data_2KN1
# 
_entry.id   2KN1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KN1         
RCSB  RCSB101323   
WWPDB D_1000101323 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2kmz PDB 'human Fn14 solution NMR structure'   
unspecified 2kn0 PDB 'xenopus Fn14 solution NMR structure' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KN1 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-08-11 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pellegrini, M.'  1  
'Willen, L.'      2  
'Perroud, M.'     3  
'Krushinskie, D.' 4  
'Strauch, K.'     5  
'Cuervo, H.'      6  
'Sun, Y.'         7  
'Day, E.S.'       8  
'Schneider, P.'   9  
'Zheng, T.S.'     10 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the extracellular domains of human and Xenopus Fn14: implications in the evolution of TWEAK and Fn14 interactions.' 
_citation.journal_abbrev            'Febs J.' 
_citation.journal_volume            280 
_citation.page_first                1818 
_citation.page_last                 1829 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1742-464X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23438059 
_citation.pdbx_database_id_DOI      10.1111/febs.12206 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pellegrini, M.'  1 
primary 'Willen, L.'      2 
primary 'Perroud, M.'     3 
primary 'Krushinskie, D.' 4 
primary 'Strauch, K.'     5 
primary 'Cuervo, H.'      6 
primary 'Day, E.S.'       7 
primary 'Schneider, P.'   8 
primary 'Zheng, T.S.'     9 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 syn 
_entity.pdbx_description           'Tumor necrosis factor receptor superfamily member 17' 
_entity.formula_weight             5601.405 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'residues 2-50' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'B-cell maturation protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       'LQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK(CY1)(NH2)' 
_entity_poly.pdbx_seq_one_letter_code_can   LQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKCX 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LEU n 
1 2  GLN n 
1 3  MET n 
1 4  ALA n 
1 5  GLY n 
1 6  GLN n 
1 7  CYS n 
1 8  SER n 
1 9  GLN n 
1 10 ASN n 
1 11 GLU n 
1 12 TYR n 
1 13 PHE n 
1 14 ASP n 
1 15 SER n 
1 16 LEU n 
1 17 LEU n 
1 18 HIS n 
1 19 ALA n 
1 20 CYS n 
1 21 ILE n 
1 22 PRO n 
1 23 CYS n 
1 24 GLN n 
1 25 LEU n 
1 26 ARG n 
1 27 CYS n 
1 28 SER n 
1 29 SER n 
1 30 ASN n 
1 31 THR n 
1 32 PRO n 
1 33 PRO n 
1 34 LEU n 
1 35 THR n 
1 36 CYS n 
1 37 GLN n 
1 38 ARG n 
1 39 TYR n 
1 40 CYS n 
1 41 ASN n 
1 42 ALA n 
1 43 SER n 
1 44 VAL n 
1 45 THR n 
1 46 ASN n 
1 47 SER n 
1 48 VAL n 
1 49 LYS n 
1 50 CY1 n 
1 51 NH2 n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                'solid phase peptide synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TNR17_HUMAN 
_struct_ref.pdbx_db_accession          Q02223 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   LQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK 
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KN1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 49 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q02223 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  50 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       49 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KN1 CY1 A 50 ? UNP Q02223 ? ? INSERTION 50 1 
1 2KN1 NH2 A 51 ? UNP Q02223 ? ? INSERTION 51 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'     133.103 
CY1 'L-peptide linking' n ACETAMIDOMETHYLCYSTEINE ? 'C6 H12 N2 O3 S' 192.236 
CYS 'L-peptide linking' y CYSTEINE                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'  149.211 
NH2 non-polymer         . 'AMINO GROUP'           ? 'H2 N'           16.023  
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.experiment_id   2 
_pdbx_nmr_exptl.solution_id     1 
_pdbx_nmr_exptl.type            '2D NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      10 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298-318 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '900 uM BCMA, 10 mM sodium phosphate, 0.02 % sodium azide, 95% H2O, 5% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '95% H2O/5% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2KN1 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  '20 lowest energy structures' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KN1 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KN1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Brunger A. T. et.al.' 'structure solution' CNS    1.1  1 
Goddard                'data analysis'      SPARKY 3.11 2 
'Brunger A. T. et.al.' refinement           CNS    1.1  3 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'Solution NMR structure of the extracellular CRD domain of human BCMA (synthetic source)' 
_exptl.entry_id                   2KN1 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KN1 
_struct.title                     'Solution NMR Structure of BCMA' 
_struct.pdbx_descriptor           'Tumor necrosis factor receptor superfamily member 17' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KN1 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'BCMA, BAFF, TNF Receptor, CRD, APRIL, SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 23 ? SER A 28 ? CYS A 23 SER A 28 1 ? 6 
HELX_P HELX_P2 2 CYS A 36 ? ASN A 41 ? CYS A 36 ASN A 41 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 7  A CYS 20 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf2 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 23 A CYS 36 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 27 A CYS 40 1_555 ? ? ? ? ? ? ? 2.031 ? 
covale1 covale ? ? A LYS 49 C  ? ? ? 1_555 A CY1 50 N  ? ? A LYS 49 A CY1 50 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale ? ? A CY1 50 C  ? ? ? 1_555 A NH2 51 N  ? ? A CY1 50 A NH2 51 1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 11 ? PHE A 13 ? GLU A 11 PHE A 13 
A 2 CYS A 20 ? PRO A 22 ? CYS A 20 PRO A 22 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    12 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     12 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    21 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     21 
# 
_atom_sites.entry_id                    2KN1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . LEU A 1 1  ? -8.995  -7.884  17.242  1.00 0.00 ? 1  LEU A N    1  
ATOM   2     C CA   . LEU A 1 1  ? -7.585  -8.027  16.795  1.00 0.00 ? 1  LEU A CA   1  
ATOM   3     C C    . LEU A 1 1  ? -7.419  -9.225  15.866  1.00 0.00 ? 1  LEU A C    1  
ATOM   4     O O    . LEU A 1 1  ? -7.092  -10.326 16.308  1.00 0.00 ? 1  LEU A O    1  
ATOM   5     C CB   . LEU A 1 1  ? -6.696  -8.192  18.030  1.00 0.00 ? 1  LEU A CB   1  
ATOM   6     C CG   . LEU A 1 1  ? -5.312  -7.544  17.923  1.00 0.00 ? 1  LEU A CG   1  
ATOM   7     C CD1  . LEU A 1 1  ? -5.251  -6.272  18.756  1.00 0.00 ? 1  LEU A CD1  1  
ATOM   8     C CD2  . LEU A 1 1  ? -4.229  -8.520  18.359  1.00 0.00 ? 1  LEU A CD2  1  
ATOM   9     H H1   . LEU A 1 1  ? -9.073  -6.988  17.764  1.00 0.00 ? 1  LEU A H1   1  
ATOM   10    H H2   . LEU A 1 1  ? -9.218  -8.696  17.853  1.00 0.00 ? 1  LEU A H2   1  
ATOM   11    H H3   . LEU A 1 1  ? -9.597  -7.875  16.394  1.00 0.00 ? 1  LEU A H3   1  
ATOM   12    H HA   . LEU A 1 1  ? -7.298  -7.130  16.268  1.00 0.00 ? 1  LEU A HA   1  
ATOM   13    H HB2  . LEU A 1 1  ? -7.211  -7.761  18.877  1.00 0.00 ? 1  LEU A HB2  1  
ATOM   14    H HB3  . LEU A 1 1  ? -6.562  -9.248  18.212  1.00 0.00 ? 1  LEU A HB3  1  
ATOM   15    H HG   . LEU A 1 1  ? -5.127  -7.276  16.893  1.00 0.00 ? 1  LEU A HG   1  
ATOM   16    H HD11 . LEU A 1 1  ? -4.802  -6.490  19.714  1.00 0.00 ? 1  LEU A HD11 1  
ATOM   17    H HD12 . LEU A 1 1  ? -6.250  -5.891  18.905  1.00 0.00 ? 1  LEU A HD12 1  
ATOM   18    H HD13 . LEU A 1 1  ? -4.656  -5.532  18.240  1.00 0.00 ? 1  LEU A HD13 1  
ATOM   19    H HD21 . LEU A 1 1  ? -3.258  -8.108  18.127  1.00 0.00 ? 1  LEU A HD21 1  
ATOM   20    H HD22 . LEU A 1 1  ? -4.357  -9.456  17.836  1.00 0.00 ? 1  LEU A HD22 1  
ATOM   21    H HD23 . LEU A 1 1  ? -4.304  -8.689  19.423  1.00 0.00 ? 1  LEU A HD23 1  
ATOM   22    N N    . GLN A 1 2  ? -7.647  -9.002  14.576  1.00 0.00 ? 2  GLN A N    1  
ATOM   23    C CA   . GLN A 1 2  ? -7.522  -10.063 13.583  1.00 0.00 ? 2  GLN A CA   1  
ATOM   24    C C    . GLN A 1 2  ? -6.379  -9.769  12.617  1.00 0.00 ? 2  GLN A C    1  
ATOM   25    O O    . GLN A 1 2  ? -6.300  -8.681  12.047  1.00 0.00 ? 2  GLN A O    1  
ATOM   26    C CB   . GLN A 1 2  ? -8.832  -10.222 12.808  1.00 0.00 ? 2  GLN A CB   1  
ATOM   27    C CG   . GLN A 1 2  ? -9.319  -8.934  12.164  1.00 0.00 ? 2  GLN A CG   1  
ATOM   28    C CD   . GLN A 1 2  ? -10.444 -9.165  11.175  1.00 0.00 ? 2  GLN A CD   1  
ATOM   29    O OE1  . GLN A 1 2  ? -10.265 -9.013  9.967   1.00 0.00 ? 2  GLN A OE1  1  
ATOM   30    N NE2  . GLN A 1 2  ? -11.614 -9.535  11.685  1.00 0.00 ? 2  GLN A NE2  1  
ATOM   31    H H    . GLN A 1 2  ? -7.904  -8.102  14.284  1.00 0.00 ? 2  GLN A H    1  
ATOM   32    H HA   . GLN A 1 2  ? -7.309  -10.983 14.105  1.00 0.00 ? 2  GLN A HA   1  
ATOM   33    H HB2  . GLN A 1 2  ? -8.689  -10.956 12.029  1.00 0.00 ? 2  GLN A HB2  1  
ATOM   34    H HB3  . GLN A 1 2  ? -9.597  -10.572 13.485  1.00 0.00 ? 2  GLN A HB3  1  
ATOM   35    H HG2  . GLN A 1 2  ? -9.673  -8.270  12.939  1.00 0.00 ? 2  GLN A HG2  1  
ATOM   36    H HG3  . GLN A 1 2  ? -8.492  -8.471  11.645  1.00 0.00 ? 2  GLN A HG3  1  
ATOM   37    H HE21 . GLN A 1 2  ? -11.683 -9.637  12.657  1.00 0.00 ? 2  GLN A HE21 1  
ATOM   38    H HE22 . GLN A 1 2  ? -12.359 -9.692  11.068  1.00 0.00 ? 2  GLN A HE22 1  
ATOM   39    N N    . MET A 1 3  ? -5.496  -10.750 12.437  1.00 0.00 ? 3  MET A N    1  
ATOM   40    C CA   . MET A 1 3  ? -4.350  -10.604 11.535  1.00 0.00 ? 3  MET A CA   1  
ATOM   41    C C    . MET A 1 3  ? -3.250  -9.736  12.139  1.00 0.00 ? 3  MET A C    1  
ATOM   42    O O    . MET A 1 3  ? -2.201  -9.540  11.526  1.00 0.00 ? 3  MET A O    1  
ATOM   43    C CB   . MET A 1 3  ? -4.793  -10.006 10.202  1.00 0.00 ? 3  MET A CB   1  
ATOM   44    C CG   . MET A 1 3  ? -3.820  -10.259 9.060   1.00 0.00 ? 3  MET A CG   1  
ATOM   45    S SD   . MET A 1 3  ? -3.536  -12.015 8.764   1.00 0.00 ? 3  MET A SD   1  
ATOM   46    C CE   . MET A 1 3  ? -3.094  -12.000 7.029   1.00 0.00 ? 3  MET A CE   1  
ATOM   47    H H    . MET A 1 3  ? -5.618  -11.596 12.920  1.00 0.00 ? 3  MET A H    1  
ATOM   48    H HA   . MET A 1 3  ? -3.949  -11.584 11.363  1.00 0.00 ? 3  MET A HA   1  
ATOM   49    H HB2  . MET A 1 3  ? -5.750  -10.427 9.933   1.00 0.00 ? 3  MET A HB2  1  
ATOM   50    H HB3  . MET A 1 3  ? -4.901  -8.939  10.326  1.00 0.00 ? 3  MET A HB3  1  
ATOM   51    H HG2  . MET A 1 3  ? -4.220  -9.818  8.159   1.00 0.00 ? 3  MET A HG2  1  
ATOM   52    H HG3  . MET A 1 3  ? -2.876  -9.791  9.299   1.00 0.00 ? 3  MET A HG3  1  
ATOM   53    H HE1  . MET A 1 3  ? -2.208  -12.599 6.877   1.00 0.00 ? 3  MET A HE1  1  
ATOM   54    H HE2  . MET A 1 3  ? -2.901  -10.985 6.715   1.00 0.00 ? 3  MET A HE2  1  
ATOM   55    H HE3  . MET A 1 3  ? -3.908  -12.407 6.447   1.00 0.00 ? 3  MET A HE3  1  
ATOM   56    N N    . ALA A 1 4  ? -3.494  -9.217  13.332  1.00 0.00 ? 4  ALA A N    1  
ATOM   57    C CA   . ALA A 1 4  ? -2.525  -8.374  14.014  1.00 0.00 ? 4  ALA A CA   1  
ATOM   58    C C    . ALA A 1 4  ? -1.264  -9.157  14.366  1.00 0.00 ? 4  ALA A C    1  
ATOM   59    O O    . ALA A 1 4  ? -1.026  -9.489  15.527  1.00 0.00 ? 4  ALA A O    1  
ATOM   60    C CB   . ALA A 1 4  ? -3.156  -7.782  15.262  1.00 0.00 ? 4  ALA A CB   1  
ATOM   61    H H    . ALA A 1 4  ? -4.348  -9.402  13.765  1.00 0.00 ? 4  ALA A H    1  
ATOM   62    H HA   . ALA A 1 4  ? -2.261  -7.564  13.352  1.00 0.00 ? 4  ALA A HA   1  
ATOM   63    H HB1  . ALA A 1 4  ? -2.695  -8.211  16.139  1.00 0.00 ? 4  ALA A HB1  1  
ATOM   64    H HB2  . ALA A 1 4  ? -4.212  -8.005  15.265  1.00 0.00 ? 4  ALA A HB2  1  
ATOM   65    H HB3  . ALA A 1 4  ? -3.012  -6.712  15.265  1.00 0.00 ? 4  ALA A HB3  1  
ATOM   66    N N    . GLY A 1 5  ? -0.461  -9.454  13.350  1.00 0.00 ? 5  GLY A N    1  
ATOM   67    C CA   . GLY A 1 5  ? 0.768   -10.199 13.560  1.00 0.00 ? 5  GLY A CA   1  
ATOM   68    C C    . GLY A 1 5  ? 1.099   -11.105 12.389  1.00 0.00 ? 5  GLY A C    1  
ATOM   69    O O    . GLY A 1 5  ? 1.560   -12.230 12.579  1.00 0.00 ? 5  GLY A O    1  
ATOM   70    H H    . GLY A 1 5  ? -0.707  -9.164  12.447  1.00 0.00 ? 5  GLY A H    1  
ATOM   71    H HA2  . GLY A 1 5  ? 1.581   -9.500  13.703  1.00 0.00 ? 5  GLY A HA2  1  
ATOM   72    H HA3  . GLY A 1 5  ? 0.665   -10.806 14.450  1.00 0.00 ? 5  GLY A HA3  1  
ATOM   73    N N    . GLN A 1 6  ? 0.872   -10.608 11.174  1.00 0.00 ? 6  GLN A N    1  
ATOM   74    C CA   . GLN A 1 6  ? 1.148   -11.366 9.962   1.00 0.00 ? 6  GLN A CA   1  
ATOM   75    C C    . GLN A 1 6  ? 0.534   -10.671 8.756   1.00 0.00 ? 6  GLN A C    1  
ATOM   76    O O    . GLN A 1 6  ? -0.466  -11.121 8.198   1.00 0.00 ? 6  GLN A O    1  
ATOM   77    C CB   . GLN A 1 6  ? 0.622   -12.801 10.077  1.00 0.00 ? 6  GLN A CB   1  
ATOM   78    C CG   . GLN A 1 6  ? 1.722   -13.844 10.198  1.00 0.00 ? 6  GLN A CG   1  
ATOM   79    C CD   . GLN A 1 6  ? 2.554   -13.963 8.937   1.00 0.00 ? 6  GLN A CD   1  
ATOM   80    O OE1  . GLN A 1 6  ? 2.634   -13.028 8.140   1.00 0.00 ? 6  GLN A OE1  1  
ATOM   81    N NE2  . GLN A 1 6  ? 3.183   -15.118 8.750   1.00 0.00 ? 6  GLN A NE2  1  
ATOM   82    H H    . GLN A 1 6  ? 0.515   -9.702  11.089  1.00 0.00 ? 6  GLN A H    1  
ATOM   83    H HA   . GLN A 1 6  ? 2.216   -11.386 9.831   1.00 0.00 ? 6  GLN A HA   1  
ATOM   84    H HB2  . GLN A 1 6  ? -0.008  -12.872 10.951  1.00 0.00 ? 6  GLN A HB2  1  
ATOM   85    H HB3  . GLN A 1 6  ? 0.033   -13.031 9.201   1.00 0.00 ? 6  GLN A HB3  1  
ATOM   86    H HG2  . GLN A 1 6  ? 2.372   -13.571 11.015  1.00 0.00 ? 6  GLN A HG2  1  
ATOM   87    H HG3  . GLN A 1 6  ? 1.269   -14.803 10.405  1.00 0.00 ? 6  GLN A HG3  1  
ATOM   88    H HE21 . GLN A 1 6  ? 3.075   -15.819 9.427   1.00 0.00 ? 6  GLN A HE21 1  
ATOM   89    H HE22 . GLN A 1 6  ? 3.729   -15.223 7.943   1.00 0.00 ? 6  GLN A HE22 1  
ATOM   90    N N    . CYS A 1 7  ? 1.149   -9.564  8.373   1.00 0.00 ? 7  CYS A N    1  
ATOM   91    C CA   . CYS A 1 7  ? 0.684   -8.775  7.236   1.00 0.00 ? 7  CYS A CA   1  
ATOM   92    C C    . CYS A 1 7  ? 1.679   -8.837  6.088   1.00 0.00 ? 7  CYS A C    1  
ATOM   93    O O    . CYS A 1 7  ? 2.891   -8.860  6.306   1.00 0.00 ? 7  CYS A O    1  
ATOM   94    C CB   . CYS A 1 7  ? 0.483   -7.316  7.652   1.00 0.00 ? 7  CYS A CB   1  
ATOM   95    S SG   . CYS A 1 7  ? -1.029  -7.024  8.626   1.00 0.00 ? 7  CYS A SG   1  
ATOM   96    H H    . CYS A 1 7  ? 1.937   -9.269  8.874   1.00 0.00 ? 7  CYS A H    1  
ATOM   97    H HA   . CYS A 1 7  ? -0.260  -9.180  6.907   1.00 0.00 ? 7  CYS A HA   1  
ATOM   98    H HB2  . CYS A 1 7  ? 1.325   -7.002  8.251   1.00 0.00 ? 7  CYS A HB2  1  
ATOM   99    H HB3  . CYS A 1 7  ? 0.431   -6.697  6.763   1.00 0.00 ? 7  CYS A HB3  1  
ATOM   100   N N    . SER A 1 8  ? 1.166   -8.847  4.862   1.00 0.00 ? 8  SER A N    1  
ATOM   101   C CA   . SER A 1 8  ? 2.025   -8.878  3.688   1.00 0.00 ? 8  SER A CA   1  
ATOM   102   C C    . SER A 1 8  ? 2.960   -7.682  3.715   1.00 0.00 ? 8  SER A C    1  
ATOM   103   O O    . SER A 1 8  ? 2.675   -6.673  4.356   1.00 0.00 ? 8  SER A O    1  
ATOM   104   C CB   . SER A 1 8  ? 1.190   -8.869  2.406   1.00 0.00 ? 8  SER A CB   1  
ATOM   105   O OG   . SER A 1 8  ? 0.120   -9.795  2.485   1.00 0.00 ? 8  SER A OG   1  
ATOM   106   H H    . SER A 1 8  ? 0.194   -8.815  4.745   1.00 0.00 ? 8  SER A H    1  
ATOM   107   H HA   . SER A 1 8  ? 2.616   -9.780  3.723   1.00 0.00 ? 8  SER A HA   1  
ATOM   108   H HB2  . SER A 1 8  ? 0.783   -7.881  2.251   1.00 0.00 ? 8  SER A HB2  1  
ATOM   109   H HB3  . SER A 1 8  ? 1.818   -9.135  1.568   1.00 0.00 ? 8  SER A HB3  1  
ATOM   110   H HG   . SER A 1 8  ? 0.471   -10.685 2.569   1.00 0.00 ? 8  SER A HG   1  
ATOM   111   N N    . GLN A 1 9  ? 4.085   -7.798  3.037   1.00 0.00 ? 9  GLN A N    1  
ATOM   112   C CA   . GLN A 1 9  ? 5.054   -6.721  3.017   1.00 0.00 ? 9  GLN A CA   1  
ATOM   113   C C    . GLN A 1 9  ? 4.427   -5.409  2.580   1.00 0.00 ? 9  GLN A C    1  
ATOM   114   O O    . GLN A 1 9  ? 3.809   -5.313  1.520   1.00 0.00 ? 9  GLN A O    1  
ATOM   115   C CB   . GLN A 1 9  ? 6.242   -7.073  2.120   1.00 0.00 ? 9  GLN A CB   1  
ATOM   116   C CG   . GLN A 1 9  ? 7.580   -6.611  2.674   1.00 0.00 ? 9  GLN A CG   1  
ATOM   117   C CD   . GLN A 1 9  ? 8.662   -6.556  1.614   1.00 0.00 ? 9  GLN A CD   1  
ATOM   118   O OE1  . GLN A 1 9  ? 9.324   -5.533  1.439   1.00 0.00 ? 9  GLN A OE1  1  
ATOM   119   N NE2  . GLN A 1 9  ? 8.848   -7.660  0.900   1.00 0.00 ? 9  GLN A NE2  1  
ATOM   120   H H    . GLN A 1 9  ? 4.275   -8.626  2.560   1.00 0.00 ? 9  GLN A H    1  
ATOM   121   H HA   . GLN A 1 9  ? 5.397   -6.596  4.027   1.00 0.00 ? 9  GLN A HA   1  
ATOM   122   H HB2  . GLN A 1 9  ? 6.279   -8.145  1.996   1.00 0.00 ? 9  GLN A HB2  1  
ATOM   123   H HB3  . GLN A 1 9  ? 6.098   -6.612  1.154   1.00 0.00 ? 9  GLN A HB3  1  
ATOM   124   H HG2  . GLN A 1 9  ? 7.460   -5.624  3.095   1.00 0.00 ? 9  GLN A HG2  1  
ATOM   125   H HG3  . GLN A 1 9  ? 7.890   -7.297  3.449   1.00 0.00 ? 9  GLN A HG3  1  
ATOM   126   H HE21 . GLN A 1 9  ? 8.284   -8.437  1.095   1.00 0.00 ? 9  GLN A HE21 1  
ATOM   127   H HE22 . GLN A 1 9  ? 9.541   -7.652  0.207   1.00 0.00 ? 9  GLN A HE22 1  
ATOM   128   N N    . ASN A 1 10 ? 4.594   -4.405  3.427   1.00 0.00 ? 10 ASN A N    1  
ATOM   129   C CA   . ASN A 1 10 ? 4.058   -3.082  3.175   1.00 0.00 ? 10 ASN A CA   1  
ATOM   130   C C    . ASN A 1 10 ? 2.542   -3.108  3.109   1.00 0.00 ? 10 ASN A C    1  
ATOM   131   O O    . ASN A 1 10 ? 1.925   -2.297  2.419   1.00 0.00 ? 10 ASN A O    1  
ATOM   132   C CB   . ASN A 1 10 ? 4.645   -2.490  1.891   1.00 0.00 ? 10 ASN A CB   1  
ATOM   133   C CG   . ASN A 1 10 ? 5.439   -1.223  2.154   1.00 0.00 ? 10 ASN A CG   1  
ATOM   134   O OD1  . ASN A 1 10 ? 6.658   -1.197  1.986   1.00 0.00 ? 10 ASN A OD1  1  
ATOM   135   N ND2  . ASN A 1 10 ? 4.754   -0.165  2.578   1.00 0.00 ? 10 ASN A ND2  1  
ATOM   136   H H    . ASN A 1 10 ? 5.094   -4.563  4.255   1.00 0.00 ? 10 ASN A H    1  
ATOM   137   H HA   . ASN A 1 10 ? 4.341   -2.463  4.007   1.00 0.00 ? 10 ASN A HA   1  
ATOM   138   H HB2  . ASN A 1 10 ? 5.303   -3.216  1.436   1.00 0.00 ? 10 ASN A HB2  1  
ATOM   139   H HB3  . ASN A 1 10 ? 3.843   -2.259  1.204   1.00 0.00 ? 10 ASN A HB3  1  
ATOM   140   H HD21 . ASN A 1 10 ? 3.785   -0.256  2.697   1.00 0.00 ? 10 ASN A HD21 1  
ATOM   141   H HD22 . ASN A 1 10 ? 5.246   0.664   2.754   1.00 0.00 ? 10 ASN A HD22 1  
ATOM   142   N N    . GLU A 1 11 ? 1.943   -4.031  3.848   1.00 0.00 ? 11 GLU A N    1  
ATOM   143   C CA   . GLU A 1 11 ? 0.486   -4.118  3.878   1.00 0.00 ? 11 GLU A CA   1  
ATOM   144   C C    . GLU A 1 11 ? -0.069  -3.210  4.954   1.00 0.00 ? 11 GLU A C    1  
ATOM   145   O O    . GLU A 1 11 ? 0.544   -3.041  6.008   1.00 0.00 ? 11 GLU A O    1  
ATOM   146   C CB   . GLU A 1 11 ? 0.002   -5.558  4.074   1.00 0.00 ? 11 GLU A CB   1  
ATOM   147   C CG   . GLU A 1 11 ? -1.084  -5.968  3.092   1.00 0.00 ? 11 GLU A CG   1  
ATOM   148   C CD   . GLU A 1 11 ? -1.464  -7.431  3.215   1.00 0.00 ? 11 GLU A CD   1  
ATOM   149   O OE1  . GLU A 1 11 ? -1.205  -8.024  4.283   1.00 0.00 ? 11 GLU A OE1  1  
ATOM   150   O OE2  . GLU A 1 11 ? -2.020  -7.983  2.243   1.00 0.00 ? 11 GLU A OE2  1  
ATOM   151   H H    . GLU A 1 11 ? 2.495   -4.650  4.394   1.00 0.00 ? 11 GLU A H    1  
ATOM   152   H HA   . GLU A 1 11 ? 0.127   -3.751  2.944   1.00 0.00 ? 11 GLU A HA   1  
ATOM   153   H HB2  . GLU A 1 11 ? 0.836   -6.226  3.949   1.00 0.00 ? 11 GLU A HB2  1  
ATOM   154   H HB3  . GLU A 1 11 ? -0.388  -5.664  5.075   1.00 0.00 ? 11 GLU A HB3  1  
ATOM   155   H HG2  . GLU A 1 11 ? -1.961  -5.369  3.275   1.00 0.00 ? 11 GLU A HG2  1  
ATOM   156   H HG3  . GLU A 1 11 ? -0.729  -5.787  2.087   1.00 0.00 ? 11 GLU A HG3  1  
ATOM   157   N N    . TYR A 1 12 ? -1.230  -2.609  4.687   1.00 0.00 ? 12 TYR A N    1  
ATOM   158   C CA   . TYR A 1 12 ? -1.827  -1.697  5.667   1.00 0.00 ? 12 TYR A CA   1  
ATOM   159   C C    . TYR A 1 12 ? -3.175  -2.198  6.161   1.00 0.00 ? 12 TYR A C    1  
ATOM   160   O O    . TYR A 1 12 ? -4.105  -2.399  5.384   1.00 0.00 ? 12 TYR A O    1  
ATOM   161   C CB   . TYR A 1 12 ? -1.950  -0.277  5.103   1.00 0.00 ? 12 TYR A CB   1  
ATOM   162   C CG   . TYR A 1 12 ? -3.026  -0.094  4.054   1.00 0.00 ? 12 TYR A CG   1  
ATOM   163   C CD1  . TYR A 1 12 ? -2.750  -0.284  2.707   1.00 0.00 ? 12 TYR A CD1  1  
ATOM   164   C CD2  . TYR A 1 12 ? -4.312  0.287   4.412   1.00 0.00 ? 12 TYR A CD2  1  
ATOM   165   C CE1  . TYR A 1 12 ? -3.726  -0.103  1.746   1.00 0.00 ? 12 TYR A CE1  1  
ATOM   166   C CE2  . TYR A 1 12 ? -5.293  0.472   3.458   1.00 0.00 ? 12 TYR A CE2  1  
ATOM   167   C CZ   . TYR A 1 12 ? -4.996  0.276   2.126   1.00 0.00 ? 12 TYR A CZ   1  
ATOM   168   O OH   . TYR A 1 12 ? -5.972  0.457   1.171   1.00 0.00 ? 12 TYR A OH   1  
ATOM   169   H H    . TYR A 1 12 ? -1.687  -2.776  3.816   1.00 0.00 ? 12 TYR A H    1  
ATOM   170   H HA   . TYR A 1 12 ? -1.157  -1.660  6.517   1.00 0.00 ? 12 TYR A HA   1  
ATOM   171   H HB2  . TYR A 1 12 ? -2.171  0.397   5.916   1.00 0.00 ? 12 TYR A HB2  1  
ATOM   172   H HB3  . TYR A 1 12 ? -1.005  0.005   4.661   1.00 0.00 ? 12 TYR A HB3  1  
ATOM   173   H HD1  . TYR A 1 12 ? -1.754  -0.581  2.412   1.00 0.00 ? 12 TYR A HD1  1  
ATOM   174   H HD2  . TYR A 1 12 ? -4.543  0.439   5.457   1.00 0.00 ? 12 TYR A HD2  1  
ATOM   175   H HE1  . TYR A 1 12 ? -3.492  -0.257  0.703   1.00 0.00 ? 12 TYR A HE1  1  
ATOM   176   H HE2  . TYR A 1 12 ? -6.287  0.768   3.757   1.00 0.00 ? 12 TYR A HE2  1  
ATOM   177   H HH   . TYR A 1 12 ? -6.583  1.139   1.461   1.00 0.00 ? 12 TYR A HH   1  
ATOM   178   N N    . PHE A 1 13 ? -3.259  -2.390  7.474   1.00 0.00 ? 13 PHE A N    1  
ATOM   179   C CA   . PHE A 1 13 ? -4.476  -2.868  8.120   1.00 0.00 ? 13 PHE A CA   1  
ATOM   180   C C    . PHE A 1 13 ? -5.494  -1.747  8.265   1.00 0.00 ? 13 PHE A C    1  
ATOM   181   O O    . PHE A 1 13 ? -5.503  -1.031  9.266   1.00 0.00 ? 13 PHE A O    1  
ATOM   182   C CB   . PHE A 1 13 ? -4.145  -3.437  9.502   1.00 0.00 ? 13 PHE A CB   1  
ATOM   183   C CG   . PHE A 1 13 ? -5.278  -4.199  10.125  1.00 0.00 ? 13 PHE A CG   1  
ATOM   184   C CD1  . PHE A 1 13 ? -5.717  -5.390  9.569   1.00 0.00 ? 13 PHE A CD1  1  
ATOM   185   C CD2  . PHE A 1 13 ? -5.904  -3.724  11.266  1.00 0.00 ? 13 PHE A CD2  1  
ATOM   186   C CE1  . PHE A 1 13 ? -6.761  -6.093  10.140  1.00 0.00 ? 13 PHE A CE1  1  
ATOM   187   C CE2  . PHE A 1 13 ? -6.948  -4.423  11.842  1.00 0.00 ? 13 PHE A CE2  1  
ATOM   188   C CZ   . PHE A 1 13 ? -7.377  -5.609  11.278  1.00 0.00 ? 13 PHE A CZ   1  
ATOM   189   H H    . PHE A 1 13 ? -2.472  -2.200  8.027   1.00 0.00 ? 13 PHE A H    1  
ATOM   190   H HA   . PHE A 1 13 ? -4.902  -3.653  7.510   1.00 0.00 ? 13 PHE A HA   1  
ATOM   191   H HB2  . PHE A 1 13 ? -3.303  -4.106  9.417   1.00 0.00 ? 13 PHE A HB2  1  
ATOM   192   H HB3  . PHE A 1 13 ? -3.886  -2.625  10.165  1.00 0.00 ? 13 PHE A HB3  1  
