.535  -1.601  1.00 0.00 ? 818 LEU A HG   6  
ATOM 11144 H HD11 . LEU A 1 111 ? -3.192  11.623  -1.792  1.00 0.00 ? 818 LEU A HD11 6  
ATOM 11145 H HD12 . LEU A 1 111 ? -3.457  10.701  -0.311  1.00 0.00 ? 818 LEU A HD12 6  
ATOM 11146 H HD13 . LEU A 1 111 ? -3.481  12.463  -0.269  1.00 0.00 ? 818 LEU A HD13 6  
ATOM 11147 H HD21 . LEU A 1 111 ? -4.981  10.601  -3.013  1.00 0.00 ? 818 LEU A HD21 6  
ATOM 11148 H HD22 . LEU A 1 111 ? -6.628  10.542  -2.365  1.00 0.00 ? 818 LEU A HD22 6  
ATOM 11149 H HD23 . LEU A 1 111 ? -5.354  9.538   -1.661  1.00 0.00 ? 818 LEU A HD23 6  
ATOM 11150 N N    . LEU A 1 112 ? -8.060  9.193   0.291   1.00 0.00 ? 819 LEU A N    6  
ATOM 11151 C CA   . LEU A 1 112 ? -8.904  8.167   -0.306  1.00 0.00 ? 819 LEU A CA   6  
ATOM 11152 C C    . LEU A 1 112 ? -9.453  8.772   -1.581  1.00 0.00 ? 819 LEU A C    6  
ATOM 11153 O O    . LEU A 1 112 ? -8.915  9.786   -2.036  1.00 0.00 ? 819 LEU A O    6  
ATOM 11154 C CB   . LEU A 1 112 ? -10.062 7.829   0.658   1.00 0.00 ? 819 LEU A CB   6  
ATOM 11155 C CG   . LEU A 1 112 ? -9.672  7.474   2.111   1.00 0.00 ? 819 LEU A CG   6  
ATOM 11156 C CD1  . LEU A 1 112 ? -10.898 7.086   2.920   1.00 0.00 ? 819 LEU A CD1  6  
ATOM 11157 C CD2  . LEU A 1 112 ? -8.614  6.374   2.167   1.00 0.00 ? 819 LEU A CD2  6  
ATOM 11158 H H    . LEU A 1 112 ? -8.479  10.051  0.508   1.00 0.00 ? 819 LEU A H    6  
ATOM 11159 H HA   . LEU A 1 112 ? -8.346  7.273   -0.549  1.00 0.00 ? 819 LEU A HA   6  
ATOM 11160 H HB2  . LEU A 1 112 ? -10.726 8.679   0.685   1.00 0.00 ? 819 LEU A HB2  6  
ATOM 11161 H HB3  . LEU A 1 112 ? -10.606 6.993   0.243   1.00 0.00 ? 819 LEU A HB3  6  
ATOM 11162 H HG   . LEU A 1 112 ? -9.263  8.363   2.570   1.00 0.00 ? 819 LEU A HG   6  
ATOM 11163 H HD11 . LEU A 1 112 ? -11.380 6.233   2.465   1.00 0.00 ? 819 LEU A HD11 6  
ATOM 11164 H HD12 . LEU A 1 112 ? -11.585 7.919   2.953   1.00 0.00 ? 819 LEU A HD12 6  
ATOM 11165 H HD13 . LEU A 1 112 ? -10.594 6.830   3.925   1.00 0.00 ? 819 LEU A HD13 6  
ATOM 11166 H HD21 . LEU A 1 112 ? -8.965  5.485   1.668   1.00 0.00 ? 819 LEU A HD21 6  
ATOM 11167 H HD22 . LEU A 1 112 ? -8.396  6.140   3.198   1.00 0.00 ? 819 LEU A HD22 6  
ATOM 11168 H HD23 . LEU A 1 112 ? -7.711  6.722   1.686   1.00 0.00 ? 819 LEU A HD23 6  
ATOM 11169 N N    . GLU A 1 113 ? -10.465 8.168   -2.188  1.00 0.00 ? 820 GLU A N    6  
ATOM 11170 C CA   . GLU A 1 113 ? -11.126 8.794   -3.336  1.00 0.00 ? 820 GLU A CA   6  
ATOM 11171 C C    . GLU A 1 113 ? -11.680 10.152  -2.919  1.00 0.00 ? 820 GLU A C    6  
ATOM 11172 O O    . GLU A 1 113 ? -11.233 11.188  -3.431  1.00 0.00 ? 820 GLU A O    6  
ATOM 11173 C CB   . GLU A 1 113 ? -12.223 7.894   -3.926  1.00 0.00 ? 820 GLU A CB   6  
ATOM 11174 C CG   . GLU A 1 113 ? -11.721 6.809   -4.888  1.00 0.00 ? 820 GLU A CG   6  
ATOM 11175 C CD   . GLU A 1 113 ? -10.585 5.978   -4.346  1.00 0.00 ? 820 GLU A CD   6  
ATOM 11176 O OE1  . GLU A 1 113 ? -10.754 5.332   -3.318  1.00 0.00 ? 820 GLU A OE1  6  
ATOM 11177 O OE2  . GLU A 1 113 ? -9.499  5.935   -4.973  1.00 0.00 ? 820 GLU A OE2  6  
ATOM 11178 H H    . GLU A 1 113 ? -10.758 7.279   -1.891  1.00 0.00 ? 820 GLU A H    6  
ATOM 11179 H HA   . GLU A 1 113 ? -10.356 8.963   -4.075  1.00 0.00 ? 820 GLU A HA   6  
ATOM 11180 H HB2  . GLU A 1 113 ? -12.741 7.409   -3.113  1.00 0.00 ? 820 GLU A HB2  6  
ATOM 11181 H HB3  . GLU A 1 113 ? -12.927 8.517   -4.457  1.00 0.00 ? 820 GLU A HB3  6  
ATOM 11182 H HG2  . GLU A 1 113 ? -12.541 6.145   -5.118  1.00 0.00 ? 820 GLU A HG2  6  
ATOM 11183 H HG3  . GLU A 1 113 ? -11.399 7.290   -5.800  1.00 0.00 ? 820 GLU A HG3  6  
ATOM 11184 N N    . ASP A 1 114 ? -12.623 10.129  -1.979  1.00 0.00 ? 821 ASP A N    6  
ATOM 11185 C CA   . ASP A 1 114 ? -13.161 11.325  -1.332  1.00 0.00 ? 821 ASP A CA   6  
ATOM 11186 C C    . ASP A 1 114 ? -14.261 10.927  -0.389  1.00 0.00 ? 821 ASP A C    6  
ATOM 11187 O O    . ASP A 1 114 ? -15.432 10.876  -0.798  1.00 0.00 ? 821 ASP A O    6  
ATOM 11188 C CB   . ASP A 1 114 ? -13.682 12.383  -2.306  1.00 0.00 ? 821 ASP A CB   6  
ATOM 11189 C CG   . ASP A 1 114 ? -14.087 13.641  -1.574  1.00 0.00 ? 821 ASP A CG   6  
ATOM 11190 O OD1  . ASP A 1 114 ? -13.215 14.268  -0.936  1.00 0.00 ? 821 ASP A OD1  6  
ATOM 11191 O OD2  . ASP A 1 114 ? -15.274 14.036  -1.613  1.00 0.00 ? 821 ASP A OD2  6  
ATOM 11192 O OXT  . ASP A 1 114 ? -13.972 10.618  0.763   1.00 0.00 ? 821 ASP A OXT  6  
ATOM 11193 H H    . ASP A 1 114 ? -13.000 9.273   -1.688  1.00 0.00 ? 821 ASP A H    6  
ATOM 11194 H HA   . ASP A 1 114 ? -12.359 11.743  -0.741  1.00 0.00 ? 821 ASP A HA   6  
