data_2KLR
# 
_entry.id   2KLR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KLR         
RCSB  RCSB101278   
WWPDB D_1000101278 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KLR 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-08 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jehle, S.'      1 
'Rajagopal, P.'  2 
'Markovic, S.'   3 
'Bardiaux, B.'   4 
'Kuehne, R.'     5 
'Higman, V.A.'   6 
'Klevit, R.E.'   7 
'van Rossum, B.' 8 
'Oschkinat, H.'  9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers.' 
Nat.Struct.Mol.Biol. 17  1037 1042 2010 ?      US 1545-9993 ?    ? 20802487 10.1038/nsmb.1891 
1       
'AlphaB-crystallin: a hybrid solid-state/solution-state NMR investigation reveals structural aspects of the heterogeneous oligomer.' 
J.Mol.Biol.          385 1481 1497 2009 JMOBAK UK 0022-2836 0070 ? 19041879 ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jehle, S.'        1  
primary 'Rajagopal, P.'    2  
primary 'Bardiaux, B.'     3  
primary 'Markovic, S.'     4  
primary 'Kuhne, R.'        5  
primary 'Stout, J.R.'      6  
primary 'Higman, V.A.'     7  
primary 'Klevit, R.E.'     8  
primary 'van Rossum, B.J.' 9  
primary 'Oschkinat, H.'    10 
1       'Jehle, S.'        11 
1       'van Rossum, B.'   12 
1       'Stout, J.R.'      13 
1       'Noguchi, S.M.'    14 
1       'Falber, K.'       15 
1       'Rehbein, K.'      16 
1       'Oschkinat, H.'    17 
1       'Klevit, R.E.'     18 
1       'Rajagopal, P.'    19 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Alpha-crystallin B chain' 
_entity.formula_weight             20191.930 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Alpha-crystallin domain homodimer in oligomers of alphaB-crystallin' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Alpha(B)-crystallin, Rosenthal fiber component, Heat shock protein beta-5, HspB5, Renal carcinoma antigen NY-REN-27' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLD
VKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIP
ITREEKPAVTAAPKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLD
VKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIP
ITREEKPAVTAAPKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ILE n 
1 4   ALA n 
1 5   ILE n 
1 6   HIS n 
1 7   HIS n 
1 8   PRO n 
1 9   TRP n 
1 10  ILE n 
1 11  ARG n 
1 12  ARG n 
1 13  PRO n 
1 14  PHE n 
1 15  PHE n 
1 16  PRO n 
1 17  PHE n 
1 18  HIS n 
1 19  SER n 
1 20  PRO n 
1 21  SER n 
1 22  ARG n 
1 23  LEU n 
1 24  PHE n 
1 25  ASP n 
1 26  GLN n 
1 27  PHE n 
1 28  PHE n 
1 29  GLY n 
1 30  GLU n 
1 31  HIS n 
1 32  LEU n 
1 33  LEU n 
1 34  GLU n 
1 35  SER n 
1 36  ASP n 
1 37  LEU n 
1 38  PHE n 
1 39  PRO n 
1 40  THR n 
1 41  SER n 
1 42  THR n 
1 43  SER n 
1 44  LEU n 
1 45  SER n 
1 46  PRO n 
1 47  PHE n 
1 48  TYR n 
1 49  LEU n 
1 50  ARG n 
1 51  PRO n 
1 52  PRO n 
1 53  SER n 
1 54  PHE n 
1 55  LEU n 
1 56  ARG n 
1 57  ALA n 
1 58  PRO n 
1 59  SER n 
1 60  TRP n 
1 61  PHE n 
1 62  ASP n 
1 63  THR n 
1 64  GLY n 
1 65  LEU n 
1 66  SER n 
1 67  GLU n 
1 68  MET n 
1 69  ARG n 
1 70  LEU n 
1 71  GLU n 
1 72  LYS n 
1 73  ASP n 
1 74  ARG n 
1 75  PHE n 
1 76  SER n 
1 77  VAL n 
1 78  ASN n 
1 79  LEU n 
1 80  ASP n 
1 81  VAL n 
1 82  LYS n 
1 83  HIS n 
1 84  PHE n 
1 85  SER n 
1 86  PRO n 
1 87  GLU n 
1 88  GLU n 
1 89  LEU n 
1 90  LYS n 
1 91  VAL n 
1 92  LYS n 
1 93  VAL n 
1 94  LEU n 
1 95  GLY n 
1 96  ASP n 
1 97  VAL n 
1 98  ILE n 
1 99  GLU n 
1 100 VAL n 
1 101 HIS n 
1 102 GLY n 
1 103 LYS n 
1 104 HIS n 
1 105 GLU n 
1 106 GLU n 
1 107 ARG n 
1 108 GLN n 
1 109 ASP n 
1 110 GLU n 
1 111 HIS n 
1 112 GLY n 
1 113 PHE n 
1 114 ILE n 
1 115 SER n 
1 116 ARG n 
1 117 GLU n 
1 118 PHE n 
1 119 HIS n 
1 120 ARG n 
1 121 LYS n 
1 122 TYR n 
1 123 ARG n 
1 124 ILE n 
1 125 PRO n 
1 126 ALA n 
1 127 ASP n 
1 128 VAL n 
1 129 ASP n 
1 130 PRO n 
1 131 LEU n 
1 132 THR n 
1 133 ILE n 
1 134 THR n 
1 135 SER n 
1 136 SER n 
1 137 LEU n 
1 138 SER n 
1 139 SER n 
1 140 ASP n 
1 141 GLY n 
1 142 VAL n 
1 143 LEU n 
1 144 THR n 
1 145 VAL n 
1 146 ASN n 
1 147 GLY n 
1 148 PRO n 
1 149 ARG n 
1 150 LYS n 
1 151 GLN n 
1 152 VAL n 
1 153 SER n 
1 154 GLY n 
1 155 PRO n 
1 156 GLU n 
1 157 ARG n 
1 158 THR n 
1 159 ILE n 
1 160 PRO n 
1 161 ILE n 
1 162 THR n 
1 163 ARG n 
1 164 GLU n 
1 165 GLU n 
1 166 LYS n 
1 167 PRO n 
1 168 ALA n 
1 169 VAL n 
1 170 THR n 
1 171 ALA n 
1 172 ALA n 
1 173 PRO n 
1 174 LYS n 
1 175 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CRYAB, CRYA2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET16b 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CRYAB_HUMAN 
_struct_ref.pdbx_db_accession          P02511 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLD
VKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIP
ITREEKPAVTAAPKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KLR A 1 ? 175 ? P02511 1 ? 175 ? 1 175 
2 1 2KLR B 1 ? 175 ? P02511 1 ? 175 ? 1 175 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 13C-13C PDSD'      
1 2  2 '2D 13C-13C PDSD'      
1 3  3 '2D 13C-13C CHHC'      
1 4  3 '2D 13C-13C PDSD'      
1 5  1 '3D 15N-13C-13C NCACX' 
1 6  2 '3D 15N-13C-13C NCACX' 
1 7  1 '3D 15N-13C-13C NCOCX' 
1 8  2 '3D 15N-13C-13C NCOCX' 
1 9  4 '2D 15N-13C TEDOR'     
1 10 5 '2D 15N-13C TEDOR'     
1 11 4 '2D 15N-13C NHHC'      
1 12 5 '2D 15N-13C NHHC'      
1 13 4 '2D 15N-13C PAIN'      
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.6 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         270 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'18 mg [1,3-13C]-glycerol; U-100% 15 alphaB-crystallin, 100% H2O' 1 '100% H2O' 
'17 mg [2-13C]-glycerol; U-100% 15N alphaB-crystallin, 100% H2O' 2 '100% H2O' 
'4 mg [U-100% 13C; U-100% 15N] alphaB-crystallin, 16 mg alphaB-crystallin, 100% H2O' 3 '100% H2O' 
'10 mg [U-100% 15N]; [U-100% 12C] 13C depleted alphaB-crystallin, 10 mg [2-13C]-glycerol ; U-100% 15N alphaB-crystallin, 100% H2O' 
4 '100% H2O' 

'10 mg [U-100% 15N]; [U-100% 12C] 13C depleted alphaB-crystallin, 10 mg [1,3-13C]-glycerol ; U-100% 15N alphaB-crystallin, 100% H2O' 
5 '100% H2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
400 Bruker Avance 1 'Bruker Avance' 
600 Bruker Avance 2 'Bruker Avance' 
700 Bruker Avance 3 'Bruker Avance' 
900 Bruker Avance 4 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2KLR 
_pdbx_nmr_refine.method             'simulated annealing, molecular dynamics, torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KLR 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KLR 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                                                         collection                     TOPSPIN    ?   1  
'Bruker Biospin'                                                         processing                     TOPSPIN    ?   2  
Goddard                                                                  'chemical shift assignment'    SPARKY     ?   3  
Goddard                                                                  'data analysis'                SPARKY     ?   4  
Goddard                                                                  'peak picking'                 SPARKY     ?   5  
'Schwieters, Kuszewski, Tjandra and Clore'                               'structure solution'           X-PLOR_NIH ?   6  
'Cornilescu, Delaglio and Bax'                                           'dihedral angle determination' TALOS      ?   7  
'Rieping W, Habeck M, Bardiaux B, Bernard A, Malliavin TE, Nilges M.'    'structure solution'           ARIA       2.2 8  
'Rieping W, Habeck M, Bardiaux B, Bernard A, Malliavin TE, Nilges M.'    refinement                     ARIA       2.2 9  
'Brunger, Adams, Clore, Gros, Nilges and Read'                           'structure solution'           CNS        1.2 10 
'Brunger, Adams, Clore, Gros, Nilges and Read'                           refinement                     CNS        1.2 11 
'(SOLARIA) Fossi M, Castellani F, Nilges M, Oschkinat H, van Rossum BJ.' 'structure solution'           SOLARIA    1   12 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KLR 
_exptl.method                     'SOLID-STATE NMR' 
_exptl.method_details             ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given    ? 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000 0.00000   0.00000  0.00000  
2 generate ? -0.352219 0.835492  -0.421776 -0.808833 -0.498466 -0.311962 -0.470883 0.231268  0.851343 -19.63822 37.06250 -5.49449 
3 generate ? -0.355727 -0.809154 -0.467684 0.832480  -0.501776 0.234942  -0.424777 -0.305763 0.852100 20.45375  36.11392 7.93886  
# 
_struct.entry_id                  2KLR 
_struct.title                     'Solid-state NMR structure of the alpha-crystallin domain in alphaB-crystallin oligomers' 
_struct.pdbx_descriptor           'Alpha-crystallin B chain' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KLR 
_struct_keywords.pdbx_keywords   CHAPERONE 
_struct_keywords.text            
;Protein, dimer, oligomer, heterogeneity, intermolecular interactions, chaperone, sHSP, human, small heat-shock protein, Cataract, Desmin-related myopathy, Disease mutation, Eye lens protein, Glycoprotein, Methylation, Oxidation, Phosphoprotein
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'The authors state that the NCS Matrix for the hexamer should be applied to model 7 in the ensemble.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 85 ? GLU A 87 ? SER A 85 GLU A 87 5 ? 3 
HELX_P HELX_P2 2 SER B 85 ? GLU B 87 ? SER B 85 GLU B 87 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 6 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 74  ? LEU A 79  ? ARG A 74  LEU A 79  
A 2 LEU A 143 ? PRO A 148 ? LEU A 143 PRO A 148 
A 3 THR A 134 ? LEU A 137 ? THR A 134 LEU A 137 
B 1 LEU A 89  ? LEU A 94  ? LEU A 89  LEU A 94  
B 2 VAL A 97  ? ASP A 109 ? VAL A 97  ASP A 109 
B 3 GLY A 112 ? ARG A 123 ? GLY A 112 ARG A 123 
B 4 GLY B 112 ? ARG B 123 ? GLY B 112 ARG B 123 
B 5 VAL B 97  ? ASP B 109 ? VAL B 97  ASP B 109 
B 6 LEU B 89  ? LEU B 94  ? LEU B 89  LEU B 94  
C 1 ARG B 74  ? LEU B 79  ? ARG B 74  LEU B 79  
C 2 LEU B 143 ? PRO B 148 ? LEU B 143 PRO B 148 
C 3 THR B 134 ? LEU B 137 ? THR B 134 LEU B 137 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 79  ? N LEU A 79  O LEU A 143 ? O LEU A 143 
A 2 3 O ASN A 146 ? O ASN A 146 N THR A 134 ? N THR A 134 
B 1 2 N LYS A 90  ? N LYS A 90  O HIS A 101 ? O HIS A 101 
B 2 3 N GLY A 102 ? N GLY A 102 O PHE A 118 ? O PHE A 118 
B 3 4 N PHE A 113 ? N PHE A 113 O LYS B 121 ? O LYS B 121 
B 4 5 O PHE B 118 ? O PHE B 118 N GLY B 102 ? N GLY B 102 
B 5 6 O HIS B 101 ? O HIS B 101 N LYS B 90  ? N LYS B 90  
C 1 2 N LEU B 79  ? N LEU B 79  O LEU B 143 ? O LEU B 143 
C 2 3 O ASN B 146 ? O ASN B 146 N THR B 134 ? N THR B 134 
# 
_atom_sites.entry_id                    2KLR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ARG A 1 69  ? -38.193 8.918   -1.118  1.00 0.00 ? 69  ARG A N    1  
ATOM 2     C CA   . ARG A 1 69  ? -37.949 7.572   -0.674  1.00 0.00 ? 69  ARG A CA   1  
ATOM 3     C C    . ARG A 1 69  ? -36.459 7.296   -0.518  1.00 0.00 ? 69  ARG A C    1  
ATOM 4     O O    . ARG A 1 69  ? -36.068 6.626   0.439   1.00 0.00 ? 69  ARG A O    1  
ATOM 5     C CB   . ARG A 1 69  ? -38.580 6.637   -1.720  1.00 0.00 ? 69  ARG A CB   1  
ATOM 6     C CG   . ARG A 1 69  ? -38.399 5.147   -1.496  1.00 0.00 ? 69  ARG A CG   1  
ATOM 7     C CD   . ARG A 1 69  ? -39.105 4.349   -2.596  1.00 0.00 ? 69  ARG A CD   1  
ATOM 8     N NE   . ARG A 1 69  ? -38.575 4.640   -3.952  1.00 0.00 ? 69  ARG A NE   1  
ATOM 9     C CZ   . ARG A 1 69  ? -39.210 4.364   -5.111  1.00 0.00 ? 69  ARG A CZ   1  
ATOM 10    N NH1  . ARG A 1 69  ? -40.400 3.780   -5.106  1.00 0.00 ? 69  ARG A NH1  1  
ATOM 11    N NH2  . ARG A 1 69  ? -38.630 4.666   -6.260  1.00 0.00 ? 69  ARG A NH2  1  
ATOM 12    H H    . ARG A 1 69  ? -38.251 9.101   -2.082  1.00 0.00 ? 69  ARG A H    1  
ATOM 13    H HA   . ARG A 1 69  ? -38.455 7.409   0.265   1.00 0.00 ? 69  ARG A HA   1  
ATOM 14    H HB2  . ARG A 1 69  ? -39.642 6.829   -1.746  1.00 0.00 ? 69  ARG A HB2  1  
ATOM 15    H HB3  . ARG A 1 69  ? -38.179 6.880   -2.691  1.00 0.00 ? 69  ARG A HB3  1  
ATOM 16    H HG2  . ARG A 1 69  ? -37.345 4.913   -1.511  1.00 0.00 ? 69  ARG A HG2  1  
ATOM 17    H HG3  . ARG A 1 69  ? -38.821 4.878   -0.539  1.00 0.00 ? 69  ARG A HG3  1  
ATOM 18    H HD2  . ARG A 1 69  ? -38.980 3.295   -2.396  1.00 0.00 ? 69  ARG A HD2  1  
ATOM 19    H HD3  . ARG A 1 69  ? -40.156 4.592   -2.574  1.00 0.00 ? 69  ARG A HD3  1  
ATOM 20    H HE   . ARG A 1 69  ? -37.692 5.071   -4.009  1.00 0.00 ? 69  ARG A HE   1  
ATOM 21    H HH11 . ARG A 1 69  ? -40.875 3.526   -4.261  1.00 0.00 ? 69  ARG A HH11 1  
ATOM 22    H HH12 . ARG A 1 69  ? -40.883 3.555   -5.956  1.00 0.00 ? 69  ARG A HH12 1  
ATOM 23    H HH21 . ARG A 1 69  ? -37.711 5.086   -6.259  1.00 0.00 ? 69  ARG A HH21 1  
ATOM 24    H HH22 . ARG A 1 69  ? -39.060 4.523   -7.158  1.00 0.00 ? 69  ARG A HH22 1  
ATOM 25    N N    . LEU A 1 70  ? -35.641 7.845   -1.413  1.00 0.00 ? 70  LEU A N    1  
ATOM 26    C CA   . LEU A 1 70  ? -34.201 7.541   -1.461  1.00 0.00 ? 70  LEU A CA   1  
ATOM 27    C C    . LEU A 1 70  ? -34.033 6.032   -1.621  1.00 0.00 ? 70  LEU A C    1  
ATOM 28    O O    . LEU A 1 70  ? -33.397 5.355   -0.809  1.00 0.00 ? 70  LEU A O    1  
ATOM 29    C CB   . LEU A 1 70  ? -33.423 8.107   -0.237  1.00 0.00 ? 70  LEU A CB   1  
ATOM 30    C CG   . LEU A 1 70  ? -31.897 7.898   -0.220  1.00 0.00 ? 70  LEU A CG   1  
ATOM 31    C CD1  . LEU A 1 70  ? -31.247 8.503   -1.455  1.00 0.00 ? 70  LEU A CD1  1  
ATOM 32    C CD2  . LEU A 1 70  ? -31.296 8.500   1.037   1.00 0.00 ? 70  LEU A CD2  1  
ATOM 33    H H    . LEU A 1 70  ? -36.002 8.489   -2.058  1.00 0.00 ? 70  LEU A H    1  
ATOM 34    H HA   . LEU A 1 70  ? -33.838 7.993   -2.374  1.00 0.00 ? 70  LEU A HA   1  
ATOM 35    H HB2  . LEU A 1 70  ? -33.601 9.171   -0.191  1.00 0.00 ? 70  LEU A HB2  1  
ATOM 36    H HB3  . LEU A 1 70  ? -33.834 7.660   0.656   1.00 0.00 ? 70  LEU A HB3  1  
ATOM 37    H HG   . LEU A 1 70  ? -31.687 6.838   -0.222  1.00 0.00 ? 70  LEU A HG   1  
ATOM 38    H HD11 . LEU A 1 70  ? -31.634 8.022   -2.341  1.00 0.00 ? 70  LEU A HD11 1  
ATOM 39    H HD12 . LEU A 1 70  ? -30.178 8.365   -1.406  1.00 0.00 ? 70  LEU A HD12 1  
ATOM 40    H HD13 . LEU A 1 70  ? -31.473 9.557   -1.493  1.00 0.00 ? 70  LEU A HD13 1  
ATOM 41    H HD21 . LEU A 1 70  ? -31.499 9.560   1.060   1.00 0.00 ? 70  LEU A HD21 1  
ATOM 42    H HD22 . LEU A 1 70  ? -30.228 8.338   1.040   1.00 0.00 ? 70  LEU A HD22 1  
ATOM 43    H HD23 . LEU A 1 70  ? -31.733 8.029   1.906   1.00 0.00 ? 70  LEU A HD23 1  
ATOM 44    N N    . GLU A 1 71  ? -34.762 5.555   -2.635  1.00 0.00 ? 71  GLU A N    1  
ATOM 45    C CA   . GLU A 1 71  ? -34.815 4.178   -3.121  1.00 0.00 ? 71  GLU A CA   1  
ATOM 46    C C    . GLU A 1 71  ? -34.866 3.078   -2.065  1.00 0.00 ? 71  GLU A C    1  
ATOM 47    O O    . GLU A 1 71  ? -33.886 2.759   -1.399  1.00 0.00 ? 71  GLU A O    1  
ATOM 48    C CB   . GLU A 1 71  ? -33.778 3.923   -4.193  1.00 0.00 ? 71  GLU A CB   1  
ATOM 49    C CG   . GLU A 1 71  ? -33.962 4.833   -5.395  1.00 0.00 ? 71  GLU A CG   1  
ATOM 50    C CD   . GLU A 1 71  ? -35.368 4.766   -5.936  1.00 0.00 ? 71  GLU A CD   1  
ATOM 51    O OE1  . GLU A 1 71  ? -35.700 3.807   -6.652  1.00 0.00 ? 71  GLU A OE1  1  
ATOM 52    O OE2  . GLU A 1 71  ? -36.190 5.667   -5.628  1.00 0.00 ? 71  GLU A OE2  1  
ATOM 53    H H    . GLU A 1 71  ? -35.305 6.222   -3.102  1.00 0.00 ? 71  GLU A H    1  
ATOM 54    H HA   . GLU A 1 71  ? -35.777 4.125   -3.610  1.00 0.00 ? 71  GLU A HA   1  
ATOM 55    H HB2  . GLU A 1 71  ? -32.796 4.093   -3.775  1.00 0.00 ? 71  GLU A HB2  1  
ATOM 56    H HB3  . GLU A 1 71  ? -33.854 2.898   -4.523  1.00 0.00 ? 71  GLU A HB3  1  
ATOM 57    H HG2  . GLU A 1 71  ? -33.758 5.851   -5.095  1.00 0.00 ? 71  GLU A HG2  1  
ATOM 58    H HG3  . GLU A 1 71  ? -33.274 4.543   -6.173  1.00 0.00 ? 71  GLU A HG3  1  
ATOM 59    N N    . LYS A 1 72  ? -36.008 2.446   -1.985  1.00 0.00 ? 72  LYS A N    1  
ATOM 60    C CA   . LYS A 1 72  ? -36.201 1.399   -1.033  1.00 0.00 ? 72  LYS A CA   1  
ATOM 61    C C    . LYS A 1 72  ? -35.718 0.131   -1.696  1.00 0.00 ? 72  LYS A C    1  
ATOM 62    O O    . LYS A 1 72  ? -36.360 -0.391  -2.611  1.00 0.00 ? 72  LYS A O    1  
ATOM 63    C CB   . LYS A 1 72  ? -37.705 1.328   -0.646  1.00 0.00 ? 72  LYS A CB   1  
ATOM 64    C CG   . LYS A 1 72  ? -38.092 0.399   0.526   1.00 0.00 ? 72  LYS A CG   1  
ATOM 65    C CD   . LYS A 1 72  ? -37.977 -1.085  0.188   1.00 0.00 ? 72  LYS A CD   1  
ATOM 66    C CE   . LYS A 1 72  ? -38.403 -1.964  1.350   1.00 0.00 ? 72  LYS A CE   1  
ATOM 67    N NZ   . LYS A 1 72  ? -37.550 -1.773  2.551   1.00 0.00 ? 72  LYS A NZ   1  
ATOM 68    H H    . LYS A 1 72  ? -36.720 2.642   -2.626  1.00 0.00 ? 72  LYS A H    1  
ATOM 69    H HA   . LYS A 1 72  ? -35.603 1.609   -0.159  1.00 0.00 ? 72  LYS A HA   1  
ATOM 70    H HB2  . LYS A 1 72  ? -38.036 2.323   -0.390  1.00 0.00 ? 72  LYS A HB2  1  
ATOM 71    H HB3  . LYS A 1 72  ? -38.248 1.007   -1.524  1.00 0.00 ? 72  LYS A HB3  1  
ATOM 72    H HG2  . LYS A 1 72  ? -37.437 0.608   1.358   1.00 0.00 ? 72  LYS A HG2  1  
ATOM 73    H HG3  . LYS A 1 72  ? -39.109 0.617   0.817   1.00 0.00 ? 72  LYS A HG3  1  
ATOM 74    H HD2  . LYS A 1 72  ? -38.611 -1.298  -0.660  1.00 0.00 ? 72  LYS A HD2  1  
ATOM 75    H HD3  . LYS A 1 72  ? -36.952 -1.306  -0.068  1.00 0.00 ? 72  LYS A HD3  1  
ATOM 76    H HE2  . LYS A 1 72  ? -39.428 -1.735  1.599   1.00 0.00 ? 72  LYS A HE2  1  
ATOM 77    H HE3  . LYS A 1 72  ? -38.340 -2.993  1.027   1.00 0.00 ? 72  LYS A HE3  1  
ATOM 78    H HZ1  . LYS A 1 72  ? -37.580 -0.795  2.904   1.00 0.00 ? 72  LYS A HZ1  1  
ATOM 79    H HZ2  . LYS A 1 72  ? -36.561 -2.015  2.337   1.00 0.00 ? 72  LYS A HZ2  1  
ATOM 80    H HZ3  . LYS A 1 72  ? -37.870 -2.387  3.325   1.00 0.00 ? 72  LYS A HZ3  1  
ATOM 81    N N    . ASP A 1 73  ? -34.586 -0.313  -1.252  1.00 0.00 ? 73  ASP A N    1  
ATOM 82    C CA   . ASP A 1 73  ? -33.900 -1.487  -1.744  1.00 0.00 ? 73  ASP A CA   1  
ATOM 83    C C    . ASP A 1 73  ? -32.691 -1.619  -0.893  1.00 0.00 ? 73  ASP A C    1  
ATOM 84    O O    . ASP A 1 73  ? -32.075 -0.612  -0.579  1.00 0.00 ? 73  ASP A O    1  
ATOM 85    C CB   . ASP A 1 73  ? -33.460 -1.306  -3.220  1.00 0.00 ? 73  ASP A CB   1  
ATOM 86    C CG   . ASP A 1 73  ? -32.794 -2.538  -3.813  1.00 0.00 ? 73  ASP A CG   1  
ATOM 87    O OD1  . ASP A 1 73  ? -33.516 -3.509  -4.153  1.00 0.00 ? 73  ASP A OD1  1  
ATOM 88    O OD2  . ASP A 1 73  ? -31.556 -2.559  -3.986  1.00 0.00 ? 73  ASP A OD2  1  
ATOM 89    H H    . ASP A 1 73  ? -34.132 0.173   -0.529  1.00 0.00 ? 73  ASP A H    1  
ATOM 90    H HA   . ASP A 1 73  ? -34.537 -2.351  -1.642  1.00 0.00 ? 73  ASP A HA   1  
ATOM 91    H HB2  . ASP A 1 73  ? -34.328 -1.073  -3.820  1.00 0.00 ? 73  ASP A HB2  1  
ATOM 92    H HB3  . ASP A 1 73  ? -32.767 -0.480  -3.270  1.00 0.00 ? 73  ASP A HB3  1  
ATOM 93    N N    . ARG A 1 74  ? -32.349 -2.798  -0.482  1.00 0.00 ? 74  ARG A N    1  
ATOM 94    C CA   . ARG A 1 74  ? -31.163 -2.923  0.303   1.00 0.00 ? 74  ARG A CA   1  
ATOM 95    C C    . ARG A 1 74  ? -30.048 -3.262  -0.645  1.00 0.00 ? 74  ARG A C    1  
ATOM 96    O O    . ARG A 1 74  ? -30.073 -4.292  -1.333  1.00 0.00 ? 74  ARG A O    1  
ATOM 97    C CB   . ARG A 1 74  ? -31.319 -3.986  1.427   1.00 0.00 ? 74  ARG A CB   1  
ATOM 98    C CG   . ARG A 1 74  ? -31.621 -5.402  0.943   1.00 0.00 ? 74  ARG A CG   1  
ATOM 99    C CD   . ARG A 1 74  ? -31.787 -6.389  2.085   1.00 0.00 ? 74  ARG A CD   1  
ATOM 100   N NE   . ARG A 1 74  ? -30.587 -6.516  2.927   1.00 0.00 ? 74  ARG A NE   1  
ATOM 101   C CZ   . ARG A 1 74  ? -30.284 -7.599  3.665   1.00 0.00 ? 74  ARG A CZ   1  
ATOM 102   N NH1  . ARG A 1 74  ? -31.033 -8.702  3.582   1.00 0.00 ? 74  ARG A NH1  1  
ATOM 103   N NH2  . ARG A 1 74  ? -29.218 -7.586  4.458   1.00 0.00 ? 74  ARG A NH2  1  
ATOM 104   H H    . ARG A 1 74  ? -32.892 -3.581  -0.716  1.00 0.00 ? 74  ARG A H    1  
ATOM 105   H HA   . ARG A 1 74  ? -30.960 -1.954  0.737   1.00 0.00 ? 74  ARG A HA   1  
ATOM 106   H HB2  . ARG A 1 74  ? -30.403 -4.020  1.997   1.00 0.00 ? 74  ARG A HB2  1  
ATOM 107   H HB3  . ARG A 1 74  ? -32.119 -3.674  2.082   1.00 0.00 ? 74  ARG A HB3  1  
ATOM 108   H HG2  . ARG A 1 74  ? -32.528 -5.388  0.358   1.00 0.00 ? 74  ARG A HG2  1  
ATOM 109   H HG3  . ARG A 1 74  ? -30.799 -5.723  0.319   1.00 0.00 ? 74  ARG A HG3  1  
ATOM 110   H HD2  . ARG A 1 74  ? -32.616 -6.086  2.704   1.00 0.00 ? 74  ARG A HD2  1  
ATOM 111   H HD3  . ARG A 1 74  ? -32.008 -7.353  1.655   1.00 0.00 ? 74  ARG A HD3  1  
ATOM 112   H HE   . ARG A 1 74  ? -29.995 -5.727  2.945   1.00 0.00 ? 74  ARG A HE   1  
ATOM 113   H HH11 . ARG A 1 74  ? -31.830 -8.760  2.975   1.00 0.00 ? 74  ARG A HH11 1  
ATOM 114   H HH12 . ARG A 1 74  ? -30.829 -9.521  4.122   1.00 0.00 ? 74  ARG A HH12 1  
ATOM 115   H HH21 . ARG A 1 74  ? -28.628 -6.777  4.525   1.00 0.00 ? 74  ARG A HH21 1  
ATOM 116   H HH22 . ARG A 1 74  ? -28.938 -8.371  5.019   1.00 0.00 ? 74  ARG A HH22 1  
ATOM 117   N N    . PHE A 1 75  ? -29.100 -2.402  -0.717  1.00 0.00 ? 75  PHE A N    1  
ATOM 118   C CA   . PHE A 1 75  ? -28.048 -2.559  -1.642  1.00 0.00 ? 75  PHE A CA   1  
ATOM 119   C C    . PHE A 1 75  ? -26.790 -2.873  -0.890  1.00 0.00 ? 75  PHE A C    1  
ATOM 120   O O    . PHE A 1 75  ? -26.607 -2.414  0.241   1.00 0.00 ? 75  PHE A O    1  
ATOM 121   C CB   . PHE A 1 75  ? -27.912 -1.285  -2.471  1.00 0.00 ? 75  PHE A CB   1  
ATOM 122   C CG   . PHE A 1 75  ? -27.018 -1.418  -3.658  1.00 0.00 ? 75  PHE A CG   1  
ATOM 123   C CD1  . PHE A 1 75  ? -27.469 -2.061  -4.791  1.00 0.00 ? 75  PHE A CD1  1  
ATOM 124   C CD2  . PHE A 1 75  ? -25.741 -0.904  -3.648  1.00 0.00 ? 75  PHE A CD2  1  
ATOM 125   C CE1  . PHE A 1 75  ? -26.658 -2.194  -5.896  1.00 0.00 ? 75  PHE A CE1  1  
ATOM 126   C CE2  . PHE A 1 75  ? -24.927 -1.035  -4.750  1.00 0.00 ? 75  PHE A CE2  1  
ATOM 127   C CZ   . PHE A 1 75  ? -25.384 -1.681  -5.875  1.00 0.00 ? 75  PHE A CZ   1  
ATOM 128   H H    . PHE A 1 75  ? -29.088 -1.609  -0.133  1.00 0.00 ? 75  PHE A H    1  
ATOM 129   H HA   . PHE A 1 75  ? -28.298 -3.378  -2.298  1.00 0.00 ? 75  PHE A HA   1  
ATOM 130   H HB2  . PHE A 1 75  ? -28.896 -1.023  -2.828  1.00 0.00 ? 75  PHE A HB2  1  
ATOM 131   H HB3  . PHE A 1 75  ? -27.538 -0.490  -1.843  1.00 0.00 ? 75  PHE A HB3  1  
ATOM 132   H HD1  . PHE A 1 75  ? -28.470 -2.466  -4.805  1.00 0.00 ? 75  PHE A HD1  1  
ATOM 133   H HD2  . PHE A 1 75  ? -25.377 -0.397  -2.767  1.00 0.00 ? 75  PHE A HD2  1  
ATOM 134   H HE1  . PHE A 1 75  ? -27.021 -2.698  -6.779  1.00 0.00 ? 75  PHE A HE1  1  
ATOM 135   H HE2  . PHE A 1 75  ? -23.926 -0.632  -4.730  1.00 0.00 ? 75  PHE A HE2  1  
ATOM 136   H HZ   . PHE A 1 75  ? -24.743 -1.783  -6.738  1.00 0.00 ? 75  PHE A HZ   1  
ATOM 137   N N    . SER A 1 76  ? -25.980 -3.725  -1.439  1.00 0.00 ? 76  SER A N    1  
ATOM 138   C CA   . SER A 1 76  ? -24.748 -4.068  -0.815  1.00 0.00 ? 76  SER A CA   1  
ATOM 139   C C    . SER A 1 76  ? -23.610 -4.140  -1.822  1.00 0.00 ? 76  SER A C    1  
ATOM 140   O O    . SER A 1 76  ? -23.746 -4.723  -2.913  1.00 0.00 ? 76  SER A O    1  
ATOM 141   C CB   . SER A 1 76  ? -24.895 -5.381  -0.049  1.00 0.00 ? 76  SER A CB   1  
ATOM 142   O OG   . SER A 1 76  ? -25.960 -5.274  0.897   1.00 0.00 ? 76  SER A OG   1  
ATOM 143   H H    . SER A 1 76  ? -26.218 -4.145  -2.295  1.00 0.00 ? 76  SER A H    1  
ATOM 144   H HA   . SER A 1 76  ? -24.520 -3.291  -0.103  1.00 0.00 ? 76  SER A HA   1  
ATOM 145   H HB2  . SER A 1 76  ? -25.116 -6.179  -0.740  1.00 0.00 ? 76  SER A HB2  1  
ATOM 146   H HB3  . SER A 1 76  ? -23.980 -5.599  0.482   1.00 0.00 ? 76  SER A HB3  1  
ATOM 147   H HG   . SER A 1 76  ? -26.277 -4.367  0.771   1.00 0.00 ? 76  SER A HG   1  
ATOM 148   N N    . VAL A 1 77  ? -22.532 -3.500  -1.480  1.00 0.00 ? 77  VAL A N    1  
ATOM 149   C CA   . VAL A 1 77  ? -21.302 -3.572  -2.219  1.00 0.00 ? 77  VAL A CA   1  
ATOM 150   C C    . VAL A 1 77  ? -20.305 -4.146  -1.256  1.00 0.00 ? 77  VAL A C    1  
ATOM 151   O O    . VAL A 1 77  ? -20.354 -3.839  -0.062  1.00 0.00 ? 77  VAL A O    1  
ATOM 152   C CB   . VAL A 1 77  ? -20.797 -2.172  -2.720  1.00 0.00 ? 77  VAL A CB   1  
ATOM 153   C CG1  . VAL A 1 77  ? -19.543 -2.303  -3.552  1.00 0.00 ? 77  VAL A CG1  1  
ATOM 154   C CG2  . VAL A 1 77  ? -21.866 -1.444  -3.495  1.00 0.00 ? 77  VAL A CG2  1  
ATOM 155   H H    . VAL A 1 77  ? -22.546 -2.962  -0.654  1.00 0.00 ? 77  VAL A H    1  
ATOM 156   H HA   . VAL A 1 77  ? -21.425 -4.254  -3.045  1.00 0.00 ? 77  VAL A HA   1  
ATOM 157   H HB   . VAL A 1 77  ? -20.528 -1.576  -1.864  1.00 0.00 ? 77  VAL A HB   1  
ATOM 158   H HG11 . VAL A 1 77  ? -19.221 -1.326  -3.880  1.00 0.00 ? 77  VAL A HG11 1  
ATOM 159   H HG12 . VAL A 1 77  ? -19.746 -2.921  -4.413  1.00 0.00 ? 77  VAL A HG12 1  
ATOM 160   H HG13 . VAL A 1 77  ? -18.763 -2.757  -2.959  1.00 0.00 ? 77  VAL A HG13 1  
ATOM 161   H HG21 . VAL A 1 77  ? -22.734 -1.306  -2.868  1.00 0.00 ? 77  VAL A HG21 1  
ATOM 162   H HG22 . VAL A 1 77  ? -22.140 -2.028  -4.362  1.00 0.00 ? 77  VAL A HG22 1  
ATOM 163   H HG23 . VAL A 1 77  ? -21.493 -0.481  -3.811  1.00 0.00 ? 77  VAL A HG23 1  
ATOM 164   N N    . ASN A 1 78  ? -19.448 -4.975  -1.712  1.00 0.00 ? 78  ASN A N    1  
ATOM 165   C CA   . ASN A 1 78  ? -18.504 -5.564  -0.829  1.00 0.00 ? 78  ASN A CA   1  
ATOM 166   C C    . ASN A 1 78  ? -17.139 -5.045  -1.159  1.00 0.00 ? 78  ASN A C    1  
ATOM 167   O O    . ASN A 1 78  ? -16.832 -4.792  -2.312  1.00 0.00 ? 78  ASN A O    1  
ATOM 168   C CB   . ASN A 1 78  ? -18.556 -7.098  -0.910  1.00 0.00 ? 78  ASN A CB   1  
ATOM 169   C CG   . ASN A 1 78  ? -17.654 -7.779  0.114   1.00 0.00 ? 78  ASN A CG   1  
ATOM 170   O OD1  . ASN A 1 78  ? -18.060 -8.002  1.251   1.00 0.00 ? 78  ASN A OD1  1  
ATOM 171   N ND2  . ASN A 1 78  ? -16.465 -8.147  -0.282  1.00 0.00 ? 78  ASN A ND2  1  
ATOM 172   H H    . ASN A 1 78  ? -19.404 -5.192  -2.667  1.00 0.00 ? 78  ASN A H    1  
ATOM 173   H HA   . ASN A 1 78  ? -18.755 -5.258  0.175   1.00 0.00 ? 78  ASN A HA   1  
ATOM 174   H HB2  . ASN A 1 78  ? -19.571 -7.425  -0.739  1.00 0.00 ? 78  ASN A HB2  1  
ATOM 175   H HB3  . ASN A 1 78  ? -18.247 -7.407  -1.898  1.00 0.00 ? 78  ASN A HB3  1  
ATOM 176   H HD21 . ASN A 1 78  ? -16.192 -7.978  -1.212  1.00 0.00 ? 78  ASN A HD21 1  
ATOM 177   H HD22 . ASN A 1 78  ? -15.880 -8.592  0.366   1.00 0.00 ? 78  ASN A HD22 1  
ATOM 178   N N    . LEU A 1 79  ? -16.357 -4.857  -0.163  1.00 0.00 ? 79  LEU A N    1  
ATOM 179   C CA   . LEU A 1 79  ? -15.019 -4.410  -0.296  1.00 0.00 ? 79  LEU A CA   1  
ATOM 180   C C    . LEU A 1 79  ? -14.182 -5.509  0.310   1.00 0.00 ? 79  LEU A C    1  
ATOM 181   O O    . LEU A 1 79  ? -14.444 -5.939  1.435   1.00 0.00 ? 79  LEU A O    1  
ATOM 182   C CB   . LEU A 1 79  ? -14.789 -3.101  0.508   1.00 0.00 ? 79  LEU A CB   1  
ATOM 183   C CG   . LEU A 1 79  ? -15.420 -1.763  0.027   1.00 0.00 ? 79  LEU A CG   1  
ATOM 184   C CD1  . LEU A 1 79  ? -14.879 -1.341  -1.308  1.00 0.00 ? 79  LEU A CD1  1  
ATOM 185   C CD2  . LEU A 1 79  ? -16.939 -1.799  0.004   1.00 0.00 ? 79  LEU A CD2  1  
ATOM 186   H H    . LEU A 1 79  ? -16.669 -5.040  0.754   1.00 0.00 ? 79  LEU A H    1  
ATOM 187   H HA   . LEU A 1 79  ? -14.783 -4.263  -1.340  1.00 0.00 ? 79  LEU A HA   1  
ATOM 188   H HB2  . LEU A 1 79  ? -15.204 -3.283  1.486   1.00 0.00 ? 79  LEU A HB2  1  
ATOM 189   H HB3  . LEU A 1 79  ? -13.724 -2.959  0.613   1.00 0.00 ? 79  LEU A HB3  1  
ATOM 190   H HG   . LEU A 1 79  ? -15.117 -0.995  0.724   1.00 0.00 ? 79  LEU A HG   1  
ATOM 191   H HD11 . LEU A 1 79  ? -15.349 -0.415  -1.605  1.00 0.00 ? 79  LEU A HD11 1  
ATOM 192   H HD12 . LEU A 1 79  ? -15.092 -2.106  -2.040  1.00 0.00 ? 79  LEU A HD12 1  
ATOM 193   H HD13 . LEU A 1 79  ? -13.812 -1.194  -1.235  1.00 0.00 ? 79  LEU A HD13 1  
ATOM 194   H HD21 . LEU A 1 79  ? -17.313 -2.029  0.991   1.00 0.00 ? 79  LEU A HD21 1  
ATOM 195   H HD22 . LEU A 1 79  ? -17.266 -2.563  -0.687  1.00 0.00 ? 79  LEU A HD22 1  
ATOM 196   H HD23 . LEU A 1 79  ? -17.322 -0.840  -0.312  1.00 0.00 ? 79  LEU A HD23 1  
ATOM 197   N N    . ASP A 1 80  ? -13.211 -5.992  -0.400  1.00 0.00 ? 80  ASP A N    1  
ATOM 198   C CA   . ASP A 1 80  ? -12.461 -7.102  0.122   1.00 0.00 ? 80  ASP A CA   1  
ATOM 199   C C    . ASP A 1 80  ? -11.026 -6.768  0.348   1.00 0.00 ? 80  ASP A C    1  
ATOM 200   O O    . ASP A 1 80  ? -10.357 -6.189  -0.514  1.00 0.00 ? 80  ASP A O    1  
ATOM 201   C CB   . ASP A 1 80  ? -12.611 -8.413  -0.705  1.00 0.00 ? 80  ASP A CB   1  
ATOM 202   C CG   . ASP A 1 80  ? -11.679 -8.566  -1.918  1.00 0.00 ? 80  ASP A CG   1  
ATOM 203   O OD1  . ASP A 1 80  ? -12.053 -8.169  -3.017  1.00 0.00 ? 80  ASP A OD1  1  
ATOM 204   O OD2  . ASP A 1 80  ? -10.612 -9.171  -1.761  1.00 0.00 ? 80  ASP A OD2  1  
ATOM 205   H H    . ASP A 1 80  ? -12.967 -5.595  -1.258  1.00 0.00 ? 80  ASP A H    1  
ATOM 206   H HA   . ASP A 1 80  ? -12.883 -7.288  1.099   1.00 0.00 ? 80  ASP A HA   1  
ATOM 207   H HB2  . ASP A 1 80  ? -12.423 -9.253  -0.053  1.00 0.00 ? 80  ASP A HB2  1  
ATOM 208   H HB3  . ASP A 1 80  ? -13.633 -8.474  -1.049  1.00 0.00 ? 80  ASP A HB3  1  
ATOM 209   N N    . VAL A 1 81  ? -10.603 -7.036  1.530   1.00 0.00 ? 81  VAL A N    1  
ATOM 210   C CA   . VAL A 1 81  ? -9.235  -7.035  1.891   1.00 0.00 ? 81  VAL A CA   1  
ATOM 211   C C    . VAL A 1 81  ? -8.991  -8.451  2.329   1.00 0.00 ? 81  VAL A C    1  
ATOM 212   O O    . VAL A 1 81  ? -9.640  -8.950  3.250   1.00 0.00 ? 81  VAL A O    1  
ATOM 213   C CB   . VAL A 1 81  ? -8.923  -6.054  3.048   1.00 0.00 ? 81  VAL A CB   1  
ATOM 214   C CG1  . VAL A 1 81  ? -7.459  -6.137  3.426   1.00 0.00 ? 81  VAL A CG1  1  
ATOM 215   C CG2  . VAL A 1 81  ? -9.283  -4.625  2.661   1.00 0.00 ? 81  VAL A CG2  1  
ATOM 216   H H    . VAL A 1 81  ? -11.244 -7.261  2.239   1.00 0.00 ? 81  VAL A H    1  
ATOM 217   H HA   . VAL A 1 81  ? -8.642  -6.812  1.015   1.00 0.00 ? 81  VAL A HA   1  
ATOM 218   H HB   . VAL A 1 81  ? -9.517  -6.338  3.905   1.00 0.00 ? 81  VAL A HB   1  
ATOM 219   H HG11 . VAL A 1 81  ? -6.852  -5.890  2.568   1.00 0.00 ? 81  VAL A HG11 1  
ATOM 220   H HG12 . VAL A 1 81  ? -7.227  -7.140  3.755   1.00 0.00 ? 81  VAL A HG12 1  
ATOM 221   H HG13 . VAL A 1 81  ? -7.255  -5.439  4.224   1.00 0.00 ? 81  VAL A HG13 1  
ATOM 222   H HG21 . VAL A 1 81  ? -8.724  -4.338  1.782   1.00 0.00 ? 81  VAL A HG21 1  
ATOM 223   H HG22 . VAL A 1 81  ? -9.040  -3.959  3.475   1.00 0.00 ? 81  VAL A HG22 1  
ATOM 224   H HG23 . VAL A 1 81  ? -10.340 -4.564  2.448   1.00 0.00 ? 81  VAL A HG23 1  
ATOM 225   N N    . LYS A 1 82  ? -8.116  -9.110  1.578   1.00 0.00 ? 82  LYS A N    1  
ATOM 226   C CA   . LYS A 1 82  ? -7.872  -10.539 1.681   1.00 0.00 ? 82  LYS A CA   1  
ATOM 227   C C    . LYS A 1 82  ? -7.521  -10.982 3.068   1.00 0.00 ? 82  LYS A C    1  
ATOM 228   O O    . LYS A 1 82  ? -8.118  -11.894 3.551   1.00 0.00 ? 82  LYS A O    1  
ATOM 229   C CB   . LYS A 1 82  ? -6.838  -10.976 0.667   1.00 0.00 ? 82  LYS A CB   1  
ATOM 230   C CG   . LYS A 1 82  ? -6.545  -12.466 0.642   1.00 0.00 ? 82  LYS A CG   1  
ATOM 231   C CD   . LYS A 1 82  ? -5.757  -12.881 -0.601  1.00 0.00 ? 82  LYS A CD   1  
ATOM 232   C CE   . LYS A 1 82  ? -4.419  -12.167 -0.727  1.00 0.00 ? 82  LYS A CE   1  
ATOM 233   N NZ   . LYS A 1 82  ? -3.658  -12.621 -1.916  1.00 0.00 ? 82  LYS A NZ   1  
ATOM 234   H H    . LYS A 1 82  ? -7.624  -8.592  0.910   1.00 0.00 ? 82  LYS A H    1  
ATOM 235   H HA   . LYS A 1 82  ? -8.804  -11.020 1.420   1.00 0.00 ? 82  LYS A HA   1  
ATOM 236   H HB2  . LYS A 1 82  ? -7.176  -10.687 -0.317  1.00 0.00 ? 82  LYS A HB2  1  
ATOM 237   H HB3  . LYS A 1 82  ? -5.917  -10.454 0.882   1.00 0.00 ? 82  LYS A HB3  1  
ATOM 238   H HG2  . LYS A 1 82  ? -5.973  -12.725 1.522   1.00 0.00 ? 82  LYS A HG2  1  
ATOM 239   H HG3  . LYS A 1 82  ? -7.485  -12.996 0.657   1.00 0.00 ? 82  LYS A HG3  1  
ATOM 240   H HD2  . LYS A 1 82  ? -5.574  -13.944 -0.549  1.00 0.00 ? 82  LYS A HD2  1  
ATOM 241   H HD3  . LYS A 1 82  ? -6.357  -12.668 -1.474  1.00 0.00 ? 82  LYS A HD3  1  
ATOM 242   H HE2  . LYS A 1 82  ? -4.598  -11.106 -0.815  1.00 0.00 ? 82  LYS A HE2  1  
ATOM 243   H HE3  . LYS A 1 82  ? -3.838  -12.360 0.161   1.00 0.00 ? 82  LYS A HE3  1  
ATOM 244   H HZ1  . LYS A 1 82  ? -4.218  -12.482 -2.781  1.00 0.00 ? 82  LYS A HZ1  1  
ATOM 245   H HZ2  . LYS A 1 82  ? -3.404  -13.629 -1.859  1.00 0.00 ? 82  LYS A HZ2  1  
ATOM 246   H HZ3  . LYS A 1 82  ? -2.789  -12.063 -2.036  1.00 0.00 ? 82  LYS A HZ3  1  
ATOM 247   N N    . HIS A 1 83  ? -6.522  -10.389 3.675   1.00 0.00 ? 83  HIS A N    1  
ATOM 248   C CA   . HIS A 1 83  ? -6.271  -10.621 5.091   1.00 0.00 ? 83  HIS A CA   1  
ATOM 249   C C    . HIS A 1 83  ? -5.641  -9.392  5.662   1.00 0.00 ? 83  HIS A C    1  
ATOM 250   O O    . HIS A 1 83  ? -4.601  -8.967  5.173   1.00 0.00 ? 83  HIS A O    1  
ATOM 251   C CB   . HIS A 1 83  ? -5.301  -11.812 5.365   1.00 0.00 ? 83  HIS A CB   1  
ATOM 252   C CG   . HIS A 1 83  ? -5.735  -13.158 4.871   1.00 0.00 ? 83  HIS A CG   1  
ATOM 253   N ND1  . HIS A 1 83  ? -6.857  -13.792 5.313   1.00 0.00 ? 83  HIS A ND1  1  
ATOM 254   C CD2  . HIS A 1 83  ? -5.189  -13.978 3.952   1.00 0.00 ? 83  HIS A CD2  1  
ATOM 255   C CE1  . HIS A 1 83  ? -6.988  -14.932 4.706   1.00 0.00 ? 83  HIS A CE1  1  
ATOM 256   N NE2  . HIS A 1 83  ? -5.990  -15.076 3.869   1.00 0.00 ? 83  HIS A NE2  1  
ATOM 257   H H    . HIS A 1 83  ? -5.932  -9.777  3.189   1.00 0.00 ? 83  HIS A H    1  
ATOM 258   H HA   . HIS A 1 83  ? -7.215  -10.809 5.581   1.00 0.00 ? 83  HIS A HA   1  
ATOM 259   H HB2  . HIS A 1 83  ? -4.346  -11.603 4.908   1.00 0.00 ? 83  HIS A HB2  1  
ATOM 260   H HB3  . HIS A 1 83  ? -5.152  -11.882 6.432   1.00 0.00 ? 83  HIS A HB3  1  
ATOM 261   H HD1  . HIS A 1 83  ? -7.526  -13.422 5.946   1.00 0.00 ? 83  HIS A HD1  1  
ATOM 262   H HD2  . HIS A 1 83  ? -4.287  -13.795 3.386   1.00 0.00 ? 83  HIS A HD2  1  
ATOM 263   H HE1  . HIS A 1 83  ? -7.784  -15.641 4.875   1.00 0.00 ? 83  HIS A HE1  1  
ATOM 264   H HE2  . HIS A 1 83  ? -6.030  -15.671 3.088   1.00 0.00 ? 83  HIS A HE2  1  
ATOM 265   N N    . PHE A 1 84  ? -6.284  -8.843  6.656   1.00 0.00 ? 84  PHE A N    1  
ATOM 266   C CA   . PHE A 1 84  ? -5.820  -7.744  7.504   1.00 0.00 ? 84  PHE A CA   1  
ATOM 267   C C    . PHE A 1 84  ? -6.643  -7.784  8.766   1.00 0.00 ? 84  PHE A C    1  
ATOM 268   O O    . PHE A 1 84  ? -7.585  -8.577  8.866   1.00 0.00 ? 84  PHE A O    1  
ATOM 269   C CB   . PHE A 1 84  ? -5.930  -6.337  6.857   1.00 0.00 ? 84  PHE A CB   1  
ATOM 270   C CG   . PHE A 1 84  ? -4.730  -5.846  6.038   1.00 0.00 ? 84  PHE A CG   1  
ATOM 271   C CD1  . PHE A 1 84  ? -3.493  -6.484  6.078   1.00 0.00 ? 84  PHE A CD1  1  
ATOM 272   C CD2  . PHE A 1 84  ? -4.854  -4.724  5.242   1.00 0.00 ? 84  PHE A CD2  1  
ATOM 273   C CE1  . PHE A 1 84  ? -2.430  -6.015  5.336   1.00 0.00 ? 84  PHE A CE1  1  
ATOM 274   C CE2  . PHE A 1 84  ? -3.788  -4.253  4.504   1.00 0.00 ? 84  PHE A CE2  1  
ATOM 275   C CZ   . PHE A 1 84  ? -2.577  -4.900  4.550   1.00 0.00 ? 84  PHE A CZ   1  
ATOM 276   H H    . PHE A 1 84  ? -7.182  -9.185  6.870   1.00 0.00 ? 84  PHE A H    1  
ATOM 277   H HA   . PHE A 1 84  ? -4.799  -7.956  7.782   1.00 0.00 ? 84  PHE A HA   1  
ATOM 278   H HB2  . PHE A 1 84  ? -6.784  -6.333  6.196   1.00 0.00 ? 84  PHE A HB2  1  
ATOM 279   H HB3  . PHE A 1 84  ? -6.111  -5.618  7.643   1.00 0.00 ? 84  PHE A HB3  1  
ATOM 280   H HD1  . PHE A 1 84  ? -3.351  -7.363  6.688   1.00 0.00 ? 84  PHE A HD1  1  
ATOM 281   H HD2  . PHE A 1 84  ? -5.805  -4.214  5.197   1.00 0.00 ? 84  PHE A HD2  1  
ATOM 282   H HE1  . PHE A 1 84  ? -1.480  -6.527  5.375   1.00 0.00 ? 84  PHE A HE1  1  
ATOM 283   H HE2  . PHE A 1 84  ? -3.906  -3.373  3.888   1.00 0.00 ? 84  PHE A HE2  1  
ATOM 284   H HZ   . PHE A 1 84  ? -1.742  -4.529  3.973   1.00 0.00 ? 84  PHE A HZ   1  
ATOM 285   N N    . SER A 1 85  ? -6.279  -6.999  9.717   1.00 0.00 ? 85  SER A N    1  
ATOM 286   C CA   . SER A 1 85  ? -7.007  -6.901  10.940  1.00 0.00 ? 85  SER A CA   1  
ATOM 287   C C    . SER A 1 85  ? -7.642  -5.493  11.031  1.00 0.00 ? 85  SER A C    1  
ATOM 288   O O    . SER A 1 85  ? -7.027  -4.513  10.616  1.00 0.00 ? 85  SER A O    1  
ATOM 289   C CB   . SER A 1 85  ? -6.049  -7.159  12.089  1.00 0.00 ? 85  SER A CB   1  
ATOM 290   O OG   . SER A 1 85  ? -5.384  -8.405  11.904  1.00 0.00 ? 85  SER A OG   1  
ATOM 291   H H    . SER A 1 85  ? -5.477  -6.442  9.621   1.00 0.00 ? 85  SER A H    1  
ATOM 292   H HA   . SER A 1 85  ? -7.776  -7.657  10.932  1.00 0.00 ? 85  SER A HA   1  
ATOM 293   H HB2  . SER A 1 85  ? -5.319  -6.367  12.160  1.00 0.00 ? 85  SER A HB2  1  
ATOM 294   H HB3  . SER A 1 85  ? -6.613  -7.223  13.006  1.00 0.00 ? 85  SER A HB3  1  
ATOM 295   H HG   . SER A 1 85  ? -5.940  -9.057  12.351  1.00 0.00 ? 85  SER A HG   1  
ATOM 296   N N    . PRO A 1 86  ? -8.914  -5.403  11.559  1.00 0.00 ? 86  PRO A N    1  
ATOM 297   C CA   . PRO A 1 86  ? -9.746  -4.162  11.591  1.00 0.00 ? 86  PRO A CA   1  
ATOM 298   C C    . PRO A 1 86  ? -9.061  -2.897  12.119  1.00 0.00 ? 86  PRO A C    1  
ATOM 299   O O    . PRO A 1 86  ? -9.428  -1.786  11.725  1.00 0.00 ? 86  PRO A O    1  
ATOM 300   C CB   . PRO A 1 86  ? -10.902 -4.539  12.509  1.00 0.00 ? 86  PRO A CB   1  
ATOM 301   C CG   . PRO A 1 86  ? -11.055 -5.998  12.320  1.00 0.00 ? 86  PRO A CG   1  
ATOM 302   C CD   . PRO A 1 86  ? -9.663  -6.536  12.164  1.00 0.00 ? 86  PRO A CD   1  
ATOM 303   H HA   . PRO A 1 86  ? -10.149 -3.950  10.612  1.00 0.00 ? 86  PRO A HA   1  
ATOM 304   H HB2  . PRO A 1 86  ? -10.647 -4.290  13.529  1.00 0.00 ? 86  PRO A HB2  1  
ATOM 305   H HB3  . PRO A 1 86  ? -11.794 -4.005  12.215  1.00 0.00 ? 86  PRO A HB3  1  
ATOM 306   H HG2  . PRO A 1 86  ? -11.536 -6.434  13.183  1.00 0.00 ? 86  PRO A HG2  1  
ATOM 307   H HG3  . PRO A 1 86  ? -11.631 -6.194  11.428  1.00 0.00 ? 86  PRO A HG3  1  
ATOM 308   H HD2  . PRO A 1 86  ? -9.249  -6.808  13.123  1.00 0.00 ? 86  PRO A HD2  1  
ATOM 309   H HD3  . PRO A 1 86  ? -9.676  -7.388  11.500  1.00 0.00 ? 86  PRO A HD3  1  
ATOM 310   N N    . GLU A 1 87  ? -8.087  -3.044  12.994  1.00 0.00 ? 87  GLU A N    1  
ATOM 311   C CA   . GLU A 1 87  ? -7.390  -1.886  13.536  1.00 0.00 ? 87  GLU A CA   1  
ATOM 312   C C    . GLU A 1 87  ? -6.447  -1.279  12.507  1.00 0.00 ? 87  GLU A C    1  
ATOM 313   O O    . GLU A 1 87  ? -6.081  -0.108  12.595  1.00 0.00 ? 87  GLU A O    1  
ATOM 314   C CB   . GLU A 1 87  ? -6.652  -2.227  14.824  1.00 0.00 ? 87  GLU A CB   1  
ATOM 315   C CG   . GLU A 1 87  ? -7.573  -2.670  15.946  1.00 0.00 ? 87  GLU A CG   1  
ATOM 316   C CD   . GLU A 1 87  ? -8.632  -1.656  16.242  1.00 0.00 ? 87  GLU A CD   1  
ATOM 317   O OE1  . GLU A 1 87  ? -8.308  -0.597  16.810  1.00 0.00 ? 87  GLU A OE1  1  
ATOM 318   O OE2  . GLU A 1 87  ? -9.804  -1.884  15.892  1.00 0.00 ? 87  GLU A OE2  1  
ATOM 319   H H    . GLU A 1 87  ? -7.838  -3.949  13.284  1.00 0.00 ? 87  GLU A H    1  
ATOM 320   H HA   . GLU A 1 87  ? -8.149  -1.150  13.755  1.00 0.00 ? 87  GLU A HA   1  
ATOM 321   H HB2  . GLU A 1 87  ? -5.945  -3.016  14.622  1.00 0.00 ? 87  GLU A HB2  1  
ATOM 322   H HB3  . GLU A 1 87  ? -6.114  -1.350  15.155  1.00 0.00 ? 87  GLU A HB3  1  
ATOM 323   H HG2  . GLU A 1 87  ? -8.071  -3.584  15.662  1.00 0.00 ? 87  GLU A HG2  1  
ATOM 324   H HG3  . GLU A 1 87  ? -6.992  -2.835  16.841  1.00 0.00 ? 87  GLU A HG3  1  
ATOM 325   N N    . GLU A 1 88  ? -6.099  -2.060  11.513  1.00 0.00 ? 88  GLU A N    1  
ATOM 326   C CA   . GLU A 1 88  ? -5.245  -1.607  10.440  1.00 0.00 ? 88  GLU A CA   1  
ATOM 327   C C    . GLU A 1 88  ? -6.090  -1.209  9.237   1.00 0.00 ? 88  GLU A C    1  
ATOM 328   O O    . GLU A 1 88  ? -5.585  -1.084  8.121   1.00 0.00 ? 88  GLU A O    1  
ATOM 329   C CB   . GLU A 1 88  ? -4.225  -2.685  10.027  1.00 0.00 ? 88  GLU A CB   1  
ATOM 330   C CG   . GLU A 1 88  ? -3.099  -2.961  11.026  1.00 0.00 ? 88  GLU A CG   1  
ATOM 331   C CD   . GLU A 1 88  ? -3.545  -3.595  12.316  1.00 0.00 ? 88  GLU A CD   1  
ATOM 332   O OE1  . GLU A 1 88  ? -3.775  -4.812  12.335  1.00 0.00 ? 88  GLU A OE1  1  
ATOM 333   O OE2  . GLU A 1 88  ? -3.596  -2.910  13.343  1.00 0.00 ? 88  GLU A OE2  1  
ATOM 334   H H    . GLU A 1 88  ? -6.436  -2.984  11.477  1.00 0.00 ? 88  GLU A H    1  
ATOM 335   H HA   . GLU A 1 88  ? -4.713  -0.737  10.795  1.00 0.00 ? 88  GLU A HA   1  
ATOM 336   H HB2  . GLU A 1 88  ? -4.757  -3.611  9.869   1.00 0.00 ? 88  GLU A HB2  1  
ATOM 337   H HB3  . GLU A 1 88  ? -3.780  -2.385  9.089   1.00 0.00 ? 88  GLU A HB3  1  
ATOM 338   H HG2  . GLU A 1 88  ? -2.380  -3.621  10.564  1.00 0.00 ? 88  GLU A HG2  1  
ATOM 339   H HG3  . GLU A 1 88  ? -2.611  -2.024  11.253  1.00 0.00 ? 88  GLU A HG3  1  
ATOM 340   N N    . LEU A 1 89  ? -7.367  -0.983  9.479   1.00 0.00 ? 89  LEU A N    1  
ATOM 341   C CA   . LEU A 1 89  ? -8.312  -0.641  8.439   1.00 0.00 ? 89  LEU A CA   1  
ATOM 342   C C    . LEU A 1 89  ? -8.939  0.694   8.696   1.00 0.00 ? 89  LEU A C    1  
ATOM 343   O O    . LEU A 1 89  ? -9.101  1.123   9.849   1.00 0.00 ? 89  LEU A O    1  
ATOM 344   C CB   . LEU A 1 89  ? -9.443  -1.688  8.354   1.00 0.00 ? 89  LEU A CB   1  
ATOM 345   C CG   . LEU A 1 89  ? -9.455  -2.649  7.154   1.00 0.00 ? 89  LEU A CG   1  
ATOM 346   C CD1  . LEU A 1 89  ? -9.606  -1.899  5.840   1.00 0.00 ? 89  LEU A CD1  1  
ATOM 347   C CD2  . LEU A 1 89  ? -8.209  -3.522  7.140   1.00 0.00 ? 89  LEU A CD2  1  
ATOM 348   H H    . LEU A 1 89  ? -7.693  -1.040  10.401  1.00 0.00 ? 89  LEU A H    1  
ATOM 349   H HA   . LEU A 1 89  ? -7.797  -0.629  7.491   1.00 0.00 ? 89  LEU A HA   1  
ATOM 350   H HB2  . LEU A 1 89  ? -9.398  -2.288  9.251   1.00 0.00 ? 89  LEU A HB2  1  
ATOM 351   H HB3  . LEU A 1 89  ? -10.382 -1.152  8.362   1.00 0.00 ? 89  LEU A HB3  1  
ATOM 352   H HG   . LEU A 1 89  ? -10.316 -3.295  7.249   1.00 0.00 ? 89  LEU A HG   1  
ATOM 353   H HD11 . LEU A 1 89  ? -10.526 -1.334  5.852   1.00 0.00 ? 89  LEU A HD11 1  
ATOM 354   H HD12 . LEU A 1 89  ? -9.637  -2.608  5.026   1.00 0.00 ? 89  LEU A HD12 1  
ATOM 355   H HD13 . LEU A 1 89  ? -8.770  -1.228  5.701   1.00 0.00 ? 89  LEU A HD13 1  
ATOM 356   H HD21 . LEU A 1 89  ? -8.245  -4.187  6.290   1.00 0.00 ? 89  LEU A HD21 1  
ATOM 357   H HD22 . LEU A 1 89  ? -8.165  -4.103  8.050   1.00 0.00 ? 89  LEU A HD22 1  
ATOM 358   H HD23 . LEU A 1 89  ? -7.332  -2.897  7.071   1.00 0.00 ? 89  LEU A HD23 1  
ATOM 359   N N    . LYS A 1 90  ? -9.239  1.346   7.629   1.00 0.00 ? 90  LYS A N    1  
ATOM 360   C CA   . LYS A 1 90  ? -9.966  2.558   7.609   1.00 0.00 ? 90  LYS A CA   1  
ATOM 361   C C    . LYS A 1 90  ? -10.939 2.464   6.454   1.00 0.00 ? 90  LYS A C    1  
ATOM 362   O O    . LYS A 1 90  ? -10.540 2.192   5.316   1.00 0.00 ? 90  LYS A O    1  
ATOM 363   C CB   . LYS A 1 90  ? -9.006  3.756   7.409   1.00 0.00 ? 90  LYS A CB   1  
ATOM 364   C CG   . LYS A 1 90  ? -9.695  5.106   7.189   1.00 0.00 ? 90  LYS A CG   1  
ATOM 365   C CD   . LYS A 1 90  ? -10.579 5.497   8.361   1.00 0.00 ? 90  LYS A CD   1  
ATOM 366   C CE   . LYS A 1 90  ? -11.341 6.793   8.079   1.00 0.00 ? 90  LYS A CE   1  
ATOM 367   N NZ   . LYS A 1 90  ? -10.442 7.964   7.903   1.00 0.00 ? 90  LYS A NZ   1  
ATOM 368   H H    . LYS A 1 90  ? -8.926  0.998   6.763   1.00 0.00 ? 90  LYS A H    1  
ATOM 369   H HA   . LYS A 1 90  ? -10.496 2.667   8.542   1.00 0.00 ? 90  LYS A HA   1  
ATOM 370   H HB2  . LYS A 1 90  ? -8.377  3.844   8.283   1.00 0.00 ? 90  LYS A HB2  1  
ATOM 371   H HB3  . LYS A 1 90  ? -8.381  3.552   6.553   1.00 0.00 ? 90  LYS A HB3  1  
ATOM 372   H HG2  . LYS A 1 90  ? -8.944  5.870   7.055   1.00 0.00 ? 90  LYS A HG2  1  
ATOM 373   H HG3  . LYS A 1 90  ? -10.301 5.045   6.298   1.00 0.00 ? 90  LYS A HG3  1  
ATOM 374   H HD2  . LYS A 1 90  ? -11.291 4.706   8.536   1.00 0.00 ? 90  LYS A HD2  1  
ATOM 375   H HD3  . LYS A 1 90  ? -9.963  5.634   9.239   1.00 0.00 ? 90  LYS A HD3  1  
ATOM 376   H HE2  . LYS A 1 90  ? -11.912 6.658   7.171   1.00 0.00 ? 90  LYS A HE2  1  
ATOM 377   H HE3  . LYS A 1 90  ? -12.021 6.983   8.896   1.00 0.00 ? 90  LYS A HE3  1  
ATOM 378   H HZ1  . LYS A 1 90  ? -10.997 8.816   7.684   1.00 0.00 ? 90  LYS A HZ1  1  
ATOM 379   H HZ2  . LYS A 1 90  ? -9.762  7.831   7.127   1.00 0.00 ? 90  LYS A HZ2  1  
ATOM 380   H HZ3  . LYS A 1 90  ? -9.908  8.162   8.771   1.00 0.00 ? 90  LYS A HZ3  1  
ATOM 381   N N    . VAL A 1 91  ? -12.184 2.649   6.735   1.00 0.00 ? 91  VAL A N    1  
ATOM 382   C CA   . VAL A 1 91  ? -13.179 2.639   5.714   1.00 0.00 ? 91  VAL A CA   1  
ATOM 383   C C    . VAL A 1 91  ? -13.699 4.048   5.535   1.00 0.00 ? 91  VAL A C    1  
ATOM 384   O O    . VAL A 1 91  ? -14.043 4.730   6.512   1.00 0.00 ? 91  VAL A O    1  
ATOM 385   C CB   . VAL A 1 91  ? -14.325 1.613   5.990   1.00 0.00 ? 91  VAL A CB   1  
ATOM 386   C CG1  . VAL A 1 91  ? -14.954 1.816   7.360   1.00 0.00 ? 91  VAL A CG1  1  
ATOM 387   C CG2  . VAL A 1 91  ? -15.397 1.695   4.906   1.00 0.00 ? 91  VAL A CG2  1  
ATOM 388   H H    . VAL A 1 91  ? -12.457 2.818   7.665   1.00 0.00 ? 91  VAL A H    1  
ATOM 389   H HA   . VAL A 1 91  ? -12.672 2.367   4.798   1.00 0.00 ? 91  VAL A HA   1  
ATOM 390   H HB   . VAL A 1 91  ? -13.901 0.619   5.962   1.00 0.00 ? 91  VAL A HB   1  
ATOM 391   H HG11 . VAL A 1 91  ? -15.778 1.128   7.477   1.00 0.00 ? 91  VAL A HG11 1  
ATOM 392   H HG12 . VAL A 1 91  ? -15.310 2.831   7.447   1.00 0.00 ? 91  VAL A HG12 1  
ATOM 393   H HG13 . VAL A 1 91  ? -14.215 1.623   8.123   1.00 0.00 ? 91  VAL A HG13 1  
ATOM 394   H HG21 . VAL A 1 91  ? -14.969 1.452   3.945   1.00 0.00 ? 91  VAL A HG21 1  
ATOM 395   H HG22 . VAL A 1 91  ? -15.798 2.698   4.879   1.00 0.00 ? 91  VAL A HG22 1  
ATOM 396   H HG23 . VAL A 1 91  ? -16.192 1.003   5.136   1.00 0.00 ? 91  VAL A HG23 1  
ATOM 397   N N    . LYS A 1 92  ? -13.722 4.499   4.321   1.00 0.00 ? 92  LYS A N    1  
ATOM 398   C CA   . LYS A 1 92  ? -14.105 5.837   4.033   1.00 0.00 ? 92  LYS A CA   1  
ATOM 399   C C    . LYS A 1 92  ? -15.155 5.885   2.937   1.00 0.00 ? 92  LYS A C    1  
ATOM 400   O O    . LYS A 1 92  ? -15.019 5.253   1.893   1.00 0.00 ? 92  LYS A O    1  
ATOM 401   C CB   . LYS A 1 92  ? -12.861 6.653   3.631   1.00 0.00 ? 92  LYS A CB   1  
ATOM 402   C CG   . LYS A 1 92  ? -12.029 5.983   2.540   1.00 0.00 ? 92  LYS A CG   1  
ATOM 403   C CD   . LYS A 1 92  ? -10.935 6.872   1.968   1.00 0.00 ? 92  LYS A CD   1  
ATOM 404   C CE   . LYS A 1 92  ? -11.505 8.142   1.344   1.00 0.00 ? 92  LYS A CE   1  
ATOM 405   N NZ   . LYS A 1 92  ? -10.529 8.802   0.457   1.00 0.00 ? 92  LYS A NZ   1  
ATOM 406   H H    . LYS A 1 92  ? -13.496 3.914   3.560   1.00 0.00 ? 92  LYS A H    1  
ATOM 407   H HA   . LYS A 1 92  ? -14.508 6.274   4.933   1.00 0.00 ? 92  LYS A HA   1  
ATOM 408   H HB2  . LYS A 1 92  ? -13.179 7.622   3.276   1.00 0.00 ? 92  LYS A HB2  1  
ATOM 409   H HB3  . LYS A 1 92  ? -12.236 6.781   4.502   1.00 0.00 ? 92  LYS A HB3  1  
ATOM 410   H HG2  . LYS A 1 92  ? -11.574 5.092   2.946   1.00 0.00 ? 92  LYS A HG2  1  
ATOM 411   H HG3  . LYS A 1 92  ? -12.711 5.703   1.752   1.00 0.00 ? 92  LYS A HG3  1  
ATOM 412   H HD2  . LYS A 1 92  ? -10.266 7.151   2.769   1.00 0.00 ? 92  LYS A HD2  1  
ATOM 413   H HD3  . LYS A 1 92  ? -10.387 6.324   1.216   1.00 0.00 ? 92  LYS A HD3  1  
ATOM 414   H HE2  . LYS A 1 92  ? -12.380 7.882   0.767   1.00 0.00 ? 92  LYS A HE2  1  
ATOM 415   H HE3  . LYS A 1 92  ? -11.785 8.825   2.133   1.00 0.00 ? 92  LYS A HE3  1  
ATOM 416   H HZ1  . LYS A 1 92  ? -10.489 8.277   -0.447  1.00 0.00 ? 92  LYS A HZ1  1  
ATOM 417   H HZ2  . LYS A 1 92  ? -9.572  8.855   0.860   1.00 0.00 ? 92  LYS A HZ2  1  
ATOM 418   H HZ3  . LYS A 1 92  ? -10.842 9.762   0.216   1.00 0.00 ? 92  LYS A HZ3  1  
ATOM 419   N N    . VAL A 1 93  ? -16.196 6.610   3.192   1.00 0.00 ? 93  VAL A N    1  
ATOM 420   C CA   . VAL A 1 93  ? -17.211 6.855   2.212   1.00 0.00 ? 93  VAL A CA   1  
ATOM 421   C C    . VAL A 1 93  ? -17.344 8.353   2.069   1.00 0.00 ? 93  VAL A C    1  
ATOM 422   O O    . VAL A 1 93  ? -17.628 9.072   3.040   1.00 0.00 ? 93  VAL A O    1  
ATOM 423   C CB   . VAL A 1 93  ? -18.579 6.155   2.541   1.00 0.00 ? 93  VAL A CB   1  
ATOM 424   C CG1  . VAL A 1 93  ? -19.154 6.570   3.893   1.00 0.00 ? 93  VAL A CG1  1  
ATOM 425   C CG2  . VAL A 1 93  ? -19.592 6.383   1.427   1.00 0.00 ? 93  VAL A CG2  1  
ATOM 426   H H    . VAL A 1 93  ? -16.305 7.013   4.078   1.00 0.00 ? 93  VAL A H    1  
ATOM 427   H HA   . VAL A 1 93  ? -16.825 6.478   1.274   1.00 0.00 ? 93  VAL A HA   1  
ATOM 428   H HB   . VAL A 1 93  ? -18.388 5.095   2.602   1.00 0.00 ? 93  VAL A HB   1  
ATOM 429   H HG11 . VAL A 1 93  ? -20.091 6.060   4.059   1.00 0.00 ? 93  VAL A HG11 1  
ATOM 430   H HG12 . VAL A 1 93  ? -19.320 7.637   3.895   1.00 0.00 ? 93  VAL A HG12 1  
ATOM 431   H HG13 . VAL A 1 93  ? -18.456 6.312   4.676   1.00 0.00 ? 93  VAL A HG13 1  
ATOM 432   H HG21 . VAL A 1 93  ? -19.212 5.971   0.504   1.00 0.00 ? 93  VAL A HG21 1  
ATOM 433   H HG22 . VAL A 1 93  ? -19.757 7.443   1.306   1.00 0.00 ? 93  VAL A HG22 1  
ATOM 434   H HG23 . VAL A 1 93  ? -20.523 5.898   1.679   1.00 0.00 ? 93  VAL A HG23 1  
ATOM 435   N N    . LEU A 1 94  ? -17.071 8.838   0.911   1.00 0.00 ? 94  LEU A N    1  
ATOM 436   C CA   . LEU A 1 94  ? -17.044 10.245  0.707   1.00 0.00 ? 94  LEU A CA   1  
ATOM 437   C C    . LEU A 1 94  ? -17.780 10.589  -0.561  1.00 0.00 ? 94  LEU A C    1  
ATOM 438   O O    . LEU A 1 94  ? -17.192 10.630  -1.662  1.00 0.00 ? 94  LEU A O    1  
ATOM 439   C CB   . LEU A 1 94  ? -15.586 10.705  0.652   1.00 0.00 ? 94  LEU A CB   1  
ATOM 440   C CG   . LEU A 1 94  ? -15.338 12.199  0.520   1.00 0.00 ? 94  LEU A CG   1  
ATOM 441   C CD1  . LEU A 1 94  ? -15.905 12.947  1.708   1.00 0.00 ? 94  LEU A CD1  1  
ATOM 442   C CD2  . LEU A 1 94  ? -13.856 12.461  0.382   1.00 0.00 ? 94  LEU A CD2  1  
ATOM 443   H H    . LEU A 1 94  ? -16.909 8.235   0.147   1.00 0.00 ? 94  LEU A H    1  
ATOM 444   H HA   . LEU A 1 94  ? -17.524 10.719  1.548   1.00 0.00 ? 94  LEU A HA   1  
ATOM 445   H HB2  . LEU A 1 94  ? -15.097 10.370  1.555   1.00 0.00 ? 94  LEU A HB2  1  
ATOM 446   H HB3  . LEU A 1 94  ? -15.116 10.213  -0.186  1.00 0.00 ? 94  LEU A HB3  1  
ATOM 447   H HG   . LEU A 1 94  ? -15.827 12.564  -0.370  1.00 0.00 ? 94  LEU A HG   1  
ATOM 448   H HD11 . LEU A 1 94  ? -15.722 14.002  1.577   1.00 0.00 ? 94  LEU A HD11 1  
ATOM 449   H HD12 . LEU A 1 94  ? -15.431 12.607  2.615   1.00 0.00 ? 94  LEU A HD12 1  
ATOM 450   H HD13 . LEU A 1 94  ? -16.971 12.777  1.766   1.00 0.00 ? 94  LEU A HD13 1  
ATOM 451   H HD21 . LEU A 1 94  ? -13.340 12.090  1.256   1.00 0.00 ? 94  LEU A HD21 1  
ATOM 452   H HD22 . LEU A 1 94  ? -13.698 13.524  0.296   1.00 0.00 ? 94  LEU A HD22 1  
ATOM 453   H HD23 . LEU A 1 94  ? -13.481 11.966  -0.500  1.00 0.00 ? 94  LEU A HD23 1  
ATOM 454   N N    . GLY A 1 95  ? -19.058 10.843  -0.406  1.00 0.00 ? 95  GLY A N    1  
ATOM 455   C CA   . GLY A 1 95  ? -19.882 11.176  -1.523  1.00 0.00 ? 95  GLY A CA   1  
ATOM 456   C C    . GLY A 1 95  ? -20.030 10.019  -2.475  1.00 0.00 ? 95  GLY A C    1  
ATOM 457   O O    . GLY A 1 95  ? -20.612 8.995   -2.140  1.00 0.00 ? 95  GLY A O    1  
ATOM 458   H H    . GLY A 1 95  ? -19.449 10.792  0.493   1.00 0.00 ? 95  GLY A H    1  
ATOM 459   H HA2  . GLY A 1 95  ? -20.858 11.476  -1.173  1.00 0.00 ? 95  GLY A HA2  1  
ATOM 460   H HA3  . GLY A 1 95  ? -19.429 12.001  -2.050  1.00 0.00 ? 95  GLY A HA3  1  
ATOM 461   N N    . ASP A 1 96  ? -19.454 10.188  -3.629  1.00 0.00 ? 96  ASP A N    1  
ATOM 462   C CA   . ASP A 1 96  ? -19.530 9.239   -4.728  1.00 0.00 ? 96  ASP A CA   1  
ATOM 463   C C    . ASP A 1 96  ? -18.451 8.177   -4.630  1.00 0.00 ? 96  ASP A C    1  
ATOM 464   O O    . ASP A 1 96  ? -18.414 7.252   -5.433  1.00 0.00 ? 96  ASP A O    1  
ATOM 465   C CB   . ASP A 1 96  ? -19.373 9.998   -6.059  1.00 0.00 ? 96  ASP A CB   1  
ATOM 466   C CG   . ASP A 1 96  ? -18.067 10.780  -6.152  1.00 0.00 ? 96  ASP A CG   1  
ATOM 467   O OD1  . ASP A 1 96  ? -17.912 11.798  -5.421  1.00 0.00 ? 96  ASP A OD1  1  
ATOM 468   O OD2  . ASP A 1 96  ? -17.199 10.441  -6.962  1.00 0.00 ? 96  ASP A OD2  1  
ATOM 469   H H    . ASP A 1 96  ? -18.923 11.000  -3.771  1.00 0.00 ? 96  ASP A H    1  
ATOM 470   H HA   . ASP A 1 96  ? -20.503 8.773   -4.723  1.00 0.00 ? 96  ASP A HA   1  
ATOM 471   H HB2  . ASP A 1 96  ? -19.393 9.284   -6.871  1.00 0.00 ? 96  ASP A HB2  1  
ATOM 472   H HB3  . ASP A 1 96  ? -20.196 10.689  -6.170  1.00 0.00 ? 96  ASP A HB3  1  
ATOM 473   N N    . VAL A 1 97  ? -17.566 8.295   -3.678  1.00 0.00 ? 97  VAL A N    1  
ATOM 474   C CA   . VAL A 1 97  ? -16.531 7.303   -3.556  1.00 0.00 ? 97  VAL A CA   1  
ATOM 475   C C    . VAL A 1 97  ? -16.632 6.521   -2.279  1.00 0.00 ? 97  VAL A C    1  
ATOM 476   O O    . VAL A 1 97  ? -16.903 7.067   -1.197  1.00 0.00 ? 97  VAL A O    1  
ATOM 477   C CB   . VAL A 1 97  ? -15.079 7.852   -3.743  1.00 0.00 ? 97  VAL A CB   1  
ATOM 478   C CG1  . VAL A 1 97  ? -14.889 8.422   -5.135  1.00 0.00 ? 97  VAL A CG1  1  
ATOM 479   C CG2  . VAL A 1 97  ? -14.708 8.881   -2.683  1.00 0.00 ? 97  VAL A CG2  1  
ATOM 480   H H    . VAL A 1 97  ? -17.622 9.033   -3.033  1.00 0.00 ? 97  VAL A H    1  
ATOM 481   H HA   . VAL A 1 97  ? -16.717 6.601   -4.356  1.00 0.00 ? 97  VAL A HA   1  
ATOM 482   H HB   . VAL A 1 97  ? -14.408 7.010   -3.653  1.00 0.00 ? 97  VAL A HB   1  
ATOM 483   H HG11 . VAL A 1 97  ? -13.883 8.797   -5.235  1.00 0.00 ? 97  VAL A HG11 1  
ATOM 484   H HG12 . VAL A 1 97  ? -15.590 9.229   -5.291  1.00 0.00 ? 97  VAL A HG12 1  
ATOM 485   H HG13 . VAL A 1 97  ? -15.060 7.649   -5.869  1.00 0.00 ? 97  VAL A HG13 1  
ATOM 486   H HG21 . VAL A 1 97  ? -15.411 9.699   -2.713  1.00 0.00 ? 97  VAL A HG21 1  
ATOM 487   H HG22 . VAL A 1 97  ? -13.709 9.250   -2.867  1.00 0.00 ? 97  VAL A HG22 1  
ATOM 488   H HG23 . VAL A 1 97  ? -14.743 8.416   -1.708  1.00 0.00 ? 97  VAL A HG23 1  
ATOM 489   N N    . ILE A 1 98  ? -16.433 5.252   -2.412  1.00 0.00 ? 98  ILE A N    1  
ATOM 490   C CA   . ILE A 1 98  ? -16.375 4.360   -1.309  1.00 0.00 ? 98  ILE A CA   1  
ATOM 491   C C    . ILE A 1 98  ? -15.045 3.625   -1.404  1.00 0.00 ? 98  ILE A C    1  
ATOM 492   O O    . ILE A 1 98  ? -14.746 2.983   -2.414  1.00 0.00 ? 98  ILE A O    1  
ATOM 493   C CB   . ILE A 1 98  ? -17.629 3.381   -1.229  1.00 0.00 ? 98  ILE A CB   1  
ATOM 494   C CG1  . ILE A 1 98  ? -17.429 2.322   -0.141  1.00 0.00 ? 98  ILE A CG1  1  
ATOM 495   C CG2  . ILE A 1 98  ? -17.980 2.742   -2.548  1.00 0.00 ? 98  ILE A CG2  1  
ATOM 496   C CD1  . ILE A 1 98  ? -17.295 2.887   1.259   1.00 0.00 ? 98  ILE A CD1  1  
ATOM 497   H H    . ILE A 1 98  ? -16.275 4.892   -3.312  1.00 0.00 ? 98  ILE A H    1  
ATOM 498   H HA   . ILE A 1 98  ? -16.339 4.978   -0.424  1.00 0.00 ? 98  ILE A HA   1  
ATOM 499   H HB   . ILE A 1 98  ? -18.477 3.988   -0.946  1.00 0.00 ? 98  ILE A HB   1  
ATOM 500   H HG12 . ILE A 1 98  ? -18.275 1.651   -0.153  1.00 0.00 ? 98  ILE A HG12 1  
ATOM 501   H HG13 . ILE A 1 98  ? -16.534 1.760   -0.363  1.00 0.00 ? 98  ILE A HG13 1  
ATOM 502   H HG21 . ILE A 1 98  ? -17.172 2.093   -2.849  1.00 0.00 ? 98  ILE A HG21 1  
ATOM 503   H HG22 . ILE A 1 98  ? -18.130 3.506   -3.297  1.00 0.00 ? 98  ILE A HG22 1  
ATOM 504   H HG23 . ILE A 1 98  ? -18.883 2.160   -2.438  1.00 0.00 ? 98  ILE A HG23 1  
ATOM 505   H HD11 . ILE A 1 98  ? -18.215 3.383   1.531   1.00 0.00 ? 98  ILE A HD11 1  
ATOM 506   H HD12 . ILE A 1 98  ? -16.476 3.590   1.293   1.00 0.00 ? 98  ILE A HD12 1  
ATOM 507   H HD13 . ILE A 1 98  ? -17.099 2.084   1.953   1.00 0.00 ? 98  ILE A HD13 1  
ATOM 508   N N    . GLU A 1 99  ? -14.228 3.769   -0.393  1.00 0.00 ? 99  GLU A N    1  
ATOM 509   C CA   . GLU A 1 99  ? -12.895 3.231   -0.422  1.00 0.00 ? 99  GLU A CA   1  
ATOM 510   C C    . GLU A 1 99  ? -12.552 2.605   0.909   1.00 0.00 ? 99  GLU A C    1  
ATOM 511   O O    . GLU A 1 99  ? -13.051 3.022   1.960   1.00 0.00 ? 99  GLU A O    1  
ATOM 512   C CB   . GLU A 1 99  ? -11.865 4.337   -0.701  1.00 0.00 ? 99  GLU A CB   1  
ATOM 513   C CG   . GLU A 1 99  ? -12.074 5.150   -1.967  1.00 0.00 ? 99  GLU A CG   1  
ATOM 514   C CD   . GLU A 1 99  ? -11.038 6.230   -2.095  1.00 0.00 ? 99  GLU A CD   1  
ATOM 515   O OE1  . GLU A 1 99  ? -9.916  5.938   -2.560  1.00 0.00 ? 99  GLU A OE1  1  
ATOM 516   O OE2  . GLU A 1 99  ? -11.296 7.372   -1.708  1.00 0.00 ? 99  GLU A OE2  1  
ATOM 517   H H    . GLU A 1 99  ? -14.521 4.240   0.422   1.00 0.00 ? 99  GLU A H    1  
ATOM 518   H HA   . GLU A 1 99  ? -12.826 2.496   -1.209  1.00 0.00 ? 99  GLU A HA   1  
ATOM 519   H HB2  . GLU A 1 99  ? -11.860 5.027   0.128   1.00 0.00 ? 99  GLU A HB2  1  
ATOM 520   H HB3  . GLU A 1 99  ? -10.889 3.877   -0.758  1.00 0.00 ? 99  GLU A HB3  1  
ATOM 521   H HG2  . GLU A 1 99  ? -12.011 4.500   -2.826  1.00 0.00 ? 99  GLU A HG2  1  
ATOM 522   H HG3  . GLU A 1 99  ? -13.051 5.611   -1.931  1.00 0.00 ? 99  GLU A HG3  1  
ATOM 523   N N    . VAL A 1 100 ? -11.726 1.610   0.866   1.00 0.00 ? 100 VAL A N    1  
ATOM 524   C CA   . VAL A 1 100 ? -11.206 1.007   2.062   1.00 0.00 ? 100 VAL A CA   1  
ATOM 525   C C    . VAL A 1 100 ? -9.707  1.036   2.009   1.00 0.00 ? 100 VAL A C    1  
ATOM 526   O O    . VAL A 1 100 ? -9.100  0.771   0.951   1.00 0.00 ? 100 VAL A O    1  
ATOM 527   C CB   . VAL A 1 100 ? -11.715 -0.438  2.332   1.00 0.00 ? 100 VAL A CB   1  
ATOM 528   C CG1  . VAL A 1 100 ? -13.186 -0.423  2.653   1.00 0.00 ? 100 VAL A CG1  1  
ATOM 529   C CG2  . VAL A 1 100 ? -11.450 -1.358  1.155   1.00 0.00 ? 100 VAL A CG2  1  
ATOM 530   H H    . VAL A 1 100 ? -11.434 1.284   -0.013  1.00 0.00 ? 100 VAL A H    1  
ATOM 531   H HA   . VAL A 1 100 ? -11.508 1.647   2.878   1.00 0.00 ? 100 VAL A HA   1  
ATOM 532   H HB   . VAL A 1 100 ? -11.188 -0.820  3.194   1.00 0.00 ? 100 VAL A HB   1  
ATOM 533   H HG11 . VAL A 1 100 ? -13.344 0.125   3.570   1.00 0.00 ? 100 VAL A HG11 1  
ATOM 534   H HG12 . VAL A 1 100 ? -13.545 -1.437  2.761   1.00 0.00 ? 100 VAL A HG12 1  
ATOM 535   H HG13 . VAL A 1 100 ? -13.717 0.068   1.850   1.00 0.00 ? 100 VAL A HG13 1  
ATOM 536   H HG21 . VAL A 1 100 ? -10.397 -1.350  0.917   1.00 0.00 ? 100 VAL A HG21 1  
ATOM 537   H HG22 . VAL A 1 100 ? -12.011 -0.990  0.310   1.00 0.00 ? 100 VAL A HG22 1  
ATOM 538   H HG23 . VAL A 1 100 ? -11.762 -2.363  1.398   1.00 0.00 ? 100 VAL A HG23 1  
ATOM 539   N N    . HIS A 1 101 ? -9.118  1.424   3.084   1.00 0.00 ? 101 HIS A N    1  
ATOM 540   C CA   . HIS A 1 101 ? -7.705  1.487   3.182   1.00 0.00 ? 101 HIS A CA   1  
ATOM 541   C C    . HIS A 1 101 ? -7.236  0.662   4.346   1.00 0.00 ? 101 HIS A C    1  
ATOM 542   O O    . HIS A 1 101 ? -7.679  0.853   5.463   1.00 0.00 ? 101 HIS A O    1  
ATOM 543   C CB   . HIS A 1 101 ? -7.209  2.936   3.337   1.00 0.00 ? 101 HIS A CB   1  
ATOM 544   C CG   . HIS A 1 101 ? -5.719  3.016   3.513   1.00 0.00 ? 101 HIS A CG   1  
ATOM 545   N ND1  . HIS A 1 101 ? -5.109  3.314   4.712   1.00 0.00 ? 101 HIS A ND1  1  
ATOM 546   C CD2  . HIS A 1 101 ? -4.725  2.774   2.645   1.00 0.00 ? 101 HIS A CD2  1  
ATOM 547   C CE1  . HIS A 1 101 ? -3.817  3.245   4.564   1.00 0.00 ? 101 HIS A CE1  1  
ATOM 548   N NE2  . HIS A 1 101 ? -3.560  2.920   3.324   1.00 0.00 ? 101 HIS A NE2  1  
ATOM 549   H H    . HIS A 1 101 ? -9.653  1.673   3.873   1.00 0.00 ? 101 HIS A H    1  
ATOM 550   H HA   . HIS A 1 101 ? -7.289  1.080   2.272   1.00 0.00 ? 101 HIS A HA   1  
ATOM 551   H HB2  . HIS A 1 101 ? -7.476  3.501   2.457   1.00 0.00 ? 101 HIS A HB2  1  
ATOM 552   H HB3  . HIS A 1 101 ? -7.674  3.380   4.205   1.00 0.00 ? 101 HIS A HB3  1  
ATOM 553   H HD1  . HIS A 1 101 ? -5.539  3.550   5.567   1.00 0.00 ? 101 HIS A HD1  1  
ATOM 554   H HD2  . HIS A 1 101 ? -4.840  2.508   1.604   1.00 0.00 ? 101 HIS A HD2  1  
ATOM 555   H HE1  . HIS A 1 101 ? -3.084  3.427   5.336   1.00 0.00 ? 101 HIS A HE1  1  
ATOM 556   H HE2  . HIS A 1 101 ? -2.657  2.786   2.937   1.00 0.00 ? 101 HIS A HE2  1  
ATOM 557   N N    . GLY A 1 102 ? -6.359  -0.246  4.066   1.00 0.00 ? 102 GLY A N    1  
ATOM 558   C CA   . GLY A 1 102 ? -5.730  -1.024  5.077   1.00 0.00 ? 102 GLY A CA   1  
ATOM 559   C C    . GLY A 1 102 ? -4.237  -0.884  4.954   1.00 0.00 ? 102 GLY A C    1  
ATOM 560   O O    . GLY A 1 102 ? -3.723  -0.789  3.838   1.00 0.00 ? 102 GLY A O    1  
ATOM 561   H H    . GLY A 1 102 ? -6.117  -0.426  3.128   1.00 0.00 ? 102 GLY A H    1  
ATOM 562   H HA2  . GLY A 1 102 ? -6.053  -0.677  6.048   1.00 0.00 ? 102 GLY A HA2  1  
ATOM 563   H HA3  . GLY A 1 102 ? -5.998  -2.062  4.954   1.00 0.00 ? 102 GLY A HA3  1  
ATOM 564   N N    . LYS A 1 103 ? -3.549  -0.840  6.061   1.00 0.00 ? 103 LYS A N    1  
ATOM 565   C CA   . LYS A 1 103 ? -2.102  -0.701  6.075   1.00 0.00 ? 103 LYS A CA   1  
ATOM 566   C C    . LYS A 1 103 ? -1.528  -1.537  7.211   1.00 0.00 ? 103 LYS A C    1  
ATOM 567   O O    . LYS A 1 103 ? -1.934  -1.381  8.349   1.00 0.00 ? 103 LYS A O    1  
ATOM 568   C CB   . LYS A 1 103 ? -1.712  0.779   6.263   1.00 0.00 ? 103 LYS A CB   1  
ATOM 569   C CG   . LYS A 1 103 ? -0.204  1.040   6.367   1.00 0.00 ? 103 LYS A CG   1  
ATOM 570   C CD   . LYS A 1 103 ? 0.117   2.532   6.467   1.00 0.00 ? 103 LYS A CD   1  
ATOM 571   C CE   . LYS A 1 103 ? -0.418  3.171   7.751   1.00 0.00 ? 103 LYS A CE   1  
ATOM 572   N NZ   . LYS A 1 103 ? 0.196   2.600   8.976   1.00 0.00 ? 103 LYS A NZ   1  
ATOM 573   H H    . LYS A 1 103 ? -4.032  -0.915  6.917   1.00 0.00 ? 103 LYS A H    1  
ATOM 574   H HA   . LYS A 1 103 ? -1.711  -1.055  5.133   1.00 0.00 ? 103 LYS A HA   1  
ATOM 575   H HB2  . LYS A 1 103 ? -2.096  1.346   5.427   1.00 0.00 ? 103 LYS A HB2  1  
ATOM 576   H HB3  . LYS A 1 103 ? -2.181  1.137   7.168   1.00 0.00 ? 103 LYS A HB3  1  
ATOM 577   H HG2  . LYS A 1 103 ? 0.166   0.551   7.256   1.00 0.00 ? 103 LYS A HG2  1  
ATOM 578   H HG3  . LYS A 1 103 ? 0.295   0.625   5.505   1.00 0.00 ? 103 LYS A HG3  1  
ATOM 579   H HD2  . LYS A 1 103 ? 1.188   2.660   6.438   1.00 0.00 ? 103 LYS A HD2  1  
ATOM 580   H HD3  . LYS A 1 103 ? -0.321  3.035   5.617   1.00 0.00 ? 103 LYS A HD3  1  
ATOM 581   H HE2  . LYS A 1 103 ? -0.209  4.230   7.723   1.00 0.00 ? 103 LYS A HE2  1  
ATOM 582   H HE3  . LYS A 1 103 ? -1.487  3.024   7.787   1.00 0.00 ? 103 LYS A HE3  1  
ATOM 583   H HZ1  . LYS A 1 103 ? 1.224   2.750   9.007   1.00 0.00 ? 103 LYS A HZ1  1  
ATOM 584   H HZ2  . LYS A 1 103 ? 0.012   1.579   9.063   1.00 0.00 ? 103 LYS A HZ2  1  
ATOM 585   H HZ3  . LYS A 1 103 ? -0.220  3.039   9.821   1.00 0.00 ? 103 LYS A HZ3  1  
ATOM 586   N N    . HIS A 1 104 ? -0.590  -2.392  6.911   1.00 0.00 ? 104 HIS A N    1  
ATOM 587   C CA   . HIS A 1 104 ? -0.021  -3.277  7.913   1.00 0.00 ? 104 HIS A CA   1  
ATOM 588   C C    . HIS A 1 104 ? 1.482   -3.333  7.778   1.00 0.00 ? 104 HIS A C    1  
ATOM 589   O O    . HIS A 1 104 ? 2.014   -3.318  6.667   1.00 0.00 ? 104 HIS A O    1  
ATOM 590   C CB   . HIS A 1 104 ? -0.660  -4.676  7.759   1.00 0.00 ? 104 HIS A CB   1  
ATOM 591   C CG   . HIS A 1 104 ? -0.117  -5.783  8.631   1.00 0.00 ? 104 HIS A CG   1  
ATOM 592   N ND1  . HIS A 1 104 ? -0.335  -5.863  9.980   1.00 0.00 ? 104 HIS A ND1  1  
ATOM 593   C CD2  . HIS A 1 104 ? 0.614   -6.876  8.312   1.00 0.00 ? 104 HIS A CD2  1  
ATOM 594   C CE1  . HIS A 1 104 ? 0.235   -6.947  10.452  1.00 0.00 ? 104 HIS A CE1  1  
ATOM 595   N NE2  . HIS A 1 104 ? 0.814   -7.578  9.463   1.00 0.00 ? 104 HIS A NE2  1  
ATOM 596   H H    . HIS A 1 104 ? -0.245  -2.444  5.988   1.00 0.00 ? 104 HIS A H    1  
ATOM 597   H HA   . HIS A 1 104 ? -0.276  -2.889  8.889   1.00 0.00 ? 104 HIS A HA   1  
ATOM 598   H HB2  . HIS A 1 104 ? -1.715  -4.599  7.974   1.00 0.00 ? 104 HIS A HB2  1  
ATOM 599   H HB3  . HIS A 1 104 ? -0.548  -4.982  6.730   1.00 0.00 ? 104 HIS A HB3  1  
ATOM 600   H HD1  . HIS A 1 104 ? -0.834  -5.218  10.529  1.00 0.00 ? 104 HIS A HD1  1  
ATOM 601   H HD2  . HIS A 1 104 ? 0.973   -7.143  7.328   1.00 0.00 ? 104 HIS A HD2  1  
ATOM 602   H HE1  . HIS A 1 104 ? 0.228   -7.264  11.483  1.00 0.00 ? 104 HIS A HE1  1  
ATOM 603   H HE2  . HIS A 1 104 ? 1.458   -8.312  9.574   1.00 0.00 ? 104 HIS A HE2  1  
ATOM 604   N N    . GLU A 1 105 ? 2.155   -3.366  8.904   1.00 0.00 ? 105 GLU A N    1  
ATOM 605   C CA   . GLU A 1 105 ? 3.584   -3.503  8.927   1.00 0.00 ? 105 GLU A CA   1  
ATOM 606   C C    . GLU A 1 105 ? 3.842   -5.007  8.800   1.00 0.00 ? 105 GLU A C    1  
ATOM 607   O O    . GLU A 1 105 ? 3.378   -5.798  9.628   1.00 0.00 ? 105 GLU A O    1  
ATOM 608   C CB   . GLU A 1 105 ? 4.112   -2.978  10.273  1.00 0.00 ? 105 GLU A CB   1  
ATOM 609   C CG   . GLU A 1 105 ? 5.618   -2.733  10.337  1.00 0.00 ? 105 GLU A CG   1  
ATOM 610   C CD   . GLU A 1 105 ? 6.064   -1.520  9.534   1.00 0.00 ? 105 GLU A CD   1  
ATOM 611   O OE1  . GLU A 1 105 ? 6.078   -0.388  10.078  1.00 0.00 ? 105 GLU A OE1  1  
ATOM 612   O OE2  . GLU A 1 105 ? 6.421   -1.655  8.377   1.00 0.00 ? 105 GLU A OE2  1  
ATOM 613   H H    . GLU A 1 105 ? 1.679   -3.322  9.761   1.00 0.00 ? 105 GLU A H    1  
ATOM 614   H HA   . GLU A 1 105 ? 4.021   -2.962  8.101   1.00 0.00 ? 105 GLU A HA   1  
ATOM 615   H HB2  . GLU A 1 105 ? 3.616   -2.044  10.493  1.00 0.00 ? 105 GLU A HB2  1  
ATOM 616   H HB3  . GLU A 1 105 ? 3.849   -3.694  11.037  1.00 0.00 ? 105 GLU A HB3  1  
ATOM 617   H HG2  . GLU A 1 105 ? 5.903   -2.581  11.367  1.00 0.00 ? 105 GLU A HG2  1  
ATOM 618   H HG3  . GLU A 1 105 ? 6.124   -3.606  9.951   1.00 0.00 ? 105 GLU A HG3  1  
ATOM 619   N N    . GLU A 1 106 ? 4.548   -5.376  7.783   1.00 0.00 ? 106 GLU A N    1  
ATOM 620   C CA   . GLU A 1 106 ? 4.778   -6.759  7.429   1.00 0.00 ? 106 GLU A CA   1  
ATOM 621   C C    . GLU A 1 106 ? 5.893   -7.348  8.235   1.00 0.00 ? 106 GLU A C    1  
ATOM 622   O O    . GLU A 1 106 ? 5.704   -8.297  8.989   1.00 0.00 ? 106 GLU A O    1  
ATOM 623   C CB   . GLU A 1 106 ? 5.163   -6.853  5.956   1.00 0.00 ? 106 GLU A CB   1  
ATOM 624   C CG   . GLU A 1 106 ? 4.074   -6.475  4.995   1.00 0.00 ? 106 GLU A CG   1  
ATOM 625   C CD   . GLU A 1 106 ? 2.940   -7.444  5.039   1.00 0.00 ? 106 GLU A CD   1  
ATOM 626   O OE1  . GLU A 1 106 ? 3.127   -8.598  4.594   1.00 0.00 ? 106 GLU A OE1  1  
ATOM 627   O OE2  . GLU A 1 106 ? 1.838   -7.082  5.499   1.00 0.00 ? 106 GLU A OE2  1  
ATOM 628   H H    . GLU A 1 106 ? 4.984   -4.676  7.243   1.00 0.00 ? 106 GLU A H    1  
ATOM 629   H HA   . GLU A 1 106 ? 3.869   -7.322  7.572   1.00 0.00 ? 106 GLU A HA   1  
ATOM 630   H HB2  . GLU A 1 106 ? 6.002   -6.196  5.779   1.00 0.00 ? 106 GLU A HB2  1  
ATOM 631   H HB3  . GLU A 1 106 ? 5.467   -7.868  5.745   1.00 0.00 ? 106 GLU A HB3  1  
ATOM 632   H HG2  . GLU A 1 106 ? 3.706   -5.493  5.252   1.00 0.00 ? 106 GLU A HG2  1  
ATOM 633   H HG3  . GLU A 1 106 ? 4.478   -6.459  3.994   1.00 0.00 ? 106 GLU A HG3  1  
ATOM 634   N N    . ARG A 1 107 ? 7.052   -6.788  8.059   1.00 0.00 ? 107 ARG A N    1  
ATOM 635   C CA   . ARG A 1 107 ? 8.255   -7.290  8.646   1.00 0.00 ? 107 ARG A CA   1  
ATOM 636   C C    . ARG A 1 107 ? 9.126   -6.143  9.089   1.00 0.00 ? 107 ARG A C    1  
ATOM 637   O O    . ARG A 1 107 ? 9.391   -5.235  8.327   1.00 0.00 ? 107 ARG A O    1  
ATOM 638   C CB   . ARG A 1 107 ? 8.967   -8.219  7.636   1.00 0.00 ? 107 ARG A CB   1  
ATOM 639   C CG   . ARG A 1 107 ? 8.325   -9.596  7.564   1.00 0.00 ? 107 ARG A CG   1  
ATOM 640   C CD   . ARG A 1 107 ? 8.826   -10.462 6.470   1.00 0.00 ? 107 ARG A CD   1  
ATOM 641   N NE   . ARG A 1 107 ? 8.264   -10.054 5.203   1.00 0.00 ? 107 ARG A NE   1  
ATOM 642   C CZ   . ARG A 1 107 ? 8.971   -9.763  4.158   1.00 0.00 ? 107 ARG A CZ   1  
ATOM 643   N NH1  . ARG A 1 107 ? 10.284  -9.823  4.218   1.00 0.00 ? 107 ARG A NH1  1  
ATOM 644   N NH2  . ARG A 1 107 ? 8.377   -9.407  3.037   1.00 0.00 ? 107 ARG A NH2  1  
ATOM 645   H H    . ARG A 1 107 ? 7.113   -5.970  7.519   1.00 0.00 ? 107 ARG A H    1  
ATOM 646   H HA   . ARG A 1 107 ? 7.978   -7.873  9.509   1.00 0.00 ? 107 ARG A HA   1  
ATOM 647   H HB2  . ARG A 1 107 ? 8.879   -7.771  6.659   1.00 0.00 ? 107 ARG A HB2  1  
ATOM 648   H HB3  . ARG A 1 107 ? 10.006  -8.327  7.910   1.00 0.00 ? 107 ARG A HB3  1  
ATOM 649   H HG2  . ARG A 1 107 ? 8.502   -10.105 8.498   1.00 0.00 ? 107 ARG A HG2  1  
ATOM 650   H HG3  . ARG A 1 107 ? 7.259   -9.459  7.446   1.00 0.00 ? 107 ARG A HG3  1  
ATOM 651   H HD2  . ARG A 1 107 ? 9.902   -10.392 6.437   1.00 0.00 ? 107 ARG A HD2  1  
ATOM 652   H HD3  . ARG A 1 107 ? 8.538   -11.484 6.671   1.00 0.00 ? 107 ARG A HD3  1  
ATOM 653   H HE   . ARG A 1 107 ? 7.281   -10.013 5.170   1.00 0.00 ? 107 ARG A HE   1  
ATOM 654   H HH11 . ARG A 1 107 ? 10.809  -10.096 5.024   1.00 0.00 ? 107 ARG A HH11 1  
ATOM 655   H HH12 . ARG A 1 107 ? 10.823  -9.529  3.416   1.00 0.00 ? 107 ARG A HH12 1  
ATOM 656   H HH21 . ARG A 1 107 ? 7.379   -9.346  2.943   1.00 0.00 ? 107 ARG A HH21 1  
ATOM 657   H HH22 . ARG A 1 107 ? 8.970   -9.200  2.243   1.00 0.00 ? 107 ARG A HH22 1  
ATOM 658   N N    . GLN A 1 108 ? 9.496   -6.152  10.335  1.00 0.00 ? 108 GLN A N    1  
ATOM 659   C CA   . GLN A 1 108 ? 10.329  -5.103  10.891  1.00 0.00 ? 108 GLN A CA   1  
ATOM 660   C C    . GLN A 1 108 ? 11.754  -5.620  11.013  1.00 0.00 ? 108 GLN A C    1  
ATOM 661   O O    . GLN A 1 108 ? 11.963  -6.733  11.512  1.00 0.00 ? 108 GLN A O    1  
ATOM 662   C CB   . GLN A 1 108 ? 9.784   -4.686  12.267  1.00 0.00 ? 108 GLN A CB   1  
ATOM 663   C CG   . GLN A 1 108 ? 8.315   -4.266  12.235  1.00 0.00 ? 108 GLN A CG   1  
ATOM 664   C CD   . GLN A 1 108 ? 7.784   -3.827  13.587  1.00 0.00 ? 108 GLN A CD   1  
ATOM 665   O OE1  . GLN A 1 108 ? 7.284   -4.641  14.376  1.00 0.00 ? 108 GLN A OE1  1  
ATOM 666   N NE2  . GLN A 1 108 ? 7.835   -2.549  13.854  1.00 0.00 ? 108 GLN A NE2  1  
ATOM 667   H H    . GLN A 1 108 ? 9.195   -6.889  10.909  1.00 0.00 ? 108 GLN A H    1  
ATOM 668   H HA   . GLN A 1 108 ? 10.305  -4.256  10.223  1.00 0.00 ? 108 GLN A HA   1  
ATOM 669   H HB2  . GLN A 1 108 ? 9.882   -5.520  12.946  1.00 0.00 ? 108 GLN A HB2  1  
ATOM 670   H HB3  . GLN A 1 108 ? 10.368  -3.859  12.642  1.00 0.00 ? 108 GLN A HB3  1  
ATOM 671   H HG2  . GLN A 1 108 ? 8.199   -3.448  11.540  1.00 0.00 ? 108 GLN A HG2  1  
ATOM 672   H HG3  . GLN A 1 108 ? 7.728   -5.103  11.889  1.00 0.00 ? 108 GLN A HG3  1  
ATOM 673   H HE21 . GLN A 1 108 ? 8.197   -1.923  13.186  1.00 0.00 ? 108 GLN A HE21 1  
ATOM 674   H HE22 . GLN A 1 108 ? 7.507   -2.227  14.719  1.00 0.00 ? 108 GLN A HE22 1  
ATOM 675   N N    . ASP A 1 109 ? 12.712  -4.862  10.545  1.00 0.00 ? 109 ASP A N    1  
ATOM 676   C CA   . ASP A 1 109 ? 14.107  -5.268  10.593  1.00 0.00 ? 109 ASP A CA   1  
ATOM 677   C C    . ASP A 1 109 ? 14.996  -4.076  10.939  1.00 0.00 ? 109 ASP A C    1  
ATOM 678   O O    . ASP A 1 109 ? 14.488  -2.965  11.065  1.00 0.00 ? 109 ASP A O    1  
ATOM 679   C CB   . ASP A 1 109 ? 14.556  -5.898  9.247   1.00 0.00 ? 109 ASP A CB   1  
ATOM 680   C CG   . ASP A 1 109 ? 14.702  -4.927  8.069   1.00 0.00 ? 109 ASP A CG   1  
ATOM 681   O OD1  . ASP A 1 109 ? 15.795  -4.290  7.950   1.00 0.00 ? 109 ASP A OD1  1  
ATOM 682   O OD2  . ASP A 1 109 ? 13.800  -4.852  7.227   1.00 0.00 ? 109 ASP A OD2  1  
ATOM 683   H H    . ASP A 1 109 ? 12.524  -3.989  10.125  1.00 0.00 ? 109 ASP A H    1  
ATOM 684   H HA   . ASP A 1 109 ? 14.204  -6.008  11.373  1.00 0.00 ? 109 ASP A HA   1  
ATOM 685   H HB2  . ASP A 1 109 ? 15.514  -6.374  9.395   1.00 0.00 ? 109 ASP A HB2  1  
ATOM 686   H HB3  . ASP A 1 109 ? 13.836  -6.656  8.977   1.00 0.00 ? 109 ASP A HB3  1  
ATOM 687   N N    . GLU A 1 110 ? 16.302  -4.363  11.180  1.00 0.00 ? 110 GLU A N    1  
ATOM 688   C CA   . GLU A 1 110 ? 17.422  -3.395  11.439  1.00 0.00 ? 110 GLU A CA   1  
ATOM 689   C C    . GLU A 1 110 ? 16.961  -1.948  11.750  1.00 0.00 ? 110 GLU A C    1  
ATOM 690   O O    . GLU A 1 110 ? 16.835  -1.543  12.910  1.00 0.00 ? 110 GLU A O    1  
ATOM 691   C CB   . GLU A 1 110 ? 18.403  -3.418  10.240  1.00 0.00 ? 110 GLU A CB   1  
ATOM 692   C CG   . GLU A 1 110 ? 19.640  -2.541  10.387  1.00 0.00 ? 110 GLU A CG   1  
ATOM 693   C CD   . GLU A 1 110 ? 20.536  -2.985  11.505  1.00 0.00 ? 110 GLU A CD   1  
ATOM 694   O OE1  . GLU A 1 110 ? 20.318  -2.581  12.648  1.00 0.00 ? 110 GLU A OE1  1  
ATOM 695   O OE2  . GLU A 1 110 ? 21.467  -3.784  11.251  1.00 0.00 ? 110 GLU A OE2  1  
ATOM 696   H H    . GLU A 1 110 ? 16.548  -5.311  11.196  1.00 0.00 ? 110 GLU A H    1  
ATOM 697   H HA   . GLU A 1 110 ? 17.954  -3.758  12.305  1.00 0.00 ? 110 GLU A HA   1  
ATOM 698   H HB2  . GLU A 1 110 ? 18.740  -4.434  10.099  1.00 0.00 ? 110 GLU A HB2  1  
ATOM 699   H HB3  . GLU A 1 110 ? 17.869  -3.109  9.354   1.00 0.00 ? 110 GLU A HB3  1  
ATOM 700   H HG2  . GLU A 1 110 ? 20.202  -2.579  9.466   1.00 0.00 ? 110 GLU A HG2  1  
ATOM 701   H HG3  . GLU A 1 110 ? 19.320  -1.526  10.574  1.00 0.00 ? 110 GLU A HG3  1  
ATOM 702   N N    . HIS A 1 111 ? 16.714  -1.207  10.695  1.00 0.00 ? 111 HIS A N    1  
ATOM 703   C CA   . HIS A 1 111 ? 16.182  0.147   10.726  1.00 0.00 ? 111 HIS A CA   1  
ATOM 704   C C    . HIS A 1 111 ? 15.327  0.280   9.519   1.00 0.00 ? 111 HIS A C    1  
ATOM 705   O O    . HIS A 1 111 ? 15.197  1.355   8.921   1.00 0.00 ? 111 HIS A O    1  
ATOM 706   C CB   . HIS A 1 111 ? 17.288  1.227   10.694  1.00 0.00 ? 111 HIS A CB   1  
ATOM 707   C CG   . HIS A 1 111 ? 18.073  1.390   11.959  1.00 0.00 ? 111 HIS A CG   1  
ATOM 708   N ND1  . HIS A 1 111 ? 17.682  2.225   12.974  1.00 0.00 ? 111 HIS A ND1  1  
ATOM 709   C CD2  . HIS A 1 111 ? 19.247  0.842   12.360  1.00 0.00 ? 111 HIS A CD2  1  
ATOM 710   C CE1  . HIS A 1 111 ? 18.570  2.190   13.935  1.00 0.00 ? 111 HIS A CE1  1  
ATOM 711   N NE2  . HIS A 1 111 ? 19.531  1.361   13.592  1.00 0.00 ? 111 HIS A NE2  1  
ATOM 712   H H    . HIS A 1 111 ? 16.880  -1.601  9.812   1.00 0.00 ? 111 HIS A H    1  
ATOM 713   H HA   . HIS A 1 111 ? 15.572  0.256   11.611  1.00 0.00 ? 111 HIS A HA   1  
ATOM 714   H HB2  . HIS A 1 111 ? 17.991  0.969   9.917   1.00 0.00 ? 111 HIS A HB2  1  
ATOM 715   H HB3  . HIS A 1 111 ? 16.835  2.178   10.452  1.00 0.00 ? 111 HIS A HB3  1  
ATOM 716   H HD1  . HIS A 1 111 ? 16.866  2.775   12.995  1.00 0.00 ? 111 HIS A HD1  1  
ATOM 717   H HD2  . HIS A 1 111 ? 19.848  0.132   11.811  1.00 0.00 ? 111 HIS A HD2  1  
ATOM 718   H HE1  . HIS A 1 111 ? 18.516  2.752   14.855  1.00 0.00 ? 111 HIS A HE1  1  
ATOM 719   H HE2  . HIS A 1 111 ? 20.450  1.469   13.925  1.00 0.00 ? 111 HIS A HE2  1  
ATOM 720   N N    . GLY A 1 112 ? 14.778  -0.842  9.146   1.00 0.00 ? 112 GLY A N    1  
ATOM 721   C CA   . GLY A 1 112 ? 13.989  -0.946  7.991   1.00 0.00 ? 112 GLY A CA   1  
ATOM 722   C C    . GLY A 1 112 ? 12.741  -1.656  8.316   1.00 0.00 ? 112 GLY A C    1  
ATOM 723   O O    . GLY A 1 112 ? 12.752  -2.656  8.982   1.00 0.00 ? 112 GLY A O    1  
ATOM 724   H H    . GLY A 1 112 ? 14.854  -1.645  9.711   1.00 0.00 ? 112 GLY A H    1  
ATOM 725   H HA2  . GLY A 1 112 ? 13.774  0.049   7.628   1.00 0.00 ? 112 GLY A HA2  1  
ATOM 726   H HA3  . GLY A 1 112 ? 14.528  -1.496  7.233   1.00 0.00 ? 112 GLY A HA3  1  
ATOM 727   N N    . PHE A 1 113 ? 11.691  -1.126  7.930   1.00 0.00 ? 113 PHE A N    1  
ATOM 728   C CA   . PHE A 1 113 ? 10.450  -1.717  8.204   1.00 0.00 ? 113 PHE A CA   1  
ATOM 729   C C    . PHE A 1 113 ? 9.804   -1.965  6.895   1.00 0.00 ? 113 PHE A C    1  
ATOM 730   O O    . PHE A 1 113 ? 10.022  -1.196  5.952   1.00 0.00 ? 113 PHE A O    1  
ATOM 731   C CB   . PHE A 1 113 ? 9.605   -0.778  9.067   1.00 0.00 ? 113 PHE A CB   1  
ATOM 732   C CG   . PHE A 1 113 ? 10.305  -0.342  10.323  1.00 0.00 ? 113 PHE A CG   1  
ATOM 733   C CD1  . PHE A 1 113 ? 10.348  -1.167  11.425  1.00 0.00 ? 113 PHE A CD1  1  
ATOM 734   C CD2  . PHE A 1 113 ? 10.946  0.886   10.385  1.00 0.00 ? 113 PHE A CD2  1  
ATOM 735   C CE1  . PHE A 1 113 ? 11.008  -0.782  12.571  1.00 0.00 ? 113 PHE A CE1  1  
ATOM 736   C CE2  . PHE A 1 113 ? 11.612  1.275   11.526  1.00 0.00 ? 113 PHE A CE2  1  
ATOM 737   C CZ   . PHE A 1 113 ? 11.642  0.440   12.621  1.00 0.00 ? 113 PHE A CZ   1  
ATOM 738   H H    . PHE A 1 113 ? 11.743  -0.297  7.404   1.00 0.00 ? 113 PHE A H    1  
ATOM 739   H HA   . PHE A 1 113 ? 10.606  -2.648  8.728   1.00 0.00 ? 113 PHE A HA   1  
ATOM 740   H HB2  . PHE A 1 113 ? 9.365   0.103   8.492   1.00 0.00 ? 113 PHE A HB2  1  
ATOM 741   H HB3  . PHE A 1 113 ? 8.690   -1.279  9.348   1.00 0.00 ? 113 PHE A HB3  1  
ATOM 742   H HD1  . PHE A 1 113 ? 9.851   -2.124  11.388  1.00 0.00 ? 113 PHE A HD1  1  
ATOM 743   H HD2  . PHE A 1 113 ? 10.920  1.543   9.527   1.00 0.00 ? 113 PHE A HD2  1  
ATOM 744   H HE1  . PHE A 1 113 ? 11.030  -1.437  13.429  1.00 0.00 ? 113 PHE A HE1  1  
ATOM 745   H HE2  . PHE A 1 113 ? 12.109  2.234   11.561  1.00 0.00 ? 113 PHE A HE2  1  
ATOM 746   H HZ   . PHE A 1 113 ? 12.165  0.742   13.517  1.00 0.00 ? 113 PHE A HZ   1  
ATOM 747   N N    . ILE A 1 114 ? 9.013   -2.963  6.795   1.00 0.00 ? 114 ILE A N    1  
ATOM 748   C CA   . ILE A 1 114 ? 8.393   -3.265  5.549   1.00 0.00 ? 114 ILE A CA   1  
ATOM 749   C C    . ILE A 1 114 ? 6.916   -3.268  5.786   1.00 0.00 ? 114 ILE A C    1  
ATOM 750   O O    . ILE A 1 114 ? 6.454   -3.906  6.713   1.00 0.00 ? 114 ILE A O    1  
ATOM 751   C CB   . ILE A 1 114 ? 8.775   -4.686  5.070   1.00 0.00 ? 114 ILE A CB   1  
ATOM 752   C CG1  . ILE A 1 114 ? 10.260  -4.958  5.231   1.00 0.00 ? 114 ILE A CG1  1  
ATOM 753   C CG2  . ILE A 1 114 ? 8.366   -4.850  3.606   1.00 0.00 ? 114 ILE A CG2  1  
ATOM 754   C CD1  . ILE A 1 114 ? 10.664  -6.348  4.841   1.00 0.00 ? 114 ILE A CD1  1  
ATOM 755   H H    . ILE A 1 114 ? 8.832   -3.539  7.572   1.00 0.00 ? 114 ILE A H    1  
ATOM 756   H HA   . ILE A 1 114 ? 8.675   -2.545  4.797   1.00 0.00 ? 114 ILE A HA   1  
ATOM 757   H HB   . ILE A 1 114 ? 8.208   -5.396  5.656   1.00 0.00 ? 114 ILE A HB   1  
ATOM 758   H HG12 . ILE A 1 114 ? 10.820  -4.274  4.614   1.00 0.00 ? 114 ILE A HG12 1  
ATOM 759   H HG13 . ILE A 1 114 ? 10.534  -4.811  6.265   1.00 0.00 ? 114 ILE A HG13 1  
ATOM 760   H HG21 . ILE A 1 114 ? 8.870   -4.107  3.005   1.00 0.00 ? 114 ILE A HG21 1  
ATOM 761   H HG22 . ILE A 1 114 ? 7.298   -4.722  3.511   1.00 0.00 ? 114 ILE A HG22 1  
ATOM 762   H HG23 . ILE A 1 114 ? 8.642   -5.837  3.263   1.00 0.00 ? 114 ILE A HG23 1  
ATOM 763   H HD11 . ILE A 1 114 ? 10.211  -7.066  5.503   1.00 0.00 ? 114 ILE A HD11 1  
ATOM 764   H HD12 . ILE A 1 114 ? 11.739  -6.433  4.911   1.00 0.00 ? 114 ILE A HD12 1  
ATOM 765   H HD13 . ILE A 1 114 ? 10.351  -6.546  3.826   1.00 0.00 ? 114 ILE A HD13 1  
ATOM 766   N N    . SER A 1 115 ? 6.176   -2.617  4.935   1.00 0.00 ? 115 SER A N    1  
ATOM 767   C CA   . SER A 1 115 ? 4.760   -2.485  5.090   1.00 0.00 ? 115 SER A CA   1  
ATOM 768   C C    . SER A 1 115 ? 4.048   -2.883  3.805   1.00 0.00 ? 115 SER A C    1  
ATOM 769   O O    . SER A 1 115 ? 4.638   -2.864  2.712   1.00 0.00 ? 115 SER A O    1  
ATOM 770   C CB   . SER A 1 115 ? 4.416   -1.022  5.382   1.00 0.00 ? 115 SER A CB   1  
ATOM 771   O OG   . SER A 1 115 ? 5.186   -0.485  6.454   1.00 0.00 ? 115 SER A OG   1  
ATOM 772   H H    . SER A 1 115 ? 6.573   -2.178  4.149   1.00 0.00 ? 115 SER A H    1  
ATOM 773   H HA   . SER A 1 115 ? 4.422   -3.088  5.918   1.00 0.00 ? 115 SER A HA   1  
ATOM 774   H HB2  . SER A 1 115 ? 4.605   -0.430  4.499   1.00 0.00 ? 115 SER A HB2  1  
ATOM 775   H HB3  . SER A 1 115 ? 3.368   -0.950  5.637   1.00 0.00 ? 115 SER A HB3  1  
ATOM 776   H HG   . SER A 1 115 ? 5.571   -1.207  6.990   1.00 0.00 ? 115 SER A HG   1  
ATOM 777   N N    . ARG A 1 116 ? 2.804   -3.223  3.941   1.00 0.00 ? 116 ARG A N    1  
ATOM 778   C CA   . ARG A 1 116 ? 1.950   -3.519  2.836   1.00 0.00 ? 116 ARG A CA   1  
ATOM 779   C C    . ARG A 1 116 ? 0.647   -2.793  3.066   1.00 0.00 ? 116 ARG A C    1  
ATOM 780   O O    . ARG A 1 116 ? 0.233   -2.601  4.215   1.00 0.00 ? 116 ARG A O    1  
ATOM 781   C CB   . ARG A 1 116 ? 1.724   -5.034  2.750   1.00 0.00 ? 116 ARG A CB   1  
ATOM 782   C CG   . ARG A 1 116 ? 0.650   -5.499  1.767   1.00 0.00 ? 116 ARG A CG   1  
ATOM 783   C CD   . ARG A 1 116 ? 0.513   -7.013  1.789   1.00 0.00 ? 116 ARG A CD   1  
ATOM 784   N NE   . ARG A 1 116 ? 0.415   -7.525  3.159   1.00 0.00 ? 116 ARG A NE   1  
ATOM 785   C CZ   . ARG A 1 116 ? -0.288  -8.566  3.574   1.00 0.00 ? 116 ARG A CZ   1  
ATOM 786   N NH1  . ARG A 1 116 ? -1.038  -9.263  2.736   1.00 0.00 ? 116 ARG A NH1  1  
ATOM 787   N NH2  . ARG A 1 116 ? -0.193  -8.924  4.848   1.00 0.00 ? 116 ARG A NH2  1  
ATOM 788   H H    . ARG A 1 116 ? 2.412   -3.271  4.843   1.00 0.00 ? 116 ARG A H    1  
ATOM 789   H HA   . ARG A 1 116 ? 2.414   -3.166  1.928   1.00 0.00 ? 116 ARG A HA   1  
ATOM 790   H HB2  . ARG A 1 116 ? 2.655   -5.503  2.466   1.00 0.00 ? 116 ARG A HB2  1  
ATOM 791   H HB3  . ARG A 1 116 ? 1.453   -5.380  3.736   1.00 0.00 ? 116 ARG A HB3  1  
ATOM 792   H HG2  . ARG A 1 116 ? -0.294  -5.055  2.044   1.00 0.00 ? 116 ARG A HG2  1  
ATOM 793   H HG3  . ARG A 1 116 ? 0.921   -5.182  0.770   1.00 0.00 ? 116 ARG A HG3  1  
ATOM 794   H HD2  . ARG A 1 116 ? -0.373  -7.294  1.240   1.00 0.00 ? 116 ARG A HD2  1  
ATOM 795   H HD3  . ARG A 1 116 ? 1.383   -7.444  1.316   1.00 0.00 ? 116 ARG A HD3  1  
ATOM 796   H HE   . ARG A 1 116 ? 0.964   -7.069  3.843   1.00 0.00 ? 116 ARG A HE   1  
ATOM 797   H HH11 . ARG A 1 116 ? -1.126  -9.062  1.758   1.00 0.00 ? 116 ARG A HH11 1  
ATOM 798   H HH12 . ARG A 1 116 ? -1.567  -10.053 3.053   1.00 0.00 ? 116 ARG A HH12 1  
ATOM 799   H HH21 . ARG A 1 116 ? 0.427   -8.390  5.442   1.00 0.00 ? 116 ARG A HH21 1  
ATOM 800   H HH22 . ARG A 1 116 ? -0.695  -9.687  5.263   1.00 0.00 ? 116 ARG A HH22 1  
ATOM 801   N N    . GLU A 1 117 ? 0.015   -2.399  2.011   1.00 0.00 ? 117 GLU A N    1  
ATOM 802   C CA   . GLU A 1 117 ? -1.234  -1.707  2.089   1.00 0.00 ? 117 GLU A CA   1  
ATOM 803   C C    . GLU A 1 117 ? -2.213  -2.321  1.124   1.00 0.00 ? 117 GLU A C    1  
ATOM 804   O O    . GLU A 1 117 ? -1.814  -2.884  0.101   1.00 0.00 ? 117 GLU A O    1  
ATOM 805   C CB   . GLU A 1 117 ? -1.069  -0.213  1.757   1.00 0.00 ? 117 GLU A CB   1  
ATOM 806   C CG   . GLU A 1 117 ? -0.186  0.568   2.716   1.00 0.00 ? 117 GLU A CG   1  
ATOM 807   C CD   . GLU A 1 117 ? -0.093  2.032   2.362   1.00 0.00 ? 117 GLU A CD   1  
ATOM 808   O OE1  . GLU A 1 117 ? -1.129  2.732   2.398   1.00 0.00 ? 117 GLU A OE1  1  
ATOM 809   O OE2  . GLU A 1 117 ? 1.000   2.524   2.037   1.00 0.00 ? 117 GLU A OE2  1  
ATOM 810   H H    . GLU A 1 117 ? 0.404   -2.577  1.125   1.00 0.00 ? 117 GLU A H    1  
ATOM 811   H HA   . GLU A 1 117 ? -1.616  -1.798  3.095   1.00 0.00 ? 117 GLU A HA   1  
ATOM 812   H HB2  . GLU A 1 117 ? -0.654  -0.119  0.766   1.00 0.00 ? 117 GLU A HB2  1  
ATOM 813   H HB3  . GLU A 1 117 ? -2.050  0.240   1.759   1.00 0.00 ? 117 GLU A HB3  1  
ATOM 814   H HG2  . GLU A 1 117 ? -0.612  0.485   3.705   1.00 0.00 ? 117 GLU A HG2  1  
ATOM 815   H HG3  . GLU A 1 117 ? 0.805   0.140   2.713   1.00 0.00 ? 117 GLU A HG3  1  
ATOM 816   N N    . PHE A 1 118 ? -3.458  -2.248  1.467   1.00 0.00 ? 118 PHE A N    1  
ATOM 817   C CA   . PHE A 1 118 ? -4.538  -2.652  0.612   1.00 0.00 ? 118 PHE A CA   1  
ATOM 818   C C    . PHE A 1 118 ? -5.487  -1.507  0.494   1.00 0.00 ? 118 PHE A C    1  
ATOM 819   O O    . PHE A 1 118 ? -5.937  -0.949  1.494   1.00 0.00 ? 118 PHE A O    1  
ATOM 820   C CB   . PHE A 1 118 ? -5.288  -3.888  1.129   1.00 0.00 ? 118 PHE A CB   1  
ATOM 821   C CG   . PHE A 1 118 ? -4.736  -5.215  0.677   1.00 0.00 ? 118 PHE A CG   1  
ATOM 822   C CD1  . PHE A 1 118 ? -5.170  -5.774  -0.515  1.00 0.00 ? 118 PHE A CD1  1  
ATOM 823   C CD2  . PHE A 1 118 ? -3.820  -5.911  1.441   1.00 0.00 ? 118 PHE A CD2  1  
ATOM 824   C CE1  . PHE A 1 118 ? -4.698  -7.000  -0.936  1.00 0.00 ? 118 PHE A CE1  1  
ATOM 825   C CE2  . PHE A 1 118 ? -3.340  -7.137  1.025   1.00 0.00 ? 118 PHE A CE2  1  
ATOM 826   C CZ   . PHE A 1 118 ? -3.781  -7.683  -0.165  1.00 0.00 ? 118 PHE A CZ   1  
ATOM 827   H H    . PHE A 1 118 ? -3.679  -1.860  2.344   1.00 0.00 ? 118 PHE A H    1  
ATOM 828   H HA   . PHE A 1 118 ? -4.126  -2.864  -0.365  1.00 0.00 ? 118 PHE A HA   1  
ATOM 829   H HB2  . PHE A 1 118 ? -5.269  -3.883  2.208   1.00 0.00 ? 118 PHE A HB2  1  
ATOM 830   H HB3  . PHE A 1 118 ? -6.316  -3.827  0.803   1.00 0.00 ? 118 PHE A HB3  1  
ATOM 831   H HD1  . PHE A 1 118 ? -5.886  -5.238  -1.120  1.00 0.00 ? 118 PHE A HD1  1  
ATOM 832   H HD2  . PHE A 1 118 ? -3.475  -5.485  2.371   1.00 0.00 ? 118 PHE A HD2  1  
ATOM 833   H HE1  . PHE A 1 118 ? -5.044  -7.423  -1.867  1.00 0.00 ? 118 PHE A HE1  1  
ATOM 834   H HE2  . PHE A 1 118 ? -2.623  -7.670  1.632   1.00 0.00 ? 118 PHE A HE2  1  
ATOM 835   H HZ   . PHE A 1 118 ? -3.408  -8.644  -0.490  1.00 0.00 ? 118 PHE A HZ   1  
ATOM 836   N N    . HIS A 1 119 ? -5.754  -1.122  -0.701  1.00 0.00 ? 119 HIS A N    1  
ATOM 837   C CA   . HIS A 1 119 ? -6.670  -0.059  -0.962  1.00 0.00 ? 119 HIS A CA   1  
ATOM 838   C C    . HIS A 1 119 ? -7.641  -0.476  -2.037  1.00 0.00 ? 119 HIS A C    1  
ATOM 839   O O    . HIS A 1 119 ? -7.239  -0.807  -3.136  1.00 0.00 ? 119 HIS A O    1  
ATOM 840   C CB   . HIS A 1 119 ? -5.901  1.226   -1.358  1.00 0.00 ? 119 HIS A CB   1  
ATOM 841   C CG   . HIS A 1 119 ? -6.753  2.385   -1.834  1.00 0.00 ? 119 HIS A CG   1  
ATOM 842   N ND1  . HIS A 1 119 ? -6.544  3.002   -3.042  1.00 0.00 ? 119 HIS A ND1  1  
ATOM 843   C CD2  . HIS A 1 119 ? -7.790  3.051   -1.256  1.00 0.00 ? 119 HIS A CD2  1  
ATOM 844   C CE1  . HIS A 1 119 ? -7.399  3.980   -3.195  1.00 0.00 ? 119 HIS A CE1  1  
ATOM 845   N NE2  . HIS A 1 119 ? -8.163  4.034   -2.139  1.00 0.00 ? 119 HIS A NE2  1  
ATOM 846   H H    . HIS A 1 119 ? -5.337  -1.589  -1.462  1.00 0.00 ? 119 HIS A H    1  
ATOM 847   H HA   . HIS A 1 119 ? -7.220  0.136   -0.054  1.00 0.00 ? 119 HIS A HA   1  
ATOM 848   H HB2  . HIS A 1 119 ? -5.343  1.571   -0.502  1.00 0.00 ? 119 HIS A HB2  1  
ATOM 849   H HB3  . HIS A 1 119 ? -5.205  0.978   -2.147  1.00 0.00 ? 119 HIS A HB3  1  
ATOM 850   H HD1  . HIS A 1 119 ? -5.847  2.778   -3.699  1.00 0.00 ? 119 HIS A HD1  1  
ATOM 851   H HD2  . HIS A 1 119 ? -8.232  2.847   -0.291  1.00 0.00 ? 119 HIS A HD2  1  
ATOM 852   H HE1  . HIS A 1 119 ? -7.462  4.631   -4.054  1.00 0.00 ? 119 HIS A HE1  1  
ATOM 853   H HE2  . HIS A 1 119 ? -8.893  4.702   -2.060  1.00 0.00 ? 119 HIS A HE2  1  
ATOM 854   N N    . ARG A 1 120 ? -8.896  -0.446  -1.739  1.00 0.00 ? 120 ARG A N    1  
ATOM 855   C CA   . ARG A 1 120 ? -9.875  -0.709  -2.749  1.00 0.00 ? 120 ARG A CA   1  
ATOM 856   C C    . ARG A 1 120 ? -10.597 0.573   -2.979  1.00 0.00 ? 120 ARG A C    1  
ATOM 857   O O    . ARG A 1 120 ? -10.908 1.282   -2.025  1.00 0.00 ? 120 ARG A O    1  
ATOM 858   C CB   . ARG A 1 120 ? -10.822 -1.858  -2.344  1.00 0.00 ? 120 ARG A CB   1  
ATOM 859   C CG   . ARG A 1 120 ? -11.882 -2.215  -3.388  1.00 0.00 ? 120 ARG A CG   1  
ATOM 860   C CD   . ARG A 1 120 ? -12.586 -3.529  -3.039  1.00 0.00 ? 120 ARG A CD   1  
ATOM 861   N NE   . ARG A 1 120 ? -13.618 -3.904  -4.027  1.00 0.00 ? 120 ARG A NE   1  
ATOM 862   C CZ   . ARG A 1 120 ? -14.254 -5.102  -4.101  1.00 0.00 ? 120 ARG A CZ   1  
ATOM 863   N NH1  . ARG A 1 120 ? -13.750 -6.171  -3.518  1.00 0.00 ? 120 ARG A NH1  1  
ATOM 864   N NH2  . ARG A 1 120 ? -15.314 -5.242  -4.864  1.00 0.00 ? 120 ARG A NH2  1  
ATOM 865   H H    . ARG A 1 120 ? -9.172  -0.216  -0.824  1.00 0.00 ? 120 ARG A H    1  
ATOM 866   H HA   . ARG A 1 120 ? -9.345  -0.964  -3.654  1.00 0.00 ? 120 ARG A HA   1  
ATOM 867   H HB2  . ARG A 1 120 ? -10.238 -2.742  -2.138  1.00 0.00 ? 120 ARG A HB2  1  
ATOM 868   H HB3  . ARG A 1 120 ? -11.332 -1.570  -1.438  1.00 0.00 ? 120 ARG A HB3  1  
ATOM 869   H HG2  . ARG A 1 120 ? -12.616 -1.422  -3.405  1.00 0.00 ? 120 ARG A HG2  1  
ATOM 870   H HG3  . ARG A 1 120 ? -11.420 -2.286  -4.362  1.00 0.00 ? 120 ARG A HG3  1  
ATOM 871   H HD2  . ARG A 1 120 ? -11.855 -4.320  -2.971  1.00 0.00 ? 120 ARG A HD2  1  
ATOM 872   H HD3  . ARG A 1 120 ? -13.055 -3.407  -2.075  1.00 0.00 ? 120 ARG A HD3  1  
ATOM 873   H HE   . ARG A 1 120 ? -13.902 -3.183  -4.633  1.00 0.00 ? 120 ARG A HE   1  
ATOM 874   H HH11 . ARG A 1 120 ? -12.888 -6.222  -3.013  1.00 0.00 ? 120 ARG A HH11 1  
ATOM 875   H HH12 . ARG A 1 120 ? -14.237 -7.049  -3.550  1.00 0.00 ? 120 ARG A HH12 1  
ATOM 876   H HH21 . ARG A 1 120 ? -15.688 -4.488  -5.415  1.00 0.00 ? 120 ARG A HH21 1  
ATOM 877   H HH22 . ARG A 1 120 ? -15.828 -6.099  -4.943  1.00 0.00 ? 120 ARG A HH22 1  
ATOM 878   N N    . LYS A 1 121 ? -10.840 0.878   -4.207  1.00 0.00 ? 121 LYS A N    1  
ATOM 879   C CA   . LYS A 1 121 ? -11.393 2.153   -4.575  1.00 0.00 ? 121 LYS A CA   1  
ATOM 880   C C    . LYS A 1 121 ? -12.587 1.977   -5.477  1.00 0.00 ? 121 LYS A C    1  
ATOM 881   O O    . LYS A 1 121 ? -12.528 1.247   -6.446  1.00 0.00 ? 121 LYS A O    1  
ATOM 882   C CB   . LYS A 1 121 ? -10.301 3.018   -5.265  1.00 0.00 ? 121 LYS A CB   1  
ATOM 883   C CG   . LYS A 1 121 ? -9.626  2.355   -6.483  1.00 0.00 ? 121 LYS A CG   1  
ATOM 884   C CD   . LYS A 1 121 ? -8.560  3.253   -7.110  1.00 0.00 ? 121 LYS A CD   1  
ATOM 885   C CE   . LYS A 1 121 ? -7.915  2.610   -8.353  1.00 0.00 ? 121 LYS A CE   1  
ATOM 886   N NZ   . LYS A 1 121 ? -7.169  1.356   -8.044  1.00 0.00 ? 121 LYS A NZ   1  
ATOM 887   H H    . LYS A 1 121 ? -10.671 0.220   -4.922  1.00 0.00 ? 121 LYS A H    1  
ATOM 888   H HA   . LYS A 1 121 ? -11.701 2.657   -3.672  1.00 0.00 ? 121 LYS A HA   1  
ATOM 889   H HB2  . LYS A 1 121 ? -10.752 3.942   -5.595  1.00 0.00 ? 121 LYS A HB2  1  
ATOM 890   H HB3  . LYS A 1 121 ? -9.535  3.249   -4.540  1.00 0.00 ? 121 LYS A HB3  1  
ATOM 891   H HG2  . LYS A 1 121 ? -9.162  1.433   -6.168  1.00 0.00 ? 121 LYS A HG2  1  
ATOM 892   H HG3  . LYS A 1 121 ? -10.385 2.139   -7.221  1.00 0.00 ? 121 LYS A HG3  1  
ATOM 893   H HD2  . LYS A 1 121 ? -9.017  4.187   -7.398  1.00 0.00 ? 121 LYS A HD2  1  
ATOM 894   H HD3  . LYS A 1 121 ? -7.792  3.445   -6.375  1.00 0.00 ? 121 LYS A HD3  1  
ATOM 895   H HE2  . LYS A 1 121 ? -8.691  2.381   -9.067  1.00 0.00 ? 121 LYS A HE2  1  
ATOM 896   H HE3  . LYS A 1 121 ? -7.235  3.326   -8.792  1.00 0.00 ? 121 LYS A HE3  1  
ATOM 897   H HZ1  . LYS A 1 121 ? -7.743  0.625   -7.585  1.00 0.00 ? 121 LYS A HZ1  1  
ATOM 898   H HZ2  . LYS A 1 121 ? -6.344  1.537   -7.438  1.00 0.00 ? 121 LYS A HZ2  1  
ATOM 899   H HZ3  . LYS A 1 121 ? -6.796  0.900   -8.910  1.00 0.00 ? 121 LYS A HZ3  1  
ATOM 900   N N    . TYR A 1 122 ? -13.647 2.622   -5.140  1.00 0.00 ? 122 TYR A N    1  
ATOM 901   C CA   . TYR A 1 122 ? -14.857 2.604   -5.918  1.00 0.00 ? 122 TYR A CA   1  
ATOM 902   C C    . TYR A 1 122 ? -15.302 3.990   -6.167  1.00 0.00 ? 122 TYR A C    1  
ATOM 903   O O    . TYR A 1 122 ? -15.125 4.858   -5.314  1.00 0.00 ? 122 TYR A O    1  
ATOM 904   C CB   . TYR A 1 122 ? -15.986 1.966   -5.142  1.00 0.00 ? 122 TYR A CB   1  
ATOM 905   C CG   . TYR A 1 122 ? -16.259 0.519   -5.349  1.00 0.00 ? 122 TYR A CG   1  
ATOM 906   C CD1  . TYR A 1 122 ? -17.139 0.115   -6.337  1.00 0.00 ? 122 TYR A CD1  1  
ATOM 907   C CD2  . TYR A 1 122 ? -15.697 -0.438  -4.541  1.00 0.00 ? 122 TYR A CD2  1  
ATOM 908   C CE1  . TYR A 1 122 ? -17.442 -1.205  -6.515  1.00 0.00 ? 122 TYR A CE1  1  
ATOM 909   C CE2  . TYR A 1 122 ? -16.000 -1.766  -4.709  1.00 0.00 ? 122 TYR A CE2  1  
ATOM 910   C CZ   . TYR A 1 122 ? -16.873 -2.140  -5.694  1.00 0.00 ? 122 TYR A CZ   1  
ATOM 911   O OH   . TYR A 1 122 ? -17.155 -3.466  -5.889  1.00 0.00 ? 122 TYR A OH   1  
ATOM 912   H H    . TYR A 1 122 ? -13.665 3.150   -4.311  1.00 0.00 ? 122 TYR A H    1  
ATOM 913   H HA   . TYR A 1 122 ? -14.721 2.056   -6.837  1.00 0.00 ? 122 TYR A HA   1  
ATOM 914   H HB2  . TYR A 1 122 ? -15.727 2.072   -4.100  1.00 0.00 ? 122 TYR A HB2  1  
ATOM 915   H HB3  . TYR A 1 122 ? -16.893 2.523   -5.330  1.00 0.00 ? 122 TYR A HB3  1  
ATOM 916   H HD1  . TYR A 1 122 ? -17.581 0.861   -6.980  1.00 0.00 ? 122 TYR A HD1  1  
ATOM 917   H HD2  . TYR A 1 122 ? -15.007 -0.135  -3.767  1.00 0.00 ? 122 TYR A HD2  1  
ATOM 918   H HE1  . TYR A 1 122 ? -18.130 -1.502  -7.292  1.00 0.00 ? 122 TYR A HE1  1  
ATOM 919   H HE2  . TYR A 1 122 ? -15.554 -2.512  -4.069  1.00 0.00 ? 122 TYR A HE2  1  
ATOM 920   H HH   . TYR A 1 122 ? -16.847 -3.648  -6.799  1.00 0.00 ? 122 TYR A HH   1  
ATOM 921   N N    . ARG A 1 123 ? -15.860 4.214   -7.304  1.00 0.00 ? 123 ARG A N    1  
ATOM 922   C CA   . ARG A 1 123 ? -16.550 5.432   -7.521  1.00 0.00 ? 123 ARG A CA   1  
ATOM 923   C C    . ARG A 1 123 ? -17.912 5.091   -8.035  1.00 0.00 ? 123 ARG A C    1  
ATOM 924   O O    . ARG A 1 123 ? -18.084 4.762   -9.214  1.00 0.00 ? 123 ARG A O    1  
ATOM 925   C CB   . ARG A 1 123 ? -15.850 6.373   -8.485  1.00 0.00 ? 123 ARG A CB   1  
ATOM 926   C CG   . ARG A 1 123 ? -16.572 7.702   -8.561  1.00 0.00 ? 123 ARG A CG   1  
ATOM 927   C CD   . ARG A 1 123 ? -15.978 8.637   -9.569  1.00 0.00 ? 123 ARG A CD   1  
ATOM 928   N NE   . ARG A 1 123 ? -16.654 9.936   -9.523  1.00 0.00 ? 123 ARG A NE   1  
ATOM 929   C CZ   . ARG A 1 123 ? -16.915 10.701  -10.581 1.00 0.00 ? 123 ARG A CZ   1  
ATOM 930   N NH1  . ARG A 1 123 ? -16.562 10.302  -11.790 1.00 0.00 ? 123 ARG A NH1  1  
ATOM 931   N NH2  . ARG A 1 123 ? -17.514 11.883  -10.429 1.00 0.00 ? 123 ARG A NH2  1  
ATOM 932   H H    . ARG A 1 123 ? -15.819 3.537   -8.017  1.00 0.00 ? 123 ARG A H    1  
ATOM 933   H HA   . ARG A 1 123 ? -16.664 5.912   -6.558  1.00 0.00 ? 123 ARG A HA   1  
ATOM 934   H HB2  . ARG A 1 123 ? -14.837 6.539   -8.148  1.00 0.00 ? 123 ARG A HB2  1  
ATOM 935   H HB3  . ARG A 1 123 ? -15.840 5.934   -9.470  1.00 0.00 ? 123 ARG A HB3  1  
ATOM 936   H HG2  . ARG A 1 123 ? -17.601 7.520   -8.834  1.00 0.00 ? 123 ARG A HG2  1  
ATOM 937   H HG3  . ARG A 1 123 ? -16.544 8.168   -7.586  1.00 0.00 ? 123 ARG A HG3  1  
ATOM 938   H HD2  . ARG A 1 123 ? -14.929 8.770   -9.348  1.00 0.00 ? 123 ARG A HD2  1  
ATOM 939   H HD3  . ARG A 1 123 ? -16.095 8.214   -10.555 1.00 0.00 ? 123 ARG A HD3  1  
ATOM 940   H HE   . ARG A 1 123 ? -16.902 10.209  -8.599  1.00 0.00 ? 123 ARG A HE   1  
ATOM 941   H HH11 . ARG A 1 123 ? -16.088 9.435   -11.965 1.00 0.00 ? 123 ARG A HH11 1  
ATOM 942   H HH12 . ARG A 1 123 ? -16.764 10.841  -12.613 1.00 0.00 ? 123 ARG A HH12 1  
ATOM 943   H HH21 . ARG A 1 123 ? -17.790 12.247  -9.538  1.00 0.00 ? 123 ARG A HH21 1  
ATOM 944   H HH22 . ARG A 1 123 ? -17.708 12.471  -11.220 1.00 0.00 ? 123 ARG A HH22 1  
ATOM 945   N N    . ILE A 1 124 ? -18.851 5.107   -7.158  1.00 0.00 ? 124 ILE A N    1  
ATOM 946   C CA   . ILE A 1 124 ? -20.208 4.845   -7.497  1.00 0.00 ? 124 ILE A CA   1  
ATOM 947   C C    . ILE A 1 124 ? -21.133 5.852   -6.802  1.00 0.00 ? 124 ILE A C    1  
ATOM 948   O O    . ILE A 1 124 ? -21.362 5.769   -5.614  1.00 0.00 ? 124 ILE A O    1  
ATOM 949   C CB   . ILE A 1 124 ? -20.604 3.367   -7.147  1.00 0.00 ? 124 ILE A CB   1  
ATOM 950   C CG1  . ILE A 1 124 ? -20.032 2.919   -5.793  1.00 0.00 ? 124 ILE A CG1  1  
ATOM 951   C CG2  . ILE A 1 124 ? -20.187 2.408   -8.264  1.00 0.00 ? 124 ILE A CG2  1  
ATOM 952   C CD1  . ILE A 1 124 ? -20.371 1.485   -5.421  1.00 0.00 ? 124 ILE A CD1  1  
ATOM 953   H H    . ILE A 1 124 ? -18.637 5.348   -6.231  1.00 0.00 ? 124 ILE A H    1  
ATOM 954   H HA   . ILE A 1 124 ? -20.297 4.972   -8.566  1.00 0.00 ? 124 ILE A HA   1  
ATOM 955   H HB   . ILE A 1 124 ? -21.681 3.346   -7.100  1.00 0.00 ? 124 ILE A HB   1  
ATOM 956   H HG12 . ILE A 1 124 ? -18.956 3.006   -5.825  1.00 0.00 ? 124 ILE A HG12 1  
ATOM 957   H HG13 . ILE A 1 124 ? -20.413 3.568   -5.018  1.00 0.00 ? 124 ILE A HG13 1  
ATOM 958   H HG21 . ILE A 1 124 ? -20.474 1.401   -7.999  1.00 0.00 ? 124 ILE A HG21 1  
ATOM 959   H HG22 . ILE A 1 124 ? -19.115 2.455   -8.389  1.00 0.00 ? 124 ILE A HG22 1  
ATOM 960   H HG23 . ILE A 1 124 ? -20.669 2.692   -9.188  1.00 0.00 ? 124 ILE A HG23 1  
ATOM 961   H HD11 . ILE A 1 124 ? -19.983 0.816   -6.176  1.00 0.00 ? 124 ILE A HD11 1  
ATOM 962   H HD12 . ILE A 1 124 ? -21.442 1.371   -5.356  1.00 0.00 ? 124 ILE A HD12 1  
ATOM 963   H HD13 . ILE A 1 124 ? -19.923 1.247   -4.468  1.00 0.00 ? 124 ILE A HD13 1  
ATOM 964   N N    . PRO A 1 125 ? -21.665 6.826   -7.546  1.00 0.00 ? 125 PRO A N    1  
ATOM 965   C CA   . PRO A 1 125 ? -22.607 7.796   -7.006  1.00 0.00 ? 125 PRO A CA   1  
ATOM 966   C C    . PRO A 1 125 ? -24.047 7.292   -7.069  1.00 0.00 ? 125 PRO A C    1  
ATOM 967   O O    . PRO A 1 125 ? -24.828 7.497   -6.148  1.00 0.00 ? 125 PRO A O    1  
ATOM 968   C CB   . PRO A 1 125 ? -22.441 9.023   -7.925  1.00 0.00 ? 125 PRO A CB   1  
ATOM 969   C CG   . PRO A 1 125 ? -21.424 8.634   -8.966  1.00 0.00 ? 125 PRO A CG   1  
ATOM 970   C CD   . PRO A 1 125 ? -21.306 7.137   -8.927  1.00 0.00 ? 125 PRO A CD   1  
ATOM 971   H HA   . PRO A 1 125 ? -22.363 8.069   -5.990  1.00 0.00 ? 125 PRO A HA   1  
ATOM 972   H HB2  . PRO A 1 125 ? -23.395 9.255   -8.375  1.00 0.00 ? 125 PRO A HB2  1  
ATOM 973   H HB3  . PRO A 1 125 ? -22.105 9.868   -7.342  1.00 0.00 ? 125 PRO A HB3  1  
ATOM 974   H HG2  . PRO A 1 125 ? -21.763 8.952   -9.941  1.00 0.00 ? 125 PRO A HG2  1  
ATOM 975   H HG3  . PRO A 1 125 ? -20.473 9.092   -8.741  1.00 0.00 ? 125 PRO A HG3  1  
ATOM 976   H HD2  . PRO A 1 125 ? -21.991 6.687   -9.629  1.00 0.00 ? 125 PRO A HD2  1  
ATOM 977   H HD3  . PRO A 1 125 ? -20.289 6.851   -9.144  1.00 0.00 ? 125 PRO A HD3  1  
ATOM 978   N N    . ALA A 1 126 ? -24.390 6.635   -8.167  1.00 0.00 ? 126 ALA A N    1  
ATOM 979   C CA   . ALA A 1 126 ? -25.727 6.109   -8.374  1.00 0.00 ? 126 ALA A CA   1  
ATOM 980   C C    . ALA A 1 126 ? -26.028 4.948   -7.436  1.00 0.00 ? 126 ALA A C    1  
ATOM 981   O O    . ALA A 1 126 ? -27.180 4.583   -7.231  1.00 0.00 ? 126 ALA A O    1  
ATOM 982   C CB   . ALA A 1 126 ? -25.932 5.697   -9.824  1.00 0.00 ? 126 ALA A CB   1  
ATOM 983   H H    . ALA A 1 126 ? -23.707 6.467   -8.850  1.00 0.00 ? 126 ALA A H    1  
ATOM 984   H HA   . ALA A 1 126 ? -26.418 6.907   -8.151  1.00 0.00 ? 126 ALA A HA   1  
ATOM 985   H HB1  . ALA A 1 126 ? -25.318 4.840   -10.057 1.00 0.00 ? 126 ALA A HB1  1  
ATOM 986   H HB2  . ALA A 1 126 ? -25.673 6.517   -10.477 1.00 0.00 ? 126 ALA A HB2  1  
ATOM 987   H HB3  . ALA A 1 126 ? -26.969 5.437   -9.974  1.00 0.00 ? 126 ALA A HB3  1  
ATOM 988   N N    . ASP A 1 127 ? -24.992 4.349   -6.903  1.00 0.00 ? 127 ASP A N    1  
ATOM 989   C CA   . ASP A 1 127 ? -25.164 3.212   -6.020  1.00 0.00 ? 127 ASP A CA   1  
ATOM 990   C C    . ASP A 1 127 ? -24.851 3.573   -4.585  1.00 0.00 ? 127 ASP A C    1  
ATOM 991   O O    . ASP A 1 127 ? -25.262 2.873   -3.662  1.00 0.00 ? 127 ASP A O    1  
ATOM 992   C CB   . ASP A 1 127 ? -24.281 2.029   -6.456  1.00 0.00 ? 127 ASP A CB   1  
ATOM 993   C CG   . ASP A 1 127 ? -24.580 1.531   -7.854  1.00 0.00 ? 127 ASP A CG   1  
ATOM 994   O OD1  . ASP A 1 127 ? -25.508 0.729   -8.034  1.00 0.00 ? 127 ASP A OD1  1  
ATOM 995   O OD2  . ASP A 1 127 ? -23.900 1.948   -8.810  1.00 0.00 ? 127 ASP A OD2  1  
ATOM 996   H H    . ASP A 1 127 ? -24.095 4.675   -7.129  1.00 0.00 ? 127 ASP A H    1  
ATOM 997   H HA   . ASP A 1 127 ? -26.197 2.902   -6.082  1.00 0.00 ? 127 ASP A HA   1  
ATOM 998   H HB2  . ASP A 1 127 ? -23.245 2.326   -6.414  1.00 0.00 ? 127 ASP A HB2  1  
ATOM 999   H HB3  . ASP A 1 127 ? -24.436 1.213   -5.765  1.00 0.00 ? 127 ASP A HB3  1  
ATOM 1000  N N    . VAL A 1 128 ? -24.157 4.680   -4.385  1.00 0.00 ? 128 VAL A N    1  
ATOM 1001  C CA   . VAL A 1 128 ? -23.720 5.055   -3.051  1.00 0.00 ? 128 VAL A CA   1  
ATOM 1002  C C    . VAL A 1 128 ? -24.092 6.469   -2.670  1.00 0.00 ? 128 VAL A C    1  
ATOM 1003  O O    . VAL A 1 128 ? -23.732 7.439   -3.349  1.00 0.00 ? 128 VAL A O    1  
ATOM 1004  C CB   . VAL A 1 128 ? -22.180 4.851   -2.842  1.00 0.00 ? 128 VAL A CB   1  
ATOM 1005  C CG1  . VAL A 1 128 ? -21.704 5.445   -1.516  1.00 0.00 ? 128 VAL A CG1  1  
ATOM 1006  C CG2  . VAL A 1 128 ? -21.846 3.387   -2.857  1.00 0.00 ? 128 VAL A CG2  1  
ATOM 1007  H H    . VAL A 1 128 ? -23.944 5.285   -5.124  1.00 0.00 ? 128 VAL A H    1  
ATOM 1008  H HA   . VAL A 1 128 ? -24.224 4.387   -2.371  1.00 0.00 ? 128 VAL A HA   1  
ATOM 1009  H HB   . VAL A 1 128 ? -21.650 5.330   -3.652  1.00 0.00 ? 128 VAL A HB   1  
ATOM 1010  H HG11 . VAL A 1 128 ? -21.913 6.504   -1.501  1.00 0.00 ? 128 VAL A HG11 1  
ATOM 1011  H HG12 . VAL A 1 128 ? -20.642 5.286   -1.409  1.00 0.00 ? 128 VAL A HG12 1  
ATOM 1012  H HG13 . VAL A 1 128 ? -22.225 4.964   -0.701  1.00 0.00 ? 128 VAL A HG13 1  
ATOM 1013  H HG21 . VAL A 1 128 ? -22.365 2.894   -2.049  1.00 0.00 ? 128 VAL A HG21 1  
ATOM 1014  H HG22 . VAL A 1 128 ? -20.782 3.258   -2.730  1.00 0.00 ? 128 VAL A HG22 1  
ATOM 1015  H HG23 . VAL A 1 128 ? -22.157 2.955   -3.797  1.00 0.00 ? 128 VAL A HG23 1  
ATOM 1016  N N    . ASP A 1 129 ? -24.840 6.571   -1.603  1.00 0.00 ? 129 ASP A N    1  
ATOM 1017  C CA   . ASP A 1 129 ? -25.090 7.831   -0.966  1.00 0.00 ? 129 ASP A CA   1  
ATOM 1018  C C    . ASP A 1 129 ? -24.610 7.688   0.473   1.00 0.00 ? 129 ASP A C    1  
ATOM 1019  O O    . ASP A 1 129 ? -25.097 6.805   1.204   1.00 0.00 ? 129 ASP A O    1  
ATOM 1020  C CB   . ASP A 1 129 ? -26.563 8.206   -0.964  1.00 0.00 ? 129 ASP A CB   1  
ATOM 1021  C CG   . ASP A 1 129 ? -26.777 9.638   -0.489  1.00 0.00 ? 129 ASP A CG   1  
ATOM 1022  O OD1  . ASP A 1 129 ? -26.651 9.908   0.730   1.00 0.00 ? 129 ASP A OD1  1  
ATOM 1023  O OD2  . ASP A 1 129 ? -27.035 10.536  -1.347  1.00 0.00 ? 129 ASP A OD2  1  
ATOM 1024  H H    . ASP A 1 129 ? -25.233 5.763   -1.214  1.00 0.00 ? 129 ASP A H    1  
ATOM 1025  H HA   . ASP A 1 129 ? -24.504 8.582   -1.475  1.00 0.00 ? 129 ASP A HA   1  
ATOM 1026  H HB2  . ASP A 1 129 ? -26.975 8.065   -1.950  1.00 0.00 ? 129 ASP A HB2  1  
ATOM 1027  H HB3  . ASP A 1 129 ? -27.078 7.542   -0.290  1.00 0.00 ? 129 ASP A HB3  1  
ATOM 1028  N N    . PRO A 1 130 ? -23.662 8.525   0.908   1.00 0.00 ? 130 PRO A N    1  
ATOM 1029  C CA   . PRO A 1 130 ? -23.040 8.419   2.241   1.00 0.00 ? 130 PRO A CA   1  
ATOM 1030  C C    . PRO A 1 130 ? -24.016 8.568   3.422   1.00 0.00 ? 130 PRO A C    1  
ATOM 1031  O O    . PRO A 1 130 ? -23.681 8.207   4.548   1.00 0.00 ? 130 PRO A O    1  
ATOM 1032  C CB   . PRO A 1 130 ? -21.999 9.547   2.252   1.00 0.00 ? 130 PRO A CB   1  
ATOM 1033  C CG   . PRO A 1 130 ? -22.446 10.490  1.196   1.00 0.00 ? 130 PRO A CG   1  
ATOM 1034  C CD   . PRO A 1 130 ? -23.103 9.651   0.140   1.00 0.00 ? 130 PRO A CD   1  
ATOM 1035  H HA   . PRO A 1 130 ? -22.531 7.472   2.344   1.00 0.00 ? 130 PRO A HA   1  
ATOM 1036  H HB2  . PRO A 1 130 ? -21.987 10.016  3.225   1.00 0.00 ? 130 PRO A HB2  1  
ATOM 1037  H HB3  . PRO A 1 130 ? -21.021 9.145   2.032   1.00 0.00 ? 130 PRO A HB3  1  
ATOM 1038  H HG2  . PRO A 1 130 ? -23.152 11.191  1.617   1.00 0.00 ? 130 PRO A HG2  1  
ATOM 1039  H HG3  . PRO A 1 130 ? -21.597 11.018  0.790   1.00 0.00 ? 130 PRO A HG3  1  
ATOM 1040  H HD2  . PRO A 1 130 ? -23.885 10.215  -0.347  1.00 0.00 ? 130 PRO A HD2  1  
ATOM 1041  H HD3  . PRO A 1 130 ? -22.375 9.305   -0.580  1.00 0.00 ? 130 PRO A HD3  1  
ATOM 1042  N N    . LEU A 1 131 ? -25.208 9.076   3.171   1.00 0.00 ? 131 LEU A N    1  
ATOM 1043  C CA   . LEU A 1 131 ? -26.182 9.252   4.231   1.00 0.00 ? 131 LEU A CA   1  
ATOM 1044  C C    . LEU A 1 131 ? -26.920 7.940   4.537   1.00 0.00 ? 131 LEU A C    1  
ATOM 1045  O O    . LEU A 1 131 ? -27.418 7.735   5.649   1.00 0.00 ? 131 LEU A O    1  
ATOM 1046  C CB   . LEU A 1 131 ? -27.189 10.350  3.861   1.00 0.00 ? 131 LEU A CB   1  
ATOM 1047  C CG   . LEU A 1 131 ? -28.256 10.683  4.908   1.00 0.00 ? 131 LEU A CG   1  
ATOM 1048  C CD1  . LEU A 1 131 ? -27.632 11.270  6.165   1.00 0.00 ? 131 LEU A CD1  1  
ATOM 1049  C CD2  . LEU A 1 131 ? -29.295 11.618  4.334   1.00 0.00 ? 131 LEU A CD2  1  
ATOM 1050  H H    . LEU A 1 131 ? -25.448 9.341   2.253   1.00 0.00 ? 131 LEU A H    1  
ATOM 1051  H HA   . LEU A 1 131 ? -25.648 9.562   5.118   1.00 0.00 ? 131 LEU A HA   1  
ATOM 1052  H HB2  . LEU A 1 131 ? -26.634 11.254  3.657   1.00 0.00 ? 131 LEU A HB2  1  
ATOM 1053  H HB3  . LEU A 1 131 ? -27.689 10.050  2.952   1.00 0.00 ? 131 LEU A HB3  1  
ATOM 1054  H HG   . LEU A 1 131 ? -28.747 9.764   5.190   1.00 0.00 ? 131 LEU A HG   1  
ATOM 1055  H HD11 . LEU A 1 131 ? -27.088 12.168  5.912   1.00 0.00 ? 131 LEU A HD11 1  
ATOM 1056  H HD12 . LEU A 1 131 ? -26.961 10.548  6.607   1.00 0.00 ? 131 LEU A HD12 1  
ATOM 1057  H HD13 . LEU A 1 131 ? -28.413 11.509  6.871   1.00 0.00 ? 131 LEU A HD13 1  
ATOM 1058  H HD21 . LEU A 1 131 ? -28.810 12.531  4.027   1.00 0.00 ? 131 LEU A HD21 1  
ATOM 1059  H HD22 . LEU A 1 131 ? -30.038 11.839  5.086   1.00 0.00 ? 131 LEU A HD22 1  
ATOM 1060  H HD23 . LEU A 1 131 ? -29.768 11.152  3.483   1.00 0.00 ? 131 LEU A HD23 1  
ATOM 1061  N N    . THR A 1 132 ? -26.989 7.058   3.568   1.00 0.00 ? 132 THR A N    1  
ATOM 1062  C CA   . THR A 1 132 ? -27.761 5.839   3.740   1.00 0.00 ? 132 THR A CA   1  
ATOM 1063  C C    . THR A 1 132 ? -26.905 4.578   3.620   1.00 0.00 ? 132 THR A C    1  
ATOM 1064  O O    . THR A 1 132 ? -27.269 3.512   4.138   1.00 0.00 ? 132 THR A O    1  
ATOM 1065  C CB   . THR A 1 132 ? -28.972 5.840   2.755   1.00 0.00 ? 132 THR A CB   1  
ATOM 1066  O OG1  . THR A 1 132 ? -29.750 4.663   2.876   1.00 0.00 ? 132 THR A OG1  1  
ATOM 1067  C CG2  . THR A 1 132 ? -28.523 6.013   1.322   1.00 0.00 ? 132 THR A CG2  1  
ATOM 1068  H H    . THR A 1 132 ? -26.518 7.239   2.727   1.00 0.00 ? 132 THR A H    1  
ATOM 1069  H HA   . THR A 1 132 ? -28.155 5.866   4.745   1.00 0.00 ? 132 THR A HA   1  
ATOM 1070  H HB   . THR A 1 132 ? -29.601 6.679   3.015   1.00 0.00 ? 132 THR A HB   1  
ATOM 1071  H HG1  . THR A 1 132 ? -29.550 4.121   2.100   1.00 0.00 ? 132 THR A HG1  1  
ATOM 1072  H HG21 . THR A 1 132 ? -27.847 5.213   1.053   1.00 0.00 ? 132 THR A HG21 1  
ATOM 1073  H HG22 . THR A 1 132 ? -28.018 6.962   1.252   1.00 0.00 ? 132 THR A HG22 1  
ATOM 1074  H HG23 . THR A 1 132 ? -29.382 6.006   0.666   1.00 0.00 ? 132 THR A HG23 1  
ATOM 1075  N N    . ILE A 1 133 ? -25.774 4.693   2.984   1.00 0.00 ? 133 ILE A N    1  
ATOM 1076  C CA   . ILE A 1 133 ? -24.891 3.575   2.843   1.00 0.00 ? 133 ILE A CA   1  
ATOM 1077  C C    . ILE A 1 133 ? -23.941 3.532   4.025   1.00 0.00 ? 133 ILE A C    1  
ATOM 1078  O O    . ILE A 1 133 ? -23.284 4.520   4.352   1.00 0.00 ? 133 ILE A O    1  
ATOM 1079  C CB   . ILE A 1 133 ? -24.144 3.612   1.485   1.00 0.00 ? 133 ILE A CB   1  
ATOM 1080  C CG1  . ILE A 1 133 ? -25.156 3.463   0.326   1.00 0.00 ? 133 ILE A CG1  1  
ATOM 1081  C CG2  . ILE A 1 133 ? -23.053 2.540   1.401   1.00 0.00 ? 133 ILE A CG2  1  
ATOM 1082  C CD1  . ILE A 1 133 ? -25.864 2.124   0.268   1.00 0.00 ? 133 ILE A CD1  1  
ATOM 1083  H H    . ILE A 1 133 ? -25.506 5.550   2.587   1.00 0.00 ? 133 ILE A H    1  
ATOM 1084  H HA   . ILE A 1 133 ? -25.504 2.686   2.884   1.00 0.00 ? 133 ILE A HA   1  
ATOM 1085  H HB   . ILE A 1 133 ? -23.669 4.578   1.395   1.00 0.00 ? 133 ILE A HB   1  
ATOM 1086  H HG12 . ILE A 1 133 ? -25.912 4.229   0.414   1.00 0.00 ? 133 ILE A HG12 1  
ATOM 1087  H HG13 . ILE A 1 133 ? -24.626 3.597   -0.604  1.00 0.00 ? 133 ILE A HG13 1  
ATOM 1088  H HG21 . ILE A 1 133 ? -22.559 2.597   0.441   1.00 0.00 ? 133 ILE A HG21 1  
ATOM 1089  H HG22 . ILE A 1 133 ? -23.501 1.565   1.516   1.00 0.00 ? 133 ILE A HG22 1  
ATOM 1090  H HG23 . ILE A 1 133 ? -22.331 2.698   2.189   1.00 0.00 ? 133 ILE A HG23 1  
ATOM 1091  H HD11 . ILE A 1 133 ? -26.454 1.977   1.160   1.00 0.00 ? 133 ILE A HD11 1  
ATOM 1092  H HD12 . ILE A 1 133 ? -25.134 1.335   0.182   1.00 0.00 ? 133 ILE A HD12 1  
ATOM 1093  H HD13 . ILE A 1 133 ? -26.513 2.104   -0.596  1.00 0.00 ? 133 ILE A HD13 1  
ATOM 1094  N N    . THR A 1 134 ? -23.900 2.400   4.655   1.00 0.00 ? 134 THR A N    1  
ATOM 1095  C CA   . THR A 1 134 ? -23.150 2.175   5.860   1.00 0.00 ? 134 THR A CA   1  
ATOM 1096  C C    . THR A 1 134 ? -22.180 1.048   5.648   1.00 0.00 ? 134 THR A C    1  
ATOM 1097  O O    . THR A 1 134 ? -22.273 0.344   4.657   1.00 0.00 ? 134 THR A O    1  
ATOM 1098  C CB   . THR A 1 134 ? -24.099 1.853   7.035   1.00 0.00 ? 134 THR A CB   1  
ATOM 1099  O OG1  . THR A 1 134 ? -24.995 0.779   6.668   1.00 0.00 ? 134 THR A OG1  1  
ATOM 1100  C CG2  . THR A 1 134 ? -24.910 3.076   7.439   1.00 0.00 ? 134 THR A CG2  1  
ATOM 1101  H H    . THR A 1 134 ? -24.401 1.645   4.273   1.00 0.00 ? 134 THR A H    1  
ATOM 1102  H HA   . THR A 1 134 ? -22.608 3.080   6.092   1.00 0.00 ? 134 THR A HA   1  
ATOM 1103  H HB   . THR A 1 134 ? -23.501 1.530   7.876   1.00 0.00 ? 134 THR A HB   1  
ATOM 1104  H HG1  . THR A 1 134 ? -25.228 0.860   5.731   1.00 0.00 ? 134 THR A HG1  1  
ATOM 1105  H HG21 . THR A 1 134 ? -24.240 3.867   7.743   1.00 0.00 ? 134 THR A HG21 1  
ATOM 1106  H HG22 . THR A 1 134 ? -25.562 2.823   8.262   1.00 0.00 ? 134 THR A HG22 1  
ATOM 1107  H HG23 . THR A 1 134 ? -25.500 3.410   6.598   1.00 0.00 ? 134 THR A HG23 1  
ATOM 1108  N N    . SER A 1 135 ? -21.256 0.868   6.558   1.00 0.00 ? 135 SER A N    1  
ATOM 1109  C CA   . SER A 1 135 ? -20.236 -0.123  6.390   1.00 0.00 ? 135 SER A CA   1  
ATOM 1110  C C    . SER A 1 135 ? -20.177 -1.066  7.596   1.00 0.00 ? 135 SER A C    1  
ATOM 1111  O O    . SER A 1 135 ? -20.234 -0.632  8.748   1.00 0.00 ? 135 SER A O    1  
ATOM 1112  C CB   . SER A 1 135 ? -18.899 0.592   6.233   1.00 0.00 ? 135 SER A CB   1  
ATOM 1113  O OG   . SER A 1 135 ? -18.997 1.617   5.246   1.00 0.00 ? 135 SER A OG   1  
ATOM 1114  H H    . SER A 1 135 ? -21.235 1.409   7.377   1.00 0.00 ? 135 SER A H    1  
ATOM 1115  H HA   . SER A 1 135 ? -20.427 -0.684  5.488   1.00 0.00 ? 135 SER A HA   1  
ATOM 1116  H HB2  . SER A 1 135 ? -18.618 1.038   7.176   1.00 0.00 ? 135 SER A HB2  1  
ATOM 1117  H HB3  . SER A 1 135 ? -18.147 -0.119  5.927   1.00 0.00 ? 135 SER A HB3  1  
ATOM 1118  H HG   . SER A 1 135 ? -19.867 1.507   4.847   1.00 0.00 ? 135 SER A HG   1  
ATOM 1119  N N    . SER A 1 136 ? -20.109 -2.335  7.309   1.00 0.00 ? 136 SER A N    1  
ATOM 1120  C CA   . SER A 1 136 ? -19.954 -3.373  8.288   1.00 0.00 ? 136 SER A CA   1  
ATOM 1121  C C    . SER A 1 136 ? -18.636 -4.084  7.974   1.00 0.00 ? 136 SER A C    1  
ATOM 1122  O O    . SER A 1 136 ? -18.230 -4.114  6.811   1.00 0.00 ? 136 SER A O    1  
ATOM 1123  C CB   . SER A 1 136 ? -21.162 -4.323  8.204   1.00 0.00 ? 136 SER A CB   1  
ATOM 1124  O OG   . SER A 1 136 ? -21.384 -4.760  6.859   1.00 0.00 ? 136 SER A OG   1  
ATOM 1125  H H    . SER A 1 136 ? -20.160 -2.619  6.367   1.00 0.00 ? 136 SER A H    1  
ATOM 1126  H HA   . SER A 1 136 ? -19.899 -2.922  9.267   1.00 0.00 ? 136 SER A HA   1  
ATOM 1127  H HB2  . SER A 1 136 ? -20.984 -5.188  8.825   1.00 0.00 ? 136 SER A HB2  1  
ATOM 1128  H HB3  . SER A 1 136 ? -22.046 -3.808  8.550   1.00 0.00 ? 136 SER A HB3  1  
ATOM 1129  H HG   . SER A 1 136 ? -22.079 -4.214  6.472   1.00 0.00 ? 136 SER A HG   1  
ATOM 1130  N N    . LEU A 1 137 ? -17.965 -4.632  8.957   1.00 0.00 ? 137 LEU A N    1  
ATOM 1131  C CA   . LEU A 1 137 ? -16.654 -5.204  8.713   1.00 0.00 ? 137 LEU A CA   1  
ATOM 1132  C C    . LEU A 1 137 ? -16.467 -6.535  9.403   1.00 0.00 ? 137 LEU A C    1  
ATOM 1133  O O    . LEU A 1 137 ? -16.960 -6.753  10.510  1.00 0.00 ? 137 LEU A O    1  
ATOM 1134  C CB   . LEU A 1 137 ? -15.489 -4.190  9.053   1.00 0.00 ? 137 LEU A CB   1  
ATOM 1135  C CG   . LEU A 1 137 ? -15.234 -3.704  10.530  1.00 0.00 ? 137 LEU A CG   1  
ATOM 1136  C CD1  . LEU A 1 137 ? -16.469 -3.133  11.211  1.00 0.00 ? 137 LEU A CD1  1  
ATOM 1137  C CD2  . LEU A 1 137 ? -14.560 -4.764  11.392  1.00 0.00 ? 137 LEU A CD2  1  
ATOM 1138  H H    . LEU A 1 137 ? -18.353 -4.701  9.856   1.00 0.00 ? 137 LEU A H    1  
ATOM 1139  H HA   . LEU A 1 137 ? -16.614 -5.399  7.652   1.00 0.00 ? 137 LEU A HA   1  
ATOM 1140  H HB2  . LEU A 1 137 ? -14.567 -4.636  8.713   1.00 0.00 ? 137 LEU A HB2  1  
ATOM 1141  H HB3  . LEU A 1 137 ? -15.660 -3.314  8.446   1.00 0.00 ? 137 LEU A HB3  1  
ATOM 1142  H HG   . LEU A 1 137 ? -14.553 -2.868  10.453  1.00 0.00 ? 137 LEU A HG   1  
ATOM 1143  H HD11 . LEU A 1 137 ? -16.842 -2.293  10.647  1.00 0.00 ? 137 LEU A HD11 1  
ATOM 1144  H HD12 . LEU A 1 137 ? -16.213 -2.811  12.209  1.00 0.00 ? 137 LEU A HD12 1  
ATOM 1145  H HD13 . LEU A 1 137 ? -17.233 -3.894  11.269  1.00 0.00 ? 137 LEU A HD13 1  
ATOM 1146  H HD21 . LEU A 1 137 ? -14.393 -4.371  12.384  1.00 0.00 ? 137 LEU A HD21 1  
ATOM 1147  H HD22 . LEU A 1 137 ? -13.612 -5.034  10.949  1.00 0.00 ? 137 LEU A HD22 1  
ATOM 1148  H HD23 . LEU A 1 137 ? -15.192 -5.638  11.451  1.00 0.00 ? 137 LEU A HD23 1  
ATOM 1149  N N    . SER A 1 138 ? -15.793 -7.418  8.734   1.00 0.00 ? 138 SER A N    1  
ATOM 1150  C CA   . SER A 1 138 ? -15.448 -8.683  9.277   1.00 0.00 ? 138 SER A CA   1  
ATOM 1151  C C    . SER A 1 138 ? -13.982 -8.574  9.727   1.00 0.00 ? 138 SER A C    1  
ATOM 1152  O O    . SER A 1 138 ? -13.235 -7.708  9.249   1.00 0.00 ? 138 SER A O    1  
ATOM 1153  C CB   . SER A 1 138 ? -15.596 -9.720  8.154   1.00 0.00 ? 138 SER A CB   1  
ATOM 1154  O OG   . SER A 1 138 ? -15.519 -11.043 8.642   1.00 0.00 ? 138 SER A OG   1  
ATOM 1155  H H    . SER A 1 138 ? -15.498 -7.197  7.820   1.00 0.00 ? 138 SER A H    1  
ATOM 1156  H HA   . SER A 1 138 ? -16.098 -8.930  10.103  1.00 0.00 ? 138 SER A HA   1  
ATOM 1157  H HB2  . SER A 1 138 ? -16.543 -9.585  7.655   1.00 0.00 ? 138 SER A HB2  1  
ATOM 1158  H HB3  . SER A 1 138 ? -14.795 -9.568  7.445   1.00 0.00 ? 138 SER A HB3  1  
ATOM 1159  H HG   . SER A 1 138 ? -16.409 -11.252 8.956   1.00 0.00 ? 138 SER A HG   1  
ATOM 1160  N N    . SER A 1 139 ? -13.576 -9.490  10.588  1.00 0.00 ? 139 SER A N    1  
ATOM 1161  C CA   . SER A 1 139 ? -12.267 -9.483  11.220  1.00 0.00 ? 139 SER A CA   1  
ATOM 1162  C C    . SER A 1 139 ? -11.127 -9.772  10.235  1.00 0.00 ? 139 SER A C    1  
ATOM 1163  O O    . SER A 1 139 ? -9.969  -9.458  10.516  1.00 0.00 ? 139 SER A O    1  
ATOM 1164  C CB   . SER A 1 139 ? -12.252 -10.473 12.406  1.00 0.00 ? 139 SER A CB   1  
ATOM 1165  O OG   . SER A 1 139 ? -11.057 -10.380 13.166  1.00 0.00 ? 139 SER A OG   1  
ATOM 1166  H H    . SER A 1 139 ? -14.188 -10.224 10.818  1.00 0.00 ? 139 SER A H    1  
ATOM 1167  H HA   . SER A 1 139 ? -12.115 -8.491  11.618  1.00 0.00 ? 139 SER A HA   1  
ATOM 1168  H HB2  . SER A 1 139 ? -13.085 -10.259 13.058  1.00 0.00 ? 139 SER A HB2  1  
ATOM 1169  H HB3  . SER A 1 139 ? -12.348 -11.480 12.028  1.00 0.00 ? 139 SER A HB3  1  
ATOM 1170  H HG   . SER A 1 139 ? -10.594 -11.225 13.078  1.00 0.00 ? 139 SER A HG   1  
ATOM 1171  N N    . ASP A 1 140 ? -11.452 -10.376 9.103   1.00 0.00 ? 140 ASP A N    1  
ATOM 1172  C CA   . ASP A 1 140 ? -10.435 -10.748 8.113   1.00 0.00 ? 140 ASP A CA   1  
ATOM 1173  C C    . ASP A 1 140 ? -10.113 -9.594  7.157   1.00 0.00 ? 140 ASP A C    1  
ATOM 1174  O O    . ASP A 1 140 ? -9.126  -9.635  6.424   1.00 0.00 ? 140 ASP A O    1  
ATOM 1175  C CB   . ASP A 1 140 ? -10.876 -12.001 7.341   1.00 0.00 ? 140 ASP A CB   1  
ATOM 1176  C CG   . ASP A 1 140 ? -9.801  -12.568 6.426   1.00 0.00 ? 140 ASP A CG   1  
ATOM 1177  O OD1  . ASP A 1 140 ? -8.648  -12.757 6.900   1.00 0.00 ? 140 ASP A OD1  1  
ATOM 1178  O OD2  . ASP A 1 140 ? -10.122 -12.934 5.284   1.00 0.00 ? 140 ASP A OD2  1  
ATOM 1179  H H    . ASP A 1 140 ? -12.389 -10.623 8.957   1.00 0.00 ? 140 ASP A H    1  
ATOM 1180  H HA   . ASP A 1 140 ? -9.540  -10.986 8.667   1.00 0.00 ? 140 ASP A HA   1  
ATOM 1181  H HB2  . ASP A 1 140 ? -11.156 -12.770 8.046   1.00 0.00 ? 140 ASP A HB2  1  
ATOM 1182  H HB3  . ASP A 1 140 ? -11.738 -11.750 6.739   1.00 0.00 ? 140 ASP A HB3  1  
ATOM 1183  N N    . GLY A 1 141 ? -10.916 -8.546  7.205   1.00 0.00 ? 141 GLY A N    1  
ATOM 1184  C CA   . GLY A 1 141 ? -10.689 -7.414  6.325   1.00 0.00 ? 141 GLY A CA   1  
ATOM 1185  C C    . GLY A 1 141 ? -11.803 -7.229  5.320   1.00 0.00 ? 141 GLY A C    1  
ATOM 1186  O O    . GLY A 1 141 ? -11.752 -6.338  4.474   1.00 0.00 ? 141 GLY A O    1  
ATOM 1187  H H    . GLY A 1 141 ? -11.635 -8.521  7.871   1.00 0.00 ? 141 GLY A H    1  
ATOM 1188  H HA2  . GLY A 1 141 ? -10.604 -6.519  6.925   1.00 0.00 ? 141 GLY A HA2  1  
ATOM 1189  H HA3  . GLY A 1 141 ? -9.760  -7.570  5.795   1.00 0.00 ? 141 GLY A HA3  1  
ATOM 1190  N N    . VAL A 1 142 ? -12.800 -8.077  5.396   1.00 0.00 ? 142 VAL A N    1  
ATOM 1191  C CA   . VAL A 1 142 ? -13.943 -7.965  4.514   1.00 0.00 ? 142 VAL A CA   1  
ATOM 1192  C C    . VAL A 1 142 ? -14.836 -6.836  5.012   1.00 0.00 ? 142 VAL A C    1  
ATOM 1193  O O    . VAL A 1 142 ? -15.248 -6.832  6.170   1.00 0.00 ? 142 VAL A O    1  
ATOM 1194  C CB   . VAL A 1 142 ? -14.763 -9.279  4.449   1.00 0.00 ? 142 VAL A CB   1  
ATOM 1195  C CG1  . VAL A 1 142 ? -15.873 -9.169  3.418   1.00 0.00 ? 142 VAL A CG1  1  
ATOM 1196  C CG2  . VAL A 1 142 ? -13.869 -10.464 4.139   1.00 0.00 ? 142 VAL A CG2  1  
ATOM 1197  H H    . VAL A 1 142 ? -12.752 -8.793  6.059   1.00 0.00 ? 142 VAL A H    1  
ATOM 1198  H HA   . VAL A 1 142 ? -13.580 -7.716  3.528   1.00 0.00 ? 142 VAL A HA   1  
ATOM 1199  H HB   . VAL A 1 142 ? -15.226 -9.439  5.412   1.00 0.00 ? 142 VAL A HB   1  
ATOM 1200  H HG11 . VAL A 1 142 ? -16.416 -10.100 3.366   1.00 0.00 ? 142 VAL A HG11 1  
ATOM 1201  H HG12 . VAL A 1 142 ? -15.443 -8.952  2.452   1.00 0.00 ? 142 VAL A HG12 1  
ATOM 1202  H HG13 . VAL A 1 142 ? -16.548 -8.374  3.698   1.00 0.00 ? 142 VAL A HG13 1  
ATOM 1203  H HG21 . VAL A 1 142 ? -14.462 -11.367 4.111   1.00 0.00 ? 142 VAL A HG21 1  
ATOM 1204  H HG22 . VAL A 1 142 ? -13.110 -10.555 4.902   1.00 0.00 ? 142 VAL A HG22 1  
ATOM 1205  H HG23 . VAL A 1 142 ? -13.400 -10.316 3.178   1.00 0.00 ? 142 VAL A HG23 1  
ATOM 1206  N N    . LEU A 1 143 ? -15.105 -5.898  4.164   1.00 0.00 ? 143 LEU A N    1  
ATOM 1207  C CA   . LEU A 1 143 ? -15.898 -4.754  4.503   1.00 0.00 ? 143 LEU A CA   1  
ATOM 1208  C C    . LEU A 1 143 ? -17.120 -4.760  3.589   1.00 0.00 ? 143 LEU A C    1  
ATOM 1209  O O    . LEU A 1 143 ? -17.002 -4.989  2.408   1.00 0.00 ? 143 LEU A O    1  
ATOM 1210  C CB   . LEU A 1 143 ? -15.005 -3.484  4.318   1.00 0.00 ? 143 LEU A CB   1  
ATOM 1211  C CG   . LEU A 1 143 ? -15.542 -2.081  4.707   1.00 0.00 ? 143 LEU A CG   1  
ATOM 1212  C CD1  . LEU A 1 143 ? -16.702 -1.618  3.848   1.00 0.00 ? 143 LEU A CD1  1  
ATOM 1213  C CD2  . LEU A 1 143 ? -15.893 -2.023  6.167   1.00 0.00 ? 143 LEU A CD2  1  
ATOM 1214  H H    . LEU A 1 143 ? -14.774 -5.963  3.238   1.00 0.00 ? 143 LEU A H    1  
ATOM 1215  H HA   . LEU A 1 143 ? -16.208 -4.834  5.534   1.00 0.00 ? 143 LEU A HA   1  
ATOM 1216  H HB2  . LEU A 1 143 ? -14.122 -3.647  4.919   1.00 0.00 ? 143 LEU A HB2  1  
ATOM 1217  H HB3  . LEU A 1 143 ? -14.676 -3.452  3.291   1.00 0.00 ? 143 LEU A HB3  1  
ATOM 1218  H HG   . LEU A 1 143 ? -14.747 -1.371  4.539   1.00 0.00 ? 143 LEU A HG   1  
ATOM 1219  H HD11 . LEU A 1 143 ? -17.033 -0.644  4.175   1.00 0.00 ? 143 LEU A HD11 1  
ATOM 1220  H HD12 . LEU A 1 143 ? -17.516 -2.323  3.929   1.00 0.00 ? 143 LEU A HD12 1  
ATOM 1221  H HD13 . LEU A 1 143 ? -16.375 -1.561  2.821   1.00 0.00 ? 143 LEU A HD13 1  
ATOM 1222  H HD21 . LEU A 1 143 ? -16.659 -2.751  6.388   1.00 0.00 ? 143 LEU A HD21 1  
ATOM 1223  H HD22 . LEU A 1 143 ? -16.253 -1.035  6.409   1.00 0.00 ? 143 LEU A HD22 1  
ATOM 1224  H HD23 . LEU A 1 143 ? -15.009 -2.234  6.751   1.00 0.00 ? 143 LEU A HD23 1  
ATOM 1225  N N    . THR A 1 144 ? -18.274 -4.581  4.130   1.00 0.00 ? 144 THR A N    1  
ATOM 1226  C CA   . THR A 1 144 ? -19.463 -4.556  3.334   1.00 0.00 ? 144 THR A CA   1  
ATOM 1227  C C    . THR A 1 144 ? -20.202 -3.223  3.503   1.00 0.00 ? 144 THR A C    1  
ATOM 1228  O O    . THR A 1 144 ? -20.453 -2.780  4.623   1.00 0.00 ? 144 THR A O    1  
ATOM 1229  C CB   . THR A 1 144 ? -20.373 -5.753  3.694   1.00 0.00 ? 144 THR A CB   1  
ATOM 1230  O OG1  . THR A 1 144 ? -19.603 -6.970  3.562   1.00 0.00 ? 144 THR A OG1  1  
ATOM 1231  C CG2  . THR A 1 144 ? -21.583 -5.827  2.765   1.00 0.00 ? 144 THR A CG2  1  
ATOM 1232  H H    . THR A 1 144 ? -18.346 -4.452  5.104   1.00 0.00 ? 144 THR A H    1  
ATOM 1233  H HA   . THR A 1 144 ? -19.163 -4.655  2.301   1.00 0.00 ? 144 THR A HA   1  
ATOM 1234  H HB   . THR A 1 144 ? -20.703 -5.644  4.718   1.00 0.00 ? 144 THR A HB   1  
ATOM 1235  H HG1  . THR A 1 144 ? -18.785 -6.728  3.108   1.00 0.00 ? 144 THR A HG1  1  
ATOM 1236  H HG21 . THR A 1 144 ? -22.158 -4.917  2.850   1.00 0.00 ? 144 THR A HG21 1  
ATOM 1237  H HG22 . THR A 1 144 ? -22.201 -6.668  3.040   1.00 0.00 ? 144 THR A HG22 1  
ATOM 1238  H HG23 . THR A 1 144 ? -21.246 -5.947  1.745   1.00 0.00 ? 144 THR A HG23 1  
ATOM 1239  N N    . VAL A 1 145 ? -20.501 -2.582  2.402   1.00 0.00 ? 145 VAL A N    1  
ATOM 1240  C CA   . VAL A 1 145 ? -21.256 -1.368  2.429   1.00 0.00 ? 145 VAL A CA   1  
ATOM 1241  C C    . VAL A 1 145 ? -22.687 -1.658  2.037   1.00 0.00 ? 145 VAL A C    1  
ATOM 1242  O O    . VAL A 1 145 ? -22.953 -2.232  0.976   1.00 0.00 ? 145 VAL A O    1  
ATOM 1243  C CB   . VAL A 1 145 ? -20.622 -0.215  1.592   1.00 0.00 ? 145 VAL A CB   1  
ATOM 1244  C CG1  . VAL A 1 145 ? -19.342 0.227   2.237   1.00 0.00 ? 145 VAL A CG1  1  
ATOM 1245  C CG2  . VAL A 1 145 ? -20.349 -0.623  0.151   1.00 0.00 ? 145 VAL A CG2  1  
ATOM 1246  H H    . VAL A 1 145 ? -20.242 -2.959  1.530   1.00 0.00 ? 145 VAL A H    1  
ATOM 1247  H HA   . VAL A 1 145 ? -21.285 -1.074  3.468   1.00 0.00 ? 145 VAL A HA   1  
ATOM 1248  H HB   . VAL A 1 145 ? -21.308 0.621   1.595   1.00 0.00 ? 145 VAL A HB   1  
ATOM 1249  H HG11 . VAL A 1 145 ? -18.922 1.047   1.677   1.00 0.00 ? 145 VAL A HG11 1  
ATOM 1250  H HG12 . VAL A 1 145 ? -18.643 -0.597  2.248   1.00 0.00 ? 145 VAL A HG12 1  
ATOM 1251  H HG13 . VAL A 1 145 ? -19.537 0.547   3.250   1.00 0.00 ? 145 VAL A HG13 1  
ATOM 1252  H HG21 . VAL A 1 145 ? -21.298 -0.902  -0.282  1.00 0.00 ? 145 VAL A HG21 1  
ATOM 1253  H HG22 . VAL A 1 145 ? -19.676 -1.467  0.131   1.00 0.00 ? 145 VAL A HG22 1  
ATOM 1254  H HG23 . VAL A 1 145 ? -19.925 0.208   -0.393  1.00 0.00 ? 145 VAL A HG23 1  
ATOM 1255  N N    . ASN A 1 146 ? -23.591 -1.315  2.911   1.00 0.00 ? 146 ASN A N    1  
ATOM 1256  C CA   . ASN A 1 146 ? -24.982 -1.656  2.744   1.00 0.00 ? 146 ASN A CA   1  
ATOM 1257  C C    . ASN A 1 146 ? -25.896 -0.504  3.132   1.00 0.00 ? 146 ASN A C    1  
ATOM 1258  O O    . ASN A 1 146 ? -25.526 0.370   3.931   1.00 0.00 ? 146 ASN A O    1  
ATOM 1259  C CB   . ASN A 1 146 ? -25.335 -2.907  3.588   1.00 0.00 ? 146 ASN A CB   1  
ATOM 1260  C CG   . ASN A 1 146 ? -25.245 -2.676  5.102   1.00 0.00 ? 146 ASN A CG   1  
ATOM 1261  O OD1  . ASN A 1 146 ? -24.179 -2.831  5.714   1.00 0.00 ? 146 ASN A OD1  1  
ATOM 1262  N ND2  . ASN A 1 146 ? -26.357 -2.343  5.717   1.00 0.00 ? 146 ASN A ND2  1  
ATOM 1263  H H    . ASN A 1 146 ? -23.307 -0.800  3.699   1.00 0.00 ? 146 ASN A H    1  
ATOM 1264  H HA   . ASN A 1 146 ? -25.147 -1.900  1.706   1.00 0.00 ? 146 ASN A HA   1  
ATOM 1265  H HB2  . ASN A 1 146 ? -26.348 -3.200  3.358   1.00 0.00 ? 146 ASN A HB2  1  
ATOM 1266  H HB3  . ASN A 1 146 ? -24.664 -3.710  3.322   1.00 0.00 ? 146 ASN A HB3  1  
ATOM 1267  H HD21 . ASN A 1 146 ? -27.179 -2.264  5.181   1.00 0.00 ? 146 ASN A HD21 1  
ATOM 1268  H HD22 . ASN A 1 146 ? -26.353 -2.185  6.685   1.00 0.00 ? 146 ASN A HD22 1  
ATOM 1269  N N    . GLY A 1 147 ? -27.055 -0.530  2.568   1.00 0.00 ? 147 GLY A N    1  
ATOM 1270  C CA   . GLY A 1 147 ? -28.070 0.421   2.851   1.00 0.00 ? 147 GLY A CA   1  
ATOM 1271  C C    . GLY A 1 147 ? -28.893 0.639   1.623   1.00 0.00 ? 147 GLY A C    1  
ATOM 1272  O O    . GLY A 1 147 ? -28.580 0.047   0.584   1.00 0.00 ? 147 GLY A O    1  
ATOM 1273  H H    . GLY A 1 147 ? -27.238 -1.205  1.878   1.00 0.00 ? 147 GLY A H    1  
ATOM 1274  H HA2  . GLY A 1 147 ? -28.693 0.057   3.653   1.00 0.00 ? 147 GLY A HA2  1  
ATOM 1275  H HA3  . GLY A 1 147 ? -27.620 1.358   3.140   1.00 0.00 ? 147 GLY A HA3  1  
ATOM 1276  N N    . PRO A 1 148 ? -30.001 1.368   1.719   1.00 0.00 ? 148 PRO A N    1  
ATOM 1277  C CA   . PRO A 1 148 ? -30.770 1.798   0.550   1.00 0.00 ? 148 PRO A CA   1  
ATOM 1278  C C    . PRO A 1 148 ? -29.895 2.471   -0.489  1.00 0.00 ? 148 PRO A C    1  
ATOM 1279  O O    . PRO A 1 148 ? -28.967 3.223   -0.153  1.00 0.00 ? 148 PRO A O    1  
ATOM 1280  C CB   . PRO A 1 148 ? -31.714 2.801   1.137   1.00 0.00 ? 148 PRO A CB   1  
ATOM 1281  C CG   . PRO A 1 148 ? -31.990 2.264   2.488   1.00 0.00 ? 148 PRO A CG   1  
ATOM 1282  C CD   . PRO A 1 148 ? -30.675 1.745   2.969   1.00 0.00 ? 148 PRO A CD   1  
ATOM 1283  H HA   . PRO A 1 148 ? -31.322 0.985   0.104   1.00 0.00 ? 148 PRO A HA   1  
ATOM 1284  H HB2  . PRO A 1 148 ? -31.238 3.770   1.175   1.00 0.00 ? 148 PRO A HB2  1  
ATOM 1285  H HB3  . PRO A 1 148 ? -32.615 2.851   0.543   1.00 0.00 ? 148 PRO A HB3  1  
ATOM 1286  H HG2  . PRO A 1 148 ? -32.351 3.048   3.135   1.00 0.00 ? 148 PRO A HG2  1  
ATOM 1287  H HG3  . PRO A 1 148 ? -32.710 1.462   2.429   1.00 0.00 ? 148 PRO A HG3  1  
ATOM 1288  H HD2  . PRO A 1 148 ? -30.129 2.524   3.478   1.00 0.00 ? 148 PRO A HD2  1  
ATOM 1289  H HD3  . PRO A 1 148 ? -30.817 0.884   3.605   1.00 0.00 ? 148 PRO A HD3  1  
ATOM 1290  N N    . ARG A 1 149 ? -30.204 2.213   -1.718  1.00 0.00 ? 149 ARG A N    1  
ATOM 1291  C CA   . ARG A 1 149 ? -29.440 2.695   -2.836  1.00 0.00 ? 149 ARG A CA   1  
ATOM 1292  C C    . ARG A 1 149 ? -29.953 4.032   -3.318  1.00 0.00 ? 149 ARG A C    1  
ATOM 1293  O O    . ARG A 1 149 ? -31.027 4.475   -2.932  1.00 0.00 ? 149 ARG A O    1  
ATOM 1294  C CB   . ARG A 1 149 ? -29.480 1.727   -3.989  1.00 0.00 ? 149 ARG A CB   1  
ATOM 1295  C CG   . ARG A 1 149 ? -30.852 1.566   -4.622  1.00 0.00 ? 149 ARG A CG   1  
ATOM 1296  C CD   . ARG A 1 149 ? -30.707 0.911   -5.955  1.00 0.00 ? 149 ARG A CD   1  
ATOM 1297  N NE   . ARG A 1 149 ? -29.776 1.685   -6.779  1.00 0.00 ? 149 ARG A NE   1  
ATOM 1298  C CZ   . ARG A 1 149 ? -28.757 1.171   -7.448  1.00 0.00 ? 149 ARG A CZ   1  
ATOM 1299  N NH1  . ARG A 1 149 ? -28.657 -0.151  -7.616  1.00 0.00 ? 149 ARG A NH1  1  
ATOM 1300  N NH2  . ARG A 1 149 ? -27.858 1.971   -7.979  1.00 0.00 ? 149 ARG A NH2  1  
ATOM 1301  H H    . ARG A 1 149 ? -31.016 1.689   -1.879  1.00 0.00 ? 149 ARG A H    1  
ATOM 1302  H HA   . ARG A 1 149 ? -28.415 2.804   -2.518  1.00 0.00 ? 149 ARG A HA   1  
ATOM 1303  H HB2  . ARG A 1 149 ? -28.801 2.074   -4.754  1.00 0.00 ? 149 ARG A HB2  1  
ATOM 1304  H HB3  . ARG A 1 149 ? -29.148 0.760   -3.647  1.00 0.00 ? 149 ARG A HB3  1  
ATOM 1305  H HG2  . ARG A 1 149 ? -31.475 0.961   -3.981  1.00 0.00 ? 149 ARG A HG2  1  
ATOM 1306  H HG3  . ARG A 1 149 ? -31.297 2.542   -4.751  1.00 0.00 ? 149 ARG A HG3  1  
ATOM 1307  H HD2  . ARG A 1 149 ? -30.317 -0.086  -5.806  1.00 0.00 ? 149 ARG A HD2  1  
ATOM 1308  H HD3  . ARG A 1 149 ? -31.667 0.868   -6.446  1.00 0.00 ? 149 ARG A HD3  1  
ATOM 1309  H HE   . ARG A 1 149 ? -29.916 2.667   -6.729  1.00 0.00 ? 149 ARG A HE   1  
ATOM 1310  H HH11 . ARG A 1 149 ? -29.342 -0.790  -7.254  1.00 0.00 ? 149 ARG A HH11 1  
ATOM 1311  H HH12 . ARG A 1 149 ? -27.875 -0.547  -8.103  1.00 0.00 ? 149 ARG A HH12 1  
ATOM 1312  H HH21 . ARG A 1 149 ? -27.923 2.973   -7.908  1.00 0.00 ? 149 ARG A HH21 1  
ATOM 1313  H HH22 . ARG A 1 149 ? -27.025 1.595   -8.409  1.00 0.00 ? 149 ARG A HH22 1  
ATOM 1314  N N    . LYS A 1 150 ? -29.168 4.681   -4.128  1.00 0.00 ? 150 LYS A N    1  
ATOM 1315  C CA   . LYS A 1 150 ? -29.574 5.917   -4.708  1.00 0.00 ? 150 LYS A CA   1  
ATOM 1316  C C    . LYS A 1 150 ? -29.958 5.652   -6.184  1.00 0.00 ? 150 LYS A C    1  
ATOM 1317  O O    . LYS A 1 150 ? -30.178 4.458   -6.561  1.00 0.00 ? 150 LYS A O    1  
ATOM 1318  C CB   . LYS A 1 150 ? -28.422 6.918   -4.580  1.00 0.00 ? 150 LYS A CB   1  
ATOM 1319  C CG   . LYS A 1 150 ? -28.783 8.370   -4.834  1.00 0.00 ? 150 LYS A CG   1  
ATOM 1320  C CD   . LYS A 1 150 ? -27.617 9.254   -4.475  1.00 0.00 ? 150 LYS A CD   1  
ATOM 1321  C CE   . LYS A 1 150 ? -27.957 10.715  -4.551  1.00 0.00 ? 150 LYS A CE   1  
ATOM 1322  N NZ   . LYS A 1 150 ? -26.900 11.519  -3.919  1.00 0.00 ? 150 LYS A NZ   1  
ATOM 1323  H H    . LYS A 1 150 ? -28.300 4.306   -4.379  1.00 0.00 ? 150 LYS A H    1  
ATOM 1324  H HA   . LYS A 1 150 ? -30.437 6.281   -4.171  1.00 0.00 ? 150 LYS A HA   1  
ATOM 1325  H HB2  . LYS A 1 150 ? -28.022 6.847   -3.579  1.00 0.00 ? 150 LYS A HB2  1  
ATOM 1326  H HB3  . LYS A 1 150 ? -27.649 6.633   -5.279  1.00 0.00 ? 150 LYS A HB3  1  
ATOM 1327  H HG2  . LYS A 1 150 ? -29.027 8.500   -5.878  1.00 0.00 ? 150 LYS A HG2  1  
ATOM 1328  H HG3  . LYS A 1 150 ? -29.633 8.636   -4.222  1.00 0.00 ? 150 LYS A HG3  1  
ATOM 1329  H HD2  . LYS A 1 150 ? -27.303 9.049   -3.465  1.00 0.00 ? 150 LYS A HD2  1  
ATOM 1330  H HD3  . LYS A 1 150 ? -26.802 9.050   -5.154  1.00 0.00 ? 150 LYS A HD3  1  
ATOM 1331  H HE2  . LYS A 1 150 ? -28.039 10.991  -5.590  1.00 0.00 ? 150 LYS A HE2  1  
ATOM 1332  H HE3  . LYS A 1 150 ? -28.894 10.895  -4.044  1.00 0.00 ? 150 LYS A HE3  1  