ATOM   193   H HD1  . PHE A 1 13 ? -5.235  -5.770  8.680   1.00 0.00 ? 13 PHE A HD1  1  
ATOM   194   H HD2  . PHE A 1 13 ? -5.569  -2.796  11.707  1.00 0.00 ? 13 PHE A HD2  1  
ATOM   195   H HE1  . PHE A 1 13 ? -7.094  -7.020  9.698   1.00 0.00 ? 13 PHE A HE1  1  
ATOM   196   H HE2  . PHE A 1 13 ? -7.428  -4.042  12.731  1.00 0.00 ? 13 PHE A HE2  1  
ATOM   197   H HZ   . PHE A 1 13 ? -8.193  -6.156  11.726  1.00 0.00 ? 13 PHE A HZ   1  
ATOM   198   N N    . ASP A 1 14 ? -6.365  -1.609  7.274   1.00 0.00 ? 14 ASP A N    1  
ATOM   199   C CA   . ASP A 1 14 ? -7.396  -0.580  7.318   1.00 0.00 ? 14 ASP A CA   1  
ATOM   200   C C    . ASP A 1 14 ? -8.358  -0.862  8.457   1.00 0.00 ? 14 ASP A C    1  
ATOM   201   O O    . ASP A 1 14 ? -9.242  -1.701  8.335   1.00 0.00 ? 14 ASP A O    1  
ATOM   202   C CB   . ASP A 1 14 ? -8.156  -0.521  5.993   1.00 0.00 ? 14 ASP A CB   1  
ATOM   203   C CG   . ASP A 1 14 ? -8.499  0.899   5.588   1.00 0.00 ? 14 ASP A CG   1  
ATOM   204   O OD1  . ASP A 1 14 ? -8.901  1.687   6.470   1.00 0.00 ? 14 ASP A OD1  1  
ATOM   205   O OD2  . ASP A 1 14 ? -8.367  1.223   4.389   1.00 0.00 ? 14 ASP A OD2  1  
ATOM   206   H H    . ASP A 1 14 ? -6.323  -2.220  6.505   1.00 0.00 ? 14 ASP A H    1  
ATOM   207   H HA   . ASP A 1 14 ? -6.921  0.373   7.497   1.00 0.00 ? 14 ASP A HA   1  
ATOM   208   H HB2  . ASP A 1 14 ? -7.550  -0.962  5.216   1.00 0.00 ? 14 ASP A HB2  1  
ATOM   209   H HB3  . ASP A 1 14 ? -9.074  -1.079  6.089   1.00 0.00 ? 14 ASP A HB3  1  
ATOM   210   N N    . SER A 1 15 ? -8.181  -0.158  9.570   1.00 0.00 ? 15 SER A N    1  
ATOM   211   C CA   . SER A 1 15 ? -9.042  -0.344  10.731  1.00 0.00 ? 15 SER A CA   1  
ATOM   212   C C    . SER A 1 15 ? -10.513 -0.298  10.332  1.00 0.00 ? 15 SER A C    1  
ATOM   213   O O    . SER A 1 15 ? -11.371 -0.847  11.024  1.00 0.00 ? 15 SER A O    1  
ATOM   214   C CB   . SER A 1 15 ? -8.750  0.721   11.790  1.00 0.00 ? 15 SER A CB   1  
ATOM   215   O OG   . SER A 1 15 ? -8.964  2.024   11.276  1.00 0.00 ? 15 SER A OG   1  
ATOM   216   H H    . SER A 1 15 ? -7.455  0.498   9.612   1.00 0.00 ? 15 SER A H    1  
ATOM   217   H HA   . SER A 1 15 ? -8.827  -1.318  11.142  1.00 0.00 ? 15 SER A HA   1  
ATOM   218   H HB2  . SER A 1 15 ? -9.402  0.571   12.638  1.00 0.00 ? 15 SER A HB2  1  
ATOM   219   H HB3  . SER A 1 15 ? -7.721  0.637   12.108  1.00 0.00 ? 15 SER A HB3  1  
ATOM   220   H HG   . SER A 1 15 ? -9.685  2.442   11.752  1.00 0.00 ? 15 SER A HG   1  
ATOM   221   N N    . LEU A 1 16 ? -10.797 0.349   9.207   1.00 0.00 ? 16 LEU A N    1  
ATOM   222   C CA   . LEU A 1 16 ? -12.164 0.447   8.715   1.00 0.00 ? 16 LEU A CA   1  
ATOM   223   C C    . LEU A 1 16 ? -12.546 -0.813  7.944   1.00 0.00 ? 16 LEU A C    1  
ATOM   224   O O    . LEU A 1 16 ? -13.720 -1.172  7.862   1.00 0.00 ? 16 LEU A O    1  
ATOM   225   C CB   . LEU A 1 16 ? -12.323 1.679   7.821   1.00 0.00 ? 16 LEU A CB   1  
ATOM   226   C CG   . LEU A 1 16 ? -13.710 2.323   7.847   1.00 0.00 ? 16 LEU A CG   1  
ATOM   227   C CD1  . LEU A 1 16 ? -14.771 1.322   7.418   1.00 0.00 ? 16 LEU A CD1  1  
ATOM   228   C CD2  . LEU A 1 16 ? -14.018 2.869   9.233   1.00 0.00 ? 16 LEU A CD2  1  
ATOM   229   H H    . LEU A 1 16 ? -10.068 0.761   8.690   1.00 0.00 ? 16 LEU A H    1  
ATOM   230   H HA   . LEU A 1 16 ? -12.817 0.544   9.569   1.00 0.00 ? 16 LEU A HA   1  
ATOM   231   H HB2  . LEU A 1 16 ? -11.599 2.418   8.131   1.00 0.00 ? 16 LEU A HB2  1  
ATOM   232   H HB3  . LEU A 1 16 ? -12.104 1.390   6.804   1.00 0.00 ? 16 LEU A HB3  1  
ATOM   233   H HG   . LEU A 1 16 ? -13.729 3.148   7.149   1.00 0.00 ? 16 LEU A HG   1  
ATOM   234   H HD11 . LEU A 1 16 ? -14.370 0.679   6.650   1.00 0.00 ? 16 LEU A HD11 1  
ATOM   235   H HD12 . LEU A 1 16 ? -15.630 1.851   7.033   1.00 0.00 ? 16 LEU A HD12 1  
ATOM   236   H HD13 . LEU A 1 16 ? -15.068 0.726   8.269   1.00 0.00 ? 16 LEU A HD13 1  
ATOM   237   H HD21 . LEU A 1 16 ? -13.237 3.552   9.533   1.00 0.00 ? 16 LEU A HD21 1  
ATOM   238   H HD22 . LEU A 1 16 ? -14.072 2.052   9.938   1.00 0.00 ? 16 LEU A HD22 1  
ATOM   239   H HD23 . LEU A 1 16 ? -14.963 3.390   9.212   1.00 0.00 ? 16 LEU A HD23 1  
ATOM   240   N N    . LEU A 1 17 ? -11.543 -1.476  7.376   1.00 0.00 ? 17 LEU A N    1  
ATOM   241   C CA   . LEU A 1 17 ? -11.759 -2.691  6.606   1.00 0.00 ? 17 LEU A CA   1  
ATOM   242   C C    . LEU A 1 17 ? -11.419 -3.940  7.417   1.00 0.00 ? 17 LEU A C    1  
ATOM   243   O O    . LEU A 1 17 ? -11.901 -5.032  7.114   1.00 0.00 ? 17 LEU A O    1  
ATOM   244   C CB   . LEU A 1 17 ? -10.899 -2.657  5.344   1.00 0.00 ? 17 LEU A CB   1  
ATOM   245   C CG   . LEU A 1 17 ? -11.112 -1.435  4.449   1.00 0.00 ? 17 LEU A CG   1  
ATOM   246   C CD1  . LEU A 1 17 ? -9.984  -1.315  3.435   1.00 0.00 ? 17 LEU A CD1  1  
ATOM   247   C CD2  . LEU A 1 17 ? -12.461 -1.515  3.748   1.00 0.00 ? 17 LEU A CD2  1  
ATOM   248   H H    . LEU A 1 17 ? -10.629 -1.137  7.473   1.00 0.00 ? 17 LEU A H    1  
ATOM   249   H HA   . LEU A 1 17 ? -12.800 -2.729  6.321   1.00 0.00 ? 17 LEU A HA   1  
ATOM   250   H HB2  . LEU A 1 17 ? -9.860  -2.681  5.646   1.00 0.00 ? 17 LEU A HB2  1  
ATOM   251   H HB3  . LEU A 1 17 ? -11.110 -3.542  4.764   1.00 0.00 ? 17 LEU A HB3  1  
ATOM   252   H HG   . LEU A 1 17 ? -11.104 -0.545  5.062   1.00 0.00 ? 17 LEU A HG   1  
ATOM   253   H HD11 . LEU A 1 17 ? -9.062  -1.659  3.879   1.00 0.00 ? 17 LEU A HD11 1  
ATOM   254   H HD12 . LEU A 1 17 ? -9.877  -0.283  3.136   1.00 0.00 ? 17 LEU A HD12 1  
ATOM   255   H HD13 . LEU A 1 17 ? -10.214 -1.919  2.569   1.00 0.00 ? 17 LEU A HD13 1  
ATOM   256   H HD21 . LEU A 1 17 ? -12.327 -1.363  2.687   1.00 0.00 ? 17 LEU A HD21 1  
ATOM   257   H HD22 . LEU A 1 17 ? -13.116 -0.750  4.140   1.00 0.00 ? 17 LEU A HD22 1  
ATOM   258   H HD23 . LEU A 1 17 ? -12.901 -2.487  3.919   1.00 0.00 ? 17 LEU A HD23 1  
ATOM   259   N N    . HIS A 1 18 ? -10.569 -3.787  8.432   1.00 0.00 ? 18 HIS A N    1  
ATOM   260   C CA   . HIS A 1 18 ? -10.159 -4.919  9.252   1.00 0.00 ? 18 HIS A CA   1  
ATOM   261   C C    . HIS A 1 18 ? -9.434  -5.938  8.388   1.00 0.00 ? 18 HIS A C    1  
ATOM   262   O O    . HIS A 1 18 ? -9.767  -7.124  8.379   1.00 0.00 ? 18 HIS A O    1  
ATOM   263   C CB   . HIS A 1 18 ? -11.366 -5.571  9.908   1.00 0.00 ? 18 HIS A CB   1  
ATOM   264   C CG   . HIS A 1 18 ? -12.208 -4.621  10.699  1.00 0.00 ? 18 HIS A CG   1  
ATOM   265   N ND1  . HIS A 1 18 ? -13.496 -4.282  10.342  1.00 0.00 ? 18 HIS A ND1  1  
ATOM   266   C CD2  . HIS A 1 18 ? -11.942 -3.935  11.836  1.00 0.00 ? 18 HIS A CD2  1  
ATOM   267   C CE1  . HIS A 1 18 ? -13.986 -3.429  11.223  1.00 0.00 ? 18 HIS A CE1  1  
ATOM   268   N NE2  . HIS A 1 18 ? -13.063 -3.202  12.140  1.00 0.00 ? 18 HIS A NE2  1  
ATOM   269   H H    . HIS A 1 18 ? -10.197 -2.899  8.622   1.00 0.00 ? 18 HIS A H    1  
ATOM   270   H HA   . HIS A 1 18 ? -9.486  -4.558  10.016  1.00 0.00 ? 18 HIS A HA   1  
ATOM   271   H HB2  . HIS A 1 18 ? -11.983 -6.004  9.139   1.00 0.00 ? 18 HIS A HB2  1  
ATOM   272   H HB3  . HIS A 1 18 ? -11.022 -6.349  10.571  1.00 0.00 ? 18 HIS A HB3  1  
ATOM   273   H HD1  . HIS A 1 18 ? -13.979 -4.616  9.557   1.00 0.00 ? 18 HIS A HD1  1  
ATOM   274   H HD2  . HIS A 1 18 ? -11.019 -3.959  12.399  1.00 0.00 ? 18 HIS A HD2  1  
ATOM   275   H HE1  . HIS A 1 18 ? -14.973 -2.991  11.199  1.00 0.00 ? 18 HIS A HE1  1  
ATOM   276   H HE2  . HIS A 1 18 ? -13.135 -2.545  12.864  1.00 0.00 ? 18 HIS A HE2  1  
ATOM   277   N N    . ALA A 1 19 ? -8.451  -5.453  7.652   1.00 0.00 ? 19 ALA A N    1  
ATOM   278   C CA   . ALA A 1 19 ? -7.674  -6.284  6.760   1.00 0.00 ? 19 ALA A CA   1  
ATOM   279   C C    . ALA A 1 19 ? -6.463  -5.545  6.245   1.00 0.00 ? 19 ALA A C    1  
ATOM   280   O O    . ALA A 1 19 ? -6.574  -4.439  5.719   1.00 0.00 ? 19 ALA A O    1  
ATOM   281   C CB   . ALA A 1 19 ? -8.505  -6.709  5.565   1.00 0.00 ? 19 ALA A CB   1  
ATOM   282   H H    . ALA A 1 19 ? -8.248  -4.507  7.705   1.00 0.00 ? 19 ALA A H    1  
ATOM   283   H HA   . ALA A 1 19 ? -7.362  -7.169  7.293   1.00 0.00 ? 19 ALA A HA   1  
ATOM   284   H HB1  . ALA A 1 19 ? -8.477  -7.784  5.469   1.00 0.00 ? 19 ALA A HB1  1  
ATOM   285   H HB2  . ALA A 1 19 ? -8.089  -6.254  4.670   1.00 0.00 ? 19 ALA A HB2  1  
ATOM   286   H HB3  . ALA A 1 19 ? -9.524  -6.381  5.698   1.00 0.00 ? 19 ALA A HB3  1  
ATOM   287   N N    . CYS A 1 20 ? -5.318  -6.174  6.359   1.00 0.00 ? 20 CYS A N    1  
ATOM   288   C CA   . CYS A 1 20 ? -4.106  -5.579  5.847   1.00 0.00 ? 20 CYS A CA   1  
ATOM   289   C C    . CYS A 1 20 ? -4.172  -5.566  4.328   1.00 0.00 ? 20 CYS A C    1  
ATOM   290   O O    . CYS A 1 20 ? -4.116  -6.608  3.674   1.00 0.00 ? 20 CYS A O    1  
ATOM   291   C CB   . CYS A 1 20 ? -2.865  -6.330  6.313   1.00 0.00 ? 20 CYS A CB   1  
ATOM   292   S SG   . CYS A 1 20 ? -1.950  -5.501  7.652   1.00 0.00 ? 20 CYS A SG   1  
ATOM   293   H H    . CYS A 1 20 ? -5.300  -7.058  6.764   1.00 0.00 ? 20 CYS A H    1  
ATOM   294   H HA   . CYS A 1 20 ? -4.071  -4.563  6.199   1.00 0.00 ? 20 CYS A HA   1  
ATOM   295   H HB2  . CYS A 1 20 ? -3.153  -7.308  6.665   1.00 0.00 ? 20 CYS A HB2  1  
ATOM   296   H HB3  . CYS A 1 20 ? -2.193  -6.436  5.475   1.00 0.00 ? 20 CYS A HB3  1  
ATOM   297   N N    . ILE A 1 21 ? -4.319  -4.376  3.784   1.00 0.00 ? 21 ILE A N    1  
ATOM   298   C CA   . ILE A 1 21 ? -4.424  -4.179  2.355   1.00 0.00 ? 21 ILE A CA   1  
ATOM   299   C C    . ILE A 1 21 ? -3.095  -3.700  1.787   1.00 0.00 ? 21 ILE A C    1  
ATOM   300   O O    . ILE A 1 21 ? -2.370  -2.965  2.451   1.00 0.00 ? 21 ILE A O    1  
ATOM   301   C CB   . ILE A 1 21 ? -5.488  -3.118  2.039   1.00 0.00 ? 21 ILE A CB   1  
ATOM   302   C CG1  . ILE A 1 21 ? -6.641  -3.149  3.056   1.00 0.00 ? 21 ILE A CG1  1  
ATOM   303   C CG2  . ILE A 1 21 ? -6.013  -3.284  0.622   1.00 0.00 ? 21 ILE A CG2  1  
ATOM   304   C CD1  . ILE A 1 21 ? -7.497  -4.398  2.998   1.00 0.00 ? 21 ILE A CD1  1  
ATOM   305   H H    . ILE A 1 21 ? -4.370  -3.599  4.364   1.00 0.00 ? 21 ILE A H    1  
ATOM   306   H HA   . ILE A 1 21 ? -4.704  -5.111  1.895   1.00 0.00 ? 21 ILE A HA   1  
ATOM   307   H HB   . ILE A 1 21 ? -4.998  -2.162  2.110   1.00 0.00 ? 21 ILE A HB   1  
ATOM   308   H HG12 . ILE A 1 21 ? -6.233  -3.077  4.051   1.00 0.00 ? 21 ILE A HG12 1  
ATOM   309   H HG13 . ILE A 1 21 ? -7.285  -2.300  2.878   1.00 0.00 ? 21 ILE A HG13 1  
ATOM   310   H HG21 . ILE A 1 21 ? -7.014  -2.882  0.559   1.00 0.00 ? 21 ILE A HG21 1  
ATOM   311   H HG22 . ILE A 1 21 ? -6.030  -4.333  0.365   1.00 0.00 ? 21 ILE A HG22 1  
ATOM   312   H HG23 . ILE A 1 21 ? -5.369  -2.755  -0.065  1.00 0.00 ? 21 ILE A HG23 1  
ATOM   313   H HD11 . ILE A 1 21 ? -6.917  -5.250  3.318   1.00 0.00 ? 21 ILE A HD11 1  
ATOM   314   H HD12 . ILE A 1 21 ? -7.845  -4.553  1.988   1.00 0.00 ? 21 ILE A HD12 1  
ATOM   315   H HD13 . ILE A 1 21 ? -8.348  -4.278  3.654   1.00 0.00 ? 21 ILE A HD13 1  
ATOM   316   N N    . PRO A 1 22 ? -2.738  -4.096  0.557   1.00 0.00 ? 22 PRO A N    1  
ATOM   317   C CA   . PRO A 1 22 ? -1.484  -3.677  -0.048  1.00 0.00 ? 22 PRO A CA   1  
ATOM   318   C C    . PRO A 1 22 ? -1.563  -2.265  -0.629  1.00 0.00 ? 22 PRO A C    1  
ATOM   319   O O    . PRO A 1 22 ? -2.617  -1.830  -1.094  1.00 0.00 ? 22 PRO A O    1  
ATOM   320   C CB   . PRO A 1 22 ? -1.241  -4.717  -1.157  1.00 0.00 ? 22 PRO A CB   1  
ATOM   321   C CG   . PRO A 1 22 ? -2.384  -5.682  -1.082  1.00 0.00 ? 22 PRO A CG   1  
ATOM   322   C CD   . PRO A 1 22 ? -3.489  -4.977  -0.339  1.00 0.00 ? 22 PRO A CD   1  
ATOM   323   H HA   . PRO A 1 22 ? -0.686  -3.714  0.674   1.00 0.00 ? 22 PRO A HA   1  
ATOM   324   H HB2  . PRO A 1 22 ? -1.214  -4.224  -2.115  1.00 0.00 ? 22 PRO A HB2  1  
ATOM   325   H HB3  . PRO A 1 22 ? -0.298  -5.215  -0.981  1.00 0.00 ? 22 PRO A HB3  1  
ATOM   326   H HG2  . PRO A 1 22 ? -2.707  -5.944  -2.080  1.00 0.00 ? 22 PRO A HG2  1  
ATOM   327   H HG3  . PRO A 1 22 ? -2.076  -6.569  -0.545  1.00 0.00 ? 22 PRO A HG3  1  
ATOM   328   H HD2  . PRO A 1 22 ? -4.105  -4.405  -1.021  1.00 0.00 ? 22 PRO A HD2  1  
ATOM   329   H HD3  . PRO A 1 22 ? -4.084  -5.684  0.216   1.00 0.00 ? 22 PRO A HD3  1  
ATOM   330   N N    . CYS A 1 23 ? -0.438  -1.553  -0.589  1.00 0.00 ? 23 CYS A N    1  
ATOM   331   C CA   . CYS A 1 23 ? -0.371  -0.179  -1.100  1.00 0.00 ? 23 CYS A CA   1  
ATOM   332   C C    . CYS A 1 23 ? -0.871  -0.093  -2.542  1.00 0.00 ? 23 CYS A C    1  
ATOM   333   O O    . CYS A 1 23 ? -1.560  0.856   -2.910  1.00 0.00 ? 23 CYS A O    1  
ATOM   334   C CB   . CYS A 1 23 ? 1.060   0.369   -1.019  1.00 0.00 ? 23 CYS A CB   1  
ATOM   335   S SG   . CYS A 1 23 ? 1.974   -0.102  0.489   1.00 0.00 ? 23 CYS A SG   1  
ATOM   336   H H    . CYS A 1 23 ? 0.364   -1.959  -0.201  1.00 0.00 ? 23 CYS A H    1  
ATOM   337   H HA   . CYS A 1 23 ? -1.011  0.431   -0.479  1.00 0.00 ? 23 CYS A HA   1  
ATOM   338   H HB2  . CYS A 1 23 ? 1.624   0.010   -1.868  1.00 0.00 ? 23 CYS A HB2  1  
ATOM   339   H HB3  . CYS A 1 23 ? 1.022   1.449   -1.055  1.00 0.00 ? 23 CYS A HB3  1  
ATOM   340   N N    . GLN A 1 24 ? -0.501  -1.082  -3.355  1.00 0.00 ? 24 GLN A N    1  
ATOM   341   C CA   . GLN A 1 24 ? -0.897  -1.124  -4.771  1.00 0.00 ? 24 GLN A CA   1  
ATOM   342   C C    . GLN A 1 24 ? -2.335  -0.655  -4.973  1.00 0.00 ? 24 GLN A C    1  
ATOM   343   O O    . GLN A 1 24 ? -2.621  0.162   -5.849  1.00 0.00 ? 24 GLN A O    1  
ATOM   344   C CB   . GLN A 1 24 ? -0.754  -2.540  -5.360  1.00 0.00 ? 24 GLN A CB   1  
ATOM   345   C CG   . GLN A 1 24 ? 0.216   -3.453  -4.623  1.00 0.00 ? 24 GLN A CG   1  
ATOM   346   C CD   . GLN A 1 24 ? 1.659   -3.017  -4.777  1.00 0.00 ? 24 GLN A CD   1  
ATOM   347   O OE1  . GLN A 1 24 ? 1.944   -1.840  -4.994  1.00 0.00 ? 24 GLN A OE1  1  
ATOM   348   N NE2  . GLN A 1 24 ? 2.578   -3.971  -4.667  1.00 0.00 ? 24 GLN A NE2  1  
ATOM   349   H H    . GLN A 1 24 ? 0.063   -1.793  -2.998  1.00 0.00 ? 24 GLN A H    1  
ATOM   350   H HA   . GLN A 1 24 ? -0.249  -0.460  -5.307  1.00 0.00 ? 24 GLN A HA   1  
ATOM   351   H HB2  . GLN A 1 24 ? -1.723  -3.015  -5.354  1.00 0.00 ? 24 GLN A HB2  1  
ATOM   352   H HB3  . GLN A 1 24 ? -0.419  -2.453  -6.384  1.00 0.00 ? 24 GLN A HB3  1  
ATOM   353   H HG2  . GLN A 1 24 ? -0.035  -3.459  -3.574  1.00 0.00 ? 24 GLN A HG2  1  
ATOM   354   H HG3  . GLN A 1 24 ? 0.116   -4.453  -5.019  1.00 0.00 ? 24 GLN A HG3  1  
ATOM   355   H HE21 . GLN A 1 24 ? 2.275   -4.887  -4.495  1.00 0.00 ? 24 GLN A HE21 1  
ATOM   356   H HE22 . GLN A 1 24 ? 3.520   -3.720  -4.766  1.00 0.00 ? 24 GLN A HE22 1  
ATOM   357   N N    . LEU A 1 25 ? -3.229  -1.198  -4.167  1.00 0.00 ? 25 LEU A N    1  
ATOM   358   C CA   . LEU A 1 25 ? -4.651  -0.869  -4.247  1.00 0.00 ? 25 LEU A CA   1  
ATOM   359   C C    . LEU A 1 25 ? -4.894  0.638   -4.172  1.00 0.00 ? 25 LEU A C    1  
ATOM   360   O O    . LEU A 1 25 ? -5.928  1.127   -4.628  1.00 0.00 ? 25 LEU A O    1  
ATOM   361   C CB   . LEU A 1 25 ? -5.419  -1.576  -3.127  1.00 0.00 ? 25 LEU A CB   1  
ATOM   362   C CG   . LEU A 1 25 ? -6.732  -2.234  -3.559  1.00 0.00 ? 25 LEU A CG   1  
ATOM   363   C CD1  . LEU A 1 25 ? -6.457  -3.437  -4.448  1.00 0.00 ? 25 LEU A CD1  1  
ATOM   364   C CD2  . LEU A 1 25 ? -7.551  -2.641  -2.342  1.00 0.00 ? 25 LEU A CD2  1  
ATOM   365   H H    . LEU A 1 25 ? -2.926  -1.850  -3.507  1.00 0.00 ? 25 LEU A H    1  
ATOM   366   H HA   . LEU A 1 25 ? -5.015  -1.228  -5.195  1.00 0.00 ? 25 LEU A HA   1  
ATOM   367   H HB2  . LEU A 1 25 ? -4.780  -2.338  -2.706  1.00 0.00 ? 25 LEU A HB2  1  
ATOM   368   H HB3  . LEU A 1 25 ? -5.642  -0.852  -2.357  1.00 0.00 ? 25 LEU A HB3  1  
ATOM   369   H HG   . LEU A 1 25 ? -7.311  -1.523  -4.130  1.00 0.00 ? 25 LEU A HG   1  
ATOM   370   H HD11 . LEU A 1 25 ? -5.467  -3.817  -4.244  1.00 0.00 ? 25 LEU A HD11 1  
ATOM   371   H HD12 . LEU A 1 25 ? -6.523  -3.142  -5.484  1.00 0.00 ? 25 LEU A HD12 1  
ATOM   372   H HD13 . LEU A 1 25 ? -7.186  -4.208  -4.246  1.00 0.00 ? 25 LEU A HD13 1  
ATOM   373   H HD21 . LEU A 1 25 ? -7.522  -3.715  -2.230  1.00 0.00 ? 25 LEU A HD21 1  
ATOM   374   H HD22 . LEU A 1 25 ? -8.574  -2.320  -2.473  1.00 0.00 ? 25 LEU A HD22 1  
ATOM   375   H HD23 . LEU A 1 25 ? -7.139  -2.176  -1.458  1.00 0.00 ? 25 LEU A HD23 1  
ATOM   376   N N    . ARG A 1 26 ? -3.950  1.368   -3.590  1.00 0.00 ? 26 ARG A N    1  
ATOM   377   C CA   . ARG A 1 26 ? -4.085  2.817   -3.454  1.00 0.00 ? 26 ARG A CA   1  
ATOM   378   C C    . ARG A 1 26 ? -2.946  3.570   -4.129  1.00 0.00 ? 26 ARG A C    1  
ATOM   379   O O    . ARG A 1 26 ? -2.906  4.801   -4.120  1.00 0.00 ? 26 ARG A O    1  
ATOM   380   C CB   . ARG A 1 26 ? -4.140  3.202   -1.982  1.00 0.00 ? 26 ARG A CB   1  
ATOM   381   C CG   . ARG A 1 26 ? -5.071  2.330   -1.154  1.00 0.00 ? 26 ARG A CG   1  
ATOM   382   C CD   . ARG A 1 26 ? -6.313  3.093   -0.720  1.00 0.00 ? 26 ARG A CD   1  
ATOM   383   N NE   . ARG A 1 26 ? -7.425  2.884   -1.644  1.00 0.00 ? 26 ARG A NE   1  
ATOM   384   C CZ   . ARG A 1 26 ? -8.540  3.611   -1.639  1.00 0.00 ? 26 ARG A CZ   1  
ATOM   385   N NH1  . ARG A 1 26 ? -8.694  4.596   -0.763  1.00 0.00 ? 26 ARG A NH1  1  
ATOM   386   N NH2  . ARG A 1 26 ? -9.503  3.354   -2.512  1.00 0.00 ? 26 ARG A NH2  1  
ATOM   387   H H    . ARG A 1 26 ? -3.154  0.927   -3.238  1.00 0.00 ? 26 ARG A H    1  
ATOM   388   H HA   . ARG A 1 26 ? -5.001  3.098   -3.925  1.00 0.00 ? 26 ARG A HA   1  
ATOM   389   H HB2  . ARG A 1 26 ? -3.144  3.124   -1.571  1.00 0.00 ? 26 ARG A HB2  1  
ATOM   390   H HB3  . ARG A 1 26 ? -4.472  4.224   -1.905  1.00 0.00 ? 26 ARG A HB3  1  
ATOM   391   H HG2  . ARG A 1 26 ? -5.374  1.479   -1.746  1.00 0.00 ? 26 ARG A HG2  1  
ATOM   392   H HG3  . ARG A 1 26 ? -4.543  1.990   -0.275  1.00 0.00 ? 26 ARG A HG3  1  
ATOM   393   H HD2  . ARG A 1 26 ? -6.592  2.755   0.268   1.00 0.00 ? 26 ARG A HD2  1  
ATOM   394   H HD3  . ARG A 1 26 ? -6.070  4.144   -0.678  1.00 0.00 ? 26 ARG A HD3  1  
ATOM   395   H HE   . ARG A 1 26 ? -7.337  2.163   -2.302  1.00 0.00 ? 26 ARG A HE   1  
ATOM   396   H HH11 . ARG A 1 26 ? -7.971  4.797   -0.101  1.00 0.00 ? 26 ARG A HH11 1  
ATOM   397   H HH12 . ARG A 1 26 ? -9.534  5.139   -0.764  1.00 0.00 ? 26 ARG A HH12 1  
ATOM   398   H HH21 . ARG A 1 26 ? -9.392  2.613   -3.175  1.00 0.00 ? 26 ARG A HH21 1  
ATOM   399   H HH22 . ARG A 1 26 ? -10.341 3.900   -2.508  1.00 0.00 ? 26 ARG A HH22 1  
ATOM   400   N N    . CYS A 1 27 ? -2.028  2.827   -4.706  1.00 0.00 ? 27 CYS A N    1  
ATOM   401   C CA   . CYS A 1 27 ? -0.879  3.416   -5.386  1.00 0.00 ? 27 CYS A CA   1  
ATOM   402   C C    . CYS A 1 27 ? -1.252  3.897   -6.786  1.00 0.00 ? 27 CYS A C    1  
ATOM   403   O O    . CYS A 1 27 ? -0.909  5.012   -7.181  1.00 0.00 ? 27 CYS A O    1  
ATOM   404   C CB   . CYS A 1 27 ? 0.281   2.415   -5.478  1.00 0.00 ? 27 CYS A CB   1  
ATOM   405   S SG   . CYS A 1 27 ? 1.769   3.081   -6.293  1.00 0.00 ? 27 CYS A SG   1  
ATOM   406   H H    . CYS A 1 27 ? -2.126  1.863   -4.668  1.00 0.00 ? 27 CYS A H    1  
ATOM   407   H HA   . CYS A 1 27 ? -0.557  4.262   -4.802  1.00 0.00 ? 27 CYS A HA   1  
ATOM   408   H HB2  . CYS A 1 27 ? 0.565   2.107   -4.483  1.00 0.00 ? 27 CYS A HB2  1  
ATOM   409   H HB3  . CYS A 1 27 ? -0.039  1.549   -6.041  1.00 0.00 ? 27 CYS A HB3  1  
ATOM   410   N N    . SER A 1 28 ? -1.931  3.039   -7.544  1.00 0.00 ? 28 SER A N    1  
ATOM   411   C CA   . SER A 1 28 ? -2.321  3.356   -8.899  1.00 0.00 ? 28 SER A CA   1  
ATOM   412   C C    . SER A 1 28 ? -3.510  4.310   -8.975  1.00 0.00 ? 28 SER A C    1  
ATOM   413   O O    . SER A 1 28 ? -3.989  4.623   -10.065 1.00 0.00 ? 28 SER A O    1  
ATOM   414   C CB   . SER A 1 28 ? -2.627  2.076   -9.678  1.00 0.00 ? 28 SER A CB   1  
ATOM   415   O OG   . SER A 1 28 ? -1.443  1.506   -10.209 1.00 0.00 ? 28 SER A OG   1  
ATOM   416   H H    . SER A 1 28 ? -2.149  2.169   -7.194  1.00 0.00 ? 28 SER A H    1  
ATOM   417   H HA   . SER A 1 28 ? -1.485  3.829   -9.337  1.00 0.00 ? 28 SER A HA   1  
ATOM   418   H HB2  . SER A 1 28 ? -3.092  1.358   -9.019  1.00 0.00 ? 28 SER A HB2  1  
ATOM   419   H HB3  . SER A 1 28 ? -3.298  2.305   -10.493 1.00 0.00 ? 28 SER A HB3  1  
ATOM   420   H HG   . SER A 1 28 ? -1.185  1.983   -11.001 1.00 0.00 ? 28 SER A HG   1  
ATOM   421   N N    . SER A 1 29 ? -3.986  4.768   -7.829  1.00 0.00 ? 29 SER A N    1  
ATOM   422   C CA   . SER A 1 29 ? -5.114  5.680   -7.793  1.00 0.00 ? 29 SER A CA   1  
ATOM   423   C C    . SER A 1 29 ? -5.390  6.191   -6.387  1.00 0.00 ? 29 SER A C    1  
ATOM   424   O O    . SER A 1 29 ? -5.131  5.511   -5.395  1.00 0.00 ? 29 SER A O    1  
ATOM   425   C CB   . SER A 1 29 ? -6.350  4.991   -8.345  1.00 0.00 ? 29 SER A CB   1  
ATOM   426   O OG   . SER A 1 29 ? -7.172  4.483   -7.307  1.00 0.00 ? 29 SER A OG   1  
ATOM   427   H H    . SER A 1 29 ? -3.577  4.490   -7.003  1.00 0.00 ? 29 SER A H    1  
ATOM   428   H HA   . SER A 1 29 ? -4.876  6.521   -8.425  1.00 0.00 ? 29 SER A HA   1  
ATOM   429   H HB2  . SER A 1 29 ? -6.918  5.701   -8.924  1.00 0.00 ? 29 SER A HB2  1  
ATOM   430   H HB3  . SER A 1 29 ? -6.035  4.173   -8.972  1.00 0.00 ? 29 SER A HB3  1  
ATOM   431   H HG   . SER A 1 29 ? -8.009  4.955   -7.301  1.00 0.00 ? 29 SER A HG   1  
ATOM   432   N N    . ASN A 1 30 ? -5.923  7.404   -6.327  1.00 0.00 ? 30 ASN A N    1  
ATOM   433   C CA   . ASN A 1 30 ? -6.258  8.058   -5.060  1.00 0.00 ? 30 ASN A CA   1  
ATOM   434   C C    . ASN A 1 30 ? -5.006  8.591   -4.359  1.00 0.00 ? 30 ASN A C    1  
ATOM   435   O O    . ASN A 1 30 ? -5.098  9.399   -3.435  1.00 0.00 ? 30 ASN A O    1  
ATOM   436   C CB   . ASN A 1 30 ? -7.000  7.084   -4.140  1.00 0.00 ? 30 ASN A CB   1  
ATOM   437   C CG   . ASN A 1 30 ? -8.123  7.752   -3.370  1.00 0.00 ? 30 ASN A CG   1  
ATOM   438   O OD1  . ASN A 1 30 ? -9.289  7.667   -3.754  1.00 0.00 ? 30 ASN A OD1  1  
ATOM   439   N ND2  . ASN A 1 30 ? -7.776  8.422   -2.277  1.00 0.00 ? 30 ASN A ND2  1  
ATOM   440   H H    . ASN A 1 30 ? -6.095  7.874   -7.164  1.00 0.00 ? 30 ASN A H    1  
ATOM   441   H HA   . ASN A 1 30 ? -6.908  8.890   -5.283  1.00 0.00 ? 30 ASN A HA   1  
ATOM   442   H HB2  . ASN A 1 30 ? -7.422  6.288   -4.735  1.00 0.00 ? 30 ASN A HB2  1  
ATOM   443   H HB3  . ASN A 1 30 ? -6.301  6.665   -3.433  1.00 0.00 ? 30 ASN A HB3  1  
ATOM   444   H HD21 . ASN A 1 30 ? -6.828  8.448   -2.031  1.00 0.00 ? 30 ASN A HD21 1  
ATOM   445   H HD22 . ASN A 1 30 ? -8.484  8.861   -1.760  1.00 0.00 ? 30 ASN A HD22 1  
ATOM   446   N N    . THR A 1 31 ? -3.844  8.126   -4.815  1.00 0.00 ? 31 THR A N    1  
ATOM   447   C CA   . THR A 1 31 ? -2.546  8.525   -4.267  1.00 0.00 ? 31 THR A CA   1  
ATOM   448   C C    . THR A 1 31 ? -2.595  8.882   -2.776  1.00 0.00 ? 31 THR A C    1  
ATOM   449   O O    . THR A 1 31 ? -2.157  9.962   -2.379  1.00 0.00 ? 31 THR A O    1  
ATOM   450   C CB   . THR A 1 31 ? -1.982  9.703   -5.064  1.00 0.00 ? 31 THR A CB   1  
ATOM   451   O OG1  . THR A 1 31 ? -0.664  10.007  -4.644  1.00 0.00 ? 31 THR A OG1  1  
ATOM   452   C CG2  . THR A 1 31 ? -2.808  10.965  -4.934  1.00 0.00 ? 31 THR A CG2  1  
ATOM   453   H H    . THR A 1 31 ? -3.855  7.491   -5.556  1.00 0.00 ? 31 THR A H    1  
ATOM   454   H HA   . THR A 1 31 ? -1.884  7.685   -4.386  1.00 0.00 ? 31 THR A HA   1  
ATOM   455   H HB   . THR A 1 31 ? -1.951  9.435   -6.110  1.00 0.00 ? 31 THR A HB   1  
ATOM   456   H HG1  . THR A 1 31 ? -0.678  10.297  -3.729  1.00 0.00 ? 31 THR A HG1  1  