ATOM 11195 H HB2  . ASP A 1 114 ? -12.899 12.624  -3.009  1.00 0.00 ? 821 ASP A HB2  6  
ATOM 11196 H HB3  . ASP A 1 114 ? -14.536 11.992  -2.837  1.00 0.00 ? 821 ASP A HB3  6  
ATOM 11197 N N    . ALA A 1 1   ? -14.518 16.486  4.119   1.00 0.00 ? 708 ALA A N    7  
ATOM 11198 C CA   . ALA A 1 1   ? -15.940 16.578  3.990   1.00 0.00 ? 708 ALA A CA   7  
ATOM 11199 C C    . ALA A 1 1   ? -16.525 15.174  3.868   1.00 0.00 ? 708 ALA A C    7  
ATOM 11200 O O    . ALA A 1 1   ? -15.951 14.325  3.172   1.00 0.00 ? 708 ALA A O    7  
ATOM 11201 C CB   . ALA A 1 1   ? -16.291 17.397  2.756   1.00 0.00 ? 708 ALA A CB   7  
ATOM 11202 H H1   . ALA A 1 1   ? -13.958 16.550  3.315   1.00 0.00 ? 708 ALA A H1   7  
ATOM 11203 H HA   . ALA A 1 1   ? -16.325 17.083  4.862   1.00 0.00 ? 708 ALA A HA   7  
ATOM 11204 H HB1  . ALA A 1 1   ? -15.890 18.395  2.856   1.00 0.00 ? 708 ALA A HB1  7  
ATOM 11205 H HB2  . ALA A 1 1   ? -17.365 17.449  2.650   1.00 0.00 ? 708 ALA A HB2  7  
ATOM 11206 H HB3  . ALA A 1 1   ? -15.867 16.927  1.881   1.00 0.00 ? 708 ALA A HB3  7  
ATOM 11207 N N    . PRO A 1 2   ? -17.621 14.871  4.577   1.00 0.00 ? 709 PRO A N    7  
ATOM 11208 C CA   . PRO A 1 2   ? -18.311 13.612  4.411   1.00 0.00 ? 709 PRO A CA   7  
ATOM 11209 C C    . PRO A 1 2   ? -19.183 13.697  3.169   1.00 0.00 ? 709 PRO A C    7  
ATOM 11210 O O    . PRO A 1 2   ? -20.334 14.140  3.221   1.00 0.00 ? 709 PRO A O    7  
ATOM 11211 C CB   . PRO A 1 2   ? -19.173 13.468  5.682   1.00 0.00 ? 709 PRO A CB   7  
ATOM 11212 C CG   . PRO A 1 2   ? -18.894 14.693  6.506   1.00 0.00 ? 709 PRO A CG   7  
ATOM 11213 C CD   . PRO A 1 2   ? -18.270 15.708  5.591   1.00 0.00 ? 709 PRO A CD   7  
ATOM 11214 H HA   . PRO A 1 2   ? -17.621 12.787  4.312   1.00 0.00 ? 709 PRO A HA   7  
ATOM 11215 H HB2  . PRO A 1 2   ? -20.214 13.415  5.401   1.00 0.00 ? 709 PRO A HB2  7  
ATOM 11216 H HB3  . PRO A 1 2   ? -18.894 12.568  6.210   1.00 0.00 ? 709 PRO A HB3  7  
ATOM 11217 H HG2  . PRO A 1 2   ? -19.815 15.080  6.912   1.00 0.00 ? 709 PRO A HG2  7  
ATOM 11218 H HG3  . PRO A 1 2   ? -18.212 14.442  7.306   1.00 0.00 ? 709 PRO A HG3  7  
ATOM 11219 H HD2  . PRO A 1 2   ? -19.030 16.340  5.152   1.00 0.00 ? 709 PRO A HD2  7  
ATOM 11220 H HD3  . PRO A 1 2   ? -17.550 16.295  6.139   1.00 0.00 ? 709 PRO A HD3  7  
ATOM 11221 N N    . LYS A 1 3   ? -18.620 13.327  2.065   1.00 0.00 ? 710 LYS A N    7  
ATOM 11222 C CA   . LYS A 1 3   ? -19.263 13.497  0.784   1.00 0.00 ? 710 LYS A CA   7  
ATOM 11223 C C    . LYS A 1 3   ? -19.864 12.209  0.267   1.00 0.00 ? 710 LYS A C    7  
ATOM 11224 O O    . LYS A 1 3   ? -20.919 12.226  -0.382  1.00 0.00 ? 710 LYS A O    7  
ATOM 11225 C CB   . LYS A 1 3   ? -18.284 14.114  -0.242  1.00 0.00 ? 710 LYS A CB   7  
ATOM 11226 C CG   . LYS A 1 3   ? -16.904 13.461  -0.253  1.00 0.00 ? 710 LYS A CG   7  
ATOM 11227 C CD   . LYS A 1 3   ? -15.998 14.019  -1.340  1.00 0.00 ? 710 LYS A CD   7  
ATOM 11228 C CE   . LYS A 1 3   ? -14.581 13.499  -1.161  1.00 0.00 ? 710 LYS A CE   7  
ATOM 11229 N NZ   . LYS A 1 3   ? -13.686 13.843  -2.287  1.00 0.00 ? 710 LYS A NZ   7  
ATOM 11230 H H    . LYS A 1 3   ? -17.737 12.889  2.117   1.00 0.00 ? 710 LYS A H    7  
ATOM 11231 H HA   . LYS A 1 3   ? -20.071 14.199  0.930   1.00 0.00 ? 710 LYS A HA   7  
ATOM 11232 H HB2  . LYS A 1 3   ? -18.710 14.017  -1.231  1.00 0.00 ? 710 LYS A HB2  7  
ATOM 11233 H HB3  . LYS A 1 3   ? -18.161 15.165  -0.021  1.00 0.00 ? 710 LYS A HB3  7  
ATOM 11234 H HG2  . LYS A 1 3   ? -16.435 13.631  0.706   1.00 0.00 ? 710 LYS A HG2  7  
ATOM 11235 H HG3  . LYS A 1 3   ? -17.025 12.397  -0.403  1.00 0.00 ? 710 LYS A HG3  7  
ATOM 11236 H HD2  . LYS A 1 3   ? -16.369 13.712  -2.306  1.00 0.00 ? 710 LYS A HD2  7  
ATOM 11237 H HD3  . LYS A 1 3   ? -15.988 15.098  -1.279  1.00 0.00 ? 710 LYS A HD3  7  
ATOM 11238 H HE2  . LYS A 1 3   ? -14.172 13.922  -0.255  1.00 0.00 ? 710 LYS A HE2  7  
ATOM 11239 H HE3  . LYS A 1 3   ? -14.619 12.426  -1.059  1.00 0.00 ? 710 LYS A HE3  7  
ATOM 11240 H HZ1  . LYS A 1 3   ? -13.744 14.848  -2.554  1.00 0.00 ? 710 LYS A HZ1  7  
ATOM 11241 H HZ2  . LYS A 1 3   ? -13.867 13.222  -3.107  1.00 0.00 ? 710 LYS A HZ2  7  
ATOM 11242 H HZ3  . LYS A 1 3   ? -12.706 13.643  -2.006  1.00 0.00 ? 710 LYS A HZ3  7  
ATOM 11243 N N    . ALA A 1 4   ? -19.248 11.091  0.573   1.00 0.00 ? 711 ALA A N    7  
ATOM 11244 C CA   . ALA A 1 4   ? -19.739 9.835   0.032   1.00 0.00 ? 711 ALA A CA   7  
ATOM 11245 C C    . ALA A 1 4   ? -19.478 8.667   0.944   1.00 0.00 ? 711 ALA A C    7  
ATOM 11246 O O    . ALA A 1 4   ? -20.367 7.859   1.190   1.00 0.00 ? 711 ALA A O    7  