ATOM 1333  H HZ1  . LYS A 1 150 ? -27.105 12.536  -3.979  1.00 0.00 ? 150 LYS A HZ1  1  
ATOM 1334  H HZ2  . LYS A 1 150 ? -25.981 11.328  -4.365  1.00 0.00 ? 150 LYS A HZ2  1  
ATOM 1335  H HZ3  . LYS A 1 150 ? -26.831 11.238  -2.915  1.00 0.00 ? 150 LYS A HZ3  1  
ATOM 1336  N N    . ARG B 1 69  ? 38.030  8.802   1.371   1.00 0.00 ? 69  ARG B N    1  
ATOM 1337  C CA   . ARG B 1 69  ? 37.783  7.469   0.904   1.00 0.00 ? 69  ARG B CA   1  
ATOM 1338  C C    . ARG B 1 69  ? 36.298  7.210   0.735   1.00 0.00 ? 69  ARG B C    1  
ATOM 1339  O O    . ARG B 1 69  ? 35.900  6.572   -0.241  1.00 0.00 ? 69  ARG B O    1  
ATOM 1340  C CB   . ARG B 1 69  ? 38.385  6.513   1.949   1.00 0.00 ? 69  ARG B CB   1  
ATOM 1341  C CG   . ARG B 1 69  ? 38.231  5.028   1.671   1.00 0.00 ? 69  ARG B CG   1  
ATOM 1342  C CD   . ARG B 1 69  ? 38.936  4.201   2.744   1.00 0.00 ? 69  ARG B CD   1  
ATOM 1343  N NE   . ARG B 1 69  ? 38.411  4.463   4.107   1.00 0.00 ? 69  ARG B NE   1  
ATOM 1344  C CZ   . ARG B 1 69  ? 39.035  4.144   5.261   1.00 0.00 ? 69  ARG B CZ   1  
ATOM 1345  N NH1  . ARG B 1 69  ? 40.219  3.553   5.257   1.00 0.00 ? 69  ARG B NH1  1  
ATOM 1346  N NH2  . ARG B 1 69  ? 38.453  4.429   6.406   1.00 0.00 ? 69  ARG B NH2  1  
ATOM 1347  H H    . ARG B 1 69  ? 38.078  8.965   2.338   1.00 0.00 ? 69  ARG B H    1  
ATOM 1348  H HA   . ARG B 1 69  ? 38.302  7.308   -0.028  1.00 0.00 ? 69  ARG B HA   1  
ATOM 1349  H HB2  . ARG B 1 69  ? 39.440  6.722   2.045   1.00 0.00 ? 69  ARG B HB2  1  
ATOM 1350  H HB3  . ARG B 1 69  ? 37.917  6.726   2.900   1.00 0.00 ? 69  ARG B HB3  1  
ATOM 1351  H HG2  . ARG B 1 69  ? 37.179  4.782   1.669   1.00 0.00 ? 69  ARG B HG2  1  
ATOM 1352  H HG3  . ARG B 1 69  ? 38.664  4.799   0.707   1.00 0.00 ? 69  ARG B HG3  1  
ATOM 1353  H HD2  . ARG B 1 69  ? 38.800  3.155   2.515   1.00 0.00 ? 69  ARG B HD2  1  
ATOM 1354  H HD3  . ARG B 1 69  ? 39.990  4.436   2.723   1.00 0.00 ? 69  ARG B HD3  1  
ATOM 1355  H HE   . ARG B 1 69  ? 37.534  4.907   4.176   1.00 0.00 ? 69  ARG B HE   1  
ATOM 1356  H HH11 . ARG B 1 69  ? 40.700  3.321   4.409   1.00 0.00 ? 69  ARG B HH11 1  
ATOM 1357  H HH12 . ARG B 1 69  ? 40.694  3.299   6.106   1.00 0.00 ? 69  ARG B HH12 1  
ATOM 1358  H HH21 . ARG B 1 69  ? 37.546  4.881   6.412   1.00 0.00 ? 69  ARG B HH21 1  
ATOM 1359  H HH22 . ARG B 1 69  ? 38.861  4.213   7.298   1.00 0.00 ? 69  ARG B HH22 1  
ATOM 1360  N N    . LEU B 1 70  ? 35.483  7.730   1.642   1.00 0.00 ? 70  LEU B N    1  
ATOM 1361  C CA   . LEU B 1 70  ? 34.045  7.423   1.671   1.00 0.00 ? 70  LEU B CA   1  
ATOM 1362  C C    . LEU B 1 70  ? 33.875  5.908   1.789   1.00 0.00 ? 70  LEU B C    1  
ATOM 1363  O O    . LEU B 1 70  ? 33.257  5.255   0.950   1.00 0.00 ? 70  LEU B O    1  
ATOM 1364  C CB   . LEU B 1 70  ? 33.274  8.027   0.463   1.00 0.00 ? 70  LEU B CB   1  
ATOM 1365  C CG   . LEU B 1 70  ? 31.741  7.833   0.453   1.00 0.00 ? 70  LEU B CG   1  
ATOM 1366  C CD1  . LEU B 1 70  ? 31.097  8.420   1.703   1.00 0.00 ? 70  LEU B CD1  1  
ATOM 1367  C CD2  . LEU B 1 70  ? 31.139  8.456   -0.792  1.00 0.00 ? 70  LEU B CD2  1  
ATOM 1368  H H    . LEU B 1 70  ? 35.835  8.348   2.319   1.00 0.00 ? 70  LEU B H    1  
ATOM 1369  H HA   . LEU B 1 70  ? 33.676  7.845   2.594   1.00 0.00 ? 70  LEU B HA   1  
ATOM 1370  H HB2  . LEU B 1 70  ? 33.478  9.086   0.433   1.00 0.00 ? 70  LEU B HB2  1  
ATOM 1371  H HB3  . LEU B 1 70  ? 33.675  7.581   -0.435  1.00 0.00 ? 70  LEU B HB3  1  
ATOM 1372  H HG   . LEU B 1 70  ? 31.523  6.775   0.439   1.00 0.00 ? 70  LEU B HG   1  
ATOM 1373  H HD11 . LEU B 1 70  ? 31.475  7.912   2.577   1.00 0.00 ? 70  LEU B HD11 1  
ATOM 1374  H HD12 . LEU B 1 70  ? 30.026  8.292   1.648   1.00 0.00 ? 70  LEU B HD12 1  
ATOM 1375  H HD13 . LEU B 1 70  ? 31.328  9.472   1.768   1.00 0.00 ? 70  LEU B HD13 1  
ATOM 1376  H HD21 . LEU B 1 70  ? 30.065  8.348   -0.768  1.00 0.00 ? 70  LEU B HD21 1  
ATOM 1377  H HD22 . LEU B 1 70  ? 31.532  7.954   -1.662  1.00 0.00 ? 70  LEU B HD22 1  
ATOM 1378  H HD23 . LEU B 1 70  ? 31.398  9.504   -0.833  1.00 0.00 ? 70  LEU B HD23 1  
ATOM 1379  N N    . GLU B 1 71  ? 34.588  5.400   2.798   1.00 0.00 ? 71  GLU B N    1  
ATOM 1380  C CA   . GLU B 1 71  ? 34.638  4.009   3.243   1.00 0.00 ? 71  GLU B CA   1  
ATOM 1381  C C    . GLU B 1 71  ? 34.694  2.938   2.158   1.00 0.00 ? 71  GLU B C    1  
ATOM 1382  O O    . GLU B 1 71  ? 33.721  2.644   1.469   1.00 0.00 ? 71  GLU B O    1  
ATOM 1383  C CB   . GLU B 1 71  ? 33.599  3.721   4.309   1.00 0.00 ? 71  GLU B CB   1  
ATOM 1384  C CG   . GLU B 1 71  ? 33.784  4.587   5.539   1.00 0.00 ? 71  GLU B CG   1  
ATOM 1385  C CD   . GLU B 1 71  ? 35.181  4.480   6.085   1.00 0.00 ? 71  GLU B CD   1  
ATOM 1386  O OE1  . GLU B 1 71  ? 35.474  3.506   6.808   1.00 0.00 ? 71  GLU B OE1  1  
ATOM 1387  O OE2  . GLU B 1 71  ? 36.023  5.339   5.779   1.00 0.00 ? 71  GLU B OE2  1  
ATOM 1388  H H    . GLU B 1 71  ? 35.120  6.055   3.298   1.00 0.00 ? 71  GLU B H    1  
ATOM 1389  H HA   . GLU B 1 71  ? 35.599  3.947   3.734   1.00 0.00 ? 71  GLU B HA   1  
ATOM 1390  H HB2  . GLU B 1 71  ? 32.617  3.905   3.898   1.00 0.00 ? 71  GLU B HB2  1  
ATOM 1391  H HB3  . GLU B 1 71  ? 33.674  2.687   4.605   1.00 0.00 ? 71  GLU B HB3  1  
ATOM 1392  H HG2  . GLU B 1 71  ? 33.588  5.616   5.277   1.00 0.00 ? 71  GLU B HG2  1  
ATOM 1393  H HG3  . GLU B 1 71  ? 33.088  4.268   6.300   1.00 0.00 ? 71  GLU B HG3  1  
ATOM 1394  N N    . LYS B 1 72  ? 35.833  2.305   2.064   1.00 0.00 ? 72  LYS B N    1  
ATOM 1395  C CA   . LYS B 1 72  ? 36.026  1.281   1.089   1.00 0.00 ? 72  LYS B CA   1  
ATOM 1396  C C    . LYS B 1 72  ? 35.538  -0.007  1.723   1.00 0.00 ? 72  LYS B C    1  
ATOM 1397  O O    . LYS B 1 72  ? 36.184  -0.574  2.629   1.00 0.00 ? 72  LYS B O    1  
ATOM 1398  C CB   . LYS B 1 72  ? 37.532  1.217   0.697   1.00 0.00 ? 72  LYS B CB   1  
ATOM 1399  C CG   . LYS B 1 72  ? 37.911  0.321   -0.504  1.00 0.00 ? 72  LYS B CG   1  
ATOM 1400  C CD   . LYS B 1 72  ? 37.785  -1.173  -0.210  1.00 0.00 ? 72  LYS B CD   1  
ATOM 1401  C CE   . LYS B 1 72  ? 38.220  -2.031  -1.391  1.00 0.00 ? 72  LYS B CE   1  
ATOM 1402  N NZ   . LYS B 1 72  ? 37.387  -1.822  -2.597  1.00 0.00 ? 72  LYS B NZ   1  
ATOM 1403  H H    . LYS B 1 72  ? 36.543  2.492   2.711   1.00 0.00 ? 72  LYS B H    1  
ATOM 1404  H HA   . LYS B 1 72  ? 35.425  1.506   0.221   1.00 0.00 ? 72  LYS B HA   1  
ATOM 1405  H HB2  . LYS B 1 72  ? 37.862  2.218   0.468   1.00 0.00 ? 72  LYS B HB2  1  
ATOM 1406  H HB3  . LYS B 1 72  ? 38.083  0.871   1.559   1.00 0.00 ? 72  LYS B HB3  1  
ATOM 1407  H HG2  . LYS B 1 72  ? 37.265  0.561   -1.336  1.00 0.00 ? 72  LYS B HG2  1  
ATOM 1408  H HG3  . LYS B 1 72  ? 38.931  0.539   -0.781  1.00 0.00 ? 72  LYS B HG3  1  
ATOM 1409  H HD2  . LYS B 1 72  ? 38.407  -1.414  0.639   1.00 0.00 ? 72  LYS B HD2  1  
ATOM 1410  H HD3  . LYS B 1 72  ? 36.755  -1.392  0.028   1.00 0.00 ? 72  LYS B HD3  1  
ATOM 1411  H HE2  . LYS B 1 72  ? 39.243  -1.790  -1.636  1.00 0.00 ? 72  LYS B HE2  1  
ATOM 1412  H HE3  . LYS B 1 72  ? 38.160  -3.068  -1.102  1.00 0.00 ? 72  LYS B HE3  1  
ATOM 1413  H HZ1  . LYS B 1 72  ? 37.471  -0.851  -2.959  1.00 0.00 ? 72  LYS B HZ1  1  
ATOM 1414  H HZ2  . LYS B 1 72  ? 36.381  -2.014  -2.419  1.00 0.00 ? 72  LYS B HZ2  1  
ATOM 1415  H HZ3  . LYS B 1 72  ? 37.694  -2.456  -3.363  1.00 0.00 ? 72  LYS B HZ3  1  
ATOM 1416  N N    . ASP B 1 73  ? 34.398  -0.427  1.269   1.00 0.00 ? 73  ASP B N    1  
ATOM 1417  C CA   . ASP B 1 73  ? 33.710  -1.610  1.723   1.00 0.00 ? 73  ASP B CA   1  
ATOM 1418  C C    . ASP B 1 73  ? 32.511  -1.716  0.858   1.00 0.00 ? 73  ASP B C    1  
ATOM 1419  O O    . ASP B 1 73  ? 31.914  -0.696  0.547   1.00 0.00 ? 73  ASP B O    1  
ATOM 1420  C CB   . ASP B 1 73  ? 33.244  -1.455  3.189   1.00 0.00 ? 73  ASP B CB   1  
ATOM 1421  C CG   . ASP B 1 73  ? 32.600  -2.715  3.755   1.00 0.00 ? 73  ASP B CG   1  
ATOM 1422  O OD1  . ASP B 1 73  ? 33.342  -3.676  4.069   1.00 0.00 ? 73  ASP B OD1  1  
ATOM 1423  O OD2  . ASP B 1 73  ? 31.371  -2.754  3.937   1.00 0.00 ? 73  ASP B OD2  1  
ATOM 1424  H H    . ASP B 1 73  ? 33.928  0.099   0.583   1.00 0.00 ? 73  ASP B H    1  
ATOM 1425  H HA   . ASP B 1 73  ? 34.349  -2.470  1.620   1.00 0.00 ? 73  ASP B HA   1  
ATOM 1426  H HB2  . ASP B 1 73  ? 34.084  -1.187  3.811   1.00 0.00 ? 73  ASP B HB2  1  
ATOM 1427  H HB3  . ASP B 1 73  ? 32.519  -0.657  3.229   1.00 0.00 ? 73  ASP B HB3  1  
ATOM 1428  N N    . ARG B 1 74  ? 32.159  -2.884  0.424   1.00 0.00 ? 74  ARG B N    1  
ATOM 1429  C CA   . ARG B 1 74  ? 30.980  -2.982  -0.375  1.00 0.00 ? 74  ARG B CA   1  
ATOM 1430  C C    . ARG B 1 74  ? 29.861  -3.338  0.556   1.00 0.00 ? 74  ARG B C    1  
ATOM 1431  O O    . ARG B 1 74  ? 29.872  -4.389  1.204   1.00 0.00 ? 74  ARG B O    1  
ATOM 1432  C CB   . ARG B 1 74  ? 31.141  -4.015  -1.527  1.00 0.00 ? 74  ARG B CB   1  
ATOM 1433  C CG   . ARG B 1 74  ? 31.436  -5.446  -1.082  1.00 0.00 ? 74  ARG B CG   1  
ATOM 1434  C CD   . ARG B 1 74  ? 31.607  -6.398  -2.253  1.00 0.00 ? 74  ARG B CD   1  
ATOM 1435  N NE   . ARG B 1 74  ? 30.412  -6.488  -3.120  1.00 0.00 ? 74  ARG B NE   1  
ATOM 1436  C CZ   . ARG B 1 74  ? 30.104  -7.562  -3.881  1.00 0.00 ? 74  ARG B CZ   1  
ATOM 1437  N NH1  . ARG B 1 74  ? 30.844  -8.671  -3.813  1.00 0.00 ? 74  ARG B NH1  1  
ATOM 1438  N NH2  . ARG B 1 74  ? 29.050  -7.523  -4.694  1.00 0.00 ? 74  ARG B NH2  1  
ATOM 1439  H H    . ARG B 1 74  ? 32.665  -3.686  0.673   1.00 0.00 ? 74  ARG B H    1  
ATOM 1440  H HA   . ARG B 1 74  ? 30.786  -2.001  -0.784  1.00 0.00 ? 74  ARG B HA   1  
ATOM 1441  H HB2  . ARG B 1 74  ? 30.229  -4.031  -2.105  1.00 0.00 ? 74  ARG B HB2  1  
ATOM 1442  H HB3  . ARG B 1 74  ? 31.948  -3.688  -2.167  1.00 0.00 ? 74  ARG B HB3  1  
ATOM 1443  H HG2  . ARG B 1 74  ? 32.346  -5.444  -0.502  1.00 0.00 ? 74  ARG B HG2  1  
ATOM 1444  H HG3  . ARG B 1 74  ? 30.620  -5.787  -0.462  1.00 0.00 ? 74  ARG B HG3  1  
ATOM 1445  H HD2  . ARG B 1 74  ? 32.449  -6.072  -2.845  1.00 0.00 ? 74  ARG B HD2  1  
ATOM 1446  H HD3  . ARG B 1 74  ? 31.822  -7.379  -1.855  1.00 0.00 ? 74  ARG B HD3  1  
ATOM 1447  H HE   . ARG B 1 74  ? 29.844  -5.685  -3.159  1.00 0.00 ? 74  ARG B HE   1  
ATOM 1448  H HH11 . ARG B 1 74  ? 31.636  -8.769  -3.207  1.00 0.00 ? 74  ARG B HH11 1  
ATOM 1449  H HH12 . ARG B 1 74  ? 30.649  -9.472  -4.387  1.00 0.00 ? 74  ARG B HH12 1  
ATOM 1450  H HH21 . ARG B 1 74  ? 28.458  -6.716  -4.767  1.00 0.00 ? 74  ARG B HH21 1  
ATOM 1451  H HH22 . ARG B 1 74  ? 28.808  -8.299  -5.284  1.00 0.00 ? 74  ARG B HH22 1  
ATOM 1452  N N    . PHE B 1 75  ? 28.918  -2.476  0.650   1.00 0.00 ? 75  PHE B N    1  
ATOM 1453  C CA   . PHE B 1 75  ? 27.862  -2.657  1.568   1.00 0.00 ? 75  PHE B CA   1  
ATOM 1454  C C    . PHE B 1 75  ? 26.605  -2.945  0.800   1.00 0.00 ? 75  PHE B C    1  
ATOM 1455  O O    . PHE B 1 75  ? 26.433  -2.459  -0.325  1.00 0.00 ? 75  PHE B O    1  
ATOM 1456  C CB   . PHE B 1 75  ? 27.728  -1.409  2.435   1.00 0.00 ? 75  PHE B CB   1  
ATOM 1457  C CG   . PHE B 1 75  ? 26.831  -1.576  3.616   1.00 0.00 ? 75  PHE B CG   1  
ATOM 1458  C CD1  . PHE B 1 75  ? 27.275  -2.254  4.731   1.00 0.00 ? 75  PHE B CD1  1  
ATOM 1459  C CD2  . PHE B 1 75  ? 25.554  -1.060  3.618   1.00 0.00 ? 75  PHE B CD2  1  
ATOM 1460  C CE1  . PHE B 1 75  ? 26.459  -2.418  5.830   1.00 0.00 ? 75  PHE B CE1  1  
ATOM 1461  C CE2  . PHE B 1 75  ? 24.738  -1.220  4.713   1.00 0.00 ? 75  PHE B CE2  1  
ATOM 1462  C CZ   . PHE B 1 75  ? 25.188  -1.901  5.819   1.00 0.00 ? 75  PHE B CZ   1  
ATOM 1463  H H    . PHE B 1 75  ? 28.908  -1.663  0.094   1.00 0.00 ? 75  PHE B H    1  
ATOM 1464  H HA   . PHE B 1 75  ? 28.104  -3.499  2.199   1.00 0.00 ? 75  PHE B HA   1  
ATOM 1465  H HB2  . PHE B 1 75  ? 28.711  -1.158  2.804   1.00 0.00 ? 75  PHE B HB2  1  
ATOM 1466  H HB3  . PHE B 1 75  ? 27.355  -0.592  1.834   1.00 0.00 ? 75  PHE B HB3  1  
ATOM 1467  H HD1  . PHE B 1 75  ? 28.275  -2.662  4.739   1.00 0.00 ? 75  PHE B HD1  1  
ATOM 1468  H HD2  . PHE B 1 75  ? 25.194  -0.523  2.753   1.00 0.00 ? 75  PHE B HD2  1  
ATOM 1469  H HE1  . PHE B 1 75  ? 26.814  -2.949  6.700   1.00 0.00 ? 75  PHE B HE1  1  
ATOM 1470  H HE2  . PHE B 1 75  ? 23.738  -0.812  4.703   1.00 0.00 ? 75  PHE B HE2  1  
ATOM 1471  H HZ   . PHE B 1 75  ? 24.544  -2.026  6.676   1.00 0.00 ? 75  PHE B HZ   1  
ATOM 1472  N N    . SER B 1 76  ? 25.790  -3.806  1.324   1.00 0.00 ? 76  SER B N    1  
ATOM 1473  C CA   . SER B 1 76  ? 24.563  -4.134  0.694   1.00 0.00 ? 76  SER B CA   1  
ATOM 1474  C C    . SER B 1 76  ? 23.426  -4.232  1.698   1.00 0.00 ? 76  SER B C    1  
ATOM 1475  O O    . SER B 1 76  ? 23.557  -4.859  2.757   1.00 0.00 ? 76  SER B O    1  
ATOM 1476  C CB   . SER B 1 76  ? 24.710  -5.435  -0.088  1.00 0.00 ? 76  SER B CB   1  
ATOM 1477  O OG   . SER B 1 76  ? 25.778  -5.330  -1.035  1.00 0.00 ? 76  SER B OG   1  
ATOM 1478  H H    . SER B 1 76  ? 26.018  -4.253  2.168   1.00 0.00 ? 76  SER B H    1  
ATOM 1479  H HA   . SER B 1 76  ? 24.336  -3.348  -0.010  1.00 0.00 ? 76  SER B HA   1  
ATOM 1480  H HB2  . SER B 1 76  ? 24.925  -6.241  0.598   1.00 0.00 ? 76  SER B HB2  1  
ATOM 1481  H HB3  . SER B 1 76  ? 23.793  -5.645  -0.618  1.00 0.00 ? 76  SER B HB3  1  
ATOM 1482  H HG   . SER B 1 76  ? 26.094  -4.419  -0.946  1.00 0.00 ? 76  SER B HG   1  
ATOM 1483  N N    . VAL B 1 77  ? 22.352  -3.582  1.379   1.00 0.00 ? 77  VAL B N    1  
ATOM 1484  C CA   . VAL B 1 77  ? 21.122  -3.677  2.116   1.00 0.00 ? 77  VAL B CA   1  
ATOM 1485  C C    . VAL B 1 77  ? 20.123  -4.224  1.131   1.00 0.00 ? 77  VAL B C    1  
ATOM 1486  O O    . VAL B 1 77  ? 20.175  -3.885  -0.054  1.00 0.00 ? 77  VAL B O    1  
ATOM 1487  C CB   . VAL B 1 77  ? 20.617  -2.288  2.645   1.00 0.00 ? 77  VAL B CB   1  
ATOM 1488  C CG1  . VAL B 1 77  ? 19.356  -2.430  3.458   1.00 0.00 ? 77  VAL B CG1  1  
ATOM 1489  C CG2  . VAL B 1 77  ? 21.681  -1.584  3.448   1.00 0.00 ? 77  VAL B CG2  1  
ATOM 1490  H H    . VAL B 1 77  ? 22.370  -3.009  0.578   1.00 0.00 ? 77  VAL B H    1  
ATOM 1491  H HA   . VAL B 1 77  ? 21.254  -4.371  2.933   1.00 0.00 ? 77  VAL B HA   1  
ATOM 1492  H HB   . VAL B 1 77  ? 20.363  -1.671  1.800   1.00 0.00 ? 77  VAL B HB   1  
ATOM 1493  H HG11 . VAL B 1 77  ? 19.552  -3.056  4.314   1.00 0.00 ? 77  VAL B HG11 1  
ATOM 1494  H HG12 . VAL B 1 77  ? 18.587  -2.886  2.851   1.00 0.00 ? 77  VAL B HG12 1  
ATOM 1495  H HG13 . VAL B 1 77  ? 19.025  -1.457  3.792   1.00 0.00 ? 77  VAL B HG13 1  
ATOM 1496  H HG21 . VAL B 1 77  ? 21.950  -2.195  4.297   1.00 0.00 ? 77  VAL B HG21 1  
ATOM 1497  H HG22 . VAL B 1 77  ? 21.306  -0.632  3.794   1.00 0.00 ? 77  VAL B HG22 1  
ATOM 1498  H HG23 . VAL B 1 77  ? 22.553  -1.427  2.829   1.00 0.00 ? 77  VAL B HG23 1  
ATOM 1499  N N    . ASN B 1 78  ? 19.264  -5.066  1.557   1.00 0.00 ? 78  ASN B N    1  
ATOM 1500  C CA   . ASN B 1 78  ? 18.315  -5.618  0.654   1.00 0.00 ? 78  ASN B CA   1  
ATOM 1501  C C    . ASN B 1 78  ? 16.950  -5.103  0.999   1.00 0.00 ? 78  ASN B C    1  
ATOM 1502  O O    . ASN B 1 78  ? 16.644  -4.865  2.162   1.00 0.00 ? 78  ASN B O    1  
ATOM 1503  C CB   . ASN B 1 78  ? 18.365  -7.153  0.686   1.00 0.00 ? 78  ASN B CB   1  
ATOM 1504  C CG   . ASN B 1 78  ? 17.458  -7.802  -0.348  1.00 0.00 ? 78  ASN B CG   1  
ATOM 1505  O OD1  . ASN B 1 78  ? 17.864  -7.997  -1.491  1.00 0.00 ? 78  ASN B OD1  1  
ATOM 1506  N ND2  . ASN B 1 78  ? 16.269  -8.184  0.049   1.00 0.00 ? 78  ASN B ND2  1  
ATOM 1507  H H    . ASN B 1 78  ? 19.232  -5.331  2.503   1.00 0.00 ? 78  ASN B H    1  
ATOM 1508  H HA   . ASN B 1 78  ? 18.570  -5.281  -0.339  1.00 0.00 ? 78  ASN B HA   1  
ATOM 1509  H HB2  . ASN B 1 78  ? 19.377  -7.473  0.490   1.00 0.00 ? 78  ASN B HB2  1  
ATOM 1510  H HB3  . ASN B 1 78  ? 18.074  -7.500  1.666   1.00 0.00 ? 78  ASN B HB3  1  
ATOM 1511  H HD21 . ASN B 1 78  ? 16.020  -8.038  0.989   1.00 0.00 ? 78  ASN B HD21 1  
ATOM 1512  H HD22 . ASN B 1 78  ? 15.671  -8.609  -0.601  1.00 0.00 ? 78  ASN B HD22 1  
ATOM 1513  N N    . LEU B 1 79  ? 16.171  -4.887  0.007   1.00 0.00 ? 79  LEU B N    1  
ATOM 1514  C CA   . LEU B 1 79  ? 14.834  -4.444  0.152   1.00 0.00 ? 79  LEU B CA   1  
ATOM 1515  C C    . LEU B 1 79  ? 13.995  -5.525  -0.487  1.00 0.00 ? 79  LEU B C    1  
ATOM 1516  O O    . LEU B 1 79  ? 14.256  -5.918  -1.628  1.00 0.00 ? 79  LEU B O    1  
ATOM 1517  C CB   . LEU B 1 79  ? 14.606  -3.113  -0.618  1.00 0.00 ? 79  LEU B CB   1  
ATOM 1518  C CG   . LEU B 1 79  ? 15.239  -1.789  -0.103  1.00 0.00 ? 79  LEU B CG   1  
ATOM 1519  C CD1  . LEU B 1 79  ? 14.701  -1.403  1.243   1.00 0.00 ? 79  LEU B CD1  1  
ATOM 1520  C CD2  . LEU B 1 79  ? 16.758  -1.827  -0.084  1.00 0.00 ? 79  LEU B CD2  1  
ATOM 1521  H H    . LEU B 1 79  ? 16.482  -5.040  -0.915  1.00 0.00 ? 79  LEU B H    1  
ATOM 1522  H HA   . LEU B 1 79  ? 14.597  -4.325  1.198   1.00 0.00 ? 79  LEU B HA   1  
ATOM 1523  H HB2  . LEU B 1 79  ? 15.018  -3.268  -1.602  1.00 0.00 ? 79  LEU B HB2  1  
ATOM 1524  H HB3  . LEU B 1 79  ? 13.540  -2.965  -0.717  1.00 0.00 ? 79  LEU B HB3  1  
ATOM 1525  H HG   . LEU B 1 79  ? 14.936  -1.003  -0.779  1.00 0.00 ? 79  LEU B HG   1  
ATOM 1526  H HD11 . LEU B 1 79  ? 15.164  -0.480  1.561   1.00 0.00 ? 79  LEU B HD11 1  
ATOM 1527  H HD12 . LEU B 1 79  ? 14.923  -2.183  1.955   1.00 0.00 ? 79  LEU B HD12 1  
ATOM 1528  H HD13 . LEU B 1 79  ? 13.632  -1.263  1.178   1.00 0.00 ? 79  LEU B HD13 1  
ATOM 1529  H HD21 . LEU B 1 79  ? 17.128  -2.025  -1.079  1.00 0.00 ? 79  LEU B HD21 1  
ATOM 1530  H HD22 . LEU B 1 79  ? 17.085  -2.614  0.581   1.00 0.00 ? 79  LEU B HD22 1  
ATOM 1531  H HD23 . LEU B 1 79  ? 17.140  -0.879  0.264   1.00 0.00 ? 79  LEU B HD23 1  
ATOM 1532  N N    . ASP B 1 80  ? 13.026  -6.029  0.205   1.00 0.00 ? 80  ASP B N    1  
ATOM 1533  C CA   . ASP B 1 80  ? 12.277  -7.116  -0.359  1.00 0.00 ? 80  ASP B CA   1  
ATOM 1534  C C    . ASP B 1 80  ? 10.839  -6.774  -0.577  1.00 0.00 ? 80  ASP B C    1  
ATOM 1535  O O    . ASP B 1 80  ? 10.169  -6.217  0.300   1.00 0.00 ? 80  ASP B O    1  
ATOM 1536  C CB   . ASP B 1 80  ? 12.427  -8.457  0.419   1.00 0.00 ? 80  ASP B CB   1  
ATOM 1537  C CG   . ASP B 1 80  ? 11.483  -8.649  1.608   1.00 0.00 ? 80  ASP B CG   1  
ATOM 1538  O OD1  . ASP B 1 80  ? 11.835  -8.268  2.706   1.00 0.00 ? 80  ASP B OD1  1  
ATOM 1539  O OD2  . ASP B 1 80  ? 10.418  -9.254  1.421   1.00 0.00 ? 80  ASP B OD2  1  
ATOM 1540  H H    . ASP B 1 80  ? 12.787  -5.670  1.080   1.00 0.00 ? 80  ASP B H    1  
ATOM 1541  H HA   . ASP B 1 80  ? 12.699  -7.267  -1.343  1.00 0.00 ? 80  ASP B HA   1  
ATOM 1542  H HB2  . ASP B 1 80  ? 12.251  -9.271  -0.267  1.00 0.00 ? 80  ASP B HB2  1  
ATOM 1543  H HB3  . ASP B 1 80  ? 13.444  -8.526  0.775   1.00 0.00 ? 80  ASP B HB3  1  
ATOM 1544  N N    . VAL B 1 81  ? 10.418  -7.008  -1.766  1.00 0.00 ? 81  VAL B N    1  
ATOM 1545  C CA   . VAL B 1 81  ? 9.049   -6.994  -2.125  1.00 0.00 ? 81  VAL B CA   1  
ATOM 1546  C C    . VAL B 1 81  ? 8.805   -8.397  -2.601  1.00 0.00 ? 81  VAL B C    1  
ATOM 1547  O O    . VAL B 1 81  ? 9.458   -8.876  -3.527  1.00 0.00 ? 81  VAL B O    1  
ATOM 1548  C CB   . VAL B 1 81  ? 8.741   -5.982  -3.257  1.00 0.00 ? 81  VAL B CB   1  
ATOM 1549  C CG1  . VAL B 1 81  ? 7.278   -6.052  -3.640  1.00 0.00 ? 81  VAL B CG1  1  
ATOM 1550  C CG2  . VAL B 1 81  ? 9.104   -4.563  -2.829  1.00 0.00 ? 81  VAL B CG2  1  
ATOM 1551  H H    . VAL B 1 81  ? 11.060  -7.208  -2.479  1.00 0.00 ? 81  VAL B H    1  
ATOM 1552  H HA   . VAL B 1 81  ? 8.454   -6.794  -1.247  1.00 0.00 ? 81  VAL B HA   1  
ATOM 1553  H HB   . VAL B 1 81  ? 9.337   -6.242  -4.120  1.00 0.00 ? 81  VAL B HB   1  
ATOM 1554  H HG11 . VAL B 1 81  ? 6.668   -5.824  -2.778  1.00 0.00 ? 81  VAL B HG11 1  
ATOM 1555  H HG12 . VAL B 1 81  ? 7.045   -7.043  -3.998  1.00 0.00 ? 81  VAL B HG12 1  
ATOM 1556  H HG13 . VAL B 1 81  ? 7.082   -5.331  -4.419  1.00 0.00 ? 81  VAL B HG13 1  
ATOM 1557  H HG21 . VAL B 1 81  ? 10.159  -4.512  -2.603  1.00 0.00 ? 81  VAL B HG21 1  
ATOM 1558  H HG22 . VAL B 1 81  ? 8.533   -4.297  -1.950  1.00 0.00 ? 81  VAL B HG22 1  
ATOM 1559  H HG23 . VAL B 1 81  ? 8.869   -3.876  -3.628  1.00 0.00 ? 81  VAL B HG23 1  
ATOM 1560  N N    . LYS B 1 82  ? 7.922   -9.070  -1.872  1.00 0.00 ? 82  LYS B N    1  
ATOM 1561  C CA   . LYS B 1 82  ? 7.673   -10.494 -2.014  1.00 0.00 ? 82  LYS B CA   1  
ATOM 1562  C C    . LYS B 1 82  ? 7.323   -10.895 -3.408  1.00 0.00 ? 82  LYS B C    1  
ATOM 1563  O O    . LYS B 1 82  ? 7.917   -11.797 -3.913  1.00 0.00 ? 82  LYS B O    1  
ATOM 1564  C CB   . LYS B 1 82  ? 6.640   -10.960 -1.015  1.00 0.00 ? 82  LYS B CB   1  
ATOM 1565  C CG   . LYS B 1 82  ? 6.343   -12.455 -1.031  1.00 0.00 ? 82  LYS B CG   1  
ATOM 1566  C CD   . LYS B 1 82  ? 5.557   -12.892 0.206   1.00 0.00 ? 82  LYS B CD   1  
ATOM 1567  C CE   . LYS B 1 82  ? 4.218   -12.187 0.339   1.00 0.00 ? 82  LYS B CE   1  
ATOM 1568  N NZ   . LYS B 1 82  ? 3.476   -12.644 1.529   1.00 0.00 ? 82  LYS B NZ   1  
ATOM 1569  H H    . LYS B 1 82  ? 7.434   -8.564  -1.193  1.00 0.00 ? 82  LYS B H    1  
ATOM 1570  H HA   . LYS B 1 82  ? 8.604   -10.981 -1.769  1.00 0.00 ? 82  LYS B HA   1  
ATOM 1571  H HB2  . LYS B 1 82  ? 6.980   -10.701 -0.023  1.00 0.00 ? 82  LYS B HB2  1  
ATOM 1572  H HB3  . LYS B 1 82  ? 5.718   -10.432 -1.212  1.00 0.00 ? 82  LYS B HB3  1  
ATOM 1573  H HG2  . LYS B 1 82  ? 5.763   -12.684 -1.914  1.00 0.00 ? 82  LYS B HG2  1  
ATOM 1574  H HG3  . LYS B 1 82  ? 7.275   -12.998 -1.067  1.00 0.00 ? 82  LYS B HG3  1  
ATOM 1575  H HD2  . LYS B 1 82  ? 5.381   -13.955 0.152   1.00 0.00 ? 82  LYS B HD2  1  
ATOM 1576  H HD3  . LYS B 1 82  ? 6.153   -12.680 1.080   1.00 0.00 ? 82  LYS B HD3  1  
ATOM 1577  H HE2  . LYS B 1 82  ? 4.384   -11.122 0.421   1.00 0.00 ? 82  LYS B HE2  1  
ATOM 1578  H HE3  . LYS B 1 82  ? 3.629   -12.394 -0.541  1.00 0.00 ? 82  LYS B HE3  1  
ATOM 1579  H HZ1  . LYS B 1 82  ? 4.034   -12.492 2.393   1.00 0.00 ? 82  LYS B HZ1  1  
ATOM 1580  H HZ2  . LYS B 1 82  ? 3.246   -13.656 1.464   1.00 0.00 ? 82  LYS B HZ2  1  
ATOM 1581  H HZ3  . LYS B 1 82  ? 2.590   -12.110 1.631   1.00 0.00 ? 82  LYS B HZ3  1  
ATOM 1582  N N    . HIS B 1 83  ? 6.328   -10.279 -4.000  1.00 0.00 ? 83  HIS B N    1  
ATOM 1583  C CA   . HIS B 1 83  ? 6.077   -10.480 -5.415  1.00 0.00 ? 83  HIS B CA   1  
ATOM 1584  C C    . HIS B 1 83  ? 5.457   -9.234  -5.965  1.00 0.00 ? 83  HIS B C    1  
ATOM 1585  O O    . HIS B 1 83  ? 4.409   -8.818  -5.485  1.00 0.00 ? 83  HIS B O    1  
ATOM 1586  C CB   . HIS B 1 83  ? 5.094   -11.654 -5.702  1.00 0.00 ? 83  HIS B CB   1  
ATOM 1587  C CG   . HIS B 1 83  ? 5.532   -13.024 -5.266  1.00 0.00 ? 83  HIS B CG   1  
ATOM 1588  N ND1  . HIS B 1 83  ? 6.671   -13.630 -5.711  1.00 0.00 ? 83  HIS B ND1  1  
ATOM 1589  C CD2  . HIS B 1 83  ? 4.976   -13.888 -4.396  1.00 0.00 ? 83  HIS B CD2  1  
ATOM 1590  C CE1  . HIS B 1 83  ? 6.800   -14.795 -5.146  1.00 0.00 ? 83  HIS B CE1  1  
ATOM 1591  N NE2  . HIS B 1 83  ? 5.785   -14.984 -4.339  1.00 0.00 ? 83  HIS B NE2  1  
ATOM 1592  H H    . HIS B 1 83  ? 5.747   -9.662  -3.512  1.00 0.00 ? 83  HIS B H    1  
ATOM 1593  H HA   . HIS B 1 83  ? 7.017   -10.674 -5.910  1.00 0.00 ? 83  HIS B HA   1  
ATOM 1594  H HB2  . HIS B 1 83  ? 4.166   -11.444 -5.195  1.00 0.00 ? 83  HIS B HB2  1  
ATOM 1595  H HB3  . HIS B 1 83  ? 4.897   -11.680 -6.762  1.00 0.00 ? 83  HIS B HB3  1  
ATOM 1596  H HD1  . HIS B 1 83  ? 7.345   -13.231 -6.319  1.00 0.00 ? 83  HIS B HD1  1  
ATOM 1597  H HD2  . HIS B 1 83  ? 4.056   -13.744 -3.845  1.00 0.00 ? 83  HIS B HD2  1  
ATOM 1598  H HE1  . HIS B 1 83  ? 7.606   -15.492 -5.312  1.00 0.00 ? 83  HIS B HE1  1  
ATOM 1599  H HE2  . HIS B 1 83  ? 5.438   -15.892 -4.191  1.00 0.00 ? 83  HIS B HE2  1  
ATOM 1600  N N    . PHE B 1 84  ? 6.107   -8.666  -6.946  1.00 0.00 ? 84  PHE B N    1  
ATOM 1601  C CA   . PHE B 1 84  ? 5.651   -7.543  -7.765  1.00 0.00 ? 84  PHE B CA   1  
ATOM 1602  C C    . PHE B 1 84  ? 6.474   -7.552  -9.027  1.00 0.00 ? 84  PHE B C    1  
ATOM 1603  O O    . PHE B 1 84  ? 7.416   -8.331  -9.146  1.00 0.00 ? 84  PHE B O    1  
ATOM 1604  C CB   . PHE B 1 84  ? 5.761   -6.149  -7.080  1.00 0.00 ? 84  PHE B CB   1  
ATOM 1605  C CG   . PHE B 1 84  ? 4.558   -5.676  -6.250  1.00 0.00 ? 84  PHE B CG   1  
ATOM 1606  C CD1  . PHE B 1 84  ? 3.320   -6.306  -6.311  1.00 0.00 ? 84  PHE B CD1  1  
ATOM 1607  C CD2  . PHE B 1 84  ? 4.684   -4.579  -5.419  1.00 0.00 ? 84  PHE B CD2  1  
ATOM 1608  C CE1  . PHE B 1 84  ? 2.255   -5.857  -5.557  1.00 0.00 ? 84  PHE B CE1  1  
ATOM 1609  C CE2  . PHE B 1 84  ? 3.616   -4.126  -4.670  1.00 0.00 ? 84  PHE B CE2  1  
ATOM 1610  C CZ   . PHE B 1 84  ? 2.403   -4.766  -4.738  1.00 0.00 ? 84  PHE B CZ   1  
ATOM 1611  H H    . PHE B 1 84  ? 7.001   -9.013  -7.175  1.00 0.00 ? 84  PHE B H    1  
ATOM 1612  H HA   . PHE B 1 84  ? 4.631   -7.745  -8.054  1.00 0.00 ? 84  PHE B HA   1  
ATOM 1613  H HB2  . PHE B 1 84  ? 6.611   -6.166  -6.415  1.00 0.00 ? 84  PHE B HB2  1  
ATOM 1614  H HB3  . PHE B 1 84  ? 5.947   -5.411  -7.847  1.00 0.00 ? 84  PHE B HB3  1  
ATOM 1615  H HD1  . PHE B 1 84  ? 3.179   -7.165  -6.947  1.00 0.00 ? 84  PHE B HD1  1  
ATOM 1616  H HD2  . PHE B 1 84  ? 5.635   -4.073  -5.356  1.00 0.00 ? 84  PHE B HD2  1  
ATOM 1617  H HE1  . PHE B 1 84  ? 1.302   -6.365  -5.613  1.00 0.00 ? 84  PHE B HE1  1  
ATOM 1618  H HE2  . PHE B 1 84  ? 3.734   -3.267  -4.026  1.00 0.00 ? 84  PHE B HE2  1  
ATOM 1619  H HZ   . PHE B 1 84  ? 1.569   -4.409  -4.152  1.00 0.00 ? 84  PHE B HZ   1  
ATOM 1620  N N    . SER B 1 85  ? 6.117   -6.734  -9.958  1.00 0.00 ? 85  SER B N    1  
ATOM 1621  C CA   . SER B 1 85  ? 6.848   -6.604  -11.177 1.00 0.00 ? 85  SER B CA   1  
ATOM 1622  C C    . SER B 1 85  ? 7.484   -5.199  -11.228 1.00 0.00 ? 85  SER B C    1  
ATOM 1623  O O    . SER B 1 85  ? 6.866   -4.231  -10.797 1.00 0.00 ? 85  SER B O    1  
ATOM 1624  C CB   . SER B 1 85  ? 5.893   -6.828  -12.336 1.00 0.00 ? 85  SER B CB   1  
ATOM 1625  O OG   . SER B 1 85  ? 5.228   -8.079  -12.174 1.00 0.00 ? 85  SER B OG   1  
ATOM 1626  H H    . SER B 1 85  ? 5.323   -6.172  -9.834  1.00 0.00 ? 85  SER B H    1  
ATOM 1627  H HA   . SER B 1 85  ? 7.614   -7.365  -11.187 1.00 0.00 ? 85  SER B HA   1  
ATOM 1628  H HB2  . SER B 1 85  ? 5.161   -6.035  -12.361 1.00 0.00 ? 85  SER B HB2  1  
ATOM 1629  H HB3  . SER B 1 85  ? 6.444   -6.842  -13.264 1.00 0.00 ? 85  SER B HB3  1  
ATOM 1630  H HG   . SER B 1 85  ? 5.738   -8.582  -11.524 1.00 0.00 ? 85  SER B HG   1  
ATOM 1631  N N    . PRO B 1 86  ? 8.754   -5.096  -11.751 1.00 0.00 ? 86  PRO B N    1  
ATOM 1632  C CA   . PRO B 1 86  ? 9.589   -3.853  -11.743 1.00 0.00 ? 86  PRO B CA   1  
ATOM 1633  C C    . PRO B 1 86  ? 8.907   -2.571  -12.238 1.00 0.00 ? 86  PRO B C    1  
ATOM 1634  O O    . PRO B 1 86  ? 9.279   -1.469  -11.826 1.00 0.00 ? 86  PRO B O    1  
ATOM 1635  C CB   . PRO B 1 86  ? 10.751  -4.207  -12.662 1.00 0.00 ? 86  PRO B CB   1  
ATOM 1636  C CG   . PRO B 1 86  ? 10.898  -5.675  -12.520 1.00 0.00 ? 86  PRO B CG   1  
ATOM 1637  C CD   . PRO B 1 86  ? 9.503   -6.214  -12.389 1.00 0.00 ? 86  PRO B CD   1  
ATOM 1638  H HA   . PRO B 1 86  ? 9.982   -3.669  -10.755 1.00 0.00 ? 86  PRO B HA   1  
ATOM 1639  H HB2  . PRO B 1 86  ? 10.493  -3.927  -13.672 1.00 0.00 ? 86  PRO B HB2  1  
ATOM 1640  H HB3  . PRO B 1 86  ? 11.643  -3.684  -12.348 1.00 0.00 ? 86  PRO B HB3  1  
ATOM 1641  H HG2  . PRO B 1 86  ? 11.383  -6.086  -13.393 1.00 0.00 ? 86  PRO B HG2  1  
ATOM 1642  H HG3  . PRO B 1 86  ? 11.470  -5.901  -11.632 1.00 0.00 ? 86  PRO B HG3  1  
ATOM 1643  H HD2  . PRO B 1 86  ? 9.093   -6.455  -13.358 1.00 0.00 ? 86  PRO B HD2  1  
ATOM 1644  H HD3  . PRO B 1 86  ? 9.511   -7.085  -11.750 1.00 0.00 ? 86  PRO B HD3  1  
ATOM 1645  N N    . GLU B 1 87  ? 7.935   -2.698  -13.118 1.00 0.00 ? 87  GLU B N    1  
ATOM 1646  C CA   . GLU B 1 87  ? 7.239   -1.528  -13.630 1.00 0.00 ? 87  GLU B CA   1  
ATOM 1647  C C    . GLU B 1 87  ? 6.300   -0.939  -12.584 1.00 0.00 ? 87  GLU B C    1  
ATOM 1648  O O    . GLU B 1 87  ? 5.947   0.231   -12.640 1.00 0.00 ? 87  GLU B O    1  
ATOM 1649  C CB   . GLU B 1 87  ? 6.502   -1.833  -14.930 1.00 0.00 ? 87  GLU B CB   1  
ATOM 1650  C CG   . GLU B 1 87  ? 7.425   -2.234  -16.069 1.00 0.00 ? 87  GLU B CG   1  
ATOM 1651  C CD   . GLU B 1 87  ? 8.508   -1.208  -16.319 1.00 0.00 ? 87  GLU B CD   1  
ATOM 1652  O OE1  . GLU B 1 87  ? 8.205   -0.102  -16.827 1.00 0.00 ? 87  GLU B OE1  1  
ATOM 1653  O OE2  . GLU B 1 87  ? 9.688   -1.481  -15.991 1.00 0.00 ? 87  GLU B OE2  1  
ATOM 1654  H H    . GLU B 1 87  ? 7.687   -3.595  -13.420 1.00 0.00 ? 87  GLU B H    1  
ATOM 1655  H HA   . GLU B 1 87  ? 8.002   -0.791  -13.831 1.00 0.00 ? 87  GLU B HA   1  
ATOM 1656  H HB2  . GLU B 1 87  ? 5.808   -2.640  -14.752 1.00 0.00 ? 87  GLU B HB2  1  
ATOM 1657  H HB3  . GLU B 1 87  ? 5.952   -0.954  -15.232 1.00 0.00 ? 87  GLU B HB3  1  
ATOM 1658  H HG2  . GLU B 1 87  ? 7.895   -3.176  -15.823 1.00 0.00 ? 87  GLU B HG2  1  
ATOM 1659  H HG3  . GLU B 1 87  ? 6.842   -2.348  -16.970 1.00 0.00 ? 87  GLU B HG3  1  
ATOM 1660  N N    . GLU B 1 88  ? 5.944   -1.742  -11.612 1.00 0.00 ? 88  GLU B N    1  
ATOM 1661  C CA   . GLU B 1 88  ? 5.086   -1.314  -10.529 1.00 0.00 ? 88  GLU B CA   1  
ATOM 1662  C C    . GLU B 1 88  ? 5.932   -0.955  -9.314  1.00 0.00 ? 88  GLU B C    1  
ATOM 1663  O O    . GLU B 1 88  ? 5.430   -0.875  -8.195  1.00 0.00 ? 88  GLU B O    1  
ATOM 1664  C CB   . GLU B 1 88  ? 4.066   -2.406  -10.148 1.00 0.00 ? 88  GLU B CB   1  
ATOM 1665  C CG   . GLU B 1 88  ? 2.941   -2.667  -11.159 1.00 0.00 ? 88  GLU B CG   1  
ATOM 1666  C CD   . GLU B 1 88  ? 3.393   -3.275  -12.463 1.00 0.00 ? 88  GLU B CD   1  
ATOM 1667  O OE1  . GLU B 1 88  ? 3.617   -4.492  -12.508 1.00 0.00 ? 88  GLU B OE1  1  
ATOM 1668  O OE2  . GLU B 1 88  ? 3.455   -2.564  -13.479 1.00 0.00 ? 88  GLU B OE2  1  
ATOM 1669  H H    . GLU B 1 88  ? 6.271   -2.668  -11.588 1.00 0.00 ? 88  GLU B H    1  
ATOM 1670  H HA   . GLU B 1 88  ? 4.555   -0.433  -10.858 1.00 0.00 ? 88  GLU B HA   1  
ATOM 1671  H HB2  . GLU B 1 88  ? 4.599   -3.334  -10.009 1.00 0.00 ? 88  GLU B HB2  1  
ATOM 1672  H HB3  . GLU B 1 88  ? 3.614   -2.129  -9.206  1.00 0.00 ? 88  GLU B HB3  1  
ATOM 1673  H HG2  . GLU B 1 88  ? 2.228   -3.342  -10.711 1.00 0.00 ? 88  GLU B HG2  1  
ATOM 1674  H HG3  . GLU B 1 88  ? 2.446   -1.730  -11.365 1.00 0.00 ? 88  GLU B HG3  1  
ATOM 1675  N N    . LEU B 1 89  ? 7.209   -0.724  -9.550  1.00 0.00 ? 89  LEU B N    1  
ATOM 1676  C CA   . LEU B 1 89  ? 8.152   -0.417  -8.498  1.00 0.00 ? 89  LEU B CA   1  
ATOM 1677  C C    . LEU B 1 89  ? 8.787   0.925   -8.711  1.00 0.00 ? 89  LEU B C    1  
ATOM 1678  O O    . LEU B 1 89  ? 8.974   1.388   -9.848  1.00 0.00 ? 89  LEU B O    1  
ATOM 1679  C CB   . LEU B 1 89  ? 9.282   -1.470  -8.441  1.00 0.00 ? 89  LEU B CB   1  
ATOM 1680  C CG   . LEU B 1 89  ? 9.289   -2.463  -7.268  1.00 0.00 ? 89  LEU B CG   1  
ATOM 1681  C CD1  . LEU B 1 89  ? 9.438   -1.751  -5.932  1.00 0.00 ? 89  LEU B CD1  1  
ATOM 1682  C CD2  . LEU B 1 89  ? 8.043   -3.336  -7.283  1.00 0.00 ? 89  LEU B CD2  1  
ATOM 1683  H H    . LEU B 1 89  ? 7.533   -0.741  -10.475 1.00 0.00 ? 89  LEU B H    1  
ATOM 1684  H HA   . LEU B 1 89  ? 7.634   -0.432  -7.551  1.00 0.00 ? 89  LEU B HA   1  
ATOM 1685  H HB2  . LEU B 1 89  ? 9.236   -2.046  -9.354  1.00 0.00 ? 89  LEU B HB2  1  
ATOM 1686  H HB3  . LEU B 1 89  ? 10.223  -0.939  -8.436  1.00 0.00 ? 89  LEU B HB3  1  
ATOM 1687  H HG   . LEU B 1 89  ? 10.149  -3.108  -7.375  1.00 0.00 ? 89  LEU B HG   1  
ATOM 1688  H HD11 . LEU B 1 89  ? 9.463   -2.482  -5.138  1.00 0.00 ? 89  LEU B HD11 1  
ATOM 1689  H HD12 . LEU B 1 89  ? 8.600   -1.085  -5.778  1.00 0.00 ? 89  LEU B HD12 1  
ATOM 1690  H HD13 . LEU B 1 89  ? 10.354  -1.180  -5.923  1.00 0.00 ? 89  LEU B HD13 1  
ATOM 1691  H HD21 . LEU B 1 89  ? 8.075   -4.022  -6.448  1.00 0.00 ? 89  LEU B HD21 1  
ATOM 1692  H HD22 . LEU B 1 89  ? 8.008   -3.895  -8.206  1.00 0.00 ? 89  LEU B HD22 1  
ATOM 1693  H HD23 . LEU B 1 89  ? 7.164   -2.713  -7.207  1.00 0.00 ? 89  LEU B HD23 1  
ATOM 1694  N N    . LYS B 1 90  ? 9.082   1.543   -7.625  1.00 0.00 ? 90  LYS B N    1  
ATOM 1695  C CA   . LYS B 1 90  ? 9.815   2.750   -7.568  1.00 0.00 ? 90  LYS B CA   1  
ATOM 1696  C C    . LYS B 1 90  ? 10.784  2.621   -6.415  1.00 0.00 ? 90  LYS B C    1  
ATOM 1697  O O    . LYS B 1 90  ? 10.382  2.321   -5.288  1.00 0.00 ? 90  LYS B O    1  
ATOM 1698  C CB   . LYS B 1 90  ? 8.864   3.943   -7.341  1.00 0.00 ? 90  LYS B CB   1  
ATOM 1699  C CG   . LYS B 1 90  ? 9.561   5.279   -7.091  1.00 0.00 ? 90  LYS B CG   1  
ATOM 1700  C CD   . LYS B 1 90  ? 10.445  5.696   -8.256  1.00 0.00 ? 90  LYS B CD   1  
ATOM 1701  C CE   . LYS B 1 90  ? 11.212  6.983   -7.952  1.00 0.00 ? 90  LYS B CE   1  
ATOM 1702  N NZ   . LYS B 1 90  ? 10.323  8.147   -7.753  1.00 0.00 ? 90  LYS B NZ   1  
ATOM 1703  H H    . LYS B 1 90  ? 8.766   1.167   -6.771  1.00 0.00 ? 90  LYS B H    1  
ATOM 1704  H HA   . LYS B 1 90  ? 10.345  2.879   -8.498  1.00 0.00 ? 90  LYS B HA   1  
ATOM 1705  H HB2  . LYS B 1 90  ? 8.239   4.052   -8.214  1.00 0.00 ? 90  LYS B HB2  1  
ATOM 1706  H HB3  . LYS B 1 90  ? 8.237   3.722   -6.490  1.00 0.00 ? 90  LYS B HB3  1  
ATOM 1707  H HG2  . LYS B 1 90  ? 8.811   6.039   -6.932  1.00 0.00 ? 90  LYS B HG2  1  
ATOM 1708  H HG3  . LYS B 1 90  ? 10.170  5.188   -6.203  1.00 0.00 ? 90  LYS B HG3  1  
ATOM 1709  H HD2  . LYS B 1 90  ? 11.158  4.907   -8.441  1.00 0.00 ? 90  LYS B HD2  1  
ATOM 1710  H HD3  . LYS B 1 90  ? 9.830   5.846   -9.130  1.00 0.00 ? 90  LYS B HD3  1  
ATOM 1711  H HE2  . LYS B 1 90  ? 11.795  6.835   -7.054  1.00 0.00 ? 90  LYS B HE2  1  
ATOM 1712  H HE3  . LYS B 1 90  ? 11.876  7.185   -8.779  1.00 0.00 ? 90  LYS B HE3  1  
ATOM 1713  H HZ1  . LYS B 1 90  ? 9.765   8.332   -8.611  1.00 0.00 ? 90  LYS B HZ1  1  
ATOM 1714  H HZ2  . LYS B 1 90  ? 10.872  9.002   -7.529  1.00 0.00 ? 90  LYS B HZ2  1  
ATOM 1715  H HZ3  . LYS B 1 90  ? 9.664   7.977   -6.968  1.00 0.00 ? 90  LYS B HZ3  1  
ATOM 1716  N N    . VAL B 1 91  ? 12.028  2.805   -6.688  1.00 0.00 ? 91  VAL B N    1  
ATOM 1717  C CA   . VAL B 1 91  ? 13.024  2.771   -5.669  1.00 0.00 ? 91  VAL B CA   1  
ATOM 1718  C C    . VAL B 1 91  ? 13.548  4.175   -5.459  1.00 0.00 ? 91  VAL B C    1  
ATOM 1719  O O    . VAL B 1 91  ? 13.878  4.881   -6.424  1.00 0.00 ? 91  VAL B O    1  
ATOM 1720  C CB   . VAL B 1 91  ? 14.169  1.744   -5.968  1.00 0.00 ? 91  VAL B CB   1  
ATOM 1721  C CG1  . VAL B 1 91  ? 14.799  1.967   -7.337  1.00 0.00 ? 91  VAL B CG1  1  
ATOM 1722  C CG2  . VAL B 1 91  ? 15.239  1.802   -4.884  1.00 0.00 ? 91  VAL B CG2  1  
ATOM 1723  H H    . VAL B 1 91  ? 12.307  2.983   -7.613  1.00 0.00 ? 91  VAL B H    1  
ATOM 1724  H HA   . VAL B 1 91  ? 12.517  2.480   -4.760  1.00 0.00 ? 91  VAL B HA   1  
ATOM 1725  H HB   . VAL B 1 91  ? 13.740  0.753   -5.959  1.00 0.00 ? 91  VAL B HB   1  
ATOM 1726  H HG11 . VAL B 1 91  ? 14.051  1.832   -8.103  1.00 0.00 ? 91  VAL B HG11 1  
ATOM 1727  H HG12 . VAL B 1 91  ? 15.599  1.258   -7.487  1.00 0.00 ? 91  VAL B HG12 1  
ATOM 1728  H HG13 . VAL B 1 91  ? 15.189  2.972   -7.387  1.00 0.00 ? 91  VAL B HG13 1  
ATOM 1729  H HG21 . VAL B 1 91  ? 16.032  1.110   -5.123  1.00 0.00 ? 91  VAL B HG21 1  
ATOM 1730  H HG22 . VAL B 1 91  ? 14.811  1.548   -3.925  1.00 0.00 ? 91  VAL B HG22 1  
ATOM 1731  H HG23 . VAL B 1 91  ? 15.644  2.802   -4.839  1.00 0.00 ? 91  VAL B HG23 1  
ATOM 1732  N N    . LYS B 1 92  ? 13.574  4.594   -4.234  1.00 0.00 ? 92  LYS B N    1  
ATOM 1733  C CA   . LYS B 1 92  ? 13.957  5.924   -3.909  1.00 0.00 ? 92  LYS B CA   1  
ATOM 1734  C C    . LYS B 1 92  ? 15.003  5.938   -2.806  1.00 0.00 ? 92  LYS B C    1  
ATOM 1735  O O    . LYS B 1 92  ? 14.860  5.276   -1.777  1.00 0.00 ? 92  LYS B O    1  
ATOM 1736  C CB   . LYS B 1 92  ? 12.713  6.735   -3.487  1.00 0.00 ? 92  LYS B CB   1  
ATOM 1737  C CG   . LYS B 1 92  ? 11.880  6.032   -2.415  1.00 0.00 ? 92  LYS B CG   1  
ATOM 1738  C CD   . LYS B 1 92  ? 10.787  6.903   -1.813  1.00 0.00 ? 92  LYS B CD   1  
ATOM 1739  C CE   . LYS B 1 92  ? 11.349  8.153   -1.152  1.00 0.00 ? 92  LYS B CE   1  
ATOM 1740  N NZ   . LYS B 1 92  ? 10.352  8.788   -0.268  1.00 0.00 ? 92  LYS B NZ   1  
ATOM 1741  H H    . LYS B 1 92  ? 13.344  3.989   -3.491  1.00 0.00 ? 92  LYS B H    1  
ATOM 1742  H HA   . LYS B 1 92  ? 14.371  6.382   -4.794  1.00 0.00 ? 92  LYS B HA   1  
ATOM 1743  H HB2  . LYS B 1 92  ? 13.038  7.690   -3.100  1.00 0.00 ? 92  LYS B HB2  1  
ATOM 1744  H HB3  . LYS B 1 92  ? 12.089  6.896   -4.353  1.00 0.00 ? 92  LYS B HB3  1  
ATOM 1745  H HG2  . LYS B 1 92  ? 11.422  5.157   -2.852  1.00 0.00 ? 92  LYS B HG2  1  
ATOM 1746  H HG3  . LYS B 1 92  ? 12.562  5.723   -1.637  1.00 0.00 ? 92  LYS B HG3  1  
ATOM 1747  H HD2  . LYS B 1 92  ? 10.104  7.201   -2.592  1.00 0.00 ? 92  LYS B HD2  1  
ATOM 1748  H HD3  . LYS B 1 92  ? 10.250  6.328   -1.074  1.00 0.00 ? 92  LYS B HD3  1  
ATOM 1749  H HE2  . LYS B 1 92  ? 12.213  7.883   -0.563  1.00 0.00 ? 92  LYS B HE2  1  
ATOM 1750  H HE3  . LYS B 1 92  ? 11.640  8.858   -1.916  1.00 0.00 ? 92  LYS B HE3  1  
ATOM 1751  H HZ1  . LYS B 1 92  ? 10.252  8.218   0.601   1.00 0.00 ? 92  LYS B HZ1  1  
ATOM 1752  H HZ2  . LYS B 1 92  ? 9.423   8.872   -0.727  1.00 0.00 ? 92  LYS B HZ2  1  
ATOM 1753  H HZ3  . LYS B 1 92  ? 10.643  9.745   0.015   1.00 0.00 ? 92  LYS B HZ3  1  
ATOM 1754  N N    . VAL B 1 93  ? 16.046  6.666   -3.033  1.00 0.00 ? 93  VAL B N    1  
ATOM 1755  C CA   . VAL B 1 93  ? 17.060  6.879   -2.045  1.00 0.00 ? 93  VAL B CA   1  
ATOM 1756  C C    . VAL B 1 93  ? 17.197  8.372   -1.860  1.00 0.00 ? 93  VAL B C    1  
ATOM 1757  O O    . VAL B 1 93  ? 17.464  9.112   -2.805  1.00 0.00 ? 93  VAL B O    1  
ATOM 1758  C CB   . VAL B 1 93  ? 18.425  6.187   -2.396  1.00 0.00 ? 93  VAL B CB   1  
ATOM 1759  C CG1  . VAL B 1 93  ? 19.000  6.648   -3.737  1.00 0.00 ? 93  VAL B CG1  1  
ATOM 1760  C CG2  . VAL B 1 93  ? 19.437  6.375   -1.274  1.00 0.00 ? 93  VAL B CG2  1  
ATOM 1761  H H    . VAL B 1 93  ? 16.159  7.102   -3.906  1.00 0.00 ? 93  VAL B H    1  
ATOM 1762  H HA   . VAL B 1 93  ? 16.673  6.475   -1.119  1.00 0.00 ? 93  VAL B HA   1  
ATOM 1763  H HB   . VAL B 1 93  ? 18.231  5.129   -2.493  1.00 0.00 ? 93  VAL B HB   1  
ATOM 1764  H HG11 . VAL B 1 93  ? 19.936  6.143   -3.924  1.00 0.00 ? 93  VAL B HG11 1  
ATOM 1765  H HG12 . VAL B 1 93  ? 19.166  7.716   -3.706  1.00 0.00 ? 93  VAL B HG12 1  
ATOM 1766  H HG13 . VAL B 1 93  ? 18.300  6.418   -4.527  1.00 0.00 ? 93  VAL B HG13 1  
ATOM 1767  H HG21 . VAL B 1 93  ? 20.368  5.898   -1.543  1.00 0.00 ? 93  VAL B HG21 1  
ATOM 1768  H HG22 . VAL B 1 93  ? 19.055  5.933   -0.366  1.00 0.00 ? 93  VAL B HG22 1  
ATOM 1769  H HG23 . VAL B 1 93  ? 19.608  7.431   -1.115  1.00 0.00 ? 93  VAL B HG23 1  
ATOM 1770  N N    . LEU B 1 94  ? 16.931  8.828   -0.689  1.00 0.00 ? 94  LEU B N    1  
ATOM 1771  C CA   . LEU B 1 94  ? 16.902  10.228  -0.450  1.00 0.00 ? 94  LEU B CA   1  
ATOM 1772  C C    . LEU B 1 94  ? 17.629  10.540  0.833   1.00 0.00 ? 94  LEU B C    1  
ATOM 1773  O O    . LEU B 1 94  ? 17.030  10.560  1.925   1.00 0.00 ? 94  LEU B O    1  
ATOM 1774  C CB   . LEU B 1 94  ? 15.439  10.693  -0.391  1.00 0.00 ? 94  LEU B CB   1  
ATOM 1775  C CG   . LEU B 1 94  ? 15.191  12.191  -0.257  1.00 0.00 ? 94  LEU B CG   1  
ATOM 1776  C CD1  . LEU B 1 94  ? 15.735  12.943  -1.460  1.00 0.00 ? 94  LEU B CD1  1  
ATOM 1777  C CD2  . LEU B 1 94  ? 13.707  12.464  -0.072  1.00 0.00 ? 94  LEU B CD2  1  
ATOM 1778  H H    . LEU B 1 94  ? 16.779  8.200   0.057   1.00 0.00 ? 94  LEU B H    1  
ATOM 1779  H HA   . LEU B 1 94  ? 17.388  10.727  -1.276  1.00 0.00 ? 94  LEU B HA   1  
ATOM 1780  H HB2  . LEU B 1 94  ? 14.947  10.355  -1.291  1.00 0.00 ? 94  LEU B HB2  1  
ATOM 1781  H HB3  . LEU B 1 94  ? 14.972  10.200  0.449   1.00 0.00 ? 94  LEU B HB3  1  
ATOM 1782  H HG   . LEU B 1 94  ? 15.714  12.556  0.612   1.00 0.00 ? 94  LEU B HG   1  
ATOM 1783  H HD11 . LEU B 1 94  ? 15.534  13.998  -1.344  1.00 0.00 ? 94  LEU B HD11 1  
ATOM 1784  H HD12 . LEU B 1 94  ? 15.257  12.582  -2.358  1.00 0.00 ? 94  LEU B HD12 1  
ATOM 1785  H HD13 . LEU B 1 94  ? 16.800  12.789  -1.533  1.00 0.00 ? 94  LEU B HD13 1  
ATOM 1786  H HD21 . LEU B 1 94  ? 13.164  12.103  -0.933  1.00 0.00 ? 94  LEU B HD21 1  
ATOM 1787  H HD22 . LEU B 1 94  ? 13.547  13.526  0.034   1.00 0.00 ? 94  LEU B HD22 1  
ATOM 1788  H HD23 . LEU B 1 94  ? 13.355  11.956  0.814   1.00 0.00 ? 94  LEU B HD23 1  
ATOM 1789  N N    . GLY B 1 95  ? 18.903  10.802  0.696   1.00 0.00 ? 95  GLY B N    1  
ATOM 1790  C CA   . GLY B 1 95  ? 19.727  11.096  1.825   1.00 0.00 ? 95  GLY B CA   1  
ATOM 1791  C C    . GLY B 1 95  ? 19.874  9.912   2.739   1.00 0.00 ? 95  GLY B C    1  
ATOM 1792  O O    . GLY B 1 95  ? 20.449  8.893   2.370   1.00 0.00 ? 95  GLY B O    1  
ATOM 1793  H H    . GLY B 1 95  ? 19.292  10.813  -0.204  1.00 0.00 ? 95  GLY B H    1  
ATOM 1794  H HA2  . GLY B 1 95  ? 20.704  11.398  1.479   1.00 0.00 ? 95  GLY B HA2  1  
ATOM 1795  H HA3  . GLY B 1 95  ? 19.284  11.910  2.377   1.00 0.00 ? 95  GLY B HA3  1  
ATOM 1796  N N    . ASP B 1 96  ? 19.299  10.047  3.899   1.00 0.00 ? 96  ASP B N    1  
ATOM 1797  C CA   . ASP B 1 96  ? 19.367  9.061   4.965   1.00 0.00 ? 96  ASP B CA   1  
ATOM 1798  C C    . ASP B 1 96  ? 18.287  8.006   4.833   1.00 0.00 ? 96  ASP B C    1  
ATOM 1799  O O    . ASP B 1 96  ? 18.244  7.060   5.610   1.00 0.00 ? 96  ASP B O    1  
ATOM 1800  C CB   . ASP B 1 96  ? 19.207  9.773   6.323   1.00 0.00 ? 96  ASP B CB   1  
ATOM 1801  C CG   . ASP B 1 96  ? 17.903  10.562  6.444   1.00 0.00 ? 96  ASP B CG   1  
ATOM 1802  O OD1  . ASP B 1 96  ? 17.776  11.633  5.788   1.00 0.00 ? 96  ASP B OD1  1  
ATOM 1803  O OD2  . ASP B 1 96  ? 17.009  10.184  7.221   1.00 0.00 ? 96  ASP B OD2  1  
ATOM 1804  H H    . ASP B 1 96  ? 18.780  10.862  4.068   1.00 0.00 ? 96  ASP B H    1  
ATOM 1805  H HA   . ASP B 1 96  ? 20.339  8.595   4.949   1.00 0.00 ? 96  ASP B HA   1  
ATOM 1806  H HB2  . ASP B 1 96  ? 19.221  9.030   7.108   1.00 0.00 ? 96  ASP B HB2  1  
ATOM 1807  H HB3  . ASP B 1 96  ? 20.035  10.451  6.464   1.00 0.00 ? 96  ASP B HB3  1  
ATOM 1808  N N    . VAL B 1 97  ? 17.404  8.156   3.881   1.00 0.00 ? 97  VAL B N    1  
ATOM 1809  C CA   . VAL B 1 97  ? 16.368  7.170   3.727   1.00 0.00 ? 97  VAL B CA   1  
ATOM 1810  C C    . VAL B 1 97  ? 16.473  6.423   2.429   1.00 0.00 ? 97  VAL B C    1  
ATOM 1811  O O    . VAL B 1 97  ? 16.747  7.000   1.365   1.00 0.00 ? 97  VAL B O    1  
ATOM 1812  C CB   . VAL B 1 97  ? 14.916  7.718   3.922   1.00 0.00 ? 97  VAL B CB   1  
ATOM 1813  C CG1  . VAL B 1 97  ? 14.721  8.243   5.326   1.00 0.00 ? 97  VAL B CG1  1  
ATOM 1814  C CG2  . VAL B 1 97  ? 14.557  8.784   2.895   1.00 0.00 ? 97  VAL B CG2  1  
ATOM 1815  H H    . VAL B 1 97  ? 17.468  8.915   3.263   1.00 0.00 ? 97  VAL B H    1  
ATOM 1816  H HA   . VAL B 1 97  ? 16.547  6.446   4.508   1.00 0.00 ? 97  VAL B HA   1  
ATOM 1817  H HB   . VAL B 1 97  ? 14.241  6.884   3.799   1.00 0.00 ? 97  VAL B HB   1  
ATOM 1818  H HG11 . VAL B 1 97  ? 13.723  8.647   5.423   1.00 0.00 ? 97  VAL B HG11 1  
ATOM 1819  H HG12 . VAL B 1 97  ? 15.450  9.014   5.526   1.00 0.00 ? 97  VAL B HG12 1  
ATOM 1820  H HG13 . VAL B 1 97  ? 14.852  7.437   6.032   1.00 0.00 ? 97  VAL B HG13 1  
ATOM 1821  H HG21 . VAL B 1 97  ? 15.243  9.614   2.983   1.00 0.00 ? 97  VAL B HG21 1  
ATOM 1822  H HG22 . VAL B 1 97  ? 13.548  9.128   3.067   1.00 0.00 ? 97  VAL B HG22 1  
ATOM 1823  H HG23 . VAL B 1 97  ? 14.630  8.364   1.902   1.00 0.00 ? 97  VAL B HG23 1  
ATOM 1824  N N    . ILE B 1 98  ? 16.268  5.152   2.529   1.00 0.00 ? 98  ILE B N    1  
ATOM 1825  C CA   . ILE B 1 98  ? 16.211  4.289   1.401   1.00 0.00 ? 98  ILE B CA   1  
ATOM 1826  C C    . ILE B 1 98  ? 14.881  3.557   1.474   1.00 0.00 ? 98  ILE B C    1  
ATOM 1827  O O    . ILE B 1 98  ? 14.577  2.889   2.466   1.00 0.00 ? 98  ILE B O    1  
ATOM 1828  C CB   . ILE B 1 98  ? 17.462  3.311   1.298   1.00 0.00 ? 98  ILE B CB   1  
ATOM 1829  C CG1  . ILE B 1 98  ? 17.262  2.282   0.181   1.00 0.00 ? 98  ILE B CG1  1  
ATOM 1830  C CG2  . ILE B 1 98  ? 17.808  2.633   2.599   1.00 0.00 ? 98  ILE B CG2  1  
ATOM 1831  C CD1  . ILE B 1 98  ? 17.133  2.887   -1.203  1.00 0.00 ? 98  ILE B CD1  1  
ATOM 1832  H H    . ILE B 1 98  ? 16.107  4.769   3.418   1.00 0.00 ? 98  ILE B H    1  
ATOM 1833  H HA   . ILE B 1 98  ? 16.179  4.933   0.532   1.00 0.00 ? 98  ILE B HA   1  
ATOM 1834  H HB   . ILE B 1 98  ? 18.313  3.922   1.032   1.00 0.00 ? 98  ILE B HB   1  
ATOM 1835  H HG12 . ILE B 1 98  ? 18.104  1.608   0.176   1.00 0.00 ? 98  ILE B HG12 1  
ATOM 1836  H HG13 . ILE B 1 98  ? 16.363  1.719   0.385   1.00 0.00 ? 98  ILE B HG13 1  
ATOM 1837  H HG21 . ILE B 1 98  ? 16.995  1.981   2.879   1.00 0.00 ? 98  ILE B HG21 1  
ATOM 1838  H HG22 . ILE B 1 98  ? 17.959  3.376   3.368   1.00 0.00 ? 98  ILE B HG22 1  
ATOM 1839  H HG23 . ILE B 1 98  ? 18.708  2.049   2.474   1.00 0.00 ? 98  ILE B HG23 1  
ATOM 1840  H HD11 . ILE B 1 98  ? 18.053  3.391   -1.460  1.00 0.00 ? 98  ILE B HD11 1  
ATOM 1841  H HD12 . ILE B 1 98  ? 16.315  3.592   -1.219  1.00 0.00 ? 98  ILE B HD12 1  
ATOM 1842  H HD13 . ILE B 1 98  ? 16.937  2.104   -1.920  1.00 0.00 ? 98  ILE B HD13 1  
ATOM 1843  N N    . GLU B 1 99  ? 14.067  3.729   0.464   1.00 0.00 ? 99  GLU B N    1  
ATOM 1844  C CA   . GLU B 1 99  ? 12.729  3.194   0.477   1.00 0.00 ? 99  GLU B CA   1  
ATOM 1845  C C    . GLU B 1 99  ? 12.388  2.602   -0.869  1.00 0.00 ? 99  GLU B C    1  
ATOM 1846  O O    . GLU B 1 99  ? 12.897  3.038   -1.906  1.00 0.00 ? 99  GLU B O    1  
ATOM 1847  C CB   . GLU B 1 99  ? 11.701  4.295   0.783   1.00 0.00 ? 99  GLU B CB   1  
ATOM 1848  C CG   . GLU B 1 99  ? 11.914  5.073   2.069   1.00 0.00 ? 99  GLU B CG   1  
ATOM 1849  C CD   . GLU B 1 99  ? 10.884  6.152   2.228   1.00 0.00 ? 99  GLU B CD   1  
ATOM 1850  O OE1  . GLU B 1 99  ? 9.759   5.854   2.683   1.00 0.00 ? 99  GLU B OE1  1  
ATOM 1851  O OE2  . GLU B 1 99  ? 11.153  7.312   1.892   1.00 0.00 ? 99  GLU B OE2  1  
ATOM 1852  H H    . GLU B 1 99  ? 14.362  4.218   -0.339  1.00 0.00 ? 99  GLU B H    1  
ATOM 1853  H HA   . GLU B 1 99  ? 12.659  2.438   1.244   1.00 0.00 ? 99  GLU B HA   1  
ATOM 1854  H HB2  . GLU B 1 99  ? 11.694  5.007   -0.028  1.00 0.00 ? 99  GLU B HB2  1  
ATOM 1855  H HB3  . GLU B 1 99  ? 10.725  3.835   0.831   1.00 0.00 ? 99  GLU B HB3  1  
ATOM 1856  H HG2  . GLU B 1 99  ? 11.851  4.402   2.911   1.00 0.00 ? 99  GLU B HG2  1  
ATOM 1857  H HG3  . GLU B 1 99  ? 12.893  5.530   2.043   1.00 0.00 ? 99  GLU B HG3  1  
ATOM 1858  N N    . VAL B 1 100 ? 11.560  1.611   -0.854  1.00 0.00 ? 100 VAL B N    1  
ATOM 1859  C CA   . VAL B 1 100 ? 11.039  1.045   -2.067  1.00 0.00 ? 100 VAL B CA   1  
ATOM 1860  C C    . VAL B 1 100 ? 9.540   1.078   -2.020  1.00 0.00 ? 100 VAL B C    1  
ATOM 1861  O O    . VAL B 1 100 ? 8.927   0.786   -0.972  1.00 0.00 ? 100 VAL B O    1  
ATOM 1862  C CB   . VAL B 1 100 ? 11.544  -0.395  -2.379  1.00 0.00 ? 100 VAL B CB   1  
ATOM 1863  C CG1  . VAL B 1 100 ? 13.017  -0.374  -2.694  1.00 0.00 ? 100 VAL B CG1  1  
ATOM 1864  C CG2  . VAL B 1 100 ? 11.272  -1.348  -1.232  1.00 0.00 ? 100 VAL B CG2  1  
ATOM 1865  H H    . VAL B 1 100 ? 11.262  1.263   0.013   1.00 0.00 ? 100 VAL B H    1  
ATOM 1866  H HA   . VAL B 1 100 ? 11.348  1.707   -2.864  1.00 0.00 ? 100 VAL B HA   1  
ATOM 1867  H HB   . VAL B 1 100 ? 11.020  -0.749  -3.254  1.00 0.00 ? 100 VAL B HB   1  
ATOM 1868  H HG11 . VAL B 1 100 ? 13.183  0.201   -3.593  1.00 0.00 ? 100 VAL B HG11 1  
ATOM 1869  H HG12 . VAL B 1 100 ? 13.376  -1.383  -2.826  1.00 0.00 ? 100 VAL B HG12 1  
ATOM 1870  H HG13 . VAL B 1 100 ? 13.543  0.095   -1.874  1.00 0.00 ? 100 VAL B HG13 1  
ATOM 1871  H HG21 . VAL B 1 100 ? 10.218  -1.340  -0.995  1.00 0.00 ? 100 VAL B HG21 1  
ATOM 1872  H HG22 . VAL B 1 100 ? 11.835  -1.012  -0.374  1.00 0.00 ? 100 VAL B HG22 1  
ATOM 1873  H HG23 . VAL B 1 100 ? 11.576  -2.348  -1.506  1.00 0.00 ? 100 VAL B HG23 1  
ATOM 1874  N N    . HIS B 1 101 ? 8.957   1.496   -3.086  1.00 0.00 ? 101 HIS B N    1  
ATOM 1875  C CA   . HIS B 1 101 ? 7.542   1.564   -3.184  1.00 0.00 ? 101 HIS B CA   1  
ATOM 1876  C C    . HIS B 1 101 ? 7.073   0.773   -4.369  1.00 0.00 ? 101 HIS B C    1  
ATOM 1877  O O    . HIS B 1 101 ? 7.518   0.992   -5.479  1.00 0.00 ? 101 HIS B O    1  
ATOM 1878  C CB   . HIS B 1 101 ? 7.047   3.017   -3.296  1.00 0.00 ? 101 HIS B CB   1  
ATOM 1879  C CG   . HIS B 1 101 ? 5.556   3.110   -3.480  1.00 0.00 ? 101 HIS B CG   1  
ATOM 1880  N ND1  . HIS B 1 101 ? 4.956   3.455   -4.669  1.00 0.00 ? 101 HIS B ND1  1  
ATOM 1881  C CD2  . HIS B 1 101 ? 4.552   2.847   -2.626  1.00 0.00 ? 101 HIS B CD2  1  
ATOM 1882  C CE1  . HIS B 1 101 ? 3.658   3.399   -4.533  1.00 0.00 ? 101 HIS B CE1  1  
ATOM 1883  N NE2  . HIS B 1 101 ? 3.390   3.032   -3.307  1.00 0.00 ? 101 HIS B NE2  1  
ATOM 1884  H H    . HIS B 1 101 ? 9.495   1.764   -3.868  1.00 0.00 ? 101 HIS B H    1  
ATOM 1885  H HA   . HIS B 1 101 ? 7.124   1.130   -2.287  1.00 0.00 ? 101 HIS B HA   1  
ATOM 1886  H HB2  . HIS B 1 101 ? 7.308   3.556   -2.397  1.00 0.00 ? 101 HIS B HB2  1  
ATOM 1887  H HB3  . HIS B 1 101 ? 7.519   3.488   -4.146  1.00 0.00 ? 101 HIS B HB3  1  
ATOM 1888  H HD1  . HIS B 1 101 ? 5.397   3.696   -5.516  1.00 0.00 ? 101 HIS B HD1  1  
ATOM 1889  H HD2  . HIS B 1 101 ? 4.656   2.535   -1.597  1.00 0.00 ? 101 HIS B HD2  1  
ATOM 1890  H HE1  . HIS B 1 101 ? 2.931   3.619   -5.300  1.00 0.00 ? 101 HIS B HE1  1  
ATOM 1891  H HE2  . HIS B 1 101 ? 2.477   2.953   -2.924  1.00 0.00 ? 101 HIS B HE2  1  
ATOM 1892  N N    . GLY B 1 102 ? 6.195   -0.142  -4.117  1.00 0.00 ? 102 GLY B N    1  
ATOM 1893  C CA   . GLY B 1 102 ? 5.563   -0.886  -5.153  1.00 0.00 ? 102 GLY B CA   1  
ATOM 1894  C C    . GLY B 1 102 ? 4.070   -0.745  -5.029  1.00 0.00 ? 102 GLY B C    1  
ATOM 1895  O O    . GLY B 1 102 ? 3.554   -0.677  -3.912  1.00 0.00 ? 102 GLY B O    1  
ATOM 1896  H H    . GLY B 1 102 ? 5.951   -0.353  -3.185  1.00 0.00 ? 102 GLY B H    1  
ATOM 1897  H HA2  . GLY B 1 102 ? 5.886   -0.508  -6.112  1.00 0.00 ? 102 GLY B HA2  1  
ATOM 1898  H HA3  . GLY B 1 102 ? 5.827   -1.928  -5.060  1.00 0.00 ? 102 GLY B HA3  1  
ATOM 1899  N N    . LYS B 1 103 ? 3.385   -0.669  -6.134  1.00 0.00 ? 103 LYS B N    1  
ATOM 1900  C CA   . LYS B 1 103 ? 1.938   -0.527  -6.148  1.00 0.00 ? 103 LYS B CA   1  
ATOM 1901  C C    . LYS B 1 103 ? 1.361   -1.329  -7.309  1.00 0.00 ? 103 LYS B C    1  
ATOM 1902  O O    . LYS B 1 103 ? 1.770   -1.147  -8.446  1.00 0.00 ? 103 LYS B O    1  
ATOM 1903  C CB   . LYS B 1 103 ? 1.553   0.956   -6.293  1.00 0.00 ? 103 LYS B CB   1  
ATOM 1904  C CG   . LYS B 1 103 ? 0.047   1.226   -6.391  1.00 0.00 ? 103 LYS B CG   1  
ATOM 1905  C CD   . LYS B 1 103 ? -0.261  2.724   -6.455  1.00 0.00 ? 103 LYS B CD   1  
ATOM 1906  C CE   . LYS B 1 103 ? 0.292   3.386   -7.721  1.00 0.00 ? 103 LYS B CE   1  
ATOM 1907  N NZ   . LYS B 1 103 ? -0.347  2.877   -8.948  1.00 0.00 ? 103 LYS B NZ   1  
ATOM 1908  H H    . LYS B 1 103 ? 3.866   -0.716  -6.993  1.00 0.00 ? 103 LYS B H    1  
ATOM 1909  H HA   . LYS B 1 103 ? 1.546   -0.908  -5.218  1.00 0.00 ? 103 LYS B HA   1  
ATOM 1910  H HB2  . LYS B 1 103 ? 1.938   1.499   -5.442  1.00 0.00 ? 103 LYS B HB2  1  
ATOM 1911  H HB3  . LYS B 1 103 ? 2.024   1.335   -7.188  1.00 0.00 ? 103 LYS B HB3  1  
ATOM 1912  H HG2  . LYS B 1 103 ? -0.324  0.760   -7.291  1.00 0.00 ? 103 LYS B HG2  1  
ATOM 1913  H HG3  . LYS B 1 103 ? -0.455  0.795   -5.538  1.00 0.00 ? 103 LYS B HG3  1  
ATOM 1914  H HD2  . LYS B 1 103 ? -1.332  2.859   -6.440  1.00 0.00 ? 103 LYS B HD2  1  
ATOM 1915  H HD3  . LYS B 1 103 ? 0.170   3.202   -5.589  1.00 0.00 ? 103 LYS B HD3  1  
ATOM 1916  H HE2  . LYS B 1 103 ? 0.117   4.449   -7.661  1.00 0.00 ? 103 LYS B HE2  1  
ATOM 1917  H HE3  . LYS B 1 103 ? 1.355   3.211   -7.775  1.00 0.00 ? 103 LYS B HE3  1  
ATOM 1918  H HZ1  . LYS B 1 103 ? -0.233  1.849   -9.068  1.00 0.00 ? 103 LYS B HZ1  1  
ATOM 1919  H HZ2  . LYS B 1 103 ? 0.061   3.336   -9.786  1.00 0.00 ? 103 LYS B HZ2  1  
ATOM 1920  H HZ3  . LYS B 1 103 ? -1.363  3.101   -8.968  1.00 0.00 ? 103 LYS B HZ3  1  
ATOM 1921  N N    . HIS B 1 104 ? 0.422   -2.192  -7.031  1.00 0.00 ? 104 HIS B N    1  
ATOM 1922  C CA   . HIS B 1 104 ? -0.147  -3.045  -8.058  1.00 0.00 ? 104 HIS B CA   1  
ATOM 1923  C C    . HIS B 1 104 ? -1.650  -3.103  -7.926  1.00 0.00 ? 104 HIS B C    1  
ATOM 1924  O O    . HIS B 1 104 ? -2.182  -3.128  -6.816  1.00 0.00 ? 104 HIS B O    1  
ATOM 1925  C CB   . HIS B 1 104 ? 0.488   -4.450  -7.947  1.00 0.00 ? 104 HIS B CB   1  
ATOM 1926  C CG   . HIS B 1 104 ? -0.058  -5.530  -8.852  1.00 0.00 ? 104 HIS B CG   1  
ATOM 1927  N ND1  . HIS B 1 104 ? 0.167   -5.576  -10.204 1.00 0.00 ? 104 HIS B ND1  1  
ATOM 1928  C CD2  . HIS B 1 104 ? -0.801  -6.623  -8.566  1.00 0.00 ? 104 HIS B CD2  1  
ATOM 1929  C CE1  . HIS B 1 104 ? -0.410  -6.646  -10.708 1.00 0.00 ? 104 HIS B CE1  1  
ATOM 1930  N NE2  . HIS B 1 104 ? -1.001  -7.296  -9.736  1.00 0.00 ? 104 HIS B NE2  1  
ATOM 1931  H H    . HIS B 1 104 ? 0.074   -2.267  -6.112  1.00 0.00 ? 104 HIS B H    1  
ATOM 1932  H HA   . HIS B 1 104 ? 0.109   -2.630  -9.022  1.00 0.00 ? 104 HIS B HA   1  
ATOM 1933  H HB2  . HIS B 1 104 ? 1.543   -4.368  -8.166  1.00 0.00 ? 104 HIS B HB2  1  
ATOM 1934  H HB3  . HIS B 1 104 ? 0.380   -4.785  -6.925  1.00 0.00 ? 104 HIS B HB3  1  
ATOM 1935  H HD1  . HIS B 1 104 ? 0.669   -4.917  -10.732 1.00 0.00 ? 104 HIS B HD1  1  
ATOM 1936  H HD2  . HIS B 1 104 ? -1.169  -6.911  -7.591  1.00 0.00 ? 104 HIS B HD2  1  
ATOM 1937  H HE1  . HIS B 1 104 ? -0.401  -6.938  -11.748 1.00 0.00 ? 104 HIS B HE1  1  
ATOM 1938  H HE2  . HIS B 1 104 ? -1.619  -8.053  -9.854  1.00 0.00 ? 104 HIS B HE2  1  
ATOM 1939  N N    . GLU B 1 105 ? -2.320  -3.093  -9.054  1.00 0.00 ? 105 GLU B N    1  
ATOM 1940  C CA   . GLU B 1 105 ? -3.747  -3.235  -9.091  1.00 0.00 ? 105 GLU B CA   1  
ATOM 1941  C C    . GLU B 1 105 ? -4.002  -4.741  -9.009  1.00 0.00 ? 105 GLU B C    1  
ATOM 1942  O O    . GLU B 1 105 ? -3.529  -5.512  -9.849  1.00 0.00 ? 105 GLU B O    1  
ATOM 1943  C CB   . GLU B 1 105 ? -4.272  -2.671  -10.423 1.00 0.00 ? 105 GLU B CB   1  
ATOM 1944  C CG   . GLU B 1 105 ? -5.778  -2.427  -10.482 1.00 0.00 ? 105 GLU B CG   1  
ATOM 1945  C CD   . GLU B 1 105 ? -6.227  -1.236  -9.649  1.00 0.00 ? 105 GLU B CD   1  
ATOM 1946  O OE1  . GLU B 1 105 ? -6.252  -0.095  -10.166 1.00 0.00 ? 105 GLU B OE1  1  
ATOM 1947  O OE2  . GLU B 1 105 ? -6.586  -1.400  -8.495  1.00 0.00 ? 105 GLU B OE2  1  
ATOM 1948  H H    . GLU B 1 105 ? -1.839  -2.999  -9.903  1.00 0.00 ? 105 GLU B H    1  
ATOM 1949  H HA   . GLU B 1 105 ? -4.191  -2.719  -8.252  1.00 0.00 ? 105 GLU B HA   1  
ATOM 1950  H HB2  . GLU B 1 105 ? -3.779  -1.730  -10.614 1.00 0.00 ? 105 GLU B HB2  1  
ATOM 1951  H HB3  . GLU B 1 105 ? -4.011  -3.363  -11.210 1.00 0.00 ? 105 GLU B HB3  1  
ATOM 1952  H HG2  . GLU B 1 105 ? -6.061  -2.251  -11.510 1.00 0.00 ? 105 GLU B HG2  1  
ATOM 1953  H HG3  . GLU B 1 105 ? -6.284  -3.311  -10.123 1.00 0.00 ? 105 GLU B HG3  1  
ATOM 1954  N N    . GLU B 1 106 ? -4.714  -5.134  -8.004  1.00 0.00 ? 106 GLU B N    1  
ATOM 1955  C CA   . GLU B 1 106 ? -4.950  -6.523  -7.689  1.00 0.00 ? 106 GLU B CA   1  
ATOM 1956  C C    . GLU B 1 106 ? -6.059  -7.081  -8.523  1.00 0.00 ? 106 GLU B C    1  
ATOM 1957  O O    . GLU B 1 106 ? -5.858  -7.981  -9.342  1.00 0.00 ? 106 GLU B O    1  
ATOM 1958  C CB   . GLU B 1 106 ? -5.342  -6.658  -6.219  1.00 0.00 ? 106 GLU B CB   1  
ATOM 1959  C CG   . GLU B 1 106 ? -4.254  -6.311  -5.244  1.00 0.00 ? 106 GLU B CG   1  
ATOM 1960  C CD   . GLU B 1 106 ? -3.120  -7.279  -5.320  1.00 0.00 ? 106 GLU B CD   1  
ATOM 1961  O OE1  . GLU B 1 106 ? -3.315  -8.451  -4.950  1.00 0.00 ? 106 GLU B OE1  1  
ATOM 1962  O OE2  . GLU B 1 106 ? -2.016  -6.905  -5.752  1.00 0.00 ? 106 GLU B OE2  1  
ATOM 1963  H H    . GLU B 1 106 ? -5.144  -4.445  -7.447  1.00 0.00 ? 106 GLU B H    1  
ATOM 1964  H HA   . GLU B 1 106 ? -4.043  -7.085  -7.845  1.00 0.00 ? 106 GLU B HA   1  
ATOM 1965  H HB2  . GLU B 1 106 ? -6.182  -6.006  -6.026  1.00 0.00 ? 106 GLU B HB2  1  
ATOM 1966  H HB3  . GLU B 1 106 ? -5.649  -7.678  -6.042  1.00 0.00 ? 106 GLU B HB3  1  
ATOM 1967  H HG2  . GLU B 1 106 ? -3.881  -5.323  -5.467  1.00 0.00 ? 106 GLU B HG2  1  
ATOM 1968  H HG3  . GLU B 1 106 ? -4.658  -6.329  -4.243  1.00 0.00 ? 106 GLU B HG3  1  
ATOM 1969  N N    . ARG B 1 107 ? -7.220  -6.537  -8.323  1.00 0.00 ? 107 ARG B N    1  
ATOM 1970  C CA   . ARG B 1 107 ? -8.424  -7.021  -8.926  1.00 0.00 ? 107 ARG B CA   1  
ATOM 1971  C C    . ARG B 1 107 ? -9.296  -5.861  -9.338  1.00 0.00 ? 107 ARG B C    1  
ATOM 1972  O O    . ARG B 1 107 ? -9.585  -4.988  -8.536  1.00 0.00 ? 107 ARG B O    1  
ATOM 1973  C CB   . ARG B 1 107 ? -9.140  -7.979  -7.940  1.00 0.00 ? 107 ARG B CB   1  
ATOM 1974  C CG   . ARG B 1 107 ? -8.494  -9.351  -7.899  1.00 0.00 ? 107 ARG B CG   1  
ATOM 1975  C CD   . ARG B 1 107 ? -8.998  -10.242 -6.831  1.00 0.00 ? 107 ARG B CD   1  
ATOM 1976  N NE   . ARG B 1 107 ? -8.442  -9.868  -5.551  1.00 0.00 ? 107 ARG B NE   1  
ATOM 1977  C CZ   . ARG B 1 107 ? -9.154  -9.618  -4.495  1.00 0.00 ? 107 ARG B CZ   1  
ATOM 1978  N NH1  . ARG B 1 107 ? -10.469 -9.707  -4.553  1.00 0.00 ? 107 ARG B NH1  1  
ATOM 1979  N NH2  . ARG B 1 107 ? -8.567  -9.281  -3.369  1.00 0.00 ? 107 ARG B NH2  1  
ATOM 1980  H H    . ARG B 1 107 ? -7.275  -5.740  -7.751  1.00 0.00 ? 107 ARG B H    1  
ATOM 1981  H HA   . ARG B 1 107 ? -8.145  -7.581  -9.806  1.00 0.00 ? 107 ARG B HA   1  
ATOM 1982  H HB2  . ARG B 1 107 ? -9.069  -7.556  -6.950  1.00 0.00 ? 107 ARG B HB2  1  
ATOM 1983  H HB3  . ARG B 1 107 ? -10.175 -8.094  -8.219  1.00 0.00 ? 107 ARG B HB3  1  
ATOM 1984  H HG2  . ARG B 1 107 ? -8.662  -9.836  -8.848  1.00 0.00 ? 107 ARG B HG2  1  
ATOM 1985  H HG3  . ARG B 1 107 ? -7.430  -9.210  -7.771  1.00 0.00 ? 107 ARG B HG3  1  
ATOM 1986  H HD2  . ARG B 1 107 ? -10.074 -10.165 -6.801  1.00 0.00 ? 107 ARG B HD2  1  
ATOM 1987  H HD3  . ARG B 1 107 ? -8.715  -11.259 -7.055  1.00 0.00 ? 107 ARG B HD3  1  
ATOM 1988  H HE   . ARG B 1 107 ? -7.460  -9.812  -5.503  1.00 0.00 ? 107 ARG B HE   1  
ATOM 1989  H HH11 . ARG B 1 107 ? -10.986 -9.981  -5.365  1.00 0.00 ? 107 ARG B HH11 1  
ATOM 1990  H HH12 . ARG B 1 107 ? -11.008 -9.446  -3.739  1.00 0.00 ? 107 ARG B HH12 1  
ATOM 1991  H HH21 . ARG B 1 107 ? -7.571  -9.205  -3.277  1.00 0.00 ? 107 ARG B HH21 1  
ATOM 1992  H HH22 . ARG B 1 107 ? -9.154  -9.101  -2.562  1.00 0.00 ? 107 ARG B HH22 1  
ATOM 1993  N N    . GLN B 1 108 ? -9.673  -5.833  -10.583 1.00 0.00 ? 108 GLN B N    1  
ATOM 1994  C CA   . GLN B 1 108 ? -10.496 -4.767  -11.115 1.00 0.00 ? 108 GLN B CA   1  
ATOM 1995  C C    . GLN B 1 108 ? -11.923 -5.274  -11.259 1.00 0.00 ? 108 GLN B C    1  
ATOM 1996  O O    . GLN B 1 108 ? -12.137 -6.377  -11.780 1.00 0.00 ? 108 GLN B O    1  
ATOM 1997  C CB   . GLN B 1 108 ? -9.943  -4.314  -12.475 1.00 0.00 ? 108 GLN B CB   1  
ATOM 1998  C CG   . GLN B 1 108 ? -8.476  -3.891  -12.425 1.00 0.00 ? 108 GLN B CG   1  
ATOM 1999  C CD   . GLN B 1 108 ? -7.934  -3.433  -13.764 1.00 0.00 ? 108 GLN B CD   1  
ATOM 2000  O OE1  . GLN B 1 108 ? -7.423  -4.238  -14.553 1.00 0.00 ? 108 GLN B OE1  1  
ATOM 2001  N NE2  . GLN B 1 108 ? -7.987  -2.155  -14.017 1.00 0.00 ? 108 GLN B NE2  1  
ATOM 2002  H H    . GLN B 1 108 ? -9.413  -6.560  -11.188 1.00 0.00 ? 108 GLN B H    1  
ATOM 2003  H HA   . GLN B 1 108 ? -10.474 -3.938  -10.423 1.00 0.00 ? 108 GLN B HA   1  
ATOM 2004  H HB2  . GLN B 1 108 ? -10.036 -5.131  -13.176 1.00 0.00 ? 108 GLN B HB2  1  
ATOM 2005  H HB3  . GLN B 1 108 ? -10.527 -3.479  -12.832 1.00 0.00 ? 108 GLN B HB3  1  
ATOM 2006  H HG2  . GLN B 1 108 ? -8.364  -3.081  -11.718 1.00 0.00 ? 108 GLN B HG2  1  
ATOM 2007  H HG3  . GLN B 1 108 ? -7.894  -4.736  -12.088 1.00 0.00 ? 108 GLN B HG3  1  
ATOM 2008  H HE21 . GLN B 1 108 ? -8.357  -1.536  -13.350 1.00 0.00 ? 108 GLN B HE21 1  
ATOM 2009  H HE22 . GLN B 1 108 ? -7.649  -1.839  -14.880 1.00 0.00 ? 108 GLN B HE22 1  
ATOM 2010  N N    . ASP B 1 109 ? -12.878 -4.529  -10.760 1.00 0.00 ? 109 ASP B N    1  
ATOM 2011  C CA   . ASP B 1 109 ? -14.275 -4.923  -10.826 1.00 0.00 ? 109 ASP B CA   1  
ATOM 2012  C C    . ASP B 1 109 ? -15.151 -3.720  -11.154 1.00 0.00 ? 109 ASP B C    1  
ATOM 2013  O O    . ASP B 1 109 ? -14.631 -2.606  -11.260 1.00 0.00 ? 109 ASP B O    1  
ATOM 2014  C CB   . ASP B 1 109 ? -14.753 -5.580  -9.499  1.00 0.00 ? 109 ASP B CB   1  
ATOM 2015  C CG   . ASP B 1 109 ? -14.878 -4.646  -8.287  1.00 0.00 ? 109 ASP B CG   1  
ATOM 2016  O OD1  . ASP B 1 109 ? -15.957 -3.993  -8.142  1.00 0.00 ? 109 ASP B OD1  1  
ATOM 2017  O OD2  . ASP B 1 109 ? -13.964 -4.609  -7.448  1.00 0.00 ? 109 ASP B OD2  1  
ATOM 2018  H H    . ASP B 1 109 ? -12.688 -3.669  -10.317 1.00 0.00 ? 109 ASP B H    1  
ATOM 2019  H HA   . ASP B 1 109 ? -14.369 -5.645  -11.624 1.00 0.00 ? 109 ASP B HA   1  
ATOM 2020  H HB2  . ASP B 1 109 ? -15.732 -6.002  -9.676  1.00 0.00 ? 109 ASP B HB2  1  
ATOM 2021  H HB3  . ASP B 1 109 ? -14.083 -6.390  -9.253  1.00 0.00 ? 109 ASP B HB3  1  
ATOM 2022  N N    . GLU B 1 110 ? -16.457 -3.998  -11.398 1.00 0.00 ? 110 GLU B N    1  
ATOM 2023  C CA   . GLU B 1 110 ? -17.574 -3.023  -11.635 1.00 0.00 ? 110 GLU B CA   1  
ATOM 2024  C C    . GLU B 1 110 ? -17.106 -1.571  -11.899 1.00 0.00 ? 110 GLU B C    1  
ATOM 2025  O O    . GLU B 1 110 ? -16.970 -1.132  -13.041 1.00 0.00 ? 110 GLU B O    1  
ATOM 2026  C CB   . GLU B 1 110 ? -18.559 -3.076  -10.440 1.00 0.00 ? 110 GLU B CB   1  
ATOM 2027  C CG   . GLU B 1 110 ? -19.787 -2.189  -10.568 1.00 0.00 ? 110 GLU B CG   1  
ATOM 2028  C CD   . GLU B 1 110 ? -20.687 -2.608  -11.692 1.00 0.00 ? 110 GLU B CD   1  
ATOM 2029  O OE1  . GLU B 1 110 ? -20.476 -2.178  -12.840 1.00 0.00 ? 110 GLU B OE1  1  
ATOM 2030  O OE2  . GLU B 1 110 ? -21.624 -3.386  -11.447 1.00 0.00 ? 110 GLU B OE2  1  
ATOM 2031  H H    . GLU B 1 110 ? -16.693 -4.948  -11.437 1.00 0.00 ? 110 GLU B H    1  
ATOM 2032  H HA   . GLU B 1 110 ? -18.103 -3.361  -12.513 1.00 0.00 ? 110 GLU B HA   1  
ATOM 2033  H HB2  . GLU B 1 110 ? -18.904 -4.093  -10.330 1.00 0.00 ? 110 GLU B HB2  1  
ATOM 2034  H HB3  . GLU B 1 110 ? -18.029 -2.798  -9.541  1.00 0.00 ? 110 GLU B HB3  1  
ATOM 2035  H HG2  . GLU B 1 110 ? -20.346 -2.232  -9.644  1.00 0.00 ? 110 GLU B HG2  1  
ATOM 2036  H HG3  . GLU B 1 110 ? -19.458 -1.174  -10.740 1.00 0.00 ? 110 GLU B HG3  1  
ATOM 2037  N N    . HIS B 1 111 ? -16.869 -0.862  -10.820 1.00 0.00 ? 111 HIS B N    1  
ATOM 2038  C CA   . HIS B 1 111 ? -16.336 0.490   -10.807 1.00 0.00 ? 111 HIS B CA   1  
ATOM 2039  C C    . HIS B 1 111 ? -15.482 0.586   -9.590  1.00 0.00 ? 111 HIS B C    1  
ATOM 2040  O O    . HIS B 1 111 ? -15.350 1.645   -8.961  1.00 0.00 ? 111 HIS B O    1  
ATOM 2041  C CB   . HIS B 1 111 ? -17.444 1.568   -10.749 1.00 0.00 ? 111 HIS B CB   1  
ATOM 2042  C CG   . HIS B 1 111 ? -18.218 1.768   -12.018 1.00 0.00 ? 111 HIS B CG   1  
ATOM 2043  N ND1  . HIS B 1 111 ? -17.830 2.650   -12.998 1.00 0.00 ? 111 HIS B ND1  1  
ATOM 2044  C CD2  . HIS B 1 111 ? -19.374 1.220   -12.451 1.00 0.00 ? 111 HIS B CD2  1  
ATOM 2045  C CE1  . HIS B 1 111 ? -18.706 2.638   -13.972 1.00 0.00 ? 111 HIS B CE1  1  
ATOM 2046  N NE2  . HIS B 1 111 ? -19.652 1.781   -13.667 1.00 0.00 ? 111 HIS B NE2  1  
ATOM 2047  H H    . HIS B 1 111 ? -17.040 -1.287  -9.953  1.00 0.00 ? 111 HIS B H    1  
ATOM 2048  H HA   . HIS B 1 111 ? -15.724 0.624   -11.687 1.00 0.00 ? 111 HIS B HA   1  
ATOM 2049  H HB2  . HIS B 1 111 ? -18.155 1.283   -9.989  1.00 0.00 ? 111 HIS B HB2  1  
ATOM 2050  H HB3  . HIS B 1 111 ? -17.000 2.513   -10.471 1.00 0.00 ? 111 HIS B HB3  1  
ATOM 2051  H HD1  . HIS B 1 111 ? -17.025 3.214   -12.981 1.00 0.00 ? 111 HIS B HD1  1  
ATOM 2052  H HD2  . HIS B 1 111 ? -19.971 0.480   -11.937 1.00 0.00 ? 111 HIS B HD2  1  
ATOM 2053  H HE1  . HIS B 1 111 ? -18.655 3.230   -14.873 1.00 0.00 ? 111 HIS B HE1  1  
ATOM 2054  H HE2  . HIS B 1 111 ? -20.391 1.518   -14.259 1.00 0.00 ? 111 HIS B HE2  1  
ATOM 2055  N N    . GLY B 1 112 ? -14.935 -0.544  -9.253  1.00 0.00 ? 112 GLY B N    1  
ATOM 2056  C CA   . GLY B 1 112 ? -14.151 -0.685  -8.098  1.00 0.00 ? 112 GLY B CA   1  
ATOM 2057  C C    . GLY B 1 112 ? -12.903 -1.387  -8.437  1.00 0.00 ? 112 GLY B C    1  
ATOM 2058  O O    . GLY B 1 112 ? -12.910 -2.380  -9.121  1.00 0.00 ? 112 GLY B O    1  
ATOM 2059  H H    . GLY B 1 112 ? -15.010 -1.329  -9.842  1.00 0.00 ? 112 GLY B H    1  
ATOM 2060  H HA2  . GLY B 1 112 ? -13.936 0.298   -7.703  1.00 0.00 ? 112 GLY B HA2  1  
ATOM 2061  H HA3  . GLY B 1 112 ? -14.695 -1.254  -7.358  1.00 0.00 ? 112 GLY B HA3  1  
ATOM 2062  N N    . PHE B 1 113 ? -11.851 -0.861  -8.043  1.00 0.00 ? 113 PHE B N    1  
ATOM 2063  C CA   . PHE B 1 113 ? -10.612 -1.449  -8.329  1.00 0.00 ? 113 PHE B CA   1  
ATOM 2064  C C    . PHE B 1 113 ? -9.971  -1.740  -7.024  1.00 0.00 ? 113 PHE B C    1  
ATOM 2065  O O    . PHE B 1 113 ? -10.194 -1.004  -6.057  1.00 0.00 ? 113 PHE B O    1  
ATOM 2066  C CB   . PHE B 1 113 ? -9.762  -0.492  -9.161  1.00 0.00 ? 113 PHE B CB   1  
ATOM 2067  C CG   . PHE B 1 113 ? -10.455 -0.016  -10.406 1.00 0.00 ? 113 PHE B CG   1  
ATOM 2068  C CD1  . PHE B 1 113 ? -10.505 -0.813  -11.526 1.00 0.00 ? 113 PHE B CD1  1  
ATOM 2069  C CD2  . PHE B 1 113 ? -11.082 1.222   -10.439 1.00 0.00 ? 113 PHE B CD2  1  
ATOM 2070  C CE1  . PHE B 1 113 ? -11.157 -0.394  -12.660 1.00 0.00 ? 113 PHE B CE1  1  
ATOM 2071  C CE2  . PHE B 1 113 ? -11.742 1.647   -11.571 1.00 0.00 ? 113 PHE B CE2  1  
ATOM 2072  C CZ   . PHE B 1 113 ? -11.779 0.838   -12.684 1.00 0.00 ? 113 PHE B CZ   1  
ATOM 2073  H H    . PHE B 1 113 ? -11.904 -0.038  -7.506  1.00 0.00 ? 113 PHE B H    1  
ATOM 2074  H HA   . PHE B 1 113 ? -10.771 -2.364  -8.879  1.00 0.00 ? 113 PHE B HA   1  
ATOM 2075  H HB2  . PHE B 1 113 ? -9.519  0.372   -8.561  1.00 0.00 ? 113 PHE B HB2  1  
ATOM 2076  H HB3  . PHE B 1 113 ? -8.850  -0.992  -9.453  1.00 0.00 ? 113 PHE B HB3  1  
ATOM 2077  H HD1  . PHE B 1 113 ? -10.021 -1.776  -11.509 1.00 0.00 ? 113 PHE B HD1  1  
ATOM 2078  H HD2  . PHE B 1 113 ? -11.050 1.857   -9.566  1.00 0.00 ? 113 PHE B HD2  1  
ATOM 2079  H HE1  . PHE B 1 113 ? -11.181 -1.034  -13.527 1.00 0.00 ? 113 PHE B HE1  1  
ATOM 2080  H HE2  . PHE B 1 113 ? -12.227 2.612   -11.586 1.00 0.00 ? 113 PHE B HE2  1  
ATOM 2081  H HZ   . PHE B 1 113 ? -12.294 1.167   -13.575 1.00 0.00 ? 113 PHE B HZ   1  
ATOM 2082  N N    . ILE B 1 114 ? -9.178  -2.741  -6.954  1.00 0.00 ? 114 ILE B N    1  
ATOM 2083  C CA   . ILE B 1 114 ? -8.562  -3.079  -5.715  1.00 0.00 ? 114 ILE B CA   1  
ATOM 2084  C C    . ILE B 1 114 ? -7.085  -3.080  -5.948  1.00 0.00 ? 114 ILE B C    1  
ATOM 2085  O O    . ILE B 1 114 ? -6.627  -3.692  -6.894  1.00 0.00 ? 114 ILE B O    1  
ATOM 2086  C CB   . ILE B 1 114 ? -8.946  -4.509  -5.272  1.00 0.00 ? 114 ILE B CB   1  
ATOM 2087  C CG1  . ILE B 1 114 ? -10.428 -4.772  -5.427  1.00 0.00 ? 114 ILE B CG1  1  
ATOM 2088  C CG2  . ILE B 1 114 ? -8.528  -4.718  -3.815  1.00 0.00 ? 114 ILE B CG2  1  
ATOM 2089  C CD1  . ILE B 1 114 ? -10.826 -6.163  -5.043  1.00 0.00 ? 114 ILE B CD1  1  
ATOM 2090  H H    . ILE B 1 114 ? -8.979  -3.286  -7.746  1.00 0.00 ? 114 ILE B H    1  
ATOM 2091  H HA   . ILE B 1 114 ? -8.842  -2.377  -4.946  1.00 0.00 ? 114 ILE B HA   1  
ATOM 2092  H HB   . ILE B 1 114 ? -8.387  -5.205  -5.881  1.00 0.00 ? 114 ILE B HB   1  
ATOM 2093  H HG12 . ILE B 1 114 ? -10.981 -4.092  -4.802  1.00 0.00 ? 114 ILE B HG12 1  
ATOM 2094  H HG13 . ILE B 1 114 ? -10.708 -4.615  -6.458  1.00 0.00 ? 114 ILE B HG13 1  
ATOM 2095  H HG21 . ILE B 1 114 ? -9.036  -4.002  -3.188  1.00 0.00 ? 114 ILE B HG21 1  
ATOM 2096  H HG22 . ILE B 1 114 ? -7.462  -4.582  -3.723  1.00 0.00 ? 114 ILE B HG22 1  
ATOM 2097  H HG23 . ILE B 1 114 ? -8.792  -5.718  -3.505  1.00 0.00 ? 114 ILE B HG23 1  
ATOM 2098  H HD11 . ILE B 1 114 ? -10.347 -6.883  -5.686  1.00 0.00 ? 114 ILE B HD11 1  
ATOM 2099  H HD12 . ILE B 1 114 ? -11.898 -6.258  -5.137  1.00 0.00 ? 114 ILE B HD12 1  
ATOM 2100  H HD13 . ILE B 1 114 ? -10.539 -6.347  -4.019  1.00 0.00 ? 114 ILE B HD13 1  
ATOM 2101  N N    . SER B 1 115 ? -6.343  -2.462  -5.075  1.00 0.00 ? 115 SER B N    1  
ATOM 2102  C CA   . SER B 1 115 ? -4.925  -2.338  -5.231  1.00 0.00 ? 115 SER B CA   1  
ATOM 2103  C C    . SER B 1 115 ? -4.217  -2.767  -3.954  1.00 0.00 ? 115 SER B C    1  
ATOM 2104  O O    . SER B 1 115 ? -4.812  -2.771  -2.860  1.00 0.00 ? 115 SER B O    1  
ATOM 2105  C CB   . SER B 1 115 ? -4.569  -0.876  -5.495  1.00 0.00 ? 115 SER B CB   1  
ATOM 2106  O OG   . SER B 1 115 ? -5.397  -0.295  -6.498  1.00 0.00 ? 115 SER B OG   1  
ATOM 2107  H H    . SER B 1 115 ? -6.733  -2.051  -4.272  1.00 0.00 ? 115 SER B H    1  
ATOM 2108  H HA   . SER B 1 115 ? -4.592  -2.930  -6.071  1.00 0.00 ? 115 SER B HA   1  
ATOM 2109  H HB2  . SER B 1 115 ? -4.693  -0.312  -4.583  1.00 0.00 ? 115 SER B HB2  1  
ATOM 2110  H HB3  . SER B 1 115 ? -3.540  -0.810  -5.815  1.00 0.00 ? 115 SER B HB3  1  
ATOM 2111  H HG   . SER B 1 115 ? -5.693  -0.980  -7.130  1.00 0.00 ? 115 SER B HG   1  
ATOM 2112  N N    . ARG B 1 116 ? -2.975  -3.100  -4.095  1.00 0.00 ? 116 ARG B N    1  
ATOM 2113  C CA   . ARG B 1 116 ? -2.124  -3.429  -2.996  1.00 0.00 ? 116 ARG B CA   1  
ATOM 2114  C C    . ARG B 1 116 ? -0.820  -2.698  -3.202  1.00 0.00 ? 116 ARG B C    1  
ATOM 2115  O O    . ARG B 1 116 ? -0.405  -2.471  -4.345  1.00 0.00 ? 116 ARG B O    1  
ATOM 2116  C CB   . ARG B 1 116 ? -1.902  -4.947  -2.951  1.00 0.00 ? 116 ARG B CB   1  
ATOM 2117  C CG   . ARG B 1 116 ? -0.836  -5.444  -1.975  1.00 0.00 ? 116 ARG B CG   1  
ATOM 2118  C CD   . ARG B 1 116 ? -0.706  -6.961  -2.037  1.00 0.00 ? 116 ARG B CD   1  
ATOM 2119  N NE   . ARG B 1 116 ? -0.594  -7.433  -3.417  1.00 0.00 ? 116 ARG B NE   1  
ATOM 2120  C CZ   . ARG B 1 116 ? 0.117   -8.465  -3.856  1.00 0.00 ? 116 ARG B CZ   1  
ATOM 2121  N NH1  . ARG B 1 116 ? 0.859   -9.199  -3.026  1.00 0.00 ? 116 ARG B NH1  1  
ATOM 2122  N NH2  . ARG B 1 116 ? 0.046   -8.773  -5.144  1.00 0.00 ? 116 ARG B NH2  1  
ATOM 2123  H H    . ARG B 1 116 ? -2.579  -3.121  -4.996  1.00 0.00 ? 116 ARG B H    1  
ATOM 2124  H HA   . ARG B 1 116 ? -2.591  -3.102  -2.079  1.00 0.00 ? 116 ARG B HA   1  
ATOM 2125  H HB2  . ARG B 1 116 ? -2.837  -5.422  -2.690  1.00 0.00 ? 116 ARG B HB2  1  
ATOM 2126  H HB3  . ARG B 1 116 ? -1.627  -5.263  -3.946  1.00 0.00 ? 116 ARG B HB3  1  
ATOM 2127  H HG2  . ARG B 1 116 ? 0.112   -4.996  -2.233  1.00 0.00 ? 116 ARG B HG2  1  
ATOM 2128  H HG3  . ARG B 1 116 ? -1.111  -5.152  -0.972  1.00 0.00 ? 116 ARG B HG3  1  
ATOM 2129  H HD2  . ARG B 1 116 ? 0.175   -7.259  -1.490  1.00 0.00 ? 116 ARG B HD2  1  
ATOM 2130  H HD3  . ARG B 1 116 ? -1.580  -7.405  -1.582  1.00 0.00 ? 116 ARG B HD3  1  
ATOM 2131  H HE   . ARG B 1 116 ? -1.133  -6.953  -4.093  1.00 0.00 ? 116 ARG B HE   1  
ATOM 2132  H HH11 . ARG B 1 116 ? 0.920   -9.028  -2.039  1.00 0.00 ? 116 ARG B HH11 1  
ATOM 2133  H HH12 . ARG B 1 116 ? 1.392   -9.976  -3.366  1.00 0.00 ? 116 ARG B HH12 1  
ATOM 2134  H HH21 . ARG B 1 116 ? -0.555  -8.218  -5.732  1.00 0.00 ? 116 ARG B HH21 1  
ATOM 2135  H HH22 . ARG B 1 116 ? 0.558   -9.522  -5.575  1.00 0.00 ? 116 ARG B HH22 1  
ATOM 2136  N N    . GLU B 1 117 ? -0.189  -2.335  -2.136  1.00 0.00 ? 117 GLU B N    1  
ATOM 2137  C CA   . GLU B 1 117 ? 1.062   -1.645  -2.192  1.00 0.00 ? 117 GLU B CA   1  
ATOM 2138  C C    . GLU B 1 117 ? 2.037   -2.287  -1.246  1.00 0.00 ? 117 GLU B C    1  
ATOM 2139  O O    . GLU B 1 117 ? 1.635   -2.880  -0.241  1.00 0.00 ? 117 GLU B O    1  
ATOM 2140  C CB   . GLU B 1 117 ? 0.899   -0.161  -1.816  1.00 0.00 ? 117 GLU B CB   1  
ATOM 2141  C CG   . GLU B 1 117 ? 0.023   0.652   -2.754  1.00 0.00 ? 117 GLU B CG   1  
ATOM 2142  C CD   . GLU B 1 117 ? -0.067  2.101   -2.344  1.00 0.00 ? 117 GLU B CD   1  
ATOM 2143  O OE1  . GLU B 1 117 ? 0.964   2.801   -2.374  1.00 0.00 ? 117 GLU B OE1  1  
ATOM 2144  O OE2  . GLU B 1 117 ? -1.151  2.564   -1.961  1.00 0.00 ? 117 GLU B OE2  1  
ATOM 2145  H H    . GLU B 1 117 ? -0.581  -2.540  -1.257  1.00 0.00 ? 117 GLU B H    1  
ATOM 2146  H HA   . GLU B 1 117 ? 1.444   -1.706  -3.199  1.00 0.00 ? 117 GLU B HA   1  
ATOM 2147  H HB2  . GLU B 1 117 ? 0.477   -0.098  -0.826  1.00 0.00 ? 117 GLU B HB2  1  
ATOM 2148  H HB3  . GLU B 1 117 ? 1.881   0.291   -1.795  1.00 0.00 ? 117 GLU B HB3  1  
ATOM 2149  H HG2  . GLU B 1 117 ? 0.459   0.604   -3.741  1.00 0.00 ? 117 GLU B HG2  1  
ATOM 2150  H HG3  . GLU B 1 117 ? -0.969  0.227   -2.772  1.00 0.00 ? 117 GLU B HG3  1  
ATOM 2151  N N    . PHE B 1 118 ? 3.283   -2.204  -1.583  1.00 0.00 ? 118 PHE B N    1  
ATOM 2152  C CA   . PHE B 1 118 ? 4.361   -2.635  -0.736  1.00 0.00 ? 118 PHE B CA   1  
ATOM 2153  C C    . PHE B 1 118 ? 5.312   -1.498  -0.585  1.00 0.00 ? 118 PHE B C    1  
ATOM 2154  O O    . PHE B 1 118 ? 5.761   -0.911  -1.567  1.00 0.00 ? 118 PHE B O    1  
ATOM 2155  C CB   . PHE B 1 118 ? 5.107   -3.857  -1.288  1.00 0.00 ? 118 PHE B CB   1  
ATOM 2156  C CG   . PHE B 1 118 ? 4.554   -5.193  -0.873  1.00 0.00 ? 118 PHE B CG   1  
ATOM 2157  C CD1  . PHE B 1 118 ? 4.985   -5.784  0.303   1.00 0.00 ? 118 PHE B CD1  1  
ATOM 2158  C CD2  . PHE B 1 118 ? 3.638   -5.869  -1.657  1.00 0.00 ? 118 PHE B CD2  1  
ATOM 2159  C CE1  . PHE B 1 118 ? 4.517   -7.020  0.690   1.00 0.00 ? 118 PHE B CE1  1  
ATOM 2160  C CE2  . PHE B 1 118 ? 3.161   -7.106  -1.274  1.00 0.00 ? 118 PHE B CE2  1  
ATOM 2161  C CZ   . PHE B 1 118 ? 3.605   -7.681  -0.098  1.00 0.00 ? 118 PHE B CZ   1  
ATOM 2162  H H    . PHE B 1 118 ? 3.503   -1.791  -2.449  1.00 0.00 ? 118 PHE B H    1  
ATOM 2163  H HA   . PHE B 1 118 ? 3.945   -2.874  0.232   1.00 0.00 ? 118 PHE B HA   1  
ATOM 2164  H HB2  . PHE B 1 118 ? 5.090   -3.821  -2.367  1.00 0.00 ? 118 PHE B HB2  1  
ATOM 2165  H HB3  . PHE B 1 118 ? 6.135   -3.805  -0.960  1.00 0.00 ? 118 PHE B HB3  1  
ATOM 2166  H HD1  . PHE B 1 118 ? 5.701   -5.264  0.924   1.00 0.00 ? 118 PHE B HD1  1  
ATOM 2167  H HD2  . PHE B 1 118 ? 3.291   -5.420  -2.575  1.00 0.00 ? 118 PHE B HD2  1  
ATOM 2168  H HE1  . PHE B 1 118 ? 4.863   -7.467  1.609   1.00 0.00 ? 118 PHE B HE1  1  
ATOM 2169  H HE2  . PHE B 1 118 ? 2.446   -7.625  -1.893  1.00 0.00 ? 118 PHE B HE2  1  
ATOM 2170  H HZ   . PHE B 1 118 ? 3.244   -8.650  0.208   1.00 0.00 ? 118 PHE B HZ   1  
ATOM 2171  N N    . HIS B 1 119 ? 5.577   -1.146  0.620   1.00 0.00 ? 119 HIS B N    1  
ATOM 2172  C CA   . HIS B 1 119 ? 6.495   -0.093  0.911   1.00 0.00 ? 119 HIS B CA   1  
ATOM 2173  C C    . HIS B 1 119 ? 7.465   -0.541  1.975   1.00 0.00 ? 119 HIS B C    1  
ATOM 2174  O O    . HIS B 1 119 ? 7.061   -0.902  3.061   1.00 0.00 ? 119 HIS B O    1  
ATOM 2175  C CB   . HIS B 1 119 ? 5.728   1.181   1.339   1.00 0.00 ? 119 HIS B CB   1  
ATOM 2176  C CG   . HIS B 1 119 ? 6.582   2.321   1.850   1.00 0.00 ? 119 HIS B CG   1  
ATOM 2177  N ND1  . HIS B 1 119 ? 6.383   2.892   3.078   1.00 0.00 ? 119 HIS B ND1  1  
ATOM 2178  C CD2  . HIS B 1 119 ? 7.620   3.003   1.292   1.00 0.00 ? 119 HIS B CD2  1  
ATOM 2179  C CE1  . HIS B 1 119 ? 7.243   3.863   3.264   1.00 0.00 ? 119 HIS B CE1  1  
ATOM 2180  N NE2  . HIS B 1 119 ? 8.003   3.952   2.207   1.00 0.00 ? 119 HIS B NE2  1  
ATOM 2181  H H    . HIS B 1 119 ? 5.161   -1.635  1.368   1.00 0.00 ? 119 HIS B H    1  
ATOM 2182  H HA   . HIS B 1 119 ? 7.048   0.125   0.010   1.00 0.00 ? 119 HIS B HA   1  
ATOM 2183  H HB2  . HIS B 1 119 ? 5.171   1.551   0.492   1.00 0.00 ? 119 HIS B HB2  1  
ATOM 2184  H HB3  . HIS B 1 119 ? 5.030   0.912   2.118   1.00 0.00 ? 119 HIS B HB3  1  
ATOM 2185  H HD1  . HIS B 1 119 ? 5.672   2.650   3.713   1.00 0.00 ? 119 HIS B HD1  1  
ATOM 2186  H HD2  . HIS B 1 119 ? 8.058   2.832   0.319   1.00 0.00 ? 119 HIS B HD2  1  
ATOM 2187  H HE1  . HIS B 1 119 ? 7.315   4.483   4.145   1.00 0.00 ? 119 HIS B HE1  1  
ATOM 2188  H HE2  . HIS B 1 119 ? 8.729   4.624   2.142   1.00 0.00 ? 119 HIS B HE2  1  
ATOM 2189  N N    . ARG B 1 120 ? 8.718   -0.504  1.682   1.00 0.00 ? 120 ARG B N    1  
ATOM 2190  C CA   . ARG B 1 120 ? 9.695   -0.800  2.687   1.00 0.00 ? 120 ARG B CA   1  
ATOM 2191  C C    . ARG B 1 120 ? 10.418  0.476   2.956   1.00 0.00 ? 120 ARG B C    1  
ATOM 2192  O O    . ARG B 1 120 ? 10.734  1.214   2.023   1.00 0.00 ? 120 ARG B O    1  
ATOM 2193  C CB   . ARG B 1 120 ? 10.642  -1.936  2.253   1.00 0.00 ? 120 ARG B CB   1  
ATOM 2194  C CG   . ARG B 1 120 ? 11.694  -2.329  3.289   1.00 0.00 ? 120 ARG B CG   1  
ATOM 2195  C CD   . ARG B 1 120 ? 12.401  -3.629  2.901   1.00 0.00 ? 120 ARG B CD   1  
ATOM 2196  N NE   . ARG B 1 120 ? 13.423  -4.037  3.884   1.00 0.00 ? 120 ARG B NE   1  
ATOM 2197  C CZ   . ARG B 1 120 ? 14.052  -5.239  3.925   1.00 0.00 ? 120 ARG B CZ   1  
ATOM 2198  N NH1  . ARG B 1 120 ? 13.548  -6.290  3.313   1.00 0.00 ? 120 ARG B NH1  1  
ATOM 2199  N NH2  . ARG B 1 120 ? 15.103  -5.412  4.694   1.00 0.00 ? 120 ARG B NH2  1  
ATOM 2200  H H    . ARG B 1 120 ? 8.998   -0.249  0.774   1.00 0.00 ? 120 ARG B H    1  
ATOM 2201  H HA   . ARG B 1 120 ? 9.162   -1.076  3.585   1.00 0.00 ? 120 ARG B HA   1  
ATOM 2202  H HB2  . ARG B 1 120 ? 10.056  -2.810  2.014   1.00 0.00 ? 120 ARG B HB2  1  
ATOM 2203  H HB3  . ARG B 1 120 ? 11.157  -1.619  1.359   1.00 0.00 ? 120 ARG B HB3  1  
ATOM 2204  H HG2  . ARG B 1 120 ? 12.425  -1.536  3.337   1.00 0.00 ? 120 ARG B HG2  1  
ATOM 2205  H HG3  . ARG B 1 120 ? 11.224  -2.435  4.256   1.00 0.00 ? 120 ARG B HG3  1  
ATOM 2206  H HD2  . ARG B 1 120 ? 11.671  -4.419  2.797   1.00 0.00 ? 120 ARG B HD2  1  
ATOM 2207  H HD3  . ARG B 1 120 ? 12.880  -3.473  1.947   1.00 0.00 ? 120 ARG B HD3  1  
ATOM 2208  H HE   . ARG B 1 120 ? 13.698  -3.339  4.519   1.00 0.00 ? 120 ARG B HE   1  
ATOM 2209  H HH11 . ARG B 1 120 ? 12.686  -6.335  2.806   1.00 0.00 ? 120 ARG B HH11 1  
ATOM 2210  H HH12 . ARG B 1 120 ? 14.049  -7.161  3.331   1.00 0.00 ? 120 ARG B HH12 1  
ATOM 2211  H HH21 . ARG B 1 120 ? 15.479  -4.681  5.274   1.00 0.00 ? 120 ARG B HH21 1  
ATOM 2212  H HH22 . ARG B 1 120 ? 15.572  -6.298  4.754   1.00 0.00 ? 120 ARG B HH22 1  
ATOM 2213  N N    . LYS B 1 121 ? 10.658  0.745   4.195   1.00 0.00 ? 121 LYS B N    1  
ATOM 2214  C CA   . LYS B 1 121 ? 11.216  2.007   4.599   1.00 0.00 ? 121 LYS B CA   1  
ATOM 2215  C C    . LYS B 1 121 ? 12.407  1.800   5.496   1.00 0.00 ? 121 LYS B C    1  
ATOM 2216  O O    . LYS B 1 121 ? 12.346  1.046   6.442   1.00 0.00 ? 121 LYS B O    1  
ATOM 2217  C CB   . LYS B 1 121 ? 10.130  2.858   5.312   1.00 0.00 ? 121 LYS B CB   1  
ATOM 2218  C CG   . LYS B 1 121 ? 9.443   2.159   6.503   1.00 0.00 ? 121 LYS B CG   1  
ATOM 2219  C CD   . LYS B 1 121 ? 8.401   3.053   7.169   1.00 0.00 ? 121 LYS B CD   1  
ATOM 2220  C CE   . LYS B 1 121 ? 7.720   2.367   8.366   1.00 0.00 ? 121 LYS B CE   1  
ATOM 2221  N NZ   . LYS B 1 121 ? 6.952   1.149   7.985   1.00 0.00 ? 121 LYS B NZ   1  
ATOM 2222  H H    . LYS B 1 121 ? 10.480  0.068   4.889   1.00 0.00 ? 121 LYS B H    1  
ATOM 2223  H HA   . LYS B 1 121 ? 11.526  2.533   3.710   1.00 0.00 ? 121 LYS B HA   1  
ATOM 2224  H HB2  . LYS B 1 121 ? 10.587  3.765   5.676   1.00 0.00 ? 121 LYS B HB2  1  
ATOM 2225  H HB3  . LYS B 1 121 ? 9.369   3.119   4.590   1.00 0.00 ? 121 LYS B HB3  1  
ATOM 2226  H HG2  . LYS B 1 121 ? 8.955   1.262   6.151   1.00 0.00 ? 121 LYS B HG2  1  
ATOM 2227  H HG3  . LYS B 1 121 ? 10.198  1.895   7.229   1.00 0.00 ? 121 LYS B HG3  1  
ATOM 2228  H HD2  . LYS B 1 121 ? 8.894   3.948   7.519   1.00 0.00 ? 121 LYS B HD2  1  
ATOM 2229  H HD3  . LYS B 1 121 ? 7.654   3.323   6.439   1.00 0.00 ? 121 LYS B HD3  1  
ATOM 2230  H HE2  . LYS B 1 121 ? 8.474   2.090   9.087   1.00 0.00 ? 121 LYS B HE2  1  
ATOM 2231  H HE3  . LYS B 1 121 ? 7.045   3.079   8.820   1.00 0.00 ? 121 LYS B HE3  1  
ATOM 2232  H HZ1  . LYS B 1 121 ? 7.541   0.415   7.551   1.00 0.00 ? 121 LYS B HZ1  1  
ATOM 2233  H HZ2  . LYS B 1 121 ? 6.178   1.362   7.321   1.00 0.00 ? 121 LYS B HZ2  1  
ATOM 2234  H HZ3  . LYS B 1 121 ? 6.532   0.679   8.821   1.00 0.00 ? 121 LYS B HZ3  1  
ATOM 2235  N N    . TYR B 1 122 ? 13.471  2.449   5.175   1.00 0.00 ? 122 TYR B N    1  
ATOM 2236  C CA   . TYR B 1 122 ? 14.677  2.412   5.956   1.00 0.00 ? 122 TYR B CA   1  
ATOM 2237  C C    . TYR B 1 122 ? 15.122  3.794   6.243   1.00 0.00 ? 122 TYR B C    1  
ATOM 2238  O O    . TYR B 1 122 ? 14.938  4.691   5.415   1.00 0.00 ? 122 TYR B O    1  
ATOM 2239  C CB   . TYR B 1 122 ? 15.810  1.794   5.170   1.00 0.00 ? 122 TYR B CB   1  
ATOM 2240  C CG   . TYR B 1 122 ? 16.077  0.340   5.336   1.00 0.00 ? 122 TYR B CG   1  
ATOM 2241  C CD1  . TYR B 1 122 ? 16.960  -0.096  6.308   1.00 0.00 ? 122 TYR B CD1  1  
ATOM 2242  C CD2  . TYR B 1 122 ? 15.509  -0.591  4.501   1.00 0.00 ? 122 TYR B CD2  1  
ATOM 2243  C CE1  . TYR B 1 122 ? 17.258  -1.422  6.447   1.00 0.00 ? 122 TYR B CE1  1  
ATOM 2244  C CE2  . TYR B 1 122 ? 15.808  -1.924  4.629   1.00 0.00 ? 122 TYR B CE2  1  
ATOM 2245  C CZ   . TYR B 1 122 ? 16.684  -2.331  5.598   1.00 0.00 ? 122 TYR B CZ   1  
ATOM 2246  O OH   . TYR B 1 122 ? 16.965  -3.662  5.748   1.00 0.00 ? 122 TYR B OH   1  
ATOM 2247  H H    . TYR B 1 122 ? 13.496  2.987   4.353   1.00 0.00 ? 122 TYR B H    1  
ATOM 2248  H HA   . TYR B 1 122 ? 14.539  1.844   6.862   1.00 0.00 ? 122 TYR B HA   1  
ATOM 2249  H HB2  . TYR B 1 122 ? 15.558  1.931   4.130   1.00 0.00 ? 122 TYR B HB2  1  
ATOM 2250  H HB3  . TYR B 1 122 ? 16.718  2.341   5.377   1.00 0.00 ? 122 TYR B HB3  1  
ATOM 2251  H HD1  . TYR B 1 122 ? 17.408  0.628   6.974   1.00 0.00 ? 122 TYR B HD1  1  
ATOM 2252  H HD2  . TYR B 1 122 ? 14.818  -0.263  3.738   1.00 0.00 ? 122 TYR B HD2  1  
ATOM 2253  H HE1  . TYR B 1 122 ? 17.948  -1.749  7.210   1.00 0.00 ? 122 TYR B HE1  1  
ATOM 2254  H HE2  . TYR B 1 122 ? 15.357  -2.649  3.969   1.00 0.00 ? 122 TYR B HE2  1  
ATOM 2255  H HH   . TYR B 1 122 ? 16.659  -3.880  6.652   1.00 0.00 ? 122 TYR B HH   1  
ATOM 2256  N N    . ARG B 1 123 ? 15.684  3.984   7.384   1.00 0.00 ? 123 ARG B N    1  
ATOM 2257  C CA   . ARG B 1 123 ? 16.374  5.191   7.640   1.00 0.00 ? 123 ARG B CA   1  
ATOM 2258  C C    . ARG B 1 123 ? 17.736  4.830   8.143   1.00 0.00 ? 123 ARG B C    1  
ATOM 2259  O O    . ARG B 1 123 ? 17.905  4.466   9.310   1.00 0.00 ? 123 ARG B O    1  
ATOM 2260  C CB   . ARG B 1 123 ? 15.678  6.097   8.640   1.00 0.00 ? 123 ARG B CB   1  
ATOM 2261  C CG   . ARG B 1 123 ? 16.397  7.425   8.747   1.00 0.00 ? 123 ARG B CG   1  
ATOM 2262  C CD   . ARG B 1 123 ? 15.828  8.321   9.803   1.00 0.00 ? 123 ARG B CD   1  
ATOM 2263  N NE   . ARG B 1 123 ? 16.500  9.621   9.784   1.00 0.00 ? 123 ARG B NE   1  
ATOM 2264  C CZ   . ARG B 1 123 ? 16.752  10.380  10.852  1.00 0.00 ? 123 ARG B CZ   1  
ATOM 2265  N NH1  . ARG B 1 123 ? 16.416  9.958   12.063  1.00 0.00 ? 123 ARG B NH1  1  
ATOM 2266  N NH2  . ARG B 1 123 ? 17.348  11.558  10.708  1.00 0.00 ? 123 ARG B NH2  1  
ATOM 2267  H H    . ARG B 1 123 ? 15.646  3.284   8.073   1.00 0.00 ? 123 ARG B H    1  
ATOM 2268  H HA   . ARG B 1 123 ? 16.484  5.705   6.695   1.00 0.00 ? 123 ARG B HA   1  
ATOM 2269  H HB2  . ARG B 1 123 ? 14.661  6.268   8.320   1.00 0.00 ? 123 ARG B HB2  1  
ATOM 2270  H HB3  . ARG B 1 123 ? 15.682  5.628   9.613   1.00 0.00 ? 123 ARG B HB3  1  
ATOM 2271  H HG2  . ARG B 1 123 ? 17.434  7.240   8.983   1.00 0.00 ? 123 ARG B HG2  1  
ATOM 2272  H HG3  . ARG B 1 123 ? 16.342  7.927   7.792   1.00 0.00 ? 123 ARG B HG3  1  
ATOM 2273  H HD2  . ARG B 1 123 ? 14.770  8.455   9.631   1.00 0.00 ? 123 ARG B HD2  1  
ATOM 2274  H HD3  . ARG B 1 123 ? 15.988  7.862   10.766  1.00 0.00 ? 123 ARG B HD3  1  
ATOM 2275  H HE   . ARG B 1 123 ? 16.766  9.917   8.873   1.00 0.00 ? 123 ARG B HE   1  
ATOM 2276  H HH11 . ARG B 1 123 ? 15.968  9.075   12.220  1.00 0.00 ? 123 ARG B HH11 1  
ATOM 2277  H HH12 . ARG B 1 123 ? 16.620  10.502  12.881  1.00 0.00 ? 123 ARG B HH12 1  
ATOM 2278  H HH21 . ARG B 1 123 ? 17.627  11.918  9.813   1.00 0.00 ? 123 ARG B HH21 1  
ATOM 2279  H HH22 . ARG B 1 123 ? 17.544  12.150  11.494  1.00 0.00 ? 123 ARG B HH22 1  
ATOM 2280  N N    . ILE B 1 124 ? 18.678  4.870   7.272   1.00 0.00 ? 124 ILE B N    1  
ATOM 2281  C CA   . ILE B 1 124 ? 20.031  4.595   7.608   1.00 0.00 ? 124 ILE B CA   1  
ATOM 2282  C C    . ILE B 1 124 ? 20.959  5.618   6.945   1.00 0.00 ? 124 ILE B C    1  
ATOM 2283  O O    . ILE B 1 124 ? 21.188  5.572   5.754   1.00 0.00 ? 124 ILE B O    1  
ATOM 2284  C CB   . ILE B 1 124 ? 20.421  3.126   7.218   1.00 0.00 ? 124 ILE B CB   1  
ATOM 2285  C CG1  . ILE B 1 124 ? 19.854  2.719   5.850   1.00 0.00 ? 124 ILE B CG1  1  
ATOM 2286  C CG2  . ILE B 1 124 ? 19.997  2.141   8.306   1.00 0.00 ? 124 ILE B CG2  1  
ATOM 2287  C CD1  . ILE B 1 124 ? 20.185  1.295   5.440   1.00 0.00 ? 124 ILE B CD1  1  
ATOM 2288  H H    . ILE B 1 124 ? 18.474  5.139   6.350   1.00 0.00 ? 124 ILE B H    1  
ATOM 2289  H HA   . ILE B 1 124 ? 20.116  4.692   8.681   1.00 0.00 ? 124 ILE B HA   1  
ATOM 2290  H HB   . ILE B 1 124 ? 21.500  3.101   7.173   1.00 0.00 ? 124 ILE B HB   1  
ATOM 2291  H HG12 . ILE B 1 124 ? 18.778  2.810   5.880   1.00 0.00 ? 124 ILE B HG12 1  
ATOM 2292  H HG13 . ILE B 1 124 ? 20.242  3.388   5.096   1.00 0.00 ? 124 ILE B HG13 1  
ATOM 2293  H HG21 . ILE B 1 124 ? 20.481  2.390   9.237   1.00 0.00 ? 124 ILE B HG21 1  
ATOM 2294  H HG22 . ILE B 1 124 ? 20.274  1.139   8.011   1.00 0.00 ? 124 ILE B HG22 1  
ATOM 2295  H HG23 . ILE B 1 124 ? 18.926  2.196   8.430   1.00 0.00 ? 124 ILE B HG23 1  
ATOM 2296  H HD11 . ILE B 1 124 ? 19.765  1.093   4.466   1.00 0.00 ? 124 ILE B HD11 1  
ATOM 2297  H HD12 . ILE B 1 124 ? 19.769  0.609   6.162   1.00 0.00 ? 124 ILE B HD12 1  
ATOM 2298  H HD13 . ILE B 1 124 ? 21.257  1.169   5.406   1.00 0.00 ? 124 ILE B HD13 1  
ATOM 2299  N N    . PRO B 1 125 ? 21.493  6.571   7.719   1.00 0.00 ? 125 PRO B N    1  
ATOM 2300  C CA   . PRO B 1 125 ? 22.442  7.555   7.210   1.00 0.00 ? 125 PRO B CA   1  
ATOM 2301  C C    . PRO B 1 125 ? 23.880  7.043   7.256   1.00 0.00 ? 125 PRO B C    1  
ATOM 2302  O O    . PRO B 1 125 ? 24.657  7.264   6.338   1.00 0.00 ? 125 PRO B O    1  
ATOM 2303  C CB   . PRO B 1 125 ? 22.279  8.754   8.168   1.00 0.00 ? 125 PRO B CB   1  
ATOM 2304  C CG   . PRO B 1 125 ? 21.254  8.341   9.190   1.00 0.00 ? 125 PRO B CG   1  
ATOM 2305  C CD   . PRO B 1 125 ? 21.130  6.846   9.106   1.00 0.00 ? 125 PRO B CD   1  
ATOM 2306  H HA   . PRO B 1 125 ? 22.199  7.860   6.203   1.00 0.00 ? 125 PRO B HA   1  
ATOM 2307  H HB2  . PRO B 1 125 ? 23.230  8.965   8.635   1.00 0.00 ? 125 PRO B HB2  1  
ATOM 2308  H HB3  . PRO B 1 125 ? 21.952  9.621   7.612   1.00 0.00 ? 125 PRO B HB3  1  
ATOM 2309  H HG2  . PRO B 1 125 ? 21.582  8.631   10.176  1.00 0.00 ? 125 PRO B HG2  1  
ATOM 2310  H HG3  . PRO B 1 125 ? 20.306  8.809   8.966   1.00 0.00 ? 125 PRO B HG3  1  
ATOM 2311  H HD2  . PRO B 1 125 ? 21.810  6.376   9.801   1.00 0.00 ? 125 PRO B HD2  1  
ATOM 2312  H HD3  . PRO B 1 125 ? 20.109  6.558   9.312   1.00 0.00 ? 125 PRO B HD3  1  
ATOM 2313  N N    . ALA B 1 126 ? 24.222  6.357   8.334   1.00 0.00 ? 126 ALA B N    1  
ATOM 2314  C CA   . ALA B 1 126 ? 25.557  5.823   8.535   1.00 0.00 ? 126 ALA B CA   1  
ATOM 2315  C C    . ALA B 1 126 ? 25.856  4.689   7.566   1.00 0.00 ? 126 ALA B C    1  
ATOM 2316  O O    . ALA B 1 126 ? 27.008  4.326   7.348   1.00 0.00 ? 126 ALA B O    1  
ATOM 2317  C CB   . ALA B 1 126 ? 25.742  5.370   9.973   1.00 0.00 ? 126 ALA B CB   1  
ATOM 2318  H H    . ALA B 1 126 ? 23.537  6.156   9.006   1.00 0.00 ? 126 ALA B H    1  
ATOM 2319  H HA   . ALA B 1 126 ? 26.255  6.624   8.341   1.00 0.00 ? 126 ALA B HA   1  
ATOM 2320  H HB1  . ALA B 1 126 ? 25.068  4.555   10.188  1.00 0.00 ? 126 ALA B HB1  1  
ATOM 2321  H HB2  . ALA B 1 126 ? 25.531  6.196   10.635  1.00 0.00 ? 126 ALA B HB2  1  
ATOM 2322  H HB3  . ALA B 1 126 ? 26.758  5.037   10.121  1.00 0.00 ? 126 ALA B HB3  1  
ATOM 2323  N N    . ASP B 1 127 ? 24.818  4.105   7.017   1.00 0.00 ? 127 ASP B N    1  
ATOM 2324  C CA   . ASP B 1 127 ? 24.989  2.992   6.105   1.00 0.00 ? 127 ASP B CA   1  
ATOM 2325  C C    . ASP B 1 127 ? 24.678  3.393   4.677   1.00 0.00 ? 127 ASP B C    1  
ATOM 2326  O O    . ASP B 1 127 ? 25.086  2.714   3.737   1.00 0.00 ? 127 ASP B O    1  
ATOM 2327  C CB   . ASP B 1 127 ? 24.102  1.798   6.507   1.00 0.00 ? 127 ASP B CB   1  
ATOM 2328  C CG   . ASP B 1 127 ? 24.389  1.268   7.897   1.00 0.00 ? 127 ASP B CG   1  
ATOM 2329  O OD1  . ASP B 1 127 ? 25.302  0.449   8.064   1.00 0.00 ? 127 ASP B OD1  1  
ATOM 2330  O OD2  . ASP B 1 127 ? 23.702  1.671   8.856   1.00 0.00 ? 127 ASP B OD2  1  
ATOM 2331  H H    . ASP B 1 127 ? 23.922  4.422   7.265   1.00 0.00 ? 127 ASP B H    1  
ATOM 2332  H HA   . ASP B 1 127 ? 26.021  2.678   6.158   1.00 0.00 ? 127 ASP B HA   1  
ATOM 2333  H HB2  . ASP B 1 127 ? 23.066  2.094   6.462   1.00 0.00 ? 127 ASP B HB2  1  
ATOM 2334  H HB3  . ASP B 1 127 ? 24.264  0.999   5.798   1.00 0.00 ? 127 ASP B HB3  1  
ATOM 2335  N N    . VAL B 1 128 ? 23.989  4.507   4.502   1.00 0.00 ? 128 VAL B N    1  
ATOM 2336  C CA   . VAL B 1 128 ? 23.552  4.917   3.177   1.00 0.00 ? 128 VAL B CA   1  
ATOM 2337  C C    . VAL B 1 128 ? 23.928  6.338   2.835   1.00 0.00 ? 128 VAL B C    1  
ATOM 2338  O O    . VAL B 1 128 ? 23.571  7.290   3.538   1.00 0.00 ? 128 VAL B O    1  
ATOM 2339  C CB   . VAL B 1 128 ? 22.011  4.723   2.963   1.00 0.00 ? 128 VAL B CB   1  
ATOM 2340  C CG1  . VAL B 1 128 ? 21.539  5.355   1.651   1.00 0.00 ? 128 VAL B CG1  1  
ATOM 2341  C CG2  . VAL B 1 128 ? 21.674  3.261   2.934   1.00 0.00 ? 128 VAL B CG2  1  
ATOM 2342  H H    . VAL B 1 128 ? 23.782  5.096   5.256   1.00 0.00 ? 128 VAL B H    1  
ATOM 2343  H HA   . VAL B 1 128 ? 24.055  4.265   2.481   1.00 0.00 ? 128 VAL B HA   1  
ATOM 2344  H HB   . VAL B 1 128 ? 21.481  5.180   3.785   1.00 0.00 ? 128 VAL B HB   1  
ATOM 2345  H HG11 . VAL B 1 128 ? 21.750  6.414   1.667   1.00 0.00 ? 128 VAL B HG11 1  
ATOM 2346  H HG12 . VAL B 1 128 ? 20.477  5.200   1.537   1.00 0.00 ? 128 VAL B HG12 1  
ATOM 2347  H HG13 . VAL B 1 128 ? 22.062  4.897   0.825   1.00 0.00 ? 128 VAL B HG13 1  
ATOM 2348  H HG21 . VAL B 1 128 ? 20.609  3.140   2.807   1.00 0.00 ? 128 VAL B HG21 1  
ATOM 2349  H HG22 . VAL B 1 128 ? 21.980  2.802   3.861   1.00 0.00 ? 128 VAL B HG22 1  
ATOM 2350  H HG23 . VAL B 1 128 ? 22.191  2.789   2.112   1.00 0.00 ? 128 VAL B HG23 1  
ATOM 2351  N N    . ASP B 1 129 ? 24.677  6.468   1.773   1.00 0.00 ? 129 ASP B N    1  
ATOM 2352  C CA   . ASP B 1 129 ? 24.932  7.745   1.175   1.00 0.00 ? 129 ASP B CA   1  
ATOM 2353  C C    . ASP B 1 129 ? 24.455  7.643   -0.267  1.00 0.00 ? 129 ASP B C    1  
ATOM 2354  O O    . ASP B 1 129 ? 24.944  6.782   -1.022  1.00 0.00 ? 129 ASP B O    1  
ATOM 2355  C CB   . ASP B 1 129 ? 26.404  8.111   1.191   1.00 0.00 ? 129 ASP B CB   1  
ATOM 2356  C CG   . ASP B 1 129 ? 26.623  9.553   0.765   1.00 0.00 ? 129 ASP B CG   1  
ATOM 2357  O OD1  . ASP B 1 129 ? 26.512  9.858   -0.452  1.00 0.00 ? 129 ASP B OD1  1  
ATOM 2358  O OD2  . ASP B 1 129 ? 26.874  10.420  1.653   1.00 0.00 ? 129 ASP B OD2  1  
ATOM 2359  H H    . ASP B 1 129 ? 25.069  5.671   1.361   1.00 0.00 ? 129 ASP B H    1  
ATOM 2360  H HA   . ASP B 1 129 ? 24.347  8.482   1.705   1.00 0.00 ? 129 ASP B HA   1  
ATOM 2361  H HB2  . ASP B 1 129 ? 26.808  7.939   2.175   1.00 0.00 ? 129 ASP B HB2  1  
ATOM 2362  H HB3  . ASP B 1 129 ? 26.919  7.466   0.499   1.00 0.00 ? 129 ASP B HB3  1  
ATOM 2363  N N    . PRO B 1 130 ? 23.511  8.495   -0.685  1.00 0.00 ? 130 PRO B N    1  
ATOM 2364  C CA   . PRO B 1 130 ? 22.888  8.428   -2.022  1.00 0.00 ? 130 PRO B CA   1  
ATOM 2365  C C    . PRO B 1 130 ? 23.869  8.609   -3.198  1.00 0.00 ? 130 PRO B C    1  
ATOM 2366  O O    . PRO B 1 130 ? 23.525  8.307   -4.346  1.00 0.00 ? 130 PRO B O    1  
ATOM 2367  C CB   . PRO B 1 130 ? 21.859  9.567   -2.005  1.00 0.00 ? 130 PRO B CB   1  
ATOM 2368  C CG   . PRO B 1 130 ? 22.317  10.477  -0.924  1.00 0.00 ? 130 PRO B CG   1  
ATOM 2369  C CD   . PRO B 1 130 ? 22.952  9.600   0.113   1.00 0.00 ? 130 PRO B CD   1  
ATOM 2370  H HA   . PRO B 1 130 ? 22.370  7.490   -2.153  1.00 0.00 ? 130 PRO B HA   1  
ATOM 2371  H HB2  . PRO B 1 130 ? 21.851  10.063  -2.964  1.00 0.00 ? 130 PRO B HB2  1  
ATOM 2372  H HB3  . PRO B 1 130 ? 20.877  9.170   -1.795  1.00 0.00 ? 130 PRO B HB3  1  
ATOM 2373  H HG2  . PRO B 1 130 ? 23.039  11.177  -1.317  1.00 0.00 ? 130 PRO B HG2  1  
ATOM 2374  H HG3  . PRO B 1 130 ? 21.472  11.005  -0.504  1.00 0.00 ? 130 PRO B HG3  1  
ATOM 2375  H HD2  . PRO B 1 130 ? 23.736  10.140  0.623   1.00 0.00 ? 130 PRO B HD2  1  
ATOM 2376  H HD3  . PRO B 1 130 ? 22.214  9.237   0.813   1.00 0.00 ? 130 PRO B HD3  1  
ATOM 2377  N N    . LEU B 1 131 ? 25.066  9.102   -2.926  1.00 0.00 ? 131 LEU B N    1  
ATOM 2378  C CA   . LEU B 1 131 ? 26.044  9.309   -3.979  1.00 0.00 ? 131 LEU B CA   1  
ATOM 2379  C C    . LEU B 1 131 ? 26.774  8.001   -4.323  1.00 0.00 ? 131 LEU B C    1  
ATOM 2380  O O    . LEU B 1 131 ? 27.263  7.818   -5.447  1.00 0.00 ? 131 LEU B O    1  
ATOM 2381  C CB   . LEU B 1 131 ? 27.057  10.388  -3.568  1.00 0.00 ? 131 LEU B CB   1  
ATOM 2382  C CG   . LEU B 1 131 ? 28.130  10.748  -4.599  1.00 0.00 ? 131 LEU B CG   1  
ATOM 2383  C CD1  . LEU B 1 131 ? 27.507  11.369  -5.835  1.00 0.00 ? 131 LEU B CD1  1  
ATOM 2384  C CD2  . LEU B 1 131 ? 29.164  11.678  -3.994  1.00 0.00 ? 131 LEU B CD2  1  
ATOM 2385  H H    . LEU B 1 131 ? 25.309  9.322   -1.997  1.00 0.00 ? 131 LEU B H    1  
ATOM 2386  H HA   . LEU B 1 131 ? 25.512  9.650   -4.854  1.00 0.00 ? 131 LEU B HA   1  
ATOM 2387  H HB2  . LEU B 1 131 ? 26.504  11.286  -3.337  1.00 0.00 ? 131 LEU B HB2  1  
ATOM 2388  H HB3  . LEU B 1 131 ? 27.553  10.057  -2.668  1.00 0.00 ? 131 LEU B HB3  1  
ATOM 2389  H HG   . LEU B 1 131 ? 28.631  9.842   -4.909  1.00 0.00 ? 131 LEU B HG   1  
ATOM 2390  H HD11 . LEU B 1 131 ? 26.835  10.661  -6.294  1.00 0.00 ? 131 LEU B HD11 1  
ATOM 2391  H HD12 . LEU B 1 131 ? 28.285  11.634  -6.536  1.00 0.00 ? 131 LEU B HD12 1  
ATOM 2392  H HD13 . LEU B 1 131 ? 26.959  12.256  -5.555  1.00 0.00 ? 131 LEU B HD13 1  
ATOM 2393  H HD21 . LEU B 1 131 ? 28.678  12.575  -3.641  1.00 0.00 ? 131 LEU B HD21 1  
ATOM 2394  H HD22 . LEU B 1 131 ? 29.899  11.934  -4.742  1.00 0.00 ? 131 LEU B HD22 1  
ATOM 2395  H HD23 . LEU B 1 131 ? 29.652  11.183  -3.167  1.00 0.00 ? 131 LEU B HD23 1  
ATOM 2396  N N    . THR B 1 132 ? 26.843  7.097   -3.377  1.00 0.00 ? 132 THR B N    1  
ATOM 2397  C CA   . THR B 1 132 ? 27.606  5.882   -3.578  1.00 0.00 ? 132 THR B CA   1  
ATOM 2398  C C    . THR B 1 132 ? 26.744  4.621   -3.487  1.00 0.00 ? 132 THR B C    1  
ATOM 2399  O O    . THR B 1 132 ? 27.100  3.571   -4.032  1.00 0.00 ? 132 THR B O    1  
ATOM 2400  C CB   . THR B 1 132 ? 28.819  5.854   -2.596  1.00 0.00 ? 132 THR B CB   1  
ATOM 2401  O OG1  . THR B 1 132 ? 29.602  4.688   -2.764  1.00 0.00 ? 132 THR B OG1  1  
ATOM 2402  C CG2  . THR B 1 132 ? 28.373  5.977   -1.156  1.00 0.00 ? 132 THR B CG2  1  
ATOM 2403  H H    . THR B 1 132 ? 26.377  7.256   -2.527  1.00 0.00 ? 132 THR B H    1  
ATOM 2404  H HA   . THR B 1 132 ? 27.999  5.930   -4.583  1.00 0.00 ? 132 THR B HA   1  
ATOM 2405  H HB   . THR B 1 132 ? 29.442  6.704   -2.832  1.00 0.00 ? 132 THR B HB   1  
ATOM 2406  H HG1  . THR B 1 132 ? 29.398  4.103   -2.023  1.00 0.00 ? 132 THR B HG1  1  
ATOM 2407  H HG21 . THR B 1 132 ? 27.703  5.165   -0.912  1.00 0.00 ? 132 THR B HG21 1  
ATOM 2408  H HG22 . THR B 1 132 ? 27.863  6.921   -1.050  1.00 0.00 ? 132 THR B HG22 1  
ATOM 2409  H HG23 . THR B 1 132 ? 29.234  5.953   -0.504  1.00 0.00 ? 132 THR B HG23 1  
ATOM 2410  N N    . ILE B 1 133 ? 25.615  4.724   -2.852  1.00 0.00 ? 133 ILE B N    1  
ATOM 2411  C CA   . ILE B 1 133 ? 24.729  3.603   -2.747  1.00 0.00 ? 133 ILE B CA   1  
ATOM 2412  C C    . ILE B 1 133 ? 23.784  3.593   -3.935  1.00 0.00 ? 133 ILE B C    1  
ATOM 2413  O O    . ILE B 1 133 ? 23.132  4.597   -4.244  1.00 0.00 ? 133 ILE B O    1  
ATOM 2414  C CB   . ILE B 1 133 ? 23.978  3.602   -1.392  1.00 0.00 ? 133 ILE B CB   1  
ATOM 2415  C CG1  . ILE B 1 133 ? 24.989  3.416   -0.236  1.00 0.00 ? 133 ILE B CG1  1  
ATOM 2416  C CG2  . ILE B 1 133 ? 22.886  2.528   -1.344  1.00 0.00 ? 133 ILE B CG2  1  
ATOM 2417  C CD1  . ILE B 1 133 ? 25.696  2.075   -0.216  1.00 0.00 ? 133 ILE B CD1  1  
ATOM 2418  H H    . ILE B 1 133 ? 25.345  5.569   -2.431  1.00 0.00 ? 133 ILE B H    1  
ATOM 2419  H HA   . ILE B 1 133 ? 25.338  2.713   -2.813  1.00 0.00 ? 133 ILE B HA   1  
ATOM 2420  H HB   . ILE B 1 133 ? 23.507  4.566   -1.272  1.00 0.00 ? 133 ILE B HB   1  
ATOM 2421  H HG12 . ILE B 1 133 ? 25.746  4.183   -0.297  1.00 0.00 ? 133 ILE B HG12 1  
ATOM 2422  H HG13 . ILE B 1 133 ? 24.456  3.521   0.696   1.00 0.00 ? 133 ILE B HG13 1  
ATOM 2423  H HG21 . ILE B 1 133 ? 23.334  1.554   -1.479  1.00 0.00 ? 133 ILE B HG21 1  
ATOM 2424  H HG22 . ILE B 1 133 ? 22.172  2.708   -2.133  1.00 0.00 ? 133 ILE B HG22 1  
ATOM 2425  H HG23 . ILE B 1 133 ? 22.384  2.566   -0.388  1.00 0.00 ? 133 ILE B HG23 1  
ATOM 2426  H HD11 . ILE B 1 133 ? 26.282  1.951   -1.115  1.00 0.00 ? 133 ILE B HD11 1  
ATOM 2427  H HD12 . ILE B 1 133 ? 24.965  1.282   -0.147  1.00 0.00 ? 133 ILE B HD12 1  
ATOM 2428  H HD13 . ILE B 1 133 ? 26.351  2.032   0.642   1.00 0.00 ? 133 ILE B HD13 1  
ATOM 2429  N N    . THR B 1 134 ? 23.743  2.475   -4.593  1.00 0.00 ? 134 THR B N    1  
ATOM 2430  C CA   . THR B 1 134 ? 22.997  2.280   -5.807  1.00 0.00 ? 134 THR B CA   1  
ATOM 2431  C C    . THR B 1 134 ? 22.024  1.152   -5.631  1.00 0.00 ? 134 THR B C    1  
ATOM 2432  O O    . THR B 1 134 ? 22.124  0.411   -4.664  1.00 0.00 ? 134 THR B O    1  
ATOM 2433  C CB   . THR B 1 134 ? 23.951  1.989   -6.986  1.00 0.00 ? 134 THR B CB   1  
ATOM 2434  O OG1  . THR B 1 134 ? 24.862  0.908   -6.657  1.00 0.00 ? 134 THR B OG1  1  
ATOM 2435  C CG2  . THR B 1 134 ? 24.752  3.223   -7.350  1.00 0.00 ? 134 THR B CG2  1  
ATOM 2436  H H    . THR B 1 134 ? 24.247  1.715   -4.221  1.00 0.00 ? 134 THR B H    1  
ATOM 2437  H HA   . THR B 1 134 ? 22.454  3.189   -6.021  1.00 0.00 ? 134 THR B HA   1  
ATOM 2438  H HB   . THR B 1 134 ? 23.357  1.691   -7.838  1.00 0.00 ? 134 THR B HB   1  
ATOM 2439  H HG1  . THR B 1 134 ? 24.845  0.744   -5.701  1.00 0.00 ? 134 THR B HG1  1  
ATOM 2440  H HG21 . THR B 1 134 ? 24.079  4.012   -7.656  1.00 0.00 ? 134 THR B HG21 1  
ATOM 2441  H HG22 . THR B 1 134 ? 25.425  2.983   -8.159  1.00 0.00 ? 134 THR B HG22 1  
ATOM 2442  H HG23 . THR B 1 134 ? 25.322  3.547   -6.492  1.00 0.00 ? 134 THR B HG23 1  
ATOM 2443  N N    . SER B 1 135 ? 21.099  1.002   -6.550  1.00 0.00 ? 135 SER B N    1  
ATOM 2444  C CA   . SER B 1 135 ? 20.075  0.014   -6.407  1.00 0.00 ? 135 SER B CA   1  
ATOM 2445  C C    . SER B 1 135 ? 20.017  -0.895  -7.639  1.00 0.00 ? 135 SER B C    1  
ATOM 2446  O O    . SER B 1 135 ? 20.085  -0.430  -8.781  1.00 0.00 ? 135 SER B O    1  
ATOM 2447  C CB   . SER B 1 135 ? 18.736  0.731   -6.237  1.00 0.00 ? 135 SER B CB   1  
ATOM 2448  O OG   . SER B 1 135 ? 18.823  1.746   -5.233  1.00 0.00 ? 135 SER B OG   1  
ATOM 2449  H H    . SER B 1 135 ? 21.077  1.564   -7.354  1.00 0.00 ? 135 SER B H    1  
ATOM 2450  H HA   . SER B 1 135 ? 20.261  -0.571  -5.519  1.00 0.00 ? 135 SER B HA   1  
ATOM 2451  H HB2  . SER B 1 135 ? 18.453  1.190   -7.173  1.00 0.00 ? 135 SER B HB2  1  
ATOM 2452  H HB3  . SER B 1 135 ? 17.984  0.015   -5.945  1.00 0.00 ? 135 SER B HB3  1  
ATOM 2453  H HG   . SER B 1 135 ? 18.347  1.441   -4.454  1.00 0.00 ? 135 SER B HG   1  
ATOM 2454  N N    . SER B 1 136 ? 19.939  -2.172  -7.385  1.00 0.00 ? 136 SER B N    1  
ATOM 2455  C CA   . SER B 1 136 ? 19.787  -3.188  -8.391  1.00 0.00 ? 136 SER B CA   1  
ATOM 2456  C C    . SER B 1 136 ? 18.472  -3.906  -8.103  1.00 0.00 ? 136 SER B C    1  
ATOM 2457  O O    . SER B 1 136 ? 18.066  -3.973  -6.939  1.00 0.00 ? 136 SER B O    1  
ATOM 2458  C CB   . SER B 1 136 ? 20.993  -4.144  -8.331  1.00 0.00 ? 136 SER B CB   1  
ATOM 2459  O OG   . SER B 1 136 ? 21.249  -4.579  -6.988  1.00 0.00 ? 136 SER B OG   1  
ATOM 2460  H H    . SER B 1 136 ? 19.971  -2.481  -6.450  1.00 0.00 ? 136 SER B H    1  
ATOM 2461  H HA   . SER B 1 136 ? 19.736  -2.709  -9.358  1.00 0.00 ? 136 SER B HA   1  
ATOM 2462  H HB2  . SER B 1 136 ? 20.794  -5.011  -8.944  1.00 0.00 ? 136 SER B HB2  1  
ATOM 2463  H HB3  . SER B 1 136 ? 21.869  -3.634  -8.702  1.00 0.00 ? 136 SER B HB3  1  
ATOM 2464  H HG   . SER B 1 136 ? 21.735  -3.876  -6.538  1.00 0.00 ? 136 SER B HG   1  
ATOM 2465  N N    . LEU B 1 137 ? 17.799  -4.414  -9.108  1.00 0.00 ? 137 LEU B N    1  
ATOM 2466  C CA   . LEU B 1 137 ? 16.488  -4.996  -8.881  1.00 0.00 ? 137 LEU B CA   1  
ATOM 2467  C C    . LEU B 1 137 ? 16.304  -6.306  -9.610  1.00 0.00 ? 137 LEU B C    1  
ATOM 2468  O O    . LEU B 1 137 ? 16.813  -6.498  -10.717 1.00 0.00 ? 137 LEU B O    1  
ATOM 2469  C CB   . LEU B 1 137 ? 15.318  -3.978  -9.187  1.00 0.00 ? 137 LEU B CB   1  
ATOM 2470  C CG   . LEU B 1 137 ? 15.066  -3.439  -10.644 1.00 0.00 ? 137 LEU B CG   1  
ATOM 2471  C CD1  . LEU B 1 137 ? 16.289  -2.818  -11.289 1.00 0.00 ? 137 LEU B CD1  1  
ATOM 2472  C CD2  . LEU B 1 137 ? 14.414  -4.475  -11.554 1.00 0.00 ? 137 LEU B CD2  1  
ATOM 2473  H H    . LEU B 1 137 ? 18.183  -4.440  -10.012 1.00 0.00 ? 137 LEU B H    1  
ATOM 2474  H HA   . LEU B 1 137 ? 16.452  -5.226  -7.826  1.00 0.00 ? 137 LEU B HA   1  
ATOM 2475  H HB2  . LEU B 1 137 ? 14.399  -4.444  -8.868  1.00 0.00 ? 137 LEU B HB2  1  
ATOM 2476  H HB3  . LEU B 1 137 ? 15.482  -3.124  -8.547  1.00 0.00 ? 137 LEU B HB3  1  
ATOM 2477  H HG   . LEU B 1 137 ? 14.368  -2.619  -10.539 1.00 0.00 ? 137 LEU B HG   1  
ATOM 2478  H HD11 . LEU B 1 137 ? 16.619  -1.975  -10.700 1.00 0.00 ? 137 LEU B HD11 1  
ATOM 2479  H HD12 . LEU B 1 137 ? 16.043  -2.488  -12.287 1.00 0.00 ? 137 LEU B HD12 1  
ATOM 2480  H HD13 . LEU B 1 137 ? 17.080  -3.553  -11.335 1.00 0.00 ? 137 LEU B HD13 1  
ATOM 2481  H HD21 . LEU B 1 137 ? 14.266  -4.051  -12.537 1.00 0.00 ? 137 LEU B HD21 1  
ATOM 2482  H HD22 . LEU B 1 137 ? 13.460  -4.770  -11.140 1.00 0.00 ? 137 LEU B HD22 1  
ATOM 2483  H HD23 . LEU B 1 137 ? 15.055  -5.340  -11.627 1.00 0.00 ? 137 LEU B HD23 1  
ATOM 2484  N N    . SER B 1 138 ? 15.626  -7.207  -8.969  1.00 0.00 ? 138 SER B N    1  
ATOM 2485  C CA   . SER B 1 138 ? 15.276  -8.454  -9.549  1.00 0.00 ? 138 SER B CA   1  
ATOM 2486  C C    . SER B 1 138 ? 13.809  -8.332  -9.992  1.00 0.00 ? 138 SER B C    1  
ATOM 2487  O O    . SER B 1 138 ? 13.062  -7.479  -9.490  1.00 0.00 ? 138 SER B O    1  
ATOM 2488  C CB   . SER B 1 138 ? 15.429  -9.524  -8.460  1.00 0.00 ? 138 SER B CB   1  
ATOM 2489  O OG   . SER B 1 138 ? 15.275  -10.833 -8.971  1.00 0.00 ? 138 SER B OG   1  
ATOM 2490  H H    . SER B 1 138 ? 15.334  -7.010  -8.048  1.00 0.00 ? 138 SER B H    1  
ATOM 2491  H HA   . SER B 1 138 ? 15.923  -8.675  -10.383 1.00 0.00 ? 138 SER B HA   1  
ATOM 2492  H HB2  . SER B 1 138 ? 16.404  -9.440  -8.006  1.00 0.00 ? 138 SER B HB2  1  
ATOM 2493  H HB3  . SER B 1 138 ? 14.670  -9.352  -7.711  1.00 0.00 ? 138 SER B HB3  1  
ATOM 2494  H HG   . SER B 1 138 ? 15.989  -11.356 -8.582  1.00 0.00 ? 138 SER B HG   1  
ATOM 2495  N N    . SER B 1 139 ? 13.401  -9.223  -10.879 1.00 0.00 ? 139 SER B N    1  
ATOM 2496  C CA   . SER B 1 139 ? 12.090  -9.190  -11.509 1.00 0.00 ? 139 SER B CA   1  
ATOM 2497  C C    . SER B 1 139 ? 10.950  -9.500  -10.533 1.00 0.00 ? 139 SER B C    1  
ATOM 2498  O O    . SER B 1 139 ? 9.797   -9.165  -10.799 1.00 0.00 ? 139 SER B O    1  
ATOM 2499  C CB   . SER B 1 139 ? 12.069  -10.146 -12.712 1.00 0.00 ? 139 SER B CB   1  
ATOM 2500  O OG   . SER B 1 139 ? 10.903  -9.992  -13.508 1.00 0.00 ? 139 SER B OG   1  
ATOM 2501  H H    . SER B 1 139 ? 14.016  -9.946  -11.132 1.00 0.00 ? 139 SER B H    1  
ATOM 2502  H HA   . SER B 1 139 ? 11.945  -8.188  -11.884 1.00 0.00 ? 139 SER B HA   1  
ATOM 2503  H HB2  . SER B 1 139 ? 12.933  -9.954  -13.330 1.00 0.00 ? 139 SER B HB2  1  
ATOM 2504  H HB3  . SER B 1 139 ? 12.111  -11.162 -12.347 1.00 0.00 ? 139 SER B HB3  1  
ATOM 2505  H HG   . SER B 1 139 ? 11.199  -9.732  -14.389 1.00 0.00 ? 139 SER B HG   1  
ATOM 2506  N N    . ASP B 1 140 ? 11.273  -10.130 -9.412  1.00 0.00 ? 140 ASP B N    1  
ATOM 2507  C CA   . ASP B 1 140 ? 10.247  -10.532 -8.441  1.00 0.00 ? 140 ASP B CA   1  
ATOM 2508  C C    . ASP B 1 140 ? 9.930   -9.407  -7.453  1.00 0.00 ? 140 ASP B C    1  
ATOM 2509  O O    . ASP B 1 140 ? 8.950   -9.470  -6.714  1.00 0.00 ? 140 ASP B O    1  
ATOM 2510  C CB   . ASP B 1 140 ? 10.680  -11.807 -7.706  1.00 0.00 ? 140 ASP B CB   1  
ATOM 2511  C CG   . ASP B 1 140 ? 9.598   -12.407 -6.822  1.00 0.00 ? 140 ASP B CG   1  
ATOM 2512  O OD1  . ASP B 1 140 ? 8.452   -12.580 -7.303  1.00 0.00 ? 140 ASP B OD1  1  
ATOM 2513  O OD2  . ASP B 1 140 ? 9.910   -12.827 -5.701  1.00 0.00 ? 140 ASP B OD2  1  
ATOM 2514  H H    . ASP B 1 140 ? 12.213  -10.347 -9.247  1.00 0.00 ? 140 ASP B H    1  
ATOM 2515  H HA   . ASP B 1 140 ? 9.348   -10.745 -8.999  1.00 0.00 ? 140 ASP B HA   1  
ATOM 2516  H HB2  . ASP B 1 140 ? 10.962  -12.553 -8.434  1.00 0.00 ? 140 ASP B HB2  1  
ATOM 2517  H HB3  . ASP B 1 140 ? 11.536  -11.577 -7.089  1.00 0.00 ? 140 ASP B HB3  1  
ATOM 2518  N N    . GLY B 1 141 ? 10.737  -8.359  -7.474  1.00 0.00 ? 141 GLY B N    1  
ATOM 2519  C CA   . GLY B 1 141 ? 10.509  -7.250  -6.566  1.00 0.00 ? 141 GLY B CA   1  
ATOM 2520  C C    . GLY B 1 141 ? 11.623  -7.094  -5.554  1.00 0.00 ? 141 GLY B C    1  
ATOM 2521  O O    . GLY B 1 141 ? 11.572  -6.227  -4.686  1.00 0.00 ? 141 GLY B O    1  
ATOM 2522  H H    . GLY B 1 141 ? 11.460  -8.317  -8.134  1.00 0.00 ? 141 GLY B H    1  
ATOM 2523  H HA2  . GLY B 1 141 ? 10.428  -6.340  -7.140  1.00 0.00 ? 141 GLY B HA2  1  
ATOM 2524  H HA3  . GLY B 1 141 ? 9.581   -7.421  -6.041  1.00 0.00 ? 141 GLY B HA3  1  
ATOM 2525  N N    . VAL B 1 142 ? 12.615  -7.947  -5.647  1.00 0.00 ? 142 VAL B N    1  
ATOM 2526  C CA   . VAL B 1 142 ? 13.762  -7.862  -4.763  1.00 0.00 ? 142 VAL B CA   1  
ATOM 2527  C C    . VAL B 1 142 ? 14.658  -6.721  -5.228  1.00 0.00 ? 142 VAL B C    1  
ATOM 2528  O O    . VAL B 1 142 ? 15.075  -6.690  -6.383  1.00 0.00 ? 142 VAL B O    1  
ATOM 2529  C CB   . VAL B 1 142 ? 14.578  -9.182  -4.739  1.00 0.00 ? 142 VAL B CB   1  
ATOM 2530  C CG1  . VAL B 1 142 ? 15.703  -9.112  -3.717  1.00 0.00 ? 142 VAL B CG1  1  
ATOM 2531  C CG2  . VAL B 1 142 ? 13.678  -10.365 -4.457  1.00 0.00 ? 142 VAL B CG2  1  
ATOM 2532  H H    . VAL B 1 142 ? 12.561  -8.648  -6.324  1.00 0.00 ? 142 VAL B H    1  
ATOM 2533  H HA   . VAL B 1 142 ? 13.402  -7.644  -3.768  1.00 0.00 ? 142 VAL B HA   1  
ATOM 2534  H HB   . VAL B 1 142 ? 15.029  -9.319  -5.710  1.00 0.00 ? 142 VAL B HB   1  
ATOM 2535  H HG11 . VAL B 1 142 ? 16.368  -8.299  -3.971  1.00 0.00 ? 142 VAL B HG11 1  
ATOM 2536  H HG12 . VAL B 1 142 ? 16.253  -10.042 -3.718  1.00 0.00 ? 142 VAL B HG12 1  
ATOM 2537  H HG13 . VAL B 1 142 ? 15.287  -8.942  -2.734  1.00 0.00 ? 142 VAL B HG13 1  
ATOM 2538  H HG21 . VAL B 1 142 ? 14.265  -11.272 -4.470  1.00 0.00 ? 142 VAL B HG21 1  
ATOM 2539  H HG22 . VAL B 1 142 ? 12.913  -10.424 -5.218  1.00 0.00 ? 142 VAL B HG22 1  
ATOM 2540  H HG23 . VAL B 1 142 ? 13.216  -10.245 -3.489  1.00 0.00 ? 142 VAL B HG23 1  
ATOM 2541  N N    . LEU B 1 143 ? 14.928  -5.809  -4.354  1.00 0.00 ? 143 LEU B N    1  
ATOM 2542  C CA   . LEU B 1 143 ? 15.724  -4.656  -4.658  1.00 0.00 ? 143 LEU B CA   1  
ATOM 2543  C C    . LEU B 1 143 ? 16.944  -4.691  -3.740  1.00 0.00 ? 143 LEU B C    1  
ATOM 2544  O O    . LEU B 1 143 ? 16.824  -4.954  -2.566  1.00 0.00 ? 143 LEU B O    1  
ATOM 2545  C CB   . LEU B 1 143 ? 14.831  -3.390  -4.442  1.00 0.00 ? 143 LEU B CB   1  
ATOM 2546  C CG   . LEU B 1 143 ? 15.376  -1.979  -4.792  1.00 0.00 ? 143 LEU B CG   1  
ATOM 2547  C CD1  . LEU B 1 143 ? 16.534  -1.545  -3.916  1.00 0.00 ? 143 LEU B CD1  1  
ATOM 2548  C CD2  . LEU B 1 143 ? 15.733  -1.881  -6.250  1.00 0.00 ? 143 LEU B CD2  1  
ATOM 2549  H H    . LEU B 1 143 ? 14.598  -5.901  -3.430  1.00 0.00 ? 143 LEU B H    1  
ATOM 2550  H HA   . LEU B 1 143 ? 16.036  -4.712  -5.689  1.00 0.00 ? 143 LEU B HA   1  
ATOM 2551  H HB2  . LEU B 1 143 ? 13.950  -3.534  -5.051  1.00 0.00 ? 143 LEU B HB2  1  
ATOM 2552  H HB3  . LEU B 1 143 ? 14.501  -3.383  -3.416  1.00 0.00 ? 143 LEU B HB3  1  
ATOM 2553  H HG   . LEU B 1 143 ? 14.582  -1.269  -4.607  1.00 0.00 ? 143 LEU B HG   1  
ATOM 2554  H HD11 . LEU B 1 143 ? 16.879  -0.568  -4.219  1.00 0.00 ? 143 LEU B HD11 1  
ATOM 2555  H HD12 . LEU B 1 143 ? 17.342  -2.256  -4.004  1.00 0.00 ? 143 LEU B HD12 1  
ATOM 2556  H HD13 . LEU B 1 143 ? 16.200  -1.503  -2.890  1.00 0.00 ? 143 LEU B HD13 1  
ATOM 2557  H HD21 . LEU B 1 143 ? 16.094  -0.885  -6.466  1.00 0.00 ? 143 LEU B HD21 1  
ATOM 2558  H HD22 . LEU B 1 143 ? 14.853  -2.078  -6.843  1.00 0.00 ? 143 LEU B HD22 1  
ATOM 2559  H HD23 . LEU B 1 143 ? 16.503  -2.602  -6.486  1.00 0.00 ? 143 LEU B HD23 1  
ATOM 2560  N N    . THR B 1 144 ? 18.099  -4.498  -4.273  1.00 0.00 ? 144 THR B N    1  
ATOM 2561  C CA   . THR B 1 144 ? 19.287  -4.502  -3.477  1.00 0.00 ? 144 THR B CA   1  
ATOM 2562  C C    . THR B 1 144 ? 20.030  -3.169  -3.605  1.00 0.00 ? 144 THR B C    1  
ATOM 2563  O O    . THR B 1 144 ? 20.288  -2.699  -4.714  1.00 0.00 ? 144 THR B O    1  
ATOM 2564  C CB   . THR B 1 144 ? 20.189  -5.683  -3.880  1.00 0.00 ? 144 THR B CB   1  
ATOM 2565  O OG1  . THR B 1 144 ? 19.412  -6.898  -3.811  1.00 0.00 ? 144 THR B OG1  1  
ATOM 2566  C CG2  . THR B 1 144 ? 21.392  -5.806  -2.943  1.00 0.00 ? 144 THR B CG2  1  
ATOM 2567  H H    . THR B 1 144 ? 18.170  -4.336  -5.243  1.00 0.00 ? 144 THR B H    1  
ATOM 2568  H HA   . THR B 1 144 ? 18.990  -4.636  -2.446  1.00 0.00 ? 144 THR B HA   1  
ATOM 2569  H HB   . THR B 1 144 ? 20.531  -5.535  -4.894  1.00 0.00 ? 144 THR B HB   1  
ATOM 2570  H HG1  . THR B 1 144 ? 18.676  -6.751  -3.200  1.00 0.00 ? 144 THR B HG1  1  
ATOM 2571  H HG21 . THR B 1 144 ? 21.973  -4.896  -2.982  1.00 0.00 ? 144 THR B HG21 1  
ATOM 2572  H HG22 . THR B 1 144 ? 22.004  -6.640  -3.251  1.00 0.00 ? 144 THR B HG22 1  
ATOM 2573  H HG23 . THR B 1 144 ? 21.047  -5.968  -1.933  1.00 0.00 ? 144 THR B HG23 1  
ATOM 2574  N N    . VAL B 1 145 ? 20.324  -2.558  -2.488  1.00 0.00 ? 145 VAL B N    1  
ATOM 2575  C CA   . VAL B 1 145 ? 21.087  -1.347  -2.480  1.00 0.00 ? 145 VAL B CA   1  
ATOM 2576  C C    . VAL B 1 145 ? 22.518  -1.653  -2.092  1.00 0.00 ? 145 VAL B C    1  
ATOM 2577  O O    . VAL B 1 145 ? 22.780  -2.265  -1.050  1.00 0.00 ? 145 VAL B O    1  
ATOM 2578  C CB   . VAL B 1 145 ? 20.455  -0.215  -1.613  1.00 0.00 ? 145 VAL B CB   1  
ATOM 2579  C CG1  . VAL B 1 145 ? 19.182  0.250   -2.252  1.00 0.00 ? 145 VAL B CG1  1  
ATOM 2580  C CG2  . VAL B 1 145 ? 20.175  -0.661  -0.186  1.00 0.00 ? 145 VAL B CG2  1  
ATOM 2581  H H    . VAL B 1 145 ? 20.056  -2.954  -1.627  1.00 0.00 ? 145 VAL B H    1  
ATOM 2582  H HA   . VAL B 1 145 ? 21.118  -1.024  -3.511  1.00 0.00 ? 145 VAL B HA   1  
ATOM 2583  H HB   . VAL B 1 145 ? 21.145  0.616   -1.593  1.00 0.00 ? 145 VAL B HB   1  
ATOM 2584  H HG11 . VAL B 1 145 ? 18.760  1.058   -1.674  1.00 0.00 ? 145 VAL B HG11 1  
ATOM 2585  H HG12 . VAL B 1 145 ? 18.480  -0.570  -2.292  1.00 0.00 ? 145 VAL B HG12 1  
ATOM 2586  H HG13 . VAL B 1 145 ? 19.391  0.596   -3.254  1.00 0.00 ? 145 VAL B HG13 1  
ATOM 2587  H HG21 . VAL B 1 145 ? 21.123  -0.947  0.244   1.00 0.00 ? 145 VAL B HG21 1  
ATOM 2588  H HG22 . VAL B 1 145 ? 19.505  -1.508  -0.191  1.00 0.00 ? 145 VAL B HG22 1  
ATOM 2589  H HG23 . VAL B 1 145 ? 19.743  0.154   0.376   1.00 0.00 ? 145 VAL B HG23 1  
ATOM 2590  N N    . ASN B 1 146 ? 23.423  -1.290  -2.954  1.00 0.00 ? 146 ASN B N    1  
ATOM 2591  C CA   . ASN B 1 146 ? 24.814  -1.637  -2.794  1.00 0.00 ? 146 ASN B CA   1  
ATOM 2592  C C    . ASN B 1 146 ? 25.728  -0.478  -3.149  1.00 0.00 ? 146 ASN B C    1  
ATOM 2593  O O    . ASN B 1 146 ? 25.361  0.413   -3.925  1.00 0.00 ? 146 ASN B O    1  
ATOM 2594  C CB   . ASN B 1 146 ? 25.165  -2.866  -3.668  1.00 0.00 ? 146 ASN B CB   1  
ATOM 2595  C CG   . ASN B 1 146 ? 25.078  -2.595  -5.173  1.00 0.00 ? 146 ASN B CG   1  
ATOM 2596  O OD1  . ASN B 1 146 ? 24.011  -2.728  -5.789  1.00 0.00 ? 146 ASN B OD1  1  
ATOM 2597  N ND2  . ASN B 1 146 ? 26.193  -2.258  -5.785  1.00 0.00 ? 146 ASN B ND2  1  
ATOM 2598  H H    . ASN B 1 146 ? 23.138  -0.751  -3.726  1.00 0.00 ? 146 ASN B H    1  
ATOM 2599  H HA   . ASN B 1 146 ? 24.975  -1.908  -1.762  1.00 0.00 ? 146 ASN B HA   1  
ATOM 2600  H HB2  . ASN B 1 146 ? 26.175  -3.177  -3.444  1.00 0.00 ? 146 ASN B HB2  1  
ATOM 2601  H HB3  . ASN B 1 146 ? 24.489  -3.672  -3.427  1.00 0.00 ? 146 ASN B HB3  1  
ATOM 2602  H HD21 . ASN B 1 146 ? 27.028  -2.193  -5.272  1.00 0.00 ? 146 ASN B HD21 1  
ATOM 2603  H HD22 . ASN B 1 146 ? 26.169  -2.076  -6.748  1.00 0.00 ? 146 ASN B HD22 1  
ATOM 2604  N N    . GLY B 1 147 ? 26.885  -0.516  -2.574  1.00 0.00 ? 147 GLY B N    1  
ATOM 2605  C CA   . GLY B 1 147 ? 27.907  0.435   -2.835  1.00 0.00 ? 147 GLY B CA   1  
ATOM 2606  C C    . GLY B 1 147 ? 28.726  0.621   -1.605  1.00 0.00 ? 147 GLY B C    1  
ATOM 2607  O O    . GLY B 1 147 ? 28.413  -0.000  -0.584  1.00 0.00 ? 147 GLY B O    1  
ATOM 2608  H H    . GLY B 1 147 ? 27.054  -1.192  -1.881  1.00 0.00 ? 147 GLY B H    1  
ATOM 2609  H HA2  . GLY B 1 147 ? 28.535  0.080   -3.638  1.00 0.00 ? 147 GLY B HA2  1  
ATOM 2610  H HA3  . GLY B 1 147 ? 27.468  1.384   -3.109  1.00 0.00 ? 147 GLY B HA3  1  
ATOM 2611  N N    . PRO B 1 148 ? 29.833  1.351   -1.679  1.00 0.00 ? 148 PRO B N    1  
ATOM 2612  C CA   . PRO B 1 148 ? 30.599  1.751   -0.496  1.00 0.00 ? 148 PRO B CA   1  
ATOM 2613  C C    . PRO B 1 148 ? 29.719  2.391   0.560   1.00 0.00 ? 148 PRO B C    1  
ATOM 2614  O O    . PRO B 1 148 ? 28.793  3.149   0.244   1.00 0.00 ? 148 PRO B O    1  
ATOM 2615  C CB   . PRO B 1 148 ? 31.544  2.774   -1.049  1.00 0.00 ? 148 PRO B CB   1  
ATOM 2616  C CG   . PRO B 1 148 ? 31.820  2.293   -2.419  1.00 0.00 ? 148 PRO B CG   1  
ATOM 2617  C CD   . PRO B 1 148 ? 30.507  1.765   -2.920  1.00 0.00 ? 148 PRO B CD   1  
ATOM 2618  H HA   . PRO B 1 148 ? 31.153  0.926   -0.072  1.00 0.00 ? 148 PRO B HA   1  
ATOM 2619  H HB2  . PRO B 1 148 ? 31.066  3.743   -1.049  1.00 0.00 ? 148 PRO B HB2  1  
ATOM 2620  H HB3  . PRO B 1 148 ? 32.445  2.805   -0.453  1.00 0.00 ? 148 PRO B HB3  1  
ATOM 2621  H HG2  . PRO B 1 148 ? 32.166  3.109   -3.037  1.00 0.00 ? 148 PRO B HG2  1  
ATOM 2622  H HG3  . PRO B 1 148 ? 32.553  1.502   -2.391  1.00 0.00 ? 148 PRO B HG3  1  
ATOM 2623  H HD2  . PRO B 1 148 ? 29.952  2.546   -3.418  1.00 0.00 ? 148 PRO B HD2  1  
ATOM 2624  H HD3  . PRO B 1 148 ? 30.659  0.920   -3.577  1.00 0.00 ? 148 PRO B HD3  1  
ATOM 2625  N N    . ARG B 1 149 ? 30.023  2.095   1.780   1.00 0.00 ? 149 ARG B N    1  
ATOM 2626  C CA   . ARG B 1 149 ? 29.263  2.550   2.911   1.00 0.00 ? 149 ARG B CA   1  
ATOM 2627  C C    . ARG B 1 149 ? 29.781  3.877   3.428   1.00 0.00 ? 149 ARG B C    1  
ATOM 2628  O O    . ARG B 1 149 ? 30.860  4.324   3.053   1.00 0.00 ? 149 ARG B O    1  
ATOM 2629  C CB   . ARG B 1 149 ? 29.302  1.555   4.040   1.00 0.00 ? 149 ARG B CB   1  
ATOM 2630  C CG   . ARG B 1 149 ? 30.673  1.383   4.670   1.00 0.00 ? 149 ARG B CG   1  
ATOM 2631  C CD   . ARG B 1 149 ? 30.531  0.705   5.991   1.00 0.00 ? 149 ARG B CD   1  
ATOM 2632  N NE   . ARG B 1 149 ? 29.599  1.454   6.832   1.00 0.00 ? 149 ARG B NE   1  
ATOM 2633  C CZ   . ARG B 1 149 ? 28.577  0.913   7.487   1.00 0.00 ? 149 ARG B CZ   1  
ATOM 2634  N NH1  . ARG B 1 149 ? 28.477  -0.417  7.607   1.00 0.00 ? 149 ARG B NH1  1  
ATOM 2635  N NH2  . ARG B 1 149 ? 27.677  1.692   8.043   1.00 0.00 ? 149 ARG B NH2  1  
ATOM 2636  H H    . ARG B 1 149 ? 30.829  1.559   1.927   1.00 0.00 ? 149 ARG B H    1  
ATOM 2637  H HA   . ARG B 1 149 ? 28.237  2.671   2.598   1.00 0.00 ? 149 ARG B HA   1  
ATOM 2638  H HB2  . ARG B 1 149 ? 28.619  1.882   4.811   1.00 0.00 ? 149 ARG B HB2  1  
ATOM 2639  H HB3  . ARG B 1 149 ? 28.976  0.594   3.675   1.00 0.00 ? 149 ARG B HB3  1  
ATOM 2640  H HG2  . ARG B 1 149 ? 31.294  0.787   4.021   1.00 0.00 ? 149 ARG B HG2  1  
ATOM 2641  H HG3  . ARG B 1 149 ? 31.120  2.355   4.817   1.00 0.00 ? 149 ARG B HG3  1  
ATOM 2642  H HD2  . ARG B 1 149 ? 30.130  -0.281  5.816   1.00 0.00 ? 149 ARG B HD2  1  
ATOM 2643  H HD3  . ARG B 1 149 ? 31.492  0.648   6.482   1.00 0.00 ? 149 ARG B HD3  1  
ATOM 2644  H HE   . ARG B 1 149 ? 29.732  2.439   6.813   1.00 0.00 ? 149 ARG B HE   1  
ATOM 2645  H HH11 . ARG B 1 149 ? 29.153  -1.048  7.216   1.00 0.00 ? 149 ARG B HH11 1  
ATOM 2646  H HH12 . ARG B 1 149 ? 27.709  -0.839  8.096   1.00 0.00 ? 149 ARG B HH12 1  
ATOM 2647  H HH21 . ARG B 1 149 ? 27.732  2.697   8.005   1.00 0.00 ? 149 ARG B HH21 1  
ATOM 2648  H HH22 . ARG B 1 149 ? 26.853  1.305   8.481   1.00 0.00 ? 149 ARG B HH22 1  
ATOM 2649  N N    . LYS B 1 150 ? 28.998  4.508   4.253   1.00 0.00 ? 150 LYS B N    1  
ATOM 2650  C CA   . LYS B 1 150 ? 29.407  5.723   4.869   1.00 0.00 ? 150 LYS B CA   1  
ATOM 2651  C C    . LYS B 1 150 ? 29.783  5.402   6.335   1.00 0.00 ? 150 LYS B C    1  
ATOM 2652  O O    . LYS B 1 150 ? 30.023  4.203   6.654   1.00 0.00 ? 150 LYS B O    1  
ATOM 2653  C CB   . LYS B 1 150 ? 28.255  6.729   4.772   1.00 0.00 ? 150 LYS B CB   1  
ATOM 2654  C CG   . LYS B 1 150 ? 28.622  8.174   5.061   1.00 0.00 ? 150 LYS B CG   1  
ATOM 2655  C CD   . LYS B 1 150 ? 27.454  9.070   4.728   1.00 0.00 ? 150 LYS B CD   1  
ATOM 2656  C CE   . LYS B 1 150 ? 27.794  10.528  4.838   1.00 0.00 ? 150 LYS B CE   1  
ATOM 2657  N NZ   . LYS B 1 150 ? 26.736  11.352  4.220   1.00 0.00 ? 150 LYS B NZ   1  
ATOM 2658  H H    . LYS B 1 150 ? 28.127  4.133   4.497   1.00 0.00 ? 150 LYS B H    1  
ATOM 2659  H HA   . LYS B 1 150 ? 30.274  6.102   4.348   1.00 0.00 ? 150 LYS B HA   1  
ATOM 2660  H HB2  . LYS B 1 150 ? 27.850  6.685   3.773   1.00 0.00 ? 150 LYS B HB2  1  
ATOM 2661  H HB3  . LYS B 1 150 ? 27.485  6.430   5.466   1.00 0.00 ? 150 LYS B HB3  1  
ATOM 2662  H HG2  . LYS B 1 150 ? 28.871  8.277   6.106   1.00 0.00 ? 150 LYS B HG2  1  
ATOM 2663  H HG3  . LYS B 1 150 ? 29.469  8.454   4.452   1.00 0.00 ? 150 LYS B HG3  1  
ATOM 2664  H HD2  . LYS B 1 150 ? 27.138  8.889   3.715   1.00 0.00 ? 150 LYS B HD2  1  
ATOM 2665  H HD3  . LYS B 1 150 ? 26.642  8.848   5.405   1.00 0.00 ? 150 LYS B HD3  1  
ATOM 2666  H HE2  . LYS B 1 150 ? 27.894  10.795  5.880   1.00 0.00 ? 150 LYS B HE2  1  
ATOM 2667  H HE3  . LYS B 1 150 ? 28.727  10.711  4.324   1.00 0.00 ? 150 LYS B HE3  1  
ATOM 2668  H HZ1  . LYS B 1 150 ? 25.812  11.177  4.663   1.00 0.00 ? 150 LYS B HZ1  1  
ATOM 2669  H HZ2  . LYS B 1 150 ? 26.660  11.078  3.213   1.00 0.00 ? 150 LYS B HZ2  1  
ATOM 2670  H HZ3  . LYS B 1 150 ? 26.959  12.366  4.268   1.00 0.00 ? 150 LYS B HZ3  1  
ATOM 2671  N N    . ARG A 1 69  ? -39.140 7.551   -9.493  1.00 0.00 ? 69  ARG A N    2  
ATOM 2672  C CA   . ARG A 1 69  ? -38.083 6.912   -10.251 1.00 0.00 ? 69  ARG A CA   2  
ATOM 2673  C C    . ARG A 1 69  ? -36.829 6.853   -9.371  1.00 0.00 ? 69  ARG A C    2  
ATOM 2674  O O    . ARG A 1 69  ? -35.764 7.400   -9.674  1.00 0.00 ? 69  ARG A O    2  
ATOM 2675  C CB   . ARG A 1 69  ? -37.834 7.656   -11.576 1.00 0.00 ? 69  ARG A CB   2  
ATOM 2676  C CG   . ARG A 1 69  ? -36.770 7.026   -12.480 1.00 0.00 ? 69  ARG A CG   2  
ATOM 2677  C CD   . ARG A 1 69  ? -36.659 7.768   -13.797 1.00 0.00 ? 69  ARG A CD   2  
ATOM 2678  N NE   . ARG A 1 69  ? -37.868 7.624   -14.615 1.00 0.00 ? 69  ARG A NE   2  
ATOM 2679  C CZ   . ARG A 1 69  ? -38.358 8.557   -15.436 1.00 0.00 ? 69  ARG A CZ   2  
ATOM 2680  N NH1  . ARG A 1 69  ? -37.802 9.774   -15.478 1.00 0.00 ? 69  ARG A NH1  2  
ATOM 2681  N NH2  . ARG A 1 69  ? -39.421 8.279   -16.195 1.00 0.00 ? 69  ARG A NH2  2  
ATOM 2682  H H    . ARG A 1 69  ? -39.252 8.524   -9.582  1.00 0.00 ? 69  ARG A H    2  
ATOM 2683  H HA   . ARG A 1 69  ? -38.403 5.899   -10.449 1.00 0.00 ? 69  ARG A HA   2  
ATOM 2684  H HB2  . ARG A 1 69  ? -38.760 7.695   -12.132 1.00 0.00 ? 69  ARG A HB2  2  
ATOM 2685  H HB3  . ARG A 1 69  ? -37.525 8.664   -11.344 1.00 0.00 ? 69  ARG A HB3  2  
ATOM 2686  H HG2  . ARG A 1 69  ? -35.817 7.064   -11.973 1.00 0.00 ? 69  ARG A HG2  2  
ATOM 2687  H HG3  . ARG A 1 69  ? -37.034 5.996   -12.671 1.00 0.00 ? 69  ARG A HG3  2  
ATOM 2688  H HD2  . ARG A 1 69  ? -36.527 8.816   -13.580 1.00 0.00 ? 69  ARG A HD2  2  
ATOM 2689  H HD3  . ARG A 1 69  ? -35.810 7.395   -14.350 1.00 0.00 ? 69  ARG A HD3  2  
ATOM 2690  H HE   . ARG A 1 69  ? -38.296 6.742   -14.535 1.00 0.00 ? 69  ARG A HE   2  
ATOM 2691  H HH11 . ARG A 1 69  ? -37.016 10.006  -14.899 1.00 0.00 ? 69  ARG A HH11 2  
ATOM 2692  H HH12 . ARG A 1 69  ? -38.135 10.510  -16.070 1.00 0.00 ? 69  ARG A HH12 2  
ATOM 2693  H HH21 . ARG A 1 69  ? -39.862 7.379   -16.168 1.00 0.00 ? 69  ARG A HH21 2  
ATOM 2694  H HH22 . ARG A 1 69  ? -39.836 8.950   -16.819 1.00 0.00 ? 69  ARG A HH22 2  
ATOM 2695  N N    . LEU A 1 70  ? -37.017 6.247   -8.253  1.00 0.00 ? 70  LEU A N    2  
ATOM 2696  C CA   . LEU A 1 70  ? -36.007 6.021   -7.281  1.00 0.00 ? 70  LEU A CA   2  
ATOM 2697  C C    . LEU A 1 70  ? -36.334 4.664   -6.732  1.00 0.00 ? 70  LEU A C    2  
ATOM 2698  O O    . LEU A 1 70  ? -37.221 4.521   -5.873  1.00 0.00 ? 70  LEU A O    2  
ATOM 2699  C CB   . LEU A 1 70  ? -36.085 7.105   -6.169  1.00 0.00 ? 70  LEU A CB   2  
ATOM 2700  C CG   . LEU A 1 70  ? -34.892 7.251   -5.180  1.00 0.00 ? 70  LEU A CG   2  
ATOM 2701  C CD1  . LEU A 1 70  ? -35.159 8.387   -4.227  1.00 0.00 ? 70  LEU A CD1  2  
ATOM 2702  C CD2  . LEU A 1 70  ? -34.631 5.990   -4.373  1.00 0.00 ? 70  LEU A CD2  2  
ATOM 2703  H H    . LEU A 1 70  ? -37.920 5.907   -8.072  1.00 0.00 ? 70  LEU A H    2  
ATOM 2704  H HA   . LEU A 1 70  ? -35.036 6.021   -7.752  1.00 0.00 ? 70  LEU A HA   2  
ATOM 2705  H HB2  . LEU A 1 70  ? -36.216 8.060   -6.656  1.00 0.00 ? 70  LEU A HB2  2  
ATOM 2706  H HB3  . LEU A 1 70  ? -36.976 6.908   -5.591  1.00 0.00 ? 70  LEU A HB3  2  
ATOM 2707  H HG   . LEU A 1 70  ? -34.003 7.499   -5.741  1.00 0.00 ? 70  LEU A HG   2  
ATOM 2708  H HD11 . LEU A 1 70  ? -35.289 9.306   -4.778  1.00 0.00 ? 70  LEU A HD11 2  
ATOM 2709  H HD12 . LEU A 1 70  ? -34.330 8.486   -3.544  1.00 0.00 ? 70  LEU A HD12 2  
ATOM 2710  H HD13 . LEU A 1 70  ? -36.059 8.176   -3.669  1.00 0.00 ? 70  LEU A HD13 2  
ATOM 2711  H HD21 . LEU A 1 70  ? -33.776 6.146   -3.732  1.00 0.00 ? 70  LEU A HD21 2  
ATOM 2712  H HD22 . LEU A 1 70  ? -34.430 5.166   -5.042  1.00 0.00 ? 70  LEU A HD22 2  
ATOM 2713  H HD23 . LEU A 1 70  ? -35.494 5.760   -3.767  1.00 0.00 ? 70  LEU A HD23 2  
ATOM 2714  N N    . GLU A 1 71  ? -35.720 3.675   -7.283  1.00 0.00 ? 71  GLU A N    2  
ATOM 2715  C CA   . GLU A 1 71  ? -35.951 2.329   -6.871  1.00 0.00 ? 71  GLU A CA   2  
ATOM 2716  C C    . GLU A 1 71  ? -35.330 2.087   -5.521  1.00 0.00 ? 71  GLU A C    2  
ATOM 2717  O O    . GLU A 1 71  ? -34.230 2.573   -5.226  1.00 0.00 ? 71  GLU A O    2  
ATOM 2718  C CB   . GLU A 1 71  ? -35.425 1.348   -7.909  1.00 0.00 ? 71  GLU A CB   2  
ATOM 2719  C CG   . GLU A 1 71  ? -36.149 1.429   -9.239  1.00 0.00 ? 71  GLU A CG   2  
ATOM 2720  C CD   . GLU A 1 71  ? -35.581 0.493   -10.266 1.00 0.00 ? 71  GLU A CD   2  
ATOM 2721  O OE1  . GLU A 1 71  ? -35.887 -0.718  -10.218 1.00 0.00 ? 71  GLU A OE1  2  
ATOM 2722  O OE2  . GLU A 1 71  ? -34.814 0.959   -11.151 1.00 0.00 ? 71  GLU A OE2  2  
ATOM 2723  H H    . GLU A 1 71  ? -35.064 3.841   -7.992  1.00 0.00 ? 71  GLU A H    2  
ATOM 2724  H HA   . GLU A 1 71  ? -37.018 2.200   -6.784  1.00 0.00 ? 71  GLU A HA   2  
ATOM 2725  H HB2  . GLU A 1 71  ? -34.378 1.551   -8.081  1.00 0.00 ? 71  GLU A HB2  2  
ATOM 2726  H HB3  . GLU A 1 71  ? -35.530 0.342   -7.527  1.00 0.00 ? 71  GLU A HB3  2  
ATOM 2727  H HG2  . GLU A 1 71  ? -37.188 1.175   -9.083  1.00 0.00 ? 71  GLU A HG2  2  
ATOM 2728  H HG3  . GLU A 1 71  ? -36.082 2.442   -9.608  1.00 0.00 ? 71  GLU A HG3  2  
ATOM 2729  N N    . LYS A 1 72  ? -36.050 1.413   -4.688  1.00 0.00 ? 72  LYS A N    2  
ATOM 2730  C CA   . LYS A 1 72  ? -35.562 1.084   -3.399  1.00 0.00 ? 72  LYS A CA   2  
ATOM 2731  C C    . LYS A 1 72  ? -35.335 -0.398  -3.290  1.00 0.00 ? 72  LYS A C    2  
ATOM 2732  O O    . LYS A 1 72  ? -36.251 -1.213  -3.451  1.00 0.00 ? 72  LYS A O    2  
ATOM 2733  C CB   . LYS A 1 72  ? -36.452 1.639   -2.272  1.00 0.00 ? 72  LYS A CB   2  
ATOM 2734  C CG   . LYS A 1 72  ? -37.921 1.267   -2.350  1.00 0.00 ? 72  LYS A CG   2  
ATOM 2735  C CD   . LYS A 1 72  ? -38.672 1.851   -1.175  1.00 0.00 ? 72  LYS A CD   2  
ATOM 2736  C CE   . LYS A 1 72  ? -40.142 1.495   -1.208  1.00 0.00 ? 72  LYS A CE   2  
ATOM 2737  N NZ   . LYS A 1 72  ? -40.857 2.057   -0.050  1.00 0.00 ? 72  LYS A NZ   2  
ATOM 2738  H H    . LYS A 1 72  ? -36.945 1.110   -4.952  1.00 0.00 ? 72  LYS A H    2  
ATOM 2739  H HA   . LYS A 1 72  ? -34.590 1.551   -3.327  1.00 0.00 ? 72  LYS A HA   2  
ATOM 2740  H HB2  . LYS A 1 72  ? -36.073 1.270   -1.331  1.00 0.00 ? 72  LYS A HB2  2  
ATOM 2741  H HB3  . LYS A 1 72  ? -36.372 2.715   -2.275  1.00 0.00 ? 72  LYS A HB3  2  
ATOM 2742  H HG2  . LYS A 1 72  ? -38.333 1.664   -3.265  1.00 0.00 ? 72  LYS A HG2  2  
ATOM 2743  H HG3  . LYS A 1 72  ? -38.017 0.193   -2.341  1.00 0.00 ? 72  LYS A HG3  2  
ATOM 2744  H HD2  . LYS A 1 72  ? -38.241 1.460   -0.266  1.00 0.00 ? 72  LYS A HD2  2  
ATOM 2745  H HD3  . LYS A 1 72  ? -38.566 2.927   -1.189  1.00 0.00 ? 72  LYS A HD3  2  
ATOM 2746  H HE2  . LYS A 1 72  ? -40.577 1.892   -2.114  1.00 0.00 ? 72  LYS A HE2  2  
ATOM 2747  H HE3  . LYS A 1 72  ? -40.248 0.420   -1.202  1.00 0.00 ? 72  LYS A HE3  2  
ATOM 2748  H HZ1  . LYS A 1 72  ? -40.769 3.093   -0.031  1.00 0.00 ? 72  LYS A HZ1  2  
ATOM 2749  H HZ2  . LYS A 1 72  ? -40.456 1.684   0.835   1.00 0.00 ? 72  LYS A HZ2  2  
ATOM 2750  H HZ3  . LYS A 1 72  ? -41.870 1.825   -0.083  1.00 0.00 ? 72  LYS A HZ3  2  
ATOM 2751  N N    . ASP A 1 73  ? -34.107 -0.733  -3.098  1.00 0.00 ? 73  ASP A N    2  
ATOM 2752  C CA   . ASP A 1 73  ? -33.659 -2.089  -2.964  1.00 0.00 ? 73  ASP A CA   2  
ATOM 2753  C C    . ASP A 1 73  ? -32.499 -2.050  -2.026  1.00 0.00 ? 73  ASP A C    2  
ATOM 2754  O O    . ASP A 1 73  ? -31.732 -1.091  -2.060  1.00 0.00 ? 73  ASP A O    2  
ATOM 2755  C CB   . ASP A 1 73  ? -33.227 -2.637  -4.339  1.00 0.00 ? 73  ASP A CB   2  
ATOM 2756  C CG   . ASP A 1 73  ? -32.674 -4.045  -4.293  1.00 0.00 ? 73  ASP A CG   2  
ATOM 2757  O OD1  . ASP A 1 73  ? -33.417 -4.978  -3.960  1.00 0.00 ? 73  ASP A OD1  2  
ATOM 2758  O OD2  . ASP A 1 73  ? -31.492 -4.246  -4.608  1.00 0.00 ? 73  ASP A OD2  2  
ATOM 2759  H H    . ASP A 1 73  ? -33.424 -0.031  -3.020  1.00 0.00 ? 73  ASP A H    2  
ATOM 2760  H HA   . ASP A 1 73  ? -34.454 -2.695  -2.556  1.00 0.00 ? 73  ASP A HA   2  
ATOM 2761  H HB2  . ASP A 1 73  ? -34.077 -2.636  -5.003  1.00 0.00 ? 73  ASP A HB2  2  
ATOM 2762  H HB3  . ASP A 1 73  ? -32.469 -1.985  -4.748  1.00 0.00 ? 73  ASP A HB3  2  
ATOM 2763  N N    . ARG A 1 74  ? -32.387 -3.000  -1.157  1.00 0.00 ? 74  ARG A N    2  
ATOM 2764  C CA   . ARG A 1 74  ? -31.287 -2.996  -0.239  1.00 0.00 ? 74  ARG A CA   2  
ATOM 2765  C C    . ARG A 1 74  ? -30.204 -3.882  -0.795  1.00 0.00 ? 74  ARG A C    2  
ATOM 2766  O O    . ARG A 1 74  ? -30.438 -5.054  -1.125  1.00 0.00 ? 74  ARG A O    2  
ATOM 2767  C CB   . ARG A 1 74  ? -31.718 -3.388  1.183   1.00 0.00 ? 74  ARG A CB   2  
ATOM 2768  C CG   . ARG A 1 74  ? -32.333 -4.767  1.318   1.00 0.00 ? 74  ARG A CG   2  
ATOM 2769  C CD   . ARG A 1 74  ? -32.739 -5.055  2.742   1.00 0.00 ? 74  ARG A CD   2  
ATOM 2770  N NE   . ARG A 1 74  ? -31.620 -4.932  3.675   1.00 0.00 ? 74  ARG A NE   2  
ATOM 2771  C CZ   . ARG A 1 74  ? -31.594 -5.432  4.909   1.00 0.00 ? 74  ARG A CZ   2  
ATOM 2772  N NH1  . ARG A 1 74  ? -32.607 -6.164  5.365   1.00 0.00 ? 74  ARG A NH1  2  
ATOM 2773  N NH2  . ARG A 1 74  ? -30.559 -5.195  5.681   1.00 0.00 ? 74  ARG A NH2  2  
ATOM 2774  H H    . ARG A 1 74  ? -33.021 -3.749  -1.150  1.00 0.00 ? 74  ARG A H    2  
ATOM 2775  H HA   . ARG A 1 74  ? -30.904 -1.985  -0.236  1.00 0.00 ? 74  ARG A HA   2  
ATOM 2776  H HB2  . ARG A 1 74  ? -30.854 -3.342  1.829   1.00 0.00 ? 74  ARG A HB2  2  
ATOM 2777  H HB3  . ARG A 1 74  ? -32.438 -2.662  1.531   1.00 0.00 ? 74  ARG A HB3  2  
ATOM 2778  H HG2  . ARG A 1 74  ? -33.218 -4.806  0.702   1.00 0.00 ? 74  ARG A HG2  2  
ATOM 2779  H HG3  . ARG A 1 74  ? -31.622 -5.512  0.990   1.00 0.00 ? 74  ARG A HG3  2  
ATOM 2780  H HD2  . ARG A 1 74  ? -33.523 -4.372  3.036   1.00 0.00 ? 74  ARG A HD2  2  
ATOM 2781  H HD3  . ARG A 1 74  ? -33.108 -6.068  2.782   1.00 0.00 ? 74  ARG A HD3  2  
ATOM 2782  H HE   . ARG A 1 74  ? -30.849 -4.418  3.340   1.00 0.00 ? 74  ARG A HE   2  
ATOM 2783  H HH11 . ARG A 1 74  ? -33.416 -6.366  4.807   1.00 0.00 ? 74  ARG A HH11 2  
ATOM 2784  H HH12 . ARG A 1 74  ? -32.617 -6.539  6.296   1.00 0.00 ? 74  ARG A HH12 2  
ATOM 2785  H HH21 . ARG A 1 74  ? -29.787 -4.637  5.363   1.00 0.00 ? 74  ARG A HH21 2  