ATOM   457   H HG21 . THR A 1 31 ? -2.161  11.796  -4.694  1.00 0.00 ? 31 THR A HG21 1  
ATOM   458   H HG22 . THR A 1 31 ? -3.538  10.839  -4.148  1.00 0.00 ? 31 THR A HG22 1  
ATOM   459   H HG23 . THR A 1 31 ? -3.314  11.162  -5.867  1.00 0.00 ? 31 THR A HG23 1  
ATOM   460   N N    . PRO A 1 32 ? -3.126  7.983   -1.923  1.00 0.00 ? 32 PRO A N    1  
ATOM   461   C CA   . PRO A 1 32 ? -3.226  8.197   -0.493  1.00 0.00 ? 32 PRO A CA   1  
ATOM   462   C C    . PRO A 1 32 ? -2.250  7.339   0.331   1.00 0.00 ? 32 PRO A C    1  
ATOM   463   O O    . PRO A 1 32 ? -2.552  6.999   1.475   1.00 0.00 ? 32 PRO A O    1  
ATOM   464   C CB   . PRO A 1 32 ? -4.649  7.713   -0.252  1.00 0.00 ? 32 PRO A CB   1  
ATOM   465   C CG   . PRO A 1 32 ? -4.807  6.544   -1.189  1.00 0.00 ? 32 PRO A CG   1  
ATOM   466   C CD   . PRO A 1 32 ? -3.700  6.677   -2.254  1.00 0.00 ? 32 PRO A CD   1  
ATOM   467   H HA   . PRO A 1 32 ? -3.140  9.237   -0.222  1.00 0.00 ? 32 PRO A HA   1  
ATOM   468   H HB2  . PRO A 1 32 ? -4.762  7.415   0.781   1.00 0.00 ? 32 PRO A HB2  1  
ATOM   469   H HB3  . PRO A 1 32 ? -5.348  8.502   -0.486  1.00 0.00 ? 32 PRO A HB3  1  
ATOM   470   H HG2  . PRO A 1 32 ? -4.698  5.622   -0.627  1.00 0.00 ? 32 PRO A HG2  1  
ATOM   471   H HG3  . PRO A 1 32 ? -5.787  6.583   -1.645  1.00 0.00 ? 32 PRO A HG3  1  
ATOM   472   H HD2  . PRO A 1 32 ? -2.955  5.896   -2.149  1.00 0.00 ? 32 PRO A HD2  1  
ATOM   473   H HD3  . PRO A 1 32 ? -4.106  6.674   -3.255  1.00 0.00 ? 32 PRO A HD3  1  
ATOM   474   N N    . PRO A 1 33 ? -1.075  6.955   -0.221  1.00 0.00 ? 33 PRO A N    1  
ATOM   475   C CA   . PRO A 1 33 ? -0.111  6.124   0.502   1.00 0.00 ? 33 PRO A CA   1  
ATOM   476   C C    . PRO A 1 33 ? 0.804   6.921   1.413   1.00 0.00 ? 33 PRO A C    1  
ATOM   477   O O    . PRO A 1 33 ? 1.929   7.246   1.044   1.00 0.00 ? 33 PRO A O    1  
ATOM   478   C CB   . PRO A 1 33 ? 0.691   5.491   -0.628  1.00 0.00 ? 33 PRO A CB   1  
ATOM   479   C CG   . PRO A 1 33 ? 0.728   6.545   -1.677  1.00 0.00 ? 33 PRO A CG   1  
ATOM   480   C CD   . PRO A 1 33 ? -0.589  7.273   -1.582  1.00 0.00 ? 33 PRO A CD   1  
ATOM   481   H HA   . PRO A 1 33 ? -0.594  5.354   1.077   1.00 0.00 ? 33 PRO A HA   1  
ATOM   482   H HB2  . PRO A 1 33 ? 1.682   5.242   -0.277  1.00 0.00 ? 33 PRO A HB2  1  
ATOM   483   H HB3  . PRO A 1 33 ? 0.190   4.602   -0.979  1.00 0.00 ? 33 PRO A HB3  1  
ATOM   484   H HG2  . PRO A 1 33 ? 1.547   7.223   -1.487  1.00 0.00 ? 33 PRO A HG2  1  
ATOM   485   H HG3  . PRO A 1 33 ? 0.834   6.090   -2.650  1.00 0.00 ? 33 PRO A HG3  1  
ATOM   486   H HD2  . PRO A 1 33 ? -0.440  8.336   -1.699  1.00 0.00 ? 33 PRO A HD2  1  
ATOM   487   H HD3  . PRO A 1 33 ? -1.268  6.900   -2.331  1.00 0.00 ? 33 PRO A HD3  1  
ATOM   488   N N    . LEU A 1 34 ? 0.329   7.219   2.614   1.00 0.00 ? 34 LEU A N    1  
ATOM   489   C CA   . LEU A 1 34 ? 1.153   7.962   3.565   1.00 0.00 ? 34 LEU A CA   1  
ATOM   490   C C    . LEU A 1 34 ? 2.280   7.069   4.080   1.00 0.00 ? 34 LEU A C    1  
ATOM   491   O O    . LEU A 1 34 ? 3.449   7.449   4.020   1.00 0.00 ? 34 LEU A O    1  
ATOM   492   C CB   . LEU A 1 34 ? 0.330   8.550   4.729   1.00 0.00 ? 34 LEU A CB   1  
ATOM   493   C CG   . LEU A 1 34 ? -1.059  9.075   4.355   1.00 0.00 ? 34 LEU A CG   1  
ATOM   494   C CD1  . LEU A 1 34 ? -2.124  8.480   5.266   1.00 0.00 ? 34 LEU A CD1  1  
ATOM   495   C CD2  . LEU A 1 34 ? -1.091  10.595  4.422   1.00 0.00 ? 34 LEU A CD2  1  
ATOM   496   H H    . LEU A 1 34 ? -0.575  6.925   2.860   1.00 0.00 ? 34 LEU A H    1  
ATOM   497   H HA   . LEU A 1 34 ? 1.608   8.769   3.014   1.00 0.00 ? 34 LEU A HA   1  
ATOM   498   H HB2  . LEU A 1 34 ? 0.214   7.797   5.492   1.00 0.00 ? 34 LEU A HB2  1  
ATOM   499   H HB3  . LEU A 1 34 ? 0.893   9.371   5.151   1.00 0.00 ? 34 LEU A HB3  1  
ATOM   500   H HG   . LEU A 1 34 ? -1.285  8.781   3.344   1.00 0.00 ? 34 LEU A HG   1  
ATOM   501   H HD11 . LEU A 1 34 ? -1.750  7.570   5.712   1.00 0.00 ? 34 LEU A HD11 1  
ATOM   502   H HD12 . LEU A 1 34 ? -3.010  8.261   4.689   1.00 0.00 ? 34 LEU A HD12 1  
ATOM   503   H HD13 . LEU A 1 34 ? -2.367  9.188   6.045   1.00 0.00 ? 34 LEU A HD13 1  
ATOM   504   H HD21 . LEU A 1 34 ? -2.090  10.944  4.207   1.00 0.00 ? 34 LEU A HD21 1  
ATOM   505   H HD22 . LEU A 1 34 ? -0.403  11.002  3.695   1.00 0.00 ? 34 LEU A HD22 1  
ATOM   506   H HD23 . LEU A 1 34 ? -0.802  10.918  5.411   1.00 0.00 ? 34 LEU A HD23 1  
ATOM   507   N N    . THR A 1 35 ? 1.940   5.866   4.543   1.00 0.00 ? 35 THR A N    1  
ATOM   508   C CA   . THR A 1 35 ? 2.946   4.933   5.007   1.00 0.00 ? 35 THR A CA   1  
ATOM   509   C C    . THR A 1 35 ? 3.447   4.087   3.835   1.00 0.00 ? 35 THR A C    1  
ATOM   510   O O    . THR A 1 35 ? 4.264   3.184   4.015   1.00 0.00 ? 35 THR A O    1  
ATOM   511   C CB   . THR A 1 35 ? 2.376   4.029   6.102   1.00 0.00 ? 35 THR A CB   1  
ATOM   512   O OG1  . THR A 1 35 ? 3.362   3.126   6.570   1.00 0.00 ? 35 THR A OG1  1  
ATOM   513   C CG2  . THR A 1 35 ? 1.186   3.213   5.645   1.00 0.00 ? 35 THR A CG2  1  
ATOM   514   H H    . THR A 1 35 ? 1.005   5.588   4.547   1.00 0.00 ? 35 THR A H    1  
ATOM   515   H HA   . THR A 1 35 ? 3.769   5.502   5.409   1.00 0.00 ? 35 THR A HA   1  
ATOM   516   H HB   . THR A 1 35 ? 2.057   4.644   6.931   1.00 0.00 ? 35 THR A HB   1  
ATOM   517   H HG1  . THR A 1 35 ? 3.060   2.717   7.384   1.00 0.00 ? 35 THR A HG1  1  
ATOM   518   H HG21 . THR A 1 35 ? 1.306   2.190   5.969   1.00 0.00 ? 35 THR A HG21 1  
ATOM   519   H HG22 . THR A 1 35 ? 1.120   3.244   4.567   1.00 0.00 ? 35 THR A HG22 1  
ATOM   520   H HG23 . THR A 1 35 ? 0.283   3.623   6.073   1.00 0.00 ? 35 THR A HG23 1  
ATOM   521   N N    . CYS A 1 36 ? 2.947   4.386   2.628   1.00 0.00 ? 36 CYS A N    1  
ATOM   522   C CA   . CYS A 1 36 ? 3.345   3.649   1.437   1.00 0.00 ? 36 CYS A CA   1  
ATOM   523   C C    . CYS A 1 36 ? 3.956   4.570   0.380   1.00 0.00 ? 36 CYS A C    1  
ATOM   524   O O    . CYS A 1 36 ? 4.421   4.105   -0.658  1.00 0.00 ? 36 CYS A O    1  
ATOM   525   C CB   . CYS A 1 36 ? 2.143   2.911   0.842   1.00 0.00 ? 36 CYS A CB   1  
ATOM   526   S SG   . CYS A 1 36 ? 1.635   1.431   1.777   1.00 0.00 ? 36 CYS A SG   1  
ATOM   527   H H    . CYS A 1 36 ? 2.296   5.116   2.540   1.00 0.00 ? 36 CYS A H    1  
ATOM   528   H HA   . CYS A 1 36 ? 4.084   2.927   1.735   1.00 0.00 ? 36 CYS A HA   1  
ATOM   529   H HB2  . CYS A 1 36 ? 1.298   3.582   0.812   1.00 0.00 ? 36 CYS A HB2  1  
ATOM   530   H HB3  . CYS A 1 36 ? 2.383   2.598   -0.163  1.00 0.00 ? 36 CYS A HB3  1  
ATOM   531   N N    . GLN A 1 37 ? 3.942   5.878   0.638   1.00 0.00 ? 37 GLN A N    1  
ATOM   532   C CA   . GLN A 1 37 ? 4.488   6.854   -0.303  1.00 0.00 ? 37 GLN A CA   1  
ATOM   533   C C    . GLN A 1 37 ? 5.856   6.424   -0.817  1.00 0.00 ? 37 GLN A C    1  
ATOM   534   O O    . GLN A 1 37 ? 6.238   6.744   -1.942  1.00 0.00 ? 37 GLN A O    1  
ATOM   535   C CB   . GLN A 1 37 ? 4.587   8.230   0.364   1.00 0.00 ? 37 GLN A CB   1  
ATOM   536   C CG   . GLN A 1 37 ? 4.312   9.396   -0.573  1.00 0.00 ? 37 GLN A CG   1  
ATOM   537   C CD   . GLN A 1 37 ? 3.043   9.217   -1.384  1.00 0.00 ? 37 GLN A CD   1  
ATOM   538   O OE1  . GLN A 1 37 ? 3.051   8.584   -2.439  1.00 0.00 ? 37 GLN A OE1  1  
ATOM   539   N NE2  . GLN A 1 37 ? 1.943   9.777   -0.893  1.00 0.00 ? 37 GLN A NE2  1  
ATOM   540   H H    . GLN A 1 37 ? 3.548   6.198   1.475   1.00 0.00 ? 37 GLN A H    1  
ATOM   541   H HA   . GLN A 1 37 ? 3.814   6.911   -1.138  1.00 0.00 ? 37 GLN A HA   1  
ATOM   542   H HB2  . GLN A 1 37 ? 3.876   8.275   1.175   1.00 0.00 ? 37 GLN A HB2  1  
ATOM   543   H HB3  . GLN A 1 37 ? 5.582   8.348   0.766   1.00 0.00 ? 37 GLN A HB3  1  
ATOM   544   H HG2  . GLN A 1 37 ? 4.217   10.296  0.016   1.00 0.00 ? 37 GLN A HG2  1  
ATOM   545   H HG3  . GLN A 1 37 ? 5.145   9.499   -1.253  1.00 0.00 ? 37 GLN A HG3  1  
ATOM   546   H HE21 . GLN A 1 37 ? 2.011   10.267  -0.047  1.00 0.00 ? 37 GLN A HE21 1  
ATOM   547   H HE22 . GLN A 1 37 ? 1.109   9.678   -1.397  1.00 0.00 ? 37 GLN A HE22 1  
ATOM   548   N N    . ARG A 1 38 ? 6.580   5.690   0.011   1.00 0.00 ? 38 ARG A N    1  
ATOM   549   C CA   . ARG A 1 38 ? 7.899   5.204   -0.354  1.00 0.00 ? 38 ARG A CA   1  
ATOM   550   C C    . ARG A 1 38 ? 7.767   3.960   -1.230  1.00 0.00 ? 38 ARG A C    1  
ATOM   551   O O    . ARG A 1 38 ? 8.533   3.762   -2.172  1.00 0.00 ? 38 ARG A O    1  
ATOM   552   C CB   . ARG A 1 38 ? 8.709   4.911   0.920   1.00 0.00 ? 38 ARG A CB   1  
ATOM   553   C CG   . ARG A 1 38 ? 9.620   3.695   0.836   1.00 0.00 ? 38 ARG A CG   1  
ATOM   554   C CD   . ARG A 1 38 ? 10.853  3.978   -0.007  1.00 0.00 ? 38 ARG A CD   1  
ATOM   555   N NE   . ARG A 1 38 ? 11.562  2.748   -0.358  1.00 0.00 ? 38 ARG A NE   1  
ATOM   556   C CZ   . ARG A 1 38 ? 12.889  2.634   -0.391  1.00 0.00 ? 38 ARG A CZ   1  
ATOM   557   N NH1  . ARG A 1 38 ? 13.666  3.673   -0.105  1.00 0.00 ? 38 ARG A NH1  1  
ATOM   558   N NH2  . ARG A 1 38 ? 13.443  1.473   -0.715  1.00 0.00 ? 38 ARG A NH2  1  
ATOM   559   H H    . ARG A 1 38 ? 6.215   5.462   0.889   1.00 0.00 ? 38 ARG A H    1  
ATOM   560   H HA   . ARG A 1 38 ? 8.397   5.979   -0.919  1.00 0.00 ? 38 ARG A HA   1  
ATOM   561   H HB2  . ARG A 1 38 ? 9.322   5.771   1.143   1.00 0.00 ? 38 ARG A HB2  1  
ATOM   562   H HB3  . ARG A 1 38 ? 8.019   4.757   1.737   1.00 0.00 ? 38 ARG A HB3  1  
ATOM   563   H HG2  . ARG A 1 38 ? 9.933   3.426   1.833   1.00 0.00 ? 38 ARG A HG2  1  
ATOM   564   H HG3  . ARG A 1 38 ? 9.072   2.875   0.398   1.00 0.00 ? 38 ARG A HG3  1  
ATOM   565   H HD2  . ARG A 1 38 ? 10.541  4.488   -0.907  1.00 0.00 ? 38 ARG A HD2  1  
ATOM   566   H HD3  . ARG A 1 38 ? 11.506  4.626   0.557   1.00 0.00 ? 38 ARG A HD3  1  
ATOM   567   H HE   . ARG A 1 38 ? 11.019  1.963   -0.579  1.00 0.00 ? 38 ARG A HE   1  
ATOM   568   H HH11 . ARG A 1 38 ? 13.259  4.552   0.137   1.00 0.00 ? 38 ARG A HH11 1  
ATOM   569   H HH12 . ARG A 1 38 ? 14.661  3.574   -0.132  1.00 0.00 ? 38 ARG A HH12 1  
ATOM   570   H HH21 . ARG A 1 38 ? 12.865  0.687   -0.934  1.00 0.00 ? 38 ARG A HH21 1  
ATOM   571   H HH22 . ARG A 1 38 ? 14.439  1.384   -0.741  1.00 0.00 ? 38 ARG A HH22 1  
ATOM   572   N N    . TYR A 1 39 ? 6.784   3.126   -0.906  1.00 0.00 ? 39 TYR A N    1  
ATOM   573   C CA   . TYR A 1 39 ? 6.540   1.897   -1.642  1.00 0.00 ? 39 TYR A CA   1  
ATOM   574   C C    . TYR A 1 39 ? 5.840   2.162   -2.968  1.00 0.00 ? 39 TYR A C    1  
ATOM   575   O O    . TYR A 1 39 ? 6.166   1.546   -3.982  1.00 0.00 ? 39 TYR A O    1  
ATOM   576   C CB   . TYR A 1 39 ? 5.708   0.932   -0.797  1.00 0.00 ? 39 TYR A CB   1  
ATOM   577   C CG   . TYR A 1 39 ? 5.560   -0.434  -1.421  1.00 0.00 ? 39 TYR A CG   1  
ATOM   578   C CD1  . TYR A 1 39 ? 4.667   -0.648  -2.461  1.00 0.00 ? 39 TYR A CD1  1  
ATOM   579   C CD2  . TYR A 1 39 ? 6.323   -1.507  -0.978  1.00 0.00 ? 39 TYR A CD2  1  
ATOM   580   C CE1  . TYR A 1 39 ? 4.536   -1.894  -3.044  1.00 0.00 ? 39 TYR A CE1  1  
ATOM   581   C CE2  . TYR A 1 39 ? 6.198   -2.756  -1.554  1.00 0.00 ? 39 TYR A CE2  1  
ATOM   582   C CZ   . TYR A 1 39 ? 5.303   -2.944  -2.587  1.00 0.00 ? 39 TYR A CZ   1  
ATOM   583   O OH   . TYR A 1 39 ? 5.176   -4.187  -3.164  1.00 0.00 ? 39 TYR A OH   1  
ATOM   584   H H    . TYR A 1 39 ? 6.213   3.339   -0.147  1.00 0.00 ? 39 TYR A H    1  
ATOM   585   H HA   . TYR A 1 39 ? 7.494   1.447   -1.844  1.00 0.00 ? 39 TYR A HA   1  
ATOM   586   H HB2  . TYR A 1 39 ? 6.179   0.809   0.167   1.00 0.00 ? 39 TYR A HB2  1  
ATOM   587   H HB3  . TYR A 1 39 ? 4.719   1.345   -0.659  1.00 0.00 ? 39 TYR A HB3  1  
ATOM   588   H HD1  . TYR A 1 39 ? 4.067   0.177   -2.816  1.00 0.00 ? 39 TYR A HD1  1  
ATOM   589   H HD2  . TYR A 1 39 ? 7.023   -1.355  -0.170  1.00 0.00 ? 39 TYR A HD2  1  
ATOM   590   H HE1  . TYR A 1 39 ? 3.837   -2.039  -3.852  1.00 0.00 ? 39 TYR A HE1  1  
ATOM   591   H HE2  . TYR A 1 39 ? 6.798   -3.578  -1.195  1.00 0.00 ? 39 TYR A HE2  1  
ATOM   592   H HH   . TYR A 1 39 ? 5.917   -4.345  -3.754  1.00 0.00 ? 39 TYR A HH   1  
ATOM   593   N N    . CYS A 1 40 ? 4.878   3.077   -2.962  1.00 0.00 ? 40 CYS A N    1  
ATOM   594   C CA   . CYS A 1 40 ? 4.147   3.403   -4.183  1.00 0.00 ? 40 CYS A CA   1  
ATOM   595   C C    . CYS A 1 40 ? 5.106   3.885   -5.260  1.00 0.00 ? 40 CYS A C    1  
ATOM   596   O O    . CYS A 1 40 ? 4.999   3.490   -6.421  1.00 0.00 ? 40 CYS A O    1  
ATOM   597   C CB   . CYS A 1 40 ? 3.066   4.457   -3.920  1.00 0.00 ? 40 CYS A CB   1  
ATOM   598   S SG   . CYS A 1 40 ? 2.066   4.873   -5.385  1.00 0.00 ? 40 CYS A SG   1  
ATOM   599   H H    . CYS A 1 40 ? 4.661   3.540   -2.126  1.00 0.00 ? 40 CYS A H    1  
ATOM   600   H HA   . CYS A 1 40 ? 3.676   2.496   -4.531  1.00 0.00 ? 40 CYS A HA   1  
ATOM   601   H HB2  . CYS A 1 40 ? 2.390   4.092   -3.160  1.00 0.00 ? 40 CYS A HB2  1  
ATOM   602   H HB3  . CYS A 1 40 ? 3.534   5.367   -3.572  1.00 0.00 ? 40 CYS A HB3  1  
ATOM   603   N N    . ASN A 1 41 ? 6.058   4.726   -4.870  1.00 0.00 ? 41 ASN A N    1  
ATOM   604   C CA   . ASN A 1 41 ? 7.041   5.234   -5.809  1.00 0.00 ? 41 ASN A CA   1  
ATOM   605   C C    . ASN A 1 41 ? 8.028   4.136   -6.192  1.00 0.00 ? 41 ASN A C    1  
ATOM   606   O O    . ASN A 1 41 ? 8.756   4.251   -7.178  1.00 0.00 ? 41 ASN A O    1  
ATOM   607   C CB   . ASN A 1 41 ? 7.761   6.464   -5.228  1.00 0.00 ? 41 ASN A CB   1  
ATOM   608   C CG   . ASN A 1 41 ? 9.222   6.213   -4.893  1.00 0.00 ? 41 ASN A CG   1  
ATOM   609   O OD1  . ASN A 1 41 ? 10.114  6.880   -5.416  1.00 0.00 ? 41 ASN A OD1  1  
ATOM   610   N ND2  . ASN A 1 41 ? 9.471   5.246   -4.017  1.00 0.00 ? 41 ASN A ND2  1  
ATOM   611   H H    . ASN A 1 41 ? 6.106   4.997   -3.933  1.00 0.00 ? 41 ASN A H    1  
ATOM   612   H HA   . ASN A 1 41 ? 6.508   5.522   -6.689  1.00 0.00 ? 41 ASN A HA   1  
ATOM   613   H HB2  . ASN A 1 41 ? 7.715   7.268   -5.947  1.00 0.00 ? 41 ASN A HB2  1  
ATOM   614   H HB3  . ASN A 1 41 ? 7.253   6.772   -4.325  1.00 0.00 ? 41 ASN A HB3  1  
ATOM   615   H HD21 . ASN A 1 41 ? 8.711   4.755   -3.640  1.00 0.00 ? 41 ASN A HD21 1  
ATOM   616   H HD22 . ASN A 1 41 ? 10.405  5.063   -3.784  1.00 0.00 ? 41 ASN A HD22 1  
ATOM   617   N N    . ALA A 1 42 ? 8.024   3.065   -5.413  1.00 0.00 ? 42 ALA A N    1  
ATOM   618   C CA   . ALA A 1 42 ? 8.893   1.926   -5.668  1.00 0.00 ? 42 ALA A CA   1  
ATOM   619   C C    . ALA A 1 42 ? 8.066   0.698   -6.017  1.00 0.00 ? 42 ALA A C    1  
ATOM   620   O O    . ALA A 1 42 ? 8.489   -0.438  -5.808  1.00 0.00 ? 42 ALA A O    1  
ATOM   621   C CB   . ALA A 1 42 ? 9.786   1.652   -4.467  1.00 0.00 ? 42 ALA A CB   1  
ATOM   622   H H    . ALA A 1 42 ? 7.407   3.035   -4.655  1.00 0.00 ? 42 ALA A H    1  
ATOM   623   H HA   . ALA A 1 42 ? 9.517   2.171   -6.511  1.00 0.00 ? 42 ALA A HA   1  
ATOM   624   H HB1  . ALA A 1 42 ? 10.132  0.629   -4.502  1.00 0.00 ? 42 ALA A HB1  1  
ATOM   625   H HB2  . ALA A 1 42 ? 9.226   1.812   -3.558  1.00 0.00 ? 42 ALA A HB2  1  
ATOM   626   H HB3  . ALA A 1 42 ? 10.634  2.320   -4.490  1.00 0.00 ? 42 ALA A HB3  1  
ATOM   627   N N    . SER A 1 43 ? 6.880   0.950   -6.555  1.00 0.00 ? 43 SER A N    1  
ATOM   628   C CA   . SER A 1 43 ? 5.968   -0.111  -6.950  1.00 0.00 ? 43 SER A CA   1  
ATOM   629   C C    . SER A 1 43 ? 5.377   0.158   -8.334  1.00 0.00 ? 43 SER A C    1  
ATOM   630   O O    . SER A 1 43 ? 4.968   -0.771  -9.031  1.00 0.00 ? 43 SER A O    1  
ATOM   631   C CB   . SER A 1 43 ? 4.845   -0.260  -5.922  1.00 0.00 ? 43 SER A CB   1  
ATOM   632   O OG   . SER A 1 43 ? 4.123   -1.462  -6.126  1.00 0.00 ? 43 SER A OG   1  
ATOM   633   H H    . SER A 1 43 ? 6.615   1.876   -6.689  1.00 0.00 ? 43 SER A H    1  
ATOM   634   H HA   . SER A 1 43 ? 6.531   -1.027  -6.987  1.00 0.00 ? 43 SER A HA   1  
ATOM   635   H HB2  . SER A 1 43 ? 5.268   -0.274  -4.929  1.00 0.00 ? 43 SER A HB2  1  
ATOM   636   H HB3  . SER A 1 43 ? 4.165   0.574   -6.012  1.00 0.00 ? 43 SER A HB3  1  
ATOM   637   H HG   . SER A 1 43 ? 3.946   -1.574  -7.063  1.00 0.00 ? 43 SER A HG   1  
ATOM   638   N N    . VAL A 1 44 ? 5.337   1.429   -8.731  1.00 0.00 ? 44 VAL A N    1  
ATOM   639   C CA   . VAL A 1 44 ? 4.801   1.803   -10.030 1.00 0.00 ? 44 VAL A CA   1  
ATOM   640   C C    . VAL A 1 44 ? 5.653   2.887   -10.681 1.00 0.00 ? 44 VAL A C    1  
ATOM   641   O O    . VAL A 1 44 ? 5.155   3.956   -11.037 1.00 0.00 ? 44 VAL A O    1  
ATOM   642   C CB   . VAL A 1 44 ? 3.344   2.294   -9.924  1.00 0.00 ? 44 VAL A CB   1  
ATOM   643   C CG1  . VAL A 1 44 ? 2.731   2.457   -11.307 1.00 0.00 ? 44 VAL A CG1  1  
ATOM   644   C CG2  . VAL A 1 44 ? 2.517   1.338   -9.076  1.00 0.00 ? 44 VAL A CG2  1  
ATOM   645   H H    . VAL A 1 44 ? 5.677   2.129   -8.144  1.00 0.00 ? 44 VAL A H    1  
ATOM   646   H HA   . VAL A 1 44 ? 4.823   0.928   -10.654 1.00 0.00 ? 44 VAL A HA   1  
ATOM   647   H HB   . VAL A 1 44 ? 3.345   3.260   -9.441  1.00 0.00 ? 44 VAL A HB   1  
ATOM   648   H HG11 . VAL A 1 44 ? 1.923   3.172   -11.261 1.00 0.00 ? 44 VAL A HG11 1  
ATOM   649   H HG12 . VAL A 1 44 ? 2.351   1.505   -11.647 1.00 0.00 ? 44 VAL A HG12 1  
ATOM   650   H HG13 . VAL A 1 44 ? 3.485   2.810   -11.996 1.00 0.00 ? 44 VAL A HG13 1  
ATOM   651   H HG21 . VAL A 1 44 ? 1.561   1.789   -8.855  1.00 0.00 ? 44 VAL A HG21 1  
ATOM   652   H HG22 . VAL A 1 44 ? 3.039   1.131   -8.154  1.00 0.00 ? 44 VAL A HG22 1  
ATOM   653   H HG23 . VAL A 1 44 ? 2.363   0.417   -9.618  1.00 0.00 ? 44 VAL A HG23 1  
ATOM   654   N N    . THR A 1 45 ? 6.947   2.596   -10.811 1.00 0.00 ? 45 THR A N    1  
ATOM   655   C CA   . THR A 1 45 ? 7.914   3.506   -11.394 1.00 0.00 ? 45 THR A CA   1  
ATOM   656   C C    . THR A 1 45 ? 7.292   4.434   -12.439 1.00 0.00 ? 45 THR A C    1  
ATOM   657   O O    . THR A 1 45 ? 6.374   4.045   -13.161 1.00 0.00 ? 45 THR A O    1  
ATOM   658   C CB   . THR A 1 45 ? 9.070   2.720   -12.020 1.00 0.00 ? 45 THR A CB   1  
ATOM   659   O OG1  . THR A 1 45 ? 8.921   1.331   -11.788 1.00 0.00 ? 45 THR A OG1  1  
ATOM   660   C CG2  . THR A 1 45 ? 10.427  3.129   -11.489 1.00 0.00 ? 45 THR A CG2  1  
ATOM   661   H H    . THR A 1 45 ? 7.267   1.745   -10.486 1.00 0.00 ? 45 THR A H    1  
ATOM   662   H HA   . THR A 1 45 ? 8.298   4.089   -10.588 1.00 0.00 ? 45 THR A HA   1  
ATOM   663   H HB   . THR A 1 45 ? 9.070   2.887   -13.088 1.00 0.00 ? 45 THR A HB   1  
ATOM   664   H HG1  . THR A 1 45 ? 8.374   0.947   -12.477 1.00 0.00 ? 45 THR A HG1  1  
ATOM   665   H HG21 . THR A 1 45 ? 11.001  3.587   -12.282 1.00 0.00 ? 45 THR A HG21 1  
ATOM   666   H HG22 . THR A 1 45 ? 10.949  2.257   -11.124 1.00 0.00 ? 45 THR A HG22 1  
ATOM   667   H HG23 . THR A 1 45 ? 10.300  3.837   -10.683 1.00 0.00 ? 45 THR A HG23 1  
ATOM   668   N N    . ASN A 1 46 ? 7.805   5.657   -12.518 1.00 0.00 ? 46 ASN A N    1  
ATOM   669   C CA   . ASN A 1 46 ? 7.304   6.634   -13.476 1.00 0.00 ? 46 ASN A CA   1  
ATOM   670   C C    . ASN A 1 46 ? 8.203   7.866   -13.519 1.00 0.00 ? 46 ASN A C    1  
ATOM   671   O O    . ASN A 1 46 ? 9.127   8.002   -12.718 1.00 0.00 ? 46 ASN A O    1  
ATOM   672   C CB   . ASN A 1 46 ? 5.871   7.041   -13.120 1.00 0.00 ? 46 ASN A CB   1  
ATOM   673   C CG   . ASN A 1 46 ? 4.945   7.012   -14.321 1.00 0.00 ? 46 ASN A CG   1  
ATOM   674   O OD1  . ASN A 1 46 ? 5.366   7.263   -15.450 1.00 0.00 ? 46 ASN A OD1  1  
ATOM   675   N ND2  . ASN A 1 46 ? 3.675   6.707   -14.082 1.00 0.00 ? 46 ASN A ND2  1  
ATOM   676   H H    . ASN A 1 46 ? 8.539   5.907   -11.922 1.00 0.00 ? 46 ASN A H    1  
ATOM   677   H HA   . ASN A 1 46 ? 7.305   6.169   -14.448 1.00 0.00 ? 46 ASN A HA   1  
ATOM   678   H HB2  . ASN A 1 46 ? 5.485   6.360   -12.376 1.00 0.00 ? 46 ASN A HB2  1  
ATOM   679   H HB3  . ASN A 1 46 ? 5.877   8.043   -12.715 1.00 0.00 ? 46 ASN A HB3  1  
ATOM   680   H HD21 . ASN A 1 46 ? 3.409   6.519   -13.158 1.00 0.00 ? 46 ASN A HD21 1  
ATOM   681   H HD22 . ASN A 1 46 ? 3.054   6.681   -14.841 1.00 0.00 ? 46 ASN A HD22 1  
ATOM   682   N N    . SER A 1 47 ? 7.923   8.761   -14.462 1.00 0.00 ? 47 SER A N    1  
ATOM   683   C CA   . SER A 1 47 ? 8.702   9.986   -14.616 1.00 0.00 ? 47 SER A CA   1  
ATOM   684   C C    . SER A 1 47 ? 10.119  9.678   -15.091 1.00 0.00 ? 47 SER A C    1  
ATOM   685   O O    . SER A 1 47 ? 10.681  8.635   -14.757 1.00 0.00 ? 47 SER A O    1  
ATOM   686   C CB   . SER A 1 47 ? 8.753   10.755  -13.294 1.00 0.00 ? 47 SER A CB   1  
ATOM   687   O OG   . SER A 1 47 ? 8.690   12.154  -13.514 1.00 0.00 ? 47 SER A OG   1  
ATOM   688   H H    . SER A 1 47 ? 7.172   8.594   -15.070 1.00 0.00 ? 47 SER A H    1  
ATOM   689   H HA   . SER A 1 47 ? 8.212   10.597  -15.358 1.00 0.00 ? 47 SER A HA   1  
ATOM   690   H HB2  . SER A 1 47 ? 7.916   10.463  -12.678 1.00 0.00 ? 47 SER A HB2  1  
ATOM   691   H HB3  . SER A 1 47 ? 9.675   10.525  -12.781 1.00 0.00 ? 47 SER A HB3  1  
ATOM   692   H HG   . SER A 1 47 ? 8.826   12.615  -12.684 1.00 0.00 ? 47 SER A HG   1  
ATOM   693   N N    . VAL A 1 48 ? 10.676  10.587  -15.891 1.00 0.00 ? 48 VAL A N    1  
ATOM   694   C CA   . VAL A 1 48 ? 12.013  10.440  -16.442 1.00 0.00 ? 48 VAL A CA   1  
ATOM   695   C C    . VAL A 1 48 ? 12.195  9.091   -17.101 1.00 0.00 ? 48 VAL A C    1  
ATOM   696   O O    . VAL A 1 48 ? 12.542  8.095   -16.467 1.00 0.00 ? 48 VAL A O    1  
ATOM   697   C CB   . VAL A 1 48 ? 13.136  10.661  -15.420 1.00 0.00 ? 48 VAL A CB   1  
ATOM   698   C CG1  . VAL A 1 48 ? 13.248  12.135  -15.062 1.00 0.00 ? 48 VAL A CG1  1  
ATOM   699   C CG2  . VAL A 1 48 ? 12.944  9.817   -14.170 1.00 0.00 ? 48 VAL A CG2  1  
ATOM   700   H H    . VAL A 1 48 ? 10.163  11.378  -16.139 1.00 0.00 ? 48 VAL A H    1  
ATOM   701   H HA   . VAL A 1 48 ? 12.119  11.197  -17.208 1.00 0.00 ? 48 VAL A HA   1  
ATOM   702   H HB   . VAL A 1 48 ? 14.056  10.360  -15.896 1.00 0.00 ? 48 VAL A HB   1  
ATOM   703   H HG11 . VAL A 1 48 ? 13.310  12.722  -15.966 1.00 0.00 ? 48 VAL A HG11 1  
ATOM   704   H HG12 . VAL A 1 48 ? 14.136  12.294  -14.468 1.00 0.00 ? 48 VAL A HG12 1  
ATOM   705   H HG13 . VAL A 1 48 ? 12.378  12.435  -14.496 1.00 0.00 ? 48 VAL A HG13 1  
ATOM   706   H HG21 . VAL A 1 48 ? 12.852  8.778   -14.444 1.00 0.00 ? 48 VAL A HG21 1  
ATOM   707   H HG22 . VAL A 1 48 ? 12.051  10.135  -13.653 1.00 0.00 ? 48 VAL A HG22 1  
ATOM   708   H HG23 . VAL A 1 48 ? 13.798  9.941   -13.519 1.00 0.00 ? 48 VAL A HG23 1  
ATOM   709   N N    . LYS A 1 49 ? 11.955  9.093   -18.390 1.00 0.00 ? 49 LYS A N    1  
ATOM   710   C CA   . LYS A 1 49 ? 12.079  7.893   -19.212 1.00 0.00 ? 49 LYS A CA   1  
ATOM   711   C C    . LYS A 1 49 ? 11.051  6.841   -18.808 1.00 0.00 ? 49 LYS A C    1  
ATOM   712   O O    . LYS A 1 49 ? 10.536  6.858   -17.689 1.00 0.00 ? 49 LYS A O    1  
ATOM   713   C CB   . LYS A 1 49 ? 13.490  7.314   -19.095 1.00 0.00 ? 49 LYS A CB   1  
ATOM   714   C CG   . LYS A 1 49 ? 14.058  6.824   -20.418 1.00 0.00 ? 49 LYS A CG   1  
ATOM   715   C CD   . LYS A 1 49 ? 15.354  7.537   -20.772 1.00 0.00 ? 49 LYS A CD   1  
ATOM   716   C CE   . LYS A 1 49 ? 15.133  8.611   -21.827 1.00 0.00 ? 49 LYS A CE   1  
ATOM   717   N NZ   . LYS A 1 49 ? 16.101  8.493   -22.952 1.00 0.00 ? 49 LYS A NZ   1  
ATOM   718   H H    . LYS A 1 49 ? 11.687  9.939   -18.800 1.00 0.00 ? 49 LYS A H    1  
ATOM   719   H HA   . LYS A 1 49 ? 11.901  8.176   -20.238 1.00 0.00 ? 49 LYS A HA   1  