ATOM 11247 C CB   . ALA A 1 4   ? -19.104 9.568   -1.326  1.00 0.00 ? 711 ALA A CB   7  
ATOM 11248 H H    . ALA A 1 4   ? -18.468 11.122  1.178   1.00 0.00 ? 711 ALA A H    7  
ATOM 11249 H HA   . ALA A 1 4   ? -20.802 9.929   -0.127  1.00 0.00 ? 711 ALA A HA   7  
ATOM 11250 H HB1  . ALA A 1 4   ? -19.550 8.689   -1.770  1.00 0.00 ? 711 ALA A HB1  7  
ATOM 11251 H HB2  . ALA A 1 4   ? -18.045 9.402   -1.194  1.00 0.00 ? 711 ALA A HB2  7  
ATOM 11252 H HB3  . ALA A 1 4   ? -19.259 10.422  -1.968  1.00 0.00 ? 711 ALA A HB3  7  
ATOM 11253 N N    . SER A 1 5   ? -18.236 8.585   1.418   1.00 0.00 ? 712 SER A N    7  
ATOM 11254 C CA   . SER A 1 5   ? -17.737 7.462   2.212   1.00 0.00 ? 712 SER A CA   7  
ATOM 11255 C C    . SER A 1 5   ? -17.795 6.167   1.382   1.00 0.00 ? 712 SER A C    7  
ATOM 11256 O O    . SER A 1 5   ? -17.825 5.056   1.912   1.00 0.00 ? 712 SER A O    7  
ATOM 11257 C CB   . SER A 1 5   ? -18.501 7.380   3.536   1.00 0.00 ? 712 SER A CB   7  
ATOM 11258 O OG   . SER A 1 5   ? -18.361 8.623   4.245   1.00 0.00 ? 712 SER A OG   7  
ATOM 11259 H H    . SER A 1 5   ? -17.626 9.335   1.258   1.00 0.00 ? 712 SER A H    7  
ATOM 11260 H HA   . SER A 1 5   ? -16.694 7.667   2.409   1.00 0.00 ? 712 SER A HA   7  
ATOM 11261 H HB2  . SER A 1 5   ? -19.548 7.203   3.341   1.00 0.00 ? 712 SER A HB2  7  
ATOM 11262 H HB3  . SER A 1 5   ? -18.096 6.585   4.144   1.00 0.00 ? 712 SER A HB3  7  
ATOM 11263 H HG   . SER A 1 5   ? -17.546 9.054   3.942   1.00 0.00 ? 712 SER A HG   7  
ATOM 11264 N N    . LEU A 1 6   ? -17.717 6.372   0.046   1.00 0.00 ? 713 LEU A N    7  
ATOM 11265 C CA   . LEU A 1 6   ? -17.798 5.339   -0.990  1.00 0.00 ? 713 LEU A CA   7  
ATOM 11266 C C    . LEU A 1 6   ? -19.205 4.740   -1.074  1.00 0.00 ? 713 LEU A C    7  
ATOM 11267 O O    . LEU A 1 6   ? -20.093 5.093   -0.298  1.00 0.00 ? 713 LEU A O    7  
ATOM 11268 C CB   . LEU A 1 6   ? -16.705 4.251   -0.840  1.00 0.00 ? 713 LEU A CB   7  
ATOM 11269 C CG   . LEU A 1 6   ? -15.244 4.747   -0.890  1.00 0.00 ? 713 LEU A CG   7  
ATOM 11270 C CD1  . LEU A 1 6   ? -14.278 3.591   -0.788  1.00 0.00 ? 713 LEU A CD1  7  
ATOM 11271 C CD2  . LEU A 1 6   ? -14.964 5.535   -2.156  1.00 0.00 ? 713 LEU A CD2  7  
ATOM 11272 H H    . LEU A 1 6   ? -17.607 7.301   -0.238  1.00 0.00 ? 713 LEU A H    7  
ATOM 11273 H HA   . LEU A 1 6   ? -17.644 5.861   -1.923  1.00 0.00 ? 713 LEU A HA   7  
ATOM 11274 H HB2  . LEU A 1 6   ? -16.857 3.750   0.104   1.00 0.00 ? 713 LEU A HB2  7  
ATOM 11275 H HB3  . LEU A 1 6   ? -16.839 3.528   -1.631  1.00 0.00 ? 713 LEU A HB3  7  
ATOM 11276 H HG   . LEU A 1 6   ? -15.073 5.397   -0.043  1.00 0.00 ? 713 LEU A HG   7  
ATOM 11277 H HD11 . LEU A 1 6   ? -14.445 3.051   0.132   1.00 0.00 ? 713 LEU A HD11 7  
ATOM 11278 H HD12 . LEU A 1 6   ? -13.267 3.975   -0.805  1.00 0.00 ? 713 LEU A HD12 7  
ATOM 11279 H HD13 . LEU A 1 6   ? -14.426 2.934   -1.634  1.00 0.00 ? 713 LEU A HD13 7  
ATOM 11280 H HD21 . LEU A 1 6   ? -13.926 5.840   -2.148  1.00 0.00 ? 713 LEU A HD21 7  
ATOM 11281 H HD22 . LEU A 1 6   ? -15.598 6.408   -2.186  1.00 0.00 ? 713 LEU A HD22 7  
ATOM 11282 H HD23 . LEU A 1 6   ? -15.151 4.915   -3.020  1.00 0.00 ? 713 LEU A HD23 7  
ATOM 11283 N N    . ARG A 1 7   ? -19.422 3.884   -2.033  1.00 0.00 ? 714 ARG A N    7  
ATOM 11284 C CA   . ARG A 1 7   ? -20.721 3.265   -2.235  1.00 0.00 ? 714 ARG A CA   7  
ATOM 11285 C C    . ARG A 1 7   ? -20.538 1.777   -2.363  1.00 0.00 ? 714 ARG A C    7  
ATOM 11286 O O    . ARG A 1 7   ? -19.402 1.296   -2.306  1.00 0.00 ? 714 ARG A O    7  
ATOM 11287 C CB   . ARG A 1 7   ? -21.418 3.829   -3.488  1.00 0.00 ? 714 ARG A CB   7  
ATOM 11288 C CG   . ARG A 1 7   ? -21.798 5.307   -3.406  1.00 0.00 ? 714 ARG A CG   7  
ATOM 11289 C CD   . ARG A 1 7   ? -22.725 5.581   -2.229  1.00 0.00 ? 714 ARG A CD   7  
ATOM 11290 N NE   . ARG A 1 7   ? -23.941 4.760   -2.279  1.00 0.00 ? 714 ARG A NE   7  
ATOM 11291 C CZ   . ARG A 1 7   ? -24.651 4.367   -1.211  1.00 0.00 ? 714 ARG A CZ   7  
ATOM 11292 N NH1  . ARG A 1 7   ? -24.241 4.679   0.029   1.00 0.00 ? 714 ARG A NH1  7  
ATOM 11293 N NH2  . ARG A 1 7   ? -25.751 3.639   -1.388  1.00 0.00 ? 714 ARG A NH2  7  
ATOM 11294 H H    . ARG A 1 7   ? -18.691 3.608   -2.625  1.00 0.00 ? 714 ARG A H    7  
ATOM 11295 H HA   . ARG A 1 7   ? -21.330 3.468   -1.366  1.00 0.00 ? 714 ARG A HA   7  
ATOM 11296 H HB2  . ARG A 1 7   ? -20.756 3.704   -4.333  1.00 0.00 ? 714 ARG A HB2  7  
ATOM 11297 H HB3  . ARG A 1 7   ? -22.317 3.261   -3.668  1.00 0.00 ? 714 ARG A HB3  7  
ATOM 11298 H HG2  . ARG A 1 7   ? -20.897 5.893   -3.283  1.00 0.00 ? 714 ARG A HG2  7  