ATOM 2786  H HH22 . ARG A 1 74  ? -30.488 -5.567  6.609   1.00 0.00 ? 74  ARG A HH22 2  
ATOM 2787  N N    . PHE A 1 75  ? -29.043 -3.346  -0.914  1.00 0.00 ? 75  PHE A N    2  
ATOM 2788  C CA   . PHE A 1 75  ? -27.991 -4.015  -1.601  1.00 0.00 ? 75  PHE A CA   2  
ATOM 2789  C C    . PHE A 1 75  ? -26.760 -4.046  -0.740  1.00 0.00 ? 75  PHE A C    2  
ATOM 2790  O O    . PHE A 1 75  ? -26.505 -3.124  0.045   1.00 0.00 ? 75  PHE A O    2  
ATOM 2791  C CB   . PHE A 1 75  ? -27.737 -3.276  -2.912  1.00 0.00 ? 75  PHE A CB   2  
ATOM 2792  C CG   . PHE A 1 75  ? -26.843 -3.958  -3.902  1.00 0.00 ? 75  PHE A CG   2  
ATOM 2793  C CD1  . PHE A 1 75  ? -27.311 -5.025  -4.642  1.00 0.00 ? 75  PHE A CD1  2  
ATOM 2794  C CD2  . PHE A 1 75  ? -25.554 -3.506  -4.126  1.00 0.00 ? 75  PHE A CD2  2  
ATOM 2795  C CE1  . PHE A 1 75  ? -26.515 -5.635  -5.584  1.00 0.00 ? 75  PHE A CE1  2  
ATOM 2796  C CE2  . PHE A 1 75  ? -24.748 -4.116  -5.066  1.00 0.00 ? 75  PHE A CE2  2  
ATOM 2797  C CZ   . PHE A 1 75  ? -25.231 -5.180  -5.796  1.00 0.00 ? 75  PHE A CZ   2  
ATOM 2798  H H    . PHE A 1 75  ? -28.853 -2.480  -0.483  1.00 0.00 ? 75  PHE A H    2  
ATOM 2799  H HA   . PHE A 1 75  ? -28.306 -5.021  -1.830  1.00 0.00 ? 75  PHE A HA   2  
ATOM 2800  H HB2  . PHE A 1 75  ? -28.693 -3.148  -3.396  1.00 0.00 ? 75  PHE A HB2  2  
ATOM 2801  H HB3  . PHE A 1 75  ? -27.322 -2.304  -2.686  1.00 0.00 ? 75  PHE A HB3  2  
ATOM 2802  H HD1  . PHE A 1 75  ? -28.315 -5.384  -4.476  1.00 0.00 ? 75  PHE A HD1  2  
ATOM 2803  H HD2  . PHE A 1 75  ? -25.177 -2.671  -3.553  1.00 0.00 ? 75  PHE A HD2  2  
ATOM 2804  H HE1  . PHE A 1 75  ? -26.896 -6.471  -6.152  1.00 0.00 ? 75  PHE A HE1  2  
ATOM 2805  H HE2  . PHE A 1 75  ? -23.742 -3.761  -5.234  1.00 0.00 ? 75  PHE A HE2  2  
ATOM 2806  H HZ   . PHE A 1 75  ? -24.605 -5.658  -6.536  1.00 0.00 ? 75  PHE A HZ   2  
ATOM 2807  N N    . SER A 1 76  ? -26.036 -5.102  -0.850  1.00 0.00 ? 76  SER A N    2  
ATOM 2808  C CA   . SER A 1 76  ? -24.843 -5.267  -0.124  1.00 0.00 ? 76  SER A CA   2  
ATOM 2809  C C    . SER A 1 76  ? -23.698 -5.349  -1.123  1.00 0.00 ? 76  SER A C    2  
ATOM 2810  O O    . SER A 1 76  ? -23.766 -6.101  -2.111  1.00 0.00 ? 76  SER A O    2  
ATOM 2811  C CB   . SER A 1 76  ? -24.948 -6.545  0.739   1.00 0.00 ? 76  SER A CB   2  
ATOM 2812  O OG   . SER A 1 76  ? -23.863 -6.680  1.651   1.00 0.00 ? 76  SER A OG   2  
ATOM 2813  H H    . SER A 1 76  ? -26.312 -5.822  -1.457  1.00 0.00 ? 76  SER A H    2  
ATOM 2814  H HA   . SER A 1 76  ? -24.707 -4.411  0.521   1.00 0.00 ? 76  SER A HA   2  
ATOM 2815  H HB2  . SER A 1 76  ? -25.867 -6.516  1.305   1.00 0.00 ? 76  SER A HB2  2  
ATOM 2816  H HB3  . SER A 1 76  ? -24.962 -7.406  0.087   1.00 0.00 ? 76  SER A HB3  2  
ATOM 2817  H HG   . SER A 1 76  ? -23.143 -7.110  1.170   1.00 0.00 ? 76  SER A HG   2  
ATOM 2818  N N    . VAL A 1 77  ? -22.680 -4.583  -0.894  1.00 0.00 ? 77  VAL A N    2  
ATOM 2819  C CA   . VAL A 1 77  ? -21.526 -4.571  -1.740  1.00 0.00 ? 77  VAL A CA   2  
ATOM 2820  C C    . VAL A 1 77  ? -20.409 -5.097  -0.894  1.00 0.00 ? 77  VAL A C    2  
ATOM 2821  O O    . VAL A 1 77  ? -20.228 -4.667  0.237   1.00 0.00 ? 77  VAL A O    2  
ATOM 2822  C CB   . VAL A 1 77  ? -21.131 -3.113  -2.217  1.00 0.00 ? 77  VAL A CB   2  
ATOM 2823  C CG1  . VAL A 1 77  ? -20.013 -3.157  -3.249  1.00 0.00 ? 77  VAL A CG1  2  
ATOM 2824  C CG2  . VAL A 1 77  ? -22.335 -2.350  -2.751  1.00 0.00 ? 77  VAL A CG2  2  
ATOM 2825  H H    . VAL A 1 77  ? -22.674 -3.999  -0.100  1.00 0.00 ? 77  VAL A H    2  
ATOM 2826  H HA   . VAL A 1 77  ? -21.691 -5.208  -2.595  1.00 0.00 ? 77  VAL A HA   2  
ATOM 2827  H HB   . VAL A 1 77  ? -20.737 -2.590  -1.360  1.00 0.00 ? 77  VAL A HB   2  
ATOM 2828  H HG11 . VAL A 1 77  ? -20.336 -3.732  -4.105  1.00 0.00 ? 77  VAL A HG11 2  
ATOM 2829  H HG12 . VAL A 1 77  ? -19.140 -3.619  -2.814  1.00 0.00 ? 77  VAL A HG12 2  
ATOM 2830  H HG13 . VAL A 1 77  ? -19.771 -2.151  -3.563  1.00 0.00 ? 77  VAL A HG13 2  
ATOM 2831  H HG21 . VAL A 1 77  ? -23.086 -2.276  -1.978  1.00 0.00 ? 77  VAL A HG21 2  
ATOM 2832  H HG22 . VAL A 1 77  ? -22.743 -2.878  -3.600  1.00 0.00 ? 77  VAL A HG22 2  
ATOM 2833  H HG23 . VAL A 1 77  ? -22.030 -1.360  -3.054  1.00 0.00 ? 77  VAL A HG23 2  
ATOM 2834  N N    . ASN A 1 78  ? -19.693 -6.010  -1.392  1.00 0.00 ? 78  ASN A N    2  
ATOM 2835  C CA   . ASN A 1 78  ? -18.609 -6.548  -0.652  1.00 0.00 ? 78  ASN A CA   2  
ATOM 2836  C C    . ASN A 1 78  ? -17.380 -6.114  -1.330  1.00 0.00 ? 78  ASN A C    2  
ATOM 2837  O O    . ASN A 1 78  ? -17.364 -5.982  -2.555  1.00 0.00 ? 78  ASN A O    2  
ATOM 2838  C CB   . ASN A 1 78  ? -18.687 -8.087  -0.578  1.00 0.00 ? 78  ASN A CB   2  
ATOM 2839  C CG   . ASN A 1 78  ? -17.545 -8.721  0.221   1.00 0.00 ? 78  ASN A CG   2  
ATOM 2840  O OD1  . ASN A 1 78  ? -17.632 -8.870  1.450   1.00 0.00 ? 78  ASN A OD1  2  
ATOM 2841  N ND2  . ASN A 1 78  ? -16.486 -9.116  -0.456  1.00 0.00 ? 78  ASN A ND2  2  
ATOM 2842  H H    . ASN A 1 78  ? -19.859 -6.341  -2.301  1.00 0.00 ? 78  ASN A H    2  
ATOM 2843  H HA   . ASN A 1 78  ? -18.638 -6.137  0.346   1.00 0.00 ? 78  ASN A HA   2  
ATOM 2844  H HB2  . ASN A 1 78  ? -19.619 -8.370  -0.114  1.00 0.00 ? 78  ASN A HB2  2  
ATOM 2845  H HB3  . ASN A 1 78  ? -18.659 -8.482  -1.584  1.00 0.00 ? 78  ASN A HB3  2  
ATOM 2846  H HD21 . ASN A 1 78  ? -16.470 -8.989  -1.432  1.00 0.00 ? 78  ASN A HD21 2  
ATOM 2847  H HD22 . ASN A 1 78  ? -15.736 -9.516  0.031   1.00 0.00 ? 78  ASN A HD22 2  
ATOM 2848  N N    . LEU A 1 79  ? -16.366 -5.898  -0.591  1.00 0.00 ? 79  LEU A N    2  
ATOM 2849  C CA   . LEU A 1 79  ? -15.162 -5.460  -1.147  1.00 0.00 ? 79  LEU A CA   2  
ATOM 2850  C C    . LEU A 1 79  ? -14.109 -6.484  -0.872  1.00 0.00 ? 79  LEU A C    2  
ATOM 2851  O O    . LEU A 1 79  ? -13.934 -6.952  0.288   1.00 0.00 ? 79  LEU A O    2  
ATOM 2852  C CB   . LEU A 1 79  ? -14.707 -4.078  -0.623  1.00 0.00 ? 79  LEU A CB   2  
ATOM 2853  C CG   . LEU A 1 79  ? -15.542 -2.848  -1.035  1.00 0.00 ? 79  LEU A CG   2  
ATOM 2854  C CD1  . LEU A 1 79  ? -16.884 -2.799  -0.332  1.00 0.00 ? 79  LEU A CD1  2  
ATOM 2855  C CD2  . LEU A 1 79  ? -14.765 -1.572  -0.796  1.00 0.00 ? 79  LEU A CD2  2  
ATOM 2856  H H    . LEU A 1 79  ? -16.402 -6.036  0.384   1.00 0.00 ? 79  LEU A H    2  
ATOM 2857  H HA   . LEU A 1 79  ? -15.304 -5.396  -2.215  1.00 0.00 ? 79  LEU A HA   2  
ATOM 2858  H HB2  . LEU A 1 79  ? -14.703 -4.124  0.456   1.00 0.00 ? 79  LEU A HB2  2  
ATOM 2859  H HB3  . LEU A 1 79  ? -13.692 -3.920  -0.952  1.00 0.00 ? 79  LEU A HB3  2  
ATOM 2860  H HG   . LEU A 1 79  ? -15.742 -2.917  -2.094  1.00 0.00 ? 79  LEU A HG   2  
ATOM 2861  H HD11 . LEU A 1 79  ? -17.429 -1.924  -0.655  1.00 0.00 ? 79  LEU A HD11 2  
ATOM 2862  H HD12 . LEU A 1 79  ? -16.731 -2.756  0.736   1.00 0.00 ? 79  LEU A HD12 2  
ATOM 2863  H HD13 . LEU A 1 79  ? -17.451 -3.685  -0.579  1.00 0.00 ? 79  LEU A HD13 2  
ATOM 2864  H HD21 . LEU A 1 79  ? -14.531 -1.496  0.256   1.00 0.00 ? 79  LEU A HD21 2  
ATOM 2865  H HD22 . LEU A 1 79  ? -15.362 -0.724  -1.094  1.00 0.00 ? 79  LEU A HD22 2  
ATOM 2866  H HD23 . LEU A 1 79  ? -13.851 -1.591  -1.370  1.00 0.00 ? 79  LEU A HD23 2  
ATOM 2867  N N    . ASP A 1 80  ? -13.445 -6.848  -1.939  1.00 0.00 ? 80  ASP A N    2  
ATOM 2868  C CA   . ASP A 1 80  ? -12.394 -7.843  -1.956  1.00 0.00 ? 80  ASP A CA   2  
ATOM 2869  C C    . ASP A 1 80  ? -11.197 -7.236  -1.343  1.00 0.00 ? 80  ASP A C    2  
ATOM 2870  O O    . ASP A 1 80  ? -10.761 -6.171  -1.764  1.00 0.00 ? 80  ASP A O    2  
ATOM 2871  C CB   . ASP A 1 80  ? -12.104 -8.246  -3.408  1.00 0.00 ? 80  ASP A CB   2  
ATOM 2872  C CG   . ASP A 1 80  ? -10.966 -9.236  -3.615  1.00 0.00 ? 80  ASP A CG   2  
ATOM 2873  O OD1  . ASP A 1 80  ? -10.344 -9.712  -2.641  1.00 0.00 ? 80  ASP A OD1  2  
ATOM 2874  O OD2  . ASP A 1 80  ? -10.679 -9.578  -4.781  1.00 0.00 ? 80  ASP A OD2  2  
ATOM 2875  H H    . ASP A 1 80  ? -13.661 -6.377  -2.782  1.00 0.00 ? 80  ASP A H    2  
ATOM 2876  H HA   . ASP A 1 80  ? -12.707 -8.711  -1.397  1.00 0.00 ? 80  ASP A HA   2  
ATOM 2877  H HB2  . ASP A 1 80  ? -12.998 -8.697  -3.811  1.00 0.00 ? 80  ASP A HB2  2  
ATOM 2878  H HB3  . ASP A 1 80  ? -11.890 -7.350  -3.972  1.00 0.00 ? 80  ASP A HB3  2  
ATOM 2879  N N    . VAL A 1 81  ? -10.676 -7.890  -0.345  1.00 0.00 ? 81  VAL A N    2  
ATOM 2880  C CA   . VAL A 1 81  ? -9.596  -7.378  0.431   1.00 0.00 ? 81  VAL A CA   2  
ATOM 2881  C C    . VAL A 1 81  ? -8.621  -8.504  0.719   1.00 0.00 ? 81  VAL A C    2  
ATOM 2882  O O    . VAL A 1 81  ? -9.037  -9.647  0.901   1.00 0.00 ? 81  VAL A O    2  
ATOM 2883  C CB   . VAL A 1 81  ? -10.109 -6.828  1.802   1.00 0.00 ? 81  VAL A CB   2  
ATOM 2884  C CG1  . VAL A 1 81  ? -9.004  -6.158  2.564   1.00 0.00 ? 81  VAL A CG1  2  
ATOM 2885  C CG2  . VAL A 1 81  ? -11.289 -5.877  1.660   1.00 0.00 ? 81  VAL A CG2  2  
ATOM 2886  H H    . VAL A 1 81  ? -11.006 -8.788  -0.132  1.00 0.00 ? 81  VAL A H    2  
ATOM 2887  H HA   . VAL A 1 81  ? -9.109  -6.576  -0.102  1.00 0.00 ? 81  VAL A HA   2  
ATOM 2888  H HB   . VAL A 1 81  ? -10.423 -7.679  2.386   1.00 0.00 ? 81  VAL A HB   2  
ATOM 2889  H HG11 . VAL A 1 81  ? -8.618  -5.332  1.986   1.00 0.00 ? 81  VAL A HG11 2  
ATOM 2890  H HG12 . VAL A 1 81  ? -8.211  -6.868  2.743   1.00 0.00 ? 81  VAL A HG12 2  
ATOM 2891  H HG13 . VAL A 1 81  ? -9.382  -5.790  3.507   1.00 0.00 ? 81  VAL A HG13 2  
ATOM 2892  H HG21 . VAL A 1 81  ? -11.603 -5.543  2.637   1.00 0.00 ? 81  VAL A HG21 2  
ATOM 2893  H HG22 . VAL A 1 81  ? -12.107 -6.387  1.173   1.00 0.00 ? 81  VAL A HG22 2  
ATOM 2894  H HG23 . VAL A 1 81  ? -10.992 -5.024  1.066   1.00 0.00 ? 81  VAL A HG23 2  
ATOM 2895  N N    . LYS A 1 82  ? -7.338  -8.196  0.711   1.00 0.00 ? 82  LYS A N    2  
ATOM 2896  C CA   . LYS A 1 82  ? -6.344  -9.147  1.141   1.00 0.00 ? 82  LYS A CA   2  
ATOM 2897  C C    . LYS A 1 82  ? -6.020  -8.771  2.593   1.00 0.00 ? 82  LYS A C    2  
ATOM 2898  O O    . LYS A 1 82  ? -6.574  -7.798  3.081   1.00 0.00 ? 82  LYS A O    2  
ATOM 2899  C CB   . LYS A 1 82  ? -5.113  -9.116  0.219   1.00 0.00 ? 82  LYS A CB   2  
ATOM 2900  C CG   . LYS A 1 82  ? -4.209  -10.350 0.305   1.00 0.00 ? 82  LYS A CG   2  
ATOM 2901  C CD   . LYS A 1 82  ? -5.026  -11.631 0.117   1.00 0.00 ? 82  LYS A CD   2  
ATOM 2902  C CE   . LYS A 1 82  ? -4.159  -12.877 0.032   1.00 0.00 ? 82  LYS A CE   2  
ATOM 2903  N NZ   . LYS A 1 82  ? -3.371  -12.914 -1.210  1.00 0.00 ? 82  LYS A NZ   2  
ATOM 2904  H H    . LYS A 1 82  ? -7.060  -7.296  0.448   1.00 0.00 ? 82  LYS A H    2  
ATOM 2905  H HA   . LYS A 1 82  ? -6.818  -10.118 1.133   1.00 0.00 ? 82  LYS A HA   2  
ATOM 2906  H HB2  . LYS A 1 82  ? -5.448  -9.017  -0.802  1.00 0.00 ? 82  LYS A HB2  2  
ATOM 2907  H HB3  . LYS A 1 82  ? -4.523  -8.247  0.472   1.00 0.00 ? 82  LYS A HB3  2  
ATOM 2908  H HG2  . LYS A 1 82  ? -3.463  -10.294 -0.476  1.00 0.00 ? 82  LYS A HG2  2  
ATOM 2909  H HG3  . LYS A 1 82  ? -3.719  -10.378 1.266   1.00 0.00 ? 82  LYS A HG3  2  
ATOM 2910  H HD2  . LYS A 1 82  ? -5.689  -11.748 0.960   1.00 0.00 ? 82  LYS A HD2  2  
ATOM 2911  H HD3  . LYS A 1 82  ? -5.610  -11.542 -0.786  1.00 0.00 ? 82  LYS A HD3  2  
ATOM 2912  H HE2  . LYS A 1 82  ? -3.478  -12.885 0.871   1.00 0.00 ? 82  LYS A HE2  2  
ATOM 2913  H HE3  . LYS A 1 82  ? -4.792  -13.751 0.079   1.00 0.00 ? 82  LYS A HE3  2  
ATOM 2914  H HZ1  . LYS A 1 82  ? -2.699  -12.126 -1.262  1.00 0.00 ? 82  LYS A HZ1  2  
ATOM 2915  H HZ2  . LYS A 1 82  ? -4.009  -12.879 -2.031  1.00 0.00 ? 82  LYS A HZ2  2  
ATOM 2916  H HZ3  . LYS A 1 82  ? -2.828  -13.801 -1.264  1.00 0.00 ? 82  LYS A HZ3  2  
ATOM 2917  N N    . HIS A 1 83  ? -5.106  -9.421  3.255   1.00 0.00 ? 83  HIS A N    2  
ATOM 2918  C CA   . HIS A 1 83  ? -5.026  -9.207  4.687   1.00 0.00 ? 83  HIS A CA   2  
ATOM 2919  C C    . HIS A 1 83  ? -4.347  -7.903  5.065   1.00 0.00 ? 83  HIS A C    2  
ATOM 2920  O O    . HIS A 1 83  ? -3.198  -7.614  4.677   1.00 0.00 ? 83  HIS A O    2  
ATOM 2921  C CB   . HIS A 1 83  ? -4.328  -10.371 5.385   1.00 0.00 ? 83  HIS A CB   2  
ATOM 2922  C CG   . HIS A 1 83  ? -4.523  -10.404 6.880   1.00 0.00 ? 83  HIS A CG   2  
ATOM 2923  N ND1  . HIS A 1 83  ? -5.333  -11.311 7.485   1.00 0.00 ? 83  HIS A ND1  2  
ATOM 2924  C CD2  . HIS A 1 83  ? -4.009  -9.649  7.875   1.00 0.00 ? 83  HIS A CD2  2  
ATOM 2925  C CE1  . HIS A 1 83  ? -5.322  -11.128 8.778   1.00 0.00 ? 83  HIS A CE1  2  
ATOM 2926  N NE2  . HIS A 1 83  ? -4.524  -10.123 9.044   1.00 0.00 ? 83  HIS A NE2  2  
ATOM 2927  H H    . HIS A 1 83  ? -4.507  -10.057 2.817   1.00 0.00 ? 83  HIS A H    2  
ATOM 2928  H HA   . HIS A 1 83  ? -6.041  -9.170  5.054   1.00 0.00 ? 83  HIS A HA   2  
ATOM 2929  H HB2  . HIS A 1 83  ? -4.725  -11.296 4.995   1.00 0.00 ? 83  HIS A HB2  2  
ATOM 2930  H HB3  . HIS A 1 83  ? -3.269  -10.325 5.182   1.00 0.00 ? 83  HIS A HB3  2  
ATOM 2931  H HD1  . HIS A 1 83  ? -5.851  -11.985 6.974   1.00 0.00 ? 83  HIS A HD1  2  
ATOM 2932  H HD2  . HIS A 1 83  ? -3.321  -8.823  7.765   1.00 0.00 ? 83  HIS A HD2  2  
ATOM 2933  H HE1  . HIS A 1 83  ? -5.875  -11.706 9.502   1.00 0.00 ? 83  HIS A HE1  2  
ATOM 2934  H HE2  . HIS A 1 83  ? -4.521  -9.613  9.885   1.00 0.00 ? 83  HIS A HE2  2  
ATOM 2935  N N    . PHE A 1 84  ? -5.070  -7.141  5.839   1.00 0.00 ? 84  PHE A N    2  
ATOM 2936  C CA   . PHE A 1 84  ? -4.590  -5.950  6.447   1.00 0.00 ? 84  PHE A CA   2  
ATOM 2937  C C    . PHE A 1 84  ? -4.974  -5.950  7.908   1.00 0.00 ? 84  PHE A C    2  
ATOM 2938  O O    . PHE A 1 84  ? -5.675  -6.861  8.349   1.00 0.00 ? 84  PHE A O    2  
ATOM 2939  C CB   . PHE A 1 84  ? -4.981  -4.632  5.714   1.00 0.00 ? 84  PHE A CB   2  
ATOM 2940  C CG   . PHE A 1 84  ? -6.448  -4.341  5.454   1.00 0.00 ? 84  PHE A CG   2  
ATOM 2941  C CD1  . PHE A 1 84  ? -7.453  -4.791  6.287   1.00 0.00 ? 84  PHE A CD1  2  
ATOM 2942  C CD2  . PHE A 1 84  ? -6.798  -3.557  4.369   1.00 0.00 ? 84  PHE A CD2  2  
ATOM 2943  C CE1  . PHE A 1 84  ? -8.766  -4.470  6.037   1.00 0.00 ? 84  PHE A CE1  2  
ATOM 2944  C CE2  . PHE A 1 84  ? -8.110  -3.235  4.114   1.00 0.00 ? 84  PHE A CE2  2  
ATOM 2945  C CZ   . PHE A 1 84  ? -9.097  -3.691  4.951   1.00 0.00 ? 84  PHE A CZ   2  
ATOM 2946  H H    . PHE A 1 84  ? -5.997  -7.411  6.027   1.00 0.00 ? 84  PHE A H    2  
ATOM 2947  H HA   . PHE A 1 84  ? -3.520  -6.083  6.393   1.00 0.00 ? 84  PHE A HA   2  
ATOM 2948  H HB2  . PHE A 1 84  ? -4.607  -3.799  6.292   1.00 0.00 ? 84  PHE A HB2  2  
ATOM 2949  H HB3  . PHE A 1 84  ? -4.469  -4.626  4.763   1.00 0.00 ? 84  PHE A HB3  2  
ATOM 2950  H HD1  . PHE A 1 84  ? -7.198  -5.404  7.139   1.00 0.00 ? 84  PHE A HD1  2  
ATOM 2951  H HD2  . PHE A 1 84  ? -6.020  -3.199  3.712   1.00 0.00 ? 84  PHE A HD2  2  
ATOM 2952  H HE1  . PHE A 1 84  ? -9.542  -4.831  6.697   1.00 0.00 ? 84  PHE A HE1  2  
ATOM 2953  H HE2  . PHE A 1 84  ? -8.362  -2.624  3.260   1.00 0.00 ? 84  PHE A HE2  2  
ATOM 2954  H HZ   . PHE A 1 84  ? -10.130 -3.440  4.757   1.00 0.00 ? 84  PHE A HZ   2  
ATOM 2955  N N    . SER A 1 85  ? -4.484  -5.004  8.650   1.00 0.00 ? 85  SER A N    2  
ATOM 2956  C CA   . SER A 1 85  ? -4.756  -4.932  10.056  1.00 0.00 ? 85  SER A CA   2  
ATOM 2957  C C    . SER A 1 85  ? -6.167  -4.369  10.289  1.00 0.00 ? 85  SER A C    2  
ATOM 2958  O O    . SER A 1 85  ? -6.446  -3.233  9.902   1.00 0.00 ? 85  SER A O    2  
ATOM 2959  C CB   . SER A 1 85  ? -3.731  -4.022  10.681  1.00 0.00 ? 85  SER A CB   2  
ATOM 2960  O OG   . SER A 1 85  ? -2.420  -4.418  10.304  1.00 0.00 ? 85  SER A OG   2  
ATOM 2961  H H    . SER A 1 85  ? -3.935  -4.283  8.276   1.00 0.00 ? 85  SER A H    2  
ATOM 2962  H HA   . SER A 1 85  ? -4.662  -5.917  10.487  1.00 0.00 ? 85  SER A HA   2  
ATOM 2963  H HB2  . SER A 1 85  ? -3.903  -3.015  10.334  1.00 0.00 ? 85  SER A HB2  2  
ATOM 2964  H HB3  . SER A 1 85  ? -3.807  -4.050  11.757  1.00 0.00 ? 85  SER A HB3  2  
ATOM 2965  H HG   . SER A 1 85  ? -1.849  -3.656  10.470  1.00 0.00 ? 85  SER A HG   2  
ATOM 2966  N N    . PRO A 1 86  ? -7.079  -5.172  10.917  1.00 0.00 ? 86  PRO A N    2  
ATOM 2967  C CA   . PRO A 1 86  ? -8.471  -4.773  11.205  1.00 0.00 ? 86  PRO A CA   2  
ATOM 2968  C C    . PRO A 1 86  ? -8.599  -3.448  11.962  1.00 0.00 ? 86  PRO A C    2  
ATOM 2969  O O    . PRO A 1 86  ? -9.622  -2.769  11.868  1.00 0.00 ? 86  PRO A O    2  
ATOM 2970  C CB   . PRO A 1 86  ? -8.996  -5.917  12.067  1.00 0.00 ? 86  PRO A CB   2  
ATOM 2971  C CG   . PRO A 1 86  ? -8.228  -7.086  11.603  1.00 0.00 ? 86  PRO A CG   2  
ATOM 2972  C CD   . PRO A 1 86  ? -6.842  -6.572  11.359  1.00 0.00 ? 86  PRO A CD   2  
ATOM 2973  H HA   . PRO A 1 86  ? -9.054  -4.719  10.297  1.00 0.00 ? 86  PRO A HA   2  
ATOM 2974  H HB2  . PRO A 1 86  ? -8.798  -5.696  13.105  1.00 0.00 ? 86  PRO A HB2  2  
ATOM 2975  H HB3  . PRO A 1 86  ? -10.056 -6.049  11.914  1.00 0.00 ? 86  PRO A HB3  2  
ATOM 2976  H HG2  . PRO A 1 86  ? -8.234  -7.852  12.363  1.00 0.00 ? 86  PRO A HG2  2  
ATOM 2977  H HG3  . PRO A 1 86  ? -8.653  -7.466  10.685  1.00 0.00 ? 86  PRO A HG3  2  
ATOM 2978  H HD2  . PRO A 1 86  ? -6.259  -6.603  12.268  1.00 0.00 ? 86  PRO A HD2  2  
ATOM 2979  H HD3  . PRO A 1 86  ? -6.363  -7.144  10.578  1.00 0.00 ? 86  PRO A HD3  2  
ATOM 2980  N N    . GLU A 1 87  ? -7.603  -3.101  12.738  1.00 0.00 ? 87  GLU A N    2  
ATOM 2981  C CA   . GLU A 1 87  ? -7.641  -1.853  13.473  1.00 0.00 ? 87  GLU A CA   2  
ATOM 2982  C C    . GLU A 1 87  ? -7.099  -0.698  12.635  1.00 0.00 ? 87  GLU A C    2  
ATOM 2983  O O    . GLU A 1 87  ? -7.625  0.418   12.686  1.00 0.00 ? 87  GLU A O    2  
ATOM 2984  C CB   . GLU A 1 87  ? -6.855  -1.961  14.770  1.00 0.00 ? 87  GLU A CB   2  
ATOM 2985  C CG   . GLU A 1 87  ? -7.388  -2.989  15.748  1.00 0.00 ? 87  GLU A CG   2  
ATOM 2986  C CD   . GLU A 1 87  ? -8.791  -2.683  16.186  1.00 0.00 ? 87  GLU A CD   2  
ATOM 2987  O OE1  . GLU A 1 87  ? -8.986  -1.713  16.938  1.00 0.00 ? 87  GLU A OE1  2  
ATOM 2988  O OE2  . GLU A 1 87  ? -9.726  -3.399  15.771  1.00 0.00 ? 87  GLU A OE2  2  
ATOM 2989  H H    . GLU A 1 87  ? -6.831  -3.704  12.816  1.00 0.00 ? 87  GLU A H    2  
ATOM 2990  H HA   . GLU A 1 87  ? -8.674  -1.650  13.714  1.00 0.00 ? 87  GLU A HA   2  
ATOM 2991  H HB2  . GLU A 1 87  ? -5.843  -2.231  14.515  1.00 0.00 ? 87  GLU A HB2  2  
ATOM 2992  H HB3  . GLU A 1 87  ? -6.845  -0.998  15.257  1.00 0.00 ? 87  GLU A HB3  2  
ATOM 2993  H HG2  . GLU A 1 87  ? -7.384  -3.955  15.268  1.00 0.00 ? 87  GLU A HG2  2  
ATOM 2994  H HG3  . GLU A 1 87  ? -6.748  -3.015  16.617  1.00 0.00 ? 87  GLU A HG3  2  
ATOM 2995  N N    . GLU A 1 88  ? -6.104  -0.976  11.820  1.00 0.00 ? 88  GLU A N    2  
ATOM 2996  C CA   . GLU A 1 88  ? -5.431  0.068   11.060  1.00 0.00 ? 88  GLU A CA   2  
ATOM 2997  C C    . GLU A 1 88  ? -6.089  0.248   9.698   1.00 0.00 ? 88  GLU A C    2  
ATOM 2998  O O    . GLU A 1 88  ? -5.440  0.117   8.644   1.00 0.00 ? 88  GLU A O    2  
ATOM 2999  C CB   . GLU A 1 88  ? -3.941  -0.248  10.874  1.00 0.00 ? 88  GLU A CB   2  
ATOM 3000  C CG   . GLU A 1 88  ? -3.195  -0.597  12.150  1.00 0.00 ? 88  GLU A CG   2  
ATOM 3001  C CD   . GLU A 1 88  ? -3.317  0.454   13.218  1.00 0.00 ? 88  GLU A CD   2  
ATOM 3002  O OE1  . GLU A 1 88  ? -2.657  1.509   13.118  1.00 0.00 ? 88  GLU A OE1  2  
ATOM 3003  O OE2  . GLU A 1 88  ? -4.049  0.229   14.201  1.00 0.00 ? 88  GLU A OE2  2  
ATOM 3004  H H    . GLU A 1 88  ? -5.836  -1.908  11.687  1.00 0.00 ? 88  GLU A H    2  
ATOM 3005  H HA   . GLU A 1 88  ? -5.525  0.986   11.621  1.00 0.00 ? 88  GLU A HA   2  
ATOM 3006  H HB2  . GLU A 1 88  ? -3.837  -1.062  10.174  1.00 0.00 ? 88  GLU A HB2  2  
ATOM 3007  H HB3  . GLU A 1 88  ? -3.471  0.624   10.443  1.00 0.00 ? 88  GLU A HB3  2  
ATOM 3008  H HG2  . GLU A 1 88  ? -3.594  -1.524  12.537  1.00 0.00 ? 88  GLU A HG2  2  
ATOM 3009  H HG3  . GLU A 1 88  ? -2.149  -0.733  11.912  1.00 0.00 ? 88  GLU A HG3  2  
ATOM 3010  N N    . LEU A 1 89  ? -7.347  0.562   9.704   1.00 0.00 ? 89  LEU A N    2  
ATOM 3011  C CA   . LEU A 1 89  ? -8.068  0.730   8.484   1.00 0.00 ? 89  LEU A CA   2  
ATOM 3012  C C    . LEU A 1 89  ? -9.068  1.845   8.594   1.00 0.00 ? 89  LEU A C    2  
ATOM 3013  O O    . LEU A 1 89  ? -9.420  2.283   9.700   1.00 0.00 ? 89  LEU A O    2  
ATOM 3014  C CB   . LEU A 1 89  ? -8.714  -0.604  8.024   1.00 0.00 ? 89  LEU A CB   2  
ATOM 3015  C CG   . LEU A 1 89  ? -9.698  -1.304  8.987   1.00 0.00 ? 89  LEU A CG   2  
ATOM 3016  C CD1  . LEU A 1 89  ? -11.067 -0.639  9.011   1.00 0.00 ? 89  LEU A CD1  2  
ATOM 3017  C CD2  . LEU A 1 89  ? -9.829  -2.756  8.631   1.00 0.00 ? 89  LEU A CD2  2  
ATOM 3018  H H    . LEU A 1 89  ? -7.809  0.709   10.557  1.00 0.00 ? 89  LEU A H    2  
ATOM 3019  H HA   . LEU A 1 89  ? -7.344  1.025   7.740   1.00 0.00 ? 89  LEU A HA   2  
ATOM 3020  H HB2  . LEU A 1 89  ? -9.243  -0.411  7.103   1.00 0.00 ? 89  LEU A HB2  2  
ATOM 3021  H HB3  . LEU A 1 89  ? -7.913  -1.294  7.806   1.00 0.00 ? 89  LEU A HB3  2  
ATOM 3022  H HG   . LEU A 1 89  ? -9.297  -1.245  9.987   1.00 0.00 ? 89  LEU A HG   2  
ATOM 3023  H HD11 . LEU A 1 89  ? -11.715 -1.181  9.683   1.00 0.00 ? 89  LEU A HD11 2  
ATOM 3024  H HD12 . LEU A 1 89  ? -11.489 -0.647  8.017   1.00 0.00 ? 89  LEU A HD12 2  
ATOM 3025  H HD13 . LEU A 1 89  ? -10.966 0.380   9.353   1.00 0.00 ? 89  LEU A HD13 2  
ATOM 3026  H HD21 . LEU A 1 89  ? -10.210 -2.847  7.625   1.00 0.00 ? 89  LEU A HD21 2  
ATOM 3027  H HD22 . LEU A 1 89  ? -10.514 -3.234  9.316   1.00 0.00 ? 89  LEU A HD22 2  
ATOM 3028  H HD23 . LEU A 1 89  ? -8.861  -3.232  8.693   1.00 0.00 ? 89  LEU A HD23 2  
ATOM 3029  N N    . LYS A 1 90  ? -9.474  2.327   7.477   1.00 0.00 ? 90  LYS A N    2  
ATOM 3030  C CA   . LYS A 1 90  ? -10.468 3.320   7.388   1.00 0.00 ? 90  LYS A CA   2  
ATOM 3031  C C    . LYS A 1 90  ? -11.425 2.941   6.292   1.00 0.00 ? 90  LYS A C    2  
ATOM 3032  O O    . LYS A 1 90  ? -11.015 2.701   5.148   1.00 0.00 ? 90  LYS A O    2  
ATOM 3033  C CB   . LYS A 1 90  ? -9.832  4.683   7.078   1.00 0.00 ? 90  LYS A CB   2  
ATOM 3034  C CG   . LYS A 1 90  ? -10.822 5.826   6.895   1.00 0.00 ? 90  LYS A CG   2  
ATOM 3035  C CD   . LYS A 1 90  ? -11.669 6.047   8.134   1.00 0.00 ? 90  LYS A CD   2  
ATOM 3036  C CE   . LYS A 1 90  ? -12.652 7.182   7.934   1.00 0.00 ? 90  LYS A CE   2  
ATOM 3037  N NZ   . LYS A 1 90  ? -11.977 8.472   7.681   1.00 0.00 ? 90  LYS A NZ   2  
ATOM 3038  H H    . LYS A 1 90  ? -9.076  1.999   6.637   1.00 0.00 ? 90  LYS A H    2  
ATOM 3039  H HA   . LYS A 1 90  ? -10.983 3.384   8.334   1.00 0.00 ? 90  LYS A HA   2  
ATOM 3040  H HB2  . LYS A 1 90  ? -9.167  4.951   7.884   1.00 0.00 ? 90  LYS A HB2  2  
ATOM 3041  H HB3  . LYS A 1 90  ? -9.254  4.591   6.171   1.00 0.00 ? 90  LYS A HB3  2  
ATOM 3042  H HG2  . LYS A 1 90  ? -10.270 6.731   6.695   1.00 0.00 ? 90  LYS A HG2  2  
ATOM 3043  H HG3  . LYS A 1 90  ? -11.468 5.602   6.058   1.00 0.00 ? 90  LYS A HG3  2  
ATOM 3044  H HD2  . LYS A 1 90  ? -12.223 5.143   8.343   1.00 0.00 ? 90  LYS A HD2  2  
ATOM 3045  H HD3  . LYS A 1 90  ? -11.023 6.278   8.967   1.00 0.00 ? 90  LYS A HD3  2  
ATOM 3046  H HE2  . LYS A 1 90  ? -13.290 6.945   7.095   1.00 0.00 ? 90  LYS A HE2  2  
ATOM 3047  H HE3  . LYS A 1 90  ? -13.250 7.262   8.829   1.00 0.00 ? 90  LYS A HE3  2  
ATOM 3048  H HZ1  . LYS A 1 90  ? -12.671 9.231   7.533   1.00 0.00 ? 90  LYS A HZ1  2  
ATOM 3049  H HZ2  . LYS A 1 90  ? -11.396 8.419   6.820   1.00 0.00 ? 90  LYS A HZ2  2  
ATOM 3050  H HZ3  . LYS A 1 90  ? -11.362 8.752   8.468   1.00 0.00 ? 90  LYS A HZ3  2  
ATOM 3051  N N    . VAL A 1 91  ? -12.665 2.868   6.632   1.00 0.00 ? 91  VAL A N    2  
ATOM 3052  C CA   . VAL A 1 91  ? -13.690 2.651   5.666   1.00 0.00 ? 91  VAL A CA   2  
ATOM 3053  C C    . VAL A 1 91  ? -14.402 3.971   5.463   1.00 0.00 ? 91  VAL A C    2  
ATOM 3054  O O    . VAL A 1 91  ? -14.864 4.600   6.425   1.00 0.00 ? 91  VAL A O    2  
ATOM 3055  C CB   . VAL A 1 91  ? -14.667 1.490   6.065   1.00 0.00 ? 91  VAL A CB   2  
ATOM 3056  C CG1  . VAL A 1 91  ? -15.274 1.691   7.452   1.00 0.00 ? 91  VAL A CG1  2  
ATOM 3057  C CG2  . VAL A 1 91  ? -15.762 1.316   5.017   1.00 0.00 ? 91  VAL A CG2  2  
ATOM 3058  H H    . VAL A 1 91  ? -12.918 2.972   7.575   1.00 0.00 ? 91  VAL A H    2  
ATOM 3059  H HA   . VAL A 1 91  ? -13.191 2.404   4.739   1.00 0.00 ? 91  VAL A HA   2  
ATOM 3060  H HB   . VAL A 1 91  ? -14.090 0.578   6.097   1.00 0.00 ? 91  VAL A HB   2  
ATOM 3061  H HG11 . VAL A 1 91  ? -15.948 0.876   7.673   1.00 0.00 ? 91  VAL A HG11 2  
ATOM 3062  H HG12 . VAL A 1 91  ? -15.812 2.626   7.478   1.00 0.00 ? 91  VAL A HG12 2  
ATOM 3063  H HG13 . VAL A 1 91  ? -14.484 1.712   8.187   1.00 0.00 ? 91  VAL A HG13 2  
ATOM 3064  H HG21 . VAL A 1 91  ? -16.431 0.524   5.321   1.00 0.00 ? 91  VAL A HG21 2  
ATOM 3065  H HG22 . VAL A 1 91  ? -15.319 1.069   4.063   1.00 0.00 ? 91  VAL A HG22 2  
ATOM 3066  H HG23 . VAL A 1 91  ? -16.319 2.237   4.926   1.00 0.00 ? 91  VAL A HG23 2  
ATOM 3067  N N    . LYS A 1 92  ? -14.430 4.427   4.253   1.00 0.00 ? 92  LYS A N    2  
ATOM 3068  C CA   . LYS A 1 92  ? -14.974 5.715   3.958   1.00 0.00 ? 92  LYS A CA   2  
ATOM 3069  C C    . LYS A 1 92  ? -15.989 5.657   2.838   1.00 0.00 ? 92  LYS A C    2  
ATOM 3070  O O    . LYS A 1 92  ? -15.768 5.026   1.803   1.00 0.00 ? 92  LYS A O    2  
ATOM 3071  C CB   . LYS A 1 92  ? -13.849 6.704   3.611   1.00 0.00 ? 92  LYS A CB   2  
ATOM 3072  C CG   . LYS A 1 92  ? -12.854 6.168   2.583   1.00 0.00 ? 92  LYS A CG   2  
ATOM 3073  C CD   . LYS A 1 92  ? -11.965 7.251   1.994   1.00 0.00 ? 92  LYS A CD   2  
ATOM 3074  C CE   . LYS A 1 92  ? -12.785 8.252   1.194   1.00 0.00 ? 92  LYS A CE   2  
ATOM 3075  N NZ   . LYS A 1 92  ? -11.939 9.204   0.462   1.00 0.00 ? 92  LYS A NZ   2  
ATOM 3076  H H    . LYS A 1 92  ? -14.093 3.886   3.501   1.00 0.00 ? 92  LYS A H    2  
ATOM 3077  H HA   . LYS A 1 92  ? -15.464 6.076   4.849   1.00 0.00 ? 92  LYS A HA   2  
ATOM 3078  H HB2  . LYS A 1 92  ? -14.297 7.606   3.222   1.00 0.00 ? 92  LYS A HB2  2  
ATOM 3079  H HB3  . LYS A 1 92  ? -13.309 6.945   4.515   1.00 0.00 ? 92  LYS A HB3  2  
ATOM 3080  H HG2  . LYS A 1 92  ? -12.229 5.428   3.062   1.00 0.00 ? 92  LYS A HG2  2  
ATOM 3081  H HG3  . LYS A 1 92  ? -13.420 5.697   1.793   1.00 0.00 ? 92  LYS A HG3  2  
ATOM 3082  H HD2  . LYS A 1 92  ? -11.465 7.768   2.798   1.00 0.00 ? 92  LYS A HD2  2  
ATOM 3083  H HD3  . LYS A 1 92  ? -11.234 6.794   1.345   1.00 0.00 ? 92  LYS A HD3  2  
ATOM 3084  H HE2  . LYS A 1 92  ? -13.393 7.714   0.482   1.00 0.00 ? 92  LYS A HE2  2  
ATOM 3085  H HE3  . LYS A 1 92  ? -13.430 8.799   1.864   1.00 0.00 ? 92  LYS A HE3  2  
ATOM 3086  H HZ1  . LYS A 1 92  ? -12.538 9.866   -0.071  1.00 0.00 ? 92  LYS A HZ1  2  
ATOM 3087  H HZ2  . LYS A 1 92  ? -11.349 8.689   -0.225  1.00 0.00 ? 92  LYS A HZ2  2  
ATOM 3088  H HZ3  . LYS A 1 92  ? -11.323 9.751   1.094   1.00 0.00 ? 92  LYS A HZ3  2  
ATOM 3089  N N    . VAL A 1 93  ? -17.092 6.295   3.056   1.00 0.00 ? 93  VAL A N    2  
ATOM 3090  C CA   . VAL A 1 93  ? -18.109 6.417   2.063   1.00 0.00 ? 93  VAL A CA   2  
ATOM 3091  C C    . VAL A 1 93  ? -18.441 7.892   1.902   1.00 0.00 ? 93  VAL A C    2  
ATOM 3092  O O    . VAL A 1 93  ? -18.772 8.587   2.871   1.00 0.00 ? 93  VAL A O    2  
ATOM 3093  C CB   . VAL A 1 93  ? -19.381 5.547   2.383   1.00 0.00 ? 93  VAL A CB   2  
ATOM 3094  C CG1  . VAL A 1 93  ? -19.953 5.840   3.769   1.00 0.00 ? 93  VAL A CG1  2  
ATOM 3095  C CG2  . VAL A 1 93  ? -20.452 5.728   1.315   1.00 0.00 ? 93  VAL A CG2  2  
ATOM 3096  H H    . VAL A 1 93  ? -17.246 6.722   3.926   1.00 0.00 ? 93  VAL A H    2  
ATOM 3097  H HA   . VAL A 1 93  ? -17.670 6.082   1.134   1.00 0.00 ? 93  VAL A HA   2  
ATOM 3098  H HB   . VAL A 1 93  ? -19.074 4.511   2.374   1.00 0.00 ? 93  VAL A HB   2  
ATOM 3099  H HG11 . VAL A 1 93  ? -20.829 5.231   3.933   1.00 0.00 ? 93  VAL A HG11 2  
ATOM 3100  H HG12 . VAL A 1 93  ? -20.221 6.884   3.835   1.00 0.00 ? 93  VAL A HG12 2  
ATOM 3101  H HG13 . VAL A 1 93  ? -19.210 5.611   4.518   1.00 0.00 ? 93  VAL A HG13 2  
ATOM 3102  H HG21 . VAL A 1 93  ? -20.757 6.764   1.294   1.00 0.00 ? 93  VAL A HG21 2  
ATOM 3103  H HG22 . VAL A 1 93  ? -21.306 5.109   1.545   1.00 0.00 ? 93  VAL A HG22 2  
ATOM 3104  H HG23 . VAL A 1 93  ? -20.055 5.458   0.347   1.00 0.00 ? 93  VAL A HG23 2  
ATOM 3105  N N    . LEU A 1 94  ? -18.296 8.384   0.720   1.00 0.00 ? 94  LEU A N    2  
ATOM 3106  C CA   . LEU A 1 94  ? -18.512 9.773   0.465   1.00 0.00 ? 94  LEU A CA   2  
ATOM 3107  C C    . LEU A 1 94  ? -19.412 9.918   -0.731  1.00 0.00 ? 94  LEU A C    2  
ATOM 3108  O O    . LEU A 1 94  ? -18.949 9.932   -1.877  1.00 0.00 ? 94  LEU A O    2  
ATOM 3109  C CB   . LEU A 1 94  ? -17.167 10.491  0.237   1.00 0.00 ? 94  LEU A CB   2  
ATOM 3110  C CG   . LEU A 1 94  ? -17.227 12.014  0.038   1.00 0.00 ? 94  LEU A CG   2  
ATOM 3111  C CD1  . LEU A 1 94  ? -17.825 12.700  1.258   1.00 0.00 ? 94  LEU A CD1  2  
ATOM 3112  C CD2  . LEU A 1 94  ? -15.842 12.567  -0.254  1.00 0.00 ? 94  LEU A CD2  2  
ATOM 3113  H H    . LEU A 1 94  ? -18.063 7.782   -0.026  1.00 0.00 ? 94  LEU A H    2  
ATOM 3114  H HA   . LEU A 1 94  ? -18.996 10.201  1.330   1.00 0.00 ? 94  LEU A HA   2  
ATOM 3115  H HB2  . LEU A 1 94  ? -16.528 10.289  1.083   1.00 0.00 ? 94  LEU A HB2  2  
ATOM 3116  H HB3  . LEU A 1 94  ? -16.709 10.059  -0.641  1.00 0.00 ? 94  LEU A HB3  2  
ATOM 3117  H HG   . LEU A 1 94  ? -17.863 12.232  -0.808  1.00 0.00 ? 94  LEU A HG   2  
ATOM 3118  H HD11 . LEU A 1 94  ? -17.833 13.768  1.098   1.00 0.00 ? 94  LEU A HD11 2  
ATOM 3119  H HD12 . LEU A 1 94  ? -17.231 12.470  2.131   1.00 0.00 ? 94  LEU A HD12 2  
ATOM 3120  H HD13 . LEU A 1 94  ? -18.837 12.354  1.409   1.00 0.00 ? 94  LEU A HD13 2  
ATOM 3121  H HD21 . LEU A 1 94  ? -15.458 12.120  -1.158  1.00 0.00 ? 94  LEU A HD21 2  
ATOM 3122  H HD22 . LEU A 1 94  ? -15.182 12.338  0.571   1.00 0.00 ? 94  LEU A HD22 2  
ATOM 3123  H HD23 . LEU A 1 94  ? -15.902 13.639  -0.378  1.00 0.00 ? 94  LEU A HD23 2  
ATOM 3124  N N    . GLY A 1 95  ? -20.695 9.991   -0.471  1.00 0.00 ? 95  GLY A N    2  
ATOM 3125  C CA   . GLY A 1 95  ? -21.646 10.148  -1.533  1.00 0.00 ? 95  GLY A CA   2  
ATOM 3126  C C    . GLY A 1 95  ? -21.761 8.899   -2.369  1.00 0.00 ? 95  GLY A C    2  
ATOM 3127  O O    . GLY A 1 95  ? -22.233 7.862   -1.913  1.00 0.00 ? 95  GLY A O    2  
ATOM 3128  H H    . GLY A 1 95  ? -20.998 9.920   0.457   1.00 0.00 ? 95  GLY A H    2  
ATOM 3129  H HA2  . GLY A 1 95  ? -22.611 10.410  -1.125  1.00 0.00 ? 95  GLY A HA2  2  
ATOM 3130  H HA3  . GLY A 1 95  ? -21.314 10.955  -2.170  1.00 0.00 ? 95  GLY A HA3  2  
ATOM 3131  N N    . ASP A 1 96  ? -21.317 9.011   -3.573  1.00 0.00 ? 96  ASP A N    2  
ATOM 3132  C CA   . ASP A 1 96  ? -21.345 7.953   -4.565  1.00 0.00 ? 96  ASP A CA   2  
ATOM 3133  C C    . ASP A 1 96  ? -20.048 7.170   -4.559  1.00 0.00 ? 96  ASP A C    2  
ATOM 3134  O O    . ASP A 1 96  ? -19.874 6.232   -5.326  1.00 0.00 ? 96  ASP A O    2  
ATOM 3135  C CB   . ASP A 1 96  ? -21.556 8.579   -5.951  1.00 0.00 ? 96  ASP A CB   2  
ATOM 3136  C CG   . ASP A 1 96  ? -20.473 9.594   -6.334  1.00 0.00 ? 96  ASP A CG   2  
ATOM 3137  O OD1  . ASP A 1 96  ? -20.131 10.472  -5.510  1.00 0.00 ? 96  ASP A OD1  2  
ATOM 3138  O OD2  . ASP A 1 96  ? -19.982 9.572   -7.481  1.00 0.00 ? 96  ASP A OD2  2  
ATOM 3139  H H    . ASP A 1 96  ? -20.927 9.860   -3.881  1.00 0.00 ? 96  ASP A H    2  
ATOM 3140  H HA   . ASP A 1 96  ? -22.174 7.293   -4.362  1.00 0.00 ? 96  ASP A HA   2  
ATOM 3141  H HB2  . ASP A 1 96  ? -21.559 7.793   -6.693  1.00 0.00 ? 96  ASP A HB2  2  
ATOM 3142  H HB3  . ASP A 1 96  ? -22.514 9.079   -5.968  1.00 0.00 ? 96  ASP A HB3  2  
ATOM 3143  N N    . VAL A 1 97  ? -19.144 7.548   -3.710  1.00 0.00 ? 97  VAL A N    2  
ATOM 3144  C CA   . VAL A 1 97  ? -17.864 6.897   -3.669  1.00 0.00 ? 97  VAL A CA   2  
ATOM 3145  C C    . VAL A 1 97  ? -17.725 6.062   -2.391  1.00 0.00 ? 97  VAL A C    2  
ATOM 3146  O O    . VAL A 1 97  ? -18.079 6.514   -1.296  1.00 0.00 ? 97  VAL A O    2  
ATOM 3147  C CB   . VAL A 1 97  ? -16.721 7.960   -3.763  1.00 0.00 ? 97  VAL A CB   2  
ATOM 3148  C CG1  . VAL A 1 97  ? -15.349 7.322   -3.711  1.00 0.00 ? 97  VAL A CG1  2  
ATOM 3149  C CG2  . VAL A 1 97  ? -16.864 8.782   -5.038  1.00 0.00 ? 97  VAL A CG2  2  
ATOM 3150  H H    . VAL A 1 97  ? -19.343 8.272   -3.079  1.00 0.00 ? 97  VAL A H    2  
ATOM 3151  H HA   . VAL A 1 97  ? -17.792 6.244   -4.526  1.00 0.00 ? 97  VAL A HA   2  
ATOM 3152  H HB   . VAL A 1 97  ? -16.815 8.632   -2.922  1.00 0.00 ? 97  VAL A HB   2  
ATOM 3153  H HG11 . VAL A 1 97  ? -14.585 8.081   -3.795  1.00 0.00 ? 97  VAL A HG11 2  
ATOM 3154  H HG12 . VAL A 1 97  ? -15.249 6.612   -4.519  1.00 0.00 ? 97  VAL A HG12 2  
ATOM 3155  H HG13 . VAL A 1 97  ? -15.248 6.812   -2.765  1.00 0.00 ? 97  VAL A HG13 2  
ATOM 3156  H HG21 . VAL A 1 97  ? -16.741 8.134   -5.893  1.00 0.00 ? 97  VAL A HG21 2  
ATOM 3157  H HG22 . VAL A 1 97  ? -16.105 9.550   -5.057  1.00 0.00 ? 97  VAL A HG22 2  
ATOM 3158  H HG23 . VAL A 1 97  ? -17.844 9.236   -5.067  1.00 0.00 ? 97  VAL A HG23 2  
ATOM 3159  N N    . ILE A 1 98  ? -17.202 4.864   -2.549  1.00 0.00 ? 98  ILE A N    2  
ATOM 3160  C CA   . ILE A 1 98  ? -16.939 3.946   -1.458  1.00 0.00 ? 98  ILE A CA   2  
ATOM 3161  C C    . ILE A 1 98  ? -15.475 3.551   -1.525  1.00 0.00 ? 98  ILE A C    2  
ATOM 3162  O O    . ILE A 1 98  ? -15.019 3.045   -2.536  1.00 0.00 ? 98  ILE A O    2  
ATOM 3163  C CB   . ILE A 1 98  ? -17.863 2.649   -1.500  1.00 0.00 ? 98  ILE A CB   2  
ATOM 3164  C CG1  . ILE A 1 98  ? -19.311 3.045   -1.193  1.00 0.00 ? 98  ILE A CG1  2  
ATOM 3165  C CG2  . ILE A 1 98  ? -17.362 1.592   -0.505  1.00 0.00 ? 98  ILE A CG2  2  
ATOM 3166  C CD1  . ILE A 1 98  ? -20.243 1.879   -0.994  1.00 0.00 ? 98  ILE A CD1  2  
ATOM 3167  H H    . ILE A 1 98  ? -16.946 4.589   -3.457  1.00 0.00 ? 98  ILE A H    2  
ATOM 3168  H HA   . ILE A 1 98  ? -17.110 4.480   -0.535  1.00 0.00 ? 98  ILE A HA   2  
ATOM 3169  H HB   . ILE A 1 98  ? -17.812 2.227   -2.494  1.00 0.00 ? 98  ILE A HB   2  
ATOM 3170  H HG12 . ILE A 1 98  ? -19.323 3.624   -0.282  1.00 0.00 ? 98  ILE A HG12 2  
ATOM 3171  H HG13 . ILE A 1 98  ? -19.692 3.649   -2.003  1.00 0.00 ? 98  ILE A HG13 2  
ATOM 3172  H HG21 . ILE A 1 98  ? -17.413 1.989   0.498   1.00 0.00 ? 98  ILE A HG21 2  
ATOM 3173  H HG22 . ILE A 1 98  ? -16.336 1.344   -0.738  1.00 0.00 ? 98  ILE A HG22 2  
ATOM 3174  H HG23 . ILE A 1 98  ? -17.973 0.706   -0.577  1.00 0.00 ? 98  ILE A HG23 2  
ATOM 3175  H HD11 . ILE A 1 98  ? -21.252 2.239   -0.853  1.00 0.00 ? 98  ILE A HD11 2  
ATOM 3176  H HD12 . ILE A 1 98  ? -19.932 1.332   -0.117  1.00 0.00 ? 98  ILE A HD12 2  
ATOM 3177  H HD13 . ILE A 1 98  ? -20.196 1.227   -1.853  1.00 0.00 ? 98  ILE A HD13 2  
ATOM 3178  N N    . GLU A 1 99  ? -14.729 3.816   -0.492  1.00 0.00 ? 99  GLU A N    2  
ATOM 3179  C CA   . GLU A 1 99  ? -13.324 3.493   -0.502  1.00 0.00 ? 99  GLU A CA   2  
ATOM 3180  C C    . GLU A 1 99  ? -12.911 2.860   0.799   1.00 0.00 ? 99  GLU A C    2  
ATOM 3181  O O    . GLU A 1 99  ? -13.488 3.135   1.856   1.00 0.00 ? 99  GLU A O    2  
ATOM 3182  C CB   . GLU A 1 99  ? -12.453 4.729   -0.781  1.00 0.00 ? 99  GLU A CB   2  
ATOM 3183  C CG   . GLU A 1 99  ? -12.713 5.394   -2.116  1.00 0.00 ? 99  GLU A CG   2  
ATOM 3184  C CD   . GLU A 1 99  ? -11.797 6.543   -2.382  1.00 0.00 ? 99  GLU A CD   2  
ATOM 3185  O OE1  . GLU A 1 99  ? -12.073 7.655   -1.917  1.00 0.00 ? 99  GLU A OE1  2  
ATOM 3186  O OE2  . GLU A 1 99  ? -10.767 6.351   -3.064  1.00 0.00 ? 99  GLU A OE2  2  
ATOM 3187  H H    . GLU A 1 99  ? -15.114 4.219   0.321   1.00 0.00 ? 99  GLU A H    2  
ATOM 3188  H HA   . GLU A 1 99  ? -13.163 2.777   -1.295  1.00 0.00 ? 99  GLU A HA   2  
ATOM 3189  H HB2  . GLU A 1 99  ? -12.627 5.464   -0.010  1.00 0.00 ? 99  GLU A HB2  2  
ATOM 3190  H HB3  . GLU A 1 99  ? -11.416 4.431   -0.746  1.00 0.00 ? 99  GLU A HB3  2  
ATOM 3191  H HG2  . GLU A 1 99  ? -12.589 4.667   -2.904  1.00 0.00 ? 99  GLU A HG2  2  
ATOM 3192  H HG3  . GLU A 1 99  ? -13.730 5.750   -2.119  1.00 0.00 ? 99  GLU A HG3  2  
ATOM 3193  N N    . VAL A 1 100 ? -11.942 2.004   0.727   1.00 0.00 ? 100 VAL A N    2  
ATOM 3194  C CA   . VAL A 1 100 ? -11.399 1.372   1.896   1.00 0.00 ? 100 VAL A CA   2  
ATOM 3195  C C    . VAL A 1 100 ? -9.901  1.513   1.868   1.00 0.00 ? 100 VAL A C    2  
ATOM 3196  O O    . VAL A 1 100 ? -9.239  1.081   0.910   1.00 0.00 ? 100 VAL A O    2  
ATOM 3197  C CB   . VAL A 1 100 ? -11.796 -0.137  2.019   1.00 0.00 ? 100 VAL A CB   2  
ATOM 3198  C CG1  . VAL A 1 100 ? -11.110 -0.791  3.219   1.00 0.00 ? 100 VAL A CG1  2  
ATOM 3199  C CG2  . VAL A 1 100 ? -13.297 -0.280  2.165   1.00 0.00 ? 100 VAL A CG2  2  
ATOM 3200  H H    . VAL A 1 100 ? -11.559 1.807   -0.154  1.00 0.00 ? 100 VAL A H    2  
ATOM 3201  H HA   . VAL A 1 100 ? -11.775 1.906   2.756   1.00 0.00 ? 100 VAL A HA   2  
ATOM 3202  H HB   . VAL A 1 100 ? -11.488 -0.654  1.123   1.00 0.00 ? 100 VAL A HB   2  
ATOM 3203  H HG11 . VAL A 1 100 ? -11.414 -0.289  4.126   1.00 0.00 ? 100 VAL A HG11 2  
ATOM 3204  H HG12 . VAL A 1 100 ? -10.039 -0.712  3.105   1.00 0.00 ? 100 VAL A HG12 2  
ATOM 3205  H HG13 . VAL A 1 100 ? -11.390 -1.833  3.271   1.00 0.00 ? 100 VAL A HG13 2  
ATOM 3206  H HG21 . VAL A 1 100 ? -13.609 0.214   3.073   1.00 0.00 ? 100 VAL A HG21 2  
ATOM 3207  H HG22 . VAL A 1 100 ? -13.559 -1.327  2.219   1.00 0.00 ? 100 VAL A HG22 2  
ATOM 3208  H HG23 . VAL A 1 100 ? -13.789 0.182   1.321   1.00 0.00 ? 100 VAL A HG23 2  
ATOM 3209  N N    . HIS A 1 101 ? -9.381  2.132   2.879   1.00 0.00 ? 101 HIS A N    2  
ATOM 3210  C CA   . HIS A 1 101 ? -7.969  2.315   3.022   1.00 0.00 ? 101 HIS A CA   2  
ATOM 3211  C C    . HIS A 1 101 ? -7.560  1.509   4.213   1.00 0.00 ? 101 HIS A C    2  
ATOM 3212  O O    . HIS A 1 101 ? -8.048  1.730   5.299   1.00 0.00 ? 101 HIS A O    2  
ATOM 3213  C CB   . HIS A 1 101 ? -7.635  3.806   3.266   1.00 0.00 ? 101 HIS A CB   2  
ATOM 3214  C CG   . HIS A 1 101 ? -6.150  4.166   3.261   1.00 0.00 ? 101 HIS A CG   2  
ATOM 3215  N ND1  . HIS A 1 101 ? -5.652  5.261   2.593   1.00 0.00 ? 101 HIS A ND1  2  
ATOM 3216  C CD2  . HIS A 1 101 ? -5.068  3.600   3.880   1.00 0.00 ? 101 HIS A CD2  2  
ATOM 3217  C CE1  . HIS A 1 101 ? -4.353  5.356   2.795   1.00 0.00 ? 101 HIS A CE1  2  
ATOM 3218  N NE2  . HIS A 1 101 ? -3.974  4.364   3.566   1.00 0.00 ? 101 HIS A NE2  2  
ATOM 3219  H H    . HIS A 1 101 ? -9.973  2.461   3.593   1.00 0.00 ? 101 HIS A H    2  
ATOM 3220  H HA   . HIS A 1 101 ? -7.466  1.965   2.133   1.00 0.00 ? 101 HIS A HA   2  
ATOM 3221  H HB2  . HIS A 1 101 ? -8.116  4.391   2.498   1.00 0.00 ? 101 HIS A HB2  2  
ATOM 3222  H HB3  . HIS A 1 101 ? -8.045  4.093   4.223   1.00 0.00 ? 101 HIS A HB3  2  
ATOM 3223  H HD1  . HIS A 1 101 ? -6.167  5.880   2.026   1.00 0.00 ? 101 HIS A HD1  2  
ATOM 3224  H HD2  . HIS A 1 101 ? -5.076  2.715   4.501   1.00 0.00 ? 101 HIS A HD2  2  
ATOM 3225  H HE1  . HIS A 1 101 ? -3.710  6.126   2.398   1.00 0.00 ? 101 HIS A HE1  2  
ATOM 3226  H HE2  . HIS A 1 101 ? -3.020  4.169   3.768   1.00 0.00 ? 101 HIS A HE2  2  
ATOM 3227  N N    . GLY A 1 102 ? -6.698  0.581   4.017   1.00 0.00 ? 102 GLY A N    2  
ATOM 3228  C CA   . GLY A 1 102 ? -6.236  -0.211  5.115   1.00 0.00 ? 102 GLY A CA   2  
ATOM 3229  C C    . GLY A 1 102 ? -4.773  -0.393  5.020   1.00 0.00 ? 102 GLY A C    2  
ATOM 3230  O O    . GLY A 1 102 ? -4.217  -0.279  3.923   1.00 0.00 ? 102 GLY A O    2  
ATOM 3231  H H    . GLY A 1 102 ? -6.342  0.417   3.115   1.00 0.00 ? 102 GLY A H    2  
ATOM 3232  H HA2  . GLY A 1 102 ? -6.476  0.289   6.039   1.00 0.00 ? 102 GLY A HA2  2  
ATOM 3233  H HA3  . GLY A 1 102 ? -6.716  -1.178  5.091   1.00 0.00 ? 102 GLY A HA3  2  
ATOM 3234  N N    . LYS A 1 103 ? -4.128  -0.626  6.118   1.00 0.00 ? 103 LYS A N    2  
ATOM 3235  C CA   . LYS A 1 103 ? -2.720  -0.846  6.098   1.00 0.00 ? 103 LYS A CA   2  
ATOM 3236  C C    . LYS A 1 103 ? -2.335  -1.964  7.026   1.00 0.00 ? 103 LYS A C    2  
ATOM 3237  O O    . LYS A 1 103 ? -2.971  -2.191  8.054   1.00 0.00 ? 103 LYS A O    2  
ATOM 3238  C CB   . LYS A 1 103 ? -1.917  0.424   6.451   1.00 0.00 ? 103 LYS A CB   2  
ATOM 3239  C CG   . LYS A 1 103 ? -2.205  1.003   7.829   1.00 0.00 ? 103 LYS A CG   2  
ATOM 3240  C CD   . LYS A 1 103 ? -1.160  2.031   8.255   1.00 0.00 ? 103 LYS A CD   2  
ATOM 3241  C CE   . LYS A 1 103 ? -1.043  3.206   7.288   1.00 0.00 ? 103 LYS A CE   2  
ATOM 3242  N NZ   . LYS A 1 103 ? -0.032  4.189   7.746   1.00 0.00 ? 103 LYS A NZ   2  
ATOM 3243  H H    . LYS A 1 103 ? -4.590  -0.653  6.988   1.00 0.00 ? 103 LYS A H    2  
ATOM 3244  H HA   . LYS A 1 103 ? -2.457  -1.139  5.093   1.00 0.00 ? 103 LYS A HA   2  
ATOM 3245  H HB2  . LYS A 1 103 ? -0.862  0.201   6.394   1.00 0.00 ? 103 LYS A HB2  2  
ATOM 3246  H HB3  . LYS A 1 103 ? -2.152  1.181   5.717   1.00 0.00 ? 103 LYS A HB3  2  
ATOM 3247  H HG2  . LYS A 1 103 ? -3.174  1.478   7.810   1.00 0.00 ? 103 LYS A HG2  2  
ATOM 3248  H HG3  . LYS A 1 103 ? -2.218  0.194   8.544   1.00 0.00 ? 103 LYS A HG3  2  
ATOM 3249  H HD2  . LYS A 1 103 ? -1.422  2.413   9.231   1.00 0.00 ? 103 LYS A HD2  2  
ATOM 3250  H HD3  . LYS A 1 103 ? -0.207  1.529   8.316   1.00 0.00 ? 103 LYS A HD3  2  
ATOM 3251  H HE2  . LYS A 1 103 ? -0.750  2.832   6.318   1.00 0.00 ? 103 LYS A HE2  2  
ATOM 3252  H HE3  . LYS A 1 103 ? -2.003  3.694   7.207   1.00 0.00 ? 103 LYS A HE3  2  
ATOM 3253  H HZ1  . LYS A 1 103 ? -0.295  4.564   8.678   1.00 0.00 ? 103 LYS A HZ1  2  
ATOM 3254  H HZ2  . LYS A 1 103 ? 0.047   4.992   7.091   1.00 0.00 ? 103 LYS A HZ2  2  
ATOM 3255  H HZ3  . LYS A 1 103 ? 0.914   3.764   7.849   1.00 0.00 ? 103 LYS A HZ3  2  
ATOM 3256  N N    . HIS A 1 104 ? -1.378  -2.713  6.606   1.00 0.00 ? 104 HIS A N    2  
ATOM 3257  C CA   . HIS A 1 104 ? -0.753  -3.699  7.426   1.00 0.00 ? 104 HIS A CA   2  
ATOM 3258  C C    . HIS A 1 104 ? 0.694   -3.597  7.154   1.00 0.00 ? 104 HIS A C    2  
ATOM 3259  O O    . HIS A 1 104 ? 1.101   -3.618  5.997   1.00 0.00 ? 104 HIS A O    2  
ATOM 3260  C CB   . HIS A 1 104 ? -1.269  -5.118  7.138   1.00 0.00 ? 104 HIS A CB   2  
ATOM 3261  C CG   . HIS A 1 104 ? -0.637  -6.206  7.986   1.00 0.00 ? 104 HIS A CG   2  
ATOM 3262  N ND1  . HIS A 1 104 ? -1.017  -6.462  9.277   1.00 0.00 ? 104 HIS A ND1  2  
ATOM 3263  C CD2  . HIS A 1 104 ? 0.351   -7.094  7.711   1.00 0.00 ? 104 HIS A CD2  2  
ATOM 3264  C CE1  . HIS A 1 104 ? -0.302  -7.451  9.762   1.00 0.00 ? 104 HIS A CE1  2  
ATOM 3265  N NE2  . HIS A 1 104 ? 0.534   -7.852  8.833   1.00 0.00 ? 104 HIS A NE2  2  
ATOM 3266  H H    . HIS A 1 104 ? -1.018  -2.561  5.704   1.00 0.00 ? 104 HIS A H    2  
ATOM 3267  H HA   . HIS A 1 104 ? -0.940  -3.438  8.458   1.00 0.00 ? 104 HIS A HA   2  
ATOM 3268  H HB2  . HIS A 1 104 ? -2.318  -5.103  7.390   1.00 0.00 ? 104 HIS A HB2  2  
ATOM 3269  H HB3  . HIS A 1 104 ? -1.138  -5.360  6.094   1.00 0.00 ? 104 HIS A HB3  2  
ATOM 3270  H HD1  . HIS A 1 104 ? -1.697  -5.958  9.787   1.00 0.00 ? 104 HIS A HD1  2  
ATOM 3271  H HD2  . HIS A 1 104 ? 0.893   -7.184  6.780   1.00 0.00 ? 104 HIS A HD2  2  
ATOM 3272  H HE1  . HIS A 1 104 ? -0.388  -7.865  10.756  1.00 0.00 ? 104 HIS A HE1  2  
ATOM 3273  H HE2  . HIS A 1 104 ? 0.961   -8.739  8.845   1.00 0.00 ? 104 HIS A HE2  2  
ATOM 3274  N N    . GLU A 1 105 ? 1.468   -3.471  8.156   1.00 0.00 ? 105 GLU A N    2  
ATOM 3275  C CA   . GLU A 1 105 ? 2.865   -3.393  7.948   1.00 0.00 ? 105 GLU A CA   2  
ATOM 3276  C C    . GLU A 1 105 ? 3.389   -4.794  7.889   1.00 0.00 ? 105 GLU A C    2  
ATOM 3277  O O    . GLU A 1 105 ? 3.150   -5.571  8.811   1.00 0.00 ? 105 GLU A O    2  
ATOM 3278  C CB   . GLU A 1 105 ? 3.516   -2.526  9.008   1.00 0.00 ? 105 GLU A CB   2  
ATOM 3279  C CG   . GLU A 1 105 ? 2.857   -1.157  9.073   1.00 0.00 ? 105 GLU A CG   2  
ATOM 3280  C CD   . GLU A 1 105 ? 3.607   -0.160  9.886   1.00 0.00 ? 105 GLU A CD   2  
ATOM 3281  O OE1  . GLU A 1 105 ? 3.638   -0.272  11.132  1.00 0.00 ? 105 GLU A OE1  2  
ATOM 3282  O OE2  . GLU A 1 105 ? 4.158   0.788   9.288   1.00 0.00 ? 105 GLU A OE2  2  
ATOM 3283  H H    . GLU A 1 105 ? 1.113   -3.429  9.070   1.00 0.00 ? 105 GLU A H    2  
ATOM 3284  H HA   . GLU A 1 105 ? 3.000   -2.951  6.974   1.00 0.00 ? 105 GLU A HA   2  
ATOM 3285  H HB2  . GLU A 1 105 ? 3.423   -3.011  9.969   1.00 0.00 ? 105 GLU A HB2  2  
ATOM 3286  H HB3  . GLU A 1 105 ? 4.560   -2.389  8.769   1.00 0.00 ? 105 GLU A HB3  2  
ATOM 3287  H HG2  . GLU A 1 105 ? 2.765   -0.771  8.069   1.00 0.00 ? 105 GLU A HG2  2  
ATOM 3288  H HG3  . GLU A 1 105 ? 1.868   -1.273  9.491   1.00 0.00 ? 105 GLU A HG3  2  
ATOM 3289  N N    . GLU A 1 106 ? 4.015   -5.127  6.770   1.00 0.00 ? 106 GLU A N    2  
ATOM 3290  C CA   . GLU A 1 106 ? 4.326   -6.508  6.428   1.00 0.00 ? 106 GLU A CA   2  
ATOM 3291  C C    . GLU A 1 106 ? 5.117   -7.246  7.481   1.00 0.00 ? 106 GLU A C    2  
ATOM 3292  O O    . GLU A 1 106 ? 4.562   -8.023  8.271   1.00 0.00 ? 106 GLU A O    2  
ATOM 3293  C CB   . GLU A 1 106 ? 5.041   -6.636  5.072   1.00 0.00 ? 106 GLU A CB   2  
ATOM 3294  C CG   . GLU A 1 106 ? 4.287   -6.091  3.879   1.00 0.00 ? 106 GLU A CG   2  
ATOM 3295  C CD   . GLU A 1 106 ? 4.797   -6.676  2.577   1.00 0.00 ? 106 GLU A CD   2  
ATOM 3296  O OE1  . GLU A 1 106 ? 4.294   -7.747  2.190   1.00 0.00 ? 106 GLU A OE1  2  
ATOM 3297  O OE2  . GLU A 1 106 ? 5.705   -6.094  1.931   1.00 0.00 ? 106 GLU A OE2  2  
ATOM 3298  H H    . GLU A 1 106 ? 4.291   -4.411  6.163   1.00 0.00 ? 106 GLU A H    2  
ATOM 3299  H HA   . GLU A 1 106 ? 3.376   -7.014  6.333   1.00 0.00 ? 106 GLU A HA   2  
ATOM 3300  H HB2  . GLU A 1 106 ? 5.981   -6.109  5.133   1.00 0.00 ? 106 GLU A HB2  2  
ATOM 3301  H HB3  . GLU A 1 106 ? 5.248   -7.681  4.893   1.00 0.00 ? 106 GLU A HB3  2  
ATOM 3302  H HG2  . GLU A 1 106 ? 3.238   -6.329  3.984   1.00 0.00 ? 106 GLU A HG2  2  
ATOM 3303  H HG3  . GLU A 1 106 ? 4.417   -5.020  3.851   1.00 0.00 ? 106 GLU A HG3  2  
ATOM 3304  N N    . ARG A 1 107 ? 6.395   -7.012  7.469   1.00 0.00 ? 107 ARG A N    2  
ATOM 3305  C CA   . ARG A 1 107 ? 7.352   -7.700  8.288   1.00 0.00 ? 107 ARG A CA   2  
ATOM 3306  C C    . ARG A 1 107 ? 8.426   -6.697  8.583   1.00 0.00 ? 107 ARG A C    2  
ATOM 3307  O O    . ARG A 1 107 ? 8.571   -5.742  7.826   1.00 0.00 ? 107 ARG A O    2  
ATOM 3308  C CB   . ARG A 1 107 ? 7.945   -8.861  7.449   1.00 0.00 ? 107 ARG A CB   2  
ATOM 3309  C CG   . ARG A 1 107 ? 6.897   -9.865  6.977   1.00 0.00 ? 107 ARG A CG   2  
ATOM 3310  C CD   . ARG A 1 107 ? 7.399   -10.798 5.890   1.00 0.00 ? 107 ARG A CD   2  
ATOM 3311  N NE   . ARG A 1 107 ? 7.819   -10.086 4.662   1.00 0.00 ? 107 ARG A NE   2  
ATOM 3312  C CZ   . ARG A 1 107 ? 7.013   -9.616  3.683   1.00 0.00 ? 107 ARG A CZ   2  
ATOM 3313  N NH1  . ARG A 1 107 ? 5.687   -9.635  3.815   1.00 0.00 ? 107 ARG A NH1  2  
ATOM 3314  N NH2  . ARG A 1 107 ? 7.547   -9.141  2.567   1.00 0.00 ? 107 ARG A NH2  2  
ATOM 3315  H H    . ARG A 1 107 ? 6.762   -6.305  6.897   1.00 0.00 ? 107 ARG A H    2  
ATOM 3316  H HA   . ARG A 1 107 ? 6.893   -8.088  9.185   1.00 0.00 ? 107 ARG A HA   2  
ATOM 3317  H HB2  . ARG A 1 107 ? 8.437   -8.449  6.580   1.00 0.00 ? 107 ARG A HB2  2  
ATOM 3318  H HB3  . ARG A 1 107 ? 8.671   -9.385  8.050   1.00 0.00 ? 107 ARG A HB3  2  
ATOM 3319  H HG2  . ARG A 1 107 ? 6.577   -10.457 7.821   1.00 0.00 ? 107 ARG A HG2  2  
ATOM 3320  H HG3  . ARG A 1 107 ? 6.051   -9.310  6.599   1.00 0.00 ? 107 ARG A HG3  2  
ATOM 3321  H HD2  . ARG A 1 107 ? 8.249   -11.339 6.279   1.00 0.00 ? 107 ARG A HD2  2  
ATOM 3322  H HD3  . ARG A 1 107 ? 6.616   -11.497 5.639   1.00 0.00 ? 107 ARG A HD3  2  
ATOM 3323  H HE   . ARG A 1 107 ? 8.805   -10.015 4.560   1.00 0.00 ? 107 ARG A HE   2  
ATOM 3324  H HH11 . ARG A 1 107 ? 5.238   -10.003 4.633   1.00 0.00 ? 107 ARG A HH11 2  
ATOM 3325  H HH12 . ARG A 1 107 ? 5.075   -9.246  3.113   1.00 0.00 ? 107 ARG A HH12 2  
ATOM 3326  H HH21 . ARG A 1 107 ? 8.554   -9.155  2.445   1.00 0.00 ? 107 ARG A HH21 2  
ATOM 3327  H HH22 . ARG A 1 107 ? 6.997   -8.762  1.822   1.00 0.00 ? 107 ARG A HH22 2  
ATOM 3328  N N    . GLN A 1 108 ? 9.127   -6.835  9.667   1.00 0.00 ? 108 GLN A N    2  
ATOM 3329  C CA   . GLN A 1 108 ? 10.250  -5.962  9.893   1.00 0.00 ? 108 GLN A CA   2  
ATOM 3330  C C    . GLN A 1 108 ? 11.428  -6.525  9.146   1.00 0.00 ? 108 GLN A C    2  
ATOM 3331  O O    . GLN A 1 108 ? 11.742  -7.716  9.266   1.00 0.00 ? 108 GLN A O    2  
ATOM 3332  C CB   . GLN A 1 108 ? 10.555  -5.751  11.374  1.00 0.00 ? 108 GLN A CB   2  
ATOM 3333  C CG   . GLN A 1 108 ? 9.430   -5.057  12.123  1.00 0.00 ? 108 GLN A CG   2  
ATOM 3334  C CD   . GLN A 1 108 ? 9.821   -4.626  13.519  1.00 0.00 ? 108 GLN A CD   2  
ATOM 3335  O OE1  . GLN A 1 108 ? 10.666  -5.242  14.177  1.00 0.00 ? 108 GLN A OE1  2  
ATOM 3336  N NE2  . GLN A 1 108 ? 9.218   -3.570  13.983  1.00 0.00 ? 108 GLN A NE2  2  
ATOM 3337  H H    . GLN A 1 108 ? 8.901   -7.536  10.317  1.00 0.00 ? 108 GLN A H    2  
ATOM 3338  H HA   . GLN A 1 108 ? 9.998   -5.019  9.430   1.00 0.00 ? 108 GLN A HA   2  
ATOM 3339  H HB2  . GLN A 1 108 ? 10.726  -6.713  11.832  1.00 0.00 ? 108 GLN A HB2  2  
ATOM 3340  H HB3  . GLN A 1 108 ? 11.447  -5.151  11.469  1.00 0.00 ? 108 GLN A HB3  2  
ATOM 3341  H HG2  . GLN A 1 108 ? 9.130   -4.180  11.568  1.00 0.00 ? 108 GLN A HG2  2  
ATOM 3342  H HG3  . GLN A 1 108 ? 8.593   -5.735  12.193  1.00 0.00 ? 108 GLN A HG3  2  
ATOM 3343  H HE21 . GLN A 1 108 ? 8.553   -3.119  13.417  1.00 0.00 ? 108 GLN A HE21 2  
ATOM 3344  H HE22 . GLN A 1 108 ? 9.445   -3.240  14.879  1.00 0.00 ? 108 GLN A HE22 2  
ATOM 3345  N N    . ASP A 1 109 ? 12.046  -5.692  8.359   1.00 0.00 ? 109 ASP A N    2  
ATOM 3346  C CA   . ASP A 1 109 ? 13.090  -6.111  7.451   1.00 0.00 ? 109 ASP A CA   2  
ATOM 3347  C C    . ASP A 1 109 ? 14.454  -5.910  8.140   1.00 0.00 ? 109 ASP A C    2  
ATOM 3348  O O    . ASP A 1 109 ? 14.486  -5.581  9.337   1.00 0.00 ? 109 ASP A O    2  
ATOM 3349  C CB   . ASP A 1 109 ? 12.955  -5.295  6.140   1.00 0.00 ? 109 ASP A CB   2  
ATOM 3350  C CG   . ASP A 1 109 ? 13.657  -5.905  4.945   1.00 0.00 ? 109 ASP A CG   2  
ATOM 3351  O OD1  . ASP A 1 109 ? 14.195  -7.028  5.077   1.00 0.00 ? 109 ASP A OD1  2  
ATOM 3352  O OD2  . ASP A 1 109 ? 13.714  -5.278  3.878   1.00 0.00 ? 109 ASP A OD2  2  
ATOM 3353  H H    . ASP A 1 109 ? 11.845  -4.732  8.393   1.00 0.00 ? 109 ASP A H    2  
ATOM 3354  H HA   . ASP A 1 109 ? 12.948  -7.161  7.240   1.00 0.00 ? 109 ASP A HA   2  
ATOM 3355  H HB2  . ASP A 1 109 ? 11.907  -5.226  5.893   1.00 0.00 ? 109 ASP A HB2  2  
ATOM 3356  H HB3  . ASP A 1 109 ? 13.343  -4.300  6.303   1.00 0.00 ? 109 ASP A HB3  2  
ATOM 3357  N N    . GLU A 1 110 ? 15.549  -6.096  7.393   1.00 0.00 ? 110 GLU A N    2  
ATOM 3358  C CA   . GLU A 1 110 ? 16.948  -6.043  7.890   1.00 0.00 ? 110 GLU A CA   2  
ATOM 3359  C C    . GLU A 1 110 ? 17.169  -4.923  8.908   1.00 0.00 ? 110 GLU A C    2  
ATOM 3360  O O    . GLU A 1 110 ? 17.445  -5.175  10.075  1.00 0.00 ? 110 GLU A O    2  
ATOM 3361  C CB   . GLU A 1 110 ? 17.901  -5.835  6.717   1.00 0.00 ? 110 GLU A CB   2  
ATOM 3362  C CG   . GLU A 1 110 ? 17.860  -6.930  5.665   1.00 0.00 ? 110 GLU A CG   2  
ATOM 3363  C CD   . GLU A 1 110 ? 18.320  -8.264  6.185   1.00 0.00 ? 110 GLU A CD   2  
ATOM 3364  O OE1  . GLU A 1 110 ? 19.548  -8.520  6.186   1.00 0.00 ? 110 GLU A OE1  2  
ATOM 3365  O OE2  . GLU A 1 110 ? 17.475  -9.086  6.585   1.00 0.00 ? 110 GLU A OE2  2  
ATOM 3366  H H    . GLU A 1 110 ? 15.396  -6.288  6.439   1.00 0.00 ? 110 GLU A H    2  
ATOM 3367  H HA   . GLU A 1 110 ? 17.179  -6.991  8.350   1.00 0.00 ? 110 GLU A HA   2  
ATOM 3368  H HB2  . GLU A 1 110 ? 17.652  -4.902  6.236   1.00 0.00 ? 110 GLU A HB2  2  
ATOM 3369  H HB3  . GLU A 1 110 ? 18.909  -5.768  7.097   1.00 0.00 ? 110 GLU A HB3  2  
ATOM 3370  H HG2  . GLU A 1 110 ? 16.842  -7.033  5.318   1.00 0.00 ? 110 GLU A HG2  2  
ATOM 3371  H HG3  . GLU A 1 110 ? 18.492  -6.638  4.840   1.00 0.00 ? 110 GLU A HG3  2  
ATOM 3372  N N    . HIS A 1 111 ? 17.052  -3.706  8.446   1.00 0.00 ? 111 HIS A N    2  
ATOM 3373  C CA   . HIS A 1 111 ? 17.159  -2.498  9.280   1.00 0.00 ? 111 HIS A CA   2  
ATOM 3374  C C    . HIS A 1 111 ? 16.184  -1.538  8.771   1.00 0.00 ? 111 HIS A C    2  
ATOM 3375  O O    . HIS A 1 111 ? 16.363  -0.326  8.840   1.00 0.00 ? 111 HIS A O    2  
ATOM 3376  C CB   . HIS A 1 111 ? 18.564  -1.842  9.201   1.00 0.00 ? 111 HIS A CB   2  
ATOM 3377  C CG   . HIS A 1 111 ? 19.695  -2.544  9.897   1.00 0.00 ? 111 HIS A CG   2  
ATOM 3378  N ND1  . HIS A 1 111 ? 20.353  -2.009  10.979  1.00 0.00 ? 111 HIS A ND1  2  
ATOM 3379  C CD2  . HIS A 1 111 ? 20.341  -3.690  9.609   1.00 0.00 ? 111 HIS A CD2  2  
ATOM 3380  C CE1  . HIS A 1 111 ? 21.348  -2.792  11.317  1.00 0.00 ? 111 HIS A CE1  2  
ATOM 3381  N NE2  . HIS A 1 111 ? 21.364  -3.821  10.503  1.00 0.00 ? 111 HIS A NE2  2  
ATOM 3382  H H    . HIS A 1 111 ? 16.868  -3.603  7.486   1.00 0.00 ? 111 HIS A H    2  
ATOM 3383  H HA   . HIS A 1 111 ? 16.932  -2.751  10.305  1.00 0.00 ? 111 HIS A HA   2  
ATOM 3384  H HB2  . HIS A 1 111 ? 18.842  -1.766  8.161   1.00 0.00 ? 111 HIS A HB2  2  
ATOM 3385  H HB3  . HIS A 1 111 ? 18.489  -0.843  9.605   1.00 0.00 ? 111 HIS A HB3  2  
ATOM 3386  H HD1  . HIS A 1 111 ? 20.125  -1.173  11.445  1.00 0.00 ? 111 HIS A HD1  2  
ATOM 3387  H HD2  . HIS A 1 111 ? 20.080  -4.378  8.817   1.00 0.00 ? 111 HIS A HD2  2  
ATOM 3388  H HE1  . HIS A 1 111 ? 22.041  -2.618  12.127  1.00 0.00 ? 111 HIS A HE1  2  
ATOM 3389  H HE2  . HIS A 1 111 ? 22.190  -4.319  10.304  1.00 0.00 ? 111 HIS A HE2  2  
ATOM 3390  N N    . GLY A 1 112 ? 15.183  -2.073  8.219   1.00 0.00 ? 112 GLY A N    2  
ATOM 3391  C CA   . GLY A 1 112 ? 14.204  -1.307  7.645   1.00 0.00 ? 112 GLY A CA   2  
ATOM 3392  C C    . GLY A 1 112 ? 12.912  -1.801  8.084   1.00 0.00 ? 112 GLY A C    2  
ATOM 3393  O O    . GLY A 1 112 ? 12.777  -2.964  8.450   1.00 0.00 ? 112 GLY A O    2  
ATOM 3394  H H    . GLY A 1 112 ? 15.057  -3.046  8.242   1.00 0.00 ? 112 GLY A H    2  
ATOM 3395  H HA2  . GLY A 1 112 ? 14.349  -0.277  7.941   1.00 0.00 ? 112 GLY A HA2  2  
ATOM 3396  H HA3  . GLY A 1 112 ? 14.272  -1.378  6.570   1.00 0.00 ? 112 GLY A HA3  2  
ATOM 3397  N N    . PHE A 1 113 ? 11.988  -0.969  8.093   1.00 0.00 ? 113 PHE A N    2  
ATOM 3398  C CA   . PHE A 1 113 ? 10.713  -1.324  8.517   1.00 0.00 ? 113 PHE A CA   2  
ATOM 3399  C C    . PHE A 1 113 ? 9.836   -1.312  7.296   1.00 0.00 ? 113 PHE A C    2  
ATOM 3400  O O    . PHE A 1 113 ? 10.087  -0.536  6.365   1.00 0.00 ? 113 PHE A O    2  
ATOM 3401  C CB   . PHE A 1 113 ? 10.226  -0.352  9.592   1.00 0.00 ? 113 PHE A CB   2  
ATOM 3402  C CG   . PHE A 1 113 ? 11.160  -0.295  10.778  1.00 0.00 ? 113 PHE A CG   2  
ATOM 3403  C CD1  . PHE A 1 113 ? 11.099  -1.255  11.772  1.00 0.00 ? 113 PHE A CD1  2  
ATOM 3404  C CD2  . PHE A 1 113 ? 12.104  0.713   10.886  1.00 0.00 ? 113 PHE A CD2  2  
ATOM 3405  C CE1  . PHE A 1 113 ? 11.959  -1.211  12.849  1.00 0.00 ? 113 PHE A CE1  2  
ATOM 3406  C CE2  . PHE A 1 113 ? 12.966  0.764   11.961  1.00 0.00 ? 113 PHE A CE2  2  
ATOM 3407  C CZ   . PHE A 1 113 ? 12.894  -0.199  12.943  1.00 0.00 ? 113 PHE A CZ   2  
ATOM 3408  H H    . PHE A 1 113 ? 12.154  -0.064  7.745   1.00 0.00 ? 113 PHE A H    2  
ATOM 3409  H HA   . PHE A 1 113 ? 10.754  -2.324  8.923   1.00 0.00 ? 113 PHE A HA   2  
ATOM 3410  H HB2  . PHE A 1 113 ? 10.149  0.639   9.169   1.00 0.00 ? 113 PHE A HB2  2  
ATOM 3411  H HB3  . PHE A 1 113 ? 9.255   -0.667  9.946   1.00 0.00 ? 113 PHE A HB3  2  
ATOM 3412  H HD1  . PHE A 1 113 ? 10.368  -2.048  11.699  1.00 0.00 ? 113 PHE A HD1  2  
ATOM 3413  H HD2  . PHE A 1 113 ? 12.158  1.467   10.115  1.00 0.00 ? 113 PHE A HD2  2  
ATOM 3414  H HE1  . PHE A 1 113 ? 11.901  -1.967  13.618  1.00 0.00 ? 113 PHE A HE1  2  
ATOM 3415  H HE2  . PHE A 1 113 ? 13.697  1.555   12.032  1.00 0.00 ? 113 PHE A HE2  2  
ATOM 3416  H HZ   . PHE A 1 113 ? 13.570  -0.159  13.783  1.00 0.00 ? 113 PHE A HZ   2  
ATOM 3417  N N    . ILE A 1 114 ? 8.837   -2.142  7.261   1.00 0.00 ? 114 ILE A N    2  
ATOM 3418  C CA   . ILE A 1 114 ? 8.068   -2.293  6.052   1.00 0.00 ? 114 ILE A CA   2  
ATOM 3419  C C    . ILE A 1 114 ? 6.605   -2.033  6.334   1.00 0.00 ? 114 ILE A C    2  
ATOM 3420  O O    . ILE A 1 114 ? 6.070   -2.531  7.309   1.00 0.00 ? 114 ILE A O    2  
ATOM 3421  C CB   . ILE A 1 114 ? 8.197   -3.735  5.482   1.00 0.00 ? 114 ILE A CB   2  
ATOM 3422  C CG1  . ILE A 1 114 ? 9.670   -4.195  5.346   1.00 0.00 ? 114 ILE A CG1  2  
ATOM 3423  C CG2  . ILE A 1 114 ? 7.481   -3.826  4.164   1.00 0.00 ? 114 ILE A CG2  2  
ATOM 3424  C CD1  . ILE A 1 114 ? 10.533  -3.366  4.428   1.00 0.00 ? 114 ILE A CD1  2  
ATOM 3425  H H    . ILE A 1 114 ? 8.573   -2.667  8.046   1.00 0.00 ? 114 ILE A H    2  
ATOM 3426  H HA   . ILE A 1 114 ? 8.433   -1.597  5.311   1.00 0.00 ? 114 ILE A HA   2  
ATOM 3427  H HB   . ILE A 1 114 ? 7.684   -4.394  6.168   1.00 0.00 ? 114 ILE A HB   2  
ATOM 3428  H HG12 . ILE A 1 114 ? 10.126  -4.162  6.324   1.00 0.00 ? 114 ILE A HG12 2  
ATOM 3429  H HG13 . ILE A 1 114 ? 9.682   -5.215  4.991   1.00 0.00 ? 114 ILE A HG13 2  
ATOM 3430  H HG21 . ILE A 1 114 ? 7.632   -4.804  3.733   1.00 0.00 ? 114 ILE A HG21 2  
ATOM 3431  H HG22 . ILE A 1 114 ? 7.850   -3.060  3.501   1.00 0.00 ? 114 ILE A HG22 2  
ATOM 3432  H HG23 . ILE A 1 114 ? 6.425   -3.669  4.326   1.00 0.00 ? 114 ILE A HG23 2  
ATOM 3433  H HD11 . ILE A 1 114 ? 10.520  -2.337  4.755   1.00 0.00 ? 114 ILE A HD11 2  
ATOM 3434  H HD12 . ILE A 1 114 ? 10.143  -3.429  3.423   1.00 0.00 ? 114 ILE A HD12 2  
ATOM 3435  H HD13 . ILE A 1 114 ? 11.549  -3.734  4.444   1.00 0.00 ? 114 ILE A HD13 2  
ATOM 3436  N N    . SER A 1 115 ? 5.970   -1.277  5.464   1.00 0.00 ? 115 SER A N    2  
ATOM 3437  C CA   . SER A 1 115 ? 4.573   -0.942  5.575   1.00 0.00 ? 115 SER A CA   2  
ATOM 3438  C C    . SER A 1 115 ? 3.870   -1.278  4.233   1.00 0.00 ? 115 SER A C    2  
ATOM 3439  O O    . SER A 1 115 ? 4.452   -1.087  3.168   1.00 0.00 ? 115 SER A O    2  
ATOM 3440  C CB   . SER A 1 115 ? 4.455   0.565   5.860   1.00 0.00 ? 115 SER A CB   2  
ATOM 3441  O OG   . SER A 1 115 ? 5.317   0.958   6.930   1.00 0.00 ? 115 SER A OG   2  
ATOM 3442  H H    . SER A 1 115 ? 6.454   -0.911  4.689   1.00 0.00 ? 115 SER A H    2  
ATOM 3443  H HA   . SER A 1 115 ? 4.142   -1.498  6.392   1.00 0.00 ? 115 SER A HA   2  
ATOM 3444  H HB2  . SER A 1 115 ? 4.722   1.123   4.975   1.00 0.00 ? 115 SER A HB2  2  
ATOM 3445  H HB3  . SER A 1 115 ? 3.437   0.797   6.134   1.00 0.00 ? 115 SER A HB3  2  
ATOM 3446  H HG   . SER A 1 115 ? 4.859   0.788   7.774   1.00 0.00 ? 115 SER A HG   2  
ATOM 3447  N N    . ARG A 1 116 ? 2.660   -1.800  4.269   1.00 0.00 ? 116 ARG A N    2  
ATOM 3448  C CA   . ARG A 1 116 ? 1.931   -2.063  3.057   1.00 0.00 ? 116 ARG A CA   2  
ATOM 3449  C C    . ARG A 1 116 ? 0.570   -1.420  3.225   1.00 0.00 ? 116 ARG A C    2  
ATOM 3450  O O    . ARG A 1 116 ? 0.029   -1.399  4.335   1.00 0.00 ? 116 ARG A O    2  
ATOM 3451  C CB   . ARG A 1 116 ? 1.812   -3.593  2.888   1.00 0.00 ? 116 ARG A CB   2  
ATOM 3452  C CG   . ARG A 1 116 ? 1.154   -4.105  1.610   1.00 0.00 ? 116 ARG A CG   2  
ATOM 3453  C CD   . ARG A 1 116 ? 1.202   -5.642  1.575   1.00 0.00 ? 116 ARG A CD   2  
ATOM 3454  N NE   . ARG A 1 116 ? 0.377   -6.272  2.623   1.00 0.00 ? 116 ARG A NE   2  
ATOM 3455  C CZ   . ARG A 1 116 ? 0.541   -7.531  3.108   1.00 0.00 ? 116 ARG A CZ   2  
ATOM 3456  N NH1  . ARG A 1 116 ? 1.681   -8.215  2.896   1.00 0.00 ? 116 ARG A NH1  2  
ATOM 3457  N NH2  . ARG A 1 116 ? -0.418  -8.071  3.864   1.00 0.00 ? 116 ARG A NH2  2  
ATOM 3458  H H    . ARG A 1 116 ? 2.181   -2.028  5.094   1.00 0.00 ? 116 ARG A H    2  
ATOM 3459  H HA   . ARG A 1 116 ? 2.454   -1.635  2.215   1.00 0.00 ? 116 ARG A HA   2  
ATOM 3460  H HB2  . ARG A 1 116 ? 2.806   -4.011  2.920   1.00 0.00 ? 116 ARG A HB2  2  
ATOM 3461  H HB3  . ARG A 1 116 ? 1.259   -3.980  3.731   1.00 0.00 ? 116 ARG A HB3  2  
ATOM 3462  H HG2  . ARG A 1 116 ? 0.124   -3.775  1.563   1.00 0.00 ? 116 ARG A HG2  2  
ATOM 3463  H HG3  . ARG A 1 116 ? 1.669   -3.723  0.740   1.00 0.00 ? 116 ARG A HG3  2  
ATOM 3464  H HD2  . ARG A 1 116 ? 0.852   -5.976  0.611   1.00 0.00 ? 116 ARG A HD2  2  
ATOM 3465  H HD3  . ARG A 1 116 ? 2.228   -5.955  1.705   1.00 0.00 ? 116 ARG A HD3  2  
ATOM 3466  H HE   . ARG A 1 116 ? -0.392  -5.732  2.901   1.00 0.00 ? 116 ARG A HE   2  
ATOM 3467  H HH11 . ARG A 1 116 ? 2.483   -7.864  2.391   1.00 0.00 ? 116 ARG A HH11 2  
ATOM 3468  H HH12 . ARG A 1 116 ? 1.814   -9.157  3.223   1.00 0.00 ? 116 ARG A HH12 2  
ATOM 3469  H HH21 . ARG A 1 116 ? -1.285  -7.628  4.116   1.00 0.00 ? 116 ARG A HH21 2  
ATOM 3470  H HH22 . ARG A 1 116 ? -0.325  -8.996  4.244   1.00 0.00 ? 116 ARG A HH22 2  
ATOM 3471  N N    . GLU A 1 117 ? 0.009   -0.944  2.157   1.00 0.00 ? 117 GLU A N    2  
ATOM 3472  C CA   . GLU A 1 117 ? -1.263  -0.272  2.207   1.00 0.00 ? 117 GLU A CA   2  
ATOM 3473  C C    . GLU A 1 117 ? -2.149  -0.770  1.116   1.00 0.00 ? 117 GLU A C    2  
ATOM 3474  O O    . GLU A 1 117 ? -1.678  -1.204  0.062   1.00 0.00 ? 117 GLU A O    2  
ATOM 3475  C CB   . GLU A 1 117 ? -1.118  1.251   2.112   1.00 0.00 ? 117 GLU A CB   2  
ATOM 3476  C CG   . GLU A 1 117 ? -0.370  1.886   3.272   1.00 0.00 ? 117 GLU A CG   2  
ATOM 3477  C CD   . GLU A 1 117 ? -0.375  3.379   3.192   1.00 0.00 ? 117 GLU A CD   2  
ATOM 3478  O OE1  . GLU A 1 117 ? -1.325  4.012   3.698   1.00 0.00 ? 117 GLU A OE1  2  
ATOM 3479  O OE2  . GLU A 1 117 ? 0.553   3.955   2.588   1.00 0.00 ? 117 GLU A OE2  2  
ATOM 3480  H H    . GLU A 1 117 ? 0.452   -1.045  1.284   1.00 0.00 ? 117 GLU A H    2  
ATOM 3481  H HA   . GLU A 1 117 ? -1.720  -0.516  3.154   1.00 0.00 ? 117 GLU A HA   2  
ATOM 3482  H HB2  . GLU A 1 117 ? -0.590  1.492   1.201   1.00 0.00 ? 117 GLU A HB2  2  
ATOM 3483  H HB3  . GLU A 1 117 ? -2.104  1.688   2.065   1.00 0.00 ? 117 GLU A HB3  2  
ATOM 3484  H HG2  . GLU A 1 117 ? -0.836  1.587   4.198   1.00 0.00 ? 117 GLU A HG2  2  
ATOM 3485  H HG3  . GLU A 1 117 ? 0.654   1.542   3.258   1.00 0.00 ? 117 GLU A HG3  2  
ATOM 3486  N N    . PHE A 1 118 ? -3.408  -0.729  1.370   1.00 0.00 ? 118 PHE A N    2  
ATOM 3487  C CA   . PHE A 1 118 ? -4.400  -1.198  0.463   1.00 0.00 ? 118 PHE A CA   2  
ATOM 3488  C C    . PHE A 1 118 ? -5.381  -0.080  0.211   1.00 0.00 ? 118 PHE A C    2  
ATOM 3489  O O    . PHE A 1 118 ? -5.807  0.602   1.155   1.00 0.00 ? 118 PHE A O    2  
ATOM 3490  C CB   . PHE A 1 118 ? -5.137  -2.388  1.081   1.00 0.00 ? 118 PHE A CB   2  
ATOM 3491  C CG   . PHE A 1 118 ? -4.253  -3.556  1.465   1.00 0.00 ? 118 PHE A CG   2  
ATOM 3492  C CD1  . PHE A 1 118 ? -3.589  -3.577  2.681   1.00 0.00 ? 118 PHE A CD1  2  
ATOM 3493  C CD2  . PHE A 1 118 ? -4.105  -4.633  0.619   1.00 0.00 ? 118 PHE A CD2  2  
ATOM 3494  C CE1  . PHE A 1 118 ? -2.801  -4.646  3.032   1.00 0.00 ? 118 PHE A CE1  2  
ATOM 3495  C CE2  . PHE A 1 118 ? -3.324  -5.706  0.971   1.00 0.00 ? 118 PHE A CE2  2  
ATOM 3496  C CZ   . PHE A 1 118 ? -2.673  -5.712  2.173   1.00 0.00 ? 118 PHE A CZ   2  
ATOM 3497  H H    . PHE A 1 118 ? -3.707  -0.367  2.236   1.00 0.00 ? 118 PHE A H    2  
ATOM 3498  H HA   . PHE A 1 118 ? -3.931  -1.511  -0.458  1.00 0.00 ? 118 PHE A HA   2  
ATOM 3499  H HB2  . PHE A 1 118 ? -5.641  -2.051  1.973   1.00 0.00 ? 118 PHE A HB2  2  
ATOM 3500  H HB3  . PHE A 1 118 ? -5.875  -2.744  0.378   1.00 0.00 ? 118 PHE A HB3  2  
ATOM 3501  H HD1  . PHE A 1 118 ? -3.691  -2.738  3.354   1.00 0.00 ? 118 PHE A HD1  2  
ATOM 3502  H HD2  . PHE A 1 118 ? -4.615  -4.632  -0.333  1.00 0.00 ? 118 PHE A HD2  2  
ATOM 3503  H HE1  . PHE A 1 118 ? -2.286  -4.651  3.981   1.00 0.00 ? 118 PHE A HE1  2  
ATOM 3504  H HE2  . PHE A 1 118 ? -3.218  -6.541  0.295   1.00 0.00 ? 118 PHE A HE2  2  
ATOM 3505  H HZ   . PHE A 1 118 ? -2.058  -6.557  2.451   1.00 0.00 ? 118 PHE A HZ   2  
ATOM 3506  N N    . HIS A 1 119 ? -5.706  0.136   -1.031  1.00 0.00 ? 119 HIS A N    2  
ATOM 3507  C CA   . HIS A 1 119 ? -6.654  1.156   -1.417  1.00 0.00 ? 119 HIS A CA   2  
ATOM 3508  C C    . HIS A 1 119 ? -7.691  0.493   -2.274  1.00 0.00 ? 119 HIS A C    2  
ATOM 3509  O O    . HIS A 1 119 ? -7.362  -0.121  -3.283  1.00 0.00 ? 119 HIS A O    2  
ATOM 3510  C CB   . HIS A 1 119 ? -5.990  2.263   -2.269  1.00 0.00 ? 119 HIS A CB   2  
ATOM 3511  C CG   . HIS A 1 119 ? -4.800  2.941   -1.665  1.00 0.00 ? 119 HIS A CG   2  
ATOM 3512  N ND1  . HIS A 1 119 ? -4.845  4.184   -1.089  1.00 0.00 ? 119 HIS A ND1  2  
ATOM 3513  C CD2  . HIS A 1 119 ? -3.507  2.554   -1.606  1.00 0.00 ? 119 HIS A CD2  2  
ATOM 3514  C CE1  . HIS A 1 119 ? -3.639  4.532   -0.710  1.00 0.00 ? 119 HIS A CE1  2  
ATOM 3515  N NE2  . HIS A 1 119 ? -2.807  3.561   -1.012  1.00 0.00 ? 119 HIS A NE2  2  
ATOM 3516  H H    . HIS A 1 119 ? -5.327  -0.418  -1.755  1.00 0.00 ? 119 HIS A H    2  
ATOM 3517  H HA   . HIS A 1 119 ? -7.102  1.590   -0.537  1.00 0.00 ? 119 HIS A HA   2  
ATOM 3518  H HB2  . HIS A 1 119 ? -5.669  1.829   -3.203  1.00 0.00 ? 119 HIS A HB2  2  
ATOM 3519  H HB3  . HIS A 1 119 ? -6.732  3.019   -2.485  1.00 0.00 ? 119 HIS A HB3  2  
ATOM 3520  H HD1  . HIS A 1 119 ? -5.654  4.731   -0.960  1.00 0.00 ? 119 HIS A HD1  2  
ATOM 3521  H HD2  . HIS A 1 119 ? -3.103  1.619   -1.966  1.00 0.00 ? 119 HIS A HD2  2  
ATOM 3522  H HE1  . HIS A 1 119 ? -3.373  5.462   -0.232  1.00 0.00 ? 119 HIS A HE1  2  
ATOM 3523  H HE2  . HIS A 1 119 ? -1.888  3.776   -1.324  1.00 0.00 ? 119 HIS A HE2  2  
ATOM 3524  N N    . ARG A 1 120 ? -8.908  0.569   -1.884  1.00 0.00 ? 120 ARG A N    2  
ATOM 3525  C CA   . ARG A 1 120 ? -9.968  0.021   -2.688  1.00 0.00 ? 120 ARG A CA   2  
ATOM 3526  C C    . ARG A 1 120 ? -10.813 1.171   -3.064  1.00 0.00 ? 120 ARG A C    2  
ATOM 3527  O O    . ARG A 1 120 ? -11.066 2.039   -2.219  1.00 0.00 ? 120 ARG A O    2  
ATOM 3528  C CB   . ARG A 1 120 ? -10.726 -1.046  -1.879  1.00 0.00 ? 120 ARG A CB   2  
ATOM 3529  C CG   . ARG A 1 120 ? -9.739  -2.056  -1.350  1.00 0.00 ? 120 ARG A CG   2  
ATOM 3530  C CD   . ARG A 1 120 ? -10.283 -3.173  -0.521  1.00 0.00 ? 120 ARG A CD   2  
ATOM 3531  N NE   . ARG A 1 120 ? -9.134  -3.845  0.141   1.00 0.00 ? 120 ARG A NE   2  
ATOM 3532  C CZ   . ARG A 1 120 ? -8.170  -4.557  -0.504  1.00 0.00 ? 120 ARG A CZ   2  
ATOM 3533  N NH1  . ARG A 1 120 ? -8.377  -5.050  -1.683  1.00 0.00 ? 120 ARG A NH1  2  
ATOM 3534  N NH2  . ARG A 1 120 ? -7.061  -4.886  0.099   1.00 0.00 ? 120 ARG A NH2  2  
ATOM 3535  H H    . ARG A 1 120 ? -9.118  1.013   -1.032  1.00 0.00 ? 120 ARG A H    2  
ATOM 3536  H HA   . ARG A 1 120 ? -9.536  -0.416  -3.575  1.00 0.00 ? 120 ARG A HA   2  
ATOM 3537  H HB2  . ARG A 1 120 ? -11.242 -0.573  -1.055  1.00 0.00 ? 120 ARG A HB2  2  
ATOM 3538  H HB3  . ARG A 1 120 ? -11.435 -1.555  -2.514  1.00 0.00 ? 120 ARG A HB3  2  
ATOM 3539  H HG2  . ARG A 1 120 ? -9.204  -2.493  -2.176  1.00 0.00 ? 120 ARG A HG2  2  
ATOM 3540  H HG3  . ARG A 1 120 ? -9.020  -1.510  -0.756  1.00 0.00 ? 120 ARG A HG3  2  
ATOM 3541  H HD2  . ARG A 1 120 ? -10.962 -2.774  0.218   1.00 0.00 ? 120 ARG A HD2  2  
ATOM 3542  H HD3  . ARG A 1 120 ? -10.786 -3.887  -1.155  1.00 0.00 ? 120 ARG A HD3  2  
ATOM 3543  H HE   . ARG A 1 120 ? -9.070  -3.647  1.100   1.00 0.00 ? 120 ARG A HE   2  
ATOM 3544  H HH11 . ARG A 1 120 ? -9.256  -4.958  -2.162  1.00 0.00 ? 120 ARG A HH11 2  
ATOM 3545  H HH12 . ARG A 1 120 ? -7.626  -5.535  -2.155  1.00 0.00 ? 120 ARG A HH12 2  
ATOM 3546  H HH21 . ARG A 1 120 ? -6.837  -4.665  1.051   1.00 0.00 ? 120 ARG A HH21 2  
ATOM 3547  H HH22 . ARG A 1 120 ? -6.369  -5.370  -0.458  1.00 0.00 ? 120 ARG A HH22 2  
ATOM 3548  N N    . LYS A 1 121 ? -11.230 1.233   -4.289  1.00 0.00 ? 121 LYS A N    2  
ATOM 3549  C CA   . LYS A 1 121 ? -11.918 2.412   -4.725  1.00 0.00 ? 121 LYS A CA   2  
ATOM 3550  C C    . LYS A 1 121 ? -13.146 2.051   -5.516  1.00 0.00 ? 121 LYS A C    2  
ATOM 3551  O O    . LYS A 1 121 ? -13.071 1.300   -6.471  1.00 0.00 ? 121 LYS A O    2  
ATOM 3552  C CB   . LYS A 1 121 ? -10.959 3.210   -5.599  1.00 0.00 ? 121 LYS A CB   2  
ATOM 3553  C CG   . LYS A 1 121 ? -11.340 4.649   -5.825  1.00 0.00 ? 121 LYS A CG   2  
ATOM 3554  C CD   . LYS A 1 121 ? -10.358 5.307   -6.773  1.00 0.00 ? 121 LYS A CD   2  
ATOM 3555  C CE   . LYS A 1 121 ? -10.452 6.813   -6.712  1.00 0.00 ? 121 LYS A CE   2  
ATOM 3556  N NZ   . LYS A 1 121 ? -9.982  7.326   -5.411  1.00 0.00 ? 121 LYS A NZ   2  
ATOM 3557  H H    . LYS A 1 121 ? -11.065 0.510   -4.939  1.00 0.00 ? 121 LYS A H    2  
ATOM 3558  H HA   . LYS A 1 121 ? -12.175 3.014   -3.869  1.00 0.00 ? 121 LYS A HA   2  
ATOM 3559  H HB2  . LYS A 1 121 ? -9.982  3.195   -5.140  1.00 0.00 ? 121 LYS A HB2  2  
ATOM 3560  H HB3  . LYS A 1 121 ? -10.892 2.722   -6.561  1.00 0.00 ? 121 LYS A HB3  2  
ATOM 3561  H HG2  . LYS A 1 121 ? -12.332 4.687   -6.251  1.00 0.00 ? 121 LYS A HG2  2  
ATOM 3562  H HG3  . LYS A 1 121 ? -11.326 5.172   -4.881  1.00 0.00 ? 121 LYS A HG3  2  
ATOM 3563  H HD2  . LYS A 1 121 ? -9.355  5.011   -6.502  1.00 0.00 ? 121 LYS A HD2  2  
ATOM 3564  H HD3  . LYS A 1 121 ? -10.571 4.979   -7.779  1.00 0.00 ? 121 LYS A HD3  2  
ATOM 3565  H HE2  . LYS A 1 121 ? -9.832  7.232   -7.492  1.00 0.00 ? 121 LYS A HE2  2  
ATOM 3566  H HE3  . LYS A 1 121 ? -11.475 7.120   -6.863  1.00 0.00 ? 121 LYS A HE3  2  
ATOM 3567  H HZ1  . LYS A 1 121 ? -8.979  7.091   -5.277  1.00 0.00 ? 121 LYS A HZ1  2  
ATOM 3568  H HZ2  . LYS A 1 121 ? -10.517 6.929   -4.605  1.00 0.00 ? 121 LYS A HZ2  2  
ATOM 3569  H HZ3  . LYS A 1 121 ? -10.070 8.359   -5.377  1.00 0.00 ? 121 LYS A HZ3  2  
ATOM 3570  N N    . TYR A 1 122 ? -14.247 2.615   -5.134  1.00 0.00 ? 122 TYR A N    2  
ATOM 3571  C CA   . TYR A 1 122 ? -15.522 2.398   -5.768  1.00 0.00 ? 122 TYR A CA   2  
ATOM 3572  C C    . TYR A 1 122 ? -16.197 3.699   -6.045  1.00 0.00 ? 122 TYR A C    2  
ATOM 3573  O O    . TYR A 1 122 ? -16.210 4.578   -5.193  1.00 0.00 ? 122 TYR A O    2  
ATOM 3574  C CB   . TYR A 1 122 ? -16.459 1.618   -4.839  1.00 0.00 ? 122 TYR A CB   2  
ATOM 3575  C CG   . TYR A 1 122 ? -16.338 0.130   -4.859  1.00 0.00 ? 122 TYR A CG   2  
ATOM 3576  C CD1  . TYR A 1 122 ? -15.215 -0.530  -4.383  1.00 0.00 ? 122 TYR A CD1  2  
ATOM 3577  C CD2  . TYR A 1 122 ? -17.378 -0.623  -5.351  1.00 0.00 ? 122 TYR A CD2  2  
ATOM 3578  C CE1  . TYR A 1 122 ? -15.146 -1.907  -4.416  1.00 0.00 ? 122 TYR A CE1  2  
ATOM 3579  C CE2  . TYR A 1 122 ? -17.321 -1.982  -5.381  1.00 0.00 ? 122 TYR A CE2  2  
ATOM 3580  C CZ   . TYR A 1 122 ? -16.211 -2.621  -4.921  1.00 0.00 ? 122 TYR A CZ   2  
ATOM 3581  O OH   . TYR A 1 122 ? -16.163 -3.970  -4.979  1.00 0.00 ? 122 TYR A OH   2  
ATOM 3582  H H    . TYR A 1 122 ? -14.244 3.208   -4.350  1.00 0.00 ? 122 TYR A H    2  
ATOM 3583  H HA   . TYR A 1 122 ? -15.395 1.826   -6.673  1.00 0.00 ? 122 TYR A HA   2  
ATOM 3584  H HB2  . TYR A 1 122 ? -16.256 1.931   -3.827  1.00 0.00 ? 122 TYR A HB2  2  
ATOM 3585  H HB3  . TYR A 1 122 ? -17.477 1.880   -5.083  1.00 0.00 ? 122 TYR A HB3  2  
ATOM 3586  H HD1  . TYR A 1 122 ? -14.391 0.046   -3.994  1.00 0.00 ? 122 TYR A HD1  2  
ATOM 3587  H HD2  . TYR A 1 122 ? -18.258 -0.116  -5.718  1.00 0.00 ? 122 TYR A HD2  2  
ATOM 3588  H HE1  . TYR A 1 122 ? -14.270 -2.417  -4.046  1.00 0.00 ? 122 TYR A HE1  2  
ATOM 3589  H HE2  . TYR A 1 122 ? -18.152 -2.547  -5.776  1.00 0.00 ? 122 TYR A HE2  2  
ATOM 3590  H HH   . TYR A 1 122 ? -15.577 -4.325  -4.290  1.00 0.00 ? 122 TYR A HH   2  
ATOM 3591  N N    . ARG A 1 123 ? -16.737 3.839   -7.207  1.00 0.00 ? 123 ARG A N    2  
ATOM 3592  C CA   . ARG A 1 123 ? -17.617 4.930   -7.461  1.00 0.00 ? 123 ARG A CA   2  
ATOM 3593  C C    . ARG A 1 123 ? -18.879 4.365   -8.043  1.00 0.00 ? 123 ARG A C    2  
ATOM 3594  O O    . ARG A 1 123 ? -18.946 4.044   -9.238  1.00 0.00 ? 123 ARG A O    2  
ATOM 3595  C CB   . ARG A 1 123 ? -17.025 5.982   -8.387  1.00 0.00 ? 123 ARG A CB   2  
ATOM 3596  C CG   . ARG A 1 123 ? -17.956 7.167   -8.549  1.00 0.00 ? 123 ARG A CG   2  
ATOM 3597  C CD   . ARG A 1 123 ? -17.423 8.201   -9.498  1.00 0.00 ? 123 ARG A CD   2  
ATOM 3598  N NE   . ARG A 1 123 ? -18.346 9.333   -9.589  1.00 0.00 ? 123 ARG A NE   2  
ATOM 3599  C CZ   . ARG A 1 123 ? -18.506 10.124  -10.650 1.00 0.00 ? 123 ARG A CZ   2  
ATOM 3600  N NH1  . ARG A 1 123 ? -17.936 9.812   -11.811 1.00 0.00 ? 123 ARG A NH1  2  
ATOM 3601  N NH2  . ARG A 1 123 ? -19.281 11.200  -10.559 1.00 0.00 ? 123 ARG A NH2  2  
ATOM 3602  H H    . ARG A 1 123 ? -16.559 3.187   -7.919  1.00 0.00 ? 123 ARG A H    2  
ATOM 3603  H HA   . ARG A 1 123 ? -17.858 5.374   -6.506  1.00 0.00 ? 123 ARG A HA   2  
ATOM 3604  H HB2  . ARG A 1 123 ? -16.088 6.326   -7.977  1.00 0.00 ? 123 ARG A HB2  2  
ATOM 3605  H HB3  . ARG A 1 123 ? -16.858 5.545   -9.358  1.00 0.00 ? 123 ARG A HB3  2  
ATOM 3606  H HG2  . ARG A 1 123 ? -18.902 6.811   -8.930  1.00 0.00 ? 123 ARG A HG2  2  
ATOM 3607  H HG3  . ARG A 1 123 ? -18.116 7.620   -7.582  1.00 0.00 ? 123 ARG A HG3  2  
ATOM 3608  H HD2  . ARG A 1 123 ? -16.468 8.549   -9.129  1.00 0.00 ? 123 ARG A HD2  2  
ATOM 3609  H HD3  . ARG A 1 123 ? -17.301 7.760   -10.474 1.00 0.00 ? 123 ARG A HD3  2  
ATOM 3610  H HE   . ARG A 1 123 ? -18.851 9.501   -8.750  1.00 0.00 ? 123 ARG A HE   2  
ATOM 3611  H HH11 . ARG A 1 123 ? -17.381 8.984   -11.921 1.00 0.00 ? 123 ARG A HH11 2  
ATOM 3612  H HH12 . ARG A 1 123 ? -18.030 10.375  -12.635 1.00 0.00 ? 123 ARG A HH12 2  
ATOM 3613  H HH21 . ARG A 1 123 ? -19.745 11.438  -9.701  1.00 0.00 ? 123 ARG A HH21 2  
ATOM 3614  H HH22 . ARG A 1 123 ? -19.446 11.819  -11.330 1.00 0.00 ? 123 ARG A HH22 2  
ATOM 3615  N N    . ILE A 1 124 ? -19.848 4.213   -7.206  1.00 0.00 ? 124 ILE A N    2  
ATOM 3616  C CA   . ILE A 1 124 ? -21.121 3.681   -7.577  1.00 0.00 ? 124 ILE A CA   2  
ATOM 3617  C C    . ILE A 1 124 ? -22.252 4.501   -6.956  1.00 0.00 ? 124 ILE A C    2  
ATOM 3618  O O    . ILE A 1 124 ? -22.481 4.442   -5.767  1.00 0.00 ? 124 ILE A O    2  
ATOM 3619  C CB   . ILE A 1 124 ? -21.246 2.171   -7.186  1.00 0.00 ? 124 ILE A CB   2  
ATOM 3620  C CG1  . ILE A 1 124 ? -20.674 1.880   -5.784  1.00 0.00 ? 124 ILE A CG1  2  
ATOM 3621  C CG2  . ILE A 1 124 ? -20.599 1.287   -8.243  1.00 0.00 ? 124 ILE A CG2  2  
ATOM 3622  C CD1  . ILE A 1 124 ? -20.793 0.424   -5.362  1.00 0.00 ? 124 ILE A CD1  2  
ATOM 3623  H H    . ILE A 1 124 ? -19.716 4.504   -6.275  1.00 0.00 ? 124 ILE A H    2  
ATOM 3624  H HA   . ILE A 1 124 ? -21.193 3.754   -8.653  1.00 0.00 ? 124 ILE A HA   2  
ATOM 3625  H HB   . ILE A 1 124 ? -22.301 1.940   -7.191  1.00 0.00 ? 124 ILE A HB   2  
ATOM 3626  H HG12 . ILE A 1 124 ? -19.628 2.144   -5.773  1.00 0.00 ? 124 ILE A HG12 2  
ATOM 3627  H HG13 . ILE A 1 124 ? -21.199 2.484   -5.059  1.00 0.00 ? 124 ILE A HG13 2  
ATOM 3628  H HG21 . ILE A 1 124 ? -21.086 1.440   -9.195  1.00 0.00 ? 124 ILE A HG21 2  
ATOM 3629  H HG22 . ILE A 1 124 ? -20.694 0.251   -7.953  1.00 0.00 ? 124 ILE A HG22 2  
ATOM 3630  H HG23 . ILE A 1 124 ? -19.553 1.541   -8.330  1.00 0.00 ? 124 ILE A HG23 2  
ATOM 3631  H HD11 . ILE A 1 124 ? -21.837 0.152   -5.309  1.00 0.00 ? 124 ILE A HD11 2  
ATOM 3632  H HD12 . ILE A 1 124 ? -20.341 0.292   -4.390  1.00 0.00 ? 124 ILE A HD12 2  
ATOM 3633  H HD13 . ILE A 1 124 ? -20.299 -0.208  -6.085  1.00 0.00 ? 124 ILE A HD13 2  
ATOM 3634  N N    . PRO A 1 125 ? -22.955 5.307   -7.756  1.00 0.00 ? 125 PRO A N    2  
ATOM 3635  C CA   . PRO A 1 125 ? -24.087 6.085   -7.268  1.00 0.00 ? 125 PRO A CA   2  
ATOM 3636  C C    . PRO A 1 125 ? -25.404 5.307   -7.332  1.00 0.00 ? 125 PRO A C    2  
ATOM 3637  O O    . PRO A 1 125 ? -26.238 5.407   -6.441  1.00 0.00 ? 125 PRO A O    2  
ATOM 3638  C CB   . PRO A 1 125 ? -24.136 7.293   -8.226  1.00 0.00 ? 125 PRO A CB   2  
ATOM 3639  C CG   . PRO A 1 125 ? -23.069 7.057   -9.266  1.00 0.00 ? 125 PRO A CG   2  
ATOM 3640  C CD   . PRO A 1 125 ? -22.647 5.619   -9.154  1.00 0.00 ? 125 PRO A CD   2  
ATOM 3641  H HA   . PRO A 1 125 ? -23.925 6.433   -6.259  1.00 0.00 ? 125 PRO A HA   2  
ATOM 3642  H HB2  . PRO A 1 125 ? -25.115 7.350   -8.675  1.00 0.00 ? 125 PRO A HB2  2  
ATOM 3643  H HB3  . PRO A 1 125 ? -23.949 8.200   -7.671  1.00 0.00 ? 125 PRO A HB3  2  
ATOM 3644  H HG2  . PRO A 1 125 ? -23.469 7.247   -10.251 1.00 0.00 ? 125 PRO A HG2  2  
ATOM 3645  H HG3  . PRO A 1 125 ? -22.229 7.709   -9.080  1.00 0.00 ? 125 PRO A HG3  2  
ATOM 3646  H HD2  . PRO A 1 125 ? -23.215 5.000   -9.833  1.00 0.00 ? 125 PRO A HD2  2  
ATOM 3647  H HD3  . PRO A 1 125 ? -21.589 5.537   -9.350  1.00 0.00 ? 125 PRO A HD3  2  
ATOM 3648  N N    . ALA A 1 126 ? -25.591 4.550   -8.400  1.00 0.00 ? 126 ALA A N    2  
ATOM 3649  C CA   . ALA A 1 126 ? -26.813 3.784   -8.599  1.00 0.00 ? 126 ALA A CA   2  
ATOM 3650  C C    . ALA A 1 126 ? -26.932 2.648   -7.604  1.00 0.00 ? 126 ALA A C    2  
ATOM 3651  O O    . ALA A 1 126 ? -28.010 2.286   -7.183  1.00 0.00 ? 126 ALA A O    2  
ATOM 3652  C CB   . ALA A 1 126 ? -26.896 3.259   -10.016 1.00 0.00 ? 126 ALA A CB   2  
ATOM 3653  H H    . ALA A 1 126 ? -24.875 4.495   -9.068  1.00 0.00 ? 126 ALA A H    2  
ATOM 3654  H HA   . ALA A 1 126 ? -27.642 4.457   -8.442  1.00 0.00 ? 126 ALA A HA   2  
ATOM 3655  H HB1  . ALA A 1 126 ? -26.104 2.544   -10.183 1.00 0.00 ? 126 ALA A HB1  2  
ATOM 3656  H HB2  . ALA A 1 126 ? -26.796 4.078   -10.711 1.00 0.00 ? 126 ALA A HB2  2  
ATOM 3657  H HB3  . ALA A 1 126 ? -27.850 2.777   -10.161 1.00 0.00 ? 126 ALA A HB3  2  
ATOM 3658  N N    . ASP A 1 127 ? -25.827 2.102   -7.219  1.00 0.00 ? 127 ASP A N    2  
ATOM 3659  C CA   . ASP A 1 127 ? -25.838 0.958   -6.326  1.00 0.00 ? 127 ASP A CA   2  
ATOM 3660  C C    . ASP A 1 127 ? -25.752 1.402   -4.892  1.00 0.00 ? 127 ASP A C    2  
ATOM 3661  O O    . ASP A 1 127 ? -26.064 0.645   -3.981  1.00 0.00 ? 127 ASP A O    2  
ATOM 3662  C CB   . ASP A 1 127 ? -24.663 0.014   -6.633  1.00 0.00 ? 127 ASP A CB   2  
ATOM 3663  C CG   . ASP A 1 127 ? -24.668 -0.504  -8.050  1.00 0.00 ? 127 ASP A CG   2  
ATOM 3664  O OD1  . ASP A 1 127 ? -24.071 0.152   -8.939  1.00 0.00 ? 127 ASP A OD1  2  
ATOM 3665  O OD2  . ASP A 1 127 ? -25.279 -1.555  -8.316  1.00 0.00 ? 127 ASP A OD2  2  
ATOM 3666  H H    . ASP A 1 127 ? -24.975 2.454   -7.548  1.00 0.00 ? 127 ASP A H    2  
ATOM 3667  H HA   . ASP A 1 127 ? -26.758 0.422   -6.488  1.00 0.00 ? 127 ASP A HA   2  
ATOM 3668  H HB2  . ASP A 1 127 ? -23.736 0.542   -6.471  1.00 0.00 ? 127 ASP A HB2  2  
ATOM 3669  H HB3  . ASP A 1 127 ? -24.709 -0.828  -5.959  1.00 0.00 ? 127 ASP A HB3  2  
ATOM 3670  N N    . VAL A 1 128 ? -25.356 2.637   -4.699  1.00 0.00 ? 128 VAL A N    2  
ATOM 3671  C CA   . VAL A 1 128 ? -25.046 3.139   -3.387  1.00 0.00 ? 128 VAL A CA   2  
ATOM 3672  C C    . VAL A 1 128 ? -25.693 4.472   -3.050  1.00 0.00 ? 128 VAL A C    2  
ATOM 3673  O O    . VAL A 1 128 ? -25.497 5.475   -3.739  1.00 0.00 ? 128 VAL A O    2  
ATOM 3674  C CB   . VAL A 1 128 ? -23.500 3.222   -3.220  1.00 0.00 ? 128 VAL A CB   2  
ATOM 3675  C CG1  . VAL A 1 128 ? -23.060 4.145   -2.087  1.00 0.00 ? 128 VAL A CG1  2  
ATOM 3676  C CG2  . VAL A 1 128 ? -22.958 1.837   -2.990  1.00 0.00 ? 128 VAL A CG2  2  
ATOM 3677  H H    . VAL A 1 128 ? -25.285 3.251   -5.457  1.00 0.00 ? 128 VAL A H    2  
ATOM 3678  H HA   . VAL A 1 128 ? -25.391 2.407   -2.673  1.00 0.00 ? 128 VAL A HA   2  
ATOM 3679  H HB   . VAL A 1 128 ? -23.075 3.583   -4.144  1.00 0.00 ? 128 VAL A HB   2  
ATOM 3680  H HG11 . VAL A 1 128 ? -21.981 4.167   -2.038  1.00 0.00 ? 128 VAL A HG11 2  
ATOM 3681  H HG12 . VAL A 1 128 ? -23.451 3.777   -1.152  1.00 0.00 ? 128 VAL A HG12 2  
ATOM 3682  H HG13 . VAL A 1 128 ? -23.434 5.141   -2.268  1.00 0.00 ? 128 VAL A HG13 2  
ATOM 3683  H HG21 . VAL A 1 128 ? -23.249 1.200   -3.812  1.00 0.00 ? 128 VAL A HG21 2  
ATOM 3684  H HG22 . VAL A 1 128 ? -23.361 1.438   -2.071  1.00 0.00 ? 128 VAL A HG22 2  
ATOM 3685  H HG23 . VAL A 1 128 ? -21.882 1.878   -2.934  1.00 0.00 ? 128 VAL A HG23 2  
ATOM 3686  N N    . ASP A 1 129 ? -26.479 4.461   -2.012  1.00 0.00 ? 129 ASP A N    2  
ATOM 3687  C CA   . ASP A 1 129 ? -26.969 5.677   -1.401  1.00 0.00 ? 129 ASP A CA   2  
ATOM 3688  C C    . ASP A 1 129 ? -26.466 5.673   0.038   1.00 0.00 ? 129 ASP A C    2  
ATOM 3689  O O    . ASP A 1 129 ? -26.897 4.866   0.843   1.00 0.00 ? 129 ASP A O    2  
ATOM 3690  C CB   . ASP A 1 129 ? -28.491 5.769   -1.438  1.00 0.00 ? 129 ASP A CB   2  
ATOM 3691  C CG   . ASP A 1 129 ? -28.976 7.080   -0.873  1.00 0.00 ? 129 ASP A CG   2  
ATOM 3692  O OD1  . ASP A 1 129 ? -29.199 7.175   0.340   1.00 0.00 ? 129 ASP A OD1  2  
ATOM 3693  O OD2  . ASP A 1 129 ? -29.125 8.058   -1.639  1.00 0.00 ? 129 ASP A OD2  2  
ATOM 3694  H H    . ASP A 1 129 ? -26.765 3.594   -1.645  1.00 0.00 ? 129 ASP A H    2  
ATOM 3695  H HA   . ASP A 1 129 ? -26.521 6.506   -1.928  1.00 0.00 ? 129 ASP A HA   2  
ATOM 3696  H HB2  . ASP A 1 129 ? -28.826 5.686   -2.462  1.00 0.00 ? 129 ASP A HB2  2  
ATOM 3697  H HB3  . ASP A 1 129 ? -28.912 4.963   -0.857  1.00 0.00 ? 129 ASP A HB3  2  
ATOM 3698  N N    . PRO A 1 130 ? -25.552 6.573   0.388   1.00 0.00 ? 130 PRO A N    2  
ATOM 3699  C CA   . PRO A 1 130 ? -24.810 6.525   1.666   1.00 0.00 ? 130 PRO A CA   2  
ATOM 3700  C C    . PRO A 1 130 ? -25.610 6.864   2.925   1.00 0.00 ? 130 PRO A C    2  
ATOM 3701  O O    . PRO A 1 130 ? -25.013 7.034   3.993   1.00 0.00 ? 130 PRO A O    2  
ATOM 3702  C CB   . PRO A 1 130 ? -23.720 7.570   1.456   1.00 0.00 ? 130 PRO A CB   2  
ATOM 3703  C CG   . PRO A 1 130 ? -24.354 8.557   0.551   1.00 0.00 ? 130 PRO A CG   2  
ATOM 3704  C CD   . PRO A 1 130 ? -25.162 7.745   -0.412  1.00 0.00 ? 130 PRO A CD   2  
ATOM 3705  H HA   . PRO A 1 130 ? -24.333 5.569   1.810   1.00 0.00 ? 130 PRO A HA   2  
ATOM 3706  H HB2  . PRO A 1 130 ? -23.443 8.008   2.404   1.00 0.00 ? 130 PRO A HB2  2  
ATOM 3707  H HB3  . PRO A 1 130 ? -22.858 7.114   0.993   1.00 0.00 ? 130 PRO A HB3  2  
ATOM 3708  H HG2  . PRO A 1 130 ? -24.991 9.221   1.117   1.00 0.00 ? 130 PRO A HG2  2  
ATOM 3709  H HG3  . PRO A 1 130 ? -23.594 9.115   0.027   1.00 0.00 ? 130 PRO A HG3  2  
ATOM 3710  H HD2  . PRO A 1 130 ? -26.032 8.297   -0.733  1.00 0.00 ? 130 PRO A HD2  2  
ATOM 3711  H HD3  . PRO A 1 130 ? -24.557 7.446   -1.255  1.00 0.00 ? 130 PRO A HD3  2  
ATOM 3712  N N    . LEU A 1 131 ? -26.922 6.904   2.830   1.00 0.00 ? 131 LEU A N    2  
ATOM 3713  C CA   . LEU A 1 131 ? -27.736 7.319   3.949   1.00 0.00 ? 131 LEU A CA   2  
ATOM 3714  C C    . LEU A 1 131 ? -27.691 6.314   5.110   1.00 0.00 ? 131 LEU A C    2  
ATOM 3715  O O    . LEU A 1 131 ? -27.516 6.700   6.256   1.00 0.00 ? 131 LEU A O    2  
ATOM 3716  C CB   . LEU A 1 131 ? -29.184 7.538   3.496   1.00 0.00 ? 131 LEU A CB   2  
ATOM 3717  C CG   . LEU A 1 131 ? -30.144 8.128   4.530   1.00 0.00 ? 131 LEU A CG   2  
ATOM 3718  C CD1  . LEU A 1 131 ? -29.704 9.527   4.941   1.00 0.00 ? 131 LEU A CD1  2  
ATOM 3719  C CD2  . LEU A 1 131 ? -31.556 8.152   3.982   1.00 0.00 ? 131 LEU A CD2  2  
ATOM 3720  H H    . LEU A 1 131 ? -27.350 6.662   1.978   1.00 0.00 ? 131 LEU A H    2  
ATOM 3721  H HA   . LEU A 1 131 ? -27.347 8.264   4.297   1.00 0.00 ? 131 LEU A HA   2  
ATOM 3722  H HB2  . LEU A 1 131 ? -29.174 8.196   2.640   1.00 0.00 ? 131 LEU A HB2  2  
ATOM 3723  H HB3  . LEU A 1 131 ? -29.579 6.584   3.180   1.00 0.00 ? 131 LEU A HB3  2  
ATOM 3724  H HG   . LEU A 1 131 ? -30.133 7.504   5.413   1.00 0.00 ? 131 LEU A HG   2  
ATOM 3725  H HD11 . LEU A 1 131 ? -28.723 9.486   5.388   1.00 0.00 ? 131 LEU A HD11 2  
ATOM 3726  H HD12 . LEU A 1 131 ? -30.409 9.929   5.654   1.00 0.00 ? 131 LEU A HD12 2  
ATOM 3727  H HD13 . LEU A 1 131 ? -29.676 10.163  4.068   1.00 0.00 ? 131 LEU A HD13 2  
ATOM 3728  H HD21 . LEU A 1 131 ? -31.583 8.744   3.079   1.00 0.00 ? 131 LEU A HD21 2  
ATOM 3729  H HD22 . LEU A 1 131 ? -32.218 8.587   4.716   1.00 0.00 ? 131 LEU A HD22 2  
ATOM 3730  H HD23 . LEU A 1 131 ? -31.876 7.145   3.763   1.00 0.00 ? 131 LEU A HD23 2  
ATOM 3731  N N    . THR A 1 132 ? -27.810 5.037   4.824   1.00 0.00 ? 132 THR A N    2  
ATOM 3732  C CA   . THR A 1 132 ? -27.861 4.043   5.899   1.00 0.00 ? 132 THR A CA   2  
ATOM 3733  C C    . THR A 1 132 ? -26.729 3.018   5.805   1.00 0.00 ? 132 THR A C    2  
ATOM 3734  O O    . THR A 1 132 ? -26.729 2.016   6.532   1.00 0.00 ? 132 THR A O    2  
ATOM 3735  C CB   . THR A 1 132 ? -29.231 3.314   5.928   1.00 0.00 ? 132 THR A CB   2  
ATOM 3736  O OG1  . THR A 1 132 ? -29.379 2.564   7.138   1.00 0.00 ? 132 THR A OG1  2  
ATOM 3737  C CG2  . THR A 1 132 ? -29.349 2.368   4.749   1.00 0.00 ? 132 THR A CG2  2  
ATOM 3738  H H    . THR A 1 132 ? -27.897 4.763   3.888   1.00 0.00 ? 132 THR A H    2  
ATOM 3739  H HA   . THR A 1 132 ? -27.750 4.579   6.830   1.00 0.00 ? 132 THR A HA   2  
ATOM 3740  H HB   . THR A 1 132 ? -30.014 4.052   5.861   1.00 0.00 ? 132 THR A HB   2  
ATOM 3741  H HG1  . THR A 1 132 ? -28.582 2.028   7.245   1.00 0.00 ? 132 THR A HG1  2  
ATOM 3742  H HG21 . THR A 1 132 ? -30.298 1.854   4.780   1.00 0.00 ? 132 THR A HG21 2  
ATOM 3743  H HG22 . THR A 1 132 ? -28.540 1.653   4.774   1.00 0.00 ? 132 THR A HG22 2  
ATOM 3744  H HG23 . THR A 1 132 ? -29.289 2.960   3.850   1.00 0.00 ? 132 THR A HG23 2  
ATOM 3745  N N    . ILE A 1 133 ? -25.780 3.254   4.936   1.00 0.00 ? 133 ILE A N    2  
ATOM 3746  C CA   . ILE A 1 133 ? -24.789 2.228   4.655   1.00 0.00 ? 133 ILE A CA   2  
ATOM 3747  C C    . ILE A 1 133 ? -23.873 1.962   5.846   1.00 0.00 ? 133 ILE A C    2  
ATOM 3748  O O    . ILE A 1 133 ? -23.346 2.896   6.469   1.00 0.00 ? 133 ILE A O    2  
ATOM 3749  C CB   . ILE A 1 133 ? -23.955 2.541   3.395   1.00 0.00 ? 133 ILE A CB   2  
ATOM 3750  C CG1  . ILE A 1 133 ? -24.872 2.720   2.198   1.00 0.00 ? 133 ILE A CG1  2  
ATOM 3751  C CG2  . ILE A 1 133 ? -22.983 1.410   3.120   1.00 0.00 ? 133 ILE A CG2  2  
ATOM 3752  C CD1  . ILE A 1 133 ? -24.154 2.976   0.908   1.00 0.00 ? 133 ILE A CD1  2  
ATOM 3753  H H    . ILE A 1 133 ? -25.738 4.133   4.506   1.00 0.00 ? 133 ILE A H    2  
ATOM 3754  H HA   . ILE A 1 133 ? -25.343 1.317   4.472   1.00 0.00 ? 133 ILE A HA   2  
ATOM 3755  H HB   . ILE A 1 133 ? -23.403 3.455   3.554   1.00 0.00 ? 133 ILE A HB   2  
ATOM 3756  H HG12 . ILE A 1 133 ? -25.431 1.810   2.052   1.00 0.00 ? 133 ILE A HG12 2  
ATOM 3757  H HG13 . ILE A 1 133 ? -25.553 3.538   2.376   1.00 0.00 ? 133 ILE A HG13 2  
ATOM 3758  H HG21 . ILE A 1 133 ? -23.535 0.494   2.965   1.00 0.00 ? 133 ILE A HG21 2  
ATOM 3759  H HG22 . ILE A 1 133 ? -22.319 1.293   3.965   1.00 0.00 ? 133 ILE A HG22 2  
ATOM 3760  H HG23 . ILE A 1 133 ? -22.409 1.637   2.235   1.00 0.00 ? 133 ILE A HG23 2  
ATOM 3761  H HD11 . ILE A 1 133 ? -23.531 3.853   1.000   1.00 0.00 ? 133 ILE A HD11 2  
ATOM 3762  H HD12 . ILE A 1 133 ? -24.885 3.125   0.128   1.00 0.00 ? 133 ILE A HD12 2  
ATOM 3763  H HD13 . ILE A 1 133 ? -23.540 2.120   0.670   1.00 0.00 ? 133 ILE A HD13 2  
ATOM 3764  N N    . THR A 1 134 ? -23.705 0.691   6.136   1.00 0.00 ? 134 THR A N    2  
ATOM 3765  C CA   . THR A 1 134 ? -22.894 0.218   7.215   1.00 0.00 ? 134 THR A CA   2  
ATOM 3766  C C    . THR A 1 134 ? -21.811 -0.698  6.683   1.00 0.00 ? 134 THR A C    2  
ATOM 3767  O O    . THR A 1 134 ? -21.858 -1.099  5.518   1.00 0.00 ? 134 THR A O    2  
ATOM 3768  C CB   . THR A 1 134 ? -23.769 -0.518  8.256   1.00 0.00 ? 134 THR A CB   2  
ATOM 3769  O OG1  . THR A 1 134 ? -24.725 -1.368  7.586   1.00 0.00 ? 134 THR A OG1  2  
ATOM 3770  C CG2  . THR A 1 134 ? -24.504 0.469   9.146   1.00 0.00 ? 134 THR A CG2  2  
ATOM 3771  H H    . THR A 1 134 ? -24.169 0.013   5.593   1.00 0.00 ? 134 THR A H    2  
ATOM 3772  H HA   . THR A 1 134 ? -22.440 1.072   7.690   1.00 0.00 ? 134 THR A HA   2  
ATOM 3773  H HB   . THR A 1 134 ? -23.126 -1.136  8.866   1.00 0.00 ? 134 THR A HB   2  
ATOM 3774  H HG1  . THR A 1 134 ? -24.273 -1.920  6.929   1.00 0.00 ? 134 THR A HG1  2  
ATOM 3775  H HG21 . THR A 1 134 ? -25.121 -0.073  9.849   1.00 0.00 ? 134 THR A HG21 2  
ATOM 3776  H HG22 . THR A 1 134 ? -25.126 1.109   8.539   1.00 0.00 ? 134 THR A HG22 2  
ATOM 3777  H HG23 . THR A 1 134 ? -23.789 1.069   9.688   1.00 0.00 ? 134 THR A HG23 2  
ATOM 3778  N N    . SER A 1 135 ? -20.825 -0.984  7.492   1.00 0.00 ? 135 SER A N    2  
ATOM 3779  C CA   . SER A 1 135 ? -19.726 -1.788  7.072   1.00 0.00 ? 135 SER A CA   2  
ATOM 3780  C C    . SER A 1 135 ? -19.453 -2.908  8.067   1.00 0.00 ? 135 SER A C    2  
ATOM 3781  O O    . SER A 1 135 ? -19.423 -2.687  9.275   1.00 0.00 ? 135 SER A O    2  
ATOM 3782  C CB   . SER A 1 135 ? -18.504 -0.895  6.917   1.00 0.00 ? 135 SER A CB   2  
ATOM 3783  O OG   . SER A 1 135 ? -18.825 0.226   6.101   1.00 0.00 ? 135 SER A OG   2  
ATOM 3784  H H    . SER A 1 135 ? -20.814 -0.634  8.412   1.00 0.00 ? 135 SER A H    2  
ATOM 3785  H HA   . SER A 1 135 ? -19.959 -2.211  6.106   1.00 0.00 ? 135 SER A HA   2  
ATOM 3786  H HB2  . SER A 1 135 ? -18.188 -0.548  7.890   1.00 0.00 ? 135 SER A HB2  2  
ATOM 3787  H HB3  . SER A 1 135 ? -17.706 -1.452  6.448   1.00 0.00 ? 135 SER A HB3  2  
ATOM 3788  H HG   . SER A 1 135 ? -19.608 -0.028  5.599   1.00 0.00 ? 135 SER A HG   2  
ATOM 3789  N N    . SER A 1 136 ? -19.263 -4.087  7.553   1.00 0.00 ? 136 SER A N    2  
ATOM 3790  C CA   . SER A 1 136 ? -18.950 -5.246  8.342   1.00 0.00 ? 136 SER A CA   2  
ATOM 3791  C C    . SER A 1 136 ? -17.560 -5.726  7.937   1.00 0.00 ? 136 SER A C    2  
ATOM 3792  O O    . SER A 1 136 ? -17.179 -5.605  6.760   1.00 0.00 ? 136 SER A O    2  
ATOM 3793  C CB   . SER A 1 136 ? -19.992 -6.319  8.075   1.00 0.00 ? 136 SER A CB   2  
ATOM 3794  O OG   . SER A 1 136 ? -21.307 -5.794  8.277   1.00 0.00 ? 136 SER A OG   2  
ATOM 3795  H H    . SER A 1 136 ? -19.336 -4.187  6.576   1.00 0.00 ? 136 SER A H    2  
ATOM 3796  H HA   . SER A 1 136 ? -18.961 -4.973  9.387   1.00 0.00 ? 136 SER A HA   2  
ATOM 3797  H HB2  . SER A 1 136 ? -19.902 -6.662  7.055   1.00 0.00 ? 136 SER A HB2  2  
ATOM 3798  H HB3  . SER A 1 136 ? -19.841 -7.146  8.752   1.00 0.00 ? 136 SER A HB3  2  
ATOM 3799  H HG   . SER A 1 136 ? -21.203 -4.913  8.660   1.00 0.00 ? 136 SER A HG   2  
ATOM 3800  N N    . LEU A 1 137 ? -16.810 -6.242  8.878   1.00 0.00 ? 137 LEU A N    2  
ATOM 3801  C CA   . LEU A 1 137 ? -15.433 -6.616  8.631   1.00 0.00 ? 137 LEU A CA   2  
ATOM 3802  C C    . LEU A 1 137 ? -15.213 -8.098  8.928   1.00 0.00 ? 137 LEU A C    2  
ATOM 3803  O O    . LEU A 1 137 ? -15.739 -8.624  9.911   1.00 0.00 ? 137 LEU A O    2  
ATOM 3804  C CB   . LEU A 1 137 ? -14.523 -5.758  9.524   1.00 0.00 ? 137 LEU A CB   2  
ATOM 3805  C CG   . LEU A 1 137 ? -13.011 -5.925  9.349   1.00 0.00 ? 137 LEU A CG   2  
ATOM 3806  C CD1  . LEU A 1 137 ? -12.575 -5.482  7.962   1.00 0.00 ? 137 LEU A CD1  2  
ATOM 3807  C CD2  . LEU A 1 137 ? -12.274 -5.146  10.420  1.00 0.00 ? 137 LEU A CD2  2  
ATOM 3808  H H    . LEU A 1 137 ? -17.177 -6.399  9.776   1.00 0.00 ? 137 LEU A H    2  
ATOM 3809  H HA   . LEU A 1 137 ? -15.195 -6.410  7.599   1.00 0.00 ? 137 LEU A HA   2  
ATOM 3810  H HB2  . LEU A 1 137 ? -14.763 -4.721  9.342   1.00 0.00 ? 137 LEU A HB2  2  
ATOM 3811  H HB3  . LEU A 1 137 ? -14.766 -5.980  10.552  1.00 0.00 ? 137 LEU A HB3  2  
ATOM 3812  H HG   . LEU A 1 137 ? -12.759 -6.971  9.457   1.00 0.00 ? 137 LEU A HG   2  
ATOM 3813  H HD11 . LEU A 1 137 ? -12.853 -4.450  7.810   1.00 0.00 ? 137 LEU A HD11 2  
ATOM 3814  H HD12 . LEU A 1 137 ? -13.047 -6.100  7.214   1.00 0.00 ? 137 LEU A HD12 2  
ATOM 3815  H HD13 . LEU A 1 137 ? -11.502 -5.576  7.881   1.00 0.00 ? 137 LEU A HD13 2  
ATOM 3816  H HD21 . LEU A 1 137 ? -12.543 -5.523  11.395  1.00 0.00 ? 137 LEU A HD21 2  
ATOM 3817  H HD22 . LEU A 1 137 ? -12.539 -4.102  10.350  1.00 0.00 ? 137 LEU A HD22 2  
ATOM 3818  H HD23 . LEU A 1 137 ? -11.211 -5.257  10.269  1.00 0.00 ? 137 LEU A HD23 2  
ATOM 3819  N N    . SER A 1 138 ? -14.484 -8.766  8.065   1.00 0.00 ? 138 SER A N    2  
ATOM 3820  C CA   . SER A 1 138 ? -14.124 -10.149 8.278   1.00 0.00 ? 138 SER A CA   2  
ATOM 3821  C C    . SER A 1 138 ? -12.715 -10.225 8.897   1.00 0.00 ? 138 SER A C    2  
ATOM 3822  O O    . SER A 1 138 ? -11.990 -9.230  8.815   1.00 0.00 ? 138 SER A O    2  
ATOM 3823  C CB   . SER A 1 138 ? -14.169 -10.904 6.952   1.00 0.00 ? 138 SER A CB   2  
ATOM 3824  O OG   . SER A 1 138 ? -15.455 -10.791 6.342   1.00 0.00 ? 138 SER A OG   2  
ATOM 3825  H H    . SER A 1 138 ? -14.176 -8.308  7.251   1.00 0.00 ? 138 SER A H    2  
ATOM 3826  H HA   . SER A 1 138 ? -14.838 -10.581 8.962   1.00 0.00 ? 138 SER A HA   2  
ATOM 3827  H HB2  . SER A 1 138 ? -13.422 -10.490 6.292   1.00 0.00 ? 138 SER A HB2  2  
ATOM 3828  H HB3  . SER A 1 138 ? -13.955 -11.946 7.123   1.00 0.00 ? 138 SER A HB3  2  
ATOM 3829  H HG   . SER A 1 138 ? -15.858 -9.986  6.695   1.00 0.00 ? 138 SER A HG   2  
ATOM 3830  N N    . SER A 1 139 ? -12.311 -11.350 9.460   1.00 0.00 ? 139 SER A N    2  
ATOM 3831  C CA   . SER A 1 139 ? -11.027 -11.431 10.184  1.00 0.00 ? 139 SER A CA   2  
ATOM 3832  C C    . SER A 1 139 ? -9.804  -11.101 9.290   1.00 0.00 ? 139 SER A C    2  
ATOM 3833  O O    . SER A 1 139 ? -8.842  -10.461 9.748   1.00 0.00 ? 139 SER A O    2  
ATOM 3834  C CB   . SER A 1 139 ? -10.867 -12.817 10.854  1.00 0.00 ? 139 SER A CB   2  
ATOM 3835  O OG   . SER A 1 139 ? -9.696  -12.880 11.681  1.00 0.00 ? 139 SER A OG   2  
ATOM 3836  H H    . SER A 1 139 ? -12.880 -12.149 9.404   1.00 0.00 ? 139 SER A H    2  
ATOM 3837  H HA   . SER A 1 139 ? -11.067 -10.684 10.963  1.00 0.00 ? 139 SER A HA   2  
ATOM 3838  H HB2  . SER A 1 139 ? -11.729 -13.017 11.471  1.00 0.00 ? 139 SER A HB2  2  
ATOM 3839  H HB3  . SER A 1 139 ? -10.793 -13.574 10.089  1.00 0.00 ? 139 SER A HB3  2  
ATOM 3840  H HG   . SER A 1 139 ? -9.779  -12.200 12.367  1.00 0.00 ? 139 SER A HG   2  
ATOM 3841  N N    . ASP A 1 140 ? -9.870  -11.462 8.013   1.00 0.00 ? 140 ASP A N    2  
ATOM 3842  C CA   . ASP A 1 140 ? -8.736  -11.247 7.106   1.00 0.00 ? 140 ASP A CA   2  
ATOM 3843  C C    . ASP A 1 140 ? -8.722  -9.807  6.608   1.00 0.00 ? 140 ASP A C    2  
ATOM 3844  O O    . ASP A 1 140 ? -7.736  -9.327  6.065   1.00 0.00 ? 140 ASP A O    2  
ATOM 3845  C CB   . ASP A 1 140 ? -8.796  -12.220 5.919   1.00 0.00 ? 140 ASP A CB   2  
ATOM 3846  C CG   . ASP A 1 140 ? -7.497  -12.286 5.142   1.00 0.00 ? 140 ASP A CG   2  
ATOM 3847  O OD1  . ASP A 1 140 ? -6.499  -12.823 5.695   1.00 0.00 ? 140 ASP A OD1  2  
ATOM 3848  O OD2  . ASP A 1 140 ? -7.434  -11.838 3.995   1.00 0.00 ? 140 ASP A OD2  2  
ATOM 3849  H H    . ASP A 1 140 ? -10.682 -11.900 7.676   1.00 0.00 ? 140 ASP A H    2  
ATOM 3850  H HA   . ASP A 1 140 ? -7.828  -11.426 7.664   1.00 0.00 ? 140 ASP A HA   2  
ATOM 3851  H HB2  . ASP A 1 140 ? -9.026  -13.213 6.278   1.00 0.00 ? 140 ASP A HB2  2  
ATOM 3852  H HB3  . ASP A 1 140 ? -9.579  -11.900 5.247   1.00 0.00 ? 140 ASP A HB3  2  
ATOM 3853  N N    . GLY A 1 141 ? -9.800  -9.107  6.871   1.00 0.00 ? 141 GLY A N    2  
ATOM 3854  C CA   . GLY A 1 141 ? -9.904  -7.745  6.454   1.00 0.00 ? 141 GLY A CA   2  
ATOM 3855  C C    . GLY A 1 141 ? -10.924 -7.532  5.364   1.00 0.00 ? 141 GLY A C    2  
ATOM 3856  O O    . GLY A 1 141 ? -11.054 -6.432  4.861   1.00 0.00 ? 141 GLY A O    2  
ATOM 3857  H H    . GLY A 1 141 ? -10.512 -9.511  7.411   1.00 0.00 ? 141 GLY A H    2  
ATOM 3858  H HA2  . GLY A 1 141 ? -10.180 -7.147  7.309   1.00 0.00 ? 141 GLY A HA2  2  
ATOM 3859  H HA3  . GLY A 1 141 ? -8.938  -7.416  6.099   1.00 0.00 ? 141 GLY A HA3  2  
ATOM 3860  N N    . VAL A 1 142 ? -11.701 -8.559  5.046   1.00 0.00 ? 142 VAL A N    2  
ATOM 3861  C CA   . VAL A 1 142 ? -12.675 -8.446  3.955   1.00 0.00 ? 142 VAL A CA   2  
ATOM 3862  C C    . VAL A 1 142 ? -13.813 -7.539  4.412   1.00 0.00 ? 142 VAL A C    2  
ATOM 3863  O O    . VAL A 1 142 ? -14.346 -7.706  5.517   1.00 0.00 ? 142 VAL A O    2  
ATOM 3864  C CB   . VAL A 1 142 ? -13.228 -9.833  3.524   1.00 0.00 ? 142 VAL A CB   2  
ATOM 3865  C CG1  . VAL A 1 142 ? -14.163 -9.710  2.326   1.00 0.00 ? 142 VAL A CG1  2  
ATOM 3866  C CG2  . VAL A 1 142 ? -12.085 -10.783 3.209   1.00 0.00 ? 142 VAL A CG2  2  
ATOM 3867  H H    . VAL A 1 142 ? -11.596 -9.393  5.544   1.00 0.00 ? 142 VAL A H    2  
ATOM 3868  H HA   . VAL A 1 142 ? -12.191 -7.967  3.116   1.00 0.00 ? 142 VAL A HA   2  
ATOM 3869  H HB   . VAL A 1 142 ? -13.797 -10.246 4.342   1.00 0.00 ? 142 VAL A HB   2  
ATOM 3870  H HG11 . VAL A 1 142 ? -14.537 -10.687 2.056   1.00 0.00 ? 142 VAL A HG11 2  
ATOM 3871  H HG12 . VAL A 1 142 ? -13.626 -9.291  1.488   1.00 0.00 ? 142 VAL A HG12 2  
ATOM 3872  H HG13 . VAL A 1 142 ? -14.992 -9.065  2.579   1.00 0.00 ? 142 VAL A HG13 2  
ATOM 3873  H HG21 . VAL A 1 142 ? -12.488 -11.749 2.947   1.00 0.00 ? 142 VAL A HG21 2  
ATOM 3874  H HG22 . VAL A 1 142 ? -11.454 -10.885 4.082   1.00 0.00 ? 142 VAL A HG22 2  
ATOM 3875  H HG23 . VAL A 1 142 ? -11.505 -10.395 2.385   1.00 0.00 ? 142 VAL A HG23 2  
ATOM 3876  N N    . LEU A 1 143 ? -14.186 -6.592  3.581   1.00 0.00 ? 143 LEU A N    2  
ATOM 3877  C CA   . LEU A 1 143 ? -15.068 -5.529  4.011   1.00 0.00 ? 143 LEU A CA   2  
ATOM 3878  C C    . LEU A 1 143 ? -16.390 -5.607  3.259   1.00 0.00 ? 143 LEU A C    2  
ATOM 3879  O O    . LEU A 1 143 ? -16.413 -5.835  2.072   1.00 0.00 ? 143 LEU A O    2  
ATOM 3880  C CB   . LEU A 1 143 ? -14.321 -4.177  3.784   1.00 0.00 ? 143 LEU A CB   2  
ATOM 3881  C CG   . LEU A 1 143 ? -14.881 -2.875  4.413   1.00 0.00 ? 143 LEU A CG   2  
ATOM 3882  C CD1  . LEU A 1 143 ? -16.169 -2.424  3.770   1.00 0.00 ? 143 LEU A CD1  2  
ATOM 3883  C CD2  . LEU A 1 143 ? -15.056 -3.026  5.914   1.00 0.00 ? 143 LEU A CD2  2  
ATOM 3884  H H    . LEU A 1 143 ? -13.899 -6.610  2.638   1.00 0.00 ? 143 LEU A H    2  
ATOM 3885  H HA   . LEU A 1 143 ? -15.250 -5.647  5.068   1.00 0.00 ? 143 LEU A HA   2  
ATOM 3886  H HB2  . LEU A 1 143 ? -13.316 -4.299  4.159   1.00 0.00 ? 143 LEU A HB2  2  
ATOM 3887  H HB3  . LEU A 1 143 ? -14.252 -4.029  2.717   1.00 0.00 ? 143 LEU A HB3  2  
ATOM 3888  H HG   . LEU A 1 143 ? -14.160 -2.089  4.248   1.00 0.00 ? 143 LEU A HG   2  
ATOM 3889  H HD11 . LEU A 1 143 ? -16.520 -1.528  4.259   1.00 0.00 ? 143 LEU A HD11 2  
ATOM 3890  H HD12 . LEU A 1 143 ? -16.910 -3.204  3.863   1.00 0.00 ? 143 LEU A HD12 2  
ATOM 3891  H HD13 . LEU A 1 143 ? -15.993 -2.217  2.725   1.00 0.00 ? 143 LEU A HD13 2  
ATOM 3892  H HD21 . LEU A 1 143 ? -14.104 -3.270  6.362   1.00 0.00 ? 143 LEU A HD21 2  
ATOM 3893  H HD22 . LEU A 1 143 ? -15.764 -3.815  6.121   1.00 0.00 ? 143 LEU A HD22 2  
ATOM 3894  H HD23 . LEU A 1 143 ? -15.419 -2.097  6.328   1.00 0.00 ? 143 LEU A HD23 2  
ATOM 3895  N N    . THR A 1 144 ? -17.473 -5.480  3.966   1.00 0.00 ? 144 THR A N    2  
ATOM 3896  C CA   . THR A 1 144 ? -18.784 -5.502  3.364   1.00 0.00 ? 144 THR A CA   2  
ATOM 3897  C C    . THR A 1 144 ? -19.521 -4.194  3.681   1.00 0.00 ? 144 THR A C    2  
ATOM 3898  O O    . THR A 1 144 ? -19.584 -3.799  4.839   1.00 0.00 ? 144 THR A O    2  
ATOM 3899  C CB   . THR A 1 144 ? -19.573 -6.710  3.906   1.00 0.00 ? 144 THR A CB   2  
ATOM 3900  O OG1  . THR A 1 144 ? -18.749 -7.899  3.793   1.00 0.00 ? 144 THR A OG1  2  
ATOM 3901  C CG2  . THR A 1 144 ? -20.856 -6.923  3.120   1.00 0.00 ? 144 THR A CG2  2  
ATOM 3902  H H    . THR A 1 144 ? -17.407 -5.360  4.940   1.00 0.00 ? 144 THR A H    2  
ATOM 3903  H HA   . THR A 1 144 ? -18.671 -5.605  2.296   1.00 0.00 ? 144 THR A HA   2  
ATOM 3904  H HB   . THR A 1 144 ? -19.807 -6.535  4.945   1.00 0.00 ? 144 THR A HB   2  
ATOM 3905  H HG1  . THR A 1 144 ? -18.482 -8.009  2.866   1.00 0.00 ? 144 THR A HG1  2  
ATOM 3906  H HG21 . THR A 1 144 ? -20.620 -7.103  2.082   1.00 0.00 ? 144 THR A HG21 2  
ATOM 3907  H HG22 . THR A 1 144 ? -21.478 -6.044  3.200   1.00 0.00 ? 144 THR A HG22 2  
ATOM 3908  H HG23 . THR A 1 144 ? -21.386 -7.775  3.521   1.00 0.00 ? 144 THR A HG23 2  
ATOM 3909  N N    . VAL A 1 145 ? -20.038 -3.532  2.674   1.00 0.00 ? 145 VAL A N    2  
ATOM 3910  C CA   . VAL A 1 145 ? -20.818 -2.317  2.849   1.00 0.00 ? 145 VAL A CA   2  
ATOM 3911  C C    . VAL A 1 145 ? -22.249 -2.579  2.400   1.00 0.00 ? 145 VAL A C    2  
ATOM 3912  O O    . VAL A 1 145 ? -22.486 -3.054  1.299   1.00 0.00 ? 145 VAL A O    2  
ATOM 3913  C CB   . VAL A 1 145 ? -20.219 -1.080  2.099   1.00 0.00 ? 145 VAL A CB   2  
ATOM 3914  C CG1  . VAL A 1 145 ? -18.934 -0.616  2.743   1.00 0.00 ? 145 VAL A CG1  2  
ATOM 3915  C CG2  . VAL A 1 145 ? -19.975 -1.388  0.634   1.00 0.00 ? 145 VAL A CG2  2  
ATOM 3916  H H    . VAL A 1 145 ? -19.949 -3.882  1.757   1.00 0.00 ? 145 VAL A H    2  
ATOM 3917  H HA   . VAL A 1 145 ? -20.841 -2.116  3.911   1.00 0.00 ? 145 VAL A HA   2  
ATOM 3918  H HB   . VAL A 1 145 ? -20.934 -0.272  2.160   1.00 0.00 ? 145 VAL A HB   2  
ATOM 3919  H HG11 . VAL A 1 145 ? -19.120 -0.338  3.769   1.00 0.00 ? 145 VAL A HG11 2  
ATOM 3920  H HG12 . VAL A 1 145 ? -18.547 0.235   2.203   1.00 0.00 ? 145 VAL A HG12 2  
ATOM 3921  H HG13 . VAL A 1 145 ? -18.213 -1.419  2.716   1.00 0.00 ? 145 VAL A HG13 2  
ATOM 3922  H HG21 . VAL A 1 145 ? -19.417 -2.309  0.539   1.00 0.00 ? 145 VAL A HG21 2  
ATOM 3923  H HG22 . VAL A 1 145 ? -19.446 -0.575  0.165   1.00 0.00 ? 145 VAL A HG22 2  
ATOM 3924  H HG23 . VAL A 1 145 ? -20.942 -1.490  0.168   1.00 0.00 ? 145 VAL A HG23 2  
ATOM 3925  N N    . ASN A 1 146 ? -23.180 -2.321  3.248   1.00 0.00 ? 146 ASN A N    2  
ATOM 3926  C CA   . ASN A 1 146 ? -24.565 -2.623  2.945   1.00 0.00 ? 146 ASN A CA   2  
ATOM 3927  C C    . ASN A 1 146 ? -25.496 -1.464  3.250   1.00 0.00 ? 146 ASN A C    2  
ATOM 3928  O O    . ASN A 1 146 ? -25.341 -0.773  4.267   1.00 0.00 ? 146 ASN A O    2  
ATOM 3929  C CB   . ASN A 1 146 ? -25.023 -3.910  3.663   1.00 0.00 ? 146 ASN A CB   2  
ATOM 3930  C CG   . ASN A 1 146 ? -24.898 -3.878  5.194   1.00 0.00 ? 146 ASN A CG   2  
ATOM 3931  O OD1  . ASN A 1 146 ? -24.015 -3.230  5.771   1.00 0.00 ? 146 ASN A OD1  2  
ATOM 3932  N ND2  . ASN A 1 146 ? -25.779 -4.572  5.859   1.00 0.00 ? 146 ASN A ND2  2  
ATOM 3933  H H    . ASN A 1 146 ? -22.949 -1.927  4.119   1.00 0.00 ? 146 ASN A H    2  
ATOM 3934  H HA   . ASN A 1 146 ? -24.613 -2.804  1.882   1.00 0.00 ? 146 ASN A HA   2  
ATOM 3935  H HB2  . ASN A 1 146 ? -26.062 -4.085  3.425   1.00 0.00 ? 146 ASN A HB2  2  
ATOM 3936  H HB3  . ASN A 1 146 ? -24.439 -4.738  3.289   1.00 0.00 ? 146 ASN A HB3  2  
ATOM 3937  H HD21 . ASN A 1 146 ? -26.458 -5.062  5.347   1.00 0.00 ? 146 ASN A HD21 2  
ATOM 3938  H HD22 . ASN A 1 146 ? -25.732 -4.599  6.837   1.00 0.00 ? 146 ASN A HD22 2  
ATOM 3939  N N    . GLY A 1 147 ? -26.437 -1.247  2.355   1.00 0.00 ? 147 GLY A N    2  
ATOM 3940  C CA   . GLY A 1 147 ? -27.397 -0.190  2.499   1.00 0.00 ? 147 GLY A CA   2  
ATOM 3941  C C    . GLY A 1 147 ? -28.356 -0.138  1.311   1.00 0.00 ? 147 GLY A C    2  
ATOM 3942  O O    . GLY A 1 147 ? -28.699 -1.179  0.762   1.00 0.00 ? 147 GLY A O    2  
ATOM 3943  H H    . GLY A 1 147 ? -26.500 -1.822  1.557   1.00 0.00 ? 147 GLY A H    2  
ATOM 3944  H HA2  . GLY A 1 147 ? -27.964 -0.366  3.402   1.00 0.00 ? 147 GLY A HA2  2  
ATOM 3945  H HA3  . GLY A 1 147 ? -26.886 0.752   2.589   1.00 0.00 ? 147 GLY A HA3  2  
ATOM 3946  N N    . PRO A 1 148 ? -28.798 1.052   0.882   1.00 0.00 ? 148 PRO A N    2  
ATOM 3947  C CA   . PRO A 1 148 ? -29.751 1.198   -0.196  1.00 0.00 ? 148 PRO A CA   2  
ATOM 3948  C C    . PRO A 1 148 ? -29.119 1.360   -1.581  1.00 0.00 ? 148 PRO A C    2  
ATOM 3949  O O    . PRO A 1 148 ? -28.118 2.072   -1.773  1.00 0.00 ? 148 PRO A O    2  
ATOM 3950  C CB   . PRO A 1 148 ? -30.516 2.476   0.174   1.00 0.00 ? 148 PRO A CB   2  
ATOM 3951  C CG   . PRO A 1 148 ? -29.710 3.136   1.253   1.00 0.00 ? 148 PRO A CG   2  
ATOM 3952  C CD   . PRO A 1 148 ? -28.430 2.347   1.397   1.00 0.00 ? 148 PRO A CD   2  
ATOM 3953  H HA   . PRO A 1 148 ? -30.451 0.375   -0.217  1.00 0.00 ? 148 PRO A HA   2  
ATOM 3954  H HB2  . PRO A 1 148 ? -30.600 3.106   -0.700  1.00 0.00 ? 148 PRO A HB2  2  
ATOM 3955  H HB3  . PRO A 1 148 ? -31.502 2.213   0.527   1.00 0.00 ? 148 PRO A HB3  2  
ATOM 3956  H HG2  . PRO A 1 148 ? -29.494 4.159   0.983   1.00 0.00 ? 148 PRO A HG2  2  
ATOM 3957  H HG3  . PRO A 1 148 ? -30.276 3.111   2.172   1.00 0.00 ? 148 PRO A HG3  2  
ATOM 3958  H HD2  . PRO A 1 148 ? -27.646 2.789   0.801   1.00 0.00 ? 148 PRO A HD2  2  
ATOM 3959  H HD3  . PRO A 1 148 ? -28.125 2.289   2.432   1.00 0.00 ? 148 PRO A HD3  2  
ATOM 3960  N N    . ARG A 1 149 ? -29.732 0.699   -2.510  1.00 0.00 ? 149 ARG A N    2  
ATOM 3961  C CA   . ARG A 1 149 ? -29.419 0.732   -3.909  1.00 0.00 ? 149 ARG A CA   2  
ATOM 3962  C C    . ARG A 1 149 ? -30.476 1.592   -4.552  1.00 0.00 ? 149 ARG A C    2  
ATOM 3963  O O    . ARG A 1 149 ? -31.658 1.478   -4.193  1.00 0.00 ? 149 ARG A O    2  
ATOM 3964  C CB   . ARG A 1 149 ? -29.514 -0.696  -4.410  1.00 0.00 ? 149 ARG A CB   2  
ATOM 3965  C CG   . ARG A 1 149 ? -29.308 -0.956  -5.886  1.00 0.00 ? 149 ARG A CG   2  
ATOM 3966  C CD   . ARG A 1 149 ? -29.496 -2.437  -6.110  1.00 0.00 ? 149 ARG A CD   2  
ATOM 3967  N NE   . ARG A 1 149 ? -29.386 -2.878  -7.492  1.00 0.00 ? 149 ARG A NE   2  
ATOM 3968  C CZ   . ARG A 1 149 ? -29.804 -4.087  -7.904  1.00 0.00 ? 149 ARG A CZ   2  
ATOM 3969  N NH1  . ARG A 1 149 ? -30.519 -4.865  -7.076  1.00 0.00 ? 149 ARG A NH1  2  
ATOM 3970  N NH2  . ARG A 1 149 ? -29.560 -4.497  -9.144  1.00 0.00 ? 149 ARG A NH2  2  
ATOM 3971  H H    . ARG A 1 149 ? -30.486 0.124   -2.247  1.00 0.00 ? 149 ARG A H    2  
ATOM 3972  H HA   . ARG A 1 149 ? -28.426 1.123   -4.073  1.00 0.00 ? 149 ARG A HA   2  
ATOM 3973  H HB2  . ARG A 1 149 ? -28.755 -1.256  -3.888  1.00 0.00 ? 149 ARG A HB2  2  
ATOM 3974  H HB3  . ARG A 1 149 ? -30.481 -1.085  -4.122  1.00 0.00 ? 149 ARG A HB3  2  
ATOM 3975  H HG2  . ARG A 1 149 ? -30.028 -0.396  -6.462  1.00 0.00 ? 149 ARG A HG2  2  
ATOM 3976  H HG3  . ARG A 1 149 ? -28.303 -0.687  -6.168  1.00 0.00 ? 149 ARG A HG3  2  
ATOM 3977  H HD2  . ARG A 1 149 ? -28.748 -2.965  -5.539  1.00 0.00 ? 149 ARG A HD2  2  
ATOM 3978  H HD3  . ARG A 1 149 ? -30.472 -2.710  -5.735  1.00 0.00 ? 149 ARG A HD3  2  
ATOM 3979  H HE   . ARG A 1 149 ? -28.933 -2.259  -8.110  1.00 0.00 ? 149 ARG A HE   2  
ATOM 3980  H HH11 . ARG A 1 149 ? -30.784 -4.598  -6.135  1.00 0.00 ? 149 ARG A HH11 2  
ATOM 3981  H HH12 . ARG A 1 149 ? -30.803 -5.790  -7.344  1.00 0.00 ? 149 ARG A HH12 2  
ATOM 3982  H HH21 . ARG A 1 149 ? -29.065 -3.933  -9.812  1.00 0.00 ? 149 ARG A HH21 2  
ATOM 3983  H HH22 . ARG A 1 149 ? -29.865 -5.401  -9.462  1.00 0.00 ? 149 ARG A HH22 2  
ATOM 3984  N N    . LYS A 1 150 ? -30.087 2.444   -5.449  1.00 0.00 ? 150 LYS A N    2  
ATOM 3985  C CA   . LYS A 1 150 ? -30.988 3.380   -6.060  1.00 0.00 ? 150 LYS A CA   2  
ATOM 3986  C C    . LYS A 1 150 ? -31.133 3.072   -7.546  1.00 0.00 ? 150 LYS A C    2  
ATOM 3987  O O    . LYS A 1 150 ? -30.342 3.585   -8.359  1.00 0.00 ? 150 LYS A O    2  
ATOM 3988  C CB   . LYS A 1 150 ? -30.465 4.795   -5.833  1.00 0.00 ? 150 LYS A CB   2  
ATOM 3989  C CG   . LYS A 1 150 ? -31.395 5.917   -6.288  1.00 0.00 ? 150 LYS A CG   2  
ATOM 3990  C CD   . LYS A 1 150 ? -30.804 7.286   -5.965  1.00 0.00 ? 150 LYS A CD   2  
ATOM 3991  C CE   . LYS A 1 150 ? -30.540 7.434   -4.469  1.00 0.00 ? 150 LYS A CE   2  
ATOM 3992  N NZ   . LYS A 1 150 ? -29.919 8.723   -4.123  1.00 0.00 ? 150 LYS A NZ   2  
ATOM 3993  H H    . LYS A 1 150 ? -29.157 2.442   -5.772  1.00 0.00 ? 150 LYS A H    2  
ATOM 3994  H HA   . LYS A 1 150 ? -31.952 3.283   -5.584  1.00 0.00 ? 150 LYS A HA   2  
ATOM 3995  H HB2  . LYS A 1 150 ? -30.296 4.899   -4.774  1.00 0.00 ? 150 LYS A HB2  2  
ATOM 3996  H HB3  . LYS A 1 150 ? -29.519 4.900   -6.346  1.00 0.00 ? 150 LYS A HB3  2  
ATOM 3997  H HG2  . LYS A 1 150 ? -31.545 5.839   -7.355  1.00 0.00 ? 150 LYS A HG2  2  
ATOM 3998  H HG3  . LYS A 1 150 ? -32.343 5.812   -5.780  1.00 0.00 ? 150 LYS A HG3  2  
ATOM 3999  H HD2  . LYS A 1 150 ? -29.874 7.405   -6.502  1.00 0.00 ? 150 LYS A HD2  2  
ATOM 4000  H HD3  . LYS A 1 150 ? -31.500 8.052   -6.275  1.00 0.00 ? 150 LYS A HD3  2  
ATOM 4001  H HE2  . LYS A 1 150 ? -31.472 7.345   -3.932  1.00 0.00 ? 150 LYS A HE2  2  
ATOM 4002  H HE3  . LYS A 1 150 ? -29.877 6.646   -4.146  1.00 0.00 ? 150 LYS A HE3  2  
ATOM 4003  H HZ1  . LYS A 1 150 ? -29.739 8.718   -3.093  1.00 0.00 ? 150 LYS A HZ1  2  
ATOM 4004  H HZ2  . LYS A 1 150 ? -30.562 9.511   -4.335  1.00 0.00 ? 150 LYS A HZ2  2  
ATOM 4005  H HZ3  . LYS A 1 150 ? -29.009 8.852   -4.611  1.00 0.00 ? 150 LYS A HZ3  2  
ATOM 4006  N N    . ARG B 1 69  ? 38.979  7.205   9.667   1.00 0.00 ? 69  ARG B N    2  
ATOM 4007  C CA   . ARG B 1 69  ? 37.923  6.551   10.413  1.00 0.00 ? 69  ARG B CA   2  
ATOM 4008  C C    . ARG B 1 69  ? 36.668  6.517   9.532   1.00 0.00 ? 69  ARG B C    2  
ATOM 4009  O O    . ARG B 1 69  ? 35.601  7.039   9.860   1.00 0.00 ? 69  ARG B O    2  
ATOM 4010  C CB   . ARG B 1 69  ? 37.677  7.265   11.758  1.00 0.00 ? 69  ARG B CB   2  
ATOM 4011  C CG   . ARG B 1 69  ? 36.609  6.621   12.639  1.00 0.00 ? 69  ARG B CG   2  
ATOM 4012  C CD   . ARG B 1 69  ? 36.493  7.329   13.973  1.00 0.00 ? 69  ARG B CD   2  
ATOM 4013  N NE   . ARG B 1 69  ? 37.700  7.148   14.785  1.00 0.00 ? 69  ARG B NE   2  
ATOM 4014  C CZ   . ARG B 1 69  ? 38.199  8.036   15.644  1.00 0.00 ? 69  ARG B CZ   2  
ATOM 4015  N NH1  . ARG B 1 69  ? 37.650  9.252   15.753  1.00 0.00 ? 69  ARG B NH1  2  
ATOM 4016  N NH2  . ARG B 1 69  ? 39.271  7.717   16.371  1.00 0.00 ? 69  ARG B NH2  2  
ATOM 4017  H H    . ARG B 1 69  ? 39.080  8.178   9.775   1.00 0.00 ? 69  ARG B H    2  
ATOM 4018  H HA   . ARG B 1 69  ? 38.239  5.533   10.587  1.00 0.00 ? 69  ARG B HA   2  
ATOM 4019  H HB2  . ARG B 1 69  ? 38.603  7.283   12.314  1.00 0.00 ? 69  ARG B HB2  2  
ATOM 4020  H HB3  . ARG B 1 69  ? 37.378  8.284   11.552  1.00 0.00 ? 69  ARG B HB3  2  
ATOM 4021  H HG2  . ARG B 1 69  ? 35.658  6.676   12.130  1.00 0.00 ? 69  ARG B HG2  2  
ATOM 4022  H HG3  . ARG B 1 69  ? 36.870  5.587   12.806  1.00 0.00 ? 69  ARG B HG3  2  
ATOM 4023  H HD2  . ARG B 1 69  ? 36.347  8.383   13.789  1.00 0.00 ? 69  ARG B HD2  2  
ATOM 4024  H HD3  . ARG B 1 69  ? 35.644  6.934   14.509  1.00 0.00 ? 69  ARG B HD3  2  
ATOM 4025  H HE   . ARG B 1 69  ? 38.122  6.265   14.671  1.00 0.00 ? 69  ARG B HE   2  
ATOM 4026  H HH11 . ARG B 1 69  ? 36.860  9.545   15.207  1.00 0.00 ? 69  ARG B HH11 2  
ATOM 4027  H HH12 . ARG B 1 69  ? 38.005  9.926   16.407  1.00 0.00 ? 69  ARG B HH12 2  
ATOM 4028  H HH21 . ARG B 1 69  ? 39.720  6.822   16.287  1.00 0.00 ? 69  ARG B HH21 2  
ATOM 4029  H HH22 . ARG B 1 69  ? 39.689  8.349   17.031  1.00 0.00 ? 69  ARG B HH22 2  
ATOM 4030  N N    . LEU B 1 70  ? 36.854  5.946   8.395   1.00 0.00 ? 70  LEU B N    2  
ATOM 4031  C CA   . LEU B 1 70  ? 35.845  5.749   7.420   1.00 0.00 ? 70  LEU B CA   2  
ATOM 4032  C C    . LEU B 1 70  ? 36.165  4.407   6.840   1.00 0.00 ? 70  LEU B C    2  
ATOM 4033  O O    . LEU B 1 70  ? 37.049  4.280   5.992   1.00 0.00 ? 70  LEU B O    2  
ATOM 4034  C CB   . LEU B 1 70  ? 35.924  6.863   6.337   1.00 0.00 ? 70  LEU B CB   2  
ATOM 4035  C CG   . LEU B 1 70  ? 34.733  7.030   5.347   1.00 0.00 ? 70  LEU B CG   2  
ATOM 4036  C CD1  . LEU B 1 70  ? 34.984  8.207   4.436   1.00 0.00 ? 70  LEU B CD1  2  
ATOM 4037  C CD2  . LEU B 1 70  ? 34.487  5.789   4.498   1.00 0.00 ? 70  LEU B CD2  2  
ATOM 4038  H H    . LEU B 1 70  ? 37.753  5.607   8.189   1.00 0.00 ? 70  LEU B H    2  
ATOM 4039  H HA   . LEU B 1 70  ? 34.874  5.741   7.893   1.00 0.00 ? 70  LEU B HA   2  
ATOM 4040  H HB2  . LEU B 1 70  ? 36.052  7.804   6.850   1.00 0.00 ? 70  LEU B HB2  2  
ATOM 4041  H HB3  . LEU B 1 70  ? 36.817  6.682   5.758   1.00 0.00 ? 70  LEU B HB3  2  
ATOM 4042  H HG   . LEU B 1 70  ? 33.839  7.247   5.915   1.00 0.00 ? 70  LEU B HG   2  
ATOM 4043  H HD11 . LEU B 1 70  ? 35.886  8.037   3.868   1.00 0.00 ? 70  LEU B HD11 2  
ATOM 4044  H HD12 . LEU B 1 70  ? 35.102  9.104   5.027   1.00 0.00 ? 70  LEU B HD12 2  
ATOM 4045  H HD13 . LEU B 1 70  ? 34.150  8.326   3.759   1.00 0.00 ? 70  LEU B HD13 2  
ATOM 4046  H HD21 . LEU B 1 70  ? 33.648  5.967   3.842   1.00 0.00 ? 70  LEU B HD21 2  
ATOM 4047  H HD22 . LEU B 1 70  ? 34.270  4.948   5.141   1.00 0.00 ? 70  LEU B HD22 2  
ATOM 4048  H HD23 . LEU B 1 70  ? 35.367  5.574   3.909   1.00 0.00 ? 70  LEU B HD23 2  
ATOM 4049  N N    . GLU B 1 71  ? 35.533  3.410   7.355   1.00 0.00 ? 71  GLU B N    2  
ATOM 4050  C CA   . GLU B 1 71  ? 35.767  2.076   6.913   1.00 0.00 ? 71  GLU B CA   2  
ATOM 4051  C C    . GLU B 1 71  ? 35.162  1.864   5.551   1.00 0.00 ? 71  GLU B C    2  
ATOM 4052  O O    . GLU B 1 71  ? 34.074  2.358   5.249   1.00 0.00 ? 71  GLU B O    2  
ATOM 4053  C CB   . GLU B 1 71  ? 35.237  1.072   7.922   1.00 0.00 ? 71  GLU B CB   2  
ATOM 4054  C CG   . GLU B 1 71  ? 35.971  1.116   9.247   1.00 0.00 ? 71  GLU B CG   2  
ATOM 4055  C CD   . GLU B 1 71  ? 35.404  0.167   10.259  1.00 0.00 ? 71  GLU B CD   2  
ATOM 4056  O OE1  . GLU B 1 71  ? 35.674  -1.052  10.174  1.00 0.00 ? 71  GLU B OE1  2  
ATOM 4057  O OE2  . GLU B 1 71  ? 34.664  0.614   11.157  1.00 0.00 ? 71  GLU B OE2  2  
ATOM 4058  H H    . GLU B 1 71  ? 34.856  3.578   8.045   1.00 0.00 ? 71  GLU B H    2  
ATOM 4059  H HA   . GLU B 1 71  ? 36.836  1.951   6.830   1.00 0.00 ? 71  GLU B HA   2  
ATOM 4060  H HB2  . GLU B 1 71  ? 34.192  1.274   8.101   1.00 0.00 ? 71  GLU B HB2  2  
ATOM 4061  H HB3  . GLU B 1 71  ? 35.340  0.079   7.511   1.00 0.00 ? 71  GLU B HB3  2  
ATOM 4062  H HG2  . GLU B 1 71  ? 37.002  0.848   9.074   1.00 0.00 ? 71  GLU B HG2  2  
ATOM 4063  H HG3  . GLU B 1 71  ? 35.926  2.121   9.639   1.00 0.00 ? 71  GLU B HG3  2  
ATOM 4064  N N    . LYS B 1 72  ? 35.888  1.203   4.709   1.00 0.00 ? 72  LYS B N    2  
ATOM 4065  C CA   . LYS B 1 72  ? 35.407  0.917   3.407   1.00 0.00 ? 72  LYS B CA   2  
ATOM 4066  C C    . LYS B 1 72  ? 35.169  -0.560  3.245   1.00 0.00 ? 72  LYS B C    2  
ATOM 4067  O O    . LYS B 1 72  ? 36.080  -1.380  3.369   1.00 0.00 ? 72  LYS B O    2  
ATOM 4068  C CB   . LYS B 1 72  ? 36.298  1.517   2.304   1.00 0.00 ? 72  LYS B CB   2  
ATOM 4069  C CG   . LYS B 1 72  ? 37.758  1.105   2.337   1.00 0.00 ? 72  LYS B CG   2  
ATOM 4070  C CD   . LYS B 1 72  ? 38.521  1.767   1.205   1.00 0.00 ? 72  LYS B CD   2  
ATOM 4071  C CE   . LYS B 1 72  ? 39.973  1.342   1.182   1.00 0.00 ? 72  LYS B CE   2  
ATOM 4072  N NZ   . LYS B 1 72  ? 40.723  1.998   0.090   1.00 0.00 ? 72  LYS B NZ   2  
ATOM 4073  H H    . LYS B 1 72  ? 36.775  0.889   4.980   1.00 0.00 ? 72  LYS B H    2  
ATOM 4074  H HA   . LYS B 1 72  ? 34.436  1.385   3.357   1.00 0.00 ? 72  LYS B HA   2  
ATOM 4075  H HB2  . LYS B 1 72  ? 35.900  1.225   1.344   1.00 0.00 ? 72  LYS B HB2  2  
ATOM 4076  H HB3  . LYS B 1 72  ? 36.249  2.594   2.379   1.00 0.00 ? 72  LYS B HB3  2  
ATOM 4077  H HG2  . LYS B 1 72  ? 38.187  1.408   3.282   1.00 0.00 ? 72  LYS B HG2  2  
ATOM 4078  H HG3  . LYS B 1 72  ? 37.824  0.032   2.232   1.00 0.00 ? 72  LYS B HG3  2  
ATOM 4079  H HD2  . LYS B 1 72  ? 38.065  1.488   0.267   1.00 0.00 ? 72  LYS B HD2  2  
ATOM 4080  H HD3  . LYS B 1 72  ? 38.467  2.839   1.321   1.00 0.00 ? 72  LYS B HD3  2  
ATOM 4081  H HE2  . LYS B 1 72  ? 40.428  1.601   2.126   1.00 0.00 ? 72  LYS B HE2  2  
ATOM 4082  H HE3  . LYS B 1 72  ? 40.016  0.272   1.047   1.00 0.00 ? 72  LYS B HE3  2  
ATOM 4083  H HZ1  . LYS B 1 72  ? 40.886  3.009   0.267   1.00 0.00 ? 72  LYS B HZ1  2  
ATOM 4084  H HZ2  . LYS B 1 72  ? 40.219  1.893   -0.815  1.00 0.00 ? 72  LYS B HZ2  2  
ATOM 4085  H HZ3  . LYS B 1 72  ? 41.647  1.537   -0.039  1.00 0.00 ? 72  LYS B HZ3  2  
ATOM 4086  N N    . ASP B 1 73  ? 33.937  -0.886  3.081   1.00 0.00 ? 73  ASP B N    2  
ATOM 4087  C CA   . ASP B 1 73  ? 33.487  -2.238  2.888   1.00 0.00 ? 73  ASP B CA   2  
ATOM 4088  C C    . ASP B 1 73  ? 32.327  -2.165  1.944   1.00 0.00 ? 73  ASP B C    2  
ATOM 4089  O O    . ASP B 1 73  ? 31.565  -1.201  2.001   1.00 0.00 ? 73  ASP B O    2  
ATOM 4090  C CB   . ASP B 1 73  ? 33.053  -2.838  4.243   1.00 0.00 ? 73  ASP B CB   2  
ATOM 4091  C CG   . ASP B 1 73  ? 32.490  -4.244  4.147   1.00 0.00 ? 73  ASP B CG   2  
ATOM 4092  O OD1  . ASP B 1 73  ? 33.220  -5.162  3.757   1.00 0.00 ? 73  ASP B OD1  2  
ATOM 4093  O OD2  . ASP B 1 73  ? 31.303  -4.447  4.463   1.00 0.00 ? 73  ASP B OD2  2  
ATOM 4094  H H    . ASP B 1 73  ? 33.245  -0.189  3.082   1.00 0.00 ? 73  ASP B H    2  
ATOM 4095  H HA   . ASP B 1 73  ? 34.285  -2.825  2.458   1.00 0.00 ? 73  ASP B HA   2  
ATOM 4096  H HB2  . ASP B 1 73  ? 33.911  -2.872  4.898   1.00 0.00 ? 73  ASP B HB2  2  
ATOM 4097  H HB3  . ASP B 1 73  ? 32.305  -2.196  4.685   1.00 0.00 ? 73  ASP B HB3  2  
ATOM 4098  N N    . ARG B 1 74  ? 32.215  -3.091  1.046   1.00 0.00 ? 74  ARG B N    2  
ATOM 4099  C CA   . ARG B 1 74  ? 31.110  -3.064  0.125   1.00 0.00 ? 74  ARG B CA   2  
ATOM 4100  C C    . ARG B 1 74  ? 30.025  -3.963  0.657   1.00 0.00 ? 74  ARG B C    2  
ATOM 4101  O O    . ARG B 1 74  ? 30.265  -5.133  0.971   1.00 0.00 ? 74  ARG B O    2  
ATOM 4102  C CB   . ARG B 1 74  ? 31.535  -3.422  -1.312  1.00 0.00 ? 74  ARG B CB   2  
ATOM 4103  C CG   . ARG B 1 74  ? 32.163  -4.788  -1.484  1.00 0.00 ? 74  ARG B CG   2  
ATOM 4104  C CD   . ARG B 1 74  ? 32.569  -5.025  -2.918  1.00 0.00 ? 74  ARG B CD   2  
ATOM 4105  N NE   . ARG B 1 74  ? 31.435  -4.898  -3.840  1.00 0.00 ? 74  ARG B NE   2  
ATOM 4106  C CZ   . ARG B 1 74  ? 31.413  -5.330  -5.099  1.00 0.00 ? 74  ARG B CZ   2  
ATOM 4107  N NH1  . ARG B 1 74  ? 32.419  -6.040  -5.590  1.00 0.00 ? 74  ARG B NH1  2  
ATOM 4108  N NH2  . ARG B 1 74  ? 30.365  -5.083  -5.853  1.00 0.00 ? 74  ARG B NH2  2  
ATOM 4109  H H    . ARG B 1 74  ? 32.857  -3.831  1.017   1.00 0.00 ? 74  ARG B H    2  
ATOM 4110  H HA   . ARG B 1 74  ? 30.724  -2.054  0.149   1.00 0.00 ? 74  ARG B HA   2  
ATOM 4111  H HB2  . ARG B 1 74  ? 30.663  -3.379  -1.947  1.00 0.00 ? 74  ARG B HB2  2  
ATOM 4112  H HB3  . ARG B 1 74  ? 32.244  -2.683  -1.655  1.00 0.00 ? 74  ARG B HB3  2  
ATOM 4113  H HG2  . ARG B 1 74  ? 33.042  -4.850  -0.860  1.00 0.00 ? 74  ARG B HG2  2  
ATOM 4114  H HG3  . ARG B 1 74  ? 31.447  -5.539  -1.187  1.00 0.00 ? 74  ARG B HG3  2  
ATOM 4115  H HD2  . ARG B 1 74  ? 33.327  -4.309  -3.195  1.00 0.00 ? 74  ARG B HD2  2  
ATOM 4116  H HD3  . ARG B 1 74  ? 32.970  -6.024  -2.997  1.00 0.00 ? 74  ARG B HD3  2  
ATOM 4117  H HE   . ARG B 1 74  ? 30.645  -4.439  -3.478  1.00 0.00 ? 74  ARG B HE   2  
ATOM 4118  H HH11 . ARG B 1 74  ? 33.225  -6.289  -5.048  1.00 0.00 ? 74  ARG B HH11 2  
ATOM 4119  H HH12 . ARG B 1 74  ? 32.405  -6.357  -6.545  1.00 0.00 ? 74  ARG B HH12 2  
ATOM 4120  H HH21 . ARG B 1 74  ? 29.566  -4.575  -5.516  1.00 0.00 ? 74  ARG B HH21 2  
ATOM 4121  H HH22 . ARG B 1 74  ? 30.318  -5.406  -6.802  1.00 0.00 ? 74  ARG B HH22 2  
ATOM 4122  N N    . PHE B 1 75  ? 28.865  -3.430  0.788   1.00 0.00 ? 75  PHE B N    2  
ATOM 4123  C CA   . PHE B 1 75  ? 27.813  -4.115  1.455   1.00 0.00 ? 75  PHE B CA   2  
ATOM 4124  C C    . PHE B 1 75  ? 26.584  -4.119  0.593   1.00 0.00 ? 75  PHE B C    2  
ATOM 4125  O O    . PHE B 1 75  ? 26.332  -3.172  -0.168  1.00 0.00 ? 75  PHE B O    2  
ATOM 4126  C CB   . PHE B 1 75  ? 27.562  -3.410  2.787   1.00 0.00 ? 75  PHE B CB   2  
ATOM 4127  C CG   . PHE B 1 75  ? 26.664  -4.118  3.757   1.00 0.00 ? 75  PHE B CG   2  
ATOM 4128  C CD1  . PHE B 1 75  ? 27.127  -5.211  4.464   1.00 0.00 ? 75  PHE B CD1  2  
ATOM 4129  C CD2  . PHE B 1 75  ? 25.374  -3.671  3.990   1.00 0.00 ? 75  PHE B CD2  2  
ATOM 4130  C CE1  . PHE B 1 75  ? 26.323  -5.850  5.382   1.00 0.00 ? 75  PHE B CE1  2  
ATOM 4131  C CE2  . PHE B 1 75  ? 24.562  -4.311  4.908   1.00 0.00 ? 75  PHE B CE2  2  
ATOM 4132  C CZ   . PHE B 1 75  ? 25.039  -5.400  5.604   1.00 0.00 ? 75  PHE B CZ   2  
ATOM 4133  H H    . PHE B 1 75  ? 28.674  -2.552  0.381   1.00 0.00 ? 75  PHE B H    2  
ATOM 4134  H HA   . PHE B 1 75  ? 28.125  -5.128  1.656   1.00 0.00 ? 75  PHE B HA   2  
ATOM 4135  H HB2  . PHE B 1 75  ? 28.518  -3.305  3.276   1.00 0.00 ? 75  PHE B HB2  2  
ATOM 4136  H HB3  . PHE B 1 75  ? 27.152  -2.430  2.591   1.00 0.00 ? 75  PHE B HB3  2  
ATOM 4137  H HD1  . PHE B 1 75  ? 28.132  -5.566  4.289   1.00 0.00 ? 75  PHE B HD1  2  
ATOM 4138  H HD2  . PHE B 1 75  ? 25.001  -2.816  3.445   1.00 0.00 ? 75  PHE B HD2  2  
ATOM 4139  H HE1  . PHE B 1 75  ? 26.698  -6.703  5.928   1.00 0.00 ? 75  PHE B HE1  2  
ATOM 4140  H HE2  . PHE B 1 75  ? 23.555  -3.960  5.083   1.00 0.00 ? 75  PHE B HE2  2  
ATOM 4141  H HZ   . PHE B 1 75  ? 24.409  -5.902  6.324   1.00 0.00 ? 75  PHE B HZ   2  
ATOM 4142  N N    . SER B 1 76  ? 25.852  -5.171  0.680   1.00 0.00 ? 76  SER B N    2  
ATOM 4143  C CA   . SER B 1 76  ? 24.665  -5.314  -0.059  1.00 0.00 ? 76  SER B CA   2  
ATOM 4144  C C    . SER B 1 76  ? 23.518  -5.426  0.933   1.00 0.00 ? 76  SER B C    2  
ATOM 4145  O O    . SER B 1 76  ? 23.577  -6.219  1.885   1.00 0.00 ? 76  SER B O    2  
ATOM 4146  C CB   . SER B 1 76  ? 24.776  -6.567  -0.954  1.00 0.00 ? 76  SER B CB   2  
ATOM 4147  O OG   . SER B 1 76  ? 23.695  -6.678  -1.869  1.00 0.00 ? 76  SER B OG   2  
ATOM 4148  H H    . SER B 1 76  ? 26.108  -5.897  1.290   1.00 0.00 ? 76  SER B H    2  
ATOM 4149  H HA   . SER B 1 76  ? 24.529  -4.442  -0.679  1.00 0.00 ? 76  SER B HA   2  
ATOM 4150  H HB2  . SER B 1 76  ? 25.696  -6.523  -1.518  1.00 0.00 ? 76  SER B HB2  2  
ATOM 4151  H HB3  . SER B 1 76  ? 24.791  -7.445  -0.325  1.00 0.00 ? 76  SER B HB3  2  
ATOM 4152  H HG   . SER B 1 76  ? 24.076  -6.656  -2.758  1.00 0.00 ? 76  SER B HG   2  
ATOM 4153  N N    . VAL B 1 77  ? 22.501  -4.648  0.730   1.00 0.00 ? 77  VAL B N    2  
ATOM 4154  C CA   . VAL B 1 77  ? 21.346  -4.659  1.576   1.00 0.00 ? 77  VAL B CA   2  
ATOM 4155  C C    . VAL B 1 77  ? 20.229  -5.155  0.714   1.00 0.00 ? 77  VAL B C    2  
ATOM 4156  O O    . VAL B 1 77  ? 20.051  -4.692  -0.406  1.00 0.00 ? 77  VAL B O    2  
ATOM 4157  C CB   . VAL B 1 77  ? 20.955  -3.214  2.095   1.00 0.00 ? 77  VAL B CB   2  
ATOM 4158  C CG1  . VAL B 1 77  ? 19.836  -3.283  3.129   1.00 0.00 ? 77  VAL B CG1  2  
ATOM 4159  C CG2  . VAL B 1 77  ? 22.161  -2.466  2.648   1.00 0.00 ? 77  VAL B CG2  2  
ATOM 4160  H H    . VAL B 1 77  ? 22.496  -4.040  -0.046  1.00 0.00 ? 77  VAL B H    2  
ATOM 4161  H HA   . VAL B 1 77  ? 21.508  -5.322  2.414   1.00 0.00 ? 77  VAL B HA   2  
ATOM 4162  H HB   . VAL B 1 77  ? 20.557  -2.667  1.256   1.00 0.00 ? 77  VAL B HB   2  
ATOM 4163  H HG11 . VAL B 1 77  ? 18.962  -3.734  2.684   1.00 0.00 ? 77  VAL B HG11 2  
ATOM 4164  H HG12 . VAL B 1 77  ? 19.594  -2.287  3.469   1.00 0.00 ? 77  VAL B HG12 2  
ATOM 4165  H HG13 . VAL B 1 77  ? 20.160  -3.880  3.970   1.00 0.00 ? 77  VAL B HG13 2  
ATOM 4166  H HG21 . VAL B 1 77  ? 22.902  -2.357  1.870   1.00 0.00 ? 77  VAL B HG21 2  
ATOM 4167  H HG22 . VAL B 1 77  ? 22.581  -3.027  3.468   1.00 0.00 ? 77  VAL B HG22 2  
ATOM 4168  H HG23 . VAL B 1 77  ? 21.855  -1.491  2.996   1.00 0.00 ? 77  VAL B HG23 2  
ATOM 4169  N N    . ASN B 1 78  ? 19.510  -6.082  1.183   1.00 0.00 ? 78  ASN B N    2  
ATOM 4170  C CA   . ASN B 1 78  ? 18.425  -6.593  0.431   1.00 0.00 ? 78  ASN B CA   2  
ATOM 4171  C C    . ASN B 1 78  ? 17.196  -6.178  1.122   1.00 0.00 ? 78  ASN B C    2  
ATOM 4172  O O    . ASN B 1 78  ? 17.180  -6.085  2.351   1.00 0.00 ? 78  ASN B O    2  
ATOM 4173  C CB   . ASN B 1 78  ? 18.501  -8.127  0.314   1.00 0.00 ? 78  ASN B CB   2  
ATOM 4174  C CG   . ASN B 1 78  ? 17.358  -8.730  -0.494  1.00 0.00 ? 78  ASN B CG   2  
ATOM 4175  O OD1  . ASN B 1 78  ? 17.442  -8.831  -1.726  1.00 0.00 ? 78  ASN B OD1  2  
ATOM 4176  N ND2  . ASN B 1 78  ? 16.314  -9.163  0.179   1.00 0.00 ? 78  ASN B ND2  2  
ATOM 4177  H H    . ASN B 1 78  ? 19.672  -6.450  2.080   1.00 0.00 ? 78  ASN B H    2  
ATOM 4178  H HA   . ASN B 1 78  ? 18.452  -6.155  -0.555  1.00 0.00 ? 78  ASN B HA   2  
ATOM 4179  H HB2  . ASN B 1 78  ? 19.430  -8.401  -0.163  1.00 0.00 ? 78  ASN B HB2  2  
ATOM 4180  H HB3  . ASN B 1 78  ? 18.476  -8.551  1.306   1.00 0.00 ? 78  ASN B HB3  2  
ATOM 4181  H HD21 . ASN B 1 78  ? 16.306  -9.085  1.160   1.00 0.00 ? 78  ASN B HD21 2  
ATOM 4182  H HD22 . ASN B 1 78  ? 15.556  -9.554  -0.305  1.00 0.00 ? 78  ASN B HD22 2  
ATOM 4183  N N    . LEU B 1 79  ? 16.182  -5.940  0.390   1.00 0.00 ? 79  LEU B N    2  
ATOM 4184  C CA   . LEU B 1 79  ? 14.981  -5.515  0.956   1.00 0.00 ? 79  LEU B CA   2  
ATOM 4185  C C    . LEU B 1 79  ? 13.928  -6.528  0.654   1.00 0.00 ? 79  LEU B C    2  
ATOM 4186  O O    . LEU B 1 79  ? 13.747  -6.956  -0.518  1.00 0.00 ? 79  LEU B O    2  
ATOM 4187  C CB   . LEU B 1 79  ? 14.532  -4.117  0.470   1.00 0.00 ? 79  LEU B CB   2  
ATOM 4188  C CG   . LEU B 1 79  ? 15.368  -2.902  0.918   1.00 0.00 ? 79  LEU B CG   2  
ATOM 4189  C CD1  . LEU B 1 79  ? 16.710  -2.836  0.216   1.00 0.00 ? 79  LEU B CD1  2  
ATOM 4190  C CD2  . LEU B 1 79  ? 14.594  -1.618  0.717   1.00 0.00 ? 79  LEU B CD2  2  
ATOM 4191  H H    . LEU B 1 79  ? 16.217  -6.054  -0.587  1.00 0.00 ? 79  LEU B H    2  
ATOM 4192  H HA   . LEU B 1 79  ? 15.124  -5.478  2.026   1.00 0.00 ? 79  LEU B HA   2  
ATOM 4193  H HB2  . LEU B 1 79  ? 14.525  -4.133  -0.610  1.00 0.00 ? 79  LEU B HB2  2  
ATOM 4194  H HB3  . LEU B 1 79  ? 13.516  -3.966  0.805   1.00 0.00 ? 79  LEU B HB3  2  
ATOM 4195  H HG   . LEU B 1 79  ? 15.569  -3.003  1.974   1.00 0.00 ? 79  LEU B HG   2  
ATOM 4196  H HD11 . LEU B 1 79  ? 17.254  -1.970  0.564   1.00 0.00 ? 79  LEU B HD11 2  
ATOM 4197  H HD12 . LEU B 1 79  ? 16.558  -2.762  -0.850  1.00 0.00 ? 79  LEU B HD12 2  
ATOM 4198  H HD13 . LEU B 1 79  ? 17.277  -3.728  0.439   1.00 0.00 ? 79  LEU B HD13 2  
ATOM 4199  H HD21 . LEU B 1 79  ? 14.349  -1.512  -0.329  1.00 0.00 ? 79  LEU B HD21 2  
ATOM 4200  H HD22 . LEU B 1 79  ? 15.197  -0.781  1.033   1.00 0.00 ? 79  LEU B HD22 2  
ATOM 4201  H HD23 . LEU B 1 79  ? 13.687  -1.649  1.302   1.00 0.00 ? 79  LEU B HD23 2  
ATOM 4202  N N    . ASP B 1 80  ? 13.266  -6.922  1.714   1.00 0.00 ? 80  ASP B N    2  
ATOM 4203  C CA   . ASP B 1 80  ? 12.216  -7.915  1.706   1.00 0.00 ? 80  ASP B CA   2  
ATOM 4204  C C    . ASP B 1 80  ? 11.019  -7.289  1.099   1.00 0.00 ? 80  ASP B C    2  
ATOM 4205  O O    . ASP B 1 80  ? 10.587  -6.229  1.544   1.00 0.00 ? 80  ASP B O    2  
ATOM 4206  C CB   . ASP B 1 80  ? 11.915  -8.357  3.154   1.00 0.00 ? 80  ASP B CB   2  
ATOM 4207  C CG   . ASP B 1 80  ? 10.780  -9.358  3.311   1.00 0.00 ? 80  ASP B CG   2  
ATOM 4208  O OD1  . ASP B 1 80  ? 10.166  -9.779  2.324   1.00 0.00 ? 80  ASP B OD1  2  
ATOM 4209  O OD2  . ASP B 1 80  ? 10.483  -9.756  4.457   1.00 0.00 ? 80  ASP B OD2  2  
ATOM 4210  H H    . ASP B 1 80  ? 13.481  -6.477  2.571   1.00 0.00 ? 80  ASP B H    2  
ATOM 4211  H HA   . ASP B 1 80  ? 12.533  -8.769  1.127   1.00 0.00 ? 80  ASP B HA   2  
ATOM 4212  H HB2  . ASP B 1 80  ? 12.803  -8.810  3.568   1.00 0.00 ? 80  ASP B HB2  2  
ATOM 4213  H HB3  . ASP B 1 80  ? 11.679  -7.478  3.736   1.00 0.00 ? 80  ASP B HB3  2  
ATOM 4214  N N    . VAL B 1 81  ? 10.497  -7.918  0.084   1.00 0.00 ? 81  VAL B N    2  
ATOM 4215  C CA   . VAL B 1 81  ? 9.415   -7.383  -0.680  1.00 0.00 ? 81  VAL B CA   2  
ATOM 4216  C C    . VAL B 1 81  ? 8.437   -8.498  -1.005  1.00 0.00 ? 81  VAL B C    2  
ATOM 4217  O O    . VAL B 1 81  ? 8.848   -9.636  -1.231  1.00 0.00 ? 81  VAL B O    2  
ATOM 4218  C CB   . VAL B 1 81  ? 9.930   -6.791  -2.034  1.00 0.00 ? 81  VAL B CB   2  
ATOM 4219  C CG1  . VAL B 1 81  ? 8.824   -6.097  -2.776  1.00 0.00 ? 81  VAL B CG1  2  
ATOM 4220  C CG2  . VAL B 1 81  ? 11.110  -5.845  -1.859  1.00 0.00 ? 81  VAL B CG2  2  
ATOM 4221  H H    . VAL B 1 81  ? 10.828  -8.813  -0.146  1.00 0.00 ? 81  VAL B H    2  
ATOM 4222  H HA   . VAL B 1 81  ? 8.929   -6.596  -0.123  1.00 0.00 ? 81  VAL B HA   2  
ATOM 4223  H HB   . VAL B 1 81  ? 10.245  -7.622  -2.644  1.00 0.00 ? 81  VAL B HB   2  
ATOM 4224  H HG11 . VAL B 1 81  ? 8.030   -6.800  -2.980  1.00 0.00 ? 81  VAL B HG11 2  
ATOM 4225  H HG12 . VAL B 1 81  ? 9.207   -5.706  -3.707  1.00 0.00 ? 81  VAL B HG12 2  
ATOM 4226  H HG13 . VAL B 1 81  ? 8.439   -5.286  -2.177  1.00 0.00 ? 81  VAL B HG13 2  
ATOM 4227  H HG21 . VAL B 1 81  ? 11.423  -5.474  -2.824  1.00 0.00 ? 81  VAL B HG21 2  
ATOM 4228  H HG22 . VAL B 1 81  ? 11.929  -6.374  -1.393  1.00 0.00 ? 81  VAL B HG22 2  
ATOM 4229  H HG23 . VAL B 1 81  ? 10.815  -5.017  -1.232  1.00 0.00 ? 81  VAL B HG23 2  
ATOM 4230  N N    . LYS B 1 82  ? 7.153   -8.188  -0.980  1.00 0.00 ? 82  LYS B N    2  
ATOM 4231  C CA   . LYS B 1 82  ? 6.156   -9.120  -1.441  1.00 0.00 ? 82  LYS B CA   2  
ATOM 4232  C C    . LYS B 1 82  ? 5.836   -8.701  -2.882  1.00 0.00 ? 82  LYS B C    2  
ATOM 4233  O O    . LYS B 1 82  ? 6.388   -7.712  -3.341  1.00 0.00 ? 82  LYS B O    2  
ATOM 4234  C CB   . LYS B 1 82  ? 4.923   -9.109  -0.519  1.00 0.00 ? 82  LYS B CB   2  
ATOM 4235  C CG   . LYS B 1 82  ? 4.014   -10.338 -0.637  1.00 0.00 ? 82  LYS B CG   2  
ATOM 4236  C CD   . LYS B 1 82  ? 4.821   -11.623 -0.467  1.00 0.00 ? 82  LYS B CD   2  
ATOM 4237  C CE   . LYS B 1 82  ? 3.949   -12.867 -0.444  1.00 0.00 ? 82  LYS B CE   2  
ATOM 4238  N NZ   . LYS B 1 82  ? 3.134   -12.958 0.783   1.00 0.00 ? 82  LYS B NZ   2  
ATOM 4239  H H    . LYS B 1 82  ? 6.877   -7.301  -0.675  1.00 0.00 ? 82  LYS B H    2  