ATOM   720   H HB2  . LYS A 1 49 ? 14.148  8.075   -18.703 1.00 0.00 ? 49 LYS A HB2  1  
ATOM   721   H HB3  . LYS A 1 49 ? 13.469  6.481   -18.407 1.00 0.00 ? 49 LYS A HB3  1  
ATOM   722   H HG2  . LYS A 1 49 ? 14.251  5.764   -20.344 1.00 0.00 ? 49 LYS A HG2  1  
ATOM   723   H HG3  . LYS A 1 49 ? 13.332  7.005   -21.198 1.00 0.00 ? 49 LYS A HG3  1  
ATOM   724   H HD2  . LYS A 1 49 ? 15.755  7.998   -19.882 1.00 0.00 ? 49 LYS A HD2  1  
ATOM   725   H HD3  . LYS A 1 49 ? 16.059  6.812   -21.151 1.00 0.00 ? 49 LYS A HD3  1  
ATOM   726   H HE2  . LYS A 1 49 ? 14.130  8.516   -22.216 1.00 0.00 ? 49 LYS A HE2  1  
ATOM   727   H HE3  . LYS A 1 49 ? 15.248  9.580   -21.364 1.00 0.00 ? 49 LYS A HE3  1  
ATOM   728   H HZ1  . LYS A 1 49 ? 15.611  8.623   -23.860 1.00 0.00 ? 49 LYS A HZ1  1  
ATOM   729   H HZ2  . LYS A 1 49 ? 16.548  7.554   -22.944 1.00 0.00 ? 49 LYS A HZ2  1  
ATOM   730   H HZ3  . LYS A 1 49 ? 16.842  9.217   -22.864 1.00 0.00 ? 49 LYS A HZ3  1  
HETATM 731   N N    . CY1 A 1 50 ? 10.760  5.925   -19.726 1.00 0.00 ? 50 CY1 A N    1  
HETATM 732   C CA   . CY1 A 1 50 ? 9.796   4.862   -19.470 1.00 0.00 ? 50 CY1 A CA   1  
HETATM 733   C CB   . CY1 A 1 50 ? 8.394   5.303   -19.899 1.00 0.00 ? 50 CY1 A CB   1  
HETATM 734   S SG   . CY1 A 1 50 ? 7.344   5.726   -18.495 1.00 0.00 ? 50 CY1 A SG   1  
HETATM 735   C CD   . CY1 A 1 50 ? 6.985   4.110   -17.777 1.00 0.00 ? 50 CY1 A CD   1  
HETATM 736   N NE   . CY1 A 1 50 ? 6.063   3.366   -18.631 1.00 0.00 ? 50 CY1 A NE   1  
HETATM 737   C CZ   . CY1 A 1 50 ? 4.888   3.831   -19.044 1.00 0.00 ? 50 CY1 A CZ   1  
HETATM 738   O OAC  . CY1 A 1 50 ? 4.449   4.944   -18.751 1.00 0.00 ? 50 CY1 A OAC  1  
HETATM 739   C CM   . CY1 A 1 50 ? 4.082   2.896   -19.925 1.00 0.00 ? 50 CY1 A CM   1  
HETATM 740   C C    . CY1 A 1 50 ? 10.189  3.583   -20.203 1.00 0.00 ? 50 CY1 A C    1  
HETATM 741   O O    . CY1 A 1 50 ? 9.907   3.432   -21.392 1.00 0.00 ? 50 CY1 A O    1  
HETATM 742   H H    . CY1 A 1 50 ? 11.207  5.965   -20.598 1.00 0.00 ? 50 CY1 A H    1  
HETATM 743   H HA   . CY1 A 1 50 ? 9.794   4.667   -18.408 1.00 0.00 ? 50 CY1 A HA   1  
HETATM 744   H HB2  . CY1 A 1 50 ? 8.477   6.170   -20.538 1.00 0.00 ? 50 CY1 A HB2  1  
HETATM 745   H HB3  . CY1 A 1 50 ? 7.923   4.501   -20.447 1.00 0.00 ? 50 CY1 A HB3  1  
HETATM 746   H HD2  . CY1 A 1 50 ? 7.999   3.784   -17.956 1.00 0.00 ? 50 CY1 A HD2  1  
HETATM 747   H HD3  . CY1 A 1 50 ? 6.615   4.131   -16.763 1.00 0.00 ? 50 CY1 A HD3  1  
HETATM 748   H HE   . CY1 A 1 50 ? 6.199   2.400   -18.725 1.00 0.00 ? 50 CY1 A HE   1  
HETATM 749   H HM1  . CY1 A 1 50 ? 3.784   3.428   -20.826 1.00 0.00 ? 50 CY1 A HM1  1  
HETATM 750   H HM2  . CY1 A 1 50 ? 3.215   2.546   -19.370 1.00 0.00 ? 50 CY1 A HM2  1  
HETATM 751   H HM3  . CY1 A 1 50 ? 4.675   2.051   -20.205 1.00 0.00 ? 50 CY1 A HM3  1  
HETATM 752   N N    . NH2 A 1 51 ? 10.841  2.656   -19.510 1.00 0.00 ? 51 NH2 A N    1  
HETATM 753   H HN1  . NH2 A 1 51 ? 11.037  2.836   -18.567 1.00 0.00 ? 51 NH2 A HN1  1  
HETATM 754   H HN2  . NH2 A 1 51 ? 11.100  1.831   -19.971 1.00 0.00 ? 51 NH2 A HN2  1  
ATOM   755   N N    . LEU A 1 1  ? -2.451  0.077   16.734  1.00 0.00 ? 1  LEU A N    2  
ATOM   756   C CA   . LEU A 1 1  ? -1.127  -0.350  16.207  1.00 0.00 ? 1  LEU A CA   2  
ATOM   757   C C    . LEU A 1 1  ? -1.159  -0.496  14.690  1.00 0.00 ? 1  LEU A C    2  
ATOM   758   O O    . LEU A 1 1  ? -0.506  0.259   13.970  1.00 0.00 ? 1  LEU A O    2  
ATOM   759   C CB   . LEU A 1 1  ? -0.750  -1.681  16.860  1.00 0.00 ? 1  LEU A CB   2  
ATOM   760   C CG   . LEU A 1 1  ? 0.082   -1.562  18.140  1.00 0.00 ? 1  LEU A CG   2  
ATOM   761   C CD1  . LEU A 1 1  ? -0.798  -1.733  19.368  1.00 0.00 ? 1  LEU A CD1  2  
ATOM   762   C CD2  . LEU A 1 1  ? 1.208   -2.587  18.141  1.00 0.00 ? 1  LEU A CD2  2  
ATOM   763   H H1   . LEU A 1 1  ? -3.177  -0.506  16.275  1.00 0.00 ? 1  LEU A H1   2  
ATOM   764   H H2   . LEU A 1 1  ? -2.573  1.085   16.500  1.00 0.00 ? 1  LEU A H2   2  
ATOM   765   H H3   . LEU A 1 1  ? -2.445  -0.072  17.762  1.00 0.00 ? 1  LEU A H3   2  
ATOM   766   H HA   . LEU A 1 1  ? -0.394  0.398   16.475  1.00 0.00 ? 1  LEU A HA   2  
ATOM   767   H HB2  . LEU A 1 1  ? -1.661  -2.213  17.094  1.00 0.00 ? 1  LEU A HB2  2  
ATOM   768   H HB3  . LEU A 1 1  ? -0.188  -2.262  16.144  1.00 0.00 ? 1  LEU A HB3  2  
ATOM   769   H HG   . LEU A 1 1  ? 0.525   -0.577  18.181  1.00 0.00 ? 1  LEU A HG   2  
ATOM   770   H HD11 . LEU A 1 1  ? -1.627  -1.043  19.315  1.00 0.00 ? 1  LEU A HD11 2  
ATOM   771   H HD12 . LEU A 1 1  ? -0.218  -1.532  20.257  1.00 0.00 ? 1  LEU A HD12 2  
ATOM   772   H HD13 . LEU A 1 1  ? -1.173  -2.746  19.404  1.00 0.00 ? 1  LEU A HD13 2  
ATOM   773   H HD21 . LEU A 1 1  ? 1.826   -2.441  19.016  1.00 0.00 ? 1  LEU A HD21 2  
ATOM   774   H HD22 . LEU A 1 1  ? 1.808   -2.464  17.252  1.00 0.00 ? 1  LEU A HD22 2  
ATOM   775   H HD23 . LEU A 1 1  ? 0.788   -3.582  18.158  1.00 0.00 ? 1  LEU A HD23 2  
ATOM   776   N N    . GLN A 1 2  ? -1.925  -1.470  14.210  1.00 0.00 ? 2  GLN A N    2  
ATOM   777   C CA   . GLN A 1 2  ? -2.044  -1.716  12.777  1.00 0.00 ? 2  GLN A CA   2  
ATOM   778   C C    . GLN A 1 2  ? -0.703  -2.136  12.183  1.00 0.00 ? 2  GLN A C    2  
ATOM   779   O O    . GLN A 1 2  ? 0.342   -1.593  12.540  1.00 0.00 ? 2  GLN A O    2  
ATOM   780   C CB   . GLN A 1 2  ? -2.561  -0.465  12.065  1.00 0.00 ? 2  GLN A CB   2  
ATOM   781   C CG   . GLN A 1 2  ? -3.717  0.208   12.788  1.00 0.00 ? 2  GLN A CG   2  
ATOM   782   C CD   . GLN A 1 2  ? -3.458  1.676   13.063  1.00 0.00 ? 2  GLN A CD   2  
ATOM   783   O OE1  . GLN A 1 2  ? -3.507  2.123   14.209  1.00 0.00 ? 2  GLN A OE1  2  
ATOM   784   N NE2  . GLN A 1 2  ? -3.180  2.437   12.010  1.00 0.00 ? 2  GLN A NE2  2  
ATOM   785   H H    . GLN A 1 2  ? -2.423  -2.039  14.834  1.00 0.00 ? 2  GLN A H    2  
ATOM   786   H HA   . GLN A 1 2  ? -2.753  -2.518  12.637  1.00 0.00 ? 2  GLN A HA   2  
ATOM   787   H HB2  . GLN A 1 2  ? -1.754  0.246   11.977  1.00 0.00 ? 2  GLN A HB2  2  
ATOM   788   H HB3  . GLN A 1 2  ? -2.896  -0.741  11.076  1.00 0.00 ? 2  GLN A HB3  2  
ATOM   789   H HG2  . GLN A 1 2  ? -4.604  0.123   12.178  1.00 0.00 ? 2  GLN A HG2  2  
ATOM   790   H HG3  . GLN A 1 2  ? -3.879  -0.296  13.728  1.00 0.00 ? 2  GLN A HG3  2  
ATOM   791   H HE21 . GLN A 1 2  ? -3.159  2.014   11.126  1.00 0.00 ? 2  GLN A HE21 2  
ATOM   792   H HE22 . GLN A 1 2  ? -3.008  3.390   12.160  1.00 0.00 ? 2  GLN A HE22 2  
ATOM   793   N N    . MET A 1 3  ? -0.745  -3.114  11.278  1.00 0.00 ? 3  MET A N    2  
ATOM   794   C CA   . MET A 1 3  ? 0.462   -3.628  10.626  1.00 0.00 ? 3  MET A CA   2  
ATOM   795   C C    . MET A 1 3  ? 1.228   -4.584  11.533  1.00 0.00 ? 3  MET A C    2  
ATOM   796   O O    . MET A 1 3  ? 2.184   -5.227  11.100  1.00 0.00 ? 3  MET A O    2  
ATOM   797   C CB   . MET A 1 3  ? 1.377   -2.481  10.187  1.00 0.00 ? 3  MET A CB   2  
ATOM   798   C CG   . MET A 1 3  ? 2.442   -2.900  9.187   1.00 0.00 ? 3  MET A CG   2  
ATOM   799   S SD   . MET A 1 3  ? 1.745   -3.614  7.685   1.00 0.00 ? 3  MET A SD   2  
ATOM   800   C CE   . MET A 1 3  ? 1.269   -2.134  6.796   1.00 0.00 ? 3  MET A CE   2  
ATOM   801   H H    . MET A 1 3  ? -1.613  -3.506  11.044  1.00 0.00 ? 3  MET A H    2  
ATOM   802   H HA   . MET A 1 3  ? 0.150   -4.176  9.754   1.00 0.00 ? 3  MET A HA   2  
ATOM   803   H HB2  . MET A 1 3  ? 0.774   -1.707  9.736   1.00 0.00 ? 3  MET A HB2  2  
ATOM   804   H HB3  . MET A 1 3  ? 1.871   -2.079  11.059  1.00 0.00 ? 3  MET A HB3  2  
ATOM   805   H HG2  . MET A 1 3  ? 3.025   -2.032  8.918   1.00 0.00 ? 3  MET A HG2  2  
ATOM   806   H HG3  . MET A 1 3  ? 3.085   -3.632  9.653   1.00 0.00 ? 3  MET A HG3  2  
ATOM   807   H HE1  . MET A 1 3  ? 1.418   -2.288  5.738   1.00 0.00 ? 3  MET A HE1  2  
ATOM   808   H HE2  . MET A 1 3  ? 1.875   -1.305  7.129   1.00 0.00 ? 3  MET A HE2  2  
ATOM   809   H HE3  . MET A 1 3  ? 0.228   -1.920  6.987   1.00 0.00 ? 3  MET A HE3  2  
ATOM   810   N N    . ALA A 1 4  ? 0.806   -4.679  12.787  1.00 0.00 ? 4  ALA A N    2  
ATOM   811   C CA   . ALA A 1 4  ? 1.455   -5.560  13.747  1.00 0.00 ? 4  ALA A CA   2  
ATOM   812   C C    . ALA A 1 4  ? 0.489   -6.633  14.236  1.00 0.00 ? 4  ALA A C    2  
ATOM   813   O O    . ALA A 1 4  ? -0.086  -6.519  15.318  1.00 0.00 ? 4  ALA A O    2  
ATOM   814   C CB   . ALA A 1 4  ? 1.982   -4.742  14.910  1.00 0.00 ? 4  ALA A CB   2  
ATOM   815   H H    . ALA A 1 4  ? 0.040   -4.144  13.078  1.00 0.00 ? 4  ALA A H    2  
ATOM   816   H HA   . ALA A 1 4  ? 2.297   -6.037  13.262  1.00 0.00 ? 4  ALA A HA   2  
ATOM   817   H HB1  . ALA A 1 4  ? 1.300   -4.818  15.743  1.00 0.00 ? 4  ALA A HB1  2  
ATOM   818   H HB2  . ALA A 1 4  ? 2.066   -3.708  14.607  1.00 0.00 ? 4  ALA A HB2  2  
ATOM   819   H HB3  . ALA A 1 4  ? 2.953   -5.113  15.201  1.00 0.00 ? 4  ALA A HB3  2  
ATOM   820   N N    . GLY A 1 5  ? 0.316   -7.679  13.432  1.00 0.00 ? 5  GLY A N    2  
ATOM   821   C CA   . GLY A 1 5  ? -0.583  -8.756  13.802  1.00 0.00 ? 5  GLY A CA   2  
ATOM   822   C C    . GLY A 1 5  ? -0.509  -9.928  12.844  1.00 0.00 ? 5  GLY A C    2  
ATOM   823   O O    . GLY A 1 5  ? -0.331  -11.069 13.272  1.00 0.00 ? 5  GLY A O    2  
ATOM   824   H H    . GLY A 1 5  ? 0.802   -7.722  12.582  1.00 0.00 ? 5  GLY A H    2  
ATOM   825   H HA2  . GLY A 1 5  ? -0.324  -9.101  14.795  1.00 0.00 ? 5  GLY A HA2  2  
ATOM   826   H HA3  . GLY A 1 5  ? -1.598  -8.378  13.815  1.00 0.00 ? 5  GLY A HA3  2  
ATOM   827   N N    . GLN A 1 6  ? -0.636  -9.651  11.545  1.00 0.00 ? 6  GLN A N    2  
ATOM   828   C CA   . GLN A 1 6  ? -0.577  -10.694 10.525  1.00 0.00 ? 6  GLN A CA   2  
ATOM   829   C C    . GLN A 1 6  ? -1.101  -10.181 9.192   1.00 0.00 ? 6  GLN A C    2  
ATOM   830   O O    . GLN A 1 6  ? -2.198  -10.533 8.758   1.00 0.00 ? 6  GLN A O    2  
ATOM   831   C CB   . GLN A 1 6  ? -1.364  -11.939 10.957  1.00 0.00 ? 6  GLN A CB   2  
ATOM   832   C CG   . GLN A 1 6  ? -0.483  -13.138 11.266  1.00 0.00 ? 6  GLN A CG   2  
ATOM   833   C CD   . GLN A 1 6  ? -1.230  -14.453 11.161  1.00 0.00 ? 6  GLN A CD   2  
ATOM   834   O OE1  . GLN A 1 6  ? -1.973  -14.832 12.066  1.00 0.00 ? 6  GLN A OE1  2  
ATOM   835   N NE2  . GLN A 1 6  ? -1.035  -15.157 10.052  1.00 0.00 ? 6  GLN A NE2  2  
ATOM   836   H H    . GLN A 1 6  ? -0.763  -8.721  11.261  1.00 0.00 ? 6  GLN A H    2  
ATOM   837   H HA   . GLN A 1 6  ? 0.459   -10.958 10.397  1.00 0.00 ? 6  GLN A HA   2  
ATOM   838   H HB2  . GLN A 1 6  ? -1.934  -11.701 11.843  1.00 0.00 ? 6  GLN A HB2  2  
ATOM   839   H HB3  . GLN A 1 6  ? -2.046  -12.215 10.166  1.00 0.00 ? 6  GLN A HB3  2  
ATOM   840   H HG2  . GLN A 1 6  ? 0.340   -13.153 10.568  1.00 0.00 ? 6  GLN A HG2  2  
ATOM   841   H HG3  . GLN A 1 6  ? -0.099  -13.038 12.271  1.00 0.00 ? 6  GLN A HG3  2  
ATOM   842   H HE21 . GLN A 1 6  ? -0.428  -14.794 9.374   1.00 0.00 ? 6  GLN A HE21 2  
ATOM   843   H HE22 . GLN A 1 6  ? -1.506  -16.012 9.957   1.00 0.00 ? 6  GLN A HE22 2  
ATOM   844   N N    . CYS A 1 7  ? -0.297  -9.352  8.549   1.00 0.00 ? 7  CYS A N    2  
ATOM   845   C CA   . CYS A 1 7  ? -0.657  -8.788  7.252   1.00 0.00 ? 7  CYS A CA   2  
ATOM   846   C C    . CYS A 1 7  ? 0.117   -9.473  6.138   1.00 0.00 ? 7  CYS A C    2  
ATOM   847   O O    . CYS A 1 7  ? 1.312   -9.736  6.272   1.00 0.00 ? 7  CYS A O    2  
ATOM   848   C CB   . CYS A 1 7  ? -0.372  -7.284  7.205   1.00 0.00 ? 7  CYS A CB   2  
ATOM   849   S SG   . CYS A 1 7  ? -1.572  -6.253  8.116   1.00 0.00 ? 7  CYS A SG   2  
ATOM   850   H H    . CYS A 1 7  ? 0.564   -9.121  8.956   1.00 0.00 ? 7  CYS A H    2  
ATOM   851   H HA   . CYS A 1 7  ? -1.708  -8.956  7.097   1.00 0.00 ? 7  CYS A HA   2  
ATOM   852   H HB2  . CYS A 1 7  ? 0.602   -7.099  7.631   1.00 0.00 ? 7  CYS A HB2  2  
ATOM   853   H HB3  . CYS A 1 7  ? -0.370  -6.958  6.169   1.00 0.00 ? 7  CYS A HB3  2  
ATOM   854   N N    . SER A 1 8  ? -0.561  -9.743  5.031   1.00 0.00 ? 8  SER A N    2  
ATOM   855   C CA   . SER A 1 8  ? 0.086   -10.370 3.891   1.00 0.00 ? 8  SER A CA   2  
ATOM   856   C C    . SER A 1 8  ? 1.182   -9.461  3.374   1.00 0.00 ? 8  SER A C    2  
ATOM   857   O O    . SER A 1 8  ? 1.213   -8.271  3.682   1.00 0.00 ? 8  SER A O    2  
ATOM   858   C CB   . SER A 1 8  ? -0.924  -10.666 2.780   1.00 0.00 ? 8  SER A CB   2  
ATOM   859   O OG   . SER A 1 8  ? -2.025  -11.411 3.273   1.00 0.00 ? 8  SER A OG   2  
ATOM   860   H H    . SER A 1 8  ? -1.508  -9.496  4.973   1.00 0.00 ? 8  SER A H    2  
ATOM   861   H HA   . SER A 1 8  ? 0.536   -11.293 4.218   1.00 0.00 ? 8  SER A HA   2  
ATOM   862   H HB2  . SER A 1 8  ? -1.287  -9.737  2.371   1.00 0.00 ? 8  SER A HB2  2  
ATOM   863   H HB3  . SER A 1 8  ? -0.440  -11.236 2.001   1.00 0.00 ? 8  SER A HB3  2  
ATOM   864   H HG   . SER A 1 8  ? -2.329  -11.027 4.098   1.00 0.00 ? 8  SER A HG   2  
ATOM   865   N N    . GLN A 1 9  ? 2.090   -10.023 2.604   1.00 0.00 ? 9  GLN A N    2  
ATOM   866   C CA   . GLN A 1 9  ? 3.196   -9.252  2.065   1.00 0.00 ? 9  GLN A CA   2  
ATOM   867   C C    . GLN A 1 9  ? 2.716   -7.957  1.428   1.00 0.00 ? 9  GLN A C    2  
ATOM   868   O O    . GLN A 1 9  ? 1.680   -7.915  0.766   1.00 0.00 ? 9  GLN A O    2  
ATOM   869   C CB   . GLN A 1 9  ? 3.997   -10.080 1.058   1.00 0.00 ? 9  GLN A CB   2  
ATOM   870   C CG   . GLN A 1 9  ? 3.230   -10.409 -0.214  1.00 0.00 ? 9  GLN A CG   2  
ATOM   871   C CD   . GLN A 1 9  ? 4.087   -10.289 -1.459  1.00 0.00 ? 9  GLN A CD   2  
ATOM   872   O OE1  . GLN A 1 9  ? 5.047   -9.519  -1.495  1.00 0.00 ? 9  GLN A OE1  2  
ATOM   873   N NE2  . GLN A 1 9  ? 3.743   -11.052 -2.489  1.00 0.00 ? 9  GLN A NE2  2  
ATOM   874   H H    . GLN A 1 9  ? 2.026   -10.976 2.409   1.00 0.00 ? 9  GLN A H    2  
ATOM   875   H HA   . GLN A 1 9  ? 3.829   -8.992  2.892   1.00 0.00 ? 9  GLN A HA   2  
ATOM   876   H HB2  . GLN A 1 9  ? 4.885   -9.529  0.784   1.00 0.00 ? 9  GLN A HB2  2  
ATOM   877   H HB3  . GLN A 1 9  ? 4.290   -11.007 1.526   1.00 0.00 ? 9  GLN A HB3  2  
ATOM   878   H HG2  . GLN A 1 9  ? 2.863   -11.421 -0.146  1.00 0.00 ? 9  GLN A HG2  2  
ATOM   879   H HG3  . GLN A 1 9  ? 2.396   -9.729  -0.302  1.00 0.00 ? 9  GLN A HG3  2  
ATOM   880   H HE21 . GLN A 1 9  ? 2.967   -11.642 -2.390  1.00 0.00 ? 9  GLN A HE21 2  
ATOM   881   H HE22 . GLN A 1 9  ? 4.279   -10.995 -3.308  1.00 0.00 ? 9  GLN A HE22 2  
ATOM   882   N N    . ASN A 1 10 ? 3.482   -6.899  1.663   1.00 0.00 ? 10 ASN A N    2  
ATOM   883   C CA   . ASN A 1 10 ? 3.170   -5.572  1.148   1.00 0.00 ? 10 ASN A CA   2  
ATOM   884   C C    . ASN A 1 10 ? 1.703   -5.223  1.350   1.00 0.00 ? 10 ASN A C    2  
ATOM   885   O O    . ASN A 1 10 ? 1.112   -4.497  0.551   1.00 0.00 ? 10 ASN A O    2  
ATOM   886   C CB   . ASN A 1 10 ? 3.548   -5.450  -0.344  1.00 0.00 ? 10 ASN A CB   2  
ATOM   887   C CG   . ASN A 1 10 ? 2.945   -6.557  -1.194  1.00 0.00 ? 10 ASN A CG   2  
ATOM   888   O OD1  . ASN A 1 10 ? 3.661   -7.432  -1.683  1.00 0.00 ? 10 ASN A OD1  2  
ATOM   889   N ND2  . ASN A 1 10 ? 1.627   -6.528  -1.380  1.00 0.00 ? 10 ASN A ND2  2  
ATOM   890   H H    . ASN A 1 10 ? 4.283   -7.015  2.218   1.00 0.00 ? 10 ASN A H    2  
ATOM   891   H HA   . ASN A 1 10 ? 3.754   -4.869  1.723   1.00 0.00 ? 10 ASN A HA   2  
ATOM   892   H HB2  . ASN A 1 10 ? 3.195   -4.500  -0.727  1.00 0.00 ? 10 ASN A HB2  2  
ATOM   893   H HB3  . ASN A 1 10 ? 4.626   -5.492  -0.451  1.00 0.00 ? 10 ASN A HB3  2  
ATOM   894   H HD21 . ASN A 1 10 ? 1.113   -5.805  -0.965  1.00 0.00 ? 10 ASN A HD21 2  
ATOM   895   H HD22 . ASN A 1 10 ? 1.223   -7.235  -1.926  1.00 0.00 ? 10 ASN A HD22 2  
ATOM   896   N N    . GLU A 1 11 ? 1.120   -5.726  2.431   1.00 0.00 ? 11 GLU A N    2  
ATOM   897   C CA   . GLU A 1 11 ? -0.276  -5.423  2.723   1.00 0.00 ? 11 GLU A CA   2  
ATOM   898   C C    . GLU A 1 11 ? -0.373  -4.339  3.773   1.00 0.00 ? 11 GLU A C    2  
ATOM   899   O O    . GLU A 1 11 ? 0.456   -4.270  4.679   1.00 0.00 ? 11 GLU A O    2  
ATOM   900   C CB   . GLU A 1 11 ? -1.047  -6.676  3.141   1.00 0.00 ? 11 GLU A CB   2  
ATOM   901   C CG   . GLU A 1 11 ? -2.382  -6.827  2.427   1.00 0.00 ? 11 GLU A CG   2  
ATOM   902   C CD   . GLU A 1 11 ? -3.081  -8.132  2.757   1.00 0.00 ? 11 GLU A CD   2  
ATOM   903   O OE1  . GLU A 1 11 ? -2.716  -8.761  3.772   1.00 0.00 ? 11 GLU A OE1  2  
ATOM   904   O OE2  . GLU A 1 11 ? -3.992  -8.525  1.998   1.00 0.00 ? 11 GLU A OE2  2  
ATOM   905   H H    . GLU A 1 11 ? 1.645   -6.296  3.050   1.00 0.00 ? 11 GLU A H    2  
ATOM   906   H HA   . GLU A 1 11 ? -0.704  -5.032  1.831   1.00 0.00 ? 11 GLU A HA   2  
ATOM   907   H HB2  . GLU A 1 11 ? -0.450  -7.545  2.917   1.00 0.00 ? 11 GLU A HB2  2  
ATOM   908   H HB3  . GLU A 1 11 ? -1.232  -6.638  4.204   1.00 0.00 ? 11 GLU A HB3  2  
ATOM   909   H HG2  . GLU A 1 11 ? -3.024  -6.013  2.718   1.00 0.00 ? 11 GLU A HG2  2  
ATOM   910   H HG3  . GLU A 1 11 ? -2.212  -6.786  1.361   1.00 0.00 ? 11 GLU A HG3  2  
ATOM   911   N N    . TYR A 1 12 ? -1.383  -3.472  3.645   1.00 0.00 ? 12 TYR A N    2  
ATOM   912   C CA   . TYR A 1 12 ? -1.533  -2.380  4.608   1.00 0.00 ? 12 TYR A CA   2  
ATOM   913   C C    . TYR A 1 12 ? -2.803  -2.528  5.430   1.00 0.00 ? 12 TYR A C    2  
ATOM   914   O O    . TYR A 1 12 ? -3.910  -2.588  4.899   1.00 0.00 ? 12 TYR A O    2  
ATOM   915   C CB   . TYR A 1 12 ? -1.464  -1.011  3.919   1.00 0.00 ? 12 TYR A CB   2  
ATOM   916   C CG   . TYR A 1 12 ? -2.750  -0.534  3.278   1.00 0.00 ? 12 TYR A CG   2  
ATOM   917   C CD1  . TYR A 1 12 ? -3.038  -0.829  1.954   1.00 0.00 ? 12 TYR A CD1  2  
ATOM   918   C CD2  . TYR A 1 12 ? -3.660  0.231   3.993   1.00 0.00 ? 12 TYR A CD2  2  
ATOM   919   C CE1  . TYR A 1 12 ? -4.201  -0.378  1.360   1.00 0.00 ? 12 TYR A CE1  2  
ATOM   920   C CE2  . TYR A 1 12 ? -4.824  0.687   3.406   1.00 0.00 ? 12 TYR A CE2  2  
ATOM   921   C CZ   . TYR A 1 12 ? -5.089  0.379   2.089   1.00 0.00 ? 12 TYR A CZ   2  
ATOM   922   O OH   . TYR A 1 12 ? -6.248  0.832   1.500   1.00 0.00 ? 12 TYR A OH   2  
ATOM   923   H H    . TYR A 1 12 ? -2.030  -3.567  2.887   1.00 0.00 ? 12 TYR A H    2  
ATOM   924   H HA   . TYR A 1 12 ? -0.696  -2.447  5.291   1.00 0.00 ? 12 TYR A HA   2  
ATOM   925   H HB2  . TYR A 1 12 ? -1.179  -0.275  4.653   1.00 0.00 ? 12 TYR A HB2  2  
ATOM   926   H HB3  . TYR A 1 12 ? -0.706  -1.048  3.150   1.00 0.00 ? 12 TYR A HB3  2  
ATOM   927   H HD1  . TYR A 1 12 ? -2.339  -1.422  1.384   1.00 0.00 ? 12 TYR A HD1  2  
ATOM   928   H HD2  . TYR A 1 12 ? -3.450  0.469   5.025   1.00 0.00 ? 12 TYR A HD2  2  
ATOM   929   H HE1  . TYR A 1 12 ? -4.406  -0.618  0.328   1.00 0.00 ? 12 TYR A HE1  2  
ATOM   930   H HE2  . TYR A 1 12 ? -5.519  1.283   3.978   1.00 0.00 ? 12 TYR A HE2  2  
ATOM   931   H HH   . TYR A 1 12 ? -6.368  1.763   1.703   1.00 0.00 ? 12 TYR A HH   2  
ATOM   932   N N    . PHE A 1 13 ? -2.609  -2.597  6.741   1.00 0.00 ? 13 PHE A N    2  
ATOM   933   C CA   . PHE A 1 13 ? -3.699  -2.754  7.695   1.00 0.00 ? 13 PHE A CA   2  
ATOM   934   C C    . PHE A 1 13 ? -4.448  -1.439  7.894   1.00 0.00 ? 13 PHE A C    2  
ATOM   935   O O    . PHE A 1 13 ? -4.088  -0.640  8.757   1.00 0.00 ? 13 PHE A O    2  
ATOM   936   C CB   . PHE A 1 13 ? -3.124  -3.223  9.037   1.00 0.00 ? 13 PHE A CB   2  
ATOM   937   C CG   . PHE A 1 13 ? -4.038  -4.106  9.841   1.00 0.00 ? 13 PHE A CG   2  
ATOM   938   C CD1  . PHE A 1 13 ? -5.411  -3.928  9.807   1.00 0.00 ? 13 PHE A CD1  2  
ATOM   939   C CD2  . PHE A 1 13 ? -3.517  -5.111  10.639  1.00 0.00 ? 13 PHE A CD2  2  
ATOM   940   C CE1  . PHE A 1 13 ? -6.244  -4.737  10.553  1.00 0.00 ? 13 PHE A CE1  2  
ATOM   941   C CE2  . PHE A 1 13 ? -4.346  -5.922  11.386  1.00 0.00 ? 13 PHE A CE2  2  
ATOM   942   C CZ   . PHE A 1 13 ? -5.712  -5.735  11.343  1.00 0.00 ? 13 PHE A CZ   2  
ATOM   943   H H    . PHE A 1 13 ? -1.690  -2.546  7.079   1.00 0.00 ? 13 PHE A H    2  
ATOM   944   H HA   . PHE A 1 13 ? -4.380  -3.508  7.313   1.00 0.00 ? 13 PHE A HA   2  
ATOM   945   H HB2  . PHE A 1 13 ? -2.216  -3.776  8.853   1.00 0.00 ? 13 PHE A HB2  2  
ATOM   946   H HB3  . PHE A 1 13 ? -2.891  -2.355  9.636   1.00 0.00 ? 13 PHE A HB3  2  
ATOM   947   H HD1  . PHE A 1 13 ? -5.830  -3.149  9.187   1.00 0.00 ? 13 PHE A HD1  2  
ATOM   948   H HD2  . PHE A 1 13 ? -2.448  -5.258  10.675  1.00 0.00 ? 13 PHE A HD2  2  
ATOM   949   H HE1  . PHE A 1 13 ? -7.312  -4.588  10.521  1.00 0.00 ? 13 PHE A HE1  2  
ATOM   950   H HE2  . PHE A 1 13 ? -3.927  -6.702  12.005  1.00 0.00 ? 13 PHE A HE2  2  
ATOM   951   H HZ   . PHE A 1 13 ? -6.363  -6.369  11.927  1.00 0.00 ? 13 PHE A HZ   2  
ATOM   952   N N    . ASP A 1 14 ? -5.498  -1.222  7.110   1.00 0.00 ? 14 ASP A N    2  
ATOM   953   C CA   . ASP A 1 14 ? -6.288  0.001   7.228   1.00 0.00 ? 14 ASP A CA   2  
ATOM   954   C C    . ASP A 1 14 ? -7.070  0.002   8.532   1.00 0.00 ? 14 ASP A C    2  
ATOM   955   O O    . ASP A 1 14 ? -8.103  -0.651  8.642   1.00 0.00 ? 14 ASP A O    2  
ATOM   956   C CB   . ASP A 1 14 ? -7.249  0.140   6.046   1.00 0.00 ? 14 ASP A CB   2  
ATOM   957   C CG   . ASP A 1 14 ? -7.394  1.577   5.587   1.00 0.00 ? 14 ASP A CG   2  
ATOM   958   O OD1  . ASP A 1 14 ? -7.285  2.485   6.437   1.00 0.00 ? 14 ASP A OD1  2  
ATOM   959   O OD2  . ASP A 1 14 ? -7.620  1.795   4.378   1.00 0.00 ? 14 ASP A OD2  2  
ATOM   960   H H    . ASP A 1 14 ? -5.752  -1.898  6.446   1.00 0.00 ? 14 ASP A H    2  
ATOM   961   H HA   . ASP A 1 14 ? -5.613  0.845   7.231   1.00 0.00 ? 14 ASP A HA   2  
ATOM   962   H HB2  . ASP A 1 14 ? -6.883  -0.449  5.219   1.00 0.00 ? 14 ASP A HB2  2  
ATOM   963   H HB3  . ASP A 1 14 ? -8.221  -0.223  6.339   1.00 0.00 ? 14 ASP A HB3  2  
ATOM   964   N N    . SER A 1 15 ? -6.575  0.742   9.517   1.00 0.00 ? 15 SER A N    2  
ATOM   965   C CA   . SER A 1 15 ? -7.239  0.824   10.812  1.00 0.00 ? 15 SER A CA   2  
ATOM   966   C C    . SER A 1 15 ? -8.713  1.173   10.641  1.00 0.00 ? 15 SER A C    2  
ATOM   967   O O    . SER A 1 15 ? -9.537  0.868   11.503  1.00 0.00 ? 15 SER A O    2  
ATOM   968   C CB   . SER A 1 15 ? -6.558  1.865   11.705  1.00 0.00 ? 15 SER A CB   2  
ATOM   969   O OG   . SER A 1 15 ? -6.886  3.181   11.293  1.00 0.00 ? 15 SER A OG   2  
ATOM   970   H H    . SER A 1 15 ? -5.748  1.243   9.369   1.00 0.00 ? 15 SER A H    2  
ATOM   971   H HA   . SER A 1 15 ? -7.164  -0.147  11.279  1.00 0.00 ? 15 SER A HA   2  
ATOM   972   H HB2  . SER A 1 15 ? -6.885  1.730   12.724  1.00 0.00 ? 15 SER A HB2  2  
ATOM   973   H HB3  . SER A 1 15 ? -5.488  1.741   11.651  1.00 0.00 ? 15 SER A HB3  2  
ATOM   974   H HG   . SER A 1 15 ? -6.746  3.264   10.347  1.00 0.00 ? 15 SER A HG   2  
ATOM   975   N N    . LEU A 1 16 ? -9.037  1.809   9.520   1.00 0.00 ? 16 LEU A N    2  
ATOM   976   C CA   . LEU A 1 16 ? -10.414 2.188   9.237   1.00 0.00 ? 16 LEU A CA   2  
ATOM   977   C C    . LEU A 1 16 ? -11.186 1.008   8.657   1.00 0.00 ? 16 LEU A C    2  
ATOM   978   O O    . LEU A 1 16 ? -12.406 0.922   8.795   1.00 0.00 ? 16 LEU A O    2  
ATOM   979   C CB   . LEU A 1 16 ? -10.452 3.367   8.263   1.00 0.00 ? 16 LEU A CB   2  
ATOM   980   C CG   . LEU A 1 16 ? -11.851 3.916   7.965   1.00 0.00 ? 16 LEU A CG   2  
ATOM   981   C CD1  . LEU A 1 16 ? -11.978 5.353   8.450   1.00 0.00 ? 16 LEU A CD1  2  
ATOM   982   C CD2  . LEU A 1 16 ? -12.156 3.826   6.478   1.00 0.00 ? 16 LEU A CD2  2  
ATOM   983   H H    . LEU A 1 16 ? -8.334  2.019   8.865   1.00 0.00 ? 16 LEU A H    2  