ATOM 11299 H HG3  . ARG A 1 7   ? -22.297 5.594   -4.321  1.00 0.00 ? 714 ARG A HG3  7  
ATOM 11300 H HD2  . ARG A 1 7   ? -22.198 5.376   -1.309  1.00 0.00 ? 714 ARG A HD2  7  
ATOM 11301 H HD3  . ARG A 1 7   ? -23.010 6.622   -2.248  1.00 0.00 ? 714 ARG A HD3  7  
ATOM 11302 H HE   . ARG A 1 7   ? -24.220 4.510   -3.190  1.00 0.00 ? 714 ARG A HE   7  
ATOM 11303 H HH11 . ARG A 1 7   ? -23.404 5.205   0.202   1.00 0.00 ? 714 ARG A HH11 7  
ATOM 11304 H HH12 . ARG A 1 7   ? -24.742 4.419   0.859   1.00 0.00 ? 714 ARG A HH12 7  
ATOM 11305 H HH21 . ARG A 1 7   ? -26.062 3.367   -2.302  1.00 0.00 ? 714 ARG A HH21 7  
ATOM 11306 H HH22 . ARG A 1 7   ? -26.348 3.323   -0.646  1.00 0.00 ? 714 ARG A HH22 7  
ATOM 11307 N N    . LEU A 1 8   ? -21.625 1.044   -2.521  1.00 0.00 ? 715 LEU A N    7  
ATOM 11308 C CA   . LEU A 1 8   ? -21.551 -0.394  -2.677  1.00 0.00 ? 715 LEU A CA   7  
ATOM 11309 C C    . LEU A 1 8   ? -21.042 -0.730  -4.064  1.00 0.00 ? 715 LEU A C    7  
ATOM 11310 O O    . LEU A 1 8   ? -21.701 -0.463  -5.069  1.00 0.00 ? 715 LEU A O    7  
ATOM 11311 C CB   . LEU A 1 8   ? -22.902 -1.064  -2.389  1.00 0.00 ? 715 LEU A CB   7  
ATOM 11312 C CG   . LEU A 1 8   ? -23.450 -0.866  -0.964  1.00 0.00 ? 715 LEU A CG   7  
ATOM 11313 C CD1  . LEU A 1 8   ? -24.794 -1.545  -0.806  1.00 0.00 ? 715 LEU A CD1  7  
ATOM 11314 C CD2  . LEU A 1 8   ? -22.469 -1.392  0.078   1.00 0.00 ? 715 LEU A CD2  7  
ATOM 11315 H H    . LEU A 1 8   ? -22.509 1.471   -2.555  1.00 0.00 ? 715 LEU A H    7  
ATOM 11316 H HA   . LEU A 1 8   ? -20.823 -0.743  -1.962  1.00 0.00 ? 715 LEU A HA   7  
ATOM 11317 H HB2  . LEU A 1 8   ? -23.627 -0.691  -3.096  1.00 0.00 ? 715 LEU A HB2  7  
ATOM 11318 H HB3  . LEU A 1 8   ? -22.786 -2.126  -2.555  1.00 0.00 ? 715 LEU A HB3  7  
ATOM 11319 H HG   . LEU A 1 8   ? -23.593 0.190   -0.790  1.00 0.00 ? 715 LEU A HG   7  
ATOM 11320 H HD11 . LEU A 1 8   ? -25.147 -1.400  0.203   1.00 0.00 ? 715 LEU A HD11 7  
ATOM 11321 H HD12 . LEU A 1 8   ? -24.695 -2.601  -1.009  1.00 0.00 ? 715 LEU A HD12 7  
ATOM 11322 H HD13 . LEU A 1 8   ? -25.499 -1.106  -1.495  1.00 0.00 ? 715 LEU A HD13 7  
ATOM 11323 H HD21 . LEU A 1 8   ? -22.276 -2.439  -0.099  1.00 0.00 ? 715 LEU A HD21 7  
ATOM 11324 H HD22 . LEU A 1 8   ? -22.900 -1.272  1.061   1.00 0.00 ? 715 LEU A HD22 7  
ATOM 11325 H HD23 . LEU A 1 8   ? -21.545 -0.838  0.023   1.00 0.00 ? 715 LEU A HD23 7  
ATOM 11326 N N    . GLY A 1 9   ? -19.868 -1.287  -4.106  1.00 0.00 ? 716 GLY A N    7  
ATOM 11327 C CA   . GLY A 1 9   ? -19.206 -1.557  -5.359  1.00 0.00 ? 716 GLY A CA   7  
ATOM 11328 C C    . GLY A 1 9   ? -17.729 -1.264  -5.240  1.00 0.00 ? 716 GLY A C    7  
ATOM 11329 O O    . GLY A 1 9   ? -16.953 -1.475  -6.174  1.00 0.00 ? 716 GLY A O    7  
ATOM 11330 H H    . GLY A 1 9   ? -19.444 -1.538  -3.257  1.00 0.00 ? 716 GLY A H    7  
ATOM 11331 H HA2  . GLY A 1 9   ? -19.354 -2.595  -5.620  1.00 0.00 ? 716 GLY A HA2  7  
ATOM 11332 H HA3  . GLY A 1 9   ? -19.629 -0.928  -6.128  1.00 0.00 ? 716 GLY A HA3  7  
ATOM 11333 N N    . PHE A 1 10  ? -17.357 -0.735  -4.092  1.00 0.00 ? 717 PHE A N    7  
ATOM 11334 C CA   . PHE A 1 10  ? -15.974 -0.468  -3.736  1.00 0.00 ? 717 PHE A CA   7  
ATOM 11335 C C    . PHE A 1 10  ? -15.544 -1.439  -2.655  1.00 0.00 ? 717 PHE A C    7  
ATOM 11336 O O    . PHE A 1 10  ? -14.567 -1.194  -1.966  1.00 0.00 ? 717 PHE A O    7  
ATOM 11337 C CB   . PHE A 1 10  ? -15.811 0.954   -3.181  1.00 0.00 ? 717 PHE A CB   7  
ATOM 11338 C CG   . PHE A 1 10  ? -15.901 2.068   -4.178  1.00 0.00 ? 717 PHE A CG   7  
ATOM 11339 C CD1  . PHE A 1 10  ? -14.779 2.459   -4.883  1.00 0.00 ? 717 PHE A CD1  7  
ATOM 11340 C CD2  . PHE A 1 10  ? -17.084 2.748   -4.382  1.00 0.00 ? 717 PHE A CD2  7  
ATOM 11341 C CE1  . PHE A 1 10  ? -14.835 3.504   -5.777  1.00 0.00 ? 717 PHE A CE1  7  
ATOM 11342 C CE2  . PHE A 1 10  ? -17.151 3.795   -5.280  1.00 0.00 ? 717 PHE A CE2  7  
ATOM 11343 C CZ   . PHE A 1 10  ? -16.023 4.175   -5.978  1.00 0.00 ? 717 PHE A CZ   7  
ATOM 11344 H H    . PHE A 1 10  ? -18.045 -0.495  -3.435  1.00 0.00 ? 717 PHE A H    7  
ATOM 11345 H HA   . PHE A 1 10  ? -15.354 -0.583  -4.611  1.00 0.00 ? 717 PHE A HA   7  
ATOM 11346 H HB2  . PHE A 1 10  ? -16.583 1.125   -2.446  1.00 0.00 ? 717 PHE A HB2  7  
ATOM 11347 H HB3  . PHE A 1 10  ? -14.850 1.014   -2.690  1.00 0.00 ? 717 PHE A HB3  7  
ATOM 11348 H HD1  . PHE A 1 10  ? -13.849 1.932   -4.731  1.00 0.00 ? 717 PHE A HD1  7  
ATOM 11349 H HD2  . PHE A 1 10  ? -17.966 2.449   -3.835  1.00 0.00 ? 717 PHE A HD2  7  
ATOM 11350 H HE1  . PHE A 1 10  ? -13.944 3.796   -6.313  1.00 0.00 ? 717 PHE A HE1  7  