ATOM 4240  H HA   . LYS B 1 82  ? 6.625   -10.092 -1.459  1.00 0.00 ? 82  LYS B HA   2  
ATOM 4241  H HB2  . LYS B 1 82  ? 5.256   -9.038  0.507   1.00 0.00 ? 82  LYS B HB2  2  
ATOM 4242  H HB3  . LYS B 1 82  ? 4.337   -8.232  -0.749  1.00 0.00 ? 82  LYS B HB3  2  
ATOM 4243  H HG2  . LYS B 1 82  ? 3.262   -10.292 0.138   1.00 0.00 ? 82  LYS B HG2  2  
ATOM 4244  H HG3  . LYS B 1 82  ? 3.534   -10.344 -1.605  1.00 0.00 ? 82  LYS B HG3  2  
ATOM 4245  H HD2  . LYS B 1 82  ? 5.503   -11.719 -1.299  1.00 0.00 ? 82  LYS B HD2  2  
ATOM 4246  H HD3  . LYS B 1 82  ? 5.382   -11.568 0.455   1.00 0.00 ? 82  LYS B HD3  2  
ATOM 4247  H HE2  . LYS B 1 82  ? 3.288   -12.844 -1.297  1.00 0.00 ? 82  LYS B HE2  2  
ATOM 4248  H HE3  . LYS B 1 82  ? 4.584   -13.738 -0.512  1.00 0.00 ? 82  LYS B HE3  2  
ATOM 4249  H HZ1  . LYS B 1 82  ? 2.461   -12.174 0.897   1.00 0.00 ? 82  LYS B HZ1  2  
ATOM 4250  H HZ2  . LYS B 1 82  ? 3.737   -13.003 1.629   1.00 0.00 ? 82  LYS B HZ2  2  
ATOM 4251  H HZ3  . LYS B 1 82  ? 2.587   -13.845 0.776   1.00 0.00 ? 82  LYS B HZ3  2  
ATOM 4252  N N    . HIS B 1 83  ? 4.921   -9.330  -3.562  1.00 0.00 ? 83  HIS B N    2  
ATOM 4253  C CA   . HIS B 1 83  ? 4.842   -9.078  -4.986  1.00 0.00 ? 83  HIS B CA   2  
ATOM 4254  C C    . HIS B 1 83  ? 4.165   -7.763  -5.329  1.00 0.00 ? 83  HIS B C    2  
ATOM 4255  O O    . HIS B 1 83  ? 3.010   -7.488  -4.943  1.00 0.00 ? 83  HIS B O    2  
ATOM 4256  C CB   . HIS B 1 83  ? 4.136   -10.225 -5.710  1.00 0.00 ? 83  HIS B CB   2  
ATOM 4257  C CG   . HIS B 1 83  ? 4.328   -10.220 -7.213  1.00 0.00 ? 83  HIS B CG   2  
ATOM 4258  N ND1  . HIS B 1 83  ? 5.126   -11.123 -7.844  1.00 0.00 ? 83  HIS B ND1  2  
ATOM 4259  C CD2  . HIS B 1 83  ? 3.825   -9.428  -8.191  1.00 0.00 ? 83  HIS B CD2  2  
ATOM 4260  C CE1  . HIS B 1 83  ? 5.124   -10.903 -9.133  1.00 0.00 ? 83  HIS B CE1  2  
ATOM 4261  N NE2  . HIS B 1 83  ? 4.342   -9.876  -9.377  1.00 0.00 ? 83  HIS B NE2  2  
ATOM 4262  H H    . HIS B 1 83  ? 4.319   -9.968  -3.136  1.00 0.00 ? 83  HIS B H    2  
ATOM 4263  H HA   . HIS B 1 83  ? 5.856   -9.038  -5.357  1.00 0.00 ? 83  HIS B HA   2  
ATOM 4264  H HB2  . HIS B 1 83  ? 4.520   -11.160 -5.333  1.00 0.00 ? 83  HIS B HB2  2  
ATOM 4265  H HB3  . HIS B 1 83  ? 3.077   -10.165 -5.507  1.00 0.00 ? 83  HIS B HB3  2  
ATOM 4266  H HD1  . HIS B 1 83  ? 5.629   -11.828 -7.360  1.00 0.00 ? 83  HIS B HD1  2  
ATOM 4267  H HD2  . HIS B 1 83  ? 3.145   -8.599  -8.058  1.00 0.00 ? 83  HIS B HD2  2  
ATOM 4268  H HE1  . HIS B 1 83  ? 5.670   -11.473 -9.870  1.00 0.00 ? 83  HIS B HE1  2  
ATOM 4269  H HE2  . HIS B 1 83  ? 4.421   -9.335  -10.193 1.00 0.00 ? 83  HIS B HE2  2  
ATOM 4270  N N    . PHE B 1 84  ? 4.891   -6.980  -6.078  1.00 0.00 ? 84  PHE B N    2  
ATOM 4271  C CA   . PHE B 1 84  ? 4.413   -5.768  -6.653  1.00 0.00 ? 84  PHE B CA   2  
ATOM 4272  C C    . PHE B 1 84  ? 4.798   -5.726  -8.114  1.00 0.00 ? 84  PHE B C    2  
ATOM 4273  O O    . PHE B 1 84  ? 5.486   -6.627  -8.583  1.00 0.00 ? 84  PHE B O    2  
ATOM 4274  C CB   . PHE B 1 84  ? 4.806   -4.474  -5.884  1.00 0.00 ? 84  PHE B CB   2  
ATOM 4275  C CG   . PHE B 1 84  ? 6.273   -4.194  -5.615  1.00 0.00 ? 84  PHE B CG   2  
ATOM 4276  C CD1  . PHE B 1 84  ? 7.278   -4.623  -6.460  1.00 0.00 ? 84  PHE B CD1  2  
ATOM 4277  C CD2  . PHE B 1 84  ? 6.624   -3.442  -4.508  1.00 0.00 ? 84  PHE B CD2  2  
ATOM 4278  C CE1  . PHE B 1 84  ? 8.592   -4.309  -6.203  1.00 0.00 ? 84  PHE B CE1  2  
ATOM 4279  C CE2  . PHE B 1 84  ? 7.937   -3.129  -4.245  1.00 0.00 ? 84  PHE B CE2  2  
ATOM 4280  C CZ   . PHE B 1 84  ? 8.925   -3.563  -5.095  1.00 0.00 ? 84  PHE B CZ   2  
ATOM 4281  H H    . PHE B 1 84  ? 5.821   -7.241  -6.263  1.00 0.00 ? 84  PHE B H    2  
ATOM 4282  H HA   . PHE B 1 84  ? 3.343   -5.899  -6.605  1.00 0.00 ? 84  PHE B HA   2  
ATOM 4283  H HB2  . PHE B 1 84  ? 4.435   -3.626  -6.440  1.00 0.00 ? 84  PHE B HB2  2  
ATOM 4284  H HB3  . PHE B 1 84  ? 4.292   -4.491  -4.934  1.00 0.00 ? 84  PHE B HB3  2  
ATOM 4285  H HD1  . PHE B 1 84  ? 7.021   -5.210  -7.329  1.00 0.00 ? 84  PHE B HD1  2  
ATOM 4286  H HD2  . PHE B 1 84  ? 5.848   -3.100  -3.840  1.00 0.00 ? 84  PHE B HD2  2  
ATOM 4287  H HE1  . PHE B 1 84  ? 9.366   -4.652  -6.873  1.00 0.00 ? 84  PHE B HE1  2  
ATOM 4288  H HE2  . PHE B 1 84  ? 8.193   -2.543  -3.373  1.00 0.00 ? 84  PHE B HE2  2  
ATOM 4289  H HZ   . PHE B 1 84  ? 9.958   -3.319  -4.896  1.00 0.00 ? 84  PHE B HZ   2  
ATOM 4290  N N    . SER B 1 85  ? 4.312   -4.757  -8.831  1.00 0.00 ? 85  SER B N    2  
ATOM 4291  C CA   . SER B 1 85  ? 4.589   -4.644  -10.233 1.00 0.00 ? 85  SER B CA   2  
ATOM 4292  C C    . SER B 1 85  ? 6.000   -4.078  -10.447 1.00 0.00 ? 85  SER B C    2  
ATOM 4293  O O    . SER B 1 85  ? 6.278   -2.957  -10.028 1.00 0.00 ? 85  SER B O    2  
ATOM 4294  C CB   . SER B 1 85  ? 3.569   -3.717  -10.837 1.00 0.00 ? 85  SER B CB   2  
ATOM 4295  O OG   . SER B 1 85  ? 2.258   -4.125  -10.481 1.00 0.00 ? 85  SER B OG   2  
ATOM 4296  H H    . SER B 1 85  ? 3.767   -4.042  -8.439  1.00 0.00 ? 85  SER B H    2  
ATOM 4297  H HA   . SER B 1 85  ? 4.495   -5.616  -10.694 1.00 0.00 ? 85  SER B HA   2  
ATOM 4298  H HB2  . SER B 1 85  ? 3.742   -2.721  -10.461 1.00 0.00 ? 85  SER B HB2  2  
ATOM 4299  H HB3  . SER B 1 85  ? 3.659   -3.718  -11.913 1.00 0.00 ? 85  SER B HB3  2  
ATOM 4300  H HG   . SER B 1 85  ? 1.703   -3.334  -10.554 1.00 0.00 ? 85  SER B HG   2  
ATOM 4301  N N    . PRO B 1 86  ? 6.908   -4.865  -11.101 1.00 0.00 ? 86  PRO B N    2  
ATOM 4302  C CA   . PRO B 1 86  ? 8.303   -4.463  -11.379 1.00 0.00 ? 86  PRO B CA   2  
ATOM 4303  C C    . PRO B 1 86  ? 8.433   -3.115  -12.098 1.00 0.00 ? 86  PRO B C    2  
ATOM 4304  O O    . PRO B 1 86  ? 9.452   -2.437  -11.985 1.00 0.00 ? 86  PRO B O    2  
ATOM 4305  C CB   . PRO B 1 86  ? 8.822   -5.586  -12.276 1.00 0.00 ? 86  PRO B CB   2  
ATOM 4306  C CG   . PRO B 1 86  ? 8.043   -6.767  -11.858 1.00 0.00 ? 86  PRO B CG   2  
ATOM 4307  C CD   . PRO B 1 86  ? 6.663   -6.250  -11.586 1.00 0.00 ? 86  PRO B CD   2  
ATOM 4308  H HA   . PRO B 1 86  ? 8.886   -4.438  -10.470 1.00 0.00 ? 86  PRO B HA   2  
ATOM 4309  H HB2  . PRO B 1 86  ? 8.637   -5.330  -13.309 1.00 0.00 ? 86  PRO B HB2  2  
ATOM 4310  H HB3  . PRO B 1 86  ? 9.880   -5.733  -12.119 1.00 0.00 ? 86  PRO B HB3  2  
ATOM 4311  H HG2  . PRO B 1 86  ? 8.028   -7.498  -12.652 1.00 0.00 ? 86  PRO B HG2  2  
ATOM 4312  H HG3  . PRO B 1 86  ? 8.466   -7.192  -10.959 1.00 0.00 ? 86  PRO B HG3  2  
ATOM 4313  H HD2  . PRO B 1 86  ? 6.074   -6.244  -12.491 1.00 0.00 ? 86  PRO B HD2  2  
ATOM 4314  H HD3  . PRO B 1 86  ? 6.187   -6.846  -10.821 1.00 0.00 ? 86  PRO B HD3  2  
ATOM 4315  N N    . GLU B 1 87  ? 7.432   -2.745  -12.861 1.00 0.00 ? 87  GLU B N    2  
ATOM 4316  C CA   . GLU B 1 87  ? 7.468   -1.476  -13.564 1.00 0.00 ? 87  GLU B CA   2  
ATOM 4317  C C    . GLU B 1 87  ? 6.930   -0.340  -12.695 1.00 0.00 ? 87  GLU B C    2  
ATOM 4318  O O    . GLU B 1 87  ? 7.450   0.780   -12.724 1.00 0.00 ? 87  GLU B O    2  
ATOM 4319  C CB   . GLU B 1 87  ? 6.675   -1.553  -14.859 1.00 0.00 ? 87  GLU B CB   2  
ATOM 4320  C CG   . GLU B 1 87  ? 7.213   -2.558  -15.856 1.00 0.00 ? 87  GLU B CG   2  
ATOM 4321  C CD   . GLU B 1 87  ? 8.618   -2.247  -16.288 1.00 0.00 ? 87  GLU B CD   2  
ATOM 4322  O OE1  . GLU B 1 87  ? 8.825   -1.251  -17.010 1.00 0.00 ? 87  GLU B OE1  2  
ATOM 4323  O OE2  . GLU B 1 87  ? 9.546   -2.979  -15.897 1.00 0.00 ? 87  GLU B OE2  2  
ATOM 4324  H H    . GLU B 1 87  ? 6.666   -3.350  -12.953 1.00 0.00 ? 87  GLU B H    2  
ATOM 4325  H HA   . GLU B 1 87  ? 8.499   -1.265  -13.805 1.00 0.00 ? 87  GLU B HA   2  
ATOM 4326  H HB2  . GLU B 1 87  ? 5.657   -1.824  -14.620 1.00 0.00 ? 87  GLU B HB2  2  
ATOM 4327  H HB3  . GLU B 1 87  ? 6.675   -0.578  -15.323 1.00 0.00 ? 87  GLU B HB3  2  
ATOM 4328  H HG2  . GLU B 1 87  ? 7.219   -3.525  -15.377 1.00 0.00 ? 87  GLU B HG2  2  
ATOM 4329  H HG3  . GLU B 1 87  ? 6.570   -2.585  -16.723 1.00 0.00 ? 87  GLU B HG3  2  
ATOM 4330  N N    . GLU B 1 88  ? 5.938   -0.639  -11.881 1.00 0.00 ? 88  GLU B N    2  
ATOM 4331  C CA   . GLU B 1 88  ? 5.262   0.384   -11.090 1.00 0.00 ? 88  GLU B CA   2  
ATOM 4332  C C    . GLU B 1 88  ? 5.918   0.517   -9.720  1.00 0.00 ? 88  GLU B C    2  
ATOM 4333  O O    . GLU B 1 88  ? 5.273   0.342   -8.669  1.00 0.00 ? 88  GLU B O    2  
ATOM 4334  C CB   . GLU B 1 88  ? 3.768   0.063   -10.920 1.00 0.00 ? 88  GLU B CB   2  
ATOM 4335  C CG   . GLU B 1 88  ? 3.023   -0.243  -12.216 1.00 0.00 ? 88  GLU B CG   2  
ATOM 4336  C CD   . GLU B 1 88  ? 3.179   0.836   -13.256 1.00 0.00 ? 88  GLU B CD   2  
ATOM 4337  O OE1  . GLU B 1 88  ? 2.516   1.890   -13.165 1.00 0.00 ? 88  GLU B OE1  2  
ATOM 4338  O OE2  . GLU B 1 88  ? 3.970   0.650   -14.200 1.00 0.00 ? 88  GLU B OE2  2  
ATOM 4339  H H    . GLU B 1 88  ? 5.674   -1.574  -11.765 1.00 0.00 ? 88  GLU B H    2  
ATOM 4340  H HA   . GLU B 1 88  ? 5.363   1.323   -11.615 1.00 0.00 ? 88  GLU B HA   2  
ATOM 4341  H HB2  . GLU B 1 88  ? 3.660   -0.775  -10.249 1.00 0.00 ? 88  GLU B HB2  2  
ATOM 4342  H HB3  . GLU B 1 88  ? 3.295   0.918   -10.461 1.00 0.00 ? 88  GLU B HB3  2  
ATOM 4343  H HG2  . GLU B 1 88  ? 3.406   -1.165  -12.628 1.00 0.00 ? 88  GLU B HG2  2  
ATOM 4344  H HG3  . GLU B 1 88  ? 1.973   -0.363  -11.993 1.00 0.00 ? 88  GLU B HG3  2  
ATOM 4345  N N    . LEU B 1 89  ? 7.180   0.820   -9.720  1.00 0.00 ? 89  LEU B N    2  
ATOM 4346  C CA   . LEU B 1 89  ? 7.905   0.956   -8.497  1.00 0.00 ? 89  LEU B CA   2  
ATOM 4347  C C    . LEU B 1 89  ? 8.901   2.073   -8.580  1.00 0.00 ? 89  LEU B C    2  
ATOM 4348  O O    . LEU B 1 89  ? 9.255   2.535   -9.680  1.00 0.00 ? 89  LEU B O    2  
ATOM 4349  C CB   . LEU B 1 89  ? 8.557   -0.388  -8.078  1.00 0.00 ? 89  LEU B CB   2  
ATOM 4350  C CG   . LEU B 1 89  ? 9.535   -1.061  -9.066  1.00 0.00 ? 89  LEU B CG   2  
ATOM 4351  C CD1  . LEU B 1 89  ? 10.908  -0.392  -9.092  1.00 0.00 ? 89  LEU B CD1  2  
ATOM 4352  C CD2  . LEU B 1 89  ? 9.668   -2.524  -8.747  1.00 0.00 ? 89  LEU B CD2  2  
ATOM 4353  H H    . LEU B 1 89  ? 7.639   0.967   -10.574 1.00 0.00 ? 89  LEU B H    2  
ATOM 4354  H HA   . LEU B 1 89  ? 7.185   1.226   -7.740  1.00 0.00 ? 89  LEU B HA   2  
ATOM 4355  H HB2  . LEU B 1 89  ? 9.097   -0.216  -7.159  1.00 0.00 ? 89  LEU B HB2  2  
ATOM 4356  H HB3  . LEU B 1 89  ? 7.760   -1.086  -7.867  1.00 0.00 ? 89  LEU B HB3  2  
ATOM 4357  H HG   . LEU B 1 89  ? 9.120   -0.979  -10.060 1.00 0.00 ? 89  LEU B HG   2  
ATOM 4358  H HD11 . LEU B 1 89  ? 11.537  -0.892  -9.814  1.00 0.00 ? 89  LEU B HD11 2  
ATOM 4359  H HD12 . LEU B 1 89  ? 11.359  -0.460  -8.114  1.00 0.00 ? 89  LEU B HD12 2  
ATOM 4360  H HD13 . LEU B 1 89  ? 10.796  0.646   -9.365  1.00 0.00 ? 89  LEU B HD13 2  
ATOM 4361  H HD21 . LEU B 1 89  ? 8.700   -2.999  -8.817  1.00 0.00 ? 89  LEU B HD21 2  
ATOM 4362  H HD22 . LEU B 1 89  ? 10.052  -2.638  -7.744  1.00 0.00 ? 89  LEU B HD22 2  
ATOM 4363  H HD23 . LEU B 1 89  ? 10.351  -2.982  -9.446  1.00 0.00 ? 89  LEU B HD23 2  
ATOM 4364  N N    . LYS B 1 90  ? 9.309   2.527   -7.453  1.00 0.00 ? 90  LYS B N    2  
ATOM 4365  C CA   . LYS B 1 90  ? 10.302  3.518   -7.335  1.00 0.00 ? 90  LYS B CA   2  
ATOM 4366  C C    . LYS B 1 90  ? 11.260  3.106   -6.244  1.00 0.00 ? 90  LYS B C    2  
ATOM 4367  O O    . LYS B 1 90  ? 10.850  2.832   -5.106  1.00 0.00 ? 90  LYS B O    2  
ATOM 4368  C CB   . LYS B 1 90  ? 9.659   4.876   -6.992  1.00 0.00 ? 90  LYS B CB   2  
ATOM 4369  C CG   . LYS B 1 90  ? 10.652  6.013   -6.761  1.00 0.00 ? 90  LYS B CG   2  
ATOM 4370  C CD   . LYS B 1 90  ? 11.514  6.271   -7.987  1.00 0.00 ? 90  LYS B CD   2  
ATOM 4371  C CE   . LYS B 1 90  ? 12.503  7.391   -7.740  1.00 0.00 ? 90  LYS B CE   2  
ATOM 4372  N NZ   . LYS B 1 90  ? 11.835  8.685   -7.481  1.00 0.00 ? 90  LYS B NZ   2  
ATOM 4373  H H    . LYS B 1 90  ? 8.909   2.179   -6.621  1.00 0.00 ? 90  LYS B H    2  
ATOM 4374  H HA   . LYS B 1 90  ? 10.818  3.603   -8.279  1.00 0.00 ? 90  LYS B HA   2  
ATOM 4375  H HB2  . LYS B 1 90  ? 9.003   5.166   -7.799  1.00 0.00 ? 90  LYS B HB2  2  
ATOM 4376  H HB3  . LYS B 1 90  ? 9.070   4.757   -6.096  1.00 0.00 ? 90  LYS B HB3  2  
ATOM 4377  H HG2  . LYS B 1 90  ? 10.106  6.912   -6.520  1.00 0.00 ? 90  LYS B HG2  2  
ATOM 4378  H HG3  . LYS B 1 90  ? 11.291  5.749   -5.931  1.00 0.00 ? 90  LYS B HG3  2  
ATOM 4379  H HD2  . LYS B 1 90  ? 12.062  5.371   -8.220  1.00 0.00 ? 90  LYS B HD2  2  
ATOM 4380  H HD3  . LYS B 1 90  ? 10.877  6.537   -8.816  1.00 0.00 ? 90  LYS B HD3  2  
ATOM 4381  H HE2  . LYS B 1 90  ? 13.107  7.133   -6.883  1.00 0.00 ? 90  LYS B HE2  2  
ATOM 4382  H HE3  . LYS B 1 90  ? 13.138  7.487   -8.607  1.00 0.00 ? 90  LYS B HE3  2  
ATOM 4383  H HZ1  . LYS B 1 90  ? 11.279  8.985   -8.307  1.00 0.00 ? 90  LYS B HZ1  2  
ATOM 4384  H HZ2  . LYS B 1 90  ? 12.547  9.417   -7.291  1.00 0.00 ? 90  LYS B HZ2  2  
ATOM 4385  H HZ3  . LYS B 1 90  ? 11.193  8.634   -6.664  1.00 0.00 ? 90  LYS B HZ3  2  
ATOM 4386  N N    . VAL B 1 91  ? 12.503  3.041   -6.583  1.00 0.00 ? 91  VAL B N    2  
ATOM 4387  C CA   . VAL B 1 91  ? 13.525  2.790   -5.621  1.00 0.00 ? 91  VAL B CA   2  
ATOM 4388  C C    . VAL B 1 91  ? 14.250  4.100   -5.384  1.00 0.00 ? 91  VAL B C    2  
ATOM 4389  O O    . VAL B 1 91  ? 14.729  4.744   -6.329  1.00 0.00 ? 91  VAL B O    2  
ATOM 4390  C CB   . VAL B 1 91  ? 14.493  1.633   -6.050  1.00 0.00 ? 91  VAL B CB   2  
ATOM 4391  C CG1  . VAL B 1 91  ? 15.081  1.859   -7.436  1.00 0.00 ? 91  VAL B CG1  2  
ATOM 4392  C CG2  . VAL B 1 91  ? 15.598  1.432   -5.018  1.00 0.00 ? 91  VAL B CG2  2  
ATOM 4393  H H    . VAL B 1 91  ? 12.754  3.180   -7.523  1.00 0.00 ? 91  VAL B H    2  
ATOM 4394  H HA   . VAL B 1 91  ? 13.024  2.523   -4.702  1.00 0.00 ? 91  VAL B HA   2  
ATOM 4395  H HB   . VAL B 1 91  ? 13.909  0.724   -6.095  1.00 0.00 ? 91  VAL B HB   2  
ATOM 4396  H HG11 . VAL B 1 91  ? 14.286  1.881   -8.165  1.00 0.00 ? 91  VAL B HG11 2  
ATOM 4397  H HG12 . VAL B 1 91  ? 15.767  1.059   -7.674  1.00 0.00 ? 91  VAL B HG12 2  
ATOM 4398  H HG13 . VAL B 1 91  ? 15.605  2.802   -7.449  1.00 0.00 ? 91  VAL B HG13 2  
ATOM 4399  H HG21 . VAL B 1 91  ? 16.256  0.641   -5.343  1.00 0.00 ? 91  VAL B HG21 2  
ATOM 4400  H HG22 . VAL B 1 91  ? 15.163  1.171   -4.065  1.00 0.00 ? 91  VAL B HG22 2  
ATOM 4401  H HG23 . VAL B 1 91  ? 16.160  2.348   -4.915  1.00 0.00 ? 91  VAL B HG23 2  
ATOM 4402  N N    . LYS B 1 92  ? 14.277  4.523   -4.162  1.00 0.00 ? 92  LYS B N    2  
ATOM 4403  C CA   . LYS B 1 92  ? 14.819  5.802   -3.832  1.00 0.00 ? 92  LYS B CA   2  
ATOM 4404  C C    . LYS B 1 92  ? 15.835  5.709   -2.712  1.00 0.00 ? 92  LYS B C    2  
ATOM 4405  O O    . LYS B 1 92  ? 15.614  5.038   -1.701  1.00 0.00 ? 92  LYS B O    2  
ATOM 4406  C CB   . LYS B 1 92  ? 13.691  6.782   -3.457  1.00 0.00 ? 92  LYS B CB   2  
ATOM 4407  C CG   . LYS B 1 92  ? 12.713  6.211   -2.430  1.00 0.00 ? 92  LYS B CG   2  
ATOM 4408  C CD   . LYS B 1 92  ? 11.820  7.263   -1.791  1.00 0.00 ? 92  LYS B CD   2  
ATOM 4409  C CE   . LYS B 1 92  ? 12.640  8.291   -1.022  1.00 0.00 ? 92  LYS B CE   2  
ATOM 4410  N NZ   . LYS B 1 92  ? 11.800  9.157   -0.180  1.00 0.00 ? 92  LYS B NZ   2  
ATOM 4411  H H    . LYS B 1 92  ? 13.945  3.963   -3.422  1.00 0.00 ? 92  LYS B H    2  
ATOM 4412  H HA   . LYS B 1 92  ? 15.303  6.182   -4.717  1.00 0.00 ? 92  LYS B HA   2  
ATOM 4413  H HB2  . LYS B 1 92  ? 14.136  7.678   -3.052  1.00 0.00 ? 92  LYS B HB2  2  
ATOM 4414  H HB3  . LYS B 1 92  ? 13.137  7.035   -4.349  1.00 0.00 ? 92  LYS B HB3  2  
ATOM 4415  H HG2  . LYS B 1 92  ? 12.087  5.477   -2.917  1.00 0.00 ? 92  LYS B HG2  2  
ATOM 4416  H HG3  . LYS B 1 92  ? 13.296  5.721   -1.664  1.00 0.00 ? 92  LYS B HG3  2  
ATOM 4417  H HD2  . LYS B 1 92  ? 11.262  7.761   -2.569  1.00 0.00 ? 92  LYS B HD2  2  
ATOM 4418  H HD3  . LYS B 1 92  ? 11.132  6.779   -1.113  1.00 0.00 ? 92  LYS B HD3  2  
ATOM 4419  H HE2  . LYS B 1 92  ? 13.345  7.774   -0.390  1.00 0.00 ? 92  LYS B HE2  2  
ATOM 4420  H HE3  . LYS B 1 92  ? 13.179  8.907   -1.726  1.00 0.00 ? 92  LYS B HE3  2  
ATOM 4421  H HZ1  . LYS B 1 92  ? 11.464  8.616   0.647   1.00 0.00 ? 92  LYS B HZ1  2  
ATOM 4422  H HZ2  . LYS B 1 92  ? 11.000  9.573   -0.691  1.00 0.00 ? 92  LYS B HZ2  2  
ATOM 4423  H HZ3  . LYS B 1 92  ? 12.390  9.933   0.186   1.00 0.00 ? 92  LYS B HZ3  2  
ATOM 4424  N N    . VAL B 1 93  ? 16.926  6.366   -2.901  1.00 0.00 ? 93  VAL B N    2  
ATOM 4425  C CA   . VAL B 1 93  ? 17.950  6.451   -1.914  1.00 0.00 ? 93  VAL B CA   2  
ATOM 4426  C C    . VAL B 1 93  ? 18.295  7.917   -1.715  1.00 0.00 ? 93  VAL B C    2  
ATOM 4427  O O    . VAL B 1 93  ? 18.656  8.632   -2.661  1.00 0.00 ? 93  VAL B O    2  
ATOM 4428  C CB   . VAL B 1 93  ? 19.211  5.578   -2.263  1.00 0.00 ? 93  VAL B CB   2  
ATOM 4429  C CG1  . VAL B 1 93  ? 19.772  5.903   -3.641  1.00 0.00 ? 93  VAL B CG1  2  
ATOM 4430  C CG2  . VAL B 1 93  ? 20.291  5.726   -1.196  1.00 0.00 ? 93  VAL B CG2  2  
ATOM 4431  H H    . VAL B 1 93  ? 17.061  6.855   -3.741  1.00 0.00 ? 93  VAL B H    2  
ATOM 4432  H HA   . VAL B 1 93  ? 17.513  6.095   -0.990  1.00 0.00 ? 93  VAL B HA   2  
ATOM 4433  H HB   . VAL B 1 93  ? 18.895  4.544   -2.277  1.00 0.00 ? 93  VAL B HB   2  
ATOM 4434  H HG11 . VAL B 1 93  ? 20.077  6.938   -3.671  1.00 0.00 ? 93  VAL B HG11 2  
ATOM 4435  H HG12 . VAL B 1 93  ? 19.012  5.731   -4.389  1.00 0.00 ? 93  VAL B HG12 2  
ATOM 4436  H HG13 . VAL B 1 93  ? 20.623  5.268   -3.839  1.00 0.00 ? 93  VAL B HG13 2  
ATOM 4437  H HG21 . VAL B 1 93  ? 19.898  5.435   -0.234  1.00 0.00 ? 93  VAL B HG21 2  
ATOM 4438  H HG22 . VAL B 1 93  ? 20.599  6.762   -1.154  1.00 0.00 ? 93  VAL B HG22 2  
ATOM 4439  H HG23 . VAL B 1 93  ? 21.140  5.106   -1.444  1.00 0.00 ? 93  VAL B HG23 2  
ATOM 4440  N N    . LEU B 1 94  ? 18.137  8.378   -0.521  1.00 0.00 ? 94  LEU B N    2  
ATOM 4441  C CA   . LEU B 1 94  ? 18.359  9.754   -0.225  1.00 0.00 ? 94  LEU B CA   2  
ATOM 4442  C C    . LEU B 1 94  ? 19.263  9.863   0.971   1.00 0.00 ? 94  LEU B C    2  
ATOM 4443  O O    . LEU B 1 94  ? 18.801  9.834   2.123   1.00 0.00 ? 94  LEU B O    2  
ATOM 4444  C CB   . LEU B 1 94  ? 17.018  10.469  0.025   1.00 0.00 ? 94  LEU B CB   2  
ATOM 4445  C CG   . LEU B 1 94  ? 17.086  11.983  0.261   1.00 0.00 ? 94  LEU B CG   2  
ATOM 4446  C CD1  . LEU B 1 94  ? 17.694  12.690  -0.942  1.00 0.00 ? 94  LEU B CD1  2  
ATOM 4447  C CD2  . LEU B 1 94  ? 15.706  12.537  0.555   1.00 0.00 ? 94  LEU B CD2  2  
ATOM 4448  H H    . LEU B 1 94  ? 17.892  7.758   0.206   1.00 0.00 ? 94  LEU B H    2  
ATOM 4449  H HA   . LEU B 1 94  ? 18.839  10.206  -1.079  1.00 0.00 ? 94  LEU B HA   2  
ATOM 4450  H HB2  . LEU B 1 94  ? 16.378  10.292  -0.828  1.00 0.00 ? 94  LEU B HB2  2  
ATOM 4451  H HB3  . LEU B 1 94  ? 16.556  10.016  0.890   1.00 0.00 ? 94  LEU B HB3  2  
ATOM 4452  H HG   . LEU B 1 94  ? 17.719  12.178  1.114   1.00 0.00 ? 94  LEU B HG   2  
ATOM 4453  H HD11 . LEU B 1 94  ? 17.716  13.753  -0.754  1.00 0.00 ? 94  LEU B HD11 2  
ATOM 4454  H HD12 . LEU B 1 94  ? 17.097  12.489  -1.819  1.00 0.00 ? 94  LEU B HD12 2  
ATOM 4455  H HD13 . LEU B 1 94  ? 18.701  12.335  -1.100  1.00 0.00 ? 94  LEU B HD13 2  
ATOM 4456  H HD21 . LEU B 1 94  ? 15.055  12.335  -0.283  1.00 0.00 ? 94  LEU B HD21 2  
ATOM 4457  H HD22 . LEU B 1 94  ? 15.772  13.605  0.706   1.00 0.00 ? 94  LEU B HD22 2  
ATOM 4458  H HD23 . LEU B 1 94  ? 15.308  12.073  1.444   1.00 0.00 ? 94  LEU B HD23 2  
ATOM 4459  N N    . GLY B 1 95  ? 20.545  9.942   0.707   1.00 0.00 ? 95  GLY B N    2  
ATOM 4460  C CA   . GLY B 1 95  ? 21.498  10.061  1.772   1.00 0.00 ? 95  GLY B CA   2  
ATOM 4461  C C    . GLY B 1 95  ? 21.604  8.788   2.580   1.00 0.00 ? 95  GLY B C    2  
ATOM 4462  O O    . GLY B 1 95  ? 22.075  7.763   2.105   1.00 0.00 ? 95  GLY B O    2  
ATOM 4463  H H    . GLY B 1 95  ? 20.844  9.916   -0.227  1.00 0.00 ? 95  GLY B H    2  
ATOM 4464  H HA2  . GLY B 1 95  ? 22.465  10.325  1.371   1.00 0.00 ? 95  GLY B HA2  2  
ATOM 4465  H HA3  . GLY B 1 95  ? 21.171  10.855  2.426   1.00 0.00 ? 95  GLY B HA3  2  
ATOM 4466  N N    . ASP B 1 96  ? 21.160  8.874   3.788   1.00 0.00 ? 96  ASP B N    2  
ATOM 4467  C CA   . ASP B 1 96  ? 21.186  7.786   4.754   1.00 0.00 ? 96  ASP B CA   2  
ATOM 4468  C C    . ASP B 1 96  ? 19.888  7.007   4.729   1.00 0.00 ? 96  ASP B C    2  
ATOM 4469  O O    . ASP B 1 96  ? 19.712  6.052   5.470   1.00 0.00 ? 96  ASP B O    2  
ATOM 4470  C CB   . ASP B 1 96  ? 21.406  8.371   6.159   1.00 0.00 ? 96  ASP B CB   2  
ATOM 4471  C CG   . ASP B 1 96  ? 20.335  9.381   6.577   1.00 0.00 ? 96  ASP B CG   2  
ATOM 4472  O OD1  . ASP B 1 96  ? 20.025  10.314  5.790   1.00 0.00 ? 96  ASP B OD1  2  
ATOM 4473  O OD2  . ASP B 1 96  ? 19.825  9.305   7.708   1.00 0.00 ? 96  ASP B OD2  2  
ATOM 4474  H H    . ASP B 1 96  ? 20.762  9.718   4.100   1.00 0.00 ? 96  ASP B H    2  
ATOM 4475  H HA   . ASP B 1 96  ? 22.006  7.123   4.529   1.00 0.00 ? 96  ASP B HA   2  
ATOM 4476  H HB2  . ASP B 1 96  ? 21.405  7.567   6.881   1.00 0.00 ? 96  ASP B HB2  2  
ATOM 4477  H HB3  . ASP B 1 96  ? 22.366  8.866   6.188   1.00 0.00 ? 96  ASP B HB3  2  
ATOM 4478  N N    . VAL B 1 97  ? 18.986  7.405   3.888   1.00 0.00 ? 97  VAL B N    2  
ATOM 4479  C CA   . VAL B 1 97  ? 17.704  6.757   3.828   1.00 0.00 ? 97  VAL B CA   2  
ATOM 4480  C C    . VAL B 1 97  ? 17.565  5.962   2.528   1.00 0.00 ? 97  VAL B C    2  
ATOM 4481  O O    . VAL B 1 97  ? 17.920  6.448   1.448   1.00 0.00 ? 97  VAL B O    2  
ATOM 4482  C CB   . VAL B 1 97  ? 16.563  7.819   3.961   1.00 0.00 ? 97  VAL B CB   2  
ATOM 4483  C CG1  . VAL B 1 97  ? 15.187  7.190   3.869   1.00 0.00 ? 97  VAL B CG1  2  
ATOM 4484  C CG2  . VAL B 1 97  ? 16.697  8.578   5.276   1.00 0.00 ? 97  VAL B CG2  2  
ATOM 4485  H H    . VAL B 1 97  ? 19.183  8.143   3.272   1.00 0.00 ? 97  VAL B H    2  
ATOM 4486  H HA   . VAL B 1 97  ? 17.635  6.077   4.665   1.00 0.00 ? 97  VAL B HA   2  
ATOM 4487  H HB   . VAL B 1 97  ? 16.667  8.532   3.156   1.00 0.00 ? 97  VAL B HB   2  
ATOM 4488  H HG11 . VAL B 1 97  ? 14.427  7.951   3.962   1.00 0.00 ? 97  VAL B HG11 2  
ATOM 4489  H HG12 . VAL B 1 97  ? 15.071  6.460   4.657   1.00 0.00 ? 97  VAL B HG12 2  
ATOM 4490  H HG13 . VAL B 1 97  ? 15.100  6.706   2.908   1.00 0.00 ? 97  VAL B HG13 2  
ATOM 4491  H HG21 . VAL B 1 97  ? 17.649  9.085   5.308   1.00 0.00 ? 97  VAL B HG21 2  
ATOM 4492  H HG22 . VAL B 1 97  ? 16.635  7.879   6.096   1.00 0.00 ? 97  VAL B HG22 2  
ATOM 4493  H HG23 . VAL B 1 97  ? 15.895  9.296   5.366   1.00 0.00 ? 97  VAL B HG23 2  
ATOM 4494  N N    . ILE B 1 98  ? 17.041  4.761   2.651   1.00 0.00 ? 98  ILE B N    2  
ATOM 4495  C CA   . ILE B 1 98  ? 16.776  3.875   1.533   1.00 0.00 ? 98  ILE B CA   2  
ATOM 4496  C C    . ILE B 1 98  ? 15.311  3.481   1.590   1.00 0.00 ? 98  ILE B C    2  
ATOM 4497  O O    . ILE B 1 98  ? 14.858  2.943   2.584   1.00 0.00 ? 98  ILE B O    2  
ATOM 4498  C CB   . ILE B 1 98  ? 17.700  2.577   1.538   1.00 0.00 ? 98  ILE B CB   2  
ATOM 4499  C CG1  . ILE B 1 98  ? 19.147  2.978   1.240   1.00 0.00 ? 98  ILE B CG1  2  
ATOM 4500  C CG2  . ILE B 1 98  ? 17.195  1.547   0.515   1.00 0.00 ? 98  ILE B CG2  2  
ATOM 4501  C CD1  . ILE B 1 98  ? 20.075  1.814   1.015   1.00 0.00 ? 98  ILE B CD1  2  
ATOM 4502  H H    . ILE B 1 98  ? 16.783  4.462   3.552   1.00 0.00 ? 98  ILE B H    2  
ATOM 4503  H HA   . ILE B 1 98  ? 16.943  4.434   0.624   1.00 0.00 ? 98  ILE B HA   2  
ATOM 4504  H HB   . ILE B 1 98  ? 17.646  2.126   2.518   1.00 0.00 ? 98  ILE B HB   2  
ATOM 4505  H HG12 . ILE B 1 98  ? 19.160  3.577   0.343   1.00 0.00 ? 98  ILE B HG12 2  
ATOM 4506  H HG13 . ILE B 1 98  ? 19.530  3.563   2.063   1.00 0.00 ? 98  ILE B HG13 2  
ATOM 4507  H HG21 . ILE B 1 98  ? 17.231  1.976   -0.475  1.00 0.00 ? 98  ILE B HG21 2  
ATOM 4508  H HG22 . ILE B 1 98  ? 16.176  1.278   0.751   1.00 0.00 ? 98  ILE B HG22 2  
ATOM 4509  H HG23 . ILE B 1 98  ? 17.819  0.666   0.553   1.00 0.00 ? 98  ILE B HG23 2  
ATOM 4510  H HD11 . ILE B 1 98  ? 20.032  1.138   1.855   1.00 0.00 ? 98  ILE B HD11 2  
ATOM 4511  H HD12 . ILE B 1 98  ? 21.084  2.177   0.881   1.00 0.00 ? 98  ILE B HD12 2  
ATOM 4512  H HD13 . ILE B 1 98  ? 19.768  1.301   0.117   1.00 0.00 ? 98  ILE B HD13 2  
ATOM 4513  N N    . GLU B 1 99  ? 14.563  3.780   0.566   1.00 0.00 ? 99  GLU B N    2  
ATOM 4514  C CA   . GLU B 1 99  ? 13.156  3.458   0.566   1.00 0.00 ? 99  GLU B CA   2  
ATOM 4515  C C    . GLU B 1 99  ? 12.745  2.862   -0.754  1.00 0.00 ? 99  GLU B C    2  
ATOM 4516  O O    . GLU B 1 99  ? 13.325  3.165   -1.802  1.00 0.00 ? 99  GLU B O    2  
ATOM 4517  C CB   . GLU B 1 99  ? 12.285  4.686   0.877   1.00 0.00 ? 99  GLU B CB   2  
ATOM 4518  C CG   . GLU B 1 99  ? 12.551  5.325   2.223   1.00 0.00 ? 99  GLU B CG   2  
ATOM 4519  C CD   . GLU B 1 99  ? 11.629  6.466   2.516   1.00 0.00 ? 99  GLU B CD   2  
ATOM 4520  O OE1  . GLU B 1 99  ? 11.907  7.613   2.098   1.00 0.00 ? 99  GLU B OE1  2  
ATOM 4521  O OE2  . GLU B 1 99  ? 10.591  6.252   3.175   1.00 0.00 ? 99  GLU B OE2  2  
ATOM 4522  H H    . GLU B 1 99  ? 14.946  4.208   -0.235  1.00 0.00 ? 99  GLU B H    2  
ATOM 4523  H HA   . GLU B 1 99  ? 12.994  2.720   1.338   1.00 0.00 ? 99  GLU B HA   2  
ATOM 4524  H HB2  . GLU B 1 99  ? 12.457  5.438   0.121   1.00 0.00 ? 99  GLU B HB2  2  
ATOM 4525  H HB3  . GLU B 1 99  ? 11.247  4.393   0.840   1.00 0.00 ? 99  GLU B HB3  2  
ATOM 4526  H HG2  . GLU B 1 99  ? 12.433  4.582   2.997   1.00 0.00 ? 99  GLU B HG2  2  
ATOM 4527  H HG3  . GLU B 1 99  ? 13.567  5.686   2.228   1.00 0.00 ? 99  GLU B HG3  2  
ATOM 4528  N N    . VAL B 1 100 ? 11.777  2.003   -0.706  1.00 0.00 ? 100 VAL B N    2  
ATOM 4529  C CA   . VAL B 1 100 ? 11.233  1.407   -1.893  1.00 0.00 ? 100 VAL B CA   2  
ATOM 4530  C C    . VAL B 1 100 ? 9.735   1.550   -1.863  1.00 0.00 ? 100 VAL B C    2  
ATOM 4531  O O    . VAL B 1 100 ? 9.071   1.098   -0.915  1.00 0.00 ? 100 VAL B O    2  
ATOM 4532  C CB   . VAL B 1 100 ? 11.630  -0.099  -2.062  1.00 0.00 ? 100 VAL B CB   2  
ATOM 4533  C CG1  . VAL B 1 100 ? 10.943  -0.715  -3.281  1.00 0.00 ? 100 VAL B CG1  2  
ATOM 4534  C CG2  . VAL B 1 100 ? 13.132  -0.239  -2.210  1.00 0.00 ? 100 VAL B CG2  2  
ATOM 4535  H H    . VAL B 1 100 ? 11.395  1.779   0.171   1.00 0.00 ? 100 VAL B H    2  
ATOM 4536  H HA   . VAL B 1 100 ? 11.612  1.968   -2.735  1.00 0.00 ? 100 VAL B HA   2  
ATOM 4537  H HB   . VAL B 1 100 ? 11.318  -0.642  -1.183  1.00 0.00 ? 100 VAL B HB   2  
ATOM 4538  H HG11 . VAL B 1 100 ? 11.223  -0.165  -4.167  1.00 0.00 ? 100 VAL B HG11 2  
ATOM 4539  H HG12 . VAL B 1 100 ? 9.871   -0.667  -3.153  1.00 0.00 ? 100 VAL B HG12 2  
ATOM 4540  H HG13 . VAL B 1 100 ? 11.250  -1.745  -3.383  1.00 0.00 ? 100 VAL B HG13 2  
ATOM 4541  H HG21 . VAL B 1 100 ? 13.448  0.278   -3.104  1.00 0.00 ? 100 VAL B HG21 2  
ATOM 4542  H HG22 . VAL B 1 100 ? 13.390  -1.285  -2.291  1.00 0.00 ? 100 VAL B HG22 2  
ATOM 4543  H HG23 . VAL B 1 100 ? 13.623  0.197   -1.353  1.00 0.00 ? 100 VAL B HG23 2  
ATOM 4544  N N    . HIS B 1 101 ? 9.216   2.199   -2.855  1.00 0.00 ? 101 HIS B N    2  
ATOM 4545  C CA   . HIS B 1 101 ? 7.806   2.390   -2.993  1.00 0.00 ? 101 HIS B CA   2  
ATOM 4546  C C    . HIS B 1 101 ? 7.399   1.618   -4.207  1.00 0.00 ? 101 HIS B C    2  
ATOM 4547  O O    . HIS B 1 101 ? 7.896   1.863   -5.278  1.00 0.00 ? 101 HIS B O    2  
ATOM 4548  C CB   . HIS B 1 101 ? 7.476   3.891   -3.194  1.00 0.00 ? 101 HIS B CB   2  
ATOM 4549  C CG   . HIS B 1 101 ? 5.992   4.248   -3.186  1.00 0.00 ? 101 HIS B CG   2  
ATOM 4550  N ND1  . HIS B 1 101 ? 5.499   5.344   -2.520  1.00 0.00 ? 101 HIS B ND1  2  
ATOM 4551  C CD2  . HIS B 1 101 ? 4.909   3.680   -3.795  1.00 0.00 ? 101 HIS B CD2  2  
ATOM 4552  C CE1  . HIS B 1 101 ? 4.203   5.435   -2.710  1.00 0.00 ? 101 HIS B CE1  2  
ATOM 4553  N NE2  . HIS B 1 101 ? 3.820   4.442   -3.474  1.00 0.00 ? 101 HIS B NE2  2  
ATOM 4554  H H    . HIS B 1 101 ? 9.807   2.546   -3.561  1.00 0.00 ? 101 HIS B H    2  
ATOM 4555  H HA   . HIS B 1 101 ? 7.299   2.014   -2.118  1.00 0.00 ? 101 HIS B HA   2  
ATOM 4556  H HB2  . HIS B 1 101 ? 7.948   4.459   -2.407  1.00 0.00 ? 101 HIS B HB2  2  
ATOM 4557  H HB3  . HIS B 1 101 ? 7.886   4.209   -4.140  1.00 0.00 ? 101 HIS B HB3  2  
ATOM 4558  H HD1  . HIS B 1 101 ? 6.035   6.000   -2.019  1.00 0.00 ? 101 HIS B HD1  2  
ATOM 4559  H HD2  . HIS B 1 101 ? 4.914   2.793   -4.413  1.00 0.00 ? 101 HIS B HD2  2  
ATOM 4560  H HE1  . HIS B 1 101 ? 3.567   6.207   -2.307  1.00 0.00 ? 101 HIS B HE1  2  
ATOM 4561  H HE2  . HIS B 1 101 ? 2.873   4.259   -3.709  1.00 0.00 ? 101 HIS B HE2  2  
ATOM 4562  N N    . GLY B 1 102 ? 6.534   0.687   -4.039  1.00 0.00 ? 102 GLY B N    2  
ATOM 4563  C CA   . GLY B 1 102 ? 6.072   -0.075  -5.158  1.00 0.00 ? 102 GLY B CA   2  
ATOM 4564  C C    . GLY B 1 102 ? 4.608   -0.257  -5.069  1.00 0.00 ? 102 GLY B C    2  
ATOM 4565  O O    . GLY B 1 102 ? 4.052   -0.176  -3.968  1.00 0.00 ? 102 GLY B O    2  
ATOM 4566  H H    . GLY B 1 102 ? 6.173   0.500   -3.145  1.00 0.00 ? 102 GLY B H    2  
ATOM 4567  H HA2  . GLY B 1 102 ? 6.315   0.446   -6.072  1.00 0.00 ? 102 GLY B HA2  2  
ATOM 4568  H HA3  . GLY B 1 102 ? 6.550   -1.043  -5.158  1.00 0.00 ? 102 GLY B HA3  2  
ATOM 4569  N N    . LYS B 1 103 ? 3.964   -0.456  -6.176  1.00 0.00 ? 103 LYS B N    2  
ATOM 4570  C CA   . LYS B 1 103 ? 2.555   -0.672  -6.161  1.00 0.00 ? 103 LYS B CA   2  
ATOM 4571  C C    . LYS B 1 103 ? 2.167   -1.767  -7.118  1.00 0.00 ? 103 LYS B C    2  
ATOM 4572  O O    . LYS B 1 103 ? 2.806   -1.976  -8.151  1.00 0.00 ? 103 LYS B O    2  
ATOM 4573  C CB   . LYS B 1 103 ? 1.756   0.611   -6.476  1.00 0.00 ? 103 LYS B CB   2  
ATOM 4574  C CG   . LYS B 1 103 ? 2.034   1.220   -7.843  1.00 0.00 ? 103 LYS B CG   2  
ATOM 4575  C CD   . LYS B 1 103 ? 0.987   2.262   -8.229  1.00 0.00 ? 103 LYS B CD   2  
ATOM 4576  C CE   . LYS B 1 103 ? 0.912   3.433   -7.256  1.00 0.00 ? 103 LYS B CE   2  
ATOM 4577  N NZ   . LYS B 1 103 ? -0.142  4.396   -7.652  1.00 0.00 ? 103 LYS B NZ   2  
ATOM 4578  H H    . LYS B 1 103 ? 4.424   -0.460  -7.047  1.00 0.00 ? 103 LYS B H    2  
ATOM 4579  H HA   . LYS B 1 103 ? 2.295   -0.992  -5.163  1.00 0.00 ? 103 LYS B HA   2  
ATOM 4580  H HB2  . LYS B 1 103 ? 0.700   0.392   -6.413  1.00 0.00 ? 103 LYS B HB2  2  
ATOM 4581  H HB3  . LYS B 1 103 ? 2.004   1.346   -5.726  1.00 0.00 ? 103 LYS B HB3  2  
ATOM 4582  H HG2  . LYS B 1 103 ? 3.007   1.689   -7.830  1.00 0.00 ? 103 LYS B HG2  2  
ATOM 4583  H HG3  . LYS B 1 103 ? 2.030   0.428   -8.578  1.00 0.00 ? 103 LYS B HG3  2  
ATOM 4584  H HD2  . LYS B 1 103 ? 1.235   2.649   -9.207  1.00 0.00 ? 103 LYS B HD2  2  
ATOM 4585  H HD3  . LYS B 1 103 ? 0.021   1.778   -8.274  1.00 0.00 ? 103 LYS B HD3  2  
ATOM 4586  H HE2  . LYS B 1 103 ? 0.689   3.057   -6.268  1.00 0.00 ? 103 LYS B HE2  2  
ATOM 4587  H HE3  . LYS B 1 103 ? 1.865   3.939   -7.242  1.00 0.00 ? 103 LYS B HE3  2  
ATOM 4588  H HZ1  . LYS B 1 103 ? 0.008   4.733   -8.624  1.00 0.00 ? 103 LYS B HZ1  2  
ATOM 4589  H HZ2  . LYS B 1 103 ? -0.172  5.225   -7.026  1.00 0.00 ? 103 LYS B HZ2  2  
ATOM 4590  H HZ3  . LYS B 1 103 ? -1.085  3.955   -7.637  1.00 0.00 ? 103 LYS B HZ3  2  
ATOM 4591  N N    . HIS B 1 104 ? 1.207   -2.525  -6.716  1.00 0.00 ? 104 HIS B N    2  
ATOM 4592  C CA   . HIS B 1 104 ? 0.581   -3.480  -7.564  1.00 0.00 ? 104 HIS B CA   2  
ATOM 4593  C C    . HIS B 1 104 ? -0.867  -3.387  -7.294  1.00 0.00 ? 104 HIS B C    2  
ATOM 4594  O O    . HIS B 1 104 ? -1.278  -3.445  -6.139  1.00 0.00 ? 104 HIS B O    2  
ATOM 4595  C CB   . HIS B 1 104 ? 1.095   -4.909  -7.323  1.00 0.00 ? 104 HIS B CB   2  
ATOM 4596  C CG   . HIS B 1 104 ? 0.459   -5.970  -8.203  1.00 0.00 ? 104 HIS B CG   2  
ATOM 4597  N ND1  . HIS B 1 104 ? 0.825   -6.178  -9.508  1.00 0.00 ? 104 HIS B ND1  2  
ATOM 4598  C CD2  . HIS B 1 104 ? -0.521  -6.875  -7.949  1.00 0.00 ? 104 HIS B CD2  2  
ATOM 4599  C CE1  . HIS B 1 104 ? 0.112   -7.157  -10.017 1.00 0.00 ? 104 HIS B CE1  2  
ATOM 4600  N NE2  . HIS B 1 104 ? -0.708  -7.595  -9.094  1.00 0.00 ? 104 HIS B NE2  2  
ATOM 4601  H H    . HIS B 1 104 ? 0.851   -2.397  -5.808  1.00 0.00 ? 104 HIS B H    2  
ATOM 4602  H HA   . HIS B 1 104 ? 0.776   -3.186  -8.584  1.00 0.00 ? 104 HIS B HA   2  
ATOM 4603  H HB2  . HIS B 1 104 ? 2.143   -4.890  -7.575  1.00 0.00 ? 104 HIS B HB2  2  
ATOM 4604  H HB3  . HIS B 1 104 ? 0.964   -5.183  -6.287  1.00 0.00 ? 104 HIS B HB3  2  
ATOM 4605  H HD1  . HIS B 1 104 ? 1.477   -5.635  -10.017 1.00 0.00 ? 104 HIS B HD1  2  
ATOM 4606  H HD2  . HIS B 1 104 ? -1.053  -7.002  -7.016  1.00 0.00 ? 104 HIS B HD2  2  
ATOM 4607  H HE1  . HIS B 1 104 ? 0.193   -7.540  -11.024 1.00 0.00 ? 104 HIS B HE1  2  
ATOM 4608  H HE2  . HIS B 1 104 ? -1.228  -8.426  -9.183  1.00 0.00 ? 104 HIS B HE2  2  
ATOM 4609  N N    . GLU B 1 105 ? -1.637  -3.227  -8.293  1.00 0.00 ? 105 GLU B N    2  
ATOM 4610  C CA   . GLU B 1 105 ? -3.033  -3.158  -8.088  1.00 0.00 ? 105 GLU B CA   2  
ATOM 4611  C C    . GLU B 1 105 ? -3.563  -4.559  -8.066  1.00 0.00 ? 105 GLU B C    2  
ATOM 4612  O O    . GLU B 1 105 ? -3.333  -5.313  -9.006  1.00 0.00 ? 105 GLU B O    2  
ATOM 4613  C CB   . GLU B 1 105 ? -3.681  -2.260  -9.123  1.00 0.00 ? 105 GLU B CB   2  
ATOM 4614  C CG   . GLU B 1 105 ? -3.036  -0.886  -9.127  1.00 0.00 ? 105 GLU B CG   2  
ATOM 4615  C CD   . GLU B 1 105 ? -3.772  0.133   -9.924  1.00 0.00 ? 105 GLU B CD   2  
ATOM 4616  O OE1  . GLU B 1 105 ? -3.802  0.050   -11.176 1.00 0.00 ? 105 GLU B OE1  2  
ATOM 4617  O OE2  . GLU B 1 105 ? -4.334  1.055   -9.313  1.00 0.00 ? 105 GLU B OE2  2  
ATOM 4618  H H    . GLU B 1 105 ? -1.272  -3.143  -9.203  1.00 0.00 ? 105 GLU B H    2  
ATOM 4619  H HA   . GLU B 1 105 ? -3.171  -2.741  -7.103  1.00 0.00 ? 105 GLU B HA   2  
ATOM 4620  H HB2  . GLU B 1 105 ? -3.564  -2.707  -10.099 1.00 0.00 ? 105 GLU B HB2  2  
ATOM 4621  H HB3  . GLU B 1 105 ? -4.730  -2.143  -8.897  1.00 0.00 ? 105 GLU B HB3  2  
ATOM 4622  H HG2  . GLU B 1 105 ? -2.977  -0.533  -8.108  1.00 0.00 ? 105 GLU B HG2  2  
ATOM 4623  H HG3  . GLU B 1 105 ? -2.034  -0.984  -9.516  1.00 0.00 ? 105 GLU B HG3  2  
ATOM 4624  N N    . GLU B 1 106 ? -4.191  -4.919  -6.955  1.00 0.00 ? 106 GLU B N    2  
ATOM 4625  C CA   . GLU B 1 106 ? -4.510  -6.307  -6.654  1.00 0.00 ? 106 GLU B CA   2  
ATOM 4626  C C    . GLU B 1 106 ? -5.303  -7.016  -7.727  1.00 0.00 ? 106 GLU B C    2  
ATOM 4627  O O    . GLU B 1 106 ? -4.750  -7.789  -8.521  1.00 0.00 ? 106 GLU B O    2  
ATOM 4628  C CB   . GLU B 1 106 ? -5.224  -6.471  -5.303  1.00 0.00 ? 106 GLU B CB   2  
ATOM 4629  C CG   . GLU B 1 106 ? -4.470  -5.957  -4.096  1.00 0.00 ? 106 GLU B CG   2  
ATOM 4630  C CD   . GLU B 1 106 ? -4.980  -6.581  -2.811  1.00 0.00 ? 106 GLU B CD   2  
ATOM 4631  O OE1  . GLU B 1 106 ? -4.476  -7.668  -2.458  1.00 0.00 ? 106 GLU B OE1  2  
ATOM 4632  O OE2  . GLU B 1 106 ? -5.893  -6.024  -2.154  1.00 0.00 ? 106 GLU B OE2  2  
ATOM 4633  H H    . GLU B 1 106 ? -4.455  -4.214  -6.330  1.00 0.00 ? 106 GLU B H    2  
ATOM 4634  H HA   . GLU B 1 106 ? -3.562  -6.818  -6.573  1.00 0.00 ? 106 GLU B HA   2  
ATOM 4635  H HB2  . GLU B 1 106 ? -6.167  -5.947  -5.347  1.00 0.00 ? 106 GLU B HB2  2  
ATOM 4636  H HB3  . GLU B 1 106 ? -5.428  -7.521  -5.152  1.00 0.00 ? 106 GLU B HB3  2  
ATOM 4637  H HG2  . GLU B 1 106 ? -3.421  -6.190  -4.207  1.00 0.00 ? 106 GLU B HG2  2  
ATOM 4638  H HG3  . GLU B 1 106 ? -4.602  -4.887  -4.037  1.00 0.00 ? 106 GLU B HG3  2  
ATOM 4639  N N    . ARG B 1 107 ? -6.578  -6.778  -7.714  1.00 0.00 ? 107 ARG B N    2  
ATOM 4640  C CA   . ARG B 1 107 ? -7.536  -7.445  -8.548  1.00 0.00 ? 107 ARG B CA   2  
ATOM 4641  C C    . ARG B 1 107 ? -8.606  -6.428  -8.813  1.00 0.00 ? 107 ARG B C    2  
ATOM 4642  O O    . ARG B 1 107 ? -8.743  -5.498  -8.029  1.00 0.00 ? 107 ARG B O    2  
ATOM 4643  C CB   . ARG B 1 107 ? -8.129  -8.627  -7.737  1.00 0.00 ? 107 ARG B CB   2  
ATOM 4644  C CG   . ARG B 1 107 ? -7.085  -9.660  -7.300  1.00 0.00 ? 107 ARG B CG   2  
ATOM 4645  C CD   . ARG B 1 107 ? -7.590  -10.616 -6.231  1.00 0.00 ? 107 ARG B CD   2  
ATOM 4646  N NE   . ARG B 1 107 ? -8.011  -9.918  -4.995  1.00 0.00 ? 107 ARG B NE   2  
ATOM 4647  C CZ   . ARG B 1 107 ? -7.204  -9.471  -3.998  1.00 0.00 ? 107 ARG B CZ   2  
ATOM 4648  N NH1  . ARG B 1 107 ? -5.873  -9.519  -4.105  1.00 0.00 ? 107 ARG B NH1  2  
ATOM 4649  N NH2  . ARG B 1 107 ? -7.746  -8.999  -2.881  1.00 0.00 ? 107 ARG B NH2  2  
ATOM 4650  H H    . ARG B 1 107 ? -6.952  -6.080  -7.133  1.00 0.00 ? 107 ARG B H    2  
ATOM 4651  H HA   . ARG B 1 107 ? -7.079  -7.806  -9.457  1.00 0.00 ? 107 ARG B HA   2  
ATOM 4652  H HB2  . ARG B 1 107 ? -8.605  -8.235  -6.852  1.00 0.00 ? 107 ARG B HB2  2  
ATOM 4653  H HB3  . ARG B 1 107 ? -8.873  -9.128  -8.338  1.00 0.00 ? 107 ARG B HB3  2  
ATOM 4654  H HG2  . ARG B 1 107 ? -6.784  -10.239 -8.161  1.00 0.00 ? 107 ARG B HG2  2  
ATOM 4655  H HG3  . ARG B 1 107 ? -6.225  -9.129  -6.919  1.00 0.00 ? 107 ARG B HG3  2  
ATOM 4656  H HD2  . ARG B 1 107 ? -8.435  -11.159 -6.627  1.00 0.00 ? 107 ARG B HD2  2  
ATOM 4657  H HD3  . ARG B 1 107 ? -6.801  -11.311 -5.986  1.00 0.00 ? 107 ARG B HD3  2  
ATOM 4658  H HE   . ARG B 1 107 ? -8.999  -9.832  -4.909  1.00 0.00 ? 107 ARG B HE   2  
ATOM 4659  H HH11 . ARG B 1 107 ? -5.405  -9.896  -4.906  1.00 0.00 ? 107 ARG B HH11 2  
ATOM 4660  H HH12 . ARG B 1 107 ? -5.281  -9.140  -3.381  1.00 0.00 ? 107 ARG B HH12 2  
ATOM 4661  H HH21 . ARG B 1 107 ? -8.753  -8.993  -2.772  1.00 0.00 ? 107 ARG B HH21 2  
ATOM 4662  H HH22 . ARG B 1 107 ? -7.194  -8.638  -2.128  1.00 0.00 ? 107 ARG B HH22 2  
ATOM 4663  N N    . GLN B 1 108 ? -9.311  -6.533  -9.903  1.00 0.00 ? 108 GLN B N    2  
ATOM 4664  C CA   . GLN B 1 108 ? -10.426 -5.645  -10.101 1.00 0.00 ? 108 GLN B CA   2  
ATOM 4665  C C    . GLN B 1 108 ? -11.602 -6.225  -9.373  1.00 0.00 ? 108 GLN B C    2  
ATOM 4666  O O    . GLN B 1 108 ? -11.913 -7.411  -9.526  1.00 0.00 ? 108 GLN B O    2  
ATOM 4667  C CB   . GLN B 1 108 ? -10.729 -5.392  -11.572 1.00 0.00 ? 108 GLN B CB   2  
ATOM 4668  C CG   . GLN B 1 108 ? -9.599  -4.684  -12.297 1.00 0.00 ? 108 GLN B CG   2  
ATOM 4669  C CD   . GLN B 1 108 ? -9.987  -4.214  -13.678 1.00 0.00 ? 108 GLN B CD   2  
ATOM 4670  O OE1  . GLN B 1 108 ? -10.831 -4.806  -14.342 1.00 0.00 ? 108 GLN B OE1  2  
ATOM 4671  N NE2  . GLN B 1 108 ? -9.381  -3.150  -14.119 1.00 0.00 ? 108 GLN B NE2  2  
ATOM 4672  H H    . GLN B 1 108 ? -9.105  -7.219  -10.572 1.00 0.00 ? 108 GLN B H    2  
ATOM 4673  H HA   . GLN B 1 108 ? -10.167 -4.717  -9.612  1.00 0.00 ? 108 GLN B HA   2  
ATOM 4674  H HB2  . GLN B 1 108 ? -10.913 -6.337  -12.062 1.00 0.00 ? 108 GLN B HB2  2  
ATOM 4675  H HB3  . GLN B 1 108 ? -11.615 -4.780  -11.649 1.00 0.00 ? 108 GLN B HB3  2  
ATOM 4676  H HG2  . GLN B 1 108 ? -9.298  -3.825  -11.715 1.00 0.00 ? 108 GLN B HG2  2  
ATOM 4677  H HG3  . GLN B 1 108 ? -8.764  -5.364  -12.383 1.00 0.00 ? 108 GLN B HG3  2  
ATOM 4678  H HE21 . GLN B 1 108 ? -8.711  -2.719  -13.547 1.00 0.00 ? 108 GLN B HE21 2  
ATOM 4679  H HE22 . GLN B 1 108 ? -9.620  -2.810  -15.008 1.00 0.00 ? 108 GLN B HE22 2  
ATOM 4680  N N    . ASP B 1 109 ? -12.226 -5.412  -8.572  1.00 0.00 ? 109 ASP B N    2  
ATOM 4681  C CA   . ASP B 1 109 ? -13.268 -5.855  -7.677  1.00 0.00 ? 109 ASP B CA   2  
ATOM 4682  C C    . ASP B 1 109 ? -14.629 -5.643  -8.357  1.00 0.00 ? 109 ASP B C    2  
ATOM 4683  O O    . ASP B 1 109 ? -14.661 -5.291  -9.546  1.00 0.00 ? 109 ASP B O    2  
ATOM 4684  C CB   . ASP B 1 109 ? -13.137 -5.080  -6.341  1.00 0.00 ? 109 ASP B CB   2  
ATOM 4685  C CG   . ASP B 1 109 ? -13.829 -5.733  -5.162  1.00 0.00 ? 109 ASP B CG   2  
ATOM 4686  O OD1  . ASP B 1 109 ? -14.335 -6.865  -5.323  1.00 0.00 ? 109 ASP B OD1  2  
ATOM 4687  O OD2  . ASP B 1 109 ? -13.890 -5.138  -4.073  1.00 0.00 ? 109 ASP B OD2  2  
ATOM 4688  H H    . ASP B 1 109 ? -12.031 -4.451  -8.590  1.00 0.00 ? 109 ASP B H    2  
ATOM 4689  H HA   . ASP B 1 109 ? -13.124 -6.908  -7.501  1.00 0.00 ? 109 ASP B HA   2  
ATOM 4690  H HB2  . ASP B 1 109 ? -12.089 -5.002  -6.095  1.00 0.00 ? 109 ASP B HB2  2  
ATOM 4691  H HB3  . ASP B 1 109 ? -13.539 -4.085  -6.472  1.00 0.00 ? 109 ASP B HB3  2  
ATOM 4692  N N    . GLU B 1 110 ? -15.722 -5.854  -7.618  1.00 0.00 ? 110 GLU B N    2  
ATOM 4693  C CA   . GLU B 1 110 ? -17.121 -5.771  -8.116  1.00 0.00 ? 110 GLU B CA   2  
ATOM 4694  C C    . GLU B 1 110 ? -17.339 -4.613  -9.096  1.00 0.00 ? 110 GLU B C    2  
ATOM 4695  O O    . GLU B 1 110 ? -17.622 -4.814  -10.274 1.00 0.00 ? 110 GLU B O    2  
ATOM 4696  C CB   . GLU B 1 110 ? -18.072 -5.604  -6.935  1.00 0.00 ? 110 GLU B CB   2  
ATOM 4697  C CG   . GLU B 1 110 ? -18.022 -6.732  -5.919  1.00 0.00 ? 110 GLU B CG   2  
ATOM 4698  C CD   . GLU B 1 110 ? -18.490 -8.049  -6.476  1.00 0.00 ? 110 GLU B CD   2  
ATOM 4699  O OE1  . GLU B 1 110 ? -19.716 -8.326  -6.418  1.00 0.00 ? 110 GLU B OE1  2  
ATOM 4700  O OE2  . GLU B 1 110 ? -17.661 -8.834  -6.972  1.00 0.00 ? 110 GLU B OE2  2  
ATOM 4701  H H    . GLU B 1 110 ? -15.570 -6.096  -6.674  1.00 0.00 ? 110 GLU B H    2  
ATOM 4702  H HA   . GLU B 1 110 ? -17.360 -6.699  -8.611  1.00 0.00 ? 110 GLU B HA   2  
ATOM 4703  H HB2  . GLU B 1 110 ? -17.823 -4.684  -6.425  1.00 0.00 ? 110 GLU B HB2  2  
ATOM 4704  H HB3  . GLU B 1 110 ? -19.081 -5.529  -7.314  1.00 0.00 ? 110 GLU B HB3  2  
ATOM 4705  H HG2  . GLU B 1 110 ? -17.002 -6.848  -5.585  1.00 0.00 ? 110 GLU B HG2  2  
ATOM 4706  H HG3  . GLU B 1 110 ? -18.643 -6.465  -5.077  1.00 0.00 ? 110 GLU B HG3  2  
ATOM 4707  N N    . HIS B 1 111 ? -17.222 -3.418  -8.595  1.00 0.00 ? 111 HIS B N    2  
ATOM 4708  C CA   . HIS B 1 111 ? -17.330 -2.187  -9.394  1.00 0.00 ? 111 HIS B CA   2  
ATOM 4709  C C    . HIS B 1 111 ? -16.354 -1.241  -8.859  1.00 0.00 ? 111 HIS B C    2  
ATOM 4710  O O    . HIS B 1 111 ? -16.529 -0.024  -8.898  1.00 0.00 ? 111 HIS B O    2  
ATOM 4711  C CB   . HIS B 1 111 ? -18.734 -1.540  -9.296  1.00 0.00 ? 111 HIS B CB   2  
ATOM 4712  C CG   . HIS B 1 111 ? -19.869 -2.226  -10.012 1.00 0.00 ? 111 HIS B CG   2  
ATOM 4713  N ND1  . HIS B 1 111 ? -20.510 -1.668  -11.095 1.00 0.00 ? 111 HIS B ND1  2  
ATOM 4714  C CD2  . HIS B 1 111 ? -20.538 -3.370  -9.740  1.00 0.00 ? 111 HIS B CD2  2  
ATOM 4715  C CE1  . HIS B 1 111 ? -21.518 -2.430  -11.451 1.00 0.00 ? 111 HIS B CE1  2  
ATOM 4716  N NE2  . HIS B 1 111 ? -21.560 -3.472  -10.647 1.00 0.00 ? 111 HIS B NE2  2  
ATOM 4717  H H    . HIS B 1 111 ? -17.033 -3.346  -7.634  1.00 0.00 ? 111 HIS B H    2  
ATOM 4718  H HA   . HIS B 1 111 ? -17.106 -2.417  -10.425 1.00 0.00 ? 111 HIS B HA   2  
ATOM 4719  H HB2  . HIS B 1 111 ? -19.011 -1.492  -8.254  1.00 0.00 ? 111 HIS B HB2  2  
ATOM 4720  H HB3  . HIS B 1 111 ? -18.665 -0.528  -9.670  1.00 0.00 ? 111 HIS B HB3  2  
ATOM 4721  H HD1  . HIS B 1 111 ? -20.261 -0.830  -11.548 1.00 0.00 ? 111 HIS B HD1  2  
ATOM 4722  H HD2  . HIS B 1 111 ? -20.308 -4.074  -8.953  1.00 0.00 ? 111 HIS B HD2  2  
ATOM 4723  H HE1  . HIS B 1 111 ? -22.200 -2.237  -12.265 1.00 0.00 ? 111 HIS B HE1  2  
ATOM 4724  H HE2  . HIS B 1 111 ? -22.414 -3.912  -10.427 1.00 0.00 ? 111 HIS B HE2  2  
ATOM 4725  N N    . GLY B 1 112 ? -15.354 -1.799  -8.322  1.00 0.00 ? 112 GLY B N    2  
ATOM 4726  C CA   . GLY B 1 112 ? -14.372 -1.054  -7.725  1.00 0.00 ? 112 GLY B CA   2  
ATOM 4727  C C    . GLY B 1 112 ? -13.082 -1.537  -8.180  1.00 0.00 ? 112 GLY B C    2  
ATOM 4728  O O    . GLY B 1 112 ? -12.949 -2.688  -8.584  1.00 0.00 ? 112 GLY B O    2  
ATOM 4729  H H    . GLY B 1 112 ? -15.229 -2.771  -8.376  1.00 0.00 ? 112 GLY B H    2  
ATOM 4730  H HA2  . GLY B 1 112 ? -14.516 -0.015  -7.990  1.00 0.00 ? 112 GLY B HA2  2  
ATOM 4731  H HA3  . GLY B 1 112 ? -14.440 -1.156  -6.652  1.00 0.00 ? 112 GLY B HA3  2  
ATOM 4732  N N    . PHE B 1 113 ? -12.157 -0.706  -8.162  1.00 0.00 ? 113 PHE B N    2  
ATOM 4733  C CA   . PHE B 1 113 ? -10.883 -1.050  -8.595  1.00 0.00 ? 113 PHE B CA   2  
ATOM 4734  C C    . PHE B 1 113 ? -10.006 -1.077  -7.374  1.00 0.00 ? 113 PHE B C    2  
ATOM 4735  O O    . PHE B 1 113 ? -10.259 -0.334  -6.413  1.00 0.00 ? 113 PHE B O    2  
ATOM 4736  C CB   . PHE B 1 113 ? -10.392 -0.052  -9.644  1.00 0.00 ? 113 PHE B CB   2  
ATOM 4737  C CG   . PHE B 1 113 ? -11.327 0.039   -10.829 1.00 0.00 ? 113 PHE B CG   2  
ATOM 4738  C CD1  . PHE B 1 113 ? -11.260 -0.893  -11.854 1.00 0.00 ? 113 PHE B CD1  2  
ATOM 4739  C CD2  . PHE B 1 113 ? -12.276 1.047   -10.906 1.00 0.00 ? 113 PHE B CD2  2  
ATOM 4740  C CE1  . PHE B 1 113 ? -12.121 -0.820  -12.931 1.00 0.00 ? 113 PHE B CE1  2  
ATOM 4741  C CE2  . PHE B 1 113 ? -13.137 1.125   -11.981 1.00 0.00 ? 113 PHE B CE2  2  
ATOM 4742  C CZ   . PHE B 1 113 ? -13.061 0.191   -12.994 1.00 0.00 ? 113 PHE B CZ   2  
ATOM 4743  H H    . PHE B 1 113 ? -12.322 0.189   -7.790  1.00 0.00 ? 113 PHE B H    2  
ATOM 4744  H HA   . PHE B 1 113 ? -10.927 -2.038  -9.028  1.00 0.00 ? 113 PHE B HA   2  
ATOM 4745  H HB2  . PHE B 1 113 ? -10.320 0.928   -9.195  1.00 0.00 ? 113 PHE B HB2  2  
ATOM 4746  H HB3  . PHE B 1 113 ? -9.422  -0.356  -10.005 1.00 0.00 ? 113 PHE B HB3  2  
ATOM 4747  H HD1  . PHE B 1 113 ? -10.526 -1.683  -11.804 1.00 0.00 ? 113 PHE B HD1  2  
ATOM 4748  H HD2  . PHE B 1 113 ? -12.338 1.780   -10.115 1.00 0.00 ? 113 PHE B HD2  2  
ATOM 4749  H HE1  . PHE B 1 113 ? -12.058 -1.552  -13.723 1.00 0.00 ? 113 PHE B HE1  2  
ATOM 4750  H HE2  . PHE B 1 113 ? -13.871 1.915   -12.028 1.00 0.00 ? 113 PHE B HE2  2  
ATOM 4751  H HZ   . PHE B 1 113 ? -13.735 0.248   -13.836 1.00 0.00 ? 113 PHE B HZ   2  
ATOM 4752  N N    . ILE B 1 114 ? -9.011  -1.910  -7.368  1.00 0.00 ? 114 ILE B N    2  
ATOM 4753  C CA   . ILE B 1 114 ? -8.239  -2.097  -6.167  1.00 0.00 ? 114 ILE B CA   2  
ATOM 4754  C C    . ILE B 1 114 ? -6.774  -1.833  -6.443  1.00 0.00 ? 114 ILE B C    2  
ATOM 4755  O O    . ILE B 1 114 ? -6.237  -2.302  -7.444  1.00 0.00 ? 114 ILE B O    2  
ATOM 4756  C CB   . ILE B 1 114 ? -8.370  -3.557  -5.633  1.00 0.00 ? 114 ILE B CB   2  
ATOM 4757  C CG1  . ILE B 1 114 ? -9.844  -4.019  -5.509  1.00 0.00 ? 114 ILE B CG1  2  
ATOM 4758  C CG2  . ILE B 1 114 ? -7.654  -3.689  -4.319  1.00 0.00 ? 114 ILE B CG2  2  
ATOM 4759  C CD1  . ILE B 1 114 ? -10.707 -3.211  -4.570  1.00 0.00 ? 114 ILE B CD1  2  
ATOM 4760  H H    . ILE B 1 114 ? -8.765  -2.408  -8.177  1.00 0.00 ? 114 ILE B H    2  
ATOM 4761  H HA   . ILE B 1 114 ? -8.599  -1.423  -5.405  1.00 0.00 ? 114 ILE B HA   2  
ATOM 4762  H HB   . ILE B 1 114 ? -7.862  -4.199  -6.340  1.00 0.00 ? 114 ILE B HB   2  
ATOM 4763  H HG12 . ILE B 1 114 ? -10.301 -3.959  -6.486  1.00 0.00 ? 114 ILE B HG12 2  
ATOM 4764  H HG13 . ILE B 1 114 ? -9.860  -5.049  -5.182  1.00 0.00 ? 114 ILE B HG13 2  
ATOM 4765  H HG21 . ILE B 1 114 ? -8.045  -2.961  -3.627  1.00 0.00 ? 114 ILE B HG21 2  
ATOM 4766  H HG22 . ILE B 1 114 ? -6.599  -3.515  -4.468  1.00 0.00 ? 114 ILE B HG22 2  
ATOM 4767  H HG23 . ILE B 1 114 ? -7.807  -4.682  -3.922  1.00 0.00 ? 114 ILE B HG23 2  
ATOM 4768  H HD11 . ILE B 1 114 ? -10.692 -2.173  -4.867  1.00 0.00 ? 114 ILE B HD11 2  
ATOM 4769  H HD12 . ILE B 1 114 ? -10.319 -3.301  -3.567  1.00 0.00 ? 114 ILE B HD12 2  
ATOM 4770  H HD13 . ILE B 1 114 ? -11.723 -3.578  -4.596  1.00 0.00 ? 114 ILE B HD13 2  
ATOM 4771  N N    . SER B 1 115 ? -6.137  -1.105  -5.551  1.00 0.00 ? 115 SER B N    2  
ATOM 4772  C CA   . SER B 1 115 ? -4.739  -0.772  -5.648  1.00 0.00 ? 115 SER B CA   2  
ATOM 4773  C C    . SER B 1 115 ? -4.042  -1.149  -4.315  1.00 0.00 ? 115 SER B C    2  
ATOM 4774  O O    . SER B 1 115 ? -4.624  -0.988  -3.247  1.00 0.00 ? 115 SER B O    2  
ATOM 4775  C CB   . SER B 1 115 ? -4.613  0.740   -5.878  1.00 0.00 ? 115 SER B CB   2  
ATOM 4776  O OG   . SER B 1 115 ? -5.481  1.185   -6.919  1.00 0.00 ? 115 SER B OG   2  
ATOM 4777  H H    . SER B 1 115 ? -6.625  -0.759  -4.768  1.00 0.00 ? 115 SER B H    2  
ATOM 4778  H HA   . SER B 1 115 ? -4.306  -1.300  -6.482  1.00 0.00 ? 115 SER B HA   2  
ATOM 4779  H HB2  . SER B 1 115 ? -4.865  1.266   -4.970  1.00 0.00 ? 115 SER B HB2  2  
ATOM 4780  H HB3  . SER B 1 115 ? -3.595  0.977   -6.151  1.00 0.00 ? 115 SER B HB3  2  
ATOM 4781  H HG   . SER B 1 115 ? -5.059  1.024   -7.779  1.00 0.00 ? 115 SER B HG   2  
ATOM 4782  N N    . ARG B 1 116 ? -2.832  -1.672  -4.364  1.00 0.00 ? 116 ARG B N    2  
ATOM 4783  C CA   . ARG B 1 116 ? -2.103  -1.970  -3.160  1.00 0.00 ? 116 ARG B CA   2  
ATOM 4784  C C    . ARG B 1 116 ? -0.742  -1.325  -3.310  1.00 0.00 ? 116 ARG B C    2  
ATOM 4785  O O    . ARG B 1 116 ? -0.204  -1.270  -4.419  1.00 0.00 ? 116 ARG B O    2  
ATOM 4786  C CB   . ARG B 1 116 ? -1.986  -3.505  -3.034  1.00 0.00 ? 116 ARG B CB   2  
ATOM 4787  C CG   . ARG B 1 116 ? -1.332  -4.053  -1.770  1.00 0.00 ? 116 ARG B CG   2  
ATOM 4788  C CD   . ARG B 1 116 ? -1.386  -5.590  -1.778  1.00 0.00 ? 116 ARG B CD   2  
ATOM 4789  N NE   . ARG B 1 116 ? -0.556  -6.197  -2.835  1.00 0.00 ? 116 ARG B NE   2  
ATOM 4790  C CZ   . ARG B 1 116 ? -0.726  -7.437  -3.365  1.00 0.00 ? 116 ARG B CZ   2  
ATOM 4791  N NH1  . ARG B 1 116 ? -1.872  -8.117  -3.191  1.00 0.00 ? 116 ARG B NH1  2  
ATOM 4792  N NH2  . ARG B 1 116 ? 0.243   -7.966  -4.124  1.00 0.00 ? 116 ARG B NH2  2  
ATOM 4793  H H    . ARG B 1 116 ? -2.351  -1.879  -5.192  1.00 0.00 ? 116 ARG B H    2  
ATOM 4794  H HA   . ARG B 1 116 ? -2.626  -1.565  -2.307  1.00 0.00 ? 116 ARG B HA   2  
ATOM 4795  H HB2  . ARG B 1 116 ? -2.979  -3.921  -3.080  1.00 0.00 ? 116 ARG B HB2  2  
ATOM 4796  H HB3  . ARG B 1 116 ? -1.430  -3.867  -3.887  1.00 0.00 ? 116 ARG B HB3  2  
ATOM 4797  H HG2  . ARG B 1 116 ? -0.302  -3.728  -1.711  1.00 0.00 ? 116 ARG B HG2  2  
ATOM 4798  H HG3  . ARG B 1 116 ? -1.846  -3.693  -0.890  1.00 0.00 ? 116 ARG B HG3  2  
ATOM 4799  H HD2  . ARG B 1 116 ? -1.041  -5.955  -0.821  1.00 0.00 ? 116 ARG B HD2  2  
ATOM 4800  H HD3  . ARG B 1 116 ? -2.412  -5.895  -1.922  1.00 0.00 ? 116 ARG B HD3  2  
ATOM 4801  H HE   . ARG B 1 116 ? 0.223   -5.654  -3.081  1.00 0.00 ? 116 ARG B HE   2  
ATOM 4802  H HH11 . ARG B 1 116 ? -2.677  -7.773  -2.685  1.00 0.00 ? 116 ARG B HH11 2  
ATOM 4803  H HH12 . ARG B 1 116 ? -1.996  -9.040  -3.568  1.00 0.00 ? 116 ARG B HH12 2  
ATOM 4804  H HH21 . ARG B 1 116 ? 1.115   -7.517  -4.342  1.00 0.00 ? 116 ARG B HH21 2  
ATOM 4805  H HH22 . ARG B 1 116 ? 0.147   -8.880  -4.533  1.00 0.00 ? 116 ARG B HH22 2  
ATOM 4806  N N    . GLU B 1 117 ? -0.178  -0.882  -2.229  1.00 0.00 ? 117 GLU B N    2  
ATOM 4807  C CA   . GLU B 1 117 ? 1.093   -0.209  -2.257  1.00 0.00 ? 117 GLU B CA   2  
ATOM 4808  C C    . GLU B 1 117 ? 1.979   -0.739  -1.179  1.00 0.00 ? 117 GLU B C    2  
ATOM 4809  O O    . GLU B 1 117 ? 1.509   -1.203  -0.139  1.00 0.00 ? 117 GLU B O    2  
ATOM 4810  C CB   . GLU B 1 117 ? 0.949   1.312   -2.117  1.00 0.00 ? 117 GLU B CB   2  
ATOM 4811  C CG   . GLU B 1 117 ? 0.208   1.981   -3.261  1.00 0.00 ? 117 GLU B CG   2  
ATOM 4812  C CD   . GLU B 1 117 ? 0.206   3.473   -3.139  1.00 0.00 ? 117 GLU B CD   2  
ATOM 4813  O OE1  . GLU B 1 117 ? 1.167   4.125   -3.615  1.00 0.00 ? 117 GLU B OE1  2  
ATOM 4814  O OE2  . GLU B 1 117 ? -0.728  4.027   -2.551  1.00 0.00 ? 117 GLU B OE2  2  
ATOM 4815  H H    . GLU B 1 117 ? -0.618  -1.012  -1.357  1.00 0.00 ? 117 GLU B H    2  
ATOM 4816  H HA   . GLU B 1 117 ? 1.550   -0.424  -3.212  1.00 0.00 ? 117 GLU B HA   2  
ATOM 4817  H HB2  . GLU B 1 117 ? 0.414   1.524   -1.202  1.00 0.00 ? 117 GLU B HB2  2  
ATOM 4818  H HB3  . GLU B 1 117 ? 1.936   1.747   -2.051  1.00 0.00 ? 117 GLU B HB3  2  
ATOM 4819  H HG2  . GLU B 1 117 ? 0.680   1.708   -4.191  1.00 0.00 ? 117 GLU B HG2  2  
ATOM 4820  H HG3  . GLU B 1 117 ? -0.813  1.632   -3.263  1.00 0.00 ? 117 GLU B HG3  2  
ATOM 4821  N N    . PHE B 1 118 ? 3.237   -0.695  -1.433  1.00 0.00 ? 118 PHE B N    2  
ATOM 4822  C CA   . PHE B 1 118 ? 4.228   -1.188  -0.539  1.00 0.00 ? 118 PHE B CA   2  
ATOM 4823  C C    . PHE B 1 118 ? 5.213   -0.079  -0.254  1.00 0.00 ? 118 PHE B C    2  
ATOM 4824  O O    . PHE B 1 118 ? 5.644   0.632   -1.177  1.00 0.00 ? 118 PHE B O    2  
ATOM 4825  C CB   . PHE B 1 118 ? 4.962   -2.361  -1.189  1.00 0.00 ? 118 PHE B CB   2  
ATOM 4826  C CG   . PHE B 1 118 ? 4.076   -3.516  -1.607  1.00 0.00 ? 118 PHE B CG   2  
ATOM 4827  C CD1  . PHE B 1 118 ? 3.412   -3.500  -2.823  1.00 0.00 ? 118 PHE B CD1  2  
ATOM 4828  C CD2  . PHE B 1 118 ? 3.927   -4.616  -0.793  1.00 0.00 ? 118 PHE B CD2  2  
ATOM 4829  C CE1  . PHE B 1 118 ? 2.621   -4.558  -3.206  1.00 0.00 ? 118 PHE B CE1  2  
ATOM 4830  C CE2  . PHE B 1 118 ? 3.145   -5.677  -1.175  1.00 0.00 ? 118 PHE B CE2  2  
ATOM 4831  C CZ   . PHE B 1 118 ? 2.493   -5.648  -2.378  1.00 0.00 ? 118 PHE B CZ   2  
ATOM 4832  H H    . PHE B 1 118 ? 3.534   -0.313  -2.291  1.00 0.00 ? 118 PHE B H    2  
ATOM 4833  H HA   . PHE B 1 118 ? 3.757   -1.526  0.371   1.00 0.00 ? 118 PHE B HA   2  
ATOM 4834  H HB2  . PHE B 1 118 ? 5.469   -2.000  -2.072  1.00 0.00 ? 118 PHE B HB2  2  
ATOM 4835  H HB3  . PHE B 1 118 ? 5.699   -2.737  -0.494  1.00 0.00 ? 118 PHE B HB3  2  
ATOM 4836  H HD1  . PHE B 1 118 ? 3.513   -2.642  -3.472  1.00 0.00 ? 118 PHE B HD1  2  
ATOM 4837  H HD2  . PHE B 1 118 ? 4.439   -4.642  0.158   1.00 0.00 ? 118 PHE B HD2  2  
ATOM 4838  H HE1  . PHE B 1 118 ? 2.106   -4.536  -4.155  1.00 0.00 ? 118 PHE B HE1  2  
ATOM 4839  H HE2  . PHE B 1 118 ? 3.038   -6.531  -0.523  1.00 0.00 ? 118 PHE B HE2  2  
ATOM 4840  H HZ   . PHE B 1 118 ? 1.878   -6.485  -2.677  1.00 0.00 ? 118 PHE B HZ   2  
ATOM 4841  N N    . HIS B 1 119 ? 5.541   0.098   0.992   1.00 0.00 ? 119 HIS B N    2  
ATOM 4842  C CA   . HIS B 1 119 ? 6.489   1.103   1.409   1.00 0.00 ? 119 HIS B CA   2  
ATOM 4843  C C    . HIS B 1 119 ? 7.523   0.416   2.248   1.00 0.00 ? 119 HIS B C    2  
ATOM 4844  O O    . HIS B 1 119 ? 7.194   -0.222  3.241   1.00 0.00 ? 119 HIS B O    2  
ATOM 4845  C CB   . HIS B 1 119 ? 5.827   2.187   2.290   1.00 0.00 ? 119 HIS B CB   2  
ATOM 4846  C CG   . HIS B 1 119 ? 4.639   2.879   1.707   1.00 0.00 ? 119 HIS B CG   2  
ATOM 4847  N ND1  . HIS B 1 119 ? 4.683   4.146   1.188   1.00 0.00 ? 119 HIS B ND1  2  
ATOM 4848  C CD2  . HIS B 1 119 ? 3.349   2.490   1.621   1.00 0.00 ? 119 HIS B CD2  2  
ATOM 4849  C CE1  . HIS B 1 119 ? 3.477   4.505   0.813   1.00 0.00 ? 119 HIS B CE1  2  
ATOM 4850  N NE2  . HIS B 1 119 ? 2.647   3.518   1.068   1.00 0.00 ? 119 HIS B NE2  2  
ATOM 4851  H H    . HIS B 1 119 ? 5.164   -0.479  1.700   1.00 0.00 ? 119 HIS B H    2  
ATOM 4852  H HA   . HIS B 1 119 ? 6.941   1.562   0.543   1.00 0.00 ? 119 HIS B HA   2  
ATOM 4853  H HB2  . HIS B 1 119 ? 5.502   1.728   3.211   1.00 0.00 ? 119 HIS B HB2  2  
ATOM 4854  H HB3  . HIS B 1 119 ? 6.568   2.936   2.527   1.00 0.00 ? 119 HIS B HB3  2  
ATOM 4855  H HD1  . HIS B 1 119 ? 5.477   4.723   1.156   1.00 0.00 ? 119 HIS B HD1  2  
ATOM 4856  H HD2  . HIS B 1 119 ? 2.947   1.536   1.934   1.00 0.00 ? 119 HIS B HD2  2  
ATOM 4857  H HE1  . HIS B 1 119 ? 3.213   5.455   0.370   1.00 0.00 ? 119 HIS B HE1  2  
ATOM 4858  H HE2  . HIS B 1 119 ? 1.755   3.719   1.457   1.00 0.00 ? 119 HIS B HE2  2  
ATOM 4859  N N    . ARG B 1 120 ? 8.741   0.501   1.862   1.00 0.00 ? 120 ARG B N    2  
ATOM 4860  C CA   . ARG B 1 120 ? 9.799   -0.072  2.650   1.00 0.00 ? 120 ARG B CA   2  
ATOM 4861  C C    . ARG B 1 120 ? 10.647  1.063   3.057   1.00 0.00 ? 120 ARG B C    2  
ATOM 4862  O O    . ARG B 1 120 ? 10.899  1.956   2.238   1.00 0.00 ? 120 ARG B O    2  
ATOM 4863  C CB   . ARG B 1 120 ? 10.555  -1.114  1.809   1.00 0.00 ? 120 ARG B CB   2  
ATOM 4864  C CG   . ARG B 1 120 ? 9.564   -2.108  1.253   1.00 0.00 ? 120 ARG B CG   2  
ATOM 4865  C CD   . ARG B 1 120 ? 10.107  -3.204  0.394   1.00 0.00 ? 120 ARG B CD   2  
ATOM 4866  N NE   . ARG B 1 120 ? 8.958   -3.853  -0.289  1.00 0.00 ? 120 ARG B NE   2  
ATOM 4867  C CZ   . ARG B 1 120 ? 7.991   -4.580  0.336   1.00 0.00 ? 120 ARG B CZ   2  
ATOM 4868  N NH1  . ARG B 1 120 ? 8.199   -5.112  1.497   1.00 0.00 ? 120 ARG B NH1  2  
ATOM 4869  N NH2  . ARG B 1 120 ? 6.881   -4.888  -0.277  1.00 0.00 ? 120 ARG B NH2  2  
ATOM 4870  H H    . ARG B 1 120 ? 8.958   0.968   1.026   1.00 0.00 ? 120 ARG B H    2  
ATOM 4871  H HA   . ARG B 1 120 ? 9.367   -0.535  3.524   1.00 0.00 ? 120 ARG B HA   2  
ATOM 4872  H HB2  . ARG B 1 120 ? 11.068  -0.618  0.999   1.00 0.00 ? 120 ARG B HB2  2  
ATOM 4873  H HB3  . ARG B 1 120 ? 11.264  -1.643  2.428   1.00 0.00 ? 120 ARG B HB3  2  
ATOM 4874  H HG2  . ARG B 1 120 ? 9.030   -2.570  2.065   1.00 0.00 ? 120 ARG B HG2  2  
ATOM 4875  H HG3  . ARG B 1 120 ? 8.846   -1.544  0.676   1.00 0.00 ? 120 ARG B HG3  2  
ATOM 4876  H HD2  . ARG B 1 120 ? 10.788  -2.786  -0.333  1.00 0.00 ? 120 ARG B HD2  2  
ATOM 4877  H HD3  . ARG B 1 120 ? 10.609  -3.939  1.004   1.00 0.00 ? 120 ARG B HD3  2  
ATOM 4878  H HE   . ARG B 1 120 ? 8.897   -3.631  -1.244  1.00 0.00 ? 120 ARG B HE   2  
ATOM 4879  H HH11 . ARG B 1 120 ? 9.080   -5.041  1.976   1.00 0.00 ? 120 ARG B HH11 2  
ATOM 4880  H HH12 . ARG B 1 120 ? 7.450   -5.610  1.959   1.00 0.00 ? 120 ARG B HH12 2  
ATOM 4881  H HH21 . ARG B 1 120 ? 6.658   -4.640  -1.221  1.00 0.00 ? 120 ARG B HH21 2  
ATOM 4882  H HH22 . ARG B 1 120 ? 6.188   -5.387  0.267   1.00 0.00 ? 120 ARG B HH22 2  
ATOM 4883  N N    . LYS B 1 121 ? 11.067  1.089   4.282   1.00 0.00 ? 121 LYS B N    2  
ATOM 4884  C CA   . LYS B 1 121 ? 11.755  2.256   4.751   1.00 0.00 ? 121 LYS B CA   2  
ATOM 4885  C C    . LYS B 1 121 ? 12.980  1.872   5.534   1.00 0.00 ? 121 LYS B C    2  
ATOM 4886  O O    . LYS B 1 121 ? 12.897  1.101   6.475   1.00 0.00 ? 121 LYS B O    2  
ATOM 4887  C CB   . LYS B 1 121 ? 10.798  3.032   5.645   1.00 0.00 ? 121 LYS B CB   2  
ATOM 4888  C CG   . LYS B 1 121 ? 11.188  4.458   5.916   1.00 0.00 ? 121 LYS B CG   2  
ATOM 4889  C CD   . LYS B 1 121 ? 10.215  5.093   6.881   1.00 0.00 ? 121 LYS B CD   2  
ATOM 4890  C CE   . LYS B 1 121 ? 10.330  6.598   6.867   1.00 0.00 ? 121 LYS B CE   2  
ATOM 4891  N NZ   . LYS B 1 121 ? 9.874   7.152   5.584   1.00 0.00 ? 121 LYS B NZ   2  
ATOM 4892  H H    . LYS B 1 121 ? 10.912  0.341   4.903   1.00 0.00 ? 121 LYS B H    2  
ATOM 4893  H HA   . LYS B 1 121 ? 12.015  2.881   3.913   1.00 0.00 ? 121 LYS B HA   2  
ATOM 4894  H HB2  . LYS B 1 121 ? 9.822   3.034   5.182   1.00 0.00 ? 121 LYS B HB2  2  
ATOM 4895  H HB3  . LYS B 1 121 ? 10.724  2.514   6.590   1.00 0.00 ? 121 LYS B HB3  2  
ATOM 4896  H HG2  . LYS B 1 121 ? 12.180  4.477   6.343   1.00 0.00 ? 121 LYS B HG2  2  
ATOM 4897  H HG3  . LYS B 1 121 ? 11.177  5.011   4.987   1.00 0.00 ? 121 LYS B HG3  2  
ATOM 4898  H HD2  . LYS B 1 121 ? 9.211   4.817   6.597   1.00 0.00 ? 121 LYS B HD2  2  
ATOM 4899  H HD3  . LYS B 1 121 ? 10.421  4.729   7.877   1.00 0.00 ? 121 LYS B HD3  2  
ATOM 4900  H HE2  . LYS B 1 121 ? 9.729   7.007   7.665   1.00 0.00 ? 121 LYS B HE2  2  
ATOM 4901  H HE3  . LYS B 1 121 ? 11.365  6.863   7.020   1.00 0.00 ? 121 LYS B HE3  2  
ATOM 4902  H HZ1  . LYS B 1 121 ? 10.027  8.177   5.523   1.00 0.00 ? 121 LYS B HZ1  2  
ATOM 4903  H HZ2  . LYS B 1 121 ? 8.858   6.965   5.458   1.00 0.00 ? 121 LYS B HZ2  2  
ATOM 4904  H HZ3  . LYS B 1 121 ? 10.353  6.706   4.768   1.00 0.00 ? 121 LYS B HZ3  2  
ATOM 4905  N N    . TYR B 1 122 ? 14.082  2.443   5.169   1.00 0.00 ? 122 TYR B N    2  
ATOM 4906  C CA   . TYR B 1 122 ? 15.355  2.210   5.798   1.00 0.00 ? 122 TYR B CA   2  
ATOM 4907  C C    . TYR B 1 122 ? 16.033  3.501   6.108   1.00 0.00 ? 122 TYR B C    2  
ATOM 4908  O O    . TYR B 1 122 ? 16.054  4.398   5.273   1.00 0.00 ? 122 TYR B O    2  
ATOM 4909  C CB   . TYR B 1 122 ? 16.292  1.453   4.849   1.00 0.00 ? 122 TYR B CB   2  
ATOM 4910  C CG   . TYR B 1 122 ? 16.168  -0.032  4.826   1.00 0.00 ? 122 TYR B CG   2  
ATOM 4911  C CD1  . TYR B 1 122 ? 15.045  -0.677  4.330   1.00 0.00 ? 122 TYR B CD1  2  
ATOM 4912  C CD2  . TYR B 1 122 ? 17.207  -0.801  5.297   1.00 0.00 ? 122 TYR B CD2  2  
ATOM 4913  C CE1  . TYR B 1 122 ? 14.974  -2.055  4.324   1.00 0.00 ? 122 TYR B CE1  2  
ATOM 4914  C CE2  . TYR B 1 122 ? 17.148  -2.160  5.289   1.00 0.00 ? 122 TYR B CE2  2  
ATOM 4915  C CZ   . TYR B 1 122 ? 16.037  -2.784  4.809   1.00 0.00 ? 122 TYR B CZ   2  
ATOM 4916  O OH   . TYR B 1 122 ? 15.987  -4.134  4.829   1.00 0.00 ? 122 TYR B OH   2  
ATOM 4917  H H    . TYR B 1 122 ? 14.087  3.056   4.400   1.00 0.00 ? 122 TYR B H    2  
ATOM 4918  H HA   . TYR B 1 122 ? 15.226  1.612   6.687   1.00 0.00 ? 122 TYR B HA   2  
ATOM 4919  H HB2  . TYR B 1 122 ? 16.088  1.794   3.846   1.00 0.00 ? 122 TYR B HB2  2  
ATOM 4920  H HB3  . TYR B 1 122 ? 17.312  1.707   5.098   1.00 0.00 ? 122 TYR B HB3  2  
ATOM 4921  H HD1  . TYR B 1 122 ? 14.219  -0.089  3.956   1.00 0.00 ? 122 TYR B HD1  2  
ATOM 4922  H HD2  . TYR B 1 122 ? 18.086  -0.306  5.680   1.00 0.00 ? 122 TYR B HD2  2  
ATOM 4923  H HE1  . TYR B 1 122 ? 14.098  -2.555  3.938   1.00 0.00 ? 122 TYR B HE1  2  
ATOM 4924  H HE2  . TYR B 1 122 ? 17.977  -2.737  5.668   1.00 0.00 ? 122 TYR B HE2  2  
ATOM 4925  H HH   . TYR B 1 122 ? 15.420  -4.473  4.116   1.00 0.00 ? 122 TYR B HH   2  
ATOM 4926  N N    . ARG B 1 123 ? 16.570  3.613   7.277   1.00 0.00 ? 123 ARG B N    2  
ATOM 4927  C CA   . ARG B 1 123 ? 17.450  4.689   7.560   1.00 0.00 ? 123 ARG B CA   2  
ATOM 4928  C C    . ARG B 1 123 ? 18.713  4.103   8.125   1.00 0.00 ? 123 ARG B C    2  
ATOM 4929  O O    . ARG B 1 123 ? 18.785  3.752   9.305   1.00 0.00 ? 123 ARG B O    2  
ATOM 4930  C CB   . ARG B 1 123 ? 16.859  5.713   8.518   1.00 0.00 ? 123 ARG B CB   2  
ATOM 4931  C CG   . ARG B 1 123 ? 17.795  6.887   8.718   1.00 0.00 ? 123 ARG B CG   2  
ATOM 4932  C CD   . ARG B 1 123 ? 17.259  7.903   9.684   1.00 0.00 ? 123 ARG B CD   2  
ATOM 4933  N NE   . ARG B 1 123 ? 18.185  9.025   9.812   1.00 0.00 ? 123 ARG B NE   2  
ATOM 4934  C CZ   . ARG B 1 123 ? 18.346  9.780   10.897  1.00 0.00 ? 123 ARG B CZ   2  
ATOM 4935  N NH1  . ARG B 1 123 ? 17.762  9.443   12.045  1.00 0.00 ? 123 ARG B NH1  2  
ATOM 4936  N NH2  . ARG B 1 123 ? 19.122  10.852  10.840  1.00 0.00 ? 123 ARG B NH2  2  
ATOM 4937  H H    . ARG B 1 123 ? 16.372  2.965   7.987   1.00 0.00 ? 123 ARG B H    2  
ATOM 4938  H HA   . ARG B 1 123 ? 17.691  5.164   6.618   1.00 0.00 ? 123 ARG B HA   2  
ATOM 4939  H HB2  . ARG B 1 123 ? 15.922  6.070   8.118   1.00 0.00 ? 123 ARG B HB2  2  
ATOM 4940  H HB3  . ARG B 1 123 ? 16.687  5.246   9.476   1.00 0.00 ? 123 ARG B HB3  2  
ATOM 4941  H HG2  . ARG B 1 123 ? 18.735  6.518   9.100   1.00 0.00 ? 123 ARG B HG2  2  
ATOM 4942  H HG3  . ARG B 1 123 ? 17.966  7.361   7.763   1.00 0.00 ? 123 ARG B HG3  2  
ATOM 4943  H HD2  . ARG B 1 123 ? 16.313  8.270   9.316   1.00 0.00 ? 123 ARG B HD2  2  
ATOM 4944  H HD3  . ARG B 1 123 ? 17.122  7.445   10.651  1.00 0.00 ? 123 ARG B HD3  2  
ATOM 4945  H HE   . ARG B 1 123 ? 18.689  9.212   8.976   1.00 0.00 ? 123 ARG B HE   2  
ATOM 4946  H HH11 . ARG B 1 123 ? 17.194  8.620   12.134  1.00 0.00 ? 123 ARG B HH11 2  
ATOM 4947  H HH12 . ARG B 1 123 ? 17.847  9.991   12.883  1.00 0.00 ? 123 ARG B HH12 2  
ATOM 4948  H HH21 . ARG B 1 123 ? 19.590  11.123  9.995   1.00 0.00 ? 123 ARG B HH21 2  
ATOM 4949  H HH22 . ARG B 1 123 ? 19.286  11.439  11.638  1.00 0.00 ? 123 ARG B HH22 2  
ATOM 4950  N N    . ILE B 1 124 ? 19.682  3.971   7.283   1.00 0.00 ? 124 ILE B N    2  
ATOM 4951  C CA   . ILE B 1 124 ? 20.955  3.429   7.642   1.00 0.00 ? 124 ILE B CA   2  
ATOM 4952  C C    . ILE B 1 124 ? 22.089  4.267   7.045   1.00 0.00 ? 124 ILE B C    2  
ATOM 4953  O O    . ILE B 1 124 ? 22.313  4.247   5.855   1.00 0.00 ? 124 ILE B O    2  
ATOM 4954  C CB   . ILE B 1 124 ? 21.078  1.931   7.209   1.00 0.00 ? 124 ILE B CB   2  
ATOM 4955  C CG1  . ILE B 1 124 ? 20.508  1.681   5.798   1.00 0.00 ? 124 ILE B CG1  2  
ATOM 4956  C CG2  . ILE B 1 124 ? 20.427  1.018   8.239   1.00 0.00 ? 124 ILE B CG2  2  
ATOM 4957  C CD1  . ILE B 1 124 ? 20.624  0.236   5.338   1.00 0.00 ? 124 ILE B CD1  2  
ATOM 4958  H H    . ILE B 1 124 ? 19.546  4.288   6.363   1.00 0.00 ? 124 ILE B H    2  
ATOM 4959  H HA   . ILE B 1 124 ? 21.023  3.471   8.720   1.00 0.00 ? 124 ILE B HA   2  
ATOM 4960  H HB   . ILE B 1 124 ? 22.133  1.698   7.210   1.00 0.00 ? 124 ILE B HB   2  
ATOM 4961  H HG12 . ILE B 1 124 ? 19.463  1.951   5.785   1.00 0.00 ? 124 ILE B HG12 2  
ATOM 4962  H HG13 . ILE B 1 124 ? 21.040  2.301   5.092   1.00 0.00 ? 124 ILE B HG13 2  
ATOM 4963  H HG21 . ILE B 1 124 ? 20.520  -0.010  7.918   1.00 0.00 ? 124 ILE B HG21 2  
ATOM 4964  H HG22 . ILE B 1 124 ? 19.381  1.272   8.335   1.00 0.00 ? 124 ILE B HG22 2  
ATOM 4965  H HG23 . ILE B 1 124 ? 20.914  1.141   9.195   1.00 0.00 ? 124 ILE B HG23 2  
ATOM 4966  H HD11 . ILE B 1 124 ? 21.667  -0.036  5.277   1.00 0.00 ? 124 ILE B HD11 2  
ATOM 4967  H HD12 . ILE B 1 124 ? 20.171  0.132   4.362   1.00 0.00 ? 124 ILE B HD12 2  
ATOM 4968  H HD13 . ILE B 1 124 ? 20.130  -0.413  6.045   1.00 0.00 ? 124 ILE B HD13 2  
ATOM 4969  N N    . PRO B 1 125 ? 22.795  5.051   7.870   1.00 0.00 ? 125 PRO B N    2  
ATOM 4970  C CA   . PRO B 1 125 ? 23.937  5.840   7.410   1.00 0.00 ? 125 PRO B CA   2  
ATOM 4971  C C    . PRO B 1 125 ? 25.248  5.051   7.446   1.00 0.00 ? 125 PRO B C    2  
ATOM 4972  O O    . PRO B 1 125 ? 26.071  5.161   6.555   1.00 0.00 ? 125 PRO B O    2  
ATOM 4973  C CB   . PRO B 1 125 ? 23.999  7.012   8.415   1.00 0.00 ? 125 PRO B CB   2  
ATOM 4974  C CG   . PRO B 1 125 ? 22.910  6.759   9.429   1.00 0.00 ? 125 PRO B CG   2  
ATOM 4975  C CD   . PRO B 1 125 ? 22.488  5.324   9.277   1.00 0.00 ? 125 PRO B CD   2  
ATOM 4976  H HA   . PRO B 1 125 ? 23.778  6.229   6.415   1.00 0.00 ? 125 PRO B HA   2  
ATOM 4977  H HB2  . PRO B 1 125 ? 24.972  7.024   8.884   1.00 0.00 ? 125 PRO B HB2  2  
ATOM 4978  H HB3  . PRO B 1 125 ? 23.841  7.944   7.894   1.00 0.00 ? 125 PRO B HB3  2  
ATOM 4979  H HG2  . PRO B 1 125 ? 23.291  6.928   10.426  1.00 0.00 ? 125 PRO B HG2  2  
ATOM 4980  H HG3  . PRO B 1 125 ? 22.076  7.419   9.238   1.00 0.00 ? 125 PRO B HG3  2  
ATOM 4981  H HD2  . PRO B 1 125 ? 23.057  4.689   9.941   1.00 0.00 ? 125 PRO B HD2  2  
ATOM 4982  H HD3  . PRO B 1 125 ? 21.430  5.237   9.471   1.00 0.00 ? 125 PRO B HD3  2  
ATOM 4983  N N    . ALA B 1 126 ? 25.434  4.264   8.496   1.00 0.00 ? 126 ALA B N    2  
ATOM 4984  C CA   . ALA B 1 126 ? 26.653  3.491   8.672   1.00 0.00 ? 126 ALA B CA   2  
ATOM 4985  C C    . ALA B 1 126 ? 26.768  2.379   7.646   1.00 0.00 ? 126 ALA B C    2  
ATOM 4986  O O    . ALA B 1 126 ? 27.842  2.018   7.219   1.00 0.00 ? 126 ALA B O    2  
ATOM 4987  C CB   . ALA B 1 126 ? 26.727  2.931   10.082  1.00 0.00 ? 126 ALA B CB   2  
ATOM 4988  H H    . ALA B 1 126 ? 24.723  4.185   9.164   1.00 0.00 ? 126 ALA B H    2  
ATOM 4989  H HA   . ALA B 1 126 ? 27.486  4.164   8.536   1.00 0.00 ? 126 ALA B HA   2  
ATOM 4990  H HB1  . ALA B 1 126 ? 25.954  2.190   10.225  1.00 0.00 ? 126 ALA B HB1  2  
ATOM 4991  H HB2  . ALA B 1 126 ? 26.594  3.733   10.791  1.00 0.00 ? 126 ALA B HB2  2  
ATOM 4992  H HB3  . ALA B 1 126 ? 27.693  2.478   10.241  1.00 0.00 ? 126 ALA B HB3  2  
ATOM 4993  N N    . ASP B 1 127 ? 25.659  1.850   7.243   1.00 0.00 ? 127 ASP B N    2  
ATOM 4994  C CA   . ASP B 1 127 ? 25.668  0.733   6.317   1.00 0.00 ? 127 ASP B CA   2  
ATOM 4995  C C    . ASP B 1 127 ? 25.584  1.218   4.894   1.00 0.00 ? 127 ASP B C    2  
ATOM 4996  O O    . ASP B 1 127 ? 25.886  0.485   3.960   1.00 0.00 ? 127 ASP B O    2  
ATOM 4997  C CB   . ASP B 1 127 ? 24.493  -0.218  6.593   1.00 0.00 ? 127 ASP B CB   2  
ATOM 4998  C CG   . ASP B 1 127 ? 24.497  -0.788  7.989   1.00 0.00 ? 127 ASP B CG   2  
ATOM 4999  O OD1  . ASP B 1 127 ? 25.098  -1.855  8.215   1.00 0.00 ? 127 ASP B OD1  2  
ATOM 5000  O OD2  . ASP B 1 127 ? 23.891  -0.177  8.895   1.00 0.00 ? 127 ASP B OD2  2  
ATOM 5001  H H    . ASP B 1 127 ? 24.811  2.205   7.582   1.00 0.00 ? 127 ASP B H    2  
ATOM 5002  H HA   . ASP B 1 127 ? 26.589  0.191   6.462   1.00 0.00 ? 127 ASP B HA   2  
ATOM 5003  H HB2  . ASP B 1 127 ? 23.569  0.319   6.451   1.00 0.00 ? 127 ASP B HB2  2  
ATOM 5004  H HB3  . ASP B 1 127 ? 24.535  -1.034  5.886   1.00 0.00 ? 127 ASP B HB3  2  
ATOM 5005  N N    . VAL B 1 128 ? 25.194  2.461   4.734   1.00 0.00 ? 128 VAL B N    2  
ATOM 5006  C CA   . VAL B 1 128 ? 24.883  2.999   3.438   1.00 0.00 ? 128 VAL B CA   2  
ATOM 5007  C C    . VAL B 1 128 ? 25.534  4.335   3.136   1.00 0.00 ? 128 VAL B C    2  
ATOM 5008  O O    . VAL B 1 128 ? 25.329  5.316   3.843   1.00 0.00 ? 128 VAL B O    2  
ATOM 5009  C CB   . VAL B 1 128 ? 23.338  3.090   3.276   1.00 0.00 ? 128 VAL B CB   2  
ATOM 5010  C CG1  . VAL B 1 128 ? 22.898  4.044   2.167   1.00 0.00 ? 128 VAL B CG1  2  
ATOM 5011  C CG2  . VAL B 1 128 ? 22.793  1.712   3.009   1.00 0.00 ? 128 VAL B CG2  2  
ATOM 5012  H H    . VAL B 1 128 ? 25.139  3.060   5.508   1.00 0.00 ? 128 VAL B H    2  
ATOM 5013  H HA   . VAL B 1 128 ? 25.223  2.283   2.704   1.00 0.00 ? 128 VAL B HA   2  
ATOM 5014  H HB   . VAL B 1 128 ? 22.914  3.430   4.209   1.00 0.00 ? 128 VAL B HB   2  
ATOM 5015  H HG11 . VAL B 1 128 ? 23.278  5.035   2.371   1.00 0.00 ? 128 VAL B HG11 2  
ATOM 5016  H HG12 . VAL B 1 128 ? 21.820  4.076   2.128   1.00 0.00 ? 128 VAL B HG12 2  
ATOM 5017  H HG13 . VAL B 1 128 ? 23.276  3.700   1.218   1.00 0.00 ? 128 VAL B HG13 2  
ATOM 5018  H HG21 . VAL B 1 128 ? 23.084  1.055   3.816   1.00 0.00 ? 128 VAL B HG21 2  
ATOM 5019  H HG22 . VAL B 1 128 ? 23.195  1.335   2.080   1.00 0.00 ? 128 VAL B HG22 2  
ATOM 5020  H HG23 . VAL B 1 128 ? 21.716  1.755   2.955   1.00 0.00 ? 128 VAL B HG23 2  
ATOM 5021  N N    . ASP B 1 129 ? 26.328  4.354   2.103   1.00 0.00 ? 129 ASP B N    2  
ATOM 5022  C CA   . ASP B 1 129 ? 26.817  5.588   1.527   1.00 0.00 ? 129 ASP B CA   2  
ATOM 5023  C C    . ASP B 1 129 ? 26.311  5.626   0.091   1.00 0.00 ? 129 ASP B C    2  
ATOM 5024  O O    . ASP B 1 129 ? 26.747  4.849   -0.740  1.00 0.00 ? 129 ASP B O    2  
ATOM 5025  C CB   . ASP B 1 129 ? 28.339  5.680   1.563   1.00 0.00 ? 129 ASP B CB   2  
ATOM 5026  C CG   . ASP B 1 129 ? 28.827  7.009   1.036   1.00 0.00 ? 129 ASP B CG   2  
ATOM 5027  O OD1  . ASP B 1 129 ? 29.022  7.154   -0.185  1.00 0.00 ? 129 ASP B OD1  2  
ATOM 5028  O OD2  . ASP B 1 129 ? 29.013  7.955   1.837   1.00 0.00 ? 129 ASP B OD2  2  
ATOM 5029  H H    . ASP B 1 129 ? 26.621  3.496   1.721   1.00 0.00 ? 129 ASP B H    2  
ATOM 5030  H HA   . ASP B 1 129 ? 26.370  6.402   2.081   1.00 0.00 ? 129 ASP B HA   2  
ATOM 5031  H HB2  . ASP B 1 129 ? 28.677  5.567   2.582   1.00 0.00 ? 129 ASP B HB2  2  
ATOM 5032  H HB3  . ASP B 1 129 ? 28.759  4.891   0.957   1.00 0.00 ? 129 ASP B HB3  2  
ATOM 5033  N N    . PRO B 1 130 ? 25.397  6.533   -0.231  1.00 0.00 ? 130 PRO B N    2  
ATOM 5034  C CA   . PRO B 1 130 ? 24.653  6.525   -1.516  1.00 0.00 ? 130 PRO B CA   2  
ATOM 5035  C C    . PRO B 1 130 ? 25.460  6.912   -2.758  1.00 0.00 ? 130 PRO B C    2  
ATOM 5036  O O    . PRO B 1 130 ? 24.881  7.156   -3.810  1.00 0.00 ? 130 PRO B O    2  
ATOM 5037  C CB   . PRO B 1 130 ? 23.566  7.565   -1.273  1.00 0.00 ? 130 PRO B CB   2  
ATOM 5038  C CG   . PRO B 1 130 ? 24.199  8.516   -0.329  1.00 0.00 ? 130 PRO B CG   2  
ATOM 5039  C CD   . PRO B 1 130 ? 24.997  7.672   0.613   1.00 0.00 ? 130 PRO B CD   2  
ATOM 5040  H HA   . PRO B 1 130 ? 24.177  5.572   -1.692  1.00 0.00 ? 130 PRO B HA   2  
ATOM 5041  H HB2  . PRO B 1 130 ? 23.296  8.037   -2.205  1.00 0.00 ? 130 PRO B HB2  2  
ATOM 5042  H HB3  . PRO B 1 130 ? 22.699  7.095   -0.831  1.00 0.00 ? 130 PRO B HB3  2  
ATOM 5043  H HG2  . PRO B 1 130 ? 24.850  9.190   -0.867  1.00 0.00 ? 130 PRO B HG2  2  
ATOM 5044  H HG3  . PRO B 1 130 ? 23.440  9.064   0.207   1.00 0.00 ? 130 PRO B HG3  2  
ATOM 5045  H HD2  . PRO B 1 130 ? 25.859  8.216   0.973   1.00 0.00 ? 130 PRO B HD2  2  
ATOM 5046  H HD3  . PRO B 1 130 ? 24.381  7.340   1.436   1.00 0.00 ? 130 PRO B HD3  2  
ATOM 5047  N N    . LEU B 1 131 ? 26.771  6.918   -2.663  1.00 0.00 ? 131 LEU B N    2  
ATOM 5048  C CA   . LEU B 1 131 ? 27.586  7.372   -3.769  1.00 0.00 ? 131 LEU B CA   2  
ATOM 5049  C C    . LEU B 1 131 ? 27.532  6.406   -4.961  1.00 0.00 ? 131 LEU B C    2  
ATOM 5050  O O    . LEU B 1 131 ? 27.354  6.834   -6.093  1.00 0.00 ? 131 LEU B O    2  
ATOM 5051  C CB   . LEU B 1 131 ? 29.038  7.569   -3.319  1.00 0.00 ? 131 LEU B CB   2  
ATOM 5052  C CG   . LEU B 1 131 ? 29.992  8.193   -4.340  1.00 0.00 ? 131 LEU B CG   2  
ATOM 5053  C CD1  . LEU B 1 131 ? 29.551  9.605   -4.704  1.00 0.00 ? 131 LEU B CD1  2  
ATOM 5054  C CD2  . LEU B 1 131 ? 31.407  8.202   -3.802  1.00 0.00 ? 131 LEU B CD2  2  
ATOM 5055  H H    . LEU B 1 131 ? 27.189  6.601   -1.831  1.00 0.00 ? 131 LEU B H    2  
ATOM 5056  H HA   . LEU B 1 131 ? 27.197  8.329   -4.082  1.00 0.00 ? 131 LEU B HA   2  
ATOM 5057  H HB2  . LEU B 1 131 ? 29.042  8.191   -2.438  1.00 0.00 ? 131 LEU B HB2  2  
ATOM 5058  H HB3  . LEU B 1 131 ? 29.430  6.601   -3.046  1.00 0.00 ? 131 LEU B HB3  2  
ATOM 5059  H HG   . LEU B 1 131 ? 29.976  7.598   -5.242  1.00 0.00 ? 131 LEU B HG   2  
ATOM 5060  H HD11 . LEU B 1 131 ? 28.572  9.577   -5.158  1.00 0.00 ? 131 LEU B HD11 2  
ATOM 5061  H HD12 . LEU B 1 131 ? 30.259  10.036  -5.396  1.00 0.00 ? 131 LEU B HD12 2  
ATOM 5062  H HD13 . LEU B 1 131 ? 29.516  10.207  -3.809  1.00 0.00 ? 131 LEU B HD13 2  
ATOM 5063  H HD21 . LEU B 1 131 ? 31.727  7.190   -3.609  1.00 0.00 ? 131 LEU B HD21 2  
ATOM 5064  H HD22 . LEU B 1 131 ? 31.438  8.773   -2.885  1.00 0.00 ? 131 LEU B HD22 2  
ATOM 5065  H HD23 . LEU B 1 131 ? 32.065  8.656   -4.527  1.00 0.00 ? 131 LEU B HD23 2  
ATOM 5066  N N    . THR B 1 132 ? 27.644  5.124   -4.715  1.00 0.00 ? 132 THR B N    2  
ATOM 5067  C CA   . THR B 1 132 ? 27.694  4.158   -5.818  1.00 0.00 ? 132 THR B CA   2  
ATOM 5068  C C    . THR B 1 132 ? 26.560  3.134   -5.753  1.00 0.00 ? 132 THR B C    2  
ATOM 5069  O O    . THR B 1 132 ? 26.566  2.151   -6.500  1.00 0.00 ? 132 THR B O    2  
ATOM 5070  C CB   . THR B 1 132 ? 29.065  3.429   -5.864  1.00 0.00 ? 132 THR B CB   2  
ATOM 5071  O OG1  . THR B 1 132 ? 29.205  2.680   -7.079  1.00 0.00 ? 132 THR B OG1  2  
ATOM 5072  C CG2  . THR B 1 132 ? 29.185  2.482   -4.695  1.00 0.00 ? 132 THR B CG2  2  
ATOM 5073  H H    . THR B 1 132 ? 27.705  4.813   -3.789  1.00 0.00 ? 132 THR B H    2  
ATOM 5074  H HA   . THR B 1 132 ? 27.585  4.718   -6.735  1.00 0.00 ? 132 THR B HA   2  
ATOM 5075  H HB   . THR B 1 132 ? 29.857  4.161   -5.800  1.00 0.00 ? 132 THR B HB   2  
ATOM 5076  H HG1  . THR B 1 132 ? 28.346  2.280   -7.280  1.00 0.00 ? 132 THR B HG1  2  
ATOM 5077  H HG21 . THR B 1 132 ? 29.102  3.067   -3.792  1.00 0.00 ? 132 THR B HG21 2  
ATOM 5078  H HG22 . THR B 1 132 ? 30.144  1.988   -4.728  1.00 0.00 ? 132 THR B HG22 2  
ATOM 5079  H HG23 . THR B 1 132 ? 28.390  1.752   -4.732  1.00 0.00 ? 132 THR B HG23 2  
ATOM 5080  N N    . ILE B 1 133 ? 25.603  3.351   -4.883  1.00 0.00 ? 133 ILE B N    2  
ATOM 5081  C CA   . ILE B 1 133 ? 24.617  2.320   -4.629  1.00 0.00 ? 133 ILE B CA   2  
ATOM 5082  C C    . ILE B 1 133 ? 23.703  2.080   -5.830  1.00 0.00 ? 133 ILE B C    2  
ATOM 5083  O O    . ILE B 1 133 ? 23.192  3.013   -6.449  1.00 0.00 ? 133 ILE B O    2  
ATOM 5084  C CB   . ILE B 1 133 ? 23.785  2.595   -3.358  1.00 0.00 ? 133 ILE B CB   2  
ATOM 5085  C CG1  . ILE B 1 133 ? 24.706  2.742   -2.158  1.00 0.00 ? 133 ILE B CG1  2  
ATOM 5086  C CG2  . ILE B 1 133 ? 22.817  1.456   -3.114  1.00 0.00 ? 133 ILE B CG2  2  
ATOM 5087  C CD1  . ILE B 1 133 ? 23.992  2.960   -0.859  1.00 0.00 ? 133 ILE B CD1  2  
ATOM 5088  H H    . ILE B 1 133 ? 25.523  4.228   -4.456  1.00 0.00 ? 133 ILE B H    2  
ATOM 5089  H HA   . ILE B 1 133 ? 25.176  1.408   -4.471  1.00 0.00 ? 133 ILE B HA   2  
ATOM 5090  H HB   . ILE B 1 133 ? 23.231  3.512   -3.489  1.00 0.00 ? 133 ILE B HB   2  
ATOM 5091  H HG12 . ILE B 1 133 ? 25.267  1.830   -2.040  1.00 0.00 ? 133 ILE B HG12 2  
ATOM 5092  H HG13 . ILE B 1 133 ? 25.383  3.570   -2.315  1.00 0.00 ? 133 ILE B HG13 2  
ATOM 5093  H HG21 . ILE B 1 133 ? 22.236  1.660   -2.226  1.00 0.00 ? 133 ILE B HG21 2  
ATOM 5094  H HG22 . ILE B 1 133 ? 23.368  0.535   -2.981  1.00 0.00 ? 133 ILE B HG22 2  
ATOM 5095  H HG23 . ILE B 1 133 ? 22.155  1.359   -3.963  1.00 0.00 ? 133 ILE B HG23 2  
ATOM 5096  H HD11 . ILE B 1 133 ? 23.375  3.844   -0.920  1.00 0.00 ? 133 ILE B HD11 2  
ATOM 5097  H HD12 . ILE B 1 133 ? 24.724  3.080   -0.075  1.00 0.00 ? 133 ILE B HD12 2  
ATOM 5098  H HD13 . ILE B 1 133 ? 23.372  2.101   -0.645  1.00 0.00 ? 133 ILE B HD13 2  
ATOM 5099  N N    . THR B 1 134 ? 23.533  0.823   -6.143  1.00 0.00 ? 134 THR B N    2  
ATOM 5100  C CA   . THR B 1 134 ? 22.727  0.379   -7.237  1.00 0.00 ? 134 THR B CA   2  
ATOM 5101  C C    . THR B 1 134 ? 21.643  -0.548  -6.730  1.00 0.00 ? 134 THR B C    2  
ATOM 5102  O O    . THR B 1 134 ? 21.687  -0.982  -5.577  1.00 0.00 ? 134 THR B O    2  
ATOM 5103  C CB   . THR B 1 134 ? 23.608  -0.333  -8.283  1.00 0.00 ? 134 THR B CB   2  
ATOM 5104  O OG1  . THR B 1 134 ? 24.562  -1.186  -7.615  1.00 0.00 ? 134 THR B OG1  2  
ATOM 5105  C CG2  . THR B 1 134 ? 24.344  0.672   -9.148  1.00 0.00 ? 134 THR B CG2  2  
ATOM 5106  H H    . THR B 1 134 ? 23.991  0.139   -5.608  1.00 0.00 ? 134 THR B H    2  
ATOM 5107  H HA   . THR B 1 134 ? 22.274  1.243   -7.698  1.00 0.00 ? 134 THR B HA   2  
ATOM 5108  H HB   . THR B 1 134 ? 22.973  -0.946  -8.905  1.00 0.00 ? 134 THR B HB   2  
ATOM 5109  H HG1  . THR B 1 134 ? 24.104  -1.777  -6.999  1.00 0.00 ? 134 THR B HG1  2  
ATOM 5110  H HG21 . THR B 1 134 ? 24.955  0.140   -9.864  1.00 0.00 ? 134 THR B HG21 2  
ATOM 5111  H HG22 . THR B 1 134 ? 24.973  1.288   -8.524  1.00 0.00 ? 134 THR B HG22 2  
ATOM 5112  H HG23 . THR B 1 134 ? 23.633  1.293   -9.671  1.00 0.00 ? 134 THR B HG23 2  
ATOM 5113  N N    . SER B 1 135 ? 20.664  -0.817  -7.550  1.00 0.00 ? 135 SER B N    2  
ATOM 5114  C CA   . SER B 1 135 ? 19.557  -1.633  -7.153  1.00 0.00 ? 135 SER B CA   2  
ATOM 5115  C C    . SER B 1 135 ? 19.281  -2.717  -8.186  1.00 0.00 ? 135 SER B C    2  
ATOM 5116  O O    . SER B 1 135 ? 19.246  -2.448  -9.392  1.00 0.00 ? 135 SER B O    2  
ATOM 5117  C CB   . SER B 1 135 ? 18.333  -0.755  -6.970  1.00 0.00 ? 135 SER B CB   2  
ATOM 5118  O OG   . SER B 1 135 ? 18.653  0.351   -6.133  1.00 0.00 ? 135 SER B OG   2  
ATOM 5119  H H    . SER B 1 135 ? 20.683  -0.471  -8.467  1.00 0.00 ? 135 SER B H    2  
ATOM 5120  H HA   . SER B 1 135 ? 19.791  -2.093  -6.205  1.00 0.00 ? 135 SER B HA   2  
ATOM 5121  H HB2  . SER B 1 135 ? 18.003  -0.389  -7.931  1.00 0.00 ? 135 SER B HB2  2  
ATOM 5122  H HB3  . SER B 1 135 ? 17.542  -1.325  -6.506  1.00 0.00 ? 135 SER B HB3  2  
ATOM 5123  H HG   . SER B 1 135 ? 19.435  0.090   -5.632  1.00 0.00 ? 135 SER B HG   2  
ATOM 5124  N N    . SER B 1 136 ? 19.089  -3.907  -7.705  1.00 0.00 ? 136 SER B N    2  
ATOM 5125  C CA   . SER B 1 136 ? 18.776  -5.044  -8.523  1.00 0.00 ? 136 SER B CA   2  
ATOM 5126  C C    . SER B 1 136 ? 17.384  -5.530  -8.136  1.00 0.00 ? 136 SER B C    2  
ATOM 5127  O O    . SER B 1 136 ? 17.003  -5.446  -6.953  1.00 0.00 ? 136 SER B O    2  
ATOM 5128  C CB   . SER B 1 136 ? 19.819  -6.132  -8.284  1.00 0.00 ? 136 SER B CB   2  
ATOM 5129  O OG   . SER B 1 136 ? 21.130  -5.607  -8.486  1.00 0.00 ? 136 SER B OG   2  
ATOM 5130  H H    . SER B 1 136 ? 19.164  -4.041  -6.733  1.00 0.00 ? 136 SER B H    2  
ATOM 5131  H HA   . SER B 1 136 ? 18.792  -4.741  -9.558  1.00 0.00 ? 136 SER B HA   2  
ATOM 5132  H HB2  . SER B 1 136 ? 19.736  -6.501  -7.273  1.00 0.00 ? 136 SER B HB2  2  
ATOM 5133  H HB3  . SER B 1 136 ? 19.661  -6.944  -8.979  1.00 0.00 ? 136 SER B HB3  2  
ATOM 5134  H HG   . SER B 1 136 ? 21.166  -5.398  -9.429  1.00 0.00 ? 136 SER B HG   2  
ATOM 5135  N N    . LEU B 1 137 ? 16.633  -6.019  -9.092  1.00 0.00 ? 137 LEU B N    2  
ATOM 5136  C CA   . LEU B 1 137 ? 15.253  -6.394  -8.853  1.00 0.00 ? 137 LEU B CA   2  
ATOM 5137  C C    . LEU B 1 137 ? 15.028  -7.864  -9.193  1.00 0.00 ? 137 LEU B C    2  
ATOM 5138  O O    . LEU B 1 137 ? 15.556  -8.359  -10.183 1.00 0.00 ? 137 LEU B O    2  
ATOM 5139  C CB   . LEU B 1 137 ? 14.346  -5.508  -9.718  1.00 0.00 ? 137 LEU B CB   2  
ATOM 5140  C CG   . LEU B 1 137 ? 12.834  -5.679  -9.552  1.00 0.00 ? 137 LEU B CG   2  
ATOM 5141  C CD1  . LEU B 1 137 ? 12.396  -5.275  -8.153  1.00 0.00 ? 137 LEU B CD1  2  
ATOM 5142  C CD2  . LEU B 1 137 ? 12.098  -4.867  -10.599 1.00 0.00 ? 137 LEU B CD2  2  
ATOM 5143  H H    . LEU B 1 137 ? 17.007  -6.159  -9.992  1.00 0.00 ? 137 LEU B H    2  
ATOM 5144  H HA   . LEU B 1 137 ? 15.021  -6.216  -7.815  1.00 0.00 ? 137 LEU B HA   2  
ATOM 5145  H HB2  . LEU B 1 137 ? 14.585  -4.478  -9.502  1.00 0.00 ? 137 LEU B HB2  2  
ATOM 5146  H HB3  . LEU B 1 137 ? 14.592  -5.700  -10.751 1.00 0.00 ? 137 LEU B HB3  2  
ATOM 5147  H HG   . LEU B 1 137 ? 12.581  -6.720  -9.688  1.00 0.00 ? 137 LEU B HG   2  
ATOM 5148  H HD11 . LEU B 1 137 ? 11.325  -5.373  -8.072  1.00 0.00 ? 137 LEU B HD11 2  
ATOM 5149  H HD12 . LEU B 1 137 ? 12.677  -4.249  -7.967  1.00 0.00 ? 137 LEU B HD12 2  
ATOM 5150  H HD13 . LEU B 1 137 ? 12.870  -5.918  -7.425  1.00 0.00 ? 137 LEU B HD13 2  
ATOM 5151  H HD21 . LEU B 1 137 ? 12.360  -3.825  -10.499 1.00 0.00 ? 137 LEU B HD21 2  
ATOM 5152  H HD22 . LEU B 1 137 ? 11.034  -4.986  -10.459 1.00 0.00 ? 137 LEU B HD22 2  
ATOM 5153  H HD23 . LEU B 1 137 ? 12.372  -5.215  -11.584 1.00 0.00 ? 137 LEU B HD23 2  
ATOM 5154  N N    . SER B 1 138 ? 14.300  -8.558  -8.347  1.00 0.00 ? 138 SER B N    2  
ATOM 5155  C CA   . SER B 1 138 ? 13.936  -9.933  -8.601  1.00 0.00 ? 138 SER B CA   2  
ATOM 5156  C C    . SER B 1 138 ? 12.527  -9.984  -9.221  1.00 0.00 ? 138 SER B C    2  
ATOM 5157  O O    . SER B 1 138 ? 11.805  -8.991  -9.106  1.00 0.00 ? 138 SER B O    2  
ATOM 5158  C CB   . SER B 1 138 ? 13.980  -10.736 -7.301  1.00 0.00 ? 138 SER B CB   2  
ATOM 5159  O OG   . SER B 1 138 ? 15.258  -10.631 -6.673  1.00 0.00 ? 138 SER B OG   2  
ATOM 5160  H H    . SER B 1 138 ? 13.991  -8.130  -7.517  1.00 0.00 ? 138 SER B H    2  
ATOM 5161  H HA   . SER B 1 138 ? 14.646  -10.345 -9.303  1.00 0.00 ? 138 SER B HA   2  
ATOM 5162  H HB2  . SER B 1 138 ? 13.224  -10.352 -6.633  1.00 0.00 ? 138 SER B HB2  2  
ATOM 5163  H HB3  . SER B 1 138 ? 13.774  -11.775 -7.506  1.00 0.00 ? 138 SER B HB3  2  
ATOM 5164  H HG   . SER B 1 138 ? 15.652  -9.775  -6.886  1.00 0.00 ? 138 SER B HG   2  
ATOM 5165  N N    . SER B 1 139 ? 12.119  -11.089 -9.813  1.00 0.00 ? 139 SER B N    2  
ATOM 5166  C CA   . SER B 1 139 ? 10.844  -11.147 -10.536 1.00 0.00 ? 139 SER B CA   2  
ATOM 5167  C C    . SER B 1 139 ? 9.623   -10.843 -9.637  1.00 0.00 ? 139 SER B C    2  
ATOM 5168  O O    . SER B 1 139 ? 8.666   -10.188 -10.073 1.00 0.00 ? 139 SER B O    2  
ATOM 5169  C CB   . SER B 1 139 ? 10.688  -12.517 -11.229 1.00 0.00 ? 139 SER B CB   2  
ATOM 5170  O OG   . SER B 1 139 ? 9.533   -12.573 -12.069 1.00 0.00 ? 139 SER B OG   2  
ATOM 5171  H H    . SER B 1 139 ? 12.677  -11.896 -9.788  1.00 0.00 ? 139 SER B H    2  
ATOM 5172  H HA   . SER B 1 139 ? 10.891  -10.386 -11.300 1.00 0.00 ? 139 SER B HA   2  
ATOM 5173  H HB2  . SER B 1 139 ? 11.556  -12.705 -11.840 1.00 0.00 ? 139 SER B HB2  2  
ATOM 5174  H HB3  . SER B 1 139 ? 10.609  -13.286 -10.476 1.00 0.00 ? 139 SER B HB3  2  
ATOM 5175  H HG   . SER B 1 139 ? 9.466   -11.713 -12.509 1.00 0.00 ? 139 SER B HG   2  
ATOM 5176  N N    . ASP B 1 140 ? 9.687   -11.243 -8.374  1.00 0.00 ? 140 ASP B N    2  
ATOM 5177  C CA   . ASP B 1 140 ? 8.548   -11.050 -7.465  1.00 0.00 ? 140 ASP B CA   2  
ATOM 5178  C C    . ASP B 1 140 ? 8.539   -9.629  -6.923  1.00 0.00 ? 140 ASP B C    2  
ATOM 5179  O O    . ASP B 1 140 ? 7.549   -9.162  -6.368  1.00 0.00 ? 140 ASP B O    2  
ATOM 5180  C CB   . ASP B 1 140 ? 8.604   -12.062 -6.314  1.00 0.00 ? 140 ASP B CB   2  
ATOM 5181  C CG   . ASP B 1 140 ? 7.312   -12.150 -5.528  1.00 0.00 ? 140 ASP B CG   2  
ATOM 5182  O OD1  . ASP B 1 140 ? 6.302   -12.678 -6.087  1.00 0.00 ? 140 ASP B OD1  2  
ATOM 5183  O OD2  . ASP B 1 140 ? 7.269   -11.748 -4.358  1.00 0.00 ? 140 ASP B OD2  2  
ATOM 5184  H H    . ASP B 1 140 ? 10.495  -11.703 -8.059  1.00 0.00 ? 140 ASP B H    2  
ATOM 5185  H HA   . ASP B 1 140 ? 7.643   -11.209 -8.032  1.00 0.00 ? 140 ASP B HA   2  
ATOM 5186  H HB2  . ASP B 1 140 ? 8.811   -13.039 -6.720  1.00 0.00 ? 140 ASP B HB2  2  
ATOM 5187  H HB3  . ASP B 1 140 ? 9.400   -11.783 -5.638  1.00 0.00 ? 140 ASP B HB3  2  
ATOM 5188  N N    . GLY B 1 141 ? 9.622   -8.924  -7.166  1.00 0.00 ? 141 GLY B N    2  
ATOM 5189  C CA   . GLY B 1 141 ? 9.729   -7.574  -6.710  1.00 0.00 ? 141 GLY B CA   2  
ATOM 5190  C C    . GLY B 1 141 ? 10.746  -7.393  -5.614  1.00 0.00 ? 141 GLY B C    2  
ATOM 5191  O O    . GLY B 1 141 ? 10.874  -6.307  -5.078  1.00 0.00 ? 141 GLY B O    2  
ATOM 5192  H H    . GLY B 1 141 ? 10.337  -9.309  -7.716  1.00 0.00 ? 141 GLY B H    2  
ATOM 5193  H HA2  . GLY B 1 141 ? 10.005  -6.952  -7.548  1.00 0.00 ? 141 GLY B HA2  2  
ATOM 5194  H HA3  . GLY B 1 141 ? 8.762   -7.257  -6.348  1.00 0.00 ? 141 GLY B HA3  2  
ATOM 5195  N N    . VAL B 1 142 ? 11.524  -8.428  -5.325  1.00 0.00 ? 142 VAL B N    2  
ATOM 5196  C CA   . VAL B 1 142 ? 12.497  -8.347  -4.230  1.00 0.00 ? 142 VAL B CA   2  
ATOM 5197  C C    . VAL B 1 142 ? 13.635  -7.431  -4.660  1.00 0.00 ? 142 VAL B C    2  
ATOM 5198  O O    . VAL B 1 142 ? 14.158  -7.560  -5.775  1.00 0.00 ? 142 VAL B O    2  
ATOM 5199  C CB   . VAL B 1 142 ? 13.043  -9.745  -3.834  1.00 0.00 ? 142 VAL B CB   2  
ATOM 5200  C CG1  . VAL B 1 142 ? 13.989  -9.659  -2.639  1.00 0.00 ? 142 VAL B CG1  2  
ATOM 5201  C CG2  . VAL B 1 142 ? 11.897  -10.685 -3.530  1.00 0.00 ? 142 VAL B CG2  2  
ATOM 5202  H H    . VAL B 1 142 ? 11.434  -9.247  -5.850  1.00 0.00 ? 142 VAL B H    2  
ATOM 5203  H HA   . VAL B 1 142 ? 12.015  -7.888  -3.381  1.00 0.00 ? 142 VAL B HA   2  
ATOM 5204  H HB   . VAL B 1 142 ? 13.601  -10.148 -4.666  1.00 0.00 ? 142 VAL B HB   2  
ATOM 5205  H HG11 . VAL B 1 142 ? 14.356  -10.645 -2.394  1.00 0.00 ? 142 VAL B HG11 2  
ATOM 5206  H HG12 . VAL B 1 142 ? 13.460  -9.251  -1.790  1.00 0.00 ? 142 VAL B HG12 2  
ATOM 5207  H HG13 . VAL B 1 142 ? 14.822  -9.015  -2.885  1.00 0.00 ? 142 VAL B HG13 2  
ATOM 5208  H HG21 . VAL B 1 142 ? 12.293  -11.636 -3.211  1.00 0.00 ? 142 VAL B HG21 2  
ATOM 5209  H HG22 . VAL B 1 142 ? 11.290  -10.819 -4.412  1.00 0.00 ? 142 VAL B HG22 2  
ATOM 5210  H HG23 . VAL B 1 142 ? 11.295  -10.265 -2.737  1.00 0.00 ? 142 VAL B HG23 2  
ATOM 5211  N N    . LEU B 1 143 ? 14.011  -6.514  -3.800  1.00 0.00 ? 143 LEU B N    2  
ATOM 5212  C CA   . LEU B 1 143 ? 14.892  -5.441  -4.200  1.00 0.00 ? 143 LEU B CA   2  
ATOM 5213  C C    . LEU B 1 143 ? 16.214  -5.540  -3.451  1.00 0.00 ? 143 LEU B C    2  
ATOM 5214  O O    . LEU B 1 143 ? 16.235  -5.792  -2.269  1.00 0.00 ? 143 LEU B O    2  
ATOM 5215  C CB   . LEU B 1 143 ? 14.146  -4.092  -3.939  1.00 0.00 ? 143 LEU B CB   2  
ATOM 5216  C CG   . LEU B 1 143 ? 14.710  -2.773  -4.529  1.00 0.00 ? 143 LEU B CG   2  
ATOM 5217  C CD1  . LEU B 1 143 ? 15.995  -2.343  -3.870  1.00 0.00 ? 143 LEU B CD1  2  
ATOM 5218  C CD2  . LEU B 1 143 ? 14.889  -2.880  -6.034  1.00 0.00 ? 143 LEU B CD2  2  
ATOM 5219  H H    . LEU B 1 143 ? 13.736  -6.570  -2.855  1.00 0.00 ? 143 LEU B H    2  
ATOM 5220  H HA   . LEU B 1 143 ? 15.073  -5.534  -5.260  1.00 0.00 ? 143 LEU B HA   2  
ATOM 5221  H HB2  . LEU B 1 143 ? 13.141  -4.202  -4.322  1.00 0.00 ? 143 LEU B HB2  2  
ATOM 5222  H HB3  . LEU B 1 143 ? 14.069  -3.971  -2.868  1.00 0.00 ? 143 LEU B HB3  2  
ATOM 5223  H HG   . LEU B 1 143 ? 13.990  -1.990  -4.343  1.00 0.00 ? 143 LEU B HG   2  
ATOM 5224  H HD11 . LEU B 1 143 ? 16.351  -1.436  -4.335  1.00 0.00 ? 143 LEU B HD11 2  
ATOM 5225  H HD12 . LEU B 1 143 ? 16.735  -3.123  -3.979  1.00 0.00 ? 143 LEU B HD12 2  
ATOM 5226  H HD13 . LEU B 1 143 ? 15.813  -2.161  -2.821  1.00 0.00 ? 143 LEU B HD13 2  
ATOM 5227  H HD21 . LEU B 1 143 ? 13.936  -3.099  -6.493  1.00 0.00 ? 143 LEU B HD21 2  
ATOM 5228  H HD22 . LEU B 1 143 ? 15.589  -3.670  -6.260  1.00 0.00 ? 143 LEU B HD22 2  
ATOM 5229  H HD23 . LEU B 1 143 ? 15.266  -1.944  -6.416  1.00 0.00 ? 143 LEU B HD23 2  
ATOM 5230  N N    . THR B 1 144 ? 17.297  -5.394  -4.155  1.00 0.00 ? 144 THR B N    2  
ATOM 5231  C CA   . THR B 1 144 ? 18.607  -5.439  -3.558  1.00 0.00 ? 144 THR B CA   2  
ATOM 5232  C C    . THR B 1 144 ? 19.346  -4.122  -3.833  1.00 0.00 ? 144 THR B C    2  
ATOM 5233  O O    . THR B 1 144 ? 19.409  -3.688  -4.976  1.00 0.00 ? 144 THR B O    2  
ATOM 5234  C CB   . THR B 1 144 ? 19.387  -6.629  -4.148  1.00 0.00 ? 144 THR B CB   2  
ATOM 5235  O OG1  . THR B 1 144 ? 18.558  -7.819  -4.077  1.00 0.00 ? 144 THR B OG1  2  
ATOM 5236  C CG2  . THR B 1 144 ? 20.671  -6.870  -3.375  1.00 0.00 ? 144 THR B CG2  2  
ATOM 5237  H H    . THR B 1 144 ? 17.228  -5.249  -5.125  1.00 0.00 ? 144 THR B H    2  
ATOM 5238  H HA   . THR B 1 144 ? 18.498  -5.582  -2.495  1.00 0.00 ? 144 THR B HA   2  
ATOM 5239  H HB   . THR B 1 144 ? 19.620  -6.416  -5.181  1.00 0.00 ? 144 THR B HB   2  
ATOM 5240  H HG1  . THR B 1 144 ? 18.162  -7.866  -3.195  1.00 0.00 ? 144 THR B HG1  2  
ATOM 5241  H HG21 . THR B 1 144 ? 20.426  -7.088  -2.346  1.00 0.00 ? 144 THR B HG21 2  
ATOM 5242  H HG22 . THR B 1 144 ? 21.290  -5.986  -3.420  1.00 0.00 ? 144 THR B HG22 2  
ATOM 5243  H HG23 . THR B 1 144 ? 21.204  -7.705  -3.805  1.00 0.00 ? 144 THR B HG23 2  
ATOM 5244  N N    . VAL B 1 145 ? 19.863  -3.491  -2.808  1.00 0.00 ? 145 VAL B N    2  
ATOM 5245  C CA   . VAL B 1 145 ? 20.644  -2.273  -2.948  1.00 0.00 ? 145 VAL B CA   2  
ATOM 5246  C C    . VAL B 1 145 ? 22.073  -2.549  -2.507  1.00 0.00 ? 145 VAL B C    2  
ATOM 5247  O O    . VAL B 1 145 ? 22.311  -3.051  -1.419  1.00 0.00 ? 145 VAL B O    2  
ATOM 5248  C CB   . VAL B 1 145 ? 20.047  -1.056  -2.163  1.00 0.00 ? 145 VAL B CB   2  
ATOM 5249  C CG1  . VAL B 1 145 ? 18.764  -0.571  -2.795  1.00 0.00 ? 145 VAL B CG1  2  
ATOM 5250  C CG2  . VAL B 1 145 ? 19.803  -1.403  -0.707  1.00 0.00 ? 145 VAL B CG2  2  
ATOM 5251  H H    . VAL B 1 145 ? 19.768  -3.864  -1.900  1.00 0.00 ? 145 VAL B H    2  
ATOM 5252  H HA   . VAL B 1 145 ? 20.667  -2.043  -4.004  1.00 0.00 ? 145 VAL B HA   2  
ATOM 5253  H HB   . VAL B 1 145 ? 20.763  -0.247  -2.202  1.00 0.00 ? 145 VAL B HB   2  
ATOM 5254  H HG11 . VAL B 1 145 ? 18.955  -0.258  -3.811  1.00 0.00 ? 145 VAL B HG11 2  
ATOM 5255  H HG12 . VAL B 1 145 ? 18.374  0.261   -2.226  1.00 0.00 ? 145 VAL B HG12 2  
ATOM 5256  H HG13 . VAL B 1 145 ? 18.044  -1.375  -2.798  1.00 0.00 ? 145 VAL B HG13 2  
ATOM 5257  H HG21 . VAL B 1 145 ? 20.762  -1.535  -0.233  1.00 0.00 ? 145 VAL B HG21 2  
ATOM 5258  H HG22 . VAL B 1 145 ? 19.223  -2.312  -0.638  1.00 0.00 ? 145 VAL B HG22 2  
ATOM 5259  H HG23 . VAL B 1 145 ? 19.261  -0.601  -0.232  1.00 0.00 ? 145 VAL B HG23 2  
ATOM 5260  N N    . ASN B 1 146 ? 23.007  -2.267  -3.348  1.00 0.00 ? 146 ASN B N    2  
ATOM 5261  C CA   . ASN B 1 146 ? 24.391  -2.582  -3.050  1.00 0.00 ? 146 ASN B CA   2  
ATOM 5262  C C    . ASN B 1 146 ? 25.325  -1.420  -3.323  1.00 0.00 ? 146 ASN B C    2  
ATOM 5263  O O    . ASN B 1 146 ? 25.181  -0.710  -4.333  1.00 0.00 ? 146 ASN B O    2  
ATOM 5264  C CB   . ASN B 1 146 ? 24.848  -3.852  -3.799  1.00 0.00 ? 146 ASN B CB   2  
ATOM 5265  C CG   . ASN B 1 146 ? 24.734  -3.781  -5.327  1.00 0.00 ? 146 ASN B CG   2  
ATOM 5266  O OD1  . ASN B 1 146 ? 23.850  -3.122  -5.899  1.00 0.00 ? 146 ASN B OD1  2  
ATOM 5267  N ND2  . ASN B 1 146 ? 25.634  -4.452  -5.997  1.00 0.00 ? 146 ASN B ND2  2  
ATOM 5268  H H    . ASN B 1 146 ? 22.774  -1.846  -4.206  1.00 0.00 ? 146 ASN B H    2  
ATOM 5269  H HA   . ASN B 1 146 ? 24.437  -2.789  -1.991  1.00 0.00 ? 146 ASN B HA   2  
ATOM 5270  H HB2  . ASN B 1 146 ? 25.883  -4.041  -3.557  1.00 0.00 ? 146 ASN B HB2  2  
ATOM 5271  H HB3  . ASN B 1 146 ? 24.257  -4.685  -3.451  1.00 0.00 ? 146 ASN B HB3  2  
ATOM 5272  H HD21 . ASN B 1 146 ? 26.306  -4.941  -5.473  1.00 0.00 ? 146 ASN B HD21 2  
ATOM 5273  H HD22 . ASN B 1 146 ? 25.619  -4.474  -6.978  1.00 0.00 ? 146 ASN B HD22 2  
ATOM 5274  N N    . GLY B 1 147 ? 26.260  -1.222  -2.416  1.00 0.00 ? 147 GLY B N    2  
ATOM 5275  C CA   . GLY B 1 147 ? 27.222  -0.166  -2.531  1.00 0.00 ? 147 GLY B CA   2  
ATOM 5276  C C    . GLY B 1 147 ? 28.184  -0.153  -1.348  1.00 0.00 ? 147 GLY B C    2  
ATOM 5277  O O    . GLY B 1 147 ? 28.531  -1.211  -0.836  1.00 0.00 ? 147 GLY B O    2  
ATOM 5278  H H    . GLY B 1 147 ? 26.317  -1.814  -1.631  1.00 0.00 ? 147 GLY B H    2  
ATOM 5279  H HA2  . GLY B 1 147 ? 27.784  -0.314  -3.442  1.00 0.00 ? 147 GLY B HA2  2  
ATOM 5280  H HA3  . GLY B 1 147 ? 26.715  0.782   -2.590  1.00 0.00 ? 147 GLY B HA3  2  
ATOM 5281  N N    . PRO B 1 148 ? 28.627  1.024   -0.882  1.00 0.00 ? 148 PRO B N    2  
ATOM 5282  C CA   . PRO B 1 148 ? 29.581  1.138   0.199   1.00 0.00 ? 148 PRO B CA   2  
ATOM 5283  C C    . PRO B 1 148 ? 28.950  1.257   1.589   1.00 0.00 ? 148 PRO B C    2  
ATOM 5284  O O    . PRO B 1 148 ? 27.952  1.965   1.799   1.00 0.00 ? 148 PRO B O    2  
ATOM 5285  C CB   . PRO B 1 148 ? 30.343  2.429   -0.133  1.00 0.00 ? 148 PRO B CB   2  
ATOM 5286  C CG   . PRO B 1 148 ? 29.546  3.112   -1.200  1.00 0.00 ? 148 PRO B CG   2  
ATOM 5287  C CD   . PRO B 1 148 ? 28.264  2.331   -1.363  1.00 0.00 ? 148 PRO B CD   2  
ATOM 5288  H HA   . PRO B 1 148 ? 30.282  0.317   0.198   1.00 0.00 ? 148 PRO B HA   2  
ATOM 5289  H HB2  . PRO B 1 148 ? 30.420  3.039   0.755   1.00 0.00 ? 148 PRO B HB2  2  
ATOM 5290  H HB3  . PRO B 1 148 ? 31.332  2.181   -0.486  1.00 0.00 ? 148 PRO B HB3  2  
ATOM 5291  H HG2  . PRO B 1 148 ? 29.338  4.132   -0.913  1.00 0.00 ? 148 PRO B HG2  2  
ATOM 5292  H HG3  . PRO B 1 148 ? 30.115  3.099   -2.117  1.00 0.00 ? 148 PRO B HG3  2  
ATOM 5293  H HD2  . PRO B 1 148 ? 27.483  2.760   -0.751  1.00 0.00 ? 148 PRO B HD2  2  
ATOM 5294  H HD3  . PRO B 1 148 ? 27.959  2.301   -2.397  1.00 0.00 ? 148 PRO B HD3  2  
ATOM 5295  N N    . ARG B 1 149 ? 29.565  0.571   2.498   1.00 0.00 ? 149 ARG B N    2  
ATOM 5296  C CA   . ARG B 1 149 ? 29.251  0.565   3.900   1.00 0.00 ? 149 ARG B CA   2  
ATOM 5297  C C    . ARG B 1 149 ? 30.311  1.410   4.564   1.00 0.00 ? 149 ARG B C    2  
ATOM 5298  O O    . ARG B 1 149 ? 31.486  1.322   4.181   1.00 0.00 ? 149 ARG B O    2  
ATOM 5299  C CB   . ARG B 1 149 ? 29.349  -0.874  4.361   1.00 0.00 ? 149 ARG B CB   2  
ATOM 5300  C CG   . ARG B 1 149 ? 29.141  -1.173  5.827   1.00 0.00 ? 149 ARG B CG   2  
ATOM 5301  C CD   . ARG B 1 149 ? 29.332  -2.657  6.008   1.00 0.00 ? 149 ARG B CD   2  
ATOM 5302  N NE   . ARG B 1 149 ? 29.172  -3.148  7.367   1.00 0.00 ? 149 ARG B NE   2  
ATOM 5303  C CZ   . ARG B 1 149 ? 29.619  -4.347  7.764   1.00 0.00 ? 149 ARG B CZ   2  
ATOM 5304  N NH1  . ARG B 1 149 ? 30.352  -5.095  6.932   1.00 0.00 ? 149 ARG B NH1  2  
ATOM 5305  N NH2  . ARG B 1 149 ? 29.352  -4.785  8.990   1.00 0.00 ? 149 ARG B NH2  2  
ATOM 5306  H H    . ARG B 1 149 ? 30.322  0.007   2.223   1.00 0.00 ? 149 ARG B H    2  
ATOM 5307  H HA   . ARG B 1 149 ? 28.259  0.953   4.074   1.00 0.00 ? 149 ARG B HA   2  
ATOM 5308  H HB2  . ARG B 1 149 ? 28.589  -1.421  3.824   1.00 0.00 ? 149 ARG B HB2  2  
ATOM 5309  H HB3  . ARG B 1 149 ? 30.315  -1.256  4.063   1.00 0.00 ? 149 ARG B HB3  2  
ATOM 5310  H HG2  . ARG B 1 149 ? 29.864  -0.629  6.417   1.00 0.00 ? 149 ARG B HG2  2  
ATOM 5311  H HG3  . ARG B 1 149 ? 28.137  -0.912  6.121   1.00 0.00 ? 149 ARG B HG3  2  
ATOM 5312  H HD2  . ARG B 1 149 ? 28.609  -3.169  5.393   1.00 0.00 ? 149 ARG B HD2  2  
ATOM 5313  H HD3  . ARG B 1 149 ? 30.322  -2.913  5.661   1.00 0.00 ? 149 ARG B HD3  2  
ATOM 5314  H HE   . ARG B 1 149 ? 28.666  -2.569  7.982   1.00 0.00 ? 149 ARG B HE   2  
ATOM 5315  H HH11 . ARG B 1 149 ? 30.598  -4.801  5.993   1.00 0.00 ? 149 ARG B HH11 2  
ATOM 5316  H HH12 . ARG B 1 149 ? 30.698  -6.001  7.190   1.00 0.00 ? 149 ARG B HH12 2  
ATOM 5317  H HH21 . ARG B 1 149 ? 28.813  -4.227  9.630   1.00 0.00 ? 149 ARG B HH21 2  
ATOM 5318  H HH22 . ARG B 1 149 ? 29.675  -5.670  9.339   1.00 0.00 ? 149 ARG B HH22 2  
ATOM 5319  N N    . LYS B 1 150 ? 29.924  2.231   5.490   1.00 0.00 ? 150 LYS B N    2  
ATOM 5320  C CA   . LYS B 1 150 ? 30.827  3.147   6.120   1.00 0.00 ? 150 LYS B CA   2  
ATOM 5321  C C    . LYS B 1 150 ? 30.978  2.787   7.592   1.00 0.00 ? 150 LYS B C    2  
ATOM 5322  O O    . LYS B 1 150 ? 30.174  3.249   8.422   1.00 0.00 ? 150 LYS B O    2  
ATOM 5323  C CB   . LYS B 1 150 ? 30.300  4.571   5.938   1.00 0.00 ? 150 LYS B CB   2  
ATOM 5324  C CG   . LYS B 1 150 ? 31.233  5.678   6.424   1.00 0.00 ? 150 LYS B CG   2  
ATOM 5325  C CD   . LYS B 1 150 ? 30.644  7.061   6.139   1.00 0.00 ? 150 LYS B CD   2  
ATOM 5326  C CE   . LYS B 1 150 ? 30.405  7.266   4.647   1.00 0.00 ? 150 LYS B CE   2  
ATOM 5327  N NZ   . LYS B 1 150 ? 29.795  8.573   4.341   1.00 0.00 ? 150 LYS B NZ   2  
ATOM 5328  H H    . LYS B 1 150 ? 29.002  2.216   5.836   1.00 0.00 ? 150 LYS B H    2  
ATOM 5329  H HA   . LYS B 1 150 ? 31.789  3.063   5.637   1.00 0.00 ? 150 LYS B HA   2  
ATOM 5330  H HB2  . LYS B 1 150 ? 30.125  4.710   4.883   1.00 0.00 ? 150 LYS B HB2  2  
ATOM 5331  H HB3  . LYS B 1 150 ? 29.359  4.656   6.462   1.00 0.00 ? 150 LYS B HB3  2  
ATOM 5332  H HG2  . LYS B 1 150 ? 31.384  5.570   7.487   1.00 0.00 ? 150 LYS B HG2  2  
ATOM 5333  H HG3  . LYS B 1 150 ? 32.180  5.586   5.913   1.00 0.00 ? 150 LYS B HG3  2  
ATOM 5334  H HD2  . LYS B 1 150 ? 29.703  7.155   6.659   1.00 0.00 ? 150 LYS B HD2  2  
ATOM 5335  H HD3  . LYS B 1 150 ? 31.332  7.815   6.494   1.00 0.00 ? 150 LYS B HD3  2  
ATOM 5336  H HE2  . LYS B 1 150 ? 31.347  7.197   4.123   1.00 0.00 ? 150 LYS B HE2  2  
ATOM 5337  H HE3  . LYS B 1 150 ? 29.745  6.493   4.285   1.00 0.00 ? 150 LYS B HE3  2  
ATOM 5338  H HZ1  . LYS B 1 150 ? 29.555  8.581   3.325   1.00 0.00 ? 150 LYS B HZ1  2  
ATOM 5339  H HZ2  . LYS B 1 150 ? 30.413  9.381   4.556   1.00 0.00 ? 150 LYS B HZ2  2  
ATOM 5340  H HZ3  . LYS B 1 150 ? 28.904  8.677   4.866   1.00 0.00 ? 150 LYS B HZ3  2  
ATOM 5341  N N    . ARG A 1 69  ? -35.442 1.676   -13.375 1.00 0.00 ? 69  ARG A N    3  
ATOM 5342  C CA   . ARG A 1 69  ? -36.140 1.921   -12.152 1.00 0.00 ? 69  ARG A CA   3  
ATOM 5343  C C    . ARG A 1 69  ? -35.151 1.873   -11.003 1.00 0.00 ? 69  ARG A C    3  
ATOM 5344  O O    . ARG A 1 69  ? -34.972 0.836   -10.355 1.00 0.00 ? 69  ARG A O    3  
ATOM 5345  C CB   . ARG A 1 69  ? -37.231 0.867   -11.973 1.00 0.00 ? 69  ARG A CB   3  
ATOM 5346  C CG   . ARG A 1 69  ? -38.218 1.141   -10.847 1.00 0.00 ? 69  ARG A CG   3  
ATOM 5347  C CD   . ARG A 1 69  ? -39.208 -0.006  -10.715 1.00 0.00 ? 69  ARG A CD   3  
ATOM 5348  N NE   . ARG A 1 69  ? -39.854 -0.324  -12.000 1.00 0.00 ? 69  ARG A NE   3  
ATOM 5349  C CZ   . ARG A 1 69  ? -40.503 -1.462  -12.275 1.00 0.00 ? 69  ARG A CZ   3  
ATOM 5350  N NH1  . ARG A 1 69  ? -40.808 -2.308  -11.300 1.00 0.00 ? 69  ARG A NH1  3  
ATOM 5351  N NH2  . ARG A 1 69  ? -40.889 -1.727  -13.516 1.00 0.00 ? 69  ARG A NH2  3  
ATOM 5352  H H    . ARG A 1 69  ? -35.314 0.746   -13.665 1.00 0.00 ? 69  ARG A H    3  
ATOM 5353  H HA   . ARG A 1 69  ? -36.593 2.900   -12.198 1.00 0.00 ? 69  ARG A HA   3  
ATOM 5354  H HB2  . ARG A 1 69  ? -37.789 0.790   -12.894 1.00 0.00 ? 69  ARG A HB2  3  
ATOM 5355  H HB3  . ARG A 1 69  ? -36.754 -0.083  -11.781 1.00 0.00 ? 69  ARG A HB3  3  
ATOM 5356  H HG2  . ARG A 1 69  ? -37.675 1.250   -9.920  1.00 0.00 ? 69  ARG A HG2  3  
ATOM 5357  H HG3  . ARG A 1 69  ? -38.759 2.051   -11.063 1.00 0.00 ? 69  ARG A HG3  3  
ATOM 5358  H HD2  . ARG A 1 69  ? -38.684 -0.883  -10.363 1.00 0.00 ? 69  ARG A HD2  3  
ATOM 5359  H HD3  . ARG A 1 69  ? -39.970 0.269   -10.002 1.00 0.00 ? 69  ARG A HD3  3  
ATOM 5360  H HE   . ARG A 1 69  ? -39.736 0.359   -12.705 1.00 0.00 ? 69  ARG A HE   3  
ATOM 5361  H HH11 . ARG A 1 69  ? -40.576 -2.140  -10.339 1.00 0.00 ? 69  ARG A HH11 3  
ATOM 5362  H HH12 . ARG A 1 69  ? -41.301 -3.161  -11.492 1.00 0.00 ? 69  ARG A HH12 3  
ATOM 5363  H HH21 . ARG A 1 69  ? -40.726 -1.114  -14.295 1.00 0.00 ? 69  ARG A HH21 3  
ATOM 5364  H HH22 . ARG A 1 69  ? -41.365 -2.579  -13.753 1.00 0.00 ? 69  ARG A HH22 3  
ATOM 5365  N N    . LEU A 1 70  ? -34.474 2.968   -10.801 1.00 0.00 ? 70  LEU A N    3  
ATOM 5366  C CA   . LEU A 1 70  ? -33.522 3.101   -9.714  1.00 0.00 ? 70  LEU A CA   3  
ATOM 5367  C C    . LEU A 1 70  ? -34.253 3.449   -8.418  1.00 0.00 ? 70  LEU A C    3  
ATOM 5368  O O    . LEU A 1 70  ? -35.502 3.414   -8.371  1.00 0.00 ? 70  LEU A O    3  
ATOM 5369  C CB   . LEU A 1 70  ? -32.449 4.180   -10.025 1.00 0.00 ? 70  LEU A CB   3  
ATOM 5370  C CG   . LEU A 1 70  ? -31.350 3.867   -11.075 1.00 0.00 ? 70  LEU A CG   3  
ATOM 5371  C CD1  . LEU A 1 70  ? -30.559 2.625   -10.708 1.00 0.00 ? 70  LEU A CD1  3  
ATOM 5372  C CD2  . LEU A 1 70  ? -31.903 3.763   -12.485 1.00 0.00 ? 70  LEU A CD2  3  
ATOM 5373  H H    . LEU A 1 70  ? -34.616 3.724   -11.407 1.00 0.00 ? 70  LEU A H    3  
ATOM 5374  H HA   . LEU A 1 70  ? -33.033 2.147   -9.582  1.00 0.00 ? 70  LEU A HA   3  
ATOM 5375  H HB2  . LEU A 1 70  ? -32.971 5.064   -10.360 1.00 0.00 ? 70  LEU A HB2  3  
ATOM 5376  H HB3  . LEU A 1 70  ? -31.964 4.419   -9.091  1.00 0.00 ? 70  LEU A HB3  3  
ATOM 5377  H HG   . LEU A 1 70  ? -30.644 4.685   -11.051 1.00 0.00 ? 70  LEU A HG   3  
ATOM 5378  H HD11 . LEU A 1 70  ? -29.793 2.454   -11.450 1.00 0.00 ? 70  LEU A HD11 3  
ATOM 5379  H HD12 . LEU A 1 70  ? -31.224 1.775   -10.681 1.00 0.00 ? 70  LEU A HD12 3  
ATOM 5380  H HD13 . LEU A 1 70  ? -30.102 2.760   -9.740  1.00 0.00 ? 70  LEU A HD13 3  
ATOM 5381  H HD21 . LEU A 1 70  ? -32.386 4.689   -12.757 1.00 0.00 ? 70  LEU A HD21 3  
ATOM 5382  H HD22 . LEU A 1 70  ? -32.623 2.959   -12.530 1.00 0.00 ? 70  LEU A HD22 3  
ATOM 5383  H HD23 . LEU A 1 70  ? -31.097 3.565   -13.176 1.00 0.00 ? 70  LEU A HD23 3  
ATOM 5384  N N    . GLU A 1 71  ? -33.470 3.760   -7.377  1.00 0.00 ? 71  GLU A N    3  
ATOM 5385  C CA   . GLU A 1 71  ? -33.931 4.146   -6.035  1.00 0.00 ? 71  GLU A CA   3  
ATOM 5386  C C    . GLU A 1 71  ? -34.570 2.921   -5.382  1.00 0.00 ? 71  GLU A C    3  
ATOM 5387  O O    . GLU A 1 71  ? -35.464 3.046   -4.529  1.00 0.00 ? 71  GLU A O    3  
ATOM 5388  C CB   . GLU A 1 71  ? -34.993 5.274   -6.084  1.00 0.00 ? 71  GLU A CB   3  
ATOM 5389  C CG   . GLU A 1 71  ? -34.732 6.434   -7.047  1.00 0.00 ? 71  GLU A CG   3  
ATOM 5390  C CD   . GLU A 1 71  ? -33.628 7.374   -6.658  1.00 0.00 ? 71  GLU A CD   3  
ATOM 5391  O OE1  . GLU A 1 71  ? -32.450 7.089   -6.951  1.00 0.00 ? 71  GLU A OE1  3  
ATOM 5392  O OE2  . GLU A 1 71  ? -33.940 8.478   -6.147  1.00 0.00 ? 71  GLU A OE2  3  
ATOM 5393  H H    . GLU A 1 71  ? -32.493 3.660   -7.492  1.00 0.00 ? 71  GLU A H    3  
ATOM 5394  H HA   . GLU A 1 71  ? -33.076 4.466   -5.458  1.00 0.00 ? 71  GLU A HA   3  
ATOM 5395  H HB2  . GLU A 1 71  ? -35.933 4.826   -6.369  1.00 0.00 ? 71  GLU A HB2  3  
ATOM 5396  H HB3  . GLU A 1 71  ? -35.101 5.678   -5.088  1.00 0.00 ? 71  GLU A HB3  3  
ATOM 5397  H HG2  . GLU A 1 71  ? -34.484 6.023   -8.014  1.00 0.00 ? 71  GLU A HG2  3  
ATOM 5398  H HG3  . GLU A 1 71  ? -35.653 6.989   -7.134  1.00 0.00 ? 71  GLU A HG3  3  
ATOM 5399  N N    . LYS A 1 72  ? -34.118 1.739   -5.769  1.00 0.00 ? 72  LYS A N    3  
ATOM 5400  C CA   . LYS A 1 72  ? -34.788 0.533   -5.360  1.00 0.00 ? 72  LYS A CA   3  
ATOM 5401  C C    . LYS A 1 72  ? -33.844 -0.478  -4.716  1.00 0.00 ? 72  LYS A C    3  
ATOM 5402  O O    . LYS A 1 72  ? -32.643 -0.500  -5.004  1.00 0.00 ? 72  LYS A O    3  
ATOM 5403  C CB   . LYS A 1 72  ? -35.492 -0.084  -6.587  1.00 0.00 ? 72  LYS A CB   3  
ATOM 5404  C CG   . LYS A 1 72  ? -36.389 -1.277  -6.291  1.00 0.00 ? 72  LYS A CG   3  
ATOM 5405  C CD   . LYS A 1 72  ? -37.055 -1.793  -7.553  1.00 0.00 ? 72  LYS A CD   3  
ATOM 5406  C CE   . LYS A 1 72  ? -38.009 -2.942  -7.260  1.00 0.00 ? 72  LYS A CE   3  
ATOM 5407  N NZ   . LYS A 1 72  ? -37.334 -4.106  -6.669  1.00 0.00 ? 72  LYS A NZ   3  
ATOM 5408  H H    . LYS A 1 72  ? -33.313 1.669   -6.337  1.00 0.00 ? 72  LYS A H    3  
ATOM 5409  H HA   . LYS A 1 72  ? -35.555 0.800   -4.652  1.00 0.00 ? 72  LYS A HA   3  
ATOM 5410  H HB2  . LYS A 1 72  ? -36.096 0.677   -7.056  1.00 0.00 ? 72  LYS A HB2  3  
ATOM 5411  H HB3  . LYS A 1 72  ? -34.731 -0.397  -7.288  1.00 0.00 ? 72  LYS A HB3  3  
ATOM 5412  H HG2  . LYS A 1 72  ? -35.790 -2.067  -5.862  1.00 0.00 ? 72  LYS A HG2  3  
ATOM 5413  H HG3  . LYS A 1 72  ? -37.149 -0.977  -5.586  1.00 0.00 ? 72  LYS A HG3  3  
ATOM 5414  H HD2  . LYS A 1 72  ? -37.609 -0.987  -8.010  1.00 0.00 ? 72  LYS A HD2  3  
ATOM 5415  H HD3  . LYS A 1 72  ? -36.292 -2.136  -8.236  1.00 0.00 ? 72  LYS A HD3  3  
ATOM 5416  H HE2  . LYS A 1 72  ? -38.762 -2.600  -6.566  1.00 0.00 ? 72  LYS A HE2  3  
ATOM 5417  H HE3  . LYS A 1 72  ? -38.484 -3.240  -8.184  1.00 0.00 ? 72  LYS A HE3  3  
ATOM 5418  H HZ1  . LYS A 1 72  ? -36.611 -4.488  -7.311  1.00 0.00 ? 72  LYS A HZ1  3  
ATOM 5419  H HZ2  . LYS A 1 72  ? -38.025 -4.860  -6.482  1.00 0.00 ? 72  LYS A HZ2  3  
ATOM 5420  H HZ3  . LYS A 1 72  ? -36.883 -3.866  -5.765  1.00 0.00 ? 72  LYS A HZ3  3  
ATOM 5421  N N    . ASP A 1 73  ? -34.419 -1.277  -3.799  1.00 0.00 ? 73  ASP A N    3  
ATOM 5422  C CA   . ASP A 1 73  ? -33.772 -2.434  -3.149  1.00 0.00 ? 73  ASP A CA   3  
ATOM 5423  C C    . ASP A 1 73  ? -32.635 -1.984  -2.217  1.00 0.00 ? 73  ASP A C    3  
ATOM 5424  O O    . ASP A 1 73  ? -32.405 -0.784  -2.031  1.00 0.00 ? 73  ASP A O    3  
ATOM 5425  C CB   . ASP A 1 73  ? -33.261 -3.425  -4.224  1.00 0.00 ? 73  ASP A CB   3  
ATOM 5426  C CG   . ASP A 1 73  ? -33.151 -4.861  -3.738  1.00 0.00 ? 73  ASP A CG   3  
ATOM 5427  O OD1  . ASP A 1 73  ? -32.178 -5.214  -3.065  1.00 0.00 ? 73  ASP A OD1  3  
ATOM 5428  O OD2  . ASP A 1 73  ? -34.048 -5.672  -4.050  1.00 0.00 ? 73  ASP A OD2  3  
ATOM 5429  H H    . ASP A 1 73  ? -35.338 -1.060  -3.536  1.00 0.00 ? 73  ASP A H    3  
ATOM 5430  H HA   . ASP A 1 73  ? -34.524 -2.927  -2.551  1.00 0.00 ? 73  ASP A HA   3  
ATOM 5431  H HB2  . ASP A 1 73  ? -33.939 -3.406  -5.064  1.00 0.00 ? 73  ASP A HB2  3  
ATOM 5432  H HB3  . ASP A 1 73  ? -32.286 -3.100  -4.558  1.00 0.00 ? 73  ASP A HB3  3  
ATOM 5433  N N    . ARG A 1 74  ? -32.018 -2.917  -1.561  1.00 0.00 ? 74  ARG A N    3  
ATOM 5434  C CA   . ARG A 1 74  ? -30.908 -2.640  -0.704  1.00 0.00 ? 74  ARG A CA   3  
ATOM 5435  C C    . ARG A 1 74  ? -29.707 -3.248  -1.298  1.00 0.00 ? 74  ARG A C    3  
ATOM 5436  O O    . ARG A 1 74  ? -29.626 -4.472  -1.481  1.00 0.00 ? 74  ARG A O    3  
ATOM 5437  C CB   . ARG A 1 74  ? -31.107 -3.126  0.722   1.00 0.00 ? 74  ARG A CB   3  
ATOM 5438  C CG   . ARG A 1 74  ? -32.035 -2.261  1.544   1.00 0.00 ? 74  ARG A CG   3  
ATOM 5439  C CD   . ARG A 1 74  ? -32.100 -2.742  2.977   1.00 0.00 ? 74  ARG A CD   3  
ATOM 5440  N NE   . ARG A 1 74  ? -30.766 -2.803  3.604   1.00 0.00 ? 74  ARG A NE   3  
ATOM 5441  C CZ   . ARG A 1 74  ? -30.478 -2.441  4.858   1.00 0.00 ? 74  ARG A CZ   3  
ATOM 5442  N NH1  . ARG A 1 74  ? -31.374 -1.792  5.596   1.00 0.00 ? 74  ARG A NH1  3  
ATOM 5443  N NH2  . ARG A 1 74  ? -29.268 -2.694  5.355   1.00 0.00 ? 74  ARG A NH2  3  
ATOM 5444  H H    . ARG A 1 74  ? -32.275 -3.855  -1.709  1.00 0.00 ? 74  ARG A H    3  
ATOM 5445  H HA   . ARG A 1 74  ? -30.774 -1.568  -0.702  1.00 0.00 ? 74  ARG A HA   3  
ATOM 5446  H HB2  . ARG A 1 74  ? -31.511 -4.127  0.695   1.00 0.00 ? 74  ARG A HB2  3  
ATOM 5447  H HB3  . ARG A 1 74  ? -30.144 -3.152  1.210   1.00 0.00 ? 74  ARG A HB3  3  
ATOM 5448  H HG2  . ARG A 1 74  ? -31.673 -1.243  1.530   1.00 0.00 ? 74  ARG A HG2  3  
ATOM 5449  H HG3  . ARG A 1 74  ? -33.024 -2.301  1.114   1.00 0.00 ? 74  ARG A HG3  3  
ATOM 5450  H HD2  . ARG A 1 74  ? -32.731 -2.078  3.544   1.00 0.00 ? 74  ARG A HD2  3  
ATOM 5451  H HD3  . ARG A 1 74  ? -32.528 -3.732  2.983   1.00 0.00 ? 74  ARG A HD3  3  
ATOM 5452  H HE   . ARG A 1 74  ? -30.060 -3.208  3.051   1.00 0.00 ? 74  ARG A HE   3  
ATOM 5453  H HH11 . ARG A 1 74  ? -32.282 -1.532  5.259   1.00 0.00 ? 74  ARG A HH11 3  
ATOM 5454  H HH12 . ARG A 1 74  ? -31.193 -1.562  6.559   1.00 0.00 ? 74  ARG A HH12 3  
ATOM 5455  H HH21 . ARG A 1 74  ? -28.550 -3.153  4.820   1.00 0.00 ? 74  ARG A HH21 3  
ATOM 5456  H HH22 . ARG A 1 74  ? -29.034 -2.452  6.303   1.00 0.00 ? 74  ARG A HH22 3  
ATOM 5457  N N    . PHE A 1 75  ? -28.774 -2.442  -1.576  1.00 0.00 ? 75  PHE A N    3  
ATOM 5458  C CA   . PHE A 1 75  ? -27.646 -2.854  -2.281  1.00 0.00 ? 75  PHE A CA   3  
ATOM 5459  C C    . PHE A 1 75  ? -26.474 -2.969  -1.338  1.00 0.00 ? 75  PHE A C    3  
ATOM 5460  O O    . PHE A 1 75  ? -26.424 -2.305  -0.276  1.00 0.00 ? 75  PHE A O    3  
ATOM 5461  C CB   . PHE A 1 75  ? -27.365 -1.850  -3.403  1.00 0.00 ? 75  PHE A CB   3  
ATOM 5462  C CG   . PHE A 1 75  ? -26.480 -2.397  -4.459  1.00 0.00 ? 75  PHE A CG   3  
ATOM 5463  C CD1  . PHE A 1 75  ? -27.001 -3.249  -5.406  1.00 0.00 ? 75  PHE A CD1  3  
ATOM 5464  C CD2  . PHE A 1 75  ? -25.133 -2.085  -4.502  1.00 0.00 ? 75  PHE A CD2  3  
ATOM 5465  C CE1  . PHE A 1 75  ? -26.194 -3.791  -6.382  1.00 0.00 ? 75  PHE A CE1  3  
ATOM 5466  C CE2  . PHE A 1 75  ? -24.323 -2.619  -5.477  1.00 0.00 ? 75  PHE A CE2  3  
ATOM 5467  C CZ   . PHE A 1 75  ? -24.855 -3.475  -6.416  1.00 0.00 ? 75  PHE A CZ   3  
ATOM 5468  H H    . PHE A 1 75  ? -28.834 -1.501  -1.284  1.00 0.00 ? 75  PHE A H    3  
ATOM 5469  H HA   . PHE A 1 75  ? -27.847 -3.814  -2.730  1.00 0.00 ? 75  PHE A HA   3  
ATOM 5470  H HB2  . PHE A 1 75  ? -28.298 -1.563  -3.864  1.00 0.00 ? 75  PHE A HB2  3  
ATOM 5471  H HB3  . PHE A 1 75  ? -26.891 -0.974  -2.986  1.00 0.00 ? 75  PHE A HB3  3  
ATOM 5472  H HD1  . PHE A 1 75  ? -28.052 -3.494  -5.379  1.00 0.00 ? 75  PHE A HD1  3  
ATOM 5473  H HD2  . PHE A 1 75  ? -24.719 -1.414  -3.765  1.00 0.00 ? 75  PHE A HD2  3  
ATOM 5474  H HE1  . PHE A 1 75  ? -26.609 -4.459  -7.122  1.00 0.00 ? 75  PHE A HE1  3  
ATOM 5475  H HE2  . PHE A 1 75  ? -23.271 -2.373  -5.505  1.00 0.00 ? 75  PHE A HE2  3  
ATOM 5476  H HZ   . PHE A 1 75  ? -24.221 -3.905  -7.176  1.00 0.00 ? 75  PHE A HZ   3  
ATOM 5477  N N    . SER A 1 76  ? -25.590 -3.853  -1.671  1.00 0.00 ? 76  SER A N    3  
ATOM 5478  C CA   . SER A 1 76  ? -24.420 -4.057  -0.926  1.00 0.00 ? 76  SER A CA   3  
ATOM 5479  C C    . SER A 1 76  ? -23.257 -4.214  -1.869  1.00 0.00 ? 76  SER A C    3  
ATOM 5480  O O    . SER A 1 76  ? -23.402 -4.751  -2.972  1.00 0.00 ? 76  SER A O    3  
ATOM 5481  C CB   . SER A 1 76  ? -24.574 -5.287  -0.028  1.00 0.00 ? 76  SER A CB   3  
ATOM 5482  O OG   . SER A 1 76  ? -24.964 -6.436  -0.781  1.00 0.00 ? 76  SER A OG   3  
ATOM 5483  H H    . SER A 1 76  ? -25.704 -4.407  -2.471  1.00 0.00 ? 76  SER A H    3  
ATOM 5484  H HA   . SER A 1 76  ? -24.257 -3.191  -0.303  1.00 0.00 ? 76  SER A HA   3  
ATOM 5485  H HB2  . SER A 1 76  ? -23.631 -5.495  0.457   1.00 0.00 ? 76  SER A HB2  3  
ATOM 5486  H HB3  . SER A 1 76  ? -25.327 -5.089  0.720   1.00 0.00 ? 76  SER A HB3  3  
ATOM 5487  H HG   . SER A 1 76  ? -25.927 -6.489  -0.712  1.00 0.00 ? 76  SER A HG   3  
ATOM 5488  N N    . VAL A 1 77  ? -22.145 -3.721  -1.475  1.00 0.00 ? 77  VAL A N    3  
ATOM 5489  C CA   . VAL A 1 77  ? -20.946 -3.883  -2.211  1.00 0.00 ? 77  VAL A CA   3  
ATOM 5490  C C    . VAL A 1 77  ? -20.052 -4.688  -1.315  1.00 0.00 ? 77  VAL A C    3  
ATOM 5491  O O    . VAL A 1 77  ? -19.962 -4.419  -0.117  1.00 0.00 ? 77  VAL A O    3  
ATOM 5492  C CB   . VAL A 1 77  ? -20.260 -2.511  -2.565  1.00 0.00 ? 77  VAL A CB   3  
ATOM 5493  C CG1  . VAL A 1 77  ? -19.057 -2.715  -3.478  1.00 0.00 ? 77  VAL A CG1  3  
ATOM 5494  C CG2  . VAL A 1 77  ? -21.257 -1.550  -3.198  1.00 0.00 ? 77  VAL A CG2  3  
ATOM 5495  H H    . VAL A 1 77  ? -22.108 -3.245  -0.614  1.00 0.00 ? 77  VAL A H    3  
ATOM 5496  H HA   . VAL A 1 77  ? -21.161 -4.439  -3.113  1.00 0.00 ? 77  VAL A HA   3  
ATOM 5497  H HB   . VAL A 1 77  ? -19.889 -2.071  -1.652  1.00 0.00 ? 77  VAL A HB   3  
ATOM 5498  H HG11 . VAL A 1 77  ? -19.376 -3.182  -4.398  1.00 0.00 ? 77  VAL A HG11 3  
ATOM 5499  H HG12 . VAL A 1 77  ? -18.336 -3.351  -2.986  1.00 0.00 ? 77  VAL A HG12 3  
ATOM 5500  H HG13 . VAL A 1 77  ? -18.602 -1.760  -3.696  1.00 0.00 ? 77  VAL A HG13 3  
ATOM 5501  H HG21 . VAL A 1 77  ? -21.628 -1.977  -4.118  1.00 0.00 ? 77  VAL A HG21 3  
ATOM 5502  H HG22 . VAL A 1 77  ? -20.768 -0.611  -3.410  1.00 0.00 ? 77  VAL A HG22 3  
ATOM 5503  H HG23 . VAL A 1 77  ? -22.082 -1.386  -2.521  1.00 0.00 ? 77  VAL A HG23 3  
ATOM 5504  N N    . ASN A 1 78  ? -19.456 -5.683  -1.830  1.00 0.00 ? 78  ASN A N    3  
ATOM 5505  C CA   . ASN A 1 78  ? -18.581 -6.480  -1.039  1.00 0.00 ? 78  ASN A CA   3  
ATOM 5506  C C    . ASN A 1 78  ? -17.212 -6.253  -1.515  1.00 0.00 ? 78  ASN A C    3  
ATOM 5507  O O    . ASN A 1 78  ? -16.977 -6.161  -2.719  1.00 0.00 ? 78  ASN A O    3  
ATOM 5508  C CB   . ASN A 1 78  ? -18.947 -7.974  -1.068  1.00 0.00 ? 78  ASN A CB   3  
ATOM 5509  C CG   . ASN A 1 78  ? -18.978 -8.591  -2.467  1.00 0.00 ? 78  ASN A CG   3  
ATOM 5510  O OD1  . ASN A 1 78  ? -20.008 -8.570  -3.143  1.00 0.00 ? 78  ASN A OD1  3  
ATOM 5511  N ND2  . ASN A 1 78  ? -17.883 -9.155  -2.901  1.00 0.00 ? 78  ASN A ND2  3  
ATOM 5512  H H    . ASN A 1 78  ? -19.572 -5.907  -2.777  1.00 0.00 ? 78  ASN A H    3  
ATOM 5513  H HA   . ASN A 1 78  ? -18.648 -6.117  -0.025  1.00 0.00 ? 78  ASN A HA   3  
ATOM 5514  H HB2  . ASN A 1 78  ? -18.219 -8.515  -0.485  1.00 0.00 ? 78  ASN A HB2  3  
ATOM 5515  H HB3  . ASN A 1 78  ? -19.922 -8.099  -0.619  1.00 0.00 ? 78  ASN A HB3  3  
ATOM 5516  H HD21 . ASN A 1 78  ? -17.080 -9.172  -2.337  1.00 0.00 ? 78  ASN A HD21 3  
ATOM 5517  H HD22 . ASN A 1 78  ? -17.882 -9.553  -3.796  1.00 0.00 ? 78  ASN A HD22 3  
ATOM 5518  N N    . LEU A 1 79  ? -16.325 -6.110  -0.603  1.00 0.00 ? 79  LEU A N    3  
ATOM 5519  C CA   . LEU A 1 79  ? -14.997 -5.810  -0.936  1.00 0.00 ? 79  LEU A CA   3  
ATOM 5520  C C    . LEU A 1 79  ? -14.102 -6.926  -0.422  1.00 0.00 ? 79  LEU A C    3  
ATOM 5521  O O    . LEU A 1 79  ? -14.119 -7.248  0.767   1.00 0.00 ? 79  LEU A O    3  
ATOM 5522  C CB   . LEU A 1 79  ? -14.549 -4.462  -0.313  1.00 0.00 ? 79  LEU A CB   3  
ATOM 5523  C CG   . LEU A 1 79  ? -15.208 -3.151  -0.807  1.00 0.00 ? 79  LEU A CG   3  
ATOM 5524  C CD1  . LEU A 1 79  ? -16.669 -3.040  -0.419  1.00 0.00 ? 79  LEU A CD1  3  
ATOM 5525  C CD2  . LEU A 1 79  ? -14.444 -1.957  -0.289  1.00 0.00 ? 79  LEU A CD2  3  
ATOM 5526  H H    . LEU A 1 79  ? -16.550 -6.192  0.351   1.00 0.00 ? 79  LEU A H    3  
ATOM 5527  H HA   . LEU A 1 79  ? -14.936 -5.736  -2.010  1.00 0.00 ? 79  LEU A HA   3  
ATOM 5528  H HB2  . LEU A 1 79  ? -14.732 -4.527  0.749   1.00 0.00 ? 79  LEU A HB2  3  
ATOM 5529  H HB3  . LEU A 1 79  ? -13.482 -4.378  -0.456  1.00 0.00 ? 79  LEU A HB3  3  
ATOM 5530  H HG   . LEU A 1 79  ? -15.158 -3.124  -1.886  1.00 0.00 ? 79  LEU A HG   3  
ATOM 5531  H HD11 . LEU A 1 79  ? -17.075 -2.115  -0.803  1.00 0.00 ? 79  LEU A HD11 3  
ATOM 5532  H HD12 . LEU A 1 79  ? -16.760 -3.053  0.656   1.00 0.00 ? 79  LEU A HD12 3  
ATOM 5533  H HD13 . LEU A 1 79  ? -17.216 -3.873  -0.836  1.00 0.00 ? 79  LEU A HD13 3  
ATOM 5534  H HD21 . LEU A 1 79  ? -14.421 -1.984  0.787   1.00 0.00 ? 79  LEU A HD21 3  
ATOM 5535  H HD22 . LEU A 1 79  ? -14.927 -1.048  -0.617  1.00 0.00 ? 79  LEU A HD22 3  
ATOM 5536  H HD23 . LEU A 1 79  ? -13.435 -1.981  -0.669  1.00 0.00 ? 79  LEU A HD23 3  
ATOM 5537  N N    . ASP A 1 80  ? -13.280 -7.459  -1.288  1.00 0.00 ? 80  ASP A N    3  
ATOM 5538  C CA   . ASP A 1 80  ? -12.400 -8.570  -0.957  1.00 0.00 ? 80  ASP A CA   3  
ATOM 5539  C C    . ASP A 1 80  ? -10.955 -8.132  -1.062  1.00 0.00 ? 80  ASP A C    3  
ATOM 5540  O O    . ASP A 1 80  ? -10.612 -7.316  -1.905  1.00 0.00 ? 80  ASP A O    3  
ATOM 5541  C CB   . ASP A 1 80  ? -12.647 -9.814  -1.833  1.00 0.00 ? 80  ASP A CB   3  
ATOM 5542  C CG   . ASP A 1 80  ? -11.951 -9.792  -3.185  1.00 0.00 ? 80  ASP A CG   3  
ATOM 5543  O OD1  . ASP A 1 80  ? -12.531 -9.320  -4.182  1.00 0.00 ? 80  ASP A OD1  3  
ATOM 5544  O OD2  . ASP A 1 80  ? -10.830 -10.301 -3.264  1.00 0.00 ? 80  ASP A OD2  3  
ATOM 5545  H H    . ASP A 1 80  ? -13.250 -7.095  -2.203  1.00 0.00 ? 80  ASP A H    3  
ATOM 5546  H HA   . ASP A 1 80  ? -12.594 -8.818  0.075   1.00 0.00 ? 80  ASP A HA   3  
ATOM 5547  H HB2  . ASP A 1 80  ? -12.291 -10.681 -1.298  1.00 0.00 ? 80  ASP A HB2  3  
ATOM 5548  H HB3  . ASP A 1 80  ? -13.711 -9.915  -1.990  1.00 0.00 ? 80  ASP A HB3  3  
ATOM 5549  N N    . VAL A 1 81  ? -10.161 -8.560  -0.126  1.00 0.00 ? 81  VAL A N    3  
ATOM 5550  C CA   . VAL A 1 81  ? -8.752  -8.250  -0.082  1.00 0.00 ? 81  VAL A CA   3  
ATOM 5551  C C    . VAL A 1 81  ? -8.038  -9.445  0.538   1.00 0.00 ? 81  VAL A C    3  
ATOM 5552  O O    . VAL A 1 81  ? -8.718  -10.340 1.041   1.00 0.00 ? 81  VAL A O    3  
ATOM 5553  C CB   . VAL A 1 81  ? -8.493  -6.856  0.665   1.00 0.00 ? 81  VAL A CB   3  
ATOM 5554  C CG1  . VAL A 1 81  ? -7.381  -6.878  1.710   1.00 0.00 ? 81  VAL A CG1  3  
ATOM 5555  C CG2  . VAL A 1 81  ? -8.197  -5.772  -0.361  1.00 0.00 ? 81  VAL A CG2  3  
ATOM 5556  H H    . VAL A 1 81  ? -10.486 -9.169  0.570   1.00 0.00 ? 81  VAL A H    3  
ATOM 5557  H HA   . VAL A 1 81  ? -8.427  -8.177  -1.110  1.00 0.00 ? 81  VAL A HA   3  
ATOM 5558  H HB   . VAL A 1 81  ? -9.409  -6.574  1.162   1.00 0.00 ? 81  VAL A HB   3  
ATOM 5559  H HG11 . VAL A 1 81  ? -7.608  -7.620  2.461   1.00 0.00 ? 81  VAL A HG11 3  
ATOM 5560  H HG12 . VAL A 1 81  ? -7.304  -5.907  2.177   1.00 0.00 ? 81  VAL A HG12 3  
ATOM 5561  H HG13 . VAL A 1 81  ? -6.445  -7.124  1.232   1.00 0.00 ? 81  VAL A HG13 3  
ATOM 5562  H HG21 . VAL A 1 81  ? -8.029  -4.832  0.143   1.00 0.00 ? 81  VAL A HG21 3  
ATOM 5563  H HG22 . VAL A 1 81  ? -9.036  -5.676  -1.034  1.00 0.00 ? 81  VAL A HG22 3  
ATOM 5564  H HG23 . VAL A 1 81  ? -7.314  -6.044  -0.923  1.00 0.00 ? 81  VAL A HG23 3  
ATOM 5565  N N    . LYS A 1 82  ? -6.722  -9.519  0.430   1.00 0.00 ? 82  LYS A N    3  
ATOM 5566  C CA   . LYS A 1 82  ? -5.958  -10.607 1.033   1.00 0.00 ? 82  LYS A CA   3  
ATOM 5567  C C    . LYS A 1 82  ? -5.945  -10.469 2.572   1.00 0.00 ? 82  LYS A C    3  
ATOM 5568  O O    . LYS A 1 82  ? -6.689  -9.663  3.124   1.00 0.00 ? 82  LYS A O    3  
ATOM 5569  C CB   . LYS A 1 82  ? -4.550  -10.623 0.457   1.00 0.00 ? 82  LYS A CB   3  
ATOM 5570  C CG   . LYS A 1 82  ? -4.513  -10.847 -1.057  1.00 0.00 ? 82  LYS A CG   3  
ATOM 5571  C CD   . LYS A 1 82  ? -3.101  -10.739 -1.612  1.00 0.00 ? 82  LYS A CD   3  
ATOM 5572  C CE   . LYS A 1 82  ? -3.049  -11.034 -3.106  1.00 0.00 ? 82  LYS A CE   3  
ATOM 5573  N NZ   . LYS A 1 82  ? -3.467  -12.419 -3.426  1.00 0.00 ? 82  LYS A NZ   3  
ATOM 5574  H H    . LYS A 1 82  ? -6.249  -8.811  -0.052  1.00 0.00 ? 82  LYS A H    3  
ATOM 5575  H HA   . LYS A 1 82  ? -6.458  -11.529 0.775   1.00 0.00 ? 82  LYS A HA   3  
ATOM 5576  H HB2  . LYS A 1 82  ? -4.078  -9.678  0.677   1.00 0.00 ? 82  LYS A HB2  3  
ATOM 5577  H HB3  . LYS A 1 82  ? -3.985  -11.412 0.929   1.00 0.00 ? 82  LYS A HB3  3  
ATOM 5578  H HG2  . LYS A 1 82  ? -4.898  -11.833 -1.272  1.00 0.00 ? 82  LYS A HG2  3  
ATOM 5579  H HG3  . LYS A 1 82  ? -5.138  -10.106 -1.533  1.00 0.00 ? 82  LYS A HG3  3  
ATOM 5580  H HD2  . LYS A 1 82  ? -2.748  -9.730  -1.453  1.00 0.00 ? 82  LYS A HD2  3  
ATOM 5581  H HD3  . LYS A 1 82  ? -2.454  -11.428 -1.089  1.00 0.00 ? 82  LYS A HD3  3  
ATOM 5582  H HE2  . LYS A 1 82  ? -3.705  -10.347 -3.621  1.00 0.00 ? 82  LYS A HE2  3  
ATOM 5583  H HE3  . LYS A 1 82  ? -2.036  -10.884 -3.453  1.00 0.00 ? 82  LYS A HE3  3  
ATOM 5584  H HZ1  . LYS A 1 82  ? -2.864  -13.115 -2.941  1.00 0.00 ? 82  LYS A HZ1  3  
ATOM 5585  H HZ2  . LYS A 1 82  ? -3.418  -12.600 -4.449  1.00 0.00 ? 82  LYS A HZ2  3  
ATOM 5586  H HZ3  . LYS A 1 82  ? -4.452  -12.585 -3.142  1.00 0.00 ? 82  LYS A HZ3  3  
ATOM 5587  N N    . HIS A 1 83  ? -5.072  -11.165 3.260   1.00 0.00 ? 83  HIS A N    3  
ATOM 5588  C CA   . HIS A 1 83  ? -5.145  -11.136 4.705   1.00 0.00 ? 83  HIS A CA   3  
ATOM 5589  C C    . HIS A 1 83  ? -4.554  -9.832  5.203   1.00 0.00 ? 83  HIS A C    3  
ATOM 5590  O O    . HIS A 1 83  ? -3.394  -9.490  4.906   1.00 0.00 ? 83  HIS A O    3  
ATOM 5591  C CB   . HIS A 1 83  ? -4.394  -12.341 5.300   1.00 0.00 ? 83  HIS A CB   3  
ATOM 5592  C CG   . HIS A 1 83  ? -4.510  -12.475 6.791   1.00 0.00 ? 83  HIS A CG   3  
ATOM 5593  N ND1  . HIS A 1 83  ? -3.450  -12.291 7.654   1.00 0.00 ? 83  HIS A ND1  3  
ATOM 5594  C CD2  . HIS A 1 83  ? -5.568  -12.808 7.570   1.00 0.00 ? 83  HIS A CD2  3  
ATOM 5595  C CE1  . HIS A 1 83  ? -3.852  -12.501 8.889   1.00 0.00 ? 83  HIS A CE1  3  
ATOM 5596  N NE2  . HIS A 1 83  ? -5.127  -12.816 8.866   1.00 0.00 ? 83  HIS A NE2  3  
ATOM 5597  H H    . HIS A 1 83  ? -4.386  -11.696 2.807   1.00 0.00 ? 83  HIS A H    3  
ATOM 5598  H HA   . HIS A 1 83  ? -6.185  -11.188 4.990   1.00 0.00 ? 83  HIS A HA   3  
ATOM 5599  H HB2  . HIS A 1 83  ? -4.781  -13.249 4.863   1.00 0.00 ? 83  HIS A HB2  3  
ATOM 5600  H HB3  . HIS A 1 83  ? -3.347  -12.253 5.054   1.00 0.00 ? 83  HIS A HB3  3  
ATOM 5601  H HD1  . HIS A 1 83  ? -2.523  -12.081 7.402   1.00 0.00 ? 83  HIS A HD1  3  
ATOM 5602  H HD2  . HIS A 1 83  ? -6.571  -13.030 7.233   1.00 0.00 ? 83  HIS A HD2  3  
ATOM 5603  H HE1  . HIS A 1 83  ? -3.238  -12.422 9.773   1.00 0.00 ? 83  HIS A HE1  3  
ATOM 5604  H HE2  . HIS A 1 83  ? -5.699  -12.861 9.665   1.00 0.00 ? 83  HIS A HE2  3  
ATOM 5605  N N    . PHE A 1 84  ? -5.350  -9.116  5.956   1.00 0.00 ? 84  PHE A N    3  
ATOM 5606  C CA   . PHE A 1 84  ? -5.003  -7.822  6.426   1.00 0.00 ? 84  PHE A CA   3  
ATOM 5607  C C    . PHE A 1 84  ? -5.862  -7.535  7.644   1.00 0.00 ? 84  PHE A C    3  
ATOM 5608  O O    . PHE A 1 84  ? -7.021  -7.941  7.687   1.00 0.00 ? 84  PHE A O    3  
ATOM 5609  C CB   . PHE A 1 84  ? -5.308  -6.822  5.316   1.00 0.00 ? 84  PHE A CB   3  
ATOM 5610  C CG   . PHE A 1 84  ? -4.654  -5.500  5.481   1.00 0.00 ? 84  PHE A CG   3  
ATOM 5611  C CD1  . PHE A 1 84  ? -3.407  -5.285  4.946   1.00 0.00 ? 84  PHE A CD1  3  
ATOM 5612  C CD2  . PHE A 1 84  ? -5.280  -4.473  6.146   1.00 0.00 ? 84  PHE A CD2  3  
ATOM 5613  C CE1  . PHE A 1 84  ? -2.799  -4.071  5.062   1.00 0.00 ? 84  PHE A CE1  3  
ATOM 5614  C CE2  . PHE A 1 84  ? -4.672  -3.257  6.273   1.00 0.00 ? 84  PHE A CE2  3  
ATOM 5615  C CZ   . PHE A 1 84  ? -3.433  -3.059  5.728   1.00 0.00 ? 84  PHE A CZ   3  
ATOM 5616  H H    . PHE A 1 84  ? -6.240  -9.445  6.207   1.00 0.00 ? 84  PHE A H    3  
ATOM 5617  H HA   . PHE A 1 84  ? -3.953  -7.783  6.672   1.00 0.00 ? 84  PHE A HA   3  
ATOM 5618  H HB2  . PHE A 1 84  ? -4.979  -7.233  4.373   1.00 0.00 ? 84  PHE A HB2  3  
ATOM 5619  H HB3  . PHE A 1 84  ? -6.376  -6.666  5.274   1.00 0.00 ? 84  PHE A HB3  3  
ATOM 5620  H HD1  . PHE A 1 84  ? -2.910  -6.088  4.423   1.00 0.00 ? 84  PHE A HD1  3  
ATOM 5621  H HD2  . PHE A 1 84  ? -6.255  -4.639  6.577   1.00 0.00 ? 84  PHE A HD2  3  
ATOM 5622  H HE1  . PHE A 1 84  ? -1.818  -3.911  4.639   1.00 0.00 ? 84  PHE A HE1  3  
ATOM 5623  H HE2  . PHE A 1 84  ? -5.165  -2.452  6.799   1.00 0.00 ? 84  PHE A HE2  3  
ATOM 5624  H HZ   . PHE A 1 84  ? -2.954  -2.096  5.824   1.00 0.00 ? 84  PHE A HZ   3  
ATOM 5625  N N    . SER A 1 85  ? -5.295  -6.869  8.615   1.00 0.00 ? 85  SER A N    3  
ATOM 5626  C CA   . SER A 1 85  ? -5.978  -6.573  9.850   1.00 0.00 ? 85  SER A CA   3  
ATOM 5627  C C    . SER A 1 85  ? -7.027  -5.462  9.648   1.00 0.00 ? 85  SER A C    3  
ATOM 5628  O O    . SER A 1 85  ? -6.695  -4.370  9.174   1.00 0.00 ? 85  SER A O    3  
ATOM 5629  C CB   . SER A 1 85  ? -4.955  -6.096  10.836  1.00 0.00 ? 85  SER A CB   3  
ATOM 5630  O OG   . SER A 1 85  ? -3.801  -6.937  10.823  1.00 0.00 ? 85  SER A OG   3  
ATOM 5631  H H    . SER A 1 85  ? -4.376  -6.546  8.528   1.00 0.00 ? 85  SER A H    3  
ATOM 5632  H HA   . SER A 1 85  ? -6.426  -7.479  10.224  1.00 0.00 ? 85  SER A HA   3  
ATOM 5633  H HB2  . SER A 1 85  ? -4.655  -5.090  10.578  1.00 0.00 ? 85  SER A HB2  3  
ATOM 5634  H HB3  . SER A 1 85  ? -5.374  -6.103  11.831  1.00 0.00 ? 85  SER A HB3  3  
ATOM 5635  H HG   . SER A 1 85  ? -3.078  -6.323  11.043  1.00 0.00 ? 85  SER A HG   3  
ATOM 5636  N N    . PRO A 1 86  ? -8.312  -5.740  10.020  1.00 0.00 ? 86  PRO A N    3  
ATOM 5637  C CA   . PRO A 1 86  ? -9.423  -4.790  9.895   1.00 0.00 ? 86  PRO A CA   3  
ATOM 5638  C C    . PRO A 1 86  ? -9.178  -3.441  10.599  1.00 0.00 ? 86  PRO A C    3  
ATOM 5639  O O    . PRO A 1 86  ? -9.670  -2.415  10.150  1.00 0.00 ? 86  PRO A O    3  
ATOM 5640  C CB   . PRO A 1 86  ? -10.623 -5.522  10.526  1.00 0.00 ? 86  PRO A CB   3  
ATOM 5641  C CG   . PRO A 1 86  ? -10.053 -6.681  11.254  1.00 0.00 ? 86  PRO A CG   3  
ATOM 5642  C CD   . PRO A 1 86  ? -8.789  -7.036  10.545  1.00 0.00 ? 86  PRO A CD   3  
ATOM 5643  H HA   . PRO A 1 86  ? -9.637  -4.594  8.854   1.00 0.00 ? 86  PRO A HA   3  
ATOM 5644  H HB2  . PRO A 1 86  ? -11.142 -4.853  11.195  1.00 0.00 ? 86  PRO A HB2  3  
ATOM 5645  H HB3  . PRO A 1 86  ? -11.297 -5.842  9.745   1.00 0.00 ? 86  PRO A HB3  3  
ATOM 5646  H HG2  . PRO A 1 86  ? -9.846  -6.403  12.276  1.00 0.00 ? 86  PRO A HG2  3  
ATOM 5647  H HG3  . PRO A 1 86  ? -10.745 -7.509  11.226  1.00 0.00 ? 86  PRO A HG3  3  
ATOM 5648  H HD2  . PRO A 1 86  ? -8.086  -7.461  11.245  1.00 0.00 ? 86  PRO A HD2  3  
ATOM 5649  H HD3  . PRO A 1 86  ? -8.983  -7.722  9.733   1.00 0.00 ? 86  PRO A HD3  3  
ATOM 5650  N N    . GLU A 1 87  ? -8.419  -3.444  11.685  1.00 0.00 ? 87  GLU A N    3  
ATOM 5651  C CA   . GLU A 1 87  ? -8.103  -2.198  12.391  1.00 0.00 ? 87  GLU A CA   3  
ATOM 5652  C C    . GLU A 1 87  ? -7.077  -1.368  11.641  1.00 0.00 ? 87  GLU A C    3  
ATOM 5653  O O    . GLU A 1 87  ? -7.075  -0.137  11.722  1.00 0.00 ? 87  GLU A O    3  
ATOM 5654  C CB   . GLU A 1 87  ? -7.620  -2.468  13.812  1.00 0.00 ? 87  GLU A CB   3  
ATOM 5655  C CG   . GLU A 1 87  ? -8.710  -2.876  14.773  1.00 0.00 ? 87  GLU A CG   3  
ATOM 5656  C CD   . GLU A 1 87  ? -9.701  -1.764  14.994  1.00 0.00 ? 87  GLU A CD   3  
ATOM 5657  O OE1  . GLU A 1 87  ? -10.684 -1.670  14.253  1.00 0.00 ? 87  GLU A OE1  3  
ATOM 5658  O OE2  . GLU A 1 87  ? -9.521  -0.950  15.936  1.00 0.00 ? 87  GLU A OE2  3  
ATOM 5659  H H    . GLU A 1 87  ? -8.078  -4.300  12.028  1.00 0.00 ? 87  GLU A H    3  
ATOM 5660  H HA   . GLU A 1 87  ? -9.019  -1.628  12.444  1.00 0.00 ? 87  GLU A HA   3  
ATOM 5661  H HB2  . GLU A 1 87  ? -6.888  -3.262  13.777  1.00 0.00 ? 87  GLU A HB2  3  
ATOM 5662  H HB3  . GLU A 1 87  ? -7.148  -1.574  14.192  1.00 0.00 ? 87  GLU A HB3  3  
ATOM 5663  H HG2  . GLU A 1 87  ? -9.234  -3.729  14.367  1.00 0.00 ? 87  GLU A HG2  3  
ATOM 5664  H HG3  . GLU A 1 87  ? -8.268  -3.139  15.722  1.00 0.00 ? 87  GLU A HG3  3  
ATOM 5665  N N    . GLU A 1 88  ? -6.253  -2.028  10.856  1.00 0.00 ? 88  GLU A N    3  
ATOM 5666  C CA   . GLU A 1 88  ? -5.178  -1.356  10.147  1.00 0.00 ? 88  GLU A CA   3  
ATOM 5667  C C    . GLU A 1 88  ? -5.661  -0.782  8.818   1.00 0.00 ? 88  GLU A C    3  
ATOM 5668  O O    . GLU A 1 88  ? -4.903  -0.133  8.084   1.00 0.00 ? 88  GLU A O    3  
ATOM 5669  C CB   . GLU A 1 88  ? -3.983  -2.290  9.957   1.00 0.00 ? 88  GLU A CB   3  
ATOM 5670  C CG   . GLU A 1 88  ? -3.357  -2.742  11.272  1.00 0.00 ? 88  GLU A CG   3  
ATOM 5671  C CD   . GLU A 1 88  ? -2.130  -3.597  11.081  1.00 0.00 ? 88  GLU A CD   3  
ATOM 5672  O OE1  . GLU A 1 88  ? -1.057  -3.063  10.770  1.00 0.00 ? 88  GLU A OE1  3  
ATOM 5673  O OE2  . GLU A 1 88  ? -2.205  -4.833  11.261  1.00 0.00 ? 88  GLU A OE2  3  
ATOM 5674  H H    . GLU A 1 88  ? -6.385  -2.992  10.725  1.00 0.00 ? 88  GLU A H    3  
ATOM 5675  H HA   . GLU A 1 88  ? -4.873  -0.527  10.769  1.00 0.00 ? 88  GLU A HA   3  
ATOM 5676  H HB2  . GLU A 1 88  ? -4.306  -3.165  9.411   1.00 0.00 ? 88  GLU A HB2  3  
ATOM 5677  H HB3  . GLU A 1 88  ? -3.228  -1.778  9.380   1.00 0.00 ? 88  GLU A HB3  3  
ATOM 5678  H HG2  . GLU A 1 88  ? -3.080  -1.871  11.846  1.00 0.00 ? 88  GLU A HG2  3  
ATOM 5679  H HG3  . GLU A 1 88  ? -4.092  -3.308  11.825  1.00 0.00 ? 88  GLU A HG3  3  
ATOM 5680  N N    . LEU A 1 89  ? -6.929  -0.961  8.538   1.00 0.00 ? 89  LEU A N    3  
ATOM 5681  C CA   . LEU A 1 89  ? -7.516  -0.444  7.338   1.00 0.00 ? 89  LEU A CA   3  
ATOM 5682  C C    . LEU A 1 89  ? -8.628  0.504   7.713   1.00 0.00 ? 89  LEU A C    3  
ATOM 5683  O O    . LEU A 1 89  ? -9.253  0.350   8.757   1.00 0.00 ? 89  LEU A O    3  
ATOM 5684  C CB   . LEU A 1 89  ? -8.003  -1.600  6.401   1.00 0.00 ? 89  LEU A CB   3  
ATOM 5685  C CG   . LEU A 1 89  ? -9.135  -2.533  6.905   1.00 0.00 ? 89  LEU A CG   3  
ATOM 5686  C CD1  . LEU A 1 89  ? -10.515 -1.915  6.729   1.00 0.00 ? 89  LEU A CD1  3  
ATOM 5687  C CD2  . LEU A 1 89  ? -9.065  -3.897  6.234   1.00 0.00 ? 89  LEU A CD2  3  
ATOM 5688  H H    . LEU A 1 89  ? -7.499  -1.440  9.176   1.00 0.00 ? 89  LEU A H    3  
ATOM 5689  H HA   . LEU A 1 89  ? -6.752  0.124   6.832   1.00 0.00 ? 89  LEU A HA   3  
ATOM 5690  H HB2  . LEU A 1 89  ? -8.347  -1.149  5.483   1.00 0.00 ? 89  LEU A HB2  3  
ATOM 5691  H HB3  . LEU A 1 89  ? -7.146  -2.213  6.162   1.00 0.00 ? 89  LEU A HB3  3  
ATOM 5692  H HG   . LEU A 1 89  ? -8.992  -2.678  7.966   1.00 0.00 ? 89  LEU A HG   3  
ATOM 5693  H HD11 . LEU A 1 89  ? -10.574 -1.004  7.305   1.00 0.00 ? 89  LEU A HD11 3  