ATOM   984   H HA   . LEU A 1 16 ? -10.875 2.483   10.167  1.00 0.00 ? 16 LEU A HA   2  
ATOM   985   H HB2  . LEU A 1 16 ? -9.852  4.166   8.675   1.00 0.00 ? 16 LEU A HB2  2  
ATOM   986   H HB3  . LEU A 1 16 ? -10.007 3.051   7.331   1.00 0.00 ? 16 LEU A HB3  2  
ATOM   987   H HG   . LEU A 1 16 ? -12.582 3.322   8.494   1.00 0.00 ? 16 LEU A HG   2  
ATOM   988   H HD11 . LEU A 1 16 ? -11.820 6.027   7.621   1.00 0.00 ? 16 LEU A HD11 2  
ATOM   989   H HD12 . LEU A 1 16 ? -11.239 5.542   9.214   1.00 0.00 ? 16 LEU A HD12 2  
ATOM   990   H HD13 . LEU A 1 16 ? -12.965 5.509   8.858   1.00 0.00 ? 16 LEU A HD13 2  
ATOM   991   H HD21 . LEU A 1 16 ? -11.527 3.075   6.025   1.00 0.00 ? 16 LEU A HD21 2  
ATOM   992   H HD22 . LEU A 1 16 ? -11.967 4.782   6.012   1.00 0.00 ? 16 LEU A HD22 2  
ATOM   993   H HD23 . LEU A 1 16 ? -13.194 3.558   6.339   1.00 0.00 ? 16 LEU A HD23 2  
ATOM   994   N N    . LEU A 1 17 ? -10.464 0.102   8.002   1.00 0.00 ? 17 LEU A N    2  
ATOM   995   C CA   . LEU A 1 17 ? -11.072 -1.071  7.392   1.00 0.00 ? 17 LEU A CA   2  
ATOM   996   C C    . LEU A 1 17 ? -10.903 -2.312  8.265   1.00 0.00 ? 17 LEU A C    2  
ATOM   997   O O    . LEU A 1 17 ? -11.634 -3.290  8.106   1.00 0.00 ? 17 LEU A O    2  
ATOM   998   C CB   . LEU A 1 17 ? -10.437 -1.324  6.024   1.00 0.00 ? 17 LEU A CB   2  
ATOM   999   C CG   . LEU A 1 17 ? -10.503 -0.144  5.053   1.00 0.00 ? 17 LEU A CG   2  
ATOM   1000  C CD1  . LEU A 1 17 ? -9.822  -0.494  3.739   1.00 0.00 ? 17 LEU A CD1  2  
ATOM   1001  C CD2  . LEU A 1 17 ? -11.948 0.268   4.814   1.00 0.00 ? 17 LEU A CD2  2  
ATOM   1002  H H    . LEU A 1 17 ? -9.495  0.229   7.921   1.00 0.00 ? 17 LEU A H    2  
ATOM   1003  H HA   . LEU A 1 17 ? -12.125 -0.874  7.257   1.00 0.00 ? 17 LEU A HA   2  
ATOM   1004  H HB2  . LEU A 1 17 ? -9.397  -1.580  6.179   1.00 0.00 ? 17 LEU A HB2  2  
ATOM   1005  H HB3  . LEU A 1 17 ? -10.934 -2.166  5.569   1.00 0.00 ? 17 LEU A HB3  2  
ATOM   1006  H HG   . LEU A 1 17 ? -9.982  0.698   5.486   1.00 0.00 ? 17 LEU A HG   2  
ATOM   1007  H HD11 . LEU A 1 17 ? -9.866  -1.562  3.585   1.00 0.00 ? 17 LEU A HD11 2  
ATOM   1008  H HD12 . LEU A 1 17 ? -8.791  -0.177  3.773   1.00 0.00 ? 17 LEU A HD12 2  
ATOM   1009  H HD13 . LEU A 1 17 ? -10.328 0.009   2.928   1.00 0.00 ? 17 LEU A HD13 2  
ATOM   1010  H HD21 . LEU A 1 17 ? -12.409 0.528   5.756   1.00 0.00 ? 17 LEU A HD21 2  
ATOM   1011  H HD22 . LEU A 1 17 ? -12.487 -0.553  4.365   1.00 0.00 ? 17 LEU A HD22 2  
ATOM   1012  H HD23 . LEU A 1 17 ? -11.975 1.121   4.152   1.00 0.00 ? 17 LEU A HD23 2  
ATOM   1013  N N    . HIS A 1 18 ? -9.928  -2.285  9.173   1.00 0.00 ? 18 HIS A N    2  
ATOM   1014  C CA   . HIS A 1 18 ? -9.672  -3.431  10.038  1.00 0.00 ? 18 HIS A CA   2  
ATOM   1015  C C    . HIS A 1 18 ? -9.323  -4.643  9.188   1.00 0.00 ? 18 HIS A C    2  
ATOM   1016  O O    . HIS A 1 18 ? -9.870  -5.732  9.365   1.00 0.00 ? 18 HIS A O    2  
ATOM   1017  C CB   . HIS A 1 18 ? -10.892 -3.738  10.895  1.00 0.00 ? 18 HIS A CB   2  
ATOM   1018  C CG   . HIS A 1 18 ? -11.249 -2.641  11.849  1.00 0.00 ? 18 HIS A CG   2  
ATOM   1019  N ND1  . HIS A 1 18 ? -12.320 -1.794  11.657  1.00 0.00 ? 18 HIS A ND1  2  
ATOM   1020  C CD2  . HIS A 1 18 ? -10.668 -2.252  13.010  1.00 0.00 ? 18 HIS A CD2  2  
ATOM   1021  C CE1  . HIS A 1 18 ? -12.383 -0.932  12.657  1.00 0.00 ? 18 HIS A CE1  2  
ATOM   1022  N NE2  . HIS A 1 18 ? -11.392 -1.190  13.490  1.00 0.00 ? 18 HIS A NE2  2  
ATOM   1023  H H    . HIS A 1 18 ? -9.358  -1.490  9.251   1.00 0.00 ? 18 HIS A H    2  
ATOM   1024  H HA   . HIS A 1 18 ? -8.835  -3.192  10.677  1.00 0.00 ? 18 HIS A HA   2  
ATOM   1025  H HB2  . HIS A 1 18 ? -11.736 -3.905  10.246  1.00 0.00 ? 18 HIS A HB2  2  
ATOM   1026  H HB3  . HIS A 1 18 ? -10.699 -4.631  11.465  1.00 0.00 ? 18 HIS A HB3  2  
ATOM   1027  H HD1  . HIS A 1 18 ? -12.942 -1.820  10.901  1.00 0.00 ? 18 HIS A HD1  2  
ATOM   1028  H HD2  . HIS A 1 18 ? -9.797  -2.697  13.471  1.00 0.00 ? 18 HIS A HD2  2  
ATOM   1029  H HE1  . HIS A 1 18 ? -13.120 -0.151  12.773  1.00 0.00 ? 18 HIS A HE1  2  
ATOM   1030  H HE2  . HIS A 1 18 ? -11.154 -0.645  14.270  1.00 0.00 ? 18 HIS A HE2  2  
ATOM   1031  N N    . ALA A 1 19 ? -8.407  -4.428  8.262   1.00 0.00 ? 19 ALA A N    2  
ATOM   1032  C CA   . ALA A 1 19 ? -7.965  -5.447  7.357   1.00 0.00 ? 19 ALA A CA   2  
ATOM   1033  C C    . ALA A 1 19 ? -6.700  -5.012  6.659   1.00 0.00 ? 19 ALA A C    2  
ATOM   1034  O O    . ALA A 1 19 ? -6.479  -3.828  6.400   1.00 0.00 ? 19 ALA A O    2  
ATOM   1035  C CB   . ALA A 1 19 ? -9.025  -5.731  6.310   1.00 0.00 ? 19 ALA A CB   2  
ATOM   1036  H H    . ALA A 1 19 ? -8.018  -3.549  8.181   1.00 0.00 ? 19 ALA A H    2  
ATOM   1037  H HA   . ALA A 1 19 ? -7.781  -6.350  7.911   1.00 0.00 ? 19 ALA A HA   2  
ATOM   1038  H HB1  . ALA A 1 19 ? -8.605  -5.549  5.325   1.00 0.00 ? 19 ALA A HB1  2  
ATOM   1039  H HB2  . ALA A 1 19 ? -9.872  -5.080  6.468   1.00 0.00 ? 19 ALA A HB2  2  
ATOM   1040  H HB3  . ALA A 1 19 ? -9.338  -6.760  6.382   1.00 0.00 ? 19 ALA A HB3  2  
ATOM   1041  N N    . CYS A 1 20 ? -5.904  -5.986  6.329   1.00 0.00 ? 20 CYS A N    2  
ATOM   1042  C CA   . CYS A 1 20 ? -4.675  -5.747  5.607   1.00 0.00 ? 20 CYS A CA   2  
ATOM   1043  C C    . CYS A 1 20 ? -4.973  -5.728  4.112   1.00 0.00 ? 20 CYS A C    2  
ATOM   1044  O O    . CYS A 1 20 ? -5.309  -6.752  3.516   1.00 0.00 ? 20 CYS A O    2  
ATOM   1045  C CB   . CYS A 1 20 ? -3.619  -6.804  5.936   1.00 0.00 ? 20 CYS A CB   2  
ATOM   1046  S SG   . CYS A 1 20 ? -3.379  -7.093  7.721   1.00 0.00 ? 20 CYS A SG   2  
ATOM   1047  H H    . CYS A 1 20 ? -6.171  -6.888  6.556   1.00 0.00 ? 20 CYS A H    2  
ATOM   1048  H HA   . CYS A 1 20 ? -4.320  -4.772  5.896   1.00 0.00 ? 20 CYS A HA   2  
ATOM   1049  H HB2  . CYS A 1 20 ? -3.911  -7.744  5.490   1.00 0.00 ? 20 CYS A HB2  2  
ATOM   1050  H HB3  . CYS A 1 20 ? -2.671  -6.495  5.523   1.00 0.00 ? 20 CYS A HB3  2  
ATOM   1051  N N    . ILE A 1 21 ? -4.876  -4.544  3.527   1.00 0.00 ? 21 ILE A N    2  
ATOM   1052  C CA   . ILE A 1 21 ? -5.160  -4.350  2.108   1.00 0.00 ? 21 ILE A CA   2  
ATOM   1053  C C    . ILE A 1 21 ? -3.878  -4.141  1.318   1.00 0.00 ? 21 ILE A C    2  
ATOM   1054  O O    . ILE A 1 21 ? -2.952  -3.498  1.791   1.00 0.00 ? 21 ILE A O    2  
ATOM   1055  C CB   . ILE A 1 21 ? -6.074  -3.120  1.902   1.00 0.00 ? 21 ILE A CB   2  
ATOM   1056  C CG1  . ILE A 1 21 ? -7.493  -3.399  2.412   1.00 0.00 ? 21 ILE A CG1  2  
ATOM   1057  C CG2  . ILE A 1 21 ? -6.136  -2.690  0.436   1.00 0.00 ? 21 ILE A CG2  2  
ATOM   1058  C CD1  . ILE A 1 21 ? -7.547  -3.932  3.821   1.00 0.00 ? 21 ILE A CD1  2  
ATOM   1059  H H    . ILE A 1 21 ? -4.624  -3.771  4.072   1.00 0.00 ? 21 ILE A H    2  
ATOM   1060  H HA   . ILE A 1 21 ? -5.668  -5.226  1.739   1.00 0.00 ? 21 ILE A HA   2  
ATOM   1061  H HB   . ILE A 1 21 ? -5.645  -2.307  2.470   1.00 0.00 ? 21 ILE A HB   2  
ATOM   1062  H HG12 . ILE A 1 21 ? -8.062  -2.483  2.386   1.00 0.00 ? 21 ILE A HG12 2  
ATOM   1063  H HG13 . ILE A 1 21 ? -7.962  -4.124  1.763   1.00 0.00 ? 21 ILE A HG13 2  
ATOM   1064  H HG21 . ILE A 1 21 ? -5.163  -2.789  -0.017  1.00 0.00 ? 21 ILE A HG21 2  
ATOM   1065  H HG22 . ILE A 1 21 ? -6.455  -1.661  0.379   1.00 0.00 ? 21 ILE A HG22 2  
ATOM   1066  H HG23 . ILE A 1 21 ? -6.845  -3.312  -0.090  1.00 0.00 ? 21 ILE A HG23 2  
ATOM   1067  H HD11 . ILE A 1 21 ? -6.735  -3.514  4.391   1.00 0.00 ? 21 ILE A HD11 2  
ATOM   1068  H HD12 . ILE A 1 21 ? -7.455  -5.009  3.803   1.00 0.00 ? 21 ILE A HD12 2  
ATOM   1069  H HD13 . ILE A 1 21 ? -8.487  -3.658  4.276   1.00 0.00 ? 21 ILE A HD13 2  
ATOM   1070  N N    . PRO A 1 22 ? -3.808  -4.665  0.089   1.00 0.00 ? 22 PRO A N    2  
ATOM   1071  C CA   . PRO A 1 22 ? -2.625  -4.498  -0.749  1.00 0.00 ? 22 PRO A CA   2  
ATOM   1072  C C    . PRO A 1 22 ? -2.333  -3.026  -1.034  1.00 0.00 ? 22 PRO A C    2  
ATOM   1073  O O    . PRO A 1 22 ? -3.180  -2.164  -0.808  1.00 0.00 ? 22 PRO A O    2  
ATOM   1074  C CB   . PRO A 1 22 ? -2.978  -5.254  -2.040  1.00 0.00 ? 22 PRO A CB   2  
ATOM   1075  C CG   . PRO A 1 22 ? -4.465  -5.354  -2.034  1.00 0.00 ? 22 PRO A CG   2  
ATOM   1076  C CD   . PRO A 1 22 ? -4.859  -5.448  -0.584  1.00 0.00 ? 22 PRO A CD   2  
ATOM   1077  H HA   . PRO A 1 22 ? -1.767  -4.943  -0.283  1.00 0.00 ? 22 PRO A HA   2  
ATOM   1078  H HB2  . PRO A 1 22 ? -2.626  -4.699  -2.897  1.00 0.00 ? 22 PRO A HB2  2  
ATOM   1079  H HB3  . PRO A 1 22 ? -2.519  -6.232  -2.025  1.00 0.00 ? 22 PRO A HB3  2  
ATOM   1080  H HG2  . PRO A 1 22 ? -4.892  -4.468  -2.486  1.00 0.00 ? 22 PRO A HG2  2  
ATOM   1081  H HG3  . PRO A 1 22 ? -4.777  -6.238  -2.570  1.00 0.00 ? 22 PRO A HG3  2  
ATOM   1082  H HD2  . PRO A 1 22 ? -5.835  -5.015  -0.421  1.00 0.00 ? 22 PRO A HD2  2  
ATOM   1083  H HD3  . PRO A 1 22 ? -4.842  -6.477  -0.251  1.00 0.00 ? 22 PRO A HD3  2  
ATOM   1084  N N    . CYS A 1 23 ? -1.129  -2.744  -1.532  1.00 0.00 ? 23 CYS A N    2  
ATOM   1085  C CA   . CYS A 1 23 ? -0.736  -1.359  -1.844  1.00 0.00 ? 23 CYS A CA   2  
ATOM   1086  C C    . CYS A 1 23 ? -0.401  -1.191  -3.324  1.00 0.00 ? 23 CYS A C    2  
ATOM   1087  O O    . CYS A 1 23 ? -0.449  -0.081  -3.854  1.00 0.00 ? 23 CYS A O    2  
ATOM   1088  C CB   . CYS A 1 23 ? 0.461   -0.906  -0.987  1.00 0.00 ? 23 CYS A CB   2  
ATOM   1089  S SG   . CYS A 1 23 ? 0.640   0.903   -0.875  1.00 0.00 ? 23 CYS A SG   2  
ATOM   1090  H H    . CYS A 1 23 ? -0.497  -3.480  -1.697  1.00 0.00 ? 23 CYS A H    2  
ATOM   1091  H HA   . CYS A 1 23 ? -1.579  -0.720  -1.617  1.00 0.00 ? 23 CYS A HA   2  
ATOM   1092  H HB2  . CYS A 1 23 ? 0.345   -1.279  0.022   1.00 0.00 ? 23 CYS A HB2  2  
ATOM   1093  H HB3  . CYS A 1 23 ? 1.377   -1.295  -1.411  1.00 0.00 ? 23 CYS A HB3  2  
ATOM   1094  N N    . GLN A 1 24 ? -0.069  -2.291  -3.992  1.00 0.00 ? 24 GLN A N    2  
ATOM   1095  C CA   . GLN A 1 24 ? 0.263   -2.242  -5.414  1.00 0.00 ? 24 GLN A CA   2  
ATOM   1096  C C    . GLN A 1 24 ? -0.977  -1.935  -6.238  1.00 0.00 ? 24 GLN A C    2  
ATOM   1097  O O    . GLN A 1 24 ? -0.957  -1.086  -7.129  1.00 0.00 ? 24 GLN A O    2  
ATOM   1098  C CB   . GLN A 1 24 ? 0.883   -3.564  -5.887  1.00 0.00 ? 24 GLN A CB   2  
ATOM   1099  C CG   . GLN A 1 24 ? 1.560   -4.366  -4.787  1.00 0.00 ? 24 GLN A CG   2  
ATOM   1100  C CD   . GLN A 1 24 ? 2.441   -5.473  -5.332  1.00 0.00 ? 24 GLN A CD   2  
ATOM   1101  O OE1  . GLN A 1 24 ? 3.597   -5.615  -4.931  1.00 0.00 ? 24 GLN A OE1  2  
ATOM   1102  N NE2  . GLN A 1 24 ? 1.899   -6.264  -6.250  1.00 0.00 ? 24 GLN A NE2  2  
ATOM   1103  H H    . GLN A 1 24 ? -0.053  -3.150  -3.523  1.00 0.00 ? 24 GLN A H    2  
ATOM   1104  H HA   . GLN A 1 24 ? 0.971   -1.450  -5.557  1.00 0.00 ? 24 GLN A HA   2  
ATOM   1105  H HB2  . GLN A 1 24 ? 0.106   -4.177  -6.319  1.00 0.00 ? 24 GLN A HB2  2  
ATOM   1106  H HB3  . GLN A 1 24 ? 1.619   -3.348  -6.648  1.00 0.00 ? 24 GLN A HB3  2  
ATOM   1107  H HG2  . GLN A 1 24 ? 2.168   -3.699  -4.194  1.00 0.00 ? 24 GLN A HG2  2  
ATOM   1108  H HG3  . GLN A 1 24 ? 0.796   -4.807  -4.163  1.00 0.00 ? 24 GLN A HG3  2  
ATOM   1109  H HE21 . GLN A 1 24 ? 0.972   -6.091  -6.521  1.00 0.00 ? 24 GLN A HE21 2  
ATOM   1110  H HE22 . GLN A 1 24 ? 2.446   -6.987  -6.620  1.00 0.00 ? 24 GLN A HE22 2  
ATOM   1111  N N    . LEU A 1 25 ? -2.050  -2.639  -5.925  1.00 0.00 ? 25 LEU A N    2  
ATOM   1112  C CA   . LEU A 1 25 ? -3.316  -2.466  -6.620  1.00 0.00 ? 25 LEU A CA   2  
ATOM   1113  C C    . LEU A 1 25 ? -3.979  -1.135  -6.263  1.00 0.00 ? 25 LEU A C    2  
ATOM   1114  O O    . LEU A 1 25 ? -4.975  -0.748  -6.874  1.00 0.00 ? 25 LEU A O    2  
ATOM   1115  C CB   . LEU A 1 25 ? -4.262  -3.623  -6.292  1.00 0.00 ? 25 LEU A CB   2  
ATOM   1116  C CG   . LEU A 1 25 ? -5.514  -3.704  -7.169  1.00 0.00 ? 25 LEU A CG   2  
ATOM   1117  C CD1  . LEU A 1 25 ? -5.315  -4.707  -8.294  1.00 0.00 ? 25 LEU A CD1  2  
ATOM   1118  C CD2  . LEU A 1 25 ? -6.730  -4.075  -6.331  1.00 0.00 ? 25 LEU A CD2  2  
ATOM   1119  H H    . LEU A 1 25 ? -1.986  -3.294  -5.210  1.00 0.00 ? 25 LEU A H    2  
ATOM   1120  H HA   . LEU A 1 25 ? -3.107  -2.477  -7.675  1.00 0.00 ? 25 LEU A HA   2  
ATOM   1121  H HB2  . LEU A 1 25 ? -3.713  -4.548  -6.395  1.00 0.00 ? 25 LEU A HB2  2  
ATOM   1122  H HB3  . LEU A 1 25 ? -4.574  -3.522  -5.263  1.00 0.00 ? 25 LEU A HB3  2  
ATOM   1123  H HG   . LEU A 1 25 ? -5.697  -2.736  -7.613  1.00 0.00 ? 25 LEU A HG   2  
ATOM   1124  H HD11 . LEU A 1 25 ? -4.278  -4.711  -8.593  1.00 0.00 ? 25 LEU A HD11 2  
ATOM   1125  H HD12 . LEU A 1 25 ? -5.932  -4.429  -9.136  1.00 0.00 ? 25 LEU A HD12 2  
ATOM   1126  H HD13 . LEU A 1 25 ? -5.596  -5.692  -7.951  1.00 0.00 ? 25 LEU A HD13 2  
ATOM   1127  H HD21 . LEU A 1 25 ? -7.605  -3.582  -6.728  1.00 0.00 ? 25 LEU A HD21 2  
ATOM   1128  H HD22 . LEU A 1 25 ? -6.572  -3.760  -5.309  1.00 0.00 ? 25 LEU A HD22 2  
ATOM   1129  H HD23 . LEU A 1 25 ? -6.874  -5.145  -6.360  1.00 0.00 ? 25 LEU A HD23 2  
ATOM   1130  N N    . ARG A 1 26 ? -3.431  -0.437  -5.269  1.00 0.00 ? 26 ARG A N    2  
ATOM   1131  C CA   . ARG A 1 26 ? -3.989  0.842   -4.846  1.00 0.00 ? 26 ARG A CA   2  
ATOM   1132  C C    . ARG A 1 26 ? -3.017  1.992   -5.075  1.00 0.00 ? 26 ARG A C    2  
ATOM   1133  O O    . ARG A 1 26 ? -3.341  3.154   -4.834  1.00 0.00 ? 26 ARG A O    2  
ATOM   1134  C CB   . ARG A 1 26 ? -4.387  0.790   -3.374  1.00 0.00 ? 26 ARG A CB   2  
ATOM   1135  C CG   . ARG A 1 26 ? -5.107  -0.491  -2.981  1.00 0.00 ? 26 ARG A CG   2  
ATOM   1136  C CD   . ARG A 1 26 ? -6.425  -0.201  -2.279  1.00 0.00 ? 26 ARG A CD   2  
ATOM   1137  N NE   . ARG A 1 26 ? -7.549  -0.230  -3.211  1.00 0.00 ? 26 ARG A NE   2  
ATOM   1138  C CZ   . ARG A 1 26 ? -8.798  0.092   -2.878  1.00 0.00 ? 26 ARG A CZ   2  
ATOM   1139  N NH1  . ARG A 1 26 ? -9.084  0.467   -1.638  1.00 0.00 ? 26 ARG A NH1  2  
ATOM   1140  N NH2  . ARG A 1 26 ? -9.761  0.039   -3.787  1.00 0.00 ? 26 ARG A NH2  2  
ATOM   1141  H H    . ARG A 1 26 ? -2.642  -0.788  -4.814  1.00 0.00 ? 26 ARG A H    2  
ATOM   1142  H HA   . ARG A 1 26 ? -4.857  1.015   -5.440  1.00 0.00 ? 26 ARG A HA   2  
ATOM   1143  H HB2  . ARG A 1 26 ? -3.493  0.876   -2.775  1.00 0.00 ? 26 ARG A HB2  2  
ATOM   1144  H HB3  . ARG A 1 26 ? -5.036  1.626   -3.160  1.00 0.00 ? 26 ARG A HB3  2  
ATOM   1145  H HG2  . ARG A 1 26 ? -5.304  -1.069  -3.871  1.00 0.00 ? 26 ARG A HG2  2  
ATOM   1146  H HG3  . ARG A 1 26 ? -4.473  -1.057  -2.314  1.00 0.00 ? 26 ARG A HG3  2  
ATOM   1147  H HD2  . ARG A 1 26 ? -6.571  -0.944  -1.509  1.00 0.00 ? 26 ARG A HD2  2  
ATOM   1148  H HD3  . ARG A 1 26 ? -6.361  0.775   -1.821  1.00 0.00 ? 26 ARG A HD3  2  
ATOM   1149  H HE   . ARG A 1 26 ? -7.366  -0.504  -4.135  1.00 0.00 ? 26 ARG A HE   2  
ATOM   1150  H HH11 . ARG A 1 26 ? -8.363  0.510   -0.947  1.00 0.00 ? 26 ARG A HH11 2  
ATOM   1151  H HH12 . ARG A 1 26 ? -10.025 0.708   -1.394  1.00 0.00 ? 26 ARG A HH12 2  
ATOM   1152  H HH21 . ARG A 1 26 ? -9.550  -0.243  -4.724  1.00 0.00 ? 26 ARG A HH21 2  
ATOM   1153  H HH22 . ARG A 1 26 ? -10.699 0.280   -3.538  1.00 0.00 ? 26 ARG A HH22 2  
ATOM   1154  N N    . CYS A 1 27 ? -1.832  1.655   -5.538  1.00 0.00 ? 27 CYS A N    2  
ATOM   1155  C CA   . CYS A 1 27 ? -0.799  2.653   -5.807  1.00 0.00 ? 27 CYS A CA   2  
ATOM   1156  C C    . CYS A 1 27 ? -1.134  3.458   -7.062  1.00 0.00 ? 27 CYS A C    2  
ATOM   1157  O O    . CYS A 1 27 ? -0.709  4.604   -7.207  1.00 0.00 ? 27 CYS A O    2  
ATOM   1158  C CB   . CYS A 1 27 ? 0.580   1.998   -5.968  1.00 0.00 ? 27 CYS A CB   2  
ATOM   1159  S SG   . CYS A 1 27 ? 1.924   3.179   -6.316  1.00 0.00 ? 27 CYS A SG   2  
ATOM   1160  H H    . CYS A 1 27 ? -1.652  0.714   -5.703  1.00 0.00 ? 27 CYS A H    2  
ATOM   1161  H HA   . CYS A 1 27 ? -0.767  3.325   -4.963  1.00 0.00 ? 27 CYS A HA   2  
ATOM   1162  H HB2  . CYS A 1 27 ? 0.833   1.475   -5.058  1.00 0.00 ? 27 CYS A HB2  2  
ATOM   1163  H HB3  . CYS A 1 27 ? 0.545   1.294   -6.788  1.00 0.00 ? 27 CYS A HB3  2  
ATOM   1164  N N    . SER A 1 28 ? -1.885  2.843   -7.972  1.00 0.00 ? 28 SER A N    2  
ATOM   1165  C CA   . SER A 1 28 ? -2.263  3.481   -9.210  1.00 0.00 ? 28 SER A CA   2  
ATOM   1166  C C    . SER A 1 28 ? -3.491  4.378   -9.045  1.00 0.00 ? 28 SER A C    2  
ATOM   1167  O O    . SER A 1 28 ? -4.130  4.748   -10.031 1.00 0.00 ? 28 SER A O    2  
ATOM   1168  C CB   . SER A 1 28 ? -2.526  2.430   -10.289 1.00 0.00 ? 28 SER A CB   2  
ATOM   1169  O OG   . SER A 1 28 ? -3.661  1.642   -9.971  1.00 0.00 ? 28 SER A OG   2  
ATOM   1170  H H    . SER A 1 28 ? -2.173  1.942   -7.817  1.00 0.00 ? 28 SER A H    2  
ATOM   1171  H HA   . SER A 1 28 ? -1.435  4.074   -9.504  1.00 0.00 ? 28 SER A HA   2  
ATOM   1172  H HB2  . SER A 1 28 ? -2.699  2.922   -11.234 1.00 0.00 ? 28 SER A HB2  2  
ATOM   1173  H HB3  . SER A 1 28 ? -1.666  1.781   -10.373 1.00 0.00 ? 28 SER A HB3  2  
ATOM   1174  H HG   . SER A 1 28 ? -4.425  2.212   -9.859  1.00 0.00 ? 28 SER A HG   2  
ATOM   1175  N N    . SER A 1 29 ? -3.817  4.729   -7.805  1.00 0.00 ? 29 SER A N    2  
ATOM   1176  C CA   . SER A 1 29 ? -4.958  5.576   -7.525  1.00 0.00 ? 29 SER A CA   2  
ATOM   1177  C C    . SER A 1 29 ? -4.649  6.502   -6.362  1.00 0.00 ? 29 SER A C    2  
ATOM   1178  O O    . SER A 1 29 ? -3.542  6.505   -5.825  1.00 0.00 ? 29 SER A O    2  
ATOM   1179  C CB   . SER A 1 29 ? -6.188  4.726   -7.206  1.00 0.00 ? 29 SER A CB   2  
ATOM   1180  O OG   . SER A 1 29 ? -7.362  5.305   -7.750  1.00 0.00 ? 29 SER A OG   2  
ATOM   1181  H H    . SER A 1 29 ? -3.281  4.415   -7.059  1.00 0.00 ? 29 SER A H    2  
ATOM   1182  H HA   . SER A 1 29 ? -5.160  6.174   -8.399  1.00 0.00 ? 29 SER A HA   2  
ATOM   1183  H HB2  . SER A 1 29 ? -6.061  3.739   -7.628  1.00 0.00 ? 29 SER A HB2  2  
ATOM   1184  H HB3  . SER A 1 29 ? -6.302  4.648   -6.135  1.00 0.00 ? 29 SER A HB3  2  
ATOM   1185  H HG   . SER A 1 29 ? -8.122  4.767   -7.515  1.00 0.00 ? 29 SER A HG   2  
ATOM   1186  N N    . ASN A 1 30 ? -5.640  7.285   -5.989  1.00 0.00 ? 30 ASN A N    2  
ATOM   1187  C CA   . ASN A 1 30 ? -5.512  8.226   -4.900  1.00 0.00 ? 30 ASN A CA   2  
ATOM   1188  C C    . ASN A 1 30 ? -5.096  7.511   -3.623  1.00 0.00 ? 30 ASN A C    2  
ATOM   1189  O O    . ASN A 1 30 ? -4.120  7.892   -2.976  1.00 0.00 ? 30 ASN A O    2  
ATOM   1190  C CB   . ASN A 1 30 ? -6.829  8.972   -4.678  1.00 0.00 ? 30 ASN A CB   2  
ATOM   1191  C CG   . ASN A 1 30 ? -6.654  10.214  -3.826  1.00 0.00 ? 30 ASN A CG   2  
ATOM   1192  O OD1  . ASN A 1 30 ? -5.821  11.071  -4.122  1.00 0.00 ? 30 ASN A OD1  2  
ATOM   1193  N ND2  . ASN A 1 30 ? -7.440  10.317  -2.761  1.00 0.00 ? 30 ASN A ND2  2  
ATOM   1194  H H    . ASN A 1 30 ? -6.474  7.227   -6.462  1.00 0.00 ? 30 ASN A H    2  
ATOM   1195  H HA   . ASN A 1 30 ? -4.755  8.929   -5.176  1.00 0.00 ? 30 ASN A HA   2  
ATOM   1196  H HB2  . ASN A 1 30 ? -7.233  9.268   -5.634  1.00 0.00 ? 30 ASN A HB2  2  
ATOM   1197  H HB3  . ASN A 1 30 ? -7.530  8.314   -4.184  1.00 0.00 ? 30 ASN A HB3  2  
ATOM   1198  H HD21 . ASN A 1 30 ? -8.080  9.596   -2.587  1.00 0.00 ? 30 ASN A HD21 2  
ATOM   1199  H HD22 . ASN A 1 30 ? -7.348  11.110  -2.193  1.00 0.00 ? 30 ASN A HD22 2  
ATOM   1200  N N    . THR A 1 31 ? -5.849  6.462   -3.287  1.00 0.00 ? 31 THR A N    2  
ATOM   1201  C CA   . THR A 1 31 ? -5.598  5.637   -2.100  1.00 0.00 ? 31 THR A CA   2  
ATOM   1202  C C    . THR A 1 31 ? -4.577  6.276   -1.154  1.00 0.00 ? 31 THR A C    2  
ATOM   1203  O O    . THR A 1 31 ? -3.472  5.759   -0.992  1.00 0.00 ? 31 THR A O    2  
ATOM   1204  C CB   . THR A 1 31 ? -5.118  4.254   -2.535  1.00 0.00 ? 31 THR A CB   2  
ATOM   1205  O OG1  . THR A 1 31 ? -6.133  3.578   -3.256  1.00 0.00 ? 31 THR A OG1  2  
ATOM   1206  C CG2  . THR A 1 31 ? -4.703  3.361   -1.384  1.00 0.00 ? 31 THR A CG2  2  
ATOM   1207  H H    . THR A 1 31 ? -6.601  6.227   -3.868  1.00 0.00 ? 31 THR A H    2  
ATOM   1208  H HA   . THR A 1 31 ? -6.530  5.522   -1.577  1.00 0.00 ? 31 THR A HA   2  
ATOM   1209  H HB   . THR A 1 31 ? -4.269  4.376   -3.186  1.00 0.00 ? 31 THR A HB   2  
ATOM   1210  H HG1  . THR A 1 31 ? -6.962  3.640   -2.776  1.00 0.00 ? 31 THR A HG1  2  
ATOM   1211  H HG21 . THR A 1 31 ? -3.669  3.078   -1.504  1.00 0.00 ? 31 THR A HG21 2  
ATOM   1212  H HG22 . THR A 1 31 ? -5.321  2.476   -1.374  1.00 0.00 ? 31 THR A HG22 2  
ATOM   1213  H HG23 . THR A 1 31 ? -4.825  3.895   -0.452  1.00 0.00 ? 31 THR A HG23 2  
ATOM   1214  N N    . PRO A 1 32 ? -4.933  7.416   -0.523  1.00 0.00 ? 32 PRO A N    2  
ATOM   1215  C CA   . PRO A 1 32 ? -4.056  8.136   0.404   1.00 0.00 ? 32 PRO A CA   2  
ATOM   1216  C C    . PRO A 1 32 ? -3.149  7.201   1.203   1.00 0.00 ? 32 PRO A C    2  
ATOM   1217  O O    . PRO A 1 32 ? -3.528  6.699   2.260   1.00 0.00 ? 32 PRO A O    2  
ATOM   1218  C CB   . PRO A 1 32 ? -5.042  8.870   1.331   1.00 0.00 ? 32 PRO A CB   2  
ATOM   1219  C CG   . PRO A 1 32 ? -6.414  8.624   0.768   1.00 0.00 ? 32 PRO A CG   2  
ATOM   1220  C CD   . PRO A 1 32 ? -6.210  8.114   -0.652  1.00 0.00 ? 32 PRO A CD   2  
ATOM   1221  H HA   . PRO A 1 32 ? -3.447  8.857   -0.117  1.00 0.00 ? 32 PRO A HA   2  
ATOM   1222  H HB2  . PRO A 1 32 ? -4.955  8.475   2.332   1.00 0.00 ? 32 PRO A HB2  2  
ATOM   1223  H HB3  . PRO A 1 32 ? -4.808  9.924   1.339   1.00 0.00 ? 32 PRO A HB3  2  
ATOM   1224  H HG2  . PRO A 1 32 ? -6.920  7.881   1.375   1.00 0.00 ? 32 PRO A HG2  2  
ATOM   1225  H HG3  . PRO A 1 32 ? -6.980  9.550   0.770   1.00 0.00 ? 32 PRO A HG3  2  
ATOM   1226  H HD2  . PRO A 1 32 ? -7.002  7.437   -0.951  1.00 0.00 ? 32 PRO A HD2  2  
ATOM   1227  H HD3  . PRO A 1 32 ? -6.127  8.935   -1.356  1.00 0.00 ? 32 PRO A HD3  2  
ATOM   1228  N N    . PRO A 1 33 ? -1.933  6.948   0.685   1.00 0.00 ? 33 PRO A N    2  
ATOM   1229  C CA   . PRO A 1 33 ? -0.960  6.069   1.313   1.00 0.00 ? 33 PRO A CA   2  
ATOM   1230  C C    . PRO A 1 33 ? 0.024   6.803   2.203   1.00 0.00 ? 33 PRO A C    2  
ATOM   1231  O O    . PRO A 1 33 ? 1.149   7.087   1.798   1.00 0.00 ? 33 PRO A O    2  
ATOM   1232  C CB   . PRO A 1 33 ? -0.240  5.475   0.107   1.00 0.00 ? 33 PRO A CB   2  
ATOM   1233  C CG   . PRO A 1 33 ? -0.312  6.526   -0.960  1.00 0.00 ? 33 PRO A CG   2  
ATOM   1234  C CD   . PRO A 1 33 ? -1.410  7.493   -0.577  1.00 0.00 ? 33 PRO A CD   2  
ATOM   1235  H HA   . PRO A 1 33 ? -1.427  5.282   1.882   1.00 0.00 ? 33 PRO A HA   2  
ATOM   1236  H HB2  . PRO A 1 33 ? 0.784   5.257   0.373   1.00 0.00 ? 33 PRO A HB2  2  
ATOM   1237  H HB3  . PRO A 1 33 ? -0.737  4.568   -0.201  1.00 0.00 ? 33 PRO A HB3  2  
ATOM   1238  H HG2  . PRO A 1 33 ? 0.633   7.045   -1.020  1.00 0.00 ? 33 PRO A HG2  2  
ATOM   1239  H HG3  . PRO A 1 33 ? -0.540  6.063   -1.909  1.00 0.00 ? 33 PRO A HG3  2  
ATOM   1240  H HD2  . PRO A 1 33 ? -1.004  8.482   -0.428  1.00 0.00 ? 33 PRO A HD2  2  
ATOM   1241  H HD3  . PRO A 1 33 ? -2.177  7.511   -1.337  1.00 0.00 ? 33 PRO A HD3  2  
ATOM   1242  N N    . LEU A 1 34 ? -0.393  7.101   3.423   1.00 0.00 ? 34 LEU A N    2  
ATOM   1243  C CA   . LEU A 1 34 ? 0.493   7.788   4.351   1.00 0.00 ? 34 LEU A CA   2  
ATOM   1244  C C    . LEU A 1 34 ? 1.660   6.882   4.736   1.00 0.00 ? 34 LEU A C    2  
ATOM   1245  O O    . LEU A 1 34 ? 2.817   7.296   4.658   1.00 0.00 ? 34 LEU A O    2  
ATOM   1246  C CB   . LEU A 1 34 ? -0.261  8.295   5.591   1.00 0.00 ? 34 LEU A CB   2  
ATOM   1247  C CG   . LEU A 1 34 ? -1.586  9.005   5.302   1.00 0.00 ? 34 LEU A CG   2  