ATOM 11351 H HE2  . PHE A 1 10  ? -18.083 4.318   -5.432  1.00 0.00 ? 717 PHE A HE2  7  
ATOM 11352 H HZ   . PHE A 1 10  ? -16.070 4.996   -6.678  1.00 0.00 ? 717 PHE A HZ   7  
ATOM 11353 N N    . SER A 1 11  ? -16.244 -2.562  -2.578  1.00 0.00 ? 718 SER A N    7  
ATOM 11354 C CA   . SER A 1 11  ? -16.072 -3.574  -1.532  1.00 0.00 ? 718 SER A CA   7  
ATOM 11355 C C    . SER A 1 11  ? -14.610 -3.981  -1.374  1.00 0.00 ? 718 SER A C    7  
ATOM 11356 O O    . SER A 1 11  ? -14.061 -3.995  -0.265  1.00 0.00 ? 718 SER A O    7  
ATOM 11357 C CB   . SER A 1 11  ? -16.928 -4.805  -1.921  1.00 0.00 ? 718 SER A CB   7  
ATOM 11358 O OG   . SER A 1 11  ? -16.747 -5.917  -1.047  1.00 0.00 ? 718 SER A OG   7  
ATOM 11359 H H    . SER A 1 11  ? -16.921 -2.712  -3.266  1.00 0.00 ? 718 SER A H    7  
ATOM 11360 H HA   . SER A 1 11  ? -16.447 -3.187  -0.599  1.00 0.00 ? 718 SER A HA   7  
ATOM 11361 H HB2  . SER A 1 11  ? -17.971 -4.529  -1.893  1.00 0.00 ? 718 SER A HB2  7  
ATOM 11362 H HB3  . SER A 1 11  ? -16.672 -5.106  -2.926  1.00 0.00 ? 718 SER A HB3  7  
ATOM 11363 H HG   . SER A 1 11  ? -16.090 -6.504  -1.451  1.00 0.00 ? 718 SER A HG   7  
ATOM 11364 N N    . GLU A 1 12  ? -13.985 -4.282  -2.465  1.00 0.00 ? 719 GLU A N    7  
ATOM 11365 C CA   . GLU A 1 12  ? -12.619 -4.690  -2.459  1.00 0.00 ? 719 GLU A CA   7  
ATOM 11366 C C    . GLU A 1 12  ? -11.711 -3.489  -2.264  1.00 0.00 ? 719 GLU A C    7  
ATOM 11367 O O    . GLU A 1 12  ? -10.870 -3.460  -1.369  1.00 0.00 ? 719 GLU A O    7  
ATOM 11368 C CB   . GLU A 1 12  ? -12.287 -5.422  -3.756  1.00 0.00 ? 719 GLU A CB   7  
ATOM 11369 C CG   . GLU A 1 12  ? -13.268 -6.546  -4.081  1.00 0.00 ? 719 GLU A CG   7  
ATOM 11370 C CD   . GLU A 1 12  ? -13.496 -7.452  -2.904  1.00 0.00 ? 719 GLU A CD   7  
ATOM 11371 O OE1  . GLU A 1 12  ? -12.559 -8.105  -2.476  1.00 0.00 ? 719 GLU A OE1  7  
ATOM 11372 O OE2  . GLU A 1 12  ? -14.629 -7.477  -2.344  1.00 0.00 ? 719 GLU A OE2  7  
ATOM 11373 H H    . GLU A 1 12  ? -14.470 -4.227  -3.316  1.00 0.00 ? 719 GLU A H    7  
ATOM 11374 H HA   . GLU A 1 12  ? -12.476 -5.370  -1.631  1.00 0.00 ? 719 GLU A HA   7  
ATOM 11375 H HB2  . GLU A 1 12  ? -12.284 -4.715  -4.572  1.00 0.00 ? 719 GLU A HB2  7  
ATOM 11376 H HB3  . GLU A 1 12  ? -11.302 -5.855  -3.657  1.00 0.00 ? 719 GLU A HB3  7  
ATOM 11377 H HG2  . GLU A 1 12  ? -14.215 -6.118  -4.374  1.00 0.00 ? 719 GLU A HG2  7  
ATOM 11378 H HG3  . GLU A 1 12  ? -12.867 -7.132  -4.896  1.00 0.00 ? 719 GLU A HG3  7  
ATOM 11379 N N    . TYR A 1 13  ? -11.951 -2.473  -3.063  1.00 0.00 ? 720 TYR A N    7  
ATOM 11380 C CA   . TYR A 1 13  ? -11.095 -1.300  -3.108  1.00 0.00 ? 720 TYR A CA   7  
ATOM 11381 C C    . TYR A 1 13  ? -11.048 -0.524  -1.800  1.00 0.00 ? 720 TYR A C    7  
ATOM 11382 O O    . TYR A 1 13  ? -9.993  -0.025  -1.431  1.00 0.00 ? 720 TYR A O    7  
ATOM 11383 C CB   . TYR A 1 13  ? -11.452 -0.402  -4.293  1.00 0.00 ? 720 TYR A CB   7  
ATOM 11384 C CG   . TYR A 1 13  ? -11.229 -1.095  -5.617  1.00 0.00 ? 720 TYR A CG   7  
ATOM 11385 C CD1  . TYR A 1 13  ? -9.959  -1.170  -6.175  1.00 0.00 ? 720 TYR A CD1  7  
ATOM 11386 C CD2  . TYR A 1 13  ? -12.277 -1.699  -6.295  1.00 0.00 ? 720 TYR A CD2  7  
ATOM 11387 C CE1  . TYR A 1 13  ? -9.743  -1.830  -7.368  1.00 0.00 ? 720 TYR A CE1  7  
ATOM 11388 C CE2  . TYR A 1 13  ? -12.067 -2.354  -7.492  1.00 0.00 ? 720 TYR A CE2  7  
ATOM 11389 C CZ   . TYR A 1 13  ? -10.802 -2.418  -8.021  1.00 0.00 ? 720 TYR A CZ   7  
ATOM 11390 O OH   . TYR A 1 13  ? -10.591 -3.090  -9.205  1.00 0.00 ? 720 TYR A OH   7  
ATOM 11391 H H    . TYR A 1 13  ? -12.749 -2.523  -3.631  1.00 0.00 ? 720 TYR A H    7  
ATOM 11392 H HA   . TYR A 1 13  ? -10.098 -1.678  -3.278  1.00 0.00 ? 720 TYR A HA   7  
ATOM 11393 H HB2  . TYR A 1 13  ? -12.493 -0.122  -4.227  1.00 0.00 ? 720 TYR A HB2  7  
ATOM 11394 H HB3  . TYR A 1 13  ? -10.837 0.485   -4.273  1.00 0.00 ? 720 TYR A HB3  7  
ATOM 11395 H HD1  . TYR A 1 13  ? -9.130  -0.706  -5.662  1.00 0.00 ? 720 TYR A HD1  7  
ATOM 11396 H HD2  . TYR A 1 13  ? -13.272 -1.647  -5.878  1.00 0.00 ? 720 TYR A HD2  7  
ATOM 11397 H HE1  . TYR A 1 13  ? -8.748  -1.878  -7.786  1.00 0.00 ? 720 TYR A HE1  7  
ATOM 11398 H HE2  . TYR A 1 13  ? -12.892 -2.819  -8.010  1.00 0.00 ? 720 TYR A HE2  7  
ATOM 11399 H HH   . TYR A 1 13  ? -11.317 -2.868  -9.804  1.00 0.00 ? 720 TYR A HH   7  
ATOM 11400 N N    . SER A 1 14  ? -12.161 -0.448  -1.094  1.00 0.00 ? 721 SER A N    7  
ATOM 11401 C CA   . SER A 1 14  ? -12.211 0.252   0.173   1.00 0.00 ? 721 SER A CA   7  
ATOM 11402 C C    . SER A 1 14  ? -11.361 -0.485  1.193   1.00 0.00 ? 721 SER A C    7  