ATOM 5694  H HD12 . LEU A 1 89  ? -11.270 -2.608  7.066   1.00 0.00 ? 89  LEU A HD12 3  
ATOM 5695  H HD13 . LEU A 1 89  ? -10.676 -1.688  5.685   1.00 0.00 ? 89  LEU A HD13 3  
ATOM 5696  H HD21 . LEU A 1 89  ? -9.077  -3.780  5.161   1.00 0.00 ? 89  LEU A HD21 3  
ATOM 5697  H HD22 . LEU A 1 89  ? -9.910  -4.494  6.543   1.00 0.00 ? 89  LEU A HD22 3  
ATOM 5698  H HD23 . LEU A 1 89  ? -8.159  -4.400  6.535   1.00 0.00 ? 89  LEU A HD23 3  
ATOM 5699  N N    . LYS A 1 90  ? -8.833  1.501   6.919   1.00 0.00 ? 90  LYS A N    3  
ATOM 5700  C CA   . LYS A 1 90  ? -9.875  2.455   7.158   1.00 0.00 ? 90  LYS A CA   3  
ATOM 5701  C C    . LYS A 1 90  ? -10.747 2.571   5.938   1.00 0.00 ? 90  LYS A C    3  
ATOM 5702  O O    . LYS A 1 90  ? -10.247 2.795   4.814   1.00 0.00 ? 90  LYS A O    3  
ATOM 5703  C CB   . LYS A 1 90  ? -9.302  3.832   7.525   1.00 0.00 ? 90  LYS A CB   3  
ATOM 5704  C CG   . LYS A 1 90  ? -8.455  3.859   8.795   1.00 0.00 ? 90  LYS A CG   3  
ATOM 5705  C CD   . LYS A 1 90  ? -9.261  3.438   10.019  1.00 0.00 ? 90  LYS A CD   3  
ATOM 5706  C CE   . LYS A 1 90  ? -8.417  3.488   11.285  1.00 0.00 ? 90  LYS A CE   3  
ATOM 5707  N NZ   . LYS A 1 90  ? -7.248  2.575   11.228  1.00 0.00 ? 90  LYS A NZ   3  
ATOM 5708  H H    . LYS A 1 90  ? -8.258  1.629   6.130   1.00 0.00 ? 90  LYS A H    3  
ATOM 5709  H HA   . LYS A 1 90  ? -10.471 2.093   7.982   1.00 0.00 ? 90  LYS A HA   3  
ATOM 5710  H HB2  . LYS A 1 90  ? -8.686  4.177   6.708   1.00 0.00 ? 90  LYS A HB2  3  
ATOM 5711  H HB3  . LYS A 1 90  ? -10.124 4.521   7.653   1.00 0.00 ? 90  LYS A HB3  3  
ATOM 5712  H HG2  . LYS A 1 90  ? -7.627  3.177   8.676   1.00 0.00 ? 90  LYS A HG2  3  
ATOM 5713  H HG3  . LYS A 1 90  ? -8.080  4.860   8.945   1.00 0.00 ? 90  LYS A HG3  3  
ATOM 5714  H HD2  . LYS A 1 90  ? -10.103 4.105   10.132  1.00 0.00 ? 90  LYS A HD2  3  
ATOM 5715  H HD3  . LYS A 1 90  ? -9.618  2.429   9.876   1.00 0.00 ? 90  LYS A HD3  3  
ATOM 5716  H HE2  . LYS A 1 90  ? -8.059  4.496   11.422  1.00 0.00 ? 90  LYS A HE2  3  
ATOM 5717  H HE3  . LYS A 1 90  ? -9.038  3.212   12.126  1.00 0.00 ? 90  LYS A HE3  3  
ATOM 5718  H HZ1  . LYS A 1 90  ? -6.633  2.783   10.418  1.00 0.00 ? 90  LYS A HZ1  3  
ATOM 5719  H HZ2  . LYS A 1 90  ? -7.522  1.570   11.190  1.00 0.00 ? 90  LYS A HZ2  3  
ATOM 5720  H HZ3  . LYS A 1 90  ? -6.672  2.698   12.083  1.00 0.00 ? 90  LYS A HZ3  3  
ATOM 5721  N N    . VAL A 1 91  ? -12.014 2.396   6.142   1.00 0.00 ? 91  VAL A N    3  
ATOM 5722  C CA   . VAL A 1 91  ? -12.987 2.517   5.099   1.00 0.00 ? 91  VAL A CA   3  
ATOM 5723  C C    . VAL A 1 91  ? -13.634 3.893   5.191   1.00 0.00 ? 91  VAL A C    3  
ATOM 5724  O O    . VAL A 1 91  ? -14.081 4.315   6.265   1.00 0.00 ? 91  VAL A O    3  
ATOM 5725  C CB   . VAL A 1 91  ? -14.058 1.357   5.147   1.00 0.00 ? 91  VAL A CB   3  
ATOM 5726  C CG1  . VAL A 1 91  ? -14.723 1.244   6.514   1.00 0.00 ? 91  VAL A CG1  3  
ATOM 5727  C CG2  . VAL A 1 91  ? -15.122 1.532   4.058   1.00 0.00 ? 91  VAL A CG2  3  
ATOM 5728  H H    . VAL A 1 91  ? -12.331 2.212   7.055   1.00 0.00 ? 91  VAL A H    3  
ATOM 5729  H HA   . VAL A 1 91  ? -12.451 2.465   4.162   1.00 0.00 ? 91  VAL A HA   3  
ATOM 5730  H HB   . VAL A 1 91  ? -13.540 0.428   4.963   1.00 0.00 ? 91  VAL A HB   3  
ATOM 5731  H HG11 . VAL A 1 91  ? -15.223 2.173   6.745   1.00 0.00 ? 91  VAL A HG11 3  
ATOM 5732  H HG12 . VAL A 1 91  ? -13.974 1.040   7.265   1.00 0.00 ? 91  VAL A HG12 3  
ATOM 5733  H HG13 . VAL A 1 91  ? -15.445 0.441   6.498   1.00 0.00 ? 91  VAL A HG13 3  
ATOM 5734  H HG21 . VAL A 1 91  ? -14.652 1.552   3.086   1.00 0.00 ? 91  VAL A HG21 3  
ATOM 5735  H HG22 . VAL A 1 91  ? -15.645 2.463   4.221   1.00 0.00 ? 91  VAL A HG22 3  
ATOM 5736  H HG23 . VAL A 1 91  ? -15.823 0.712   4.103   1.00 0.00 ? 91  VAL A HG23 3  
ATOM 5737  N N    . LYS A 1 92  ? -13.624 4.609   4.105   1.00 0.00 ? 92  LYS A N    3  
ATOM 5738  C CA   . LYS A 1 92  ? -14.194 5.915   4.070   1.00 0.00 ? 92  LYS A CA   3  
ATOM 5739  C C    . LYS A 1 92  ? -15.135 6.032   2.892   1.00 0.00 ? 92  LYS A C    3  
ATOM 5740  O O    . LYS A 1 92  ? -14.853 5.520   1.800   1.00 0.00 ? 92  LYS A O    3  
ATOM 5741  C CB   . LYS A 1 92  ? -13.097 7.000   4.006   1.00 0.00 ? 92  LYS A CB   3  
ATOM 5742  C CG   . LYS A 1 92  ? -12.191 6.929   2.777   1.00 0.00 ? 92  LYS A CG   3  
ATOM 5743  C CD   . LYS A 1 92  ? -11.174 8.057   2.775   1.00 0.00 ? 92  LYS A CD   3  
ATOM 5744  C CE   . LYS A 1 92  ? -10.384 8.081   1.476   1.00 0.00 ? 92  LYS A CE   3  
ATOM 5745  N NZ   . LYS A 1 92  ? -9.419  9.198   1.428   1.00 0.00 ? 92  LYS A NZ   3  
ATOM 5746  H H    . LYS A 1 92  ? -13.234 4.253   3.274   1.00 0.00 ? 92  LYS A H    3  
ATOM 5747  H HA   . LYS A 1 92  ? -14.758 6.049   4.981   1.00 0.00 ? 92  LYS A HA   3  
ATOM 5748  H HB2  . LYS A 1 92  ? -13.571 7.971   4.011   1.00 0.00 ? 92  LYS A HB2  3  
ATOM 5749  H HB3  . LYS A 1 92  ? -12.480 6.912   4.887   1.00 0.00 ? 92  LYS A HB3  3  
ATOM 5750  H HG2  . LYS A 1 92  ? -11.668 5.984   2.781   1.00 0.00 ? 92  LYS A HG2  3  
ATOM 5751  H HG3  . LYS A 1 92  ? -12.802 6.999   1.889   1.00 0.00 ? 92  LYS A HG3  3  
ATOM 5752  H HD2  . LYS A 1 92  ? -11.688 8.998   2.898   1.00 0.00 ? 92  LYS A HD2  3  
ATOM 5753  H HD3  . LYS A 1 92  ? -10.490 7.913   3.599   1.00 0.00 ? 92  LYS A HD3  3  
ATOM 5754  H HE2  . LYS A 1 92  ? -9.844  7.151   1.379   1.00 0.00 ? 92  LYS A HE2  3  
ATOM 5755  H HE3  . LYS A 1 92  ? -11.077 8.178   0.653   1.00 0.00 ? 92  LYS A HE3  3  
ATOM 5756  H HZ1  . LYS A 1 92  ? -9.876  10.117  1.599   1.00 0.00 ? 92  LYS A HZ1  3  
ATOM 5757  H HZ2  . LYS A 1 92  ? -8.972  9.240   0.490   1.00 0.00 ? 92  LYS A HZ2  3  
ATOM 5758  H HZ3  . LYS A 1 92  ? -8.648  9.074   2.114   1.00 0.00 ? 92  LYS A HZ3  3  
ATOM 5759  N N    . VAL A 1 93  ? -16.245 6.653   3.111   1.00 0.00 ? 93  VAL A N    3  
ATOM 5760  C CA   . VAL A 1 93  ? -17.197 6.875   2.067   1.00 0.00 ? 93  VAL A CA   3  
ATOM 5761  C C    . VAL A 1 93  ? -17.461 8.372   1.931   1.00 0.00 ? 93  VAL A C    3  
ATOM 5762  O O    . VAL A 1 93  ? -17.894 9.040   2.879   1.00 0.00 ? 93  VAL A O    3  
ATOM 5763  C CB   . VAL A 1 93  ? -18.512 6.045   2.273   1.00 0.00 ? 93  VAL A CB   3  
ATOM 5764  C CG1  . VAL A 1 93  ? -19.167 6.325   3.615   1.00 0.00 ? 93  VAL A CG1  3  
ATOM 5765  C CG2  . VAL A 1 93  ? -19.497 6.269   1.129   1.00 0.00 ? 93  VAL A CG2  3  
ATOM 5766  H H    . VAL A 1 93  ? -16.447 6.983   4.014   1.00 0.00 ? 93  VAL A H    3  
ATOM 5767  H HA   . VAL A 1 93  ? -16.719 6.552   1.151   1.00 0.00 ? 93  VAL A HA   3  
ATOM 5768  H HB   . VAL A 1 93  ? -18.233 5.000   2.270   1.00 0.00 ? 93  VAL A HB   3  
ATOM 5769  H HG11 . VAL A 1 93  ? -18.487 6.048   4.407   1.00 0.00 ? 93  VAL A HG11 3  
ATOM 5770  H HG12 . VAL A 1 93  ? -20.079 5.757   3.708   1.00 0.00 ? 93  VAL A HG12 3  
ATOM 5771  H HG13 . VAL A 1 93  ? -19.387 7.380   3.688   1.00 0.00 ? 93  VAL A HG13 3  
ATOM 5772  H HG21 . VAL A 1 93  ? -19.051 5.952   0.199   1.00 0.00 ? 93  VAL A HG21 3  
ATOM 5773  H HG22 . VAL A 1 93  ? -19.740 7.320   1.069   1.00 0.00 ? 93  VAL A HG22 3  
ATOM 5774  H HG23 . VAL A 1 93  ? -20.398 5.702   1.309   1.00 0.00 ? 93  VAL A HG23 3  
ATOM 5775  N N    . LEU A 1 94  ? -17.143 8.902   0.789   1.00 0.00 ? 94  LEU A N    3  
ATOM 5776  C CA   . LEU A 1 94  ? -17.292 10.306  0.545   1.00 0.00 ? 94  LEU A CA   3  
ATOM 5777  C C    . LEU A 1 94  ? -18.330 10.470  -0.526  1.00 0.00 ? 94  LEU A C    3  
ATOM 5778  O O    . LEU A 1 94  ? -17.996 10.502  -1.722  1.00 0.00 ? 94  LEU A O    3  
ATOM 5779  C CB   . LEU A 1 94  ? -15.964 10.958  0.055   1.00 0.00 ? 94  LEU A CB   3  
ATOM 5780  C CG   . LEU A 1 94  ? -14.686 10.790  0.903   1.00 0.00 ? 94  LEU A CG   3  
ATOM 5781  C CD1  . LEU A 1 94  ? -14.915 11.139  2.362   1.00 0.00 ? 94  LEU A CD1  3  
ATOM 5782  C CD2  . LEU A 1 94  ? -14.062 9.409   0.732   1.00 0.00 ? 94  LEU A CD2  3  
ATOM 5783  H H    . LEU A 1 94  ? -16.841 8.311   0.061   1.00 0.00 ? 94  LEU A H    3  
ATOM 5784  H HA   . LEU A 1 94  ? -17.615 10.787  1.456   1.00 0.00 ? 94  LEU A HA   3  
ATOM 5785  H HB2  . LEU A 1 94  ? -15.750 10.570  -0.930  1.00 0.00 ? 94  LEU A HB2  3  
ATOM 5786  H HB3  . LEU A 1 94  ? -16.156 12.016  -0.047  1.00 0.00 ? 94  LEU A HB3  3  
ATOM 5787  H HG   . LEU A 1 94  ? -13.978 11.520  0.538   1.00 0.00 ? 94  LEU A HG   3  
ATOM 5788  H HD11 . LEU A 1 94  ? -15.669 10.484  2.773   1.00 0.00 ? 94  LEU A HD11 3  
ATOM 5789  H HD12 . LEU A 1 94  ? -15.249 12.163  2.440   1.00 0.00 ? 94  LEU A HD12 3  
ATOM 5790  H HD13 . LEU A 1 94  ? -13.993 11.015  2.910   1.00 0.00 ? 94  LEU A HD13 3  
ATOM 5791  H HD21 . LEU A 1 94  ? -14.768 8.656   1.046   1.00 0.00 ? 94  LEU A HD21 3  
ATOM 5792  H HD22 . LEU A 1 94  ? -13.169 9.340   1.336   1.00 0.00 ? 94  LEU A HD22 3  
ATOM 5793  H HD23 . LEU A 1 94  ? -13.807 9.254   -0.306  1.00 0.00 ? 94  LEU A HD23 3  
ATOM 5794  N N    . GLY A 1 95  ? -19.568 10.596  -0.120  1.00 0.00 ? 95  GLY A N    3  
ATOM 5795  C CA   . GLY A 1 95  ? -20.637 10.700  -1.068  1.00 0.00 ? 95  GLY A CA   3  
ATOM 5796  C C    . GLY A 1 95  ? -20.747 9.446   -1.906  1.00 0.00 ? 95  GLY A C    3  
ATOM 5797  O O    . GLY A 1 95  ? -21.055 8.369   -1.407  1.00 0.00 ? 95  GLY A O    3  
ATOM 5798  H H    . GLY A 1 95  ? -19.764 10.626  0.840   1.00 0.00 ? 95  GLY A H    3  
ATOM 5799  H HA2  . GLY A 1 95  ? -21.568 10.891  -0.558  1.00 0.00 ? 95  GLY A HA2  3  
ATOM 5800  H HA3  . GLY A 1 95  ? -20.426 11.529  -1.726  1.00 0.00 ? 95  GLY A HA3  3  
ATOM 5801  N N    . ASP A 1 96  ? -20.442 9.596   -3.156  1.00 0.00 ? 96  ASP A N    3  
ATOM 5802  C CA   . ASP A 1 96  ? -20.505 8.540   -4.145  1.00 0.00 ? 96  ASP A CA   3  
ATOM 5803  C C    . ASP A 1 96  ? -19.199 7.757   -4.215  1.00 0.00 ? 96  ASP A C    3  
ATOM 5804  O O    . ASP A 1 96  ? -19.073 6.816   -4.988  1.00 0.00 ? 96  ASP A O    3  
ATOM 5805  C CB   . ASP A 1 96  ? -20.811 9.160   -5.515  1.00 0.00 ? 96  ASP A CB   3  
ATOM 5806  C CG   . ASP A 1 96  ? -19.807 10.227  -5.943  1.00 0.00 ? 96  ASP A CG   3  
ATOM 5807  O OD1  . ASP A 1 96  ? -19.697 11.269  -5.256  1.00 0.00 ? 96  ASP A OD1  3  
ATOM 5808  O OD2  . ASP A 1 96  ? -19.134 10.063  -6.975  1.00 0.00 ? 96  ASP A OD2  3  
ATOM 5809  H H    . ASP A 1 96  ? -20.140 10.474  -3.480  1.00 0.00 ? 96  ASP A H    3  
ATOM 5810  H HA   . ASP A 1 96  ? -21.314 7.873   -3.890  1.00 0.00 ? 96  ASP A HA   3  
ATOM 5811  H HB2  . ASP A 1 96  ? -20.806 8.378   -6.259  1.00 0.00 ? 96  ASP A HB2  3  
ATOM 5812  H HB3  . ASP A 1 96  ? -21.793 9.609   -5.484  1.00 0.00 ? 96  ASP A HB3  3  
ATOM 5813  N N    . VAL A 1 97  ? -18.236 8.126   -3.424  1.00 0.00 ? 97  VAL A N    3  
ATOM 5814  C CA   . VAL A 1 97  ? -16.967 7.443   -3.465  1.00 0.00 ? 97  VAL A CA   3  
ATOM 5815  C C    . VAL A 1 97  ? -16.809 6.536   -2.244  1.00 0.00 ? 97  VAL A C    3  
ATOM 5816  O O    . VAL A 1 97  ? -17.085 6.943   -1.121  1.00 0.00 ? 97  VAL A O    3  
ATOM 5817  C CB   . VAL A 1 97  ? -15.800 8.481   -3.510  1.00 0.00 ? 97  VAL A CB   3  
ATOM 5818  C CG1  . VAL A 1 97  ? -14.444 7.804   -3.548  1.00 0.00 ? 97  VAL A CG1  3  
ATOM 5819  C CG2  . VAL A 1 97  ? -15.951 9.416   -4.699  1.00 0.00 ? 97  VAL A CG2  3  
ATOM 5820  H H    . VAL A 1 97  ? -18.378 8.866   -2.795  1.00 0.00 ? 97  VAL A H    3  
ATOM 5821  H HA   . VAL A 1 97  ? -16.927 6.846   -4.365  1.00 0.00 ? 97  VAL A HA   3  
ATOM 5822  H HB   . VAL A 1 97  ? -15.851 9.076   -2.610  1.00 0.00 ? 97  VAL A HB   3  
ATOM 5823  H HG11 . VAL A 1 97  ? -13.663 8.549   -3.580  1.00 0.00 ? 97  VAL A HG11 3  
ATOM 5824  H HG12 . VAL A 1 97  ? -14.381 7.167   -4.418  1.00 0.00 ? 97  VAL A HG12 3  
ATOM 5825  H HG13 . VAL A 1 97  ? -14.343 7.211   -2.654  1.00 0.00 ? 97  VAL A HG13 3  
ATOM 5826  H HG21 . VAL A 1 97  ? -15.921 8.839   -5.612  1.00 0.00 ? 97  VAL A HG21 3  
ATOM 5827  H HG22 . VAL A 1 97  ? -15.141 10.130  -4.700  1.00 0.00 ? 97  VAL A HG22 3  
ATOM 5828  H HG23 . VAL A 1 97  ? -16.893 9.938   -4.632  1.00 0.00 ? 97  VAL A HG23 3  
ATOM 5829  N N    . ILE A 1 98  ? -16.336 5.335   -2.476  1.00 0.00 ? 98  ILE A N    3  
ATOM 5830  C CA   . ILE A 1 98  ? -16.048 4.394   -1.421  1.00 0.00 ? 98  ILE A CA   3  
ATOM 5831  C C    . ILE A 1 98  ? -14.586 4.030   -1.544  1.00 0.00 ? 98  ILE A C    3  
ATOM 5832  O O    . ILE A 1 98  ? -14.163 3.519   -2.578  1.00 0.00 ? 98  ILE A O    3  
ATOM 5833  C CB   . ILE A 1 98  ? -16.921 3.076   -1.519  1.00 0.00 ? 98  ILE A CB   3  
ATOM 5834  C CG1  . ILE A 1 98  ? -18.407 3.386   -1.337  1.00 0.00 ? 98  ILE A CG1  3  
ATOM 5835  C CG2  . ILE A 1 98  ? -16.460 2.044   -0.476  1.00 0.00 ? 98  ILE A CG2  3  
ATOM 5836  C CD1  . ILE A 1 98  ? -19.284 2.157   -1.393  1.00 0.00 ? 98  ILE A CD1  3  
ATOM 5837  H H    . ILE A 1 98  ? -16.141 5.078   -3.405  1.00 0.00 ? 98  ILE A H    3  
ATOM 5838  H HA   . ILE A 1 98  ? -16.221 4.876   -0.470  1.00 0.00 ? 98  ILE A HA   3  
ATOM 5839  H HB   . ILE A 1 98  ? -16.764 2.634   -2.489  1.00 0.00 ? 98  ILE A HB   3  
ATOM 5840  H HG12 . ILE A 1 98  ? -18.556 3.852   -0.374  1.00 0.00 ? 98  ILE A HG12 3  
ATOM 5841  H HG13 . ILE A 1 98  ? -18.729 4.064   -2.114  1.00 0.00 ? 98  ILE A HG13 3  
ATOM 5842  H HG21 . ILE A 1 98  ? -16.571 2.459   0.515   1.00 0.00 ? 98  ILE A HG21 3  
ATOM 5843  H HG22 . ILE A 1 98  ? -15.422 1.799   -0.646  1.00 0.00 ? 98  ILE A HG22 3  
ATOM 5844  H HG23 . ILE A 1 98  ? -17.059 1.149   -0.562  1.00 0.00 ? 98  ILE A HG23 3  
ATOM 5845  H HD11 . ILE A 1 98  ? -20.305 2.436   -1.184  1.00 0.00 ? 98  ILE A HD11 3  
ATOM 5846  H HD12 . ILE A 1 98  ? -18.950 1.456   -0.643  1.00 0.00 ? 98  ILE A HD12 3  
ATOM 5847  H HD13 . ILE A 1 98  ? -19.219 1.703   -2.369  1.00 0.00 ? 98  ILE A HD13 3  
ATOM 5848  N N    . GLU A 1 99  ? -13.813 4.300   -0.529  1.00 0.00 ? 99  GLU A N    3  
ATOM 5849  C CA   . GLU A 1 99  ? -12.410 3.986   -0.568  1.00 0.00 ? 99  GLU A CA   3  
ATOM 5850  C C    . GLU A 1 99  ? -11.945 3.374   0.713   1.00 0.00 ? 99  GLU A C    3  
ATOM 5851  O O    . GLU A 1 99  ? -12.308 3.807   1.801   1.00 0.00 ? 99  GLU A O    3  
ATOM 5852  C CB   . GLU A 1 99  ? -11.533 5.197   -0.926  1.00 0.00 ? 99  GLU A CB   3  
ATOM 5853  C CG   . GLU A 1 99  ? -11.739 5.707   -2.335  1.00 0.00 ? 99  GLU A CG   3  
ATOM 5854  C CD   . GLU A 1 99  ? -10.692 6.675   -2.769  1.00 0.00 ? 99  GLU A CD   3  
ATOM 5855  O OE1  . GLU A 1 99  ? -9.500  6.336   -2.696  1.00 0.00 ? 99  GLU A OE1  3  
ATOM 5856  O OE2  . GLU A 1 99  ? -11.025 7.770   -3.254  1.00 0.00 ? 99  GLU A OE2  3  
ATOM 5857  H H    . GLU A 1 99  ? -14.188 4.716   0.282   1.00 0.00 ? 99  GLU A H    3  
ATOM 5858  H HA   . GLU A 1 99  ? -12.285 3.245   -1.343  1.00 0.00 ? 99  GLU A HA   3  
ATOM 5859  H HB2  . GLU A 1 99  ? -11.754 6.001   -0.240  1.00 0.00 ? 99  GLU A HB2  3  
ATOM 5860  H HB3  . GLU A 1 99  ? -10.495 4.919   -0.815  1.00 0.00 ? 99  GLU A HB3  3  
ATOM 5861  H HG2  . GLU A 1 99  ? -11.736 4.875   -3.018  1.00 0.00 ? 99  GLU A HG2  3  
ATOM 5862  H HG3  . GLU A 1 99  ? -12.701 6.194   -2.381  1.00 0.00 ? 99  GLU A HG3  3  
ATOM 5863  N N    . VAL A 1 100 ? -11.154 2.365   0.586   1.00 0.00 ? 100 VAL A N    3  
ATOM 5864  C CA   . VAL A 1 100 ? -10.582 1.708   1.716   1.00 0.00 ? 100 VAL A CA   3  
ATOM 5865  C C    . VAL A 1 100 ? -9.097  1.833   1.604   1.00 0.00 ? 100 VAL A C    3  
ATOM 5866  O O    . VAL A 1 100 ? -8.520  1.479   0.577   1.00 0.00 ? 100 VAL A O    3  
ATOM 5867  C CB   . VAL A 1 100 ? -10.963 0.205   1.803   1.00 0.00 ? 100 VAL A CB   3  
ATOM 5868  C CG1  . VAL A 1 100 ? -10.350 -0.441  3.043   1.00 0.00 ? 100 VAL A CG1  3  
ATOM 5869  C CG2  . VAL A 1 100 ? -12.464 0.033   1.816   1.00 0.00 ? 100 VAL A CG2  3  
ATOM 5870  H H    . VAL A 1 100 ? -10.927 2.077   -0.327  1.00 0.00 ? 100 VAL A H    3  
ATOM 5871  H HA   . VAL A 1 100 ? -10.914 2.215   2.610   1.00 0.00 ? 100 VAL A HA   3  
ATOM 5872  H HB   . VAL A 1 100 ? -10.565 -0.294  0.932   1.00 0.00 ? 100 VAL A HB   3  
ATOM 5873  H HG11 . VAL A 1 100 ? -10.695 0.080   3.924   1.00 0.00 ? 100 VAL A HG11 3  
ATOM 5874  H HG12 . VAL A 1 100 ? -9.273  -0.384  2.990   1.00 0.00 ? 100 VAL A HG12 3  
ATOM 5875  H HG13 . VAL A 1 100 ? -10.654 -1.474  3.099   1.00 0.00 ? 100 VAL A HG13 3  
ATOM 5876  H HG21 . VAL A 1 100 ? -12.702 -1.020  1.843   1.00 0.00 ? 100 VAL A HG21 3  
ATOM 5877  H HG22 . VAL A 1 100 ? -12.887 0.473   0.924   1.00 0.00 ? 100 VAL A HG22 3  
ATOM 5878  H HG23 . VAL A 1 100 ? -12.872 0.518   2.690   1.00 0.00 ? 100 VAL A HG23 3  
ATOM 5879  N N    . HIS A 1 101 ? -8.498  2.356   2.610   1.00 0.00 ? 101 HIS A N    3  
ATOM 5880  C CA   . HIS A 1 101 ? -7.073  2.516   2.643   1.00 0.00 ? 101 HIS A CA   3  
ATOM 5881  C C    . HIS A 1 101 ? -6.571  1.904   3.920   1.00 0.00 ? 101 HIS A C    3  
ATOM 5882  O O    . HIS A 1 101 ? -7.119  2.166   4.982   1.00 0.00 ? 101 HIS A O    3  
ATOM 5883  C CB   . HIS A 1 101 ? -6.649  4.011   2.527   1.00 0.00 ? 101 HIS A CB   3  
ATOM 5884  C CG   . HIS A 1 101 ? -7.091  4.902   3.664   1.00 0.00 ? 101 HIS A CG   3  
ATOM 5885  N ND1  . HIS A 1 101 ? -6.260  5.278   4.683   1.00 0.00 ? 101 HIS A ND1  3  
ATOM 5886  C CD2  . HIS A 1 101 ? -8.284  5.480   3.930   1.00 0.00 ? 101 HIS A CD2  3  
ATOM 5887  C CE1  . HIS A 1 101 ? -6.907  6.040   5.526   1.00 0.00 ? 101 HIS A CE1  3  
ATOM 5888  N NE2  . HIS A 1 101 ? -8.140  6.179   5.093   1.00 0.00 ? 101 HIS A NE2  3  
ATOM 5889  H H    . HIS A 1 101 ? -9.030  2.609   3.399   1.00 0.00 ? 101 HIS A H    3  
ATOM 5890  H HA   . HIS A 1 101 ? -6.663  1.959   1.813   1.00 0.00 ? 101 HIS A HA   3  
ATOM 5891  H HB2  . HIS A 1 101 ? -5.573  4.060   2.487   1.00 0.00 ? 101 HIS A HB2  3  
ATOM 5892  H HB3  . HIS A 1 101 ? -7.051  4.416   1.610   1.00 0.00 ? 101 HIS A HB3  3  
ATOM 5893  H HD1  . HIS A 1 101 ? -5.316  5.020   4.782   1.00 0.00 ? 101 HIS A HD1  3  
ATOM 5894  H HD2  . HIS A 1 101 ? -9.181  5.403   3.333   1.00 0.00 ? 101 HIS A HD2  3  
ATOM 5895  H HE1  . HIS A 1 101 ? -6.499  6.481   6.423   1.00 0.00 ? 101 HIS A HE1  3  
ATOM 5896  H HE2  . HIS A 1 101 ? -8.740  6.904   5.384   1.00 0.00 ? 101 HIS A HE2  3  
ATOM 5897  N N    . GLY A 1 102 ? -5.609  1.061   3.819   1.00 0.00 ? 102 GLY A N    3  
ATOM 5898  C CA   . GLY A 1 102 ? -5.065  0.440   4.977   1.00 0.00 ? 102 GLY A CA   3  
ATOM 5899  C C    . GLY A 1 102 ? -3.618  0.187   4.813   1.00 0.00 ? 102 GLY A C    3  
ATOM 5900  O O    . GLY A 1 102 ? -3.140  0.079   3.685   1.00 0.00 ? 102 GLY A O    3  
ATOM 5901  H H    . GLY A 1 102 ? -5.235  0.829   2.939   1.00 0.00 ? 102 GLY A H    3  
ATOM 5902  H HA2  . GLY A 1 102 ? -5.211  1.091   5.826   1.00 0.00 ? 102 GLY A HA2  3  
ATOM 5903  H HA3  . GLY A 1 102 ? -5.568  -0.500  5.148   1.00 0.00 ? 102 GLY A HA3  3  
ATOM 5904  N N    . LYS A 1 103 ? -2.928  0.074   5.911   1.00 0.00 ? 103 LYS A N    3  
ATOM 5905  C CA   . LYS A 1 103 ? -1.507  -0.139  5.916   1.00 0.00 ? 103 LYS A CA   3  
ATOM 5906  C C    . LYS A 1 103 ? -1.121  -1.082  7.074   1.00 0.00 ? 103 LYS A C    3  
ATOM 5907  O O    . LYS A 1 103 ? -1.620  -0.942  8.182   1.00 0.00 ? 103 LYS A O    3  
ATOM 5908  C CB   . LYS A 1 103 ? -0.788  1.202   6.074   1.00 0.00 ? 103 LYS A CB   3  
ATOM 5909  C CG   . LYS A 1 103 ? -1.234  1.998   7.292   1.00 0.00 ? 103 LYS A CG   3  
ATOM 5910  C CD   . LYS A 1 103 ? -0.451  3.271   7.440   1.00 0.00 ? 103 LYS A CD   3  
ATOM 5911  C CE   . LYS A 1 103 ? -0.888  4.030   8.671   1.00 0.00 ? 103 LYS A CE   3  
ATOM 5912  N NZ   . LYS A 1 103 ? -0.082  5.240   8.882   1.00 0.00 ? 103 LYS A NZ   3  
ATOM 5913  H H    . LYS A 1 103 ? -3.386  0.104   6.782   1.00 0.00 ? 103 LYS A H    3  
ATOM 5914  H HA   . LYS A 1 103 ? -1.221  -0.585  4.978   1.00 0.00 ? 103 LYS A HA   3  
ATOM 5915  H HB2  . LYS A 1 103 ? 0.271   1.018   6.158   1.00 0.00 ? 103 LYS A HB2  3  
ATOM 5916  H HB3  . LYS A 1 103 ? -0.971  1.801   5.193   1.00 0.00 ? 103 LYS A HB3  3  
ATOM 5917  H HG2  . LYS A 1 103 ? -2.280  2.242   7.184   1.00 0.00 ? 103 LYS A HG2  3  
ATOM 5918  H HG3  . LYS A 1 103 ? -1.097  1.389   8.174   1.00 0.00 ? 103 LYS A HG3  3  
ATOM 5919  H HD2  . LYS A 1 103 ? 0.596   3.023   7.535   1.00 0.00 ? 103 LYS A HD2  3  
ATOM 5920  H HD3  . LYS A 1 103 ? -0.604  3.887   6.567   1.00 0.00 ? 103 LYS A HD3  3  
ATOM 5921  H HE2  . LYS A 1 103 ? -1.923  4.314   8.555   1.00 0.00 ? 103 LYS A HE2  3  
ATOM 5922  H HE3  . LYS A 1 103 ? -0.792  3.382   9.530   1.00 0.00 ? 103 LYS A HE3  3  
ATOM 5923  H HZ1  . LYS A 1 103 ? 0.927   4.995   8.962   1.00 0.00 ? 103 LYS A HZ1  3  
ATOM 5924  H HZ2  . LYS A 1 103 ? -0.353  5.731   9.758   1.00 0.00 ? 103 LYS A HZ2  3  
ATOM 5925  H HZ3  . LYS A 1 103 ? -0.188  5.905   8.093   1.00 0.00 ? 103 LYS A HZ3  3  
ATOM 5926  N N    . HIS A 1 104 ? -0.289  -2.052  6.795   1.00 0.00 ? 104 HIS A N    3  
ATOM 5927  C CA   . HIS A 1 104 ? 0.162   -3.009  7.795   1.00 0.00 ? 104 HIS A CA   3  
ATOM 5928  C C    . HIS A 1 104 ? 1.654   -3.251  7.658   1.00 0.00 ? 104 HIS A C    3  
ATOM 5929  O O    . HIS A 1 104 ? 2.127   -3.587  6.578   1.00 0.00 ? 104 HIS A O    3  
ATOM 5930  C CB   . HIS A 1 104 ? -0.635  -4.336  7.629   1.00 0.00 ? 104 HIS A CB   3  
ATOM 5931  C CG   . HIS A 1 104 ? -0.097  -5.547  8.353   1.00 0.00 ? 104 HIS A CG   3  
ATOM 5932  N ND1  . HIS A 1 104 ? -0.331  -5.817  9.671   1.00 0.00 ? 104 HIS A ND1  3  
ATOM 5933  C CD2  . HIS A 1 104 ? 0.660   -6.570  7.899   1.00 0.00 ? 104 HIS A CD2  3  
ATOM 5934  C CE1  . HIS A 1 104 ? 0.262   -6.942  9.998   1.00 0.00 ? 104 HIS A CE1  3  
ATOM 5935  N NE2  . HIS A 1 104 ? 0.865   -7.418  8.945   1.00 0.00 ? 104 HIS A NE2  3  
ATOM 5936  H H    . HIS A 1 104 ? 0.049   -2.146  5.874   1.00 0.00 ? 104 HIS A H    3  
ATOM 5937  H HA   . HIS A 1 104 ? -0.048  -2.602  8.773   1.00 0.00 ? 104 HIS A HA   3  
ATOM 5938  H HB2  . HIS A 1 104 ? -1.642  -4.181  7.987   1.00 0.00 ? 104 HIS A HB2  3  
ATOM 5939  H HB3  . HIS A 1 104 ? -0.683  -4.574  6.576   1.00 0.00 ? 104 HIS A HB3  3  
ATOM 5940  H HD1  . HIS A 1 104 ? -0.884  -5.272  10.292  1.00 0.00 ? 104 HIS A HD1  3  
ATOM 5941  H HD2  . HIS A 1 104 ? 1.015   -6.689  6.886   1.00 0.00 ? 104 HIS A HD2  3  
ATOM 5942  H HE1  . HIS A 1 104 ? 0.259   -7.402  10.975  1.00 0.00 ? 104 HIS A HE1  3  
ATOM 5943  H HE2  . HIS A 1 104 ? 1.592   -8.081  9.021   1.00 0.00 ? 104 HIS A HE2  3  
ATOM 5944  N N    . GLU A 1 105 ? 2.381   -3.111  8.743   1.00 0.00 ? 105 GLU A N    3  
ATOM 5945  C CA   . GLU A 1 105 ? 3.802   -3.396  8.743   1.00 0.00 ? 105 GLU A CA   3  
ATOM 5946  C C    . GLU A 1 105 ? 3.992   -4.871  9.030   1.00 0.00 ? 105 GLU A C    3  
ATOM 5947  O O    . GLU A 1 105 ? 3.279   -5.441  9.862   1.00 0.00 ? 105 GLU A O    3  
ATOM 5948  C CB   . GLU A 1 105 ? 4.552   -2.503  9.744   1.00 0.00 ? 105 GLU A CB   3  
ATOM 5949  C CG   . GLU A 1 105 ? 4.120   -2.644  11.186  1.00 0.00 ? 105 GLU A CG   3  
ATOM 5950  C CD   . GLU A 1 105 ? 4.825   -1.664  12.084  1.00 0.00 ? 105 GLU A CD   3  
ATOM 5951  O OE1  . GLU A 1 105 ? 5.908   -1.988  12.609  1.00 0.00 ? 105 GLU A OE1  3  
ATOM 5952  O OE2  . GLU A 1 105 ? 4.301   -0.545  12.286  1.00 0.00 ? 105 GLU A OE2  3  
ATOM 5953  H H    . GLU A 1 105 ? 1.954   -2.821  9.578   1.00 0.00 ? 105 GLU A H    3  
ATOM 5954  H HA   . GLU A 1 105 ? 4.158   -3.202  7.744   1.00 0.00 ? 105 GLU A HA   3  
ATOM 5955  H HB2  . GLU A 1 105 ? 5.605   -2.741  9.692   1.00 0.00 ? 105 GLU A HB2  3  
ATOM 5956  H HB3  . GLU A 1 105 ? 4.420   -1.472  9.448   1.00 0.00 ? 105 GLU A HB3  3  
ATOM 5957  H HG2  . GLU A 1 105 ? 3.055   -2.495  11.255  1.00 0.00 ? 105 GLU A HG2  3  
ATOM 5958  H HG3  . GLU A 1 105 ? 4.359   -3.645  11.513  1.00 0.00 ? 105 GLU A HG3  3  
ATOM 5959  N N    . GLU A 1 106 ? 4.876   -5.494  8.312   1.00 0.00 ? 106 GLU A N    3  
ATOM 5960  C CA   . GLU A 1 106 ? 5.022   -6.920  8.417   1.00 0.00 ? 106 GLU A CA   3  
ATOM 5961  C C    . GLU A 1 106 ? 6.278   -7.315  9.154   1.00 0.00 ? 106 GLU A C    3  
ATOM 5962  O O    . GLU A 1 106 ? 6.224   -8.089  10.107  1.00 0.00 ? 106 GLU A O    3  
ATOM 5963  C CB   . GLU A 1 106 ? 4.957   -7.581  7.036   1.00 0.00 ? 106 GLU A CB   3  
ATOM 5964  C CG   . GLU A 1 106 ? 3.685   -7.235  6.288   1.00 0.00 ? 106 GLU A CG   3  
ATOM 5965  C CD   . GLU A 1 106 ? 3.416   -8.111  5.099   1.00 0.00 ? 106 GLU A CD   3  
ATOM 5966  O OE1  . GLU A 1 106 ? 3.028   -9.271  5.312   1.00 0.00 ? 106 GLU A OE1  3  
ATOM 5967  O OE2  . GLU A 1 106 ? 3.464   -7.645  3.961   1.00 0.00 ? 106 GLU A OE2  3  
ATOM 5968  H H    . GLU A 1 106 ? 5.450   -4.970  7.708   1.00 0.00 ? 106 GLU A H    3  
ATOM 5969  H HA   . GLU A 1 106 ? 4.177   -7.273  8.989   1.00 0.00 ? 106 GLU A HA   3  
ATOM 5970  H HB2  . GLU A 1 106 ? 5.803   -7.254  6.450   1.00 0.00 ? 106 GLU A HB2  3  
ATOM 5971  H HB3  . GLU A 1 106 ? 5.002   -8.654  7.154   1.00 0.00 ? 106 GLU A HB3  3  
ATOM 5972  H HG2  . GLU A 1 106 ? 2.864   -7.348  6.979   1.00 0.00 ? 106 GLU A HG2  3  
ATOM 5973  H HG3  . GLU A 1 106 ? 3.740   -6.205  5.964   1.00 0.00 ? 106 GLU A HG3  3  
ATOM 5974  N N    . ARG A 1 107 ? 7.400   -6.816  8.706   1.00 0.00 ? 107 ARG A N    3  
ATOM 5975  C CA   . ARG A 1 107 ? 8.664   -7.149  9.306   1.00 0.00 ? 107 ARG A CA   3  
ATOM 5976  C C    . ARG A 1 107 ? 9.655   -6.018  9.224   1.00 0.00 ? 107 ARG A C    3  
ATOM 5977  O O    . ARG A 1 107 ? 9.556   -5.158  8.348   1.00 0.00 ? 107 ARG A O    3  
ATOM 5978  C CB   . ARG A 1 107 ? 9.215   -8.454  8.735   1.00 0.00 ? 107 ARG A CB   3  
ATOM 5979  C CG   . ARG A 1 107 ? 9.121   -8.578  7.239   1.00 0.00 ? 107 ARG A CG   3  
ATOM 5980  C CD   . ARG A 1 107 ? 9.524   -9.970  6.811   1.00 0.00 ? 107 ARG A CD   3  
ATOM 5981  N NE   . ARG A 1 107 ? 9.293   -10.218 5.395   1.00 0.00 ? 107 ARG A NE   3  
ATOM 5982  C CZ   . ARG A 1 107 ? 8.255   -10.898 4.896   1.00 0.00 ? 107 ARG A CZ   3  
ATOM 5983  N NH1  . ARG A 1 107 ? 7.265   -11.319 5.693   1.00 0.00 ? 107 ARG A NH1  3  
ATOM 5984  N NH2  . ARG A 1 107 ? 8.226   -11.166 3.605   1.00 0.00 ? 107 ARG A NH2  3  
ATOM 5985  H H    . ARG A 1 107 ? 7.406   -6.179  7.962   1.00 0.00 ? 107 ARG A H    3  
ATOM 5986  H HA   . ARG A 1 107 ? 8.460   -7.308  10.355  1.00 0.00 ? 107 ARG A HA   3  
ATOM 5987  H HB2  . ARG A 1 107 ? 10.256  -8.536  9.009   1.00 0.00 ? 107 ARG A HB2  3  
ATOM 5988  H HB3  . ARG A 1 107 ? 8.674   -9.276  9.179   1.00 0.00 ? 107 ARG A HB3  3  
ATOM 5989  H HG2  . ARG A 1 107 ? 8.102   -8.391  6.935   1.00 0.00 ? 107 ARG A HG2  3  
ATOM 5990  H HG3  . ARG A 1 107 ? 9.781   -7.858  6.781   1.00 0.00 ? 107 ARG A HG3  3  
ATOM 5991  H HD2  . ARG A 1 107 ? 10.576  -10.102 7.015   1.00 0.00 ? 107 ARG A HD2  3  
ATOM 5992  H HD3  . ARG A 1 107 ? 8.966   -10.689 7.386   1.00 0.00 ? 107 ARG A HD3  3  
ATOM 5993  H HE   . ARG A 1 107 ? 9.997   -9.911  4.772   1.00 0.00 ? 107 ARG A HE   3  
ATOM 5994  H HH11 . ARG A 1 107 ? 7.259   -11.153 6.683   1.00 0.00 ? 107 ARG A HH11 3  
ATOM 5995  H HH12 . ARG A 1 107 ? 6.484   -11.838 5.336   1.00 0.00 ? 107 ARG A HH12 3  
ATOM 5996  H HH21 . ARG A 1 107 ? 9.017   -10.843 3.062   1.00 0.00 ? 107 ARG A HH21 3  
ATOM 5997  H HH22 . ARG A 1 107 ? 7.503   -11.680 3.139   1.00 0.00 ? 107 ARG A HH22 3  
ATOM 5998  N N    . GLN A 1 108 ? 10.557  -6.007  10.166  1.00 0.00 ? 108 GLN A N    3  
ATOM 5999  C CA   . GLN A 1 108 ? 11.612  -5.035  10.262  1.00 0.00 ? 108 GLN A CA   3  
ATOM 6000  C C    . GLN A 1 108 ? 12.949  -5.710  9.993   1.00 0.00 ? 108 GLN A C    3  
ATOM 6001  O O    . GLN A 1 108 ? 13.322  -6.668  10.675  1.00 0.00 ? 108 GLN A O    3  
ATOM 6002  C CB   . GLN A 1 108 ? 11.598  -4.409  11.661  1.00 0.00 ? 108 GLN A CB   3  
ATOM 6003  C CG   . GLN A 1 108 ? 12.767  -3.478  11.955  1.00 0.00 ? 108 GLN A CG   3  
ATOM 6004  C CD   . GLN A 1 108 ? 12.687  -2.872  13.339  1.00 0.00 ? 108 GLN A CD   3  
ATOM 6005  O OE1  . GLN A 1 108 ? 11.599  -2.631  13.869  1.00 0.00 ? 108 GLN A OE1  3  
ATOM 6006  N NE2  . GLN A 1 108 ? 13.813  -2.658  13.957  1.00 0.00 ? 108 GLN A NE2  3  
ATOM 6007  H H    . GLN A 1 108 ? 10.535  -6.708  10.853  1.00 0.00 ? 108 GLN A H    3  
ATOM 6008  H HA   . GLN A 1 108 ? 11.444  -4.264  9.527   1.00 0.00 ? 108 GLN A HA   3  
ATOM 6009  H HB2  . GLN A 1 108 ? 10.685  -3.843  11.781  1.00 0.00 ? 108 GLN A HB2  3  
ATOM 6010  H HB3  . GLN A 1 108 ? 11.609  -5.205  12.390  1.00 0.00 ? 108 GLN A HB3  3  
ATOM 6011  H HG2  . GLN A 1 108 ? 13.688  -4.037  11.873  1.00 0.00 ? 108 GLN A HG2  3  
ATOM 6012  H HG3  . GLN A 1 108 ? 12.767  -2.682  11.225  1.00 0.00 ? 108 GLN A HG3  3  
ATOM 6013  H HE21 . GLN A 1 108 ? 14.660  -2.896  13.522  1.00 0.00 ? 108 GLN A HE21 3  
ATOM 6014  H HE22 . GLN A 1 108 ? 13.762  -2.256  14.849  1.00 0.00 ? 108 GLN A HE22 3  
ATOM 6015  N N    . ASP A 1 109 ? 13.647  -5.204  8.995   1.00 0.00 ? 109 ASP A N    3  
ATOM 6016  C CA   . ASP A 1 109 ? 14.962  -5.691  8.611   1.00 0.00 ? 109 ASP A CA   3  
ATOM 6017  C C    . ASP A 1 109 ? 15.978  -5.197  9.624   1.00 0.00 ? 109 ASP A C    3  
ATOM 6018  O O    . ASP A 1 109 ? 16.536  -5.975  10.394  1.00 0.00 ? 109 ASP A O    3  
ATOM 6019  C CB   . ASP A 1 109 ? 15.358  -5.187  7.204   1.00 0.00 ? 109 ASP A CB   3  
ATOM 6020  C CG   . ASP A 1 109 ? 14.435  -5.652  6.093   1.00 0.00 ? 109 ASP A CG   3  
ATOM 6021  O OD1  . ASP A 1 109 ? 14.630  -6.773  5.580   1.00 0.00 ? 109 ASP A OD1  3  
ATOM 6022  O OD2  . ASP A 1 109 ? 13.535  -4.909  5.719   1.00 0.00 ? 109 ASP A OD2  3  
ATOM 6023  H H    . ASP A 1 109 ? 13.259  -4.450  8.493   1.00 0.00 ? 109 ASP A H    3  
ATOM 6024  H HA   . ASP A 1 109 ? 14.941  -6.771  8.614   1.00 0.00 ? 109 ASP A HA   3  
ATOM 6025  H HB2  . ASP A 1 109 ? 15.346  -4.107  7.210   1.00 0.00 ? 109 ASP A HB2  3  
ATOM 6026  H HB3  . ASP A 1 109 ? 16.361  -5.520  6.985   1.00 0.00 ? 109 ASP A HB3  3  
ATOM 6027  N N    . GLU A 1 110 ? 16.178  -3.886  9.625   1.00 0.00 ? 110 GLU A N    3  
ATOM 6028  C CA   . GLU A 1 110 ? 17.038  -3.174  10.571  1.00 0.00 ? 110 GLU A CA   3  
ATOM 6029  C C    . GLU A 1 110 ? 16.967  -1.707  10.233  1.00 0.00 ? 110 GLU A C    3  
ATOM 6030  O O    . GLU A 1 110 ? 17.498  -1.285  9.210   1.00 0.00 ? 110 GLU A O    3  
ATOM 6031  C CB   . GLU A 1 110 ? 18.498  -3.640  10.523  1.00 0.00 ? 110 GLU A CB   3  
ATOM 6032  C CG   . GLU A 1 110 ? 19.370  -2.976  11.584  1.00 0.00 ? 110 GLU A CG   3  
ATOM 6033  C CD   . GLU A 1 110 ? 20.799  -3.426  11.542  1.00 0.00 ? 110 GLU A CD   3  
ATOM 6034  O OE1  . GLU A 1 110 ? 21.125  -4.455  12.153  1.00 0.00 ? 110 GLU A OE1  3  
ATOM 6035  O OE2  . GLU A 1 110 ? 21.630  -2.752  10.904  1.00 0.00 ? 110 GLU A OE2  3  
ATOM 6036  H H    . GLU A 1 110 ? 15.721  -3.361  8.936   1.00 0.00 ? 110 GLU A H    3  
ATOM 6037  H HA   . GLU A 1 110 ? 16.631  -3.319  11.561  1.00 0.00 ? 110 GLU A HA   3  
ATOM 6038  H HB2  . GLU A 1 110 ? 18.529  -4.709  10.672  1.00 0.00 ? 110 GLU A HB2  3  
ATOM 6039  H HB3  . GLU A 1 110 ? 18.908  -3.406  9.551   1.00 0.00 ? 110 GLU A HB3  3  
ATOM 6040  H HG2  . GLU A 1 110 ? 19.346  -1.907  11.433  1.00 0.00 ? 110 GLU A HG2  3  
ATOM 6041  H HG3  . GLU A 1 110 ? 18.962  -3.205  12.557  1.00 0.00 ? 110 GLU A HG3  3  
ATOM 6042  N N    . HIS A 1 111 ? 16.255  -0.939  11.074  1.00 0.00 ? 111 HIS A N    3  
ATOM 6043  C CA   . HIS A 1 111 ? 16.000  0.514   10.852  1.00 0.00 ? 111 HIS A CA   3  
ATOM 6044  C C    . HIS A 1 111 ? 15.257  0.694   9.555   1.00 0.00 ? 111 HIS A C    3  
ATOM 6045  O O    . HIS A 1 111 ? 15.311  1.747   8.909   1.00 0.00 ? 111 HIS A O    3  
ATOM 6046  C CB   . HIS A 1 111 ? 17.310  1.329   10.832  1.00 0.00 ? 111 HIS A CB   3  
ATOM 6047  C CG   . HIS A 1 111 ? 18.131  1.188   12.070  1.00 0.00 ? 111 HIS A CG   3  
ATOM 6048  N ND1  . HIS A 1 111 ? 19.396  0.657   12.071  1.00 0.00 ? 111 HIS A ND1  3  
ATOM 6049  C CD2  . HIS A 1 111 ? 17.864  1.511   13.355  1.00 0.00 ? 111 HIS A CD2  3  
ATOM 6050  C CE1  . HIS A 1 111 ? 19.868  0.654   13.292  1.00 0.00 ? 111 HIS A CE1  3  
ATOM 6051  N NE2  . HIS A 1 111 ? 18.963  1.165   14.088  1.00 0.00 ? 111 HIS A NE2  3  
ATOM 6052  H H    . HIS A 1 111 ? 15.906  -1.349  11.895  1.00 0.00 ? 111 HIS A H    3  
ATOM 6053  H HA   . HIS A 1 111 ? 15.374  0.862   11.660  1.00 0.00 ? 111 HIS A HA   3  
ATOM 6054  H HB2  . HIS A 1 111 ? 17.914  0.996   10.001  1.00 0.00 ? 111 HIS A HB2  3  
ATOM 6055  H HB3  . HIS A 1 111 ? 17.071  2.373   10.699  1.00 0.00 ? 111 HIS A HB3  3  
ATOM 6056  H HD1  . HIS A 1 111 ? 19.903  0.347   11.286  1.00 0.00 ? 111 HIS A HD1  3  
ATOM 6057  H HD2  . HIS A 1 111 ? 16.955  1.955   13.732  1.00 0.00 ? 111 HIS A HD2  3  
ATOM 6058  H HE1  . HIS A 1 111 ? 20.843  0.303   13.588  1.00 0.00 ? 111 HIS A HE1  3  
ATOM 6059  H HE2  . HIS A 1 111 ? 19.043  1.216   15.066  1.00 0.00 ? 111 HIS A HE2  3  
ATOM 6060  N N    . GLY A 1 112 ? 14.571  -0.351  9.208   1.00 0.00 ? 112 GLY A N    3  
ATOM 6061  C CA   . GLY A 1 112 ? 13.870  -0.454  8.012   1.00 0.00 ? 112 GLY A CA   3  
ATOM 6062  C C    . GLY A 1 112 ? 12.816  -1.436  8.183   1.00 0.00 ? 112 GLY A C    3  
ATOM 6063  O O    . GLY A 1 112 ? 13.079  -2.581  8.525   1.00 0.00 ? 112 GLY A O    3  
ATOM 6064  H H    . GLY A 1 112 ? 14.515  -1.097  9.839   1.00 0.00 ? 112 GLY A H    3  
ATOM 6065  H HA2  . GLY A 1 112 ? 13.444  0.508   7.764   1.00 0.00 ? 112 GLY A HA2  3  
ATOM 6066  H HA3  . GLY A 1 112 ? 14.535  -0.776  7.224   1.00 0.00 ? 112 GLY A HA3  3  
ATOM 6067  N N    . PHE A 1 113 ? 11.663  -0.999  8.024   1.00 0.00 ? 113 PHE A N    3  
ATOM 6068  C CA   . PHE A 1 113 ? 10.525  -1.787  8.211   1.00 0.00 ? 113 PHE A CA   3  
ATOM 6069  C C    . PHE A 1 113 ? 9.769   -1.858  6.937   1.00 0.00 ? 113 PHE A C    3  
ATOM 6070  O O    . PHE A 1 113 ? 9.853   -0.935  6.094   1.00 0.00 ? 113 PHE A O    3  
ATOM 6071  C CB   . PHE A 1 113 ? 9.694   -1.280  9.402   1.00 0.00 ? 113 PHE A CB   3  
ATOM 6072  C CG   . PHE A 1 113 ? 9.535   0.220   9.468   1.00 0.00 ? 113 PHE A CG   3  
ATOM 6073  C CD1  . PHE A 1 113 ? 8.497   0.851   8.803   1.00 0.00 ? 113 PHE A CD1  3  
ATOM 6074  C CD2  . PHE A 1 113 ? 10.419  0.992   10.205  1.00 0.00 ? 113 PHE A CD2  3  
ATOM 6075  C CE1  . PHE A 1 113 ? 8.348   2.219   8.870   1.00 0.00 ? 113 PHE A CE1  3  
ATOM 6076  C CE2  . PHE A 1 113 ? 10.273  2.359   10.277  1.00 0.00 ? 113 PHE A CE2  3  
ATOM 6077  C CZ   . PHE A 1 113 ? 9.237   2.974   9.609   1.00 0.00 ? 113 PHE A CZ   3  
ATOM 6078  H H    . PHE A 1 113 ? 11.556  -0.071  7.716   1.00 0.00 ? 113 PHE A H    3  
ATOM 6079  H HA   . PHE A 1 113 ? 10.871  -2.784  8.434   1.00 0.00 ? 113 PHE A HA   3  
ATOM 6080  H HB2  . PHE A 1 113 ? 8.706   -1.712  9.346   1.00 0.00 ? 113 PHE A HB2  3  
ATOM 6081  H HB3  . PHE A 1 113 ? 10.164  -1.606  10.318  1.00 0.00 ? 113 PHE A HB3  3  
ATOM 6082  H HD1  . PHE A 1 113 ? 7.801   0.261   8.224   1.00 0.00 ? 113 PHE A HD1  3  
ATOM 6083  H HD2  . PHE A 1 113 ? 11.231  0.509   10.724  1.00 0.00 ? 113 PHE A HD2  3  
ATOM 6084  H HE1  . PHE A 1 113 ? 7.537   2.702   8.346   1.00 0.00 ? 113 PHE A HE1  3  
ATOM 6085  H HE2  . PHE A 1 113 ? 10.969  2.948   10.856  1.00 0.00 ? 113 PHE A HE2  3  
ATOM 6086  H HZ   . PHE A 1 113 ? 9.121   4.046   9.664   1.00 0.00 ? 113 PHE A HZ   3  
ATOM 6087  N N    . ILE A 1 114 ? 9.036   -2.905  6.766   1.00 0.00 ? 114 ILE A N    3  
ATOM 6088  C CA   . ILE A 1 114 ? 8.366   -3.104  5.541   1.00 0.00 ? 114 ILE A CA   3  
ATOM 6089  C C    . ILE A 1 114 ? 6.911   -3.188  5.843   1.00 0.00 ? 114 ILE A C    3  
ATOM 6090  O O    . ILE A 1 114 ? 6.491   -3.701  6.900   1.00 0.00 ? 114 ILE A O    3  
ATOM 6091  C CB   . ILE A 1 114 ? 8.808   -4.422  4.765   1.00 0.00 ? 114 ILE A CB   3  
ATOM 6092  C CG1  . ILE A 1 114 ? 8.015   -5.673  5.188   1.00 0.00 ? 114 ILE A CG1  3  
ATOM 6093  C CG2  . ILE A 1 114 ? 10.289  -4.693  4.996   1.00 0.00 ? 114 ILE A CG2  3  
ATOM 6094  C CD1  . ILE A 1 114 ? 8.250   -6.872  4.282   1.00 0.00 ? 114 ILE A CD1  3  
ATOM 6095  H H    . ILE A 1 114 ? 8.960   -3.575  7.482   1.00 0.00 ? 114 ILE A H    3  
ATOM 6096  H HA   . ILE A 1 114 ? 8.550   -2.248  4.909   1.00 0.00 ? 114 ILE A HA   3  
ATOM 6097  H HB   . ILE A 1 114 ? 8.666   -4.249  3.707   1.00 0.00 ? 114 ILE A HB   3  
ATOM 6098  H HG12 . ILE A 1 114 ? 8.305   -5.954  6.190   1.00 0.00 ? 114 ILE A HG12 3  
ATOM 6099  H HG13 . ILE A 1 114 ? 6.959   -5.444  5.174   1.00 0.00 ? 114 ILE A HG13 3  
ATOM 6100  H HG21 . ILE A 1 114 ? 10.573  -5.579  4.448   1.00 0.00 ? 114 ILE A HG21 3  
ATOM 6101  H HG22 . ILE A 1 114 ? 10.450  -4.864  6.051   1.00 0.00 ? 114 ILE A HG22 3  
ATOM 6102  H HG23 . ILE A 1 114 ? 10.892  -3.855  4.680   1.00 0.00 ? 114 ILE A HG23 3  
ATOM 6103  H HD11 . ILE A 1 114 ? 7.666   -7.710  4.632   1.00 0.00 ? 114 ILE A HD11 3  
ATOM 6104  H HD12 . ILE A 1 114 ? 9.298   -7.133  4.297   1.00 0.00 ? 114 ILE A HD12 3  
ATOM 6105  H HD13 . ILE A 1 114 ? 7.956   -6.625  3.273   1.00 0.00 ? 114 ILE A HD13 3  
ATOM 6106  N N    . SER A 1 115 ? 6.145   -2.611  4.993   1.00 0.00 ? 115 SER A N    3  
ATOM 6107  C CA   . SER A 1 115 ? 4.749   -2.582  5.140   1.00 0.00 ? 115 SER A CA   3  
ATOM 6108  C C    . SER A 1 115 ? 4.084   -2.921  3.825   1.00 0.00 ? 115 SER A C    3  
ATOM 6109  O O    . SER A 1 115 ? 4.664   -2.728  2.744   1.00 0.00 ? 115 SER A O    3  
ATOM 6110  C CB   . SER A 1 115 ? 4.324   -1.184  5.595   1.00 0.00 ? 115 SER A CB   3  
ATOM 6111  O OG   . SER A 1 115 ? 5.075   -0.769  6.742   1.00 0.00 ? 115 SER A OG   3  
ATOM 6112  H H    . SER A 1 115 ? 6.513   -2.158  4.201   1.00 0.00 ? 115 SER A H    3  
ATOM 6113  H HA   . SER A 1 115 ? 4.445   -3.295  5.887   1.00 0.00 ? 115 SER A HA   3  
ATOM 6114  H HB2  . SER A 1 115 ? 4.496   -0.479  4.795   1.00 0.00 ? 115 SER A HB2  3  
ATOM 6115  H HB3  . SER A 1 115 ? 3.274   -1.190  5.849   1.00 0.00 ? 115 SER A HB3  3  
ATOM 6116  H HG   . SER A 1 115 ? 5.620   -1.523  6.997   1.00 0.00 ? 115 SER A HG   3  
ATOM 6117  N N    . ARG A 1 116 ? 2.889   -3.369  3.928   1.00 0.00 ? 116 ARG A N    3  
ATOM 6118  C CA   . ARG A 1 116 ? 2.066   -3.638  2.825   1.00 0.00 ? 116 ARG A CA   3  
ATOM 6119  C C    . ARG A 1 116 ? 0.814   -2.879  3.096   1.00 0.00 ? 116 ARG A C    3  
ATOM 6120  O O    . ARG A 1 116 ? 0.402   -2.742  4.251   1.00 0.00 ? 116 ARG A O    3  
ATOM 6121  C CB   . ARG A 1 116 ? 1.812   -5.151  2.749   1.00 0.00 ? 116 ARG A CB   3  
ATOM 6122  C CG   . ARG A 1 116 ? 0.653   -5.597  1.865   1.00 0.00 ? 116 ARG A CG   3  
ATOM 6123  C CD   . ARG A 1 116 ? 0.611   -7.117  1.739   1.00 0.00 ? 116 ARG A CD   3  
ATOM 6124  N NE   . ARG A 1 116 ? 0.873   -7.807  3.014   1.00 0.00 ? 116 ARG A NE   3  
ATOM 6125  C CZ   . ARG A 1 116 ? -0.000  -8.543  3.718   1.00 0.00 ? 116 ARG A CZ   3  
ATOM 6126  N NH1  . ARG A 1 116 ? -1.264  -8.658  3.326   1.00 0.00 ? 116 ARG A NH1  3  
ATOM 6127  N NH2  . ARG A 1 116 ? 0.416   -9.199  4.787   1.00 0.00 ? 116 ARG A NH2  3  
ATOM 6128  H H    . ARG A 1 116 ? 2.496   -3.521  4.816   1.00 0.00 ? 116 ARG A H    3  
ATOM 6129  H HA   . ARG A 1 116 ? 2.540   -3.290  1.921   1.00 0.00 ? 116 ARG A HA   3  
ATOM 6130  H HB2  . ARG A 1 116 ? 2.705   -5.628  2.376   1.00 0.00 ? 116 ARG A HB2  3  
ATOM 6131  H HB3  . ARG A 1 116 ? 1.631   -5.513  3.750   1.00 0.00 ? 116 ARG A HB3  3  
ATOM 6132  H HG2  . ARG A 1 116 ? -0.274  -5.253  2.299   1.00 0.00 ? 116 ARG A HG2  3  
ATOM 6133  H HG3  . ARG A 1 116 ? 0.764   -5.164  0.882   1.00 0.00 ? 116 ARG A HG3  3  
ATOM 6134  H HD2  . ARG A 1 116 ? -0.370  -7.393  1.385   1.00 0.00 ? 116 ARG A HD2  3  
ATOM 6135  H HD3  . ARG A 1 116 ? 1.349   -7.423  1.015   1.00 0.00 ? 116 ARG A HD3  3  
ATOM 6136  H HE   . ARG A 1 116 ? 1.816   -7.726  3.323   1.00 0.00 ? 116 ARG A HE   3  
ATOM 6137  H HH11 . ARG A 1 116 ? -1.584  -8.216  2.489   1.00 0.00 ? 116 ARG A HH11 3  
ATOM 6138  H HH12 . ARG A 1 116 ? -1.956  -9.179  3.841   1.00 0.00 ? 116 ARG A HH12 3  
ATOM 6139  H HH21 . ARG A 1 116 ? 1.390   -9.153  5.069   1.00 0.00 ? 116 ARG A HH21 3  
ATOM 6140  H HH22 . ARG A 1 116 ? -0.179  -9.777  5.348   1.00 0.00 ? 116 ARG A HH22 3  
ATOM 6141  N N    . GLU A 1 117 ? 0.212   -2.407  2.079   1.00 0.00 ? 117 GLU A N    3  
ATOM 6142  C CA   . GLU A 1 117 ? -0.902  -1.543  2.203   1.00 0.00 ? 117 GLU A CA   3  
ATOM 6143  C C    . GLU A 1 117 ? -1.941  -1.966  1.204   1.00 0.00 ? 117 GLU A C    3  
ATOM 6144  O O    . GLU A 1 117 ? -1.616  -2.620  0.210   1.00 0.00 ? 117 GLU A O    3  
ATOM 6145  C CB   . GLU A 1 117 ? -0.453  -0.082  1.949   1.00 0.00 ? 117 GLU A CB   3  
ATOM 6146  C CG   . GLU A 1 117 ? 0.727   0.375   2.817   1.00 0.00 ? 117 GLU A CG   3  
ATOM 6147  C CD   . GLU A 1 117 ? 1.161   1.793   2.558   1.00 0.00 ? 117 GLU A CD   3  
ATOM 6148  O OE1  . GLU A 1 117 ? 1.907   2.036   1.601   1.00 0.00 ? 117 GLU A OE1  3  
ATOM 6149  O OE2  . GLU A 1 117 ? 0.763   2.705   3.332   1.00 0.00 ? 117 GLU A OE2  3  
ATOM 6150  H H    . GLU A 1 117 ? 0.530   -2.621  1.172   1.00 0.00 ? 117 GLU A H    3  
ATOM 6151  H HA   . GLU A 1 117 ? -1.302  -1.620  3.202   1.00 0.00 ? 117 GLU A HA   3  
ATOM 6152  H HB2  . GLU A 1 117 ? -0.156  0.020   0.920   1.00 0.00 ? 117 GLU A HB2  3  
ATOM 6153  H HB3  . GLU A 1 117 ? -1.286  0.576   2.143   1.00 0.00 ? 117 GLU A HB3  3  
ATOM 6154  H HG2  . GLU A 1 117 ? 0.445   0.297   3.856   1.00 0.00 ? 117 GLU A HG2  3  
ATOM 6155  H HG3  . GLU A 1 117 ? 1.563   -0.284  2.631   1.00 0.00 ? 117 GLU A HG3  3  
ATOM 6156  N N    . PHE A 1 118 ? -3.164  -1.683  1.488   1.00 0.00 ? 118 PHE A N    3  
ATOM 6157  C CA   . PHE A 1 118 ? -4.242  -1.990  0.590   1.00 0.00 ? 118 PHE A CA   3  
ATOM 6158  C C    . PHE A 1 118 ? -5.085  -0.788  0.353   1.00 0.00 ? 118 PHE A C    3  
ATOM 6159  O O    . PHE A 1 118 ? -5.431  -0.059  1.285   1.00 0.00 ? 118 PHE A O    3  
ATOM 6160  C CB   . PHE A 1 118 ? -5.109  -3.158  1.064   1.00 0.00 ? 118 PHE A CB   3  
ATOM 6161  C CG   . PHE A 1 118 ? -4.520  -4.513  0.807   1.00 0.00 ? 118 PHE A CG   3  
ATOM 6162  C CD1  . PHE A 1 118 ? -3.713  -5.118  1.732   1.00 0.00 ? 118 PHE A CD1  3  
ATOM 6163  C CD2  . PHE A 1 118 ? -4.798  -5.185  -0.370  1.00 0.00 ? 118 PHE A CD2  3  
ATOM 6164  C CE1  . PHE A 1 118 ? -3.189  -6.368  1.506   1.00 0.00 ? 118 PHE A CE1  3  
ATOM 6165  C CE2  . PHE A 1 118 ? -4.277  -6.436  -0.609  1.00 0.00 ? 118 PHE A CE2  3  
ATOM 6166  C CZ   . PHE A 1 118 ? -3.471  -7.028  0.334   1.00 0.00 ? 118 PHE A CZ   3  
ATOM 6167  H H    . PHE A 1 118 ? -3.352  -1.209  2.330   1.00 0.00 ? 118 PHE A H    3  
ATOM 6168  H HA   . PHE A 1 118 ? -3.789  -2.262  -0.351  1.00 0.00 ? 118 PHE A HA   3  
ATOM 6169  H HB2  . PHE A 1 118 ? -5.266  -3.067  2.128   1.00 0.00 ? 118 PHE A HB2  3  
ATOM 6170  H HB3  . PHE A 1 118 ? -6.065  -3.108  0.564   1.00 0.00 ? 118 PHE A HB3  3  
ATOM 6171  H HD1  . PHE A 1 118 ? -3.489  -4.602  2.654   1.00 0.00 ? 118 PHE A HD1  3  
ATOM 6172  H HD2  . PHE A 1 118 ? -5.431  -4.716  -1.110  1.00 0.00 ? 118 PHE A HD2  3  
ATOM 6173  H HE1  . PHE A 1 118 ? -2.555  -6.823  2.250   1.00 0.00 ? 118 PHE A HE1  3  
ATOM 6174  H HE2  . PHE A 1 118 ? -4.501  -6.951  -1.531  1.00 0.00 ? 118 PHE A HE2  3  
ATOM 6175  H HZ   . PHE A 1 118 ? -3.060  -8.009  0.152   1.00 0.00 ? 118 PHE A HZ   3  
ATOM 6176  N N    . HIS A 1 119 ? -5.387  -0.558  -0.900  1.00 0.00 ? 119 HIS A N    3  
ATOM 6177  C CA   . HIS A 1 119 ? -6.237  0.525   -1.300  1.00 0.00 ? 119 HIS A CA   3  
ATOM 6178  C C    . HIS A 1 119 ? -7.309  0.033   -2.267  1.00 0.00 ? 119 HIS A C    3  
ATOM 6179  O O    . HIS A 1 119 ? -7.009  -0.518  -3.304  1.00 0.00 ? 119 HIS A O    3  
ATOM 6180  C CB   . HIS A 1 119 ? -5.425  1.670   -1.934  1.00 0.00 ? 119 HIS A CB   3  
ATOM 6181  C CG   . HIS A 1 119 ? -6.259  2.831   -2.420  1.00 0.00 ? 119 HIS A CG   3  
ATOM 6182  N ND1  . HIS A 1 119 ? -6.305  3.225   -3.739  1.00 0.00 ? 119 HIS A ND1  3  
ATOM 6183  C CD2  . HIS A 1 119 ? -7.074  3.686   -1.751  1.00 0.00 ? 119 HIS A CD2  3  
ATOM 6184  C CE1  . HIS A 1 119 ? -7.106  4.258   -3.859  1.00 0.00 ? 119 HIS A CE1  3  
ATOM 6185  N NE2  . HIS A 1 119 ? -7.585  4.556   -2.676  1.00 0.00 ? 119 HIS A NE2  3  
ATOM 6186  H H    . HIS A 1 119 ? -5.044  -1.167  -1.595  1.00 0.00 ? 119 HIS A H    3  
ATOM 6187  H HA   . HIS A 1 119 ? -6.725  0.898   -0.412  1.00 0.00 ? 119 HIS A HA   3  
ATOM 6188  H HB2  . HIS A 1 119 ? -4.728  2.050   -1.203  1.00 0.00 ? 119 HIS A HB2  3  
ATOM 6189  H HB3  . HIS A 1 119 ? -4.870  1.281   -2.777  1.00 0.00 ? 119 HIS A HB3  3  
ATOM 6190  H HD1  . HIS A 1 119 ? -5.807  2.821   -4.487  1.00 0.00 ? 119 HIS A HD1  3  
ATOM 6191  H HD2  . HIS A 1 119 ? -7.281  3.680   -0.691  1.00 0.00 ? 119 HIS A HD2  3  
ATOM 6192  H HE1  . HIS A 1 119 ? -7.332  4.775   -4.780  1.00 0.00 ? 119 HIS A HE1  3  
ATOM 6193  H HE2  . HIS A 1 119 ? -8.329  5.201   -2.544  1.00 0.00 ? 119 HIS A HE2  3  
ATOM 6194  N N    . ARG A 1 120 ? -8.533  0.236   -1.917  1.00 0.00 ? 120 ARG A N    3  
ATOM 6195  C CA   . ARG A 1 120 ? -9.646  -0.049  -2.798  1.00 0.00 ? 120 ARG A CA   3  
ATOM 6196  C C    . ARG A 1 120 ? -10.317 1.245   -3.100  1.00 0.00 ? 120 ARG A C    3  
ATOM 6197  O O    . ARG A 1 120 ? -10.445 2.081   -2.201  1.00 0.00 ? 120 ARG A O    3  
ATOM 6198  C CB   . ARG A 1 120 ? -10.637 -1.037  -2.170  1.00 0.00 ? 120 ARG A CB   3  
ATOM 6199  C CG   . ARG A 1 120 ? -10.205 -2.484  -2.265  1.00 0.00 ? 120 ARG A CG   3  
ATOM 6200  C CD   . ARG A 1 120 ? -11.108 -3.420  -1.491  1.00 0.00 ? 120 ARG A CD   3  
ATOM 6201  N NE   . ARG A 1 120 ? -10.989 -3.238  -0.022  1.00 0.00 ? 120 ARG A NE   3  
ATOM 6202  C CZ   . ARG A 1 120 ? -11.142 -4.236  0.874   1.00 0.00 ? 120 ARG A CZ   3  
ATOM 6203  N NH1  . ARG A 1 120 ? -11.442 -5.447  0.466   1.00 0.00 ? 120 ARG A NH1  3  
ATOM 6204  N NH2  . ARG A 1 120 ? -10.988 -4.016  2.174   1.00 0.00 ? 120 ARG A NH2  3  
ATOM 6205  H H    . ARG A 1 120 ? -8.707  0.630   -1.032  1.00 0.00 ? 120 ARG A H    3  
ATOM 6206  H HA   . ARG A 1 120 ? -9.249  -0.457  -3.716  1.00 0.00 ? 120 ARG A HA   3  
ATOM 6207  H HB2  . ARG A 1 120 ? -10.774 -0.788  -1.128  1.00 0.00 ? 120 ARG A HB2  3  
ATOM 6208  H HB3  . ARG A 1 120 ? -11.578 -0.929  -2.685  1.00 0.00 ? 120 ARG A HB3  3  
ATOM 6209  H HG2  . ARG A 1 120 ? -10.218 -2.764  -3.305  1.00 0.00 ? 120 ARG A HG2  3  
ATOM 6210  H HG3  . ARG A 1 120 ? -9.196  -2.567  -1.887  1.00 0.00 ? 120 ARG A HG3  3  
ATOM 6211  H HD2  . ARG A 1 120 ? -12.129 -3.237  -1.789  1.00 0.00 ? 120 ARG A HD2  3  
ATOM 6212  H HD3  . ARG A 1 120 ? -10.841 -4.436  -1.740  1.00 0.00 ? 120 ARG A HD3  3  
ATOM 6213  H HE   . ARG A 1 120 ? -10.777 -2.320  0.253   1.00 0.00 ? 120 ARG A HE   3  
ATOM 6214  H HH11 . ARG A 1 120 ? -11.561 -5.670  -0.510  1.00 0.00 ? 120 ARG A HH11 3  
ATOM 6215  H HH12 . ARG A 1 120 ? -11.563 -6.213  1.104   1.00 0.00 ? 120 ARG A HH12 3  
ATOM 6216  H HH21 . ARG A 1 120 ? -10.756 -3.125  2.564   1.00 0.00 ? 120 ARG A HH21 3  
ATOM 6217  H HH22 . ARG A 1 120 ? -11.092 -4.778  2.828   1.00 0.00 ? 120 ARG A HH22 3  
ATOM 6218  N N    . LYS A 1 121 ? -10.704 1.447   -4.328  1.00 0.00 ? 121 LYS A N    3  
ATOM 6219  C CA   . LYS A 1 121 ? -11.341 2.687   -4.693  1.00 0.00 ? 121 LYS A CA   3  
ATOM 6220  C C    . LYS A 1 121 ? -12.528 2.400   -5.568  1.00 0.00 ? 121 LYS A C    3  
ATOM 6221  O O    . LYS A 1 121 ? -12.397 1.699   -6.559  1.00 0.00 ? 121 LYS A O    3  
ATOM 6222  C CB   . LYS A 1 121 ? -10.343 3.566   -5.457  1.00 0.00 ? 121 LYS A CB   3  
ATOM 6223  C CG   . LYS A 1 121 ? -10.855 4.952   -5.820  1.00 0.00 ? 121 LYS A CG   3  
ATOM 6224  C CD   . LYS A 1 121 ? -9.877  5.666   -6.730  1.00 0.00 ? 121 LYS A CD   3  
ATOM 6225  C CE   . LYS A 1 121 ? -10.304 7.096   -7.015  1.00 0.00 ? 121 LYS A CE   3  
ATOM 6226  N NZ   . LYS A 1 121 ? -10.139 7.983   -5.842  1.00 0.00 ? 121 LYS A NZ   3  
ATOM 6227  H H    . LYS A 1 121 ? -10.582 0.755   -5.017  1.00 0.00 ? 121 LYS A H    3  
ATOM 6228  H HA   . LYS A 1 121 ? -11.646 3.195   -3.795  1.00 0.00 ? 121 LYS A HA   3  
ATOM 6229  H HB2  . LYS A 1 121 ? -9.458  3.688   -4.851  1.00 0.00 ? 121 LYS A HB2  3  
ATOM 6230  H HB3  . LYS A 1 121 ? -10.070 3.057   -6.368  1.00 0.00 ? 121 LYS A HB3  3  
ATOM 6231  H HG2  . LYS A 1 121 ? -11.805 4.860   -6.325  1.00 0.00 ? 121 LYS A HG2  3  
ATOM 6232  H HG3  . LYS A 1 121 ? -10.980 5.532   -4.918  1.00 0.00 ? 121 LYS A HG3  3  
ATOM 6233  H HD2  . LYS A 1 121 ? -8.905  5.679   -6.258  1.00 0.00 ? 121 LYS A HD2  3  
ATOM 6234  H HD3  . LYS A 1 121 ? -9.814  5.124   -7.663  1.00 0.00 ? 121 LYS A HD3  3  
ATOM 6235  H HE2  . LYS A 1 121 ? -9.710  7.483   -7.830  1.00 0.00 ? 121 LYS A HE2  3  
ATOM 6236  H HE3  . LYS A 1 121 ? -11.345 7.087   -7.306  1.00 0.00 ? 121 LYS A HE3  3  
ATOM 6237  H HZ1  . LYS A 1 121 ? -10.444 8.950   -6.077  1.00 0.00 ? 121 LYS A HZ1  3  
ATOM 6238  H HZ2  . LYS A 1 121 ? -9.136  8.040   -5.579  1.00 0.00 ? 121 LYS A HZ2  3  
ATOM 6239  H HZ3  . LYS A 1 121 ? -10.670 7.683   -4.994  1.00 0.00 ? 121 LYS A HZ3  3  
ATOM 6240  N N    . TYR A 1 122 ? -13.660 2.944   -5.198  1.00 0.00 ? 122 TYR A N    3  
ATOM 6241  C CA   . TYR A 1 122 ? -14.897 2.803   -5.934  1.00 0.00 ? 122 TYR A CA   3  
ATOM 6242  C C    . TYR A 1 122 ? -15.527 4.150   -6.091  1.00 0.00 ? 122 TYR A C    3  
ATOM 6243  O O    . TYR A 1 122 ? -15.463 4.969   -5.170  1.00 0.00 ? 122 TYR A O    3  
ATOM 6244  C CB   . TYR A 1 122 ? -15.922 1.952   -5.160  1.00 0.00 ? 122 TYR A CB   3  
ATOM 6245  C CG   . TYR A 1 122 ? -15.518 0.547   -4.821  1.00 0.00 ? 122 TYR A CG   3  
ATOM 6246  C CD1  . TYR A 1 122 ? -14.594 0.295   -3.829  1.00 0.00 ? 122 TYR A CD1  3  
ATOM 6247  C CD2  . TYR A 1 122 ? -16.082 -0.535  -5.481  1.00 0.00 ? 122 TYR A CD2  3  
ATOM 6248  C CE1  . TYR A 1 122 ? -14.233 -0.977  -3.509  1.00 0.00 ? 122 TYR A CE1  3  
ATOM 6249  C CE2  . TYR A 1 122 ? -15.721 -1.822  -5.160  1.00 0.00 ? 122 TYR A CE2  3  
ATOM 6250  C CZ   . TYR A 1 122 ? -14.793 -2.032  -4.171  1.00 0.00 ? 122 TYR A CZ   3  
ATOM 6251  O OH   . TYR A 1 122 ? -14.418 -3.297  -3.842  1.00 0.00 ? 122 TYR A OH   3  
ATOM 6252  H H    . TYR A 1 122 ? -13.704 3.467   -4.365  1.00 0.00 ? 122 TYR A H    3  
ATOM 6253  H HA   . TYR A 1 122 ? -14.718 2.344   -6.893  1.00 0.00 ? 122 TYR A HA   3  
ATOM 6254  H HB2  . TYR A 1 122 ? -16.127 2.459   -4.232  1.00 0.00 ? 122 TYR A HB2  3  
ATOM 6255  H HB3  . TYR A 1 122 ? -16.835 1.916   -5.735  1.00 0.00 ? 122 TYR A HB3  3  
ATOM 6256  H HD1  . TYR A 1 122 ? -14.147 1.127   -3.307  1.00 0.00 ? 122 TYR A HD1  3  
ATOM 6257  H HD2  . TYR A 1 122 ? -16.811 -0.359  -6.259  1.00 0.00 ? 122 TYR A HD2  3  
ATOM 6258  H HE1  . TYR A 1 122 ? -13.511 -1.155  -2.727  1.00 0.00 ? 122 TYR A HE1  3  
ATOM 6259  H HE2  . TYR A 1 122 ? -16.164 -2.658  -5.681  1.00 0.00 ? 122 TYR A HE2  3  
ATOM 6260  H HH   . TYR A 1 122 ? -14.206 -3.769  -4.669  1.00 0.00 ? 122 TYR A HH   3  
ATOM 6261  N N    . ARG A 1 123 ? -16.118 4.398   -7.212  1.00 0.00 ? 123 ARG A N    3  
ATOM 6262  C CA   . ARG A 1 123 ? -16.941 5.566   -7.344  1.00 0.00 ? 123 ARG A CA   3  
ATOM 6263  C C    . ARG A 1 123 ? -18.272 5.132   -7.892  1.00 0.00 ? 123 ARG A C    3  
ATOM 6264  O O    . ARG A 1 123 ? -18.419 4.897   -9.100  1.00 0.00 ? 123 ARG A O    3  
ATOM 6265  C CB   . ARG A 1 123 ? -16.305 6.644   -8.215  1.00 0.00 ? 123 ARG A CB   3  
ATOM 6266  C CG   . ARG A 1 123 ? -17.118 7.921   -8.205  1.00 0.00 ? 123 ARG A CG   3  
ATOM 6267  C CD   . ARG A 1 123 ? -16.472 9.027   -8.993  1.00 0.00 ? 123 ARG A CD   3  
ATOM 6268  N NE   . ARG A 1 123 ? -17.235 10.270  -8.864  1.00 0.00 ? 123 ARG A NE   3  
ATOM 6269  C CZ   . ARG A 1 123 ? -17.038 11.379  -9.577  1.00 0.00 ? 123 ARG A CZ   3  
ATOM 6270  N NH1  . ARG A 1 123 ? -16.060 11.435  -10.482 1.00 0.00 ? 123 ARG A NH1  3  
ATOM 6271  N NH2  . ARG A 1 123 ? -17.820 12.437  -9.383  1.00 0.00 ? 123 ARG A NH2  3  
ATOM 6272  H H    . ARG A 1 123 ? -16.019 3.766   -7.959  1.00 0.00 ? 123 ARG A H    3  
ATOM 6273  H HA   . ARG A 1 123 ? -17.102 5.948   -6.346  1.00 0.00 ? 123 ARG A HA   3  
ATOM 6274  H HB2  . ARG A 1 123 ? -15.314 6.858   -7.845  1.00 0.00 ? 123 ARG A HB2  3  
ATOM 6275  H HB3  . ARG A 1 123 ? -16.241 6.289   -9.233  1.00 0.00 ? 123 ARG A HB3  3  
ATOM 6276  H HG2  . ARG A 1 123 ? -18.088 7.715   -8.635  1.00 0.00 ? 123 ARG A HG2  3  
ATOM 6277  H HG3  . ARG A 1 123 ? -17.249 8.245   -7.183  1.00 0.00 ? 123 ARG A HG3  3  
ATOM 6278  H HD2  . ARG A 1 123 ? -15.469 9.184   -8.625  1.00 0.00 ? 123 ARG A HD2  3  
ATOM 6279  H HD3  . ARG A 1 123 ? -16.441 8.743   -10.034 1.00 0.00 ? 123 ARG A HD3  3  
ATOM 6280  H HE   . ARG A 1 123 ? -17.949 10.224  -8.170  1.00 0.00 ? 123 ARG A HE   3  
ATOM 6281  H HH11 . ARG A 1 123 ? -15.455 10.652  -10.642 1.00 0.00 ? 123 ARG A HH11 3  
ATOM 6282  H HH12 . ARG A 1 123 ? -15.901 12.255  -11.037 1.00 0.00 ? 123 ARG A HH12 3  
ATOM 6283  H HH21 . ARG A 1 123 ? -18.564 12.425  -8.707  1.00 0.00 ? 123 ARG A HH21 3  
ATOM 6284  H HH22 . ARG A 1 123 ? -17.733 13.287  -9.908  1.00 0.00 ? 123 ARG A HH22 3  
ATOM 6285  N N    . ILE A 1 124 ? -19.217 4.982   -7.002  1.00 0.00 ? 124 ILE A N    3  
ATOM 6286  C CA   . ILE A 1 124 ? -20.532 4.504   -7.318  1.00 0.00 ? 124 ILE A CA   3  
ATOM 6287  C C    . ILE A 1 124 ? -21.618 5.320   -6.583  1.00 0.00 ? 124 ILE A C    3  
ATOM 6288  O O    . ILE A 1 124 ? -21.789 5.188   -5.385  1.00 0.00 ? 124 ILE A O    3  
ATOM 6289  C CB   . ILE A 1 124 ? -20.643 2.980   -6.985  1.00 0.00 ? 124 ILE A CB   3  
ATOM 6290  C CG1  . ILE A 1 124 ? -19.934 2.633   -5.657  1.00 0.00 ? 124 ILE A CG1  3  
ATOM 6291  C CG2  . ILE A 1 124 ? -20.104 2.137   -8.138  1.00 0.00 ? 124 ILE A CG2  3  
ATOM 6292  C CD1  . ILE A 1 124 ? -19.929 1.154   -5.321  1.00 0.00 ? 124 ILE A CD1  3  
ATOM 6293  H H    . ILE A 1 124 ? -19.050 5.262   -6.073  1.00 0.00 ? 124 ILE A H    3  
ATOM 6294  H HA   . ILE A 1 124 ? -20.667 4.621   -8.383  1.00 0.00 ? 124 ILE A HA   3  
ATOM 6295  H HB   . ILE A 1 124 ? -21.695 2.754   -6.892  1.00 0.00 ? 124 ILE A HB   3  
ATOM 6296  H HG12 . ILE A 1 124 ? -18.906 2.959   -5.712  1.00 0.00 ? 124 ILE A HG12 3  
ATOM 6297  H HG13 . ILE A 1 124 ? -20.424 3.160   -4.852  1.00 0.00 ? 124 ILE A HG13 3  
ATOM 6298  H HG21 . ILE A 1 124 ? -20.193 1.089   -7.893  1.00 0.00 ? 124 ILE A HG21 3  
ATOM 6299  H HG22 . ILE A 1 124 ? -19.065 2.382   -8.302  1.00 0.00 ? 124 ILE A HG22 3  
ATOM 6300  H HG23 . ILE A 1 124 ? -20.668 2.347   -9.035  1.00 0.00 ? 124 ILE A HG23 3  
ATOM 6301  H HD11 . ILE A 1 124 ? -19.404 0.996   -4.392  1.00 0.00 ? 124 ILE A HD11 3  
ATOM 6302  H HD12 . ILE A 1 124 ? -19.432 0.612   -6.113  1.00 0.00 ? 124 ILE A HD12 3  
ATOM 6303  H HD13 . ILE A 1 124 ? -20.946 0.802   -5.230  1.00 0.00 ? 124 ILE A HD13 3  
ATOM 6304  N N    . PRO A 1 125 ? -22.352 6.192   -7.298  1.00 0.00 ? 125 PRO A N    3  
ATOM 6305  C CA   . PRO A 1 125 ? -23.448 6.985   -6.705  1.00 0.00 ? 125 PRO A CA   3  
ATOM 6306  C C    . PRO A 1 125 ? -24.807 6.282   -6.764  1.00 0.00 ? 125 PRO A C    3  
ATOM 6307  O O    . PRO A 1 125 ? -25.544 6.277   -5.804  1.00 0.00 ? 125 PRO A O    3  
ATOM 6308  C CB   . PRO A 1 125 ? -23.489 8.247   -7.598  1.00 0.00 ? 125 PRO A CB   3  
ATOM 6309  C CG   . PRO A 1 125 ? -22.398 8.065   -8.622  1.00 0.00 ? 125 PRO A CG   3  
ATOM 6310  C CD   . PRO A 1 125 ? -22.100 6.593   -8.677  1.00 0.00 ? 125 PRO A CD   3  
ATOM 6311  H HA   . PRO A 1 125 ? -23.230 7.277   -5.689  1.00 0.00 ? 125 PRO A HA   3  
ATOM 6312  H HB2  . PRO A 1 125 ? -24.459 8.312   -8.068  1.00 0.00 ? 125 PRO A HB2  3  
ATOM 6313  H HB3  . PRO A 1 125 ? -23.323 9.128   -6.995  1.00 0.00 ? 125 PRO A HB3  3  
ATOM 6314  H HG2  . PRO A 1 125 ? -22.733 8.422   -9.582  1.00 0.00 ? 125 PRO A HG2  3  
ATOM 6315  H HG3  . PRO A 1 125 ? -21.520 8.614   -8.317  1.00 0.00 ? 125 PRO A HG3  3  
ATOM 6316  H HD2  . PRO A 1 125 ? -22.759 6.091   -9.369  1.00 0.00 ? 125 PRO A HD2  3  
ATOM 6317  H HD3  . PRO A 1 125 ? -21.065 6.443   -8.945  1.00 0.00 ? 125 PRO A HD3  3  
ATOM 6318  N N    . ALA A 1 126 ? -25.133 5.705   -7.908  1.00 0.00 ? 126 ALA A N    3  
ATOM 6319  C CA   . ALA A 1 126 ? -26.425 5.051   -8.090  1.00 0.00 ? 126 ALA A CA   3  
ATOM 6320  C C    . ALA A 1 126 ? -26.556 3.803   -7.236  1.00 0.00 ? 126 ALA A C    3  
ATOM 6321  O O    . ALA A 1 126 ? -27.635 3.423   -6.867  1.00 0.00 ? 126 ALA A O    3  
ATOM 6322  C CB   . ALA A 1 126 ? -26.660 4.724   -9.552  1.00 0.00 ? 126 ALA A CB   3  
ATOM 6323  H H    . ALA A 1 126 ? -24.499 5.727   -8.651  1.00 0.00 ? 126 ALA A H    3  
ATOM 6324  H HA   . ALA A 1 126 ? -27.186 5.752   -7.779  1.00 0.00 ? 126 ALA A HA   3  
ATOM 6325  H HB1  . ALA A 1 126 ? -26.552 5.620   -10.145 1.00 0.00 ? 126 ALA A HB1  3  
ATOM 6326  H HB2  . ALA A 1 126 ? -27.655 4.322   -9.679  1.00 0.00 ? 126 ALA A HB2  3  
ATOM 6327  H HB3  . ALA A 1 126 ? -25.934 3.992   -9.872  1.00 0.00 ? 126 ALA A HB3  3  
ATOM 6328  N N    . ASP A 1 127 ? -25.439 3.174   -6.945  1.00 0.00 ? 127 ASP A N    3  
ATOM 6329  C CA   . ASP A 1 127 ? -25.445 1.952   -6.153  1.00 0.00 ? 127 ASP A CA   3  
ATOM 6330  C C    . ASP A 1 127 ? -25.294 2.291   -4.680  1.00 0.00 ? 127 ASP A C    3  
ATOM 6331  O O    . ASP A 1 127 ? -25.571 1.464   -3.809  1.00 0.00 ? 127 ASP A O    3  
ATOM 6332  C CB   . ASP A 1 127 ? -24.239 1.044   -6.533  1.00 0.00 ? 127 ASP A CB   3  
ATOM 6333  C CG   . ASP A 1 127 ? -24.151 0.637   -7.993  1.00 0.00 ? 127 ASP A CG   3  
ATOM 6334  O OD1  . ASP A 1 127 ? -23.726 1.462   -8.831  1.00 0.00 ? 127 ASP A OD1  3  
ATOM 6335  O OD2  . ASP A 1 127 ? -24.469 -0.520  -8.338  1.00 0.00 ? 127 ASP A OD2  3  
ATOM 6336  H H    . ASP A 1 127 ? -24.587 3.520   -7.281  1.00 0.00 ? 127 ASP A H    3  
ATOM 6337  H HA   . ASP A 1 127 ? -26.359 1.405   -6.326  1.00 0.00 ? 127 ASP A HA   3  
ATOM 6338  H HB2  . ASP A 1 127 ? -23.326 1.563   -6.287  1.00 0.00 ? 127 ASP A HB2  3  
ATOM 6339  H HB3  . ASP A 1 127 ? -24.290 0.148   -5.931  1.00 0.00 ? 127 ASP A HB3  3  
ATOM 6340  N N    . VAL A 1 128 ? -24.823 3.504   -4.401  1.00 0.00 ? 128 VAL A N    3  
ATOM 6341  C CA   . VAL A 1 128 ? -24.456 3.868   -3.048  1.00 0.00 ? 128 VAL A CA   3  
ATOM 6342  C C    . VAL A 1 128 ? -24.986 5.221   -2.552  1.00 0.00 ? 128 VAL A C    3  
ATOM 6343  O O    . VAL A 1 128 ? -24.787 6.263   -3.164  1.00 0.00 ? 128 VAL A O    3  
ATOM 6344  C CB   . VAL A 1 128 ? -22.905 3.812   -2.843  1.00 0.00 ? 128 VAL A CB   3  
ATOM 6345  C CG1  . VAL A 1 128 ? -22.493 4.327   -1.464  1.00 0.00 ? 128 VAL A CG1  3  
ATOM 6346  C CG2  . VAL A 1 128 ? -22.405 2.397   -3.023  1.00 0.00 ? 128 VAL A CG2  3  
ATOM 6347  H H    . VAL A 1 128 ? -24.763 4.182   -5.104  1.00 0.00 ? 128 VAL A H    3  
ATOM 6348  H HA   . VAL A 1 128 ? -24.870 3.104   -2.409  1.00 0.00 ? 128 VAL A HA   3  
ATOM 6349  H HB   . VAL A 1 128 ? -22.439 4.432   -3.594  1.00 0.00 ? 128 VAL A HB   3  
ATOM 6350  H HG11 . VAL A 1 128 ? -22.805 5.356   -1.360  1.00 0.00 ? 128 VAL A HG11 3  
ATOM 6351  H HG12 . VAL A 1 128 ? -21.421 4.261   -1.352  1.00 0.00 ? 128 VAL A HG12 3  
ATOM 6352  H HG13 . VAL A 1 128 ? -22.978 3.730   -0.705  1.00 0.00 ? 128 VAL A HG13 3  
ATOM 6353  H HG21 . VAL A 1 128 ? -21.330 2.381   -2.940  1.00 0.00 ? 128 VAL A HG21 3  
ATOM 6354  H HG22 . VAL A 1 128 ? -22.689 2.043   -4.003  1.00 0.00 ? 128 VAL A HG22 3  
ATOM 6355  H HG23 . VAL A 1 128 ? -22.835 1.758   -2.267  1.00 0.00 ? 128 VAL A HG23 3  
ATOM 6356  N N    . ASP A 1 129 ? -25.620 5.165   -1.419  1.00 0.00 ? 129 ASP A N    3  
ATOM 6357  C CA   . ASP A 1 129 ? -25.997 6.319   -0.637  1.00 0.00 ? 129 ASP A CA   3  
ATOM 6358  C C    . ASP A 1 129 ? -25.357 6.190   0.745   1.00 0.00 ? 129 ASP A C    3  
ATOM 6359  O O    . ASP A 1 129 ? -25.765 5.322   1.543   1.00 0.00 ? 129 ASP A O    3  
ATOM 6360  C CB   . ASP A 1 129 ? -27.512 6.452   -0.429  1.00 0.00 ? 129 ASP A CB   3  
ATOM 6361  C CG   . ASP A 1 129 ? -28.231 7.187   -1.521  1.00 0.00 ? 129 ASP A CG   3  
ATOM 6362  O OD1  . ASP A 1 129 ? -27.869 8.346   -1.815  1.00 0.00 ? 129 ASP A OD1  3  
ATOM 6363  O OD2  . ASP A 1 129 ? -29.211 6.663   -2.042  1.00 0.00 ? 129 ASP A OD2  3  
ATOM 6364  H H    . ASP A 1 129 ? -25.837 4.274   -1.091  1.00 0.00 ? 129 ASP A H    3  
ATOM 6365  H HA   . ASP A 1 129 ? -25.619 7.189   -1.153  1.00 0.00 ? 129 ASP A HA   3  
ATOM 6366  H HB2  . ASP A 1 129 ? -27.942 5.463   -0.362  1.00 0.00 ? 129 ASP A HB2  3  
ATOM 6367  H HB3  . ASP A 1 129 ? -27.686 6.967   0.505   1.00 0.00 ? 129 ASP A HB3  3  
ATOM 6368  N N    . PRO A 1 130 ? -24.352 7.025   1.062   1.00 0.00 ? 130 PRO A N    3  
ATOM 6369  C CA   . PRO A 1 130 ? -23.624 7.002   2.354   1.00 0.00 ? 130 PRO A CA   3  
ATOM 6370  C C    . PRO A 1 130 ? -24.505 7.242   3.595   1.00 0.00 ? 130 PRO A C    3  
ATOM 6371  O O    . PRO A 1 130 ? -24.066 7.021   4.731   1.00 0.00 ? 130 PRO A O    3  
ATOM 6372  C CB   . PRO A 1 130 ? -22.604 8.132   2.219   1.00 0.00 ? 130 PRO A CB   3  
ATOM 6373  C CG   . PRO A 1 130 ? -23.132 8.978   1.129   1.00 0.00 ? 130 PRO A CG   3  
ATOM 6374  C CD   . PRO A 1 130 ? -23.777 8.034   0.172   1.00 0.00 ? 130 PRO A CD   3  
ATOM 6375  H HA   . PRO A 1 130 ? -23.098 6.067   2.465   1.00 0.00 ? 130 PRO A HA   3  
ATOM 6376  H HB2  . PRO A 1 130 ? -22.547 8.674   3.151   1.00 0.00 ? 130 PRO A HB2  3  
ATOM 6377  H HB3  . PRO A 1 130 ? -21.635 7.723   1.972   1.00 0.00 ? 130 PRO A HB3  3  
ATOM 6378  H HG2  . PRO A 1 130 ? -23.853 9.679   1.520   1.00 0.00 ? 130 PRO A HG2  3  
ATOM 6379  H HG3  . PRO A 1 130 ? -22.318 9.499   0.649   1.00 0.00 ? 130 PRO A HG3  3  
ATOM 6380  H HD2  . PRO A 1 130 ? -24.526 8.557   -0.399  1.00 0.00 ? 130 PRO A HD2  3  
ATOM 6381  H HD3  . PRO A 1 130 ? -23.039 7.597   -0.486  1.00 0.00 ? 130 PRO A HD3  3  
ATOM 6382  N N    . LEU A 1 131 ? -25.721 7.680   3.376   1.00 0.00 ? 131 LEU A N    3  
ATOM 6383  C CA   . LEU A 1 131 ? -26.659 7.953   4.458   1.00 0.00 ? 131 LEU A CA   3  
ATOM 6384  C C    . LEU A 1 131 ? -27.000 6.675   5.233   1.00 0.00 ? 131 LEU A C    3  
ATOM 6385  O O    . LEU A 1 131 ? -27.055 6.671   6.461   1.00 0.00 ? 131 LEU A O    3  
ATOM 6386  C CB   . LEU A 1 131 ? -27.948 8.562   3.893   1.00 0.00 ? 131 LEU A CB   3  
ATOM 6387  C CG   . LEU A 1 131 ? -27.793 9.843   3.069   1.00 0.00 ? 131 LEU A CG   3  
ATOM 6388  C CD1  . LEU A 1 131 ? -29.140 10.303  2.546   1.00 0.00 ? 131 LEU A CD1  3  
ATOM 6389  C CD2  . LEU A 1 131 ? -27.137 10.943  3.890   1.00 0.00 ? 131 LEU A CD2  3  
ATOM 6390  H H    . LEU A 1 131 ? -25.980 7.842   2.445   1.00 0.00 ? 131 LEU A H    3  
ATOM 6391  H HA   . LEU A 1 131 ? -26.206 8.667   5.128   1.00 0.00 ? 131 LEU A HA   3  
ATOM 6392  H HB2  . LEU A 1 131 ? -28.419 7.818   3.267   1.00 0.00 ? 131 LEU A HB2  3  
ATOM 6393  H HB3  . LEU A 1 131 ? -28.607 8.773   4.722   1.00 0.00 ? 131 LEU A HB3  3  
ATOM 6394  H HG   . LEU A 1 131 ? -27.163 9.634   2.217   1.00 0.00 ? 131 LEU A HG   3  
ATOM 6395  H HD11 . LEU A 1 131 ? -29.007 11.200  1.961   1.00 0.00 ? 131 LEU A HD11 3  
ATOM 6396  H HD12 . LEU A 1 131 ? -29.797 10.513  3.376   1.00 0.00 ? 131 LEU A HD12 3  
ATOM 6397  H HD13 . LEU A 1 131 ? -29.573 9.531   1.927   1.00 0.00 ? 131 LEU A HD13 3  
ATOM 6398  H HD21 . LEU A 1 131 ? -27.065 11.840  3.293   1.00 0.00 ? 131 LEU A HD21 3  
ATOM 6399  H HD22 . LEU A 1 131 ? -26.149 10.631  4.195   1.00 0.00 ? 131 LEU A HD22 3  
ATOM 6400  H HD23 . LEU A 1 131 ? -27.736 11.143  4.767   1.00 0.00 ? 131 LEU A HD23 3  
ATOM 6401  N N    . THR A 1 132 ? -27.169 5.595   4.513   1.00 0.00 ? 132 THR A N    3  
ATOM 6402  C CA   . THR A 1 132 ? -27.608 4.346   5.103   1.00 0.00 ? 132 THR A CA   3  
ATOM 6403  C C    . THR A 1 132 ? -26.561 3.238   4.928   1.00 0.00 ? 132 THR A C    3  
ATOM 6404  O O    . THR A 1 132 ? -26.826 2.069   5.212   1.00 0.00 ? 132 THR A O    3  
ATOM 6405  C CB   . THR A 1 132 ? -28.993 3.929   4.511   1.00 0.00 ? 132 THR A CB   3  
ATOM 6406  O OG1  . THR A 1 132 ? -29.454 2.668   5.048   1.00 0.00 ? 132 THR A OG1  3  
ATOM 6407  C CG2  . THR A 1 132 ? -28.920 3.854   2.995   1.00 0.00 ? 132 THR A CG2  3  
ATOM 6408  H H    . THR A 1 132 ? -26.997 5.629   3.547   1.00 0.00 ? 132 THR A H    3  
ATOM 6409  H HA   . THR A 1 132 ? -27.737 4.524   6.160   1.00 0.00 ? 132 THR A HA   3  
ATOM 6410  H HB   . THR A 1 132 ? -29.708 4.691   4.782   1.00 0.00 ? 132 THR A HB   3  
ATOM 6411  H HG1  . THR A 1 132 ? -28.656 2.164   5.272   1.00 0.00 ? 132 THR A HG1  3  
ATOM 6412  H HG21 . THR A 1 132 ? -29.882 3.567   2.598   1.00 0.00 ? 132 THR A HG21 3  
ATOM 6413  H HG22 . THR A 1 132 ? -28.181 3.114   2.723   1.00 0.00 ? 132 THR A HG22 3  
ATOM 6414  H HG23 . THR A 1 132 ? -28.632 4.815   2.598   1.00 0.00 ? 132 THR A HG23 3  
ATOM 6415  N N    . ILE A 1 133 ? -25.391 3.608   4.463   1.00 0.00 ? 133 ILE A N    3  
ATOM 6416  C CA   . ILE A 1 133 ? -24.348 2.635   4.207   1.00 0.00 ? 133 ILE A CA   3  
ATOM 6417  C C    . ILE A 1 133 ? -23.683 2.204   5.541   1.00 0.00 ? 133 ILE A C    3  
ATOM 6418  O O    . ILE A 1 133 ? -23.507 3.017   6.457   1.00 0.00 ? 133 ILE A O    3  
ATOM 6419  C CB   . ILE A 1 133 ? -23.286 3.202   3.202   1.00 0.00 ? 133 ILE A CB   3  
ATOM 6420  C CG1  . ILE A 1 133 ? -22.382 2.089   2.670   1.00 0.00 ? 133 ILE A CG1  3  
ATOM 6421  C CG2  . ILE A 1 133 ? -22.444 4.276   3.861   1.00 0.00 ? 133 ILE A CG2  3  
ATOM 6422  C CD1  . ILE A 1 133 ? -21.318 2.556   1.697   1.00 0.00 ? 133 ILE A CD1  3  
ATOM 6423  H H    . ILE A 1 133 ? -25.211 4.560   4.326   1.00 0.00 ? 133 ILE A H    3  
ATOM 6424  H HA   . ILE A 1 133 ? -24.817 1.765   3.772   1.00 0.00 ? 133 ILE A HA   3  
ATOM 6425  H HB   . ILE A 1 133 ? -23.814 3.651   2.373   1.00 0.00 ? 133 ILE A HB   3  
ATOM 6426  H HG12 . ILE A 1 133 ? -21.879 1.622   3.503   1.00 0.00 ? 133 ILE A HG12 3  
ATOM 6427  H HG13 . ILE A 1 133 ? -22.993 1.353   2.170   1.00 0.00 ? 133 ILE A HG13 3  
ATOM 6428  H HG21 . ILE A 1 133 ? -23.078 5.070   4.225   1.00 0.00 ? 133 ILE A HG21 3  
ATOM 6429  H HG22 . ILE A 1 133 ? -21.739 4.663   3.140   1.00 0.00 ? 133 ILE A HG22 3  
ATOM 6430  H HG23 . ILE A 1 133 ? -21.903 3.837   4.686   1.00 0.00 ? 133 ILE A HG23 3  
ATOM 6431  H HD11 . ILE A 1 133 ? -20.726 1.715   1.369   1.00 0.00 ? 133 ILE A HD11 3  
ATOM 6432  H HD12 . ILE A 1 133 ? -20.680 3.277   2.185   1.00 0.00 ? 133 ILE A HD12 3  
ATOM 6433  H HD13 . ILE A 1 133 ? -21.791 3.017   0.843   1.00 0.00 ? 133 ILE A HD13 3  
ATOM 6434  N N    . THR A 1 134 ? -23.367 0.940   5.645   1.00 0.00 ? 134 THR A N    3  
ATOM 6435  C CA   . THR A 1 134 ? -22.726 0.370   6.815   1.00 0.00 ? 134 THR A CA   3  
ATOM 6436  C C    . THR A 1 134 ? -21.664 -0.612  6.366   1.00 0.00 ? 134 THR A C    3  
ATOM 6437  O O    . THR A 1 134 ? -21.769 -1.142  5.259   1.00 0.00 ? 134 THR A O    3  
ATOM 6438  C CB   . THR A 1 134 ? -23.773 -0.337  7.708   1.00 0.00 ? 134 THR A CB   3  
ATOM 6439  O OG1  . THR A 1 134 ? -24.693 -1.070  6.884   1.00 0.00 ? 134 THR A OG1  3  
ATOM 6440  C CG2  . THR A 1 134 ? -24.540 0.652   8.567   1.00 0.00 ? 134 THR A CG2  3  
ATOM 6441  H H    . THR A 1 134 ? -23.563 0.333   4.898   1.00 0.00 ? 134 THR A H    3  
ATOM 6442  H HA   . THR A 1 134 ? -22.263 1.169   7.375   1.00 0.00 ? 134 THR A HA   3  
ATOM 6443  H HB   . THR A 1 134 ? -23.248 -1.033  8.346   1.00 0.00 ? 134 THR A HB   3  
ATOM 6444  H HG1  . THR A 1 134 ? -24.762 -0.630  6.026   1.00 0.00 ? 134 THR A HG1  3  
ATOM 6445  H HG21 . THR A 1 134 ? -25.050 1.358   7.930   1.00 0.00 ? 134 THR A HG21 3  
ATOM 6446  H HG22 . THR A 1 134 ? -23.851 1.181   9.209   1.00 0.00 ? 134 THR A HG22 3  
ATOM 6447  H HG23 . THR A 1 134 ? -25.264 0.122   9.170   1.00 0.00 ? 134 THR A HG23 3  
ATOM 6448  N N    . SER A 1 135 ? -20.657 -0.853  7.177   1.00 0.00 ? 135 SER A N    3  
ATOM 6449  C CA   . SER A 1 135 ? -19.599 -1.745  6.781   1.00 0.00 ? 135 SER A CA   3  
ATOM 6450  C C    . SER A 1 135 ? -19.306 -2.774  7.874   1.00 0.00 ? 135 SER A C    3  
ATOM 6451  O O    . SER A 1 135 ? -19.203 -2.433  9.058   1.00 0.00 ? 135 SER A O    3  
ATOM 6452  C CB   . SER A 1 135 ? -18.324 -0.930  6.466   1.00 0.00 ? 135 SER A CB   3  
ATOM 6453  O OG   . SER A 1 135 ? -17.296 -1.747  5.931   1.00 0.00 ? 135 SER A OG   3  
ATOM 6454  H H    . SER A 1 135 ? -20.608 -0.437  8.065   1.00 0.00 ? 135 SER A H    3  
ATOM 6455  H HA   . SER A 1 135 ? -19.903 -2.257  5.880   1.00 0.00 ? 135 SER A HA   3  
ATOM 6456  H HB2  . SER A 1 135 ? -18.552 -0.143  5.763   1.00 0.00 ? 135 SER A HB2  3  
ATOM 6457  H HB3  . SER A 1 135 ? -17.959 -0.483  7.377   1.00 0.00 ? 135 SER A HB3  3  
ATOM 6458  H HG   . SER A 1 135 ? -17.695 -2.364  5.311   1.00 0.00 ? 135 SER A HG   3  
ATOM 6459  N N    . SER A 1 136 ? -19.200 -4.007  7.476   1.00 0.00 ? 136 SER A N    3  
ATOM 6460  C CA   . SER A 1 136 ? -18.798 -5.084  8.336   1.00 0.00 ? 136 SER A CA   3  
ATOM 6461  C C    . SER A 1 136 ? -17.528 -5.689  7.761   1.00 0.00 ? 136 SER A C    3  
ATOM 6462  O O    . SER A 1 136 ? -17.469 -5.979  6.566   1.00 0.00 ? 136 SER A O    3  
ATOM 6463  C CB   . SER A 1 136 ? -19.941 -6.096  8.485   1.00 0.00 ? 136 SER A CB   3  
ATOM 6464  O OG   . SER A 1 136 ? -20.671 -6.244  7.257   1.00 0.00 ? 136 SER A OG   3  
ATOM 6465  H H    . SER A 1 136 ? -19.407 -4.230  6.540   1.00 0.00 ? 136 SER A H    3  
ATOM 6466  H HA   . SER A 1 136 ? -18.562 -4.652  9.298   1.00 0.00 ? 136 SER A HA   3  
ATOM 6467  H HB2  . SER A 1 136 ? -19.534 -7.056  8.767   1.00 0.00 ? 136 SER A HB2  3  
ATOM 6468  H HB3  . SER A 1 136 ? -20.619 -5.757  9.254   1.00 0.00 ? 136 SER A HB3  3  
ATOM 6469  H HG   . SER A 1 136 ? -20.100 -6.600  6.560   1.00 0.00 ? 136 SER A HG   3  
ATOM 6470  N N    . LEU A 1 137 ? -16.524 -5.858  8.582   1.00 0.00 ? 137 LEU A N    3  
ATOM 6471  C CA   . LEU A 1 137 ? -15.209 -6.220  8.101   1.00 0.00 ? 137 LEU A CA   3  
ATOM 6472  C C    . LEU A 1 137 ? -14.632 -7.399  8.854   1.00 0.00 ? 137 LEU A C    3  
ATOM 6473  O O    . LEU A 1 137 ? -14.739 -7.484  10.076  1.00 0.00 ? 137 LEU A O    3  
ATOM 6474  C CB   . LEU A 1 137 ? -14.243 -4.992  8.129   1.00 0.00 ? 137 LEU A CB   3  
ATOM 6475  C CG   . LEU A 1 137 ? -13.867 -4.333  9.490   1.00 0.00 ? 137 LEU A CG   3  
ATOM 6476  C CD1  . LEU A 1 137 ? -12.887 -3.209  9.253   1.00 0.00 ? 137 LEU A CD1  3  
ATOM 6477  C CD2  . LEU A 1 137 ? -15.071 -3.778  10.234  1.00 0.00 ? 137 LEU A CD2  3  
ATOM 6478  H H    . LEU A 1 137 ? -16.658 -5.773  9.550   1.00 0.00 ? 137 LEU A H    3  
ATOM 6479  H HA   . LEU A 1 137 ? -15.329 -6.520  7.072   1.00 0.00 ? 137 LEU A HA   3  
ATOM 6480  H HB2  . LEU A 1 137 ? -13.318 -5.301  7.664   1.00 0.00 ? 137 LEU A HB2  3  
ATOM 6481  H HB3  . LEU A 1 137 ? -14.679 -4.229  7.502   1.00 0.00 ? 137 LEU A HB3  3  
ATOM 6482  H HG   . LEU A 1 137 ? -13.379 -5.070  10.111  1.00 0.00 ? 137 LEU A HG   3  
ATOM 6483  H HD11 . LEU A 1 137 ? -13.327 -2.475  8.593   1.00 0.00 ? 137 LEU A HD11 3  
ATOM 6484  H HD12 . LEU A 1 137 ? -11.988 -3.607  8.809   1.00 0.00 ? 137 LEU A HD12 3  
ATOM 6485  H HD13 . LEU A 1 137 ? -12.646 -2.744  10.197  1.00 0.00 ? 137 LEU A HD13 3  
ATOM 6486  H HD21 . LEU A 1 137 ? -15.748 -4.580  10.485  1.00 0.00 ? 137 LEU A HD21 3  
ATOM 6487  H HD22 . LEU A 1 137 ? -15.576 -3.051  9.617   1.00 0.00 ? 137 LEU A HD22 3  
ATOM 6488  H HD23 . LEU A 1 137 ? -14.732 -3.300  11.142  1.00 0.00 ? 137 LEU A HD23 3  
ATOM 6489  N N    . SER A 1 138 ? -14.033 -8.299  8.118   1.00 0.00 ? 138 SER A N    3  
ATOM 6490  C CA   . SER A 1 138 ? -13.465 -9.498  8.669   1.00 0.00 ? 138 SER A CA   3  
ATOM 6491  C C    . SER A 1 138 ? -11.954 -9.344  8.832   1.00 0.00 ? 138 SER A C    3  
ATOM 6492  O O    . SER A 1 138 ? -11.335 -8.409  8.301   1.00 0.00 ? 138 SER A O    3  
ATOM 6493  C CB   . SER A 1 138 ? -13.776 -10.665 7.726   1.00 0.00 ? 138 SER A CB   3  
ATOM 6494  O OG   . SER A 1 138 ? -13.262 -10.419 6.426   1.00 0.00 ? 138 SER A OG   3  
ATOM 6495  H H    . SER A 1 138 ? -13.953 -8.156  7.150   1.00 0.00 ? 138 SER A H    3  
ATOM 6496  H HA   . SER A 1 138 ? -13.920 -9.696  9.627   1.00 0.00 ? 138 SER A HA   3  
ATOM 6497  H HB2  . SER A 1 138 ? -13.316 -11.563 8.110   1.00 0.00 ? 138 SER A HB2  3  
ATOM 6498  H HB3  . SER A 1 138 ? -14.845 -10.802 7.660   1.00 0.00 ? 138 SER A HB3  3  
ATOM 6499  H HG   . SER A 1 138 ? -13.888 -9.862  5.946   1.00 0.00 ? 138 SER A HG   3  
ATOM 6500  N N    . SER A 1 139 ? -11.379 -10.291 9.557   1.00 0.00 ? 139 SER A N    3  
ATOM 6501  C CA   . SER A 1 139 ? -9.963  -10.374 9.859   1.00 0.00 ? 139 SER A CA   3  
ATOM 6502  C C    . SER A 1 139 ? -9.115  -10.659 8.608   1.00 0.00 ? 139 SER A C    3  
ATOM 6503  O O    . SER A 1 139 ? -7.887  -10.604 8.653   1.00 0.00 ? 139 SER A O    3  
ATOM 6504  C CB   . SER A 1 139 ? -9.777  -11.486 10.870  1.00 0.00 ? 139 SER A CB   3  
ATOM 6505  O OG   . SER A 1 139 ? -10.705 -11.327 11.938  1.00 0.00 ? 139 SER A OG   3  
ATOM 6506  H H    . SER A 1 139 ? -11.934 -10.995 9.957   1.00 0.00 ? 139 SER A H    3  
ATOM 6507  H HA   . SER A 1 139 ? -9.653  -9.450  10.322  1.00 0.00 ? 139 SER A HA   3  
ATOM 6508  H HB2  . SER A 1 139 ? -9.944  -12.441 10.393  1.00 0.00 ? 139 SER A HB2  3  
ATOM 6509  H HB3  . SER A 1 139 ? -8.776  -11.448 11.270  1.00 0.00 ? 139 SER A HB3  3  
ATOM 6510  H HG   . SER A 1 139 ? -10.280 -10.738 12.575  1.00 0.00 ? 139 SER A HG   3  
ATOM 6511  N N    . ASP A 1 140 ? -9.777  -11.005 7.520   1.00 0.00 ? 140 ASP A N    3  
ATOM 6512  C CA   . ASP A 1 140 ? -9.100  -11.365 6.285   1.00 0.00 ? 140 ASP A CA   3  
ATOM 6513  C C    . ASP A 1 140 ? -9.260  -10.249 5.237   1.00 0.00 ? 140 ASP A C    3  
ATOM 6514  O O    . ASP A 1 140 ? -9.207  -10.477 4.050   1.00 0.00 ? 140 ASP A O    3  
ATOM 6515  C CB   . ASP A 1 140 ? -9.608  -12.728 5.786   1.00 0.00 ? 140 ASP A CB   3  
ATOM 6516  C CG   . ASP A 1 140 ? -8.776  -13.343 4.665   1.00 0.00 ? 140 ASP A CG   3  
ATOM 6517  O OD1  . ASP A 1 140 ? -7.549  -13.538 4.843   1.00 0.00 ? 140 ASP A OD1  3  
ATOM 6518  O OD2  . ASP A 1 140 ? -9.359  -13.713 3.620   1.00 0.00 ? 140 ASP A OD2  3  
ATOM 6519  H H    . ASP A 1 140 ? -10.757 -11.013 7.538   1.00 0.00 ? 140 ASP A H    3  
ATOM 6520  H HA   . ASP A 1 140 ? -8.049  -11.446 6.521   1.00 0.00 ? 140 ASP A HA   3  
ATOM 6521  H HB2  . ASP A 1 140 ? -9.613  -13.423 6.612   1.00 0.00 ? 140 ASP A HB2  3  
ATOM 6522  H HB3  . ASP A 1 140 ? -10.622 -12.606 5.430   1.00 0.00 ? 140 ASP A HB3  3  
ATOM 6523  N N    . GLY A 1 141 ? -9.580  -9.047  5.720   1.00 0.00 ? 141 GLY A N    3  
ATOM 6524  C CA   . GLY A 1 141 ? -9.613  -7.855  4.861   1.00 0.00 ? 141 GLY A CA   3  
ATOM 6525  C C    . GLY A 1 141 ? -10.878 -7.705  4.023   1.00 0.00 ? 141 GLY A C    3  
ATOM 6526  O O    . GLY A 1 141 ? -11.068 -6.678  3.317   1.00 0.00 ? 141 GLY A O    3  
ATOM 6527  H H    . GLY A 1 141 ? -9.784  -8.962  6.677   1.00 0.00 ? 141 GLY A H    3  
ATOM 6528  H HA2  . GLY A 1 141 ? -9.518  -6.981  5.487   1.00 0.00 ? 141 GLY A HA2  3  
ATOM 6529  H HA3  . GLY A 1 141 ? -8.760  -7.895  4.201   1.00 0.00 ? 141 GLY A HA3  3  
ATOM 6530  N N    . VAL A 1 142 ? -11.729 -8.691  4.078   1.00 0.00 ? 142 VAL A N    3  
ATOM 6531  C CA   . VAL A 1 142 ? -12.966 -8.679  3.335   1.00 0.00 ? 142 VAL A CA   3  
ATOM 6532  C C    . VAL A 1 142 ? -14.012 -7.886  4.109   1.00 0.00 ? 142 VAL A C    3  
ATOM 6533  O O    . VAL A 1 142 ? -14.341 -8.225  5.259   1.00 0.00 ? 142 VAL A O    3  
ATOM 6534  C CB   . VAL A 1 142 ? -13.478 -10.122 3.067   1.00 0.00 ? 142 VAL A CB   3  
ATOM 6535  C CG1  . VAL A 1 142 ? -14.758 -10.114 2.241   1.00 0.00 ? 142 VAL A CG1  3  
ATOM 6536  C CG2  . VAL A 1 142 ? -12.406 -10.947 2.370   1.00 0.00 ? 142 VAL A CG2  3  
ATOM 6537  H H    . VAL A 1 142 ? -11.506 -9.460  4.644   1.00 0.00 ? 142 VAL A H    3  
ATOM 6538  H HA   . VAL A 1 142 ? -12.780 -8.189  2.391   1.00 0.00 ? 142 VAL A HA   3  
ATOM 6539  H HB   . VAL A 1 142 ? -13.694 -10.584 4.018   1.00 0.00 ? 142 VAL A HB   3  
ATOM 6540  H HG11 . VAL A 1 142 ? -14.570 -9.639  1.290   1.00 0.00 ? 142 VAL A HG11 3  
ATOM 6541  H HG12 . VAL A 1 142 ? -15.525 -9.565  2.768   1.00 0.00 ? 142 VAL A HG12 3  
ATOM 6542  H HG13 . VAL A 1 142 ? -15.088 -11.128 2.075   1.00 0.00 ? 142 VAL A HG13 3  
ATOM 6543  H HG21 . VAL A 1 142 ? -12.793 -11.935 2.172   1.00 0.00 ? 142 VAL A HG21 3  
ATOM 6544  H HG22 . VAL A 1 142 ? -11.534 -11.018 3.004   1.00 0.00 ? 142 VAL A HG22 3  
ATOM 6545  H HG23 . VAL A 1 142 ? -12.133 -10.472 1.439   1.00 0.00 ? 142 VAL A HG23 3  
ATOM 6546  N N    . LEU A 1 143 ? -14.507 -6.837  3.513   1.00 0.00 ? 143 LEU A N    3  
ATOM 6547  C CA   . LEU A 1 143 ? -15.479 -6.006  4.155   1.00 0.00 ? 143 LEU A CA   3  
ATOM 6548  C C    . LEU A 1 143 ? -16.655 -5.771  3.261   1.00 0.00 ? 143 LEU A C    3  
ATOM 6549  O O    . LEU A 1 143 ? -16.501 -5.569  2.067   1.00 0.00 ? 143 LEU A O    3  
ATOM 6550  C CB   . LEU A 1 143 ? -14.862 -4.694  4.736   1.00 0.00 ? 143 LEU A CB   3  
ATOM 6551  C CG   . LEU A 1 143 ? -14.326 -3.603  3.786   1.00 0.00 ? 143 LEU A CG   3  
ATOM 6552  C CD1  . LEU A 1 143 ? -15.453 -2.749  3.227   1.00 0.00 ? 143 LEU A CD1  3  
ATOM 6553  C CD2  . LEU A 1 143 ? -13.325 -2.730  4.509   1.00 0.00 ? 143 LEU A CD2  3  
ATOM 6554  H H    . LEU A 1 143 ? -14.265 -6.644  2.580   1.00 0.00 ? 143 LEU A H    3  
ATOM 6555  H HA   . LEU A 1 143 ? -15.846 -6.596  4.982   1.00 0.00 ? 143 LEU A HA   3  
ATOM 6556  H HB2  . LEU A 1 143 ? -15.619 -4.226  5.346   1.00 0.00 ? 143 LEU A HB2  3  
ATOM 6557  H HB3  . LEU A 1 143 ? -14.055 -4.989  5.390   1.00 0.00 ? 143 LEU A HB3  3  
ATOM 6558  H HG   . LEU A 1 143 ? -13.822 -4.076  2.957   1.00 0.00 ? 143 LEU A HG   3  
ATOM 6559  H HD11 . LEU A 1 143 ? -16.107 -3.367  2.629   1.00 0.00 ? 143 LEU A HD11 3  
ATOM 6560  H HD12 . LEU A 1 143 ? -15.048 -1.941  2.638   1.00 0.00 ? 143 LEU A HD12 3  
ATOM 6561  H HD13 . LEU A 1 143 ? -16.017 -2.333  4.049   1.00 0.00 ? 143 LEU A HD13 3  
ATOM 6562  H HD21 . LEU A 1 143 ? -12.492 -3.332  4.839   1.00 0.00 ? 143 LEU A HD21 3  
ATOM 6563  H HD22 . LEU A 1 143 ? -13.799 -2.272  5.365   1.00 0.00 ? 143 LEU A HD22 3  
ATOM 6564  H HD23 . LEU A 1 143 ? -12.970 -1.960  3.841   1.00 0.00 ? 143 LEU A HD23 3  
ATOM 6565  N N    . THR A 1 144 ? -17.802 -5.875  3.805   1.00 0.00 ? 144 THR A N    3  
ATOM 6566  C CA   . THR A 1 144 ? -18.991 -5.661  3.077   1.00 0.00 ? 144 THR A CA   3  
ATOM 6567  C C    . THR A 1 144 ? -19.629 -4.346  3.478   1.00 0.00 ? 144 THR A C    3  
ATOM 6568  O O    . THR A 1 144 ? -19.706 -4.015  4.673   1.00 0.00 ? 144 THR A O    3  
ATOM 6569  C CB   . THR A 1 144 ? -19.956 -6.831  3.292   1.00 0.00 ? 144 THR A CB   3  
ATOM 6570  O OG1  . THR A 1 144 ? -20.013 -7.161  4.698   1.00 0.00 ? 144 THR A OG1  3  
ATOM 6571  C CG2  . THR A 1 144 ? -19.512 -8.051  2.508   1.00 0.00 ? 144 THR A CG2  3  
ATOM 6572  H H    . THR A 1 144 ? -17.877 -6.102  4.760   1.00 0.00 ? 144 THR A H    3  
ATOM 6573  H HA   . THR A 1 144 ? -18.736 -5.622  2.028   1.00 0.00 ? 144 THR A HA   3  
ATOM 6574  H HB   . THR A 1 144 ? -20.936 -6.527  2.953   1.00 0.00 ? 144 THR A HB   3  
ATOM 6575  H HG1  . THR A 1 144 ? -19.742 -8.085  4.784   1.00 0.00 ? 144 THR A HG1  3  
ATOM 6576  H HG21 . THR A 1 144 ? -19.499 -7.814  1.454   1.00 0.00 ? 144 THR A HG21 3  
ATOM 6577  H HG22 . THR A 1 144 ? -20.199 -8.862  2.687   1.00 0.00 ? 144 THR A HG22 3  
ATOM 6578  H HG23 . THR A 1 144 ? -18.521 -8.341  2.822   1.00 0.00 ? 144 THR A HG23 3  
ATOM 6579  N N    . VAL A 1 145 ? -20.016 -3.582  2.506   1.00 0.00 ? 145 VAL A N    3  
ATOM 6580  C CA   . VAL A 1 145 ? -20.718 -2.363  2.741   1.00 0.00 ? 145 VAL A CA   3  
ATOM 6581  C C    . VAL A 1 145 ? -22.142 -2.533  2.234   1.00 0.00 ? 145 VAL A C    3  
ATOM 6582  O O    . VAL A 1 145 ? -22.357 -2.843  1.075   1.00 0.00 ? 145 VAL A O    3  
ATOM 6583  C CB   . VAL A 1 145 ? -20.005 -1.118  2.094   1.00 0.00 ? 145 VAL A CB   3  
ATOM 6584  C CG1  . VAL A 1 145 ? -18.740 -0.778  2.850   1.00 0.00 ? 145 VAL A CG1  3  
ATOM 6585  C CG2  . VAL A 1 145 ? -19.650 -1.370  0.639   1.00 0.00 ? 145 VAL A CG2  3  
ATOM 6586  H H    . VAL A 1 145 ? -19.854 -3.854  1.572   1.00 0.00 ? 145 VAL A H    3  
ATOM 6587  H HA   . VAL A 1 145 ? -20.766 -2.232  3.813   1.00 0.00 ? 145 VAL A HA   3  
ATOM 6588  H HB   . VAL A 1 145 ? -20.677 -0.276  2.146   1.00 0.00 ? 145 VAL A HB   3  
ATOM 6589  H HG11 . VAL A 1 145 ? -18.994 -0.546  3.873   1.00 0.00 ? 145 VAL A HG11 3  
ATOM 6590  H HG12 . VAL A 1 145 ? -18.263 0.076   2.394   1.00 0.00 ? 145 VAL A HG12 3  
ATOM 6591  H HG13 . VAL A 1 145 ? -18.067 -1.623  2.830   1.00 0.00 ? 145 VAL A HG13 3  
ATOM 6592  H HG21 . VAL A 1 145 ? -20.566 -1.556  0.100   1.00 0.00 ? 145 VAL A HG21 3  
ATOM 6593  H HG22 . VAL A 1 145 ? -19.004 -2.233  0.564   1.00 0.00 ? 145 VAL A HG22 3  
ATOM 6594  H HG23 . VAL A 1 145 ? -19.150 -0.504  0.231   1.00 0.00 ? 145 VAL A HG23 3  
ATOM 6595  N N    . ASN A 1 146 ? -23.098 -2.363  3.096   1.00 0.00 ? 146 ASN A N    3  
ATOM 6596  C CA   . ASN A 1 146 ? -24.487 -2.613  2.734   1.00 0.00 ? 146 ASN A CA   3  
ATOM 6597  C C    . ASN A 1 146 ? -25.370 -1.534  3.280   1.00 0.00 ? 146 ASN A C    3  
ATOM 6598  O O    . ASN A 1 146 ? -24.931 -0.740  4.125   1.00 0.00 ? 146 ASN A O    3  
ATOM 6599  C CB   . ASN A 1 146 ? -24.970 -3.980  3.264   1.00 0.00 ? 146 ASN A CB   3  
ATOM 6600  C CG   . ASN A 1 146 ? -25.094 -4.044  4.784   1.00 0.00 ? 146 ASN A CG   3  
ATOM 6601  O OD1  . ASN A 1 146 ? -26.144 -3.710  5.353   1.00 0.00 ? 146 ASN A OD1  3  
ATOM 6602  N ND2  . ASN A 1 146 ? -24.069 -4.511  5.444   1.00 0.00 ? 146 ASN A ND2  3  
ATOM 6603  H H    . ASN A 1 146 ? -22.873 -2.040  3.997   1.00 0.00 ? 146 ASN A H    3  
ATOM 6604  H HA   . ASN A 1 146 ? -24.563 -2.615  1.659   1.00 0.00 ? 146 ASN A HA   3  
ATOM 6605  H HB2  . ASN A 1 146 ? -25.939 -4.192  2.839   1.00 0.00 ? 146 ASN A HB2  3  
ATOM 6606  H HB3  . ASN A 1 146 ? -24.275 -4.741  2.944   1.00 0.00 ? 146 ASN A HB3  3  
ATOM 6607  H HD21 . ASN A 1 146 ? -23.277 -4.807  4.944   1.00 0.00 ? 146 ASN A HD21 3  
ATOM 6608  H HD22 . ASN A 1 146 ? -24.125 -4.566  6.421   1.00 0.00 ? 146 ASN A HD22 3  
ATOM 6609  N N    . GLY A 1 147 ? -26.583 -1.461  2.778   1.00 0.00 ? 147 GLY A N    3  
ATOM 6610  C CA   . GLY A 1 147 ? -27.510 -0.487  3.293   1.00 0.00 ? 147 GLY A CA   3  
ATOM 6611  C C    . GLY A 1 147 ? -28.163 0.390   2.225   1.00 0.00 ? 147 GLY A C    3  
ATOM 6612  O O    . GLY A 1 147 ? -29.386 0.547   2.244   1.00 0.00 ? 147 GLY A O    3  
ATOM 6613  H H    . GLY A 1 147 ? -26.830 -2.032  2.016   1.00 0.00 ? 147 GLY A H    3  
ATOM 6614  H HA2  . GLY A 1 147 ? -28.290 -1.008  3.832   1.00 0.00 ? 147 GLY A HA2  3  
ATOM 6615  H HA3  . GLY A 1 147 ? -26.982 0.150   3.988   1.00 0.00 ? 147 GLY A HA3  3  
ATOM 6616  N N    . PRO A 1 148 ? -27.384 0.998   1.277   1.00 0.00 ? 148 PRO A N    3  
ATOM 6617  C CA   . PRO A 1 148 ? -27.922 1.907   0.253   1.00 0.00 ? 148 PRO A CA   3  
ATOM 6618  C C    . PRO A 1 148 ? -28.920 1.276   -0.706  1.00 0.00 ? 148 PRO A C    3  
ATOM 6619  O O    . PRO A 1 148 ? -29.115 0.068   -0.735  1.00 0.00 ? 148 PRO A O    3  
ATOM 6620  C CB   . PRO A 1 148 ? -26.678 2.343   -0.500  1.00 0.00 ? 148 PRO A CB   3  
ATOM 6621  C CG   . PRO A 1 148 ? -25.719 1.247   -0.300  1.00 0.00 ? 148 PRO A CG   3  
ATOM 6622  C CD   . PRO A 1 148 ? -25.916 0.865   1.111   1.00 0.00 ? 148 PRO A CD   3  
ATOM 6623  H HA   . PRO A 1 148 ? -28.379 2.780   0.696   1.00 0.00 ? 148 PRO A HA   3  
ATOM 6624  H HB2  . PRO A 1 148 ? -26.897 2.522   -1.543  1.00 0.00 ? 148 PRO A HB2  3  
ATOM 6625  H HB3  . PRO A 1 148 ? -26.329 3.239   -0.013  1.00 0.00 ? 148 PRO A HB3  3  
ATOM 6626  H HG2  . PRO A 1 148 ? -25.950 0.423   -0.958  1.00 0.00 ? 148 PRO A HG2  3  
ATOM 6627  H HG3  . PRO A 1 148 ? -24.708 1.594   -0.459  1.00 0.00 ? 148 PRO A HG3  3  
ATOM 6628  H HD2  . PRO A 1 148 ? -25.591 -0.150  1.283   1.00 0.00 ? 148 PRO A HD2  3  
ATOM 6629  H HD3  . PRO A 1 148 ? -25.397 1.550   1.764   1.00 0.00 ? 148 PRO A HD3  3  
ATOM 6630  N N    . ARG A 1 149 ? -29.541 2.129   -1.464  1.00 0.00 ? 149 ARG A N    3  
ATOM 6631  C CA   . ARG A 1 149 ? -30.520 1.769   -2.459  1.00 0.00 ? 149 ARG A CA   3  
ATOM 6632  C C    . ARG A 1 149 ? -29.855 1.940   -3.805  1.00 0.00 ? 149 ARG A C    3  
ATOM 6633  O O    . ARG A 1 149 ? -28.889 2.719   -3.919  1.00 0.00 ? 149 ARG A O    3  
ATOM 6634  C CB   . ARG A 1 149 ? -31.696 2.752   -2.378  1.00 0.00 ? 149 ARG A CB   3  
ATOM 6635  C CG   . ARG A 1 149 ? -31.246 4.170   -2.666  1.00 0.00 ? 149 ARG A CG   3  
ATOM 6636  C CD   . ARG A 1 149 ? -32.328 5.204   -2.593  1.00 0.00 ? 149 ARG A CD   3  
ATOM 6637  N NE   . ARG A 1 149 ? -31.734 6.508   -2.875  1.00 0.00 ? 149 ARG A NE   3  
ATOM 6638  C CZ   . ARG A 1 149 ? -32.379 7.631   -3.132  1.00 0.00 ? 149 ARG A CZ   3  
ATOM 6639  N NH1  . ARG A 1 149 ? -33.698 7.689   -3.026  1.00 0.00 ? 149 ARG A NH1  3  
ATOM 6640  N NH2  . ARG A 1 149 ? -31.692 8.715   -3.465  1.00 0.00 ? 149 ARG A NH2  3  
ATOM 6641  H H    . ARG A 1 149 ? -29.302 3.077   -1.415  1.00 0.00 ? 149 ARG A H    3  
ATOM 6642  H HA   . ARG A 1 149 ? -30.869 0.758   -2.308  1.00 0.00 ? 149 ARG A HA   3  
ATOM 6643  H HB2  . ARG A 1 149 ? -32.451 2.467   -3.097  1.00 0.00 ? 149 ARG A HB2  3  
ATOM 6644  H HB3  . ARG A 1 149 ? -32.113 2.723   -1.381  1.00 0.00 ? 149 ARG A HB3  3  
ATOM 6645  H HG2  . ARG A 1 149 ? -30.484 4.441   -1.951  1.00 0.00 ? 149 ARG A HG2  3  
ATOM 6646  H HG3  . ARG A 1 149 ? -30.811 4.182   -3.654  1.00 0.00 ? 149 ARG A HG3  3  
ATOM 6647  H HD2  . ARG A 1 149 ? -33.093 4.979   -3.322  1.00 0.00 ? 149 ARG A HD2  3  
ATOM 6648  H HD3  . ARG A 1 149 ? -32.749 5.219   -1.600  1.00 0.00 ? 149 ARG A HD3  3  
ATOM 6649  H HE   . ARG A 1 149 ? -30.739 6.482   -2.886  1.00 0.00 ? 149 ARG A HE   3  
ATOM 6650  H HH11 . ARG A 1 149 ? -34.248 6.897   -2.749  1.00 0.00 ? 149 ARG A HH11 3  
ATOM 6651  H HH12 . ARG A 1 149 ? -34.214 8.524   -3.231  1.00 0.00 ? 149 ARG A HH12 3  
ATOM 6652  H HH21 . ARG A 1 149 ? -30.691 8.691   -3.529  1.00 0.00 ? 149 ARG A HH21 3  
ATOM 6653  H HH22 . ARG A 1 149 ? -32.142 9.587   -3.666  1.00 0.00 ? 149 ARG A HH22 3  
ATOM 6654  N N    . LYS A 1 150 ? -30.310 1.244   -4.785  1.00 0.00 ? 150 LYS A N    3  
ATOM 6655  C CA   . LYS A 1 150 ? -29.780 1.429   -6.089  1.00 0.00 ? 150 LYS A CA   3  
ATOM 6656  C C    . LYS A 1 150 ? -30.865 1.990   -6.992  1.00 0.00 ? 150 LYS A C    3  
ATOM 6657  O O    . LYS A 1 150 ? -31.752 1.220   -7.435  1.00 0.00 ? 150 LYS A O    3  
ATOM 6658  C CB   . LYS A 1 150 ? -29.177 0.146   -6.649  1.00 0.00 ? 150 LYS A CB   3  
ATOM 6659  C CG   . LYS A 1 150 ? -28.573 0.336   -8.021  1.00 0.00 ? 150 LYS A CG   3  
ATOM 6660  C CD   . LYS A 1 150 ? -27.776 -0.858  -8.448  1.00 0.00 ? 150 LYS A CD   3  
ATOM 6661  C CE   . LYS A 1 150 ? -27.185 -0.637  -9.821  1.00 0.00 ? 150 LYS A CE   3  
ATOM 6662  N NZ   . LYS A 1 150 ? -26.203 -1.671  -10.148 1.00 0.00 ? 150 LYS A NZ   3  
ATOM 6663  H H    . LYS A 1 150 ? -31.043 0.597   -4.681  1.00 0.00 ? 150 LYS A H    3  
ATOM 6664  H HA   . LYS A 1 150 ? -29.006 2.178   -6.003  1.00 0.00 ? 150 LYS A HA   3  
ATOM 6665  H HB2  . LYS A 1 150 ? -28.405 -0.201  -5.978  1.00 0.00 ? 150 LYS A HB2  3  
ATOM 6666  H HB3  . LYS A 1 150 ? -29.951 -0.604  -6.719  1.00 0.00 ? 150 LYS A HB3  3  
ATOM 6667  H HG2  . LYS A 1 150 ? -29.364 0.505   -8.737  1.00 0.00 ? 150 LYS A HG2  3  
ATOM 6668  H HG3  . LYS A 1 150 ? -27.927 1.202   -7.999  1.00 0.00 ? 150 LYS A HG3  3  
ATOM 6669  H HD2  . LYS A 1 150 ? -26.977 -1.021  -7.740  1.00 0.00 ? 150 LYS A HD2  3  
ATOM 6670  H HD3  . LYS A 1 150 ? -28.423 -1.722  -8.475  1.00 0.00 ? 150 LYS A HD3  3  
ATOM 6671  H HE2  . LYS A 1 150 ? -27.972 -0.642  -10.559 1.00 0.00 ? 150 LYS A HE2  3  
ATOM 6672  H HE3  . LYS A 1 150 ? -26.697 0.325   -9.828  1.00 0.00 ? 150 LYS A HE3  3  
ATOM 6673  H HZ1  . LYS A 1 150 ? -25.392 -1.549  -9.503  1.00 0.00 ? 150 LYS A HZ1  3  
ATOM 6674  H HZ2  . LYS A 1 150 ? -25.863 -1.572  -11.125 1.00 0.00 ? 150 LYS A HZ2  3  
ATOM 6675  H HZ3  . LYS A 1 150 ? -26.609 -2.620  -10.033 1.00 0.00 ? 150 LYS A HZ3  3  
ATOM 6676  N N    . ARG B 1 69  ? 35.321  1.250   13.345  1.00 0.00 ? 69  ARG B N    3  
ATOM 6677  C CA   . ARG B 1 69  ? 36.003  1.518   12.123  1.00 0.00 ? 69  ARG B CA   3  
ATOM 6678  C C    . ARG B 1 69  ? 35.007  1.494   10.977  1.00 0.00 ? 69  ARG B C    3  
ATOM 6679  O O    . ARG B 1 69  ? 34.808  0.465   10.312  1.00 0.00 ? 69  ARG B O    3  
ATOM 6680  C CB   . ARG B 1 69  ? 37.094  0.469   11.922  1.00 0.00 ? 69  ARG B CB   3  
ATOM 6681  C CG   . ARG B 1 69  ? 38.070  0.755   10.795  1.00 0.00 ? 69  ARG B CG   3  
ATOM 6682  C CD   . ARG B 1 69  ? 39.048  -0.394  10.641  1.00 0.00 ? 69  ARG B CD   3  
ATOM 6683  N NE   . ARG B 1 69  ? 39.699  -0.743  11.911  1.00 0.00 ? 69  ARG B NE   3  
ATOM 6684  C CZ   . ARG B 1 69  ? 40.359  -1.883  12.144  1.00 0.00 ? 69  ARG B CZ   3  
ATOM 6685  N NH1  . ARG B 1 69  ? 40.681  -2.685  11.138  1.00 0.00 ? 69  ARG B NH1  3  
ATOM 6686  N NH2  . ARG B 1 69  ? 40.729  -2.190  13.381  1.00 0.00 ? 69  ARG B NH2  3  
ATOM 6687  H H    . ARG B 1 69  ? 35.231  0.319   13.643  1.00 0.00 ? 69  ARG B H    3  
ATOM 6688  H HA   . ARG B 1 69  ? 36.459  2.494   12.184  1.00 0.00 ? 69  ARG B HA   3  
ATOM 6689  H HB2  . ARG B 1 69  ? 37.664  0.391   12.837  1.00 0.00 ? 69  ARG B HB2  3  
ATOM 6690  H HB3  . ARG B 1 69  ? 36.624  -0.483  11.731  1.00 0.00 ? 69  ARG B HB3  3  
ATOM 6691  H HG2  . ARG B 1 69  ? 37.521  0.883   9.874   1.00 0.00 ? 69  ARG B HG2  3  
ATOM 6692  H HG3  . ARG B 1 69  ? 38.620  1.657   11.023  1.00 0.00 ? 69  ARG B HG3  3  
ATOM 6693  H HD2  . ARG B 1 69  ? 38.522  -1.260  10.268  1.00 0.00 ? 69  ARG B HD2  3  
ATOM 6694  H HD3  . ARG B 1 69  ? 39.810  -0.104  9.933   1.00 0.00 ? 69  ARG B HD3  3  
ATOM 6695  H HE   . ARG B 1 69  ? 39.564  -0.081  12.632  1.00 0.00 ? 69  ARG B HE   3  
ATOM 6696  H HH11 . ARG B 1 69  ? 40.444  -2.472  10.186  1.00 0.00 ? 69  ARG B HH11 3  
ATOM 6697  H HH12 . ARG B 1 69  ? 41.179  -3.544  11.289  1.00 0.00 ? 69  ARG B HH12 3  
ATOM 6698  H HH21 . ARG B 1 69  ? 40.527  -1.593  14.164  1.00 0.00 ? 69  ARG B HH21 3  
ATOM 6699  H HH22 . ARG B 1 69  ? 41.206  -3.042  13.617  1.00 0.00 ? 69  ARG B HH22 3  
ATOM 6700  N N    . LEU B 1 70  ? 34.343  2.604   10.794  1.00 0.00 ? 70  LEU B N    3  
ATOM 6701  C CA   . LEU B 1 70  ? 33.385  2.760   9.720   1.00 0.00 ? 70  LEU B CA   3  
ATOM 6702  C C    . LEU B 1 70  ? 34.110  3.148   8.433   1.00 0.00 ? 70  LEU B C    3  
ATOM 6703  O O    . LEU B 1 70  ? 35.365  3.121   8.381   1.00 0.00 ? 70  LEU B O    3  
ATOM 6704  C CB   . LEU B 1 70  ? 32.305  3.820   10.065  1.00 0.00 ? 70  LEU B CB   3  
ATOM 6705  C CG   . LEU B 1 70  ? 31.215  3.464   11.110  1.00 0.00 ? 70  LEU B CG   3  
ATOM 6706  C CD1  . LEU B 1 70  ? 30.439  2.222   10.714  1.00 0.00 ? 70  LEU B CD1  3  
ATOM 6707  C CD2  . LEU B 1 70  ? 31.772  3.337   12.515  1.00 0.00 ? 70  LEU B CD2  3  
ATOM 6708  H H    . LEU B 1 70  ? 34.509  3.356   11.401  1.00 0.00 ? 70  LEU B H    3  
ATOM 6709  H HA   . LEU B 1 70  ? 32.905  1.806   9.564   1.00 0.00 ? 70  LEU B HA   3  
ATOM 6710  H HB2  . LEU B 1 70  ? 32.811  4.702   10.423  1.00 0.00 ? 70  LEU B HB2  3  
ATOM 6711  H HB3  . LEU B 1 70  ? 31.811  4.075   9.140   1.00 0.00 ? 70  LEU B HB3  3  
ATOM 6712  H HG   . LEU B 1 70  ? 30.501  4.274   11.103  1.00 0.00 ? 70  LEU B HG   3  
ATOM 6713  H HD11 . LEU B 1 70  ? 31.109  1.376   10.666  1.00 0.00 ? 70  LEU B HD11 3  
ATOM 6714  H HD12 . LEU B 1 70  ? 29.986  2.376   9.747   1.00 0.00 ? 70  LEU B HD12 3  
ATOM 6715  H HD13 . LEU B 1 70  ? 29.668  2.031   11.446  1.00 0.00 ? 70  LEU B HD13 3  
ATOM 6716  H HD21 . LEU B 1 70  ? 32.213  4.276   12.815  1.00 0.00 ? 70  LEU B HD21 3  
ATOM 6717  H HD22 . LEU B 1 70  ? 32.528  2.564   12.534  1.00 0.00 ? 70  LEU B HD22 3  
ATOM 6718  H HD23 . LEU B 1 70  ? 30.976  3.077   13.197  1.00 0.00 ? 70  LEU B HD23 3  
ATOM 6719  N N    . GLU B 1 71  ? 33.325  3.495   7.409   1.00 0.00 ? 71  GLU B N    3  
ATOM 6720  C CA   . GLU B 1 71  ? 33.786  3.913   6.076   1.00 0.00 ? 71  GLU B CA   3  
ATOM 6721  C C    . GLU B 1 71  ? 34.423  2.702   5.390   1.00 0.00 ? 71  GLU B C    3  
ATOM 6722  O O    . GLU B 1 71  ? 35.324  2.849   4.555   1.00 0.00 ? 71  GLU B O    3  
ATOM 6723  C CB   . GLU B 1 71  ? 34.854  5.040   6.153   1.00 0.00 ? 71  GLU B CB   3  
ATOM 6724  C CG   . GLU B 1 71  ? 34.595  6.172   7.154   1.00 0.00 ? 71  GLU B CG   3  
ATOM 6725  C CD   . GLU B 1 71  ? 33.479  7.109   6.811   1.00 0.00 ? 71  GLU B CD   3  
ATOM 6726  O OE1  . GLU B 1 71  ? 32.313  6.816   7.127   1.00 0.00 ? 71  GLU B OE1  3  
ATOM 6727  O OE2  . GLU B 1 71  ? 33.775  8.218   6.309   1.00 0.00 ? 71  GLU B OE2  3  
ATOM 6728  H H    . GLU B 1 71  ? 32.345  3.423   7.525   1.00 0.00 ? 71  GLU B H    3  
ATOM 6729  H HA   . GLU B 1 71  ? 32.932  4.248   5.507   1.00 0.00 ? 71  GLU B HA   3  
ATOM 6730  H HB2  . GLU B 1 71  ? 35.799  4.589   6.415   1.00 0.00 ? 71  GLU B HB2  3  
ATOM 6731  H HB3  . GLU B 1 71  ? 34.951  5.476   5.170   1.00 0.00 ? 71  GLU B HB3  3  
ATOM 6732  H HG2  . GLU B 1 71  ? 34.360  5.726   8.109   1.00 0.00 ? 71  GLU B HG2  3  
ATOM 6733  H HG3  . GLU B 1 71  ? 35.508  6.741   7.257   1.00 0.00 ? 71  GLU B HG3  3  
ATOM 6734  N N    . LYS B 1 72  ? 33.966  1.509   5.735   1.00 0.00 ? 72  LYS B N    3  
ATOM 6735  C CA   . LYS B 1 72  ? 34.636  0.310   5.287   1.00 0.00 ? 72  LYS B CA   3  
ATOM 6736  C C    . LYS B 1 72  ? 33.685  -0.679  4.620   1.00 0.00 ? 72  LYS B C    3  
ATOM 6737  O O    . LYS B 1 72  ? 32.485  -0.723  4.937   1.00 0.00 ? 72  LYS B O    3  
ATOM 6738  C CB   . LYS B 1 72  ? 35.327  -0.356  6.497   1.00 0.00 ? 72  LYS B CB   3  
ATOM 6739  C CG   . LYS B 1 72  ? 36.241  -1.528  6.162   1.00 0.00 ? 72  LYS B CG   3  
ATOM 6740  C CD   . LYS B 1 72  ? 36.882  -2.101  7.412   1.00 0.00 ? 72  LYS B CD   3  
ATOM 6741  C CE   . LYS B 1 72  ? 37.852  -3.233  7.091   1.00 0.00 ? 72  LYS B CE   3  
ATOM 6742  N NZ   . LYS B 1 72  ? 37.199  -4.369  6.410   1.00 0.00 ? 72  LYS B NZ   3  
ATOM 6743  H H    . LYS B 1 72  ? 33.152  1.427   6.288   1.00 0.00 ? 72  LYS B H    3  
ATOM 6744  H HA   . LYS B 1 72  ? 35.408  0.593   4.587   1.00 0.00 ? 72  LYS B HA   3  
ATOM 6745  H HB2  . LYS B 1 72  ? 35.906  0.386   7.027   1.00 0.00 ? 72  LYS B HB2  3  
ATOM 6746  H HB3  . LYS B 1 72  ? 34.556  -0.715  7.162   1.00 0.00 ? 72  LYS B HB3  3  
ATOM 6747  H HG2  . LYS B 1 72  ? 35.662  -2.299  5.677   1.00 0.00 ? 72  LYS B HG2  3  
ATOM 6748  H HG3  . LYS B 1 72  ? 37.015  -1.186  5.490   1.00 0.00 ? 72  LYS B HG3  3  
ATOM 6749  H HD2  . LYS B 1 72  ? 37.414  -1.318  7.929   1.00 0.00 ? 72  LYS B HD2  3  
ATOM 6750  H HD3  . LYS B 1 72  ? 36.096  -2.486  8.045   1.00 0.00 ? 72  LYS B HD3  3  
ATOM 6751  H HE2  . LYS B 1 72  ? 38.636  -2.853  6.454   1.00 0.00 ? 72  LYS B HE2  3  
ATOM 6752  H HE3  . LYS B 1 72  ? 38.289  -3.581  8.015   1.00 0.00 ? 72  LYS B HE3  3  
ATOM 6753  H HZ1  . LYS B 1 72  ? 36.418  -4.766  6.972   1.00 0.00 ? 72  LYS B HZ1  3  
ATOM 6754  H HZ2  . LYS B 1 72  ? 37.888  -5.134  6.259   1.00 0.00 ? 72  LYS B HZ2  3  
ATOM 6755  H HZ3  . LYS B 1 72  ? 36.825  -4.116  5.474   1.00 0.00 ? 72  LYS B HZ3  3  
ATOM 6756  N N    . ASP B 1 73  ? 34.251  -1.446  3.674   1.00 0.00 ? 73  ASP B N    3  
ATOM 6757  C CA   . ASP B 1 73  ? 33.602  -2.583  2.994   1.00 0.00 ? 73  ASP B CA   3  
ATOM 6758  C C    . ASP B 1 73  ? 32.467  -2.106  2.080   1.00 0.00 ? 73  ASP B C    3  
ATOM 6759  O O    . ASP B 1 73  ? 32.216  -0.904  1.951   1.00 0.00 ? 73  ASP B O    3  
ATOM 6760  C CB   . ASP B 1 73  ? 33.088  -3.595  4.046   1.00 0.00 ? 73  ASP B CB   3  
ATOM 6761  C CG   . ASP B 1 73  ? 32.976  -5.019  3.535   1.00 0.00 ? 73  ASP B CG   3  
ATOM 6762  O OD1  . ASP B 1 73  ? 32.002  -5.353  2.855   1.00 0.00 ? 73  ASP B OD1  3  
ATOM 6763  O OD2  . ASP B 1 73  ? 33.881  -5.839  3.837   1.00 0.00 ? 73  ASP B OD2  3  
ATOM 6764  H H    . ASP B 1 73  ? 35.165  -1.228  3.392   1.00 0.00 ? 73  ASP B H    3  
ATOM 6765  H HA   . ASP B 1 73  ? 34.350  -3.065  2.382   1.00 0.00 ? 73  ASP B HA   3  
ATOM 6766  H HB2  . ASP B 1 73  ? 33.762  -3.594  4.889   1.00 0.00 ? 73  ASP B HB2  3  
ATOM 6767  H HB3  . ASP B 1 73  ? 32.113  -3.274  4.382   1.00 0.00 ? 73  ASP B HB3  3  
ATOM 6768  N N    . ARG B 1 74  ? 31.851  -3.020  1.399   1.00 0.00 ? 74  ARG B N    3  
ATOM 6769  C CA   . ARG B 1 74  ? 30.744  -2.721  0.553   1.00 0.00 ? 74  ARG B CA   3  
ATOM 6770  C C    . ARG B 1 74  ? 29.544  -3.342  1.134   1.00 0.00 ? 74  ARG B C    3  
ATOM 6771  O O    . ARG B 1 74  ? 29.467  -4.568  1.287   1.00 0.00 ? 74  ARG B O    3  
ATOM 6772  C CB   . ARG B 1 74  ? 30.945  -3.164  -0.890  1.00 0.00 ? 74  ARG B CB   3  
ATOM 6773  C CG   . ARG B 1 74  ? 31.864  -2.261  -1.682  1.00 0.00 ? 74  ARG B CG   3  
ATOM 6774  C CD   . ARG B 1 74  ? 31.946  -2.688  -3.134  1.00 0.00 ? 74  ARG B CD   3  
ATOM 6775  N NE   . ARG B 1 74  ? 30.618  -2.781  -3.770  1.00 0.00 ? 74  ARG B NE   3  
ATOM 6776  C CZ   . ARG B 1 74  ? 30.302  -2.334  -4.994  1.00 0.00 ? 74  ARG B CZ   3  
ATOM 6777  N NH1  . ARG B 1 74  ? 31.199  -1.670  -5.723  1.00 0.00 ? 74  ARG B NH1  3  
ATOM 6778  N NH2  . ARG B 1 74  ? 29.082  -2.567  -5.480  1.00 0.00 ? 74  ARG B NH2  3  
ATOM 6779  H H    . ARG B 1 74  ? 32.099  -3.963  1.522   1.00 0.00 ? 74  ARG B H    3  
ATOM 6780  H HA   . ARG B 1 74  ? 30.609  -1.648  0.581   1.00 0.00 ? 74  ARG B HA   3  
ATOM 6781  H HB2  . ARG B 1 74  ? 31.361  -4.161  -0.891  1.00 0.00 ? 74  ARG B HB2  3  
ATOM 6782  H HB3  . ARG B 1 74  ? 29.983  -3.186  -1.381  1.00 0.00 ? 74  ARG B HB3  3  
ATOM 6783  H HG2  . ARG B 1 74  ? 31.485  -1.251  -1.634  1.00 0.00 ? 74  ARG B HG2  3  
ATOM 6784  H HG3  . ARG B 1 74  ? 32.851  -2.299  -1.244  1.00 0.00 ? 74  ARG B HG3  3  
ATOM 6785  H HD2  . ARG B 1 74  ? 32.538  -1.961  -3.669  1.00 0.00 ? 74  ARG B HD2  3  
ATOM 6786  H HD3  . ARG B 1 74  ? 32.427  -3.651  -3.183  1.00 0.00 ? 74  ARG B HD3  3  
ATOM 6787  H HE   . ARG B 1 74  ? 29.937  -3.257  -3.243  1.00 0.00 ? 74  ARG B HE   3  
ATOM 6788  H HH11 . ARG B 1 74  ? 32.129  -1.488  -5.390  1.00 0.00 ? 74  ARG B HH11 3  
ATOM 6789  H HH12 . ARG B 1 74  ? 30.992  -1.301  -6.632  1.00 0.00 ? 74  ARG B HH12 3  
ATOM 6790  H HH21 . ARG B 1 74  ? 28.400  -3.078  -4.949  1.00 0.00 ? 74  ARG B HH21 3  
ATOM 6791  H HH22 . ARG B 1 74  ? 28.769  -2.249  -6.380  1.00 0.00 ? 74  ARG B HH22 3  
ATOM 6792  N N    . PHE B 1 75  ? 28.612  -2.537  1.436   1.00 0.00 ? 75  PHE B N    3  
ATOM 6793  C CA   . PHE B 1 75  ? 27.487  -2.967  2.130   1.00 0.00 ? 75  PHE B CA   3  
ATOM 6794  C C    . PHE B 1 75  ? 26.312  -3.051  1.186   1.00 0.00 ? 75  PHE B C    3  
ATOM 6795  O O    . PHE B 1 75  ? 26.260  -2.355  0.143   1.00 0.00 ? 75  PHE B O    3  
ATOM 6796  C CB   . PHE B 1 75  ? 27.207  -1.999  3.280   1.00 0.00 ? 75  PHE B CB   3  
ATOM 6797  C CG   . PHE B 1 75  ? 26.322  -2.576  4.323   1.00 0.00 ? 75  PHE B CG   3  
ATOM 6798  C CD1  . PHE B 1 75  ? 26.845  -3.453  5.248   1.00 0.00 ? 75  PHE B CD1  3  
ATOM 6799  C CD2  . PHE B 1 75  ? 24.976  -2.258  4.380   1.00 0.00 ? 75  PHE B CD2  3  
ATOM 6800  C CE1  . PHE B 1 75  ? 26.038  -4.012  6.218   1.00 0.00 ? 75  PHE B CE1  3  
ATOM 6801  C CE2  . PHE B 1 75  ? 24.167  -2.812  5.346   1.00 0.00 ? 75  PHE B CE2  3  
ATOM 6802  C CZ   . PHE B 1 75  ? 24.698  -3.690  6.267   1.00 0.00 ? 75  PHE B CZ   3  
ATOM 6803  H H    . PHE B 1 75  ? 28.676  -1.589  1.167   1.00 0.00 ? 75  PHE B H    3  
ATOM 6804  H HA   . PHE B 1 75  ? 27.693  -3.940  2.551   1.00 0.00 ? 75  PHE B HA   3  
ATOM 6805  H HB2  . PHE B 1 75  ? 28.140  -1.723  3.750   1.00 0.00 ? 75  PHE B HB2  3  
ATOM 6806  H HB3  . PHE B 1 75  ? 26.733  -1.112  2.887   1.00 0.00 ? 75  PHE B HB3  3  
ATOM 6807  H HD1  . PHE B 1 75  ? 27.895  -3.705  5.209   1.00 0.00 ? 75  PHE B HD1  3  
ATOM 6808  H HD2  . PHE B 1 75  ? 24.562  -1.570  3.658   1.00 0.00 ? 75  PHE B HD2  3  
ATOM 6809  H HE1  . PHE B 1 75  ? 26.454  -4.700  6.940   1.00 0.00 ? 75  PHE B HE1  3  
ATOM 6810  H HE2  . PHE B 1 75  ? 23.119  -2.559  5.380   1.00 0.00 ? 75  PHE B HE2  3  
ATOM 6811  H HZ   . PHE B 1 75  ? 24.065  -4.126  7.026   1.00 0.00 ? 75  PHE B HZ   3  
ATOM 6812  N N    . SER B 1 76  ? 25.427  -3.941  1.494   1.00 0.00 ? 76  SER B N    3  
ATOM 6813  C CA   . SER B 1 76  ? 24.255  -4.122  0.746   1.00 0.00 ? 76  SER B CA   3  
ATOM 6814  C C    . SER B 1 76  ? 23.095  -4.309  1.683   1.00 0.00 ? 76  SER B C    3  
ATOM 6815  O O    . SER B 1 76  ? 23.246  -4.885  2.762   1.00 0.00 ? 76  SER B O    3  
ATOM 6816  C CB   . SER B 1 76  ? 24.409  -5.318  -0.199  1.00 0.00 ? 76  SER B CB   3  
ATOM 6817  O OG   . SER B 1 76  ? 24.809  -6.487  0.501   1.00 0.00 ? 76  SER B OG   3  
ATOM 6818  H H    . SER B 1 76  ? 25.544  -4.505  2.287   1.00 0.00 ? 76  SER B H    3  
ATOM 6819  H HA   . SER B 1 76  ? 24.089  -3.233  0.156   1.00 0.00 ? 76  SER B HA   3  
ATOM 6820  H HB2  . SER B 1 76  ? 23.464  -5.513  -0.684  1.00 0.00 ? 76  SER B HB2  3  
ATOM 6821  H HB3  . SER B 1 76  ? 25.154  -5.087  -0.946  1.00 0.00 ? 76  SER B HB3  3  
ATOM 6822  H HG   . SER B 1 76  ? 25.680  -6.316  0.880   1.00 0.00 ? 76  SER B HG   3  
ATOM 6823  N N    . VAL B 1 77  ? 21.980  -3.803  1.309   1.00 0.00 ? 77  VAL B N    3  
ATOM 6824  C CA   . VAL B 1 77  ? 20.780  -3.983  2.044   1.00 0.00 ? 77  VAL B CA   3  
ATOM 6825  C C    . VAL B 1 77  ? 19.881  -4.762  1.126   1.00 0.00 ? 77  VAL B C    3  
ATOM 6826  O O    . VAL B 1 77  ? 19.796  -4.462  -0.068  1.00 0.00 ? 77  VAL B O    3  
ATOM 6827  C CB   . VAL B 1 77  ? 20.099  -2.619  2.435   1.00 0.00 ? 77  VAL B CB   3  
ATOM 6828  C CG1  . VAL B 1 77  ? 18.895  -2.845  3.345   1.00 0.00 ? 77  VAL B CG1  3  
ATOM 6829  C CG2  . VAL B 1 77  ? 21.098  -1.680  3.094   1.00 0.00 ? 77  VAL B CG2  3  
ATOM 6830  H H    . VAL B 1 77  ? 21.941  -3.302  0.462   1.00 0.00 ? 77  VAL B H    3  
ATOM 6831  H HA   . VAL B 1 77  ? 21.003  -4.561  2.928   1.00 0.00 ? 77  VAL B HA   3  
ATOM 6832  H HB   . VAL B 1 77  ? 19.727  -2.153  1.536   1.00 0.00 ? 77  VAL B HB   3  
ATOM 6833  H HG11 . VAL B 1 77  ? 19.219  -3.335  4.252   1.00 0.00 ? 77  VAL B HG11 3  
ATOM 6834  H HG12 . VAL B 1 77  ? 18.172  -3.467  2.839   1.00 0.00 ? 77  VAL B HG12 3  
ATOM 6835  H HG13 . VAL B 1 77  ? 18.445  -1.895  3.591   1.00 0.00 ? 77  VAL B HG13 3  
ATOM 6836  H HG21 . VAL B 1 77  ? 21.476  -2.138  3.996   1.00 0.00 ? 77  VAL B HG21 3  
ATOM 6837  H HG22 . VAL B 1 77  ? 20.610  -0.749  3.340   1.00 0.00 ? 77  VAL B HG22 3  
ATOM 6838  H HG23 . VAL B 1 77  ? 21.916  -1.492  2.415   1.00 0.00 ? 77  VAL B HG23 3  
ATOM 6839  N N    . ASN B 1 78  ? 19.279  -5.765  1.617   1.00 0.00 ? 78  ASN B N    3  
ATOM 6840  C CA   . ASN B 1 78  ? 18.404  -6.540  0.806   1.00 0.00 ? 78  ASN B CA   3  
ATOM 6841  C C    . ASN B 1 78  ? 17.035  -6.324  1.288   1.00 0.00 ? 78  ASN B C    3  
ATOM 6842  O O    . ASN B 1 78  ? 16.794  -6.274  2.493   1.00 0.00 ? 78  ASN B O    3  
ATOM 6843  C CB   . ASN B 1 78  ? 18.769  -8.037  0.789   1.00 0.00 ? 78  ASN B CB   3  
ATOM 6844  C CG   . ASN B 1 78  ? 18.799  -8.695  2.166   1.00 0.00 ? 78  ASN B CG   3  
ATOM 6845  O OD1  . ASN B 1 78  ? 19.829  -8.697  2.842   1.00 0.00 ? 78  ASN B OD1  3  
ATOM 6846  N ND2  . ASN B 1 78  ? 17.712  -9.273  2.575   1.00 0.00 ? 78  ASN B ND2  3  
ATOM 6847  H H    . ASN B 1 78  ? 19.377  -5.994  2.568   1.00 0.00 ? 78  ASN B H    3  
ATOM 6848  H HA   . ASN B 1 78  ? 18.472  -6.147  -0.196  1.00 0.00 ? 78  ASN B HA   3  
ATOM 6849  H HB2  . ASN B 1 78  ? 18.049  -8.566  0.184   1.00 0.00 ? 78  ASN B HB2  3  
ATOM 6850  H HB3  . ASN B 1 78  ? 19.745  -8.145  0.340   1.00 0.00 ? 78  ASN B HB3  3  
ATOM 6851  H HD21 . ASN B 1 78  ? 16.917  -9.270  1.997   1.00 0.00 ? 78  ASN B HD21 3  
ATOM 6852  H HD22 . ASN B 1 78  ? 17.713  -9.703  3.456   1.00 0.00 ? 78  ASN B HD22 3  
ATOM 6853  N N    . LEU B 1 79  ? 16.148  -6.153  0.378   1.00 0.00 ? 79  LEU B N    3  
ATOM 6854  C CA   . LEU B 1 79  ? 14.820  -5.861  0.721   1.00 0.00 ? 79  LEU B CA   3  
ATOM 6855  C C    . LEU B 1 79  ? 13.922  -6.962  0.178   1.00 0.00 ? 79  LEU B C    3  
ATOM 6856  O O    . LEU B 1 79  ? 13.951  -7.262  -1.016  1.00 0.00 ? 79  LEU B O    3  
ATOM 6857  C CB   . LEU B 1 79  ? 14.374  -4.494  0.138   1.00 0.00 ? 79  LEU B CB   3  
ATOM 6858  C CG   . LEU B 1 79  ? 15.038  -3.200  0.668   1.00 0.00 ? 79  LEU B CG   3  
ATOM 6859  C CD1  . LEU B 1 79  ? 16.499  -3.080  0.281   1.00 0.00 ? 79  LEU B CD1  3  
ATOM 6860  C CD2  . LEU B 1 79  ? 14.278  -1.989  0.190   1.00 0.00 ? 79  LEU B CD2  3  
ATOM 6861  H H    . LEU B 1 79  ? 16.375  -6.200  -0.577  1.00 0.00 ? 79  LEU B H    3  
ATOM 6862  H HA   . LEU B 1 79  ? 14.761  -5.819  1.797   1.00 0.00 ? 79  LEU B HA   3  
ATOM 6863  H HB2  . LEU B 1 79  ? 14.548  -4.529  -0.927  1.00 0.00 ? 79  LEU B HB2  3  
ATOM 6864  H HB3  . LEU B 1 79  ? 13.308  -4.410  0.290   1.00 0.00 ? 79  LEU B HB3  3  
ATOM 6865  H HG   . LEU B 1 79  ? 14.989  -3.207  1.748   1.00 0.00 ? 79  LEU B HG   3  
ATOM 6866  H HD11 . LEU B 1 79  ? 16.587  -3.062  -0.794  1.00 0.00 ? 79  LEU B HD11 3  
ATOM 6867  H HD12 . LEU B 1 79  ? 17.044  -3.928  0.671   1.00 0.00 ? 79  LEU B HD12 3  
ATOM 6868  H HD13 . LEU B 1 79  ? 16.909  -2.169  0.691   1.00 0.00 ? 79  LEU B HD13 3  
ATOM 6869  H HD21 . LEU B 1 79  ? 14.267  -1.973  -0.888  1.00 0.00 ? 79  LEU B HD21 3  
ATOM 6870  H HD22 . LEU B 1 79  ? 14.755  -1.092  0.557   1.00 0.00 ? 79  LEU B HD22 3  
ATOM 6871  H HD23 . LEU B 1 79  ? 13.262  -2.030  0.554   1.00 0.00 ? 79  LEU B HD23 3  
ATOM 6872  N N    . ASP B 1 80  ? 13.096  -7.520  1.029   1.00 0.00 ? 80  ASP B N    3  
ATOM 6873  C CA   . ASP B 1 80  ? 12.214  -8.622  0.668   1.00 0.00 ? 80  ASP B CA   3  
ATOM 6874  C C    . ASP B 1 80  ? 10.774  -8.180  0.785   1.00 0.00 ? 80  ASP B C    3  
ATOM 6875  O O    . ASP B 1 80  ? 10.438  -7.383  1.650   1.00 0.00 ? 80  ASP B O    3  
ATOM 6876  C CB   . ASP B 1 80  ? 12.452  -9.893  1.510   1.00 0.00 ? 80  ASP B CB   3  
ATOM 6877  C CG   . ASP B 1 80  ? 11.762  -9.896  2.869   1.00 0.00 ? 80  ASP B CG   3  
ATOM 6878  O OD1  . ASP B 1 80  ? 12.365  -9.466  3.874   1.00 0.00 ? 80  ASP B OD1  3  
ATOM 6879  O OD2  . ASP B 1 80  ? 10.640  -10.384 2.952   1.00 0.00 ? 80  ASP B OD2  3  
ATOM 6880  H H    . ASP B 1 80  ? 13.056  -7.173  1.950   1.00 0.00 ? 80  ASP B H    3  
ATOM 6881  H HA   . ASP B 1 80  ? 12.407  -8.842  -0.371  1.00 0.00 ? 80  ASP B HA   3  
ATOM 6882  H HB2  . ASP B 1 80  ? 12.093  -10.749 0.959   1.00 0.00 ? 80  ASP B HB2  3  
ATOM 6883  H HB3  . ASP B 1 80  ? 13.514  -10.003 1.664   1.00 0.00 ? 80  ASP B HB3  3  
ATOM 6884  N N    . VAL B 1 81  ? 9.977   -8.577  -0.162  1.00 0.00 ? 81  VAL B N    3  
ATOM 6885  C CA   . VAL B 1 81  ? 8.571   -8.261  -0.193  1.00 0.00 ? 81  VAL B CA   3  
ATOM 6886  C C    . VAL B 1 81  ? 7.856   -9.434  -0.848  1.00 0.00 ? 81  VAL B C    3  
ATOM 6887  O O    . VAL B 1 81  ? 8.536   -10.306 -1.387  1.00 0.00 ? 81  VAL B O    3  
ATOM 6888  C CB   . VAL B 1 81  ? 8.317   -6.847  -0.899  1.00 0.00 ? 81  VAL B CB   3  
ATOM 6889  C CG1  . VAL B 1 81  ? 7.204   -6.836  -1.944  1.00 0.00 ? 81  VAL B CG1  3  
ATOM 6890  C CG2  . VAL B 1 81  ? 8.024   -5.793  0.158   1.00 0.00 ? 81  VAL B CG2  3  
ATOM 6891  H H    . VAL B 1 81  ? 10.295  -9.166  -0.879  1.00 0.00 ? 81  VAL B H    3  
ATOM 6892  H HA   . VAL B 1 81  ? 8.246   -8.215  0.836   1.00 0.00 ? 81  VAL B HA   3  
ATOM 6893  H HB   . VAL B 1 81  ? 9.233   -6.553  -1.389  1.00 0.00 ? 81  VAL B HB   3  
ATOM 6894  H HG11 . VAL B 1 81  ? 6.268   -7.095  -1.472  1.00 0.00 ? 81  VAL B HG11 3  
ATOM 6895  H HG12 . VAL B 1 81  ? 7.425   -7.561  -2.712  1.00 0.00 ? 81  VAL B HG12 3  
ATOM 6896  H HG13 . VAL B 1 81  ? 7.126   -5.852  -2.384  1.00 0.00 ? 81  VAL B HG13 3  
ATOM 6897  H HG21 . VAL B 1 81  ? 7.857   -4.839  -0.319  1.00 0.00 ? 81  VAL B HG21 3  
ATOM 6898  H HG22 . VAL B 1 81  ? 8.863   -5.717  0.833   1.00 0.00 ? 81  VAL B HG22 3  
ATOM 6899  H HG23 . VAL B 1 81  ? 7.142   -6.075  0.714   1.00 0.00 ? 81  VAL B HG23 3  
ATOM 6900  N N    . LYS B 1 82  ? 6.538   -9.512  -0.736  1.00 0.00 ? 82  LYS B N    3  
ATOM 6901  C CA   . LYS B 1 82  ? 5.774   -10.583 -1.372  1.00 0.00 ? 82  LYS B CA   3  
ATOM 6902  C C    . LYS B 1 82  ? 5.763   -10.400 -2.907  1.00 0.00 ? 82  LYS B C    3  
ATOM 6903  O O    . LYS B 1 82  ? 6.509   -9.582  -3.432  1.00 0.00 ? 82  LYS B O    3  
ATOM 6904  C CB   . LYS B 1 82  ? 4.360   -10.619 -0.804  1.00 0.00 ? 82  LYS B CB   3  
ATOM 6905  C CG   . LYS B 1 82  ? 4.317   -10.872 0.701   1.00 0.00 ? 82  LYS B CG   3  
ATOM 6906  C CD   . LYS B 1 82  ? 2.900   -10.811 1.248   1.00 0.00 ? 82  LYS B CD   3  
ATOM 6907  C CE   . LYS B 1 82  ? 2.857   -11.108 2.744   1.00 0.00 ? 82  LYS B CE   3  
ATOM 6908  N NZ   . LYS B 1 82  ? 3.280   -12.491 3.059   1.00 0.00 ? 82  LYS B NZ   3  
ATOM 6909  H H    . LYS B 1 82  ? 6.073   -8.823  -0.221  1.00 0.00 ? 82  LYS B H    3  
ATOM 6910  H HA   . LYS B 1 82  ? 6.274   -11.512 -1.144  1.00 0.00 ? 82  LYS B HA   3  
ATOM 6911  H HB2  . LYS B 1 82  ? 3.885   -9.671  -1.009  1.00 0.00 ? 82  LYS B HB2  3  
ATOM 6912  H HB3  . LYS B 1 82  ? 3.799   -11.400 -1.295  1.00 0.00 ? 82  LYS B HB3  3  
ATOM 6913  H HG2  . LYS B 1 82  ? 4.724   -11.852 0.896   1.00 0.00 ? 82  LYS B HG2  3  
ATOM 6914  H HG3  . LYS B 1 82  ? 4.923   -10.128 1.196   1.00 0.00 ? 82  LYS B HG3  3  
ATOM 6915  H HD2  . LYS B 1 82  ? 2.496   -9.825  1.076   1.00 0.00 ? 82  LYS B HD2  3  
ATOM 6916  H HD3  . LYS B 1 82  ? 2.299   -11.543 0.728   1.00 0.00 ? 82  LYS B HD3  3  
ATOM 6917  H HE2  . LYS B 1 82  ? 3.515   -10.421 3.255   1.00 0.00 ? 82  LYS B HE2  3  
ATOM 6918  H HE3  . LYS B 1 82  ? 1.846   -10.960 3.096   1.00 0.00 ? 82  LYS B HE3  3  
ATOM 6919  H HZ1  . LYS B 1 82  ? 2.624   -13.175 2.635   1.00 0.00 ? 82  LYS B HZ1  3  
ATOM 6920  H HZ2  . LYS B 1 82  ? 3.280   -12.629 4.091   1.00 0.00 ? 82  LYS B HZ2  3  
ATOM 6921  H HZ3  . LYS B 1 82  ? 4.243   -12.682 2.717   1.00 0.00 ? 82  LYS B HZ3  3  
ATOM 6922  N N    . HIS B 1 83  ? 4.888   -11.070 -3.618  1.00 0.00 ? 83  HIS B N    3  
ATOM 6923  C CA   . HIS B 1 83  ? 4.961   -10.996 -5.063  1.00 0.00 ? 83  HIS B CA   3  
ATOM 6924  C C    . HIS B 1 83  ? 4.370   -9.680  -5.514  1.00 0.00 ? 83  HIS B C    3  
ATOM 6925  O O    . HIS B 1 83  ? 3.218   -9.342  -5.182  1.00 0.00 ? 83  HIS B O    3  
ATOM 6926  C CB   . HIS B 1 83  ? 4.214   -12.175 -5.695  1.00 0.00 ? 83  HIS B CB   3  
ATOM 6927  C CG   . HIS B 1 83  ? 4.326   -12.270 -7.187  1.00 0.00 ? 83  HIS B CG   3  
ATOM 6928  N ND1  . HIS B 1 83  ? 3.269   -12.039 -8.041  1.00 0.00 ? 83  HIS B ND1  3  
ATOM 6929  C CD2  . HIS B 1 83  ? 5.370   -12.621 -7.973  1.00 0.00 ? 83  HIS B CD2  3  
ATOM 6930  C CE1  . HIS B 1 83  ? 3.659   -12.249 -9.281  1.00 0.00 ? 83  HIS B CE1  3  
ATOM 6931  N NE2  . HIS B 1 83  ? 4.926   -12.600 -9.267  1.00 0.00 ? 83  HIS B NE2  3  
ATOM 6932  H H    . HIS B 1 83  ? 4.184   -11.602 -3.192  1.00 0.00 ? 83  HIS B H    3  
ATOM 6933  H HA   . HIS B 1 83  ? 6.002   -11.034 -5.350  1.00 0.00 ? 83  HIS B HA   3  
ATOM 6934  H HB2  . HIS B 1 83  ? 4.624   -13.085 -5.287  1.00 0.00 ? 83  HIS B HB2  3  
ATOM 6935  H HB3  . HIS B 1 83  ? 3.167   -12.111 -5.440  1.00 0.00 ? 83  HIS B HB3  3  
ATOM 6936  H HD1  . HIS B 1 83  ? 2.370   -11.737 -7.783  1.00 0.00 ? 83  HIS B HD1  3  
ATOM 6937  H HD2  . HIS B 1 83  ? 6.366   -12.871 -7.638  1.00 0.00 ? 83  HIS B HD2  3  
ATOM 6938  H HE1  . HIS B 1 83  ? 3.041   -12.148 -10.162 1.00 0.00 ? 83  HIS B HE1  3  
ATOM 6939  H HE2  . HIS B 1 83  ? 5.520   -12.549 -10.051 1.00 0.00 ? 83  HIS B HE2  3  
ATOM 6940  N N    . PHE B 1 84  ? 5.163   -8.943  -6.247  1.00 0.00 ? 84  PHE B N    3  
ATOM 6941  C CA   . PHE B 1 84  ? 4.816   -7.635  -6.677  1.00 0.00 ? 84  PHE B CA   3  
ATOM 6942  C C    . PHE B 1 84  ? 5.676   -7.313  -7.886  1.00 0.00 ? 84  PHE B C    3  
ATOM 6943  O O    . PHE B 1 84  ? 6.837   -7.722  -7.944  1.00 0.00 ? 84  PHE B O    3  
ATOM 6944  C CB   . PHE B 1 84  ? 5.124   -6.669  -5.541  1.00 0.00 ? 84  PHE B CB   3  
ATOM 6945  C CG   . PHE B 1 84  ? 4.471   -5.345  -5.667  1.00 0.00 ? 84  PHE B CG   3  
ATOM 6946  C CD1  . PHE B 1 84  ? 3.226   -5.143  -5.125  1.00 0.00 ? 84  PHE B CD1  3  
ATOM 6947  C CD2  . PHE B 1 84  ? 5.098   -4.301  -6.303  1.00 0.00 ? 84  PHE B CD2  3  
ATOM 6948  C CE1  . PHE B 1 84  ? 2.621   -3.925  -5.206  1.00 0.00 ? 84  PHE B CE1  3  
ATOM 6949  C CE2  . PHE B 1 84  ? 4.494   -3.081  -6.395  1.00 0.00 ? 84  PHE B CE2  3  
ATOM 6950  C CZ   . PHE B 1 84  ? 3.256   -2.896  -5.844  1.00 0.00 ? 84  PHE B CZ   3  
ATOM 6951  H H    . PHE B 1 84  ? 6.051   -9.263  -6.516  1.00 0.00 ? 84  PHE B H    3  
ATOM 6952  H HA   . PHE B 1 84  ? 3.766   -7.589  -6.920  1.00 0.00 ? 84  PHE B HA   3  
ATOM 6953  H HB2  . PHE B 1 84  ? 4.794   -7.109  -4.611  1.00 0.00 ? 84  PHE B HB2  3  
ATOM 6954  H HB3  . PHE B 1 84  ? 6.192   -6.517  -5.497  1.00 0.00 ? 84  PHE B HB3  3  
ATOM 6955  H HD1  . PHE B 1 84  ? 2.728   -5.959  -4.624  1.00 0.00 ? 84  PHE B HD1  3  
ATOM 6956  H HD2  . PHE B 1 84  ? 6.072   -4.457  -6.741  1.00 0.00 ? 84  PHE B HD2  3  
ATOM 6957  H HE1  . PHE B 1 84  ? 1.641   -3.775  -4.776  1.00 0.00 ? 84  PHE B HE1  3  
ATOM 6958  H HE2  . PHE B 1 84  ? 4.987   -2.263  -6.898  1.00 0.00 ? 84  PHE B HE2  3  
ATOM 6959  H HZ   . PHE B 1 84  ? 2.779   -1.930  -5.909  1.00 0.00 ? 84  PHE B HZ   3  
ATOM 6960  N N    . SER B 1 85  ? 5.108   -6.627  -8.841  1.00 0.00 ? 85  SER B N    3  
ATOM 6961  C CA   . SER B 1 85  ? 5.788   -6.295  -10.068 1.00 0.00 ? 85  SER B CA   3  
ATOM 6962  C C    . SER B 1 85  ? 6.837   -5.194  -9.838  1.00 0.00 ? 85  SER B C    3  
ATOM 6963  O O    . SER B 1 85  ? 6.508   -4.111  -9.342  1.00 0.00 ? 85  SER B O    3  
ATOM 6964  C CB   . SER B 1 85  ? 4.767   -5.786  -11.041 1.00 0.00 ? 85  SER B CB   3  
ATOM 6965  O OG   . SER B 1 85  ? 3.598   -6.603  -11.040 1.00 0.00 ? 85  SER B OG   3  
ATOM 6966  H H    . SER B 1 85  ? 4.179   -6.334  -8.753  1.00 0.00 ? 85  SER B H    3  
ATOM 6967  H HA   . SER B 1 85  ? 6.234   -7.191  -10.471 1.00 0.00 ? 85  SER B HA   3  
ATOM 6968  H HB2  . SER B 1 85  ? 4.488   -4.779  -10.770 1.00 0.00 ? 85  SER B HB2  3  
ATOM 6969  H HB3  . SER B 1 85  ? 5.188   -5.788  -12.035 1.00 0.00 ? 85  SER B HB3  3  
ATOM 6970  H HG   . SER B 1 85  ? 2.897   -5.978  -11.295 1.00 0.00 ? 85  SER B HG   3  
ATOM 6971  N N    . PRO B 1 86  ? 8.124   -5.464  -10.218 1.00 0.00 ? 86  PRO B N    3  
ATOM 6972  C CA   . PRO B 1 86  ? 9.233   -4.517  -10.067 1.00 0.00 ? 86  PRO B CA   3  
ATOM 6973  C C    . PRO B 1 86  ? 8.986   -3.154  -10.733 1.00 0.00 ? 86  PRO B C    3  
ATOM 6974  O O    . PRO B 1 86  ? 9.475   -2.143  -10.259 1.00 0.00 ? 86  PRO B O    3  
ATOM 6975  C CB   . PRO B 1 86  ? 10.435  -5.227  -10.715 1.00 0.00 ? 86  PRO B CB   3  
ATOM 6976  C CG   . PRO B 1 86  ? 9.877   -6.379  -11.459 1.00 0.00 ? 86  PRO B CG   3  
ATOM 6977  C CD   . PRO B 1 86  ? 8.601   -6.746  -10.771 1.00 0.00 ? 86  PRO B CD   3  
ATOM 6978  H HA   . PRO B 1 86  ? 9.443   -4.351  -9.021  1.00 0.00 ? 86  PRO B HA   3  
ATOM 6979  H HB2  . PRO B 1 86  ? 10.945  -4.543  -11.376 1.00 0.00 ? 86  PRO B HB2  3  
ATOM 6980  H HB3  . PRO B 1 86  ? 11.116  -5.553  -9.942  1.00 0.00 ? 86  PRO B HB3  3  
ATOM 6981  H HG2  . PRO B 1 86  ? 9.693   -6.094  -12.484 1.00 0.00 ? 86  PRO B HG2  3  
ATOM 6982  H HG3  . PRO B 1 86  ? 10.571  -7.206  -11.427 1.00 0.00 ? 86  PRO B HG3  3  
ATOM 6983  H HD2  . PRO B 1 86  ? 7.899   -7.152  -11.484 1.00 0.00 ? 86  PRO B HD2  3  
ATOM 6984  H HD3  . PRO B 1 86  ? 8.785   -7.450  -9.973  1.00 0.00 ? 86  PRO B HD3  3  
ATOM 6985  N N    . GLU B 1 87  ? 8.231   -3.129  -11.822 1.00 0.00 ? 87  GLU B N    3  
ATOM 6986  C CA   . GLU B 1 87  ? 7.909   -1.863  -12.493 1.00 0.00 ? 87  GLU B CA   3  
ATOM 6987  C C    . GLU B 1 87  ? 6.887   -1.045  -11.716 1.00 0.00 ? 87  GLU B C    3  
ATOM 6988  O O    . GLU B 1 87  ? 6.884   0.194   -11.777 1.00 0.00 ? 87  GLU B O    3  
ATOM 6989  C CB   . GLU B 1 87  ? 7.426   -2.094  -13.919 1.00 0.00 ? 87  GLU B CB   3  
ATOM 6990  C CG   . GLU B 1 87  ? 8.526   -2.489  -14.885 1.00 0.00 ? 87  GLU B CG   3  
ATOM 6991  C CD   . GLU B 1 87  ? 9.517   -1.373  -15.097 1.00 0.00 ? 87  GLU B CD   3  
ATOM 6992  O OE1  . GLU B 1 87  ? 10.468  -1.247  -14.312 1.00 0.00 ? 87  GLU B OE1  3  
ATOM 6993  O OE2  . GLU B 1 87  ? 9.352   -0.586  -16.054 1.00 0.00 ? 87  GLU B OE2  3  
ATOM 6994  H H    . GLU B 1 87  ? 7.911   -3.982  -12.189 1.00 0.00 ? 87  GLU B H    3  
ATOM 6995  H HA   . GLU B 1 87  ? 8.821   -1.287  -12.532 1.00 0.00 ? 87  GLU B HA   3  
ATOM 6996  H HB2  . GLU B 1 87  ? 6.686   -2.878  -13.906 1.00 0.00 ? 87  GLU B HB2  3  
ATOM 6997  H HB3  . GLU B 1 87  ? 6.967   -1.185  -14.280 1.00 0.00 ? 87  GLU B HB3  3  
ATOM 6998  H HG2  . GLU B 1 87  ? 9.050   -3.345  -14.486 1.00 0.00 ? 87  GLU B HG2  3  
ATOM 6999  H HG3  . GLU B 1 87  ? 8.085   -2.746  -15.836 1.00 0.00 ? 87  GLU B HG3  3  
ATOM 7000  N N    . GLU B 1 88  ? 6.070   -1.723  -10.940 1.00 0.00 ? 88  GLU B N    3  
ATOM 7001  C CA   . GLU B 1 88  ? 4.998   -1.067  -10.212 1.00 0.00 ? 88  GLU B CA   3  
ATOM 7002  C C    . GLU B 1 88  ? 5.483   -0.533  -8.870  1.00 0.00 ? 88  GLU B C    3  
ATOM 7003  O O    . GLU B 1 88  ? 4.724   0.094   -8.118  1.00 0.00 ? 88  GLU B O    3  
ATOM 7004  C CB   . GLU B 1 88  ? 3.796   -2.001  -10.049 1.00 0.00 ? 88  GLU B CB   3  
ATOM 7005  C CG   . GLU B 1 88  ? 3.166   -2.406  -11.376 1.00 0.00 ? 88  GLU B CG   3  
ATOM 7006  C CD   . GLU B 1 88  ? 1.934   -3.268  -11.216 1.00 0.00 ? 88  GLU B CD   3  
ATOM 7007  O OE1  . GLU B 1 88  ? 0.849   -2.743  -10.918 1.00 0.00 ? 88  GLU B OE1  3  
ATOM 7008  O OE2  . GLU B 1 88  ? 2.017   -4.497  -11.414 1.00 0.00 ? 88  GLU B OE2  3  
ATOM 7009  H H    . GLU B 1 88  ? 6.201   -2.688  -10.817 1.00 0.00 ? 88  GLU B H    3  
ATOM 7010  H HA   . GLU B 1 88  ? 4.695   -0.219  -10.808 1.00 0.00 ? 88  GLU B HA   3  
ATOM 7011  H HB2  . GLU B 1 88  ? 4.116   -2.895  -9.534  1.00 0.00 ? 88  GLU B HB2  3  
ATOM 7012  H HB3  . GLU B 1 88  ? 3.046   -1.501  -9.456  1.00 0.00 ? 88  GLU B HB3  3  
ATOM 7013  H HG2  . GLU B 1 88  ? 2.893   -1.515  -11.920 1.00 0.00 ? 88  GLU B HG2  3  
ATOM 7014  H HG3  . GLU B 1 88  ? 3.898   -2.955  -11.951 1.00 0.00 ? 88  GLU B HG3  3  
ATOM 7015  N N    . LEU B 1 89  ? 6.754   -0.724  -8.596  1.00 0.00 ? 89  LEU B N    3  
ATOM 7016  C CA   . LEU B 1 89  ? 7.343   -0.242  -7.383  1.00 0.00 ? 89  LEU B CA   3  
ATOM 7017  C C    . LEU B 1 89  ? 8.459   0.712   -7.732  1.00 0.00 ? 89  LEU B C    3  
ATOM 7018  O O    . LEU B 1 89  ? 9.092   0.579   -8.781  1.00 0.00 ? 89  LEU B O    3  
ATOM 7019  C CB   . LEU B 1 89  ? 7.829   -1.427  -6.481  1.00 0.00 ? 89  LEU B CB   3  
ATOM 7020  C CG   . LEU B 1 89  ? 8.958   -2.347  -7.014  1.00 0.00 ? 89  LEU B CG   3  
ATOM 7021  C CD1  . LEU B 1 89  ? 10.340  -1.736  -6.823  1.00 0.00 ? 89  LEU B CD1  3  
ATOM 7022  C CD2  . LEU B 1 89  ? 8.887   -3.730  -6.381  1.00 0.00 ? 89  LEU B CD2  3  
ATOM 7023  H H    . LEU B 1 89  ? 7.327   -1.182  -9.247  1.00 0.00 ? 89  LEU B H    3  
ATOM 7024  H HA   . LEU B 1 89  ? 6.582   0.315   -6.858  1.00 0.00 ? 89  LEU B HA   3  
ATOM 7025  H HB2  . LEU B 1 89  ? 8.175   -1.002  -5.551  1.00 0.00 ? 89  LEU B HB2  3  
ATOM 7026  H HB3  . LEU B 1 89  ? 6.971   -2.044  -6.259  1.00 0.00 ? 89  LEU B HB3  3  
ATOM 7027  H HG   . LEU B 1 89  ? 8.812   -2.461  -8.078  1.00 0.00 ? 89  LEU B HG   3  
ATOM 7028  H HD11 . LEU B 1 89  ? 10.399  -0.806  -7.369  1.00 0.00 ? 89  LEU B HD11 3  
ATOM 7029  H HD12 . LEU B 1 89  ? 11.093  -2.418  -7.187  1.00 0.00 ? 89  LEU B HD12 3  
ATOM 7030  H HD13 . LEU B 1 89  ? 10.507  -1.544  -5.773  1.00 0.00 ? 89  LEU B HD13 3  
ATOM 7031  H HD21 . LEU B 1 89  ? 9.727   -4.322  -6.713  1.00 0.00 ? 89  LEU B HD21 3  
ATOM 7032  H HD22 . LEU B 1 89  ? 7.969   -4.216  -6.666  1.00 0.00 ? 89  LEU B HD22 3  
ATOM 7033  H HD23 . LEU B 1 89  ? 8.922   -3.633  -5.306  1.00 0.00 ? 89  LEU B HD23 3  
ATOM 7034  N N    . LYS B 1 90  ? 8.666   1.688   -6.913  1.00 0.00 ? 90  LYS B N    3  
ATOM 7035  C CA   . LYS B 1 90  ? 9.710   2.644   -7.122  1.00 0.00 ? 90  LYS B CA   3  
ATOM 7036  C C    . LYS B 1 90  ? 10.581  2.721   -5.897  1.00 0.00 ? 90  LYS B C    3  
ATOM 7037  O O    . LYS B 1 90  ? 10.086  2.914   -4.770  1.00 0.00 ? 90  LYS B O    3  
ATOM 7038  C CB   . LYS B 1 90  ? 9.139   4.031   -7.446  1.00 0.00 ? 90  LYS B CB   3  
ATOM 7039  C CG   . LYS B 1 90  ? 8.288   4.095   -8.709  1.00 0.00 ? 90  LYS B CG   3  
ATOM 7040  C CD   . LYS B 1 90  ? 9.083   3.692   -9.942  1.00 0.00 ? 90  LYS B CD   3  
ATOM 7041  C CE   . LYS B 1 90  ? 8.247   3.811   -11.204 1.00 0.00 ? 90  LYS B CE   3  
ATOM 7042  N NZ   . LYS B 1 90  ? 7.055   2.923   -11.200 1.00 0.00 ? 90  LYS B NZ   3  
ATOM 7043  H H    . LYS B 1 90  ? 8.083   1.801   -6.126  1.00 0.00 ? 90  LYS B H    3  
ATOM 7044  H HA   . LYS B 1 90  ? 10.309  2.312   -7.955  1.00 0.00 ? 90  LYS B HA   3  
ATOM 7045  H HB2  . LYS B 1 90  ? 8.531   4.358   -6.616  1.00 0.00 ? 90  LYS B HB2  3  
ATOM 7046  H HB3  . LYS B 1 90  ? 9.965   4.717   -7.562  1.00 0.00 ? 90  LYS B HB3  3  
ATOM 7047  H HG2  . LYS B 1 90  ? 7.453   3.419   -8.598  1.00 0.00 ? 90  LYS B HG2  3  
ATOM 7048  H HG3  . LYS B 1 90  ? 7.921   5.104   -8.836  1.00 0.00 ? 90  LYS B HG3  3  
ATOM 7049  H HD2  . LYS B 1 90  ? 9.949   4.331   -10.033 1.00 0.00 ? 90  LYS B HD2  3  
ATOM 7050  H HD3  . LYS B 1 90  ? 9.403   2.666   -9.832  1.00 0.00 ? 90  LYS B HD3  3  
ATOM 7051  H HE2  . LYS B 1 90  ? 7.917   4.834   -11.297 1.00 0.00 ? 90  LYS B HE2  3  
ATOM 7052  H HE3  . LYS B 1 90  ? 8.876   3.562   -12.045 1.00 0.00 ? 90  LYS B HE3  3  
ATOM 7053  H HZ1  . LYS B 1 90  ? 6.462   3.089   -10.362 1.00 0.00 ? 90  LYS B HZ1  3  
ATOM 7054  H HZ2  . LYS B 1 90  ? 7.304   1.912   -11.238 1.00 0.00 ? 90  LYS B HZ2  3  
ATOM 7055  H HZ3  . LYS B 1 90  ? 6.462   3.137   -12.026 1.00 0.00 ? 90  LYS B HZ3  3  
ATOM 7056  N N    . VAL B 1 91  ? 11.848  2.540   -6.106  1.00 0.00 ? 91  VAL B N    3  
ATOM 7057  C CA   . VAL B 1 91  ? 12.822  2.636   -5.061  1.00 0.00 ? 91  VAL B CA   3  
ATOM 7058  C C    . VAL B 1 91  ? 13.466  4.019   -5.114  1.00 0.00 ? 91  VAL B C    3  
ATOM 7059  O O    . VAL B 1 91  ? 13.902  4.474   -6.172  1.00 0.00 ? 91  VAL B O    3  
ATOM 7060  C CB   . VAL B 1 91  ? 13.894  1.483   -5.154  1.00 0.00 ? 91  VAL B CB   3  
ATOM 7061  C CG1  . VAL B 1 91  ? 14.555  1.421   -6.531  1.00 0.00 ? 91  VAL B CG1  3  
ATOM 7062  C CG2  . VAL B 1 91  ? 14.959  1.620   -4.062  1.00 0.00 ? 91  VAL B CG2  3  
ATOM 7063  H H    . VAL B 1 91  ? 12.166  2.352   -7.015  1.00 0.00 ? 91  VAL B H    3  
ATOM 7064  H HA   . VAL B 1 91  ? 12.291  2.548   -4.124  1.00 0.00 ? 91  VAL B HA   3  
ATOM 7065  H HB   . VAL B 1 91  ? 13.377  0.546   -5.004  1.00 0.00 ? 91  VAL B HB   3  
ATOM 7066  H HG11 . VAL B 1 91  ? 13.803  1.235   -7.283  1.00 0.00 ? 91  VAL B HG11 3  
ATOM 7067  H HG12 . VAL B 1 91  ? 15.285  0.625   -6.544  1.00 0.00 ? 91  VAL B HG12 3  
ATOM 7068  H HG13 . VAL B 1 91  ? 15.045  2.361   -6.735  1.00 0.00 ? 91  VAL B HG13 3  
ATOM 7069  H HG21 . VAL B 1 91  ? 15.675  0.816   -4.154  1.00 0.00 ? 91  VAL B HG21 3  
ATOM 7070  H HG22 . VAL B 1 91  ? 14.495  1.578   -3.088  1.00 0.00 ? 91  VAL B HG22 3  
ATOM 7071  H HG23 . VAL B 1 91  ? 15.467  2.566   -4.173  1.00 0.00 ? 91  VAL B HG23 3  
ATOM 7072  N N    . LYS B 1 92  ? 13.465  4.701   -4.012  1.00 0.00 ? 92  LYS B N    3  
ATOM 7073  C CA   . LYS B 1 92  ? 14.040  6.008   -3.941  1.00 0.00 ? 92  LYS B CA   3  
ATOM 7074  C C    . LYS B 1 92  ? 14.982  6.086   -2.760  1.00 0.00 ? 92  LYS B C    3  
ATOM 7075  O O    . LYS B 1 92  ? 14.704  5.533   -1.688  1.00 0.00 ? 92  LYS B O    3  
ATOM 7076  C CB   . LYS B 1 92  ? 12.946  7.091   -3.843  1.00 0.00 ? 92  LYS B CB   3  
ATOM 7077  C CG   . LYS B 1 92  ? 12.043  6.986   -2.616  1.00 0.00 ? 92  LYS B CG   3  
ATOM 7078  C CD   . LYS B 1 92  ? 11.034  8.121   -2.574  1.00 0.00 ? 92  LYS B CD   3  
ATOM 7079  C CE   . LYS B 1 92  ? 10.231  8.093   -1.287  1.00 0.00 ? 92  LYS B CE   3  
ATOM 7080  N NZ   . LYS B 1 92  ? 9.263   9.205   -1.209  1.00 0.00 ? 92  LYS B NZ   3  
ATOM 7081  H H    . LYS B 1 92  ? 13.075  4.325   -3.188  1.00 0.00 ? 92  LYS B H    3  
ATOM 7082  H HA   . LYS B 1 92  ? 14.604  6.165   -4.848  1.00 0.00 ? 92  LYS B HA   3  
ATOM 7083  H HB2  . LYS B 1 92  ? 13.422  8.060   -3.820  1.00 0.00 ? 92  LYS B HB2  3  
ATOM 7084  H HB3  . LYS B 1 92  ? 12.326  7.034   -4.724  1.00 0.00 ? 92  LYS B HB3  3  
ATOM 7085  H HG2  . LYS B 1 92  ? 11.516  6.044   -2.649  1.00 0.00 ? 92  LYS B HG2  3  
ATOM 7086  H HG3  . LYS B 1 92  ? 12.659  7.024   -1.729  1.00 0.00 ? 92  LYS B HG3  3  
ATOM 7087  H HD2  . LYS B 1 92  ? 11.557  9.063   -2.646  1.00 0.00 ? 92  LYS B HD2  3  
ATOM 7088  H HD3  . LYS B 1 92  ? 10.360  8.020   -3.411  1.00 0.00 ? 92  LYS B HD3  3  
ATOM 7089  H HE2  . LYS B 1 92  ? 9.695   7.156   -1.238  1.00 0.00 ? 92  LYS B HE2  3  
ATOM 7090  H HE3  . LYS B 1 92  ? 10.912  8.157   -0.451  1.00 0.00 ? 92  LYS B HE3  3  
ATOM 7091  H HZ1  . LYS B 1 92  ? 9.738   10.130  -1.203  1.00 0.00 ? 92  LYS B HZ1  3  
ATOM 7092  H HZ2  . LYS B 1 92  ? 8.697   9.128   -0.339  1.00 0.00 ? 92  LYS B HZ2  3  
ATOM 7093  H HZ3  . LYS B 1 92  ? 8.594   9.182   -2.002  1.00 0.00 ? 92  LYS B HZ3  3  
ATOM 7094  N N    . VAL B 1 93  ? 16.079  6.738   -2.955  1.00 0.00 ? 93  VAL B N    3  
ATOM 7095  C CA   . VAL B 1 93  ? 17.042  6.911   -1.914  1.00 0.00 ? 93  VAL B CA   3  
ATOM 7096  C C    . VAL B 1 93  ? 17.315  8.399   -1.731  1.00 0.00 ? 93  VAL B C    3  
ATOM 7097  O O    . VAL B 1 93  ? 17.758  9.098   -2.658  1.00 0.00 ? 93  VAL B O    3  
ATOM 7098  C CB   . VAL B 1 93  ? 18.355  6.079   -2.159  1.00 0.00 ? 93  VAL B CB   3  
ATOM 7099  C CG1  . VAL B 1 93  ? 19.007  6.405   -3.498  1.00 0.00 ? 93  VAL B CG1  3  
ATOM 7100  C CG2  . VAL B 1 93  ? 19.342  6.258   -1.012  1.00 0.00 ? 93  VAL B CG2  3  
ATOM 7101  H H    . VAL B 1 93  ? 16.250  7.152   -3.827  1.00 0.00 ? 93  VAL B H    3  
ATOM 7102  H HA   . VAL B 1 93  ? 16.569  6.562   -1.007  1.00 0.00 ? 93  VAL B HA   3  
ATOM 7103  H HB   . VAL B 1 93  ? 18.070  5.037   -2.195  1.00 0.00 ? 93  VAL B HB   3  
ATOM 7104  H HG11 . VAL B 1 93  ? 18.314  6.198   -4.298  1.00 0.00 ? 93  VAL B HG11 3  
ATOM 7105  H HG12 . VAL B 1 93  ? 19.894  5.803   -3.627  1.00 0.00 ? 93  VAL B HG12 3  
ATOM 7106  H HG13 . VAL B 1 93  ? 19.279  7.450   -3.518  1.00 0.00 ? 93  VAL B HG13 3  
ATOM 7107  H HG21 . VAL B 1 93  ? 18.897  5.910   -0.092  1.00 0.00 ? 93  VAL B HG21 3  
ATOM 7108  H HG22 . VAL B 1 93  ? 19.588  7.306   -0.915  1.00 0.00 ? 93  VAL B HG22 3  
ATOM 7109  H HG23 . VAL B 1 93  ? 20.242  5.696   -1.214  1.00 0.00 ? 93  VAL B HG23 3  
ATOM 7110  N N    . LEU B 1 94  ? 16.995  8.893   -0.573  1.00 0.00 ? 94  LEU B N    3  
ATOM 7111  C CA   . LEU B 1 94  ? 17.148  10.290  -0.283  1.00 0.00 ? 94  LEU B CA   3  
ATOM 7112  C C    . LEU B 1 94  ? 18.185  10.417  0.790   1.00 0.00 ? 94  LEU B C    3  
ATOM 7113  O O    . LEU B 1 94  ? 17.854  10.414  1.986   1.00 0.00 ? 94  LEU B O    3  
ATOM 7114  C CB   . LEU B 1 94  ? 15.820  10.931  0.222   1.00 0.00 ? 94  LEU B CB   3  
ATOM 7115  C CG   . LEU B 1 94  ? 14.536  10.784  -0.635  1.00 0.00 ? 94  LEU B CG   3  
ATOM 7116  C CD1  . LEU B 1 94  ? 14.755  11.168  -2.090  1.00 0.00 ? 94  LEU B CD1  3  
ATOM 7117  C CD2  . LEU B 1 94  ? 13.911  9.401   -0.497  1.00 0.00 ? 94  LEU B CD2  3  
ATOM 7118  H H    . LEU B 1 94  ? 16.691  8.277   0.132   1.00 0.00 ? 94  LEU B H    3  
ATOM 7119  H HA   . LEU B 1 94  ? 17.480  10.800  -1.172  1.00 0.00 ? 94  LEU B HA   3  
ATOM 7120  H HB2  . LEU B 1 94  ? 15.606  10.511  1.192   1.00 0.00 ? 94  LEU B HB2  3  
ATOM 7121  H HB3  . LEU B 1 94  ? 16.010  11.986  0.361   1.00 0.00 ? 94  LEU B HB3  3  
ATOM 7122  H HG   . LEU B 1 94  ? 13.825  11.505  -0.257  1.00 0.00 ? 94  LEU B HG   3  
ATOM 7123  H HD11 . LEU B 1 94  ? 15.517  10.533  -2.517  1.00 0.00 ? 94  LEU B HD11 3  
ATOM 7124  H HD12 . LEU B 1 94  ? 15.065  12.200  -2.150  1.00 0.00 ? 94  LEU B HD12 3  
ATOM 7125  H HD13 . LEU B 1 94  ? 13.833  11.037  -2.636  1.00 0.00 ? 94  LEU B HD13 3  
ATOM 7126  H HD21 . LEU B 1 94  ? 14.614  8.654   -0.835  1.00 0.00 ? 94  LEU B HD21 3  
ATOM 7127  H HD22 . LEU B 1 94  ? 13.018  9.351   -1.102  1.00 0.00 ? 94  LEU B HD22 3  
ATOM 7128  H HD23 . LEU B 1 94  ? 13.655  9.219   0.536   1.00 0.00 ? 94  LEU B HD23 3  
ATOM 7129  N N    . GLY B 1 95  ? 19.422  10.548  0.384   1.00 0.00 ? 95  GLY B N    3  
ATOM 7130  C CA   . GLY B 1 95  ? 20.498  10.626  1.326   1.00 0.00 ? 95  GLY B CA   3  
ATOM 7131  C C    . GLY B 1 95  ? 20.610  9.346   2.122   1.00 0.00 ? 95  GLY B C    3  
ATOM 7132  O O    . GLY B 1 95  ? 20.902  8.283   1.587   1.00 0.00 ? 95  GLY B O    3  
ATOM 7133  H H    . GLY B 1 95  ? 19.620  10.570  -0.576  1.00 0.00 ? 95  GLY B H    3  
ATOM 7134  H HA2  . GLY B 1 95  ? 21.424  10.826  0.808   1.00 0.00 ? 95  GLY B HA2  3  
ATOM 7135  H HA3  . GLY B 1 95  ? 20.300  11.438  2.009   1.00 0.00 ? 95  GLY B HA3  3  
ATOM 7136  N N    . ASP B 1 96  ? 20.314  9.463   3.378   1.00 0.00 ? 96  ASP B N    3  
ATOM 7137  C CA   . ASP B 1 96  ? 20.365  8.376   4.337   1.00 0.00 ? 96  ASP B CA   3  
ATOM 7138  C C    . ASP B 1 96  ? 19.058  7.597   4.384   1.00 0.00 ? 96  ASP B C    3  
ATOM 7139  O O    . ASP B 1 96  ? 18.924  6.646   5.137   1.00 0.00 ? 96  ASP B O    3  
ATOM 7140  C CB   . ASP B 1 96  ? 20.673  8.951   5.730   1.00 0.00 ? 96  ASP B CB   3  
ATOM 7141  C CG   . ASP B 1 96  ? 19.683  10.022  6.185   1.00 0.00 ? 96  ASP B CG   3  
ATOM 7142  O OD1  . ASP B 1 96  ? 19.616  11.105  5.535   1.00 0.00 ? 96  ASP B OD1  3  
ATOM 7143  O OD2  . ASP B 1 96  ? 18.969  9.832   7.183   1.00 0.00 ? 96  ASP B OD2  3  
ATOM 7144  H H    . ASP B 1 96  ? 20.041  10.342  3.721   1.00 0.00 ? 96  ASP B H    3  
ATOM 7145  H HA   . ASP B 1 96  ? 21.172  7.712   4.066   1.00 0.00 ? 96  ASP B HA   3  
ATOM 7146  H HB2  . ASP B 1 96  ? 20.654  8.148   6.451   1.00 0.00 ? 96  ASP B HB2  3  
ATOM 7147  H HB3  . ASP B 1 96  ? 21.662  9.385   5.712   1.00 0.00 ? 96  ASP B HB3  3  