ATOM   1248  C CD1  . LEU A 1 34 ? -2.166  9.587   6.583   1.00 0.00 ? 34 LEU A CD1  2  
ATOM   1249  C CD2  . LEU A 1 34 ? -1.394  10.095  4.255   1.00 0.00 ? 34 LEU A CD2  2  
ATOM   1250  H H    . LEU A 1 34 ? -1.301  6.849   3.699   1.00 0.00 ? 34 LEU A H    2  
ATOM   1251  H HA   . LEU A 1 34 ? 0.903   8.628   3.819   1.00 0.00 ? 34 LEU A HA   2  
ATOM   1252  H HB2  . LEU A 1 34 ? -0.462  7.460   6.244   1.00 0.00 ? 34 LEU A HB2  2  
ATOM   1253  H HB3  . LEU A 1 34 ? 0.382   8.989   6.114   1.00 0.00 ? 34 LEU A HB3  2  
ATOM   1254  H HG   . LEU A 1 34 ? -2.294  8.287   4.913   1.00 0.00 ? 34 LEU A HG   2  
ATOM   1255  H HD11 . LEU A 1 34 ? -1.381  10.067  7.147   1.00 0.00 ? 34 LEU A HD11 2  
ATOM   1256  H HD12 . LEU A 1 34 ? -2.602  8.794   7.173   1.00 0.00 ? 34 LEU A HD12 2  
ATOM   1257  H HD13 . LEU A 1 34 ? -2.928  10.312  6.335   1.00 0.00 ? 34 LEU A HD13 2  
ATOM   1258  H HD21 . LEU A 1 34 ? -0.346  10.180  4.010   1.00 0.00 ? 34 LEU A HD21 2  
ATOM   1259  H HD22 . LEU A 1 34 ? -1.750  11.038  4.645   1.00 0.00 ? 34 LEU A HD22 2  
ATOM   1260  H HD23 . LEU A 1 34 ? -1.952  9.841   3.366   1.00 0.00 ? 34 LEU A HD23 2  
ATOM   1261  N N    . THR A 1 35 ? 1.372   5.637   5.110   1.00 0.00 ? 35 THR A N    2  
ATOM   1262  C CA   . THR A 1 35 ? 2.420   4.698   5.448   1.00 0.00 ? 35 THR A CA   2  
ATOM   1263  C C    . THR A 1 35 ? 2.853   3.933   4.200   1.00 0.00 ? 35 THR A C    2  
ATOM   1264  O O    . THR A 1 35 ? 3.671   3.015   4.277   1.00 0.00 ? 35 THR A O    2  
ATOM   1265  C CB   . THR A 1 35 ? 1.940   3.723   6.525   1.00 0.00 ? 35 THR A CB   2  
ATOM   1266  O OG1  . THR A 1 35 ? 2.996   2.876   6.942   1.00 0.00 ? 35 THR A OG1  2  
ATOM   1267  C CG2  . THR A 1 35 ? 0.797   2.841   6.070   1.00 0.00 ? 35 THR A CG2  2  
ATOM   1268  H H    . THR A 1 35 ? 0.445   5.334   5.133   1.00 0.00 ? 35 THR A H    2  
ATOM   1269  H HA   . THR A 1 35 ? 3.259   5.259   5.827   1.00 0.00 ? 35 THR A HA   2  
ATOM   1270  H HB   . THR A 1 35 ? 1.600   4.287   7.382   1.00 0.00 ? 35 THR A HB   2  
ATOM   1271  H HG1  . THR A 1 35 ? 3.447   2.522   6.171   1.00 0.00 ? 35 THR A HG1  2  
ATOM   1272  H HG21 . THR A 1 35 ? 0.478   3.145   5.084   1.00 0.00 ? 35 THR A HG21 2  
ATOM   1273  H HG22 . THR A 1 35 ? -0.029  2.937   6.760   1.00 0.00 ? 35 THR A HG22 2  
ATOM   1274  H HG23 . THR A 1 35 ? 1.125   1.813   6.041   1.00 0.00 ? 35 THR A HG23 2  
ATOM   1275  N N    . CYS A 1 36 ? 2.293   4.308   3.042   1.00 0.00 ? 36 CYS A N    2  
ATOM   1276  C CA   . CYS A 1 36 ? 2.627   3.639   1.792   1.00 0.00 ? 36 CYS A CA   2  
ATOM   1277  C C    . CYS A 1 36 ? 3.258   4.595   0.778   1.00 0.00 ? 36 CYS A C    2  
ATOM   1278  O O    . CYS A 1 36 ? 3.824   4.154   -0.220  1.00 0.00 ? 36 CYS A O    2  
ATOM   1279  C CB   . CYS A 1 36 ? 1.380   2.990   1.187   1.00 0.00 ? 36 CYS A CB   2  
ATOM   1280  S SG   . CYS A 1 36 ? 1.523   1.193   0.929   1.00 0.00 ? 36 CYS A SG   2  
ATOM   1281  H H    . CYS A 1 36 ? 1.637   5.042   3.030   1.00 0.00 ? 36 CYS A H    2  
ATOM   1282  H HA   . CYS A 1 36 ? 3.339   2.868   2.025   1.00 0.00 ? 36 CYS A HA   2  
ATOM   1283  H HB2  . CYS A 1 36 ? 0.540   3.161   1.843   1.00 0.00 ? 36 CYS A HB2  2  
ATOM   1284  H HB3  . CYS A 1 36 ? 1.178   3.441   0.227   1.00 0.00 ? 36 CYS A HB3  2  
ATOM   1285  N N    . GLN A 1 37 ? 3.154   5.904   1.025   1.00 0.00 ? 37 GLN A N    2  
ATOM   1286  C CA   . GLN A 1 37 ? 3.709   6.908   0.115   1.00 0.00 ? 37 GLN A CA   2  
ATOM   1287  C C    . GLN A 1 37 ? 5.081   6.495   -0.397  1.00 0.00 ? 37 GLN A C    2  
ATOM   1288  O O    . GLN A 1 37 ? 5.333   6.476   -1.602  1.00 0.00 ? 37 GLN A O    2  
ATOM   1289  C CB   . GLN A 1 37 ? 3.811   8.270   0.823   1.00 0.00 ? 37 GLN A CB   2  
ATOM   1290  C CG   . GLN A 1 37 ? 4.404   8.184   2.222   1.00 0.00 ? 37 GLN A CG   2  
ATOM   1291  C CD   . GLN A 1 37 ? 4.016   9.365   3.091   1.00 0.00 ? 37 GLN A CD   2  
ATOM   1292  O OE1  . GLN A 1 37 ? 2.998   10.015  2.858   1.00 0.00 ? 37 GLN A OE1  2  
ATOM   1293  N NE2  . GLN A 1 37 ? 4.831   9.648   4.101   1.00 0.00 ? 37 GLN A NE2  2  
ATOM   1294  H H    . GLN A 1 37 ? 2.683   6.206   1.832   1.00 0.00 ? 37 GLN A H    2  
ATOM   1295  H HA   . GLN A 1 37 ? 3.043   6.989   -0.726  1.00 0.00 ? 37 GLN A HA   2  
ATOM   1296  H HB2  . GLN A 1 37 ? 4.441   8.923   0.236   1.00 0.00 ? 37 GLN A HB2  2  
ATOM   1297  H HB3  . GLN A 1 37 ? 2.825   8.707   0.903   1.00 0.00 ? 37 GLN A HB3  2  
ATOM   1298  H HG2  . GLN A 1 37 ? 4.052   7.280   2.695   1.00 0.00 ? 37 GLN A HG2  2  
ATOM   1299  H HG3  . GLN A 1 37 ? 5.480   8.153   2.142   1.00 0.00 ? 37 GLN A HG3  2  
ATOM   1300  H HE21 . GLN A 1 37 ? 5.624   9.088   4.227   1.00 0.00 ? 37 GLN A HE21 2  
ATOM   1301  H HE22 . GLN A 1 37 ? 4.605   10.407  4.679   1.00 0.00 ? 37 GLN A HE22 2  
ATOM   1302  N N    . ARG A 1 38 ? 5.956   6.165   0.531   1.00 0.00 ? 38 ARG A N    2  
ATOM   1303  C CA   . ARG A 1 38 ? 7.311   5.746   0.198   1.00 0.00 ? 38 ARG A CA   2  
ATOM   1304  C C    . ARG A 1 38 ? 7.292   4.508   -0.695  1.00 0.00 ? 38 ARG A C    2  
ATOM   1305  O O    . ARG A 1 38 ? 8.130   4.360   -1.584  1.00 0.00 ? 38 ARG A O    2  
ATOM   1306  C CB   . ARG A 1 38 ? 8.102   5.457   1.477   1.00 0.00 ? 38 ARG A CB   2  
ATOM   1307  C CG   . ARG A 1 38 ? 9.211   6.461   1.751   1.00 0.00 ? 38 ARG A CG   2  
ATOM   1308  C CD   . ARG A 1 38 ? 9.962   6.127   3.032   1.00 0.00 ? 38 ARG A CD   2  
ATOM   1309  N NE   . ARG A 1 38 ? 11.409  6.143   2.831   1.00 0.00 ? 38 ARG A NE   2  
ATOM   1310  C CZ   . ARG A 1 38 ? 12.176  7.216   3.018   1.00 0.00 ? 38 ARG A CZ   2  
ATOM   1311  N NH1  . ARG A 1 38 ? 11.642  8.370   3.400   1.00 0.00 ? 38 ARG A NH1  2  
ATOM   1312  N NH2  . ARG A 1 38 ? 13.485  7.135   2.822   1.00 0.00 ? 38 ARG A NH2  2  
ATOM   1313  H H    . ARG A 1 38 ? 5.680   6.207   1.466   1.00 0.00 ? 38 ARG A H    2  
ATOM   1314  H HA   . ARG A 1 38 ? 7.787   6.555   -0.335  1.00 0.00 ? 38 ARG A HA   2  
ATOM   1315  H HB2  . ARG A 1 38 ? 7.423   5.469   2.317   1.00 0.00 ? 38 ARG A HB2  2  
ATOM   1316  H HB3  . ARG A 1 38 ? 8.547   4.476   1.400   1.00 0.00 ? 38 ARG A HB3  2  
ATOM   1317  H HG2  . ARG A 1 38 ? 9.906   6.450   0.925   1.00 0.00 ? 38 ARG A HG2  2  
ATOM   1318  H HG3  . ARG A 1 38 ? 8.777   7.446   1.846   1.00 0.00 ? 38 ARG A HG3  2  
ATOM   1319  H HD2  . ARG A 1 38 ? 9.690   6.850   3.786   1.00 0.00 ? 38 ARG A HD2  2  
ATOM   1320  H HD3  . ARG A 1 38 ? 9.655   5.145   3.360   1.00 0.00 ? 38 ARG A HD3  2  
ATOM   1321  H HE   . ARG A 1 38 ? 11.834  5.308   2.543   1.00 0.00 ? 38 ARG A HE   2  
ATOM   1322  H HH11 . ARG A 1 38 ? 10.656  8.442   3.548   1.00 0.00 ? 38 ARG A HH11 2  
ATOM   1323  H HH12 . ARG A 1 38 ? 12.227  9.169   3.539   1.00 0.00 ? 38 ARG A HH12 2  
ATOM   1324  H HH21 . ARG A 1 38 ? 13.895  6.270   2.532   1.00 0.00 ? 38 ARG A HH21 2  
ATOM   1325  H HH22 . ARG A 1 38 ? 14.063  7.939   2.962   1.00 0.00 ? 38 ARG A HH22 2  
ATOM   1326  N N    . TYR A 1 39 ? 6.340   3.614   -0.447  1.00 0.00 ? 39 TYR A N    2  
ATOM   1327  C CA   . TYR A 1 39 ? 6.228   2.385   -1.217  1.00 0.00 ? 39 TYR A CA   2  
ATOM   1328  C C    . TYR A 1 39 ? 5.566   2.612   -2.568  1.00 0.00 ? 39 TYR A C    2  
ATOM   1329  O O    . TYR A 1 39 ? 6.049   2.124   -3.589  1.00 0.00 ? 39 TYR A O    2  
ATOM   1330  C CB   . TYR A 1 39 ? 5.458   1.324   -0.422  1.00 0.00 ? 39 TYR A CB   2  
ATOM   1331  C CG   . TYR A 1 39 ? 5.740   -0.087  -0.881  1.00 0.00 ? 39 TYR A CG   2  
ATOM   1332  C CD1  . TYR A 1 39 ? 5.047   -0.640  -1.951  1.00 0.00 ? 39 TYR A CD1  2  
ATOM   1333  C CD2  . TYR A 1 39 ? 6.708   -0.860  -0.254  1.00 0.00 ? 39 TYR A CD2  2  
ATOM   1334  C CE1  . TYR A 1 39 ? 5.312   -1.926  -2.382  1.00 0.00 ? 39 TYR A CE1  2  
ATOM   1335  C CE2  . TYR A 1 39 ? 6.977   -2.147  -0.678  1.00 0.00 ? 39 TYR A CE2  2  
ATOM   1336  C CZ   . TYR A 1 39 ? 6.278   -2.675  -1.743  1.00 0.00 ? 39 TYR A CZ   2  
ATOM   1337  O OH   . TYR A 1 39 ? 6.544   -3.955  -2.170  1.00 0.00 ? 39 TYR A OH   2  
ATOM   1338  H H    . TYR A 1 39 ? 5.709   3.777   0.275   1.00 0.00 ? 39 TYR A H    2  
ATOM   1339  H HA   . TYR A 1 39 ? 7.225   2.029   -1.390  1.00 0.00 ? 39 TYR A HA   2  
ATOM   1340  H HB2  . TYR A 1 39 ? 5.732   1.395   0.620   1.00 0.00 ? 39 TYR A HB2  2  
ATOM   1341  H HB3  . TYR A 1 39 ? 4.398   1.502   -0.524  1.00 0.00 ? 39 TYR A HB3  2  
ATOM   1342  H HD1  . TYR A 1 39 ? 4.291   -0.052  -2.448  1.00 0.00 ? 39 TYR A HD1  2  
ATOM   1343  H HD2  . TYR A 1 39 ? 7.254   -0.445  0.581   1.00 0.00 ? 39 TYR A HD2  2  
ATOM   1344  H HE1  . TYR A 1 39 ? 4.764   -2.339  -3.216  1.00 0.00 ? 39 TYR A HE1  2  
ATOM   1345  H HE2  . TYR A 1 39 ? 7.733   -2.734  -0.177  1.00 0.00 ? 39 TYR A HE2  2  
ATOM   1346  H HH   . TYR A 1 39 ? 6.440   -4.566  -1.437  1.00 0.00 ? 39 TYR A HH   2  
ATOM   1347  N N    . CYS A 1 40 ? 4.467   3.352   -2.580  1.00 0.00 ? 40 CYS A N    2  
ATOM   1348  C CA   . CYS A 1 40 ? 3.767   3.622   -3.830  1.00 0.00 ? 40 CYS A CA   2  
ATOM   1349  C C    . CYS A 1 40 ? 4.681   4.366   -4.790  1.00 0.00 ? 40 CYS A C    2  
ATOM   1350  O O    . CYS A 1 40 ? 4.728   4.058   -5.980  1.00 0.00 ? 40 CYS A O    2  
ATOM   1351  C CB   . CYS A 1 40 ? 2.480   4.419   -3.589  1.00 0.00 ? 40 CYS A CB   2  
ATOM   1352  S SG   . CYS A 1 40 ? 1.519   4.758   -5.102  1.00 0.00 ? 40 CYS A SG   2  
ATOM   1353  H H    . CYS A 1 40 ? 4.126   3.720   -1.740  1.00 0.00 ? 40 CYS A H    2  
ATOM   1354  H HA   . CYS A 1 40 ? 3.514   2.670   -4.272  1.00 0.00 ? 40 CYS A HA   2  
ATOM   1355  H HB2  . CYS A 1 40 ? 1.841   3.865   -2.917  1.00 0.00 ? 40 CYS A HB2  2  
ATOM   1356  H HB3  . CYS A 1 40 ? 2.731   5.369   -3.139  1.00 0.00 ? 40 CYS A HB3  2  
ATOM   1357  N N    . ASN A 1 41 ? 5.426   5.333   -4.263  1.00 0.00 ? 41 ASN A N    2  
ATOM   1358  C CA   . ASN A 1 41 ? 6.351   6.094   -5.082  1.00 0.00 ? 41 ASN A CA   2  
ATOM   1359  C C    . ASN A 1 41 ? 7.543   5.230   -5.473  1.00 0.00 ? 41 ASN A C    2  
ATOM   1360  O O    . ASN A 1 41 ? 8.267   5.535   -6.420  1.00 0.00 ? 41 ASN A O    2  
ATOM   1361  C CB   . ASN A 1 41 ? 6.793   7.377   -4.355  1.00 0.00 ? 41 ASN A CB   2  
ATOM   1362  C CG   . ASN A 1 41 ? 8.233   7.339   -3.871  1.00 0.00 ? 41 ASN A CG   2  
ATOM   1363  O OD1  . ASN A 1 41 ? 9.035   8.208   -4.209  1.00 0.00 ? 41 ASN A OD1  2  
ATOM   1364  N ND2  . ASN A 1 41 ? 8.565   6.330   -3.075  1.00 0.00 ? 41 ASN A ND2  2  
ATOM   1365  H H    . ASN A 1 41 ? 5.361   5.526   -3.310  1.00 0.00 ? 41 ASN A H    2  
ATOM   1366  H HA   . ASN A 1 41 ? 5.828   6.357   -5.976  1.00 0.00 ? 41 ASN A HA   2  
ATOM   1367  H HB2  . ASN A 1 41 ? 6.687   8.214   -5.028  1.00 0.00 ? 41 ASN A HB2  2  
ATOM   1368  H HB3  . ASN A 1 41 ? 6.150   7.531   -3.500  1.00 0.00 ? 41 ASN A HB3  2  
ATOM   1369  H HD21 . ASN A 1 41 ? 7.874   5.672   -2.846  1.00 0.00 ? 41 ASN A HD21 2  
ATOM   1370  H HD22 . ASN A 1 41 ? 9.488   6.281   -2.749  1.00 0.00 ? 41 ASN A HD22 2  
ATOM   1371  N N    . ALA A 1 42 ? 7.720   4.138   -4.746  1.00 0.00 ? 42 ALA A N    2  
ATOM   1372  C CA   . ALA A 1 42 ? 8.799   3.203   -5.017  1.00 0.00 ? 42 ALA A CA   2  
ATOM   1373  C C    . ALA A 1 42 ? 8.235   1.890   -5.539  1.00 0.00 ? 42 ALA A C    2  
ATOM   1374  O O    . ALA A 1 42 ? 8.838   0.829   -5.383  1.00 0.00 ? 42 ALA A O    2  
ATOM   1375  C CB   . ALA A 1 42 ? 9.639   2.973   -3.771  1.00 0.00 ? 42 ALA A CB   2  
ATOM   1376  H H    . ALA A 1 42 ? 7.093   3.948   -4.017  1.00 0.00 ? 42 ALA A H    2  
ATOM   1377  H HA   . ALA A 1 42 ? 9.425   3.636   -5.780  1.00 0.00 ? 42 ALA A HA   2  
ATOM   1378  H HB1  . ALA A 1 42 ? 10.180  3.876   -3.530  1.00 0.00 ? 42 ALA A HB1  2  
ATOM   1379  H HB2  . ALA A 1 42 ? 10.339  2.171   -3.951  1.00 0.00 ? 42 ALA A HB2  2  
ATOM   1380  H HB3  . ALA A 1 42 ? 8.994   2.709   -2.946  1.00 0.00 ? 42 ALA A HB3  2  
ATOM   1381  N N    . SER A 1 43 ? 7.066   1.983   -6.160  1.00 0.00 ? 43 SER A N    2  
ATOM   1382  C CA   . SER A 1 43 ? 6.391   0.823   -6.716  1.00 0.00 ? 43 SER A CA   2  
ATOM   1383  C C    . SER A 1 43 ? 5.938   1.080   -8.154  1.00 0.00 ? 43 SER A C    2  
ATOM   1384  O O    . SER A 1 43 ? 5.745   0.139   -8.924  1.00 0.00 ? 43 SER A O    2  
ATOM   1385  C CB   . SER A 1 43 ? 5.188   0.442   -5.851  1.00 0.00 ? 43 SER A CB   2  
ATOM   1386  O OG   . SER A 1 43 ? 4.438   -0.600  -6.451  1.00 0.00 ? 43 SER A OG   2  
ATOM   1387  H H    . SER A 1 43 ? 6.647   2.858   -6.241  1.00 0.00 ? 43 SER A H    2  
ATOM   1388  H HA   . SER A 1 43 ? 7.093   0.008   -6.717  1.00 0.00 ? 43 SER A HA   2  
ATOM   1389  H HB2  . SER A 1 43 ? 5.534   0.109   -4.884  1.00 0.00 ? 43 SER A HB2  2  
ATOM   1390  H HB3  . SER A 1 43 ? 4.548   1.304   -5.728  1.00 0.00 ? 43 SER A HB3  2  
ATOM   1391  H HG   . SER A 1 43 ? 3.711   -0.845  -5.874  1.00 0.00 ? 43 SER A HG   2  
ATOM   1392  N N    . VAL A 1 44 ? 5.767   2.352   -8.518  1.00 0.00 ? 44 VAL A N    2  
ATOM   1393  C CA   . VAL A 1 44 ? 5.338   2.699   -9.864  1.00 0.00 ? 44 VAL A CA   2  
ATOM   1394  C C    . VAL A 1 44 ? 6.027   3.967   -10.362 1.00 0.00 ? 44 VAL A C    2  
ATOM   1395  O O    . VAL A 1 44 ? 5.372   4.926   -10.772 1.00 0.00 ? 44 VAL A O    2  
ATOM   1396  C CB   . VAL A 1 44 ? 3.806   2.881   -9.944  1.00 0.00 ? 44 VAL A CB   2  
ATOM   1397  C CG1  . VAL A 1 44 ? 3.357   4.067   -9.103  1.00 0.00 ? 44 VAL A CG1  2  
ATOM   1398  C CG2  . VAL A 1 44 ? 3.364   3.046   -11.391 1.00 0.00 ? 44 VAL A CG2  2  
ATOM   1399  H H    . VAL A 1 44 ? 5.932   3.067   -7.872  1.00 0.00 ? 44 VAL A H    2  
ATOM   1400  H HA   . VAL A 1 44 ? 5.620   1.886   -10.510 1.00 0.00 ? 44 VAL A HA   2  
ATOM   1401  H HB   . VAL A 1 44 ? 3.334   1.992   -9.546  1.00 0.00 ? 44 VAL A HB   2  
ATOM   1402  H HG11 . VAL A 1 44 ? 3.481   4.978   -9.668  1.00 0.00 ? 44 VAL A HG11 2  
ATOM   1403  H HG12 . VAL A 1 44 ? 3.951   4.116   -8.203  1.00 0.00 ? 44 VAL A HG12 2  
ATOM   1404  H HG13 . VAL A 1 44 ? 2.316   3.948   -8.840  1.00 0.00 ? 44 VAL A HG13 2  
ATOM   1405  H HG21 . VAL A 1 44 ? 4.203   3.370   -11.988 1.00 0.00 ? 44 VAL A HG21 2  
ATOM   1406  H HG22 . VAL A 1 44 ? 2.577   3.783   -11.446 1.00 0.00 ? 44 VAL A HG22 2  
ATOM   1407  H HG23 . VAL A 1 44 ? 3.000   2.101   -11.766 1.00 0.00 ? 44 VAL A HG23 2  
ATOM   1408  N N    . THR A 1 45 ? 7.354   3.951   -10.341 1.00 0.00 ? 45 THR A N    2  
ATOM   1409  C CA   . THR A 1 45 ? 8.145   5.086   -10.804 1.00 0.00 ? 45 THR A CA   2  
ATOM   1410  C C    . THR A 1 45 ? 7.721   6.381   -10.108 1.00 0.00 ? 45 THR A C    2  
ATOM   1411  O O    . THR A 1 45 ? 6.722   6.412   -9.390  1.00 0.00 ? 45 THR A O    2  
ATOM   1412  C CB   . THR A 1 45 ? 7.996   5.225   -12.318 1.00 0.00 ? 45 THR A CB   2  
ATOM   1413  O OG1  . THR A 1 45 ? 8.138   3.966   -12.951 1.00 0.00 ? 45 THR A OG1  2  
ATOM   1414  C CG2  . THR A 1 45 ? 9.002   6.166   -12.945 1.00 0.00 ? 45 THR A CG2  2  
ATOM   1415  H H    . THR A 1 45 ? 7.813   3.152   -10.020 1.00 0.00 ? 45 THR A H    2  
ATOM   1416  H HA   . THR A 1 45 ? 9.179   4.888   -10.570 1.00 0.00 ? 45 THR A HA   2  
ATOM   1417  H HB   . THR A 1 45 ? 7.010   5.602   -12.532 1.00 0.00 ? 45 THR A HB   2  
ATOM   1418  H HG1  . THR A 1 45 ? 9.011   3.611   -12.767 1.00 0.00 ? 45 THR A HG1  2  
ATOM   1419  H HG21 . THR A 1 45 ? 8.637   7.181   -12.877 1.00 0.00 ? 45 THR A HG21 2  
ATOM   1420  H HG22 . THR A 1 45 ? 9.142   5.904   -13.983 1.00 0.00 ? 45 THR A HG22 2  
ATOM   1421  H HG23 . THR A 1 45 ? 9.944   6.086   -12.423 1.00 0.00 ? 45 THR A HG23 2  
ATOM   1422  N N    . ASN A 1 46 ? 8.486   7.446   -10.328 1.00 0.00 ? 46 ASN A N    2  
ATOM   1423  C CA   . ASN A 1 46 ? 8.191   8.739   -9.732  1.00 0.00 ? 46 ASN A CA   2  
ATOM   1424  C C    . ASN A 1 46 ? 8.295   9.851   -10.771 1.00 0.00 ? 46 ASN A C    2  
ATOM   1425  O O    . ASN A 1 46 ? 8.955   9.693   -11.798 1.00 0.00 ? 46 ASN A O    2  
ATOM   1426  C CB   . ASN A 1 46 ? 9.144   9.019   -8.568  1.00 0.00 ? 46 ASN A CB   2  
ATOM   1427  C CG   . ASN A 1 46 ? 10.599  8.862   -8.966  1.00 0.00 ? 46 ASN A CG   2  
ATOM   1428  O OD1  . ASN A 1 46 ? 11.240  7.863   -8.639  1.00 0.00 ? 46 ASN A OD1  2  
ATOM   1429  N ND2  . ASN A 1 46 ? 11.128  9.852   -9.674  1.00 0.00 ? 46 ASN A ND2  2  
ATOM   1430  H H    . ASN A 1 46 ? 9.261   7.363   -10.905 1.00 0.00 ? 46 ASN A H    2  
ATOM   1431  H HA   . ASN A 1 46 ? 7.183   8.704   -9.361  1.00 0.00 ? 46 ASN A HA   2  
ATOM   1432  H HB2  . ASN A 1 46 ? 8.992   10.029  -8.221  1.00 0.00 ? 46 ASN A HB2  2  
ATOM   1433  H HB3  . ASN A 1 46 ? 8.932   8.330   -7.764  1.00 0.00 ? 46 ASN A HB3  2  
ATOM   1434  H HD21 . ASN A 1 46 ? 10.558  10.617  -9.899  1.00 0.00 ? 46 ASN A HD21 2  
ATOM   1435  H HD22 . ASN A 1 46 ? 12.067  9.777   -9.947  1.00 0.00 ? 46 ASN A HD22 2  
ATOM   1436  N N    . SER A 1 47 ? 7.636   10.974  -10.500 1.00 0.00 ? 47 SER A N    2  
ATOM   1437  C CA   . SER A 1 47 ? 7.653   12.109  -11.415 1.00 0.00 ? 47 SER A CA   2  
ATOM   1438  C C    . SER A 1 47 ? 7.019   11.740  -12.752 1.00 0.00 ? 47 SER A C    2  
ATOM   1439  O O    . SER A 1 47 ? 7.118   10.598  -13.196 1.00 0.00 ? 47 SER A O    2  
ATOM   1440  C CB   . SER A 1 47 ? 9.088   12.593  -11.635 1.00 0.00 ? 47 SER A CB   2  
ATOM   1441  O OG   . SER A 1 47 ? 9.108   13.896  -12.193 1.00 0.00 ? 47 SER A OG   2  
ATOM   1442  H H    . SER A 1 47 ? 7.124   11.039  -9.667  1.00 0.00 ? 47 SER A H    2  
ATOM   1443  H HA   . SER A 1 47 ? 7.080   12.906  -10.966 1.00 0.00 ? 47 SER A HA   2  
ATOM   1444  H HB2  . SER A 1 47 ? 9.609   12.612  -10.690 1.00 0.00 ? 47 SER A HB2  2  
ATOM   1445  H HB3  . SER A 1 47 ? 9.594   11.918  -12.310 1.00 0.00 ? 47 SER A HB3  2  
ATOM   1446  H HG   . SER A 1 47 ? 10.009  14.129  -12.432 1.00 0.00 ? 47 SER A HG   2  
ATOM   1447  N N    . VAL A 1 48 ? 6.377   12.719  -13.388 1.00 0.00 ? 48 VAL A N    2  
ATOM   1448  C CA   . VAL A 1 48 ? 5.725   12.526  -14.677 1.00 0.00 ? 48 VAL A CA   2  
ATOM   1449  C C    . VAL A 1 48 ? 4.844   13.717  -15.007 1.00 0.00 ? 48 VAL A C    2  
ATOM   1450  O O    . VAL A 1 48 ? 3.723   13.842  -14.512 1.00 0.00 ? 48 VAL A O    2  
ATOM   1451  C CB   . VAL A 1 48 ? 4.856   11.261  -14.745 1.00 0.00 ? 48 VAL A CB   2  
ATOM   1452  C CG1  . VAL A 1 48 ? 5.655   10.075  -15.267 1.00 0.00 ? 48 VAL A CG1  2  
ATOM   1453  C CG2  . VAL A 1 48 ? 4.226   10.951  -13.394 1.00 0.00 ? 48 VAL A CG2  2  
ATOM   1454  H H    . VAL A 1 48 ? 6.347   13.610  -12.982 1.00 0.00 ? 48 VAL A H    2  
ATOM   1455  H HA   . VAL A 1 48 ? 6.497   12.447  -15.429 1.00 0.00 ? 48 VAL A HA   2  
ATOM   1456  H HB   . VAL A 1 48 ? 4.066   11.461  -15.449 1.00 0.00 ? 48 VAL A HB   2  
ATOM   1457  H HG11 . VAL A 1 48 ? 6.627   10.412  -15.598 1.00 0.00 ? 48 VAL A HG11 2  
ATOM   1458  H HG12 . VAL A 1 48 ? 5.129   9.624   -16.095 1.00 0.00 ? 48 VAL A HG12 2  
ATOM   1459  H HG13 . VAL A 1 48 ? 5.777   9.347   -14.478 1.00 0.00 ? 48 VAL A HG13 2  
ATOM   1460  H HG21 . VAL A 1 48 ? 3.303   10.412  -13.544 1.00 0.00 ? 48 VAL A HG21 2  
ATOM   1461  H HG22 . VAL A 1 48 ? 4.025   11.873  -12.870 1.00 0.00 ? 48 VAL A HG22 2  
ATOM   1462  H HG23 . VAL A 1 48 ? 4.905   10.346  -12.810 1.00 0.00 ? 48 VAL A HG23 2  
ATOM   1463  N N    . LYS A 1 49 ? 5.365   14.582  -15.847 1.00 0.00 ? 49 LYS A N    2  
ATOM   1464  C CA   . LYS A 1 49 ? 4.651   15.782  -16.272 1.00 0.00 ? 49 LYS A CA   2  
ATOM   1465  C C    . LYS A 1 49 ? 4.244   16.633  -15.074 1.00 0.00 ? 49 LYS A C    2  
ATOM   1466  O O    . LYS A 1 49 ? 3.182   16.428  -14.486 1.00 0.00 ? 49 LYS A O    2  
ATOM   1467  C CB   . LYS A 1 49 ? 3.412   15.400  -17.086 1.00 0.00 ? 49 LYS A CB   2  
ATOM   1468  C CG   . LYS A 1 49 ? 2.825   16.555  -17.882 1.00 0.00 ? 49 LYS A CG   2  
ATOM   1469  C CD   . LYS A 1 49 ? 1.494   17.013  -17.309 1.00 0.00 ? 49 LYS A CD   2  
ATOM   1470  C CE   . LYS A 1 49 ? 0.325   16.476  -18.118 1.00 0.00 ? 49 LYS A CE   2  
ATOM   1471  N NZ   . LYS A 1 49 ? -0.001  17.356  -19.275 1.00 0.00 ? 49 LYS A NZ   2  
ATOM   1472  H H    . LYS A 1 49 ? 6.258   14.406  -16.193 1.00 0.00 ? 49 LYS A H    2  
ATOM   1473  H HA   . LYS A 1 49 ? 5.315   16.359  -16.899 1.00 0.00 ? 49 LYS A HA   2  
ATOM   1474  H HB2  . LYS A 1 49 ? 3.679   14.613  -17.777 1.00 0.00 ? 49 LYS A HB2  2  
ATOM   1475  H HB3  . LYS A 1 49 ? 2.652   15.032  -16.411 1.00 0.00 ? 49 LYS A HB3  2  
ATOM   1476  H HG2  . LYS A 1 49 ? 3.518   17.383  -17.858 1.00 0.00 ? 49 LYS A HG2  2  
ATOM   1477  H HG3  . LYS A 1 49 ? 2.678   16.237  -18.904 1.00 0.00 ? 49 LYS A HG3  2  
ATOM   1478  H HD2  . LYS A 1 49 ? 1.408   16.658  -16.292 1.00 0.00 ? 49 LYS A HD2  2  
ATOM   1479  H HD3  . LYS A 1 49 ? 1.461   18.093  -17.318 1.00 0.00 ? 49 LYS A HD3  2  
ATOM   1480  H HE2  . LYS A 1 49 ? 0.579   15.493  -18.487 1.00 0.00 ? 49 LYS A HE2  2  
ATOM   1481  H HE3  . LYS A 1 49 ? -0.541  16.407  -17.476 1.00 0.00 ? 49 LYS A HE3  2  
ATOM   1482  H HZ1  . LYS A 1 49 ? -0.850  17.006  -19.763 1.00 0.00 ? 49 LYS A HZ1  2  
ATOM   1483  H HZ2  . LYS A 1 49 ? 0.792   17.369  -19.948 1.00 0.00 ? 49 LYS A HZ2  2  
ATOM   1484  H HZ3  . LYS A 1 49 ? -0.178  18.327  -18.946 1.00 0.00 ? 49 LYS A HZ3  2  
HETATM 1485  N N    . CY1 A 1 50 ? 5.094   17.590  -14.718 1.00 0.00 ? 50 CY1 A N    2  
HETATM 1486  C CA   . CY1 A 1 50 ? 4.821   18.472  -13.590 1.00 0.00 ? 50 CY1 A CA   2  
HETATM 1487  C CB   . CY1 A 1 50 ? 5.130   17.760  -12.273 1.00 0.00 ? 50 CY1 A CB   2  
HETATM 1488  S SG   . CY1 A 1 50 ? 4.504   18.658  -10.839 1.00 0.00 ? 50 CY1 A SG   2  
HETATM 1489  C CD   . CY1 A 1 50 ? 3.307   17.500  -10.149 1.00 0.00 ? 50 CY1 A CD   2  
HETATM 1490  N NE   . CY1 A 1 50 ? 2.382   18.198  -9.262  1.00 0.00 ? 50 CY1 A NE   2  
HETATM 1491  C CZ   . CY1 A 1 50 ? 1.710   17.613  -8.276  1.00 0.00 ? 50 CY1 A CZ   2  
HETATM 1492  O OAC  . CY1 A 1 50 ? 1.794   16.416  -8.000  1.00 0.00 ? 50 CY1 A OAC  2  
HETATM 1493  C CM   . CY1 A 1 50 ? 0.799   18.522  -7.472  1.00 0.00 ? 50 CY1 A CM   2  
HETATM 1494  C C    . CY1 A 1 50 ? 5.641   19.755  -13.693 1.00 0.00 ? 50 CY1 A C    2  
HETATM 1495  O O    . CY1 A 1 50 ? 6.702   19.870  -13.080 1.00 0.00 ? 50 CY1 A O    2  
HETATM 1496  H H    . CY1 A 1 50 ? 5.923   17.706  -15.226 1.00 0.00 ? 50 CY1 A H    2  
HETATM 1497  H HA   . CY1 A 1 50 ? 3.773   18.726  -13.615 1.00 0.00 ? 50 CY1 A HA   2  
HETATM 1498  H HB2  . CY1 A 1 50 ? 4.677   16.780  -12.287 1.00 0.00 ? 50 CY1 A HB2  2  
HETATM 1499  H HB3  . CY1 A 1 50 ? 6.199   17.657  -12.169 1.00 0.00 ? 50 CY1 A HB3  2  
HETATM 1500  H HD2  . CY1 A 1 50 ? 2.819   17.271  -11.085 1.00 0.00 ? 50 CY1 A HD2  2  
HETATM 1501  H HD3  . CY1 A 1 50 ? 3.957   16.859  -9.573  1.00 0.00 ? 50 CY1 A HD3  2  
HETATM 1502  H HE   . CY1 A 1 50 ? 2.308   19.172  -9.347  1.00 0.00 ? 50 CY1 A HE   2  
HETATM 1503  H HM1  . CY1 A 1 50 ? -0.233  18.319  -7.746  1.00 0.00 ? 50 CY1 A HM1  2  
HETATM 1504  H HM2  . CY1 A 1 50 ? 1.064   19.556  -7.675  1.00 0.00 ? 50 CY1 A HM2  2  
HETATM 1505  H HM3  . CY1 A 1 50 ? 0.920   18.334  -6.426  1.00 0.00 ? 50 CY1 A HM3  2  
HETATM 1506  N N    . NH2 A 1 51 ? 5.163   20.726  -14.463 1.00 0.00 ? 51 NH2 A N    2  
HETATM 1507  H HN1  . NH2 A 1 51 ? 4.312   20.575  -14.926 1.00 0.00 ? 51 NH2 A HN1  2  
HETATM 1508  H HN2  . NH2 A 1 51 ? 5.680   21.555  -14.539 1.00 0.00 ? 51 NH2 A HN2  2  
ATOM   1509  N N    . LEU A 1 1  ? -0.049  -4.159  18.307  1.00 0.00 ? 1  LEU A N    3  
ATOM   1510  C CA   . LEU A 1 1  ? -0.615  -4.269  16.936  1.00 0.00 ? 1  LEU A CA   3  
ATOM   1511  C C    . LEU A 1 1  ? -1.559  -5.462  16.826  1.00 0.00 ? 1  LEU A C    3  