ATOM 11403 O O    . SER A 1 14  ? -10.535 0.121   1.839   1.00 0.00 ? 721 SER A O    7  
ATOM 11404 C CB   . SER A 1 14  ? -13.659 0.392   0.680   1.00 0.00 ? 721 SER A CB   7  
ATOM 11405 O OG   . SER A 1 14  ? -13.746 1.247   1.820   1.00 0.00 ? 721 SER A OG   7  
ATOM 11406 H H    . SER A 1 14  ? -12.989 -0.863  -1.429  1.00 0.00 ? 721 SER A H    7  
ATOM 11407 H HA   . SER A 1 14  ? -11.792 1.235   0.020   1.00 0.00 ? 721 SER A HA   7  
ATOM 11408 H HB2  . SER A 1 14  ? -14.277 0.799   -0.108  1.00 0.00 ? 721 SER A HB2  7  
ATOM 11409 H HB3  . SER A 1 14  ? -14.027 -0.586  0.951   1.00 0.00 ? 721 SER A HB3  7  
ATOM 11410 H HG   . SER A 1 14  ? -13.013 1.103   2.431   1.00 0.00 ? 721 SER A HG   7  
ATOM 11411 N N    . ARG A 1 15  ? -11.530 -1.805  1.277   1.00 0.00 ? 722 ARG A N    7  
ATOM 11412 C CA   . ARG A 1 15  ? -10.778 -2.631  2.229   1.00 0.00 ? 722 ARG A CA   7  
ATOM 11413 C C    . ARG A 1 15  ? -9.280  -2.474  2.021   1.00 0.00 ? 722 ARG A C    7  
ATOM 11414 O O    . ARG A 1 15  ? -8.522  -2.265  2.981   1.00 0.00 ? 722 ARG A O    7  
ATOM 11415 C CB   . ARG A 1 15  ? -11.186 -4.105  2.117   1.00 0.00 ? 722 ARG A CB   7  
ATOM 11416 C CG   . ARG A 1 15  ? -12.619 -4.393  2.543   1.00 0.00 ? 722 ARG A CG   7  
ATOM 11417 C CD   . ARG A 1 15  ? -12.818 -4.131  4.025   1.00 0.00 ? 722 ARG A CD   7  
ATOM 11418 N NE   . ARG A 1 15  ? -14.194 -4.391  4.465   1.00 0.00 ? 722 ARG A NE   7  
ATOM 11419 C CZ   . ARG A 1 15  ? -14.574 -5.460  5.185   1.00 0.00 ? 722 ARG A CZ   7  
ATOM 11420 N NH1  . ARG A 1 15  ? -13.748 -6.503  5.313   1.00 0.00 ? 722 ARG A NH1  7  
ATOM 11421 N NH2  . ARG A 1 15  ? -15.786 -5.505  5.729   1.00 0.00 ? 722 ARG A NH2  7  
ATOM 11422 H H    . ARG A 1 15  ? -12.178 -2.236  0.681   1.00 0.00 ? 722 ARG A H    7  
ATOM 11423 H HA   . ARG A 1 15  ? -11.016 -2.273  3.219   1.00 0.00 ? 722 ARG A HA   7  
ATOM 11424 H HB2  . ARG A 1 15  ? -11.067 -4.422  1.092   1.00 0.00 ? 722 ARG A HB2  7  
ATOM 11425 H HB3  . ARG A 1 15  ? -10.525 -4.690  2.740   1.00 0.00 ? 722 ARG A HB3  7  
ATOM 11426 H HG2  . ARG A 1 15  ? -13.288 -3.758  1.981   1.00 0.00 ? 722 ARG A HG2  7  
ATOM 11427 H HG3  . ARG A 1 15  ? -12.846 -5.429  2.338   1.00 0.00 ? 722 ARG A HG3  7  
ATOM 11428 H HD2  . ARG A 1 15  ? -12.148 -4.765  4.586   1.00 0.00 ? 722 ARG A HD2  7  
ATOM 11429 H HD3  . ARG A 1 15  ? -12.581 -3.097  4.231   1.00 0.00 ? 722 ARG A HD3  7  
ATOM 11430 H HE   . ARG A 1 15  ? -14.819 -3.660  4.245   1.00 0.00 ? 722 ARG A HE   7  
ATOM 11431 H HH11 . ARG A 1 15  ? -12.840 -6.520  4.891   1.00 0.00 ? 722 ARG A HH11 7  
ATOM 11432 H HH12 . ARG A 1 15  ? -13.984 -7.347  5.810   1.00 0.00 ? 722 ARG A HH12 7  
ATOM 11433 H HH21 . ARG A 1 15  ? -16.458 -4.766  5.631   1.00 0.00 ? 722 ARG A HH21 7  
ATOM 11434 H HH22 . ARG A 1 15  ? -16.087 -6.287  6.286   1.00 0.00 ? 722 ARG A HH22 7  
ATOM 11435 N N    . ILE A 1 16  ? -8.869  -2.526  0.775   1.00 0.00 ? 723 ILE A N    7  
ATOM 11436 C CA   . ILE A 1 16  ? -7.474  -2.358  0.426   1.00 0.00 ? 723 ILE A CA   7  
ATOM 11437 C C    . ILE A 1 16  ? -6.984  -0.911  0.721   1.00 0.00 ? 723 ILE A C    7  
ATOM 11438 O O    . ILE A 1 16  ? -5.929  -0.713  1.329   1.00 0.00 ? 723 ILE A O    7  
ATOM 11439 C CB   . ILE A 1 16  ? -7.191  -2.752  -1.062  1.00 0.00 ? 723 ILE A CB   7  
ATOM 11440 C CG1  . ILE A 1 16  ? -7.057  -4.272  -1.253  1.00 0.00 ? 723 ILE A CG1  7  
ATOM 11441 C CG2  . ILE A 1 16  ? -5.964  -2.067  -1.602  1.00 0.00 ? 723 ILE A CG2  7  
ATOM 11442 C CD1  . ILE A 1 16  ? -8.307  -5.095  -1.036  1.00 0.00 ? 723 ILE A CD1  7  
ATOM 11443 H H    . ILE A 1 16  ? -9.532  -2.694  0.069   1.00 0.00 ? 723 ILE A H    7  
ATOM 11444 H HA   . ILE A 1 16  ? -6.939  -3.047  1.066   1.00 0.00 ? 723 ILE A HA   7  
ATOM 11445 H HB   . ILE A 1 16  ? -8.030  -2.411  -1.650  1.00 0.00 ? 723 ILE A HB   7  
ATOM 11446 H HG12 . ILE A 1 16  ? -6.757  -4.411  -2.279  1.00 0.00 ? 723 ILE A HG12 7  
ATOM 11447 H HG13 . ILE A 1 16  ? -6.275  -4.644  -0.607  1.00 0.00 ? 723 ILE A HG13 7  
ATOM 11448 H HG21 . ILE A 1 16  ? -6.106  -0.997  -1.567  1.00 0.00 ? 723 ILE A HG21 7  
ATOM 11449 H HG22 . ILE A 1 16  ? -5.799  -2.380  -2.622  1.00 0.00 ? 723 ILE A HG22 7  
ATOM 11450 H HG23 . ILE A 1 16  ? -5.111  -2.335  -0.996  1.00 0.00 ? 723 ILE A HG23 7  
ATOM 11451 H HD11 . ILE A 1 16  ? -8.650  -4.970  -0.019  1.00 0.00 ? 723 ILE A HD11 7  
ATOM 11452 H HD12 . ILE A 1 16  ? -8.096  -6.138  -1.222  1.00 0.00 ? 723 ILE A HD12 7  
ATOM 11453 H HD13 . ILE A 1 16  ? -9.080  -4.767  -1.715  1.00 0.00 ? 723 ILE A HD13 7  
ATOM 11454 N N    . SER A 1 17  ? -7.754  0.077   0.297   1.00 0.00 ? 724 SER A N    7  