ATOM 7148  N N    . VAL B 1 97  ? 18.098  7.984   3.599   1.00 0.00 ? 97  VAL B N    3  
ATOM 7149  C CA   . VAL B 1 97  ? 16.826  7.304   3.623   1.00 0.00 ? 97  VAL B CA   3  
ATOM 7150  C C    . VAL B 1 97  ? 16.666  6.435   2.378   1.00 0.00 ? 97  VAL B C    3  
ATOM 7151  O O    . VAL B 1 97  ? 16.943  6.877   1.268   1.00 0.00 ? 97  VAL B O    3  
ATOM 7152  C CB   . VAL B 1 97  ? 15.662  8.339   3.694   1.00 0.00 ? 97  VAL B CB   3  
ATOM 7153  C CG1  . VAL B 1 97  ? 14.306  7.665   3.715   1.00 0.00 ? 97  VAL B CG1  3  
ATOM 7154  C CG2  . VAL B 1 97  ? 15.812  9.220   4.905   1.00 0.00 ? 97  VAL B CG2  3  
ATOM 7155  H H    . VAL B 1 97  ? 18.247  8.724   2.972   1.00 0.00 ? 97  VAL B H    3  
ATOM 7156  H HA   . VAL B 1 97  ? 16.785  6.682   4.504   1.00 0.00 ? 97  VAL B HA   3  
ATOM 7157  H HB   . VAL B 1 97  ? 15.715  8.965   2.815   1.00 0.00 ? 97  VAL B HB   3  
ATOM 7158  H HG11 . VAL B 1 97  ? 13.526  8.411   3.752   1.00 0.00 ? 97  VAL B HG11 3  
ATOM 7159  H HG12 . VAL B 1 97  ? 14.235  7.018   4.577   1.00 0.00 ? 97  VAL B HG12 3  
ATOM 7160  H HG13 . VAL B 1 97  ? 14.208  7.084   2.811   1.00 0.00 ? 97  VAL B HG13 3  
ATOM 7161  H HG21 . VAL B 1 97  ? 15.751  8.614   5.797   1.00 0.00 ? 97  VAL B HG21 3  
ATOM 7162  H HG22 . VAL B 1 97  ? 15.019  9.953   4.912   1.00 0.00 ? 97  VAL B HG22 3  
ATOM 7163  H HG23 . VAL B 1 97  ? 16.771  9.715   4.868   1.00 0.00 ? 97  VAL B HG23 3  
ATOM 7164  N N    . ILE B 1 98  ? 16.188  5.232   2.574   1.00 0.00 ? 98  ILE B N    3  
ATOM 7165  C CA   . ILE B 1 98  ? 15.894  4.321   1.495   1.00 0.00 ? 98  ILE B CA   3  
ATOM 7166  C C    . ILE B 1 98  ? 14.432  3.958   1.613   1.00 0.00 ? 98  ILE B C    3  
ATOM 7167  O O    . ILE B 1 98  ? 14.011  3.420   2.634   1.00 0.00 ? 98  ILE B O    3  
ATOM 7168  C CB   . ILE B 1 98  ? 16.766  3.000   1.555   1.00 0.00 ? 98  ILE B CB   3  
ATOM 7169  C CG1  . ILE B 1 98  ? 18.252  3.311   1.380   1.00 0.00 ? 98  ILE B CG1  3  
ATOM 7170  C CG2  . ILE B 1 98  ? 16.301  1.998   0.485   1.00 0.00 ? 98  ILE B CG2  3  
ATOM 7171  C CD1  . ILE B 1 98  ? 19.128  2.080   1.401   1.00 0.00 ? 98  ILE B CD1  3  
ATOM 7172  H H    . ILE B 1 98  ? 15.990  4.949   3.495   1.00 0.00 ? 98  ILE B H    3  
ATOM 7173  H HA   . ILE B 1 98  ? 16.068  4.831   0.558   1.00 0.00 ? 98  ILE B HA   3  
ATOM 7174  H HB   . ILE B 1 98  ? 16.608  2.532   2.514   1.00 0.00 ? 98  ILE B HB   3  
ATOM 7175  H HG12 . ILE B 1 98  ? 18.400  3.804   0.430   1.00 0.00 ? 98  ILE B HG12 3  
ATOM 7176  H HG13 . ILE B 1 98  ? 18.574  3.965   2.176   1.00 0.00 ? 98  ILE B HG13 3  
ATOM 7177  H HG21 . ILE B 1 98  ? 16.414  2.441   -0.495  1.00 0.00 ? 98  ILE B HG21 3  
ATOM 7178  H HG22 . ILE B 1 98  ? 15.262  1.753   0.649   1.00 0.00 ? 98  ILE B HG22 3  
ATOM 7179  H HG23 . ILE B 1 98  ? 16.897  1.099   0.546   1.00 0.00 ? 98  ILE B HG23 3  
ATOM 7180  H HD11 . ILE B 1 98  ? 20.151  2.363   1.207   1.00 0.00 ? 98  ILE B HD11 3  
ATOM 7181  H HD12 . ILE B 1 98  ? 18.798  1.405   0.625   1.00 0.00 ? 98  ILE B HD12 3  
ATOM 7182  H HD13 . ILE B 1 98  ? 19.057  1.594   2.361   1.00 0.00 ? 98  ILE B HD13 3  
ATOM 7183  N N    . GLU B 1 99  ? 13.656  4.259   0.608   1.00 0.00 ? 99  GLU B N    3  
ATOM 7184  C CA   . GLU B 1 99  ? 12.251  3.949   0.640   1.00 0.00 ? 99  GLU B CA   3  
ATOM 7185  C C    . GLU B 1 99  ? 11.784  3.372   -0.658  1.00 0.00 ? 99  GLU B C    3  
ATOM 7186  O O    . GLU B 1 99  ? 12.151  3.831   -1.737  1.00 0.00 ? 99  GLU B O    3  
ATOM 7187  C CB   . GLU B 1 99  ? 11.379  5.150   1.032   1.00 0.00 ? 99  GLU B CB   3  
ATOM 7188  C CG   . GLU B 1 99  ? 11.589  5.614   2.456   1.00 0.00 ? 99  GLU B CG   3  
ATOM 7189  C CD   . GLU B 1 99  ? 10.549  6.573   2.929   1.00 0.00 ? 99  GLU B CD   3  
ATOM 7190  O OE1  . GLU B 1 99  ? 9.357   6.244   2.860   1.00 0.00 ? 99  GLU B OE1  3  
ATOM 7191  O OE2  . GLU B 1 99  ? 10.892  7.639   3.460   1.00 0.00 ? 99  GLU B OE2  3  
ATOM 7192  H H    . GLU B 1 99  ? 14.029  4.695   -0.192  1.00 0.00 ? 99  GLU B H    3  
ATOM 7193  H HA   . GLU B 1 99  ? 12.126  3.186   1.394   1.00 0.00 ? 99  GLU B HA   3  
ATOM 7194  H HB2  . GLU B 1 99  ? 11.604  5.974   0.371   1.00 0.00 ? 99  GLU B HB2  3  
ATOM 7195  H HB3  . GLU B 1 99  ? 10.341  4.878   0.913   1.00 0.00 ? 99  GLU B HB3  3  
ATOM 7196  H HG2  . GLU B 1 99  ? 11.585  4.761   3.112   1.00 0.00 ? 99  GLU B HG2  3  
ATOM 7197  H HG3  . GLU B 1 99  ? 12.552  6.095   2.513   1.00 0.00 ? 99  GLU B HG3  3  
ATOM 7198  N N    . VAL B 1 100 ? 10.992  2.362   -0.558  1.00 0.00 ? 100 VAL B N    3  
ATOM 7199  C CA   . VAL B 1 100 ? 10.416  1.740   -1.705  1.00 0.00 ? 100 VAL B CA   3  
ATOM 7200  C C    . VAL B 1 100 ? 8.933   1.864   -1.589  1.00 0.00 ? 100 VAL B C    3  
ATOM 7201  O O    . VAL B 1 100 ? 8.357   1.471   -0.577  1.00 0.00 ? 100 VAL B O    3  
ATOM 7202  C CB   . VAL B 1 100 ? 10.796  0.239   -1.836  1.00 0.00 ? 100 VAL B CB   3  
ATOM 7203  C CG1  . VAL B 1 100 ? 10.181  -0.369  -3.094  1.00 0.00 ? 100 VAL B CG1  3  
ATOM 7204  C CG2  . VAL B 1 100 ? 12.298  0.065   -1.858  1.00 0.00 ? 100 VAL B CG2  3  
ATOM 7205  H H    . VAL B 1 100 ? 10.763  2.051   0.346   1.00 0.00 ? 100 VAL B H    3  
ATOM 7206  H HA   . VAL B 1 100 ? 10.750  2.271   -2.585  1.00 0.00 ? 100 VAL B HA   3  
ATOM 7207  H HB   . VAL B 1 100 ? 10.400  -0.288  -0.981  1.00 0.00 ? 100 VAL B HB   3  
ATOM 7208  H HG11 . VAL B 1 100 ? 10.473  -1.405  -3.179  1.00 0.00 ? 100 VAL B HG11 3  
ATOM 7209  H HG12 . VAL B 1 100 ? 10.526  0.173   -3.961  1.00 0.00 ? 100 VAL B HG12 3  
ATOM 7210  H HG13 . VAL B 1 100 ? 9.104   -0.301  -3.037  1.00 0.00 ? 100 VAL B HG13 3  
ATOM 7211  H HG21 . VAL B 1 100 ? 12.535  -0.987  -1.910  1.00 0.00 ? 100 VAL B HG21 3  
ATOM 7212  H HG22 . VAL B 1 100 ? 12.724  0.484   -0.958  1.00 0.00 ? 100 VAL B HG22 3  
ATOM 7213  H HG23 . VAL B 1 100 ? 12.702  0.569   -2.722  1.00 0.00 ? 100 VAL B HG23 3  
ATOM 7214  N N    . HIS B 1 101 ? 8.333   2.424   -2.576  1.00 0.00 ? 101 HIS B N    3  
ATOM 7215  C CA   . HIS B 1 101 ? 6.908   2.584   -2.602  1.00 0.00 ? 101 HIS B CA   3  
ATOM 7216  C C    . HIS B 1 101 ? 6.404   2.007   -3.896  1.00 0.00 ? 101 HIS B C    3  
ATOM 7217  O O    . HIS B 1 101 ? 6.951   2.294   -4.952  1.00 0.00 ? 101 HIS B O    3  
ATOM 7218  C CB   . HIS B 1 101 ? 6.483   4.075   -2.440  1.00 0.00 ? 101 HIS B CB   3  
ATOM 7219  C CG   . HIS B 1 101 ? 6.923   4.998   -3.552  1.00 0.00 ? 101 HIS B CG   3  
ATOM 7220  N ND1  . HIS B 1 101 ? 6.090   5.406   -4.561  1.00 0.00 ? 101 HIS B ND1  3  
ATOM 7221  C CD2  . HIS B 1 101 ? 8.120   5.581   -3.802  1.00 0.00 ? 101 HIS B CD2  3  
ATOM 7222  C CE1  . HIS B 1 101 ? 6.744   6.190   -5.381  1.00 0.00 ? 101 HIS B CE1  3  
ATOM 7223  N NE2  . HIS B 1 101 ? 7.980   6.314   -4.946  1.00 0.00 ? 101 HIS B NE2  3  
ATOM 7224  H H    . HIS B 1 101 ? 8.866   2.708   -3.355  1.00 0.00 ? 101 HIS B H    3  
ATOM 7225  H HA   . HIS B 1 101 ? 6.501   2.003   -1.788  1.00 0.00 ? 101 HIS B HA   3  
ATOM 7226  H HB2  . HIS B 1 101 ? 5.407   4.129   -2.384  1.00 0.00 ? 101 HIS B HB2  3  
ATOM 7227  H HB3  . HIS B 1 101 ? 6.895   4.450   -1.515  1.00 0.00 ? 101 HIS B HB3  3  
ATOM 7228  H HD1  . HIS B 1 101 ? 5.144   5.155   -4.676  1.00 0.00 ? 101 HIS B HD1  3  
ATOM 7229  H HD2  . HIS B 1 101 ? 9.017   5.484   -3.208  1.00 0.00 ? 101 HIS B HD2  3  
ATOM 7230  H HE1  . HIS B 1 101 ? 6.333   6.659   -6.263  1.00 0.00 ? 101 HIS B HE1  3  
ATOM 7231  H HE2  . HIS B 1 101 ? 8.721   6.649   -5.498  1.00 0.00 ? 101 HIS B HE2  3  
ATOM 7232  N N    . GLY B 1 102 ? 5.441   1.159   -3.816  1.00 0.00 ? 102 GLY B N    3  
ATOM 7233  C CA   . GLY B 1 102 ? 4.896   0.568   -4.992  1.00 0.00 ? 102 GLY B CA   3  
ATOM 7234  C C    . GLY B 1 102 ? 3.444   0.324   -4.840  1.00 0.00 ? 102 GLY B C    3  
ATOM 7235  O O    . GLY B 1 102 ? 2.955   0.207   -3.716  1.00 0.00 ? 102 GLY B O    3  
ATOM 7236  H H    . GLY B 1 102 ? 5.076   0.899   -2.938  1.00 0.00 ? 102 GLY B H    3  
ATOM 7237  H HA2  . GLY B 1 102 ? 5.052   1.239   -5.823  1.00 0.00 ? 102 GLY B HA2  3  
ATOM 7238  H HA3  . GLY B 1 102 ? 5.392   -0.371  -5.184  1.00 0.00 ? 102 GLY B HA3  3  
ATOM 7239  N N    . LYS B 1 103 ? 2.755   0.242   -5.939  1.00 0.00 ? 103 LYS B N    3  
ATOM 7240  C CA   . LYS B 1 103 ? 1.332   0.029   -5.949  1.00 0.00 ? 103 LYS B CA   3  
ATOM 7241  C C    . LYS B 1 103 ? 0.944   -0.879  -7.127  1.00 0.00 ? 103 LYS B C    3  
ATOM 7242  O O    . LYS B 1 103 ? 1.425   -0.697  -8.238  1.00 0.00 ? 103 LYS B O    3  
ATOM 7243  C CB   . LYS B 1 103 ? 0.607   1.372   -6.067  1.00 0.00 ? 103 LYS B CB   3  
ATOM 7244  C CG   . LYS B 1 103 ? 1.060   2.211   -7.249  1.00 0.00 ? 103 LYS B CG   3  
ATOM 7245  C CD   . LYS B 1 103 ? 0.267   3.481   -7.367  1.00 0.00 ? 103 LYS B CD   3  
ATOM 7246  C CE   . LYS B 1 103 ? 0.742   4.295   -8.543  1.00 0.00 ? 103 LYS B CE   3  
ATOM 7247  N NZ   . LYS B 1 103 ? -0.063  5.506   -8.724  1.00 0.00 ? 103 LYS B NZ   3  
ATOM 7248  H H    . LYS B 1 103 ? 3.215   0.294   -6.807  1.00 0.00 ? 103 LYS B H    3  
ATOM 7249  H HA   . LYS B 1 103 ? 1.048   -0.444  -5.022  1.00 0.00 ? 103 LYS B HA   3  
ATOM 7250  H HB2  . LYS B 1 103 ? -0.450  1.182   -6.177  1.00 0.00 ? 103 LYS B HB2  3  
ATOM 7251  H HB3  . LYS B 1 103 ? 0.767   1.941   -5.163  1.00 0.00 ? 103 LYS B HB3  3  
ATOM 7252  H HG2  . LYS B 1 103 ? 2.103   2.462   -7.120  1.00 0.00 ? 103 LYS B HG2  3  
ATOM 7253  H HG3  . LYS B 1 103 ? 0.940   1.631   -8.152  1.00 0.00 ? 103 LYS B HG3  3  
ATOM 7254  H HD2  . LYS B 1 103 ? -0.775  3.236   -7.505  1.00 0.00 ? 103 LYS B HD2  3  
ATOM 7255  H HD3  . LYS B 1 103 ? 0.391   4.060   -6.463  1.00 0.00 ? 103 LYS B HD3  3  
ATOM 7256  H HE2  . LYS B 1 103 ? 1.770   4.580   -8.373  1.00 0.00 ? 103 LYS B HE2  3  
ATOM 7257  H HE3  . LYS B 1 103 ? 0.686   3.692   -9.436  1.00 0.00 ? 103 LYS B HE3  3  
ATOM 7258  H HZ1  . LYS B 1 103 ? -0.002  6.117   -7.886  1.00 0.00 ? 103 LYS B HZ1  3  
ATOM 7259  H HZ2  . LYS B 1 103 ? -1.065  5.279   -8.890  1.00 0.00 ? 103 LYS B HZ2  3  
ATOM 7260  H HZ3  . LYS B 1 103 ? 0.275   6.044   -9.546  1.00 0.00 ? 103 LYS B HZ3  3  
ATOM 7261  N N    . HIS B 1 104 ? 0.115   -1.857  -6.876  1.00 0.00 ? 104 HIS B N    3  
ATOM 7262  C CA   . HIS B 1 104 ? -0.340  -2.783  -7.905  1.00 0.00 ? 104 HIS B CA   3  
ATOM 7263  C C    . HIS B 1 104 ? -1.834  -3.028  -7.771  1.00 0.00 ? 104 HIS B C    3  
ATOM 7264  O O    . HIS B 1 104 ? -2.304  -3.395  -6.699  1.00 0.00 ? 104 HIS B O    3  
ATOM 7265  C CB   . HIS B 1 104 ? 0.462   -4.113  -7.783  1.00 0.00 ? 104 HIS B CB   3  
ATOM 7266  C CG   . HIS B 1 104 ? -0.078  -5.303  -8.538  1.00 0.00 ? 104 HIS B CG   3  
ATOM 7267  N ND1  . HIS B 1 104 ? 0.151   -5.542  -9.863  1.00 0.00 ? 104 HIS B ND1  3  
ATOM 7268  C CD2  . HIS B 1 104 ? -0.834  -6.333  -8.107  1.00 0.00 ? 104 HIS B CD2  3  
ATOM 7269  C CE1  . HIS B 1 104 ? -0.445  -6.656  -10.217 1.00 0.00 ? 104 HIS B CE1  3  
ATOM 7270  N NE2  . HIS B 1 104 ? -1.046  -7.154  -9.168  1.00 0.00 ? 104 HIS B NE2  3  
ATOM 7271  H H    . HIS B 1 104 ? -0.222  -1.987  -5.959  1.00 0.00 ? 104 HIS B H    3  
ATOM 7272  H HA   . HIS B 1 104 ? -0.137  -2.345  -8.871  1.00 0.00 ? 104 HIS B HA   3  
ATOM 7273  H HB2  . HIS B 1 104 ? 1.467   -3.945  -8.139  1.00 0.00 ? 104 HIS B HB2  3  
ATOM 7274  H HB3  . HIS B 1 104 ? 0.513   -4.378  -6.738  1.00 0.00 ? 104 HIS B HB3  3  
ATOM 7275  H HD1  . HIS B 1 104 ? 0.694   -4.987  -10.483 1.00 0.00 ? 104 HIS B HD1  3  
ATOM 7276  H HD2  . HIS B 1 104 ? -1.186  -6.479  -7.095  1.00 0.00 ? 104 HIS B HD2  3  
ATOM 7277  H HE1  . HIS B 1 104 ? -0.447  -7.092  -11.203 1.00 0.00 ? 104 HIS B HE1  3  
ATOM 7278  H HE2  . HIS B 1 104 ? -1.686  -7.899  -9.203  1.00 0.00 ? 104 HIS B HE2  3  
ATOM 7279  N N    . GLU B 1 105 ? -2.563  -2.853  -8.848  1.00 0.00 ? 105 GLU B N    3  
ATOM 7280  C CA   . GLU B 1 105 ? -3.983  -3.137  -8.855  1.00 0.00 ? 105 GLU B CA   3  
ATOM 7281  C C    . GLU B 1 105 ? -4.177  -4.604  -9.182  1.00 0.00 ? 105 GLU B C    3  
ATOM 7282  O O    . GLU B 1 105 ? -3.467  -5.157  -10.025 1.00 0.00 ? 105 GLU B O    3  
ATOM 7283  C CB   . GLU B 1 105 ? -4.734  -2.218  -9.828  1.00 0.00 ? 105 GLU B CB   3  
ATOM 7284  C CG   . GLU B 1 105 ? -4.278  -2.290  -11.268 1.00 0.00 ? 105 GLU B CG   3  
ATOM 7285  C CD   . GLU B 1 105 ? -5.016  -1.312  -12.135 1.00 0.00 ? 105 GLU B CD   3  
ATOM 7286  O OE1  . GLU B 1 105 ? -4.555  -0.157  -12.278 1.00 0.00 ? 105 GLU B OE1  3  
ATOM 7287  O OE2  . GLU B 1 105 ? -6.075  -1.654  -12.678 1.00 0.00 ? 105 GLU B OE2  3  
ATOM 7288  H H    . GLU B 1 105 ? -2.135  -2.527  -9.668  1.00 0.00 ? 105 GLU B H    3  
ATOM 7289  H HA   . GLU B 1 105 ? -4.339  -2.969  -7.850  1.00 0.00 ? 105 GLU B HA   3  
ATOM 7290  H HB2  . GLU B 1 105 ? -5.783  -2.474  -9.803  1.00 0.00 ? 105 GLU B HB2  3  
ATOM 7291  H HB3  . GLU B 1 105 ? -4.624  -1.198  -9.488  1.00 0.00 ? 105 GLU B HB3  3  
ATOM 7292  H HG2  . GLU B 1 105 ? -3.221  -2.072  -11.311 1.00 0.00 ? 105 GLU B HG2  3  
ATOM 7293  H HG3  . GLU B 1 105 ? -4.457  -3.288  -11.637 1.00 0.00 ? 105 GLU B HG3  3  
ATOM 7294  N N    . GLU B 1 106 ? -5.060  -5.243  -8.482  1.00 0.00 ? 106 GLU B N    3  
ATOM 7295  C CA   . GLU B 1 106 ? -5.213  -6.664  -8.633  1.00 0.00 ? 106 GLU B CA   3  
ATOM 7296  C C    . GLU B 1 106 ? -6.477  -7.028  -9.381  1.00 0.00 ? 106 GLU B C    3  
ATOM 7297  O O    . GLU B 1 106 ? -6.434  -7.759  -10.368 1.00 0.00 ? 106 GLU B O    3  
ATOM 7298  C CB   . GLU B 1 106 ? -5.146  -7.366  -7.273  1.00 0.00 ? 106 GLU B CB   3  
ATOM 7299  C CG   . GLU B 1 106 ? -3.874  -7.034  -6.515  1.00 0.00 ? 106 GLU B CG   3  
ATOM 7300  C CD   . GLU B 1 106 ? -3.597  -7.941  -5.352  1.00 0.00 ? 106 GLU B CD   3  
ATOM 7301  O OE1  . GLU B 1 106 ? -3.198  -9.086  -5.596  1.00 0.00 ? 106 GLU B OE1  3  
ATOM 7302  O OE2  . GLU B 1 106 ? -3.649  -7.508  -4.205  1.00 0.00 ? 106 GLU B OE2  3  
ATOM 7303  H H    . GLU B 1 106 ? -5.626  -4.737  -7.856  1.00 0.00 ? 106 GLU B H    3  
ATOM 7304  H HA   . GLU B 1 106 ? -4.375  -7.005  -9.222  1.00 0.00 ? 106 GLU B HA   3  
ATOM 7305  H HB2  . GLU B 1 106 ? -5.993  -7.061  -6.676  1.00 0.00 ? 106 GLU B HB2  3  
ATOM 7306  H HB3  . GLU B 1 106 ? -5.183  -8.434  -7.423  1.00 0.00 ? 106 GLU B HB3  3  
ATOM 7307  H HG2  . GLU B 1 106 ? -3.052  -7.119  -7.209  1.00 0.00 ? 106 GLU B HG2  3  
ATOM 7308  H HG3  . GLU B 1 106 ? -3.936  -6.015  -6.162  1.00 0.00 ? 106 GLU B HG3  3  
ATOM 7309  N N    . ARG B 1 107 ? -7.594  -6.545  -8.911  1.00 0.00 ? 107 ARG B N    3  
ATOM 7310  C CA   . ARG B 1 107 ? -8.858  -6.858  -9.527  1.00 0.00 ? 107 ARG B CA   3  
ATOM 7311  C C    . ARG B 1 107 ? -9.845  -5.731  -9.407  1.00 0.00 ? 107 ARG B C    3  
ATOM 7312  O O    . ARG B 1 107 ? -9.735  -4.888  -8.516  1.00 0.00 ? 107 ARG B O    3  
ATOM 7313  C CB   . ARG B 1 107 ? -9.411  -8.184  -8.998  1.00 0.00 ? 107 ARG B CB   3  
ATOM 7314  C CG   . ARG B 1 107 ? -9.306  -8.362  -7.506  1.00 0.00 ? 107 ARG B CG   3  
ATOM 7315  C CD   . ARG B 1 107 ? -9.706  -9.770  -7.116  1.00 0.00 ? 107 ARG B CD   3  
ATOM 7316  N NE   . ARG B 1 107 ? -9.483  -10.049 -5.705  1.00 0.00 ? 107 ARG B NE   3  
ATOM 7317  C CZ   . ARG B 1 107 ? -8.446  -10.735 -5.217  1.00 0.00 ? 107 ARG B CZ   3  
ATOM 7318  N NH1  . ARG B 1 107 ? -7.456  -11.138 -6.019  1.00 0.00 ? 107 ARG B NH1  3  
ATOM 7319  N NH2  . ARG B 1 107 ? -8.413  -11.026 -3.933  1.00 0.00 ? 107 ARG B NH2  3  
ATOM 7320  H H    . ARG B 1 107 ? -7.600  -5.941  -8.139  1.00 0.00 ? 107 ARG B H    3  
ATOM 7321  H HA   . ARG B 1 107 ? -8.652  -6.983  -10.580 1.00 0.00 ? 107 ARG B HA   3  
ATOM 7322  H HB2  . ARG B 1 107 ? -10.453 -8.257  -9.271  1.00 0.00 ? 107 ARG B HB2  3  
ATOM 7323  H HB3  . ARG B 1 107 ? -8.872  -8.988  -9.476  1.00 0.00 ? 107 ARG B HB3  3  
ATOM 7324  H HG2  . ARG B 1 107 ? -8.281  -8.190  -7.208  1.00 0.00 ? 107 ARG B HG2  3  
ATOM 7325  H HG3  . ARG B 1 107 ? -9.951  -7.652  -7.012  1.00 0.00 ? 107 ARG B HG3  3  
ATOM 7326  H HD2  . ARG B 1 107 ? -10.755 -9.906  -7.330  1.00 0.00 ? 107 ARG B HD2  3  
ATOM 7327  H HD3  . ARG B 1 107 ? -9.134  -10.471 -7.706  1.00 0.00 ? 107 ARG B HD3  3  
ATOM 7328  H HE   . ARG B 1 107 ? -10.192 -9.751  -5.081  1.00 0.00 ? 107 ARG B HE   3  
ATOM 7329  H HH11 . ARG B 1 107 ? -7.451  -10.952 -7.003  1.00 0.00 ? 107 ARG B HH11 3  
ATOM 7330  H HH12 . ARG B 1 107 ? -6.670  -11.655 -5.668  1.00 0.00 ? 107 ARG B HH12 3  
ATOM 7331  H HH21 . ARG B 1 107 ? -9.200  -10.713 -3.374  1.00 0.00 ? 107 ARG B HH21 3  
ATOM 7332  H HH22 . ARG B 1 107 ? -7.683  -11.548 -3.489  1.00 0.00 ? 107 ARG B HH22 3  
ATOM 7333  N N    . GLN B 1 108 ? -10.747 -5.686  -10.346 1.00 0.00 ? 108 GLN B N    3  
ATOM 7334  C CA   . GLN B 1 108 ? -11.802 -4.711  -10.403 1.00 0.00 ? 108 GLN B CA   3  
ATOM 7335  C C    . GLN B 1 108 ? -13.140 -5.392  -10.156 1.00 0.00 ? 108 GLN B C    3  
ATOM 7336  O O    . GLN B 1 108 ? -13.513 -6.337  -10.858 1.00 0.00 ? 108 GLN B O    3  
ATOM 7337  C CB   . GLN B 1 108 ? -11.782 -4.027  -11.773 1.00 0.00 ? 108 GLN B CB   3  
ATOM 7338  C CG   . GLN B 1 108 ? -12.961 -3.101  -12.048 1.00 0.00 ? 108 GLN B CG   3  
ATOM 7339  C CD   . GLN B 1 108 ? -12.883 -2.455  -13.415 1.00 0.00 ? 108 GLN B CD   3  
ATOM 7340  O OE1  . GLN B 1 108 ? -11.800 -2.187  -13.929 1.00 0.00 ? 108 GLN B OE1  3  
ATOM 7341  N NE2  . GLN B 1 108 ? -14.009 -2.234  -14.027 1.00 0.00 ? 108 GLN B NE2  3  
ATOM 7342  H H    . GLN B 1 108 ? -10.726 -6.359  -11.061 1.00 0.00 ? 108 GLN B H    3  
ATOM 7343  H HA   . GLN B 1 108 ? -11.633 -3.972  -9.636  1.00 0.00 ? 108 GLN B HA   3  
ATOM 7344  H HB2  . GLN B 1 108 ? -10.878 -3.439  -11.842 1.00 0.00 ? 108 GLN B HB2  3  
ATOM 7345  H HB3  . GLN B 1 108 ? -11.753 -4.785  -12.540 1.00 0.00 ? 108 GLN B HB3  3  
ATOM 7346  H HG2  . GLN B 1 108 ? -13.877 -3.669  -11.984 1.00 0.00 ? 108 GLN B HG2  3  
ATOM 7347  H HG3  . GLN B 1 108 ? -12.970 -2.324  -11.298 1.00 0.00 ? 108 GLN B HG3  3  
ATOM 7348  H HE21 . GLN B 1 108 ? -14.857 -2.490  -13.604 1.00 0.00 ? 108 GLN B HE21 3  
ATOM 7349  H HE22 . GLN B 1 108 ? -13.984 -1.811  -14.911 1.00 0.00 ? 108 GLN B HE22 3  
ATOM 7350  N N    . ASP B 1 109 ? -13.833 -4.915  -9.146  1.00 0.00 ? 109 ASP B N    3  
ATOM 7351  C CA   . ASP B 1 109 ? -15.149 -5.406  -8.779  1.00 0.00 ? 109 ASP B CA   3  
ATOM 7352  C C    . ASP B 1 109 ? -16.161 -4.881  -9.777  1.00 0.00 ? 109 ASP B C    3  
ATOM 7353  O O    . ASP B 1 109 ? -16.711 -5.631  -10.579 1.00 0.00 ? 109 ASP B O    3  
ATOM 7354  C CB   . ASP B 1 109 ? -15.542 -4.940  -7.358  1.00 0.00 ? 109 ASP B CB   3  
ATOM 7355  C CG   . ASP B 1 109 ? -14.621 -5.447  -6.266  1.00 0.00 ? 109 ASP B CG   3  
ATOM 7356  O OD1  . ASP B 1 109 ? -14.833 -6.585  -5.786  1.00 0.00 ? 109 ASP B OD1  3  
ATOM 7357  O OD2  . ASP B 1 109 ? -13.704 -4.729  -5.877  1.00 0.00 ? 109 ASP B OD2  3  
ATOM 7358  H H    . ASP B 1 109 ? -13.443 -4.184  -8.616  1.00 0.00 ? 109 ASP B H    3  
ATOM 7359  H HA   . ASP B 1 109 ? -15.134 -6.486  -8.812  1.00 0.00 ? 109 ASP B HA   3  
ATOM 7360  H HB2  . ASP B 1 109 ? -15.516 -3.861  -7.335  1.00 0.00 ? 109 ASP B HB2  3  
ATOM 7361  H HB3  . ASP B 1 109 ? -16.547 -5.270  -7.148  1.00 0.00 ? 109 ASP B HB3  3  
ATOM 7362  N N    . GLU B 1 110 ? -16.366 -3.575  -9.733  1.00 0.00 ? 110 GLU B N    3  
ATOM 7363  C CA   . GLU B 1 110 ? -17.221 -2.834  -10.658 1.00 0.00 ? 110 GLU B CA   3  
ATOM 7364  C C    . GLU B 1 110 ? -17.148 -1.379  -10.275 1.00 0.00 ? 110 GLU B C    3  
ATOM 7365  O O    . GLU B 1 110 ? -17.679 -0.985  -9.244  1.00 0.00 ? 110 GLU B O    3  
ATOM 7366  C CB   . GLU B 1 110 ? -18.678 -3.296  -10.623 1.00 0.00 ? 110 GLU B CB   3  
ATOM 7367  C CG   . GLU B 1 110 ? -19.543 -2.598  -11.662 1.00 0.00 ? 110 GLU B CG   3  
ATOM 7368  C CD   . GLU B 1 110 ? -20.972 -3.032  -11.627 1.00 0.00 ? 110 GLU B CD   3  
ATOM 7369  O OE1  . GLU B 1 110 ? -21.308 -4.063  -12.244 1.00 0.00 ? 110 GLU B OE1  3  
ATOM 7370  O OE2  . GLU B 1 110 ? -21.797 -2.344  -10.999 1.00 0.00 ? 110 GLU B OE2  3  
ATOM 7371  H H    . GLU B 1 110 ? -15.928 -3.072  -9.015  1.00 0.00 ? 110 GLU B H    3  
ATOM 7372  H HA   . GLU B 1 110 ? -16.812 -2.957  -11.650 1.00 0.00 ? 110 GLU B HA   3  
ATOM 7373  H HB2  . GLU B 1 110 ? -18.711 -4.360  -10.807 1.00 0.00 ? 110 GLU B HB2  3  
ATOM 7374  H HB3  . GLU B 1 110 ? -19.090 -3.092  -9.644  1.00 0.00 ? 110 GLU B HB3  3  
ATOM 7375  H HG2  . GLU B 1 110 ? -19.510 -1.534  -11.482 1.00 0.00 ? 110 GLU B HG2  3  
ATOM 7376  H HG3  . GLU B 1 110 ? -19.139 -2.804  -12.642 1.00 0.00 ? 110 GLU B HG3  3  
ATOM 7377  N N    . HIS B 1 111 ? -16.433 -0.591  -11.089 1.00 0.00 ? 111 HIS B N    3  
ATOM 7378  C CA   . HIS B 1 111 ? -16.176 0.853   -10.831 1.00 0.00 ? 111 HIS B CA   3  
ATOM 7379  C C    . HIS B 1 111 ? -15.429 0.997   -9.536  1.00 0.00 ? 111 HIS B C    3  
ATOM 7380  O O    . HIS B 1 111 ? -15.477 2.033   -8.866  1.00 0.00 ? 111 HIS B O    3  
ATOM 7381  C CB   . HIS B 1 111 ? -17.488 1.669   -10.787 1.00 0.00 ? 111 HIS B CB   3  
ATOM 7382  C CG   . HIS B 1 111 ? -18.309 1.575   -12.030 1.00 0.00 ? 111 HIS B CG   3  
ATOM 7383  N ND1  . HIS B 1 111 ? -19.570 1.027   -12.053 1.00 0.00 ? 111 HIS B ND1  3  
ATOM 7384  C CD2  . HIS B 1 111 ? -18.046 1.952   -13.300 1.00 0.00 ? 111 HIS B CD2  3  
ATOM 7385  C CE1  . HIS B 1 111 ? -20.041 1.065   -13.276 1.00 0.00 ? 111 HIS B CE1  3  
ATOM 7386  N NE2  . HIS B 1 111 ? -19.140 1.620   -14.049 1.00 0.00 ? 111 HIS B NE2  3  
ATOM 7387  H H    . HIS B 1 111 ? -16.090 -0.981  -11.923 1.00 0.00 ? 111 HIS B H    3  
ATOM 7388  H HA   . HIS B 1 111 ? -15.550 1.217   -11.632 1.00 0.00 ? 111 HIS B HA   3  
ATOM 7389  H HB2  . HIS B 1 111 ? -18.093 1.296   -9.974  1.00 0.00 ? 111 HIS B HB2  3  
ATOM 7390  H HB3  . HIS B 1 111 ? -17.261 2.709   -10.604 1.00 0.00 ? 111 HIS B HB3  3  
ATOM 7391  H HD1  . HIS B 1 111 ? -20.067 0.666   -11.284 1.00 0.00 ? 111 HIS B HD1  3  
ATOM 7392  H HD2  . HIS B 1 111 ? -17.144 2.428   -13.655 1.00 0.00 ? 111 HIS B HD2  3  
ATOM 7393  H HE1  . HIS B 1 111 ? -21.007 0.699   -13.594 1.00 0.00 ? 111 HIS B HE1  3  
ATOM 7394  H HE2  . HIS B 1 111 ? -19.327 1.967   -14.952 1.00 0.00 ? 111 HIS B HE2  3  
ATOM 7395  N N    . GLY B 1 112 ? -14.760 -0.066  -9.206  1.00 0.00 ? 112 GLY B N    3  
ATOM 7396  C CA   . GLY B 1 112 ? -14.040 -0.190  -8.025  1.00 0.00 ? 112 GLY B CA   3  
ATOM 7397  C C    . GLY B 1 112 ? -12.991 -1.169  -8.226  1.00 0.00 ? 112 GLY B C    3  
ATOM 7398  O O    . GLY B 1 112 ? -13.257 -2.301  -8.604  1.00 0.00 ? 112 GLY B O    3  
ATOM 7399  H H    . GLY B 1 112 ? -14.754 -0.827  -9.823  1.00 0.00 ? 112 GLY B H    3  
ATOM 7400  H HA2  . GLY B 1 112 ? -13.605 0.764   -7.766  1.00 0.00 ? 112 GLY B HA2  3  
ATOM 7401  H HA3  . GLY B 1 112 ? -14.688 -0.525  -7.228  1.00 0.00 ? 112 GLY B HA3  3  
ATOM 7402  N N    . PHE B 1 113 ? -11.839 -0.741  -8.056  1.00 0.00 ? 113 PHE B N    3  
ATOM 7403  C CA   . PHE B 1 113 ? -10.703 -1.527  -8.265  1.00 0.00 ? 113 PHE B CA   3  
ATOM 7404  C C    . PHE B 1 113 ? -9.947  -1.634  -6.996  1.00 0.00 ? 113 PHE B C    3  
ATOM 7405  O O    . PHE B 1 113 ? -10.029 -0.734  -6.130  1.00 0.00 ? 113 PHE B O    3  
ATOM 7406  C CB   . PHE B 1 113 ? -9.872  -0.990  -9.442  1.00 0.00 ? 113 PHE B CB   3  
ATOM 7407  C CG   . PHE B 1 113 ? -9.709  0.511   -9.465  1.00 0.00 ? 113 PHE B CG   3  
ATOM 7408  C CD1  . PHE B 1 113 ? -8.666  1.122   -8.786  1.00 0.00 ? 113 PHE B CD1  3  
ATOM 7409  C CD2  . PHE B 1 113 ? -10.592 1.302   -10.179 1.00 0.00 ? 113 PHE B CD2  3  
ATOM 7410  C CE1  . PHE B 1 113 ? -8.511  2.492   -8.818  1.00 0.00 ? 113 PHE B CE1  3  
ATOM 7411  C CE2  . PHE B 1 113 ? -10.442 2.669   -10.216 1.00 0.00 ? 113 PHE B CE2  3  
ATOM 7412  C CZ   . PHE B 1 113 ? -9.401  3.267   -9.535  1.00 0.00 ? 113 PHE B CZ   3  
ATOM 7413  H H    . PHE B 1 113 ? -11.730 0.179   -7.724  1.00 0.00 ? 113 PHE B H    3  
ATOM 7414  H HA   . PHE B 1 113 ? -11.050 -2.518  -8.512  1.00 0.00 ? 113 PHE B HA   3  
ATOM 7415  H HB2  . PHE B 1 113 ? -8.884  -1.422  -9.400  1.00 0.00 ? 113 PHE B HB2  3  
ATOM 7416  H HB3  . PHE B 1 113 ? -10.343 -1.290  -10.366 1.00 0.00 ? 113 PHE B HB3  3  
ATOM 7417  H HD1  . PHE B 1 113 ? -7.970  0.515   -8.226  1.00 0.00 ? 113 PHE B HD1  3  
ATOM 7418  H HD2  . PHE B 1 113 ? -11.408 0.834   -10.709 1.00 0.00 ? 113 PHE B HD2  3  
ATOM 7419  H HE1  . PHE B 1 113 ? -7.696  2.959   -8.284  1.00 0.00 ? 113 PHE B HE1  3  
ATOM 7420  H HE2  . PHE B 1 113 ? -11.141 3.268   -10.779 1.00 0.00 ? 113 PHE B HE2  3  
ATOM 7421  H HZ   . PHE B 1 113 ? -9.284  4.340   -9.565  1.00 0.00 ? 113 PHE B HZ   3  
ATOM 7422  N N    . ILE B 1 114 ? -9.215  -2.687  -6.853  1.00 0.00 ? 114 ILE B N    3  
ATOM 7423  C CA   . ILE B 1 114 ? -8.542  -2.924  -5.637  1.00 0.00 ? 114 ILE B CA   3  
ATOM 7424  C C    . ILE B 1 114 ? -7.089  -3.004  -5.945  1.00 0.00 ? 114 ILE B C    3  
ATOM 7425  O O    . ILE B 1 114 ? -6.674  -3.488  -7.021  1.00 0.00 ? 114 ILE B O    3  
ATOM 7426  C CB   . ILE B 1 114 ? -8.987  -4.265  -4.903  1.00 0.00 ? 114 ILE B CB   3  
ATOM 7427  C CG1  . ILE B 1 114 ? -8.193  -5.503  -5.366  1.00 0.00 ? 114 ILE B CG1  3  
ATOM 7428  C CG2  . ILE B 1 114 ? -10.467 -4.528  -5.148  1.00 0.00 ? 114 ILE B CG2  3  
ATOM 7429  C CD1  . ILE B 1 114 ? -8.427  -6.731  -4.503  1.00 0.00 ? 114 ILE B CD1  3  
ATOM 7430  H H    . ILE B 1 114 ? -9.138  -3.341  -7.584  1.00 0.00 ? 114 ILE B H    3  
ATOM 7431  H HA   . ILE B 1 114 ? -8.724  -2.088  -4.977  1.00 0.00 ? 114 ILE B HA   3  
ATOM 7432  H HB   . ILE B 1 114 ? -8.842  -4.127  -3.841  1.00 0.00 ? 114 ILE B HB   3  
ATOM 7433  H HG12 . ILE B 1 114 ? -8.483  -5.750  -6.377  1.00 0.00 ? 114 ILE B HG12 3  
ATOM 7434  H HG13 . ILE B 1 114 ? -7.138  -5.274  -5.345  1.00 0.00 ? 114 ILE B HG13 3  
ATOM 7435  H HG21 . ILE B 1 114 ? -11.071 -3.710  -4.788  1.00 0.00 ? 114 ILE B HG21 3  
ATOM 7436  H HG22 . ILE B 1 114 ? -10.751 -5.438  -4.641  1.00 0.00 ? 114 ILE B HG22 3  
ATOM 7437  H HG23 . ILE B 1 114 ? -10.628 -4.652  -6.208  1.00 0.00 ? 114 ILE B HG23 3  
ATOM 7438  H HD11 . ILE B 1 114 ? -7.853  -7.558  -4.891  1.00 0.00 ? 114 ILE B HD11 3  
ATOM 7439  H HD12 . ILE B 1 114 ? -9.477  -6.984  -4.517  1.00 0.00 ? 114 ILE B HD12 3  
ATOM 7440  H HD13 . ILE B 1 114 ? -8.119  -6.521  -3.488  1.00 0.00 ? 114 ILE B HD13 3  
ATOM 7441  N N    . SER B 1 115 ? -6.319  -2.451  -5.083  1.00 0.00 ? 115 SER B N    3  
ATOM 7442  C CA   . SER B 1 115 ? -4.925  -2.425  -5.232  1.00 0.00 ? 115 SER B CA   3  
ATOM 7443  C C    . SER B 1 115 ? -4.256  -2.799  -3.929  1.00 0.00 ? 115 SER B C    3  
ATOM 7444  O O    . SER B 1 115 ? -4.829  -2.633  -2.838  1.00 0.00 ? 115 SER B O    3  
ATOM 7445  C CB   . SER B 1 115 ? -4.502  -1.020  -5.661  1.00 0.00 ? 115 SER B CB   3  
ATOM 7446  O OG   . SER B 1 115 ? -5.277  -0.582  -6.781  1.00 0.00 ? 115 SER B OG   3  
ATOM 7447  H H    . SER B 1 115 ? -6.681  -2.012  -4.280  1.00 0.00 ? 115 SER B H    3  
ATOM 7448  H HA   . SER B 1 115 ? -4.630  -3.121  -5.998  1.00 0.00 ? 115 SER B HA   3  
ATOM 7449  H HB2  . SER B 1 115 ? -4.651  -0.334  -4.841  1.00 0.00 ? 115 SER B HB2  3  
ATOM 7450  H HB3  . SER B 1 115 ? -3.458  -1.026  -5.942  1.00 0.00 ? 115 SER B HB3  3  
ATOM 7451  H HG   . SER B 1 115 ? -5.730  -1.359  -7.130  1.00 0.00 ? 115 SER B HG   3  
ATOM 7452  N N    . ARG B 1 116 ? -3.062  -3.250  -4.047  1.00 0.00 ? 116 ARG B N    3  
ATOM 7453  C CA   . ARG B 1 116 ? -2.236  -3.553  -2.951  1.00 0.00 ? 116 ARG B CA   3  
ATOM 7454  C C    . ARG B 1 116 ? -0.982  -2.789  -3.199  1.00 0.00 ? 116 ARG B C    3  
ATOM 7455  O O    . ARG B 1 116 ? -0.571  -2.614  -4.349  1.00 0.00 ? 116 ARG B O    3  
ATOM 7456  C CB   . ARG B 1 116 ? -1.986  -5.070  -2.919  1.00 0.00 ? 116 ARG B CB   3  
ATOM 7457  C CG   . ARG B 1 116 ? -0.828  -5.550  -2.046  1.00 0.00 ? 116 ARG B CG   3  
ATOM 7458  C CD   . ARG B 1 116 ? -0.795  -7.079  -1.962  1.00 0.00 ? 116 ARG B CD   3  
ATOM 7459  N NE   . ARG B 1 116 ? -1.052  -7.730  -3.258  1.00 0.00 ? 116 ARG B NE   3  
ATOM 7460  C CZ   . ARG B 1 116 ? -0.173  -8.443  -3.983  1.00 0.00 ? 116 ARG B CZ   3  
ATOM 7461  N NH1  . ARG B 1 116 ? 1.094   -8.550  -3.597  1.00 0.00 ? 116 ARG B NH1  3  
ATOM 7462  N NH2  . ARG B 1 116 ? -0.580  -9.066  -5.080  1.00 0.00 ? 116 ARG B NH2  3  
ATOM 7463  H H    . ARG B 1 116 ? -2.674  -3.383  -4.942  1.00 0.00 ? 116 ARG B H    3  
ATOM 7464  H HA   . ARG B 1 116 ? -2.707  -3.231  -2.035  1.00 0.00 ? 116 ARG B HA   3  
ATOM 7465  H HB2  . ARG B 1 116 ? -2.881  -5.556  -2.563  1.00 0.00 ? 116 ARG B HB2  3  
ATOM 7466  H HB3  . ARG B 1 116 ? -1.803  -5.402  -3.930  1.00 0.00 ? 116 ARG B HB3  3  
ATOM 7467  H HG2  . ARG B 1 116 ? 0.103   -5.200  -2.468  1.00 0.00 ? 116 ARG B HG2  3  
ATOM 7468  H HG3  . ARG B 1 116 ? -0.936  -5.145  -1.049  1.00 0.00 ? 116 ARG B HG3  3  
ATOM 7469  H HD2  . ARG B 1 116 ? 0.174   -7.386  -1.601  1.00 0.00 ? 116 ARG B HD2  3  
ATOM 7470  H HD3  . ARG B 1 116 ? -1.550  -7.398  -1.257  1.00 0.00 ? 116 ARG B HD3  3  
ATOM 7471  H HE   . ARG B 1 116 ? -1.994  -7.639  -3.567  1.00 0.00 ? 116 ARG B HE   3  
ATOM 7472  H HH11 . ARG B 1 116 ? 1.425   -8.118  -2.762  1.00 0.00 ? 116 ARG B HH11 3  
ATOM 7473  H HH12 . ARG B 1 116 ? 1.777   -9.059  -4.140  1.00 0.00 ? 116 ARG B HH12 3  
ATOM 7474  H HH21 . ARG B 1 116 ? -1.554  -9.015  -5.355  1.00 0.00 ? 116 ARG B HH21 3  
ATOM 7475  H HH22 . ARG B 1 116 ? 0.026   -9.593  -5.685  1.00 0.00 ? 116 ARG B HH22 3  
ATOM 7476  N N    . GLU B 1 117 ? -0.379  -2.350  -2.168  1.00 0.00 ? 117 GLU B N    3  
ATOM 7477  C CA   . GLU B 1 117 ? 0.734   -1.480  -2.265  1.00 0.00 ? 117 GLU B CA   3  
ATOM 7478  C C    . GLU B 1 117 ? 1.774   -1.936  -1.283  1.00 0.00 ? 117 GLU B C    3  
ATOM 7479  O O    . GLU B 1 117 ? 1.451   -2.622  -0.312  1.00 0.00 ? 117 GLU B O    3  
ATOM 7480  C CB   . GLU B 1 117 ? 0.282   -0.032  -1.958  1.00 0.00 ? 117 GLU B CB   3  
ATOM 7481  C CG   . GLU B 1 117 ? -0.894  0.460   -2.817  1.00 0.00 ? 117 GLU B CG   3  
ATOM 7482  C CD   . GLU B 1 117 ? -1.317  1.879   -2.520  1.00 0.00 ? 117 GLU B CD   3  
ATOM 7483  O OE1  . GLU B 1 117 ? -2.101  2.101   -1.576  1.00 0.00 ? 117 GLU B OE1  3  
ATOM 7484  O OE2  . GLU B 1 117 ? -0.890  2.798   -3.262  1.00 0.00 ? 117 GLU B OE2  3  
ATOM 7485  H H    . GLU B 1 117 ? -0.686  -2.598  -1.267  1.00 0.00 ? 117 GLU B H    3  
ATOM 7486  H HA   . GLU B 1 117 ? 1.131   -1.520  -3.268  1.00 0.00 ? 117 GLU B HA   3  
ATOM 7487  H HB2  . GLU B 1 117 ? -0.028  0.018   -0.929  1.00 0.00 ? 117 GLU B HB2  3  
ATOM 7488  H HB3  . GLU B 1 117 ? 1.120   0.631   -2.110  1.00 0.00 ? 117 GLU B HB3  3  
ATOM 7489  H HG2  . GLU B 1 117 ? -0.612  0.404   -3.858  1.00 0.00 ? 117 GLU B HG2  3  
ATOM 7490  H HG3  . GLU B 1 117 ? -1.735  -0.195  -2.647  1.00 0.00 ? 117 GLU B HG3  3  
ATOM 7491  N N    . PHE B 1 118 ? 2.997   -1.643  -1.562  1.00 0.00 ? 118 PHE B N    3  
ATOM 7492  C CA   . PHE B 1 118 ? 4.076   -1.977  -0.677  1.00 0.00 ? 118 PHE B CA   3  
ATOM 7493  C C    . PHE B 1 118 ? 4.920   -0.785  -0.406  1.00 0.00 ? 118 PHE B C    3  
ATOM 7494  O O    . PHE B 1 118 ? 5.283   -0.038  -1.319  1.00 0.00 ? 118 PHE B O    3  
ATOM 7495  C CB   . PHE B 1 118 ? 4.939   -3.133  -1.185  1.00 0.00 ? 118 PHE B CB   3  
ATOM 7496  C CG   . PHE B 1 118 ? 4.347   -4.494  -0.966  1.00 0.00 ? 118 PHE B CG   3  
ATOM 7497  C CD1  . PHE B 1 118 ? 3.539   -5.070  -1.909  1.00 0.00 ? 118 PHE B CD1  3  
ATOM 7498  C CD2  . PHE B 1 118 ? 4.625   -5.201  0.190   1.00 0.00 ? 118 PHE B CD2  3  
ATOM 7499  C CE1  . PHE B 1 118 ? 3.011   -6.323  -1.720  1.00 0.00 ? 118 PHE B CE1  3  
ATOM 7500  C CE2  . PHE B 1 118 ? 4.100   -6.459  0.391   1.00 0.00 ? 118 PHE B CE2  3  
ATOM 7501  C CZ   . PHE B 1 118 ? 3.291   -7.021  -0.569  1.00 0.00 ? 118 PHE B CZ   3  
ATOM 7502  H H    . PHE B 1 118 ? 3.190   -1.134  -2.380  1.00 0.00 ? 118 PHE B H    3  
ATOM 7503  H HA   . PHE B 1 118 ? 3.624   -2.277  0.257   1.00 0.00 ? 118 PHE B HA   3  
ATOM 7504  H HB2  . PHE B 1 118 ? 5.092   -3.011  -2.248  1.00 0.00 ? 118 PHE B HB2  3  
ATOM 7505  H HB3  . PHE B 1 118 ? 5.896   -3.098  -0.686  1.00 0.00 ? 118 PHE B HB3  3  
ATOM 7506  H HD1  . PHE B 1 118 ? 3.315   -4.526  -2.816  1.00 0.00 ? 118 PHE B HD1  3  
ATOM 7507  H HD2  . PHE B 1 118 ? 5.260   -4.756  0.942   1.00 0.00 ? 118 PHE B HD2  3  
ATOM 7508  H HE1  . PHE B 1 118 ? 2.376   -6.754  -2.478  1.00 0.00 ? 118 PHE B HE1  3  
ATOM 7509  H HE2  . PHE B 1 118 ? 4.325   -7.002  1.298   1.00 0.00 ? 118 PHE B HE2  3  
ATOM 7510  H HZ   . PHE B 1 118 ? 2.875   -8.006  -0.419  1.00 0.00 ? 118 PHE B HZ   3  
ATOM 7511  N N    . HIS B 1 119 ? 5.221   -0.593  0.852   1.00 0.00 ? 119 HIS B N    3  
ATOM 7512  C CA   . HIS B 1 119 ? 6.073   0.477   1.281   1.00 0.00 ? 119 HIS B CA   3  
ATOM 7513  C C    . HIS B 1 119 ? 7.146   -0.044  2.232   1.00 0.00 ? 119 HIS B C    3  
ATOM 7514  O O    . HIS B 1 119 ? 6.844   -0.625  3.256   1.00 0.00 ? 119 HIS B O    3  
ATOM 7515  C CB   . HIS B 1 119 ? 5.266   1.613   1.942   1.00 0.00 ? 119 HIS B CB   3  
ATOM 7516  C CG   . HIS B 1 119 ? 6.111   2.757   2.456   1.00 0.00 ? 119 HIS B CG   3  
ATOM 7517  N ND1  . HIS B 1 119 ? 6.177   3.106   3.782   1.00 0.00 ? 119 HIS B ND1  3  
ATOM 7518  C CD2  . HIS B 1 119 ? 6.929   3.629   1.807   1.00 0.00 ? 119 HIS B CD2  3  
ATOM 7519  C CE1  . HIS B 1 119 ? 6.988   4.132   3.924   1.00 0.00 ? 119 HIS B CE1  3  
ATOM 7520  N NE2  . HIS B 1 119 ? 7.453   4.464   2.754   1.00 0.00 ? 119 HIS B NE2  3  
ATOM 7521  H H    . HIS B 1 119 ? 4.876   -1.222  1.526   1.00 0.00 ? 119 HIS B H    3  
ATOM 7522  H HA   . HIS B 1 119 ? 6.563   0.870   0.401   1.00 0.00 ? 119 HIS B HA   3  
ATOM 7523  H HB2  . HIS B 1 119 ? 4.569   2.017   1.221   1.00 0.00 ? 119 HIS B HB2  3  
ATOM 7524  H HB3  . HIS B 1 119 ? 4.712   1.207   2.776   1.00 0.00 ? 119 HIS B HB3  3  
ATOM 7525  H HD1  . HIS B 1 119 ? 5.695   2.678   4.524   1.00 0.00 ? 119 HIS B HD1  3  
ATOM 7526  H HD2  . HIS B 1 119 ? 7.127   3.654   0.744   1.00 0.00 ? 119 HIS B HD2  3  
ATOM 7527  H HE1  . HIS B 1 119 ? 7.245   4.617   4.853   1.00 0.00 ? 119 HIS B HE1  3  
ATOM 7528  H HE2  . HIS B 1 119 ? 8.177   5.134   2.631   1.00 0.00 ? 119 HIS B HE2  3  
ATOM 7529  N N    . ARG B 1 120 ? 8.371   0.166   1.886   1.00 0.00 ? 120 ARG B N    3  
ATOM 7530  C CA   . ARG B 1 120 ? 9.487   -0.149  2.759   1.00 0.00 ? 120 ARG B CA   3  
ATOM 7531  C C    . ARG B 1 120 ? 10.164  1.133   3.097   1.00 0.00 ? 120 ARG B C    3  
ATOM 7532  O O    . ARG B 1 120 ? 10.296  1.992   2.221   1.00 0.00 ? 120 ARG B O    3  
ATOM 7533  C CB   . ARG B 1 120 ? 10.475  -1.122  2.098   1.00 0.00 ? 120 ARG B CB   3  
ATOM 7534  C CG   . ARG B 1 120 ? 10.043  -2.571  2.157   1.00 0.00 ? 120 ARG B CG   3  
ATOM 7535  C CD   . ARG B 1 120 ? 10.943  -3.486  1.356   1.00 0.00 ? 120 ARG B CD   3  
ATOM 7536  N NE   . ARG B 1 120 ? 10.824  -3.260  -0.107  1.00 0.00 ? 120 ARG B NE   3  
ATOM 7537  C CZ   . ARG B 1 120 ? 10.969  -4.228  -1.035  1.00 0.00 ? 120 ARG B CZ   3  
ATOM 7538  N NH1  . ARG B 1 120 ? 11.262  -5.454  -0.669  1.00 0.00 ? 120 ARG B NH1  3  
ATOM 7539  N NH2  . ARG B 1 120 ? 10.814  -3.965  -2.330  1.00 0.00 ? 120 ARG B NH2  3  
ATOM 7540  H H    . ARG B 1 120 ? 8.544   0.590   1.014   1.00 0.00 ? 120 ARG B H    3  
ATOM 7541  H HA   . ARG B 1 120 ? 9.092   -0.584  3.665   1.00 0.00 ? 120 ARG B HA   3  
ATOM 7542  H HB2  . ARG B 1 120 ? 10.604  -0.844  1.063   1.00 0.00 ? 120 ARG B HB2  3  
ATOM 7543  H HB3  . ARG B 1 120 ? 11.419  -1.027  2.610   1.00 0.00 ? 120 ARG B HB3  3  
ATOM 7544  H HG2  . ARG B 1 120 ? 10.063  -2.881  3.190   1.00 0.00 ? 120 ARG B HG2  3  
ATOM 7545  H HG3  . ARG B 1 120 ? 9.031   -2.648  1.785   1.00 0.00 ? 120 ARG B HG3  3  
ATOM 7546  H HD2  . ARG B 1 120 ? 11.965  -3.314  1.658   1.00 0.00 ? 120 ARG B HD2  3  
ATOM 7547  H HD3  . ARG B 1 120 ? 10.677  -4.510  1.573   1.00 0.00 ? 120 ARG B HD3  3  
ATOM 7548  H HE   . ARG B 1 120 ? 10.617  -2.333  -0.354  1.00 0.00 ? 120 ARG B HE   3  
ATOM 7549  H HH11 . ARG B 1 120 ? 11.382  -5.714  0.296   1.00 0.00 ? 120 ARG B HH11 3  
ATOM 7550  H HH12 . ARG B 1 120 ? 11.374  -6.194  -1.338  1.00 0.00 ? 120 ARG B HH12 3  
ATOM 7551  H HH21 . ARG B 1 120 ? 10.590  -3.059  -2.688  1.00 0.00 ? 120 ARG B HH21 3  
ATOM 7552  H HH22 . ARG B 1 120 ? 10.910  -4.703  -3.010  1.00 0.00 ? 120 ARG B HH22 3  
ATOM 7553  N N    . LYS B 1 121 ? 10.554  1.297   4.330   1.00 0.00 ? 121 LYS B N    3  
ATOM 7554  C CA   . LYS B 1 121 ? 11.192  2.528   4.728   1.00 0.00 ? 121 LYS B CA   3  
ATOM 7555  C C    . LYS B 1 121 ? 12.380  2.215   5.592   1.00 0.00 ? 121 LYS B C    3  
ATOM 7556  O O    . LYS B 1 121 ? 12.253  1.483   6.560   1.00 0.00 ? 121 LYS B O    3  
ATOM 7557  C CB   . LYS B 1 121 ? 10.201  3.387   5.521   1.00 0.00 ? 121 LYS B CB   3  
ATOM 7558  C CG   . LYS B 1 121 ? 10.715  4.762   5.920   1.00 0.00 ? 121 LYS B CG   3  
ATOM 7559  C CD   . LYS B 1 121 ? 9.747   5.448   6.862   1.00 0.00 ? 121 LYS B CD   3  
ATOM 7560  C CE   . LYS B 1 121 ? 10.156  6.884   7.158   1.00 0.00 ? 121 LYS B CE   3  
ATOM 7561  N NZ   . LYS B 1 121 ? 9.983   7.780   5.985   1.00 0.00 ? 121 LYS B NZ   3  
ATOM 7562  H H    . LYS B 1 121 ? 10.437  0.587   5.003   1.00 0.00 ? 121 LYS B H    3  
ATOM 7563  H HA   . LYS B 1 121 ? 11.494  3.059   3.844   1.00 0.00 ? 121 LYS B HA   3  
ATOM 7564  H HB2  . LYS B 1 121 ? 9.312   3.524   4.923   1.00 0.00 ? 121 LYS B HB2  3  
ATOM 7565  H HB3  . LYS B 1 121 ? 9.930   2.852   6.421   1.00 0.00 ? 121 LYS B HB3  3  
ATOM 7566  H HG2  . LYS B 1 121 ? 11.670  4.651   6.413   1.00 0.00 ? 121 LYS B HG2  3  
ATOM 7567  H HG3  . LYS B 1 121 ? 10.833  5.367   5.034   1.00 0.00 ? 121 LYS B HG3  3  
ATOM 7568  H HD2  . LYS B 1 121 ? 8.766   5.444   6.413   1.00 0.00 ? 121 LYS B HD2  3  
ATOM 7569  H HD3  . LYS B 1 121 ? 9.717   4.893   7.787   1.00 0.00 ? 121 LYS B HD3  3  
ATOM 7570  H HE2  . LYS B 1 121 ? 9.542   7.256   7.966   1.00 0.00 ? 121 LYS B HE2  3  
ATOM 7571  H HE3  . LYS B 1 121 ? 11.192  6.894   7.462   1.00 0.00 ? 121 LYS B HE3  3  
ATOM 7572  H HZ1  . LYS B 1 121 ? 8.976   7.816   5.723   1.00 0.00 ? 121 LYS B HZ1  3  
ATOM 7573  H HZ2  . LYS B 1 121 ? 10.523  7.493   5.138   1.00 0.00 ? 121 LYS B HZ2  3  
ATOM 7574  H HZ3  . LYS B 1 121 ? 10.291  8.744   6.215   1.00 0.00 ? 121 LYS B HZ3  3  
ATOM 7575  N N    . TYR B 1 122 ? 13.511  2.768   5.236   1.00 0.00 ? 122 TYR B N    3  
ATOM 7576  C CA   . TYR B 1 122 ? 14.747  2.603   5.966   1.00 0.00 ? 122 TYR B CA   3  
ATOM 7577  C C    . TYR B 1 122 ? 15.378  3.944   6.160   1.00 0.00 ? 122 TYR B C    3  
ATOM 7578  O O    . TYR B 1 122 ? 15.313  4.793   5.264   1.00 0.00 ? 122 TYR B O    3  
ATOM 7579  C CB   . TYR B 1 122 ? 15.771  1.772   5.168   1.00 0.00 ? 122 TYR B CB   3  
ATOM 7580  C CG   . TYR B 1 122 ? 15.364  0.378   4.789   1.00 0.00 ? 122 TYR B CG   3  
ATOM 7581  C CD1  . TYR B 1 122 ? 14.438  0.159   3.790   1.00 0.00 ? 122 TYR B CD1  3  
ATOM 7582  C CD2  . TYR B 1 122 ? 15.923  -0.723  5.419   1.00 0.00 ? 122 TYR B CD2  3  
ATOM 7583  C CE1  . TYR B 1 122 ? 14.072  -1.104  3.435   1.00 0.00 ? 122 TYR B CE1  3  
ATOM 7584  C CE2  . TYR B 1 122 ? 15.557  -2.000  5.061   1.00 0.00 ? 122 TYR B CE2  3  
ATOM 7585  C CZ   . TYR B 1 122 ? 14.628  -2.177  4.066   1.00 0.00 ? 122 TYR B CZ   3  
ATOM 7586  O OH   . TYR B 1 122 ? 14.246  -3.432  3.703   1.00 0.00 ? 122 TYR B OH   3  
ATOM 7587  H H    . TYR B 1 122 ? 13.553  3.311   4.416   1.00 0.00 ? 122 TYR B H    3  
ATOM 7588  H HA   . TYR B 1 122 ? 14.564  2.119   6.913   1.00 0.00 ? 122 TYR B HA   3  
ATOM 7589  H HB2  . TYR B 1 122 ? 15.977  2.305   4.255   1.00 0.00 ? 122 TYR B HB2  3  
ATOM 7590  H HB3  . TYR B 1 122 ? 16.684  1.717   5.742   1.00 0.00 ? 122 TYR B HB3  3  
ATOM 7591  H HD1  . TYR B 1 122 ? 13.994  1.008   3.293   1.00 0.00 ? 122 TYR B HD1  3  
ATOM 7592  H HD2  . TYR B 1 122 ? 16.653  -0.569  6.201   1.00 0.00 ? 122 TYR B HD2  3  
ATOM 7593  H HE1  . TYR B 1 122 ? 13.350  -1.255  2.647   1.00 0.00 ? 122 TYR B HE1  3  
ATOM 7594  H HE2  . TYR B 1 122 ? 15.998  -2.851  5.559   1.00 0.00 ? 122 TYR B HE2  3  
ATOM 7595  H HH   . TYR B 1 122 ? 14.034  -3.926  4.518   1.00 0.00 ? 122 TYR B HH   3  
ATOM 7596  N N    . ARG B 1 123 ? 15.975  4.158   7.287   1.00 0.00 ? 123 ARG B N    3  
ATOM 7597  C CA   . ARG B 1 123 ? 16.799  5.318   7.449   1.00 0.00 ? 123 ARG B CA   3  
ATOM 7598  C C    . ARG B 1 123 ? 18.134  4.867   7.977   1.00 0.00 ? 123 ARG B C    3  
ATOM 7599  O O    . ARG B 1 123 ? 18.293  4.604   9.171   1.00 0.00 ? 123 ARG B O    3  
ATOM 7600  C CB   . ARG B 1 123 ? 16.169  6.370   8.357   1.00 0.00 ? 123 ARG B CB   3  
ATOM 7601  C CG   . ARG B 1 123 ? 16.985  7.643   8.387   1.00 0.00 ? 123 ARG B CG   3  
ATOM 7602  C CD   . ARG B 1 123 ? 16.348  8.724   9.219   1.00 0.00 ? 123 ARG B CD   3  
ATOM 7603  N NE   . ARG B 1 123 ? 17.122  9.963   9.133   1.00 0.00 ? 123 ARG B NE   3  
ATOM 7604  C CZ   . ARG B 1 123 ? 16.905  11.067  9.853   1.00 0.00 ? 123 ARG B CZ   3  
ATOM 7605  N NH1  . ARG B 1 123 ? 15.915  11.101  10.749  1.00 0.00 ? 123 ARG B NH1  3  
ATOM 7606  N NH2  . ARG B 1 123 ? 17.668  12.141  9.664   1.00 0.00 ? 123 ARG B NH2  3  
ATOM 7607  H H    . ARG B 1 123 ? 15.877  3.509   8.020   1.00 0.00 ? 123 ARG B H    3  
ATOM 7608  H HA   . ARG B 1 123 ? 16.954  5.731   6.463   1.00 0.00 ? 123 ARG B HA   3  
ATOM 7609  H HB2  . ARG B 1 123 ? 15.175  6.597   8.000   1.00 0.00 ? 123 ARG B HB2  3  
ATOM 7610  H HB3  . ARG B 1 123 ? 16.108  5.981   9.362   1.00 0.00 ? 123 ARG B HB3  3  
ATOM 7611  H HG2  . ARG B 1 123 ? 17.958  7.422   8.801   1.00 0.00 ? 123 ARG B HG2  3  
ATOM 7612  H HG3  . ARG B 1 123 ? 17.108  8.002   7.375   1.00 0.00 ? 123 ARG B HG3  3  
ATOM 7613  H HD2  . ARG B 1 123 ? 15.345  8.904   8.859   1.00 0.00 ? 123 ARG B HD2  3  
ATOM 7614  H HD3  . ARG B 1 123 ? 16.315  8.403   10.250  1.00 0.00 ? 123 ARG B HD3  3  
ATOM 7615  H HE   . ARG B 1 123 ? 17.851  9.932   8.458   1.00 0.00 ? 123 ARG B HE   3  
ATOM 7616  H HH11 . ARG B 1 123 ? 15.315  10.312  10.899  1.00 0.00 ? 123 ARG B HH11 3  
ATOM 7617  H HH12 . ARG B 1 123 ? 15.725  11.908  11.312  1.00 0.00 ? 123 ARG B HH12 3  
ATOM 7618  H HH21 . ARG B 1 123 ? 18.414  12.153  8.991   1.00 0.00 ? 123 ARG B HH21 3  
ATOM 7619  H HH22 . ARG B 1 123 ? 17.521  13.004  10.157  1.00 0.00 ? 123 ARG B HH22 3  
ATOM 7620  N N    . ILE B 1 124 ? 19.071  4.743   7.082   1.00 0.00 ? 124 ILE B N    3  
ATOM 7621  C CA   . ILE B 1 124 ? 20.387  4.256   7.385   1.00 0.00 ? 124 ILE B CA   3  
ATOM 7622  C C    . ILE B 1 124 ? 21.476  5.089   6.675   1.00 0.00 ? 124 ILE B C    3  
ATOM 7623  O O    . ILE B 1 124 ? 21.651  4.988   5.477   1.00 0.00 ? 124 ILE B O    3  
ATOM 7624  C CB   . ILE B 1 124 ? 20.495  2.741   7.013   1.00 0.00 ? 124 ILE B CB   3  
ATOM 7625  C CG1  . ILE B 1 124 ? 19.786  2.433   5.673   1.00 0.00 ? 124 ILE B CG1  3  
ATOM 7626  C CG2  . ILE B 1 124 ? 19.949  1.871   8.140   1.00 0.00 ? 124 ILE B CG2  3  
ATOM 7627  C CD1  . ILE B 1 124 ? 19.776  0.963   5.298   1.00 0.00 ? 124 ILE B CD1  3  
ATOM 7628  H H    . ILE B 1 124 ? 18.897  5.040   6.160   1.00 0.00 ? 124 ILE B H    3  
ATOM 7629  H HA   . ILE B 1 124 ? 20.523  4.344   8.453   1.00 0.00 ? 124 ILE B HA   3  
ATOM 7630  H HB   . ILE B 1 124 ? 21.547  2.513   6.914   1.00 0.00 ? 124 ILE B HB   3  
ATOM 7631  H HG12 . ILE B 1 124 ? 18.758  2.760   5.740   1.00 0.00 ? 124 ILE B HG12 3  
ATOM 7632  H HG13 . ILE B 1 124 ? 20.279  2.980   4.883   1.00 0.00 ? 124 ILE B HG13 3  
ATOM 7633  H HG21 . ILE B 1 124 ? 20.516  2.053   9.041   1.00 0.00 ? 124 ILE B HG21 3  
ATOM 7634  H HG22 . ILE B 1 124 ? 20.030  0.829   7.863   1.00 0.00 ? 124 ILE B HG22 3  
ATOM 7635  H HG23 . ILE B 1 124 ? 18.912  2.120   8.311   1.00 0.00 ? 124 ILE B HG23 3  
ATOM 7636  H HD11 . ILE B 1 124 ? 19.282  0.399   6.075   1.00 0.00 ? 124 ILE B HD11 3  
ATOM 7637  H HD12 . ILE B 1 124 ? 20.793  0.612   5.194   1.00 0.00 ? 124 ILE B HD12 3  
ATOM 7638  H HD13 . ILE B 1 124 ? 19.248  0.830   4.366   1.00 0.00 ? 124 ILE B HD13 3  
ATOM 7639  N N    . PRO B 1 125 ? 22.211  5.940   7.414   1.00 0.00 ? 125 PRO B N    3  
ATOM 7640  C CA   . PRO B 1 125 ? 23.308  6.746   6.844   1.00 0.00 ? 125 PRO B CA   3  
ATOM 7641  C C    . PRO B 1 125 ? 24.669  6.038   6.884   1.00 0.00 ? 125 PRO B C    3  
ATOM 7642  O O    . PRO B 1 125 ? 25.423  6.079   5.929   1.00 0.00 ? 125 PRO B O    3  
ATOM 7643  C CB   . PRO B 1 125 ? 23.356  7.983   7.773   1.00 0.00 ? 125 PRO B CB   3  
ATOM 7644  C CG   . PRO B 1 125 ? 22.294  7.763   8.823   1.00 0.00 ? 125 PRO B CG   3  
ATOM 7645  C CD   . PRO B 1 125 ? 21.959  6.298   8.808   1.00 0.00 ? 125 PRO B CD   3  
ATOM 7646  H HA   . PRO B 1 125 ? 23.092  7.069   5.836   1.00 0.00 ? 125 PRO B HA   3  
ATOM 7647  H HB2  . PRO B 1 125 ? 24.337  8.051   8.218   1.00 0.00 ? 125 PRO B HB2  3  
ATOM 7648  H HB3  . PRO B 1 125 ? 23.162  8.876   7.198   1.00 0.00 ? 125 PRO B HB3  3  
ATOM 7649  H HG2  . PRO B 1 125 ? 22.675  8.045   9.794   1.00 0.00 ? 125 PRO B HG2  3  
ATOM 7650  H HG3  . PRO B 1 125 ? 21.420  8.352   8.585   1.00 0.00 ? 125 PRO B HG3  3  
ATOM 7651  H HD2  . PRO B 1 125 ? 22.604  5.755   9.482   1.00 0.00 ? 125 PRO B HD2  3  
ATOM 7652  H HD3  . PRO B 1 125 ? 20.920  6.161   9.067   1.00 0.00 ? 125 PRO B HD3  3  
ATOM 7653  N N    . ALA B 1 126 ? 24.992  5.419   8.007   1.00 0.00 ? 126 ALA B N    3  
ATOM 7654  C CA   . ALA B 1 126 ? 26.285  4.758   8.166   1.00 0.00 ? 126 ALA B CA   3  
ATOM 7655  C C    . ALA B 1 126 ? 26.410  3.539   7.279   1.00 0.00 ? 126 ALA B C    3  
ATOM 7656  O O    . ALA B 1 126 ? 27.483  3.159   6.906   1.00 0.00 ? 126 ALA B O    3  
ATOM 7657  C CB   . ALA B 1 126 ? 26.533  4.386   9.609   1.00 0.00 ? 126 ALA B CB   3  
ATOM 7658  H H    . ALA B 1 126 ? 24.346  5.401   8.742   1.00 0.00 ? 126 ALA B H    3  
ATOM 7659  H HA   . ALA B 1 126 ? 27.042  5.468   7.868   1.00 0.00 ? 126 ALA B HA   3  
ATOM 7660  H HB1  . ALA B 1 126 ? 26.430  5.267   10.224  1.00 0.00 ? 126 ALA B HB1  3  
ATOM 7661  H HB2  . ALA B 1 126 ? 27.531  3.989   9.713   1.00 0.00 ? 126 ALA B HB2  3  
ATOM 7662  H HB3  . ALA B 1 126 ? 25.818  3.638   9.919   1.00 0.00 ? 126 ALA B HB3  3  
ATOM 7663  N N    . ASP B 1 127 ? 25.293  2.929   6.969   1.00 0.00 ? 127 ASP B N    3  
ATOM 7664  C CA   . ASP B 1 127 ? 25.294  1.729   6.148   1.00 0.00 ? 127 ASP B CA   3  
ATOM 7665  C C    . ASP B 1 127 ? 25.140  2.107   4.683   1.00 0.00 ? 127 ASP B C    3  
ATOM 7666  O O    . ASP B 1 127 ? 25.423  1.309   3.788   1.00 0.00 ? 127 ASP B O    3  
ATOM 7667  C CB   . ASP B 1 127 ? 24.086  0.819   6.512   1.00 0.00 ? 127 ASP B CB   3  
ATOM 7668  C CG   . ASP B 1 127 ? 24.008  0.367   7.966   1.00 0.00 ? 127 ASP B CG   3  
ATOM 7669  O OD1  . ASP B 1 127 ? 23.616  1.175   8.846   1.00 0.00 ? 127 ASP B OD1  3  
ATOM 7670  O OD2  . ASP B 1 127 ? 24.279  -0.819  8.261   1.00 0.00 ? 127 ASP B OD2  3  
ATOM 7671  H H    . ASP B 1 127 ? 24.447  3.285   7.306   1.00 0.00 ? 127 ASP B H    3  
ATOM 7672  H HA   . ASP B 1 127 ? 26.207  1.175   6.306   1.00 0.00 ? 127 ASP B HA   3  
ATOM 7673  H HB2  . ASP B 1 127 ? 23.175  1.353   6.290   1.00 0.00 ? 127 ASP B HB2  3  
ATOM 7674  H HB3  . ASP B 1 127 ? 24.126  -0.058  5.883   1.00 0.00 ? 127 ASP B HB3  3  
ATOM 7675  N N    . VAL B 1 128 ? 24.668  3.327   4.439   1.00 0.00 ? 128 VAL B N    3  
ATOM 7676  C CA   . VAL B 1 128 ? 24.304  3.730   3.097   1.00 0.00 ? 128 VAL B CA   3  
ATOM 7677  C C    . VAL B 1 128 ? 24.835  5.098   2.642   1.00 0.00 ? 128 VAL B C    3  
ATOM 7678  O O    . VAL B 1 128 ? 24.639  6.121   3.285   1.00 0.00 ? 128 VAL B O    3  
ATOM 7679  C CB   . VAL B 1 128 ? 22.755  3.684   2.892   1.00 0.00 ? 128 VAL B CB   3  
ATOM 7680  C CG1  . VAL B 1 128 ? 22.343  4.241   1.529   1.00 0.00 ? 128 VAL B CG1  3  
ATOM 7681  C CG2  . VAL B 1 128 ? 22.252  2.267   3.031   1.00 0.00 ? 128 VAL B CG2  3  
ATOM 7682  H H    . VAL B 1 128 ? 24.599  3.981   5.164   1.00 0.00 ? 128 VAL B H    3  
ATOM 7683  H HA   . VAL B 1 128 ? 24.716  2.985   2.433   1.00 0.00 ? 128 VAL B HA   3  
ATOM 7684  H HB   . VAL B 1 128 ? 22.290  4.285   3.660   1.00 0.00 ? 128 VAL B HB   3  
ATOM 7685  H HG11 . VAL B 1 128 ? 22.658  5.271   1.454   1.00 0.00 ? 128 VAL B HG11 3  
ATOM 7686  H HG12 . VAL B 1 128 ? 21.271  4.184   1.416   1.00 0.00 ? 128 VAL B HG12 3  
ATOM 7687  H HG13 . VAL B 1 128 ? 22.823  3.665   0.753   1.00 0.00 ? 128 VAL B HG13 3  
ATOM 7688  H HG21 . VAL B 1 128 ? 22.545  1.881   3.996   1.00 0.00 ? 128 VAL B HG21 3  
ATOM 7689  H HG22 . VAL B 1 128 ? 22.683  1.649   2.257   1.00 0.00 ? 128 VAL B HG22 3  
ATOM 7690  H HG23 . VAL B 1 128 ? 21.174  2.250   2.954   1.00 0.00 ? 128 VAL B HG23 3  
ATOM 7691  N N    . ASP B 1 129 ? 25.471  5.076   1.508   1.00 0.00 ? 129 ASP B N    3  
ATOM 7692  C CA   . ASP B 1 129 ? 25.845  6.254   0.757   1.00 0.00 ? 129 ASP B CA   3  
ATOM 7693  C C    . ASP B 1 129 ? 25.201  6.162   -0.625  1.00 0.00 ? 129 ASP B C    3  
ATOM 7694  O O    . ASP B 1 129 ? 25.598  5.312   -1.443  1.00 0.00 ? 129 ASP B O    3  
ATOM 7695  C CB   . ASP B 1 129 ? 27.356  6.400   0.542   1.00 0.00 ? 129 ASP B CB   3  
ATOM 7696  C CG   . ASP B 1 129 ? 28.084  7.080   1.660   1.00 0.00 ? 129 ASP B CG   3  
ATOM 7697  O OD1  . ASP B 1 129 ? 27.720  8.228   2.008   1.00 0.00 ? 129 ASP B OD1  3  
ATOM 7698  O OD2  . ASP B 1 129 ? 29.051  6.510   2.171   1.00 0.00 ? 129 ASP B OD2  3  
ATOM 7699  H H    . ASP B 1 129 ? 25.697  4.197   1.154   1.00 0.00 ? 129 ASP B H    3  
ATOM 7700  H HA   . ASP B 1 129 ? 25.464  7.110   1.292   1.00 0.00 ? 129 ASP B HA   3  
ATOM 7701  H HB2  . ASP B 1 129 ? 27.782  5.414   0.425   1.00 0.00 ? 129 ASP B HB2  3  
ATOM 7702  H HB3  . ASP B 1 129 ? 27.523  6.956   -0.368  1.00 0.00 ? 129 ASP B HB3  3  
ATOM 7703  N N    . PRO B 1 130 ? 24.206  7.015   -0.919  1.00 0.00 ? 130 PRO B N    3  
ATOM 7704  C CA   . PRO B 1 130 ? 23.474  7.023   -2.208  1.00 0.00 ? 130 PRO B CA   3  
ATOM 7705  C C    . PRO B 1 130 ? 24.349  7.292   -3.443  1.00 0.00 ? 130 PRO B C    3  
ATOM 7706  O O    . PRO B 1 130 ? 23.909  7.091   -4.576  1.00 0.00 ? 130 PRO B O    3  
ATOM 7707  C CB   . PRO B 1 130 ? 22.452  8.150   -2.045  1.00 0.00 ? 130 PRO B CB   3  
ATOM 7708  C CG   . PRO B 1 130 ? 22.980  8.973   -0.936  1.00 0.00 ? 130 PRO B CG   3  
ATOM 7709  C CD   . PRO B 1 130 ? 23.655  8.016   -0.007  1.00 0.00 ? 130 PRO B CD   3  
ATOM 7710  H HA   . PRO B 1 130 ? 22.947  6.091   -2.340  1.00 0.00 ? 130 PRO B HA   3  
ATOM 7711  H HB2  . PRO B 1 130 ? 22.388  8.713   -2.965  1.00 0.00 ? 130 PRO B HB2  3  
ATOM 7712  H HB3  . PRO B 1 130 ? 21.484  7.734   -1.806  1.00 0.00 ? 130 PRO B HB3  3  
ATOM 7713  H HG2  . PRO B 1 130 ? 23.688  9.695   -1.318  1.00 0.00 ? 130 PRO B HG2  3  
ATOM 7714  H HG3  . PRO B 1 130 ? 22.164  9.470   -0.434  1.00 0.00 ? 130 PRO B HG3  3  
ATOM 7715  H HD2  . PRO B 1 130 ? 24.431  8.538   0.533   1.00 0.00 ? 130 PRO B HD2  3  
ATOM 7716  H HD3  . PRO B 1 130 ? 22.942  7.580   0.676   1.00 0.00 ? 130 PRO B HD3  3  
ATOM 7717  N N    . LEU B 1 131 ? 25.573  7.722   -3.216  1.00 0.00 ? 131 LEU B N    3  
ATOM 7718  C CA   . LEU B 1 131 ? 26.504  8.029   -4.292  1.00 0.00 ? 131 LEU B CA   3  
ATOM 7719  C C    . LEU B 1 131 ? 26.842  6.775   -5.102  1.00 0.00 ? 131 LEU B C    3  
ATOM 7720  O O    . LEU B 1 131 ? 26.902  6.809   -6.325  1.00 0.00 ? 131 LEU B O    3  
ATOM 7721  C CB   . LEU B 1 131 ? 27.793  8.620   -3.716  1.00 0.00 ? 131 LEU B CB   3  
ATOM 7722  C CG   . LEU B 1 131 ? 27.652  9.879   -2.856  1.00 0.00 ? 131 LEU B CG   3  
ATOM 7723  C CD1  . LEU B 1 131 ? 29.012  10.316  -2.347  1.00 0.00 ? 131 LEU B CD1  3  
ATOM 7724  C CD2  . LEU B 1 131 ? 26.995  11.004  -3.639  1.00 0.00 ? 131 LEU B CD2  3  
ATOM 7725  H H    . LEU B 1 131 ? 25.846  7.846   -2.283  1.00 0.00 ? 131 LEU B H    3  
ATOM 7726  H HA   . LEU B 1 131 ? 26.049  8.760   -4.942  1.00 0.00 ? 131 LEU B HA   3  
ATOM 7727  H HB2  . LEU B 1 131 ? 28.264  7.858   -3.113  1.00 0.00 ? 131 LEU B HB2  3  
ATOM 7728  H HB3  . LEU B 1 131 ? 28.451  8.850   -4.542  1.00 0.00 ? 131 LEU B HB3  3  
ATOM 7729  H HG   . LEU B 1 131 ? 27.036  9.650   -1.999  1.00 0.00 ? 131 LEU B HG   3  
ATOM 7730  H HD11 . LEU B 1 131 ? 28.913  11.213  -1.755  1.00 0.00 ? 131 LEU B HD11 3  
ATOM 7731  H HD12 . LEU B 1 131 ? 29.664  10.511  -3.186  1.00 0.00 ? 131 LEU B HD12 3  
ATOM 7732  H HD13 . LEU B 1 131 ? 29.435  9.531   -1.738  1.00 0.00 ? 131 LEU B HD13 3  
ATOM 7733  H HD21 . LEU B 1 131 ? 26.915  11.881  -3.016  1.00 0.00 ? 131 LEU B HD21 3  
ATOM 7734  H HD22 . LEU B 1 131 ? 26.008  10.695  -3.952  1.00 0.00 ? 131 LEU B HD22 3  
ATOM 7735  H HD23 . LEU B 1 131 ? 27.591  11.237  -4.508  1.00 0.00 ? 131 LEU B HD23 3  
ATOM 7736  N N    . THR B 1 132 ? 27.012  5.674   -4.414  1.00 0.00 ? 132 THR B N    3  
ATOM 7737  C CA   . THR B 1 132 ? 27.443  4.442   -5.040  1.00 0.00 ? 132 THR B CA   3  
ATOM 7738  C C    . THR B 1 132 ? 26.393  3.335   -4.897  1.00 0.00 ? 132 THR B C    3  
ATOM 7739  O O    . THR B 1 132 ? 26.646  2.176   -5.226  1.00 0.00 ? 132 THR B O    3  
ATOM 7740  C CB   . THR B 1 132 ? 28.823  4.005   -4.462  1.00 0.00 ? 132 THR B CB   3  
ATOM 7741  O OG1  . THR B 1 132 ? 29.271  2.761   -5.031  1.00 0.00 ? 132 THR B OG1  3  
ATOM 7742  C CG2  . THR B 1 132 ? 28.757  3.889   -2.951  1.00 0.00 ? 132 THR B CG2  3  
ATOM 7743  H H    . THR B 1 132 ? 26.859  5.682   -3.446  1.00 0.00 ? 132 THR B H    3  
ATOM 7744  H HA   . THR B 1 132 ? 27.570  4.652   -6.091  1.00 0.00 ? 132 THR B HA   3  
ATOM 7745  H HB   . THR B 1 132 ? 29.544  4.767   -4.716  1.00 0.00 ? 132 THR B HB   3  
ATOM 7746  H HG1  . THR B 1 132 ? 28.491  2.304   -5.377  1.00 0.00 ? 132 THR B HG1  3  
ATOM 7747  H HG21 . THR B 1 132 ? 29.720  3.583   -2.569  1.00 0.00 ? 132 THR B HG21 3  
ATOM 7748  H HG22 . THR B 1 132 ? 28.012  3.150   -2.693  1.00 0.00 ? 132 THR B HG22 3  
ATOM 7749  H HG23 . THR B 1 132 ? 28.483  4.843   -2.526  1.00 0.00 ? 132 THR B HG23 3  
ATOM 7750  N N    . ILE B 1 133 ? 25.225  3.695   -4.417  1.00 0.00 ? 133 ILE B N    3  
ATOM 7751  C CA   . ILE B 1 133 ? 24.186  2.715   -4.184  1.00 0.00 ? 133 ILE B CA   3  
ATOM 7752  C C    . ILE B 1 133 ? 23.529  2.317   -5.531  1.00 0.00 ? 133 ILE B C    3  
ATOM 7753  O O    . ILE B 1 133 ? 23.393  3.148   -6.439  1.00 0.00 ? 133 ILE B O    3  
ATOM 7754  C CB   . ILE B 1 133 ? 23.122  3.254   -3.170  1.00 0.00 ? 133 ILE B CB   3  
ATOM 7755  C CG1  . ILE B 1 133 ? 22.220  2.130   -2.665  1.00 0.00 ? 133 ILE B CG1  3  
ATOM 7756  C CG2  . ILE B 1 133 ? 22.283  4.343   -3.802  1.00 0.00 ? 133 ILE B CG2  3  
ATOM 7757  C CD1  . ILE B 1 133 ? 21.160  2.571   -1.675  1.00 0.00 ? 133 ILE B CD1  3  
ATOM 7758  H H    . ILE B 1 133 ? 25.048  4.645   -4.261  1.00 0.00 ? 133 ILE B H    3  
ATOM 7759  H HA   . ILE B 1 133 ? 24.659  1.836   -3.770  1.00 0.00 ? 133 ILE B HA   3  
ATOM 7760  H HB   . ILE B 1 133 ? 23.649  3.684   -2.331  1.00 0.00 ? 133 ILE B HB   3  
ATOM 7761  H HG12 . ILE B 1 133 ? 21.710  1.688   -3.508  1.00 0.00 ? 133 ILE B HG12 3  
ATOM 7762  H HG13 . ILE B 1 133 ? 22.828  1.377   -2.187  1.00 0.00 ? 133 ILE B HG13 3  
ATOM 7763  H HG21 . ILE B 1 133 ? 21.753  3.930   -4.647  1.00 0.00 ? 133 ILE B HG21 3  
ATOM 7764  H HG22 . ILE B 1 133 ? 22.923  5.142   -4.145  1.00 0.00 ? 133 ILE B HG22 3  
ATOM 7765  H HG23 . ILE B 1 133 ? 21.572  4.715   -3.078  1.00 0.00 ? 133 ILE B HG23 3  
ATOM 7766  H HD11 . ILE B 1 133 ? 20.578  1.719   -1.357  1.00 0.00 ? 133 ILE B HD11 3  
ATOM 7767  H HD12 . ILE B 1 133 ? 20.510  3.295   -2.144  1.00 0.00 ? 133 ILE B HD12 3  
ATOM 7768  H HD13 . ILE B 1 133 ? 21.633  3.022   -0.817  1.00 0.00 ? 133 ILE B HD13 3  
ATOM 7769  N N    . THR B 1 134 ? 23.204  1.058   -5.668  1.00 0.00 ? 134 THR B N    3  
ATOM 7770  C CA   . THR B 1 134 ? 22.563  0.518   -6.852  1.00 0.00 ? 134 THR B CA   3  
ATOM 7771  C C    . THR B 1 134 ? 21.492  -0.473  -6.432  1.00 0.00 ? 134 THR B C    3  
ATOM 7772  O O    . THR B 1 134 ? 21.594  -1.035  -5.344  1.00 0.00 ? 134 THR B O    3  
ATOM 7773  C CB   . THR B 1 134 ? 23.606  -0.170  -7.773  1.00 0.00 ? 134 THR B CB   3  
ATOM 7774  O OG1  . THR B 1 134 ? 24.525  -0.936  -6.975  1.00 0.00 ? 134 THR B OG1  3  
ATOM 7775  C CG2  . THR B 1 134 ? 24.376  0.846   -8.604  1.00 0.00 ? 134 THR B CG2  3  
ATOM 7776  H H    . THR B 1 134 ? 23.398  0.429   -4.938  1.00 0.00 ? 134 THR B H    3  
ATOM 7777  H HA   . THR B 1 134 ? 22.105  1.339   -7.383  1.00 0.00 ? 134 THR B HA   3  
ATOM 7778  H HB   . THR B 1 134 ? 23.079  -0.846  -8.430  1.00 0.00 ? 134 THR B HB   3  
ATOM 7779  H HG1  . THR B 1 134 ? 24.555  -0.562  -6.086  1.00 0.00 ? 134 THR B HG1  3  
ATOM 7780  H HG21 . THR B 1 134 ? 24.890  1.531   -7.948  1.00 0.00 ? 134 THR B HG21 3  
ATOM 7781  H HG22 . THR B 1 134 ? 23.689  1.396   -9.230  1.00 0.00 ? 134 THR B HG22 3  
ATOM 7782  H HG23 . THR B 1 134 ? 25.097  0.331   -9.223  1.00 0.00 ? 134 THR B HG23 3  
ATOM 7783  N N    . SER B 1 135 ? 20.485  -0.683  -7.251  1.00 0.00 ? 135 SER B N    3  
ATOM 7784  C CA   . SER B 1 135 ? 19.423  -1.578  -6.886  1.00 0.00 ? 135 SER B CA   3  
ATOM 7785  C C    . SER B 1 135 ? 19.129  -2.573  -8.008  1.00 0.00 ? 135 SER B C    3  
ATOM 7786  O O    . SER B 1 135 ? 19.018  -2.196  -9.187  1.00 0.00 ? 135 SER B O    3  
ATOM 7787  C CB   . SER B 1 135 ? 18.154  -0.768  -6.557  1.00 0.00 ? 135 SER B CB   3  
ATOM 7788  O OG   . SER B 1 135 ? 17.119  -1.598  -6.050  1.00 0.00 ? 135 SER B OG   3  
ATOM 7789  H H    . SER B 1 135 ? 20.453  -0.236  -8.123  1.00 0.00 ? 135 SER B H    3  
ATOM 7790  H HA   . SER B 1 135 ? 19.717  -2.117  -5.999  1.00 0.00 ? 135 SER B HA   3  
ATOM 7791  H HB2  . SER B 1 135 ? 18.383  -0.002  -5.832  1.00 0.00 ? 135 SER B HB2  3  
ATOM 7792  H HB3  . SER B 1 135 ? 17.803  -0.295  -7.462  1.00 0.00 ? 135 SER B HB3  3  
ATOM 7793  H HG   . SER B 1 135 ? 17.498  -2.152  -5.361  1.00 0.00 ? 135 SER B HG   3  
ATOM 7794  N N    . SER B 1 136 ? 19.021  -3.819  -7.642  1.00 0.00 ? 136 SER B N    3  
ATOM 7795  C CA   . SER B 1 136 ? 18.616  -4.874  -8.532  1.00 0.00 ? 136 SER B CA   3  
ATOM 7796  C C    . SER B 1 136 ? 17.349  -5.492  -7.972  1.00 0.00 ? 136 SER B C    3  
ATOM 7797  O O    . SER B 1 136 ? 17.298  -5.823  -6.786  1.00 0.00 ? 136 SER B O    3  
ATOM 7798  C CB   . SER B 1 136 ? 19.760  -5.885  -8.711  1.00 0.00 ? 136 SER B CB   3  
ATOM 7799  O OG   . SER B 1 136 ? 20.474  -6.098  -7.491  1.00 0.00 ? 136 SER B OG   3  
ATOM 7800  H H    . SER B 1 136 ? 19.224  -4.063  -6.710  1.00 0.00 ? 136 SER B H    3  
ATOM 7801  H HA   . SER B 1 136 ? 18.376  -4.417  -9.481  1.00 0.00 ? 136 SER B HA   3  
ATOM 7802  H HB2  . SER B 1 136 ? 19.350  -6.832  -9.031  1.00 0.00 ? 136 SER B HB2  3  
ATOM 7803  H HB3  . SER B 1 136 ? 20.450  -5.524  -9.458  1.00 0.00 ? 136 SER B HB3  3  
ATOM 7804  H HG   . SER B 1 136 ? 19.874  -6.337  -6.768  1.00 0.00 ? 136 SER B HG   3  
ATOM 7805  N N    . LEU B 1 137 ? 16.342  -5.632  -8.799  1.00 0.00 ? 137 LEU B N    3  
ATOM 7806  C CA   . LEU B 1 137 ? 15.025  -6.007  -8.327  1.00 0.00 ? 137 LEU B CA   3  
ATOM 7807  C C    . LEU B 1 137 ? 14.443  -7.161  -9.115  1.00 0.00 ? 137 LEU B C    3  
ATOM 7808  O O    . LEU B 1 137 ? 14.536  -7.202  -10.343 1.00 0.00 ? 137 LEU B O    3  
ATOM 7809  C CB   . LEU B 1 137 ? 14.057  -4.777  -8.313  1.00 0.00 ? 137 LEU B CB   3  
ATOM 7810  C CG   . LEU B 1 137 ? 13.676  -4.075  -9.652  1.00 0.00 ? 137 LEU B CG   3  
ATOM 7811  C CD1  . LEU B 1 137 ? 12.698  -2.956  -9.379  1.00 0.00 ? 137 LEU B CD1  3  
ATOM 7812  C CD2  . LEU B 1 137 ? 14.875  -3.499  -10.383 1.00 0.00 ? 137 LEU B CD2  3  
ATOM 7813  H H    . LEU B 1 137 ? 16.475  -5.517  -9.765  1.00 0.00 ? 137 LEU B H    3  
ATOM 7814  H HA   . LEU B 1 137 ? 15.148  -6.340  -7.307  1.00 0.00 ? 137 LEU B HA   3  
ATOM 7815  H HB2  . LEU B 1 137 ? 13.133  -5.099  -7.855  1.00 0.00 ? 137 LEU B HB2  3  
ATOM 7816  H HB3  . LEU B 1 137 ? 14.498  -4.034  -7.665  1.00 0.00 ? 137 LEU B HB3  3  
ATOM 7817  H HG   . LEU B 1 137 ? 13.183  -4.791  -10.294 1.00 0.00 ? 137 LEU B HG   3  
ATOM 7818  H HD11 . LEU B 1 137 ? 13.139  -2.248  -8.691  1.00 0.00 ? 137 LEU B HD11 3  
ATOM 7819  H HD12 . LEU B 1 137 ? 11.793  -3.365  -8.956  1.00 0.00 ? 137 LEU B HD12 3  
ATOM 7820  H HD13 . LEU B 1 137 ? 12.464  -2.456  -10.306 1.00 0.00 ? 137 LEU B HD13 3  
ATOM 7821  H HD21 . LEU B 1 137 ? 15.557  -4.298  -10.625 1.00 0.00 ? 137 LEU B HD21 3  
ATOM 7822  H HD22 . LEU B 1 137 ? 15.372  -2.776  -9.753  1.00 0.00 ? 137 LEU B HD22 3  
ATOM 7823  H HD23 . LEU B 1 137 ? 14.545  -3.020  -11.292 1.00 0.00 ? 137 LEU B HD23 3  
ATOM 7824  N N    . SER B 1 138 ? 13.849  -8.082  -8.404  1.00 0.00 ? 138 SER B N    3  
ATOM 7825  C CA   . SER B 1 138 ? 13.273  -9.265  -8.986  1.00 0.00 ? 138 SER B CA   3  
ATOM 7826  C C    . SER B 1 138 ? 11.758  -9.103  -9.141  1.00 0.00 ? 138 SER B C    3  
ATOM 7827  O O    . SER B 1 138 ? 11.139  -8.179  -8.585  1.00 0.00 ? 138 SER B O    3  
ATOM 7828  C CB   . SER B 1 138 ? 13.580  -10.458 -8.077  1.00 0.00 ? 138 SER B CB   3  
ATOM 7829  O OG   . SER B 1 138 ? 13.063  -10.247 -6.769  1.00 0.00 ? 138 SER B OG   3  
ATOM 7830  H H    . SER B 1 138 ? 13.792  -7.966  -7.431  1.00 0.00 ? 138 SER B H    3  
ATOM 7831  H HA   . SER B 1 138 ? 13.725  -9.440  -9.950  1.00 0.00 ? 138 SER B HA   3  
ATOM 7832  H HB2  . SER B 1 138 ? 13.121  -11.346 -8.487  1.00 0.00 ? 138 SER B HB2  3  
ATOM 7833  H HB3  . SER B 1 138 ? 14.649  -10.599 -8.012  1.00 0.00 ? 138 SER B HB3  3  
ATOM 7834  H HG   . SER B 1 138 ? 13.680  -9.670  -6.299  1.00 0.00 ? 138 SER B HG   3  
ATOM 7835  N N    . SER B 1 139 ? 11.178  -10.032 -9.888  1.00 0.00 ? 139 SER B N    3  
ATOM 7836  C CA   . SER B 1 139 ? 9.764   -10.099 -10.196 1.00 0.00 ? 139 SER B CA   3  
ATOM 7837  C C    . SER B 1 139 ? 8.915   -10.416 -8.952  1.00 0.00 ? 139 SER B C    3  
ATOM 7838  O O    . SER B 1 139 ? 7.686   -10.336 -8.989  1.00 0.00 ? 139 SER B O    3  
ATOM 7839  C CB   . SER B 1 139 ? 9.570   -11.183 -11.244 1.00 0.00 ? 139 SER B CB   3  
ATOM 7840  O OG   . SER B 1 139 ? 10.529  -11.027 -12.285 1.00 0.00 ? 139 SER B OG   3  
ATOM 7841  H H    . SER B 1 139 ? 11.726  -10.740 -10.290 1.00 0.00 ? 139 SER B H    3  
ATOM 7842  H HA   . SER B 1 139 ? 9.460   -9.160  -10.630 1.00 0.00 ? 139 SER B HA   3  
ATOM 7843  H HB2  . SER B 1 139 ? 9.694   -12.154 -10.789 1.00 0.00 ? 139 SER B HB2  3  
ATOM 7844  H HB3  . SER B 1 139 ? 8.581   -11.106 -11.670 1.00 0.00 ? 139 SER B HB3  3  
ATOM 7845  H HG   . SER B 1 139 ? 10.223  -10.337 -12.885 1.00 0.00 ? 139 SER B HG   3  
ATOM 7846  N N    . ASP B 1 140 ? 9.576   -10.799 -7.877  1.00 0.00 ? 140 ASP B N    3  
ATOM 7847  C CA   . ASP B 1 140 ? 8.900   -11.192 -6.651  1.00 0.00 ? 140 ASP B CA   3  
ATOM 7848  C C    . ASP B 1 140 ? 9.068   -10.107 -5.574  1.00 0.00 ? 140 ASP B C    3  
ATOM 7849  O O    . ASP B 1 140 ? 9.022   -10.371 -4.392  1.00 0.00 ? 140 ASP B O    3  
ATOM 7850  C CB   . ASP B 1 140 ? 9.414   -12.564 -6.190  1.00 0.00 ? 140 ASP B CB   3  
ATOM 7851  C CG   . ASP B 1 140 ? 8.591   -13.216 -5.084  1.00 0.00 ? 140 ASP B CG   3  
ATOM 7852  O OD1  . ASP B 1 140 ? 7.357   -13.415 -5.254  1.00 0.00 ? 140 ASP B OD1  3  
ATOM 7853  O OD2  . ASP B 1 140 ? 9.182   -13.603 -4.046  1.00 0.00 ? 140 ASP B OD2  3  
ATOM 7854  H H    . ASP B 1 140 ? 10.555  -10.820 -7.905  1.00 0.00 ? 140 ASP B H    3  
ATOM 7855  H HA   . ASP B 1 140 ? 7.848   -11.269 -6.883  1.00 0.00 ? 140 ASP B HA   3  
ATOM 7856  H HB2  . ASP B 1 140 ? 9.438   -13.237 -7.032  1.00 0.00 ? 140 ASP B HB2  3  
ATOM 7857  H HB3  . ASP B 1 140 ? 10.421  -12.429 -5.829  1.00 0.00 ? 140 ASP B HB3  3  
ATOM 7858  N N    . GLY B 1 141 ? 9.393   -8.892  -6.022  1.00 0.00 ? 141 GLY B N    3  
ATOM 7859  C CA   . GLY B 1 141 ? 9.429   -7.724  -5.129  1.00 0.00 ? 141 GLY B CA   3  
ATOM 7860  C C    . GLY B 1 141 ? 10.692  -7.603  -4.284  1.00 0.00 ? 141 GLY B C    3  
ATOM 7861  O O    . GLY B 1 141 ? 10.883  -6.601  -3.545  1.00 0.00 ? 141 GLY B O    3  
ATOM 7862  H H    . GLY B 1 141 ? 9.600   -8.779  -6.974  1.00 0.00 ? 141 GLY B H    3  
ATOM 7863  H HA2  . GLY B 1 141 ? 9.340   -6.832  -5.729  1.00 0.00 ? 141 GLY B HA2  3  
ATOM 7864  H HA3  . GLY B 1 141 ? 8.574   -7.776  -4.472  1.00 0.00 ? 141 GLY B HA3  3  
ATOM 7865  N N    . VAL B 1 142 ? 11.545  -8.585  -4.374  1.00 0.00 ? 142 VAL B N    3  
ATOM 7866  C CA   . VAL B 1 142 ? 12.780  -8.603  -3.630  1.00 0.00 ? 142 VAL B CA   3  
ATOM 7867  C C    . VAL B 1 142 ? 13.826  -7.790  -4.381  1.00 0.00 ? 142 VAL B C    3  
ATOM 7868  O O    . VAL B 1 142 ? 14.139  -8.089  -5.541  1.00 0.00 ? 142 VAL B O    3  
ATOM 7869  C CB   . VAL B 1 142 ? 13.285  -10.057 -3.410  1.00 0.00 ? 142 VAL B CB   3  
ATOM 7870  C CG1  . VAL B 1 142 ? 14.567  -10.078 -2.597  1.00 0.00 ? 142 VAL B CG1  3  
ATOM 7871  C CG2  . VAL B 1 142 ? 12.212  -10.903 -2.732  1.00 0.00 ? 142 VAL B CG2  3  
ATOM 7872  H H    . VAL B 1 142 ? 11.328  -9.328  -4.976  1.00 0.00 ? 142 VAL B H    3  
ATOM 7873  H HA   . VAL B 1 142 ? 12.600  -8.142  -2.670  1.00 0.00 ? 142 VAL B HA   3  
ATOM 7874  H HB   . VAL B 1 142 ? 13.494  -10.489 -4.378  1.00 0.00 ? 142 VAL B HB   3  
ATOM 7875  H HG11 . VAL B 1 142 ? 14.888  -11.098 -2.451  1.00 0.00 ? 142 VAL B HG11 3  
ATOM 7876  H HG12 . VAL B 1 142 ? 14.387  -9.616  -1.637  1.00 0.00 ? 142 VAL B HG12 3  
ATOM 7877  H HG13 . VAL B 1 142 ? 15.335  -9.528  -3.121  1.00 0.00 ? 142 VAL B HG13 3  
ATOM 7878  H HG21 . VAL B 1 142 ? 12.582  -11.906 -2.584  1.00 0.00 ? 142 VAL B HG21 3  
ATOM 7879  H HG22 . VAL B 1 142 ? 11.330  -10.933 -3.356  1.00 0.00 ? 142 VAL B HG22 3  
ATOM 7880  H HG23 . VAL B 1 142 ? 11.958  -10.469 -1.776  1.00 0.00 ? 142 VAL B HG23 3  
ATOM 7881  N N    . LEU B 1 143 ? 14.326  -6.760  -3.753  1.00 0.00 ? 143 LEU B N    3  
ATOM 7882  C CA   . LEU B 1 143 ? 15.300  -5.914  -4.374  1.00 0.00 ? 143 LEU B CA   3  
ATOM 7883  C C    . LEU B 1 143 ? 16.475  -5.708  -3.475  1.00 0.00 ? 143 LEU B C    3  
ATOM 7884  O O    . LEU B 1 143 ? 16.323  -5.544  -2.276  1.00 0.00 ? 143 LEU B O    3  
ATOM 7885  C CB   . LEU B 1 143 ? 14.687  -4.584  -4.916  1.00 0.00 ? 143 LEU B CB   3  
ATOM 7886  C CG   . LEU B 1 143 ? 14.154  -3.519  -3.936  1.00 0.00 ? 143 LEU B CG   3  
ATOM 7887  C CD1  . LEU B 1 143 ? 15.282  -2.683  -3.354  1.00 0.00 ? 143 LEU B CD1  3  
ATOM 7888  C CD2  . LEU B 1 143 ? 13.152  -2.624  -4.633  1.00 0.00 ? 143 LEU B CD2  3  
ATOM 7889  H H    . LEU B 1 143 ? 14.085  -6.591  -2.815  1.00 0.00 ? 143 LEU B H    3  
ATOM 7890  H HA   . LEU B 1 143 ? 15.670  -6.481  -5.216  1.00 0.00 ? 143 LEU B HA   3  
ATOM 7891  H HB2  . LEU B 1 143 ? 15.446  -4.103  -5.515  1.00 0.00 ? 143 LEU B HB2  3  
ATOM 7892  H HB3  . LEU B 1 143 ? 13.879  -4.860  -5.580  1.00 0.00 ? 143 LEU B HB3  3  
ATOM 7893  H HG   . LEU B 1 143 ? 13.650  -4.012  -3.118  1.00 0.00 ? 143 LEU B HG   3  
ATOM 7894  H HD11 . LEU B 1 143 ? 14.878  -1.903  -2.728  1.00 0.00 ? 143 LEU B HD11 3  
ATOM 7895  H HD12 . LEU B 1 143 ? 15.847  -2.235  -4.158  1.00 0.00 ? 143 LEU B HD12 3  
ATOM 7896  H HD13 . LEU B 1 143 ? 15.931  -3.318  -2.771  1.00 0.00 ? 143 LEU B HD13 3  
ATOM 7897  H HD21 . LEU B 1 143 ? 12.325  -3.218  -4.992  1.00 0.00 ? 143 LEU B HD21 3  
ATOM 7898  H HD22 . LEU B 1 143 ? 13.630  -2.132  -5.468  1.00 0.00 ? 143 LEU B HD22 3  
ATOM 7899  H HD23 . LEU B 1 143 ? 12.788  -1.880  -3.939  1.00 0.00 ? 143 LEU B HD23 3  
ATOM 7900  N N    . THR B 1 144 ? 17.620  -5.796  -4.021  1.00 0.00 ? 144 THR B N    3  
ATOM 7901  C CA   . THR B 1 144 ? 18.812  -5.605  -3.285  1.00 0.00 ? 144 THR B CA   3  
ATOM 7902  C C    . THR B 1 144 ? 19.449  -4.280  -3.652  1.00 0.00 ? 144 THR B C    3  
ATOM 7903  O O    . THR B 1 144 ? 19.523  -3.917  -4.836  1.00 0.00 ? 144 THR B O    3  
ATOM 7904  C CB   . THR B 1 144 ? 19.778  -6.762  -3.543  1.00 0.00 ? 144 THR B CB   3  
ATOM 7905  O OG1  . THR B 1 144 ? 19.809  -7.038  -4.952  1.00 0.00 ? 144 THR B OG1  3  
ATOM 7906  C CG2  . THR B 1 144 ? 19.350  -8.011  -2.789  1.00 0.00 ? 144 THR B CG2  3  
ATOM 7907  H H    . THR B 1 144 ? 17.684  -5.986  -4.985  1.00 0.00 ? 144 THR B H    3  
ATOM 7908  H HA   . THR B 1 144 ? 18.562  -5.598  -2.235  1.00 0.00 ? 144 THR B HA   3  
ATOM 7909  H HB   . THR B 1 144 ? 20.765  -6.467  -3.218  1.00 0.00 ? 144 THR B HB   3  
ATOM 7910  H HG1  . THR B 1 144 ? 19.194  -7.767  -5.108  1.00 0.00 ? 144 THR B HG1  3  
ATOM 7911  H HG21 . THR B 1 144 ? 20.030  -8.820  -3.012  1.00 0.00 ? 144 THR B HG21 3  
ATOM 7912  H HG22 . THR B 1 144 ? 18.348  -8.285  -3.084  1.00 0.00 ? 144 THR B HG22 3  
ATOM 7913  H HG23 . THR B 1 144 ? 19.368  -7.810  -1.729  1.00 0.00 ? 144 THR B HG23 3  
ATOM 7914  N N    . VAL B 1 145 ? 19.841  -3.543  -2.664  1.00 0.00 ? 145 VAL B N    3  
ATOM 7915  C CA   . VAL B 1 145 ? 20.546  -2.318  -2.863  1.00 0.00 ? 145 VAL B CA   3  
ATOM 7916  C C    . VAL B 1 145 ? 21.970  -2.507  -2.362  1.00 0.00 ? 145 VAL B C    3  
ATOM 7917  O O    . VAL B 1 145 ? 22.188  -2.856  -1.213  1.00 0.00 ? 145 VAL B O    3  
ATOM 7918  C CB   . VAL B 1 145 ? 19.835  -1.093  -2.179  1.00 0.00 ? 145 VAL B CB   3  
ATOM 7919  C CG1  . VAL B 1 145 ? 18.570  -0.728  -2.925  1.00 0.00 ? 145 VAL B CG1  3  
ATOM 7920  C CG2  . VAL B 1 145 ? 19.481  -1.387  -0.731  1.00 0.00 ? 145 VAL B CG2  3  
ATOM 7921  H H    . VAL B 1 145 ? 19.682  -3.840  -1.737  1.00 0.00 ? 145 VAL B H    3  
ATOM 7922  H HA   . VAL B 1 145 ? 20.593  -2.155  -3.930  1.00 0.00 ? 145 VAL B HA   3  
ATOM 7923  H HB   . VAL B 1 145 ? 20.509  -0.249  -2.207  1.00 0.00 ? 145 VAL B HB   3  
ATOM 7924  H HG11 . VAL B 1 145 ? 18.824  -0.448  -3.935  1.00 0.00 ? 145 VAL B HG11 3  
ATOM 7925  H HG12 . VAL B 1 145 ? 18.082  0.099   -2.429  1.00 0.00 ? 145 VAL B HG12 3  
ATOM 7926  H HG13 . VAL B 1 145 ? 17.907  -1.581  -2.945  1.00 0.00 ? 145 VAL B HG13 3  
ATOM 7927  H HG21 . VAL B 1 145 ? 20.400  -1.574  -0.195  1.00 0.00 ? 145 VAL B HG21 3  
ATOM 7928  H HG22 . VAL B 1 145 ? 18.845  -2.259  -0.680  1.00 0.00 ? 145 VAL B HG22 3  
ATOM 7929  H HG23 . VAL B 1 145 ? 18.971  -0.537  -0.302  1.00 0.00 ? 145 VAL B HG23 3  
ATOM 7930  N N    . ASN B 1 146 ? 22.925  -2.313  -3.218  1.00 0.00 ? 146 ASN B N    3  
ATOM 7931  C CA   . ASN B 1 146 ? 24.314  -2.578  -2.867  1.00 0.00 ? 146 ASN B CA   3  
ATOM 7932  C C    . ASN B 1 146 ? 25.197  -1.482  -3.387  1.00 0.00 ? 146 ASN B C    3  
ATOM 7933  O O    . ASN B 1 146 ? 24.753  -0.663  -4.203  1.00 0.00 ? 146 ASN B O    3  
ATOM 7934  C CB   . ASN B 1 146 ? 24.792  -3.932  -3.437  1.00 0.00 ? 146 ASN B CB   3  
ATOM 7935  C CG   . ASN B 1 146 ? 24.908  -3.946  -4.953  1.00 0.00 ? 146 ASN B CG   3  
ATOM 7936  O OD1  . ASN B 1 146 ? 25.954  -3.589  -5.504  1.00 0.00 ? 146 ASN B OD1  3  
ATOM 7937  N ND2  . ASN B 1 146 ? 23.888  -4.400  -5.632  1.00 0.00 ? 146 ASN B ND2  3  
ATOM 7938  H H    . ASN B 1 146 ? 22.698  -1.966  -4.110  1.00 0.00 ? 146 ASN B H    3  
ATOM 7939  H HA   . ASN B 1 146 ? 24.392  -2.609  -1.790  1.00 0.00 ? 146 ASN B HA   3  
ATOM 7940  H HB2  . ASN B 1 146 ? 25.764  -4.162  -3.026  1.00 0.00 ? 146 ASN B HB2  3  
ATOM 7941  H HB3  . ASN B 1 146 ? 24.094  -4.701  -3.140  1.00 0.00 ? 146 ASN B HB3  3  
ATOM 7942  H HD21 . ASN B 1 146 ? 23.093  -4.725  -5.158  1.00 0.00 ? 146 ASN B HD21 3  
ATOM 7943  H HD22 . ASN B 1 146 ? 23.954  -4.394  -6.614  1.00 0.00 ? 146 ASN B HD22 3  
ATOM 7944  N N    . GLY B 1 147 ? 26.413  -1.425  -2.889  1.00 0.00 ? 147 GLY B N    3  
ATOM 7945  C CA   . GLY B 1 147 ? 27.339  -0.438  -3.376  1.00 0.00 ? 147 GLY B CA   3  
ATOM 7946  C C    . GLY B 1 147 ? 27.993  0.405   -2.282  1.00 0.00 ? 147 GLY B C    3  
ATOM 7947  O O    . GLY B 1 147 ? 29.209  0.553   -2.295  1.00 0.00 ? 147 GLY B O    3  
ATOM 7948  H H    . GLY B 1 147 ? 26.667  -2.017  -2.146  1.00 0.00 ? 147 GLY B H    3  
ATOM 7949  H HA2  . GLY B 1 147 ? 28.116  -0.941  -3.930  1.00 0.00 ? 147 GLY B HA2  3  
ATOM 7950  H HA3  . GLY B 1 147 ? 26.811  0.221   -4.050  1.00 0.00 ? 147 GLY B HA3  3  
ATOM 7951  N N    . PRO B 1 148 ? 27.218  0.985   -1.313  1.00 0.00 ? 148 PRO B N    3  
ATOM 7952  C CA   . PRO B 1 148 ? 27.767  1.864   -0.269  1.00 0.00 ? 148 PRO B CA   3  
ATOM 7953  C C    . PRO B 1 148 ? 28.762  1.202   0.673   1.00 0.00 ? 148 PRO B C    3  
ATOM 7954  O O    . PRO B 1 148 ? 28.950  -0.007  0.670   1.00 0.00 ? 148 PRO B O    3  
ATOM 7955  C CB   . PRO B 1 148 ? 26.525  2.282   0.500   1.00 0.00 ? 148 PRO B CB   3  
ATOM 7956  C CG   . PRO B 1 148 ? 25.565  1.194   0.274   1.00 0.00 ? 148 PRO B CG   3  
ATOM 7957  C CD   . PRO B 1 148 ? 25.755  0.852   -1.147  1.00 0.00 ? 148 PRO B CD   3  
ATOM 7958  H HA   . PRO B 1 148 ? 28.225  2.747   -0.688  1.00 0.00 ? 148 PRO B HA   3  
ATOM 7959  H HB2  . PRO B 1 148 ? 26.749  2.436   1.545   1.00 0.00 ? 148 PRO B HB2  3  
ATOM 7960  H HB3  . PRO B 1 148 ? 26.175  3.191   0.038   1.00 0.00 ? 148 PRO B HB3  3  
ATOM 7961  H HG2  . PRO B 1 148 ? 25.800  0.352   0.907   1.00 0.00 ? 148 PRO B HG2  3  
ATOM 7962  H HG3  . PRO B 1 148 ? 24.555  1.535   0.448   1.00 0.00 ? 148 PRO B HG3  3  
ATOM 7963  H HD2  . PRO B 1 148 ? 25.425  -0.157  -1.350  1.00 0.00 ? 148 PRO B HD2  3  
ATOM 7964  H HD3  . PRO B 1 148 ? 25.238  1.559   -1.779  1.00 0.00 ? 148 PRO B HD3  3  
ATOM 7965  N N    . ARG B 1 149 ? 29.399  2.031   1.449   1.00 0.00 ? 149 ARG B N    3  
ATOM 7966  C CA   . ARG B 1 149 ? 30.371  1.637   2.438   1.00 0.00 ? 149 ARG B CA   3  
ATOM 7967  C C    . ARG B 1 149 ? 29.699  1.770   3.790   1.00 0.00 ? 149 ARG B C    3  
ATOM 7968  O O    . ARG B 1 149 ? 28.736  2.546   3.927   1.00 0.00 ? 149 ARG B O    3  
ATOM 7969  C CB   . ARG B 1 149 ? 31.556  2.614   2.391   1.00 0.00 ? 149 ARG B CB   3  
ATOM 7970  C CG   . ARG B 1 149 ? 31.111  4.021   2.725   1.00 0.00 ? 149 ARG B CG   3  
ATOM 7971  C CD   . ARG B 1 149 ? 32.188  5.063   2.665   1.00 0.00 ? 149 ARG B CD   3  
ATOM 7972  N NE   . ARG B 1 149 ? 31.588  6.361   2.966   1.00 0.00 ? 149 ARG B NE   3  
ATOM 7973  C CZ   . ARG B 1 149 ? 32.223  7.480   3.255   1.00 0.00 ? 149 ARG B CZ   3  
ATOM 7974  N NH1  . ARG B 1 149 ? 33.534  7.553   3.141   1.00 0.00 ? 149 ARG B NH1  3  
ATOM 7975  N NH2  . ARG B 1 149 ? 31.531  8.547   3.609   1.00 0.00 ? 149 ARG B NH2  3  
ATOM 7976  H H    . ARG B 1 149 ? 29.182  2.985   1.401   1.00 0.00 ? 149 ARG B H    3  
ATOM 7977  H HA   . ARG B 1 149 ? 30.714  0.629   2.260   1.00 0.00 ? 149 ARG B HA   3  
ATOM 7978  H HB2  . ARG B 1 149 ? 32.305  2.302   3.104   1.00 0.00 ? 149 ARG B HB2  3  
ATOM 7979  H HB3  . ARG B 1 149 ? 31.979  2.614   1.399   1.00 0.00 ? 149 ARG B HB3  3  
ATOM 7980  H HG2  . ARG B 1 149 ? 30.317  4.310   2.055   1.00 0.00 ? 149 ARG B HG2  3  
ATOM 7981  H HG3  . ARG B 1 149 ? 30.714  3.987   3.726   1.00 0.00 ? 149 ARG B HG3  3  
ATOM 7982  H HD2  . ARG B 1 149 ? 32.954  4.833   3.392   1.00 0.00 ? 149 ARG B HD2  3  
ATOM 7983  H HD3  . ARG B 1 149 ? 32.613  5.094   1.673   1.00 0.00 ? 149 ARG B HD3  3  
ATOM 7984  H HE   . ARG B 1 149 ? 30.593  6.344   2.959   1.00 0.00 ? 149 ARG B HE   3  
ATOM 7985  H HH11 . ARG B 1 149 ? 34.087  6.773   2.837   1.00 0.00 ? 149 ARG B HH11 3  
ATOM 7986  H HH12 . ARG B 1 149 ? 34.036  8.393   3.357   1.00 0.00 ? 149 ARG B HH12 3  
ATOM 7987  H HH21 . ARG B 1 149 ? 30.529  8.515   3.659   1.00 0.00 ? 149 ARG B HH21 3  
ATOM 7988  H HH22 . ARG B 1 149 ? 31.962  9.420   3.845   1.00 0.00 ? 149 ARG B HH22 3  
ATOM 7989  N N    . LYS B 1 150 ? 30.156  1.051   4.752   1.00 0.00 ? 150 LYS B N    3  
ATOM 7990  C CA   . LYS B 1 150 ? 29.628  1.197   6.062   1.00 0.00 ? 150 LYS B CA   3  
ATOM 7991  C C    . LYS B 1 150 ? 30.712  1.735   6.979   1.00 0.00 ? 150 LYS B C    3  
ATOM 7992  O O    . LYS B 1 150 ? 31.611  0.956   7.388   1.00 0.00 ? 150 LYS B O    3  
ATOM 7993  C CB   . LYS B 1 150 ? 29.022  -0.101  6.581   1.00 0.00 ? 150 LYS B CB   3  
ATOM 7994  C CG   . LYS B 1 150 ? 28.437  0.039   7.967   1.00 0.00 ? 150 LYS B CG   3  
ATOM 7995  C CD   . LYS B 1 150 ? 27.619  -1.160  8.343   1.00 0.00 ? 150 LYS B CD   3  
ATOM 7996  C CE   . LYS B 1 150 ? 27.047  -1.000  9.727   1.00 0.00 ? 150 LYS B CE   3  
ATOM 7997  N NZ   . LYS B 1 150 ? 26.014  -2.011  10.001  1.00 0.00 ? 150 LYS B NZ   3  
ATOM 7998  H H    . LYS B 1 150 ? 30.889  0.409   4.619   1.00 0.00 ? 150 LYS B H    3  
ATOM 7999  H HA   . LYS B 1 150 ? 28.856  1.950   5.999   1.00 0.00 ? 150 LYS B HA   3  
ATOM 8000  H HB2  . LYS B 1 150 ? 28.240  -0.415  5.907   1.00 0.00 ? 150 LYS B HB2  3  
ATOM 8001  H HB3  . LYS B 1 150 ? 29.789  -0.861  6.610   1.00 0.00 ? 150 LYS B HB3  3  
ATOM 8002  H HG2  . LYS B 1 150 ? 29.243  0.150   8.677   1.00 0.00 ? 150 LYS B HG2  3  
ATOM 8003  H HG3  . LYS B 1 150 ? 27.811  0.918   7.992   1.00 0.00 ? 150 LYS B HG3  3  
ATOM 8004  H HD2  . LYS B 1 150 ? 26.807  -1.272  7.639   1.00 0.00 ? 150 LYS B HD2  3  
ATOM 8005  H HD3  . LYS B 1 150 ? 28.247  -2.039  8.319   1.00 0.00 ? 150 LYS B HD3  3  
ATOM 8006  H HE2  . LYS B 1 150 ? 27.845  -1.100  10.449  1.00 0.00 ? 150 LYS B HE2  3  
ATOM 8007  H HE3  . LYS B 1 150 ? 26.611  -0.016  9.810   1.00 0.00 ? 150 LYS B HE3  3  
ATOM 8008  H HZ1  . LYS B 1 150 ? 25.213  -1.808  9.361   1.00 0.00 ? 150 LYS B HZ1  3  
ATOM 8009  H HZ2  . LYS B 1 150 ? 25.672  -1.937  10.980  1.00 0.00 ? 150 LYS B HZ2  3  
ATOM 8010  H HZ3  . LYS B 1 150 ? 26.359  -2.977  9.834   1.00 0.00 ? 150 LYS B HZ3  3  
ATOM 8011  N N    . ARG A 1 69  ? -35.687 6.560   -10.263 1.00 0.00 ? 69  ARG A N    4  
ATOM 8012  C CA   . ARG A 1 69  ? -36.331 5.300   -10.076 1.00 0.00 ? 69  ARG A CA   4  
ATOM 8013  C C    . ARG A 1 69  ? -35.732 4.632   -8.862  1.00 0.00 ? 69  ARG A C    4  
ATOM 8014  O O    . ARG A 1 69  ? -34.555 4.324   -8.849  1.00 0.00 ? 69  ARG A O    4  
ATOM 8015  C CB   . ARG A 1 69  ? -36.166 4.427   -11.327 1.00 0.00 ? 69  ARG A CB   4  
ATOM 8016  C CG   . ARG A 1 69  ? -36.710 3.015   -11.183 1.00 0.00 ? 69  ARG A CG   4  
ATOM 8017  C CD   . ARG A 1 69  ? -36.607 2.256   -12.482 1.00 0.00 ? 69  ARG A CD   4  
ATOM 8018  N NE   . ARG A 1 69  ? -36.989 0.852   -12.335 1.00 0.00 ? 69  ARG A NE   4  
ATOM 8019  C CZ   . ARG A 1 69  ? -37.439 0.063   -13.323 1.00 0.00 ? 69  ARG A CZ   4  
ATOM 8020  N NH1  . ARG A 1 69  ? -37.630 0.548   -14.545 1.00 0.00 ? 69  ARG A NH1  4  
ATOM 8021  N NH2  . ARG A 1 69  ? -37.664 -1.220  -13.092 1.00 0.00 ? 69  ARG A NH2  4  
ATOM 8022  H H    . ARG A 1 69  ? -34.804 6.588   -10.689 1.00 0.00 ? 69  ARG A H    4  
ATOM 8023  H HA   . ARG A 1 69  ? -37.381 5.488   -9.908  1.00 0.00 ? 69  ARG A HA   4  
ATOM 8024  H HB2  . ARG A 1 69  ? -36.676 4.901   -12.152 1.00 0.00 ? 69  ARG A HB2  4  
ATOM 8025  H HB3  . ARG A 1 69  ? -35.115 4.363   -11.562 1.00 0.00 ? 69  ARG A HB3  4  
ATOM 8026  H HG2  . ARG A 1 69  ? -36.147 2.493   -10.424 1.00 0.00 ? 69  ARG A HG2  4  
ATOM 8027  H HG3  . ARG A 1 69  ? -37.746 3.071   -10.887 1.00 0.00 ? 69  ARG A HG3  4  
ATOM 8028  H HD2  . ARG A 1 69  ? -37.276 2.714   -13.194 1.00 0.00 ? 69  ARG A HD2  4  
ATOM 8029  H HD3  . ARG A 1 69  ? -35.593 2.311   -12.849 1.00 0.00 ? 69  ARG A HD3  4  
ATOM 8030  H HE   . ARG A 1 69  ? -36.841 0.487   -11.432 1.00 0.00 ? 69  ARG A HE   4  
ATOM 8031  H HH11 . ARG A 1 69  ? -37.454 1.503   -14.793 1.00 0.00 ? 69  ARG A HH11 4  
ATOM 8032  H HH12 . ARG A 1 69  ? -37.953 -0.046  -15.287 1.00 0.00 ? 69  ARG A HH12 4  
ATOM 8033  H HH21 . ARG A 1 69  ? -37.513 -1.651  -12.202 1.00 0.00 ? 69  ARG A HH21 4  
ATOM 8034  H HH22 . ARG A 1 69  ? -37.998 -1.821  -13.827 1.00 0.00 ? 69  ARG A HH22 4  
ATOM 8035  N N    . LEU A 1 70  ? -36.515 4.468   -7.838  1.00 0.00 ? 70  LEU A N    4  
ATOM 8036  C CA   . LEU A 1 70  ? -36.043 3.840   -6.628  1.00 0.00 ? 70  LEU A CA   4  
ATOM 8037  C C    . LEU A 1 70  ? -36.622 2.447   -6.537  1.00 0.00 ? 70  LEU A C    4  
ATOM 8038  O O    . LEU A 1 70  ? -37.831 2.282   -6.298  1.00 0.00 ? 70  LEU A O    4  
ATOM 8039  C CB   . LEU A 1 70  ? -36.426 4.643   -5.350  1.00 0.00 ? 70  LEU A CB   4  
ATOM 8040  C CG   . LEU A 1 70  ? -35.827 6.063   -5.153  1.00 0.00 ? 70  LEU A CG   4  
ATOM 8041  C CD1  . LEU A 1 70  ? -36.399 7.081   -6.128  1.00 0.00 ? 70  LEU A CD1  4  
ATOM 8042  C CD2  . LEU A 1 70  ? -36.031 6.528   -3.719  1.00 0.00 ? 70  LEU A CD2  4  
ATOM 8043  H H    . LEU A 1 70  ? -37.451 4.761   -7.894  1.00 0.00 ? 70  LEU A H    4  
ATOM 8044  H HA   . LEU A 1 70  ? -34.967 3.767   -6.690  1.00 0.00 ? 70  LEU A HA   4  
ATOM 8045  H HB2  . LEU A 1 70  ? -37.501 4.743   -5.336  1.00 0.00 ? 70  LEU A HB2  4  
ATOM 8046  H HB3  . LEU A 1 70  ? -36.145 4.043   -4.496  1.00 0.00 ? 70  LEU A HB3  4  
ATOM 8047  H HG   . LEU A 1 70  ? -34.765 6.023   -5.335  1.00 0.00 ? 70  LEU A HG   4  
ATOM 8048  H HD11 . LEU A 1 70  ? -36.189 6.767   -7.140  1.00 0.00 ? 70  LEU A HD11 4  
ATOM 8049  H HD12 . LEU A 1 70  ? -35.947 8.045   -5.948  1.00 0.00 ? 70  LEU A HD12 4  
ATOM 8050  H HD13 . LEU A 1 70  ? -37.468 7.154   -5.990  1.00 0.00 ? 70  LEU A HD13 4  
ATOM 8051  H HD21 . LEU A 1 70  ? -37.088 6.545   -3.492  1.00 0.00 ? 70  LEU A HD21 4  
ATOM 8052  H HD22 . LEU A 1 70  ? -35.621 7.520   -3.602  1.00 0.00 ? 70  LEU A HD22 4  
ATOM 8053  H HD23 . LEU A 1 70  ? -35.529 5.850   -3.046  1.00 0.00 ? 70  LEU A HD23 4  
ATOM 8054  N N    . GLU A 1 71  ? -35.817 1.454   -6.777  1.00 0.00 ? 71  GLU A N    4  
ATOM 8055  C CA   . GLU A 1 71  ? -36.276 0.093   -6.656  1.00 0.00 ? 71  GLU A CA   4  
ATOM 8056  C C    . GLU A 1 71  ? -36.026 -0.349  -5.235  1.00 0.00 ? 71  GLU A C    4  
ATOM 8057  O O    . GLU A 1 71  ? -35.014 0.024   -4.635  1.00 0.00 ? 71  GLU A O    4  
ATOM 8058  C CB   . GLU A 1 71  ? -35.527 -0.830  -7.620  1.00 0.00 ? 71  GLU A CB   4  
ATOM 8059  C CG   . GLU A 1 71  ? -36.066 -2.256  -7.632  1.00 0.00 ? 71  GLU A CG   4  
ATOM 8060  C CD   . GLU A 1 71  ? -35.266 -3.197  -8.487  1.00 0.00 ? 71  GLU A CD   4  
ATOM 8061  O OE1  . GLU A 1 71  ? -35.204 -2.999  -9.722  1.00 0.00 ? 71  GLU A OE1  4  
ATOM 8062  O OE2  . GLU A 1 71  ? -34.742 -4.184  -7.959  1.00 0.00 ? 71  GLU A OE2  4  
ATOM 8063  H H    . GLU A 1 71  ? -34.872 1.623   -7.016  1.00 0.00 ? 71  GLU A H    4  
ATOM 8064  H HA   . GLU A 1 71  ? -37.335 0.064   -6.865  1.00 0.00 ? 71  GLU A HA   4  
ATOM 8065  H HB2  . GLU A 1 71  ? -35.617 -0.424  -8.616  1.00 0.00 ? 71  GLU A HB2  4  
ATOM 8066  H HB3  . GLU A 1 71  ? -34.485 -0.862  -7.341  1.00 0.00 ? 71  GLU A HB3  4  
ATOM 8067  H HG2  . GLU A 1 71  ? -36.058 -2.630  -6.619  1.00 0.00 ? 71  GLU A HG2  4  
ATOM 8068  H HG3  . GLU A 1 71  ? -37.085 -2.239  -7.990  1.00 0.00 ? 71  GLU A HG3  4  
ATOM 8069  N N    . LYS A 1 72  ? -36.924 -1.105  -4.669  1.00 0.00 ? 72  LYS A N    4  
ATOM 8070  C CA   . LYS A 1 72  ? -36.689 -1.580  -3.350  1.00 0.00 ? 72  LYS A CA   4  
ATOM 8071  C C    . LYS A 1 72  ? -35.909 -2.862  -3.430  1.00 0.00 ? 72  LYS A C    4  
ATOM 8072  O O    . LYS A 1 72  ? -36.439 -3.925  -3.800  1.00 0.00 ? 72  LYS A O    4  
ATOM 8073  C CB   . LYS A 1 72  ? -37.979 -1.752  -2.555  1.00 0.00 ? 72  LYS A CB   4  
ATOM 8074  C CG   . LYS A 1 72  ? -38.770 -0.460  -2.389  1.00 0.00 ? 72  LYS A CG   4  
ATOM 8075  C CD   . LYS A 1 72  ? -39.927 -0.614  -1.412  1.00 0.00 ? 72  LYS A CD   4  
ATOM 8076  C CE   . LYS A 1 72  ? -39.420 -0.913  -0.008  1.00 0.00 ? 72  LYS A CE   4  
ATOM 8077  N NZ   . LYS A 1 72  ? -40.502 -0.985  0.984   1.00 0.00 ? 72  LYS A NZ   4  
ATOM 8078  H H    . LYS A 1 72  ? -37.736 -1.364  -5.156  1.00 0.00 ? 72  LYS A H    4  
ATOM 8079  H HA   . LYS A 1 72  ? -36.065 -0.847  -2.862  1.00 0.00 ? 72  LYS A HA   4  
ATOM 8080  H HB2  . LYS A 1 72  ? -38.603 -2.473  -3.063  1.00 0.00 ? 72  LYS A HB2  4  
ATOM 8081  H HB3  . LYS A 1 72  ? -37.723 -2.130  -1.578  1.00 0.00 ? 72  LYS A HB3  4  
ATOM 8082  H HG2  . LYS A 1 72  ? -38.105 0.306   -2.020  1.00 0.00 ? 72  LYS A HG2  4  
ATOM 8083  H HG3  . LYS A 1 72  ? -39.157 -0.161  -3.352  1.00 0.00 ? 72  LYS A HG3  4  
ATOM 8084  H HD2  . LYS A 1 72  ? -40.498 0.303   -1.390  1.00 0.00 ? 72  LYS A HD2  4  
ATOM 8085  H HD3  . LYS A 1 72  ? -40.559 -1.426  -1.739  1.00 0.00 ? 72  LYS A HD3  4  
ATOM 8086  H HE2  . LYS A 1 72  ? -38.911 -1.865  -0.014  1.00 0.00 ? 72  LYS A HE2  4  
ATOM 8087  H HE3  . LYS A 1 72  ? -38.726 -0.138  0.281   1.00 0.00 ? 72  LYS A HE3  4  
ATOM 8088  H HZ1  . LYS A 1 72  ? -40.091 -1.208  1.914   1.00 0.00 ? 72  LYS A HZ1  4  
ATOM 8089  H HZ2  . LYS A 1 72  ? -41.193 -1.727  0.751   1.00 0.00 ? 72  LYS A HZ2  4  
ATOM 8090  H HZ3  . LYS A 1 72  ? -40.987 -0.070  1.073   1.00 0.00 ? 72  LYS A HZ3  4  
ATOM 8091  N N    . ASP A 1 73  ? -34.659 -2.748  -3.101  1.00 0.00 ? 73  ASP A N    4  
ATOM 8092  C CA   . ASP A 1 73  ? -33.706 -3.822  -3.146  1.00 0.00 ? 73  ASP A CA   4  
ATOM 8093  C C    . ASP A 1 73  ? -32.579 -3.410  -2.247  1.00 0.00 ? 73  ASP A C    4  
ATOM 8094  O O    . ASP A 1 73  ? -32.245 -2.213  -2.177  1.00 0.00 ? 73  ASP A O    4  
ATOM 8095  C CB   . ASP A 1 73  ? -33.199 -4.032  -4.597  1.00 0.00 ? 73  ASP A CB   4  
ATOM 8096  C CG   . ASP A 1 73  ? -32.224 -5.194  -4.755  1.00 0.00 ? 73  ASP A CG   4  
ATOM 8097  O OD1  . ASP A 1 73  ? -32.476 -6.283  -4.190  1.00 0.00 ? 73  ASP A OD1  4  
ATOM 8098  O OD2  . ASP A 1 73  ? -31.232 -5.062  -5.509  1.00 0.00 ? 73  ASP A OD2  4  
ATOM 8099  H H    . ASP A 1 73  ? -34.321 -1.881  -2.788  1.00 0.00 ? 73  ASP A H    4  
ATOM 8100  H HA   . ASP A 1 73  ? -34.167 -4.727  -2.776  1.00 0.00 ? 73  ASP A HA   4  
ATOM 8101  H HB2  . ASP A 1 73  ? -34.044 -4.219  -5.242  1.00 0.00 ? 73  ASP A HB2  4  
ATOM 8102  H HB3  . ASP A 1 73  ? -32.706 -3.128  -4.922  1.00 0.00 ? 73  ASP A HB3  4  
ATOM 8103  N N    . ARG A 1 74  ? -32.033 -4.331  -1.532  1.00 0.00 ? 74  ARG A N    4  
ATOM 8104  C CA   . ARG A 1 74  ? -30.985 -4.009  -0.619  1.00 0.00 ? 74  ARG A CA   4  
ATOM 8105  C C    . ARG A 1 74  ? -29.680 -4.252  -1.284  1.00 0.00 ? 74  ARG A C    4  
ATOM 8106  O O    . ARG A 1 74  ? -29.505 -5.236  -1.999  1.00 0.00 ? 74  ARG A O    4  
ATOM 8107  C CB   . ARG A 1 74  ? -31.114 -4.782  0.683   1.00 0.00 ? 74  ARG A CB   4  
ATOM 8108  C CG   . ARG A 1 74  ? -32.356 -4.413  1.469   1.00 0.00 ? 74  ARG A CG   4  
ATOM 8109  C CD   . ARG A 1 74  ? -32.439 -5.161  2.783   1.00 0.00 ? 74  ARG A CD   4  
ATOM 8110  N NE   . ARG A 1 74  ? -32.528 -6.610  2.599   1.00 0.00 ? 74  ARG A NE   4  
ATOM 8111  C CZ   . ARG A 1 74  ? -33.487 -7.390  3.106   1.00 0.00 ? 74  ARG A CZ   4  
ATOM 8112  N NH1  . ARG A 1 74  ? -34.517 -6.854  3.773   1.00 0.00 ? 74  ARG A NH1  4  
ATOM 8113  N NH2  . ARG A 1 74  ? -33.418 -8.701  2.930   1.00 0.00 ? 74  ARG A NH2  4  
ATOM 8114  H H    . ARG A 1 74  ? -32.309 -5.267  -1.642  1.00 0.00 ? 74  ARG A H    4  
ATOM 8115  H HA   . ARG A 1 74  ? -31.062 -2.951  -0.412  1.00 0.00 ? 74  ARG A HA   4  
ATOM 8116  H HB2  . ARG A 1 74  ? -31.140 -5.840  0.471   1.00 0.00 ? 74  ARG A HB2  4  
ATOM 8117  H HB3  . ARG A 1 74  ? -30.254 -4.559  1.295   1.00 0.00 ? 74  ARG A HB3  4  
ATOM 8118  H HG2  . ARG A 1 74  ? -32.339 -3.352  1.671   1.00 0.00 ? 74  ARG A HG2  4  
ATOM 8119  H HG3  . ARG A 1 74  ? -33.225 -4.649  0.871   1.00 0.00 ? 74  ARG A HG3  4  
ATOM 8120  H HD2  . ARG A 1 74  ? -31.550 -4.942  3.356   1.00 0.00 ? 74  ARG A HD2  4  
ATOM 8121  H HD3  . ARG A 1 74  ? -33.303 -4.819  3.328   1.00 0.00 ? 74  ARG A HD3  4  
ATOM 8122  H HE   . ARG A 1 74  ? -31.786 -7.011  2.088   1.00 0.00 ? 74  ARG A HE   4  
ATOM 8123  H HH11 . ARG A 1 74  ? -34.608 -5.866  3.915   1.00 0.00 ? 74  ARG A HH11 4  
ATOM 8124  H HH12 . ARG A 1 74  ? -35.265 -7.410  4.145   1.00 0.00 ? 74  ARG A HH12 4  
ATOM 8125  H HH21 . ARG A 1 74  ? -32.660 -9.118  2.420   1.00 0.00 ? 74  ARG A HH21 4  
ATOM 8126  H HH22 . ARG A 1 74  ? -34.112 -9.335  3.285   1.00 0.00 ? 74  ARG A HH22 4  
ATOM 8127  N N    . PHE A 1 75  ? -28.780 -3.381  -1.049  1.00 0.00 ? 75  PHE A N    4  
ATOM 8128  C CA   . PHE A 1 75  ? -27.560 -3.352  -1.760  1.00 0.00 ? 75  PHE A CA   4  
ATOM 8129  C C    . PHE A 1 75  ? -26.452 -3.842  -0.882  1.00 0.00 ? 75  PHE A C    4  
ATOM 8130  O O    . PHE A 1 75  ? -26.447 -3.569  0.319   1.00 0.00 ? 75  PHE A O    4  
ATOM 8131  C CB   . PHE A 1 75  ? -27.298 -1.919  -2.185  1.00 0.00 ? 75  PHE A CB   4  
ATOM 8132  C CG   . PHE A 1 75  ? -26.273 -1.788  -3.231  1.00 0.00 ? 75  PHE A CG   4  
ATOM 8133  C CD1  . PHE A 1 75  ? -26.464 -2.391  -4.446  1.00 0.00 ? 75  PHE A CD1  4  
ATOM 8134  C CD2  . PHE A 1 75  ? -25.128 -1.057  -3.017  1.00 0.00 ? 75  PHE A CD2  4  
ATOM 8135  C CE1  . PHE A 1 75  ? -25.529 -2.278  -5.432  1.00 0.00 ? 75  PHE A CE1  4  
ATOM 8136  C CE2  . PHE A 1 75  ? -24.186 -0.938  -4.007  1.00 0.00 ? 75  PHE A CE2  4  
ATOM 8137  C CZ   . PHE A 1 75  ? -24.385 -1.551  -5.219  1.00 0.00 ? 75  PHE A CZ   4  
ATOM 8138  H H    . PHE A 1 75  ? -28.913 -2.739  -0.317  1.00 0.00 ? 75  PHE A H    4  
ATOM 8139  H HA   . PHE A 1 75  ? -27.644 -3.961  -2.647  1.00 0.00 ? 75  PHE A HA   4  
ATOM 8140  H HB2  . PHE A 1 75  ? -28.211 -1.471  -2.546  1.00 0.00 ? 75  PHE A HB2  4  
ATOM 8141  H HB3  . PHE A 1 75  ? -26.965 -1.364  -1.321  1.00 0.00 ? 75  PHE A HB3  4  
ATOM 8142  H HD1  . PHE A 1 75  ? -27.363 -2.965  -4.620  1.00 0.00 ? 75  PHE A HD1  4  
ATOM 8143  H HD2  . PHE A 1 75  ? -24.972 -0.574  -2.063  1.00 0.00 ? 75  PHE A HD2  4  
ATOM 8144  H HE1  . PHE A 1 75  ? -25.699 -2.760  -6.381  1.00 0.00 ? 75  PHE A HE1  4  
ATOM 8145  H HE2  . PHE A 1 75  ? -23.286 -0.367  -3.831  1.00 0.00 ? 75  PHE A HE2  4  
ATOM 8146  H HZ   . PHE A 1 75  ? -23.645 -1.461  -6.001  1.00 0.00 ? 75  PHE A HZ   4  
ATOM 8147  N N    . SER A 1 76  ? -25.570 -4.601  -1.442  1.00 0.00 ? 76  SER A N    4  
ATOM 8148  C CA   . SER A 1 76  ? -24.442 -5.068  -0.738  1.00 0.00 ? 76  SER A CA   4  
ATOM 8149  C C    . SER A 1 76  ? -23.216 -4.973  -1.638  1.00 0.00 ? 76  SER A C    4  
ATOM 8150  O O    . SER A 1 76  ? -23.241 -5.414  -2.797  1.00 0.00 ? 76  SER A O    4  
ATOM 8151  C CB   . SER A 1 76  ? -24.683 -6.517  -0.281  1.00 0.00 ? 76  SER A CB   4  
ATOM 8152  O OG   . SER A 1 76  ? -23.633 -6.986  0.540   1.00 0.00 ? 76  SER A OG   4  
ATOM 8153  H H    . SER A 1 76  ? -25.662 -4.877  -2.380  1.00 0.00 ? 76  SER A H    4  
ATOM 8154  H HA   . SER A 1 76  ? -24.300 -4.448  0.134   1.00 0.00 ? 76  SER A HA   4  
ATOM 8155  H HB2  . SER A 1 76  ? -25.604 -6.565  0.280   1.00 0.00 ? 76  SER A HB2  4  
ATOM 8156  H HB3  . SER A 1 76  ? -24.760 -7.154  -1.149  1.00 0.00 ? 76  SER A HB3  4  
ATOM 8157  H HG   . SER A 1 76  ? -23.360 -7.861  0.243   1.00 0.00 ? 76  SER A HG   4  
ATOM 8158  N N    . VAL A 1 77  ? -22.184 -4.376  -1.134  1.00 0.00 ? 77  VAL A N    4  
ATOM 8159  C CA   . VAL A 1 77  ? -20.915 -4.342  -1.788  1.00 0.00 ? 77  VAL A CA   4  
ATOM 8160  C C    . VAL A 1 77  ? -19.990 -5.055  -0.861  1.00 0.00 ? 77  VAL A C    4  
ATOM 8161  O O    . VAL A 1 77  ? -19.955 -4.759  0.316   1.00 0.00 ? 77  VAL A O    4  
ATOM 8162  C CB   . VAL A 1 77  ? -20.362 -2.890  -1.987  1.00 0.00 ? 77  VAL A CB   4  
ATOM 8163  C CG1  . VAL A 1 77  ? -19.047 -2.911  -2.758  1.00 0.00 ? 77  VAL A CG1  4  
ATOM 8164  C CG2  . VAL A 1 77  ? -21.360 -2.009  -2.691  1.00 0.00 ? 77  VAL A CG2  4  
ATOM 8165  H H    . VAL A 1 77  ? -22.250 -3.955  -0.246  1.00 0.00 ? 77  VAL A H    4  
ATOM 8166  H HA   . VAL A 1 77  ? -20.975 -4.856  -2.735  1.00 0.00 ? 77  VAL A HA   4  
ATOM 8167  H HB   . VAL A 1 77  ? -20.162 -2.478  -1.009  1.00 0.00 ? 77  VAL A HB   4  
ATOM 8168  H HG11 . VAL A 1 77  ? -18.678 -1.904  -2.876  1.00 0.00 ? 77  VAL A HG11 4  
ATOM 8169  H HG12 . VAL A 1 77  ? -19.209 -3.347  -3.732  1.00 0.00 ? 77  VAL A HG12 4  
ATOM 8170  H HG13 . VAL A 1 77  ? -18.321 -3.501  -2.217  1.00 0.00 ? 77  VAL A HG13 4  
ATOM 8171  H HG21 . VAL A 1 77  ? -20.946 -1.018  -2.810  1.00 0.00 ? 77  VAL A HG21 4  
ATOM 8172  H HG22 . VAL A 1 77  ? -22.267 -1.951  -2.107  1.00 0.00 ? 77  VAL A HG22 4  
ATOM 8173  H HG23 . VAL A 1 77  ? -21.582 -2.424  -3.662  1.00 0.00 ? 77  VAL A HG23 4  
ATOM 8174  N N    . ASN A 1 78  ? -19.255 -5.954  -1.341  1.00 0.00 ? 78  ASN A N    4  
ATOM 8175  C CA   . ASN A 1 78  ? -18.345 -6.633  -0.485  1.00 0.00 ? 78  ASN A CA   4  
ATOM 8176  C C    . ASN A 1 78  ? -16.983 -6.234  -0.884  1.00 0.00 ? 78  ASN A C    4  
ATOM 8177  O O    . ASN A 1 78  ? -16.754 -5.799  -2.026  1.00 0.00 ? 78  ASN A O    4  
ATOM 8178  C CB   . ASN A 1 78  ? -18.504 -8.176  -0.523  1.00 0.00 ? 78  ASN A CB   4  
ATOM 8179  C CG   . ASN A 1 78  ? -18.069 -8.818  -1.835  1.00 0.00 ? 78  ASN A CG   4  
ATOM 8180  O OD1  . ASN A 1 78  ? -16.902 -9.178  -2.006  1.00 0.00 ? 78  ASN A OD1  4  
ATOM 8181  N ND2  . ASN A 1 78  ? -18.993 -9.001  -2.740  1.00 0.00 ? 78  ASN A ND2  4  
ATOM 8182  H H    . ASN A 1 78  ? -19.295 -6.175  -2.295  1.00 0.00 ? 78  ASN A H    4  
ATOM 8183  H HA   . ASN A 1 78  ? -18.522 -6.280  0.520   1.00 0.00 ? 78  ASN A HA   4  
ATOM 8184  H HB2  . ASN A 1 78  ? -17.908 -8.607  0.268   1.00 0.00 ? 78  ASN A HB2  4  
ATOM 8185  H HB3  . ASN A 1 78  ? -19.540 -8.421  -0.347  1.00 0.00 ? 78  ASN A HB3  4  
ATOM 8186  H HD21 . ASN A 1 78  ? -19.916 -8.725  -2.541  1.00 0.00 ? 78  ASN A HD21 4  
ATOM 8187  H HD22 . ASN A 1 78  ? -18.735 -9.412  -3.593  1.00 0.00 ? 78  ASN A HD22 4  
ATOM 8188  N N    . LEU A 1 79  ? -16.105 -6.341  0.010   1.00 0.00 ? 79  LEU A N    4  
ATOM 8189  C CA   . LEU A 1 79  ? -14.790 -5.988  -0.219  1.00 0.00 ? 79  LEU A CA   4  
ATOM 8190  C C    . LEU A 1 79  ? -13.942 -7.190  -0.041  1.00 0.00 ? 79  LEU A C    4  
ATOM 8191  O O    . LEU A 1 79  ? -14.007 -7.887  0.993   1.00 0.00 ? 79  LEU A O    4  
ATOM 8192  C CB   . LEU A 1 79  ? -14.313 -4.929  0.779   1.00 0.00 ? 79  LEU A CB   4  
ATOM 8193  C CG   . LEU A 1 79  ? -12.785 -4.709  0.815   1.00 0.00 ? 79  LEU A CG   4  
ATOM 8194  C CD1  . LEU A 1 79  ? -12.307 -3.952  -0.376  1.00 0.00 ? 79  LEU A CD1  4  
ATOM 8195  C CD2  . LEU A 1 79  ? -12.318 -4.056  2.084   1.00 0.00 ? 79  LEU A CD2  4  
ATOM 8196  H H    . LEU A 1 79  ? -16.347 -6.706  0.891   1.00 0.00 ? 79  LEU A H    4  
ATOM 8197  H HA   . LEU A 1 79  ? -14.688 -5.586  -1.215  1.00 0.00 ? 79  LEU A HA   4  
ATOM 8198  H HB2  . LEU A 1 79  ? -14.792 -3.994  0.521   1.00 0.00 ? 79  LEU A HB2  4  
ATOM 8199  H HB3  . LEU A 1 79  ? -14.647 -5.226  1.759   1.00 0.00 ? 79  LEU A HB3  4  
ATOM 8200  H HG   . LEU A 1 79  ? -12.322 -5.683  0.753   1.00 0.00 ? 79  LEU A HG   4  
ATOM 8201  H HD11 . LEU A 1 79  ? -12.564 -4.496  -1.273  1.00 0.00 ? 79  LEU A HD11 4  
ATOM 8202  H HD12 . LEU A 1 79  ? -11.236 -3.832  -0.318  1.00 0.00 ? 79  LEU A HD12 4  
ATOM 8203  H HD13 . LEU A 1 79  ? -12.781 -2.982  -0.398  1.00 0.00 ? 79  LEU A HD13 4  
ATOM 8204  H HD21 . LEU A 1 79  ? -12.599 -4.653  2.937   1.00 0.00 ? 79  LEU A HD21 4  
ATOM 8205  H HD22 . LEU A 1 79  ? -12.756 -3.073  2.164   1.00 0.00 ? 79  LEU A HD22 4  
ATOM 8206  H HD23 . LEU A 1 79  ? -11.242 -3.970  2.054   1.00 0.00 ? 79  LEU A HD23 4  
ATOM 8207  N N    . ASP A 1 80  ? -13.159 -7.425  -1.036  1.00 0.00 ? 80  ASP A N    4  
ATOM 8208  C CA   . ASP A 1 80  ? -12.169 -8.419  -0.991  1.00 0.00 ? 80  ASP A CA   4  
ATOM 8209  C C    . ASP A 1 80  ? -10.865 -7.696  -0.812  1.00 0.00 ? 80  ASP A C    4  
ATOM 8210  O O    . ASP A 1 80  ? -10.585 -6.678  -1.476  1.00 0.00 ? 80  ASP A O    4  
ATOM 8211  C CB   . ASP A 1 80  ? -12.154 -9.306  -2.256  1.00 0.00 ? 80  ASP A CB   4  
ATOM 8212  C CG   . ASP A 1 80  ? -11.690 -8.608  -3.507  1.00 0.00 ? 80  ASP A CG   4  
ATOM 8213  O OD1  . ASP A 1 80  ? -12.487 -7.870  -4.121  1.00 0.00 ? 80  ASP A OD1  4  
ATOM 8214  O OD2  . ASP A 1 80  ? -10.520 -8.797  -3.914  1.00 0.00 ? 80  ASP A OD2  4  
ATOM 8215  H H    . ASP A 1 80  ? -13.250 -6.894  -1.853  1.00 0.00 ? 80  ASP A H    4  
ATOM 8216  H HA   . ASP A 1 80  ? -12.352 -9.024  -0.116  1.00 0.00 ? 80  ASP A HA   4  
ATOM 8217  H HB2  . ASP A 1 80  ? -11.497 -10.144 -2.087  1.00 0.00 ? 80  ASP A HB2  4  
ATOM 8218  H HB3  . ASP A 1 80  ? -13.153 -9.679  -2.425  1.00 0.00 ? 80  ASP A HB3  4  
ATOM 8219  N N    . VAL A 1 81  ? -10.152 -8.149  0.117   1.00 0.00 ? 81  VAL A N    4  
ATOM 8220  C CA   . VAL A 1 81  ? -8.923  -7.611  0.545   1.00 0.00 ? 81  VAL A CA   4  
ATOM 8221  C C    . VAL A 1 81  ? -8.207  -8.766  1.211   1.00 0.00 ? 81  VAL A C    4  
ATOM 8222  O O    . VAL A 1 81  ? -8.828  -9.794  1.480   1.00 0.00 ? 81  VAL A O    4  
ATOM 8223  C CB   . VAL A 1 81  ? -9.167  -6.396  1.539   1.00 0.00 ? 81  VAL A CB   4  
ATOM 8224  C CG1  . VAL A 1 81  ? -10.045 -6.776  2.702   1.00 0.00 ? 81  VAL A CG1  4  
ATOM 8225  C CG2  . VAL A 1 81  ? -7.875  -5.789  2.054   1.00 0.00 ? 81  VAL A CG2  4  
ATOM 8226  H H    . VAL A 1 81  ? -10.429 -8.956  0.605   1.00 0.00 ? 81  VAL A H    4  
ATOM 8227  H HA   . VAL A 1 81  ? -8.366  -7.280  -0.319  1.00 0.00 ? 81  VAL A HA   4  
ATOM 8228  H HB   . VAL A 1 81  ? -9.697  -5.636  0.983   1.00 0.00 ? 81  VAL A HB   4  
ATOM 8229  H HG11 . VAL A 1 81  ? -11.006 -7.107  2.335   1.00 0.00 ? 81  VAL A HG11 4  
ATOM 8230  H HG12 . VAL A 1 81  ? -10.182 -5.920  3.346   1.00 0.00 ? 81  VAL A HG12 4  
ATOM 8231  H HG13 . VAL A 1 81  ? -9.579  -7.576  3.258   1.00 0.00 ? 81  VAL A HG13 4  
ATOM 8232  H HG21 . VAL A 1 81  ? -7.303  -6.546  2.568   1.00 0.00 ? 81  VAL A HG21 4  
ATOM 8233  H HG22 . VAL A 1 81  ? -8.101  -4.981  2.735   1.00 0.00 ? 81  VAL A HG22 4  
ATOM 8234  H HG23 . VAL A 1 81  ? -7.301  -5.406  1.222   1.00 0.00 ? 81  VAL A HG23 4  
ATOM 8235  N N    . LYS A 1 82  ? -6.932  -8.640  1.390   1.00 0.00 ? 82  LYS A N    4  
ATOM 8236  C CA   . LYS A 1 82  ? -6.142  -9.670  1.995   1.00 0.00 ? 82  LYS A CA   4  
ATOM 8237  C C    . LYS A 1 82  ? -6.033  -9.412  3.472   1.00 0.00 ? 82  LYS A C    4  
ATOM 8238  O O    . LYS A 1 82  ? -6.786  -8.587  3.978   1.00 0.00 ? 82  LYS A O    4  
ATOM 8239  C CB   . LYS A 1 82  ? -4.817  -9.777  1.280   1.00 0.00 ? 82  LYS A CB   4  
ATOM 8240  C CG   . LYS A 1 82  ? -5.038  -10.139 -0.191  1.00 0.00 ? 82  LYS A CG   4  
ATOM 8241  C CD   . LYS A 1 82  ? -3.812  -9.998  -1.068  1.00 0.00 ? 82  LYS A CD   4  
ATOM 8242  C CE   . LYS A 1 82  ? -4.161  -10.390 -2.505  1.00 0.00 ? 82  LYS A CE   4  
ATOM 8243  N NZ   . LYS A 1 82  ? -3.060  -10.145 -3.449  1.00 0.00 ? 82  LYS A NZ   4  
ATOM 8244  H H    . LYS A 1 82  ? -6.511  -7.795  1.141   1.00 0.00 ? 82  LYS A H    4  
ATOM 8245  H HA   . LYS A 1 82  ? -6.691  -10.590 1.868   1.00 0.00 ? 82  LYS A HA   4  
ATOM 8246  H HB2  . LYS A 1 82  ? -4.306  -8.827  1.340   1.00 0.00 ? 82  LYS A HB2  4  
ATOM 8247  H HB3  . LYS A 1 82  ? -4.213  -10.545 1.733   1.00 0.00 ? 82  LYS A HB3  4  
ATOM 8248  H HG2  . LYS A 1 82  ? -5.347  -11.172 -0.230  1.00 0.00 ? 82  LYS A HG2  4  
ATOM 8249  H HG3  . LYS A 1 82  ? -5.831  -9.518  -0.582  1.00 0.00 ? 82  LYS A HG3  4  
ATOM 8250  H HD2  . LYS A 1 82  ? -3.468  -8.974  -1.045  1.00 0.00 ? 82  LYS A HD2  4  
ATOM 8251  H HD3  . LYS A 1 82  ? -3.037  -10.658 -0.703  1.00 0.00 ? 82  LYS A HD3  4  
ATOM 8252  H HE2  . LYS A 1 82  ? -4.409  -11.440 -2.526  1.00 0.00 ? 82  LYS A HE2  4  
ATOM 8253  H HE3  . LYS A 1 82  ? -5.023  -9.821  -2.816  1.00 0.00 ? 82  LYS A HE3  4  
ATOM 8254  H HZ1  . LYS A 1 82  ? -3.250  -10.663 -4.331  1.00 0.00 ? 82  LYS A HZ1  4  
ATOM 8255  H HZ2  . LYS A 1 82  ? -2.149  -10.495 -3.088  1.00 0.00 ? 82  LYS A HZ2  4  
ATOM 8256  H HZ3  . LYS A 1 82  ? -2.996  -9.137  -3.710  1.00 0.00 ? 82  LYS A HZ3  4  
ATOM 8257  N N    . HIS A 1 83  ? -5.097  -10.018 4.166   1.00 0.00 ? 83  HIS A N    4  
ATOM 8258  C CA   . HIS A 1 83  ? -5.172  -9.924  5.598   1.00 0.00 ? 83  HIS A CA   4  
ATOM 8259  C C    . HIS A 1 83  ? -4.715  -8.580  6.108   1.00 0.00 ? 83  HIS A C    4  
ATOM 8260  O O    . HIS A 1 83  ? -3.590  -8.116  5.856   1.00 0.00 ? 83  HIS A O    4  
ATOM 8261  C CB   . HIS A 1 83  ? -4.379  -11.039 6.302   1.00 0.00 ? 83  HIS A CB   4  
ATOM 8262  C CG   . HIS A 1 83  ? -4.609  -11.079 7.799   1.00 0.00 ? 83  HIS A CG   4  
ATOM 8263  N ND1  . HIS A 1 83  ? -3.917  -10.309 8.703   1.00 0.00 ? 83  HIS A ND1  4  
ATOM 8264  C CD2  . HIS A 1 83  ? -5.490  -11.777 8.526   1.00 0.00 ? 83  HIS A CD2  4  
ATOM 8265  C CE1  . HIS A 1 83  ? -4.373  -10.534 9.913   1.00 0.00 ? 83  HIS A CE1  4  
ATOM 8266  N NE2  . HIS A 1 83  ? -5.329  -11.422 9.835   1.00 0.00 ? 83  HIS A NE2  4  
ATOM 8267  H H    . HIS A 1 83  ? -4.389  -10.529 3.726   1.00 0.00 ? 83  HIS A H    4  
ATOM 8268  H HA   . HIS A 1 83  ? -6.212  -10.044 5.865   1.00 0.00 ? 83  HIS A HA   4  
ATOM 8269  H HB2  . HIS A 1 83  ? -4.674  -11.995 5.895   1.00 0.00 ? 83  HIS A HB2  4  
ATOM 8270  H HB3  . HIS A 1 83  ? -3.323  -10.887 6.131   1.00 0.00 ? 83  HIS A HB3  4  
ATOM 8271  H HD1  . HIS A 1 83  ? -3.200  -9.666  8.500   1.00 0.00 ? 83  HIS A HD1  4  
ATOM 8272  H HD2  . HIS A 1 83  ? -6.189  -12.502 8.136   1.00 0.00 ? 83  HIS A HD2  4  
ATOM 8273  H HE1  . HIS A 1 83  ? -4.025  -10.061 10.818  1.00 0.00 ? 83  HIS A HE1  4  
ATOM 8274  H HE2  . HIS A 1 83  ? -5.581  -12.017 10.576  1.00 0.00 ? 83  HIS A HE2  4  
ATOM 8275  N N    . PHE A 1 84  ? -5.615  -7.997  6.825   1.00 0.00 ? 84  PHE A N    4  
ATOM 8276  C CA   . PHE A 1 84  ? -5.475  -6.781  7.545   1.00 0.00 ? 84  PHE A CA   4  
ATOM 8277  C C    . PHE A 1 84  ? -6.347  -6.951  8.741   1.00 0.00 ? 84  PHE A C    4  
ATOM 8278  O O    . PHE A 1 84  ? -7.465  -7.462  8.618   1.00 0.00 ? 84  PHE A O    4  
ATOM 8279  C CB   . PHE A 1 84  ? -5.941  -5.556  6.719   1.00 0.00 ? 84  PHE A CB   4  
ATOM 8280  C CG   . PHE A 1 84  ? -5.001  -5.135  5.615   1.00 0.00 ? 84  PHE A CG   4  
ATOM 8281  C CD1  . PHE A 1 84  ? -5.072  -5.708  4.359   1.00 0.00 ? 84  PHE A CD1  4  
ATOM 8282  C CD2  . PHE A 1 84  ? -4.044  -4.163  5.847   1.00 0.00 ? 84  PHE A CD2  4  
ATOM 8283  C CE1  . PHE A 1 84  ? -4.207  -5.325  3.358   1.00 0.00 ? 84  PHE A CE1  4  
ATOM 8284  C CE2  . PHE A 1 84  ? -3.175  -3.774  4.848   1.00 0.00 ? 84  PHE A CE2  4  
ATOM 8285  C CZ   . PHE A 1 84  ? -3.254  -4.355  3.603   1.00 0.00 ? 84  PHE A CZ   4  
ATOM 8286  H H    . PHE A 1 84  ? -6.506  -8.415  6.879   1.00 0.00 ? 84  PHE A H    4  
ATOM 8287  H HA   . PHE A 1 84  ? -4.444  -6.666  7.846   1.00 0.00 ? 84  PHE A HA   4  
ATOM 8288  H HB2  . PHE A 1 84  ? -6.892  -5.785  6.262   1.00 0.00 ? 84  PHE A HB2  4  
ATOM 8289  H HB3  . PHE A 1 84  ? -6.071  -4.717  7.388   1.00 0.00 ? 84  PHE A HB3  4  
ATOM 8290  H HD1  . PHE A 1 84  ? -5.816  -6.467  4.169   1.00 0.00 ? 84  PHE A HD1  4  
ATOM 8291  H HD2  . PHE A 1 84  ? -3.978  -3.707  6.824   1.00 0.00 ? 84  PHE A HD2  4  
ATOM 8292  H HE1  . PHE A 1 84  ? -4.272  -5.784  2.382   1.00 0.00 ? 84  PHE A HE1  4  
ATOM 8293  H HE2  . PHE A 1 84  ? -2.431  -3.013  5.042   1.00 0.00 ? 84  PHE A HE2  4  
ATOM 8294  H HZ   . PHE A 1 84  ? -2.574  -4.054  2.820   1.00 0.00 ? 84  PHE A HZ   4  
ATOM 8295  N N    . SER A 1 85  ? -5.847  -6.614  9.879   1.00 0.00 ? 85  SER A N    4  
ATOM 8296  C CA   . SER A 1 85  ? -6.598  -6.752  11.079  1.00 0.00 ? 85  SER A CA   4  
ATOM 8297  C C    . SER A 1 85  ? -7.661  -5.644  11.083  1.00 0.00 ? 85  SER A C    4  
ATOM 8298  O O    . SER A 1 85  ? -7.404  -4.591  10.504  1.00 0.00 ? 85  SER A O    4  
ATOM 8299  C CB   . SER A 1 85  ? -5.644  -6.626  12.266  1.00 0.00 ? 85  SER A CB   4  
ATOM 8300  O OG   . SER A 1 85  ? -4.456  -7.388  12.020  1.00 0.00 ? 85  SER A OG   4  
ATOM 8301  H H    . SER A 1 85  ? -4.942  -6.231  9.934   1.00 0.00 ? 85  SER A H    4  
ATOM 8302  H HA   . SER A 1 85  ? -7.068  -7.724  11.085  1.00 0.00 ? 85  SER A HA   4  
ATOM 8303  H HB2  . SER A 1 85  ? -5.384  -5.590  12.420  1.00 0.00 ? 85  SER A HB2  4  
ATOM 8304  H HB3  . SER A 1 85  ? -6.122  -7.012  13.154  1.00 0.00 ? 85  SER A HB3  4  
ATOM 8305  H HG   . SER A 1 85  ? -3.921  -6.795  11.467  1.00 0.00 ? 85  SER A HG   4  
ATOM 8306  N N    . PRO A 1 86  ? -8.846  -5.846  11.686  1.00 0.00 ? 86  PRO A N    4  
ATOM 8307  C CA   . PRO A 1 86  ? -9.978  -4.891  11.581  1.00 0.00 ? 86  PRO A CA   4  
ATOM 8308  C C    . PRO A 1 86  ? -9.622  -3.406  11.828  1.00 0.00 ? 86  PRO A C    4  
ATOM 8309  O O    . PRO A 1 86  ? -10.157 -2.509  11.157  1.00 0.00 ? 86  PRO A O    4  
ATOM 8310  C CB   . PRO A 1 86  ? -10.947 -5.397  12.643  1.00 0.00 ? 86  PRO A CB   4  
ATOM 8311  C CG   . PRO A 1 86  ? -10.704 -6.864  12.674  1.00 0.00 ? 86  PRO A CG   4  
ATOM 8312  C CD   . PRO A 1 86  ? -9.223  -7.038  12.477  1.00 0.00 ? 86  PRO A CD   4  
ATOM 8313  H HA   . PRO A 1 86  ? -10.449 -4.978  10.613  1.00 0.00 ? 86  PRO A HA   4  
ATOM 8314  H HB2  . PRO A 1 86  ? -10.715 -4.932  13.591  1.00 0.00 ? 86  PRO A HB2  4  
ATOM 8315  H HB3  . PRO A 1 86  ? -11.963 -5.170  12.357  1.00 0.00 ? 86  PRO A HB3  4  
ATOM 8316  H HG2  . PRO A 1 86  ? -11.009 -7.267  13.628  1.00 0.00 ? 86  PRO A HG2  4  
ATOM 8317  H HG3  . PRO A 1 86  ? -11.249 -7.344  11.874  1.00 0.00 ? 86  PRO A HG3  4  
ATOM 8318  H HD2  . PRO A 1 86  ? -8.713  -7.058  13.429  1.00 0.00 ? 86  PRO A HD2  4  
ATOM 8319  H HD3  . PRO A 1 86  ? -9.024  -7.945  11.925  1.00 0.00 ? 86  PRO A HD3  4  
ATOM 8320  N N    . GLU A 1 87  ? -8.691  -3.152  12.725  1.00 0.00 ? 87  GLU A N    4  
ATOM 8321  C CA   . GLU A 1 87  ? -8.288  -1.789  13.049  1.00 0.00 ? 87  GLU A CA   4  
ATOM 8322  C C    . GLU A 1 87  ? -7.316  -1.215  11.983  1.00 0.00 ? 87  GLU A C    4  
ATOM 8323  O O    . GLU A 1 87  ? -7.145  0.010   11.868  1.00 0.00 ? 87  GLU A O    4  
ATOM 8324  C CB   . GLU A 1 87  ? -7.628  -1.766  14.433  1.00 0.00 ? 87  GLU A CB   4  
ATOM 8325  C CG   . GLU A 1 87  ? -7.304  -0.379  14.963  1.00 0.00 ? 87  GLU A CG   4  
ATOM 8326  C CD   . GLU A 1 87  ? -6.617  -0.426  16.295  1.00 0.00 ? 87  GLU A CD   4  
ATOM 8327  O OE1  . GLU A 1 87  ? -7.309  -0.537  17.333  1.00 0.00 ? 87  GLU A OE1  4  
ATOM 8328  O OE2  . GLU A 1 87  ? -5.370  -0.349  16.334  1.00 0.00 ? 87  GLU A OE2  4  
ATOM 8329  H H    . GLU A 1 87  ? -8.274  -3.914  13.184  1.00 0.00 ? 87  GLU A H    4  
ATOM 8330  H HA   . GLU A 1 87  ? -9.177  -1.177  13.078  1.00 0.00 ? 87  GLU A HA   4  
ATOM 8331  H HB2  . GLU A 1 87  ? -8.288  -2.249  15.137  1.00 0.00 ? 87  GLU A HB2  4  
ATOM 8332  H HB3  . GLU A 1 87  ? -6.709  -2.331  14.381  1.00 0.00 ? 87  GLU A HB3  4  
ATOM 8333  H HG2  . GLU A 1 87  ? -6.656  0.122   14.260  1.00 0.00 ? 87  GLU A HG2  4  
ATOM 8334  H HG3  . GLU A 1 87  ? -8.223  0.179   15.066  1.00 0.00 ? 87  GLU A HG3  4  
ATOM 8335  N N    . GLU A 1 88  ? -6.717  -2.086  11.193  1.00 0.00 ? 88  GLU A N    4  
ATOM 8336  C CA   . GLU A 1 88  ? -5.698  -1.681  10.225  1.00 0.00 ? 88  GLU A CA   4  
ATOM 8337  C C    . GLU A 1 88  ? -6.297  -1.109  8.945   1.00 0.00 ? 88  GLU A C    4  
ATOM 8338  O O    . GLU A 1 88  ? -5.615  -0.384  8.215   1.00 0.00 ? 88  GLU A O    4  
ATOM 8339  C CB   . GLU A 1 88  ? -4.742  -2.831  9.894   1.00 0.00 ? 88  GLU A CB   4  
ATOM 8340  C CG   . GLU A 1 88  ? -3.998  -3.378  11.099  1.00 0.00 ? 88  GLU A CG   4  
ATOM 8341  C CD   . GLU A 1 88  ? -2.985  -4.435  10.735  1.00 0.00 ? 88  GLU A CD   4  
ATOM 8342  O OE1  . GLU A 1 88  ? -3.368  -5.558  10.355  1.00 0.00 ? 88  GLU A OE1  4  
ATOM 8343  O OE2  . GLU A 1 88  ? -1.770  -4.165  10.825  1.00 0.00 ? 88  GLU A OE2  4  
ATOM 8344  H H    . GLU A 1 88  ? -6.977  -3.036  11.230  1.00 0.00 ? 88  GLU A H    4  
ATOM 8345  H HA   . GLU A 1 88  ? -5.127  -0.896  10.694  1.00 0.00 ? 88  GLU A HA   4  
ATOM 8346  H HB2  . GLU A 1 88  ? -5.309  -3.638  9.454   1.00 0.00 ? 88  GLU A HB2  4  
ATOM 8347  H HB3  . GLU A 1 88  ? -4.014  -2.482  9.175   1.00 0.00 ? 88  GLU A HB3  4  
ATOM 8348  H HG2  . GLU A 1 88  ? -3.481  -2.563  11.584  1.00 0.00 ? 88  GLU A HG2  4  
ATOM 8349  H HG3  . GLU A 1 88  ? -4.715  -3.798  11.788  1.00 0.00 ? 88  GLU A HG3  4  
ATOM 8350  N N    . LEU A 1 89  ? -7.554  -1.406  8.676   1.00 0.00 ? 89  LEU A N    4  
ATOM 8351  C CA   . LEU A 1 89  ? -8.199  -0.875  7.488   1.00 0.00 ? 89  LEU A CA   4  
ATOM 8352  C C    . LEU A 1 89  ? -9.409  -0.061  7.866   1.00 0.00 ? 89  LEU A C    4  
ATOM 8353  O O    . LEU A 1 89  ? -10.022 -0.287  8.912   1.00 0.00 ? 89  LEU A O    4  
ATOM 8354  C CB   . LEU A 1 89  ? -8.579  -1.957  6.433   1.00 0.00 ? 89  LEU A CB   4  
ATOM 8355  C CG   . LEU A 1 89  ? -9.702  -2.969  6.773   1.00 0.00 ? 89  LEU A CG   4  
ATOM 8356  C CD1  . LEU A 1 89  ? -10.094 -3.743  5.526   1.00 0.00 ? 89  LEU A CD1  4  
ATOM 8357  C CD2  . LEU A 1 89  ? -9.252  -3.954  7.842   1.00 0.00 ? 89  LEU A CD2  4  
ATOM 8358  H H    . LEU A 1 89  ? -8.072  -1.963  9.294   1.00 0.00 ? 89  LEU A H    4  
ATOM 8359  H HA   . LEU A 1 89  ? -7.493  -0.191  7.044   1.00 0.00 ? 89  LEU A HA   4  
ATOM 8360  H HB2  . LEU A 1 89  ? -8.877  -1.442  5.532   1.00 0.00 ? 89  LEU A HB2  4  
ATOM 8361  H HB3  . LEU A 1 89  ? -7.682  -2.518  6.210   1.00 0.00 ? 89  LEU A HB3  4  
ATOM 8362  H HG   . LEU A 1 89  ? -10.571 -2.438  7.131   1.00 0.00 ? 89  LEU A HG   4  
ATOM 8363  H HD11 . LEU A 1 89  ? -9.234  -4.275  5.146   1.00 0.00 ? 89  LEU A HD11 4  
ATOM 8364  H HD12 . LEU A 1 89  ? -10.457 -3.058  4.774   1.00 0.00 ? 89  LEU A HD12 4  
ATOM 8365  H HD13 . LEU A 1 89  ? -10.872 -4.450  5.774   1.00 0.00 ? 89  LEU A HD13 4  
ATOM 8366  H HD21 . LEU A 1 89  ? -9.067  -3.433  8.771   1.00 0.00 ? 89  LEU A HD21 4  
ATOM 8367  H HD22 . LEU A 1 89  ? -8.351  -4.450  7.516   1.00 0.00 ? 89  LEU A HD22 4  
ATOM 8368  H HD23 . LEU A 1 89  ? -10.022 -4.696  7.989   1.00 0.00 ? 89  LEU A HD23 4  
ATOM 8369  N N    . LYS A 1 90  ? -9.731  0.904   7.059   1.00 0.00 ? 90  LYS A N    4  
ATOM 8370  C CA   . LYS A 1 90  ? -10.873 1.720   7.295   1.00 0.00 ? 90  LYS A CA   4  
ATOM 8371  C C    . LYS A 1 90  ? -11.609 1.968   5.994   1.00 0.00 ? 90  LYS A C    4  
ATOM 8372  O O    . LYS A 1 90  ? -10.988 2.228   4.951   1.00 0.00 ? 90  LYS A O    4  
ATOM 8373  C CB   . LYS A 1 90  ? -10.465 3.037   7.962   1.00 0.00 ? 90  LYS A CB   4  
ATOM 8374  C CG   . LYS A 1 90  ? -11.635 3.875   8.471   1.00 0.00 ? 90  LYS A CG   4  
ATOM 8375  C CD   . LYS A 1 90  ? -12.558 3.126   9.470   1.00 0.00 ? 90  LYS A CD   4  
ATOM 8376  C CE   . LYS A 1 90  ? -11.916 2.799   10.839  1.00 0.00 ? 90  LYS A CE   4  
ATOM 8377  N NZ   . LYS A 1 90  ? -10.782 1.827   10.784  1.00 0.00 ? 90  LYS A NZ   4  
ATOM 8378  H H    . LYS A 1 90  ? -9.169  1.088   6.270   1.00 0.00 ? 90  LYS A H    4  
ATOM 8379  H HA   . LYS A 1 90  ? -11.519 1.175   7.967   1.00 0.00 ? 90  LYS A HA   4  
ATOM 8380  H HB2  . LYS A 1 90  ? -9.804  2.827   8.788   1.00 0.00 ? 90  LYS A HB2  4  
ATOM 8381  H HB3  . LYS A 1 90  ? -9.925  3.626   7.235   1.00 0.00 ? 90  LYS A HB3  4  
ATOM 8382  H HG2  . LYS A 1 90  ? -11.252 4.758   8.959   1.00 0.00 ? 90  LYS A HG2  4  
ATOM 8383  H HG3  . LYS A 1 90  ? -12.223 4.164   7.614   1.00 0.00 ? 90  LYS A HG3  4  
ATOM 8384  H HD2  . LYS A 1 90  ? -13.419 3.751   9.657   1.00 0.00 ? 90  LYS A HD2  4  
ATOM 8385  H HD3  . LYS A 1 90  ? -12.899 2.209   9.012   1.00 0.00 ? 90  LYS A HD3  4  
ATOM 8386  H HE2  . LYS A 1 90  ? -11.562 3.718   11.282  1.00 0.00 ? 90  LYS A HE2  4  
ATOM 8387  H HE3  . LYS A 1 90  ? -12.692 2.394   11.472  1.00 0.00 ? 90  LYS A HE3  4  
ATOM 8388  H HZ1  . LYS A 1 90  ? -11.036 0.950   10.282  1.00 0.00 ? 90  LYS A HZ1  4  
ATOM 8389  H HZ2  . LYS A 1 90  ? -10.520 1.571   11.757  1.00 0.00 ? 90  LYS A HZ2  4  
ATOM 8390  H HZ3  . LYS A 1 90  ? -9.932  2.246   10.356  1.00 0.00 ? 90  LYS A HZ3  4  
ATOM 8391  N N    . VAL A 1 91  ? -12.906 1.860   6.057   1.00 0.00 ? 91  VAL A N    4  
ATOM 8392  C CA   . VAL A 1 91  ? -13.774 2.055   4.929   1.00 0.00 ? 91  VAL A CA   4  
ATOM 8393  C C    . VAL A 1 91  ? -14.646 3.299   5.159   1.00 0.00 ? 91  VAL A C    4  
ATOM 8394  O O    . VAL A 1 91  ? -15.078 3.573   6.296   1.00 0.00 ? 91  VAL A O    4  
ATOM 8395  C CB   . VAL A 1 91  ? -14.656 0.781   4.681   1.00 0.00 ? 91  VAL A CB   4  
ATOM 8396  C CG1  . VAL A 1 91  ? -15.430 0.388   5.934   1.00 0.00 ? 91  VAL A CG1  4  
ATOM 8397  C CG2  . VAL A 1 91  ? -15.624 0.985   3.510   1.00 0.00 ? 91  VAL A CG2  4  
ATOM 8398  H H    . VAL A 1 91  ? -13.326 1.654   6.918   1.00 0.00 ? 91  VAL A H    4  
ATOM 8399  H HA   . VAL A 1 91  ? -13.153 2.226   4.061   1.00 0.00 ? 91  VAL A HA   4  
ATOM 8400  H HB   . VAL A 1 91  ? -13.994 -0.037  4.436   1.00 0.00 ? 91  VAL A HB   4  
ATOM 8401  H HG11 . VAL A 1 91  ? -16.070 1.205   6.230   1.00 0.00 ? 91  VAL A HG11 4  
ATOM 8402  H HG12 . VAL A 1 91  ? -14.737 0.169   6.733   1.00 0.00 ? 91  VAL A HG12 4  
ATOM 8403  H HG13 . VAL A 1 91  ? -16.033 -0.486  5.731   1.00 0.00 ? 91  VAL A HG13 4  
ATOM 8404  H HG21 . VAL A 1 91  ? -16.186 0.077   3.347   1.00 0.00 ? 91  VAL A HG21 4  
ATOM 8405  H HG22 . VAL A 1 91  ? -15.075 1.235   2.616   1.00 0.00 ? 91  VAL A HG22 4  
ATOM 8406  H HG23 . VAL A 1 91  ? -16.305 1.788   3.747   1.00 0.00 ? 91  VAL A HG23 4  
ATOM 8407  N N    . LYS A 1 92  ? -14.846 4.069   4.124   1.00 0.00 ? 92  LYS A N    4  
ATOM 8408  C CA   . LYS A 1 92  ? -15.674 5.245   4.190   1.00 0.00 ? 92  LYS A CA   4  
ATOM 8409  C C    . LYS A 1 92  ? -16.637 5.275   3.019   1.00 0.00 ? 92  LYS A C    4  
ATOM 8410  O O    . LYS A 1 92  ? -16.271 4.916   1.901   1.00 0.00 ? 92  LYS A O    4  
ATOM 8411  C CB   . LYS A 1 92  ? -14.835 6.537   4.212   1.00 0.00 ? 92  LYS A CB   4  
ATOM 8412  C CG   . LYS A 1 92  ? -13.895 6.721   3.018   1.00 0.00 ? 92  LYS A CG   4  
ATOM 8413  C CD   . LYS A 1 92  ? -13.274 8.138   2.925   1.00 0.00 ? 92  LYS A CD   4  
ATOM 8414  C CE   . LYS A 1 92  ? -12.351 8.521   4.101   1.00 0.00 ? 92  LYS A CE   4  
ATOM 8415  N NZ   . LYS A 1 92  ? -13.079 8.818   5.370   1.00 0.00 ? 92  LYS A NZ   4  
ATOM 8416  H H    . LYS A 1 92  ? -14.426 3.833   3.264   1.00 0.00 ? 92  LYS A H    4  
ATOM 8417  H HA   . LYS A 1 92  ? -16.246 5.188   5.104   1.00 0.00 ? 92  LYS A HA   4  
ATOM 8418  H HB2  . LYS A 1 92  ? -15.500 7.386   4.244   1.00 0.00 ? 92  LYS A HB2  4  
ATOM 8419  H HB3  . LYS A 1 92  ? -14.235 6.525   5.109   1.00 0.00 ? 92  LYS A HB3  4  
ATOM 8420  H HG2  . LYS A 1 92  ? -13.093 6.003   3.098   1.00 0.00 ? 92  LYS A HG2  4  
ATOM 8421  H HG3  . LYS A 1 92  ? -14.455 6.524   2.116   1.00 0.00 ? 92  LYS A HG3  4  
ATOM 8422  H HD2  . LYS A 1 92  ? -12.694 8.197   2.017   1.00 0.00 ? 92  LYS A HD2  4  
ATOM 8423  H HD3  . LYS A 1 92  ? -14.081 8.853   2.867   1.00 0.00 ? 92  LYS A HD3  4  
ATOM 8424  H HE2  . LYS A 1 92  ? -11.662 7.710   4.273   1.00 0.00 ? 92  LYS A HE2  4  
ATOM 8425  H HE3  . LYS A 1 92  ? -11.787 9.395   3.807   1.00 0.00 ? 92  LYS A HE3  4  
ATOM 8426  H HZ1  . LYS A 1 92  ? -12.404 9.035   6.130   1.00 0.00 ? 92  LYS A HZ1  4  
ATOM 8427  H HZ2  . LYS A 1 92  ? -13.672 8.033   5.704   1.00 0.00 ? 92  LYS A HZ2  4  
ATOM 8428  H HZ3  . LYS A 1 92  ? -13.698 9.647   5.273   1.00 0.00 ? 92  LYS A HZ3  4  
ATOM 8429  N N    . VAL A 1 93  ? -17.850 5.672   3.287   1.00 0.00 ? 93  VAL A N    4  
ATOM 8430  C CA   . VAL A 1 93  ? -18.863 5.819   2.273   1.00 0.00 ? 93  VAL A CA   4  
ATOM 8431  C C    . VAL A 1 93  ? -19.515 7.192   2.403   1.00 0.00 ? 93  VAL A C    4  
ATOM 8432  O O    . VAL A 1 93  ? -20.168 7.497   3.413   1.00 0.00 ? 93  VAL A O    4  
ATOM 8433  C CB   . VAL A 1 93  ? -19.919 4.648   2.304   1.00 0.00 ? 93  VAL A CB   4  
ATOM 8434  C CG1  . VAL A 1 93  ? -20.425 4.381   3.718   1.00 0.00 ? 93  VAL A CG1  4  
ATOM 8435  C CG2  . VAL A 1 93  ? -21.100 4.951   1.391   1.00 0.00 ? 93  VAL A CG2  4  
ATOM 8436  H H    . VAL A 1 93  ? -18.096 5.903   4.207   1.00 0.00 ? 93  VAL A H    4  
ATOM 8437  H HA   . VAL A 1 93  ? -18.344 5.801   1.324   1.00 0.00 ? 93  VAL A HA   4  
ATOM 8438  H HB   . VAL A 1 93  ? -19.437 3.750   1.949   1.00 0.00 ? 93  VAL A HB   4  
ATOM 8439  H HG11 . VAL A 1 93  ? -20.897 5.274   4.096   1.00 0.00 ? 93  VAL A HG11 4  
ATOM 8440  H HG12 . VAL A 1 93  ? -19.594 4.115   4.356   1.00 0.00 ? 93  VAL A HG12 4  
ATOM 8441  H HG13 . VAL A 1 93  ? -21.144 3.575   3.701   1.00 0.00 ? 93  VAL A HG13 4  
ATOM 8442  H HG21 . VAL A 1 93  ? -21.760 4.096   1.365   1.00 0.00 ? 93  VAL A HG21 4  
ATOM 8443  H HG22 . VAL A 1 93  ? -20.763 5.181   0.392   1.00 0.00 ? 93  VAL A HG22 4  
ATOM 8444  H HG23 . VAL A 1 93  ? -21.634 5.800   1.790   1.00 0.00 ? 93  VAL A HG23 4  
ATOM 8445  N N    . LEU A 1 94  ? -19.292 8.025   1.414   1.00 0.00 ? 94  LEU A N    4  
ATOM 8446  C CA   . LEU A 1 94  ? -19.823 9.369   1.401   1.00 0.00 ? 94  LEU A CA   4  
ATOM 8447  C C    . LEU A 1 94  ? -20.402 9.660   0.040   1.00 0.00 ? 94  LEU A C    4  
ATOM 8448  O O    . LEU A 1 94  ? -19.657 9.920   -0.923  1.00 0.00 ? 94  LEU A O    4  
ATOM 8449  C CB   . LEU A 1 94  ? -18.758 10.459  1.735   1.00 0.00 ? 94  LEU A CB   4  
ATOM 8450  C CG   . LEU A 1 94  ? -18.121 10.474  3.144   1.00 0.00 ? 94  LEU A CG   4  
ATOM 8451  C CD1  . LEU A 1 94  ? -17.072 9.387   3.312   1.00 0.00 ? 94  LEU A CD1  4  
ATOM 8452  C CD2  . LEU A 1 94  ? -17.527 11.840  3.442   1.00 0.00 ? 94  LEU A CD2  4  
ATOM 8453  H H    . LEU A 1 94  ? -18.776 7.718   0.633   1.00 0.00 ? 94  LEU A H    4  
ATOM 8454  H HA   . LEU A 1 94  ? -20.615 9.415   2.133   1.00 0.00 ? 94  LEU A HA   4  
ATOM 8455  H HB2  . LEU A 1 94  ? -17.953 10.356  1.023   1.00 0.00 ? 94  LEU A HB2  4  
ATOM 8456  H HB3  . LEU A 1 94  ? -19.222 11.420  1.566   1.00 0.00 ? 94  LEU A HB3  4  
ATOM 8457  H HG   . LEU A 1 94  ? -18.894 10.285  3.872   1.00 0.00 ? 94  LEU A HG   4  
ATOM 8458  H HD11 . LEU A 1 94  ? -16.290 9.522   2.578   1.00 0.00 ? 94  LEU A HD11 4  
ATOM 8459  H HD12 . LEU A 1 94  ? -17.530 8.419   3.175   1.00 0.00 ? 94  LEU A HD12 4  
ATOM 8460  H HD13 . LEU A 1 94  ? -16.648 9.450   4.302   1.00 0.00 ? 94  LEU A HD13 4  
ATOM 8461  H HD21 . LEU A 1 94  ? -16.781 12.078  2.699   1.00 0.00 ? 94  LEU A HD21 4  
ATOM 8462  H HD22 . LEU A 1 94  ? -17.072 11.828  4.421   1.00 0.00 ? 94  LEU A HD22 4  
ATOM 8463  H HD23 . LEU A 1 94  ? -18.310 12.584  3.419   1.00 0.00 ? 94  LEU A HD23 4  
ATOM 8464  N N    . GLY A 1 95  ? -21.702 9.592   -0.060  1.00 0.00 ? 95  GLY A N    4  
ATOM 8465  C CA   . GLY A 1 95  ? -22.356 9.898   -1.296  1.00 0.00 ? 95  GLY A CA   4  
ATOM 8466  C C    . GLY A 1 95  ? -22.112 8.868   -2.359  1.00 0.00 ? 95  GLY A C    4  
ATOM 8467  O O    . GLY A 1 95  ? -22.577 7.741   -2.271  1.00 0.00 ? 95  GLY A O    4  
ATOM 8468  H H    . GLY A 1 95  ? -22.234 9.329   0.721   1.00 0.00 ? 95  GLY A H    4  
ATOM 8469  H HA2  . GLY A 1 95  ? -23.418 9.978   -1.127  1.00 0.00 ? 95  GLY A HA2  4  
ATOM 8470  H HA3  . GLY A 1 95  ? -21.991 10.851  -1.650  1.00 0.00 ? 95  GLY A HA3  4  
ATOM 8471  N N    . ASP A 1 96  ? -21.387 9.283   -3.346  1.00 0.00 ? 96  ASP A N    4  
ATOM 8472  C CA   . ASP A 1 96  ? -21.058 8.495   -4.518  1.00 0.00 ? 96  ASP A CA   4  
ATOM 8473  C C    . ASP A 1 96  ? -19.729 7.790   -4.355  1.00 0.00 ? 96  ASP A C    4  
ATOM 8474  O O    . ASP A 1 96  ? -19.351 7.003   -5.192  1.00 0.00 ? 96  ASP A O    4  
ATOM 8475  C CB   . ASP A 1 96  ? -20.934 9.461   -5.713  1.00 0.00 ? 96  ASP A CB   4  
ATOM 8476  C CG   . ASP A 1 96  ? -19.886 10.541  -5.490  1.00 0.00 ? 96  ASP A CG   4  
ATOM 8477  O OD1  . ASP A 1 96  ? -20.151 11.474  -4.678  1.00 0.00 ? 96  ASP A OD1  4  
ATOM 8478  O OD2  . ASP A 1 96  ? -18.811 10.516  -6.110  1.00 0.00 ? 96  ASP A OD2  4  
ATOM 8479  H H    . ASP A 1 96  ? -21.025 10.194  -3.314  1.00 0.00 ? 96  ASP A H    4  
ATOM 8480  H HA   . ASP A 1 96  ? -21.850 7.796   -4.740  1.00 0.00 ? 96  ASP A HA   4  
ATOM 8481  H HB2  . ASP A 1 96  ? -20.677 8.917   -6.610  1.00 0.00 ? 96  ASP A HB2  4  
ATOM 8482  H HB3  . ASP A 1 96  ? -21.878 9.964   -5.854  1.00 0.00 ? 96  ASP A HB3  4  
ATOM 8483  N N    . VAL A 1 97  ? -19.018 8.056   -3.294  1.00 0.00 ? 97  VAL A N    4  
ATOM 8484  C CA   . VAL A 1 97  ? -17.718 7.447   -3.147  1.00 0.00 ? 97  VAL A CA   4  
ATOM 8485  C C    . VAL A 1 97  ? -17.690 6.507   -1.969  1.00 0.00 ? 97  VAL A C    4  
ATOM 8486  O O    . VAL A 1 97  ? -18.179 6.832   -0.873  1.00 0.00 ? 97  VAL A O    4  
ATOM 8487  C CB   . VAL A 1 97  ? -16.584 8.535   -3.023  1.00 0.00 ? 97  VAL A CB   4  
ATOM 8488  C CG1  . VAL A 1 97  ? -15.224 7.925   -2.700  1.00 0.00 ? 97  VAL A CG1  4  
ATOM 8489  C CG2  . VAL A 1 97  ? -16.471 9.317   -4.309  1.00 0.00 ? 97  VAL A CG2  4  
ATOM 8490  H H    . VAL A 1 97  ? -19.376 8.625   -2.580  1.00 0.00 ? 97  VAL A H    4  
ATOM 8491  H HA   . VAL A 1 97  ? -17.531 6.872   -4.042  1.00 0.00 ? 97  VAL A HA   4  
ATOM 8492  H HB   . VAL A 1 97  ? -16.849 9.226   -2.236  1.00 0.00 ? 97  VAL A HB   4  
ATOM 8493  H HG11 . VAL A 1 97  ? -15.285 7.409   -1.753  1.00 0.00 ? 97  VAL A HG11 4  
ATOM 8494  H HG12 . VAL A 1 97  ? -14.479 8.704   -2.641  1.00 0.00 ? 97  VAL A HG12 4  
ATOM 8495  H HG13 . VAL A 1 97  ? -14.953 7.223   -3.473  1.00 0.00 ? 97  VAL A HG13 4  
ATOM 8496  H HG21 . VAL A 1 97  ? -16.216 8.645   -5.116  1.00 0.00 ? 97  VAL A HG21 4  
ATOM 8497  H HG22 . VAL A 1 97  ? -15.698 10.063  -4.205  1.00 0.00 ? 97  VAL A HG22 4  
ATOM 8498  H HG23 . VAL A 1 97  ? -17.415 9.795   -4.525  1.00 0.00 ? 97  VAL A HG23 4  
ATOM 8499  N N    . ILE A 1 98  ? -17.105 5.361   -2.197  1.00 0.00 ? 98  ILE A N    4  
ATOM 8500  C CA   . ILE A 1 98  ? -16.881 4.386   -1.188  1.00 0.00 ? 98  ILE A CA   4  
ATOM 8501  C C    . ILE A 1 98  ? -15.421 3.973   -1.339  1.00 0.00 ? 98  ILE A C    4  
ATOM 8502  O O    . ILE A 1 98  ? -15.007 3.521   -2.416  1.00 0.00 ? 98  ILE A O    4  
ATOM 8503  C CB   . ILE A 1 98  ? -17.801 3.093   -1.315  1.00 0.00 ? 98  ILE A CB   4  
ATOM 8504  C CG1  . ILE A 1 98  ? -19.314 3.405   -1.372  1.00 0.00 ? 98  ILE A CG1  4  
ATOM 8505  C CG2  . ILE A 1 98  ? -17.546 2.181   -0.114  1.00 0.00 ? 98  ILE A CG2  4  
ATOM 8506  C CD1  . ILE A 1 98  ? -19.815 3.991   -2.672  1.00 0.00 ? 98  ILE A CD1  4  
ATOM 8507  H H    . ILE A 1 98  ? -16.804 5.143   -3.110  1.00 0.00 ? 98  ILE A H    4  
ATOM 8508  H HA   . ILE A 1 98  ? -17.022 4.853   -0.226  1.00 0.00 ? 98  ILE A HA   4  
ATOM 8509  H HB   . ILE A 1 98  ? -17.498 2.560   -2.204  1.00 0.00 ? 98  ILE A HB   4  
ATOM 8510  H HG12 . ILE A 1 98  ? -19.867 2.496   -1.192  1.00 0.00 ? 98  ILE A HG12 4  
ATOM 8511  H HG13 . ILE A 1 98  ? -19.528 4.107   -0.581  1.00 0.00 ? 98  ILE A HG13 4  
ATOM 8512  H HG21 . ILE A 1 98  ? -17.785 2.709   0.798   1.00 0.00 ? 98  ILE A HG21 4  
ATOM 8513  H HG22 . ILE A 1 98  ? -16.506 1.893   -0.097  1.00 0.00 ? 98  ILE A HG22 4  
ATOM 8514  H HG23 . ILE A 1 98  ? -18.164 1.298   -0.194  1.00 0.00 ? 98  ILE A HG23 4  
ATOM 8515  H HD11 . ILE A 1 98  ? -19.553 3.314   -3.471  1.00 0.00 ? 98  ILE A HD11 4  
ATOM 8516  H HD12 . ILE A 1 98  ? -19.333 4.942   -2.845  1.00 0.00 ? 98  ILE A HD12 4  
ATOM 8517  H HD13 . ILE A 1 98  ? -20.885 4.125   -2.633  1.00 0.00 ? 98  ILE A HD13 4  
ATOM 8518  N N    . GLU A 1 99  ? -14.639 4.166   -0.315  1.00 0.00 ? 99  GLU A N    4  
ATOM 8519  C CA   . GLU A 1 99  ? -13.229 3.839   -0.376  1.00 0.00 ? 99  GLU A CA   4  
ATOM 8520  C C    . GLU A 1 99  ? -12.786 3.079   0.831   1.00 0.00 ? 99  GLU A C    4  
ATOM 8521  O O    . GLU A 1 99  ? -13.302 3.285   1.941   1.00 0.00 ? 99  GLU A O    4  
ATOM 8522  C CB   . GLU A 1 99  ? -12.335 5.075   -0.542  1.00 0.00 ? 99  GLU A CB   4  
ATOM 8523  C CG   . GLU A 1 99  ? -12.482 5.784   -1.864  1.00 0.00 ? 99  GLU A CG   4  
ATOM 8524  C CD   . GLU A 1 99  ? -11.391 6.780   -2.106  1.00 0.00 ? 99  GLU A CD   4  
ATOM 8525  O OE1  . GLU A 1 99  ? -10.192 6.445   -1.908  1.00 0.00 ? 99  GLU A OE1  4  
ATOM 8526  O OE2  . GLU A 1 99  ? -11.682 7.893   -2.570  1.00 0.00 ? 99  GLU A OE2  4  
ATOM 8527  H H    . GLU A 1 99  ? -15.019 4.512   0.524   1.00 0.00 ? 99  GLU A H    4  
ATOM 8528  H HA   . GLU A 1 99  ? -13.089 3.207   -1.239  1.00 0.00 ? 99  GLU A HA   4  
ATOM 8529  H HB2  . GLU A 1 99  ? -12.570 5.777   0.243   1.00 0.00 ? 99  GLU A HB2  4  
ATOM 8530  H HB3  . GLU A 1 99  ? -11.304 4.771   -0.432  1.00 0.00 ? 99  GLU A HB3  4  
ATOM 8531  H HG2  . GLU A 1 99  ? -12.499 5.074   -2.673  1.00 0.00 ? 99  GLU A HG2  4  
ATOM 8532  H HG3  . GLU A 1 99  ? -13.424 6.314   -1.853  1.00 0.00 ? 99  GLU A HG3  4  
ATOM 8533  N N    . VAL A 1 100 ? -11.832 2.219   0.621   1.00 0.00 ? 100 VAL A N    4  
ATOM 8534  C CA   . VAL A 1 100 ? -11.258 1.431   1.668   1.00 0.00 ? 100 VAL A CA   4  
ATOM 8535  C C    . VAL A 1 100 ? -9.763  1.631   1.627   1.00 0.00 ? 100 VAL A C    4  
ATOM 8536  O O    . VAL A 1 100 ? -9.143  1.517   0.564   1.00 0.00 ? 100 VAL A O    4  
ATOM 8537  C CB   . VAL A 1 100 ? -11.540 -0.084  1.498   1.00 0.00 ? 100 VAL A CB   4  
ATOM 8538  C CG1  . VAL A 1 100 ? -11.011 -0.853  2.703   1.00 0.00 ? 100 VAL A CG1  4  
ATOM 8539  C CG2  . VAL A 1 100 ? -13.023 -0.358  1.289   1.00 0.00 ? 100 VAL A CG2  4  
ATOM 8540  H H    . VAL A 1 100 ? -11.471 2.128   -0.288  1.00 0.00 ? 100 VAL A H    4  
ATOM 8541  H HA   . VAL A 1 100 ? -11.648 1.766   2.617   1.00 0.00 ? 100 VAL A HA   4  
ATOM 8542  H HB   . VAL A 1 100 ? -10.996 -0.423  0.628   1.00 0.00 ? 100 VAL A HB   4  
ATOM 8543  H HG11 . VAL A 1 100 ? -11.533 -0.532  3.593   1.00 0.00 ? 100 VAL A HG11 4  
ATOM 8544  H HG12 . VAL A 1 100 ? -9.957  -0.646  2.820   1.00 0.00 ? 100 VAL A HG12 4  
ATOM 8545  H HG13 . VAL A 1 100 ? -11.152 -1.913  2.558   1.00 0.00 ? 100 VAL A HG13 4  
ATOM 8546  H HG21 . VAL A 1 100 ? -13.376 0.223   0.450   1.00 0.00 ? 100 VAL A HG21 4  
ATOM 8547  H HG22 . VAL A 1 100 ? -13.566 -0.067  2.175   1.00 0.00 ? 100 VAL A HG22 4  
ATOM 8548  H HG23 . VAL A 1 100 ? -13.183 -1.406  1.086   1.00 0.00 ? 100 VAL A HG23 4  
ATOM 8549  N N    . HIS A 1 101 ? -9.192  1.941   2.741   1.00 0.00 ? 101 HIS A N    4  
ATOM 8550  C CA   . HIS A 1 101 ? -7.767  2.108   2.832   1.00 0.00 ? 101 HIS A CA   4  
ATOM 8551  C C    . HIS A 1 101 ? -7.283  1.417   4.080   1.00 0.00 ? 101 HIS A C    4  
ATOM 8552  O O    . HIS A 1 101 ? -7.899  1.547   5.134   1.00 0.00 ? 101 HIS A O    4  
ATOM 8553  C CB   . HIS A 1 101 ? -7.349  3.604   2.814   1.00 0.00 ? 101 HIS A CB   4  
ATOM 8554  C CG   . HIS A 1 101 ? -7.829  4.425   3.985   1.00 0.00 ? 101 HIS A CG   4  
ATOM 8555  N ND1  . HIS A 1 101 ? -7.051  4.687   5.081   1.00 0.00 ? 101 HIS A ND1  4  
ATOM 8556  C CD2  . HIS A 1 101 ? -9.014  5.034   4.220   1.00 0.00 ? 101 HIS A CD2  4  
ATOM 8557  C CE1  . HIS A 1 101 ? -7.723  5.410   5.937   1.00 0.00 ? 101 HIS A CE1  4  
ATOM 8558  N NE2  . HIS A 1 101 ? -8.917  5.637   5.441   1.00 0.00 ? 101 HIS A NE2  4  
ATOM 8559  H H    . HIS A 1 101 ? -9.745  2.034   3.552   1.00 0.00 ? 101 HIS A H    4  
ATOM 8560  H HA   . HIS A 1 101 ? -7.332  1.606   1.980   1.00 0.00 ? 101 HIS A HA   4  
ATOM 8561  H HB2  . HIS A 1 101 ? -6.272  3.666   2.795   1.00 0.00 ? 101 HIS A HB2  4  
ATOM 8562  H HB3  . HIS A 1 101 ? -7.736  4.052   1.911   1.00 0.00 ? 101 HIS A HB3  4  
ATOM 8563  H HD1  . HIS A 1 101 ? -6.131  4.383   5.228   1.00 0.00 ? 101 HIS A HD1  4  
ATOM 8564  H HD2  . HIS A 1 101 ? -9.874  5.042   3.565   1.00 0.00 ? 101 HIS A HD2  4  
ATOM 8565  H HE1  . HIS A 1 101 ? -7.357  5.761   6.890   1.00 0.00 ? 101 HIS A HE1  4  
ATOM 8566  H HE2  . HIS A 1 101 ? -9.648  6.060   5.944   1.00 0.00 ? 101 HIS A HE2  4  
ATOM 8567  N N    . GLY A 1 102 ? -6.248  0.665   3.959   1.00 0.00 ? 102 GLY A N    4  
ATOM 8568  C CA   . GLY A 1 102 ? -5.710  -0.023  5.082   1.00 0.00 ? 102 GLY A CA   4  
ATOM 8569  C C    . GLY A 1 102 ? -4.232  -0.102  4.996   1.00 0.00 ? 102 GLY A C    4  
ATOM 8570  O O    . GLY A 1 102 ? -3.690  -0.188  3.904   1.00 0.00 ? 102 GLY A O    4  
ATOM 8571  H H    . GLY A 1 102 ? -5.817  0.559   3.080   1.00 0.00 ? 102 GLY A H    4  
ATOM 8572  H HA2  . GLY A 1 102 ? -5.971  0.522   5.976   1.00 0.00 ? 102 GLY A HA2  4  
ATOM 8573  H HA3  . GLY A 1 102 ? -6.117  -1.022  5.130   1.00 0.00 ? 102 GLY A HA3  4  
ATOM 8574  N N    . LYS A 1 103 ? -3.584  -0.070  6.112   1.00 0.00 ? 103 LYS A N    4  
ATOM 8575  C CA   . LYS A 1 103 ? -2.150  -0.109  6.159   1.00 0.00 ? 103 LYS A CA   4  
ATOM 8576  C C    . LYS A 1 103 ? -1.694  -1.145  7.185   1.00 0.00 ? 103 LYS A C    4  
ATOM 8577  O O    . LYS A 1 103 ? -2.225  -1.211  8.299   1.00 0.00 ? 103 LYS A O    4  
ATOM 8578  C CB   . LYS A 1 103 ? -1.563  1.275   6.527   1.00 0.00 ? 103 LYS A CB   4  
ATOM 8579  C CG   . LYS A 1 103 ? -2.106  1.854   7.835   1.00 0.00 ? 103 LYS A CG   4  
ATOM 8580  C CD   . LYS A 1 103 ? -1.316  3.060   8.379   1.00 0.00 ? 103 LYS A CD   4  
ATOM 8581  C CE   . LYS A 1 103 ? -1.352  4.320   7.504   1.00 0.00 ? 103 LYS A CE   4  
ATOM 8582  N NZ   . LYS A 1 103 ? -0.512  4.247   6.291   1.00 0.00 ? 103 LYS A NZ   4  
ATOM 8583  H H    . LYS A 1 103 ? -4.079  -0.044  6.961   1.00 0.00 ? 103 LYS A H    4  
ATOM 8584  H HA   . LYS A 1 103 ? -1.789  -0.394  5.183   1.00 0.00 ? 103 LYS A HA   4  
ATOM 8585  H HB2  . LYS A 1 103 ? -0.491  1.179   6.620   1.00 0.00 ? 103 LYS A HB2  4  
ATOM 8586  H HB3  . LYS A 1 103 ? -1.784  1.970   5.730   1.00 0.00 ? 103 LYS A HB3  4  
ATOM 8587  H HG2  . LYS A 1 103 ? -3.129  2.161   7.681   1.00 0.00 ? 103 LYS A HG2  4  
ATOM 8588  H HG3  . LYS A 1 103 ? -2.091  1.064   8.571   1.00 0.00 ? 103 LYS A HG3  4  
ATOM 8589  H HD2  . LYS A 1 103 ? -1.724  3.319   9.344   1.00 0.00 ? 103 LYS A HD2  4  
ATOM 8590  H HD3  . LYS A 1 103 ? -0.288  2.755   8.512   1.00 0.00 ? 103 LYS A HD3  4  
ATOM 8591  H HE2  . LYS A 1 103 ? -2.370  4.492   7.195   1.00 0.00 ? 103 LYS A HE2  4  
ATOM 8592  H HE3  . LYS A 1 103 ? -1.029  5.157   8.106   1.00 0.00 ? 103 LYS A HE3  4  
ATOM 8593  H HZ1  . LYS A 1 103 ? 0.461   3.950   6.501   1.00 0.00 ? 103 LYS A HZ1  4  
ATOM 8594  H HZ2  . LYS A 1 103 ? -0.453  5.196   5.871   1.00 0.00 ? 103 LYS A HZ2  4  
ATOM 8595  H HZ3  . LYS A 1 103 ? -0.911  3.654   5.529   1.00 0.00 ? 103 LYS A HZ3  4  
ATOM 8596  N N    . HIS A 1 104 ? -0.740  -1.943  6.813   1.00 0.00 ? 104 HIS A N    4  
ATOM 8597  C CA   . HIS A 1 104 ? -0.196  -2.950  7.689   1.00 0.00 ? 104 HIS A CA   4  
ATOM 8598  C C    . HIS A 1 104 ? 1.308   -2.851  7.682   1.00 0.00 ? 104 HIS A C    4  
ATOM 8599  O O    . HIS A 1 104 ? 1.911   -2.734  6.622   1.00 0.00 ? 104 HIS A O    4  
ATOM 8600  C CB   . HIS A 1 104 ? -0.645  -4.367  7.242   1.00 0.00 ? 104 HIS A CB   4  
ATOM 8601  C CG   . HIS A 1 104 ? -0.031  -5.506  8.026   1.00 0.00 ? 104 HIS A CG   4  