ATOM   1512  O O    . LEU A 1 1  ? -1.914  -6.082  17.828  1.00 0.00 ? 1  LEU A O    3  
ATOM   1513  C CB   . LEU A 1 1  ? 0.542   -4.409  15.943  1.00 0.00 ? 1  LEU A CB   3  
ATOM   1514  C CG   . LEU A 1 1  ? 0.785   -3.183  15.057  1.00 0.00 ? 1  LEU A CG   3  
ATOM   1515  C CD1  . LEU A 1 1  ? 2.166   -2.599  15.315  1.00 0.00 ? 1  LEU A CD1  3  
ATOM   1516  C CD2  . LEU A 1 1  ? 0.624   -3.543  13.587  1.00 0.00 ? 1  LEU A CD2  3  
ATOM   1517  H H1   . LEU A 1 1  ? 0.691   -4.882  18.403  1.00 0.00 ? 1  LEU A H1   3  
ATOM   1518  H H2   . LEU A 1 1  ? -0.824  -4.321  18.982  1.00 0.00 ? 1  LEU A H2   3  
ATOM   1519  H H3   . LEU A 1 1  ? 0.347   -3.204  18.410  1.00 0.00 ? 1  LEU A H3   3  
ATOM   1520  H HA   . LEU A 1 1  ? -1.164  -3.366  16.718  1.00 0.00 ? 1  LEU A HA   3  
ATOM   1521  H HB2  . LEU A 1 1  ? 1.444   -4.611  16.501  1.00 0.00 ? 1  LEU A HB2  3  
ATOM   1522  H HB3  . LEU A 1 1  ? 0.340   -5.255  15.301  1.00 0.00 ? 1  LEU A HB3  3  
ATOM   1523  H HG   . LEU A 1 1  ? 0.054   -2.425  15.298  1.00 0.00 ? 1  LEU A HG   3  
ATOM   1524  H HD11 . LEU A 1 1  ? 2.423   -1.916  14.518  1.00 0.00 ? 1  LEU A HD11 3  
ATOM   1525  H HD12 . LEU A 1 1  ? 2.893   -3.397  15.353  1.00 0.00 ? 1  LEU A HD12 3  
ATOM   1526  H HD13 . LEU A 1 1  ? 2.164   -2.070  16.256  1.00 0.00 ? 1  LEU A HD13 3  
ATOM   1527  H HD21 . LEU A 1 1  ? 1.297   -4.350  13.339  1.00 0.00 ? 1  LEU A HD21 3  
ATOM   1528  H HD22 . LEU A 1 1  ? 0.855   -2.681  12.978  1.00 0.00 ? 1  LEU A HD22 3  
ATOM   1529  H HD23 . LEU A 1 1  ? -0.394  -3.852  13.402  1.00 0.00 ? 1  LEU A HD23 3  
ATOM   1530  N N    . GLN A 1 2  ? -1.963  -5.780  15.599  1.00 0.00 ? 2  GLN A N    3  
ATOM   1531  C CA   . GLN A 1 2  ? -2.867  -6.898  15.357  1.00 0.00 ? 2  GLN A CA   3  
ATOM   1532  C C    . GLN A 1 2  ? -2.845  -7.308  13.888  1.00 0.00 ? 2  GLN A C    3  
ATOM   1533  O O    . GLN A 1 2  ? -2.878  -6.459  12.997  1.00 0.00 ? 2  GLN A O    3  
ATOM   1534  C CB   . GLN A 1 2  ? -4.291  -6.527  15.774  1.00 0.00 ? 2  GLN A CB   3  
ATOM   1535  C CG   . GLN A 1 2  ? -4.759  -5.194  15.214  1.00 0.00 ? 2  GLN A CG   3  
ATOM   1536  C CD   . GLN A 1 2  ? -5.686  -4.456  16.161  1.00 0.00 ? 2  GLN A CD   3  
ATOM   1537  O OE1  . GLN A 1 2  ? -5.331  -3.409  16.703  1.00 0.00 ? 2  GLN A OE1  3  
ATOM   1538  N NE2  . GLN A 1 2  ? -6.879  -5.001  16.367  1.00 0.00 ? 2  GLN A NE2  3  
ATOM   1539  H H    . GLN A 1 2  ? -1.646  -5.249  14.840  1.00 0.00 ? 2  GLN A H    3  
ATOM   1540  H HA   . GLN A 1 2  ? -2.532  -7.731  15.957  1.00 0.00 ? 2  GLN A HA   3  
ATOM   1541  H HB2  . GLN A 1 2  ? -4.967  -7.296  15.428  1.00 0.00 ? 2  GLN A HB2  3  
ATOM   1542  H HB3  . GLN A 1 2  ? -4.337  -6.477  16.852  1.00 0.00 ? 2  GLN A HB3  3  
ATOM   1543  H HG2  . GLN A 1 2  ? -3.896  -4.574  15.024  1.00 0.00 ? 2  GLN A HG2  3  
ATOM   1544  H HG3  . GLN A 1 2  ? -5.284  -5.371  14.287  1.00 0.00 ? 2  GLN A HG3  3  
ATOM   1545  H HE21 . GLN A 1 2  ? -7.092  -5.836  15.902  1.00 0.00 ? 2  GLN A HE21 3  
ATOM   1546  H HE22 . GLN A 1 2  ? -7.498  -4.544  16.974  1.00 0.00 ? 2  GLN A HE22 3  
ATOM   1547  N N    . MET A 1 3  ? -2.786  -8.617  13.644  1.00 0.00 ? 3  MET A N    3  
ATOM   1548  C CA   . MET A 1 3  ? -2.757  -9.153  12.280  1.00 0.00 ? 3  MET A CA   3  
ATOM   1549  C C    . MET A 1 3  ? -1.381  -9.014  11.643  1.00 0.00 ? 3  MET A C    3  
ATOM   1550  O O    . MET A 1 3  ? -1.149  -9.505  10.538  1.00 0.00 ? 3  MET A O    3  
ATOM   1551  C CB   . MET A 1 3  ? -3.802  -8.462  11.404  1.00 0.00 ? 3  MET A CB   3  
ATOM   1552  C CG   . MET A 1 3  ? -4.163  -9.243  10.150  1.00 0.00 ? 3  MET A CG   3  
ATOM   1553  S SD   . MET A 1 3  ? -4.846  -10.869 10.517  1.00 0.00 ? 3  MET A SD   3  
ATOM   1554  C CE   . MET A 1 3  ? -5.070  -11.524 8.866   1.00 0.00 ? 3  MET A CE   3  
ATOM   1555  H H    . MET A 1 3  ? -2.761  -9.241  14.401  1.00 0.00 ? 3  MET A H    3  
ATOM   1556  H HA   . MET A 1 3  ? -2.987  -10.199 12.339  1.00 0.00 ? 3  MET A HA   3  
ATOM   1557  H HB2  . MET A 1 3  ? -4.701  -8.315  11.984  1.00 0.00 ? 3  MET A HB2  3  
ATOM   1558  H HB3  . MET A 1 3  ? -3.416  -7.499  11.104  1.00 0.00 ? 3  MET A HB3  3  
ATOM   1559  H HG2  . MET A 1 3  ? -4.895  -8.680  9.589   1.00 0.00 ? 3  MET A HG2  3  
ATOM   1560  H HG3  . MET A 1 3  ? -3.273  -9.368  9.550   1.00 0.00 ? 3  MET A HG3  3  
ATOM   1561  H HE1  . MET A 1 3  ? -6.082  -11.336 8.538   1.00 0.00 ? 3  MET A HE1  3  
ATOM   1562  H HE2  . MET A 1 3  ? -4.884  -12.587 8.871   1.00 0.00 ? 3  MET A HE2  3  
ATOM   1563  H HE3  . MET A 1 3  ? -4.379  -11.041 8.191   1.00 0.00 ? 3  MET A HE3  3  
ATOM   1564  N N    . ALA A 1 4  ? -0.473  -8.351  12.338  1.00 0.00 ? 4  ALA A N    3  
ATOM   1565  C CA   . ALA A 1 4  ? 0.875   -8.161  11.833  1.00 0.00 ? 4  ALA A CA   3  
ATOM   1566  C C    . ALA A 1 4  ? 1.660   -9.472  11.863  1.00 0.00 ? 4  ALA A C    3  
ATOM   1567  O O    . ALA A 1 4  ? 2.665   -9.590  12.564  1.00 0.00 ? 4  ALA A O    3  
ATOM   1568  C CB   . ALA A 1 4  ? 1.572   -7.099  12.659  1.00 0.00 ? 4  ALA A CB   3  
ATOM   1569  H H    . ALA A 1 4  ? -0.710  -7.982  13.212  1.00 0.00 ? 4  ALA A H    3  
ATOM   1570  H HA   . ALA A 1 4  ? 0.805   -7.807  10.814  1.00 0.00 ? 4  ALA A HA   3  
ATOM   1571  H HB1  . ALA A 1 4  ? 1.079   -7.017  13.616  1.00 0.00 ? 4  ALA A HB1  3  
ATOM   1572  H HB2  . ALA A 1 4  ? 1.521   -6.152  12.144  1.00 0.00 ? 4  ALA A HB2  3  
ATOM   1573  H HB3  . ALA A 1 4  ? 2.605   -7.376  12.807  1.00 0.00 ? 4  ALA A HB3  3  
ATOM   1574  N N    . GLY A 1 5  ? 1.193   -10.458 11.100  1.00 0.00 ? 5  GLY A N    3  
ATOM   1575  C CA   . GLY A 1 5  ? 1.862   -11.747 11.059  1.00 0.00 ? 5  GLY A CA   3  
ATOM   1576  C C    . GLY A 1 5  ? 1.117   -12.760 10.209  1.00 0.00 ? 5  GLY A C    3  
ATOM   1577  O O    . GLY A 1 5  ? 1.173   -13.962 10.471  1.00 0.00 ? 5  GLY A O    3  
ATOM   1578  H H    . GLY A 1 5  ? 0.388   -10.311 10.563  1.00 0.00 ? 5  GLY A H    3  
ATOM   1579  H HA2  . GLY A 1 5  ? 2.854   -11.613 10.653  1.00 0.00 ? 5  GLY A HA2  3  
ATOM   1580  H HA3  . GLY A 1 5  ? 1.942   -12.130 12.067  1.00 0.00 ? 5  GLY A HA3  3  
ATOM   1581  N N    . GLN A 1 6  ? 0.425   -12.274 9.181   1.00 0.00 ? 6  GLN A N    3  
ATOM   1582  C CA   . GLN A 1 6  ? -0.326  -13.132 8.281   1.00 0.00 ? 6  GLN A CA   3  
ATOM   1583  C C    . GLN A 1 6  ? -1.077  -12.289 7.265   1.00 0.00 ? 6  GLN A C    3  
ATOM   1584  O O    . GLN A 1 6  ? -2.302  -12.168 7.309   1.00 0.00 ? 6  GLN A O    3  
ATOM   1585  C CB   . GLN A 1 6  ? -1.295  -14.029 9.056   1.00 0.00 ? 6  GLN A CB   3  
ATOM   1586  C CG   . GLN A 1 6  ? -0.785  -15.448 9.249   1.00 0.00 ? 6  GLN A CG   3  
ATOM   1587  C CD   . GLN A 1 6  ? -1.594  -16.470 8.472   1.00 0.00 ? 6  GLN A CD   3  
ATOM   1588  O OE1  . GLN A 1 6  ? -2.333  -17.265 9.053   1.00 0.00 ? 6  GLN A OE1  3  
ATOM   1589  N NE2  . GLN A 1 6  ? -1.457  -16.453 7.152   1.00 0.00 ? 6  GLN A NE2  3  
ATOM   1590  H H    . GLN A 1 6  ? 0.426   -11.314 9.017   1.00 0.00 ? 6  GLN A H    3  
ATOM   1591  H HA   . GLN A 1 6  ? 0.383   -13.741 7.753   1.00 0.00 ? 6  GLN A HA   3  
ATOM   1592  H HB2  . GLN A 1 6  ? -1.467  -13.596 10.031  1.00 0.00 ? 6  GLN A HB2  3  
ATOM   1593  H HB3  . GLN A 1 6  ? -2.233  -14.075 8.523   1.00 0.00 ? 6  GLN A HB3  3  
ATOM   1594  H HG2  . GLN A 1 6  ? 0.241   -15.497 8.917   1.00 0.00 ? 6  GLN A HG2  3  
ATOM   1595  H HG3  . GLN A 1 6  ? -0.835  -15.695 10.300  1.00 0.00 ? 6  GLN A HG3  3  
ATOM   1596  H HE21 . GLN A 1 6  ? -0.850  -15.792 6.758   1.00 0.00 ? 6  GLN A HE21 3  
ATOM   1597  H HE22 . GLN A 1 6  ? -1.968  -17.103 6.624   1.00 0.00 ? 6  GLN A HE22 3  
ATOM   1598  N N    . CYS A 1 7  ? -0.316  -11.700 6.359   1.00 0.00 ? 7  CYS A N    3  
ATOM   1599  C CA   . CYS A 1 7  ? -0.870  -10.845 5.316   1.00 0.00 ? 7  CYS A CA   3  
ATOM   1600  C C    . CYS A 1 7  ? -0.115  -11.020 4.012   1.00 0.00 ? 7  CYS A C    3  
ATOM   1601  O O    . CYS A 1 7  ? 1.107   -11.172 4.011   1.00 0.00 ? 7  CYS A O    3  
ATOM   1602  C CB   . CYS A 1 7  ? -0.791  -9.378  5.744   1.00 0.00 ? 7  CYS A CB   3  
ATOM   1603  S SG   . CYS A 1 7  ? -1.636  -9.030  7.318   1.00 0.00 ? 7  CYS A SG   3  
ATOM   1604  H H    . CYS A 1 7  ? 0.653   -11.840 6.401   1.00 0.00 ? 7  CYS A H    3  
ATOM   1605  H HA   . CYS A 1 7  ? -1.904  -11.116 5.169   1.00 0.00 ? 7  CYS A HA   3  
ATOM   1606  H HB2  . CYS A 1 7  ? 0.249   -9.098  5.856   1.00 0.00 ? 7  CYS A HB2  3  
ATOM   1607  H HB3  . CYS A 1 7  ? -1.239  -8.758  4.980   1.00 0.00 ? 7  CYS A HB3  3  
ATOM   1608  N N    . SER A 1 8  ? -0.834  -10.971 2.893   1.00 0.00 ? 8  SER A N    3  
ATOM   1609  C CA   . SER A 1 8  ? -0.188  -11.093 1.598   1.00 0.00 ? 8  SER A CA   3  
ATOM   1610  C C    . SER A 1 8  ? 0.919   -10.060 1.508   1.00 0.00 ? 8  SER A C    3  
ATOM   1611  O O    . SER A 1 8  ? 0.783   -8.950  2.014   1.00 0.00 ? 8  SER A O    3  
ATOM   1612  C CB   . SER A 1 8  ? -1.182  -10.894 0.456   1.00 0.00 ? 8  SER A CB   3  
ATOM   1613  O OG   . SER A 1 8  ? -2.409  -11.550 0.722   1.00 0.00 ? 8  SER A OG   3  
ATOM   1614  H H    . SER A 1 8  ? -1.802  -10.830 2.942   1.00 0.00 ? 8  SER A H    3  
ATOM   1615  H HA   . SER A 1 8  ? 0.245   -12.079 1.530   1.00 0.00 ? 8  SER A HA   3  
ATOM   1616  H HB2  . SER A 1 8  ? -1.370  -9.839  0.326   1.00 0.00 ? 8  SER A HB2  3  
ATOM   1617  H HB3  . SER A 1 8  ? -0.757  -11.299 -0.452  1.00 0.00 ? 8  SER A HB3  3  
ATOM   1618  H HG   . SER A 1 8  ? -2.235  -12.425 1.076   1.00 0.00 ? 8  SER A HG   3  
ATOM   1619  N N    . GLN A 1 9  ? 2.021   -10.432 0.895   1.00 0.00 ? 9  GLN A N    3  
ATOM   1620  C CA   . GLN A 1 9  ? 3.160   -9.536  0.787   1.00 0.00 ? 9  GLN A CA   3  
ATOM   1621  C C    . GLN A 1 9  ? 2.759   -8.129  0.388   1.00 0.00 ? 9  GLN A C    3  
ATOM   1622  O O    . GLN A 1 9  ? 1.989   -7.916  -0.549  1.00 0.00 ? 9  GLN A O    3  
ATOM   1623  C CB   . GLN A 1 9  ? 4.196   -10.093 -0.190  1.00 0.00 ? 9  GLN A CB   3  
ATOM   1624  C CG   . GLN A 1 9  ? 5.632   -9.790  0.207   1.00 0.00 ? 9  GLN A CG   3  
ATOM   1625  C CD   . GLN A 1 9  ? 6.612   -10.034 -0.923  1.00 0.00 ? 9  GLN A CD   3  
ATOM   1626  O OE1  . GLN A 1 9  ? 7.588   -10.768 -0.766  1.00 0.00 ? 9  GLN A OE1  3  
ATOM   1627  N NE2  . GLN A 1 9  ? 6.358   -9.417  -2.072  1.00 0.00 ? 9  GLN A NE2  3  
ATOM   1628  H H    . GLN A 1 9  ? 2.083   -11.335 0.527   1.00 0.00 ? 9  GLN A H    3  
ATOM   1629  H HA   . GLN A 1 9  ? 3.599   -9.473  1.768   1.00 0.00 ? 9  GLN A HA   3  
ATOM   1630  H HB2  . GLN A 1 9  ? 4.081   -11.165 -0.247  1.00 0.00 ? 9  GLN A HB2  3  
ATOM   1631  H HB3  . GLN A 1 9  ? 4.018   -9.669  -1.166  1.00 0.00 ? 9  GLN A HB3  3  
ATOM   1632  H HG2  . GLN A 1 9  ? 5.699   -8.754  0.504   1.00 0.00 ? 9  GLN A HG2  3  
ATOM   1633  H HG3  . GLN A 1 9  ? 5.902   -10.421 1.041   1.00 0.00 ? 9  GLN A HG3  3  
ATOM   1634  H HE21 . GLN A 1 9  ? 5.562   -8.847  -2.124  1.00 0.00 ? 9  GLN A HE21 3  
ATOM   1635  H HE22 . GLN A 1 9  ? 6.975   -9.557  -2.820  1.00 0.00 ? 9  GLN A HE22 3  
ATOM   1636  N N    . ASN A 1 10 ? 3.307   -7.176  1.128   1.00 0.00 ? 10 ASN A N    3  
ATOM   1637  C CA   . ASN A 1 10 ? 3.058   -5.767  0.903   1.00 0.00 ? 10 ASN A CA   3  
ATOM   1638  C C    . ASN A 1 10 ? 1.618   -5.391  1.204   1.00 0.00 ? 10 ASN A C    3  
ATOM   1639  O O    . ASN A 1 10 ? 1.062   -4.492  0.569   1.00 0.00 ? 10 ASN A O    3  
ATOM   1640  C CB   . ASN A 1 10 ? 3.423   -5.372  -0.529  1.00 0.00 ? 10 ASN A CB   3  
ATOM   1641  C CG   . ASN A 1 10 ? 4.912   -5.502  -0.803  1.00 0.00 ? 10 ASN A CG   3  
ATOM   1642  O OD1  . ASN A 1 10 ? 5.611   -4.501  -0.947  1.00 0.00 ? 10 ASN A OD1  3  
ATOM   1643  N ND2  . ASN A 1 10 ? 5.410   -6.734  -0.873  1.00 0.00 ? 10 ASN A ND2  3  
ATOM   1644  H H    . ASN A 1 10 ? 3.912   -7.435  1.855   1.00 0.00 ? 10 ASN A H    3  
ATOM   1645  H HA   . ASN A 1 10 ? 3.687   -5.225  1.585   1.00 0.00 ? 10 ASN A HA   3  
ATOM   1646  H HB2  . ASN A 1 10 ? 2.887   -6.003  -1.221  1.00 0.00 ? 10 ASN A HB2  3  
ATOM   1647  H HB3  . ASN A 1 10 ? 3.135   -4.344  -0.693  1.00 0.00 ? 10 ASN A HB3  3  
ATOM   1648  H HD21 . ASN A 1 10 ? 4.803   -7.490  -0.746  1.00 0.00 ? 10 ASN A HD21 3  
ATOM   1649  H HD22 . ASN A 1 10 ? 6.370   -6.834  -1.050  1.00 0.00 ? 10 ASN A HD22 3  
ATOM   1650  N N    . GLU A 1 11 ? 1.014   -6.058  2.179   1.00 0.00 ? 11 GLU A N    3  
ATOM   1651  C CA   . GLU A 1 11 ? -0.360  -5.723  2.537   1.00 0.00 ? 11 GLU A CA   3  
ATOM   1652  C C    . GLU A 1 11 ? -0.394  -4.581  3.534   1.00 0.00 ? 11 GLU A C    3  
ATOM   1653  O O    . GLU A 1 11 ? 0.468   -4.486  4.407   1.00 0.00 ? 11 GLU A O    3  
ATOM   1654  C CB   . GLU A 1 11 ? -1.134  -6.934  3.054   1.00 0.00 ? 11 GLU A CB   3  
ATOM   1655  C CG   . GLU A 1 11 ? -2.366  -7.242  2.214   1.00 0.00 ? 11 GLU A CG   3  
ATOM   1656  C CD   . GLU A 1 11 ? -2.809  -8.687  2.318   1.00 0.00 ? 11 GLU A CD   3  
ATOM   1657  O OE1  . GLU A 1 11 ? -2.705  -9.262  3.421   1.00 0.00 ? 11 GLU A OE1  3  
ATOM   1658  O OE2  . GLU A 1 11 ? -3.263  -9.244  1.297   1.00 0.00 ? 11 GLU A OE2  3  
ATOM   1659  H H    . GLU A 1 11 ? 1.505   -6.775  2.665   1.00 0.00 ? 11 GLU A H    3  
ATOM   1660  H HA   . GLU A 1 11 ? -0.827  -5.368  1.656   1.00 0.00 ? 11 GLU A HA   3  
ATOM   1661  H HB2  . GLU A 1 11 ? -0.489  -7.796  3.047   1.00 0.00 ? 11 GLU A HB2  3  
ATOM   1662  H HB3  . GLU A 1 11 ? -1.453  -6.742  4.064   1.00 0.00 ? 11 GLU A HB3  3  
ATOM   1663  H HG2  . GLU A 1 11 ? -3.175  -6.612  2.546   1.00 0.00 ? 11 GLU A HG2  3  
ATOM   1664  H HG3  . GLU A 1 11 ? -2.142  -7.020  1.178   1.00 0.00 ? 11 GLU A HG3  3  
ATOM   1665  N N    . TYR A 1 12 ? -1.392  -3.698  3.397   1.00 0.00 ? 12 TYR A N    3  
ATOM   1666  C CA   . TYR A 1 12 ? -1.490  -2.552  4.305   1.00 0.00 ? 12 TYR A CA   3  
ATOM   1667  C C    . TYR A 1 12 ? -2.667  -2.697  5.254   1.00 0.00 ? 12 TYR A C    3  
ATOM   1668  O O    . TYR A 1 12 ? -3.816  -2.807  4.835   1.00 0.00 ? 12 TYR A O    3  
ATOM   1669  C CB   . TYR A 1 12 ? -1.552  -1.224  3.539   1.00 0.00 ? 12 TYR A CB   3  
ATOM   1670  C CG   . TYR A 1 12 ? -2.915  -0.845  2.988   1.00 0.00 ? 12 TYR A CG   3  
ATOM   1671  C CD1  . TYR A 1 12 ? -3.880  -0.269  3.802   1.00 0.00 ? 12 TYR A CD1  3  
ATOM   1672  C CD2  . TYR A 1 12 ? -3.222  -1.041  1.649   1.00 0.00 ? 12 TYR A CD2  3  
ATOM   1673  C CE1  . TYR A 1 12 ? -5.113  0.098   3.296   1.00 0.00 ? 12 TYR A CE1  3  
ATOM   1674  C CE2  . TYR A 1 12 ? -4.453  -0.681  1.136   1.00 0.00 ? 12 TYR A CE2  3  
ATOM   1675  C CZ   . TYR A 1 12 ? -5.394  -0.112  1.964   1.00 0.00 ? 12 TYR A CZ   3  
ATOM   1676  O OH   . TYR A 1 12 ? -6.621  0.251   1.458   1.00 0.00 ? 12 TYR A OH   3  
ATOM   1677  H H    . TYR A 1 12 ? -2.070  -3.820  2.674   1.00 0.00 ? 12 TYR A H    3  
ATOM   1678  H HA   . TYR A 1 12 ? -0.586  -2.547  4.904   1.00 0.00 ? 12 TYR A HA   3  
ATOM   1679  H HB2  . TYR A 1 12 ? -1.244  -0.434  4.207   1.00 0.00 ? 12 TYR A HB2  3  
ATOM   1680  H HB3  . TYR A 1 12 ? -0.862  -1.270  2.710   1.00 0.00 ? 12 TYR A HB3  3  
ATOM   1681  H HD1  . TYR A 1 12 ? -3.658  -0.108  4.847   1.00 0.00 ? 12 TYR A HD1  3  
ATOM   1682  H HD2  . TYR A 1 12 ? -2.481  -1.487  1.001   1.00 0.00 ? 12 TYR A HD2  3  
ATOM   1683  H HE1  . TYR A 1 12 ? -5.850  0.546   3.942   1.00 0.00 ? 12 TYR A HE1  3  
ATOM   1684  H HE2  . TYR A 1 12 ? -4.673  -0.845  0.092   1.00 0.00 ? 12 TYR A HE2  3  
ATOM   1685  H HH   . TYR A 1 12 ? -6.762  1.190   1.604   1.00 0.00 ? 12 TYR A HH   3  
ATOM   1686  N N    . PHE A 1 13 ? -2.348  -2.708  6.543   1.00 0.00 ? 13 PHE A N    3  
ATOM   1687  C CA   . PHE A 1 13 ? -3.346  -2.859  7.597   1.00 0.00 ? 13 PHE A CA   3  
ATOM   1688  C C    . PHE A 1 13 ? -3.976  -1.524  7.970   1.00 0.00 ? 13 PHE A C    3  
ATOM   1689  O O    . PHE A 1 13 ? -3.422  -0.761  8.761   1.00 0.00 ? 13 PHE A O    3  
ATOM   1690  C CB   . PHE A 1 13 ? -2.696  -3.489  8.832   1.00 0.00 ? 13 PHE A CB   3  
ATOM   1691  C CG   . PHE A 1 13 ? -3.681  -3.919  9.881   1.00 0.00 ? 13 PHE A CG   3  
ATOM   1692  C CD1  . PHE A 1 13 ? -4.345  -5.129  9.771   1.00 0.00 ? 13 PHE A CD1  3  
ATOM   1693  C CD2  . PHE A 1 13 ? -3.944  -3.109  10.974  1.00 0.00 ? 13 PHE A CD2  3  
ATOM   1694  C CE1  . PHE A 1 13 ? -5.255  -5.525  10.733  1.00 0.00 ? 13 PHE A CE1  3  
ATOM   1695  C CE2  . PHE A 1 13 ? -4.852  -3.500  11.939  1.00 0.00 ? 13 PHE A CE2  3  
ATOM   1696  C CZ   . PHE A 1 13 ? -5.509  -4.709  11.818  1.00 0.00 ? 13 PHE A CZ   3  
ATOM   1697  H H    . PHE A 1 13 ? -1.405  -2.620  6.793   1.00 0.00 ? 13 PHE A H    3  
ATOM   1698  H HA   . PHE A 1 13 ? -4.121  -3.521  7.235   1.00 0.00 ? 13 PHE A HA   3  
ATOM   1699  H HB2  . PHE A 1 13 ? -2.135  -4.360  8.529   1.00 0.00 ? 13 PHE A HB2  3  
ATOM   1700  H HB3  . PHE A 1 13 ? -2.023  -2.772  9.280   1.00 0.00 ? 13 PHE A HB3  3  
ATOM   1701  H HD1  . PHE A 1 13 ? -4.143  -5.768  8.924   1.00 0.00 ? 13 PHE A HD1  3  
ATOM   1702  H HD2  . PHE A 1 13 ? -3.431  -2.164  11.069  1.00 0.00 ? 13 PHE A HD2  3  
ATOM   1703  H HE1  . PHE A 1 13 ? -5.767  -6.471  10.637  1.00 0.00 ? 13 PHE A HE1  3  
ATOM   1704  H HE2  . PHE A 1 13 ? -5.048  -2.860  12.787  1.00 0.00 ? 13 PHE A HE2  3  
ATOM   1705  H HZ   . PHE A 1 13 ? -6.220  -5.016  12.571  1.00 0.00 ? 13 PHE A HZ   3  
ATOM   1706  N N    . ASP A 1 14 ? -5.151  -1.259  7.413   1.00 0.00 ? 14 ASP A N    3  
ATOM   1707  C CA   . ASP A 1 14 ? -5.873  -0.025  7.703   1.00 0.00 ? 14 ASP A CA   3  
ATOM   1708  C C    . ASP A 1 14 ? -6.482  -0.088  9.093   1.00 0.00 ? 14 ASP A C    3  
ATOM   1709  O O    . ASP A 1 14 ? -7.508  -0.725  9.295   1.00 0.00 ? 14 ASP A O    3  
ATOM   1710  C CB   . ASP A 1 14 ? -6.972  0.215   6.664   1.00 0.00 ? 14 ASP A CB   3  
ATOM   1711  C CG   . ASP A 1 14 ? -6.834  1.560   5.978   1.00 0.00 ? 14 ASP A CG   3  
ATOM   1712  O OD1  . ASP A 1 14 ? -5.690  1.950   5.662   1.00 0.00 ? 14 ASP A OD1  3  
ATOM   1713  O OD2  . ASP A 1 14 ? -7.869  2.223   5.760   1.00 0.00 ? 14 ASP A OD2  3  
ATOM   1714  H H    . ASP A 1 14 ? -5.550  -1.919  6.804   1.00 0.00 ? 14 ASP A H    3  
ATOM   1715  H HA   . ASP A 1 14 ? -5.174  0.798   7.672   1.00 0.00 ? 14 ASP A HA   3  
ATOM   1716  H HB2  . ASP A 1 14 ? -6.925  -0.559  5.914   1.00 0.00 ? 14 ASP A HB2  3  
ATOM   1717  H HB3  . ASP A 1 14 ? -7.935  0.177   7.151   1.00 0.00 ? 14 ASP A HB3  3  
ATOM   1718  N N    . SER A 1 15 ? -5.846  0.577   10.051  1.00 0.00 ? 15 SER A N    3  
ATOM   1719  C CA   . SER A 1 15 ? -6.340  0.587   11.421  1.00 0.00 ? 15 SER A CA   3  
ATOM   1720  C C    . SER A 1 15 ? -7.823  0.943   11.464  1.00 0.00 ? 15 SER A C    3  
ATOM   1721  O O    . SER A 1 15 ? -8.526  0.602   12.415  1.00 0.00 ? 15 SER A O    3  
ATOM   1722  C CB   . SER A 1 15 ? -5.539  1.575   12.271  1.00 0.00 ? 15 SER A CB   3  
ATOM   1723  O OG   . SER A 1 15 ? -5.471  2.846   11.649  1.00 0.00 ? 15 SER A OG   3  
ATOM   1724  H H    . SER A 1 15 ? -5.029  1.071   9.833   1.00 0.00 ? 15 SER A H    3  
ATOM   1725  H HA   . SER A 1 15 ? -6.212  -0.407  11.821  1.00 0.00 ? 15 SER A HA   3  
ATOM   1726  H HB2  . SER A 1 15 ? -6.013  1.686   13.235  1.00 0.00 ? 15 SER A HB2  3  
ATOM   1727  H HB3  . SER A 1 15 ? -4.534  1.200   12.405  1.00 0.00 ? 15 SER A HB3  3  
ATOM   1728  H HG   . SER A 1 15 ? -6.358  3.148   11.439  1.00 0.00 ? 15 SER A HG   3  
ATOM   1729  N N    . LEU A 1 16 ? -8.296  1.621   10.422  1.00 0.00 ? 16 LEU A N    3  
ATOM   1730  C CA   . LEU A 1 16 ? -9.700  2.006   10.343  1.00 0.00 ? 16 LEU A CA   3  
ATOM   1731  C C    . LEU A 1 16 ? -10.543 0.844   9.828   1.00 0.00 ? 16 LEU A C    3  
ATOM   1732  O O    . LEU A 1 16 ? -11.722 0.724   10.158  1.00 0.00 ? 16 LEU A O    3  
ATOM   1733  C CB   . LEU A 1 16 ? -9.867  3.223   9.428   1.00 0.00 ? 16 LEU A CB   3  
ATOM   1734  C CG   . LEU A 1 16 ? -11.316 3.639   9.160   1.00 0.00 ? 16 LEU A CG   3  
ATOM   1735  C CD1  . LEU A 1 16 ? -11.413 5.145   8.978   1.00 0.00 ? 16 LEU A CD1  3  
ATOM   1736  C CD2  . LEU A 1 16 ? -11.860 2.915   7.938   1.00 0.00 ? 16 LEU A CD2  3  
ATOM   1737  H H    . LEU A 1 16 ? -7.689  1.859   9.685   1.00 0.00 ? 16 LEU A H    3  
ATOM   1738  H HA   . LEU A 1 16 ? -10.029 2.264   11.337  1.00 0.00 ? 16 LEU A HA   3  
ATOM   1739  H HB2  . LEU A 1 16 ? -9.351  4.059   9.878   1.00 0.00 ? 16 LEU A HB2  3  
ATOM   1740  H HB3  . LEU A 1 16 ? -9.400  3.001   8.480   1.00 0.00 ? 16 LEU A HB3  3  
ATOM   1741  H HG   . LEU A 1 16 ? -11.925 3.367   10.011  1.00 0.00 ? 16 LEU A HG   3  
ATOM   1742  H HD11 . LEU A 1 16 ? -10.542 5.501   8.448   1.00 0.00 ? 16 LEU A HD11 3  
ATOM   1743  H HD12 . LEU A 1 16 ? -11.467 5.623   9.945   1.00 0.00 ? 16 LEU A HD12 3  
ATOM   1744  H HD13 . LEU A 1 16 ? -12.301 5.382   8.410   1.00 0.00 ? 16 LEU A HD13 3  
ATOM   1745  H HD21 . LEU A 1 16 ? -11.108 2.900   7.164   1.00 0.00 ? 16 LEU A HD21 3  
ATOM   1746  H HD22 . LEU A 1 16 ? -12.738 3.429   7.577   1.00 0.00 ? 16 LEU A HD22 3  
ATOM   1747  H HD23 . LEU A 1 16 ? -12.121 1.901   8.206   1.00 0.00 ? 16 LEU A HD23 3  
ATOM   1748  N N    . LEU A 1 17 ? -9.926  -0.005  9.012   1.00 0.00 ? 17 LEU A N    3  
ATOM   1749  C CA   . LEU A 1 17 ? -10.606 -1.157  8.436   1.00 0.00 ? 17 LEU A CA   3  
ATOM   1750  C C    . LEU A 1 17 ? -10.258 -2.448  9.173   1.00 0.00 ? 17 LEU A C    3  
ATOM   1751  O O    . LEU A 1 17 ? -10.985 -3.437  9.078   1.00 0.00 ? 17 LEU A O    3  
ATOM   1752  C CB   . LEU A 1 17 ? -10.220 -1.289  6.964   1.00 0.00 ? 17 LEU A CB   3  
ATOM   1753  C CG   . LEU A 1 17 ? -10.511 -0.056  6.109   1.00 0.00 ? 17 LEU A CG   3  
ATOM   1754  C CD1  . LEU A 1 17 ? -9.801  -0.158  4.767   1.00 0.00 ? 17 LEU A CD1  3  
ATOM   1755  C CD2  . LEU A 1 17 ? -12.009 0.112   5.911   1.00 0.00 ? 17 LEU A CD2  3  
ATOM   1756  H H    . LEU A 1 17 ? -8.988  0.151   8.783   1.00 0.00 ? 17 LEU A H    3  
ATOM   1757  H HA   . LEU A 1 17 ? -11.671 -0.988  8.503   1.00 0.00 ? 17 LEU A HA   3  
ATOM   1758  H HB2  . LEU A 1 17 ? -9.159  -1.494  6.913   1.00 0.00 ? 17 LEU A HB2  3  
ATOM   1759  H HB3  . LEU A 1 17 ? -10.755 -2.128  6.545   1.00 0.00 ? 17 LEU A HB3  3  
ATOM   1760  H HG   . LEU A 1 17 ? -10.138 0.820   6.619   1.00 0.00 ? 17 LEU A HG   3  
ATOM   1761  H HD11 . LEU A 1 17 ? -9.914  0.771   4.229   1.00 0.00 ? 17 LEU A HD11 3  
ATOM   1762  H HD12 . LEU A 1 17 ? -10.234 -0.962  4.191   1.00 0.00 ? 17 LEU A HD12 3  
ATOM   1763  H HD13 . LEU A 1 17 ? -8.752  -0.357  4.929   1.00 0.00 ? 17 LEU A HD13 3  
ATOM   1764  H HD21 . LEU A 1 17 ? -12.209 1.085   5.487   1.00 0.00 ? 17 LEU A HD21 3  
ATOM   1765  H HD22 . LEU A 1 17 ? -12.511 0.024   6.863   1.00 0.00 ? 17 LEU A HD22 3  
ATOM   1766  H HD23 . LEU A 1 17 ? -12.372 -0.653  5.241   1.00 0.00 ? 17 LEU A HD23 3  
ATOM   1767  N N    . HIS A 1 18 ? -9.140  -2.447  9.898   1.00 0.00 ? 18 HIS A N    3  
ATOM   1768  C CA   . HIS A 1 18 ? -8.708  -3.634  10.628  1.00 0.00 ? 18 HIS A CA   3  
ATOM   1769  C C    . HIS A 1 18 ? -8.501  -4.795  9.665   1.00 0.00 ? 18 HIS A C    3  
ATOM   1770  O O    . HIS A 1 18 ? -8.896  -5.929  9.938   1.00 0.00 ? 18 HIS A O    3  
ATOM   1771  C CB   . HIS A 1 18 ? -9.745  -4.015  11.675  1.00 0.00 ? 18 HIS A CB   3  
ATOM   1772  C CG   . HIS A 1 18 ? -9.842  -3.042  12.809  1.00 0.00 ? 18 HIS A CG   3  
ATOM   1773  N ND1  . HIS A 1 18 ? -10.860 -2.120  12.926  1.00 0.00 ? 18 HIS A ND1  3  
ATOM   1774  C CD2  . HIS A 1 18 ? -9.038  -2.850  13.883  1.00 0.00 ? 18 HIS A CD2  3  