ATOM 11455 C CA   . SER A 1 17  ? -7.401  1.487   0.543   1.00 0.00 ? 724 SER A CA   7  
ATOM 11456 C C    . SER A 1 17  ? -7.310  1.789   2.057   1.00 0.00 ? 724 SER A C    7  
ATOM 11457 O O    . SER A 1 17  ? -6.380  2.475   2.508   1.00 0.00 ? 724 SER A O    7  
ATOM 11458 C CB   . SER A 1 17  ? -8.391  2.432   -0.149  1.00 0.00 ? 724 SER A CB   7  
ATOM 11459 O OG   . SER A 1 17  ? -8.440  2.172   -1.553  1.00 0.00 ? 724 SER A OG   7  
ATOM 11460 H H    . SER A 1 17  ? -8.556  -0.167  -0.217  1.00 0.00 ? 724 SER A H    7  
ATOM 11461 H HA   . SER A 1 17  ? -6.417  1.638   0.123   1.00 0.00 ? 724 SER A HA   7  
ATOM 11462 H HB2  . SER A 1 17  ? -9.376  2.284   0.269   1.00 0.00 ? 724 SER A HB2  7  
ATOM 11463 H HB3  . SER A 1 17  ? -8.081  3.455   0.006   1.00 0.00 ? 724 SER A HB3  7  
ATOM 11464 H HG   . SER A 1 17  ? -8.963  1.366   -1.658  1.00 0.00 ? 724 SER A HG   7  
ATOM 11465 N N    . ASN A 1 18  ? -8.256  1.246   2.830   1.00 0.00 ? 725 ASN A N    7  
ATOM 11466 C CA   . ASN A 1 18  ? -8.245  1.373   4.287   1.00 0.00 ? 725 ASN A CA   7  
ATOM 11467 C C    . ASN A 1 18  ? -6.981  0.788   4.850   1.00 0.00 ? 725 ASN A C    7  
ATOM 11468 O O    . ASN A 1 18  ? -6.357  1.394   5.686   1.00 0.00 ? 725 ASN A O    7  
ATOM 11469 C CB   . ASN A 1 18  ? -9.480  0.725   4.943   1.00 0.00 ? 725 ASN A CB   7  
ATOM 11470 C CG   . ASN A 1 18  ? -10.703 1.635   4.968   1.00 0.00 ? 725 ASN A CG   7  
ATOM 11471 O OD1  . ASN A 1 18  ? -11.494 1.682   4.025   1.00 0.00 ? 725 ASN A OD1  7  
ATOM 11472 N ND2  . ASN A 1 18  ? -10.883 2.340   6.059   1.00 0.00 ? 725 ASN A ND2  7  
ATOM 11473 H H    . ASN A 1 18  ? -8.993  0.749   2.409   1.00 0.00 ? 725 ASN A H    7  
ATOM 11474 H HA   . ASN A 1 18  ? -8.242  2.429   4.510   1.00 0.00 ? 725 ASN A HA   7  
ATOM 11475 H HB2  . ASN A 1 18  ? -9.738  -0.168  4.392   1.00 0.00 ? 725 ASN A HB2  7  
ATOM 11476 H HB3  . ASN A 1 18  ? -9.233  0.452   5.958   1.00 0.00 ? 725 ASN A HB3  7  
ATOM 11477 H HD21 . ASN A 1 18  ? -10.242 2.257   6.797   1.00 0.00 ? 725 ASN A HD21 7  
ATOM 11478 H HD22 . ASN A 1 18  ? -11.660 2.932   6.121   1.00 0.00 ? 725 ASN A HD22 7  
ATOM 11479 N N    . LEU A 1 19  ? -6.588  -0.367  4.332   1.00 0.00 ? 726 LEU A N    7  
ATOM 11480 C CA   . LEU A 1 19  ? -5.344  -1.037  4.703   1.00 0.00 ? 726 LEU A CA   7  
ATOM 11481 C C    . LEU A 1 19  ? -4.149  -0.107  4.540   1.00 0.00 ? 726 LEU A C    7  
ATOM 11482 O O    . LEU A 1 19  ? -3.350  0.016   5.450   1.00 0.00 ? 726 LEU A O    7  
ATOM 11483 C CB   . LEU A 1 19  ? -5.241  -2.388  3.900   1.00 0.00 ? 726 LEU A CB   7  
ATOM 11484 C CG   . LEU A 1 19  ? -3.879  -3.066  3.595   1.00 0.00 ? 726 LEU A CG   7  
ATOM 11485 C CD1  . LEU A 1 19  ? -3.118  -2.394  2.473   1.00 0.00 ? 726 LEU A CD1  7  
ATOM 11486 C CD2  . LEU A 1 19  ? -3.031  -3.141  4.802   1.00 0.00 ? 726 LEU A CD2  7  
ATOM 11487 H H    . LEU A 1 19  ? -7.156  -0.796  3.655   1.00 0.00 ? 726 LEU A H    7  
ATOM 11488 H HA   . LEU A 1 19  ? -5.378  -1.273  5.758   1.00 0.00 ? 726 LEU A HA   7  
ATOM 11489 H HB2  . LEU A 1 19  ? -5.749  -3.112  4.522   1.00 0.00 ? 726 LEU A HB2  7  
ATOM 11490 H HB3  . LEU A 1 19  ? -5.787  -2.266  2.976   1.00 0.00 ? 726 LEU A HB3  7  
ATOM 11491 H HG   . LEU A 1 19  ? -4.090  -4.079  3.287   1.00 0.00 ? 726 LEU A HG   7  
ATOM 11492 H HD11 . LEU A 1 19  ? -2.920  -1.369  2.749   1.00 0.00 ? 726 LEU A HD11 7  
ATOM 11493 H HD12 . LEU A 1 19  ? -3.711  -2.416  1.571   1.00 0.00 ? 726 LEU A HD12 7  
ATOM 11494 H HD13 . LEU A 1 19  ? -2.183  -2.908  2.308   1.00 0.00 ? 726 LEU A HD13 7  
ATOM 11495 H HD21 . LEU A 1 19  ? -2.845  -2.145  5.172   1.00 0.00 ? 726 LEU A HD21 7  
ATOM 11496 H HD22 . LEU A 1 19  ? -2.095  -3.619  4.555   1.00 0.00 ? 726 LEU A HD22 7  
ATOM 11497 H HD23 . LEU A 1 19  ? -3.541  -3.715  5.562   1.00 0.00 ? 726 LEU A HD23 7  
ATOM 11498 N N    . ILE A 1 20  ? -4.069  0.580   3.426   1.00 0.00 ? 727 ILE A N    7  
ATOM 11499 C CA   . ILE A 1 20  ? -2.970  1.495   3.179   1.00 0.00 ? 727 ILE A CA   7  
ATOM 11500 C C    . ILE A 1 20  ? -2.936  2.623   4.192   1.00 0.00 ? 727 ILE A C    7  
ATOM 11501 O O    . ILE A 1 20  ? -1.889  2.893   4.801   1.00 0.00 ? 727 ILE A O    7  
ATOM 11502 C CB   . ILE A 1 20  ? -2.967  2.029   1.710   1.00 0.00 ? 727 ILE A CB   7  
ATOM 11503 C CG1  . ILE A 1 20  ? -2.385  0.973   0.768   1.00 0.00 ? 727 ILE A CG1  7  
ATOM 11504 C CG2  . ILE A 1 20  ? -2.218  3.356   1.566   1.00 0.00 ? 727 ILE A CG2  7  
ATOM 11505 C CD1  . ILE A 1 20  ? -0.944  0.608   1.100   1.00 0.00 ? 727 ILE A CD1  7  
ATOM 11506 H H    . ILE A 1 20  ? -4.778  0.468   2.757   1.00 0.00 ? 727 ILE A H    7  