ATOM 8602  N ND1  . HIS A 1 104 ? -0.286  -5.720  9.350   1.00 0.00 ? 104 HIS A ND1  4  
ATOM 8603  C CD2  . HIS A 1 104 ? 0.852   -6.466  7.659   1.00 0.00 ? 104 HIS A CD2  4  
ATOM 8604  C CE1  . HIS A 1 104 ? 0.405   -6.747  9.773   1.00 0.00 ? 104 HIS A CE1  4  
ATOM 8605  N NE2  . HIS A 1 104 ? 1.104   -7.224  8.768   1.00 0.00 ? 104 HIS A NE2  4  
ATOM 8606  H H    . HIS A 1 104 ? -0.365  -1.864  5.906   1.00 0.00 ? 104 HIS A H    4  
ATOM 8607  H HA   . HIS A 1 104 ? -0.568  -2.765  8.685   1.00 0.00 ? 104 HIS A HA   4  
ATOM 8608  H HB2  . HIS A 1 104 ? -1.718  -4.442  7.343   1.00 0.00 ? 104 HIS A HB2  4  
ATOM 8609  H HB3  . HIS A 1 104 ? -0.387  -4.501  6.201   1.00 0.00 ? 104 HIS A HB3  4  
ATOM 8610  H HD1  . HIS A 1 104 ? -0.902  -5.185  9.916   1.00 0.00 ? 104 HIS A HD1  4  
ATOM 8611  H HD2  . HIS A 1 104 ? 1.276   -6.606  6.674   1.00 0.00 ? 104 HIS A HD2  4  
ATOM 8612  H HE1  . HIS A 1 104 ? 0.405   -7.134  10.782  1.00 0.00 ? 104 HIS A HE1  4  
ATOM 8613  H HE2  . HIS A 1 104 ? 1.899   -7.788  8.895   1.00 0.00 ? 104 HIS A HE2  4  
ATOM 8614  N N    . GLU A 1 105 ? 1.911   -2.831  8.831   1.00 0.00 ? 105 GLU A N    4  
ATOM 8615  C CA   . GLU A 1 105 ? 3.339   -2.893  8.875   1.00 0.00 ? 105 GLU A CA   4  
ATOM 8616  C C    . GLU A 1 105 ? 3.735   -4.359  8.877   1.00 0.00 ? 105 GLU A C    4  
ATOM 8617  O O    . GLU A 1 105 ? 3.285   -5.156  9.701   1.00 0.00 ? 105 GLU A O    4  
ATOM 8618  C CB   . GLU A 1 105 ? 3.905   -2.076  10.051  1.00 0.00 ? 105 GLU A CB   4  
ATOM 8619  C CG   . GLU A 1 105 ? 3.434   -2.472  11.433  1.00 0.00 ? 105 GLU A CG   4  
ATOM 8620  C CD   . GLU A 1 105 ? 3.730   -1.392  12.440  1.00 0.00 ? 105 GLU A CD   4  
ATOM 8621  O OE1  . GLU A 1 105 ? 4.857   -1.297  12.941  1.00 0.00 ? 105 GLU A OE1  4  
ATOM 8622  O OE2  . GLU A 1 105 ? 2.819   -0.591  12.741  1.00 0.00 ? 105 GLU A OE2  4  
ATOM 8623  H H    . GLU A 1 105 ? 1.403   -2.777  9.670   1.00 0.00 ? 105 GLU A H    4  
ATOM 8624  H HA   . GLU A 1 105 ? 3.673   -2.470  7.940   1.00 0.00 ? 105 GLU A HA   4  
ATOM 8625  H HB2  . GLU A 1 105 ? 4.981   -2.163  10.041  1.00 0.00 ? 105 GLU A HB2  4  
ATOM 8626  H HB3  . GLU A 1 105 ? 3.652   -1.039  9.893   1.00 0.00 ? 105 GLU A HB3  4  
ATOM 8627  H HG2  . GLU A 1 105 ? 2.370   -2.653  11.410  1.00 0.00 ? 105 GLU A HG2  4  
ATOM 8628  H HG3  . GLU A 1 105 ? 3.945   -3.375  11.734  1.00 0.00 ? 105 GLU A HG3  4  
ATOM 8629  N N    . GLU A 1 106 ? 4.496   -4.681  7.863   1.00 0.00 ? 106 GLU A N    4  
ATOM 8630  C CA   . GLU A 1 106 ? 4.897   -6.013  7.541   1.00 0.00 ? 106 GLU A CA   4  
ATOM 8631  C C    . GLU A 1 106 ? 5.829   -6.550  8.600   1.00 0.00 ? 106 GLU A C    4  
ATOM 8632  O O    . GLU A 1 106 ? 5.471   -7.418  9.369   1.00 0.00 ? 106 GLU A O    4  
ATOM 8633  C CB   . GLU A 1 106 ? 5.595   -6.007  6.171   1.00 0.00 ? 106 GLU A CB   4  
ATOM 8634  C CG   . GLU A 1 106 ? 4.709   -5.676  4.969   1.00 0.00 ? 106 GLU A CG   4  
ATOM 8635  C CD   . GLU A 1 106 ? 3.680   -6.753  4.660   1.00 0.00 ? 106 GLU A CD   4  
ATOM 8636  O OE1  . GLU A 1 106 ? 4.049   -7.805  4.064   1.00 0.00 ? 106 GLU A OE1  4  
ATOM 8637  O OE2  . GLU A 1 106 ? 2.498   -6.568  4.987   1.00 0.00 ? 106 GLU A OE2  4  
ATOM 8638  H H    . GLU A 1 106 ? 4.842   -3.949  7.309   1.00 0.00 ? 106 GLU A H    4  
ATOM 8639  H HA   . GLU A 1 106 ? 4.018   -6.636  7.469   1.00 0.00 ? 106 GLU A HA   4  
ATOM 8640  H HB2  . GLU A 1 106 ? 6.388   -5.277  6.197   1.00 0.00 ? 106 GLU A HB2  4  
ATOM 8641  H HB3  . GLU A 1 106 ? 6.033   -6.981  6.010   1.00 0.00 ? 106 GLU A HB3  4  
ATOM 8642  H HG2  . GLU A 1 106 ? 4.182   -4.755  5.174   1.00 0.00 ? 106 GLU A HG2  4  
ATOM 8643  H HG3  . GLU A 1 106 ? 5.337   -5.534  4.102   1.00 0.00 ? 106 GLU A HG3  4  
ATOM 8644  N N    . ARG A 1 107 ? 7.013   -6.019  8.626   1.00 0.00 ? 107 ARG A N    4  
ATOM 8645  C CA   . ARG A 1 107 ? 8.044   -6.386  9.562   1.00 0.00 ? 107 ARG A CA   4  
ATOM 8646  C C    . ARG A 1 107 ? 8.805   -5.132  9.899   1.00 0.00 ? 107 ARG A C    4  
ATOM 8647  O O    . ARG A 1 107 ? 8.760   -4.164  9.138   1.00 0.00 ? 107 ARG A O    4  
ATOM 8648  C CB   . ARG A 1 107 ? 9.019   -7.469  9.012   1.00 0.00 ? 107 ARG A CB   4  
ATOM 8649  C CG   . ARG A 1 107 ? 8.520   -8.925  9.007   1.00 0.00 ? 107 ARG A CG   4  
ATOM 8650  C CD   . ARG A 1 107 ? 7.508   -9.249  7.922   1.00 0.00 ? 107 ARG A CD   4  
ATOM 8651  N NE   . ARG A 1 107 ? 8.028   -9.025  6.568   1.00 0.00 ? 107 ARG A NE   4  
ATOM 8652  C CZ   . ARG A 1 107 ? 7.256   -8.878  5.485   1.00 0.00 ? 107 ARG A CZ   4  
ATOM 8653  N NH1  . ARG A 1 107 ? 5.936   -9.048  5.579   1.00 0.00 ? 107 ARG A NH1  4  
ATOM 8654  N NH2  . ARG A 1 107 ? 7.803   -8.607  4.306   1.00 0.00 ? 107 ARG A NH2  4  
ATOM 8655  H H    . ARG A 1 107 ? 7.230   -5.291  8.006   1.00 0.00 ? 107 ARG A H    4  
ATOM 8656  H HA   . ARG A 1 107 ? 7.558   -6.748  10.456  1.00 0.00 ? 107 ARG A HA   4  
ATOM 8657  H HB2  . ARG A 1 107 ? 9.234   -7.234  7.982   1.00 0.00 ? 107 ARG A HB2  4  
ATOM 8658  H HB3  . ARG A 1 107 ? 9.938   -7.428  9.578   1.00 0.00 ? 107 ARG A HB3  4  
ATOM 8659  H HG2  . ARG A 1 107 ? 9.368   -9.579  8.873   1.00 0.00 ? 107 ARG A HG2  4  
ATOM 8660  H HG3  . ARG A 1 107 ? 8.075   -9.124  9.971   1.00 0.00 ? 107 ARG A HG3  4  
ATOM 8661  H HD2  . ARG A 1 107 ? 7.218   -10.285 8.012   1.00 0.00 ? 107 ARG A HD2  4  
ATOM 8662  H HD3  . ARG A 1 107 ? 6.640   -8.623  8.068   1.00 0.00 ? 107 ARG A HD3  4  
ATOM 8663  H HE   . ARG A 1 107 ? 9.010   -8.962  6.504   1.00 0.00 ? 107 ARG A HE   4  
ATOM 8664  H HH11 . ARG A 1 107 ? 5.487   -9.307  6.441   1.00 0.00 ? 107 ARG A HH11 4  
ATOM 8665  H HH12 . ARG A 1 107 ? 5.292   -8.863  4.824   1.00 0.00 ? 107 ARG A HH12 4  
ATOM 8666  H HH21 . ARG A 1 107 ? 8.803   -8.510  4.179   1.00 0.00 ? 107 ARG A HH21 4  
ATOM 8667  H HH22 . ARG A 1 107 ? 7.256   -8.501  3.476   1.00 0.00 ? 107 ARG A HH22 4  
ATOM 8668  N N    . GLN A 1 108 ? 9.419   -5.092  11.038  1.00 0.00 ? 108 GLN A N    4  
ATOM 8669  C CA   . GLN A 1 108 ? 10.173  -3.927  11.428  1.00 0.00 ? 108 GLN A CA   4  
ATOM 8670  C C    . GLN A 1 108 ? 11.658  -4.258  11.445  1.00 0.00 ? 108 GLN A C    4  
ATOM 8671  O O    . GLN A 1 108 ? 12.069  -5.255  12.056  1.00 0.00 ? 108 GLN A O    4  
ATOM 8672  C CB   . GLN A 1 108 ? 9.704   -3.427  12.795  1.00 0.00 ? 108 GLN A CB   4  
ATOM 8673  C CG   . GLN A 1 108 ? 8.209   -3.112  12.847  1.00 0.00 ? 108 GLN A CG   4  
ATOM 8674  C CD   . GLN A 1 108 ? 7.762   -2.625  14.204  1.00 0.00 ? 108 GLN A CD   4  
ATOM 8675  O OE1  . GLN A 1 108 ? 7.394   -3.418  15.073  1.00 0.00 ? 108 GLN A OE1  4  
ATOM 8676  N NE2  . GLN A 1 108 ? 7.760   -1.335  14.394  1.00 0.00 ? 108 GLN A NE2  4  
ATOM 8677  H H    . GLN A 1 108 ? 9.396   -5.868  11.638  1.00 0.00 ? 108 GLN A H    4  
ATOM 8678  H HA   . GLN A 1 108 ? 9.996   -3.158  10.691  1.00 0.00 ? 108 GLN A HA   4  
ATOM 8679  H HB2  . GLN A 1 108 ? 9.917   -4.186  13.533  1.00 0.00 ? 108 GLN A HB2  4  
ATOM 8680  H HB3  . GLN A 1 108 ? 10.247  -2.529  13.046  1.00 0.00 ? 108 GLN A HB3  4  
ATOM 8681  H HG2  . GLN A 1 108 ? 7.988   -2.345  12.119  1.00 0.00 ? 108 GLN A HG2  4  
ATOM 8682  H HG3  . GLN A 1 108 ? 7.661   -4.009  12.600  1.00 0.00 ? 108 GLN A HG3  4  
ATOM 8683  H HE21 . GLN A 1 108 ? 8.036   -0.753  13.656  1.00 0.00 ? 108 GLN A HE21 4  
ATOM 8684  H HE22 . GLN A 1 108 ? 7.476   -0.985  15.264  1.00 0.00 ? 108 GLN A HE22 4  
ATOM 8685  N N    . ASP A 1 109 ? 12.445  -3.443  10.776  1.00 0.00 ? 109 ASP A N    4  
ATOM 8686  C CA   . ASP A 1 109 ? 13.896  -3.611  10.708  1.00 0.00 ? 109 ASP A CA   4  
ATOM 8687  C C    . ASP A 1 109 ? 14.546  -2.779  11.791  1.00 0.00 ? 109 ASP A C    4  
ATOM 8688  O O    . ASP A 1 109 ? 13.873  -2.254  12.689  1.00 0.00 ? 109 ASP A O    4  
ATOM 8689  C CB   . ASP A 1 109 ? 14.502  -3.112  9.368   1.00 0.00 ? 109 ASP A CB   4  
ATOM 8690  C CG   . ASP A 1 109 ? 14.132  -3.857  8.125   1.00 0.00 ? 109 ASP A CG   4  
ATOM 8691  O OD1  . ASP A 1 109 ? 14.370  -5.080  8.057   1.00 0.00 ? 109 ASP A OD1  4  
ATOM 8692  O OD2  . ASP A 1 109 ? 13.734  -3.206  7.130   1.00 0.00 ? 109 ASP A OD2  4  
ATOM 8693  H H    . ASP A 1 109 ? 12.068  -2.652  10.329  1.00 0.00 ? 109 ASP A H    4  
ATOM 8694  H HA   . ASP A 1 109 ? 14.141  -4.655  10.840  1.00 0.00 ? 109 ASP A HA   4  
ATOM 8695  H HB2  . ASP A 1 109 ? 14.187  -2.091  9.222   1.00 0.00 ? 109 ASP A HB2  4  
ATOM 8696  H HB3  . ASP A 1 109 ? 15.577  -3.114  9.454   1.00 0.00 ? 109 ASP A HB3  4  
ATOM 8697  N N    . GLU A 1 110 ? 15.849  -2.660  11.682  1.00 0.00 ? 110 GLU A N    4  
ATOM 8698  C CA   . GLU A 1 110 ? 16.684  -1.858  12.550  1.00 0.00 ? 110 GLU A CA   4  
ATOM 8699  C C    . GLU A 1 110 ? 16.208  -0.410  12.520  1.00 0.00 ? 110 GLU A C    4  
ATOM 8700  O O    . GLU A 1 110 ? 15.668  0.114   13.493  1.00 0.00 ? 110 GLU A O    4  
ATOM 8701  C CB   . GLU A 1 110 ? 18.139  -1.855  12.050  1.00 0.00 ? 110 GLU A CB   4  
ATOM 8702  C CG   . GLU A 1 110 ? 18.783  -3.212  11.743  1.00 0.00 ? 110 GLU A CG   4  
ATOM 8703  C CD   . GLU A 1 110 ? 18.217  -3.877  10.509  1.00 0.00 ? 110 GLU A CD   4  
ATOM 8704  O OE1  . GLU A 1 110 ? 18.479  -3.404  9.392   1.00 0.00 ? 110 GLU A OE1  4  
ATOM 8705  O OE2  . GLU A 1 110 ? 17.471  -4.863  10.646  1.00 0.00 ? 110 GLU A OE2  4  
ATOM 8706  H H    . GLU A 1 110 ? 16.287  -3.191  10.982  1.00 0.00 ? 110 GLU A H    4  
ATOM 8707  H HA   . GLU A 1 110 ? 16.658  -2.252  13.554  1.00 0.00 ? 110 GLU A HA   4  
ATOM 8708  H HB2  . GLU A 1 110 ? 18.196  -1.264  11.149  1.00 0.00 ? 110 GLU A HB2  4  
ATOM 8709  H HB3  . GLU A 1 110 ? 18.737  -1.366  12.804  1.00 0.00 ? 110 GLU A HB3  4  
ATOM 8710  H HG2  . GLU A 1 110 ? 19.844  -3.073  11.598  1.00 0.00 ? 110 GLU A HG2  4  
ATOM 8711  H HG3  . GLU A 1 110 ? 18.624  -3.862  12.589  1.00 0.00 ? 110 GLU A HG3  4  
ATOM 8712  N N    . HIS A 1 111 ? 16.409  0.215   11.374  1.00 0.00 ? 111 HIS A N    4  
ATOM 8713  C CA   . HIS A 1 111 ? 16.034  1.605   11.137  1.00 0.00 ? 111 HIS A CA   4  
ATOM 8714  C C    . HIS A 1 111 ? 15.108  1.631   9.979   1.00 0.00 ? 111 HIS A C    4  
ATOM 8715  O O    . HIS A 1 111 ? 14.870  2.674   9.358   1.00 0.00 ? 111 HIS A O    4  
ATOM 8716  C CB   . HIS A 1 111 ? 17.264  2.465   10.781  1.00 0.00 ? 111 HIS A CB   4  
ATOM 8717  C CG   . HIS A 1 111 ? 18.315  2.618   11.845  1.00 0.00 ? 111 HIS A CG   4  
ATOM 8718  N ND1  . HIS A 1 111 ? 18.531  3.790   12.524  1.00 0.00 ? 111 HIS A ND1  4  
ATOM 8719  C CD2  . HIS A 1 111 ? 19.247  1.755   12.302  1.00 0.00 ? 111 HIS A CD2  4  
ATOM 8720  C CE1  . HIS A 1 111 ? 19.544  3.643   13.347  1.00 0.00 ? 111 HIS A CE1  4  
ATOM 8721  N NE2  . HIS A 1 111 ? 19.997  2.419   13.232  1.00 0.00 ? 111 HIS A NE2  4  
ATOM 8722  H H    . HIS A 1 111 ? 16.812  -0.281  10.625  1.00 0.00 ? 111 HIS A H    4  
ATOM 8723  H HA   . HIS A 1 111 ? 15.556  2.005   12.019  1.00 0.00 ? 111 HIS A HA   4  
ATOM 8724  H HB2  . HIS A 1 111 ? 17.748  2.024   9.924   1.00 0.00 ? 111 HIS A HB2  4  
ATOM 8725  H HB3  . HIS A 1 111 ? 16.922  3.453   10.505  1.00 0.00 ? 111 HIS A HB3  4  
ATOM 8726  H HD1  . HIS A 1 111 ? 18.030  4.627   12.404  1.00 0.00 ? 111 HIS A HD1  4  
ATOM 8727  H HD2  . HIS A 1 111 ? 19.377  0.730   11.986  1.00 0.00 ? 111 HIS A HD2  4  
ATOM 8728  H HE1  . HIS A 1 111 ? 19.934  4.401   14.012  1.00 0.00 ? 111 HIS A HE1  4  
ATOM 8729  H HE2  . HIS A 1 111 ? 20.930  2.182   13.434  1.00 0.00 ? 111 HIS A HE2  4  
ATOM 8730  N N    . GLY A 1 112 ? 14.629  0.478   9.670   1.00 0.00 ? 112 GLY A N    4  
ATOM 8731  C CA   . GLY A 1 112 ? 13.764  0.318   8.601   1.00 0.00 ? 112 GLY A CA   4  
ATOM 8732  C C    . GLY A 1 112 ? 12.447  -0.122  9.071   1.00 0.00 ? 112 GLY A C    4  
ATOM 8733  O O    . GLY A 1 112 ? 12.333  -0.853  10.039  1.00 0.00 ? 112 GLY A O    4  
ATOM 8734  H H    . GLY A 1 112 ? 14.858  -0.303  10.212  1.00 0.00 ? 112 GLY A H    4  
ATOM 8735  H HA2  . GLY A 1 112 ? 13.663  1.264   8.089   1.00 0.00 ? 112 GLY A HA2  4  
ATOM 8736  H HA3  . GLY A 1 112 ? 14.161  -0.422  7.921   1.00 0.00 ? 112 GLY A HA3  4  
ATOM 8737  N N    . PHE A 1 113 ? 11.466  0.369   8.457   1.00 0.00 ? 113 PHE A N    4  
ATOM 8738  C CA   . PHE A 1 113 ? 10.139  -0.010  8.729   1.00 0.00 ? 113 PHE A CA   4  
ATOM 8739  C C    . PHE A 1 113 ? 9.564   -0.484  7.424   1.00 0.00 ? 113 PHE A C    4  
ATOM 8740  O O    . PHE A 1 113 ? 9.836   0.121   6.377   1.00 0.00 ? 113 PHE A O    4  
ATOM 8741  C CB   . PHE A 1 113 ? 9.324   1.178   9.264   1.00 0.00 ? 113 PHE A CB   4  
ATOM 8742  C CG   . PHE A 1 113 ? 9.860   1.765   10.541  1.00 0.00 ? 113 PHE A CG   4  
ATOM 8743  C CD1  . PHE A 1 113 ? 9.543   1.198   11.764  1.00 0.00 ? 113 PHE A CD1  4  
ATOM 8744  C CD2  . PHE A 1 113 ? 10.687  2.878   10.516  1.00 0.00 ? 113 PHE A CD2  4  
ATOM 8745  C CE1  . PHE A 1 113 ? 10.037  1.730   12.936  1.00 0.00 ? 113 PHE A CE1  4  
ATOM 8746  C CE2  . PHE A 1 113 ? 11.184  3.414   11.684  1.00 0.00 ? 113 PHE A CE2  4  
ATOM 8747  C CZ   . PHE A 1 113 ? 10.858  2.838   12.897  1.00 0.00 ? 113 PHE A CZ   4  
ATOM 8748  H H    . PHE A 1 113 ? 11.635  1.038   7.754   1.00 0.00 ? 113 PHE A H    4  
ATOM 8749  H HA   . PHE A 1 113 ? 10.140  -0.814  9.451   1.00 0.00 ? 113 PHE A HA   4  
ATOM 8750  H HB2  . PHE A 1 113 ? 9.316   1.960   8.521   1.00 0.00 ? 113 PHE A HB2  4  
ATOM 8751  H HB3  . PHE A 1 113 ? 8.309   0.853   9.443   1.00 0.00 ? 113 PHE A HB3  4  
ATOM 8752  H HD1  . PHE A 1 113 ? 8.901   0.331   11.795  1.00 0.00 ? 113 PHE A HD1  4  
ATOM 8753  H HD2  . PHE A 1 113 ? 10.940  3.330   9.567   1.00 0.00 ? 113 PHE A HD2  4  
ATOM 8754  H HE1  . PHE A 1 113 ? 9.781   1.278   13.884  1.00 0.00 ? 113 PHE A HE1  4  
ATOM 8755  H HE2  . PHE A 1 113 ? 11.826  4.280   11.653  1.00 0.00 ? 113 PHE A HE2  4  
ATOM 8756  H HZ   . PHE A 1 113 ? 11.246  3.254   13.815  1.00 0.00 ? 113 PHE A HZ   4  
ATOM 8757  N N    . ILE A 1 114 ? 8.795   -1.537  7.437   1.00 0.00 ? 114 ILE A N    4  
ATOM 8758  C CA   . ILE A 1 114 ? 8.263   -2.042  6.201   1.00 0.00 ? 114 ILE A CA   4  
ATOM 8759  C C    . ILE A 1 114 ? 6.772   -2.070  6.361   1.00 0.00 ? 114 ILE A C    4  
ATOM 8760  O O    . ILE A 1 114 ? 6.268   -2.565  7.365   1.00 0.00 ? 114 ILE A O    4  
ATOM 8761  C CB   . ILE A 1 114 ? 8.724   -3.511  5.971   1.00 0.00 ? 114 ILE A CB   4  
ATOM 8762  C CG1  . ILE A 1 114 ? 10.175  -3.713  6.406   1.00 0.00 ? 114 ILE A CG1  4  
ATOM 8763  C CG2  . ILE A 1 114 ? 8.584   -3.879  4.496   1.00 0.00 ? 114 ILE A CG2  4  
ATOM 8764  C CD1  . ILE A 1 114 ? 10.557  -5.162  6.535   1.00 0.00 ? 114 ILE A CD1  4  
ATOM 8765  H H    . ILE A 1 114 ? 8.564   -1.997  8.274   1.00 0.00 ? 114 ILE A H    4  
ATOM 8766  H HA   . ILE A 1 114 ? 8.568   -1.428  5.367   1.00 0.00 ? 114 ILE A HA   4  
ATOM 8767  H HB   . ILE A 1 114 ? 8.086   -4.160  6.552   1.00 0.00 ? 114 ILE A HB   4  
ATOM 8768  H HG12 . ILE A 1 114 ? 10.837  -3.267  5.679   1.00 0.00 ? 114 ILE A HG12 4  
ATOM 8769  H HG13 . ILE A 1 114 ? 10.326  -3.240  7.366   1.00 0.00 ? 114 ILE A HG13 4  
ATOM 8770  H HG21 . ILE A 1 114 ? 7.549   -3.781  4.198   1.00 0.00 ? 114 ILE A HG21 4  
ATOM 8771  H HG22 . ILE A 1 114 ? 8.906   -4.899  4.349   1.00 0.00 ? 114 ILE A HG22 4  
ATOM 8772  H HG23 . ILE A 1 114 ? 9.194   -3.218  3.900   1.00 0.00 ? 114 ILE A HG23 4  
ATOM 8773  H HD11 . ILE A 1 114 ? 10.387  -5.670  5.598   1.00 0.00 ? 114 ILE A HD11 4  
ATOM 8774  H HD12 . ILE A 1 114 ? 9.946   -5.605  7.304   1.00 0.00 ? 114 ILE A HD12 4  
ATOM 8775  H HD13 . ILE A 1 114 ? 11.601  -5.236  6.807   1.00 0.00 ? 114 ILE A HD13 4  
ATOM 8776  N N    . SER A 1 115 ? 6.066   -1.559  5.400   1.00 0.00 ? 115 SER A N    4  
ATOM 8777  C CA   . SER A 1 115 ? 4.647   -1.537  5.448   1.00 0.00 ? 115 SER A CA   4  
ATOM 8778  C C    . SER A 1 115 ? 4.059   -1.920  4.092   1.00 0.00 ? 115 SER A C    4  
ATOM 8779  O O    . SER A 1 115 ? 4.725   -1.814  3.053   1.00 0.00 ? 115 SER A O    4  
ATOM 8780  C CB   . SER A 1 115 ? 4.166   -0.143  5.900   1.00 0.00 ? 115 SER A CB   4  
ATOM 8781  O OG   . SER A 1 115 ? 2.763   -0.107  6.132   1.00 0.00 ? 115 SER A OG   4  
ATOM 8782  H H    . SER A 1 115 ? 6.484   -1.162  4.602   1.00 0.00 ? 115 SER A H    4  
ATOM 8783  H HA   . SER A 1 115 ? 4.323   -2.264  6.174   1.00 0.00 ? 115 SER A HA   4  
ATOM 8784  H HB2  . SER A 1 115 ? 4.671   0.128   6.816   1.00 0.00 ? 115 SER A HB2  4  
ATOM 8785  H HB3  . SER A 1 115 ? 4.410   0.579   5.134   1.00 0.00 ? 115 SER A HB3  4  
ATOM 8786  H HG   . SER A 1 115 ? 2.486   -0.999  6.386   1.00 0.00 ? 115 SER A HG   4  
ATOM 8787  N N    . ARG A 1 116 ? 2.850   -2.372  4.098   1.00 0.00 ? 116 ARG A N    4  
ATOM 8788  C CA   . ARG A 1 116 ? 2.139   -2.583  2.901   1.00 0.00 ? 116 ARG A CA   4  
ATOM 8789  C C    . ARG A 1 116 ? 0.753   -1.985  3.126   1.00 0.00 ? 116 ARG A C    4  
ATOM 8790  O O    . ARG A 1 116 ? 0.252   -1.997  4.249   1.00 0.00 ? 116 ARG A O    4  
ATOM 8791  C CB   . ARG A 1 116 ? 2.093   -4.093  2.568   1.00 0.00 ? 116 ARG A CB   4  
ATOM 8792  C CG   . ARG A 1 116 ? 1.692   -4.377  1.142   1.00 0.00 ? 116 ARG A CG   4  
ATOM 8793  C CD   . ARG A 1 116 ? 1.870   -5.821  0.736   1.00 0.00 ? 116 ARG A CD   4  
ATOM 8794  N NE   . ARG A 1 116 ? 1.662   -5.956  -0.721  1.00 0.00 ? 116 ARG A NE   4  
ATOM 8795  C CZ   . ARG A 1 116 ? 1.358   -7.082  -1.377  1.00 0.00 ? 116 ARG A CZ   4  
ATOM 8796  N NH1  . ARG A 1 116 ? 1.259   -8.231  -0.728  1.00 0.00 ? 116 ARG A NH1  4  
ATOM 8797  N NH2  . ARG A 1 116 ? 1.152   -7.045  -2.680  1.00 0.00 ? 116 ARG A NH2  4  
ATOM 8798  H H    . ARG A 1 116 ? 2.391   -2.570  4.945   1.00 0.00 ? 116 ARG A H    4  
ATOM 8799  H HA   . ARG A 1 116 ? 2.638   -2.040  2.112   1.00 0.00 ? 116 ARG A HA   4  
ATOM 8800  H HB2  . ARG A 1 116 ? 3.072   -4.517  2.737   1.00 0.00 ? 116 ARG A HB2  4  
ATOM 8801  H HB3  . ARG A 1 116 ? 1.384   -4.574  3.225   1.00 0.00 ? 116 ARG A HB3  4  
ATOM 8802  H HG2  . ARG A 1 116 ? 0.651   -4.116  1.017   1.00 0.00 ? 116 ARG A HG2  4  
ATOM 8803  H HG3  . ARG A 1 116 ? 2.287   -3.754  0.489   1.00 0.00 ? 116 ARG A HG3  4  
ATOM 8804  H HD2  . ARG A 1 116 ? 2.866   -6.148  0.998   1.00 0.00 ? 116 ARG A HD2  4  
ATOM 8805  H HD3  . ARG A 1 116 ? 1.137   -6.426  1.248   1.00 0.00 ? 116 ARG A HD3  4  
ATOM 8806  H HE   . ARG A 1 116 ? 1.758   -5.107  -1.205  1.00 0.00 ? 116 ARG A HE   4  
ATOM 8807  H HH11 . ARG A 1 116 ? 1.407   -8.307  0.260   1.00 0.00 ? 116 ARG A HH11 4  
ATOM 8808  H HH12 . ARG A 1 116 ? 1.018   -9.084  -1.204  1.00 0.00 ? 116 ARG A HH12 4  
ATOM 8809  H HH21 . ARG A 1 116 ? 1.212   -6.220  -3.245  1.00 0.00 ? 116 ARG A HH21 4  
ATOM 8810  H HH22 . ARG A 1 116 ? 0.898   -7.873  -3.195  1.00 0.00 ? 116 ARG A HH22 4  
ATOM 8811  N N    . GLU A 1 117 ? 0.149   -1.470  2.101   1.00 0.00 ? 117 GLU A N    4  
ATOM 8812  C CA   . GLU A 1 117 ? -1.144  -0.823  2.211   1.00 0.00 ? 117 GLU A CA   4  
ATOM 8813  C C    . GLU A 1 117 ? -2.070  -1.337  1.177   1.00 0.00 ? 117 GLU A C    4  
ATOM 8814  O O    . GLU A 1 117 ? -1.640  -1.797  0.147   1.00 0.00 ? 117 GLU A O    4  
ATOM 8815  C CB   . GLU A 1 117 ? -1.084  0.684   2.023   1.00 0.00 ? 117 GLU A CB   4  
ATOM 8816  C CG   . GLU A 1 117 ? -0.309  1.470   3.038   1.00 0.00 ? 117 GLU A CG   4  
ATOM 8817  C CD   . GLU A 1 117 ? -0.708  2.914   2.960   1.00 0.00 ? 117 GLU A CD   4  
ATOM 8818  O OE1  . GLU A 1 117 ? -0.562  3.530   1.892   1.00 0.00 ? 117 GLU A OE1  4  
ATOM 8819  O OE2  . GLU A 1 117 ? -1.280  3.434   3.929   1.00 0.00 ? 117 GLU A OE2  4  
ATOM 8820  H H    . GLU A 1 117 ? 0.570   -1.523  1.213   1.00 0.00 ? 117 GLU A H    4  
ATOM 8821  H HA   . GLU A 1 117 ? -1.550  -1.031  3.189   1.00 0.00 ? 117 GLU A HA   4  
ATOM 8822  H HB2  . GLU A 1 117 ? -0.646  0.888   1.058   1.00 0.00 ? 117 GLU A HB2  4  
ATOM 8823  H HB3  . GLU A 1 117 ? -2.099  1.056   2.013   1.00 0.00 ? 117 GLU A HB3  4  
ATOM 8824  H HG2  . GLU A 1 117 ? -0.521  1.090   4.025   1.00 0.00 ? 117 GLU A HG2  4  
ATOM 8825  H HG3  . GLU A 1 117 ? 0.747   1.389   2.828   1.00 0.00 ? 117 GLU A HG3  4  
ATOM 8826  N N    . PHE A 1 118 ? -3.319  -1.261  1.450   1.00 0.00 ? 118 PHE A N    4  
ATOM 8827  C CA   . PHE A 1 118 ? -4.336  -1.636  0.526   1.00 0.00 ? 118 PHE A CA   4  
ATOM 8828  C C    . PHE A 1 118 ? -5.218  -0.422  0.318   1.00 0.00 ? 118 PHE A C    4  
ATOM 8829  O O    . PHE A 1 118 ? -5.640  0.209   1.282   1.00 0.00 ? 118 PHE A O    4  
ATOM 8830  C CB   . PHE A 1 118 ? -5.151  -2.789  1.097   1.00 0.00 ? 118 PHE A CB   4  
ATOM 8831  C CG   . PHE A 1 118 ? -6.102  -3.430  0.133   1.00 0.00 ? 118 PHE A CG   4  
ATOM 8832  C CD1  . PHE A 1 118 ? -7.396  -2.958  -0.013  1.00 0.00 ? 118 PHE A CD1  4  
ATOM 8833  C CD2  . PHE A 1 118 ? -5.704  -4.528  -0.610  1.00 0.00 ? 118 PHE A CD2  4  
ATOM 8834  C CE1  . PHE A 1 118 ? -8.270  -3.569  -0.879  1.00 0.00 ? 118 PHE A CE1  4  
ATOM 8835  C CE2  . PHE A 1 118 ? -6.573  -5.141  -1.481  1.00 0.00 ? 118 PHE A CE2  4  
ATOM 8836  C CZ   . PHE A 1 118 ? -7.857  -4.662  -1.614  1.00 0.00 ? 118 PHE A CZ   4  
ATOM 8837  H H    . PHE A 1 118 ? -3.584  -0.900  2.328   1.00 0.00 ? 118 PHE A H    4  
ATOM 8838  H HA   . PHE A 1 118 ? -3.884  -1.931  -0.409  1.00 0.00 ? 118 PHE A HA   4  
ATOM 8839  H HB2  . PHE A 1 118 ? -4.473  -3.556  1.442   1.00 0.00 ? 118 PHE A HB2  4  
ATOM 8840  H HB3  . PHE A 1 118 ? -5.722  -2.428  1.939   1.00 0.00 ? 118 PHE A HB3  4  
ATOM 8841  H HD1  . PHE A 1 118 ? -7.717  -2.102  0.562   1.00 0.00 ? 118 PHE A HD1  4  
ATOM 8842  H HD2  . PHE A 1 118 ? -4.697  -4.901  -0.503  1.00 0.00 ? 118 PHE A HD2  4  
ATOM 8843  H HE1  . PHE A 1 118 ? -9.277  -3.193  -0.987  1.00 0.00 ? 118 PHE A HE1  4  
ATOM 8844  H HE2  . PHE A 1 118 ? -6.252  -5.997  -2.057  1.00 0.00 ? 118 PHE A HE2  4  
ATOM 8845  H HZ   . PHE A 1 118 ? -8.544  -5.146  -2.294  1.00 0.00 ? 118 PHE A HZ   4  
ATOM 8846  N N    . HIS A 1 119 ? -5.440  -0.057  -0.926  1.00 0.00 ? 119 HIS A N    4  
ATOM 8847  C CA   . HIS A 1 119 ? -6.299  1.075   -1.257  1.00 0.00 ? 119 HIS A CA   4  
ATOM 8848  C C    . HIS A 1 119 ? -7.285  0.661   -2.328  1.00 0.00 ? 119 HIS A C    4  
ATOM 8849  O O    . HIS A 1 119 ? -6.887  0.246   -3.402  1.00 0.00 ? 119 HIS A O    4  
ATOM 8850  C CB   . HIS A 1 119 ? -5.485  2.290   -1.776  1.00 0.00 ? 119 HIS A CB   4  
ATOM 8851  C CG   . HIS A 1 119 ? -4.548  2.928   -0.784  1.00 0.00 ? 119 HIS A CG   4  
ATOM 8852  N ND1  . HIS A 1 119 ? -4.852  4.084   -0.095  1.00 0.00 ? 119 HIS A ND1  4  
ATOM 8853  C CD2  . HIS A 1 119 ? -3.289  2.588   -0.400  1.00 0.00 ? 119 HIS A CD2  4  
ATOM 8854  C CE1  . HIS A 1 119 ? -3.821  4.420   0.663   1.00 0.00 ? 119 HIS A CE1  4  
ATOM 8855  N NE2  . HIS A 1 119 ? -2.870  3.529   0.494   1.00 0.00 ? 119 HIS A NE2  4  
ATOM 8856  H H    . HIS A 1 119 ? -5.075  -0.586  -1.675  1.00 0.00 ? 119 HIS A H    4  
ATOM 8857  H HA   . HIS A 1 119 ? -6.838  1.363   -0.368  1.00 0.00 ? 119 HIS A HA   4  
ATOM 8858  H HB2  . HIS A 1 119 ? -4.887  1.973   -2.618  1.00 0.00 ? 119 HIS A HB2  4  
ATOM 8859  H HB3  . HIS A 1 119 ? -6.177  3.047   -2.115  1.00 0.00 ? 119 HIS A HB3  4  
ATOM 8860  H HD1  . HIS A 1 119 ? -5.693  4.590   -0.161  1.00 0.00 ? 119 HIS A HD1  4  
ATOM 8861  H HD2  . HIS A 1 119 ? -2.726  1.731   -0.742  1.00 0.00 ? 119 HIS A HD2  4  
ATOM 8862  H HE1  . HIS A 1 119 ? -3.767  5.283   1.307   1.00 0.00 ? 119 HIS A HE1  4  
ATOM 8863  H HE2  . HIS A 1 119 ? -1.995  3.537   0.963   1.00 0.00 ? 119 HIS A HE2  4  
ATOM 8864  N N    . ARG A 1 120 ? -8.543  0.779   -2.060  1.00 0.00 ? 120 ARG A N    4  
ATOM 8865  C CA   . ARG A 1 120 ? -9.544  0.476   -3.055  1.00 0.00 ? 120 ARG A CA   4  
ATOM 8866  C C    . ARG A 1 120 ? -10.437 1.664   -3.162  1.00 0.00 ? 120 ARG A C    4  
ATOM 8867  O O    . ARG A 1 120 ? -10.799 2.252   -2.136  1.00 0.00 ? 120 ARG A O    4  
ATOM 8868  C CB   . ARG A 1 120 ? -10.350 -0.759  -2.663  1.00 0.00 ? 120 ARG A CB   4  
ATOM 8869  C CG   . ARG A 1 120 ? -11.334 -1.223  -3.728  1.00 0.00 ? 120 ARG A CG   4  
ATOM 8870  C CD   . ARG A 1 120 ? -12.013 -2.494  -3.293  1.00 0.00 ? 120 ARG A CD   4  
ATOM 8871  N NE   . ARG A 1 120 ? -12.828 -3.118  -4.333  1.00 0.00 ? 120 ARG A NE   4  
ATOM 8872  C CZ   . ARG A 1 120 ? -13.063 -4.437  -4.417  1.00 0.00 ? 120 ARG A CZ   4  
ATOM 8873  N NH1  . ARG A 1 120 ? -12.472 -5.289  -3.576  1.00 0.00 ? 120 ARG A NH1  4  
ATOM 8874  N NH2  . ARG A 1 120 ? -13.792 -4.904  -5.393  1.00 0.00 ? 120 ARG A NH2  4  
ATOM 8875  H H    . ARG A 1 120 ? -8.834  1.097   -1.175  1.00 0.00 ? 120 ARG A H    4  
ATOM 8876  H HA   . ARG A 1 120 ? -9.050  0.310   -4.002  1.00 0.00 ? 120 ARG A HA   4  
ATOM 8877  H HB2  . ARG A 1 120 ? -9.662  -1.565  -2.460  1.00 0.00 ? 120 ARG A HB2  4  
ATOM 8878  H HB3  . ARG A 1 120 ? -10.903 -0.537  -1.763  1.00 0.00 ? 120 ARG A HB3  4  
ATOM 8879  H HG2  . ARG A 1 120 ? -12.078 -0.455  -3.875  1.00 0.00 ? 120 ARG A HG2  4  
ATOM 8880  H HG3  . ARG A 1 120 ? -10.804 -1.395  -4.653  1.00 0.00 ? 120 ARG A HG3  4  
ATOM 8881  H HD2  . ARG A 1 120 ? -11.255 -3.198  -2.988  1.00 0.00 ? 120 ARG A HD2  4  
ATOM 8882  H HD3  . ARG A 1 120 ? -12.640 -2.275  -2.442  1.00 0.00 ? 120 ARG A HD3  4  
ATOM 8883  H HE   . ARG A 1 120 ? -13.209 -2.527  -5.023  1.00 0.00 ? 120 ARG A HE   4  
ATOM 8884  H HH11 . ARG A 1 120 ? -11.845 -5.011  -2.846  1.00 0.00 ? 120 ARG A HH11 4  
ATOM 8885  H HH12 . ARG A 1 120 ? -12.587 -6.287  -3.706  1.00 0.00 ? 120 ARG A HH12 4  
ATOM 8886  H HH21 . ARG A 1 120 ? -14.163 -4.286  -6.105  1.00 0.00 ? 120 ARG A HH21 4  
ATOM 8887  H HH22 . ARG A 1 120 ? -14.017 -5.874  -5.506  1.00 0.00 ? 120 ARG A HH22 4  
ATOM 8888  N N    . LYS A 1 121 ? -10.800 2.035   -4.363  1.00 0.00 ? 121 LYS A N    4  
ATOM 8889  C CA   . LYS A 1 121 ? -11.610 3.231   -4.528  1.00 0.00 ? 121 LYS A CA   4  
ATOM 8890  C C    . LYS A 1 121 ? -12.732 2.940   -5.492  1.00 0.00 ? 121 LYS A C    4  
ATOM 8891  O O    . LYS A 1 121 ? -12.477 2.443   -6.579  1.00 0.00 ? 121 LYS A O    4  
ATOM 8892  C CB   . LYS A 1 121 ? -10.747 4.352   -5.153  1.00 0.00 ? 121 LYS A CB   4  
ATOM 8893  C CG   . LYS A 1 121 ? -9.376  4.569   -4.506  1.00 0.00 ? 121 LYS A CG   4  
ATOM 8894  C CD   . LYS A 1 121 ? -8.520  5.543   -5.316  1.00 0.00 ? 121 LYS A CD   4  
ATOM 8895  C CE   . LYS A 1 121 ? -8.999  6.990   -5.213  1.00 0.00 ? 121 LYS A CE   4  
ATOM 8896  N NZ   . LYS A 1 121 ? -8.779  7.546   -3.859  1.00 0.00 ? 121 LYS A NZ   4  
ATOM 8897  H H    . LYS A 1 121 ? -10.551 1.505   -5.156  1.00 0.00 ? 121 LYS A H    4  
ATOM 8898  H HA   . LYS A 1 121 ? -11.969 3.552   -3.566  1.00 0.00 ? 121 LYS A HA   4  
ATOM 8899  H HB2  . LYS A 1 121 ? -10.588 4.123   -6.195  1.00 0.00 ? 121 LYS A HB2  4  
ATOM 8900  H HB3  . LYS A 1 121 ? -11.302 5.276   -5.085  1.00 0.00 ? 121 LYS A HB3  4  
ATOM 8901  H HG2  . LYS A 1 121 ? -9.520  4.972   -3.513  1.00 0.00 ? 121 LYS A HG2  4  
ATOM 8902  H HG3  . LYS A 1 121 ? -8.868  3.618   -4.438  1.00 0.00 ? 121 LYS A HG3  4  
ATOM 8903  H HD2  . LYS A 1 121 ? -7.504  5.492   -4.952  1.00 0.00 ? 121 LYS A HD2  4  
ATOM 8904  H HD3  . LYS A 1 121 ? -8.541  5.237   -6.352  1.00 0.00 ? 121 LYS A HD3  4  
ATOM 8905  H HE2  . LYS A 1 121 ? -8.456  7.589   -5.928  1.00 0.00 ? 121 LYS A HE2  4  
ATOM 8906  H HE3  . LYS A 1 121 ? -10.052 7.030   -5.444  1.00 0.00 ? 121 LYS A HE3  4  
ATOM 8907  H HZ1  . LYS A 1 121 ? -9.342  7.029   -3.144  1.00 0.00 ? 121 LYS A HZ1  4  
ATOM 8908  H HZ2  . LYS A 1 121 ? -9.060  8.544   -3.806  1.00 0.00 ? 121 LYS A HZ2  4  
ATOM 8909  H HZ3  . LYS A 1 121 ? -7.780  7.488   -3.577  1.00 0.00 ? 121 LYS A HZ3  4  
ATOM 8910  N N    . TYR A 1 122 ? -13.956 3.215   -5.100  1.00 0.00 ? 122 TYR A N    4  
ATOM 8911  C CA   . TYR A 1 122 ? -15.083 3.092   -5.998  1.00 0.00 ? 122 TYR A CA   4  
ATOM 8912  C C    . TYR A 1 122 ? -16.051 4.256   -5.962  1.00 0.00 ? 122 TYR A C    4  
ATOM 8913  O O    . TYR A 1 122 ? -16.418 4.737   -4.884  1.00 0.00 ? 122 TYR A O    4  
ATOM 8914  C CB   . TYR A 1 122 ? -15.775 1.705   -5.975  1.00 0.00 ? 122 TYR A CB   4  
ATOM 8915  C CG   . TYR A 1 122 ? -15.911 1.003   -4.640  1.00 0.00 ? 122 TYR A CG   4  
ATOM 8916  C CD1  . TYR A 1 122 ? -14.808 0.414   -4.031  1.00 0.00 ? 122 TYR A CD1  4  
ATOM 8917  C CD2  . TYR A 1 122 ? -17.137 0.869   -4.029  1.00 0.00 ? 122 TYR A CD2  4  
ATOM 8918  C CE1  . TYR A 1 122 ? -14.928 -0.278  -2.850  1.00 0.00 ? 122 TYR A CE1  4  
ATOM 8919  C CE2  . TYR A 1 122 ? -17.264 0.182   -2.840  1.00 0.00 ? 122 TYR A CE2  4  
ATOM 8920  C CZ   . TYR A 1 122 ? -16.154 -0.391  -2.257  1.00 0.00 ? 122 TYR A CZ   4  
ATOM 8921  O OH   . TYR A 1 122 ? -16.277 -1.085  -1.072  1.00 0.00 ? 122 TYR A OH   4  
ATOM 8922  H H    . TYR A 1 122 ? -14.147 3.497   -4.177  1.00 0.00 ? 122 TYR A H    4  
ATOM 8923  H HA   . TYR A 1 122 ? -14.618 3.195   -6.969  1.00 0.00 ? 122 TYR A HA   4  
ATOM 8924  H HB2  . TYR A 1 122 ? -16.777 1.822   -6.360  1.00 0.00 ? 122 TYR A HB2  4  
ATOM 8925  H HB3  . TYR A 1 122 ? -15.241 1.044   -6.641  1.00 0.00 ? 122 TYR A HB3  4  
ATOM 8926  H HD1  . TYR A 1 122 ? -13.843 0.515   -4.503  1.00 0.00 ? 122 TYR A HD1  4  
ATOM 8927  H HD2  . TYR A 1 122 ? -18.002 1.320   -4.488  1.00 0.00 ? 122 TYR A HD2  4  
ATOM 8928  H HE1  . TYR A 1 122 ? -14.057 -0.727  -2.395  1.00 0.00 ? 122 TYR A HE1  4  
ATOM 8929  H HE2  . TYR A 1 122 ? -18.232 0.095   -2.371  1.00 0.00 ? 122 TYR A HE2  4  
ATOM 8930  H HH   . TYR A 1 122 ? -17.058 -1.642  -1.116  1.00 0.00 ? 122 TYR A HH   4  
ATOM 8931  N N    . ARG A 1 123 ? -16.436 4.728   -7.132  1.00 0.00 ? 123 ARG A N    4  
ATOM 8932  C CA   . ARG A 1 123 ? -17.447 5.765   -7.248  1.00 0.00 ? 123 ARG A CA   4  
ATOM 8933  C C    . ARG A 1 123 ? -18.730 5.197   -7.838  1.00 0.00 ? 123 ARG A C    4  
ATOM 8934  O O    . ARG A 1 123 ? -18.836 4.966   -9.044  1.00 0.00 ? 123 ARG A O    4  
ATOM 8935  C CB   . ARG A 1 123 ? -16.971 6.989   -8.060  1.00 0.00 ? 123 ARG A CB   4  
ATOM 8936  C CG   . ARG A 1 123 ? -18.117 7.943   -8.437  1.00 0.00 ? 123 ARG A CG   4  
ATOM 8937  C CD   . ARG A 1 123 ? -17.642 9.176   -9.175  1.00 0.00 ? 123 ARG A CD   4  
ATOM 8938  N NE   . ARG A 1 123 ? -17.201 10.243  -8.268  1.00 0.00 ? 123 ARG A NE   4  
ATOM 8939  C CZ   . ARG A 1 123 ? -16.379 11.239  -8.607  1.00 0.00 ? 123 ARG A CZ   4  
ATOM 8940  N NH1  . ARG A 1 123 ? -15.796 11.244  -9.799  1.00 0.00 ? 123 ARG A NH1  4  
ATOM 8941  N NH2  . ARG A 1 123 ? -16.154 12.235  -7.756  1.00 0.00 ? 123 ARG A NH2  4  
ATOM 8942  H H    . ARG A 1 123 ? -16.032 4.362   -7.951  1.00 0.00 ? 123 ARG A H    4  
ATOM 8943  H HA   . ARG A 1 123 ? -17.673 6.080   -6.240  1.00 0.00 ? 123 ARG A HA   4  
ATOM 8944  H HB2  . ARG A 1 123 ? -16.241 7.537   -7.481  1.00 0.00 ? 123 ARG A HB2  4  
ATOM 8945  H HB3  . ARG A 1 123 ? -16.512 6.641   -8.972  1.00 0.00 ? 123 ARG A HB3  4  
ATOM 8946  H HG2  . ARG A 1 123 ? -18.813 7.412   -9.068  1.00 0.00 ? 123 ARG A HG2  4  
ATOM 8947  H HG3  . ARG A 1 123 ? -18.623 8.244   -7.530  1.00 0.00 ? 123 ARG A HG3  4  
ATOM 8948  H HD2  . ARG A 1 123 ? -16.815 8.899   -9.811  1.00 0.00 ? 123 ARG A HD2  4  
ATOM 8949  H HD3  . ARG A 1 123 ? -18.452 9.550   -9.784  1.00 0.00 ? 123 ARG A HD3  4  
ATOM 8950  H HE   . ARG A 1 123 ? -17.636 10.204  -7.376  1.00 0.00 ? 123 ARG A HE   4  
ATOM 8951  H HH11 . ARG A 1 123 ? -15.953 10.514  -10.470 1.00 0.00 ? 123 ARG A HH11 4  
ATOM 8952  H HH12 . ARG A 1 123 ? -15.159 11.959  -10.101 1.00 0.00 ? 123 ARG A HH12 4  
ATOM 8953  H HH21 . ARG A 1 123 ? -16.584 12.260  -6.851  1.00 0.00 ? 123 ARG A HH21 4  
ATOM 8954  H HH22 . ARG A 1 123 ? -15.565 13.011  -7.993  1.00 0.00 ? 123 ARG A HH22 4  
ATOM 8955  N N    . ILE A 1 124 ? -19.671 4.957   -6.985  1.00 0.00 ? 124 ILE A N    4  
ATOM 8956  C CA   . ILE A 1 124 ? -20.962 4.454   -7.359  1.00 0.00 ? 124 ILE A CA   4  
ATOM 8957  C C    . ILE A 1 124 ? -22.078 5.223   -6.615  1.00 0.00 ? 124 ILE A C    4  
ATOM 8958  O O    . ILE A 1 124 ? -22.198 5.120   -5.413  1.00 0.00 ? 124 ILE A O    4  
ATOM 8959  C CB   . ILE A 1 124 ? -21.069 2.909   -7.108  1.00 0.00 ? 124 ILE A CB   4  
ATOM 8960  C CG1  . ILE A 1 124 ? -20.327 2.467   -5.832  1.00 0.00 ? 124 ILE A CG1  4  
ATOM 8961  C CG2  . ILE A 1 124 ? -20.610 2.121   -8.325  1.00 0.00 ? 124 ILE A CG2  4  
ATOM 8962  C CD1  . ILE A 1 124 ? -20.444 0.979   -5.528  1.00 0.00 ? 124 ILE A CD1  4  
ATOM 8963  H H    . ILE A 1 124 ? -19.510 5.169   -6.039  1.00 0.00 ? 124 ILE A H    4  
ATOM 8964  H HA   . ILE A 1 124 ? -21.073 4.637   -8.418  1.00 0.00 ? 124 ILE A HA   4  
ATOM 8965  H HB   . ILE A 1 124 ? -22.121 2.694   -6.992  1.00 0.00 ? 124 ILE A HB   4  
ATOM 8966  H HG12 . ILE A 1 124 ? -19.279 2.702   -5.941  1.00 0.00 ? 124 ILE A HG12 4  
ATOM 8967  H HG13 . ILE A 1 124 ? -20.729 3.018   -4.997  1.00 0.00 ? 124 ILE A HG13 4  
ATOM 8968  H HG21 . ILE A 1 124 ? -19.579 2.361   -8.536  1.00 0.00 ? 124 ILE A HG21 4  
ATOM 8969  H HG22 . ILE A 1 124 ? -21.221 2.383   -9.176  1.00 0.00 ? 124 ILE A HG22 4  
ATOM 8970  H HG23 . ILE A 1 124 ? -20.701 1.063   -8.127  1.00 0.00 ? 124 ILE A HG23 4  
ATOM 8971  H HD11 . ILE A 1 124 ? -19.961 0.751   -4.589  1.00 0.00 ? 124 ILE A HD11 4  
ATOM 8972  H HD12 . ILE A 1 124 ? -19.986 0.410   -6.323  1.00 0.00 ? 124 ILE A HD12 4  
ATOM 8973  H HD13 . ILE A 1 124 ? -21.489 0.713   -5.460  1.00 0.00 ? 124 ILE A HD13 4  
ATOM 8974  N N    . PRO A 1 125 ? -22.823 6.101   -7.323  1.00 0.00 ? 125 PRO A N    4  
ATOM 8975  C CA   . PRO A 1 125 ? -23.980 6.823   -6.740  1.00 0.00 ? 125 PRO A CA   4  
ATOM 8976  C C    . PRO A 1 125 ? -25.382 6.385   -7.240  1.00 0.00 ? 125 PRO A C    4  
ATOM 8977  O O    . PRO A 1 125 ? -26.338 6.383   -6.483  1.00 0.00 ? 125 PRO A O    4  
ATOM 8978  C CB   . PRO A 1 125 ? -23.727 8.235   -7.251  1.00 0.00 ? 125 PRO A CB   4  
ATOM 8979  C CG   . PRO A 1 125 ? -22.931 8.084   -8.543  1.00 0.00 ? 125 PRO A CG   4  
ATOM 8980  C CD   . PRO A 1 125 ? -22.475 6.638   -8.640  1.00 0.00 ? 125 PRO A CD   4  
ATOM 8981  H HA   . PRO A 1 125 ? -23.954 6.849   -5.661  1.00 0.00 ? 125 PRO A HA   4  
ATOM 8982  H HB2  . PRO A 1 125 ? -24.678 8.716   -7.422  1.00 0.00 ? 125 PRO A HB2  4  
ATOM 8983  H HB3  . PRO A 1 125 ? -23.176 8.784   -6.505  1.00 0.00 ? 125 PRO A HB3  4  
ATOM 8984  H HG2  . PRO A 1 125 ? -23.562 8.325   -9.386  1.00 0.00 ? 125 PRO A HG2  4  
ATOM 8985  H HG3  . PRO A 1 125 ? -22.078 8.746   -8.521  1.00 0.00 ? 125 PRO A HG3  4  
ATOM 8986  H HD2  . PRO A 1 125 ? -22.994 6.124   -9.435  1.00 0.00 ? 125 PRO A HD2  4  
ATOM 8987  H HD3  . PRO A 1 125 ? -21.409 6.604   -8.803  1.00 0.00 ? 125 PRO A HD3  4  
ATOM 8988  N N    . ALA A 1 126 ? -25.502 6.053   -8.511  1.00 0.00 ? 126 ALA A N    4  
ATOM 8989  C CA   . ALA A 1 126 ? -26.794 5.781   -9.125  1.00 0.00 ? 126 ALA A CA   4  
ATOM 8990  C C    . ALA A 1 126 ? -27.428 4.516   -8.595  1.00 0.00 ? 126 ALA A C    4  
ATOM 8991  O O    . ALA A 1 126 ? -28.641 4.392   -8.536  1.00 0.00 ? 126 ALA A O    4  
ATOM 8992  C CB   . ALA A 1 126 ? -26.676 5.740   -10.642 1.00 0.00 ? 126 ALA A CB   4  
ATOM 8993  H H    . ALA A 1 126 ? -24.691 5.949   -9.050  1.00 0.00 ? 126 ALA A H    4  
ATOM 8994  H HA   . ALA A 1 126 ? -27.437 6.609   -8.867  1.00 0.00 ? 126 ALA A HA   4  
ATOM 8995  H HB1  . ALA A 1 126 ? -26.086 4.885   -10.934 1.00 0.00 ? 126 ALA A HB1  4  
ATOM 8996  H HB2  . ALA A 1 126 ? -26.198 6.645   -10.991 1.00 0.00 ? 126 ALA A HB2  4  
ATOM 8997  H HB3  . ALA A 1 126 ? -27.660 5.664   -11.079 1.00 0.00 ? 126 ALA A HB3  4  
ATOM 8998  N N    . ASP A 1 127 ? -26.610 3.593   -8.205  1.00 0.00 ? 127 ASP A N    4  
ATOM 8999  C CA   . ASP A 1 127 ? -27.092 2.311   -7.746  1.00 0.00 ? 127 ASP A CA   4  
ATOM 9000  C C    . ASP A 1 127 ? -26.814 2.171   -6.243  1.00 0.00 ? 127 ASP A C    4  
ATOM 9001  O O    . ASP A 1 127 ? -27.062 1.135   -5.640  1.00 0.00 ? 127 ASP A O    4  
ATOM 9002  C CB   . ASP A 1 127 ? -26.382 1.221   -8.580  1.00 0.00 ? 127 ASP A CB   4  
ATOM 9003  C CG   . ASP A 1 127 ? -26.956 -0.181  -8.471  1.00 0.00 ? 127 ASP A CG   4  
ATOM 9004  O OD1  . ASP A 1 127 ? -28.137 -0.393  -8.844  1.00 0.00 ? 127 ASP A OD1  4  
ATOM 9005  O OD2  . ASP A 1 127 ? -26.212 -1.112  -8.114  1.00 0.00 ? 127 ASP A OD2  4  
ATOM 9006  H H    . ASP A 1 127 ? -25.643 3.766   -8.244  1.00 0.00 ? 127 ASP A H    4  
ATOM 9007  H HA   . ASP A 1 127 ? -28.156 2.257   -7.924  1.00 0.00 ? 127 ASP A HA   4  
ATOM 9008  H HB2  . ASP A 1 127 ? -26.425 1.504   -9.622  1.00 0.00 ? 127 ASP A HB2  4  
ATOM 9009  H HB3  . ASP A 1 127 ? -25.344 1.191   -8.279  1.00 0.00 ? 127 ASP A HB3  4  
ATOM 9010  N N    . VAL A 1 128 ? -26.363 3.272   -5.628  1.00 0.00 ? 128 VAL A N    4  
ATOM 9011  C CA   . VAL A 1 128 ? -25.938 3.275   -4.220  1.00 0.00 ? 128 VAL A CA   4  
ATOM 9012  C C    . VAL A 1 128 ? -26.568 4.421   -3.447  1.00 0.00 ? 128 VAL A C    4  
ATOM 9013  O O    . VAL A 1 128 ? -26.470 5.568   -3.847  1.00 0.00 ? 128 VAL A O    4  
ATOM 9014  C CB   . VAL A 1 128 ? -24.407 3.446   -4.116  1.00 0.00 ? 128 VAL A CB   4  
ATOM 9015  C CG1  . VAL A 1 128 ? -23.922 3.407   -2.681  1.00 0.00 ? 128 VAL A CG1  4  
ATOM 9016  C CG2  . VAL A 1 128 ? -23.703 2.415   -4.927  1.00 0.00 ? 128 VAL A CG2  4  
ATOM 9017  H H    . VAL A 1 128 ? -26.340 4.126   -6.111  1.00 0.00 ? 128 VAL A H    4  
ATOM 9018  H HA   . VAL A 1 128 ? -26.203 2.331   -3.769  1.00 0.00 ? 128 VAL A HA   4  
ATOM 9019  H HB   . VAL A 1 128 ? -24.158 4.415   -4.522  1.00 0.00 ? 128 VAL A HB   4  
ATOM 9020  H HG11 . VAL A 1 128 ? -24.180 2.455   -2.242  1.00 0.00 ? 128 VAL A HG11 4  
ATOM 9021  H HG12 . VAL A 1 128 ? -24.394 4.200   -2.119  1.00 0.00 ? 128 VAL A HG12 4  
ATOM 9022  H HG13 . VAL A 1 128 ? -22.850 3.534   -2.659  1.00 0.00 ? 128 VAL A HG13 4  
ATOM 9023  H HG21 . VAL A 1 128 ? -22.637 2.530   -4.815  1.00 0.00 ? 128 VAL A HG21 4  
ATOM 9024  H HG22 . VAL A 1 128 ? -23.975 2.526   -5.965  1.00 0.00 ? 128 VAL A HG22 4  
ATOM 9025  H HG23 . VAL A 1 128 ? -24.003 1.435   -4.584  1.00 0.00 ? 128 VAL A HG23 4  
ATOM 9026  N N    . ASP A 1 129 ? -27.194 4.125   -2.345  1.00 0.00 ? 129 ASP A N    4  
ATOM 9027  C CA   . ASP A 1 129 ? -27.717 5.170   -1.488  1.00 0.00 ? 129 ASP A CA   4  
ATOM 9028  C C    . ASP A 1 129 ? -27.088 5.026   -0.102  1.00 0.00 ? 129 ASP A C    4  
ATOM 9029  O O    . ASP A 1 129 ? -27.467 4.159   0.674   1.00 0.00 ? 129 ASP A O    4  
ATOM 9030  C CB   . ASP A 1 129 ? -29.237 5.095   -1.401  1.00 0.00 ? 129 ASP A CB   4  
ATOM 9031  C CG   . ASP A 1 129 ? -29.819 6.250   -0.623  1.00 0.00 ? 129 ASP A CG   4  
ATOM 9032  O OD1  . ASP A 1 129 ? -29.948 7.368   -1.208  1.00 0.00 ? 129 ASP A OD1  4  
ATOM 9033  O OD2  . ASP A 1 129 ? -30.154 6.071   0.554   1.00 0.00 ? 129 ASP A OD2  4  
ATOM 9034  H H    . ASP A 1 129 ? -27.306 3.188   -2.075  1.00 0.00 ? 129 ASP A H    4  
ATOM 9035  H HA   . ASP A 1 129 ? -27.421 6.116   -1.916  1.00 0.00 ? 129 ASP A HA   4  
ATOM 9036  H HB2  . ASP A 1 129 ? -29.647 5.100   -2.398  1.00 0.00 ? 129 ASP A HB2  4  
ATOM 9037  H HB3  . ASP A 1 129 ? -29.514 4.174   -0.912  1.00 0.00 ? 129 ASP A HB3  4  
ATOM 9038  N N    . PRO A 1 130 ? -26.116 5.876   0.225   1.00 0.00 ? 130 PRO A N    4  
ATOM 9039  C CA   . PRO A 1 130 ? -25.286 5.745   1.445   1.00 0.00 ? 130 PRO A CA   4  
ATOM 9040  C C    . PRO A 1 130 ? -25.981 6.068   2.774   1.00 0.00 ? 130 PRO A C    4  
ATOM 9041  O O    . PRO A 1 130 ? -25.322 6.092   3.819   1.00 0.00 ? 130 PRO A O    4  
ATOM 9042  C CB   . PRO A 1 130 ? -24.168 6.747   1.195   1.00 0.00 ? 130 PRO A CB   4  
ATOM 9043  C CG   . PRO A 1 130 ? -24.803 7.787   0.356   1.00 0.00 ? 130 PRO A CG   4  
ATOM 9044  C CD   . PRO A 1 130 ? -25.720 7.053   -0.568  1.00 0.00 ? 130 PRO A CD   4  
ATOM 9045  H HA   . PRO A 1 130 ? -24.847 4.762   1.523   1.00 0.00 ? 130 PRO A HA   4  
ATOM 9046  H HB2  . PRO A 1 130 ? -23.814 7.147   2.134   1.00 0.00 ? 130 PRO A HB2  4  
ATOM 9047  H HB3  . PRO A 1 130 ? -23.359 6.263   0.668   1.00 0.00 ? 130 PRO A HB3  4  
ATOM 9048  H HG2  . PRO A 1 130 ? -25.359 8.473   0.976   1.00 0.00 ? 130 PRO A HG2  4  
ATOM 9049  H HG3  . PRO A 1 130 ? -24.045 8.309   -0.207  1.00 0.00 ? 130 PRO A HG3  4  
ATOM 9050  H HD2  . PRO A 1 130 ? -26.577 7.666   -0.805  1.00 0.00 ? 130 PRO A HD2  4  
ATOM 9051  H HD3  . PRO A 1 130 ? -25.201 6.755   -1.466  1.00 0.00 ? 130 PRO A HD3  4  
ATOM 9052  N N    . LEU A 1 131 ? -27.284 6.258   2.753   1.00 0.00 ? 131 LEU A N    4  
ATOM 9053  C CA   . LEU A 1 131 ? -28.017 6.663   3.944   1.00 0.00 ? 131 LEU A CA   4  
ATOM 9054  C C    . LEU A 1 131 ? -27.966 5.643   5.079   1.00 0.00 ? 131 LEU A C    4  
ATOM 9055  O O    . LEU A 1 131 ? -27.835 6.023   6.234   1.00 0.00 ? 131 LEU A O    4  
ATOM 9056  C CB   . LEU A 1 131 ? -29.458 7.108   3.632   1.00 0.00 ? 131 LEU A CB   4  
ATOM 9057  C CG   . LEU A 1 131 ? -29.657 8.556   3.105   1.00 0.00 ? 131 LEU A CG   4  
ATOM 9058  C CD1  . LEU A 1 131 ? -29.253 9.572   4.154   1.00 0.00 ? 131 LEU A CD1  4  
ATOM 9059  C CD2  . LEU A 1 131 ? -28.889 8.812   1.817   1.00 0.00 ? 131 LEU A CD2  4  
ATOM 9060  H H    . LEU A 1 131 ? -27.773 6.116   1.913   1.00 0.00 ? 131 LEU A H    4  
ATOM 9061  H HA   . LEU A 1 131 ? -27.481 7.526   4.308   1.00 0.00 ? 131 LEU A HA   4  
ATOM 9062  H HB2  . LEU A 1 131 ? -29.861 6.431   2.893   1.00 0.00 ? 131 LEU A HB2  4  
ATOM 9063  H HB3  . LEU A 1 131 ? -30.036 7.002   4.538   1.00 0.00 ? 131 LEU A HB3  4  
ATOM 9064  H HG   . LEU A 1 131 ? -30.709 8.703   2.911   1.00 0.00 ? 131 LEU A HG   4  
ATOM 9065  H HD11 . LEU A 1 131 ? -29.428 10.567  3.771   1.00 0.00 ? 131 LEU A HD11 4  
ATOM 9066  H HD12 . LEU A 1 131 ? -28.205 9.463   4.387   1.00 0.00 ? 131 LEU A HD12 4  
ATOM 9067  H HD13 . LEU A 1 131 ? -29.840 9.424   5.047   1.00 0.00 ? 131 LEU A HD13 4  
ATOM 9068  H HD21 . LEU A 1 131 ? -29.232 8.131   1.053   1.00 0.00 ? 131 LEU A HD21 4  
ATOM 9069  H HD22 . LEU A 1 131 ? -27.834 8.654   1.990   1.00 0.00 ? 131 LEU A HD22 4  
ATOM 9070  H HD23 . LEU A 1 131 ? -29.048 9.830   1.496   1.00 0.00 ? 131 LEU A HD23 4  
ATOM 9071  N N    . THR A 1 132 ? -28.052 4.370   4.784   1.00 0.00 ? 132 THR A N    4  
ATOM 9072  C CA   . THR A 1 132 ? -27.971 3.379   5.858   1.00 0.00 ? 132 THR A CA   4  
ATOM 9073  C C    . THR A 1 132 ? -26.784 2.439   5.660   1.00 0.00 ? 132 THR A C    4  
ATOM 9074  O O    . THR A 1 132 ? -26.644 1.422   6.373   1.00 0.00 ? 132 THR A O    4  
ATOM 9075  C CB   . THR A 1 132 ? -29.272 2.544   6.014   1.00 0.00 ? 132 THR A CB   4  
ATOM 9076  O OG1  . THR A 1 132 ? -29.208 1.744   7.213   1.00 0.00 ? 132 THR A OG1  4  
ATOM 9077  C CG2  . THR A 1 132 ? -29.447 1.621   4.829   1.00 0.00 ? 132 THR A CG2  4  
ATOM 9078  H H    . THR A 1 132 ? -28.197 4.097   3.854   1.00 0.00 ? 132 THR A H    4  
ATOM 9079  H HA   . THR A 1 132 ? -27.812 3.939   6.767   1.00 0.00 ? 132 THR A HA   4  
ATOM 9080  H HB   . THR A 1 132 ? -30.118 3.212   6.072   1.00 0.00 ? 132 THR A HB   4  
ATOM 9081  H HG1  . THR A 1 132 ? -28.293 1.437   7.291   1.00 0.00 ? 132 THR A HG1  4  
ATOM 9082  H HG21 . THR A 1 132 ? -28.585 0.977   4.739   1.00 0.00 ? 132 THR A HG21 4  
ATOM 9083  H HG22 . THR A 1 132 ? -29.553 2.230   3.945   1.00 0.00 ? 132 THR A HG22 4  
ATOM 9084  H HG23 . THR A 1 132 ? -30.338 1.025   4.963   1.00 0.00 ? 132 THR A HG23 4  
ATOM 9085  N N    . ILE A 1 133 ? -25.936 2.757   4.715   1.00 0.00 ? 133 ILE A N    4  
ATOM 9086  C CA   . ILE A 1 133 ? -24.885 1.845   4.359   1.00 0.00 ? 133 ILE A CA   4  
ATOM 9087  C C    . ILE A 1 133 ? -23.846 1.698   5.467   1.00 0.00 ? 133 ILE A C    4  
ATOM 9088  O O    . ILE A 1 133 ? -23.240 2.669   5.918   1.00 0.00 ? 133 ILE A O    4  
ATOM 9089  C CB   . ILE A 1 133 ? -24.232 2.169   3.002   1.00 0.00 ? 133 ILE A CB   4  
ATOM 9090  C CG1  . ILE A 1 133 ? -25.264 2.076   1.890   1.00 0.00 ? 133 ILE A CG1  4  
ATOM 9091  C CG2  . ILE A 1 133 ? -23.142 1.190   2.732   1.00 0.00 ? 133 ILE A CG2  4  
ATOM 9092  C CD1  . ILE A 1 133 ? -24.710 2.275   0.498   1.00 0.00 ? 133 ILE A CD1  4  
ATOM 9093  H H    . ILE A 1 133 ? -25.999 3.639   4.293   1.00 0.00 ? 133 ILE A H    4  
ATOM 9094  H HA   . ILE A 1 133 ? -25.368 0.882   4.274   1.00 0.00 ? 133 ILE A HA   4  
ATOM 9095  H HB   . ILE A 1 133 ? -23.826 3.169   3.021   1.00 0.00 ? 133 ILE A HB   4  
ATOM 9096  H HG12 . ILE A 1 133 ? -25.676 1.080   1.901   1.00 0.00 ? 133 ILE A HG12 4  
ATOM 9097  H HG13 . ILE A 1 133 ? -26.048 2.800   2.053   1.00 0.00 ? 133 ILE A HG13 4  
ATOM 9098  H HG21 . ILE A 1 133 ? -22.405 1.252   3.518   1.00 0.00 ? 133 ILE A HG21 4  
ATOM 9099  H HG22 . ILE A 1 133 ? -22.682 1.419   1.782   1.00 0.00 ? 133 ILE A HG22 4  
ATOM 9100  H HG23 . ILE A 1 133 ? -23.552 0.191   2.704   1.00 0.00 ? 133 ILE A HG23 4  
ATOM 9101  H HD11 . ILE A 1 133 ? -24.201 3.224   0.426   1.00 0.00 ? 133 ILE A HD11 4  
ATOM 9102  H HD12 . ILE A 1 133 ? -25.519 2.241   -0.218  1.00 0.00 ? 133 ILE A HD12 4  
ATOM 9103  H HD13 . ILE A 1 133 ? -24.012 1.481   0.281   1.00 0.00 ? 133 ILE A HD13 4  
ATOM 9104  N N    . THR A 1 134 ? -23.681 0.469   5.888   1.00 0.00 ? 134 THR A N    4  
ATOM 9105  C CA   . THR A 1 134 ? -22.827 0.095   6.976   1.00 0.00 ? 134 THR A CA   4  
ATOM 9106  C C    . THR A 1 134 ? -21.911 -1.033  6.581   1.00 0.00 ? 134 THR A C    4  
ATOM 9107  O O    . THR A 1 134 ? -22.114 -1.666  5.551   1.00 0.00 ? 134 THR A O    4  
ATOM 9108  C CB   . THR A 1 134 ? -23.680 -0.257  8.206   1.00 0.00 ? 134 THR A CB   4  
ATOM 9109  O OG1  . THR A 1 134 ? -24.906 -0.866  7.758   1.00 0.00 ? 134 THR A OG1  4  
ATOM 9110  C CG2  . THR A 1 134 ? -23.995 0.987   9.029   1.00 0.00 ? 134 THR A CG2  4  
ATOM 9111  H H    . THR A 1 134 ? -24.150 -0.256  5.414   1.00 0.00 ? 134 THR A H    4  
ATOM 9112  H HA   . THR A 1 134 ? -22.223 0.957   7.223   1.00 0.00 ? 134 THR A HA   4  
ATOM 9113  H HB   . THR A 1 134 ? -23.135 -0.965  8.813   1.00 0.00 ? 134 THR A HB   4  
ATOM 9114  H HG1  . THR A 1 134 ? -25.283 -0.234  7.129   1.00 0.00 ? 134 THR A HG1  4  
ATOM 9115  H HG21 . THR A 1 134 ? -24.546 1.689   8.420   1.00 0.00 ? 134 THR A HG21 4  
ATOM 9116  H HG22 . THR A 1 134 ? -23.075 1.440   9.365   1.00 0.00 ? 134 THR A HG22 4  
ATOM 9117  H HG23 . THR A 1 134 ? -24.590 0.711   9.887   1.00 0.00 ? 134 THR A HG23 4  
ATOM 9118  N N    . SER A 1 135 ? -20.921 -1.288  7.391   1.00 0.00 ? 135 SER A N    4  
ATOM 9119  C CA   . SER A 1 135 ? -19.900 -2.233  7.062   1.00 0.00 ? 135 SER A CA   4  
ATOM 9120  C C    . SER A 1 135 ? -19.703 -3.285  8.157   1.00 0.00 ? 135 SER A C    4  
ATOM 9121  O O    . SER A 1 135 ? -19.666 -2.967  9.349   1.00 0.00 ? 135 SER A O    4  
ATOM 9122  C CB   . SER A 1 135 ? -18.601 -1.460  6.812   1.00 0.00 ? 135 SER A CB   4  
ATOM 9123  O OG   . SER A 1 135 ? -18.325 -0.546  7.872   1.00 0.00 ? 135 SER A OG   4  
ATOM 9124  H H    . SER A 1 135 ? -20.873 -0.837  8.261   1.00 0.00 ? 135 SER A H    4  
ATOM 9125  H HA   . SER A 1 135 ? -20.169 -2.727  6.142   1.00 0.00 ? 135 SER A HA   4  
ATOM 9126  H HB2  . SER A 1 135 ? -17.781 -2.160  6.775   1.00 0.00 ? 135 SER A HB2  4  
ATOM 9127  H HB3  . SER A 1 135 ? -18.667 -0.913  5.884   1.00 0.00 ? 135 SER A HB3  4  
ATOM 9128  H HG   . SER A 1 135 ? -18.976 -0.681  8.573   1.00 0.00 ? 135 SER A HG   4  
ATOM 9129  N N    . SER A 1 136 ? -19.586 -4.518  7.746   1.00 0.00 ? 136 SER A N    4  
ATOM 9130  C CA   . SER A 1 136 ? -19.315 -5.612  8.637   1.00 0.00 ? 136 SER A CA   4  
ATOM 9131  C C    . SER A 1 136 ? -17.959 -6.172  8.228   1.00 0.00 ? 136 SER A C    4  
ATOM 9132  O O    . SER A 1 136 ? -17.735 -6.442  7.043   1.00 0.00 ? 136 SER A O    4  
ATOM 9133  C CB   . SER A 1 136 ? -20.427 -6.672  8.503   1.00 0.00 ? 136 SER A CB   4  
ATOM 9134  O OG   . SER A 1 136 ? -20.318 -7.695  9.490   1.00 0.00 ? 136 SER A OG   4  
ATOM 9135  H H    . SER A 1 136 ? -19.685 -4.717  6.785   1.00 0.00 ? 136 SER A H    4  
ATOM 9136  H HA   . SER A 1 136 ? -19.268 -5.239  9.649   1.00 0.00 ? 136 SER A HA   4  
ATOM 9137  H HB2  . SER A 1 136 ? -21.390 -6.195  8.600   1.00 0.00 ? 136 SER A HB2  4  
ATOM 9138  H HB3  . SER A 1 136 ? -20.359 -7.126  7.524   1.00 0.00 ? 136 SER A HB3  4  
ATOM 9139  H HG   . SER A 1 136 ? -19.578 -8.259  9.227   1.00 0.00 ? 136 SER A HG   4  
ATOM 9140  N N    . LEU A 1 137 ? -17.073 -6.334  9.180   1.00 0.00 ? 137 LEU A N    4  
ATOM 9141  C CA   . LEU A 1 137 ? -15.699 -6.682  8.896   1.00 0.00 ? 137 LEU A CA   4  
ATOM 9142  C C    . LEU A 1 137 ? -15.252 -7.879  9.729   1.00 0.00 ? 137 LEU A C    4  
ATOM 9143  O O    . LEU A 1 137 ? -15.422 -7.895  10.948  1.00 0.00 ? 137 LEU A O    4  
ATOM 9144  C CB   . LEU A 1 137 ? -14.835 -5.445  9.184   1.00 0.00 ? 137 LEU A CB   4  
ATOM 9145  C CG   . LEU A 1 137 ? -13.322 -5.546  8.985   1.00 0.00 ? 137 LEU A CG   4  
ATOM 9146  C CD1  . LEU A 1 137 ? -12.973 -5.900  7.550   1.00 0.00 ? 137 LEU A CD1  4  
ATOM 9147  C CD2  . LEU A 1 137 ? -12.689 -4.220  9.360   1.00 0.00 ? 137 LEU A CD2  4  
ATOM 9148  H H    . LEU A 1 137 ? -17.329 -6.220  10.120  1.00 0.00 ? 137 LEU A H    4  
ATOM 9149  H HA   . LEU A 1 137 ? -15.614 -6.917  7.845   1.00 0.00 ? 137 LEU A HA   4  
ATOM 9150  H HB2  . LEU A 1 137 ? -15.190 -4.643  8.554   1.00 0.00 ? 137 LEU A HB2  4  
ATOM 9151  H HB3  . LEU A 1 137 ? -15.018 -5.158  10.209  1.00 0.00 ? 137 LEU A HB3  4  
ATOM 9152  H HG   . LEU A 1 137 ? -12.915 -6.303  9.639   1.00 0.00 ? 137 LEU A HG   4  
ATOM 9153  H HD11 . LEU A 1 137 ? -13.312 -5.105  6.905   1.00 0.00 ? 137 LEU A HD11 4  
ATOM 9154  H HD12 . LEU A 1 137 ? -13.458 -6.824  7.275   1.00 0.00 ? 137 LEU A HD12 4  
ATOM 9155  H HD13 . LEU A 1 137 ? -11.904 -6.010  7.454   1.00 0.00 ? 137 LEU A HD13 4  
ATOM 9156  H HD21 . LEU A 1 137 ? -11.628 -4.247  9.168   1.00 0.00 ? 137 LEU A HD21 4  
ATOM 9157  H HD22 . LEU A 1 137 ? -12.865 -4.017  10.406  1.00 0.00 ? 137 LEU A HD22 4  
ATOM 9158  H HD23 . LEU A 1 137 ? -13.136 -3.434  8.769   1.00 0.00 ? 137 LEU A HD23 4  
ATOM 9159  N N    . SER A 1 138 ? -14.712 -8.872  9.067   1.00 0.00 ? 138 SER A N    4  
ATOM 9160  C CA   . SER A 1 138 ? -14.241 -10.072 9.719   1.00 0.00 ? 138 SER A CA   4  
ATOM 9161  C C    . SER A 1 138 ? -12.707 -10.024 9.907   1.00 0.00 ? 138 SER A C    4  
ATOM 9162  O O    . SER A 1 138 ? -12.014 -9.244  9.242   1.00 0.00 ? 138 SER A O    4  
ATOM 9163  C CB   . SER A 1 138 ? -14.648 -11.261 8.872   1.00 0.00 ? 138 SER A CB   4  
ATOM 9164  O OG   . SER A 1 138 ? -16.041 -11.193 8.565   1.00 0.00 ? 138 SER A OG   4  
ATOM 9165  H H    . SER A 1 138 ? -14.641 -8.799  8.089   1.00 0.00 ? 138 SER A H    4  
ATOM 9166  H HA   . SER A 1 138 ? -14.722 -10.143 10.682  1.00 0.00 ? 138 SER A HA   4  
ATOM 9167  H HB2  . SER A 1 138 ? -14.068 -11.270 7.963   1.00 0.00 ? 138 SER A HB2  4  
ATOM 9168  H HB3  . SER A 1 138 ? -14.463 -12.171 9.422   1.00 0.00 ? 138 SER A HB3  4  
ATOM 9169  H HG   . SER A 1 138 ? -16.248 -11.952 8.002   1.00 0.00 ? 138 SER A HG   4  
ATOM 9170  N N    . SER A 1 139 ? -12.211 -10.907 10.782  1.00 0.00 ? 139 SER A N    4  
ATOM 9171  C CA   . SER A 1 139 ? -10.834 -10.924 11.300  1.00 0.00 ? 139 SER A CA   4  
ATOM 9172  C C    . SER A 1 139 ? -9.707  -10.969 10.250  1.00 0.00 ? 139 SER A C    4  
ATOM 9173  O O    . SER A 1 139 ? -8.613  -10.464 10.517  1.00 0.00 ? 139 SER A O    4  
ATOM 9174  C CB   . SER A 1 139 ? -10.691 -12.093 12.253  1.00 0.00 ? 139 SER A CB   4  
ATOM 9175  O OG   . SER A 1 139 ? -11.761 -12.095 13.192  1.00 0.00 ? 139 SER A OG   4  
ATOM 9176  H H    . SER A 1 139 ? -12.804 -11.611 11.126  1.00 0.00 ? 139 SER A H    4  
ATOM 9177  H HA   . SER A 1 139 ? -10.706 -10.030 11.891  1.00 0.00 ? 139 SER A HA   4  
ATOM 9178  H HB2  . SER A 1 139 ? -10.706 -13.016 11.694  1.00 0.00 ? 139 SER A HB2  4  
ATOM 9179  H HB3  . SER A 1 139 ? -9.757  -12.010 12.791  1.00 0.00 ? 139 SER A HB3  4  
ATOM 9180  H HG   . SER A 1 139 ? -12.027 -11.177 13.329  1.00 0.00 ? 139 SER A HG   4  
ATOM 9181  N N    . ASP A 1 140 ? -9.941  -11.585 9.094   1.00 0.00 ? 140 ASP A N    4  
ATOM 9182  C CA   . ASP A 1 140 ? -8.874  -11.673 8.075   1.00 0.00 ? 140 ASP A CA   4  
ATOM 9183  C C    . ASP A 1 140 ? -8.896  -10.476 7.176   1.00 0.00 ? 140 ASP A C    4  
ATOM 9184  O O    . ASP A 1 140 ? -7.943  -10.190 6.480   1.00 0.00 ? 140 ASP A O    4  
ATOM 9185  C CB   . ASP A 1 140 ? -8.999  -12.955 7.212   1.00 0.00 ? 140 ASP A CB   4  
ATOM 9186  C CG   . ASP A 1 140 ? -7.869  -13.120 6.170   1.00 0.00 ? 140 ASP A CG   4  
ATOM 9187  O OD1  . ASP A 1 140 ? -6.785  -13.620 6.546   1.00 0.00 ? 140 ASP A OD1  4  
ATOM 9188  O OD2  . ASP A 1 140 ? -8.061  -12.806 4.983   1.00 0.00 ? 140 ASP A OD2  4  
ATOM 9189  H H    . ASP A 1 140 ? -10.817 -11.991 8.915   1.00 0.00 ? 140 ASP A H    4  
ATOM 9190  H HA   . ASP A 1 140 ? -7.933  -11.699 8.602   1.00 0.00 ? 140 ASP A HA   4  
ATOM 9191  H HB2  . ASP A 1 140 ? -8.984  -13.817 7.862   1.00 0.00 ? 140 ASP A HB2  4  
ATOM 9192  H HB3  . ASP A 1 140 ? -9.943  -12.929 6.689   1.00 0.00 ? 140 ASP A HB3  4  
ATOM 9193  N N    . GLY A 1 141 ? -9.934  -9.728  7.274   1.00 0.00 ? 141 GLY A N    4  
ATOM 9194  C CA   . GLY A 1 141 ? -10.118 -8.668  6.364   1.00 0.00 ? 141 GLY A CA   4  
ATOM 9195  C C    . GLY A 1 141 ? -11.092 -9.095  5.317   1.00 0.00 ? 141 GLY A C    4  
ATOM 9196  O O    . GLY A 1 141 ? -10.756 -9.271  4.165   1.00 0.00 ? 141 GLY A O    4  
ATOM 9197  H H    . GLY A 1 141 ? -10.577 -9.890  7.996   1.00 0.00 ? 141 GLY A H    4  
ATOM 9198  H HA2  . GLY A 1 141 ? -10.496 -7.805  6.893   1.00 0.00 ? 141 GLY A HA2  4  
ATOM 9199  H HA3  . GLY A 1 141 ? -9.178  -8.426  5.892   1.00 0.00 ? 141 GLY A HA3  4  
ATOM 9200  N N    . VAL A 1 142 ? -12.272 -9.382  5.747   1.00 0.00 ? 142 VAL A N    4  
ATOM 9201  C CA   . VAL A 1 142 ? -13.351 -9.692  4.852   1.00 0.00 ? 142 VAL A CA   4  
ATOM 9202  C C    . VAL A 1 142 ? -14.410 -8.663  5.161   1.00 0.00 ? 142 VAL A C    4  
ATOM 9203  O O    . VAL A 1 142 ? -14.815 -8.542  6.324   1.00 0.00 ? 142 VAL A O    4  
ATOM 9204  C CB   . VAL A 1 142 ? -13.938 -11.121 5.076   1.00 0.00 ? 142 VAL A CB   4  
ATOM 9205  C CG1  . VAL A 1 142 ? -15.024 -11.430 4.050   1.00 0.00 ? 142 VAL A CG1  4  
ATOM 9206  C CG2  . VAL A 1 142 ? -12.846 -12.182 5.029   1.00 0.00 ? 142 VAL A CG2  4  
ATOM 9207  H H    . VAL A 1 142 ? -12.444 -9.363  6.710   1.00 0.00 ? 142 VAL A H    4  
ATOM 9208  H HA   . VAL A 1 142 ? -13.008 -9.570  3.835   1.00 0.00 ? 142 VAL A HA   4  
ATOM 9209  H HB   . VAL A 1 142 ? -14.402 -11.142 6.050   1.00 0.00 ? 142 VAL A HB   4  
ATOM 9210  H HG11 . VAL A 1 142 ? -14.602 -11.394 3.056   1.00 0.00 ? 142 VAL A HG11 4  
ATOM 9211  H HG12 . VAL A 1 142 ? -15.812 -10.695 4.128   1.00 0.00 ? 142 VAL A HG12 4  
ATOM 9212  H HG13 . VAL A 1 142 ? -15.427 -12.415 4.236   1.00 0.00 ? 142 VAL A HG13 4  
ATOM 9213  H HG21 . VAL A 1 142 ? -12.370 -12.162 4.060   1.00 0.00 ? 142 VAL A HG21 4  
ATOM 9214  H HG22 . VAL A 1 142 ? -13.282 -13.156 5.194   1.00 0.00 ? 142 VAL A HG22 4  
ATOM 9215  H HG23 . VAL A 1 142 ? -12.110 -11.980 5.793   1.00 0.00 ? 142 VAL A HG23 4  
ATOM 9216  N N    . LEU A 1 143 ? -14.820 -7.900  4.194   1.00 0.00 ? 143 LEU A N    4  
ATOM 9217  C CA   . LEU A 1 143 ? -15.728 -6.808  4.464   1.00 0.00 ? 143 LEU A CA   4  
ATOM 9218  C C    . LEU A 1 143 ? -16.964 -6.831  3.592   1.00 0.00 ? 143 LEU A C    4  
ATOM 9219  O O    . LEU A 1 143 ? -16.895 -7.111  2.419   1.00 0.00 ? 143 LEU A O    4  
ATOM 9220  C CB   . LEU A 1 143 ? -14.973 -5.462  4.362   1.00 0.00 ? 143 LEU A CB   4  
ATOM 9221  C CG   . LEU A 1 143 ? -15.810 -4.172  4.221   1.00 0.00 ? 143 LEU A CG   4  
ATOM 9222  C CD1  . LEU A 1 143 ? -16.735 -3.988  5.373   1.00 0.00 ? 143 LEU A CD1  4  
ATOM 9223  C CD2  . LEU A 1 143 ? -14.923 -2.958  4.095   1.00 0.00 ? 143 LEU A CD2  4  
ATOM 9224  H H    . LEU A 1 143 ? -14.532 -8.059  3.266   1.00 0.00 ? 143 LEU A H    4  
ATOM 9225  H HA   . LEU A 1 143 ? -16.049 -6.919  5.489   1.00 0.00 ? 143 LEU A HA   4  
ATOM 9226  H HB2  . LEU A 1 143 ? -14.396 -5.370  5.269   1.00 0.00 ? 143 LEU A HB2  4  
ATOM 9227  H HB3  . LEU A 1 143 ? -14.275 -5.527  3.545   1.00 0.00 ? 143 LEU A HB3  4  
ATOM 9228  H HG   . LEU A 1 143 ? -16.407 -4.236  3.324   1.00 0.00 ? 143 LEU A HG   4  
ATOM 9229  H HD11 . LEU A 1 143 ? -17.368 -4.856  5.471   1.00 0.00 ? 143 LEU A HD11 4  
ATOM 9230  H HD12 . LEU A 1 143 ? -17.351 -3.126  5.170   1.00 0.00 ? 143 LEU A HD12 4  
ATOM 9231  H HD13 . LEU A 1 143 ? -16.172 -3.837  6.282   1.00 0.00 ? 143 LEU A HD13 4  
ATOM 9232  H HD21 . LEU A 1 143 ? -14.368 -3.019  3.173   1.00 0.00 ? 143 LEU A HD21 4  
ATOM 9233  H HD22 . LEU A 1 143 ? -14.244 -2.909  4.935   1.00 0.00 ? 143 LEU A HD22 4  
ATOM 9234  H HD23 . LEU A 1 143 ? -15.542 -2.073  4.080   1.00 0.00 ? 143 LEU A HD23 4  
ATOM 9235  N N    . THR A 1 144 ? -18.091 -6.618  4.208   1.00 0.00 ? 144 THR A N    4  
ATOM 9236  C CA   . THR A 1 144 ? -19.323 -6.431  3.507   1.00 0.00 ? 144 THR A CA   4  
ATOM 9237  C C    . THR A 1 144 ? -19.921 -5.050  3.878   1.00 0.00 ? 144 THR A C    4  
ATOM 9238  O O    . THR A 1 144 ? -20.196 -4.781  5.054   1.00 0.00 ? 144 THR A O    4  
ATOM 9239  C CB   . THR A 1 144 ? -20.313 -7.562  3.836   1.00 0.00 ? 144 THR A CB   4  
ATOM 9240  O OG1  . THR A 1 144 ? -19.682 -8.823  3.566   1.00 0.00 ? 144 THR A OG1  4  
ATOM 9241  C CG2  . THR A 1 144 ? -21.562 -7.446  2.983   1.00 0.00 ? 144 THR A CG2  4  
ATOM 9242  H H    . THR A 1 144 ? -18.093 -6.592  5.192   1.00 0.00 ? 144 THR A H    4  
ATOM 9243  H HA   . THR A 1 144 ? -19.104 -6.443  2.450   1.00 0.00 ? 144 THR A HA   4  
ATOM 9244  H HB   . THR A 1 144 ? -20.582 -7.506  4.880   1.00 0.00 ? 144 THR A HB   4  
ATOM 9245  H HG1  . THR A 1 144 ? -18.780 -8.766  3.909   1.00 0.00 ? 144 THR A HG1  4  
ATOM 9246  H HG21 . THR A 1 144 ? -22.056 -6.508  3.190   1.00 0.00 ? 144 THR A HG21 4  
ATOM 9247  H HG22 . THR A 1 144 ? -22.227 -8.267  3.201   1.00 0.00 ? 144 THR A HG22 4  
ATOM 9248  H HG23 . THR A 1 144 ? -21.285 -7.481  1.939   1.00 0.00 ? 144 THR A HG23 4  
ATOM 9249  N N    . VAL A 1 145 ? -20.078 -4.203  2.903   1.00 0.00 ? 145 VAL A N    4  
ATOM 9250  C CA   . VAL A 1 145 ? -20.652 -2.897  3.089   1.00 0.00 ? 145 VAL A CA   4  
ATOM 9251  C C    . VAL A 1 145 ? -22.049 -2.977  2.476   1.00 0.00 ? 145 VAL A C    4  
ATOM 9252  O O    . VAL A 1 145 ? -22.182 -3.249  1.296   1.00 0.00 ? 145 VAL A O    4  
ATOM 9253  C CB   . VAL A 1 145 ? -19.809 -1.829  2.315   1.00 0.00 ? 145 VAL A CB   4  
ATOM 9254  C CG1  . VAL A 1 145 ? -20.205 -0.425  2.689   1.00 0.00 ? 145 VAL A CG1  4  
ATOM 9255  C CG2  . VAL A 1 145 ? -18.315 -2.029  2.518   1.00 0.00 ? 145 VAL A CG2  4  
ATOM 9256  H H    . VAL A 1 145 ? -19.846 -4.460  1.981   1.00 0.00 ? 145 VAL A H    4  
ATOM 9257  H HA   . VAL A 1 145 ? -20.703 -2.653  4.140   1.00 0.00 ? 145 VAL A HA   4  
ATOM 9258  H HB   . VAL A 1 145 ? -20.023 -1.955  1.264   1.00 0.00 ? 145 VAL A HB   4  
ATOM 9259  H HG11 . VAL A 1 145 ? -21.247 -0.274  2.450   1.00 0.00 ? 145 VAL A HG11 4  
ATOM 9260  H HG12 . VAL A 1 145 ? -19.602 0.280   2.137   1.00 0.00 ? 145 VAL A HG12 4  
ATOM 9261  H HG13 . VAL A 1 145 ? -20.055 -0.276  3.747   1.00 0.00 ? 145 VAL A HG13 4  
ATOM 9262  H HG21 . VAL A 1 145 ? -18.038 -3.018  2.182   1.00 0.00 ? 145 VAL A HG21 4  
ATOM 9263  H HG22 . VAL A 1 145 ? -18.079 -1.927  3.567   1.00 0.00 ? 145 VAL A HG22 4  
ATOM 9264  H HG23 . VAL A 1 145 ? -17.770 -1.287  1.952   1.00 0.00 ? 145 VAL A HG23 4  
ATOM 9265  N N    . ASN A 1 146 ? -23.073 -2.741  3.241   1.00 0.00 ? 146 ASN A N    4  
ATOM 9266  C CA   . ASN A 1 146 ? -24.419 -2.958  2.731   1.00 0.00 ? 146 ASN A CA   4  
ATOM 9267  C C    . ASN A 1 146 ? -25.392 -1.878  3.157   1.00 0.00 ? 146 ASN A C    4  
ATOM 9268  O O    . ASN A 1 146 ? -25.158 -1.165  4.135   1.00 0.00 ? 146 ASN A O    4  
ATOM 9269  C CB   . ASN A 1 146 ? -24.947 -4.346  3.137   1.00 0.00 ? 146 ASN A CB   4  
ATOM 9270  C CG   . ASN A 1 146 ? -25.187 -4.502  4.631   1.00 0.00 ? 146 ASN A CG   4  
ATOM 9271  O OD1  . ASN A 1 146 ? -26.281 -4.229  5.133   1.00 0.00 ? 146 ASN A OD1  4  
ATOM 9272  N ND2  . ASN A 1 146 ? -24.184 -4.949  5.342   1.00 0.00 ? 146 ASN A ND2  4  
ATOM 9273  H H    . ASN A 1 146 ? -22.933 -2.402  4.154   1.00 0.00 ? 146 ASN A H    4  
ATOM 9274  H HA   . ASN A 1 146 ? -24.354 -2.934  1.654   1.00 0.00 ? 146 ASN A HA   4  
ATOM 9275  H HB2  . ASN A 1 146 ? -25.877 -4.524  2.622   1.00 0.00 ? 146 ASN A HB2  4  
ATOM 9276  H HB3  . ASN A 1 146 ? -24.232 -5.093  2.825   1.00 0.00 ? 146 ASN A HB3  4  
ATOM 9277  H HD21 . ASN A 1 146 ? -23.344 -5.156  4.882   1.00 0.00 ? 146 ASN A HD21 4  
ATOM 9278  H HD22 . ASN A 1 146 ? -24.302 -5.075  6.309   1.00 0.00 ? 146 ASN A HD22 4  
ATOM 9279  N N    . GLY A 1 147 ? -26.477 -1.778  2.418   1.00 0.00 ? 147 GLY A N    4  
ATOM 9280  C CA   . GLY A 1 147 ? -27.517 -0.821  2.674   1.00 0.00 ? 147 GLY A CA   4  
ATOM 9281  C C    . GLY A 1 147 ? -28.616 -0.937  1.627   1.00 0.00 ? 147 GLY A C    4  
ATOM 9282  O O    . GLY A 1 147 ? -29.017 -2.046  1.300   1.00 0.00 ? 147 GLY A O    4  
ATOM 9283  H H    . GLY A 1 147 ? -26.584 -2.395  1.657   1.00 0.00 ? 147 GLY A H    4  
ATOM 9284  H HA2  . GLY A 1 147 ? -27.933 -1.026  3.650   1.00 0.00 ? 147 GLY A HA2  4  
ATOM 9285  H HA3  . GLY A 1 147 ? -27.120 0.180   2.668   1.00 0.00 ? 147 GLY A HA3  4  
ATOM 9286  N N    . PRO A 1 148 ? -29.142 0.165   1.092   1.00 0.00 ? 148 PRO A N    4  
ATOM 9287  C CA   . PRO A 1 148 ? -30.181 0.145   0.080   1.00 0.00 ? 148 PRO A CA   4  
ATOM 9288  C C    . PRO A 1 148 ? -29.670 0.465   -1.341  1.00 0.00 ? 148 PRO A C    4  
ATOM 9289  O O    . PRO A 1 148 ? -28.689 1.211   -1.539  1.00 0.00 ? 148 PRO A O    4  
ATOM 9290  C CB   . PRO A 1 148 ? -31.093 1.268   0.554   1.00 0.00 ? 148 PRO A CB   4  
ATOM 9291  C CG   . PRO A 1 148 ? -30.197 2.209   1.312   1.00 0.00 ? 148 PRO A CG   4  
ATOM 9292  C CD   . PRO A 1 148 ? -28.842 1.534   1.455   1.00 0.00 ? 148 PRO A CD   4  
ATOM 9293  H HA   . PRO A 1 148 ? -30.737 -0.780  0.077   1.00 0.00 ? 148 PRO A HA   4  
ATOM 9294  H HB2  . PRO A 1 148 ? -31.546 1.750   -0.299  1.00 0.00 ? 148 PRO A HB2  4  
ATOM 9295  H HB3  . PRO A 1 148 ? -31.862 0.864   1.194   1.00 0.00 ? 148 PRO A HB3  4  
ATOM 9296  H HG2  . PRO A 1 148 ? -30.098 3.135   0.766   1.00 0.00 ? 148 PRO A HG2  4  
ATOM 9297  H HG3  . PRO A 1 148 ? -30.629 2.401   2.282   1.00 0.00 ? 148 PRO A HG3  4  
ATOM 9298  H HD2  . PRO A 1 148 ? -28.134 1.967   0.764   1.00 0.00 ? 148 PRO A HD2  4  
ATOM 9299  H HD3  . PRO A 1 148 ? -28.474 1.605   2.466   1.00 0.00 ? 148 PRO A HD3  4  
ATOM 9300  N N    . ARG A 1 149 ? -30.328 -0.105  -2.307  1.00 0.00 ? 149 ARG A N    4  
ATOM 9301  C CA   . ARG A 1 149 ? -30.041 0.144   -3.695  1.00 0.00 ? 149 ARG A CA   4  
ATOM 9302  C C    . ARG A 1 149 ? -31.088 1.120   -4.198  1.00 0.00 ? 149 ARG A C    4  
ATOM 9303  O O    . ARG A 1 149 ? -32.172 1.222   -3.604  1.00 0.00 ? 149 ARG A O    4  
ATOM 9304  C CB   . ARG A 1 149 ? -30.127 -1.167  -4.467  1.00 0.00 ? 149 ARG A CB   4  
ATOM 9305  C CG   . ARG A 1 149 ? -29.766 -1.087  -5.932  1.00 0.00 ? 149 ARG A CG   4  
ATOM 9306  C CD   . ARG A 1 149 ? -29.885 -2.453  -6.536  1.00 0.00 ? 149 ARG A CD   4  
ATOM 9307  N NE   . ARG A 1 149 ? -29.592 -2.488  -7.953  1.00 0.00 ? 149 ARG A NE   4  
ATOM 9308  C CZ   . ARG A 1 149 ? -30.007 -3.452  -8.770  1.00 0.00 ? 149 ARG A CZ   4  
ATOM 9309  N NH1  . ARG A 1 149 ? -30.745 -4.473  -8.297  1.00 0.00 ? 149 ARG A NH1  4  
ATOM 9310  N NH2  . ARG A 1 149 ? -29.677 -3.419  -10.049 1.00 0.00 ? 149 ARG A NH2  4  
ATOM 9311  H H    . ARG A 1 149 ? -31.063 -0.729  -2.109  1.00 0.00 ? 149 ARG A H    4  
ATOM 9312  H HA   . ARG A 1 149 ? -29.054 0.570   -3.790  1.00 0.00 ? 149 ARG A HA   4  
ATOM 9313  H HB2  . ARG A 1 149 ? -29.476 -1.894  -4.008  1.00 0.00 ? 149 ARG A HB2  4  
ATOM 9314  H HB3  . ARG A 1 149 ? -31.141 -1.529  -4.393  1.00 0.00 ? 149 ARG A HB3  4  
ATOM 9315  H HG2  . ARG A 1 149 ? -30.443 -0.411  -6.434  1.00 0.00 ? 149 ARG A HG2  4  
ATOM 9316  H HG3  . ARG A 1 149 ? -28.749 -0.739  -6.036  1.00 0.00 ? 149 ARG A HG3  4  
ATOM 9317  H HD2  . ARG A 1 149 ? -29.186 -3.104  -6.036  1.00 0.00 ? 149 ARG A HD2  4  
ATOM 9318  H HD3  . ARG A 1 149 ? -30.889 -2.816  -6.376  1.00 0.00 ? 149 ARG A HD3  4  
ATOM 9319  H HE   . ARG A 1 149 ? -29.039 -1.727  -8.275  1.00 0.00 ? 149 ARG A HE   4  
ATOM 9320  H HH11 . ARG A 1 149 ? -31.000 -4.545  -7.322  1.00 0.00 ? 149 ARG A HH11 4  
ATOM 9321  H HH12 . ARG A 1 149 ? -31.099 -5.200  -8.890  1.00 0.00 ? 149 ARG A HH12 4  
ATOM 9322  H HH21 . ARG A 1 149 ? -29.110 -2.687  -10.437 1.00 0.00 ? 149 ARG A HH21 4  
ATOM 9323  H HH22 . ARG A 1 149 ? -29.996 -4.113  -10.699 1.00 0.00 ? 149 ARG A HH22 4  
ATOM 9324  N N    . LYS A 1 150 ? -30.769 1.873   -5.201  1.00 0.00 ? 150 LYS A N    4  
ATOM 9325  C CA   . LYS A 1 150 ? -31.701 2.810   -5.741  1.00 0.00 ? 150 LYS A CA   4  
ATOM 9326  C C    . LYS A 1 150 ? -32.052 2.413   -7.162  1.00 0.00 ? 150 LYS A C    4  
ATOM 9327  O O    . LYS A 1 150 ? -33.125 1.817   -7.383  1.00 0.00 ? 150 LYS A O    4  
ATOM 9328  C CB   . LYS A 1 150 ? -31.130 4.221   -5.651  1.00 0.00 ? 150 LYS A CB   4  
ATOM 9329  C CG   . LYS A 1 150 ? -32.129 5.320   -5.980  1.00 0.00 ? 150 LYS A CG   4  
ATOM 9330  C CD   . LYS A 1 150 ? -31.587 6.699   -5.617  1.00 0.00 ? 150 LYS A CD   4  
ATOM 9331  C CE   . LYS A 1 150 ? -31.343 6.814   -4.117  1.00 0.00 ? 150 LYS A CE   4  
ATOM 9332  N NZ   . LYS A 1 150 ? -30.813 8.128   -3.712  1.00 0.00 ? 150 LYS A NZ   4  
ATOM 9333  H H    . LYS A 1 150 ? -29.895 1.787   -5.637  1.00 0.00 ? 150 LYS A H    4  
ATOM 9334  H HA   . LYS A 1 150 ? -32.597 2.754   -5.142  1.00 0.00 ? 150 LYS A HA   4  
ATOM 9335  H HB2  . LYS A 1 150 ? -30.773 4.356   -4.642  1.00 0.00 ? 150 LYS A HB2  4  
ATOM 9336  H HB3  . LYS A 1 150 ? -30.293 4.298   -6.329  1.00 0.00 ? 150 LYS A HB3  4  
ATOM 9337  H HG2  . LYS A 1 150 ? -32.364 5.291   -7.033  1.00 0.00 ? 150 LYS A HG2  4  
ATOM 9338  H HG3  . LYS A 1 150 ? -33.023 5.133   -5.404  1.00 0.00 ? 150 LYS A HG3  4  
ATOM 9339  H HD2  . LYS A 1 150 ? -30.648 6.844   -6.129  1.00 0.00 ? 150 LYS A HD2  4  
ATOM 9340  H HD3  . LYS A 1 150 ? -32.294 7.457   -5.922  1.00 0.00 ? 150 LYS A HD3  4  
ATOM 9341  H HE2  . LYS A 1 150 ? -32.270 6.639   -3.592  1.00 0.00 ? 150 LYS A HE2  4  
ATOM 9342  H HE3  . LYS A 1 150 ? -30.631 6.059   -3.826  1.00 0.00 ? 150 LYS A HE3  4  
ATOM 9343  H HZ1  . LYS A 1 150 ? -31.500 8.899   -3.827  1.00 0.00 ? 150 LYS A HZ1  4  
ATOM 9344  H HZ2  . LYS A 1 150 ? -29.940 8.346   -4.235  1.00 0.00 ? 150 LYS A HZ2  4  
ATOM 9345  H HZ3  . LYS A 1 150 ? -30.546 8.056   -2.705  1.00 0.00 ? 150 LYS A HZ3  4  
ATOM 9346  N N    . ARG B 1 69  ? 35.548  6.196   10.390  1.00 0.00 ? 69  ARG B N    4  
ATOM 9347  C CA   . ARG B 1 69  ? 36.184  4.936   10.165  1.00 0.00 ? 69  ARG B CA   4  
ATOM 9348  C C    . ARG B 1 69  ? 35.575  4.301   8.940   1.00 0.00 ? 69  ARG B C    4  
ATOM 9349  O O    . ARG B 1 69  ? 34.394  3.990   8.931   1.00 0.00 ? 69  ARG B O    4  
ATOM 9350  C CB   . ARG B 1 69  ? 36.022  4.035   11.392  1.00 0.00 ? 69  ARG B CB   4  
ATOM 9351  C CG   . ARG B 1 69  ? 36.568  2.628   11.212  1.00 0.00 ? 69  ARG B CG   4  
ATOM 9352  C CD   . ARG B 1 69  ? 36.458  1.828   12.493  1.00 0.00 ? 69  ARG B CD   4  
ATOM 9353  N NE   . ARG B 1 69  ? 36.839  0.429   12.292  1.00 0.00 ? 69  ARG B NE   4  
ATOM 9354  C CZ   . ARG B 1 69  ? 37.293  -0.404  13.236  1.00 0.00 ? 69  ARG B CZ   4  
ATOM 9355  N NH1  . ARG B 1 69  ? 37.488  0.021   14.469  1.00 0.00 ? 69  ARG B NH1  4  
ATOM 9356  N NH2  . ARG B 1 69  ? 37.528  -1.671  12.933  1.00 0.00 ? 69  ARG B NH2  4  
ATOM 9357  H H    . ARG B 1 69  ? 34.671  6.216   10.830  1.00 0.00 ? 69  ARG B H    4  
ATOM 9358  H HA   . ARG B 1 69  ? 37.235  5.116   9.992   1.00 0.00 ? 69  ARG B HA   4  
ATOM 9359  H HB2  . ARG B 1 69  ? 36.535  4.488   12.228  1.00 0.00 ? 69  ARG B HB2  4  
ATOM 9360  H HB3  . ARG B 1 69  ? 34.971  3.961   11.629  1.00 0.00 ? 69  ARG B HB3  4  
ATOM 9361  H HG2  . ARG B 1 69  ? 36.008  2.127   10.437  1.00 0.00 ? 69  ARG B HG2  4  
ATOM 9362  H HG3  . ARG B 1 69  ? 37.607  2.690   10.923  1.00 0.00 ? 69  ARG B HG3  4  
ATOM 9363  H HD2  . ARG B 1 69  ? 37.118  2.268   13.226  1.00 0.00 ? 69  ARG B HD2  4  
ATOM 9364  H HD3  . ARG B 1 69  ? 35.440  1.870   12.849  1.00 0.00 ? 69  ARG B HD3  4  
ATOM 9365  H HE   . ARG B 1 69  ? 36.687  0.089   11.382  1.00 0.00 ? 69  ARG B HE   4  
ATOM 9366  H HH11 . ARG B 1 69  ? 37.305  0.969   14.738  1.00 0.00 ? 69  ARG B HH11 4  
ATOM 9367  H HH12 . ARG B 1 69  ? 37.819  -0.579  15.202  1.00 0.00 ? 69  ARG B HH12 4  
ATOM 9368  H HH21 . ARG B 1 69  ? 37.372  -2.027  12.009  1.00 0.00 ? 69  ARG B HH21 4  
ATOM 9369  H HH22 . ARG B 1 69  ? 37.871  -2.336  13.602  1.00 0.00 ? 69  ARG B HH22 4  
ATOM 9370  N N    . LEU B 1 70  ? 36.353  4.180   7.901   1.00 0.00 ? 70  LEU B N    4  
ATOM 9371  C CA   . LEU B 1 70  ? 35.881  3.582   6.678   1.00 0.00 ? 70  LEU B CA   4  
ATOM 9372  C C    . LEU B 1 70  ? 36.470  2.195   6.543   1.00 0.00 ? 70  LEU B C    4  
ATOM 9373  O O    . LEU B 1 70  ? 37.680  2.047   6.277   1.00 0.00 ? 70  LEU B O    4  
ATOM 9374  C CB   . LEU B 1 70  ? 36.259  4.428   5.424   1.00 0.00 ? 70  LEU B CB   4  
ATOM 9375  C CG   . LEU B 1 70  ? 35.666  5.854   5.270   1.00 0.00 ? 70  LEU B CG   4  
ATOM 9376  C CD1  . LEU B 1 70  ? 36.245  6.839   6.272   1.00 0.00 ? 70  LEU B CD1  4  
ATOM 9377  C CD2  . LEU B 1 70  ? 35.872  6.360   3.853   1.00 0.00 ? 70  LEU B CD2  4  
ATOM 9378  H H    . LEU B 1 70  ? 37.282  4.493   7.943   1.00 0.00 ? 70  LEU B H    4  
ATOM 9379  H HA   . LEU B 1 70  ? 34.806  3.504   6.737   1.00 0.00 ? 70  LEU B HA   4  
ATOM 9380  H HB2  . LEU B 1 70  ? 37.333  4.530   5.417   1.00 0.00 ? 70  LEU B HB2  4  
ATOM 9381  H HB3  . LEU B 1 70  ? 35.977  3.855   4.553   1.00 0.00 ? 70  LEU B HB3  4  
ATOM 9382  H HG   . LEU B 1 70  ? 34.603  5.813   5.452   1.00 0.00 ? 70  LEU B HG   4  
ATOM 9383  H HD11 . LEU B 1 70  ? 37.311  6.922   6.125   1.00 0.00 ? 70  LEU B HD11 4  
ATOM 9384  H HD12 . LEU B 1 70  ? 36.047  6.487   7.275   1.00 0.00 ? 70  LEU B HD12 4  
ATOM 9385  H HD13 . LEU B 1 70  ? 35.785  7.805   6.133   1.00 0.00 ? 70  LEU B HD13 4  
ATOM 9386  H HD21 . LEU B 1 70  ? 36.929  6.386   3.633   1.00 0.00 ? 70  LEU B HD21 4  
ATOM 9387  H HD22 . LEU B 1 70  ? 35.462  7.355   3.762   1.00 0.00 ? 70  LEU B HD22 4  
ATOM 9388  H HD23 . LEU B 1 70  ? 35.374  5.701   3.158   1.00 0.00 ? 70  LEU B HD23 4  
ATOM 9389  N N    . GLU B 1 71  ? 35.668  1.191   6.754   1.00 0.00 ? 71  GLU B N    4  
ATOM 9390  C CA   . GLU B 1 71  ? 36.126  -0.166  6.600   1.00 0.00 ? 71  GLU B CA   4  
ATOM 9391  C C    . GLU B 1 71  ? 35.875  -0.569  5.170   1.00 0.00 ? 71  GLU B C    4  
ATOM 9392  O O    . GLU B 1 71  ? 34.856  -0.194  4.593   1.00 0.00 ? 71  GLU B O    4  
ATOM 9393  C CB   . GLU B 1 71  ? 35.368  -1.115  7.538   1.00 0.00 ? 71  GLU B CB   4  
ATOM 9394  C CG   . GLU B 1 71  ? 35.901  -2.544  7.509   1.00 0.00 ? 71  GLU B CG   4  
ATOM 9395  C CD   . GLU B 1 71  ? 35.086  -3.515  8.327   1.00 0.00 ? 71  GLU B CD   4  
ATOM 9396  O OE1  . GLU B 1 71  ? 35.024  -3.370  9.566   1.00 0.00 ? 71  GLU B OE1  4  
ATOM 9397  O OE2  . GLU B 1 71  ? 34.560  -4.480  7.760   1.00 0.00 ? 71  GLU B OE2  4  
ATOM 9398  H H    . GLU B 1 71  ? 34.720  1.349   6.997   1.00 0.00 ? 71  GLU B H    4  
ATOM 9399  H HA   . GLU B 1 71  ? 37.184  -0.207  6.812   1.00 0.00 ? 71  GLU B HA   4  
ATOM 9400  H HB2  . GLU B 1 71  ? 35.453  -0.741  8.548   1.00 0.00 ? 71  GLU B HB2  4  
ATOM 9401  H HB3  . GLU B 1 71  ? 34.326  -1.134  7.253   1.00 0.00 ? 71  GLU B HB3  4  
ATOM 9402  H HG2  . GLU B 1 71  ? 35.904  -2.885  6.484   1.00 0.00 ? 71  GLU B HG2  4  
ATOM 9403  H HG3  . GLU B 1 71  ? 36.913  -2.536  7.880   1.00 0.00 ? 71  GLU B HG3  4  
ATOM 9404  N N    . LYS B 1 72  ? 36.775  -1.300  4.569   1.00 0.00 ? 72  LYS B N    4  
ATOM 9405  C CA   . LYS B 1 72  ? 36.522  -1.724  3.232   1.00 0.00 ? 72  LYS B CA   4  
ATOM 9406  C C    . LYS B 1 72  ? 35.744  -3.010  3.271   1.00 0.00 ? 72  LYS B C    4  
ATOM 9407  O O    . LYS B 1 72  ? 36.280  -4.087  3.558   1.00 0.00 ? 72  LYS B O    4  
ATOM 9408  C CB   . LYS B 1 72  ? 37.805  -1.876  2.418   1.00 0.00 ? 72  LYS B CB   4  
ATOM 9409  C CG   . LYS B 1 72  ? 38.615  -0.592  2.304   1.00 0.00 ? 72  LYS B CG   4  
ATOM 9410  C CD   . LYS B 1 72  ? 39.764  -0.723  1.310   1.00 0.00 ? 72  LYS B CD   4  
ATOM 9411  C CE   . LYS B 1 72  ? 39.245  -0.941  -0.109  1.00 0.00 ? 72  LYS B CE   4  
ATOM 9412  N NZ   . LYS B 1 72  ? 40.327  -0.989  -1.107  1.00 0.00 ? 72  LYS B NZ   4  
ATOM 9413  H H    . LYS B 1 72  ? 37.594  -1.572  5.034   1.00 0.00 ? 72  LYS B H    4  
ATOM 9414  H HA   . LYS B 1 72  ? 35.897  -0.972  2.776   1.00 0.00 ? 72  LYS B HA   4  
ATOM 9415  H HB2  . LYS B 1 72  ? 38.422  -2.636  2.874   1.00 0.00 ? 72  LYS B HB2  4  
ATOM 9416  H HB3  . LYS B 1 72  ? 37.533  -2.200  1.425   1.00 0.00 ? 72  LYS B HB3  4  
ATOM 9417  H HG2  . LYS B 1 72  ? 37.961  0.203   1.977   1.00 0.00 ? 72  LYS B HG2  4  
ATOM 9418  H HG3  . LYS B 1 72  ? 39.014  -0.348  3.277   1.00 0.00 ? 72  LYS B HG3  4  
ATOM 9419  H HD2  . LYS B 1 72  ? 40.355  0.180   1.334   1.00 0.00 ? 72  LYS B HD2  4  
ATOM 9420  H HD3  . LYS B 1 72  ? 40.379  -1.565  1.593   1.00 0.00 ? 72  LYS B HD3  4  
ATOM 9421  H HE2  . LYS B 1 72  ? 38.712  -1.879  -0.154  1.00 0.00 ? 72  LYS B HE2  4  
ATOM 9422  H HE3  . LYS B 1 72  ? 38.569  -0.137  -0.362  1.00 0.00 ? 72  LYS B HE3  4  
ATOM 9423  H HZ1  . LYS B 1 72  ? 39.915  -1.100  -2.056  1.00 0.00 ? 72  LYS B HZ1  4  
ATOM 9424  H HZ2  . LYS B 1 72  ? 40.974  -1.781  -0.932  1.00 0.00 ? 72  LYS B HZ2  4  
ATOM 9425  H HZ3  . LYS B 1 72  ? 40.866  -0.099  -1.107  1.00 0.00 ? 72  LYS B HZ3  4  
ATOM 9426  N N    . ASP B 1 73  ? 34.490  -2.882  2.964   1.00 0.00 ? 73  ASP B N    4  
ATOM 9427  C CA   . ASP B 1 73  ? 33.540  -3.960  2.969   1.00 0.00 ? 73  ASP B CA   4  
ATOM 9428  C C    . ASP B 1 73  ? 32.411  -3.519  2.080   1.00 0.00 ? 73  ASP B C    4  
ATOM 9429  O O    . ASP B 1 73  ? 32.081  -2.325  2.043   1.00 0.00 ? 73  ASP B O    4  
ATOM 9430  C CB   . ASP B 1 73  ? 33.039  -4.218  4.414   1.00 0.00 ? 73  ASP B CB   4  
ATOM 9431  C CG   . ASP B 1 73  ? 32.059  -5.377  4.541   1.00 0.00 ? 73  ASP B CG   4  
ATOM 9432  O OD1  . ASP B 1 73  ? 32.294  -6.444  3.935   1.00 0.00 ? 73  ASP B OD1  4  
ATOM 9433  O OD2  . ASP B 1 73  ? 31.074  -5.269  5.310   1.00 0.00 ? 73  ASP B OD2  4  
ATOM 9434  H H    . ASP B 1 73  ? 34.139  -1.998  2.718   1.00 0.00 ? 73  ASP B H    4  
ATOM 9435  H HA   . ASP B 1 73  ? 34.004  -4.849  2.569   1.00 0.00 ? 73  ASP B HA   4  
ATOM 9436  H HB2  . ASP B 1 73  ? 33.890  -4.434  5.043   1.00 0.00 ? 73  ASP B HB2  4  
ATOM 9437  H HB3  . ASP B 1 73  ? 32.561  -3.320  4.776   1.00 0.00 ? 73  ASP B HB3  4  
ATOM 9438  N N    . ARG B 1 74  ? 31.864  -4.417  1.338   1.00 0.00 ? 74  ARG B N    4  
ATOM 9439  C CA   . ARG B 1 74  ? 30.813  -4.070  0.438   1.00 0.00 ? 74  ARG B CA   4  
ATOM 9440  C C    . ARG B 1 74  ? 29.511  -4.333  1.103   1.00 0.00 ? 74  ARG B C    4  
ATOM 9441  O O    . ARG B 1 74  ? 29.344  -5.331  1.814   1.00 0.00 ? 74  ARG B O    4  
ATOM 9442  C CB   . ARG B 1 74  ? 30.937  -4.812  -0.883  1.00 0.00 ? 74  ARG B CB   4  
ATOM 9443  C CG   . ARG B 1 74  ? 32.175  -4.420  -1.660  1.00 0.00 ? 74  ARG B CG   4  
ATOM 9444  C CD   . ARG B 1 74  ? 32.262  -5.141  -2.982  1.00 0.00 ? 74  ARG B CD   4  
ATOM 9445  N NE   . ARG B 1 74  ? 32.381  -6.593  -2.823  1.00 0.00 ? 74  ARG B NE   4  
ATOM 9446  C CZ   . ARG B 1 74  ? 33.318  -7.347  -3.410  1.00 0.00 ? 74  ARG B CZ   4  
ATOM 9447  N NH1  . ARG B 1 74  ? 34.296  -6.775  -4.114  1.00 0.00 ? 74  ARG B NH1  4  
ATOM 9448  N NH2  . ARG B 1 74  ? 33.282  -8.668  -3.284  1.00 0.00 ? 74  ARG B NH2  4  
ATOM 9449  H H    . ARG B 1 74  ? 32.150  -5.353  1.408   1.00 0.00 ? 74  ARG B H    4  
ATOM 9450  H HA   . ARG B 1 74  ? 30.889  -3.008  0.258   1.00 0.00 ? 74  ARG B HA   4  
ATOM 9451  H HB2  . ARG B 1 74  ? 30.972  -5.873  -0.689  1.00 0.00 ? 74  ARG B HB2  4  
ATOM 9452  H HB3  . ARG B 1 74  ? 30.073  -4.588  -1.491  1.00 0.00 ? 74  ARG B HB3  4  
ATOM 9453  H HG2  . ARG B 1 74  ? 32.150  -3.356  -1.845  1.00 0.00 ? 74  ARG B HG2  4  
ATOM 9454  H HG3  . ARG B 1 74  ? 33.045  -4.661  -1.067  1.00 0.00 ? 74  ARG B HG3  4  
ATOM 9455  H HD2  . ARG B 1 74  ? 31.366  -4.929  -3.546  1.00 0.00 ? 74  ARG B HD2  4  
ATOM 9456  H HD3  . ARG B 1 74  ? 33.122  -4.772  -3.520  1.00 0.00 ? 74  ARG B HD3  4  
ATOM 9457  H HE   . ARG B 1 74  ? 31.685  -7.013  -2.266  1.00 0.00 ? 74  ARG B HE   4  
ATOM 9458  H HH11 . ARG B 1 74  ? 34.362  -5.780  -4.227  1.00 0.00 ? 74  ARG B HH11 4  
ATOM 9459  H HH12 . ARG B 1 74  ? 35.011  -7.311  -4.564  1.00 0.00 ? 74  ARG B HH12 4  
ATOM 9460  H HH21 . ARG B 1 74  ? 32.567  -9.126  -2.750  1.00 0.00 ? 74  ARG B HH21 4  
ATOM 9461  H HH22 . ARG B 1 74  ? 33.955  -9.273  -3.714  1.00 0.00 ? 74  ARG B HH22 4  
ATOM 9462  N N    . PHE B 1 75  ? 28.607  -3.459  0.890   1.00 0.00 ? 75  PHE B N    4  
ATOM 9463  C CA   . PHE B 1 75  ? 27.388  -3.444  1.602   1.00 0.00 ? 75  PHE B CA   4  
ATOM 9464  C C    . PHE B 1 75  ? 26.275  -3.904  0.708   1.00 0.00 ? 75  PHE B C    4  
ATOM 9465  O O    . PHE B 1 75  ? 26.270  -3.601  -0.481  1.00 0.00 ? 75  PHE B O    4  
ATOM 9466  C CB   . PHE B 1 75  ? 27.132  -2.027  2.070   1.00 0.00 ? 75  PHE B CB   4  
ATOM 9467  C CG   . PHE B 1 75  ? 26.110  -1.927  3.122   1.00 0.00 ? 75  PHE B CG   4  
ATOM 9468  C CD1  . PHE B 1 75  ? 26.303  -2.570  4.319   1.00 0.00 ? 75  PHE B CD1  4  
ATOM 9469  C CD2  . PHE B 1 75  ? 24.965  -1.188  2.932   1.00 0.00 ? 75  PHE B CD2  4  
ATOM 9470  C CE1  . PHE B 1 75  ? 25.369  -2.485  5.312   1.00 0.00 ? 75  PHE B CE1  4  
ATOM 9471  C CE2  . PHE B 1 75  ? 24.026  -1.098  3.927   1.00 0.00 ? 75  PHE B CE2  4  
ATOM 9472  C CZ   . PHE B 1 75  ? 24.224  -1.748  5.120   1.00 0.00 ? 75  PHE B CZ   4  
ATOM 9473  H H    . PHE B 1 75  ? 28.734  -2.804  0.165   1.00 0.00 ? 75  PHE B H    4  
ATOM 9474  H HA   . PHE B 1 75  ? 27.468  -4.082  2.468   1.00 0.00 ? 75  PHE B HA   4  
ATOM 9475  H HB2  . PHE B 1 75  ? 28.046  -1.592  2.443   1.00 0.00 ? 75  PHE B HB2  4  
ATOM 9476  H HB3  . PHE B 1 75  ? 26.796  -1.445  1.225   1.00 0.00 ? 75  PHE B HB3  4  
ATOM 9477  H HD1  . PHE B 1 75  ? 27.200  -3.150  4.472   1.00 0.00 ? 75  PHE B HD1  4  
ATOM 9478  H HD2  . PHE B 1 75  ? 24.809  -0.677  1.994   1.00 0.00 ? 75  PHE B HD2  4  
ATOM 9479  H HE1  . PHE B 1 75  ? 25.536  -2.997  6.246   1.00 0.00 ? 75  PHE B HE1  4  
ATOM 9480  H HE2  . PHE B 1 75  ? 23.128  -0.521  3.770   1.00 0.00 ? 75  PHE B HE2  4  
ATOM 9481  H HZ   . PHE B 1 75  ? 23.486  -1.681  5.906   1.00 0.00 ? 75  PHE B HZ   4  
ATOM 9482  N N    . SER B 1 76  ? 25.393  -4.672  1.241   1.00 0.00 ? 76  SER B N    4  
ATOM 9483  C CA   . SER B 1 76  ? 24.265  -5.125  0.528   1.00 0.00 ? 76  SER B CA   4  
ATOM 9484  C C    . SER B 1 76  ? 23.053  -5.048  1.431   1.00 0.00 ? 76  SER B C    4  
ATOM 9485  O O    . SER B 1 76  ? 23.101  -5.489  2.578   1.00 0.00 ? 76  SER B O    4  
ATOM 9486  C CB   . SER B 1 76  ? 24.495  -6.569  0.050   1.00 0.00 ? 76  SER B CB   4  
ATOM 9487  O OG   . SER B 1 76  ? 23.444  -7.026  -0.792  1.00 0.00 ? 76  SER B OG   4  
ATOM 9488  H H    . SER B 1 76  ? 25.480  -4.972  2.172   1.00 0.00 ? 76  SER B H    4  
ATOM 9489  H HA   . SER B 1 76  ? 24.119  -4.491  -0.333  1.00 0.00 ? 76  SER B HA   4  
ATOM 9490  H HB2  . SER B 1 76  ? 25.420  -6.618  -0.504  1.00 0.00 ? 76  SER B HB2  4  
ATOM 9491  H HB3  . SER B 1 76  ? 24.559  -7.218  0.910   1.00 0.00 ? 76  SER B HB3  4  
ATOM 9492  H HG   . SER B 1 76  ? 22.755  -7.380  -0.213  1.00 0.00 ? 76  SER B HG   4  
ATOM 9493  N N    . VAL B 1 77  ? 22.016  -4.444  0.948   1.00 0.00 ? 77  VAL B N    4  
ATOM 9494  C CA   . VAL B 1 77  ? 20.747  -4.431  1.609   1.00 0.00 ? 77  VAL B CA   4  
ATOM 9495  C C    . VAL B 1 77  ? 19.818  -5.115  0.666   1.00 0.00 ? 77  VAL B C    4  
ATOM 9496  O O    . VAL B 1 77  ? 19.788  -4.791  -0.507  1.00 0.00 ? 77  VAL B O    4  
ATOM 9497  C CB   . VAL B 1 77  ? 20.193  -2.987  1.853   1.00 0.00 ? 77  VAL B CB   4  
ATOM 9498  C CG1  . VAL B 1 77  ? 18.885  -3.033  2.633   1.00 0.00 ? 77  VAL B CG1  4  
ATOM 9499  C CG2  . VAL B 1 77  ? 21.196  -2.125  2.574   1.00 0.00 ? 77  VAL B CG2  4  
ATOM 9500  H H    . VAL B 1 77  ? 22.068  -3.992  0.072   1.00 0.00 ? 77  VAL B H    4  
ATOM 9501  H HA   . VAL B 1 77  ? 20.814  -4.971  2.542   1.00 0.00 ? 77  VAL B HA   4  
ATOM 9502  H HB   . VAL B 1 77  ? 19.986  -2.547  0.888   1.00 0.00 ? 77  VAL B HB   4  
ATOM 9503  H HG11 . VAL B 1 77  ? 18.524  -2.029  2.797   1.00 0.00 ? 77  VAL B HG11 4  
ATOM 9504  H HG12 . VAL B 1 77  ? 19.053  -3.512  3.586   1.00 0.00 ? 77  VAL B HG12 4  
ATOM 9505  H HG13 . VAL B 1 77  ? 18.152  -3.594  2.072   1.00 0.00 ? 77  VAL B HG13 4  
ATOM 9506  H HG21 . VAL B 1 77  ? 20.782  -1.139  2.723   1.00 0.00 ? 77  VAL B HG21 4  
ATOM 9507  H HG22 . VAL B 1 77  ? 22.098  -2.052  1.984   1.00 0.00 ? 77  VAL B HG22 4  
ATOM 9508  H HG23 . VAL B 1 77  ? 21.427  -2.567  3.533   1.00 0.00 ? 77  VAL B HG23 4  
ATOM 9509  N N    . ASN B 1 78  ? 19.082  -6.027  1.118   1.00 0.00 ? 78  ASN B N    4  
ATOM 9510  C CA   . ASN B 1 78  ? 18.170  -6.678  0.243   1.00 0.00 ? 78  ASN B CA   4  
ATOM 9511  C C    . ASN B 1 78  ? 16.809  -6.290  0.653   1.00 0.00 ? 78  ASN B C    4  
ATOM 9512  O O    . ASN B 1 78  ? 16.579  -5.889  1.806   1.00 0.00 ? 78  ASN B O    4  
ATOM 9513  C CB   . ASN B 1 78  ? 18.327  -8.221  0.232   1.00 0.00 ? 78  ASN B CB   4  
ATOM 9514  C CG   . ASN B 1 78  ? 17.889  -8.905  1.518   1.00 0.00 ? 78  ASN B CG   4  
ATOM 9515  O OD1  . ASN B 1 78  ? 16.724  -9.267  1.676   1.00 0.00 ? 78  ASN B OD1  4  
ATOM 9516  N ND2  . ASN B 1 78  ? 18.810  -9.112  2.424   1.00 0.00 ? 78  ASN B ND2  4  
ATOM 9517  H H    . ASN B 1 78  ? 19.122  -6.278  2.065   1.00 0.00 ? 78  ASN B H    4  
ATOM 9518  H HA   . ASN B 1 78  ? 18.344  -6.293  -0.750  1.00 0.00 ? 78  ASN B HA   4  
ATOM 9519  H HB2  . ASN B 1 78  ? 17.732  -8.624  -0.573  1.00 0.00 ? 78  ASN B HB2  4  
ATOM 9520  H HB3  . ASN B 1 78  ? 19.364  -8.461  0.050   1.00 0.00 ? 78  ASN B HB3  4  
ATOM 9521  H HD21 . ASN B 1 78  ? 19.729  -8.819  2.230   1.00 0.00 ? 78  ASN B HD21 4  
ATOM 9522  H HD22 . ASN B 1 78  ? 18.547  -9.559  3.256   1.00 0.00 ? 78  ASN B HD22 4  
ATOM 9523  N N    . LEU B 1 79  ? 15.930  -6.369  -0.242  1.00 0.00 ? 79  LEU B N    4  
ATOM 9524  C CA   . LEU B 1 79  ? 14.617  -6.024  0.000   1.00 0.00 ? 79  LEU B CA   4  
ATOM 9525  C C    . LEU B 1 79  ? 13.766  -7.217  -0.213  1.00 0.00 ? 79  LEU B C    4  
ATOM 9526  O O    . LEU B 1 79  ? 13.823  -7.879  -1.275  1.00 0.00 ? 79  LEU B O    4  
ATOM 9527  C CB   . LEU B 1 79  ? 14.141  -4.935  -0.966  1.00 0.00 ? 79  LEU B CB   4  
ATOM 9528  C CG   . LEU B 1 79  ? 12.613  -4.711  -0.993  1.00 0.00 ? 79  LEU B CG   4  
ATOM 9529  C CD1  . LEU B 1 79  ? 12.140  -3.986  0.219   1.00 0.00 ? 79  LEU B CD1  4  
ATOM 9530  C CD2  . LEU B 1 79  ? 12.146  -4.021  -2.243  1.00 0.00 ? 79  LEU B CD2  4  
ATOM 9531  H H    . LEU B 1 79  ? 16.173  -6.712  -1.134  1.00 0.00 ? 79  LEU B H    4  
ATOM 9532  H HA   . LEU B 1 79  ? 14.514  -5.649  1.007   1.00 0.00 ? 79  LEU B HA   4  
ATOM 9533  H HB2  . LEU B 1 79  ? 14.619  -4.008  -0.683  1.00 0.00 ? 79  LEU B HB2  4  
ATOM 9534  H HB3  . LEU B 1 79  ? 14.471  -5.205  -1.953  1.00 0.00 ? 79  LEU B HB3  4  
ATOM 9535  H HG   . LEU B 1 79  ? 12.147  -5.685  -0.956  1.00 0.00 ? 79  LEU B HG   4  
ATOM 9536  H HD11 . LEU B 1 79  ? 11.069  -3.860  0.170   1.00 0.00 ? 79  LEU B HD11 4  
ATOM 9537  H HD12 . LEU B 1 79  ? 12.616  -3.018  0.262   1.00 0.00 ? 79  LEU B HD12 4  
ATOM 9538  H HD13 . LEU B 1 79  ? 12.395  -4.556  1.100   1.00 0.00 ? 79  LEU B HD13 4  
ATOM 9539  H HD21 . LEU B 1 79  ? 12.420  -4.597  -3.113  1.00 0.00 ? 79  LEU B HD21 4  
ATOM 9540  H HD22 . LEU B 1 79  ? 12.589  -3.040  -2.299  1.00 0.00 ? 79  LEU B HD22 4  
ATOM 9541  H HD23 . LEU B 1 79  ? 11.070  -3.929  -2.207  1.00 0.00 ? 79  LEU B HD23 4  
ATOM 9542  N N    . ASP B 1 80  ? 12.988  -7.482  0.778   1.00 0.00 ? 80  ASP B N    4  
ATOM 9543  C CA   . ASP B 1 80  ? 11.993  -8.469  0.708   1.00 0.00 ? 80  ASP B CA   4  
ATOM 9544  C C    . ASP B 1 80  ? 10.693  -7.739  0.548   1.00 0.00 ? 80  ASP B C    4  
ATOM 9545  O O    . ASP B 1 80  ? 10.415  -6.739  1.236   1.00 0.00 ? 80  ASP B O    4  
ATOM 9546  C CB   . ASP B 1 80  ? 11.973  -9.394  1.942   1.00 0.00 ? 80  ASP B CB   4  
ATOM 9547  C CG   . ASP B 1 80  ? 11.503  -8.733  3.216   1.00 0.00 ? 80  ASP B CG   4  
ATOM 9548  O OD1  . ASP B 1 80  ? 12.299  -8.018  3.854   1.00 0.00 ? 80  ASP B OD1  4  
ATOM 9549  O OD2  . ASP B 1 80  ? 10.332  -8.927  3.610   1.00 0.00 ? 80  ASP B OD2  4  
ATOM 9550  H H    . ASP B 1 80  ? 13.091  -6.983  1.613   1.00 0.00 ? 80  ASP B H    4  
ATOM 9551  H HA   . ASP B 1 80  ? 12.185  -9.047  -0.184  1.00 0.00 ? 80  ASP B HA   4  
ATOM 9552  H HB2  . ASP B 1 80  ? 11.315  -10.227 1.743   1.00 0.00 ? 80  ASP B HB2  4  
ATOM 9553  H HB3  . ASP B 1 80  ? 12.972  -9.771  2.099   1.00 0.00 ? 80  ASP B HB3  4  
ATOM 9554  N N    . VAL B 1 81  ? 9.979   -8.170  -0.389  1.00 0.00 ? 81  VAL B N    4  
ATOM 9555  C CA   . VAL B 1 81  ? 8.748   -7.621  -0.806  1.00 0.00 ? 81  VAL B CA   4  
ATOM 9556  C C    . VAL B 1 81  ? 8.030   -8.755  -1.510  1.00 0.00 ? 81  VAL B C    4  
ATOM 9557  O O    . VAL B 1 81  ? 8.653   -9.772  -1.833  1.00 0.00 ? 81  VAL B O    4  
ATOM 9558  C CB   . VAL B 1 81  ? 8.992   -6.374  -1.762  1.00 0.00 ? 81  VAL B CB   4  
ATOM 9559  C CG1  . VAL B 1 81  ? 9.870   -6.717  -2.935  1.00 0.00 ? 81  VAL B CG1  4  
ATOM 9560  C CG2  . VAL B 1 81  ? 7.702   -5.752  -2.258  1.00 0.00 ? 81  VAL B CG2  4  
ATOM 9561  H H    . VAL B 1 81  ? 10.268  -8.969  -0.885  1.00 0.00 ? 81  VAL B H    4  
ATOM 9562  H HA   . VAL B 1 81  ? 8.187   -7.317  0.066   1.00 0.00 ? 81  VAL B HA   4  
ATOM 9563  H HB   . VAL B 1 81  ? 9.520   -5.632  -1.180  1.00 0.00 ? 81  VAL B HB   4  
ATOM 9564  H HG11 . VAL B 1 81  ? 10.831  -7.057  -2.578  1.00 0.00 ? 81  VAL B HG11 4  
ATOM 9565  H HG12 . VAL B 1 81  ? 10.003  -5.844  -3.556  1.00 0.00 ? 81  VAL B HG12 4  
ATOM 9566  H HG13 . VAL B 1 81  ? 9.407   -7.503  -3.514  1.00 0.00 ? 81  VAL B HG13 4  
ATOM 9567  H HG21 . VAL B 1 81  ? 7.133   -6.494  -2.800  1.00 0.00 ? 81  VAL B HG21 4  
ATOM 9568  H HG22 . VAL B 1 81  ? 7.926   -4.922  -2.911  1.00 0.00 ? 81  VAL B HG22 4  
ATOM 9569  H HG23 . VAL B 1 81  ? 7.122   -5.402  -1.415  1.00 0.00 ? 81  VAL B HG23 4  
ATOM 9570  N N    . LYS B 1 82  ? 6.753   -8.629  -1.673  1.00 0.00 ? 82  LYS B N    4  
ATOM 9571  C CA   . LYS B 1 82  ? 5.966   -9.641  -2.313  1.00 0.00 ? 82  LYS B CA   4  
ATOM 9572  C C    . LYS B 1 82  ? 5.856   -9.326  -3.784  1.00 0.00 ? 82  LYS B C    4  
ATOM 9573  O O    . LYS B 1 82  ? 6.613   -8.480  -4.259  1.00 0.00 ? 82  LYS B O    4  
ATOM 9574  C CB   . LYS B 1 82  ? 4.639   -9.782  -1.603  1.00 0.00 ? 82  LYS B CB   4  
ATOM 9575  C CG   . LYS B 1 82  ? 4.867   -10.137 -0.130  1.00 0.00 ? 82  LYS B CG   4  
ATOM 9576  C CD   . LYS B 1 82  ? 3.625   -10.066 0.737   1.00 0.00 ? 82  LYS B CD   4  
ATOM 9577  C CE   . LYS B 1 82  ? 3.992   -10.409 2.181   1.00 0.00 ? 82  LYS B CE   4  
ATOM 9578  N NZ   . LYS B 1 82  ? 2.856   -10.305 3.116   1.00 0.00 ? 82  LYS B NZ   4  
ATOM 9579  H H    . LYS B 1 82  ? 6.325   -7.801  -1.381  1.00 0.00 ? 82  LYS B H    4  
ATOM 9580  H HA   . LYS B 1 82  ? 6.521   -10.563 -2.221  1.00 0.00 ? 82  LYS B HA   4  
ATOM 9581  H HB2  . LYS B 1 82  ? 4.097   -8.849  -1.669  1.00 0.00 ? 82  LYS B HB2  4  
ATOM 9582  H HB3  . LYS B 1 82  ? 4.063   -10.574 -2.057  1.00 0.00 ? 82  LYS B HB3  4  
ATOM 9583  H HG2  . LYS B 1 82  ? 5.255   -11.143 -0.075  1.00 0.00 ? 82  LYS B HG2  4  
ATOM 9584  H HG3  . LYS B 1 82  ? 5.610   -9.460  0.265   1.00 0.00 ? 82  LYS B HG3  4  
ATOM 9585  H HD2  . LYS B 1 82  ? 3.216   -9.067  0.696   1.00 0.00 ? 82  LYS B HD2  4  
ATOM 9586  H HD3  . LYS B 1 82  ? 2.896   -10.778 0.379   1.00 0.00 ? 82  LYS B HD3  4  
ATOM 9587  H HE2  . LYS B 1 82  ? 4.368   -11.419 2.218   1.00 0.00 ? 82  LYS B HE2  4  
ATOM 9588  H HE3  . LYS B 1 82  ? 4.772   -9.734  2.503   1.00 0.00 ? 82  LYS B HE3  4  
ATOM 9589  H HZ1  . LYS B 1 82  ? 2.065   -10.904 2.805   1.00 0.00 ? 82  LYS B HZ1  4  
ATOM 9590  H HZ2  . LYS B 1 82  ? 2.537   -9.322  3.230   1.00 0.00 ? 82  LYS B HZ2  4  
ATOM 9591  H HZ3  . LYS B 1 82  ? 3.166   -10.647 4.048   1.00 0.00 ? 82  LYS B HZ3  4  
ATOM 9592  N N    . HIS B 1 83  ? 4.923   -9.906  -4.501  1.00 0.00 ? 83  HIS B N    4  
ATOM 9593  C CA   . HIS B 1 83  ? 4.998   -9.769  -5.930  1.00 0.00 ? 83  HIS B CA   4  
ATOM 9594  C C    . HIS B 1 83  ? 4.544   -8.411  -6.402  1.00 0.00 ? 83  HIS B C    4  
ATOM 9595  O O    . HIS B 1 83  ? 3.428   -7.951  -6.136  1.00 0.00 ? 83  HIS B O    4  
ATOM 9596  C CB   . HIS B 1 83  ? 4.204   -10.862 -6.665  1.00 0.00 ? 83  HIS B CB   4  
ATOM 9597  C CG   . HIS B 1 83  ? 4.423   -10.856 -8.164  1.00 0.00 ? 83  HIS B CG   4  
ATOM 9598  N ND1  . HIS B 1 83  ? 3.699   -10.082 -9.049  1.00 0.00 ? 83  HIS B ND1  4  
ATOM 9599  C CD2  . HIS B 1 83  ? 5.324   -11.509 -8.914  1.00 0.00 ? 83  HIS B CD2  4  
ATOM 9600  C CE1  . HIS B 1 83  ? 4.164   -10.262 -10.268 1.00 0.00 ? 83  HIS B CE1  4  
ATOM 9601  N NE2  . HIS B 1 83  ? 5.145   -11.121 -10.210 1.00 0.00 ? 83  HIS B NE2  4  
ATOM 9602  H H    . HIS B 1 83  ? 4.223   -10.448 -4.084  1.00 0.00 ? 83  HIS B H    4  
ATOM 9603  H HA   . HIS B 1 83  ? 6.037   -9.883  -6.200  1.00 0.00 ? 83  HIS B HA   4  
ATOM 9604  H HB2  . HIS B 1 83  ? 4.500   -11.831 -6.291  1.00 0.00 ? 83  HIS B HB2  4  
ATOM 9605  H HB3  . HIS B 1 83  ? 3.153   -10.713 -6.478  1.00 0.00 ? 83  HIS B HB3  4  
ATOM 9606  H HD1  . HIS B 1 83  ? 2.916   -9.521  -8.851  1.00 0.00 ? 83  HIS B HD1  4  
ATOM 9607  H HD2  . HIS B 1 83  ? 6.038   -12.231 -8.548  1.00 0.00 ? 83  HIS B HD2  4  
ATOM 9608  H HE1  . HIS B 1 83  ? 3.799   -9.778  -11.162 1.00 0.00 ? 83  HIS B HE1  4  
ATOM 9609  H HE2  . HIS B 1 83  ? 5.678   -11.431 -10.977 1.00 0.00 ? 83  HIS B HE2  4  
ATOM 9610  N N    . PHE B 1 84  ? 5.439   -7.811  -7.097  1.00 0.00 ? 84  PHE B N    4  
ATOM 9611  C CA   . PHE B 1 84  ? 5.293   -6.574  -7.778  1.00 0.00 ? 84  PHE B CA   4  
ATOM 9612  C C    . PHE B 1 84  ? 6.165   -6.707  -8.976  1.00 0.00 ? 84  PHE B C    4  
ATOM 9613  O O    . PHE B 1 84  ? 7.284   -7.225  -8.872  1.00 0.00 ? 84  PHE B O    4  
ATOM 9614  C CB   . PHE B 1 84  ? 5.760   -5.374  -6.916  1.00 0.00 ? 84  PHE B CB   4  
ATOM 9615  C CG   . PHE B 1 84  ? 4.823   -4.985  -5.798  1.00 0.00 ? 84  PHE B CG   4  
ATOM 9616  C CD1  . PHE B 1 84  ? 4.895   -5.595  -4.559  1.00 0.00 ? 84  PHE B CD1  4  
ATOM 9617  C CD2  . PHE B 1 84  ? 3.866   -4.006  -5.997  1.00 0.00 ? 84  PHE B CD2  4  
ATOM 9618  C CE1  . PHE B 1 84  ? 4.033   -5.240  -3.545  1.00 0.00 ? 84  PHE B CE1  4  
ATOM 9619  C CE2  . PHE B 1 84  ? 3.000   -3.646  -4.985  1.00 0.00 ? 84  PHE B CE2  4  
ATOM 9620  C CZ   . PHE B 1 84  ? 3.082   -4.263  -3.760  1.00 0.00 ? 84  PHE B CZ   4  
ATOM 9621  H H    . PHE B 1 84  ? 6.330   -8.225  -7.163  1.00 0.00 ? 84  PHE B H    4  
ATOM 9622  H HA   . PHE B 1 84  ? 4.263   -6.451  -8.077  1.00 0.00 ? 84  PHE B HA   4  
ATOM 9623  H HB2  . PHE B 1 84  ? 6.712   -5.617  -6.468  1.00 0.00 ? 84  PHE B HB2  4  
ATOM 9624  H HB3  . PHE B 1 84  ? 5.889   -4.516  -7.560  1.00 0.00 ? 84  PHE B HB3  4  
ATOM 9625  H HD1  . PHE B 1 84  ? 5.639   -6.360  -4.392  1.00 0.00 ? 84  PHE B HD1  4  
ATOM 9626  H HD2  . PHE B 1 84  ? 3.798   -3.521  -6.960  1.00 0.00 ? 84  PHE B HD2  4  
ATOM 9627  H HE1  . PHE B 1 84  ? 4.101   -5.728  -2.583  1.00 0.00 ? 84  PHE B HE1  4  
ATOM 9628  H HE2  . PHE B 1 84  ? 2.257   -2.879  -5.156  1.00 0.00 ? 84  PHE B HE2  4  
ATOM 9629  H HZ   . PHE B 1 84  ? 2.405   -3.983  -2.966  1.00 0.00 ? 84  PHE B HZ   4  
ATOM 9630  N N    . SER B 1 85  ? 5.666   -6.333  -10.097 1.00 0.00 ? 85  SER B N    4  
ATOM 9631  C CA   . SER B 1 85  ? 6.411   -6.435  -11.301 1.00 0.00 ? 85  SER B CA   4  
ATOM 9632  C C    . SER B 1 85  ? 7.475   -5.331  -11.278 1.00 0.00 ? 85  SER B C    4  
ATOM 9633  O O    . SER B 1 85  ? 7.221   -4.296  -10.670 1.00 0.00 ? 85  SER B O    4  
ATOM 9634  C CB   . SER B 1 85  ? 5.452   -6.268  -12.469 1.00 0.00 ? 85  SER B CB   4  
ATOM 9635  O OG   . SER B 1 85  ? 4.266   -7.035  -12.242 1.00 0.00 ? 85  SER B OG   4  
ATOM 9636  H H    . SER B 1 85  ? 4.762   -5.941  -10.134 1.00 0.00 ? 85  SER B H    4  
ATOM 9637  H HA   . SER B 1 85  ? 6.875   -7.409  -11.341 1.00 0.00 ? 85  SER B HA   4  
ATOM 9638  H HB2  . SER B 1 85  ? 5.187   -5.227  -12.574 1.00 0.00 ? 85  SER B HB2  4  
ATOM 9639  H HB3  . SER B 1 85  ? 5.921   -6.615  -13.376 1.00 0.00 ? 85  SER B HB3  4  
ATOM 9640  H HG   . SER B 1 85  ? 3.778   -6.520  -11.574 1.00 0.00 ? 85  SER B HG   4  
ATOM 9641  N N    . PRO B 1 86  ? 8.659   -5.518  -11.884 1.00 0.00 ? 86  PRO B N    4  
ATOM 9642  C CA   . PRO B 1 86  ? 9.789   -4.568  -11.754 1.00 0.00 ? 86  PRO B CA   4  
ATOM 9643  C C    . PRO B 1 86  ? 9.435   -3.079  -11.962 1.00 0.00 ? 86  PRO B C    4  
ATOM 9644  O O    . PRO B 1 86  ? 9.978   -2.205  -11.271 1.00 0.00 ? 86  PRO B O    4  
ATOM 9645  C CB   . PRO B 1 86  ? 10.756  -5.049  -12.828 1.00 0.00 ? 86  PRO B CB   4  
ATOM 9646  C CG   . PRO B 1 86  ? 10.519  -6.514  -12.886 1.00 0.00 ? 86  PRO B CG   4  
ATOM 9647  C CD   . PRO B 1 86  ? 9.041   -6.691  -12.697 1.00 0.00 ? 86  PRO B CD   4  
ATOM 9648  H HA   . PRO B 1 86  ? 10.259  -4.682  -10.789 1.00 0.00 ? 86  PRO B HA   4  
ATOM 9649  H HB2  . PRO B 1 86  ? 10.526  -4.564  -13.766 1.00 0.00 ? 86  PRO B HB2  4  
ATOM 9650  H HB3  . PRO B 1 86  ? 11.771  -4.824  -12.536 1.00 0.00 ? 86  PRO B HB3  4  
ATOM 9651  H HG2  . PRO B 1 86  ? 10.831  -6.906  -13.843 1.00 0.00 ? 86  PRO B HG2  4  
ATOM 9652  H HG3  . PRO B 1 86  ? 11.057  -7.004  -12.088 1.00 0.00 ? 86  PRO B HG3  4  
ATOM 9653  H HD2  . PRO B 1 86  ? 8.536   -6.690  -13.651 1.00 0.00 ? 86  PRO B HD2  4  
ATOM 9654  H HD3  . PRO B 1 86  ? 8.846   -7.607  -12.162 1.00 0.00 ? 86  PRO B HD3  4  
ATOM 9655  N N    . GLU B 1 87  ? 8.502   -2.797  -12.852 1.00 0.00 ? 87  GLU B N    4  
ATOM 9656  C CA   . GLU B 1 87  ? 8.103   -1.422  -13.135 1.00 0.00 ? 87  GLU B CA   4  
ATOM 9657  C C    . GLU B 1 87  ? 7.135   -0.872  -12.051 1.00 0.00 ? 87  GLU B C    4  
ATOM 9658  O O    . GLU B 1 87  ? 6.979   0.350   -11.898 1.00 0.00 ? 87  GLU B O    4  
ATOM 9659  C CB   . GLU B 1 87  ? 7.447   -1.356  -14.518 1.00 0.00 ? 87  GLU B CB   4  
ATOM 9660  C CG   . GLU B 1 87  ? 7.122   0.047   -15.005 1.00 0.00 ? 87  GLU B CG   4  
ATOM 9661  C CD   . GLU B 1 87  ? 6.440   0.040   -16.338 1.00 0.00 ? 87  GLU B CD   4  
ATOM 9662  O OE1  . GLU B 1 87  ? 7.132   -0.055  -17.375 1.00 0.00 ? 87  GLU B OE1  4  
ATOM 9663  O OE2  . GLU B 1 87  ? 5.198   0.113   -16.380 1.00 0.00 ? 87  GLU B OE2  4  
ATOM 9664  H H    . GLU B 1 87  ? 8.078   -3.539  -13.335 1.00 0.00 ? 87  GLU B H    4  
ATOM 9665  H HA   . GLU B 1 87  ? 8.994   -0.812  -13.146 1.00 0.00 ? 87  GLU B HA   4  
ATOM 9666  H HB2  . GLU B 1 87  ? 8.105   -1.816  -15.239 1.00 0.00 ? 87  GLU B HB2  4  
ATOM 9667  H HB3  . GLU B 1 87  ? 6.527   -1.921  -14.483 1.00 0.00 ? 87  GLU B HB3  4  
ATOM 9668  H HG2  . GLU B 1 87  ? 6.473   0.525   -14.287 1.00 0.00 ? 87  GLU B HG2  4  
ATOM 9669  H HG3  . GLU B 1 87  ? 8.043   0.606   -15.087 1.00 0.00 ? 87  GLU B HG3  4  
ATOM 9670  N N    . GLU B 1 88  ? 6.534   -1.764  -11.281 1.00 0.00 ? 88  GLU B N    4  
ATOM 9671  C CA   . GLU B 1 88  ? 5.519   -1.384  -10.302 1.00 0.00 ? 88  GLU B CA   4  
ATOM 9672  C C    . GLU B 1 88  ? 6.124   -0.855  -9.009  1.00 0.00 ? 88  GLU B C    4  
ATOM 9673  O O    . GLU B 1 88  ? 5.448   -0.147  -8.253  1.00 0.00 ? 88  GLU B O    4  
ATOM 9674  C CB   . GLU B 1 88  ? 4.557   -2.540  -10.005 1.00 0.00 ? 88  GLU B CB   4  
ATOM 9675  C CG   . GLU B 1 88  ? 3.812   -3.050  -11.226 1.00 0.00 ? 88  GLU B CG   4  
ATOM 9676  C CD   . GLU B 1 88  ? 2.810   -4.130  -10.899 1.00 0.00 ? 88  GLU B CD   4  
ATOM 9677  O OE1  . GLU B 1 88  ? 3.208   -5.255  -10.550 1.00 0.00 ? 88  GLU B OE1  4  
ATOM 9678  O OE2  . GLU B 1 88  ? 1.594   -3.878  -10.993 1.00 0.00 ? 88  GLU B OE2  4  
ATOM 9679  H H    . GLU B 1 88  ? 6.787   -2.712  -11.342 1.00 0.00 ? 88  GLU B H    4  
ATOM 9680  H HA   . GLU B 1 88  ? 4.949   -0.579  -10.745 1.00 0.00 ? 88  GLU B HA   4  
ATOM 9681  H HB2  . GLU B 1 88  ? 5.122   -3.362  -9.589  1.00 0.00 ? 88  GLU B HB2  4  
ATOM 9682  H HB3  . GLU B 1 88  ? 3.830   -2.210  -9.278  1.00 0.00 ? 88  GLU B HB3  4  
ATOM 9683  H HG2  . GLU B 1 88  ? 3.282   -2.222  -11.676 1.00 0.00 ? 88  GLU B HG2  4  
ATOM 9684  H HG3  . GLU B 1 88  ? 4.532   -3.436  -11.932 1.00 0.00 ? 88  GLU B HG3  4  
ATOM 9685  N N    . LEU B 1 89  ? 7.379   -1.167  -8.752  1.00 0.00 ? 89  LEU B N    4  
ATOM 9686  C CA   . LEU B 1 89  ? 8.028   -0.673  -7.548  1.00 0.00 ? 89  LEU B CA   4  
ATOM 9687  C C    . LEU B 1 89  ? 9.243   0.145   -7.900  1.00 0.00 ? 89  LEU B C    4  
ATOM 9688  O O    . LEU B 1 89  ? 9.873   -0.066  -8.945  1.00 0.00 ? 89  LEU B O    4  
ATOM 9689  C CB   . LEU B 1 89  ? 8.405   -1.788  -6.523  1.00 0.00 ? 89  LEU B CB   4  
ATOM 9690  C CG   . LEU B 1 89  ? 9.526   -2.790  -6.895  1.00 0.00 ? 89  LEU B CG   4  
ATOM 9691  C CD1  . LEU B 1 89  ? 9.918   -3.601  -5.671  1.00 0.00 ? 89  LEU B CD1  4  
ATOM 9692  C CD2  . LEU B 1 89  ? 9.075   -3.742  -7.992  1.00 0.00 ? 89  LEU B CD2  4  
ATOM 9693  H H    . LEU B 1 89  ? 7.891   -1.707  -9.390  1.00 0.00 ? 89  LEU B H    4  
ATOM 9694  H HA   . LEU B 1 89  ? 7.324   -0.001  -7.083  1.00 0.00 ? 89  LEU B HA   4  
ATOM 9695  H HB2  . LEU B 1 89  ? 8.700   -1.301  -5.606  1.00 0.00 ? 89  LEU B HB2  4  
ATOM 9696  H HB3  . LEU B 1 89  ? 7.508   -2.355  -6.319  1.00 0.00 ? 89  LEU B HB3  4  
ATOM 9697  H HG   . LEU B 1 89  ? 10.395  -2.249  -7.238  1.00 0.00 ? 89  LEU B HG   4  
ATOM 9698  H HD11 . LEU B 1 89  ? 10.269  -2.937  -4.895  1.00 0.00 ? 89  LEU B HD11 4  
ATOM 9699  H HD12 . LEU B 1 89  ? 10.706  -4.291  -5.935  1.00 0.00 ? 89  LEU B HD12 4  
ATOM 9700  H HD13 . LEU B 1 89  ? 9.063   -4.153  -5.311  1.00 0.00 ? 89  LEU B HD13 4  
ATOM 9701  H HD21 . LEU B 1 89  ? 9.841   -4.480  -8.173  1.00 0.00 ? 89  LEU B HD21 4  
ATOM 9702  H HD22 . LEU B 1 89  ? 8.877   -3.188  -8.896  1.00 0.00 ? 89  LEU B HD22 4  
ATOM 9703  H HD23 . LEU B 1 89  ? 8.170   -4.241  -7.677  1.00 0.00 ? 89  LEU B HD23 4  
ATOM 9704  N N    . LYS B 1 90  ? 9.560   1.095   -7.067  1.00 0.00 ? 90  LYS B N    4  
ATOM 9705  C CA   . LYS B 1 90  ? 10.704  1.917   -7.279  1.00 0.00 ? 90  LYS B CA   4  
ATOM 9706  C C    . LYS B 1 90  ? 11.441  2.119   -5.972  1.00 0.00 ? 90  LYS B C    4  
ATOM 9707  O O    . LYS B 1 90  ? 10.821  2.358   -4.921  1.00 0.00 ? 90  LYS B O    4  
ATOM 9708  C CB   . LYS B 1 90  ? 10.298  3.263   -7.891  1.00 0.00 ? 90  LYS B CB   4  
ATOM 9709  C CG   . LYS B 1 90  ? 11.468  4.122   -8.377  1.00 0.00 ? 90  LYS B CG   4  
ATOM 9710  C CD   . LYS B 1 90  ? 12.387  3.415   -9.411  1.00 0.00 ? 90  LYS B CD   4  
ATOM 9711  C CE   . LYS B 1 90  ? 11.728  3.108   -10.780 1.00 0.00 ? 90  LYS B CE   4  
ATOM 9712  N NZ   . LYS B 1 90  ? 10.667  2.065   -10.739 1.00 0.00 ? 90  LYS B NZ   4  
ATOM 9713  H H    . LYS B 1 90  ? 8.994   1.262   -6.277  1.00 0.00 ? 90  LYS B H    4  
ATOM 9714  H HA   . LYS B 1 90  ? 11.347  1.399   -7.974  1.00 0.00 ? 90  LYS B HA   4  
ATOM 9715  H HB2  . LYS B 1 90  ? 9.626   3.102   -8.717  1.00 0.00 ? 90  LYS B HB2  4  
ATOM 9716  H HB3  . LYS B 1 90  ? 9.771   3.826   -7.135  1.00 0.00 ? 90  LYS B HB3  4  
ATOM 9717  H HG2  . LYS B 1 90  ? 11.072  5.014   -8.838  1.00 0.00 ? 90  LYS B HG2  4  
ATOM 9718  H HG3  . LYS B 1 90  ? 12.062  4.401   -7.519  1.00 0.00 ? 90  LYS B HG3  4  
ATOM 9719  H HD2  . LYS B 1 90  ? 13.233  4.059   -9.597  1.00 0.00 ? 90  LYS B HD2  4  
ATOM 9720  H HD3  . LYS B 1 90  ? 12.750  2.499   -8.974  1.00 0.00 ? 90  LYS B HD3  4  
ATOM 9721  H HE2  . LYS B 1 90  ? 11.295  4.018   -11.167 1.00 0.00 ? 90  LYS B HE2  4  
ATOM 9722  H HE3  . LYS B 1 90  ? 12.506  2.787   -11.457 1.00 0.00 ? 90  LYS B HE3  4  
ATOM 9723  H HZ1  . LYS B 1 90  ? 10.337  1.858   -11.702 1.00 0.00 ? 90  LYS B HZ1  4  
ATOM 9724  H HZ2  . LYS B 1 90  ? 9.837   2.345   -10.179 1.00 0.00 ? 90  LYS B HZ2  4  
ATOM 9725  H HZ3  . LYS B 1 90  ? 11.028  1.172   -10.343 1.00 0.00 ? 90  LYS B HZ3  4  
ATOM 9726  N N    . VAL B 1 91  ? 12.734  2.004   -6.040  1.00 0.00 ? 91  VAL B N    4  
ATOM 9727  C CA   . VAL B 1 91  ? 13.606  2.167   -4.908  1.00 0.00 ? 91  VAL B CA   4  
ATOM 9728  C C    . VAL B 1 91  ? 14.479  3.416   -5.102  1.00 0.00 ? 91  VAL B C    4  
ATOM 9729  O O    . VAL B 1 91  ? 14.911  3.717   -6.224  1.00 0.00 ? 91  VAL B O    4  
ATOM 9730  C CB   . VAL B 1 91  ? 14.490  0.885   -4.698  1.00 0.00 ? 91  VAL B CB   4  
ATOM 9731  C CG1  . VAL B 1 91  ? 15.264  0.532   -5.964  1.00 0.00 ? 91  VAL B CG1  4  
ATOM 9732  C CG2  . VAL B 1 91  ? 15.458  1.056   -3.523  1.00 0.00 ? 91  VAL B CG2  4  
ATOM 9733  H H    . VAL B 1 91  ? 13.150  1.806   -6.906  1.00 0.00 ? 91  VAL B H    4  
ATOM 9734  H HA   . VAL B 1 91  ? 12.988  2.311   -4.033  1.00 0.00 ? 91  VAL B HA   4  
ATOM 9735  H HB   . VAL B 1 91  ? 13.828  0.060   -4.478  1.00 0.00 ? 91  VAL B HB   4  
ATOM 9736  H HG11 . VAL B 1 91  ? 15.902  1.360   -6.237  1.00 0.00 ? 91  VAL B HG11 4  
ATOM 9737  H HG12 . VAL B 1 91  ? 14.568  0.333   -6.765  1.00 0.00 ? 91  VAL B HG12 4  
ATOM 9738  H HG13 . VAL B 1 91  ? 15.869  -0.343  -5.784  1.00 0.00 ? 91  VAL B HG13 4  
ATOM 9739  H HG21 . VAL B 1 91  ? 14.903  1.286   -2.626  1.00 0.00 ? 91  VAL B HG21 4  
ATOM 9740  H HG22 . VAL B 1 91  ? 16.134  1.869   -3.739  1.00 0.00 ? 91  VAL B HG22 4  
ATOM 9741  H HG23 . VAL B 1 91  ? 16.022  0.146   -3.376  1.00 0.00 ? 91  VAL B HG23 4  
ATOM 9742  N N    . LYS B 1 92  ? 14.682  4.157   -4.043  1.00 0.00 ? 92  LYS B N    4  
ATOM 9743  C CA   . LYS B 1 92  ? 15.513  5.330   -4.076  1.00 0.00 ? 92  LYS B CA   4  
ATOM 9744  C C    . LYS B 1 92  ? 16.475  5.325   -2.905  1.00 0.00 ? 92  LYS B C    4  
ATOM 9745  O O    . LYS B 1 92  ? 16.109  4.938   -1.796  1.00 0.00 ? 92  LYS B O    4  
ATOM 9746  C CB   . LYS B 1 92  ? 14.674  6.623   -4.060  1.00 0.00 ? 92  LYS B CB   4  
ATOM 9747  C CG   . LYS B 1 92  ? 13.739  6.777   -2.858  1.00 0.00 ? 92  LYS B CG   4  
ATOM 9748  C CD   . LYS B 1 92  ? 13.112  8.186   -2.731  1.00 0.00 ? 92  LYS B CD   4  
ATOM 9749  C CE   . LYS B 1 92  ? 12.185  8.587   -3.895  1.00 0.00 ? 92  LYS B CE   4  
ATOM 9750  N NZ   . LYS B 1 92  ? 12.902  8.892   -5.160  1.00 0.00 ? 92  LYS B NZ   4  
ATOM 9751  H H    . LYS B 1 92  ? 14.265  3.892   -3.191  1.00 0.00 ? 92  LYS B H    4  
ATOM 9752  H HA   . LYS B 1 92  ? 16.084  5.301   -4.992  1.00 0.00 ? 92  LYS B HA   4  
ATOM 9753  H HB2  . LYS B 1 92  ? 15.336  7.476   -4.082  1.00 0.00 ? 92  LYS B HB2  4  
ATOM 9754  H HB3  . LYS B 1 92  ? 14.070  6.625   -4.955  1.00 0.00 ? 92  LYS B HB3  4  
ATOM 9755  H HG2  . LYS B 1 92  ? 12.939  6.057   -2.952  1.00 0.00 ? 92  LYS B HG2  4  
ATOM 9756  H HG3  . LYS B 1 92  ? 14.302  6.561   -1.962  1.00 0.00 ? 92  LYS B HG3  4  
ATOM 9757  H HD2  . LYS B 1 92  ? 12.533  8.219   -1.819  1.00 0.00 ? 92  LYS B HD2  4  
ATOM 9758  H HD3  . LYS B 1 92  ? 13.913  8.907   -2.658  1.00 0.00 ? 92  LYS B HD3  4  
ATOM 9759  H HE2  . LYS B 1 92  ? 11.503  7.772   -4.081  1.00 0.00 ? 92  LYS B HE2  4  
ATOM 9760  H HE3  . LYS B 1 92  ? 11.614  9.453   -3.598  1.00 0.00 ? 92  LYS B HE3  4  
ATOM 9761  H HZ1  . LYS B 1 92  ? 12.230  9.220   -5.884  1.00 0.00 ? 92  LYS B HZ1  4  
ATOM 9762  H HZ2  . LYS B 1 92  ? 13.405  8.072   -5.551  1.00 0.00 ? 92  LYS B HZ2  4  
ATOM 9763  H HZ3  . LYS B 1 92  ? 13.595  9.652   -5.024  1.00 0.00 ? 92  LYS B HZ3  4  
ATOM 9764  N N    . VAL B 1 93  ? 17.683  5.731   -3.159  1.00 0.00 ? 93  VAL B N    4  
ATOM 9765  C CA   . VAL B 1 93  ? 18.699  5.850   -2.144  1.00 0.00 ? 93  VAL B CA   4  
ATOM 9766  C C    . VAL B 1 93  ? 19.351  7.229   -2.233  1.00 0.00 ? 93  VAL B C    4  
ATOM 9767  O O    . VAL B 1 93  ? 19.993  7.574   -3.238  1.00 0.00 ? 93  VAL B O    4  
ATOM 9768  C CB   . VAL B 1 93  ? 19.760  4.685   -2.210  1.00 0.00 ? 93  VAL B CB   4  
ATOM 9769  C CG1  . VAL B 1 93  ? 20.269  4.466   -3.628  1.00 0.00 ? 93  VAL B CG1  4  
ATOM 9770  C CG2  . VAL B 1 93  ? 20.938  4.960   -1.286  1.00 0.00 ? 93  VAL B CG2  4  
ATOM 9771  H H    . VAL B 1 93  ? 17.918  5.978   -4.079  1.00 0.00 ? 93  VAL B H    4  
ATOM 9772  H HA   . VAL B 1 93  ? 18.184  5.802   -1.196  1.00 0.00 ? 93  VAL B HA   4  
ATOM 9773  H HB   . VAL B 1 93  ? 19.279  3.773   -1.885  1.00 0.00 ? 93  VAL B HB   4  
ATOM 9774  H HG11 . VAL B 1 93  ? 20.728  5.375   -3.988  1.00 0.00 ? 93  VAL B HG11 4  
ATOM 9775  H HG12 . VAL B 1 93  ? 19.440  4.201   -4.267  1.00 0.00 ? 93  VAL B HG12 4  
ATOM 9776  H HG13 . VAL B 1 93  ? 20.996  3.667   -3.632  1.00 0.00 ? 93  VAL B HG13 4  
ATOM 9777  H HG21 . VAL B 1 93  ? 21.600  4.106   -1.285  1.00 0.00 ? 93  VAL B HG21 4  
ATOM 9778  H HG22 . VAL B 1 93  ? 20.601  5.156   -0.280  1.00 0.00 ? 93  VAL B HG22 4  
ATOM 9779  H HG23 . VAL B 1 93  ? 21.475  5.821   -1.656  1.00 0.00 ? 93  VAL B HG23 4  
ATOM 9780  N N    . LEU B 1 94  ? 19.131  8.029   -1.221  1.00 0.00 ? 94  LEU B N    4  
ATOM 9781  C CA   . LEU B 1 94  ? 19.665  9.372   -1.167  1.00 0.00 ? 94  LEU B CA   4  
ATOM 9782  C C    . LEU B 1 94  ? 20.249  9.622   0.200   1.00 0.00 ? 94  LEU B C    4  
ATOM 9783  O O    . LEU B 1 94  ? 19.504  9.832   1.173   1.00 0.00 ? 94  LEU B O    4  
ATOM 9784  C CB   . LEU B 1 94  ? 18.604  10.476  -1.469  1.00 0.00 ? 94  LEU B CB   4  
ATOM 9785  C CG   . LEU B 1 94  ? 17.959  10.532  -2.872  1.00 0.00 ? 94  LEU B CG   4  
ATOM 9786  C CD1  . LEU B 1 94  ? 16.903  9.457   -3.062  1.00 0.00 ? 94  LEU B CD1  4  
ATOM 9787  C CD2  . LEU B 1 94  ? 17.375  11.908  -3.133  1.00 0.00 ? 94  LEU B CD2  4  
ATOM 9788  H H    . LEU B 1 94  ? 18.613  7.700   -0.450  1.00 0.00 ? 94  LEU B H    4  
ATOM 9789  H HA   . LEU B 1 94  ? 20.458  9.435   -1.897  1.00 0.00 ? 94  LEU B HA   4  
ATOM 9790  H HB2  . LEU B 1 94  ? 17.803  10.358  -0.754  1.00 0.00 ? 94  LEU B HB2  4  
ATOM 9791  H HB3  . LEU B 1 94  ? 19.071  11.430  -1.280  1.00 0.00 ? 94  LEU B HB3  4  
ATOM 9792  H HG   . LEU B 1 94  ? 18.729  10.356  -3.609  1.00 0.00 ? 94  LEU B HG   4  
ATOM 9793  H HD11 . LEU B 1 94  ? 16.120  9.588   -2.331  1.00 0.00 ? 94  LEU B HD11 4  
ATOM 9794  H HD12 . LEU B 1 94  ? 17.354  8.484   -2.935  1.00 0.00 ? 94  LEU B HD12 4  
ATOM 9795  H HD13 . LEU B 1 94  ? 16.487  9.533   -4.056  1.00 0.00 ? 94  LEU B HD13 4  
ATOM 9796  H HD21 . LEU B 1 94  ? 16.621  12.125  -2.390  1.00 0.00 ? 94  LEU B HD21 4  
ATOM 9797  H HD22 . LEU B 1 94  ? 16.928  11.928  -4.115  1.00 0.00 ? 94  LEU B HD22 4  
ATOM 9798  H HD23 . LEU B 1 94  ? 18.159  12.651  -3.082  1.00 0.00 ? 94  LEU B HD23 4  
ATOM 9799  N N    . GLY B 1 95  ? 21.556  9.570   0.293   1.00 0.00 ? 95  GLY B N    4  
ATOM 9800  C CA   . GLY B 1 95  ? 22.213  9.833   1.540   1.00 0.00 ? 95  GLY B CA   4  
ATOM 9801  C C    . GLY B 1 95  ? 21.964  8.766   2.573   1.00 0.00 ? 95  GLY B C    4  
ATOM 9802  O O    . GLY B 1 95  ? 22.442  7.638   2.464   1.00 0.00 ? 95  GLY B O    4  
ATOM 9803  H H    . GLY B 1 95  ? 22.091  9.363   -0.504  1.00 0.00 ? 95  GLY B H    4  
ATOM 9804  H HA2  . GLY B 1 95  ? 23.276  9.918   1.374   1.00 0.00 ? 95  GLY B HA2  4  
ATOM 9805  H HA3  . GLY B 1 95  ? 21.851  10.775  1.922   1.00 0.00 ? 95  GLY B HA3  4  
ATOM 9806  N N    . ASP B 1 96  ? 21.238  9.151   3.572   1.00 0.00 ? 96  ASP B N    4  
ATOM 9807  C CA   . ASP B 1 96  ? 20.910  8.323   4.716   1.00 0.00 ? 96  ASP B CA   4  
ATOM 9808  C C    . ASP B 1 96  ? 19.579  7.625   4.533   1.00 0.00 ? 96  ASP B C    4  
ATOM 9809  O O    . ASP B 1 96  ? 19.209  6.804   5.342   1.00 0.00 ? 96  ASP B O    4  
ATOM 9810  C CB   . ASP B 1 96  ? 20.786  9.247   5.941   1.00 0.00 ? 96  ASP B CB   4  
ATOM 9811  C CG   . ASP B 1 96  ? 19.735  10.332  5.753   1.00 0.00 ? 96  ASP B CG   4  
ATOM 9812  O OD1  . ASP B 1 96  ? 19.991  11.289  4.956   1.00 0.00 ? 96  ASP B OD1  4  
ATOM 9813  O OD2  . ASP B 1 96  ? 18.672  10.283  6.386   1.00 0.00 ? 96  ASP B OD2  4  
ATOM 9814  H H    . ASP B 1 96  ? 20.879  10.065  3.568   1.00 0.00 ? 96  ASP B H    4  
ATOM 9815  H HA   . ASP B 1 96  ? 21.702  7.619   4.914   1.00 0.00 ? 96  ASP B HA   4  
ATOM 9816  H HB2  . ASP B 1 96  ? 20.526  8.671   6.817   1.00 0.00 ? 96  ASP B HB2  4  
ATOM 9817  H HB3  . ASP B 1 96  ? 21.731  9.744   6.103   1.00 0.00 ? 96  ASP B HB3  4  
ATOM 9818  N N    . VAL B 1 97  ? 18.865  7.927   3.485   1.00 0.00 ? 97  VAL B N    4  
ATOM 9819  C CA   . VAL B 1 97  ? 17.562  7.321   3.324   1.00 0.00 ? 97  VAL B CA   4  
ATOM 9820  C C    . VAL B 1 97  ? 17.531  6.417   2.117   1.00 0.00 ? 97  VAL B C    4  
ATOM 9821  O O    . VAL B 1 97  ? 18.029  6.774   1.030   1.00 0.00 ? 97  VAL B O    4  
ATOM 9822  C CB   . VAL B 1 97  ? 16.427  8.414   3.235   1.00 0.00 ? 97  VAL B CB   4  
ATOM 9823  C CG1  . VAL B 1 97  ? 15.066  7.814   2.903   1.00 0.00 ? 97  VAL B CG1  4  
ATOM 9824  C CG2  . VAL B 1 97  ? 16.317  9.164   4.545   1.00 0.00 ? 97  VAL B CG2  4  
ATOM 9825  H H    . VAL B 1 97  ? 19.211  8.530   2.796   1.00 0.00 ? 97  VAL B H    4  
ATOM 9826  H HA   . VAL B 1 97  ? 17.376  6.720   4.202   1.00 0.00 ? 97  VAL B HA   4  
ATOM 9827  H HB   . VAL B 1 97  ? 16.688  9.125   2.465   1.00 0.00 ? 97  VAL B HB   4  
ATOM 9828  H HG11 . VAL B 1 97  ? 14.789  7.103   3.669   1.00 0.00 ? 97  VAL B HG11 4  
ATOM 9829  H HG12 . VAL B 1 97  ? 15.126  7.312   1.948   1.00 0.00 ? 97  VAL B HG12 4  
ATOM 9830  H HG13 . VAL B 1 97  ? 14.326  8.599   2.850   1.00 0.00 ? 97  VAL B HG13 4  
ATOM 9831  H HG21 . VAL B 1 97  ? 16.046  8.475   5.330   1.00 0.00 ? 97  VAL B HG21 4  
ATOM 9832  H HG22 . VAL B 1 97  ? 15.558  9.928   4.464   1.00 0.00 ? 97  VAL B HG22 4  
ATOM 9833  H HG23 . VAL B 1 97  ? 17.267  9.617   4.782   1.00 0.00 ? 97  VAL B HG23 4  
ATOM 9834  N N    . ILE B 1 98  ? 16.948  5.263   2.311   1.00 0.00 ? 98  ILE B N    4  
ATOM 9835  C CA   . ILE B 1 98  ? 16.722  4.318   1.273   1.00 0.00 ? 98  ILE B CA   4  
ATOM 9836  C C    . ILE B 1 98  ? 15.265  3.902   1.412   1.00 0.00 ? 98  ILE B C    4  
ATOM 9837  O O    . ILE B 1 98  ? 14.853  3.408   2.472   1.00 0.00 ? 98  ILE B O    4  
ATOM 9838  C CB   . ILE B 1 98  ? 17.641  3.021   1.360   1.00 0.00 ? 98  ILE B CB   4  
ATOM 9839  C CG1  . ILE B 1 98  ? 19.153  3.329   1.422   1.00 0.00 ? 98  ILE B CG1  4  
ATOM 9840  C CG2  . ILE B 1 98  ? 17.384  2.146   0.133   1.00 0.00 ? 98  ILE B CG2  4  
ATOM 9841  C CD1  . ILE B 1 98  ? 19.657  3.871   2.741   1.00 0.00 ? 98  ILE B CD1  4  
ATOM 9842  H H    . ILE B 1 98  ? 16.642  5.024   3.216   1.00 0.00 ? 98  ILE B H    4  
ATOM 9843  H HA   . ILE B 1 98  ? 16.861  4.813   0.322   1.00 0.00 ? 98  ILE B HA   4  
ATOM 9844  H HB   . ILE B 1 98  ? 17.341  2.459   2.233   1.00 0.00 ? 98  ILE B HB   4  
ATOM 9845  H HG12 . ILE B 1 98  ? 19.708  2.428   1.208   1.00 0.00 ? 98  ILE B HG12 4  
ATOM 9846  H HG13 . ILE B 1 98  ? 19.365  4.058   0.657   1.00 0.00 ? 98  ILE B HG13 4  
ATOM 9847  H HG21 . ILE B 1 98  ? 17.620  2.702   -0.763  1.00 0.00 ? 98  ILE B HG21 4  
ATOM 9848  H HG22 . ILE B 1 98  ? 16.342  1.858   0.109   1.00 0.00 ? 98  ILE B HG22 4  
ATOM 9849  H HG23 . ILE B 1 98  ? 18.002  1.262   0.182   1.00 0.00 ? 98  ILE B HG23 4  
ATOM 9850  H HD11 . ILE B 1 98  ? 19.171  4.815   2.943   1.00 0.00 ? 98  ILE B HD11 4  
ATOM 9851  H HD12 . ILE B 1 98  ? 20.725  4.016   2.695   1.00 0.00 ? 98  ILE B HD12 4  
ATOM 9852  H HD13 . ILE B 1 98  ? 19.406  3.169   3.521   1.00 0.00 ? 98  ILE B HD13 4  
ATOM 9853  N N    . GLU B 1 99  ? 14.481  4.127   0.393   1.00 0.00 ? 99  GLU B N    4  
ATOM 9854  C CA   . GLU B 1 99  ? 13.071  3.801   0.449   1.00 0.00 ? 99  GLU B CA   4  
ATOM 9855  C C    . GLU B 1 99  ? 12.623  3.077   -0.779  1.00 0.00 ? 99  GLU B C    4  
ATOM 9856  O O    . GLU B 1 99  ? 13.130  3.320   -1.883  1.00 0.00 ? 99  GLU B O    4  
ATOM 9857  C CB   . GLU B 1 99  ? 12.182  5.030   0.657   1.00 0.00 ? 99  GLU B CB   4  
ATOM 9858  C CG   . GLU B 1 99  ? 12.331  5.707   2.001   1.00 0.00 ? 99  GLU B CG   4  
ATOM 9859  C CD   . GLU B 1 99  ? 11.224  6.680   2.269   1.00 0.00 ? 99  GLU B CD   4  
ATOM 9860  O OE1  . GLU B 1 99  ? 10.032  6.318   2.073   1.00 0.00 ? 99  GLU B OE1  4  
ATOM 9861  O OE2  . GLU B 1 99  ? 11.483  7.799   2.719   1.00 0.00 ? 99  GLU B OE2  4  
ATOM 9862  H H    . GLU B 1 99  ? 14.864  4.494   -0.435  1.00 0.00 ? 99  GLU B H    4  
ATOM 9863  H HA   . GLU B 1 99  ? 12.933  3.142   1.294   1.00 0.00 ? 99  GLU B HA   4  
ATOM 9864  H HB2  . GLU B 1 99  ? 12.418  5.756   -0.108  1.00 0.00 ? 99  GLU B HB2  4  
ATOM 9865  H HB3  . GLU B 1 99  ? 11.152  4.729   0.539   1.00 0.00 ? 99  GLU B HB3  4  
ATOM 9866  H HG2  . GLU B 1 99  ? 12.359  4.973   2.789   1.00 0.00 ? 99  GLU B HG2  4  
ATOM 9867  H HG3  . GLU B 1 99  ? 13.263  6.251   2.000   1.00 0.00 ? 99  GLU B HG3  4  
ATOM 9868  N N    . VAL B 1 100 ? 11.674  2.205   -0.593  1.00 0.00 ? 100 VAL B N    4  
ATOM 9869  C CA   . VAL B 1 100 ? 11.094  1.453   -1.663  1.00 0.00 ? 100 VAL B CA   4  
ATOM 9870  C C    . VAL B 1 100 ? 9.599   1.656   -1.613  1.00 0.00 ? 100 VAL B C    4  
ATOM 9871  O O    . VAL B 1 100 ? 8.987   1.522   -0.548  1.00 0.00 ? 100 VAL B O    4  
ATOM 9872  C CB   . VAL B 1 100 ? 11.372  -0.067  -1.538  1.00 0.00 ? 100 VAL B CB   4  
ATOM 9873  C CG1  . VAL B 1 100 ? 10.838  -0.802  -2.763  1.00 0.00 ? 100 VAL B CG1  4  
ATOM 9874  C CG2  . VAL B 1 100 ? 12.856  -0.349  -1.340  1.00 0.00 ? 100 VAL B CG2  4  
ATOM 9875  H H    . VAL B 1 100 ? 11.329  2.072   0.318   1.00 0.00 ? 100 VAL B H    4  
ATOM 9876  H HA   . VAL B 1 100 ? 11.482  1.814   -2.604  1.00 0.00 ? 100 VAL B HA   4  
ATOM 9877  H HB   . VAL B 1 100 ? 10.829  -0.433  -0.678  1.00 0.00 ? 100 VAL B HB   4  
ATOM 9878  H HG11 . VAL B 1 100 ? 11.356  -0.457  -3.647  1.00 0.00 ? 100 VAL B HG11 4  
ATOM 9879  H HG12 . VAL B 1 100 ? 9.784   -0.590  -2.868  1.00 0.00 ? 100 VAL B HG12 4  
ATOM 9880  H HG13 . VAL B 1 100 ? 10.976  -1.865  -2.650  1.00 0.00 ? 100 VAL B HG13 4  
ATOM 9881  H HG21 . VAL B 1 100 ? 13.212  0.209   -0.487  1.00 0.00 ? 100 VAL B HG21 4  
ATOM 9882  H HG22 . VAL B 1 100 ? 13.396  -0.033  -2.219  1.00 0.00 ? 100 VAL B HG22 4  
ATOM 9883  H HG23 . VAL B 1 100 ? 13.016  -1.403  -1.173  1.00 0.00 ? 100 VAL B HG23 4  
ATOM 9884  N N    . HIS B 1 101 ? 9.025   2.000   -2.714  1.00 0.00 ? 101 HIS B N    4  
ATOM 9885  C CA   . HIS B 1 101 ? 7.599   2.168   -2.797  1.00 0.00 ? 101 HIS B CA   4  
ATOM 9886  C C    . HIS B 1 101 ? 7.114   1.517   -4.069  1.00 0.00 ? 101 HIS B C    4  
ATOM 9887  O O    . HIS B 1 101 ? 7.728   1.681   -5.121  1.00 0.00 ? 101 HIS B O    4  
ATOM 9888  C CB   . HIS B 1 101 ? 7.176   3.663   -2.735  1.00 0.00 ? 101 HIS B CB   4  
ATOM 9889  C CG   . HIS B 1 101 ? 7.649   4.514   -3.881  1.00 0.00 ? 101 HIS B CG   4  
ATOM 9890  N ND1  . HIS B 1 101 ? 6.870   4.796   -4.977  1.00 0.00 ? 101 HIS B ND1  4  
ATOM 9891  C CD2  . HIS B 1 101 ? 8.826   5.140   -4.093  1.00 0.00 ? 101 HIS B CD2  4  
ATOM 9892  C CE1  . HIS B 1 101 ? 7.549   5.550   -5.809  1.00 0.00 ? 101 HIS B CE1  4  
ATOM 9893  N NE2  . HIS B 1 101 ? 8.734   5.776   -5.297  1.00 0.00 ? 101 HIS B NE2  4  
ATOM 9894  H H    . HIS B 1 101 ? 9.574   2.115   -3.523  1.00 0.00 ? 101 HIS B H    4  
ATOM 9895  H HA   . HIS B 1 101 ? 7.167   1.637   -1.962  1.00 0.00 ? 101 HIS B HA   4  
ATOM 9896  H HB2  . HIS B 1 101 ? 6.098   3.721   -2.715  1.00 0.00 ? 101 HIS B HB2  4  
ATOM 9897  H HB3  . HIS B 1 101 ? 7.562   4.091   -1.820  1.00 0.00 ? 101 HIS B HB3  4  
ATOM 9898  H HD1  . HIS B 1 101 ? 5.946   4.491   -5.125  1.00 0.00 ? 101 HIS B HD1  4  
ATOM 9899  H HD2  . HIS B 1 101 ? 9.682   5.137   -3.434  1.00 0.00 ? 101 HIS B HD2  4  
ATOM 9900  H HE1  . HIS B 1 101 ? 7.196   5.929   -6.756  1.00 0.00 ? 101 HIS B HE1  4  
ATOM 9901  H HE2  . HIS B 1 101 ? 9.214   6.611   -5.502  1.00 0.00 ? 101 HIS B HE2  4  
ATOM 9902  N N    . GLY B 1 102 ? 6.080   0.759   -3.970  1.00 0.00 ? 102 GLY B N    4  
ATOM 9903  C CA   . GLY B 1 102 ? 5.537   0.113   -5.117  1.00 0.00 ? 102 GLY B CA   4  
ATOM 9904  C C    . GLY B 1 102 ? 4.062   0.032   -5.027  1.00 0.00 ? 102 GLY B C    4  
ATOM 9905  O O    . GLY B 1 102 ? 3.524   -0.090  -3.936  1.00 0.00 ? 102 GLY B O    4  
ATOM 9906  H H    . GLY B 1 102 ? 5.653   0.616   -3.094  1.00 0.00 ? 102 GLY B H    4  
ATOM 9907  H HA2  . GLY B 1 102 ? 5.796   0.692   -5.991  1.00 0.00 ? 102 GLY B HA2  4  
ATOM 9908  H HA3  . GLY B 1 102 ? 5.946   -0.882  -5.202  1.00 0.00 ? 102 GLY B HA3  4  
ATOM 9909  N N    . LYS B 1 103 ? 3.410   0.095   -6.139  1.00 0.00 ? 103 LYS B N    4  
ATOM 9910  C CA   . LYS B 1 103 ? 1.976   0.057   -6.183  1.00 0.00 ? 103 LYS B CA   4  
ATOM 9911  C C    . LYS B 1 103 ? 1.517   -0.946  -7.230  1.00 0.00 ? 103 LYS B C    4  
ATOM 9912  O O    . LYS B 1 103 ? 2.028   -0.966  -8.350  1.00 0.00 ? 103 LYS B O    4  
ATOM 9913  C CB   . LYS B 1 103 ? 1.390   1.454   -6.511  1.00 0.00 ? 103 LYS B CB   4  
ATOM 9914  C CG   . LYS B 1 103 ? 1.951   2.084   -7.789  1.00 0.00 ? 103 LYS B CG   4  
ATOM 9915  C CD   . LYS B 1 103 ? 1.164   3.306   -8.303  1.00 0.00 ? 103 LYS B CD   4  
ATOM 9916  C CE   . LYS B 1 103 ? 1.200   4.541   -7.387  1.00 0.00 ? 103 LYS B CE   4  
ATOM 9917  N NZ   . LYS B 1 103 ? 0.364   4.416   -6.171  1.00 0.00 ? 103 LYS B NZ   4  
ATOM 9918  H H    . LYS B 1 103 ? 3.906   0.137   -6.988  1.00 0.00 ? 103 LYS B H    4  
ATOM 9919  H HA   . LYS B 1 103 ? 1.614   -0.252  -5.214  1.00 0.00 ? 103 LYS B HA   4  
ATOM 9920  H HB2  . LYS B 1 103 ? 0.319   1.364   -6.622  1.00 0.00 ? 103 LYS B HB2  4  
ATOM 9921  H HB3  . LYS B 1 103 ? 1.599   2.120   -5.687  1.00 0.00 ? 103 LYS B HB3  4  
ATOM 9922  H HG2  . LYS B 1 103 ? 2.961   2.405   -7.584  1.00 0.00 ? 103 LYS B HG2  4  
ATOM 9923  H HG3  . LYS B 1 103 ? 1.977   1.327   -8.559  1.00 0.00 ? 103 LYS B HG3  4  
ATOM 9924  H HD2  . LYS B 1 103 ? 1.570   3.593   -9.262  1.00 0.00 ? 103 LYS B HD2  4  
ATOM 9925  H HD3  . LYS B 1 103 ? 0.135   3.004   -8.441  1.00 0.00 ? 103 LYS B HD3  4  
ATOM 9926  H HE2  . LYS B 1 103 ? 2.220   4.701   -7.074  1.00 0.00 ? 103 LYS B HE2  4  
ATOM 9927  H HE3  . LYS B 1 103 ? 0.871   5.398   -7.955  1.00 0.00 ? 103 LYS B HE3  4  
ATOM 9928  H HZ1  . LYS B 1 103 ? 0.776   3.823   -5.414  1.00 0.00 ? 103 LYS B HZ1  4  
ATOM 9929  H HZ2  . LYS B 1 103 ? -0.592  4.078   -6.390  1.00 0.00 ? 103 LYS B HZ2  4  
ATOM 9930  H HZ3  . LYS B 1 103 ? 0.256   5.356   -5.743  1.00 0.00 ? 103 LYS B HZ3  4  
ATOM 9931  N N    . HIS B 1 104 ? 0.567   -1.759  -6.881  1.00 0.00 ? 104 HIS B N    4  
ATOM 9932  C CA   . HIS B 1 104 ? 0.020   -2.736  -7.794  1.00 0.00 ? 104 HIS B CA   4  
ATOM 9933  C C    . HIS B 1 104 ? -1.484  -2.636  -7.783  1.00 0.00 ? 104 HIS B C    4  
ATOM 9934  O O    . HIS B 1 104 ? -2.087  -2.548  -6.721  1.00 0.00 ? 104 HIS B O    4  
ATOM 9935  C CB   . HIS B 1 104 ? 0.470   -4.166  -7.393  1.00 0.00 ? 104 HIS B CB   4  
ATOM 9936  C CG   . HIS B 1 104 ? -0.144  -5.280  -8.210  1.00 0.00 ? 104 HIS B CG   4  
ATOM 9937  N ND1  . HIS B 1 104 ? 0.125   -5.472  -9.535  1.00 0.00 ? 104 HIS B ND1  4  
ATOM 9938  C CD2  . HIS B 1 104 ? -1.034  -6.241  -7.870  1.00 0.00 ? 104 HIS B CD2  4  
ATOM 9939  C CE1  . HIS B 1 104 ? -0.566  -6.489  -9.984  1.00 0.00 ? 104 HIS B CE1  4  
ATOM 9940  N NE2  . HIS B 1 104 ? -1.276  -6.976  -8.993  1.00 0.00 ? 104 HIS B NE2  4  
ATOM 9941  H H    . HIS B 1 104 ? 0.199   -1.715  -5.967  1.00 0.00 ? 104 HIS B H    4  
ATOM 9942  H HA   . HIS B 1 104 ? 0.394   -2.516  -8.781  1.00 0.00 ? 104 HIS B HA   4  
ATOM 9943  H HB2  . HIS B 1 104 ? 1.541   -4.240  -7.502  1.00 0.00 ? 104 HIS B HB2  4  
ATOM 9944  H HB3  . HIS B 1 104 ? 0.213   -4.334  -6.357  1.00 0.00 ? 104 HIS B HB3  4  
ATOM 9945  H HD1  . HIS B 1 104 ? 0.757   -4.935  -10.082 1.00 0.00 ? 104 HIS B HD1  4  
ATOM 9946  H HD2  . HIS B 1 104 ? -1.469  -6.399  -6.893  1.00 0.00 ? 104 HIS B HD2  4  
ATOM 9947  H HE1  . HIS B 1 104 ? -0.557  -6.862  -10.997 1.00 0.00 ? 104 HIS B HE1  4  
ATOM 9948  H HE2  . HIS B 1 104 ? -1.989  -7.646  -9.097  1.00 0.00 ? 104 HIS B HE2  4  
ATOM 9949  N N    . GLU B 1 105 ? -2.091  -2.593  -8.932  1.00 0.00 ? 105 GLU B N    4  
ATOM 9950  C CA   . GLU B 1 105 ? -3.516  -2.642  -8.974  1.00 0.00 ? 105 GLU B CA   4  
ATOM 9951  C C    . GLU B 1 105 ? -3.920  -4.103  -9.027  1.00 0.00 ? 105 GLU B C    4  
ATOM 9952  O O    . GLU B 1 105 ? -3.491  -4.875  -9.893  1.00 0.00 ? 105 GLU B O    4  
ATOM 9953  C CB   . GLU B 1 105 ? -4.077  -1.783  -10.123 1.00 0.00 ? 105 GLU B CB   4  
ATOM 9954  C CG   . GLU B 1 105 ? -3.618  -2.139  -11.519 1.00 0.00 ? 105 GLU B CG   4  
ATOM 9955  C CD   . GLU B 1 105 ? -3.918  -1.029  -12.490 1.00 0.00 ? 105 GLU B CD   4  
ATOM 9956  O OE1  . GLU B 1 105 ? -5.034  -0.960  -13.014 1.00 0.00 ? 105 GLU B OE1  4  
ATOM 9957  O OE2  . GLU B 1 105 ? -3.027  -0.174  -12.725 1.00 0.00 ? 105 GLU B OE2  4  
ATOM 9958  H H    . GLU B 1 105 ? -1.582  -2.536  -9.770  1.00 0.00 ? 105 GLU B H    4  
ATOM 9959  H HA   . GLU B 1 105 ? -3.847  -2.247  -8.025  1.00 0.00 ? 105 GLU B HA   4  
ATOM 9960  H HB2  . GLU B 1 105 ? -5.154  -1.854  -10.109 1.00 0.00 ? 105 GLU B HB2  4  
ATOM 9961  H HB3  . GLU B 1 105 ? -3.805  -0.754  -9.930  1.00 0.00 ? 105 GLU B HB3  4  
ATOM 9962  H HG2  . GLU B 1 105 ? -2.555  -2.327  -11.510 1.00 0.00 ? 105 GLU B HG2  4  
ATOM 9963  H HG3  . GLU B 1 105 ? -4.137  -3.029  -11.841 1.00 0.00 ? 105 GLU B HG3  4  
ATOM 9964  N N    . GLU B 1 106 ? -4.675  -4.455  -8.017  1.00 0.00 ? 106 GLU B N    4  
ATOM 9965  C CA   . GLU B 1 106 ? -5.081  -5.795  -7.735  1.00 0.00 ? 106 GLU B CA   4  
ATOM 9966  C C    . GLU B 1 106 ? -6.015  -6.296  -8.810  1.00 0.00 ? 106 GLU B C    4  
ATOM 9967  O O    . GLU B 1 106 ? -5.653  -7.138  -9.617  1.00 0.00 ? 106 GLU B O    4  
ATOM 9968  C CB   . GLU B 1 106 ? -5.775  -5.830  -6.363  1.00 0.00 ? 106 GLU B CB   4  
ATOM 9969  C CG   . GLU B 1 106 ? -4.885  -5.541  -5.152  1.00 0.00 ? 106 GLU B CG   4  
ATOM 9970  C CD   . GLU B 1 106 ? -3.857  -6.625  -4.883  1.00 0.00 ? 106 GLU B CD   4  
ATOM 9971  O OE1  . GLU B 1 106 ? -4.223  -7.706  -4.329  1.00 0.00 ? 106 GLU B OE1  4  
ATOM 9972  O OE2  . GLU B 1 106 ? -2.684  -6.428  -5.208  1.00 0.00 ? 106 GLU B OE2  4  
ATOM 9973  H H    . GLU B 1 106 ? -5.005  -3.734  -7.438  1.00 0.00 ? 106 GLU B H    4  
ATOM 9974  H HA   . GLU B 1 106 ? -4.205  -6.423  -7.688  1.00 0.00 ? 106 GLU B HA   4  
ATOM 9975  H HB2  . GLU B 1 106 ? -6.569  -5.100  -6.364  1.00 0.00 ? 106 GLU B HB2  4  
ATOM 9976  H HB3  . GLU B 1 106 ? -6.215  -6.808  -6.232  1.00 0.00 ? 106 GLU B HB3  4  
ATOM 9977  H HG2  . GLU B 1 106 ? -4.361  -4.612  -5.322  1.00 0.00 ? 106 GLU B HG2  4  
ATOM 9978  H HG3  . GLU B 1 106 ? -5.513  -5.434  -4.279  1.00 0.00 ? 106 GLU B HG3  4  
ATOM 9979  N N    . ARG B 1 107 ? -7.198  -5.769  -8.816  1.00 0.00 ? 107 ARG B N    4  
ATOM 9980  C CA   . ARG B 1 107 ? -8.233  -6.107  -9.764  1.00 0.00 ? 107 ARG B CA   4  
ATOM 9981  C C    . ARG B 1 107 ? -8.992  -4.842  -10.066 1.00 0.00 ? 107 ARG B C    4  
ATOM 9982  O O    . ARG B 1 107 ? -8.938  -3.898  -9.281  1.00 0.00 ? 107 ARG B O    4  
ATOM 9983  C CB   . ARG B 1 107 ? -9.209  -7.207  -9.248  1.00 0.00 ? 107 ARG B CB   4  
ATOM 9984  C CG   . ARG B 1 107 ? -8.707  -8.665  -9.287  1.00 0.00 ? 107 ARG B CG   4  
ATOM 9985  C CD   . ARG B 1 107 ? -7.692  -9.022  -8.210  1.00 0.00 ? 107 ARG B CD   4  
ATOM 9986  N NE   . ARG B 1 107 ? -8.209  -8.845  -6.846  1.00 0.00 ? 107 ARG B NE   4  
ATOM 9987  C CZ   . ARG B 1 107 ? -7.441  -8.715  -5.757  1.00 0.00 ? 107 ARG B CZ   4  
ATOM 9988  N NH1  . ARG B 1 107 ? -6.129  -8.892  -5.847  1.00 0.00 ? 107 ARG B NH1  4  
ATOM 9989  N NH2  . ARG B 1 107 ? -7.990  -8.474  -4.577  1.00 0.00 ? 107 ARG B NH2  4  
ATOM 9990  H H    . ARG B 1 107 ? -7.425  -5.067  -8.169  1.00 0.00 ? 107 ARG B H    4  
ATOM 9991  H HA   . ARG B 1 107 ? -7.751  -6.438  -10.671 1.00 0.00 ? 107 ARG B HA   4  
ATOM 9992  H HB2  . ARG B 1 107 ? -9.427  -7.002  -8.213  1.00 0.00 ? 107 ARG B HB2  4  
ATOM 9993  H HB3  . ARG B 1 107 ? -10.123 -7.148  -9.819  1.00 0.00 ? 107 ARG B HB3  4  
ATOM 9994  H HG2  . ARG B 1 107 ? -9.557  -9.323  -9.171  1.00 0.00 ? 107 ARG B HG2  4  
ATOM 9995  H HG3  . ARG B 1 107 ? -8.263  -8.838  -10.256 1.00 0.00 ? 107 ARG B HG3  4  
ATOM 9996  H HD2  . ARG B 1 107 ? -7.409  -10.056 -8.336  1.00 0.00 ? 107 ARG B HD2  4  
ATOM 9997  H HD3  . ARG B 1 107 ? -6.822  -8.395  -8.340  1.00 0.00 ? 107 ARG B HD3  4  
ATOM 9998  H HE   . ARG B 1 107 ? -9.191  -8.800  -6.776  1.00 0.00 ? 107 ARG B HE   4  
ATOM 9999  H HH11 . ARG B 1 107 ? -5.704  -9.158  -6.715  1.00 0.00 ? 107 ARG B HH11 4  
ATOM 10000 H HH12 . ARG B 1 107 ? -5.490  -8.700  -5.088  1.00 0.00 ? 107 ARG B HH12 4  
ATOM 10001 H HH21 . ARG B 1 107 ? -8.991  -8.388  -4.455  1.00 0.00 ? 107 ARG B HH21 4  
ATOM 10002 H HH22 . ARG B 1 107 ? -7.447  -8.380  -3.742  1.00 0.00 ? 107 ARG B HH22 4  
ATOM 10003 N N    . GLN B 1 108 ? -9.609  -4.767  -11.202 1.00 0.00 ? 108 GLN B N    4  
ATOM 10004 C CA   . GLN B 1 108 ? -10.359 -3.589  -11.553 1.00 0.00 ? 108 GLN B CA   4  
ATOM 10005 C C    . GLN B 1 108 ? -11.847 -3.915  -11.573 1.00 0.00 ? 108 GLN B C    4  
ATOM 10006 O O    . GLN B 1 108 ? -12.268 -4.901  -12.186 1.00 0.00 ? 108 GLN B O    4  
ATOM 10007 C CB   . GLN B 1 108 ? -9.891  -3.048  -12.904 1.00 0.00 ? 108 GLN B CB   4  
ATOM 10008 C CG   . GLN B 1 108 ? -8.398  -2.727  -12.944 1.00 0.00 ? 108 GLN B CG   4  
ATOM 10009 C CD   . GLN B 1 108 ? -7.946  -2.217  -14.289 1.00 0.00 ? 108 GLN B CD   4  
ATOM 10010 O OE1  . GLN B 1 108 ? -7.579  -3.000  -15.171 1.00 0.00 ? 108 GLN B OE1  4  
ATOM 10011 N NE2  . GLN B 1 108 ? -7.939  -0.920  -14.461 1.00 0.00 ? 108 GLN B NE2  4  
ATOM 10012 H H    . GLN B 1 108 ? -9.596  -5.515  -11.837 1.00 0.00 ? 108 GLN B H    4  
ATOM 10013 H HA   . GLN B 1 108 ? -10.179 -2.844  -10.791 1.00 0.00 ? 108 GLN B HA   4  
ATOM 10014 H HB2  . GLN B 1 108 ? -10.099 -3.787  -13.664 1.00 0.00 ? 108 GLN B HB2  4  
ATOM 10015 H HB3  . GLN B 1 108 ? -10.440 -2.146  -13.131 1.00 0.00 ? 108 GLN B HB3  4  
ATOM 10016 H HG2  . GLN B 1 108 ? -8.186  -1.969  -12.204 1.00 0.00 ? 108 GLN B HG2  4  
ATOM 10017 H HG3  . GLN B 1 108 ? -7.842  -3.623  -12.707 1.00 0.00 ? 108 GLN B HG3  4  
ATOM 10018 H HE21 . GLN B 1 108 ? -8.216  -0.338  -13.724 1.00 0.00 ? 108 GLN B HE21 4  
ATOM 10019 H HE22 . GLN B 1 108 ? -7.633  -0.583  -15.329 1.00 0.00 ? 108 GLN B HE22 4  
ATOM 10020 N N    . ASP B 1 109 ? -12.629 -3.116  -10.877 1.00 0.00 ? 109 ASP B N    4  
ATOM 10021 C CA   . ASP B 1 109 ? -14.079 -3.285  -10.817 1.00 0.00 ? 109 ASP B CA   4  
ATOM 10022 C C    . ASP B 1 109 ? -14.725 -2.416  -11.868 1.00 0.00 ? 109 ASP B C    4  
ATOM 10023 O O    . ASP B 1 109 ? -14.047 -1.843  -12.732 1.00 0.00 ? 109 ASP B O    4  
ATOM 10024 C CB   . ASP B 1 109 ? -14.690 -2.834  -9.463  1.00 0.00 ? 109 ASP B CB   4  
ATOM 10025 C CG   . ASP B 1 109 ? -14.312 -3.611  -8.245  1.00 0.00 ? 109 ASP B CG   4  
ATOM 10026 O OD1  . ASP B 1 109 ? -14.512 -4.840  -8.219  1.00 0.00 ? 109 ASP B OD1  4  
ATOM 10027 O OD2  . ASP B 1 109 ? -13.928 -2.984  -7.231  1.00 0.00 ? 109 ASP B OD2  4  
ATOM 10028 H H    . ASP B 1 109 ? -12.242 -2.344  -10.407 1.00 0.00 ? 109 ASP B H    4  
ATOM 10029 H HA   . ASP B 1 109 ? -14.326 -4.321  -10.989 1.00 0.00 ? 109 ASP B HA   4  
ATOM 10030 H HB2  . ASP B 1 109 ? -14.386 -1.815  -9.284  1.00 0.00 ? 109 ASP B HB2  4  
ATOM 10031 H HB3  . ASP B 1 109 ? -15.767 -2.847  -9.550  1.00 0.00 ? 109 ASP B HB3  4  
ATOM 10032 N N    . GLU B 1 110 ? -16.031 -2.310  -11.765 1.00 0.00 ? 110 GLU B N    4  
ATOM 10033 C CA   . GLU B 1 110 ? -16.869 -1.480  -12.607 1.00 0.00 ? 110 GLU B CA   4  
ATOM 10034 C C    . GLU B 1 110 ? -16.398 -0.034  -12.531 1.00 0.00 ? 110 GLU B C    4  
ATOM 10035 O O    . GLU B 1 110 ? -15.862 0.519   -13.486 1.00 0.00 ? 110 GLU B O    4  
ATOM 10036 C CB   . GLU B 1 110 ? -18.325 -1.497  -12.109 1.00 0.00 ? 110 GLU B CB   4  
ATOM 10037 C CG   . GLU B 1 110 ? -18.966 -2.868  -11.844 1.00 0.00 ? 110 GLU B CG   4  
ATOM 10038 C CD   . GLU B 1 110 ? -18.403 -3.558  -10.623 1.00 0.00 ? 110 GLU B CD   4  
ATOM 10039 O OE1  . GLU B 1 110 ? -18.686 -3.120  -9.494  1.00 0.00 ? 110 GLU B OE1  4  
ATOM 10040 O OE2  . GLU B 1 110 ? -17.637 -4.523  -10.773 1.00 0.00 ? 110 GLU B OE2  4  
ATOM 10041 H H    . GLU B 1 110 ? -16.469 -2.869  -11.085 1.00 0.00 ? 110 GLU B H    4  
ATOM 10042 H HA   . GLU B 1 110 ? -16.843 -1.841  -13.624 1.00 0.00 ? 110 GLU B HA   4  
ATOM 10043 H HB2  . GLU B 1 110 ? -18.388 -0.933  -11.192 1.00 0.00 ? 110 GLU B HB2  4  
ATOM 10044 H HB3  . GLU B 1 110 ? -18.927 -0.990  -12.850 1.00 0.00 ? 110 GLU B HB3  4  
ATOM 10045 H HG2  . GLU B 1 110 ? -20.027 -2.734  -11.698 1.00 0.00 ? 110 GLU B HG2  4  
ATOM 10046 H HG3  . GLU B 1 110 ? -18.803 -3.499  -12.706 1.00 0.00 ? 110 GLU B HG3  4  
ATOM 10047 N N    . HIS B 1 111 ? -16.591 0.556   -11.368 1.00 0.00 ? 111 HIS B N    4  
ATOM 10048 C CA   . HIS B 1 111 ? -16.213 1.940   -11.088 1.00 0.00 ? 111 HIS B CA   4  
ATOM 10049 C C    . HIS B 1 111 ? -15.284 1.930   -9.932  1.00 0.00 ? 111 HIS B C    4  
ATOM 10050 O O    . HIS B 1 111 ? -15.046 2.948   -9.278  1.00 0.00 ? 111 HIS B O    4  
ATOM 10051 C CB   . HIS B 1 111 ? -17.444 2.781   -10.701 1.00 0.00 ? 111 HIS B CB   4  
ATOM 10052 C CG   . HIS B 1 111 ? -18.488 2.974   -11.762 1.00 0.00 ? 111 HIS B CG   4  
ATOM 10053 N ND1  . HIS B 1 111 ? -18.701 4.168   -12.403 1.00 0.00 ? 111 HIS B ND1  4  
ATOM 10054 C CD2  . HIS B 1 111 ? -19.419 2.130   -12.245 1.00 0.00 ? 111 HIS B CD2  4  