ATOM 11507 H HA   . ILE A 1 20  ? -2.069  0.924   3.335   1.00 0.00 ? 727 ILE A HA   7  
ATOM 11508 H HB   . ILE A 1 20  ? -3.999  2.189   1.437   1.00 0.00 ? 727 ILE A HB   7  
ATOM 11509 H HG12 . ILE A 1 20  ? -2.978  0.073   0.829   1.00 0.00 ? 727 ILE A HG12 7  
ATOM 11510 H HG13 . ILE A 1 20  ? -2.408  1.351   -0.244  1.00 0.00 ? 727 ILE A HG13 7  
ATOM 11511 H HG21 . ILE A 1 20  ? -1.190  3.219   1.868   1.00 0.00 ? 727 ILE A HG21 7  
ATOM 11512 H HG22 . ILE A 1 20  ? -2.685  4.093   2.203   1.00 0.00 ? 727 ILE A HG22 7  
ATOM 11513 H HG23 . ILE A 1 20  ? -2.257  3.681   0.537   1.00 0.00 ? 727 ILE A HG23 7  
ATOM 11514 H HD11 . ILE A 1 20  ? -0.366  1.521   1.122   1.00 0.00 ? 727 ILE A HD11 7  
ATOM 11515 H HD12 . ILE A 1 20  ? -0.546  -0.055  0.347   1.00 0.00 ? 727 ILE A HD12 7  
ATOM 11516 H HD13 . ILE A 1 20  ? -0.893  0.137   2.070   1.00 0.00 ? 727 ILE A HD13 7  
ATOM 11517 N N    . VAL A 1 21  ? -4.075  3.228   4.420   1.00 0.00 ? 728 VAL A N    7  
ATOM 11518 C CA   . VAL A 1 21  ? -4.152  4.335   5.339   1.00 0.00 ? 728 VAL A CA   7  
ATOM 11519 C C    . VAL A 1 21  ? -3.875  3.854   6.774   1.00 0.00 ? 728 VAL A C    7  
ATOM 11520 O O    . VAL A 1 21  ? -3.054  4.431   7.474   1.00 0.00 ? 728 VAL A O    7  
ATOM 11521 C CB   . VAL A 1 21  ? -5.523  5.066   5.251   1.00 0.00 ? 728 VAL A CB   7  
ATOM 11522 C CG1  . VAL A 1 21  ? -5.577  6.262   6.194   1.00 0.00 ? 728 VAL A CG1  7  
ATOM 11523 C CG2  . VAL A 1 21  ? -5.798  5.513   3.821   1.00 0.00 ? 728 VAL A CG2  7  
ATOM 11524 H H    . VAL A 1 21  ? -4.883  2.913   3.957   1.00 0.00 ? 728 VAL A H    7  
ATOM 11525 H HA   . VAL A 1 21  ? -3.368  5.010   5.031   1.00 0.00 ? 728 VAL A HA   7  
ATOM 11526 H HB   . VAL A 1 21  ? -6.297  4.371   5.542   1.00 0.00 ? 728 VAL A HB   7  
ATOM 11527 H HG11 . VAL A 1 21  ? -6.542  6.739   6.107   1.00 0.00 ? 728 VAL A HG11 7  
ATOM 11528 H HG12 . VAL A 1 21  ? -4.804  6.968   5.927   1.00 0.00 ? 728 VAL A HG12 7  
ATOM 11529 H HG13 . VAL A 1 21  ? -5.430  5.925   7.209   1.00 0.00 ? 728 VAL A HG13 7  
ATOM 11530 H HG21 . VAL A 1 21  ? -6.749  6.021   3.776   1.00 0.00 ? 728 VAL A HG21 7  
ATOM 11531 H HG22 . VAL A 1 21  ? -5.824  4.649   3.175   1.00 0.00 ? 728 VAL A HG22 7  
ATOM 11532 H HG23 . VAL A 1 21  ? -5.014  6.182   3.498   1.00 0.00 ? 728 VAL A HG23 7  
ATOM 11533 N N    . LEU A 1 22  ? -4.516  2.763   7.165   1.00 0.00 ? 729 LEU A N    7  
ATOM 11534 C CA   . LEU A 1 22  ? -4.365  2.172   8.497   1.00 0.00 ? 729 LEU A CA   7  
ATOM 11535 C C    . LEU A 1 22  ? -2.942  1.723   8.753   1.00 0.00 ? 729 LEU A C    7  
ATOM 11536 O O    . LEU A 1 22  ? -2.398  1.957   9.836   1.00 0.00 ? 729 LEU A O    7  
ATOM 11537 C CB   . LEU A 1 22  ? -5.326  1.006   8.675   1.00 0.00 ? 729 LEU A CB   7  
ATOM 11538 C CG   . LEU A 1 22  ? -6.806  1.380   8.710   1.00 0.00 ? 729 LEU A CG   7  
ATOM 11539 C CD1  . LEU A 1 22  ? -7.658  0.142   8.603   1.00 0.00 ? 729 LEU A CD1  7  
ATOM 11540 C CD2  . LEU A 1 22  ? -7.130  2.137   9.990   1.00 0.00 ? 729 LEU A CD2  7  
ATOM 11541 H H    . LEU A 1 22  ? -5.121  2.318   6.529   1.00 0.00 ? 729 LEU A H    7  
ATOM 11542 H HA   . LEU A 1 22  ? -4.618  2.931   9.220   1.00 0.00 ? 729 LEU A HA   7  
ATOM 11543 H HB2  . LEU A 1 22  ? -5.166  0.318   7.857   1.00 0.00 ? 729 LEU A HB2  7  
ATOM 11544 H HB3  . LEU A 1 22  ? -5.082  0.504   9.599   1.00 0.00 ? 729 LEU A HB3  7  
ATOM 11545 H HG   . LEU A 1 22  ? -7.033  2.022   7.870   1.00 0.00 ? 729 LEU A HG   7  
ATOM 11546 H HD11 . LEU A 1 22  ? -7.466  -0.500  9.448   1.00 0.00 ? 729 LEU A HD11 7  
ATOM 11547 H HD12 . LEU A 1 22  ? -7.384  -0.363  7.688   1.00 0.00 ? 729 LEU A HD12 7  
ATOM 11548 H HD13 . LEU A 1 22  ? -8.700  0.423   8.564   1.00 0.00 ? 729 LEU A HD13 7  
ATOM 11549 H HD21 . LEU A 1 22  ? -6.869  1.529   10.844  1.00 0.00 ? 729 LEU A HD21 7  
ATOM 11550 H HD22 . LEU A 1 22  ? -8.187  2.349   10.021  1.00 0.00 ? 729 LEU A HD22 7  
ATOM 11551 H HD23 . LEU A 1 22  ? -6.581  3.064   10.022  1.00 0.00 ? 729 LEU A HD23 7  
ATOM 11552 N N    . HIS A 1 23  ? -2.334  1.101   7.760   1.00 0.00 ? 730 HIS A N    7  
ATOM 11553 C CA   . HIS A 1 23  ? -0.954  0.672   7.871   1.00 0.00 ? 730 HIS A CA   7  
ATOM 11554 C C    . HIS A 1 23  ? -0.041  1.874   8.028   1.00 0.00 ? 730 HIS A C    7  
ATOM 11555 O O    . HIS A 1 23  ? 0.836   1.864   8.871   1.00 0.00 ? 730 HIS A O    7  
ATOM 11556 C CB   . HIS A 1 23  ? -0.526  -0.202  6.680   1.00 0.00 ? 730 HIS A CB   7  
ATOM 11557 C CG   . HIS A 1 23  ? 0.913   -0.652  6.732   1.00 0.00 ? 730 HIS A CG   7  
ATOM 11558 N ND1  . HIS A 1 23  ? 1.396   -1.629  7.579   1.00 0.00 ? 730 HIS A ND1  7  
ATOM 11559 C CD2