ATOM 10055 C CE1  . HIS B 1 111 ? -19.716 4.051   -13.230 1.00 0.00 ? 111 HIS B CE1  4  
ATOM 10056 N NE2  . HIS B 1 111 ? -20.170 2.819   -13.154 1.00 0.00 ? 111 HIS B NE2  4  
ATOM 10057 H H    . HIS B 1 111 ? -16.997 0.046   -10.630 1.00 0.00 ? 111 HIS B H    4  
ATOM 10058 H HA   . HIS B 1 111 ? -15.740 2.369   -11.958 1.00 0.00 ? 111 HIS B HA   4  
ATOM 10059 H HB2  . HIS B 1 111 ? -17.931 2.293   -9.871  1.00 0.00 ? 111 HIS B HB2  4  
ATOM 10060 H HB3  . HIS B 1 111 ? -17.114 3.754   -10.369 1.00 0.00 ? 111 HIS B HB3  4  
ATOM 10061 H HD1  . HIS B 1 111 ? -18.189 4.996   -12.268 1.00 0.00 ? 111 HIS B HD1  4  
ATOM 10062 H HD2  . HIS B 1 111 ? -19.543 1.094   -11.961 1.00 0.00 ? 111 HIS B HD2  4  
ATOM 10063 H HE1  . HIS B 1 111 ? -20.108 4.832   -13.864 1.00 0.00 ? 111 HIS B HE1  4  
ATOM 10064 H HE2  . HIS B 1 111 ? -20.716 2.377   -13.840 1.00 0.00 ? 111 HIS B HE2  4  
ATOM 10065 N N    . GLY B 1 112 ? -14.804 0.766   -9.662  1.00 0.00 ? 112 GLY B N    4  
ATOM 10066 C CA   . GLY B 1 112 ? -13.938 0.570   -8.599  1.00 0.00 ? 112 GLY B CA   4  
ATOM 10067 C C    . GLY B 1 112 ? -12.624 0.148   -9.085  1.00 0.00 ? 112 GLY B C    4  
ATOM 10068 O O    . GLY B 1 112 ? -12.509 -0.544  -10.085 1.00 0.00 ? 112 GLY B O    4  
ATOM 10069 H H    . GLY B 1 112 ? -15.033 0.005   -10.230 1.00 0.00 ? 112 GLY B H    4  
ATOM 10070 H HA2  . GLY B 1 112 ? -13.837 1.500   -8.058  1.00 0.00 ? 112 GLY B HA2  4  
ATOM 10071 H HA3  . GLY B 1 112 ? -14.332 -0.192  -7.944  1.00 0.00 ? 112 GLY B HA3  4  
ATOM 10072 N N    . PHE B 1 113 ? -11.644 0.615   -8.451  1.00 0.00 ? 113 PHE B N    4  
ATOM 10073 C CA   . PHE B 1 113 ? -10.316 0.247   -8.736  1.00 0.00 ? 113 PHE B CA   4  
ATOM 10074 C C    . PHE B 1 113 ? -9.738  -0.264  -7.449  1.00 0.00 ? 113 PHE B C    4  
ATOM 10075 O O    . PHE B 1 113 ? -10.003 0.312   -6.387  1.00 0.00 ? 113 PHE B O    4  
ATOM 10076 C CB   . PHE B 1 113 ? -9.502  1.452   -9.234  1.00 0.00 ? 113 PHE B CB   4  
ATOM 10077 C CG   . PHE B 1 113 ? -10.035 2.081   -10.490 1.00 0.00 ? 113 PHE B CG   4  
ATOM 10078 C CD1  . PHE B 1 113 ? -9.715  1.556   -11.729 1.00 0.00 ? 113 PHE B CD1  4  
ATOM 10079 C CD2  . PHE B 1 113 ? -10.858 3.198   -10.431 1.00 0.00 ? 113 PHE B CD2  4  
ATOM 10080 C CE1  . PHE B 1 113 ? -10.198 2.128   -12.883 1.00 0.00 ? 113 PHE B CE1  4  
ATOM 10081 C CE2  . PHE B 1 113 ? -11.346 3.775   -11.583 1.00 0.00 ? 113 PHE B CE2  4  
ATOM 10082 C CZ   . PHE B 1 113 ? -11.015 3.241   -12.812 1.00 0.00 ? 113 PHE B CZ   4  
ATOM 10083 H H    . PHE B 1 113 ? -11.817 1.255   -7.721  1.00 0.00 ? 113 PHE B H    4  
ATOM 10084 H HA   . PHE B 1 113 ? -10.316 -0.531  -9.484  1.00 0.00 ? 113 PHE B HA   4  
ATOM 10085 H HB2  . PHE B 1 113 ? -9.493  2.211   -8.466  1.00 0.00 ? 113 PHE B HB2  4  
ATOM 10086 H HB3  . PHE B 1 113 ? -8.488  1.132   -9.424  1.00 0.00 ? 113 PHE B HB3  4  
ATOM 10087 H HD1  . PHE B 1 113 ? -9.078  0.686   -11.784 1.00 0.00 ? 113 PHE B HD1  4  
ATOM 10088 H HD2  . PHE B 1 113 ? -11.114 3.616   -9.469  1.00 0.00 ? 113 PHE B HD2  4  
ATOM 10089 H HE1  . PHE B 1 113 ? -9.938  1.709   -13.844 1.00 0.00 ? 113 PHE B HE1  4  
ATOM 10090 H HE2  . PHE B 1 113 ? -11.985 4.644   -11.524 1.00 0.00 ? 113 PHE B HE2  4  
ATOM 10091 H HZ   . PHE B 1 113 ? -11.396 3.693   -13.716 1.00 0.00 ? 113 PHE B HZ   4  
ATOM 10092 N N    . ILE B 1 114 ? -8.973  -1.316  -7.496  1.00 0.00 ? 114 ILE B N    4  
ATOM 10093 C CA   . ILE B 1 114 ? -8.437  -1.857  -6.276  1.00 0.00 ? 114 ILE B CA   4  
ATOM 10094 C C    . ILE B 1 114 ? -6.946  -1.885  -6.440  1.00 0.00 ? 114 ILE B C    4  
ATOM 10095 O O    . ILE B 1 114 ? -6.442  -2.351  -7.462  1.00 0.00 ? 114 ILE B O    4  
ATOM 10096 C CB   . ILE B 1 114 ? -8.895  -3.329  -6.090  1.00 0.00 ? 114 ILE B CB   4  
ATOM 10097 C CG1  . ILE B 1 114 ? -10.344 -3.520  -6.530  1.00 0.00 ? 114 ILE B CG1  4  
ATOM 10098 C CG2  . ILE B 1 114 ? -8.758  -3.732  -4.627  1.00 0.00 ? 114 ILE B CG2  4  
ATOM 10099 C CD1  . ILE B 1 114 ? -10.726 -4.966  -6.698  1.00 0.00 ? 114 ILE B CD1  4  
ATOM 10100 H H    . ILE B 1 114 ? -8.750  -1.750  -8.349  1.00 0.00 ? 114 ILE B H    4  
ATOM 10101 H HA   . ILE B 1 114 ? -8.740  -1.269  -5.423  1.00 0.00 ? 114 ILE B HA   4  
ATOM 10102 H HB   . ILE B 1 114 ? -8.257  -3.963  -6.686  1.00 0.00 ? 114 ILE B HB   4  
ATOM 10103 H HG12 . ILE B 1 114 ? -11.004 -3.096  -5.788  1.00 0.00 ? 114 ILE B HG12 4  
ATOM 10104 H HG13 . ILE B 1 114 ? -10.499 -3.021  -7.476  1.00 0.00 ? 114 ILE B HG13 4  
ATOM 10105 H HG21 . ILE B 1 114 ? -9.083  -4.754  -4.503  1.00 0.00 ? 114 ILE B HG21 4  
ATOM 10106 H HG22 . ILE B 1 114 ? -9.367  -3.083  -4.017  1.00 0.00 ? 114 ILE B HG22 4  
ATOM 10107 H HG23 . ILE B 1 114 ? -7.725  -3.643  -4.325  1.00 0.00 ? 114 ILE B HG23 4  
ATOM 10108 H HD11 . ILE B 1 114 ? -10.544 -5.500  -5.777  1.00 0.00 ? 114 ILE B HD11 4  
ATOM 10109 H HD12 . ILE B 1 114 ? -10.120 -5.388  -7.485  1.00 0.00 ? 114 ILE B HD12 4  
ATOM 10110 H HD13 . ILE B 1 114 ? -11.772 -5.038  -6.960  1.00 0.00 ? 114 ILE B HD13 4  
ATOM 10111 N N    . SER B 1 115 ? -6.240  -1.403  -5.465  1.00 0.00 ? 115 SER B N    4  
ATOM 10112 C CA   . SER B 1 115 ? -4.819  -1.381  -5.510  1.00 0.00 ? 115 SER B CA   4  
ATOM 10113 C C    . SER B 1 115 ? -4.232  -1.806  -4.166  1.00 0.00 ? 115 SER B C    4  
ATOM 10114 O O    . SER B 1 115 ? -4.895  -1.732  -3.123  1.00 0.00 ? 115 SER B O    4  
ATOM 10115 C CB   . SER B 1 115 ? -4.338  0.028   -5.922  1.00 0.00 ? 115 SER B CB   4  
ATOM 10116 O OG   . SER B 1 115 ? -2.931  0.075   -6.136  1.00 0.00 ? 115 SER B OG   4  
ATOM 10117 H H    . SER B 1 115 ? -6.658  -1.024  -4.658  1.00 0.00 ? 115 SER B H    4  
ATOM 10118 H HA   . SER B 1 115 ? -4.497  -2.085  -6.258  1.00 0.00 ? 115 SER B HA   4  
ATOM 10119 H HB2  . SER B 1 115 ? -4.832  0.318   -6.837  1.00 0.00 ? 115 SER B HB2  4  
ATOM 10120 H HB3  . SER B 1 115 ? -4.596  0.730   -5.142  1.00 0.00 ? 115 SER B HB3  4  
ATOM 10121 H HG   . SER B 1 115 ? -2.660  -0.786  -6.479  1.00 0.00 ? 115 SER B HG   4  
ATOM 10122 N N    . ARG B 1 116 ? -3.021  -2.257  -4.187  1.00 0.00 ? 116 ARG B N    4  
ATOM 10123 C CA   . ARG B 1 116 ? -2.311  -2.507  -2.997  1.00 0.00 ? 116 ARG B CA   4  
ATOM 10124 C C    . ARG B 1 116 ? -0.925  -1.901  -3.205  1.00 0.00 ? 116 ARG B C    4  
ATOM 10125 O O    . ARG B 1 116 ? -0.430  -1.872  -4.330  1.00 0.00 ? 116 ARG B O    4  
ATOM 10126 C CB   . ARG B 1 116 ? -2.264  -4.026  -2.709  1.00 0.00 ? 116 ARG B CB   4  
ATOM 10127 C CG   . ARG B 1 116 ? -1.866  -4.352  -1.289  1.00 0.00 ? 116 ARG B CG   4  
ATOM 10128 C CD   . ARG B 1 116 ? -2.044  -5.811  -0.926  1.00 0.00 ? 116 ARG B CD   4  
ATOM 10129 N NE   . ARG B 1 116 ? -1.845  -5.992  0.530   1.00 0.00 ? 116 ARG B NE   4  
ATOM 10130 C CZ   . ARG B 1 116 ? -1.522  -7.138  1.151   1.00 0.00 ? 116 ARG B CZ   4  
ATOM 10131 N NH1  . ARG B 1 116 ? -1.413  -8.270  0.464   1.00 0.00 ? 116 ARG B NH1  4  
ATOM 10132 N NH2  . ARG B 1 116 ? -1.315  -7.144  2.464   1.00 0.00 ? 116 ARG B NH2  4  
ATOM 10133 H H    . ARG B 1 116 ? -2.561  -2.423  -5.042  1.00 0.00 ? 116 ARG B H    4  
ATOM 10134 H HA   . ARG B 1 116 ? -2.808  -1.985  -2.192  1.00 0.00 ? 116 ARG B HA   4  
ATOM 10135 H HB2  . ARG B 1 116 ? -3.242  -4.444  -2.894  1.00 0.00 ? 116 ARG B HB2  4  
ATOM 10136 H HB3  . ARG B 1 116 ? -1.551  -4.487  -3.377  1.00 0.00 ? 116 ARG B HB3  4  
ATOM 10137 H HG2  . ARG B 1 116 ? -0.826  -4.096  -1.154  1.00 0.00 ? 116 ARG B HG2  4  
ATOM 10138 H HG3  . ARG B 1 116 ? -2.462  -3.750  -0.618  1.00 0.00 ? 116 ARG B HG3  4  
ATOM 10139 H HD2  . ARG B 1 116 ? -3.036  -6.133  -1.204  1.00 0.00 ? 116 ARG B HD2  4  
ATOM 10140 H HD3  . ARG B 1 116 ? -1.307  -6.399  -1.453  1.00 0.00 ? 116 ARG B HD3  4  
ATOM 10141 H HE   . ARG B 1 116 ? -1.954  -5.159  1.040   1.00 0.00 ? 116 ARG B HE   4  
ATOM 10142 H HH11 . ARG B 1 116 ? -1.562  -8.328  -0.526  1.00 0.00 ? 116 ARG B HH11 4  
ATOM 10143 H HH12 . ARG B 1 116 ? -1.159  -9.134  0.911   1.00 0.00 ? 116 ARG B HH12 4  
ATOM 10144 H HH21 . ARG B 1 116 ? -1.396  -6.335  3.048   1.00 0.00 ? 116 ARG B HH21 4  
ATOM 10145 H HH22 . ARG B 1 116 ? -1.009  -7.969  2.951   1.00 0.00 ? 116 ARG B HH22 4  
ATOM 10146 N N    . GLU B 1 117 ? -0.318  -1.418  -2.164  1.00 0.00 ? 117 GLU B N    4  
ATOM 10147 C CA   . GLU B 1 117 ? 0.977   -0.771  -2.258  1.00 0.00 ? 117 GLU B CA   4  
ATOM 10148 C C    . GLU B 1 117 ? 1.902   -1.316  -1.242  1.00 0.00 ? 117 GLU B C    4  
ATOM 10149 O O    . GLU B 1 117 ? 1.472   -1.801  -0.225  1.00 0.00 ? 117 GLU B O    4  
ATOM 10150 C CB   . GLU B 1 117 ? 0.921   0.730   -2.028  1.00 0.00 ? 117 GLU B CB   4  
ATOM 10151 C CG   . GLU B 1 117 ? 0.150   1.548   -3.020  1.00 0.00 ? 117 GLU B CG   4  
ATOM 10152 C CD   . GLU B 1 117 ? 0.555   2.987   -2.903  1.00 0.00 ? 117 GLU B CD   4  
ATOM 10153 O OE1  . GLU B 1 117 ? 0.377   3.574   -1.820  1.00 0.00 ? 117 GLU B OE1  4  
ATOM 10154 O OE2  . GLU B 1 117 ? 1.148   3.522   -3.861  1.00 0.00 ? 117 GLU B OE2  4  
ATOM 10155 H H    . GLU B 1 117 ? -0.736  -1.497  -1.275  1.00 0.00 ? 117 GLU B H    4  
ATOM 10156 H HA   . GLU B 1 117 ? 1.381   -0.953  -3.243  1.00 0.00 ? 117 GLU B HA   4  
ATOM 10157 H HB2  . GLU B 1 117 ? 0.480   0.907   -1.058  1.00 0.00 ? 117 GLU B HB2  4  
ATOM 10158 H HB3  . GLU B 1 117 ? 1.935   1.101   -2.002  1.00 0.00 ? 117 GLU B HB3  4  
ATOM 10159 H HG2  . GLU B 1 117 ? 0.359   1.193   -4.018  1.00 0.00 ? 117 GLU B HG2  4  
ATOM 10160 H HG3  . GLU B 1 117 ? -0.907  1.466   -2.814  1.00 0.00 ? 117 GLU B HG3  4  
ATOM 10161 N N    . PHE B 1 118 ? 3.151   -1.237  -1.516  1.00 0.00 ? 118 PHE B N    4  
ATOM 10162 C CA   . PHE B 1 118 ? 4.169   -1.639  -0.605  1.00 0.00 ? 118 PHE B CA   4  
ATOM 10163 C C    . PHE B 1 118 ? 5.053   -0.431  -0.360  1.00 0.00 ? 118 PHE B C    4  
ATOM 10164 O O    . PHE B 1 118 ? 5.480   0.228   -1.305  1.00 0.00 ? 118 PHE B O    4  
ATOM 10165 C CB   . PHE B 1 118 ? 4.981   -2.777  -1.210  1.00 0.00 ? 118 PHE B CB   4  
ATOM 10166 C CG   . PHE B 1 118 ? 5.935   -3.447  -0.267  1.00 0.00 ? 118 PHE B CG   4  
ATOM 10167 C CD1  . PHE B 1 118 ? 7.230   -2.979  -0.108  1.00 0.00 ? 118 PHE B CD1  4  
ATOM 10168 C CD2  . PHE B 1 118 ? 5.537   -4.566  0.445   1.00 0.00 ? 118 PHE B CD2  4  
ATOM 10169 C CE1  . PHE B 1 118 ? 8.104   -3.617  0.741   1.00 0.00 ? 118 PHE B CE1  4  
ATOM 10170 C CE2  . PHE B 1 118 ? 6.406   -5.205  1.297   1.00 0.00 ? 118 PHE B CE2  4  
ATOM 10171 C CZ   . PHE B 1 118 ? 7.690   -4.731  1.443   1.00 0.00 ? 118 PHE B CZ   4  
ATOM 10172 H H    . PHE B 1 118 ? 3.418   -0.850  -2.384  1.00 0.00 ? 118 PHE B H    4  
ATOM 10173 H HA   . PHE B 1 118 ? 3.716   -1.960  0.321   1.00 0.00 ? 118 PHE B HA   4  
ATOM 10174 H HB2  . PHE B 1 118 ? 4.303   -3.533  -1.576  1.00 0.00 ? 118 PHE B HB2  4  
ATOM 10175 H HB3  . PHE B 1 118 ? 5.550   -2.391  -2.043  1.00 0.00 ? 118 PHE B HB3  4  
ATOM 10176 H HD1  . PHE B 1 118 ? 7.549   -2.106  -0.657  1.00 0.00 ? 118 PHE B HD1  4  
ATOM 10177 H HD2  . PHE B 1 118 ? 4.529   -4.936  0.329   1.00 0.00 ? 118 PHE B HD2  4  
ATOM 10178 H HE1  . PHE B 1 118 ? 9.112   -3.247  0.859   1.00 0.00 ? 118 PHE B HE1  4  
ATOM 10179 H HE2  . PHE B 1 118 ? 6.085   -6.076  1.847   1.00 0.00 ? 118 PHE B HE2  4  
ATOM 10180 H HZ   . PHE B 1 118 ? 8.378   -5.233  2.110   1.00 0.00 ? 118 PHE B HZ   4  
ATOM 10181 N N    . HIS B 1 119 ? 5.275   -0.101  0.895   1.00 0.00 ? 119 HIS B N    4  
ATOM 10182 C CA   . HIS B 1 119 ? 6.135   1.018   1.256   1.00 0.00 ? 119 HIS B CA   4  
ATOM 10183 C C    . HIS B 1 119 ? 7.123   0.572   2.314   1.00 0.00 ? 119 HIS B C    4  
ATOM 10184 O O    . HIS B 1 119 ? 6.730   0.133   3.381   1.00 0.00 ? 119 HIS B O    4  
ATOM 10185 C CB   . HIS B 1 119 ? 5.327   2.224   1.809   1.00 0.00 ? 119 HIS B CB   4  
ATOM 10186 C CG   . HIS B 1 119 ? 4.382   2.891   0.839   1.00 0.00 ? 119 HIS B CG   4  
ATOM 10187 N ND1  . HIS B 1 119 ? 4.680   4.063   0.171   1.00 0.00 ? 119 HIS B ND1  4  
ATOM 10188 C CD2  . HIS B 1 119 ? 3.119   2.560   0.455   1.00 0.00 ? 119 HIS B CD2  4  
ATOM 10189 C CE1  . HIS B 1 119 ? 3.646   4.414   -0.574  1.00 0.00 ? 119 HIS B CE1  4  
ATOM 10190 N NE2  . HIS B 1 119 ? 2.694   3.524   -0.419  1.00 0.00 ? 119 HIS B NE2  4  
ATOM 10191 H H    . HIS B 1 119 ? 4.904   -0.644  1.629   1.00 0.00 ? 119 HIS B H    4  
ATOM 10192 H HA   . HIS B 1 119 ? 6.673   1.327   0.372   1.00 0.00 ? 119 HIS B HA   4  
ATOM 10193 H HB2  . HIS B 1 119 ? 4.734   1.883   2.643   1.00 0.00 ? 119 HIS B HB2  4  
ATOM 10194 H HB3  . HIS B 1 119 ? 6.024   2.969   2.165   1.00 0.00 ? 119 HIS B HB3  4  
ATOM 10195 H HD1  . HIS B 1 119 ? 5.505   4.595   0.235   1.00 0.00 ? 119 HIS B HD1  4  
ATOM 10196 H HD2  . HIS B 1 119 ? 2.556   1.698   0.782   1.00 0.00 ? 119 HIS B HD2  4  
ATOM 10197 H HE1  . HIS B 1 119 ? 3.589   5.286   -1.208  1.00 0.00 ? 119 HIS B HE1  4  
ATOM 10198 H HE2  . HIS B 1 119 ? 1.820   3.551   -0.887  1.00 0.00 ? 119 HIS B HE2  4  
ATOM 10199 N N    . ARG B 1 120 ? 8.378   0.690   2.043   1.00 0.00 ? 120 ARG B N    4  
ATOM 10200 C CA   . ARG B 1 120 ? 9.383   0.359   3.029   1.00 0.00 ? 120 ARG B CA   4  
ATOM 10201 C C    . ARG B 1 120 ? 10.275  1.543   3.171   1.00 0.00 ? 120 ARG B C    4  
ATOM 10202 O O    . ARG B 1 120 ? 10.625  2.171   2.160   1.00 0.00 ? 120 ARG B O    4  
ATOM 10203 C CB   . ARG B 1 120 ? 10.187  -0.863  2.600   1.00 0.00 ? 120 ARG B CB   4  
ATOM 10204 C CG   . ARG B 1 120 ? 11.173  -1.361  3.650   1.00 0.00 ? 120 ARG B CG   4  
ATOM 10205 C CD   . ARG B 1 120 ? 11.851  -2.623  3.180   1.00 0.00 ? 120 ARG B CD   4  
ATOM 10206 N NE   . ARG B 1 120 ? 12.661  -3.278  4.202   1.00 0.00 ? 120 ARG B NE   4  
ATOM 10207 C CZ   . ARG B 1 120 ? 12.896  -4.597  4.251   1.00 0.00 ? 120 ARG B CZ   4  
ATOM 10208 N NH1  . ARG B 1 120 ? 12.306  -5.426  3.385   1.00 0.00 ? 120 ARG B NH1  4  
ATOM 10209 N NH2  . ARG B 1 120 ? 13.627  -5.088  5.218   1.00 0.00 ? 120 ARG B NH2  4  
ATOM 10210 H H    . ARG B 1 120 ? 8.659   1.023   1.160   1.00 0.00 ? 120 ARG B H    4  
ATOM 10211 H HA   . ARG B 1 120 ? 8.891   0.165   3.969   1.00 0.00 ? 120 ARG B HA   4  
ATOM 10212 H HB2  . ARG B 1 120 ? 9.501   -1.664  2.368   1.00 0.00 ? 120 ARG B HB2  4  
ATOM 10213 H HB3  . ARG B 1 120 ? 10.742  -0.612  1.708   1.00 0.00 ? 120 ARG B HB3  4  
ATOM 10214 H HG2  . ARG B 1 120 ? 11.919  -0.597  3.813   1.00 0.00 ? 120 ARG B HG2  4  
ATOM 10215 H HG3  . ARG B 1 120 ? 10.645  -1.554  4.571   1.00 0.00 ? 120 ARG B HG3  4  
ATOM 10216 H HD2  . ARG B 1 120 ? 11.092  -3.319  2.853   1.00 0.00 ? 120 ARG B HD2  4  
ATOM 10217 H HD3  . ARG B 1 120 ? 12.482  -2.380  2.338   1.00 0.00 ? 120 ARG B HD3  4  
ATOM 10218 H HE   . ARG B 1 120 ? 13.041  -2.707  4.912   1.00 0.00 ? 120 ARG B HE   4  
ATOM 10219 H HH11 . ARG B 1 120 ? 11.683  -5.132  2.661   1.00 0.00 ? 120 ARG B HH11 4  
ATOM 10220 H HH12 . ARG B 1 120 ? 12.422  -6.429  3.486   1.00 0.00 ? 120 ARG B HH12 4  
ATOM 10221 H HH21 . ARG B 1 120 ? 14.001  -4.488  5.943   1.00 0.00 ? 120 ARG B HH21 4  
ATOM 10222 H HH22 . ARG B 1 120 ? 13.848  -6.060  5.305   1.00 0.00 ? 120 ARG B HH22 4  
ATOM 10223 N N    . LYS B 1 121 ? 10.644  1.878   4.382   1.00 0.00 ? 121 LYS B N    4  
ATOM 10224 C CA   . LYS B 1 121 ? 11.456  3.069   4.584   1.00 0.00 ? 121 LYS B CA   4  
ATOM 10225 C C    . LYS B 1 121 ? 12.580  2.748   5.537   1.00 0.00 ? 121 LYS B C    4  
ATOM 10226 O O    . LYS B 1 121 ? 12.327  2.223   6.612   1.00 0.00 ? 121 LYS B O    4  
ATOM 10227 C CB   . LYS B 1 121 ? 10.598  4.169   5.245   1.00 0.00 ? 121 LYS B CB   4  
ATOM 10228 C CG   . LYS B 1 121 ? 9.231   4.410   4.608   1.00 0.00 ? 121 LYS B CG   4  
ATOM 10229 C CD   . LYS B 1 121 ? 8.380   5.356   5.451   1.00 0.00 ? 121 LYS B CD   4  
ATOM 10230 C CE   . LYS B 1 121 ? 8.876   6.796   5.411   1.00 0.00 ? 121 LYS B CE   4  
ATOM 10231 N NZ   . LYS B 1 121 ? 8.678   7.420   4.086   1.00 0.00 ? 121 LYS B NZ   4  
ATOM 10232 H H    . LYS B 1 121 ? 10.397  1.329   5.163   1.00 0.00 ? 121 LYS B H    4  
ATOM 10233 H HA   . LYS B 1 121 ? 11.816  3.422   3.633   1.00 0.00 ? 121 LYS B HA   4  
ATOM 10234 H HB2  . LYS B 1 121 ? 10.439  3.902   6.280   1.00 0.00 ? 121 LYS B HB2  4  
ATOM 10235 H HB3  . LYS B 1 121 ? 11.155  5.093   5.214   1.00 0.00 ? 121 LYS B HB3  4  
ATOM 10236 H HG2  . LYS B 1 121 ? 9.375   4.850   3.632   1.00 0.00 ? 121 LYS B HG2  4  
ATOM 10237 H HG3  . LYS B 1 121 ? 8.719   3.464   4.508   1.00 0.00 ? 121 LYS B HG3  4  
ATOM 10238 H HD2  . LYS B 1 121 ? 7.367   5.329   5.082   1.00 0.00 ? 121 LYS B HD2  4  
ATOM 10239 H HD3  . LYS B 1 121 ? 8.390   5.009   6.474   1.00 0.00 ? 121 LYS B HD3  4  
ATOM 10240 H HE2  . LYS B 1 121 ? 8.332   7.370   6.146   1.00 0.00 ? 121 LYS B HE2  4  
ATOM 10241 H HE3  . LYS B 1 121 ? 9.928   6.813   5.656   1.00 0.00 ? 121 LYS B HE3  4  
ATOM 10242 H HZ1  . LYS B 1 121 ? 9.004   8.407   4.112   1.00 0.00 ? 121 LYS B HZ1  4  
ATOM 10243 H HZ2  . LYS B 1 121 ? 7.671   7.430   3.822   1.00 0.00 ? 121 LYS B HZ2  4  
ATOM 10244 H HZ3  . LYS B 1 121 ? 9.224   6.937   3.335   1.00 0.00 ? 121 LYS B HZ3  4  
ATOM 10245 N N    . TYR B 1 122 ? 13.801  3.034   5.152   1.00 0.00 ? 122 TYR B N    4  
ATOM 10246 C CA   . TYR B 1 122 ? 14.931  2.883   6.041   1.00 0.00 ? 122 TYR B CA   4  
ATOM 10247 C C    . TYR B 1 122 ? 15.899  4.046   6.038   1.00 0.00 ? 122 TYR B C    4  
ATOM 10248 O O    . TYR B 1 122 ? 16.264  4.561   4.978   1.00 0.00 ? 122 TYR B O    4  
ATOM 10249 C CB   . TYR B 1 122 ? 15.619  1.496   5.979   1.00 0.00 ? 122 TYR B CB   4  
ATOM 10250 C CG   . TYR B 1 122 ? 15.753  0.831   4.624   1.00 0.00 ? 122 TYR B CG   4  
ATOM 10251 C CD1  . TYR B 1 122 ? 14.649  0.261   3.999   1.00 0.00 ? 122 TYR B CD1  4  
ATOM 10252 C CD2  . TYR B 1 122 ? 16.976  0.716   4.008   1.00 0.00 ? 122 TYR B CD2  4  
ATOM 10253 C CE1  . TYR B 1 122 ? 14.767  -0.395  2.799   1.00 0.00 ? 122 TYR B CE1  4  
ATOM 10254 C CE2  . TYR B 1 122 ? 17.102  0.065   2.800   1.00 0.00 ? 122 TYR B CE2  4  
ATOM 10255 C CZ   . TYR B 1 122 ? 15.992  -0.490  2.201   1.00 0.00 ? 122 TYR B CZ   4  
ATOM 10256 O OH   . TYR B 1 122 ? 16.116  -1.151  0.998   1.00 0.00 ? 122 TYR B OH   4  
ATOM 10257 H H    . TYR B 1 122 ? 13.988  3.354   4.240   1.00 0.00 ? 122 TYR B H    4  
ATOM 10258 H HA   . TYR B 1 122 ? 14.464  2.959   7.013   1.00 0.00 ? 122 TYR B HA   4  
ATOM 10259 H HB2  . TYR B 1 122 ? 16.620  1.595   6.370   1.00 0.00 ? 122 TYR B HB2  4  
ATOM 10260 H HB3  . TYR B 1 122 ? 15.080  0.819   6.624   1.00 0.00 ? 122 TYR B HB3  4  
ATOM 10261 H HD1  . TYR B 1 122 ? 13.685  0.345   4.476   1.00 0.00 ? 122 TYR B HD1  4  
ATOM 10262 H HD2  . TYR B 1 122 ? 17.841  1.154   4.481   1.00 0.00 ? 122 TYR B HD2  4  
ATOM 10263 H HE1  . TYR B 1 122 ? 13.896  -0.829  2.332   1.00 0.00 ? 122 TYR B HE1  4  
ATOM 10264 H HE2  . TYR B 1 122 ? 18.070  -0.008  2.328   1.00 0.00 ? 122 TYR B HE2  4  
ATOM 10265 H HH   . TYR B 1 122 ? 16.890  -1.718  1.035   1.00 0.00 ? 122 TYR B HH   4  
ATOM 10266 N N    . ARG B 1 123 ? 16.292  4.474   7.223   1.00 0.00 ? 123 ARG B N    4  
ATOM 10267 C CA   . ARG B 1 123 ? 17.299  5.512   7.373   1.00 0.00 ? 123 ARG B CA   4  
ATOM 10268 C C    . ARG B 1 123 ? 18.581  4.925   7.944   1.00 0.00 ? 123 ARG B C    4  
ATOM 10269 O O    . ARG B 1 123 ? 18.689  4.660   9.144   1.00 0.00 ? 123 ARG B O    4  
ATOM 10270 C CB   . ARG B 1 123 ? 16.820  6.713   8.220   1.00 0.00 ? 123 ARG B CB   4  
ATOM 10271 C CG   . ARG B 1 123 ? 17.970  7.653   8.624   1.00 0.00 ? 123 ARG B CG   4  
ATOM 10272 C CD   . ARG B 1 123 ? 17.504  8.867   9.397   1.00 0.00 ? 123 ARG B CD   4  
ATOM 10273 N NE   . ARG B 1 123 ? 17.050  9.952   8.522   1.00 0.00 ? 123 ARG B NE   4  
ATOM 10274 C CZ   . ARG B 1 123 ? 16.235  10.946  8.890   1.00 0.00 ? 123 ARG B CZ   4  
ATOM 10275 N NH1  . ARG B 1 123 ? 15.646  10.928  10.089  1.00 0.00 ? 123 ARG B NH1  4  
ATOM 10276 N NH2  . ARG B 1 123 ? 15.997  11.952  8.056   1.00 0.00 ? 123 ARG B NH2  4  
ATOM 10277 H H    . ARG B 1 123 ? 15.905  4.064   8.027   1.00 0.00 ? 123 ARG B H    4  
ATOM 10278 H HA   . ARG B 1 123 ? 17.525  5.855   6.372   1.00 0.00 ? 123 ARG B HA   4  
ATOM 10279 H HB2  . ARG B 1 123 ? 16.096  7.279   7.653   1.00 0.00 ? 123 ARG B HB2  4  
ATOM 10280 H HB3  . ARG B 1 123 ? 16.355  6.342   9.120   1.00 0.00 ? 123 ARG B HB3  4  
ATOM 10281 H HG2  . ARG B 1 123 ? 18.665  7.100   9.239   1.00 0.00 ? 123 ARG B HG2  4  
ATOM 10282 H HG3  . ARG B 1 123 ? 18.476  7.977   7.726   1.00 0.00 ? 123 ARG B HG3  4  
ATOM 10283 H HD2  . ARG B 1 123 ? 16.688  8.576   10.043  1.00 0.00 ? 123 ARG B HD2  4  
ATOM 10284 H HD3  . ARG B 1 123 ? 18.327  9.225   9.999   1.00 0.00 ? 123 ARG B HD3  4  
ATOM 10285 H HE   . ARG B 1 123 ? 17.469  9.941   7.621   1.00 0.00 ? 123 ARG B HE   4  
ATOM 10286 H HH11 . ARG B 1 123 ? 15.787  10.183  10.741  1.00 0.00 ? 123 ARG B HH11 4  
ATOM 10287 H HH12 . ARG B 1 123 ? 15.040  11.669  10.388  1.00 0.00 ? 123 ARG B HH12 4  
ATOM 10288 H HH21 . ARG B 1 123 ? 16.410  11.988  7.143   1.00 0.00 ? 123 ARG B HH21 4  
ATOM 10289 H HH22 . ARG B 1 123 ? 15.417  12.731  8.307   1.00 0.00 ? 123 ARG B HH22 4  
ATOM 10290 N N    . ILE B 1 124 ? 19.522  4.711   7.085   1.00 0.00 ? 124 ILE B N    4  
ATOM 10291 C CA   . ILE B 1 124 ? 20.810  4.193   7.439   1.00 0.00 ? 124 ILE B CA   4  
ATOM 10292 C C    . ILE B 1 124 ? 21.925  4.981   6.721   1.00 0.00 ? 124 ILE B C    4  
ATOM 10293 O O    . ILE B 1 124 ? 22.047  4.913   5.514   1.00 0.00 ? 124 ILE B O    4  
ATOM 10294 C CB   . ILE B 1 124 ? 20.915  2.657   7.140   1.00 0.00 ? 124 ILE B CB   4  
ATOM 10295 C CG1  . ILE B 1 124 ? 20.172  2.255   5.852   1.00 0.00 ? 124 ILE B CG1  4  
ATOM 10296 C CG2  . ILE B 1 124 ? 20.451  1.838   8.330   1.00 0.00 ? 124 ILE B CG2  4  
ATOM 10297 C CD1  . ILE B 1 124 ? 20.286  0.776   5.503   1.00 0.00 ? 124 ILE B CD1  4  
ATOM 10298 H H    . ILE B 1 124 ? 19.357  4.957   6.145   1.00 0.00 ? 124 ILE B H    4  
ATOM 10299 H HA   . ILE B 1 124 ? 20.925  4.341   8.503   1.00 0.00 ? 124 ILE B HA   4  
ATOM 10300 H HB   . ILE B 1 124 ? 21.967  2.441   7.019   1.00 0.00 ? 124 ILE B HB   4  
ATOM 10301 H HG12 . ILE B 1 124 ? 19.124  2.490   5.969   1.00 0.00 ? 124 ILE B HG12 4  
ATOM 10302 H HG13 . ILE B 1 124 ? 20.574  2.832   5.034   1.00 0.00 ? 124 ILE B HG13 4  
ATOM 10303 H HG21 . ILE B 1 124 ? 19.410  2.053   8.525   1.00 0.00 ? 124 ILE B HG21 4  
ATOM 10304 H HG22 . ILE B 1 124 ? 21.034  2.109   9.196   1.00 0.00 ? 124 ILE B HG22 4  
ATOM 10305 H HG23 . ILE B 1 124 ? 20.572  0.784   8.120   1.00 0.00 ? 124 ILE B HG23 4  
ATOM 10306 H HD11 . ILE B 1 124 ? 21.328  0.501   5.428   1.00 0.00 ? 124 ILE B HD11 4  
ATOM 10307 H HD12 . ILE B 1 124 ? 19.793  0.582   4.563   1.00 0.00 ? 124 ILE B HD12 4  
ATOM 10308 H HD13 . ILE B 1 124 ? 19.818  0.190   6.280   1.00 0.00 ? 124 ILE B HD13 4  
ATOM 10309 N N    . PRO B 1 125 ? 22.676  5.835   7.458   1.00 0.00 ? 125 PRO B N    4  
ATOM 10310 C CA   . PRO B 1 125 ? 23.830  6.573   6.897   1.00 0.00 ? 125 PRO B CA   4  
ATOM 10311 C C    . PRO B 1 125 ? 25.235  6.123   7.373   1.00 0.00 ? 125 PRO B C    4  
ATOM 10312 O O    . PRO B 1 125 ? 26.184  6.149   6.603   1.00 0.00 ? 125 PRO B O    4  
ATOM 10313 C CB   . PRO B 1 125 ? 23.577  7.969   7.452   1.00 0.00 ? 125 PRO B CB   4  
ATOM 10314 C CG   . PRO B 1 125 ? 22.784  7.779   8.737   1.00 0.00 ? 125 PRO B CG   4  
ATOM 10315 C CD   . PRO B 1 125 ? 22.336  6.325   8.796   1.00 0.00 ? 125 PRO B CD   4  
ATOM 10316 H HA   . PRO B 1 125 ? 23.793  6.635   5.820   1.00 0.00 ? 125 PRO B HA   4  
ATOM 10317 H HB2  . PRO B 1 125 ? 24.526  8.453   7.638   1.00 0.00 ? 125 PRO B HB2  4  
ATOM 10318 H HB3  . PRO B 1 125 ? 23.019  8.535   6.725   1.00 0.00 ? 125 PRO B HB3  4  
ATOM 10319 H HG2  . PRO B 1 125 ? 23.412  8.003   9.586   1.00 0.00 ? 125 PRO B HG2  4  
ATOM 10320 H HG3  . PRO B 1 125 ? 21.926  8.436   8.735   1.00 0.00 ? 125 PRO B HG3  4  
ATOM 10321 H HD2  . PRO B 1 125 ? 22.863  5.789   9.572   1.00 0.00 ? 125 PRO B HD2  4  
ATOM 10322 H HD3  . PRO B 1 125 ? 21.270  6.282   8.964   1.00 0.00 ? 125 PRO B HD3  4  
ATOM 10323 N N    . ALA B 1 126 ? 25.366  5.757   8.634   1.00 0.00 ? 126 ALA B N    4  
ATOM 10324 C CA   . ALA B 1 126 ? 26.665  5.471   9.232   1.00 0.00 ? 126 ALA B CA   4  
ATOM 10325 C C    . ALA B 1 126 ? 27.294  4.218   8.665   1.00 0.00 ? 126 ALA B C    4  
ATOM 10326 O O    . ALA B 1 126 ? 28.504  4.096   8.599   1.00 0.00 ? 126 ALA B O    4  
ATOM 10327 C CB   . ALA B 1 126 ? 26.551  5.390   10.747  1.00 0.00 ? 126 ALA B CB   4  
ATOM 10328 H H    . ALA B 1 126 ? 24.565  5.632   9.184   1.00 0.00 ? 126 ALA B H    4  
ATOM 10329 H HA   . ALA B 1 126 ? 27.311  6.303   8.994   1.00 0.00 ? 126 ALA B HA   4  
ATOM 10330 H HB1  . ALA B 1 126 ? 25.943  4.541   11.019  1.00 0.00 ? 126 ALA B HB1  4  
ATOM 10331 H HB2  . ALA B 1 126 ? 26.095  6.295   11.122  1.00 0.00 ? 126 ALA B HB2  4  
ATOM 10332 H HB3  . ALA B 1 126 ? 27.536  5.276   11.175  1.00 0.00 ? 126 ALA B HB3  4  
ATOM 10333 N N    . ASP B 1 127 ? 26.470  3.306   8.253   1.00 0.00 ? 127 ASP B N    4  
ATOM 10334 C CA   . ASP B 1 127 ? 26.945  2.032   7.754   1.00 0.00 ? 127 ASP B CA   4  
ATOM 10335 C C    . ASP B 1 127 ? 26.659  1.935   6.247   1.00 0.00 ? 127 ASP B C    4  
ATOM 10336 O O    . ASP B 1 127 ? 26.893  0.914   5.611   1.00 0.00 ? 127 ASP B O    4  
ATOM 10337 C CB   . ASP B 1 127 ? 26.235  0.920   8.560   1.00 0.00 ? 127 ASP B CB   4  
ATOM 10338 C CG   . ASP B 1 127 ? 26.810  -0.480  8.413   1.00 0.00 ? 127 ASP B CG   4  
ATOM 10339 O OD1  . ASP B 1 127 ? 27.997  -0.696  8.762   1.00 0.00 ? 127 ASP B OD1  4  
ATOM 10340 O OD2  . ASP B 1 127 ? 26.067  -1.400  8.032   1.00 0.00 ? 127 ASP B OD2  4  
ATOM 10341 H H    . ASP B 1 127 ? 25.505  3.481   8.307   1.00 0.00 ? 127 ASP B H    4  
ATOM 10342 H HA   . ASP B 1 127 ? 28.010  1.969   7.924   1.00 0.00 ? 127 ASP B HA   4  
ATOM 10343 H HB2  . ASP B 1 127 ? 26.280  1.177   9.609   1.00 0.00 ? 127 ASP B HB2  4  
ATOM 10344 H HB3  . ASP B 1 127 ? 25.196  0.901   8.262   1.00 0.00 ? 127 ASP B HB3  4  
ATOM 10345 N N    . VAL B 1 128 ? 26.211  3.059   5.669   1.00 0.00 ? 128 VAL B N    4  
ATOM 10346 C CA   . VAL B 1 128 ? 25.784  3.111   4.264   1.00 0.00 ? 128 VAL B CA   4  
ATOM 10347 C C    . VAL B 1 128 ? 26.413  4.286   3.527   1.00 0.00 ? 128 VAL B C    4  
ATOM 10348 O O    . VAL B 1 128 ? 26.305  5.433   3.964   1.00 0.00 ? 128 VAL B O    4  
ATOM 10349 C CB   . VAL B 1 128 ? 24.252  3.283   4.164   1.00 0.00 ? 128 VAL B CB   4  
ATOM 10350 C CG1  . VAL B 1 128 ? 23.766  3.288   2.727   1.00 0.00 ? 128 VAL B CG1  4  
ATOM 10351 C CG2  . VAL B 1 128 ? 23.548  2.228   4.944   1.00 0.00 ? 128 VAL B CG2  4  
ATOM 10352 H H    . VAL B 1 128 ? 26.205  3.895   6.182   1.00 0.00 ? 128 VAL B H    4  
ATOM 10353 H HA   . VAL B 1 128 ? 26.050  2.184   3.780   1.00 0.00 ? 128 VAL B HA   4  
ATOM 10354 H HB   . VAL B 1 128 ? 24.002  4.241   4.597   1.00 0.00 ? 128 VAL B HB   4  
ATOM 10355 H HG11 . VAL B 1 128 ? 22.694  3.408   2.711   1.00 0.00 ? 128 VAL B HG11 4  
ATOM 10356 H HG12 . VAL B 1 128 ? 24.029  2.352   2.256   1.00 0.00 ? 128 VAL B HG12 4  
ATOM 10357 H HG13 . VAL B 1 128 ? 24.229  4.103   2.193   1.00 0.00 ? 128 VAL B HG13 4  
ATOM 10358 H HG21 . VAL B 1 128 ? 22.482  2.340   4.829   1.00 0.00 ? 128 VAL B HG21 4  
ATOM 10359 H HG22 . VAL B 1 128 ? 23.815  2.312   5.987   1.00 0.00 ? 128 VAL B HG22 4  
ATOM 10360 H HG23 . VAL B 1 128 ? 23.854  1.260   4.578   1.00 0.00 ? 128 VAL B HG23 4  
ATOM 10361 N N    . ASP B 1 129 ? 27.040  4.018   2.415   1.00 0.00 ? 129 ASP B N    4  
ATOM 10362 C CA   . ASP B 1 129 ? 27.562  5.084   1.585   1.00 0.00 ? 129 ASP B CA   4  
ATOM 10363 C C    . ASP B 1 129 ? 26.932  4.975   0.194   1.00 0.00 ? 129 ASP B C    4  
ATOM 10364 O O    . ASP B 1 129 ? 27.311  4.128   -0.606  1.00 0.00 ? 129 ASP B O    4  
ATOM 10365 C CB   . ASP B 1 129 ? 29.082  5.007   1.496   1.00 0.00 ? 129 ASP B CB   4  
ATOM 10366 C CG   . ASP B 1 129 ? 29.674  6.177   0.745   1.00 0.00 ? 129 ASP B CG   4  
ATOM 10367 O OD1  . ASP B 1 129 ? 29.859  7.268   1.361   1.00 0.00 ? 129 ASP B OD1  4  
ATOM 10368 O OD2  . ASP B 1 129 ? 29.978  6.035   -0.445  1.00 0.00 ? 129 ASP B OD2  4  
ATOM 10369 H H    . ASP B 1 129 ? 27.160  3.087   2.126   1.00 0.00 ? 129 ASP B H    4  
ATOM 10370 H HA   . ASP B 1 129 ? 27.268  6.020   2.036   1.00 0.00 ? 129 ASP B HA   4  
ATOM 10371 H HB2  . ASP B 1 129 ? 29.494  4.986   2.492   1.00 0.00 ? 129 ASP B HB2  4  
ATOM 10372 H HB3  . ASP B 1 129 ? 29.355  4.095   0.986   1.00 0.00 ? 129 ASP B HB3  4  
ATOM 10373 N N    . PRO B 1 130 ? 25.961  5.832   -0.108  1.00 0.00 ? 130 PRO B N    4  
ATOM 10374 C CA   . PRO B 1 130 ? 25.129  5.737   -1.331  1.00 0.00 ? 130 PRO B CA   4  
ATOM 10375 C C    . PRO B 1 130 ? 25.823  6.097   -2.651  1.00 0.00 ? 130 PRO B C    4  
ATOM 10376 O O    . PRO B 1 130 ? 25.167  6.133   -3.693  1.00 0.00 ? 130 PRO B O    4  
ATOM 10377 C CB   . PRO B 1 130 ? 24.011  6.731   -1.047  1.00 0.00 ? 130 PRO B CB   4  
ATOM 10378 C CG   . PRO B 1 130 ? 24.648  7.747   -0.182  1.00 0.00 ? 130 PRO B CG   4  
ATOM 10379 C CD   . PRO B 1 130 ? 25.574  6.991   0.714   1.00 0.00 ? 130 PRO B CD   4  
ATOM 10380 H HA   . PRO B 1 130 ? 24.691  4.758   -1.436  1.00 0.00 ? 130 PRO B HA   4  
ATOM 10381 H HB2  . PRO B 1 130 ? 23.652  7.153   -1.974  1.00 0.00 ? 130 PRO B HB2  4  
ATOM 10382 H HB3  . PRO B 1 130 ? 23.205  6.231   -0.530  1.00 0.00 ? 130 PRO B HB3  4  
ATOM 10383 H HG2  . PRO B 1 130 ? 25.202  8.451   -0.787  1.00 0.00 ? 130 PRO B HG2  4  
ATOM 10384 H HG3  . PRO B 1 130 ? 23.894  8.253   0.402   1.00 0.00 ? 130 PRO B HG3  4  
ATOM 10385 H HD2  . PRO B 1 130 ? 26.435  7.595   0.957   1.00 0.00 ? 130 PRO B HD2  4  
ATOM 10386 H HD3  . PRO B 1 130 ? 25.063  6.672   1.609   1.00 0.00 ? 130 PRO B HD3  4  
ATOM 10387 N N    . LEU B 1 131 ? 27.125  6.292   -2.623  1.00 0.00 ? 131 LEU B N    4  
ATOM 10388 C CA   . LEU B 1 131 ? 27.856  6.732   -3.802  1.00 0.00 ? 131 LEU B CA   4  
ATOM 10389 C C    . LEU B 1 131 ? 27.804  5.746   -4.970  1.00 0.00 ? 131 LEU B C    4  
ATOM 10390 O O    . LEU B 1 131 ? 27.686  6.159   -6.119  1.00 0.00 ? 131 LEU B O    4  
ATOM 10391 C CB   . LEU B 1 131 ? 29.300  7.165   -3.480  1.00 0.00 ? 131 LEU B CB   4  
ATOM 10392 C CG   . LEU B 1 131 ? 29.506  8.598   -2.912  1.00 0.00 ? 131 LEU B CG   4  
ATOM 10393 C CD1  . LEU B 1 131 ? 29.087  9.643   -3.928  1.00 0.00 ? 131 LEU B CD1  4  
ATOM 10394 C CD2  . LEU B 1 131 ? 28.750  8.816   -1.606  1.00 0.00 ? 131 LEU B CD2  4  
ATOM 10395 H H    . LEU B 1 131 ? 27.609  6.130   -1.783  1.00 0.00 ? 131 LEU B H    4  
ATOM 10396 H HA   . LEU B 1 131 ? 27.322  7.608   -4.141  1.00 0.00 ? 131 LEU B HA   4  
ATOM 10397 H HB2  . LEU B 1 131 ? 29.698  6.465   -2.760  1.00 0.00 ? 131 LEU B HB2  4  
ATOM 10398 H HB3  . LEU B 1 131 ? 29.881  7.079   -4.387  1.00 0.00 ? 131 LEU B HB3  4  
ATOM 10399 H HG   . LEU B 1 131 ? 30.560  8.742   -2.725  1.00 0.00 ? 131 LEU B HG   4  
ATOM 10400 H HD11 . LEU B 1 131 ? 29.296  10.627  -3.535  1.00 0.00 ? 131 LEU B HD11 4  
ATOM 10401 H HD12 . LEU B 1 131 ? 28.028  9.560   -4.119  1.00 0.00 ? 131 LEU B HD12 4  
ATOM 10402 H HD13 . LEU B 1 131 ? 29.633  9.499   -4.848  1.00 0.00 ? 131 LEU B HD13 4  
ATOM 10403 H HD21 . LEU B 1 131 ? 29.102  8.113   -0.865  1.00 0.00 ? 131 LEU B HD21 4  
ATOM 10404 H HD22 . LEU B 1 131 ? 27.694  8.666   -1.772  1.00 0.00 ? 131 LEU B HD22 4  
ATOM 10405 H HD23 . LEU B 1 131 ? 28.919  9.823   -1.255  1.00 0.00 ? 131 LEU B HD23 4  
ATOM 10406 N N    . THR B 1 132 ? 27.883  4.464   -4.714  1.00 0.00 ? 132 THR B N    4  
ATOM 10407 C CA   . THR B 1 132 ? 27.805  3.504   -5.817  1.00 0.00 ? 132 THR B CA   4  
ATOM 10408 C C    . THR B 1 132 ? 26.614  2.561   -5.647  1.00 0.00 ? 132 THR B C    4  
ATOM 10409 O O    . THR B 1 132 ? 26.471  1.567   -6.394  1.00 0.00 ? 132 THR B O    4  
ATOM 10410 C CB   . THR B 1 132 ? 29.111  2.676   -5.993  1.00 0.00 ? 132 THR B CB   4  
ATOM 10411 O OG1  . THR B 1 132 ? 29.049  1.910   -7.208  1.00 0.00 ? 132 THR B OG1  4  
ATOM 10412 C CG2  . THR B 1 132 ? 29.280  1.722   -4.834  1.00 0.00 ? 132 THR B CG2  4  
ATOM 10413 H H    . THR B 1 132 ? 28.000  4.170   -3.785  1.00 0.00 ? 132 THR B H    4  
ATOM 10414 H HA   . THR B 1 132 ? 27.643  4.088   -6.713  1.00 0.00 ? 132 THR B HA   4  
ATOM 10415 H HB   . THR B 1 132 ? 29.956  3.348   -6.027  1.00 0.00 ? 132 THR B HB   4  
ATOM 10416 H HG1  . THR B 1 132 ? 28.183  1.479   -7.200  1.00 0.00 ? 132 THR B HG1  4  
ATOM 10417 H HG21 . THR B 1 132 ? 30.167  1.122   -4.979  1.00 0.00 ? 132 THR B HG21 4  
ATOM 10418 H HG22 . THR B 1 132 ? 28.412  1.085   -4.752  1.00 0.00 ? 132 THR B HG22 4  
ATOM 10419 H HG23 . THR B 1 132 ? 29.393  2.312   -3.938  1.00 0.00 ? 132 THR B HG23 4  
ATOM 10420 N N    . ILE B 1 133 ? 25.766  2.856   -4.692  1.00 0.00 ? 133 ILE B N    4  
ATOM 10421 C CA   . ILE B 1 133 ? 24.716  1.936   -4.357  1.00 0.00 ? 133 ILE B CA   4  
ATOM 10422 C C    . ILE B 1 133 ? 23.675  1.816   -5.465  1.00 0.00 ? 133 ILE B C    4  
ATOM 10423 O O    . ILE B 1 133 ? 23.065  2.798   -5.895  1.00 0.00 ? 133 ILE B O    4  
ATOM 10424 C CB   . ILE B 1 133 ? 24.067  2.217   -2.989  1.00 0.00 ? 133 ILE B CB   4  
ATOM 10425 C CG1  . ILE B 1 133 ? 25.101  2.091   -1.883  1.00 0.00 ? 133 ILE B CG1  4  
ATOM 10426 C CG2  . ILE B 1 133 ? 22.976  1.231   -2.747  1.00 0.00 ? 133 ILE B CG2  4  
ATOM 10427 C CD1  . ILE B 1 133 ? 24.547  2.246   -0.483  1.00 0.00 ? 133 ILE B CD1  4  
ATOM 10428 H H    . ILE B 1 133 ? 25.823  3.730   -4.251  1.00 0.00 ? 133 ILE B H    4  
ATOM 10429 H HA   . ILE B 1 133 ? 25.202  0.970   -4.303  1.00 0.00 ? 133 ILE B HA   4  
ATOM 10430 H HB   . ILE B 1 133 ? 23.662  3.218   -2.977  1.00 0.00 ? 133 ILE B HB   4  
ATOM 10431 H HG12 . ILE B 1 133 ? 25.516  1.098   -1.926  1.00 0.00 ? 133 ILE B HG12 4  
ATOM 10432 H HG13 . ILE B 1 133 ? 25.883  2.822   -2.022  1.00 0.00 ? 133 ILE B HG13 4  
ATOM 10433 H HG21 . ILE B 1 133 ? 22.238  1.318   -3.531  1.00 0.00 ? 133 ILE B HG21 4  
ATOM 10434 H HG22 . ILE B 1 133 ? 22.516  1.430   -1.790  1.00 0.00 ? 133 ILE B HG22 4  
ATOM 10435 H HG23 . ILE B 1 133 ? 23.388  0.233   -2.752  1.00 0.00 ? 133 ILE B HG23 4  
ATOM 10436 H HD11 . ILE B 1 133 ? 24.044  3.196   -0.376  1.00 0.00 ? 133 ILE B HD11 4  
ATOM 10437 H HD12 . ILE B 1 133 ? 25.354  2.178   0.231   1.00 0.00 ? 133 ILE B HD12 4  
ATOM 10438 H HD13 . ILE B 1 133 ? 23.842  1.450   -0.293  1.00 0.00 ? 133 ILE B HD13 4  
ATOM 10439 N N    . THR B 1 134 ? 23.518  0.603   -5.926  1.00 0.00 ? 134 THR B N    4  
ATOM 10440 C CA   . THR B 1 134 ? 22.663  0.259   -7.017  1.00 0.00 ? 134 THR B CA   4  
ATOM 10441 C C    . THR B 1 134 ? 21.738  -0.873  -6.658  1.00 0.00 ? 134 THR B C    4  
ATOM 10442 O O    . THR B 1 134 ? 21.935  -1.536  -5.644  1.00 0.00 ? 134 THR B O    4  
ATOM 10443 C CB   . THR B 1 134 ? 23.512  -0.059  -8.257  1.00 0.00 ? 134 THR B CB   4  
ATOM 10444 O OG1  . THR B 1 134 ? 24.753  -0.662  -7.833  1.00 0.00 ? 134 THR B OG1  4  
ATOM 10445 C CG2  . THR B 1 134 ? 23.805  1.209   -9.055  1.00 0.00 ? 134 THR B CG2  4  
ATOM 10446 H H    . THR B 1 134 ? 24.005  -0.131  -5.485  1.00 0.00 ? 134 THR B H    4  
ATOM 10447 H HA   . THR B 1 134 ? 22.068  1.131   -7.239  1.00 0.00 ? 134 THR B HA   4  
ATOM 10448 H HB   . THR B 1 134 ? 22.966  -0.756  -8.873  1.00 0.00 ? 134 THR B HB   4  
ATOM 10449 H HG1  . THR B 1 134 ? 25.207  0.037   -7.341  1.00 0.00 ? 134 THR B HG1  4  
ATOM 10450 H HG21 . THR B 1 134 ? 24.351  1.904   -8.435  1.00 0.00 ? 134 THR B HG21 4  
ATOM 10451 H HG22 . THR B 1 134 ? 22.878  1.663   -9.372  1.00 0.00 ? 134 THR B HG22 4  
ATOM 10452 H HG23 . THR B 1 134 ? 24.397  0.961   -9.924  1.00 0.00 ? 134 THR B HG23 4  
ATOM 10453 N N    . SER B 1 135 ? 20.741  -1.100  -7.479  1.00 0.00 ? 135 SER B N    4  
ATOM 10454 C CA   . SER B 1 135 ? 19.721  -2.052  -7.179  1.00 0.00 ? 135 SER B CA   4  
ATOM 10455 C C    . SER B 1 135 ? 19.525  -3.070  -8.307  1.00 0.00 ? 135 SER B C    4  
ATOM 10456 O O    . SER B 1 135 ? 19.506  -2.715  -9.488  1.00 0.00 ? 135 SER B O    4  
ATOM 10457 C CB   . SER B 1 135 ? 18.418  -1.287  -6.903  1.00 0.00 ? 135 SER B CB   4  
ATOM 10458 O OG   . SER B 1 135 ? 18.129  -0.349  -7.940  1.00 0.00 ? 135 SER B OG   4  
ATOM 10459 H H    . SER B 1 135 ? 20.675  -0.623  -8.333  1.00 0.00 ? 135 SER B H    4  
ATOM 10460 H HA   . SER B 1 135 ? 19.990  -2.576  -6.275  1.00 0.00 ? 135 SER B HA   4  
ATOM 10461 H HB2  . SER B 1 135 ? 17.600  -1.989  -6.882  1.00 0.00 ? 135 SER B HB2  4  
ATOM 10462 H HB3  . SER B 1 135 ? 18.486  -0.762  -5.962  1.00 0.00 ? 135 SER B HB3  4  
ATOM 10463 H HG   . SER B 1 135 ? 18.754  0.382   -7.876  1.00 0.00 ? 135 SER B HG   4  
ATOM 10464 N N    . SER B 1 136 ? 19.406  -4.318  -7.931  1.00 0.00 ? 136 SER B N    4  
ATOM 10465 C CA   . SER B 1 136 ? 19.138  -5.383  -8.853  1.00 0.00 ? 136 SER B CA   4  
ATOM 10466 C C    . SER B 1 136 ? 17.780  -5.960  -8.460  1.00 0.00 ? 136 SER B C    4  
ATOM 10467 O O    . SER B 1 136 ? 17.553  -6.267  -7.277  1.00 0.00 ? 136 SER B O    4  
ATOM 10468 C CB   . SER B 1 136 ? 20.250  -6.438  -8.745  1.00 0.00 ? 136 SER B CB   4  
ATOM 10469 O OG   . SER B 1 136 ? 20.150  -7.421  -9.760  1.00 0.00 ? 136 SER B OG   4  
ATOM 10470 H H    . SER B 1 136 ? 19.501  -4.544  -6.979  1.00 0.00 ? 136 SER B H    4  
ATOM 10471 H HA   . SER B 1 136 ? 19.097  -4.979  -9.853  1.00 0.00 ? 136 SER B HA   4  
ATOM 10472 H HB2  . SER B 1 136 ? 21.210  -5.951  -8.829  1.00 0.00 ? 136 SER B HB2  4  
ATOM 10473 H HB3  . SER B 1 136 ? 20.183  -6.923  -7.782  1.00 0.00 ? 136 SER B HB3  4  
ATOM 10474 H HG   . SER B 1 136 ? 21.023  -7.483  -10.168 1.00 0.00 ? 136 SER B HG   4  
ATOM 10475 N N    . LEU B 1 137 ? 16.894  -6.103  -9.418  1.00 0.00 ? 137 LEU B N    4  
ATOM 10476 C CA   . LEU B 1 137 ? 15.518  -6.451  -9.139  1.00 0.00 ? 137 LEU B CA   4  
ATOM 10477 C C    . LEU B 1 137 ? 15.061  -7.618  -10.007 1.00 0.00 ? 137 LEU B C    4  
ATOM 10478 O O    . LEU B 1 137 ? 15.209  -7.588  -11.227 1.00 0.00 ? 137 LEU B O    4  
ATOM 10479 C CB   . LEU B 1 137 ? 14.659  -5.200  -9.385  1.00 0.00 ? 137 LEU B CB   4  
ATOM 10480 C CG   . LEU B 1 137 ? 13.144  -5.302  -9.187  1.00 0.00 ? 137 LEU B CG   4  
ATOM 10481 C CD1  . LEU B 1 137 ? 12.795  -5.702  -7.763  1.00 0.00 ? 137 LEU B CD1  4  
ATOM 10482 C CD2  . LEU B 1 137 ? 12.513  -3.966  -9.520  1.00 0.00 ? 137 LEU B CD2  4  
ATOM 10483 H H    . LEU B 1 137 ? 17.162  -6.000  -10.357 1.00 0.00 ? 137 LEU B H    4  
ATOM 10484 H HA   . LEU B 1 137 ? 15.437  -6.720  -8.097  1.00 0.00 ? 137 LEU B HA   4  
ATOM 10485 H HB2  . LEU B 1 137 ? 15.017  -4.426  -8.723  1.00 0.00 ? 137 LEU B HB2  4  
ATOM 10486 H HB3  . LEU B 1 137 ? 14.842  -4.876  -10.399 1.00 0.00 ? 137 LEU B HB3  4  
ATOM 10487 H HG   . LEU B 1 137 ? 12.736  -6.039  -9.863  1.00 0.00 ? 137 LEU B HG   4  
ATOM 10488 H HD11 . LEU B 1 137 ? 13.138  -4.930  -7.092  1.00 0.00 ? 137 LEU B HD11 4  
ATOM 10489 H HD12 . LEU B 1 137 ? 13.277  -6.638  -7.520  1.00 0.00 ? 137 LEU B HD12 4  
ATOM 10490 H HD13 . LEU B 1 137 ? 11.725  -5.813  -7.669  1.00 0.00 ? 137 LEU B HD13 4  
ATOM 10491 H HD21 . LEU B 1 137 ? 11.453  -3.997  -9.320  1.00 0.00 ? 137 LEU B HD21 4  
ATOM 10492 H HD22 . LEU B 1 137 ? 12.682  -3.734  -10.561 1.00 0.00 ? 137 LEU B HD22 4  
ATOM 10493 H HD23 . LEU B 1 137 ? 12.966  -3.199  -8.909  1.00 0.00 ? 137 LEU B HD23 4  
ATOM 10494 N N    . SER B 1 138 ? 14.534  -8.637  -9.372  1.00 0.00 ? 138 SER B N    4  
ATOM 10495 C CA   . SER B 1 138 ? 14.052  -9.818  -10.056 1.00 0.00 ? 138 SER B CA   4  
ATOM 10496 C C    . SER B 1 138 ? 12.516  -9.754  -10.241 1.00 0.00 ? 138 SER B C    4  
ATOM 10497 O O    . SER B 1 138 ? 11.827  -8.985  -9.555  1.00 0.00 ? 138 SER B O    4  
ATOM 10498 C CB   . SER B 1 138 ? 14.446  -11.034 -9.238  1.00 0.00 ? 138 SER B CB   4  
ATOM 10499 O OG   . SER B 1 138 ? 15.827  -10.974 -8.914  1.00 0.00 ? 138 SER B OG   4  
ATOM 10500 H H    . SER B 1 138 ? 14.482  -8.603  -8.389  1.00 0.00 ? 138 SER B H    4  
ATOM 10501 H HA   . SER B 1 138 ? 14.530  -9.872  -11.023 1.00 0.00 ? 138 SER B HA   4  
ATOM 10502 H HB2  . SER B 1 138 ? 13.857  -11.062 -8.335  1.00 0.00 ? 138 SER B HB2  4  
ATOM 10503 H HB3  . SER B 1 138 ? 14.264  -11.927 -9.815  1.00 0.00 ? 138 SER B HB3  4  
ATOM 10504 H HG   . SER B 1 138 ? 16.268  -10.617 -9.696  1.00 0.00 ? 138 SER B HG   4  
ATOM 10505 N N    . SER B 1 139 ? 12.015  -10.609 -11.138 1.00 0.00 ? 139 SER B N    4  
ATOM 10506 C CA   . SER B 1 139 ? 10.641  -10.611 -11.657 1.00 0.00 ? 139 SER B CA   4  
ATOM 10507 C C    . SER B 1 139 ? 9.513   -10.683 -10.611 1.00 0.00 ? 139 SER B C    4  
ATOM 10508 O O    . SER B 1 139 ? 8.416   -10.164 -10.867 1.00 0.00 ? 139 SER B O    4  
ATOM 10509 C CB   . SER B 1 139 ? 10.502  -11.755 -12.643 1.00 0.00 ? 139 SER B CB   4  
ATOM 10510 O OG   . SER B 1 139 ? 11.560  -11.717 -13.597 1.00 0.00 ? 139 SER B OG   4  
ATOM 10511 H H    . SER B 1 139 ? 12.599  -11.307 -11.505 1.00 0.00 ? 139 SER B H    4  
ATOM 10512 H HA   . SER B 1 139 ? 10.514  -9.702  -12.226 1.00 0.00 ? 139 SER B HA   4  
ATOM 10513 H HB2  . SER B 1 139 ? 10.539  -12.694 -12.108 1.00 0.00 ? 139 SER B HB2  4  
ATOM 10514 H HB3  . SER B 1 139 ? 9.559   -11.672 -13.163 1.00 0.00 ? 139 SER B HB3  4  
ATOM 10515 H HG   . SER B 1 139 ? 11.869  -12.626 -13.700 1.00 0.00 ? 139 SER B HG   4  
ATOM 10516 N N    . ASP B 1 140 ? 9.745   -11.327 -9.470  1.00 0.00 ? 140 ASP B N    4  
ATOM 10517 C CA   . ASP B 1 140 ? 8.678   -11.448 -8.455  1.00 0.00 ? 140 ASP B CA   4  
ATOM 10518 C C    . ASP B 1 140 ? 8.704   -10.280 -7.517  1.00 0.00 ? 140 ASP B C    4  
ATOM 10519 O O    . ASP B 1 140 ? 7.757   -10.013 -6.811  1.00 0.00 ? 140 ASP B O    4  
ATOM 10520 C CB   . ASP B 1 140 ? 8.799   -12.758 -7.635  1.00 0.00 ? 140 ASP B CB   4  
ATOM 10521 C CG   . ASP B 1 140 ? 7.680   -12.961 -6.586  1.00 0.00 ? 140 ASP B CG   4  
ATOM 10522 O OD1  . ASP B 1 140 ? 6.600   -13.482 -6.957  1.00 0.00 ? 140 ASP B OD1  4  
ATOM 10523 O OD2  . ASP B 1 140 ? 7.875   -12.672 -5.390  1.00 0.00 ? 140 ASP B OD2  4  
ATOM 10524 H H    . ASP B 1 140 ? 10.624  -11.729 -9.297  1.00 0.00 ? 140 ASP B H    4  
ATOM 10525 H HA   . ASP B 1 140 ? 7.738   -11.452 -8.985  1.00 0.00 ? 140 ASP B HA   4  
ATOM 10526 H HB2  . ASP B 1 140 ? 8.774   -13.600 -8.311  1.00 0.00 ? 140 ASP B HB2  4  
ATOM 10527 H HB3  . ASP B 1 140 ? 9.748   -12.753 -7.119  1.00 0.00 ? 140 ASP B HB3  4  
ATOM 10528 N N    . GLY B 1 141 ? 9.744   -9.533  -7.596  1.00 0.00 ? 141 GLY B N    4  
ATOM 10529 C CA   . GLY B 1 141 ? 9.936   -8.497  -6.659  1.00 0.00 ? 141 GLY B CA   4  
ATOM 10530 C C    . GLY B 1 141 ? 10.917  -8.952  -5.626  1.00 0.00 ? 141 GLY B C    4  
ATOM 10531 O O    . GLY B 1 141 ? 10.589  -9.147  -4.472  1.00 0.00 ? 141 GLY B O    4  
ATOM 10532 H H    . GLY B 1 141 ? 10.386  -9.679  -8.323  1.00 0.00 ? 141 GLY B H    4  
ATOM 10533 H HA2  . GLY B 1 141 ? 10.312  -7.620  -7.166  1.00 0.00 ? 141 GLY B HA2  4  
ATOM 10534 H HA3  . GLY B 1 141 ? 9.000   -8.267  -6.174  1.00 0.00 ? 141 GLY B HA3  4  
ATOM 10535 N N    . VAL B 1 142 ? 12.092  -9.233  -6.068  1.00 0.00 ? 142 VAL B N    4  
ATOM 10536 C CA   . VAL B 1 142 ? 13.174  -9.570  -5.186  1.00 0.00 ? 142 VAL B CA   4  
ATOM 10537 C C    . VAL B 1 142 ? 14.232  -8.535  -5.461  1.00 0.00 ? 142 VAL B C    4  
ATOM 10538 O O    . VAL B 1 142 ? 14.647  -8.384  -6.614  1.00 0.00 ? 142 VAL B O    4  
ATOM 10539 C CB   . VAL B 1 142 ? 13.765  -10.988 -5.452  1.00 0.00 ? 142 VAL B CB   4  
ATOM 10540 C CG1  . VAL B 1 142 ? 14.853  -11.325 -4.437  1.00 0.00 ? 142 VAL B CG1  4  
ATOM 10541 C CG2  . VAL B 1 142 ? 12.684  -12.049 -5.437  1.00 0.00 ? 142 VAL B CG2  4  
ATOM 10542 H H    . VAL B 1 142 ? 12.259  -9.194  -7.032  1.00 0.00 ? 142 VAL B H    4  
ATOM 10543 H HA   . VAL B 1 142 ? 12.835  -9.480  -4.165  1.00 0.00 ? 142 VAL B HA   4  
ATOM 10544 H HB   . VAL B 1 142 ? 14.231  -10.982 -6.426  1.00 0.00 ? 142 VAL B HB   4  
ATOM 10545 H HG11 . VAL B 1 142 ? 14.430  -11.312 -3.442  1.00 0.00 ? 142 VAL B HG11 4  
ATOM 10546 H HG12 . VAL B 1 142 ? 15.644  -10.593 -4.500  1.00 0.00 ? 142 VAL B HG12 4  
ATOM 10547 H HG13 . VAL B 1 142 ? 15.251  -12.307 -4.646  1.00 0.00 ? 142 VAL B HG13 4  
ATOM 10548 H HG21 . VAL B 1 142 ? 12.241  -12.084 -4.453  1.00 0.00 ? 142 VAL B HG21 4  
ATOM 10549 H HG22 . VAL B 1 142 ? 13.121  -13.011 -5.664  1.00 0.00 ? 142 VAL B HG22 4  
ATOM 10550 H HG23 . VAL B 1 142 ? 11.925  -11.809 -6.166  1.00 0.00 ? 142 VAL B HG23 4  
ATOM 10551 N N    . LEU B 1 143 ? 14.639  -7.800  -4.470  1.00 0.00 ? 143 LEU B N    4  
ATOM 10552 C CA   . LEU B 1 143 ? 15.548  -6.701  -4.707  1.00 0.00 ? 143 LEU B CA   4  
ATOM 10553 C C    . LEU B 1 143 ? 16.788  -6.751  -3.839  1.00 0.00 ? 143 LEU B C    4  
ATOM 10554 O O    . LEU B 1 143 ? 16.725  -7.078  -2.678  1.00 0.00 ? 143 LEU B O    4  
ATOM 10555 C CB   . LEU B 1 143 ? 14.797  -5.358  -4.563  1.00 0.00 ? 143 LEU B CB   4  
ATOM 10556 C CG   . LEU B 1 143 ? 15.634  -4.076  -4.387  1.00 0.00 ? 143 LEU B CG   4  
ATOM 10557 C CD1  . LEU B 1 143 ? 16.560  -3.859  -5.534  1.00 0.00 ? 143 LEU B CD1  4  
ATOM 10558 C CD2  . LEU B 1 143 ? 14.750  -2.866  -4.223  1.00 0.00 ? 143 LEU B CD2  4  
ATOM 10559 H H    . LEU B 1 143 ? 14.347  -7.980  -3.547  1.00 0.00 ? 143 LEU B H    4  
ATOM 10560 H HA   . LEU B 1 143 ? 15.869  -6.781  -5.735  1.00 0.00 ? 143 LEU B HA   4  
ATOM 10561 H HB2  . LEU B 1 143 ? 14.214  -5.234  -5.464  1.00 0.00 ? 143 LEU B HB2  4  
ATOM 10562 H HB3  . LEU B 1 143 ? 14.101  -5.445  -3.746  1.00 0.00 ? 143 LEU B HB3  4  
ATOM 10563 H HG   . LEU B 1 143 ? 16.232  -4.168  -3.492  1.00 0.00 ? 143 LEU B HG   4  
ATOM 10564 H HD11 . LEU B 1 143 ? 15.999  -3.696  -6.441  1.00 0.00 ? 143 LEU B HD11 4  
ATOM 10565 H HD12 . LEU B 1 143 ? 17.189  -4.730  -5.649  1.00 0.00 ? 143 LEU B HD12 4  
ATOM 10566 H HD13 . LEU B 1 143 ? 17.173  -2.998  -5.319  1.00 0.00 ? 143 LEU B HD13 4  
ATOM 10567 H HD21 . LEU B 1 143 ? 14.063  -2.790  -5.053  1.00 0.00 ? 143 LEU B HD21 4  
ATOM 10568 H HD22 . LEU B 1 143 ? 15.363  -1.978  -4.175  1.00 0.00 ? 143 LEU B HD22 4  
ATOM 10569 H HD23 . LEU B 1 143 ? 14.204  -2.959  -3.298  1.00 0.00 ? 143 LEU B HD23 4  
ATOM 10570 N N    . THR B 1 144 ? 17.911  -6.518  -4.448  1.00 0.00 ? 144 THR B N    4  
ATOM 10571 C CA   . THR B 1 144 ? 19.148  -6.359  -3.748  1.00 0.00 ? 144 THR B CA   4  
ATOM 10572 C C    . THR B 1 144 ? 19.748  -4.971  -4.076  1.00 0.00 ? 144 THR B C    4  
ATOM 10573 O O    . THR B 1 144 ? 20.030  -4.671  -5.241  1.00 0.00 ? 144 THR B O    4  
ATOM 10574 C CB   . THR B 1 144 ? 20.125  -7.482  -4.126  1.00 0.00 ? 144 THR B CB   4  
ATOM 10575 O OG1  . THR B 1 144 ? 19.475  -8.742  -3.889  1.00 0.00 ? 144 THR B OG1  4  
ATOM 10576 C CG2  . THR B 1 144 ? 21.390  -7.411  -3.286  1.00 0.00 ? 144 THR B CG2  4  
ATOM 10577 H H    . THR B 1 144 ? 17.908  -6.451  -5.431  1.00 0.00 ? 144 THR B H    4  
ATOM 10578 H HA   . THR B 1 144 ? 18.940  -6.409  -2.690  1.00 0.00 ? 144 THR B HA   4  
ATOM 10579 H HB   . THR B 1 144 ? 20.376  -7.398  -5.173  1.00 0.00 ? 144 THR B HB   4  
ATOM 10580 H HG1  . THR B 1 144 ? 18.602  -8.540  -3.531  1.00 0.00 ? 144 THR B HG1  4  
ATOM 10581 H HG21 . THR B 1 144 ? 22.062  -8.206  -3.574  1.00 0.00 ? 144 THR B HG21 4  
ATOM 10582 H HG22 . THR B 1 144 ? 21.136  -7.520  -2.242  1.00 0.00 ? 144 THR B HG22 4  
ATOM 10583 H HG23 . THR B 1 144 ? 21.873  -6.457  -3.441  1.00 0.00 ? 144 THR B HG23 4  
ATOM 10584 N N    . VAL B 1 145 ? 19.900  -4.152  -3.076  1.00 0.00 ? 145 VAL B N    4  
ATOM 10585 C CA   . VAL B 1 145 ? 20.479  -2.840  -3.222  1.00 0.00 ? 145 VAL B CA   4  
ATOM 10586 C C    . VAL B 1 145 ? 21.880  -2.943  -2.616  1.00 0.00 ? 145 VAL B C    4  
ATOM 10587 O O    . VAL B 1 145 ? 22.015  -3.264  -1.453  1.00 0.00 ? 145 VAL B O    4  
ATOM 10588 C CB   . VAL B 1 145 ? 19.640  -1.796  -2.413  1.00 0.00 ? 145 VAL B CB   4  
ATOM 10589 C CG1  . VAL B 1 145 ? 20.038  -0.383  -2.748  1.00 0.00 ? 145 VAL B CG1  4  
ATOM 10590 C CG2  . VAL B 1 145 ? 18.145  -1.985  -2.622  1.00 0.00 ? 145 VAL B CG2  4  
ATOM 10591 H H    . VAL B 1 145 ? 19.659  -4.430  -2.161  1.00 0.00 ? 145 VAL B H    4  
ATOM 10592 H HA   . VAL B 1 145 ? 20.527  -2.564  -4.265  1.00 0.00 ? 145 VAL B HA   4  
ATOM 10593 H HB   . VAL B 1 145 ? 19.853  -1.953  -1.366  1.00 0.00 ? 145 VAL B HB   4  
ATOM 10594 H HG11 . VAL B 1 145 ? 21.080  -0.242  -2.502  1.00 0.00 ? 145 VAL B HG11 4  
ATOM 10595 H HG12 . VAL B 1 145 ? 19.434  0.308   -2.179  1.00 0.00 ? 145 VAL B HG12 4  
ATOM 10596 H HG13 . VAL B 1 145 ? 19.892  -0.208  -3.804  1.00 0.00 ? 145 VAL B HG13 4  
ATOM 10597 H HG21 . VAL B 1 145 ? 17.912  -1.850  -3.668  1.00 0.00 ? 145 VAL B HG21 4  
ATOM 10598 H HG22 . VAL B 1 145 ? 17.604  -1.257  -2.037  1.00 0.00 ? 145 VAL B HG22 4  
ATOM 10599 H HG23 . VAL B 1 145 ? 17.860  -2.981  -2.317  1.00 0.00 ? 145 VAL B HG23 4  
ATOM 10600 N N    . ASN B 1 146 ? 22.903  -2.683  -3.374  1.00 0.00 ? 146 ASN B N    4  
ATOM 10601 C CA   . ASN B 1 146 ? 24.256  -2.914  -2.871  1.00 0.00 ? 146 ASN B CA   4  
ATOM 10602 C C    . ASN B 1 146 ? 25.225  -1.821  -3.268  1.00 0.00 ? 146 ASN B C    4  
ATOM 10603 O O    . ASN B 1 146 ? 24.986  -1.081  -4.225  1.00 0.00 ? 146 ASN B O    4  
ATOM 10604 C CB   . ASN B 1 146 ? 24.791  -4.291  -3.318  1.00 0.00 ? 146 ASN B CB   4  
ATOM 10605 C CG   . ASN B 1 146 ? 25.015  -4.404  -4.819  1.00 0.00 ? 146 ASN B CG   4  
ATOM 10606 O OD1  . ASN B 1 146 ? 26.102  -4.116  -5.321  1.00 0.00 ? 146 ASN B OD1  4  
ATOM 10607 N ND2  . ASN B 1 146 ? 23.999  -4.822  -5.539  1.00 0.00 ? 146 ASN B ND2  4  
ATOM 10608 H H    . ASN B 1 146 ? 22.762  -2.309  -4.274  1.00 0.00 ? 146 ASN B H    4  
ATOM 10609 H HA   . ASN B 1 146 ? 24.189  -2.920  -1.794  1.00 0.00 ? 146 ASN B HA   4  
ATOM 10610 H HB2  . ASN B 1 146 ? 25.736  -4.472  -2.828  1.00 0.00 ? 146 ASN B HB2  4  
ATOM 10611 H HB3  . ASN B 1 146 ? 24.086  -5.052  -3.017  1.00 0.00 ? 146 ASN B HB3  4  
ATOM 10612 H HD21 . ASN B 1 146 ? 23.158  -5.036  -5.087  1.00 0.00 ? 146 ASN B HD21 4  
ATOM 10613 H HD22 . ASN B 1 146 ? 24.125  -4.915  -6.509  1.00 0.00 ? 146 ASN B HD22 4  
ATOM 10614 N N    . GLY B 1 147 ? 26.312  -1.748  -2.534  1.00 0.00 ? 147 GLY B N    4  
ATOM 10615 C CA   . GLY B 1 147 ? 27.353  -0.786  -2.762  1.00 0.00 ? 147 GLY B CA   4  
ATOM 10616 C C    . GLY B 1 147 ? 28.447  -0.938  -1.715  1.00 0.00 ? 147 GLY B C    4  
ATOM 10617 O O    . GLY B 1 147 ? 28.835  -2.059  -1.412  1.00 0.00 ? 147 GLY B O    4  
ATOM 10618 H H    . GLY B 1 147 ? 26.430  -2.388  -1.796  1.00 0.00 ? 147 GLY B H    4  
ATOM 10619 H HA2  . GLY B 1 147 ? 27.771  -0.968  -3.742  1.00 0.00 ? 147 GLY B HA2  4  
ATOM 10620 H HA3  . GLY B 1 147 ? 26.960  0.215   -2.728  1.00 0.00 ? 147 GLY B HA3  4  
ATOM 10621 N N    . PRO B 1 148 ? 28.978  0.150   -1.149  1.00 0.00 ? 148 PRO B N    4  
ATOM 10622 C CA   . PRO B 1 148 ? 30.016  0.099   -0.139  1.00 0.00 ? 148 PRO B CA   4  
ATOM 10623 C C    . PRO B 1 148 ? 29.503  0.377   1.291   1.00 0.00 ? 148 PRO B C    4  
ATOM 10624 O O    . PRO B 1 148 ? 28.511  1.102   1.508   1.00 0.00 ? 148 PRO B O    4  
ATOM 10625 C CB   . PRO B 1 148 ? 30.932  1.233   -0.583  1.00 0.00 ? 148 PRO B CB   4  
ATOM 10626 C CG   . PRO B 1 148 ? 30.036  2.201   -1.307  1.00 0.00 ? 148 PRO B CG   4  
ATOM 10627 C CD   . PRO B 1 148 ? 28.679  1.533   -1.469  1.00 0.00 ? 148 PRO B CD   4  
ATOM 10628 H HA   . PRO B 1 148 ? 30.568  -0.829  -0.165  1.00 0.00 ? 148 PRO B HA   4  
ATOM 10629 H HB2  . PRO B 1 148 ? 31.393  1.685   0.283   1.00 0.00 ? 148 PRO B HB2  4  
ATOM 10630 H HB3  . PRO B 1 148 ? 31.696  0.847   -1.242  1.00 0.00 ? 148 PRO B HB3  4  
ATOM 10631 H HG2  . PRO B 1 148 ? 29.940  3.108   -0.727  1.00 0.00 ? 148 PRO B HG2  4  
ATOM 10632 H HG3  . PRO B 1 148 ? 30.465  2.428   -2.270  1.00 0.00 ? 148 PRO B HG3  4  
ATOM 10633 H HD2  . PRO B 1 148 ? 27.973  1.945   -0.764  1.00 0.00 ? 148 PRO B HD2  4  
ATOM 10634 H HD3  . PRO B 1 148 ? 28.309  1.636   -2.476  1.00 0.00 ? 148 PRO B HD3  4  
ATOM 10635 N N    . ARG B 1 149 ? 30.168  -0.214  2.241   1.00 0.00 ? 149 ARG B N    4  
ATOM 10636 C CA   . ARG B 1 149 ? 29.879  -0.010  3.636   1.00 0.00 ? 149 ARG B CA   4  
ATOM 10637 C C    . ARG B 1 149 ? 30.925  0.949   4.166   1.00 0.00 ? 149 ARG B C    4  
ATOM 10638 O O    . ARG B 1 149 ? 32.003  1.059   3.578   1.00 0.00 ? 149 ARG B O    4  
ATOM 10639 C CB   . ARG B 1 149 ? 29.967  -1.345  4.365   1.00 0.00 ? 149 ARG B CB   4  
ATOM 10640 C CG   . ARG B 1 149 ? 29.606  -1.313  5.832   1.00 0.00 ? 149 ARG B CG   4  
ATOM 10641 C CD   . ARG B 1 149 ? 29.721  -2.697  6.396   1.00 0.00 ? 149 ARG B CD   4  
ATOM 10642 N NE   . ARG B 1 149 ? 29.436  -2.767  7.814   1.00 0.00 ? 149 ARG B NE   4  
ATOM 10643 C CZ   . ARG B 1 149 ? 29.855  -3.755  8.600   1.00 0.00 ? 149 ARG B CZ   4  
ATOM 10644 N NH1  . ARG B 1 149 ? 30.572  -4.761  8.083   1.00 0.00 ? 149 ARG B NH1  4  
ATOM 10645 N NH2  . ARG B 1 149 ? 29.570  -3.741  9.895   1.00 0.00 ? 149 ARG B NH2  4  
ATOM 10646 H H    . ARG B 1 149 ? 30.920  -0.807  2.023   1.00 0.00 ? 149 ARG B H    4  
ATOM 10647 H HA   . ARG B 1 149 ? 28.891  0.412   3.743   1.00 0.00 ? 149 ARG B HA   4  
ATOM 10648 H HB2  . ARG B 1 149 ? 29.322  -2.064  3.883   1.00 0.00 ? 149 ARG B HB2  4  
ATOM 10649 H HB3  . ARG B 1 149 ? 30.985  -1.698  4.281   1.00 0.00 ? 149 ARG B HB3  4  
ATOM 10650 H HG2  . ARG B 1 149 ? 30.286  -0.653  6.352   1.00 0.00 ? 149 ARG B HG2  4  
ATOM 10651 H HG3  . ARG B 1 149 ? 28.590  -0.963  5.948   1.00 0.00 ? 149 ARG B HG3  4  
ATOM 10652 H HD2  . ARG B 1 149 ? 29.024  -3.340  5.878   1.00 0.00 ? 149 ARG B HD2  4  
ATOM 10653 H HD3  . ARG B 1 149 ? 30.726  -3.055  6.223   1.00 0.00 ? 149 ARG B HD3  4  
ATOM 10654 H HE   . ARG B 1 149 ? 28.899  -2.009  8.165   1.00 0.00 ? 149 ARG B HE   4  
ATOM 10655 H HH11 . ARG B 1 149 ? 30.809  -4.796  7.103   1.00 0.00 ? 149 ARG B HH11 4  
ATOM 10656 H HH12 . ARG B 1 149 ? 30.915  -5.526  8.635   1.00 0.00 ? 149 ARG B HH12 4  
ATOM 10657 H HH21 . ARG B 1 149 ? 29.041  -3.001  10.314  1.00 0.00 ? 149 ARG B HH21 4  
ATOM 10658 H HH22 . ARG B 1 149 ? 29.885  -4.465  10.515  1.00 0.00 ? 149 ARG B HH22 4  
ATOM 10659 N N    . LYS B 1 150 ? 30.612  1.667   5.194   1.00 0.00 ? 150 LYS B N    4  
ATOM 10660 C CA   . LYS B 1 150 ? 31.548  2.591   5.752   1.00 0.00 ? 150 LYS B CA   4  
ATOM 10661 C C    . LYS B 1 150 ? 31.914  2.156   7.153   1.00 0.00 ? 150 LYS B C    4  
ATOM 10662 O O    . LYS B 1 150 ? 33.006  1.590   7.350   1.00 0.00 ? 150 LYS B O    4  
ATOM 10663 C CB   . LYS B 1 150 ? 30.974  4.001   5.712   1.00 0.00 ? 150 LYS B CB   4  
ATOM 10664 C CG   . LYS B 1 150 ? 31.970  5.094   6.077   1.00 0.00 ? 150 LYS B CG   4  
ATOM 10665 C CD   . LYS B 1 150 ? 31.421  6.485   5.763   1.00 0.00 ? 150 LYS B CD   4  
ATOM 10666 C CE   . LYS B 1 150 ? 31.155  6.639   4.269   1.00 0.00 ? 150 LYS B CE   4  
ATOM 10667 N NZ   . LYS B 1 150 ? 30.623  7.960   3.909   1.00 0.00 ? 150 LYS B NZ   4  
ATOM 10668 H H    . LYS B 1 150 ? 29.745  1.568   5.638   1.00 0.00 ? 150 LYS B H    4  
ATOM 10669 H HA   . LYS B 1 150 ? 32.438  2.555   5.142   1.00 0.00 ? 150 LYS B HA   4  
ATOM 10670 H HB2  . LYS B 1 150 ? 30.609  4.168   4.710   1.00 0.00 ? 150 LYS B HB2  4  
ATOM 10671 H HB3  . LYS B 1 150 ? 30.139  4.052   6.396   1.00 0.00 ? 150 LYS B HB3  4  
ATOM 10672 H HG2  . LYS B 1 150 ? 32.202  5.032   7.129   1.00 0.00 ? 150 LYS B HG2  4  
ATOM 10673 H HG3  . LYS B 1 150 ? 32.864  4.928   5.495   1.00 0.00 ? 150 LYS B HG3  4  
ATOM 10674 H HD2  . LYS B 1 150 ? 30.498  6.632   6.303   1.00 0.00 ? 150 LYS B HD2  4  
ATOM 10675 H HD3  . LYS B 1 150 ? 32.143  7.228   6.070   1.00 0.00 ? 150 LYS B HD3  4  
ATOM 10676 H HE2  . LYS B 1 150 ? 32.072  6.480   3.722   1.00 0.00 ? 150 LYS B HE2  4  
ATOM 10677 H HE3  . LYS B 1 150 ? 30.433  5.897   3.970   1.00 0.00 ? 150 LYS B HE3  4  
ATOM 10678 H HZ1  . LYS B 1 150 ? 31.320  8.712   4.082   1.00 0.00 ? 150 LYS B HZ1  4  
ATOM 10679 H HZ2  . LYS B 1 150 ? 29.755  8.166   4.444   1.00 0.00 ? 150 LYS B HZ2  4  
ATOM 10680 H HZ3  . LYS B 1 150 ? 30.363  7.943   2.898   1.00 0.00 ? 150 LYS B HZ3  4  
ATOM 10681 N N    . ARG A 1 69  ? -37.378 6.573   -1.563  1.00 0.00 ? 69  ARG A N    5  
ATOM 10682 C CA   . ARG A 1 69  ? -37.505 5.178   -1.913  1.00 0.00 ? 69  ARG A CA   5  
ATOM 10683 C C    . ARG A 1 69  ? -37.298 5.038   -3.403  1.00 0.00 ? 69  ARG A C    5  
ATOM 10684 O O    . ARG A 1 69  ? -38.153 4.548   -4.130  1.00 0.00 ? 69  ARG A O    5  
ATOM 10685 C CB   . ARG A 1 69  ? -38.861 4.558   -1.486  1.00 0.00 ? 69  ARG A CB   5  
ATOM 10686 C CG   . ARG A 1 69  ? -39.116 4.458   0.022   1.00 0.00 ? 69  ARG A CG   5  
ATOM 10687 C CD   . ARG A 1 69  ? -39.410 5.805   0.647   1.00 0.00 ? 69  ARG A CD   5  
ATOM 10688 N NE   . ARG A 1 69  ? -39.645 5.715   2.091   1.00 0.00 ? 69  ARG A NE   5  
ATOM 10689 C CZ   . ARG A 1 69  ? -40.230 6.671   2.828   1.00 0.00 ? 69  ARG A CZ   5  
ATOM 10690 N NH1  . ARG A 1 69  ? -40.672 7.784   2.251   1.00 0.00 ? 69  ARG A NH1  5  
ATOM 10691 N NH2  . ARG A 1 69  ? -40.381 6.507   4.135   1.00 0.00 ? 69  ARG A NH2  5  
ATOM 10692 H H    . ARG A 1 69  ? -38.162 7.163   -1.612  1.00 0.00 ? 69  ARG A H    5  
ATOM 10693 H HA   . ARG A 1 69  ? -36.698 4.660   -1.416  1.00 0.00 ? 69  ARG A HA   5  
ATOM 10694 H HB2  . ARG A 1 69  ? -39.658 5.147   -1.912  1.00 0.00 ? 69  ARG A HB2  5  
ATOM 10695 H HB3  . ARG A 1 69  ? -38.913 3.562   -1.901  1.00 0.00 ? 69  ARG A HB3  5  
ATOM 10696 H HG2  . ARG A 1 69  ? -39.959 3.807   0.196   1.00 0.00 ? 69  ARG A HG2  5  
ATOM 10697 H HG3  . ARG A 1 69  ? -38.240 4.037   0.491   1.00 0.00 ? 69  ARG A HG3  5  
ATOM 10698 H HD2  . ARG A 1 69  ? -38.571 6.462   0.470   1.00 0.00 ? 69  ARG A HD2  5  
ATOM 10699 H HD3  . ARG A 1 69  ? -40.290 6.217   0.176   1.00 0.00 ? 69  ARG A HD3  5  
ATOM 10700 H HE   . ARG A 1 69  ? -39.330 4.886   2.522   1.00 0.00 ? 69  ARG A HE   5  
ATOM 10701 H HH11 . ARG A 1 69  ? -40.586 7.948   1.263   1.00 0.00 ? 69  ARG A HH11 5  
ATOM 10702 H HH12 . ARG A 1 69  ? -41.106 8.522   2.770   1.00 0.00 ? 69  ARG A HH12 5  
ATOM 10703 H HH21 . ARG A 1 69  ? -40.073 5.675   4.607   1.00 0.00 ? 69  ARG A HH21 5  
ATOM 10704 H HH22 . ARG A 1 69  ? -40.796 7.217   4.714   1.00 0.00 ? 69  ARG A HH22 5  
ATOM 10705 N N    . LEU A 1 70  ? -36.163 5.491   -3.840  1.00 0.00 ? 70  LEU A N    5  
ATOM 10706 C CA   . LEU A 1 70  ? -35.812 5.480   -5.226  1.00 0.00 ? 70  LEU A CA   5  
ATOM 10707 C C    . LEU A 1 70  ? -35.099 4.182   -5.514  1.00 0.00 ? 70  LEU A C    5  
ATOM 10708 O O    . LEU A 1 70  ? -33.868 4.124   -5.461  1.00 0.00 ? 70  LEU A O    5  
ATOM 10709 C CB   . LEU A 1 70  ? -34.908 6.682   -5.537  1.00 0.00 ? 70  LEU A CB   5  
ATOM 10710 C CG   . LEU A 1 70  ? -34.545 6.904   -7.005  1.00 0.00 ? 70  LEU A CG   5  
ATOM 10711 C CD1  . LEU A 1 70  ? -35.787 7.220   -7.821  1.00 0.00 ? 70  LEU A CD1  5  
ATOM 10712 C CD2  . LEU A 1 70  ? -33.519 8.016   -7.133  1.00 0.00 ? 70  LEU A CD2  5  
ATOM 10713 H H    . LEU A 1 70  ? -35.518 5.825   -3.178  1.00 0.00 ? 70  LEU A H    5  
ATOM 10714 H HA   . LEU A 1 70  ? -36.714 5.545   -5.814  1.00 0.00 ? 70  LEU A HA   5  
ATOM 10715 H HB2  . LEU A 1 70  ? -35.402 7.572   -5.176  1.00 0.00 ? 70  LEU A HB2  5  
ATOM 10716 H HB3  . LEU A 1 70  ? -33.991 6.557   -4.979  1.00 0.00 ? 70  LEU A HB3  5  
ATOM 10717 H HG   . LEU A 1 70  ? -34.112 5.996   -7.401  1.00 0.00 ? 70  LEU A HG   5  
ATOM 10718 H HD11 . LEU A 1 70  ? -35.507 7.396   -8.848  1.00 0.00 ? 70  LEU A HD11 5  
ATOM 10719 H HD12 . LEU A 1 70  ? -36.263 8.105   -7.425  1.00 0.00 ? 70  LEU A HD12 5  
ATOM 10720 H HD13 . LEU A 1 70  ? -36.475 6.389   -7.775  1.00 0.00 ? 70  LEU A HD13 5  
ATOM 10721 H HD21 . LEU A 1 70  ? -32.626 7.750   -6.588  1.00 0.00 ? 70  LEU A HD21 5  
ATOM 10722 H HD22 . LEU A 1 70  ? -33.931 8.928   -6.725  1.00 0.00 ? 70  LEU A HD22 5  
ATOM 10723 H HD23 . LEU A 1 70  ? -33.276 8.167   -8.173  1.00 0.00 ? 70  LEU A HD23 5  
ATOM 10724 N N    . GLU A 1 71  ? -35.890 3.137   -5.770  1.00 0.00 ? 71  GLU A N    5  
ATOM 10725 C CA   . GLU A 1 71  ? -35.382 1.788   -5.995  1.00 0.00 ? 71  GLU A CA   5  
ATOM 10726 C C    . GLU A 1 71  ? -34.609 1.322   -4.782  1.00 0.00 ? 71  GLU A C    5  
ATOM 10727 O O    . GLU A 1 71  ? -33.497 0.804   -4.877  1.00 0.00 ? 71  GLU A O    5  
ATOM 10728 C CB   . GLU A 1 71  ? -34.533 1.703   -7.263  1.00 0.00 ? 71  GLU A CB   5  
ATOM 10729 C CG   . GLU A 1 71  ? -35.293 2.024   -8.531  1.00 0.00 ? 71  GLU A CG   5  
ATOM 10730 C CD   . GLU A 1 71  ? -36.460 1.111   -8.718  1.00 0.00 ? 71  GLU A CD   5  
ATOM 10731 O OE1  . GLU A 1 71  ? -36.249 -0.066  -9.088  1.00 0.00 ? 71  GLU A OE1  5  
ATOM 10732 O OE2  . GLU A 1 71  ? -37.612 1.532   -8.450  1.00 0.00 ? 71  GLU A OE2  5  
ATOM 10733 H H    . GLU A 1 71  ? -36.860 3.285   -5.803  1.00 0.00 ? 71  GLU A H    5  
ATOM 10734 H HA   . GLU A 1 71  ? -36.243 1.144   -6.098  1.00 0.00 ? 71  GLU A HA   5  
ATOM 10735 H HB2  . GLU A 1 71  ? -33.703 2.387   -7.171  1.00 0.00 ? 71  GLU A HB2  5  
ATOM 10736 H HB3  . GLU A 1 71  ? -34.153 0.696   -7.341  1.00 0.00 ? 71  GLU A HB3  5  
ATOM 10737 H HG2  . GLU A 1 71  ? -35.649 3.042   -8.481  1.00 0.00 ? 71  GLU A HG2  5  
ATOM 10738 H HG3  . GLU A 1 71  ? -34.628 1.913   -9.373  1.00 0.00 ? 71  GLU A HG3  5  
ATOM 10739 N N    . LYS A 1 72  ? -35.236 1.465   -3.646  1.00 0.00 ? 72  LYS A N    5  
ATOM 10740 C CA   . LYS A 1 72  ? -34.595 1.198   -2.408  1.00 0.00 ? 72  LYS A CA   5  
ATOM 10741 C C    . LYS A 1 72  ? -34.711 -0.274  -2.073  1.00 0.00 ? 72  LYS A C    5  
ATOM 10742 O O    . LYS A 1 72  ? -35.790 -0.796  -1.757  1.00 0.00 ? 72  LYS A O    5  
ATOM 10743 C CB   . LYS A 1 72  ? -35.174 2.096   -1.309  1.00 0.00 ? 72  LYS A CB   5  
ATOM 10744 C CG   . LYS A 1 72  ? -34.533 1.921   0.053   1.00 0.00 ? 72  LYS A CG   5  
ATOM 10745 C CD   . LYS A 1 72  ? -35.040 2.960   1.034   1.00 0.00 ? 72  LYS A CD   5  
ATOM 10746 C CE   . LYS A 1 72  ? -34.467 2.739   2.425   1.00 0.00 ? 72  LYS A CE   5  
ATOM 10747 N NZ   . LYS A 1 72  ? -34.958 1.481   3.037   1.00 0.00 ? 72  LYS A NZ   5  
ATOM 10748 H H    . LYS A 1 72  ? -36.178 1.738   -3.662  1.00 0.00 ? 72  LYS A H    5  
ATOM 10749 H HA   . LYS A 1 72  ? -33.548 1.435   -2.531  1.00 0.00 ? 72  LYS A HA   5  
ATOM 10750 H HB2  . LYS A 1 72  ? -35.048 3.126   -1.605  1.00 0.00 ? 72  LYS A HB2  5  
ATOM 10751 H HB3  . LYS A 1 72  ? -36.230 1.887   -1.217  1.00 0.00 ? 72  LYS A HB3  5  
ATOM 10752 H HG2  . LYS A 1 72  ? -34.787 0.940   0.423   1.00 0.00 ? 72  LYS A HG2  5  
ATOM 10753 H HG3  . LYS A 1 72  ? -33.461 2.010   -0.043  1.00 0.00 ? 72  LYS A HG3  5  
ATOM 10754 H HD2  . LYS A 1 72  ? -34.750 3.941   0.686   1.00 0.00 ? 72  LYS A HD2  5  
ATOM 10755 H HD3  . LYS A 1 72  ? -36.118 2.899   1.082   1.00 0.00 ? 72  LYS A HD3  5  
ATOM 10756 H HE2  . LYS A 1 72  ? -33.390 2.692   2.355   1.00 0.00 ? 72  LYS A HE2  5  
ATOM 10757 H HE3  . LYS A 1 72  ? -34.749 3.572   3.053   1.00 0.00 ? 72  LYS A HE3  5  
ATOM 10758 H HZ1  . LYS A 1 72  ? -35.987 1.540   3.179   1.00 0.00 ? 72  LYS A HZ1  5  
ATOM 10759 H HZ2  . LYS A 1 72  ? -34.531 1.320   3.972   1.00 0.00 ? 72  LYS A HZ2  5  
ATOM 10760 H HZ3  . LYS A 1 72  ? -34.767 0.647   2.446   1.00 0.00 ? 72  LYS A HZ3  5  
ATOM 10761 N N    . ASP A 1 73  ? -33.604 -0.918  -2.203  1.00 0.00 ? 73  ASP A N    5  
ATOM 10762 C CA   . ASP A 1 73  ? -33.435 -2.333  -1.972  1.00 0.00 ? 73  ASP A CA   5  
ATOM 10763 C C    . ASP A 1 73  ? -32.129 -2.505  -1.239  1.00 0.00 ? 73  ASP A C    5  
ATOM 10764 O O    . ASP A 1 73  ? -31.281 -1.604  -1.298  1.00 0.00 ? 73  ASP A O    5  
ATOM 10765 C CB   . ASP A 1 73  ? -33.386 -3.050  -3.334  1.00 0.00 ? 73  ASP A CB   5  
ATOM 10766 C CG   . ASP A 1 73  ? -33.024 -4.515  -3.256  1.00 0.00 ? 73  ASP A CG   5  
ATOM 10767 O OD1  . ASP A 1 73  ? -33.907 -5.353  -2.984  1.00 0.00 ? 73  ASP A OD1  5  
ATOM 10768 O OD2  . ASP A 1 73  ? -31.853 -4.852  -3.482  1.00 0.00 ? 73  ASP A OD2  5  
ATOM 10769 H H    . ASP A 1 73  ? -32.810 -0.411  -2.477  1.00 0.00 ? 73  ASP A H    5  
ATOM 10770 H HA   . ASP A 1 73  ? -34.258 -2.713  -1.384  1.00 0.00 ? 73  ASP A HA   5  
ATOM 10771 H HB2  . ASP A 1 73  ? -34.354 -2.976  -3.802  1.00 0.00 ? 73  ASP A HB2  5  
ATOM 10772 H HB3  . ASP A 1 73  ? -32.663 -2.553  -3.963  1.00 0.00 ? 73  ASP A HB3  5  
ATOM 10773 N N    . ARG A 1 74  ? -31.949 -3.610  -0.566  1.00 0.00 ? 74  ARG A N    5  
ATOM 10774 C CA   . ARG A 1 74  ? -30.744 -3.823  0.166   1.00 0.00 ? 74  ARG A CA   5  
ATOM 10775 C C    . ARG A 1 74  ? -29.798 -4.589  -0.700  1.00 0.00 ? 74  ARG A C    5  
ATOM 10776 O O    . ARG A 1 74  ? -30.074 -5.720  -1.131  1.00 0.00 ? 74  ARG A O    5  
ATOM 10777 C CB   . ARG A 1 74  ? -30.985 -4.556  1.480   1.00 0.00 ? 74  ARG A CB   5  
ATOM 10778 C CG   . ARG A 1 74  ? -31.915 -3.833  2.434   1.00 0.00 ? 74  ARG A CG   5  
ATOM 10779 C CD   . ARG A 1 74  ? -31.992 -4.538  3.774   1.00 0.00 ? 74  ARG A CD   5  
ATOM 10780 N NE   . ARG A 1 74  ? -30.703 -4.520  4.481   1.00 0.00 ? 74  ARG A NE   5  
ATOM 10781 C CZ   . ARG A 1 74  ? -30.513 -4.892  5.755   1.00 0.00 ? 74  ARG A CZ   5  
ATOM 10782 N NH1  . ARG A 1 74  ? -31.501 -5.451  6.449   1.00 0.00 ? 74  ARG A NH1  5  
ATOM 10783 N NH2  . ARG A 1 74  ? -29.325 -4.728  6.315   1.00 0.00 ? 74  ARG A NH2  5  
ATOM 10784 H H    . ARG A 1 74  ? -32.626 -4.319  -0.579  1.00 0.00 ? 74  ARG A H    5  
ATOM 10785 H HA   . ARG A 1 74  ? -30.313 -2.855  0.370   1.00 0.00 ? 74  ARG A HA   5  
ATOM 10786 H HB2  . ARG A 1 74  ? -31.410 -5.522  1.257   1.00 0.00 ? 74  ARG A HB2  5  
ATOM 10787 H HB3  . ARG A 1 74  ? -30.035 -4.700  1.973   1.00 0.00 ? 74  ARG A HB3  5  
ATOM 10788 H HG2  . ARG A 1 74  ? -31.549 -2.828  2.587   1.00 0.00 ? 74  ARG A HG2  5  
ATOM 10789 H HG3  . ARG A 1 74  ? -32.902 -3.793  1.998   1.00 0.00 ? 74  ARG A HG3  5  
ATOM 10790 H HD2  . ARG A 1 74  ? -32.738 -4.053  4.386   1.00 0.00 ? 74  ARG A HD2  5  
ATOM 10791 H HD3  . ARG A 1 74  ? -32.278 -5.564  3.603   1.00 0.00 ? 74  ARG A HD3  5  
ATOM 10792 H HE   . ARG A 1 74  ? -29.942 -4.179  3.955   1.00 0.00 ? 74  ARG A HE   5  
ATOM 10793 H HH11 . ARG A 1 74  ? -32.405 -5.617  6.053   1.00 0.00 ? 74  ARG A HH11 5  
ATOM 10794 H HH12 . ARG A 1 74  ? -31.388 -5.736  7.406   1.00 0.00 ? 74  ARG A HH12 5  
ATOM 10795 H HH21 . ARG A 1 74  ? -28.564 -4.324  5.796   1.00 0.00 ? 74  ARG A HH21 5  
ATOM 10796 H HH22 . ARG A 1 74  ? -29.122 -4.974  7.265   1.00 0.00 ? 74  ARG A HH22 5  
ATOM 10797 N N    . PHE A 1 75  ? -28.704 -3.979  -0.952  1.00 0.00 ? 75  PHE A N    5  
ATOM 10798 C CA   . PHE A 1 75  ? -27.743 -4.455  -1.864  1.00 0.00 ? 75  PHE A CA   5  
ATOM 10799 C C    . PHE A 1 75  ? -26.416 -4.559  -1.156  1.00 0.00 ? 75  PHE A C    5  
ATOM 10800 O O    . PHE A 1 75  ? -26.185 -3.870  -0.149  1.00 0.00 ? 75  PHE A O    5  
ATOM 10801 C CB   . PHE A 1 75  ? -27.675 -3.466  -3.028  1.00 0.00 ? 75  PHE A CB   5  
ATOM 10802 C CG   . PHE A 1 75  ? -26.842 -3.908  -4.176  1.00 0.00 ? 75  PHE A CG   5  
ATOM 10803 C CD1  . PHE A 1 75  ? -27.320 -4.863  -5.034  1.00 0.00 ? 75  PHE A CD1  5  
ATOM 10804 C CD2  . PHE A 1 75  ? -25.588 -3.368  -4.403  1.00 0.00 ? 75  PHE A CD2  5  
ATOM 10805 C CE1  . PHE A 1 75  ? -26.571 -5.285  -6.103  1.00 0.00 ? 75  PHE A CE1  5  
ATOM 10806 C CE2  . PHE A 1 75  ? -24.830 -3.785  -5.473  1.00 0.00 ? 75  PHE A CE2  5  
ATOM 10807 C CZ   . PHE A 1 75  ? -25.323 -4.748  -6.325  1.00 0.00 ? 75  PHE A CZ   5  
ATOM 10808 H H    . PHE A 1 75  ? -28.497 -3.157  -0.449  1.00 0.00 ? 75  PHE A H    5  
ATOM 10809 H HA   . PHE A 1 75  ? -28.042 -5.419  -2.242  1.00 0.00 ? 75  PHE A HA   5  
ATOM 10810 H HB2  . PHE A 1 75  ? -28.678 -3.322  -3.402  1.00 0.00 ? 75  PHE A HB2  5  
ATOM 10811 H HB3  . PHE A 1 75  ? -27.291 -2.525  -2.667  1.00 0.00 ? 75  PHE A HB3  5  
ATOM 10812 H HD1  . PHE A 1 75  ? -28.298 -5.287  -4.863  1.00 0.00 ? 75  PHE A HD1  5  
ATOM 10813 H HD2  . PHE A 1 75  ? -25.205 -2.613  -3.732  1.00 0.00 ? 75  PHE A HD2  5  
ATOM 10814 H HE1  . PHE A 1 75  ? -26.968 -6.038  -6.766  1.00 0.00 ? 75  PHE A HE1  5  
ATOM 10815 H HE2  . PHE A 1 75  ? -23.852 -3.362  -5.645  1.00 0.00 ? 75  PHE A HE2  5  
ATOM 10816 H HZ   . PHE A 1 75  ? -24.732 -5.083  -7.165  1.00 0.00 ? 75  PHE A HZ   5  
ATOM 10817 N N    . SER A 1 76  ? -25.566 -5.405  -1.646  1.00 0.00 ? 76  SER A N    5  
ATOM 10818 C CA   . SER A 1 76  ? -24.292 -5.576  -1.062  1.00 0.00 ? 76  SER A CA   5  
ATOM 10819 C C    . SER A 1 76  ? -23.214 -5.477  -2.121  1.00 0.00 ? 76  SER A C    5  
ATOM 10820 O O    . SER A 1 76  ? -23.391 -5.944  -3.244  1.00 0.00 ? 76  SER A O    5  
ATOM 10821 C CB   . SER A 1 76  ? -24.231 -6.918  -0.321  1.00 0.00 ? 76  SER A CB   5  
ATOM 10822 O OG   . SER A 1 76  ? -24.550 -8.014  -1.183  1.00 0.00 ? 76  SER A OG   5  
ATOM 10823 H H    . SER A 1 76  ? -25.779 -5.927  -2.450  1.00 0.00 ? 76  SER A H    5  
ATOM 10824 H HA   . SER A 1 76  ? -24.146 -4.784  -0.344  1.00 0.00 ? 76  SER A HA   5  
ATOM 10825 H HB2  . SER A 1 76  ? -23.236 -7.063  0.071   1.00 0.00 ? 76  SER A HB2  5  
ATOM 10826 H HB3  . SER A 1 76  ? -24.937 -6.902  0.495   1.00 0.00 ? 76  SER A HB3  5  
ATOM 10827 H HG   . SER A 1 76  ? -25.367 -7.834  -1.665  1.00 0.00 ? 76  SER A HG   5  
ATOM 10828 N N    . VAL A 1 77  ? -22.141 -4.846  -1.781  1.00 0.00 ? 77  VAL A N    5  
ATOM 10829 C CA   . VAL A 1 77  ? -20.995 -4.751  -2.629  1.00 0.00 ? 77  VAL A CA   5  
ATOM 10830 C C    . VAL A 1 77  ? -19.908 -5.494  -1.894  1.00 0.00 ? 77  VAL A C    5  
ATOM 10831 O O    . VAL A 1 77  ? -19.794 -5.374  -0.668  1.00 0.00 ? 77  VAL A O    5  
ATOM 10832 C CB   . VAL A 1 77  ? -20.547 -3.254  -2.864  1.00 0.00 ? 77  VAL A CB   5  
ATOM 10833 C CG1  . VAL A 1 77  ? -19.379 -3.175  -3.843  1.00 0.00 ? 77  VAL A CG1  5  
ATOM 10834 C CG2  . VAL A 1 77  ? -21.714 -2.407  -3.357  1.00 0.00 ? 77  VAL A CG2  5  
ATOM 10835 H H    . VAL A 1 77  ? -22.098 -4.415  -0.896  1.00 0.00 ? 77  VAL A H    5  
ATOM 10836 H HA   . VAL A 1 77  ? -21.209 -5.235  -3.572  1.00 0.00 ? 77  VAL A HA   5  
ATOM 10837 H HB   . VAL A 1 77  ? -20.203 -2.857  -1.921  1.00 0.00 ? 77  VAL A HB   5  
ATOM 10838 H HG11 . VAL A 1 77  ? -18.543 -3.734  -3.450  1.00 0.00 ? 77  VAL A HG11 5  
ATOM 10839 H HG12 . VAL A 1 77  ? -19.092 -2.143  -3.980  1.00 0.00 ? 77  VAL A HG12 5  
ATOM 10840 H HG13 . VAL A 1 77  ? -19.677 -3.594  -4.794  1.00 0.00 ? 77  VAL A HG13 5  
ATOM 10841 H HG21 . VAL A 1 77  ? -22.076 -2.803  -4.294  1.00 0.00 ? 77  VAL A HG21 5  
ATOM 10842 H HG22 . VAL A 1 77  ? -21.385 -1.388  -3.501  1.00 0.00 ? 77  VAL A HG22 5  
ATOM 10843 H HG23 . VAL A 1 77  ? -22.510 -2.428  -2.628  1.00 0.00 ? 77  VAL A HG23 5  
ATOM 10844 N N    . ASN A 1 78  ? -19.168 -6.286  -2.569  1.00 0.00 ? 78  ASN A N    5  
ATOM 10845 C CA   . ASN A 1 78  ? -18.119 -7.020  -1.928  1.00 0.00 ? 78  ASN A CA   5  
ATOM 10846 C C    . ASN A 1 78  ? -16.840 -6.469  -2.419  1.00 0.00 ? 78  ASN A C    5  
ATOM 10847 O O    . ASN A 1 78  ? -16.726 -6.128  -3.579  1.00 0.00 ? 78  ASN A O    5  
ATOM 10848 C CB   . ASN A 1 78  ? -18.226 -8.541  -2.195  1.00 0.00 ? 78  ASN A CB   5  
ATOM 10849 C CG   . ASN A 1 78  ? -18.092 -8.924  -3.663  1.00 0.00 ? 78  ASN A CG   5  
ATOM 10850 O OD1  . ASN A 1 78  ? -19.071 -8.916  -4.403  1.00 0.00 ? 78  ASN A OD1  5  
ATOM 10851 N ND2  . ASN A 1 78  ? -16.913 -9.329  -4.074  1.00 0.00 ? 78  ASN A ND2  5  
ATOM 10852 H H    . ASN A 1 78  ? -19.273 -6.383  -3.540  1.00 0.00 ? 78  ASN A H    5  
ATOM 10853 H HA   . ASN A 1 78  ? -18.193 -6.832  -0.867  1.00 0.00 ? 78  ASN A HA   5  
ATOM 10854 H HB2  . ASN A 1 78  ? -17.448 -9.050  -1.646  1.00 0.00 ? 78  ASN A HB2  5  
ATOM 10855 H HB3  . ASN A 1 78  ? -19.186 -8.886  -1.839  1.00 0.00 ? 78  ASN A HB3  5  
ATOM 10856 H HD21 . ASN A 1 78  ? -16.169 -9.381  -3.437  1.00 0.00 ? 78  ASN A HD21 5  
ATOM 10857 H HD22 . ASN A 1 78  ? -16.805 -9.557  -5.022  1.00 0.00 ? 78  ASN A HD22 5  
ATOM 10858 N N    . LEU A 1 79  ? -15.907 -6.332  -1.551  1.00 0.00 ? 79  LEU A N    5  
ATOM 10859 C CA   . LEU A 1 79  ? -14.667 -5.736  -1.899  1.00 0.00 ? 79  LEU A CA   5  
ATOM 10860 C C    . LEU A 1 79  ? -13.573 -6.737  -1.655  1.00 0.00 ? 79  LEU A C    5  
ATOM 10861 O O    . LEU A 1 79  ? -13.500 -7.345  -0.570  1.00 0.00 ? 79  LEU A O    5  
ATOM 10862 C CB   . LEU A 1 79  ? -14.392 -4.460  -1.049  1.00 0.00 ? 79  LEU A CB   5  
ATOM 10863 C CG   . LEU A 1 79  ? -15.308 -3.223  -1.263  1.00 0.00 ? 79  LEU A CG   5  
ATOM 10864 C CD1  . LEU A 1 79  ? -16.729 -3.463  -0.826  1.00 0.00 ? 79  LEU A CD1  5  
ATOM 10865 C CD2  . LEU A 1 79  ? -14.752 -2.017  -0.547  1.00 0.00 ? 79  LEU A CD2  5  
ATOM 10866 H H    . LEU A 1 79  ? -16.022 -6.615  -0.615  1.00 0.00 ? 79  LEU A H    5  
ATOM 10867 H HA   . LEU A 1 79  ? -14.692 -5.461  -2.942  1.00 0.00 ? 79  LEU A HA   5  
ATOM 10868 H HB2  . LEU A 1 79  ? -14.464 -4.741  -0.009  1.00 0.00 ? 79  LEU A HB2  5  
ATOM 10869 H HB3  . LEU A 1 79  ? -13.373 -4.157  -1.239  1.00 0.00 ? 79  LEU A HB3  5  
ATOM 10870 H HG   . LEU A 1 79  ? -15.329 -2.991  -2.318  1.00 0.00 ? 79  LEU A HG   5  
ATOM 10871 H HD11 . LEU A 1 79  ? -17.303 -2.569  -1.017  1.00 0.00 ? 79  LEU A HD11 5  
ATOM 10872 H HD12 . LEU A 1 79  ? -16.750 -3.691  0.230   1.00 0.00 ? 79  LEU A HD12 5  
ATOM 10873 H HD13 . LEU A 1 79  ? -17.146 -4.287  -1.384  1.00 0.00 ? 79  LEU A HD13 5  
ATOM 10874 H HD21 . LEU A 1 79  ? -15.396 -1.168  -0.727  1.00 0.00 ? 79  LEU A HD21 5  
ATOM 10875 H HD22 . LEU A 1 79  ? -13.763 -1.799  -0.922  1.00 0.00 ? 79  LEU A HD22 5  
ATOM 10876 H HD23 . LEU A 1 79  ? -14.703 -2.212  0.512   1.00 0.00 ? 79  LEU A HD23 5  
ATOM 10877 N N    . ASP A 1 80  ? -12.746 -6.946  -2.652  1.00 0.00 ? 80  ASP A N    5  
ATOM 10878 C CA   . ASP A 1 80  ? -11.620 -7.850  -2.517  1.00 0.00 ? 80  ASP A CA   5  
ATOM 10879 C C    . ASP A 1 80  ? -10.499 -7.112  -1.906  1.00 0.00 ? 80  ASP A C    5  
ATOM 10880 O O    . ASP A 1 80  ? -10.054 -6.140  -2.449  1.00 0.00 ? 80  ASP A O    5  
ATOM 10881 C CB   . ASP A 1 80  ? -11.155 -8.382  -3.882  1.00 0.00 ? 80  ASP A CB   5  
ATOM 10882 C CG   . ASP A 1 80  ? -9.858  -9.195  -3.811  1.00 0.00 ? 80  ASP A CG   5  
ATOM 10883 O OD1  . ASP A 1 80  ? -8.757  -8.606  -3.897  1.00 0.00 ? 80  ASP A OD1  5  
ATOM 10884 O OD2  . ASP A 1 80  ? -9.919  -10.447 -3.693  1.00 0.00 ? 80  ASP A OD2  5  
ATOM 10885 H H    . ASP A 1 80  ? -12.879 -6.460  -3.497  1.00 0.00 ? 80  ASP A H    5  
ATOM 10886 H HA   . ASP A 1 80  ? -11.905 -8.682  -1.891  1.00 0.00 ? 80  ASP A HA   5  
ATOM 10887 H HB2  . ASP A 1 80  ? -11.923 -9.012  -4.305  1.00 0.00 ? 80  ASP A HB2  5  
ATOM 10888 H HB3  . ASP A 1 80  ? -10.992 -7.543  -4.541  1.00 0.00 ? 80  ASP A HB3  5  
ATOM 10889 N N    . VAL A 1 81  ? -10.064 -7.549  -0.786  1.00 0.00 ? 81  VAL A N    5  
ATOM 10890 C CA   . VAL A 1 81  ? -8.916  -7.011  -0.121  1.00 0.00 ? 81  VAL A CA   5  
ATOM 10891 C C    . VAL A 1 81  ? -8.155  -8.230  0.274   1.00 0.00 ? 81  VAL A C    5  
ATOM 10892 O O    . VAL A 1 81  ? -8.775  -9.237  0.610   1.00 0.00 ? 81  VAL A O    5  
ATOM 10893 C CB   . VAL A 1 81  ? -9.293  -6.192  1.158   1.00 0.00 ? 81  VAL A CB   5  
ATOM 10894 C CG1  . VAL A 1 81  ? -8.067  -5.532  1.781   1.00 0.00 ? 81  VAL A CG1  5  
ATOM 10895 C CG2  . VAL A 1 81  ? -10.375 -5.151  0.876   1.00 0.00 ? 81  VAL A CG2  5  
ATOM 10896 H H    . VAL A 1 81  ? -10.510 -8.307  -0.352  1.00 0.00 ? 81  VAL A H    5  
ATOM 10897 H HA   . VAL A 1 81  ? -8.343  -6.413  -0.816  1.00 0.00 ? 81  VAL A HA   5  
ATOM 10898 H HB   . VAL A 1 81  ? -9.679  -6.895  1.883   1.00 0.00 ? 81  VAL A HB   5  
ATOM 10899 H HG11 . VAL A 1 81  ? -8.365  -4.979  2.661   1.00 0.00 ? 81  VAL A HG11 5  
ATOM 10900 H HG12 . VAL A 1 81  ? -7.618  -4.858  1.068   1.00 0.00 ? 81  VAL A HG12 5  
ATOM 10901 H HG13 . VAL A 1 81  ? -7.351  -6.291  2.060   1.00 0.00 ? 81  VAL A HG13 5  
ATOM 10902 H HG21 . VAL A 1 81  ? -10.024 -4.462  0.123   1.00 0.00 ? 81  VAL A HG21 5  
ATOM 10903 H HG22 . VAL A 1 81  ? -10.604 -4.611  1.783   1.00 0.00 ? 81  VAL A HG22 5  
ATOM 10904 H HG23 . VAL A 1 81  ? -11.267 -5.647  0.518   1.00 0.00 ? 81  VAL A HG23 5  
ATOM 10905 N N    . LYS A 1 82  ? -6.852  -8.195  0.178   1.00 0.00 ? 82  LYS A N    5  
ATOM 10906 C CA   . LYS A 1 82  ? -6.079  -9.375  0.472   1.00 0.00 ? 82  LYS A CA   5  
ATOM 10907 C C    . LYS A 1 82  ? -5.857  -9.476  1.969   1.00 0.00 ? 82  LYS A C    5  
ATOM 10908 O O    . LYS A 1 82  ? -6.388  -8.650  2.714   1.00 0.00 ? 82  LYS A O    5  
ATOM 10909 C CB   . LYS A 1 82  ? -4.769  -9.384  -0.319  1.00 0.00 ? 82  LYS A CB   5  
ATOM 10910 C CG   . LYS A 1 82  ? -4.960  -8.925  -1.765  1.00 0.00 ? 82  LYS A CG   5  
ATOM 10911 C CD   . LYS A 1 82  ? -3.859  -9.398  -2.690  1.00 0.00 ? 82  LYS A CD   5  
ATOM 10912 C CE   . LYS A 1 82  ? -4.041  -10.867 -3.036  1.00 0.00 ? 82  LYS A CE   5  
ATOM 10913 N NZ   . LYS A 1 82  ? -5.353  -11.123 -3.682  1.00 0.00 ? 82  LYS A NZ   5  
ATOM 10914 H H    . LYS A 1 82  ? -6.403  -7.364  -0.071  1.00 0.00 ? 82  LYS A H    5  
ATOM 10915 H HA   . LYS A 1 82  ? -6.682  -10.220 0.173   1.00 0.00 ? 82  LYS A HA   5  
ATOM 10916 H HB2  . LYS A 1 82  ? -4.063  -8.726  0.166   1.00 0.00 ? 82  LYS A HB2  5  
ATOM 10917 H HB3  . LYS A 1 82  ? -4.367  -10.386 -0.330  1.00 0.00 ? 82  LYS A HB3  5  
ATOM 10918 H HG2  . LYS A 1 82  ? -5.898  -9.319  -2.125  1.00 0.00 ? 82  LYS A HG2  5  
ATOM 10919 H HG3  . LYS A 1 82  ? -5.004  -7.847  -1.786  1.00 0.00 ? 82  LYS A HG3  5  
ATOM 10920 H HD2  . LYS A 1 82  ? -3.883  -8.815  -3.598  1.00 0.00 ? 82  LYS A HD2  5  
ATOM 10921 H HD3  . LYS A 1 82  ? -2.906  -9.266  -2.200  1.00 0.00 ? 82  LYS A HD3  5  
ATOM 10922 H HE2  . LYS A 1 82  ? -3.252  -11.173 -3.707  1.00 0.00 ? 82  LYS A HE2  5  
ATOM 10923 H HE3  . LYS A 1 82  ? -3.983  -11.443 -2.126  1.00 0.00 ? 82  LYS A HE3  5  
ATOM 10924 H HZ1  . LYS A 1 82  ? -5.462  -10.534 -4.533  1.00 0.00 ? 82  LYS A HZ1  5  
ATOM 10925 H HZ2  . LYS A 1 82  ? -6.144  -10.916 -3.040  1.00 0.00 ? 82  LYS A HZ2  5  
ATOM 10926 H HZ3  . LYS A 1 82  ? -5.418  -12.114 -3.985  1.00 0.00 ? 82  LYS A HZ3  5  
ATOM 10927 N N    . HIS A 1 83  ? -5.025  -10.388 2.421   1.00 0.00 ? 83  HIS A N    5  
ATOM 10928 C CA   . HIS A 1 83  ? -4.920  -10.608 3.848   1.00 0.00 ? 83  HIS A CA   5  
ATOM 10929 C C    . HIS A 1 83  ? -4.120  -9.487  4.428   1.00 0.00 ? 83  HIS A C    5  
ATOM 10930 O O    . HIS A 1 83  ? -2.998  -9.195  3.986   1.00 0.00 ? 83  HIS A O    5  
ATOM 10931 C CB   . HIS A 1 83  ? -4.244  -11.956 4.131   1.00 0.00 ? 83  HIS A CB   5  
ATOM 10932 C CG   . HIS A 1 83  ? -4.087  -12.307 5.588   1.00 0.00 ? 83  HIS A CG   5  
ATOM 10933 N ND1  . HIS A 1 83  ? -2.988  -11.950 6.336   1.00 0.00 ? 83  HIS A ND1  5  
ATOM 10934 C CD2  . HIS A 1 83  ? -4.894  -12.992 6.426   1.00 0.00 ? 83  HIS A CD2  5  
ATOM 10935 C CE1  . HIS A 1 83  ? -3.128  -12.395 7.564   1.00 0.00 ? 83  HIS A CE1  5  
ATOM 10936 N NE2  . HIS A 1 83  ? -4.275  -13.029 7.646   1.00 0.00 ? 83  HIS A NE2  5  
ATOM 10937 H H    . HIS A 1 83  ? -4.476  -10.911 1.800   1.00 0.00 ? 83  HIS A H    5  
ATOM 10938 H HA   . HIS A 1 83  ? -5.913  -10.602 4.272   1.00 0.00 ? 83  HIS A HA   5  
ATOM 10939 H HB2  . HIS A 1 83  ? -4.840  -12.732 3.676   1.00 0.00 ? 83  HIS A HB2  5  
ATOM 10940 H HB3  . HIS A 1 83  ? -3.264  -11.952 3.680   1.00 0.00 ? 83  HIS A HB3  5  
ATOM 10941 H HD1  . HIS A 1 83  ? -2.202  -11.457 6.000   1.00 0.00 ? 83  HIS A HD1  5  
ATOM 10942 H HD2  . HIS A 1 83  ? -5.851  -13.431 6.179   1.00 0.00 ? 83  HIS A HD2  5  
ATOM 10943 H HE1  . HIS A 1 83  ? -2.422  -12.261 8.369   1.00 0.00 ? 83  HIS A HE1  5  
ATOM 10944 H HE2  . HIS A 1 83  ? -4.700  -13.316 8.486   1.00 0.00 ? 83  HIS A HE2  5  
ATOM 10945 N N    . PHE A 1 84  ? -4.705  -8.845  5.393   1.00 0.00 ? 84  PHE A N    5  
ATOM 10946 C CA   . PHE A 1 84  ? -4.179  -7.656  5.962   1.00 0.00 ? 84  PHE A CA   5  
ATOM 10947 C C    . PHE A 1 84  ? -4.791  -7.522  7.340   1.00 0.00 ? 84  PHE A C    5  
ATOM 10948 O O    . PHE A 1 84  ? -5.726  -8.252  7.665   1.00 0.00 ? 84  PHE A O    5  
ATOM 10949 C CB   . PHE A 1 84  ? -4.615  -6.497  5.047   1.00 0.00 ? 84  PHE A CB   5  
ATOM 10950 C CG   . PHE A 1 84  ? -4.020  -5.162  5.352   1.00 0.00 ? 84  PHE A CG   5  
ATOM 10951 C CD1  . PHE A 1 84  ? -2.677  -4.924  5.126   1.00 0.00 ? 84  PHE A CD1  5  
ATOM 10952 C CD2  . PHE A 1 84  ? -4.809  -4.135  5.824   1.00 0.00 ? 84  PHE A CD2  5  
ATOM 10953 C CE1  . PHE A 1 84  ? -2.139  -3.687  5.366   1.00 0.00 ? 84  PHE A CE1  5  
ATOM 10954 C CE2  . PHE A 1 84  ? -4.275  -2.899  6.074   1.00 0.00 ? 84  PHE A CE2  5  
ATOM 10955 C CZ   . PHE A 1 84  ? -2.940  -2.674  5.842   1.00 0.00 ? 84  PHE A CZ   5  
ATOM 10956 H H    . PHE A 1 84  ? -5.558  -9.158  5.768   1.00 0.00 ? 84  PHE A H    5  
ATOM 10957 H HA   . PHE A 1 84  ? -3.101  -7.700  6.004   1.00 0.00 ? 84  PHE A HA   5  
ATOM 10958 H HB2  . PHE A 1 84  ? -4.343  -6.739  4.031   1.00 0.00 ? 84  PHE A HB2  5  
ATOM 10959 H HB3  . PHE A 1 84  ? -5.690  -6.408  5.102   1.00 0.00 ? 84  PHE A HB3  5  
ATOM 10960 H HD1  . PHE A 1 84  ? -2.052  -5.724  4.756   1.00 0.00 ? 84  PHE A HD1  5  
ATOM 10961 H HD2  . PHE A 1 84  ? -5.857  -4.314  6.004   1.00 0.00 ? 84  PHE A HD2  5  
ATOM 10962 H HE1  . PHE A 1 84  ? -1.088  -3.510  5.186   1.00 0.00 ? 84  PHE A HE1  5  
ATOM 10963 H HE2  . PHE A 1 84  ? -4.901  -2.102  6.450   1.00 0.00 ? 84  PHE A HE2  5  
ATOM 10964 H HZ   . PHE A 1 84  ? -2.518  -1.698  6.031   1.00 0.00 ? 84  PHE A HZ   5  
ATOM 10965 N N    . SER A 1 85  ? -4.241  -6.644  8.142   1.00 0.00 ? 85  SER A N    5  
ATOM 10966 C CA   . SER A 1 85  ? -4.706  -6.408  9.482   1.00 0.00 ? 85  SER A CA   5  
ATOM 10967 C C    . SER A 1 85  ? -6.016  -5.600  9.458   1.00 0.00 ? 85  SER A C    5  
ATOM 10968 O O    . SER A 1 85  ? -6.012  -4.426  9.070   1.00 0.00 ? 85  SER A O    5  
ATOM 10969 C CB   . SER A 1 85  ? -3.629  -5.654  10.220  1.00 0.00 ? 85  SER A CB   5  
ATOM 10970 O OG   . SER A 1 85  ? -2.388  -6.351  10.127  1.00 0.00 ? 85  SER A OG   5  
ATOM 10971 H H    . SER A 1 85  ? -3.476  -6.118  7.838   1.00 0.00 ? 85  SER A H    5  
ATOM 10972 H HA   . SER A 1 85  ? -4.857  -7.362  9.961   1.00 0.00 ? 85  SER A HA   5  
ATOM 10973 H HB2  . SER A 1 85  ? -3.509  -4.676  9.777   1.00 0.00 ? 85  SER A HB2  5  
ATOM 10974 H HB3  . SER A 1 85  ? -3.892  -5.553  11.261  1.00 0.00 ? 85  SER A HB3  5  
ATOM 10975 H HG   . SER A 1 85  ? -2.129  -6.531  11.043  1.00 0.00 ? 85  SER A HG   5  
ATOM 10976 N N    . PRO A 1 86  ? -7.146  -6.219  9.891   1.00 0.00 ? 86  PRO A N    5  
ATOM 10977 C CA   . PRO A 1 86  ? -8.488  -5.616  9.822   1.00 0.00 ? 86  PRO A CA   5  
ATOM 10978 C C    . PRO A 1 86  ? -8.631  -4.265  10.536  1.00 0.00 ? 86  PRO A C    5  
ATOM 10979 O O    . PRO A 1 86  ? -9.433  -3.431  10.129  1.00 0.00 ? 86  PRO A O    5  
ATOM 10980 C CB   . PRO A 1 86  ? -9.399  -6.666  10.471  1.00 0.00 ? 86  PRO A CB   5  
ATOM 10981 C CG   . PRO A 1 86  ? -8.494  -7.550  11.243  1.00 0.00 ? 86  PRO A CG   5  
ATOM 10982 C CD   . PRO A 1 86  ? -7.208  -7.576  10.490  1.00 0.00 ? 86  PRO A CD   5  
ATOM 10983 H HA   . PRO A 1 86  ? -8.789  -5.487  8.794   1.00 0.00 ? 86  PRO A HA   5  
ATOM 10984 H HB2  . PRO A 1 86  ? -10.115 -6.175  11.114  1.00 0.00 ? 86  PRO A HB2  5  
ATOM 10985 H HB3  . PRO A 1 86  ? -9.919  -7.215  9.701   1.00 0.00 ? 86  PRO A HB3  5  
ATOM 10986 H HG2  . PRO A 1 86  ? -8.343  -7.143  12.231  1.00 0.00 ? 86  PRO A HG2  5  
ATOM 10987 H HG3  . PRO A 1 86  ? -8.916  -8.542  11.304  1.00 0.00 ? 86  PRO A HG3  5  
ATOM 10988 H HD2  . PRO A 1 86  ? -6.391  -7.746  11.175  1.00 0.00 ? 86  PRO A HD2  5  
ATOM 10989 H HD3  . PRO A 1 86  ? -7.227  -8.336  9.722   1.00 0.00 ? 86  PRO A HD3  5  
ATOM 10990 N N    . GLU A 1 87  ? -7.863  -4.042  11.581  1.00 0.00 ? 87  GLU A N    5  
ATOM 10991 C CA   . GLU A 1 87  ? -7.969  -2.797  12.330  1.00 0.00 ? 87  GLU A CA   5  
ATOM 10992 C C    . GLU A 1 87  ? -7.085  -1.717  11.736  1.00 0.00 ? 87  GLU A C    5  
ATOM 10993 O O    . GLU A 1 87  ? -7.166  -0.552  12.120  1.00 0.00 ? 87  GLU A O    5  
ATOM 10994 C CB   . GLU A 1 87  ? -7.626  -3.006  13.791  1.00 0.00 ? 87  GLU A CB   5  
ATOM 10995 C CG   . GLU A 1 87  ? -8.490  -4.038  14.480  1.00 0.00 ? 87  GLU A CG   5  
ATOM 10996 C CD   . GLU A 1 87  ? -8.187  -4.125  15.938  1.00 0.00 ? 87  GLU A CD   5  
ATOM 10997 O OE1  . GLU A 1 87  ? -7.169  -4.732  16.313  1.00 0.00 ? 87  GLU A OE1  5  
ATOM 10998 O OE2  . GLU A 1 87  ? -8.960  -3.584  16.747  1.00 0.00 ? 87  GLU A OE2  5  
ATOM 10999 H H    . GLU A 1 87  ? -7.209  -4.721  11.857  1.00 0.00 ? 87  GLU A H    5  
ATOM 11000 H HA   . GLU A 1 87  ? -8.996  -2.468  12.259  1.00 0.00 ? 87  GLU A HA   5  
ATOM 11001 H HB2  . GLU A 1 87  ? -6.596  -3.319  13.865  1.00 0.00 ? 87  GLU A HB2  5  
ATOM 11002 H HB3  . GLU A 1 87  ? -7.742  -2.067  14.313  1.00 0.00 ? 87  GLU A HB3  5  
ATOM 11003 H HG2  . GLU A 1 87  ? -9.528  -3.766  14.357  1.00 0.00 ? 87  GLU A HG2  5  
ATOM 11004 H HG3  . GLU A 1 87  ? -8.315  -5.003  14.027  1.00 0.00 ? 87  GLU A HG3  5  
ATOM 11005 N N    . GLU A 1 88  ? -6.267  -2.100  10.782  1.00 0.00 ? 88  GLU A N    5  
ATOM 11006 C CA   . GLU A 1 88  ? -5.354  -1.177  10.140  1.00 0.00 ? 88  GLU A CA   5  
ATOM 11007 C C    . GLU A 1 88  ? -5.946  -0.586  8.904   1.00 0.00 ? 88  GLU A C    5  
ATOM 11008 O O    . GLU A 1 88  ? -5.312  0.230   8.223   1.00 0.00 ? 88  GLU A O    5  
ATOM 11009 C CB   . GLU A 1 88  ? -4.024  -1.841  9.854   1.00 0.00 ? 88  GLU A CB   5  
ATOM 11010 C CG   . GLU A 1 88  ? -3.202  -2.052  11.102  1.00 0.00 ? 88  GLU A CG   5  
ATOM 11011 C CD   . GLU A 1 88  ? -2.712  -0.741  11.682  1.00 0.00 ? 88  GLU A CD   5  
ATOM 11012 O OE1  . GLU A 1 88  ? -3.525  0.088   12.142  1.00 0.00 ? 88  GLU A OE1  5  
ATOM 11013 O OE2  . GLU A 1 88  ? -1.517  -0.493  11.654  1.00 0.00 ? 88  GLU A OE2  5  
ATOM 11014 H H    . GLU A 1 88  ? -6.284  -3.036  10.482  1.00 0.00 ? 88  GLU A H    5  
ATOM 11015 H HA   . GLU A 1 88  ? -5.183  -0.376  10.843  1.00 0.00 ? 88  GLU A HA   5  
ATOM 11016 H HB2  . GLU A 1 88  ? -4.208  -2.795  9.383   1.00 0.00 ? 88  GLU A HB2  5  
ATOM 11017 H HB3  . GLU A 1 88  ? -3.461  -1.216  9.177   1.00 0.00 ? 88  GLU A HB3  5  
ATOM 11018 H HG2  . GLU A 1 88  ? -3.812  -2.555  11.838  1.00 0.00 ? 88  GLU A HG2  5  
ATOM 11019 H HG3  . GLU A 1 88  ? -2.349  -2.667  10.857  1.00 0.00 ? 88  GLU A HG3  5  
ATOM 11020 N N    . LEU A 1 89  ? -7.166  -0.938  8.641   1.00 0.00 ? 89  LEU A N    5  
ATOM 11021 C CA   . LEU A 1 89  ? -7.856  -0.441  7.506   1.00 0.00 ? 89  LEU A CA   5  
ATOM 11022 C C    . LEU A 1 89  ? -9.093  0.285   7.971   1.00 0.00 ? 89  LEU A C    5  
ATOM 11023 O O    . LEU A 1 89  ? -9.669  -0.056  9.002   1.00 0.00 ? 89  LEU A O    5  
ATOM 11024 C CB   . LEU A 1 89  ? -8.171  -1.598  6.517   1.00 0.00 ? 89  LEU A CB   5  
ATOM 11025 C CG   . LEU A 1 89  ? -9.086  -2.739  7.014   1.00 0.00 ? 89  LEU A CG   5  
ATOM 11026 C CD1  . LEU A 1 89  ? -10.563 -2.426  6.818   1.00 0.00 ? 89  LEU A CD1  5  
ATOM 11027 C CD2  . LEU A 1 89  ? -8.703  -4.067  6.374   1.00 0.00 ? 89  LEU A CD2  5  
ATOM 11028 H H    . LEU A 1 89  ? -7.641  -1.543  9.250   1.00 0.00 ? 89  LEU A H    5  
ATOM 11029 H HA   . LEU A 1 89  ? -7.212  0.273   7.016   1.00 0.00 ? 89  LEU A HA   5  
ATOM 11030 H HB2  . LEU A 1 89  ? -8.635  -1.167  5.643   1.00 0.00 ? 89  LEU A HB2  5  
ATOM 11031 H HB3  . LEU A 1 89  ? -7.230  -2.033  6.213   1.00 0.00 ? 89  LEU A HB3  5  
ATOM 11032 H HG   . LEU A 1 89  ? -8.937  -2.832  8.080   1.00 0.00 ? 89  LEU A HG   5  
ATOM 11033 H HD11 . LEU A 1 89  ? -11.159 -3.249  7.183   1.00 0.00 ? 89  LEU A HD11 5  
ATOM 11034 H HD12 . LEU A 1 89  ? -10.764 -2.280  5.766   1.00 0.00 ? 89  LEU A HD12 5  
ATOM 11035 H HD13 . LEU A 1 89  ? -10.815 -1.528  7.361   1.00 0.00 ? 89  LEU A HD13 5  
ATOM 11036 H HD21 . LEU A 1 89  ? -9.410  -4.829  6.672   1.00 0.00 ? 89  LEU A HD21 5  
ATOM 11037 H HD22 . LEU A 1 89  ? -7.713  -4.348  6.697   1.00 0.00 ? 89  LEU A HD22 5  
ATOM 11038 H HD23 . LEU A 1 89  ? -8.716  -3.965  5.299   1.00 0.00 ? 89  LEU A HD23 5  
ATOM 11039 N N    . LYS A 1 90  ? -9.461  1.293   7.256   1.00 0.00 ? 90  LYS A N    5  
ATOM 11040 C CA   . LYS A 1 90  ? -10.629 2.063   7.553   1.00 0.00 ? 90  LYS A CA   5  
ATOM 11041 C C    . LYS A 1 90  ? -11.515 2.073   6.343   1.00 0.00 ? 90  LYS A C    5  
ATOM 11042 O O    . LYS A 1 90  ? -11.058 2.397   5.223   1.00 0.00 ? 90  LYS A O    5  
ATOM 11043 C CB   . LYS A 1 90  ? -10.270 3.503   7.953   1.00 0.00 ? 90  LYS A CB   5  
ATOM 11044 C CG   . LYS A 1 90  ? -9.430  3.636   9.219   1.00 0.00 ? 90  LYS A CG   5  
ATOM 11045 C CD   . LYS A 1 90  ? -10.177 3.142   10.451  1.00 0.00 ? 90  LYS A CD   5  
ATOM 11046 C CE   . LYS A 1 90  ? -9.334  3.292   11.715  1.00 0.00 ? 90  LYS A CE   5  
ATOM 11047 N NZ   . LYS A 1 90  ? -8.980  4.705   11.994  1.00 0.00 ? 90  LYS A NZ   5  
ATOM 11048 H H    . LYS A 1 90  ? -8.918  1.542   6.472   1.00 0.00 ? 90  LYS A H    5  
ATOM 11049 H HA   . LYS A 1 90  ? -11.145 1.585   8.370   1.00 0.00 ? 90  LYS A HA   5  
ATOM 11050 H HB2  . LYS A 1 90  ? -9.724  3.960   7.142   1.00 0.00 ? 90  LYS A HB2  5  
ATOM 11051 H HB3  . LYS A 1 90  ? -11.188 4.052   8.100   1.00 0.00 ? 90  LYS A HB3  5  
ATOM 11052 H HG2  . LYS A 1 90  ? -8.533  3.045   9.102   1.00 0.00 ? 90  LYS A HG2  5  
ATOM 11053 H HG3  . LYS A 1 90  ? -9.164  4.673   9.357   1.00 0.00 ? 90  LYS A HG3  5  
ATOM 11054 H HD2  . LYS A 1 90  ? -11.088 3.713   10.564  1.00 0.00 ? 90  LYS A HD2  5  
ATOM 11055 H HD3  . LYS A 1 90  ? -10.421 2.100   10.315  1.00 0.00 ? 90  LYS A HD3  5  
ATOM 11056 H HE2  . LYS A 1 90  ? -9.892  2.903   12.554  1.00 0.00 ? 90  LYS A HE2  5  
ATOM 11057 H HE3  . LYS A 1 90  ? -8.427  2.719   11.594  1.00 0.00 ? 90  LYS A HE3  5  
ATOM 11058 H HZ1  . LYS A 1 90  ? -8.459  5.129   11.200  1.00 0.00 ? 90  LYS A HZ1  5  
ATOM 11059 H HZ2  . LYS A 1 90  ? -8.381  4.790   12.839  1.00 0.00 ? 90  LYS A HZ2  5  
ATOM 11060 H HZ3  . LYS A 1 90  ? -9.827  5.291   12.134  1.00 0.00 ? 90  LYS A HZ3  5  
ATOM 11061 N N    . VAL A 1 91  ? -12.739 1.697   6.545   1.00 0.00 ? 91  VAL A N    5  
ATOM 11062 C CA   . VAL A 1 91  ? -13.709 1.657   5.497   1.00 0.00 ? 91  VAL A CA   5  
ATOM 11063 C C    . VAL A 1 91  ? -14.520 2.939   5.588   1.00 0.00 ? 91  VAL A C    5  
ATOM 11064 O O    . VAL A 1 91  ? -15.124 3.236   6.637   1.00 0.00 ? 91  VAL A O    5  
ATOM 11065 C CB   . VAL A 1 91  ? -14.651 0.429   5.665   1.00 0.00 ? 91  VAL A CB   5  
ATOM 11066 C CG1  . VAL A 1 91  ? -15.641 0.332   4.517   1.00 0.00 ? 91  VAL A CG1  5  
ATOM 11067 C CG2  . VAL A 1 91  ? -13.857 -0.862  5.796   1.00 0.00 ? 91  VAL A CG2  5  
ATOM 11068 H H    . VAL A 1 91  ? -13.029 1.467   7.455   1.00 0.00 ? 91  VAL A H    5  
ATOM 11069 H HA   . VAL A 1 91  ? -13.204 1.602   4.545   1.00 0.00 ? 91  VAL A HA   5  
ATOM 11070 H HB   . VAL A 1 91  ? -15.217 0.573   6.574   1.00 0.00 ? 91  VAL A HB   5  
ATOM 11071 H HG11 . VAL A 1 91  ? -16.246 1.226   4.488   1.00 0.00 ? 91  VAL A HG11 5  
ATOM 11072 H HG12 . VAL A 1 91  ? -16.276 -0.531  4.659   1.00 0.00 ? 91  VAL A HG12 5  
ATOM 11073 H HG13 . VAL A 1 91  ? -15.101 0.231   3.588   1.00 0.00 ? 91  VAL A HG13 5  
ATOM 11074 H HG21 . VAL A 1 91  ? -13.255 -1.008  4.912   1.00 0.00 ? 91  VAL A HG21 5  
ATOM 11075 H HG22 . VAL A 1 91  ? -14.538 -1.693  5.910   1.00 0.00 ? 91  VAL A HG22 5  
ATOM 11076 H HG23 . VAL A 1 91  ? -13.214 -0.803  6.661   1.00 0.00 ? 91  VAL A HG23 5  
ATOM 11077 N N    . LYS A 1 92  ? -14.536 3.701   4.534   1.00 0.00 ? 92  LYS A N    5  
ATOM 11078 C CA   . LYS A 1 92  ? -15.225 4.959   4.536   1.00 0.00 ? 92  LYS A CA   5  
ATOM 11079 C C    . LYS A 1 92  ? -16.305 4.989   3.478   1.00 0.00 ? 92  LYS A C    5  
ATOM 11080 O O    . LYS A 1 92  ? -16.079 4.614   2.325   1.00 0.00 ? 92  LYS A O    5  
ATOM 11081 C CB   . LYS A 1 92  ? -14.253 6.140   4.308   1.00 0.00 ? 92  LYS A CB   5  
ATOM 11082 C CG   . LYS A 1 92  ? -13.427 6.022   3.030   1.00 0.00 ? 92  LYS A CG   5  
ATOM 11083 C CD   . LYS A 1 92  ? -12.784 7.335   2.616   1.00 0.00 ? 92  LYS A CD   5  
ATOM 11084 C CE   . LYS A 1 92  ? -11.761 7.838   3.600   1.00 0.00 ? 92  LYS A CE   5  
ATOM 11085 N NZ   . LYS A 1 92  ? -11.188 9.114   3.148   1.00 0.00 ? 92  LYS A NZ   5  
ATOM 11086 H H    . LYS A 1 92  ? -14.085 3.412   3.706   1.00 0.00 ? 92  LYS A H    5  
ATOM 11087 H HA   . LYS A 1 92  ? -15.682 5.083   5.507   1.00 0.00 ? 92  LYS A HA   5  
ATOM 11088 H HB2  . LYS A 1 92  ? -14.825 7.054   4.255   1.00 0.00 ? 92  LYS A HB2  5  
ATOM 11089 H HB3  . LYS A 1 92  ? -13.571 6.205   5.143   1.00 0.00 ? 92  LYS A HB3  5  
ATOM 11090 H HG2  . LYS A 1 92  ? -12.647 5.291   3.182   1.00 0.00 ? 92  LYS A HG2  5  
ATOM 11091 H HG3  . LYS A 1 92  ? -14.081 5.683   2.239   1.00 0.00 ? 92  LYS A HG3  5  
ATOM 11092 H HD2  . LYS A 1 92  ? -12.294 7.209   1.662   1.00 0.00 ? 92  LYS A HD2  5  
ATOM 11093 H HD3  . LYS A 1 92  ? -13.561 8.079   2.512   1.00 0.00 ? 92  LYS A HD3  5  
ATOM 11094 H HE2  . LYS A 1 92  ? -12.241 7.991   4.554   1.00 0.00 ? 92  LYS A HE2  5  
ATOM 11095 H HE3  . LYS A 1 92  ? -10.971 7.109   3.701   1.00 0.00 ? 92  LYS A HE3  5  
ATOM 11096 H HZ1  . LYS A 1 92  ? -10.798 9.032   2.187   1.00 0.00 ? 92  LYS A HZ1  5  
ATOM 11097 H HZ2  . LYS A 1 92  ? -10.446 9.451   3.792   1.00 0.00 ? 92  LYS A HZ2  5  
ATOM 11098 H HZ3  . LYS A 1 92  ? -11.944 9.828   3.109   1.00 0.00 ? 92  LYS A HZ3  5  
ATOM 11099 N N    . VAL A 1 93  ? -17.466 5.397   3.872   1.00 0.00 ? 93  VAL A N    5  
ATOM 11100 C CA   . VAL A 1 93  ? -18.529 5.634   2.948   1.00 0.00 ? 93  VAL A CA   5  
ATOM 11101 C C    . VAL A 1 93  ? -18.820 7.101   3.003   1.00 0.00 ? 93  VAL A C    5  
ATOM 11102 O O    . VAL A 1 93  ? -19.036 7.656   4.086   1.00 0.00 ? 93  VAL A O    5  
ATOM 11103 C CB   . VAL A 1 93  ? -19.830 4.847   3.279   1.00 0.00 ? 93  VAL A CB   5  
ATOM 11104 C CG1  . VAL A 1 93  ? -20.910 5.150   2.238   1.00 0.00 ? 93  VAL A CG1  5  
ATOM 11105 C CG2  . VAL A 1 93  ? -19.565 3.355   3.326   1.00 0.00 ? 93  VAL A CG2  5  
ATOM 11106 H H    . VAL A 1 93  ? -17.624 5.570   4.826   1.00 0.00 ? 93  VAL A H    5  
ATOM 11107 H HA   . VAL A 1 93  ? -18.184 5.375   1.957   1.00 0.00 ? 93  VAL A HA   5  
ATOM 11108 H HB   . VAL A 1 93  ? -20.187 5.171   4.246   1.00 0.00 ? 93  VAL A HB   5  
ATOM 11109 H HG11 . VAL A 1 93  ? -21.113 6.211   2.231   1.00 0.00 ? 93  VAL A HG11 5  
ATOM 11110 H HG12 . VAL A 1 93  ? -21.812 4.612   2.489   1.00 0.00 ? 93  VAL A HG12 5  
ATOM 11111 H HG13 . VAL A 1 93  ? -20.568 4.841   1.262   1.00 0.00 ? 93  VAL A HG13 5  
ATOM 11112 H HG21 . VAL A 1 93  ? -20.466 2.832   3.612   1.00 0.00 ? 93  VAL A HG21 5  
ATOM 11113 H HG22 . VAL A 1 93  ? -18.781 3.149   4.038   1.00 0.00 ? 93  VAL A HG22 5  
ATOM 11114 H HG23 . VAL A 1 93  ? -19.267 3.031   2.341   1.00 0.00 ? 93  VAL A HG23 5  
ATOM 11115 N N    . LEU A 1 94  ? -18.777 7.734   1.889   1.00 0.00 ? 94  LEU A N    5  
ATOM 11116 C CA   . LEU A 1 94  ? -19.046 9.130   1.813   1.00 0.00 ? 94  LEU A CA   5  
ATOM 11117 C C    . LEU A 1 94  ? -19.936 9.400   0.634   1.00 0.00 ? 94  LEU A C    5  
ATOM 11118 O O    . LEU A 1 94  ? -19.473 9.559   -0.507  1.00 0.00 ? 94  LEU A O    5  
ATOM 11119 C CB   . LEU A 1 94  ? -17.749 10.007  1.808   1.00 0.00 ? 94  LEU A CB   5  
ATOM 11120 C CG   . LEU A 1 94  ? -16.695 9.811   0.688   1.00 0.00 ? 94  LEU A CG   5  
ATOM 11121 C CD1  . LEU A 1 94  ? -15.667 10.921  0.759   1.00 0.00 ? 94  LEU A CD1  5  
ATOM 11122 C CD2  . LEU A 1 94  ? -15.983 8.465   0.809   1.00 0.00 ? 94  LEU A CD2  5  
ATOM 11123 H H    . LEU A 1 94  ? -18.573 7.241   1.059   1.00 0.00 ? 94  LEU A H    5  
ATOM 11124 H HA   . LEU A 1 94  ? -19.621 9.368   2.695   1.00 0.00 ? 94  LEU A HA   5  
ATOM 11125 H HB2  . LEU A 1 94  ? -18.055 11.041  1.780   1.00 0.00 ? 94  LEU A HB2  5  
ATOM 11126 H HB3  . LEU A 1 94  ? -17.258 9.846   2.755   1.00 0.00 ? 94  LEU A HB3  5  
ATOM 11127 H HG   . LEU A 1 94  ? -17.184 9.867   -0.272  1.00 0.00 ? 94  LEU A HG   5  
ATOM 11128 H HD11 . LEU A 1 94  ? -15.156 10.881  1.710   1.00 0.00 ? 94  LEU A HD11 5  
ATOM 11129 H HD12 . LEU A 1 94  ? -16.162 11.876  0.657   1.00 0.00 ? 94  LEU A HD12 5  
ATOM 11130 H HD13 . LEU A 1 94  ? -14.950 10.801  -0.039  1.00 0.00 ? 94  LEU A HD13 5  
ATOM 11131 H HD21 . LEU A 1 94  ? -16.702 7.666   0.708   1.00 0.00 ? 94  LEU A HD21 5  
ATOM 11132 H HD22 . LEU A 1 94  ? -15.503 8.400   1.773   1.00 0.00 ? 94  LEU A HD22 5  
ATOM 11133 H HD23 . LEU A 1 94  ? -15.238 8.380   0.031   1.00 0.00 ? 94  LEU A HD23 5  
ATOM 11134 N N    . GLY A 1 95  ? -21.221 9.387   0.899   1.00 0.00 ? 95  GLY A N    5  
ATOM 11135 C CA   . GLY A 1 95  ? -22.193 9.623   -0.128  1.00 0.00 ? 95  GLY A CA   5  
ATOM 11136 C C    . GLY A 1 95  ? -22.222 8.505   -1.136  1.00 0.00 ? 95  GLY A C    5  
ATOM 11137 O O    . GLY A 1 95  ? -22.581 7.383   -0.818  1.00 0.00 ? 95  GLY A O    5  
ATOM 11138 H H    . GLY A 1 95  ? -21.513 9.204   1.817   1.00 0.00 ? 95  GLY A H    5  
ATOM 11139 H HA2  . GLY A 1 95  ? -23.167 9.726   0.322   1.00 0.00 ? 95  GLY A HA2  5  
ATOM 11140 H HA3  . GLY A 1 95  ? -21.945 10.541  -0.640  1.00 0.00 ? 95  GLY A HA3  5  
ATOM 11141 N N    . ASP A 1 96  ? -21.804 8.822   -2.327  1.00 0.00 ? 96  ASP A N    5  
ATOM 11142 C CA   . ASP A 1 96  ? -21.769 7.889   -3.449  1.00 0.00 ? 96  ASP A CA   5  
ATOM 11143 C C    . ASP A 1 96  ? -20.400 7.245   -3.596  1.00 0.00 ? 96  ASP A C    5  
ATOM 11144 O O    . ASP A 1 96  ? -20.106 6.614   -4.599  1.00 0.00 ? 96  ASP A O    5  
ATOM 11145 C CB   . ASP A 1 96  ? -22.142 8.616   -4.754  1.00 0.00 ? 96  ASP A CB   5  
ATOM 11146 C CG   . ASP A 1 96  ? -21.246 9.804   -5.070  1.00 0.00 ? 96  ASP A CG   5  
ATOM 11147 O OD1  . ASP A 1 96  ? -21.394 10.860  -4.417  1.00 0.00 ? 96  ASP A OD1  5  
ATOM 11148 O OD2  . ASP A 1 96  ? -20.413 9.737   -5.976  1.00 0.00 ? 96  ASP A OD2  5  
ATOM 11149 H H    . ASP A 1 96  ? -21.497 9.740   -2.486  1.00 0.00 ? 96  ASP A H    5  
ATOM 11150 H HA   . ASP A 1 96  ? -22.505 7.120   -3.267  1.00 0.00 ? 96  ASP A HA   5  
ATOM 11151 H HB2  . ASP A 1 96  ? -22.072 7.916   -5.574  1.00 0.00 ? 96  ASP A HB2  5  
ATOM 11152 H HB3  . ASP A 1 96  ? -23.160 8.964   -4.676  1.00 0.00 ? 96  ASP A HB3  5  
ATOM 11153 N N    . VAL A 1 97  ? -19.555 7.413   -2.617  1.00 0.00 ? 97  VAL A N    5  
ATOM 11154 C CA   . VAL A 1 97  ? -18.227 6.851   -2.695  1.00 0.00 ? 97  VAL A CA   5  
ATOM 11155 C C    . VAL A 1 97  ? -17.985 5.896   -1.525  1.00 0.00 ? 97  VAL A C    5  
ATOM 11156 O O    . VAL A 1 97  ? -18.356 6.191   -0.381  1.00 0.00 ? 97  VAL A O    5  
ATOM 11157 C CB   . VAL A 1 97  ? -17.136 7.976   -2.687  1.00 0.00 ? 97  VAL A CB   5  
ATOM 11158 C CG1  . VAL A 1 97  ? -15.738 7.403   -2.864  1.00 0.00 ? 97  VAL A CG1  5  
ATOM 11159 C CG2  . VAL A 1 97  ? -17.407 9.021   -3.754  1.00 0.00 ? 97  VAL A CG2  5  
ATOM 11160 H H    . VAL A 1 97  ? -19.831 7.899   -1.811  1.00 0.00 ? 97  VAL A H    5  
ATOM 11161 H HA   . VAL A 1 97  ? -18.148 6.302   -3.620  1.00 0.00 ? 97  VAL A HA   5  
ATOM 11162 H HB   . VAL A 1 97  ? -17.174 8.456   -1.721  1.00 0.00 ? 97  VAL A HB   5  
ATOM 11163 H HG11 . VAL A 1 97  ? -15.673 6.901   -3.817  1.00 0.00 ? 97  VAL A HG11 5  
ATOM 11164 H HG12 . VAL A 1 97  ? -15.554 6.692   -2.073  1.00 0.00 ? 97  VAL A HG12 5  
ATOM 11165 H HG13 . VAL A 1 97  ? -15.008 8.198   -2.818  1.00 0.00 ? 97  VAL A HG13 5  
ATOM 11166 H HG21 . VAL A 1 97  ? -16.663 9.801   -3.686  1.00 0.00 ? 97  VAL A HG21 5  
ATOM 11167 H HG22 . VAL A 1 97  ? -18.387 9.448   -3.596  1.00 0.00 ? 97  VAL A HG22 5  
ATOM 11168 H HG23 . VAL A 1 97  ? -17.360 8.563   -4.730  1.00 0.00 ? 97  VAL A HG23 5  
ATOM 11169 N N    . ILE A 1 98  ? -17.380 4.774   -1.825  1.00 0.00 ? 98  ILE A N    5  
ATOM 11170 C CA   . ILE A 1 98  ? -16.959 3.800   -0.843  1.00 0.00 ? 98  ILE A CA   5  
ATOM 11171 C C    . ILE A 1 98  ? -15.470 3.529   -1.064  1.00 0.00 ? 98  ILE A C    5  
ATOM 11172 O O    . ILE A 1 98  ? -15.056 3.145   -2.156  1.00 0.00 ? 98  ILE A O    5  
ATOM 11173 C CB   . ILE A 1 98  ? -17.839 2.449   -0.868  1.00 0.00 ? 98  ILE A CB   5  
ATOM 11174 C CG1  . ILE A 1 98  ? -17.168 1.317   -0.061  1.00 0.00 ? 98  ILE A CG1  5  
ATOM 11175 C CG2  . ILE A 1 98  ? -18.157 1.975   -2.257  1.00 0.00 ? 98  ILE A CG2  5  
ATOM 11176 C CD1  . ILE A 1 98  ? -17.022 1.584   1.413   1.00 0.00 ? 98  ILE A CD1  5  
ATOM 11177 H H    . ILE A 1 98  ? -17.169 4.592   -2.768  1.00 0.00 ? 98  ILE A H    5  
ATOM 11178 H HA   . ILE A 1 98  ? -17.060 4.279   0.121   1.00 0.00 ? 98  ILE A HA   5  
ATOM 11179 H HB   . ILE A 1 98  ? -18.781 2.681   -0.393  1.00 0.00 ? 98  ILE A HB   5  
ATOM 11180 H HG12 . ILE A 1 98  ? -17.748 0.414   -0.171  1.00 0.00 ? 98  ILE A HG12 5  
ATOM 11181 H HG13 . ILE A 1 98  ? -16.182 1.147   -0.469  1.00 0.00 ? 98  ILE A HG13 5  
ATOM 11182 H HG21 . ILE A 1 98  ? -18.925 1.217   -2.210  1.00 0.00 ? 98  ILE A HG21 5  
ATOM 11183 H HG22 . ILE A 1 98  ? -17.269 1.500   -2.642  1.00 0.00 ? 98  ILE A HG22 5  
ATOM 11184 H HG23 . ILE A 1 98  ? -18.466 2.796   -2.888  1.00 0.00 ? 98  ILE A HG23 5  
ATOM 11185 H HD11 . ILE A 1 98  ? -16.458 0.784   1.871   1.00 0.00 ? 98  ILE A HD11 5  
ATOM 11186 H HD12 . ILE A 1 98  ? -17.999 1.640   1.865   1.00 0.00 ? 98  ILE A HD12 5  
ATOM 11187 H HD13 . ILE A 1 98  ? -16.502 2.519   1.559   1.00 0.00 ? 98  ILE A HD13 5  
ATOM 11188 N N    . GLU A 1 99  ? -14.675 3.789   -0.059  1.00 0.00 ? 99  GLU A N    5  
ATOM 11189 C CA   . GLU A 1 99  ? -13.245 3.592   -0.148  1.00 0.00 ? 99  GLU A CA   5  
ATOM 11190 C C    . GLU A 1 99  ? -12.741 2.841   1.057   1.00 0.00 ? 99  GLU A C    5  
ATOM 11191 O O    . GLU A 1 99  ? -13.321 2.918   2.148   1.00 0.00 ? 99  GLU A O    5  
ATOM 11192 C CB   . GLU A 1 99  ? -12.455 4.909   -0.269  1.00 0.00 ? 99  GLU A CB   5  
ATOM 11193 C CG   . GLU A 1 99  ? -12.709 5.736   -1.516  1.00 0.00 ? 99  GLU A CG   5  
ATOM 11194 C CD   . GLU A 1 99  ? -11.718 6.867   -1.648  1.00 0.00 ? 99  GLU A CD   5  
ATOM 11195 O OE1  . GLU A 1 99  ? -10.577 6.638   -2.142  1.00 0.00 ? 99  GLU A OE1  5  
ATOM 11196 O OE2  . GLU A 1 99  ? -12.030 8.012   -1.234  1.00 0.00 ? 99  GLU A OE2  5  
ATOM 11197 H H    . GLU A 1 99  ? -15.054 4.106   0.792   1.00 0.00 ? 99  GLU A H    5  
ATOM 11198 H HA   . GLU A 1 99  ? -13.055 2.994   -1.025  1.00 0.00 ? 99  GLU A HA   5  
ATOM 11199 H HB2  . GLU A 1 99  ? -12.693 5.525   0.584   1.00 0.00 ? 99  GLU A HB2  5  
ATOM 11200 H HB3  . GLU A 1 99  ? -11.402 4.671   -0.230  1.00 0.00 ? 99  GLU A HB3  5  
ATOM 11201 H HG2  . GLU A 1 99  ? -12.650 5.114   -2.394  1.00 0.00 ? 99  GLU A HG2  5  
ATOM 11202 H HG3  . GLU A 1 99  ? -13.698 6.161   -1.442  1.00 0.00 ? 99  GLU A HG3  5  
ATOM 11203 N N    . VAL A 1 100 ? -11.699 2.098   0.857   1.00 0.00 ? 100 VAL A N    5  
ATOM 11204 C CA   . VAL A 1 100 ? -11.044 1.392   1.921   1.00 0.00 ? 100 VAL A CA   5  
ATOM 11205 C C    . VAL A 1 100 ? -9.581  1.757   1.882   1.00 0.00 ? 100 VAL A C    5  
ATOM 11206 O O    . VAL A 1 100 ? -8.931  1.630   0.835   1.00 0.00 ? 100 VAL A O    5  
ATOM 11207 C CB   . VAL A 1 100 ? -11.196 -0.157  1.802   1.00 0.00 ? 100 VAL A CB   5  
ATOM 11208 C CG1  . VAL A 1 100 ? -10.436 -0.874  2.917   1.00 0.00 ? 100 VAL A CG1  5  
ATOM 11209 C CG2  . VAL A 1 100 ? -12.656 -0.555  1.844   1.00 0.00 ? 100 VAL A CG2  5  
ATOM 11210 H H    . VAL A 1 100 ? -11.338 2.049   -0.054  1.00 0.00 ? 100 VAL A H    5  
ATOM 11211 H HA   . VAL A 1 100 ? -11.466 1.725   2.858   1.00 0.00 ? 100 VAL A HA   5  
ATOM 11212 H HB   . VAL A 1 100 ? -10.782 -0.471  0.855   1.00 0.00 ? 100 VAL A HB   5  
ATOM 11213 H HG11 . VAL A 1 100 ? -9.386  -0.624  2.858   1.00 0.00 ? 100 VAL A HG11 5  
ATOM 11214 H HG12 . VAL A 1 100 ? -10.555 -1.942  2.808   1.00 0.00 ? 100 VAL A HG12 5  
ATOM 11215 H HG13 . VAL A 1 100 ? -10.826 -0.565  3.876   1.00 0.00 ? 100 VAL A HG13 5  
ATOM 11216 H HG21 . VAL A 1 100 ? -13.082 -0.248  2.788   1.00 0.00 ? 100 VAL A HG21 5  
ATOM 11217 H HG22 . VAL A 1 100 ? -12.740 -1.627  1.744   1.00 0.00 ? 100 VAL A HG22 5  
ATOM 11218 H HG23 . VAL A 1 100 ? -13.184 -0.074  1.034   1.00 0.00 ? 100 VAL A HG23 5  
ATOM 11219 N N    . HIS A 1 101 ? -9.078  2.247   2.975   1.00 0.00 ? 101 HIS A N    5  
ATOM 11220 C CA   . HIS A 1 101 ? -7.680  2.591   3.066   1.00 0.00 ? 101 HIS A CA   5  
ATOM 11221 C C    . HIS A 1 101 ? -7.102  1.939   4.283   1.00 0.00 ? 101 HIS A C    5  
ATOM 11222 O O    . HIS A 1 101 ? -7.703  1.981   5.349   1.00 0.00 ? 101 HIS A O    5  
ATOM 11223 C CB   . HIS A 1 101 ? -7.434  4.122   3.091   1.00 0.00 ? 101 HIS A CB   5  
ATOM 11224 C CG   . HIS A 1 101 ? -7.976  4.851   4.297   1.00 0.00 ? 101 HIS A CG   5  
ATOM 11225 N ND1  . HIS A 1 101 ? -7.183  5.272   5.336   1.00 0.00 ? 101 HIS A ND1  5  
ATOM 11226 C CD2  . HIS A 1 101 ? -9.233  5.234   4.614   1.00 0.00 ? 101 HIS A CD2  5  
ATOM 11227 C CE1  . HIS A 1 101 ? -7.924  5.870   6.234   1.00 0.00 ? 101 HIS A CE1  5  
ATOM 11228 N NE2  . HIS A 1 101 ? -9.169  5.868   5.825   1.00 0.00 ? 101 HIS A NE2  5  
ATOM 11229 H H    . HIS A 1 101 ? -9.661  2.349   3.761   1.00 0.00 ? 101 HIS A H    5  
ATOM 11230 H HA   . HIS A 1 101 ? -7.195  2.166   2.199   1.00 0.00 ? 101 HIS A HA   5  
ATOM 11231 H HB2  . HIS A 1 101 ? -6.367  4.296   3.067   1.00 0.00 ? 101 HIS A HB2  5  
ATOM 11232 H HB3  . HIS A 1 101 ? -7.870  4.556   2.205   1.00 0.00 ? 101 HIS A HB3  5  
ATOM 11233 H HD1  . HIS A 1 101 ? -6.205  5.168   5.395   1.00 0.00 ? 101 HIS A HD1  5  
ATOM 11234 H HD2  . HIS A 1 101 ? -10.124 5.066   4.025   1.00 0.00 ? 101 HIS A HD2  5  
ATOM 11235 H HE1  . HIS A 1 101 ? -7.570  6.292   7.162   1.00 0.00 ? 101 HIS A HE1  5  
ATOM 11236 H HE2  . HIS A 1 101 ? -9.804  6.568   6.102   1.00 0.00 ? 101 HIS A HE2  5  
ATOM 11237 N N    . GLY A 1 102 ? -5.984  1.329   4.128   1.00 0.00 ? 102 GLY A N    5  
ATOM 11238 C CA   . GLY A 1 102 ? -5.352  0.676   5.218   1.00 0.00 ? 102 GLY A CA   5  
ATOM 11239 C C    . GLY A 1 102 ? -3.877  0.730   5.088   1.00 0.00 ? 102 GLY A C    5  
ATOM 11240 O O    . GLY A 1 102 ? -3.363  0.789   3.977   1.00 0.00 ? 102 GLY A O    5  
ATOM 11241 H H    . GLY A 1 102 ? -5.547  1.308   3.245   1.00 0.00 ? 102 GLY A H    5  
ATOM 11242 H HA2  . GLY A 1 102 ? -5.635  1.177   6.132   1.00 0.00 ? 102 GLY A HA2  5  
ATOM 11243 H HA3  . GLY A 1 102 ? -5.668  -0.355  5.254   1.00 0.00 ? 102 GLY A HA3  5  
ATOM 11244 N N    . LYS A 1 103 ? -3.196  0.722   6.197   1.00 0.00 ? 103 LYS A N    5  
ATOM 11245 C CA   . LYS A 1 103 ? -1.758  0.779   6.206   1.00 0.00 ? 103 LYS A CA   5  
ATOM 11246 C C    . LYS A 1 103 ? -1.234  -0.099  7.361   1.00 0.00 ? 103 LYS A C    5  
ATOM 11247 O O    . LYS A 1 103 ? -1.730  -0.004  8.488   1.00 0.00 ? 103 LYS A O    5  
ATOM 11248 C CB   . LYS A 1 103 ? -1.253  2.247   6.378   1.00 0.00 ? 103 LYS A CB   5  
ATOM 11249 C CG   . LYS A 1 103 ? -1.337  2.856   7.798   1.00 0.00 ? 103 LYS A CG   5  
ATOM 11250 C CD   . LYS A 1 103 ? -2.758  2.988   8.338   1.00 0.00 ? 103 LYS A CD   5  
ATOM 11251 C CE   . LYS A 1 103 ? -2.741  3.366   9.817   1.00 0.00 ? 103 LYS A CE   5  
ATOM 11252 N NZ   . LYS A 1 103 ? -2.134  2.303   10.669  1.00 0.00 ? 103 LYS A NZ   5  
ATOM 11253 H H    . LYS A 1 103 ? -3.673  0.646   7.052   1.00 0.00 ? 103 LYS A H    5  
ATOM 11254 H HA   . LYS A 1 103 ? -1.398  0.382   5.270   1.00 0.00 ? 103 LYS A HA   5  
ATOM 11255 H HB2  . LYS A 1 103 ? -0.215  2.284   6.082   1.00 0.00 ? 103 LYS A HB2  5  
ATOM 11256 H HB3  . LYS A 1 103 ? -1.820  2.877   5.707   1.00 0.00 ? 103 LYS A HB3  5  
ATOM 11257 H HG2  . LYS A 1 103 ? -0.784  2.219   8.471   1.00 0.00 ? 103 LYS A HG2  5  
ATOM 11258 H HG3  . LYS A 1 103 ? -0.873  3.831   7.780   1.00 0.00 ? 103 LYS A HG3  5  
ATOM 11259 H HD2  . LYS A 1 103 ? -3.279  3.752   7.780   1.00 0.00 ? 103 LYS A HD2  5  
ATOM 11260 H HD3  . LYS A 1 103 ? -3.266  2.043   8.223   1.00 0.00 ? 103 LYS A HD3  5  
ATOM 11261 H HE2  . LYS A 1 103 ? -2.157  4.268   9.930   1.00 0.00 ? 103 LYS A HE2  5  
ATOM 11262 H HE3  . LYS A 1 103 ? -3.749  3.559   10.154  1.00 0.00 ? 103 LYS A HE3  5  
ATOM 11263 H HZ1  . LYS A 1 103 ? -1.176  2.068   10.343  1.00 0.00 ? 103 LYS A HZ1  5  
ATOM 11264 H HZ2  . LYS A 1 103 ? -2.686  1.420   10.684  1.00 0.00 ? 103 LYS A HZ2  5  
ATOM 11265 H HZ3  . LYS A 1 103 ? -2.047  2.631   11.650  1.00 0.00 ? 103 LYS A HZ3  5  
ATOM 11266 N N    . HIS A 1 104 ? -0.328  -0.995  7.092   1.00 0.00 ? 104 HIS A N    5  
ATOM 11267 C CA   . HIS A 1 104 ? 0.242   -1.791  8.164   1.00 0.00 ? 104 HIS A CA   5  
ATOM 11268 C C    . HIS A 1 104 ? 1.736   -1.951  7.992   1.00 0.00 ? 104 HIS A C    5  
ATOM 11269 O O    . HIS A 1 104 ? 2.204   -2.259  6.891   1.00 0.00 ? 104 HIS A O    5  
ATOM 11270 C CB   . HIS A 1 104 ? -0.447  -3.172  8.267   1.00 0.00 ? 104 HIS A CB   5  
ATOM 11271 C CG   . HIS A 1 104 ? 0.038   -4.044  9.400   1.00 0.00 ? 104 HIS A CG   5  
ATOM 11272 N ND1  . HIS A 1 104 ? 0.580   -5.289  9.208   1.00 0.00 ? 104 HIS A ND1  5  
ATOM 11273 C CD2  . HIS A 1 104 ? 0.022   -3.854  10.739  1.00 0.00 ? 104 HIS A CD2  5  
ATOM 11274 C CE1  . HIS A 1 104 ? 0.874   -5.824  10.370  1.00 0.00 ? 104 HIS A CE1  5  
ATOM 11275 N NE2  . HIS A 1 104 ? 0.546   -4.975  11.314  1.00 0.00 ? 104 HIS A NE2  5  
ATOM 11276 H H    . HIS A 1 104 ? -0.023  -1.127  6.163   1.00 0.00 ? 104 HIS A H    5  
ATOM 11277 H HA   . HIS A 1 104 ? 0.059   -1.251  9.080   1.00 0.00 ? 104 HIS A HA   5  
ATOM 11278 H HB2  . HIS A 1 104 ? -1.507  -3.024  8.403   1.00 0.00 ? 104 HIS A HB2  5  
ATOM 11279 H HB3  . HIS A 1 104 ? -0.286  -3.708  7.343   1.00 0.00 ? 104 HIS A HB3  5  
ATOM 11280 H HD1  . HIS A 1 104 ? 0.738   -5.745  8.352   1.00 0.00 ? 104 HIS A HD1  5  
ATOM 11281 H HD2  . HIS A 1 104 ? -0.332  -2.974  11.257  1.00 0.00 ? 104 HIS A HD2  5  
ATOM 11282 H HE1  . HIS A 1 104 ? 1.321   -6.796  10.521  1.00 0.00 ? 104 HIS A HE1  5  
ATOM 11283 H HE2  . HIS A 1 104 ? 0.271   -5.271  12.212  1.00 0.00 ? 104 HIS A HE2  5  
ATOM 11284 N N    . GLU A 1 105 ? 2.477   -1.759  9.072   1.00 0.00 ? 105 GLU A N    5  
ATOM 11285 C CA   . GLU A 1 105 ? 3.887   -2.059  9.079   1.00 0.00 ? 105 GLU A CA   5  
ATOM 11286 C C    . GLU A 1 105 ? 3.956   -3.543  9.296   1.00 0.00 ? 105 GLU A C    5  
ATOM 11287 O O    . GLU A 1 105 ? 3.452   -4.055  10.291  1.00 0.00 ? 105 GLU A O    5  
ATOM 11288 C CB   . GLU A 1 105 ? 4.593   -1.346  10.241  1.00 0.00 ? 105 GLU A CB   5  
ATOM 11289 C CG   . GLU A 1 105 ? 4.426   0.159   10.252  1.00 0.00 ? 105 GLU A CG   5  
ATOM 11290 C CD   . GLU A 1 105 ? 5.285   0.830   11.298  1.00 0.00 ? 105 GLU A CD   5  
ATOM 11291 O OE1  . GLU A 1 105 ? 4.860   0.927   12.474  1.00 0.00 ? 105 GLU A OE1  5  
ATOM 11292 O OE2  . GLU A 1 105 ? 6.389   1.290   10.957  1.00 0.00 ? 105 GLU A OE2  5  
ATOM 11293 H H    . GLU A 1 105 ? 2.078   -1.404  9.895   1.00 0.00 ? 105 GLU A H    5  
ATOM 11294 H HA   . GLU A 1 105 ? 4.328   -1.787  8.132   1.00 0.00 ? 105 GLU A HA   5  
ATOM 11295 H HB2  . GLU A 1 105 ? 4.194   -1.730  11.169  1.00 0.00 ? 105 GLU A HB2  5  
ATOM 11296 H HB3  . GLU A 1 105 ? 5.649   -1.572  10.196  1.00 0.00 ? 105 GLU A HB3  5  
ATOM 11297 H HG2  . GLU A 1 105 ? 4.699   0.540   9.280   1.00 0.00 ? 105 GLU A HG2  5  
ATOM 11298 H HG3  . GLU A 1 105 ? 3.391   0.397   10.449  1.00 0.00 ? 105 GLU A HG3  5  
ATOM 11299 N N    . GLU A 1 106 ? 4.546   -4.215  8.362   1.00 0.00 ? 106 GLU A N    5  
ATOM 11300 C CA   . GLU A 1 106 ? 4.495   -5.641  8.329   1.00 0.00 ? 106 GLU A CA   5  
ATOM 11301 C C    . GLU A 1 106 ? 5.440   -6.210  9.336   1.00 0.00 ? 106 GLU A C    5  
ATOM 11302 O O    . GLU A 1 106 ? 5.050   -6.974  10.210  1.00 0.00 ? 106 GLU A O    5  
ATOM 11303 C CB   . GLU A 1 106 ? 4.783   -6.154  6.919   1.00 0.00 ? 106 GLU A CB   5  
ATOM 11304 C CG   . GLU A 1 106 ? 3.942   -5.454  5.856   1.00 0.00 ? 106 GLU A CG   5  
ATOM 11305 C CD   . GLU A 1 106 ? 3.926   -6.174  4.539   1.00 0.00 ? 106 GLU A CD   5  
ATOM 11306 O OE1  . GLU A 1 106 ? 4.850   -5.994  3.720   1.00 0.00 ? 106 GLU A OE1  5  
ATOM 11307 O OE2  . GLU A 1 106 ? 2.966   -6.929  4.299   1.00 0.00 ? 106 GLU A OE2  5  
ATOM 11308 H H    . GLU A 1 106 ? 5.059   -3.720  7.685   1.00 0.00 ? 106 GLU A H    5  
ATOM 11309 H HA   . GLU A 1 106 ? 3.492   -5.934  8.603   1.00 0.00 ? 106 GLU A HA   5  
ATOM 11310 H HB2  . GLU A 1 106 ? 5.828   -5.996  6.697   1.00 0.00 ? 106 GLU A HB2  5  
ATOM 11311 H HB3  . GLU A 1 106 ? 4.571   -7.211  6.879   1.00 0.00 ? 106 GLU A HB3  5  
ATOM 11312 H HG2  . GLU A 1 106 ? 2.926   -5.373  6.213   1.00 0.00 ? 106 GLU A HG2  5  
ATOM 11313 H HG3  . GLU A 1 106 ? 4.341   -4.461  5.703   1.00 0.00 ? 106 GLU A HG3  5  
ATOM 11314 N N    . ARG A 1 107 ? 6.662   -5.833  9.228   1.00 0.00 ? 107 ARG A N    5  
ATOM 11315 C CA   . ARG A 1 107 ? 7.651   -6.254  10.149  1.00 0.00 ? 107 ARG A CA   5  
ATOM 11316 C C    . ARG A 1 107 ? 8.663   -5.148  10.261  1.00 0.00 ? 107 ARG A C    5  
ATOM 11317 O O    . ARG A 1 107 ? 8.768   -4.294  9.353   1.00 0.00 ? 107 ARG A O    5  
ATOM 11318 C CB   . ARG A 1 107 ? 8.339   -7.551  9.692   1.00 0.00 ? 107 ARG A CB   5  
ATOM 11319 C CG   . ARG A 1 107 ? 9.301   -7.374  8.556   1.00 0.00 ? 107 ARG A CG   5  
ATOM 11320 C CD   . ARG A 1 107 ? 9.972   -8.682  8.201   1.00 0.00 ? 107 ARG A CD   5  
ATOM 11321 N NE   . ARG A 1 107 ? 11.080  -8.499  7.262   1.00 0.00 ? 107 ARG A NE   5  
ATOM 11322 C CZ   . ARG A 1 107 ? 11.987  -9.428  6.954   1.00 0.00 ? 107 ARG A CZ   5  
ATOM 11323 N NH1  . ARG A 1 107 ? 11.906  -10.654 7.453   1.00 0.00 ? 107 ARG A NH1  5  
ATOM 11324 N NH2  . ARG A 1 107 ? 12.968  -9.125  6.137   1.00 0.00 ? 107 ARG A NH2  5  
ATOM 11325 H H    . ARG A 1 107 ? 6.937   -5.215  8.520   1.00 0.00 ? 107 ARG A H    5  
ATOM 11326 H HA   . ARG A 1 107 ? 7.176   -6.413  11.105  1.00 0.00 ? 107 ARG A HA   5  
ATOM 11327 H HB2  . ARG A 1 107 ? 8.883   -7.967  10.527  1.00 0.00 ? 107 ARG A HB2  5  
ATOM 11328 H HB3  . ARG A 1 107 ? 7.577   -8.255  9.391   1.00 0.00 ? 107 ARG A HB3  5  
ATOM 11329 H HG2  . ARG A 1 107 ? 8.763   -6.997  7.703   1.00 0.00 ? 107 ARG A HG2  5  
ATOM 11330 H HG3  . ARG A 1 107 ? 10.055  -6.658  8.848   1.00 0.00 ? 107 ARG A HG3  5  
ATOM 11331 H HD2  . ARG A 1 107 ? 10.355  -9.131  9.104   1.00 0.00 ? 107 ARG A HD2  5  
ATOM 11332 H HD3  . ARG A 1 107 ? 9.241   -9.341  7.755   1.00 0.00 ? 107 ARG A HD3  5  
ATOM 11333 H HE   . ARG A 1 107 ? 11.176  -7.609  6.835   1.00 0.00 ? 107 ARG A HE   5  
ATOM 11334 H HH11 . ARG A 1 107 ? 11.165  -10.919 8.076   1.00 0.00 ? 107 ARG A HH11 5  
ATOM 11335 H HH12 . ARG A 1 107 ? 12.576  -11.361 7.215   1.00 0.00 ? 107 ARG A HH12 5  
ATOM 11336 H HH21 . ARG A 1 107 ? 13.010  -8.188  5.760   1.00 0.00 ? 107 ARG A HH21 5  
ATOM 11337 H HH22 . ARG A 1 107 ? 13.670  -9.777  5.839   1.00 0.00 ? 107 ARG A HH22 5  
ATOM 11338 N N    . GLN A 1 108 ? 9.345   -5.100  11.356  1.00 0.00 ? 108 GLN A N    5  
ATOM 11339 C CA   . GLN A 1 108 ? 10.444  -4.211  11.476  1.00 0.00 ? 108 GLN A CA   5  
ATOM 11340 C C    . GLN A 1 108 ? 11.591  -4.942  10.815  1.00 0.00 ? 108 GLN A C    5  
ATOM 11341 O O    . GLN A 1 108 ? 12.023  -6.007  11.277  1.00 0.00 ? 108 GLN A O    5  
ATOM 11342 C CB   . GLN A 1 108 ? 10.691  -3.873  12.942  1.00 0.00 ? 108 GLN A CB   5  
ATOM 11343 C CG   . GLN A 1 108 ? 9.432   -3.319  13.599  1.00 0.00 ? 108 GLN A CG   5  
ATOM 11344 C CD   . GLN A 1 108 ? 9.636   -2.797  14.993  1.00 0.00 ? 108 GLN A CD   5  
ATOM 11345 O OE1  . GLN A 1 108 ? 10.505  -3.256  15.736  1.00 0.00 ? 108 GLN A OE1  5  
ATOM 11346 N NE2  . GLN A 1 108 ? 8.830   -1.839  15.364  1.00 0.00 ? 108 GLN A NE2  5  
ATOM 11347 H H    . GLN A 1 108 ? 9.118   -5.700  12.098  1.00 0.00 ? 108 GLN A H    5  
ATOM 11348 H HA   . GLN A 1 108 ? 10.216  -3.325  10.901  1.00 0.00 ? 108 GLN A HA   5  
ATOM 11349 H HB2  . GLN A 1 108 ? 10.997  -4.767  13.467  1.00 0.00 ? 108 GLN A HB2  5  
ATOM 11350 H HB3  . GLN A 1 108 ? 11.467  -3.126  13.017  1.00 0.00 ? 108 GLN A HB3  5  
ATOM 11351 H HG2  . GLN A 1 108 ? 9.051   -2.510  12.994  1.00 0.00 ? 108 GLN A HG2  5  
ATOM 11352 H HG3  . GLN A 1 108 ? 8.693   -4.106  13.630  1.00 0.00 ? 108 GLN A HG3  5  
ATOM 11353 H HE21 . GLN A 1 108 ? 8.156   -1.530  14.718  1.00 0.00 ? 108 GLN A HE21 5  
ATOM 11354 H HE22 . GLN A 1 108 ? 8.900   -1.464  16.267  1.00 0.00 ? 108 GLN A HE22 5  
ATOM 11355 N N    . ASP A 1 109 ? 12.031  -4.394  9.723   1.00 0.00 ? 109 ASP A N    5  
ATOM 11356 C CA   . ASP A 1 109 ? 12.877  -5.085  8.763   1.00 0.00 ? 109 ASP A CA   5  
ATOM 11357 C C    . ASP A 1 109 ? 14.366  -4.807  9.043   1.00 0.00 ? 109 ASP A C    5  
ATOM 11358 O O    . ASP A 1 109 ? 14.739  -4.633  10.212  1.00 0.00 ? 109 ASP A O    5  
ATOM 11359 C CB   . ASP A 1 109 ? 12.424  -4.607  7.370   1.00 0.00 ? 109 ASP A CB   5  
ATOM 11360 C CG   . ASP A 1 109 ? 12.908  -5.433  6.210   1.00 0.00 ? 109 ASP A CG   5  
ATOM 11361 O OD1  . ASP A 1 109 ? 12.300  -6.457  5.901   1.00 0.00 ? 109 ASP A OD1  5  
ATOM 11362 O OD2  . ASP A 1 109 ? 13.916  -5.082  5.612   1.00 0.00 ? 109 ASP A OD2  5  
ATOM 11363 H H    . ASP A 1 109 ? 11.825  -3.453  9.536   1.00 0.00 ? 109 ASP A H    5  
ATOM 11364 H HA   . ASP A 1 109 ? 12.685  -6.144  8.843   1.00 0.00 ? 109 ASP A HA   5  
ATOM 11365 H HB2  . ASP A 1 109 ? 11.346  -4.633  7.351   1.00 0.00 ? 109 ASP A HB2  5  
ATOM 11366 H HB3  . ASP A 1 109 ? 12.751  -3.586  7.233   1.00 0.00 ? 109 ASP A HB3  5  
ATOM 11367 N N    . GLU A 1 110 ? 15.207  -4.789  8.023   1.00 0.00 ? 110 GLU A N    5  
ATOM 11368 C CA   . GLU A 1 110 ? 16.629  -4.539  8.184   1.00 0.00 ? 110 GLU A CA   5  
ATOM 11369 C C    . GLU A 1 110 ? 16.861  -3.068  8.502   1.00 0.00 ? 110 GLU A C    5  
ATOM 11370 O O    . GLU A 1 110 ? 17.134  -2.259  7.613   1.00 0.00 ? 110 GLU A O    5  
ATOM 11371 C CB   . GLU A 1 110 ? 17.385  -4.942  6.916   1.00 0.00 ? 110 GLU A CB   5  
ATOM 11372 C CG   . GLU A 1 110 ? 17.310  -6.425  6.598   1.00 0.00 ? 110 GLU A CG   5  
ATOM 11373 C CD   . GLU A 1 110 ? 17.989  -7.285  7.635   1.00 0.00 ? 110 GLU A CD   5  
ATOM 11374 O OE1  . GLU A 1 110 ? 19.244  -7.328  7.667   1.00 0.00 ? 110 GLU A OE1  5  
ATOM 11375 O OE2  . GLU A 1 110 ? 17.290  -7.968  8.410   1.00 0.00 ? 110 GLU A OE2  5  
ATOM 11376 H H    . GLU A 1 110 ? 14.858  -4.920  7.108   1.00 0.00 ? 110 GLU A H    5  
ATOM 11377 H HA   . GLU A 1 110 ? 16.980  -5.136  9.011   1.00 0.00 ? 110 GLU A HA   5  
ATOM 11378 H HB2  . GLU A 1 110 ? 16.975  -4.394  6.080   1.00 0.00 ? 110 GLU A HB2  5  
ATOM 11379 H HB3  . GLU A 1 110 ? 18.424  -4.673  7.034   1.00 0.00 ? 110 GLU A HB3  5  
ATOM 11380 H HG2  . GLU A 1 110 ? 16.268  -6.704  6.562   1.00 0.00 ? 110 GLU A HG2  5  
ATOM 11381 H HG3  . GLU A 1 110 ? 17.756  -6.607  5.631   1.00 0.00 ? 110 GLU A HG3  5  
ATOM 11382 N N    . HIS A 1 111 ? 16.726  -2.734  9.782   1.00 0.00 ? 111 HIS A N    5  
ATOM 11383 C CA   . HIS A 1 111 ? 16.834  -1.362  10.345  1.00 0.00 ? 111 HIS A CA   5  
ATOM 11384 C C    . HIS A 1 111 ? 15.601  -0.559  10.009  1.00 0.00 ? 111 HIS A C    5  
ATOM 11385 O O    . HIS A 1 111 ? 14.948  -0.001  10.895  1.00 0.00 ? 111 HIS A O    5  
ATOM 11386 C CB   . HIS A 1 111 ? 18.085  -0.578  9.873   1.00 0.00 ? 111 HIS A CB   5  
ATOM 11387 C CG   . HIS A 1 111 ? 19.433  -1.240  10.045  1.00 0.00 ? 111 HIS A CG   5  
ATOM 11388 N ND1  . HIS A 1 111 ? 20.238  -1.055  11.141  1.00 0.00 ? 111 HIS A ND1  5  
ATOM 11389 C CD2  . HIS A 1 111 ? 20.151  -2.002  9.185   1.00 0.00 ? 111 HIS A CD2  5  
ATOM 11390 C CE1  . HIS A 1 111 ? 21.391  -1.667  10.942  1.00 0.00 ? 111 HIS A CE1  5  
ATOM 11391 N NE2  . HIS A 1 111 ? 21.366  -2.248  9.759   1.00 0.00 ? 111 HIS A NE2  5  
ATOM 11392 H H    . HIS A 1 111 ? 16.516  -3.472  10.397  1.00 0.00 ? 111 HIS A H    5  
ATOM 11393 H HA   . HIS A 1 111 ? 16.861  -1.462  11.419  1.00 0.00 ? 111 HIS A HA   5  
ATOM 11394 H HB2  . HIS A 1 111 ? 17.977  -0.374  8.819   1.00 0.00 ? 111 HIS A HB2  5  
ATOM 11395 H HB3  . HIS A 1 111 ? 18.109  0.366   10.397  1.00 0.00 ? 111 HIS A HB3  5  
ATOM 11396 H HD1  . HIS A 1 111 ? 19.994  -0.560  11.955  1.00 0.00 ? 111 HIS A HD1  5  
ATOM 11397 H HD2  . HIS A 1 111 ? 19.820  -2.352  8.218   1.00 0.00 ? 111 HIS A HD2  5  
ATOM 11398 H HE1  . HIS A 1 111 ? 22.224  -1.689  11.629  1.00 0.00 ? 111 HIS A HE1  5  
ATOM 11399 H HE2  . HIS A 1 111 ? 22.172  -2.251  9.187   1.00 0.00 ? 111 HIS A HE2  5  
ATOM 11400 N N    . GLY A 1 112 ? 15.279  -0.532  8.740   1.00 0.00 ? 112 GLY A N    5  
ATOM 11401 C CA   . GLY A 1 112 ? 14.137  0.166   8.267   1.00 0.00 ? 112 GLY A CA   5  
ATOM 11402 C C    . GLY A 1 112 ? 12.890  -0.585  8.559   1.00 0.00 ? 112 GLY A C    5  
ATOM 11403 O O    . GLY A 1 112 ? 12.924  -1.734  9.030   1.00 0.00 ? 112 GLY A O    5  
ATOM 11404 H H    . GLY A 1 112 ? 15.841  -1.035  8.108   1.00 0.00 ? 112 GLY A H    5  
ATOM 11405 H HA2  . GLY A 1 112 ? 14.088  1.132   8.745   1.00 0.00 ? 112 GLY A HA2  5  
ATOM 11406 H HA3  . GLY A 1 112 ? 14.222  0.299   7.199   1.00 0.00 ? 112 GLY A HA3  5  
ATOM 11407 N N    . PHE A 1 113 ? 11.820  0.016   8.296   1.00 0.00 ? 113 PHE A N    5  
ATOM 11408 C CA   . PHE A 1 113 ? 10.582  -0.570  8.591   1.00 0.00 ? 113 PHE A CA   5  
ATOM 11409 C C    . PHE A 1 113 ? 9.847   -0.731  7.300   1.00 0.00 ? 113 PHE A C    5  
ATOM 11410 O O    . PHE A 1 113 ? 10.022  0.087   6.370   1.00 0.00 ? 113 PHE A O    5  
ATOM 11411 C CB   . PHE A 1 113 ? 9.811   0.303   9.586   1.00 0.00 ? 113 PHE A CB   5  
ATOM 11412 C CG   . PHE A 1 113 ? 10.613  0.626   10.828  1.00 0.00 ? 113 PHE A CG   5  
ATOM 11413 C CD1  . PHE A 1 113 ? 10.784  -0.316  11.823  1.00 0.00 ? 113 PHE A CD1  5  
ATOM 11414 C CD2  . PHE A 1 113 ? 11.204  1.873   10.986  1.00 0.00 ? 113 PHE A CD2  5  
ATOM 11415 C CE1  . PHE A 1 113 ? 11.524  -0.027  12.952  1.00 0.00 ? 113 PHE A CE1  5  
ATOM 11416 C CE2  . PHE A 1 113 ? 11.944  2.167   12.112  1.00 0.00 ? 113 PHE A CE2  5  
ATOM 11417 C CZ   . PHE A 1 113 ? 12.104  1.216   13.095  1.00 0.00 ? 113 PHE A CZ   5  
ATOM 11418 H H    . PHE A 1 113 ? 11.855  0.883   7.833   1.00 0.00 ? 113 PHE A H    5  
ATOM 11419 H HA   . PHE A 1 113 ? 10.759  -1.541  9.028   1.00 0.00 ? 113 PHE A HA   5  
ATOM 11420 H HB2  . PHE A 1 113 ? 9.543   1.233   9.108   1.00 0.00 ? 113 PHE A HB2  5  
ATOM 11421 H HB3  . PHE A 1 113 ? 8.913   -0.212  9.892   1.00 0.00 ? 113 PHE A HB3  5  
ATOM 11422 H HD1  . PHE A 1 113 ? 10.330  -1.290  11.713  1.00 0.00 ? 113 PHE A HD1  5  
ATOM 11423 H HD2  . PHE A 1 113 ? 11.082  2.621   10.217  1.00 0.00 ? 113 PHE A HD2  5  
ATOM 11424 H HE1  . PHE A 1 113 ? 11.650  -0.772  13.724  1.00 0.00 ? 113 PHE A HE1  5  
ATOM 11425 H HE2  . PHE A 1 113 ? 12.398  3.141   12.221  1.00 0.00 ? 113 PHE A HE2  5  
ATOM 11426 H HZ   . PHE A 1 113 ? 12.683  1.443   13.977  1.00 0.00 ? 113 PHE A HZ   5  
ATOM 11427 N N    . ILE A 1 114 ? 9.029   -1.730  7.208   1.00 0.00 ? 114 ILE A N    5  
ATOM 11428 C CA   . ILE A 1 114 ? 8.372   -1.989  5.971   1.00 0.00 ? 114 ILE A CA   5  
ATOM 11429 C C    . ILE A 1 114 ? 6.892   -1.976  6.188   1.00 0.00 ? 114 ILE A C    5  
ATOM 11430 O O    . ILE A 1 114 ? 6.391   -2.452  7.210   1.00 0.00 ? 114 ILE A O    5  
ATOM 11431 C CB   . ILE A 1 114 ? 8.788   -3.353  5.321   1.00 0.00 ? 114 ILE A CB   5  
ATOM 11432 C CG1  . ILE A 1 114 ? 8.340   -4.559  6.157   1.00 0.00 ? 114 ILE A CG1  5  
ATOM 11433 C CG2  . ILE A 1 114 ? 10.288  -3.406  5.083   1.00 0.00 ? 114 ILE A CG2  5  
ATOM 11434 C CD1  . ILE A 1 114 ? 8.598   -5.888  5.483   1.00 0.00 ? 114 ILE A CD1  5  
ATOM 11435 H H    . ILE A 1 114 ? 8.843   -2.309  7.979   1.00 0.00 ? 114 ILE A H    5  
ATOM 11436 H HA   . ILE A 1 114 ? 8.630   -1.190  5.292   1.00 0.00 ? 114 ILE A HA   5  
ATOM 11437 H HB   . ILE A 1 114 ? 8.305   -3.408  4.356   1.00 0.00 ? 114 ILE A HB   5  
ATOM 11438 H HG12 . ILE A 1 114 ? 8.873   -4.555  7.098   1.00 0.00 ? 114 ILE A HG12 5  
ATOM 11439 H HG13 . ILE A 1 114 ? 7.281   -4.477  6.349   1.00 0.00 ? 114 ILE A HG13 5  
ATOM 11440 H HG21 . ILE A 1 114 ? 10.602  -2.635  4.396   1.00 0.00 ? 114 ILE A HG21 5  
ATOM 11441 H HG22 . ILE A 1 114 ? 10.561  -4.371  4.686   1.00 0.00 ? 114 ILE A HG22 5  
ATOM 11442 H HG23 . ILE A 1 114 ? 10.788  -3.253  6.029   1.00 0.00 ? 114 ILE A HG23 5  
ATOM 11443 H HD11 . ILE A 1 114 ? 8.253   -5.840  4.460   1.00 0.00 ? 114 ILE A HD11 5  
ATOM 11444 H HD12 . ILE A 1 114 ? 8.080   -6.681  5.998   1.00 0.00 ? 114 ILE A HD12 5  
ATOM 11445 H HD13 . ILE A 1 114 ? 9.658   -6.092  5.493   1.00 0.00 ? 114 ILE A HD13 5  
ATOM 11446 N N    . SER A 1 115 ? 6.183   -1.356  5.285   1.00 0.00 ? 115 SER A N    5  
ATOM 11447 C CA   . SER A 1 115 ? 4.763   -1.268  5.384   1.00 0.00 ? 115 SER A CA   5  
ATOM 11448 C C    . SER A 1 115 ? 4.094   -1.582  4.046   1.00 0.00 ? 115 SER A C    5  
ATOM 11449 O O    . SER A 1 115 ? 4.695   -1.417  2.971   1.00 0.00 ? 115 SER A O    5  
ATOM 11450 C CB   . SER A 1 115 ? 4.400   0.137   5.864   1.00 0.00 ? 115 SER A CB   5  
ATOM 11451 O OG   . SER A 1 115 ? 5.120   0.437   7.054   1.00 0.00 ? 115 SER A OG   5  
ATOM 11452 H H    . SER A 1 115 ? 6.594   -0.907  4.515   1.00 0.00 ? 115 SER A H    5  
ATOM 11453 H HA   . SER A 1 115 ? 4.423   -1.977  6.123   1.00 0.00 ? 115 SER A HA   5  
ATOM 11454 H HB2  . SER A 1 115 ? 4.664   0.855   5.102   1.00 0.00 ? 115 SER A HB2  5  
ATOM 11455 H HB3  . SER A 1 115 ? 3.341   0.191   6.071   1.00 0.00 ? 115 SER A HB3  5  
ATOM 11456 H HG   . SER A 1 115 ? 5.488   -0.399  7.364   1.00 0.00 ? 115 SER A HG   5  
ATOM 11457 N N    . ARG A 1 116 ? 2.885   -2.034  4.112   1.00 0.00 ? 116 ARG A N    5  
ATOM 11458 C CA   . ARG A 1 116 ? 2.086   -2.271  2.965   1.00 0.00 ? 116 ARG A CA   5  
ATOM 11459 C C    . ARG A 1 116 ? 0.808   -1.532  3.212   1.00 0.00 ? 116 ARG A C    5  
ATOM 11460 O O    . ARG A 1 116 ? 0.357   -1.422  4.363   1.00 0.00 ? 116 ARG A O    5  
ATOM 11461 C CB   . ARG A 1 116 ? 1.853   -3.799  2.783   1.00 0.00 ? 116 ARG A CB   5  
ATOM 11462 C CG   . ARG A 1 116 ? 0.741   -4.204  1.799   1.00 0.00 ? 116 ARG A CG   5  
ATOM 11463 C CD   . ARG A 1 116 ? 0.711   -5.724  1.557   1.00 0.00 ? 116 ARG A CD   5  
ATOM 11464 N NE   . ARG A 1 116 ? 0.804   -6.527  2.788   1.00 0.00 ? 116 ARG A NE   5  
ATOM 11465 C CZ   . ARG A 1 116 ? -0.066  -7.465  3.215   1.00 0.00 ? 116 ARG A CZ   5  
ATOM 11466 N NH1  . ARG A 1 116 ? -1.196  -7.714  2.559   1.00 0.00 ? 116 ARG A NH1  5  
ATOM 11467 N NH2  . ARG A 1 116 ? 0.220   -8.159  4.304   1.00 0.00 ? 116 ARG A NH2  5  
ATOM 11468 H H    . ARG A 1 116 ? 2.455   -2.203  4.980   1.00 0.00 ? 116 ARG A H    5  
ATOM 11469 H HA   . ARG A 1 116 ? 2.586   -1.864  2.099   1.00 0.00 ? 116 ARG A HA   5  
ATOM 11470 H HB2  . ARG A 1 116 ? 2.773   -4.244  2.433   1.00 0.00 ? 116 ARG A HB2  5  
ATOM 11471 H HB3  . ARG A 1 116 ? 1.619   -4.222  3.748   1.00 0.00 ? 116 ARG A HB3  5  
ATOM 11472 H HG2  . ARG A 1 116 ? -0.216  -3.897  2.195   1.00 0.00 ? 116 ARG A HG2  5  
ATOM 11473 H HG3  . ARG A 1 116 ? 0.888   -3.706  0.851   1.00 0.00 ? 116 ARG A HG3  5  
ATOM 11474 H HD2  . ARG A 1 116 ? -0.213  -5.973  1.055   1.00 0.00 ? 116 ARG A HD2  5  
ATOM 11475 H HD3  . ARG A 1 116 ? 1.539   -5.977  0.910   1.00 0.00 ? 116 ARG A HD3  5  
ATOM 11476 H HE   . ARG A 1 116 ? 1.626   -6.398  3.332   1.00 0.00 ? 116 ARG A HE   5  
ATOM 11477 H HH11 . ARG A 1 116 ? -1.463  -7.234  1.726   1.00 0.00 ? 116 ARG A HH11 5  
ATOM 11478 H HH12 . ARG A 1 116 ? -1.844  -8.405  2.911   1.00 0.00 ? 116 ARG A HH12 5  
ATOM 11479 H HH21 . ARG A 1 116 ? 1.077   -7.979  4.799   1.00 0.00 ? 116 ARG A HH21 5  
ATOM 11480 H HH22 . ARG A 1 116 ? -0.379  -8.869  4.691   1.00 0.00 ? 116 ARG A HH22 5  
ATOM 11481 N N    . GLU A 1 117 ? 0.233   -1.045  2.177   1.00 0.00 ? 117 GLU A N    5  
ATOM 11482 C CA   . GLU A 1 117 ? -0.931  -0.238  2.265   1.00 0.00 ? 117 GLU A CA   5  
ATOM 11483 C C    . GLU A 1 117 ? -1.929  -0.694  1.251   1.00 0.00 ? 117 GLU A C    5  
ATOM 11484 O O    . GLU A 1 117 ? -1.571  -1.310  0.238   1.00 0.00 ? 117 GLU A O    5  
ATOM 11485 C CB   . GLU A 1 117 ? -0.585  1.242   2.040   1.00 0.00 ? 117 GLU A CB   5  
ATOM 11486 C CG   . GLU A 1 117 ? 0.319   1.840   3.108   1.00 0.00 ? 117 GLU A CG   5  
ATOM 11487 C CD   . GLU A 1 117 ? 0.641   3.287   2.864   1.00 0.00 ? 117 GLU A CD   5  
ATOM 11488 O OE1  . GLU A 1 117 ? -0.265  4.140   2.970   1.00 0.00 ? 117 GLU A OE1  5  
ATOM 11489 O OE2  . GLU A 1 117 ? 1.811   3.602   2.537   1.00 0.00 ? 117 GLU A OE2  5  
ATOM 11490 H H    . GLU A 1 117 ? 0.595   -1.220  1.279   1.00 0.00 ? 117 GLU A H    5  
ATOM 11491 H HA   . GLU A 1 117 ? -1.349  -0.348  3.253   1.00 0.00 ? 117 GLU A HA   5  
ATOM 11492 H HB2  . GLU A 1 117 ? -0.085  1.339   1.088   1.00 0.00 ? 117 GLU A HB2  5  
ATOM 11493 H HB3  . GLU A 1 117 ? -1.502  1.812   2.013   1.00 0.00 ? 117 GLU A HB3  5  
ATOM 11494 H HG2  . GLU A 1 117 ? -0.175  1.756   4.063   1.00 0.00 ? 117 GLU A HG2  5  
ATOM 11495 H HG3  . GLU A 1 117 ? 1.240   1.277   3.135   1.00 0.00 ? 117 GLU A HG3  5  
ATOM 11496 N N    . PHE A 1 118 ? -3.148  -0.457  1.535   1.00 0.00 ? 118 PHE A N    5  
ATOM 11497 C CA   . PHE A 1 118 ? -4.222  -0.784  0.663   1.00 0.00 ? 118 PHE A CA   5  
ATOM 11498 C C    . PHE A 1 118 ? -5.083  0.419   0.460   1.00 0.00 ? 118 PHE A C    5  
ATOM 11499 O O    . PHE A 1 118 ? -5.513  1.045   1.418   1.00 0.00 ? 118 PHE A O    5  
ATOM 11500 C CB   . PHE A 1 118 ? -5.077  -1.941  1.212   1.00 0.00 ? 118 PHE A CB   5  
ATOM 11501 C CG   . PHE A 1 118 ? -4.470  -3.309  1.063   1.00 0.00 ? 118 PHE A CG   5  
ATOM 11502 C CD1  . PHE A 1 118 ? -3.510  -3.767  1.933   1.00 0.00 ? 118 PHE A CD1  5  
ATOM 11503 C CD2  . PHE A 1 118 ? -4.878  -4.136  0.041   1.00 0.00 ? 118 PHE A CD2  5  
ATOM 11504 C CE1  . PHE A 1 118 ? -2.970  -5.026  1.782   1.00 0.00 ? 118 PHE A CE1  5  
ATOM 11505 C CE2  . PHE A 1 118 ? -4.347  -5.391  -0.116  1.00 0.00 ? 118 PHE A CE2  5  
ATOM 11506 C CZ   . PHE A 1 118 ? -3.391  -5.839  0.757   1.00 0.00 ? 118 PHE A CZ   5  
ATOM 11507 H H    . PHE A 1 118 ? -3.342  -0.003  2.388   1.00 0.00 ? 118 PHE A H    5  
ATOM 11508 H HA   . PHE A 1 118 ? -3.806  -1.086  -0.286  1.00 0.00 ? 118 PHE A HA   5  
ATOM 11509 H HB2