ATOM   1775  C CE1  . HIS A 1 18 ? -10.679 -1.402  14.020  1.00 0.00 ? 18 HIS A CE1  3  
ATOM   1776  N NE2  . HIS A 1 18 ? -9.581  -1.826  14.619  1.00 0.00 ? 18 HIS A NE2  3  
ATOM   1777  H H    . HIS A 1 18 ? -8.587  -1.637  9.934   1.00 0.00 ? 18 HIS A H    3  
ATOM   1778  H HA   . HIS A 1 18 ? -7.773  -3.408  11.116  1.00 0.00 ? 18 HIS A HA   3  
ATOM   1779  H HB2  . HIS A 1 18 ? -10.710 -4.072  11.201  1.00 0.00 ? 18 HIS A HB2  3  
ATOM   1780  H HB3  . HIS A 1 18 ? -9.490  -4.981  12.081  1.00 0.00 ? 18 HIS A HB3  3  
ATOM   1781  H HD1  . HIS A 1 18 ? -11.604 -2.006  12.299  1.00 0.00 ? 18 HIS A HD1  3  
ATOM   1782  H HD2  . HIS A 1 18 ? -8.138  -3.400  14.116  1.00 0.00 ? 18 HIS A HD2  3  
ATOM   1783  H HE1  . HIS A 1 18 ? -11.321 -0.606  14.367  1.00 0.00 ? 18 HIS A HE1  3  
ATOM   1784  H HE2  . HIS A 1 18 ? -9.169  -1.408  15.404  1.00 0.00 ? 18 HIS A HE2  3  
ATOM   1785  N N    . ALA A 1 19 ? -7.884  -4.495  8.534   1.00 0.00 ? 19 ALA A N    3  
ATOM   1786  C CA   . ALA A 1 19 ? -7.626  -5.490  7.512   1.00 0.00 ? 19 ALA A CA   3  
ATOM   1787  C C    . ALA A 1 19 ? -6.430  -5.118  6.662   1.00 0.00 ? 19 ALA A C    3  
ATOM   1788  O O    . ALA A 1 19 ? -6.455  -4.123  5.936   1.00 0.00 ? 19 ALA A O    3  
ATOM   1789  C CB   . ALA A 1 19 ? -8.832  -5.648  6.605   1.00 0.00 ? 19 ALA A CB   3  
ATOM   1790  H H    . ALA A 1 19 ? -7.601  -3.578  8.383   1.00 0.00 ? 19 ALA A H    3  
ATOM   1791  H HA   . ALA A 1 19 ? -7.441  -6.435  7.997   1.00 0.00 ? 19 ALA A HA   3  
ATOM   1792  H HB1  . ALA A 1 19 ? -9.630  -5.010  6.950   1.00 0.00 ? 19 ALA A HB1  3  
ATOM   1793  H HB2  . ALA A 1 19 ? -9.159  -6.677  6.616   1.00 0.00 ? 19 ALA A HB2  3  
ATOM   1794  H HB3  . ALA A 1 19 ? -8.554  -5.367  5.594   1.00 0.00 ? 19 ALA A HB3  3  
ATOM   1795  N N    . CYS A 1 20 ? -5.398  -5.932  6.727   1.00 0.00 ? 20 CYS A N    3  
ATOM   1796  C CA   . CYS A 1 20 ? -4.222  -5.692  5.919   1.00 0.00 ? 20 CYS A CA   3  
ATOM   1797  C C    . CYS A 1 20 ? -4.559  -5.984  4.459   1.00 0.00 ? 20 CYS A C    3  
ATOM   1798  O O    . CYS A 1 20 ? -4.772  -7.133  4.068   1.00 0.00 ? 20 CYS A O    3  
ATOM   1799  C CB   . CYS A 1 20 ? -3.035  -6.527  6.397   1.00 0.00 ? 20 CYS A CB   3  
ATOM   1800  S SG   . CYS A 1 20 ? -3.423  -8.271  6.735   1.00 0.00 ? 20 CYS A SG   3  
ATOM   1801  H H    . CYS A 1 20 ? -5.445  -6.714  7.307   1.00 0.00 ? 20 CYS A H    3  
ATOM   1802  H HA   . CYS A 1 20 ? -3.984  -4.649  6.008   1.00 0.00 ? 20 CYS A HA   3  
ATOM   1803  H HB2  . CYS A 1 20 ? -2.265  -6.503  5.645   1.00 0.00 ? 20 CYS A HB2  3  
ATOM   1804  H HB3  . CYS A 1 20 ? -2.650  -6.094  7.309   1.00 0.00 ? 20 CYS A HB3  3  
ATOM   1805  N N    . ILE A 1 21 ? -4.660  -4.916  3.680   1.00 0.00 ? 21 ILE A N    3  
ATOM   1806  C CA   . ILE A 1 21 ? -5.036  -4.996  2.272   1.00 0.00 ? 21 ILE A CA   3  
ATOM   1807  C C    . ILE A 1 21 ? -3.911  -4.568  1.341   1.00 0.00 ? 21 ILE A C    3  
ATOM   1808  O O    . ILE A 1 21 ? -3.182  -3.629  1.639   1.00 0.00 ? 21 ILE A O    3  
ATOM   1809  C CB   . ILE A 1 21 ? -6.219  -4.051  2.020   1.00 0.00 ? 21 ILE A CB   3  
ATOM   1810  C CG1  . ILE A 1 21 ? -7.367  -4.359  2.984   1.00 0.00 ? 21 ILE A CG1  3  
ATOM   1811  C CG2  . ILE A 1 21 ? -6.700  -4.119  0.575   1.00 0.00 ? 21 ILE A CG2  3  
ATOM   1812  C CD1  . ILE A 1 21 ? -8.162  -3.137  3.385   1.00 0.00 ? 21 ILE A CD1  3  
ATOM   1813  H H    . ILE A 1 21 ? -4.516  -4.034  4.077   1.00 0.00 ? 21 ILE A H    3  
ATOM   1814  H HA   . ILE A 1 21 ? -5.339  -6.004  2.046   1.00 0.00 ? 21 ILE A HA   3  
ATOM   1815  H HB   . ILE A 1 21 ? -5.858  -3.050  2.208   1.00 0.00 ? 21 ILE A HB   3  
ATOM   1816  H HG12 . ILE A 1 21 ? -8.045  -5.055  2.514   1.00 0.00 ? 21 ILE A HG12 3  
ATOM   1817  H HG13 . ILE A 1 21 ? -6.965  -4.805  3.881   1.00 0.00 ? 21 ILE A HG13 3  
ATOM   1818  H HG21 . ILE A 1 21 ? -5.850  -4.116  -0.090  1.00 0.00 ? 21 ILE A HG21 3  
ATOM   1819  H HG22 . ILE A 1 21 ? -7.321  -3.260  0.365   1.00 0.00 ? 21 ILE A HG22 3  
ATOM   1820  H HG23 . ILE A 1 21 ? -7.273  -5.021  0.428   1.00 0.00 ? 21 ILE A HG23 3  
ATOM   1821  H HD11 . ILE A 1 21 ? -8.313  -3.141  4.455   1.00 0.00 ? 21 ILE A HD11 3  
ATOM   1822  H HD12 . ILE A 1 21 ? -9.121  -3.152  2.888   1.00 0.00 ? 21 ILE A HD12 3  
ATOM   1823  H HD13 . ILE A 1 21 ? -7.623  -2.246  3.101   1.00 0.00 ? 21 ILE A HD13 3  
ATOM   1824  N N    . PRO A 1 22 ? -3.771  -5.221  0.175   1.00 0.00 ? 22 PRO A N    3  
ATOM   1825  C CA   . PRO A 1 22 ? -2.747  -4.854  -0.803  1.00 0.00 ? 22 PRO A CA   3  
ATOM   1826  C C    . PRO A 1 22 ? -2.765  -3.354  -1.096  1.00 0.00 ? 22 PRO A C    3  
ATOM   1827  O O    . PRO A 1 22 ? -3.701  -2.657  -0.708  1.00 0.00 ? 22 PRO A O    3  
ATOM   1828  C CB   . PRO A 1 22 ? -3.122  -5.665  -2.058  1.00 0.00 ? 22 PRO A CB   3  
ATOM   1829  C CG   . PRO A 1 22 ? -4.496  -6.192  -1.795  1.00 0.00 ? 22 PRO A CG   3  
ATOM   1830  C CD   . PRO A 1 22 ? -4.597  -6.339  -0.302  1.00 0.00 ? 22 PRO A CD   3  
ATOM   1831  H HA   . PRO A 1 22 ? -1.770  -5.133  -0.463  1.00 0.00 ? 22 PRO A HA   3  
ATOM   1832  H HB2  . PRO A 1 22 ? -3.109  -5.019  -2.924  1.00 0.00 ? 22 PRO A HB2  3  
ATOM   1833  H HB3  . PRO A 1 22 ? -2.412  -6.468  -2.193  1.00 0.00 ? 22 PRO A HB3  3  
ATOM   1834  H HG2  . PRO A 1 22 ? -5.232  -5.489  -2.158  1.00 0.00 ? 22 PRO A HG2  3  
ATOM   1835  H HG3  . PRO A 1 22 ? -4.619  -7.151  -2.280  1.00 0.00 ? 22 PRO A HG3  3  
ATOM   1836  H HD2  . PRO A 1 22 ? -5.620  -6.243  0.028   1.00 0.00 ? 22 PRO A HD2  3  
ATOM   1837  H HD3  . PRO A 1 22 ? -4.183  -7.285  0.018   1.00 0.00 ? 22 PRO A HD3  3  
ATOM   1838  N N    . CYS A 1 23 ? -1.730  -2.855  -1.770  1.00 0.00 ? 23 CYS A N    3  
ATOM   1839  C CA   . CYS A 1 23 ? -1.656  -1.425  -2.087  1.00 0.00 ? 23 CYS A CA   3  
ATOM   1840  C C    . CYS A 1 23 ? -1.002  -1.161  -3.444  1.00 0.00 ? 23 CYS A C    3  
ATOM   1841  O O    . CYS A 1 23 ? -1.207  -0.103  -4.036  1.00 0.00 ? 23 CYS A O    3  
ATOM   1842  C CB   . CYS A 1 23 ? -0.889  -0.675  -0.993  1.00 0.00 ? 23 CYS A CB   3  
ATOM   1843  S SG   . CYS A 1 23 ? -1.714  0.843   -0.418  1.00 0.00 ? 23 CYS A SG   3  
ATOM   1844  H H    . CYS A 1 23 ? -1.003  -3.453  -2.050  1.00 0.00 ? 23 CYS A H    3  
ATOM   1845  H HA   . CYS A 1 23 ? -2.668  -1.043  -2.121  1.00 0.00 ? 23 CYS A HA   3  
ATOM   1846  H HB2  . CYS A 1 23 ? -0.766  -1.321  -0.136  1.00 0.00 ? 23 CYS A HB2  3  
ATOM   1847  H HB3  . CYS A 1 23 ? 0.085   -0.397  -1.371  1.00 0.00 ? 23 CYS A HB3  3  
ATOM   1848  N N    . GLN A 1 24 ? -0.217  -2.115  -3.936  1.00 0.00 ? 24 GLN A N    3  
ATOM   1849  C CA   . GLN A 1 24 ? 0.454   -1.953  -5.229  1.00 0.00 ? 24 GLN A CA   3  
ATOM   1850  C C    . GLN A 1 24 ? -0.538  -1.516  -6.295  1.00 0.00 ? 24 GLN A C    3  
ATOM   1851  O O    . GLN A 1 24 ? -0.241  -0.669  -7.136  1.00 0.00 ? 24 GLN A O    3  
ATOM   1852  C CB   . GLN A 1 24 ? 1.141   -3.251  -5.674  1.00 0.00 ? 24 GLN A CB   3  
ATOM   1853  C CG   . GLN A 1 24 ? 1.454   -4.219  -4.543  1.00 0.00 ? 24 GLN A CG   3  
ATOM   1854  C CD   . GLN A 1 24 ? 2.371   -5.345  -4.976  1.00 0.00 ? 24 GLN A CD   3  
ATOM   1855  O OE1  . GLN A 1 24 ? 3.588   -5.271  -4.806  1.00 0.00 ? 24 GLN A OE1  3  
ATOM   1856  N NE2  . GLN A 1 24 ? 1.789   -6.397  -5.539  1.00 0.00 ? 24 GLN A NE2  3  
ATOM   1857  H H    . GLN A 1 24 ? -0.084  -2.935  -3.423  1.00 0.00 ? 24 GLN A H    3  
ATOM   1858  H HA   . GLN A 1 24 ? 1.192   -1.180  -5.121  1.00 0.00 ? 24 GLN A HA   3  
ATOM   1859  H HB2  . GLN A 1 24 ? 0.499   -3.759  -6.377  1.00 0.00 ? 24 GLN A HB2  3  
ATOM   1860  H HB3  . GLN A 1 24 ? 2.069   -3.000  -6.168  1.00 0.00 ? 24 GLN A HB3  3  
ATOM   1861  H HG2  . GLN A 1 24 ? 1.929   -3.674  -3.741  1.00 0.00 ? 24 GLN A HG2  3  
ATOM   1862  H HG3  . GLN A 1 24 ? 0.526   -4.644  -4.188  1.00 0.00 ? 24 GLN A HG3  3  
ATOM   1863  H HE21 . GLN A 1 24 ? 0.815   -6.388  -5.644  1.00 0.00 ? 24 GLN A HE21 3  
ATOM   1864  H HE22 . GLN A 1 24 ? 2.360   -7.140  -5.830  1.00 0.00 ? 24 GLN A HE22 3  
ATOM   1865  N N    . LEU A 1 25 ? -1.718  -2.106  -6.242  1.00 0.00 ? 25 LEU A N    3  
ATOM   1866  C CA   . LEU A 1 25 ? -2.778  -1.797  -7.188  1.00 0.00 ? 25 LEU A CA   3  
ATOM   1867  C C    . LEU A 1 25 ? -3.337  -0.388  -6.971  1.00 0.00 ? 25 LEU A C    3  
ATOM   1868  O O    . LEU A 1 25 ? -4.202  0.063   -7.722  1.00 0.00 ? 25 LEU A O    3  
ATOM   1869  C CB   . LEU A 1 25 ? -3.905  -2.825  -7.074  1.00 0.00 ? 25 LEU A CB   3  
ATOM   1870  C CG   . LEU A 1 25 ? -5.085  -2.603  -8.024  1.00 0.00 ? 25 LEU A CG   3  
ATOM   1871  C CD1  . LEU A 1 25 ? -5.577  -3.929  -8.584  1.00 0.00 ? 25 LEU A CD1  3  
ATOM   1872  C CD2  . LEU A 1 25 ? -6.213  -1.873  -7.311  1.00 0.00 ? 25 LEU A CD2  3  
ATOM   1873  H H    . LEU A 1 25 ? -1.879  -2.769  -5.546  1.00 0.00 ? 25 LEU A H    3  
ATOM   1874  H HA   . LEU A 1 25 ? -2.356  -1.854  -8.174  1.00 0.00 ? 25 LEU A HA   3  
ATOM   1875  H HB2  . LEU A 1 25 ? -3.491  -3.804  -7.267  1.00 0.00 ? 25 LEU A HB2  3  
ATOM   1876  H HB3  . LEU A 1 25 ? -4.279  -2.806  -6.061  1.00 0.00 ? 25 LEU A HB3  3  
ATOM   1877  H HG   . LEU A 1 25 ? -4.760  -1.992  -8.853  1.00 0.00 ? 25 LEU A HG   3  
ATOM   1878  H HD11 . LEU A 1 25 ? -5.094  -4.121  -9.531  1.00 0.00 ? 25 LEU A HD11 3  
ATOM   1879  H HD12 . LEU A 1 25 ? -6.646  -3.884  -8.729  1.00 0.00 ? 25 LEU A HD12 3  
ATOM   1880  H HD13 . LEU A 1 25 ? -5.340  -4.723  -7.892  1.00 0.00 ? 25 LEU A HD13 3  
ATOM   1881  H HD21 . LEU A 1 25 ? -6.670  -1.168  -7.990  1.00 0.00 ? 25 LEU A HD21 3  
ATOM   1882  H HD22 . LEU A 1 25 ? -5.817  -1.344  -6.457  1.00 0.00 ? 25 LEU A HD22 3  
ATOM   1883  H HD23 . LEU A 1 25 ? -6.953  -2.586  -6.982  1.00 0.00 ? 25 LEU A HD23 3  
ATOM   1884  N N    . ARG A 1 26 ? -2.848  0.304   -5.942  1.00 0.00 ? 26 ARG A N    3  
ATOM   1885  C CA   . ARG A 1 26 ? -3.317  1.653   -5.646  1.00 0.00 ? 26 ARG A CA   3  
ATOM   1886  C C    . ARG A 1 26 ? -2.248  2.702   -5.918  1.00 0.00 ? 26 ARG A C    3  
ATOM   1887  O O    . ARG A 1 26 ? -2.509  3.903   -5.854  1.00 0.00 ? 26 ARG A O    3  
ATOM   1888  C CB   . ARG A 1 26 ? -3.786  1.753   -4.195  1.00 0.00 ? 26 ARG A CB   3  
ATOM   1889  C CG   . ARG A 1 26 ? -4.586  0.548   -3.725  1.00 0.00 ? 26 ARG A CG   3  
ATOM   1890  C CD   . ARG A 1 26 ? -5.882  0.400   -4.505  1.00 0.00 ? 26 ARG A CD   3  
ATOM   1891  N NE   . ARG A 1 26 ? -6.829  1.466   -4.188  1.00 0.00 ? 26 ARG A NE   3  
ATOM   1892  C CZ   . ARG A 1 26 ? -7.592  1.481   -3.097  1.00 0.00 ? 26 ARG A CZ   3  
ATOM   1893  N NH1  . ARG A 1 26 ? -7.523  0.489   -2.217  1.00 0.00 ? 26 ARG A NH1  3  
ATOM   1894  N NH2  . ARG A 1 26 ? -8.426  2.490   -2.886  1.00 0.00 ? 26 ARG A NH2  3  
ATOM   1895  H H    . ARG A 1 26 ? -2.168  -0.098  -5.372  1.00 0.00 ? 26 ARG A H    3  
ATOM   1896  H HA   . ARG A 1 26 ? -4.138  1.843   -6.294  1.00 0.00 ? 26 ARG A HA   3  
ATOM   1897  H HB2  . ARG A 1 26 ? -2.921  1.856   -3.557  1.00 0.00 ? 26 ARG A HB2  3  
ATOM   1898  H HB3  . ARG A 1 26 ? -4.404  2.631   -4.091  1.00 0.00 ? 26 ARG A HB3  3  
ATOM   1899  H HG2  . ARG A 1 26 ? -3.992  -0.342  -3.862  1.00 0.00 ? 26 ARG A HG2  3  
ATOM   1900  H HG3  . ARG A 1 26 ? -4.820  0.670   -2.677  1.00 0.00 ? 26 ARG A HG3  3  
ATOM   1901  H HD2  . ARG A 1 26 ? -5.649  0.424   -5.560  1.00 0.00 ? 26 ARG A HD2  3  
ATOM   1902  H HD3  . ARG A 1 26 ? -6.320  -0.557  -4.262  1.00 0.00 ? 26 ARG A HD3  3  
ATOM   1903  H HE   . ARG A 1 26 ? -6.901  2.211   -4.821  1.00 0.00 ? 26 ARG A HE   3  
ATOM   1904  H HH11 . ARG A 1 26 ? -6.896  -0.275  -2.371  1.00 0.00 ? 26 ARG A HH11 3  
ATOM   1905  H HH12 . ARG A 1 26 ? -8.099  0.507   -1.400  1.00 0.00 ? 26 ARG A HH12 3  
ATOM   1906  H HH21 . ARG A 1 26 ? -8.482  3.240   -3.546  1.00 0.00 ? 26 ARG A HH21 3  
ATOM   1907  H HH22 . ARG A 1 26 ? -9.000  2.501   -2.066  1.00 0.00 ? 26 ARG A HH22 3  
ATOM   1908  N N    . CYS A 1 27 ? -1.054  2.242   -6.232  1.00 0.00 ? 27 CYS A N    3  
ATOM   1909  C CA   . CYS A 1 27 ? 0.059   3.144   -6.531  1.00 0.00 ? 27 CYS A CA   3  
ATOM   1910  C C    . CYS A 1 27 ? -0.164  3.808   -7.893  1.00 0.00 ? 27 CYS A C    3  
ATOM   1911  O O    . CYS A 1 27 ? -1.069  3.423   -8.633  1.00 0.00 ? 27 CYS A O    3  
ATOM   1912  C CB   . CYS A 1 27 ? 1.401   2.390   -6.513  1.00 0.00 ? 27 CYS A CB   3  
ATOM   1913  S SG   . CYS A 1 27 ? 2.883   3.456   -6.428  1.00 0.00 ? 27 CYS A SG   3  
ATOM   1914  H H    . CYS A 1 27 ? -0.925  1.277   -6.272  1.00 0.00 ? 27 CYS A H    3  
ATOM   1915  H HA   . CYS A 1 27 ? 0.071   3.906   -5.769  1.00 0.00 ? 27 CYS A HA   3  
ATOM   1916  H HB2  . CYS A 1 27 ? 1.429   1.739   -5.650  1.00 0.00 ? 27 CYS A HB2  3  
ATOM   1917  H HB3  . CYS A 1 27 ? 1.481   1.791   -7.409  1.00 0.00 ? 27 CYS A HB3  3  
ATOM   1918  N N    . SER A 1 28 ? 0.663   4.798   -8.228  1.00 0.00 ? 28 SER A N    3  
ATOM   1919  C CA   . SER A 1 28 ? 0.551   5.495   -9.496  1.00 0.00 ? 28 SER A CA   3  
ATOM   1920  C C    . SER A 1 28 ? -0.882  5.949   -9.760  1.00 0.00 ? 28 SER A C    3  
ATOM   1921  O O    . SER A 1 28 ? -1.392  5.835   -10.874 1.00 0.00 ? 28 SER A O    3  
ATOM   1922  C CB   . SER A 1 28 ? 1.057   4.582   -10.600 1.00 0.00 ? 28 SER A CB   3  
ATOM   1923  O OG   . SER A 1 28 ? 0.003   3.831   -11.180 1.00 0.00 ? 28 SER A OG   3  
ATOM   1924  H H    . SER A 1 28 ? 1.367   5.057   -7.619  1.00 0.00 ? 28 SER A H    3  
ATOM   1925  H HA   . SER A 1 28 ? 1.186   6.366   -9.447  1.00 0.00 ? 28 SER A HA   3  
ATOM   1926  H HB2  . SER A 1 28 ? 1.532   5.173   -11.366 1.00 0.00 ? 28 SER A HB2  3  
ATOM   1927  H HB3  . SER A 1 28 ? 1.775   3.901   -10.167 1.00 0.00 ? 28 SER A HB3  3  
ATOM   1928  H HG   . SER A 1 28 ? 0.211   2.896   -11.128 1.00 0.00 ? 28 SER A HG   3  
ATOM   1929  N N    . SER A 1 29 ? -1.515  6.473   -8.717  1.00 0.00 ? 29 SER A N    3  
ATOM   1930  C CA   . SER A 1 29 ? -2.878  6.958   -8.800  1.00 0.00 ? 29 SER A CA   3  
ATOM   1931  C C    . SER A 1 29 ? -3.150  7.909   -7.648  1.00 0.00 ? 29 SER A C    3  
ATOM   1932  O O    . SER A 1 29 ? -2.293  8.129   -6.791  1.00 0.00 ? 29 SER A O    3  
ATOM   1933  C CB   . SER A 1 29 ? -3.865  5.789   -8.766  1.00 0.00 ? 29 SER A CB   3  
ATOM   1934  O OG   . SER A 1 29 ? -4.870  5.941   -9.753  1.00 0.00 ? 29 SER A OG   3  
ATOM   1935  H H    . SER A 1 29 ? -1.051  6.540   -7.862  1.00 0.00 ? 29 SER A H    3  
ATOM   1936  H HA   . SER A 1 29 ? -2.992  7.492   -9.730  1.00 0.00 ? 29 SER A HA   3  
ATOM   1937  H HB2  . SER A 1 29 ? -3.335  4.867   -8.951  1.00 0.00 ? 29 SER A HB2  3  
ATOM   1938  H HB3  . SER A 1 29 ? -4.334  5.745   -7.794  1.00 0.00 ? 29 SER A HB3  3  
ATOM   1939  H HG   . SER A 1 29 ? -5.343  6.764   -9.605  1.00 0.00 ? 29 SER A HG   3  
ATOM   1940  N N    . ASN A 1 30 ? -4.344  8.465   -7.631  1.00 0.00 ? 30 ASN A N    3  
ATOM   1941  C CA   . ASN A 1 30 ? -4.741  9.383   -6.593  1.00 0.00 ? 30 ASN A CA   3  
ATOM   1942  C C    . ASN A 1 30 ? -4.739  8.675   -5.250  1.00 0.00 ? 30 ASN A C    3  
ATOM   1943  O O    . ASN A 1 30 ? -3.961  9.014   -4.359  1.00 0.00 ? 30 ASN A O    3  
ATOM   1944  C CB   . ASN A 1 30 ? -6.129  9.958   -6.885  1.00 0.00 ? 30 ASN A CB   3  
ATOM   1945  C CG   . ASN A 1 30 ? -6.067  11.226  -7.714  1.00 0.00 ? 30 ASN A CG   3  
ATOM   1946  O OD1  . ASN A 1 30 ? -6.033  11.177  -8.943  1.00 0.00 ? 30 ASN A OD1  3  
ATOM   1947  N ND2  . ASN A 1 30 ? -6.052  12.372  -7.043  1.00 0.00 ? 30 ASN A ND2  3  
ATOM   1948  H H    . ASN A 1 30 ? -4.967  8.249   -8.325  1.00 0.00 ? 30 ASN A H    3  
ATOM   1949  H HA   . ASN A 1 30 ? -4.026  10.176  -6.582  1.00 0.00 ? 30 ASN A HA   3  
ATOM   1950  H HB2  . ASN A 1 30 ? -6.708  9.225   -7.425  1.00 0.00 ? 30 ASN A HB2  3  
ATOM   1951  H HB3  . ASN A 1 30 ? -6.622  10.184  -5.950  1.00 0.00 ? 30 ASN A HB3  3  
ATOM   1952  H HD21 . ASN A 1 30 ? -6.080  12.335  -6.063  1.00 0.00 ? 30 ASN A HD21 3  
ATOM   1953  H HD22 . ASN A 1 30 ? -6.013  13.207  -7.554  1.00 0.00 ? 30 ASN A HD22 3  
ATOM   1954  N N    . THR A 1 31 ? -5.619  7.678   -5.139  1.00 0.00 ? 31 THR A N    3  
ATOM   1955  C CA   . THR A 1 31 ? -5.768  6.855   -3.933  1.00 0.00 ? 31 THR A CA   3  
ATOM   1956  C C    . THR A 1 31 ? -4.807  7.281   -2.829  1.00 0.00 ? 31 THR A C    3  
ATOM   1957  O O    . THR A 1 31 ? -3.800  6.618   -2.575  1.00 0.00 ? 31 THR A O    3  
ATOM   1958  C CB   . THR A 1 31 ? -5.550  5.384   -4.274  1.00 0.00 ? 31 THR A CB   3  
ATOM   1959  O OG1  . THR A 1 31 ? -6.458  4.962   -5.276  1.00 0.00 ? 31 THR A OG1  3  
ATOM   1960  C CG2  . THR A 1 31 ? -5.718  4.462   -3.085  1.00 0.00 ? 31 THR A CG2  3  
ATOM   1961  H H    . THR A 1 31 ? -6.189  7.485   -5.907  1.00 0.00 ? 31 THR A H    3  
ATOM   1962  H HA   . THR A 1 31 ? -6.774  6.979   -3.577  1.00 0.00 ? 31 THR A HA   3  
ATOM   1963  H HB   . THR A 1 31 ? -4.549  5.261   -4.650  1.00 0.00 ? 31 THR A HB   3  
ATOM   1964  H HG1  . THR A 1 31 ? -6.257  5.411   -6.100  1.00 0.00 ? 31 THR A HG1  3  
ATOM   1965  H HG21 . THR A 1 31 ? -4.747  4.131   -2.746  1.00 0.00 ? 31 THR A HG21 3  
ATOM   1966  H HG22 . THR A 1 31 ? -6.309  3.606   -3.374  1.00 0.00 ? 31 THR A HG22 3  
ATOM   1967  H HG23 . THR A 1 31 ? -6.217  4.990   -2.286  1.00 0.00 ? 31 THR A HG23 3  
ATOM   1968  N N    . PRO A 1 32 ? -5.110  8.408   -2.170  1.00 0.00 ? 32 PRO A N    3  
ATOM   1969  C CA   . PRO A 1 32 ? -4.285  8.956   -1.090  1.00 0.00 ? 32 PRO A CA   3  
ATOM   1970  C C    . PRO A 1 32 ? -3.700  7.871   -0.187  1.00 0.00 ? 32 PRO A C    3  
ATOM   1971  O O    . PRO A 1 32 ? -4.350  7.409   0.750   1.00 0.00 ? 32 PRO A O    3  
ATOM   1972  C CB   . PRO A 1 32 ? -5.278  9.837   -0.339  1.00 0.00 ? 32 PRO A CB   3  
ATOM   1973  C CG   . PRO A 1 32 ? -6.152  10.379  -1.419  1.00 0.00 ? 32 PRO A CG   3  
ATOM   1974  C CD   . PRO A 1 32 ? -6.295  9.247   -2.435  1.00 0.00 ? 32 PRO A CD   3  
ATOM   1975  H HA   . PRO A 1 32 ? -3.483  9.567   -1.480  1.00 0.00 ? 32 PRO A HA   3  
ATOM   1976  H HB2  . PRO A 1 32 ? -5.836  9.240   0.366   1.00 0.00 ? 32 PRO A HB2  3  
ATOM   1977  H HB3  . PRO A 1 32 ? -4.751  10.626  0.177   1.00 0.00 ? 32 PRO A HB3  3  
ATOM   1978  H HG2  . PRO A 1 32 ? -7.115  10.659  -1.002  1.00 0.00 ? 32 PRO A HG2  3  
ATOM   1979  H HG3  . PRO A 1 32 ? -5.675  11.242  -1.870  1.00 0.00 ? 32 PRO A HG3  3  
ATOM   1980  H HD2  . PRO A 1 32 ? -7.203  8.680   -2.261  1.00 0.00 ? 32 PRO A HD2  3  
ATOM   1981  H HD3  . PRO A 1 32 ? -6.278  9.616   -3.460  1.00 0.00 ? 32 PRO A HD3  3  
ATOM   1982  N N    . PRO A 1 33 ? -2.455  7.448   -0.476  1.00 0.00 ? 33 PRO A N    3  
ATOM   1983  C CA   . PRO A 1 33 ? -1.764  6.414   0.281   1.00 0.00 ? 33 PRO A CA   3  
ATOM   1984  C C    . PRO A 1 33 ? -0.923  6.973   1.413   1.00 0.00 ? 33 PRO A C    3  
ATOM   1985  O O    . PRO A 1 33 ? 0.285   7.156   1.270   1.00 0.00 ? 33 PRO A O    3  
ATOM   1986  C CB   . PRO A 1 33 ? -0.874  5.770   -0.782  1.00 0.00 ? 33 PRO A CB   3  
ATOM   1987  C CG   . PRO A 1 33 ? -0.606  6.841   -1.795  1.00 0.00 ? 33 PRO A CG   3  
ATOM   1988  C CD   . PRO A 1 33 ? -1.618  7.944   -1.578  1.00 0.00 ? 33 PRO A CD   3  
ATOM   1989  H HA   . PRO A 1 33 ? -2.442  5.677   0.680   1.00 0.00 ? 33 PRO A HA   3  
ATOM   1990  H HB2  . PRO A 1 33 ? 0.041   5.426   -0.323  1.00 0.00 ? 33 PRO A HB2  3  
ATOM   1991  H HB3  . PRO A 1 33 ? -1.393  4.931   -1.225  1.00 0.00 ? 33 PRO A HB3  3  
ATOM   1992  H HG2  . PRO A 1 33 ? 0.393   7.226   -1.658  1.00 0.00 ? 33 PRO A HG2  3  
ATOM   1993  H HG3  . PRO A 1 33 ? -0.711  6.431   -2.789  1.00 0.00 ? 33 PRO A HG3  3  
ATOM   1994  H HD2  . PRO A 1 33 ? -1.119  8.859   -1.297  1.00 0.00 ? 33 PRO A HD2  3  
ATOM   1995  H HD3  . PRO A 1 33 ? -2.206  8.095   -2.471  1.00 0.00 ? 33 PRO A HD3  3  
ATOM   1996  N N    . LEU A 1 34 ? -1.559  7.234   2.546   1.00 0.00 ? 34 LEU A N    3  
ATOM   1997  C CA   . LEU A 1 34 ? -0.830  7.758   3.696   1.00 0.00 ? 34 LEU A CA   3  
ATOM   1998  C C    . LEU A 1 34 ? 0.085   6.683   4.271   1.00 0.00 ? 34 LEU A C    3  
ATOM   1999  O O    . LEU A 1 34 ? 1.273   6.925   4.484   1.00 0.00 ? 34 LEU A O    3  
ATOM   2000  C CB   . LEU A 1 34 ? -1.770  8.320   4.777   1.00 0.00 ? 34 LEU A CB   3  
ATOM   2001  C CG   . LEU A 1 34 ? -2.973  9.107   4.251   1.00 0.00 ? 34 LEU A CG   3  
ATOM   2002  C CD1  . LEU A 1 34 ? -4.258  8.625   4.908   1.00 0.00 ? 34 LEU A CD1  3  
ATOM   2003  C CD2  . LEU A 1 34 ? -2.780  10.598  4.485   1.00 0.00 ? 34 LEU A CD2  3  
ATOM   2004  H H    . LEU A 1 34 ? -2.525  7.064   2.604   1.00 0.00 ? 34 LEU A H    3  
ATOM   2005  H HA   . LEU A 1 34 ? -0.203  8.551   3.330   1.00 0.00 ? 34 LEU A HA   3  
ATOM   2006  H HB2  . LEU A 1 34 ? -2.136  7.505   5.381   1.00 0.00 ? 34 LEU A HB2  3  
ATOM   2007  H HB3  . LEU A 1 34 ? -1.194  8.978   5.411   1.00 0.00 ? 34 LEU A HB3  3  
ATOM   2008  H HG   . LEU A 1 34 ? -3.061  8.944   3.192   1.00 0.00 ? 34 LEU A HG   3  
ATOM   2009  H HD11 . LEU A 1 34 ? -4.495  9.261   5.747   1.00 0.00 ? 34 LEU A HD11 3  
ATOM   2010  H HD12 . LEU A 1 34 ? -4.129  7.609   5.250   1.00 0.00 ? 34 LEU A HD12 3  
ATOM   2011  H HD13 . LEU A 1 34 ? -5.064  8.663   4.189   1.00 0.00 ? 34 LEU A HD13 3  
ATOM   2012  H HD21 . LEU A 1 34 ? -2.196  11.016  3.679   1.00 0.00 ? 34 LEU A HD21 3  
ATOM   2013  H HD22 . LEU A 1 34 ? -2.264  10.752  5.421   1.00 0.00 ? 34 LEU A HD22 3  
ATOM   2014  H HD23 . LEU A 1 34 ? -3.744  11.084  4.522   1.00 0.00 ? 34 LEU A HD23 3  
ATOM   2015  N N    . THR A 1 35 ? -0.453  5.486   4.490   1.00 0.00 ? 35 THR A N    3  
ATOM   2016  C CA   . THR A 1 35 ? 0.345   4.390   5.000   1.00 0.00 ? 35 THR A CA   3  
ATOM   2017  C C    . THR A 1 35 ? 1.007   3.641   3.845   1.00 0.00 ? 35 THR A C    3  
ATOM   2018  O O    . THR A 1 35 ? 1.706   2.650   4.060   1.00 0.00 ? 35 THR A O    3  
ATOM   2019  C CB   . THR A 1 35 ? -0.524  3.432   5.817   1.00 0.00 ? 35 THR A CB   3  
ATOM   2020  O OG1  . THR A 1 35 ? -1.264  4.137   6.797   1.00 0.00 ? 35 THR A OG1  3  
ATOM   2021  C CG2  . THR A 1 35 ? 0.273   2.359   6.528   1.00 0.00 ? 35 THR A CG2  3  
ATOM   2022  H H    . THR A 1 35 ? -1.394  5.329   4.287   1.00 0.00 ? 35 THR A H    3  
ATOM   2023  H HA   . THR A 1 35 ? 1.110   4.804   5.637   1.00 0.00 ? 35 THR A HA   3  
ATOM   2024  H HB   . THR A 1 35 ? -1.222  2.940   5.153   1.00 0.00 ? 35 THR A HB   3  
ATOM   2025  H HG1  . THR A 1 35 ? -0.670  4.689   7.312   1.00 0.00 ? 35 THR A HG1  3  
ATOM   2026  H HG21 . THR A 1 35 ? 0.164   2.478   7.596   1.00 0.00 ? 35 THR A HG21 3  
ATOM   2027  H HG22 . THR A 1 35 ? 1.315   2.449   6.260   1.00 0.00 ? 35 THR A HG22 3  
ATOM   2028  H HG23 . THR A 1 35 ? -0.092  1.386   6.235   1.00 0.00 ? 35 THR A HG23 3  
ATOM   2029  N N    . CYS A 1 36 ? 0.781   4.111   2.612   1.00 0.00 ? 36 CYS A N    3  
ATOM   2030  C CA   . CYS A 1 36 ? 1.360   3.462   1.442   1.00 0.00 ? 36 CYS A CA   3  
ATOM   2031  C C    . CYS A 1 36 ? 2.281   4.398   0.660   1.00 0.00 ? 36 CYS A C    3  
ATOM   2032  O O    . CYS A 1 36 ? 3.021   3.954   -0.217  1.00 0.00 ? 36 CYS A O    3  
ATOM   2033  C CB   . CYS A 1 36 ? 0.257   2.936   0.527   1.00 0.00 ? 36 CYS A CB   3  
ATOM   2034  S SG   . CYS A 1 36 ? -0.572  1.439   1.149   1.00 0.00 ? 36 CYS A SG   3  
ATOM   2035  H H    . CYS A 1 36 ? 0.208   4.905   2.487   1.00 0.00 ? 36 CYS A H    3  
ATOM   2036  H HA   . CYS A 1 36 ? 1.943   2.630   1.793   1.00 0.00 ? 36 CYS A HA   3  
ATOM   2037  H HB2  . CYS A 1 36 ? -0.496  3.698   0.409   1.00 0.00 ? 36 CYS A HB2  3  
ATOM   2038  H HB3  . CYS A 1 36 ? 0.682   2.701   -0.438  1.00 0.00 ? 36 CYS A HB3  3  
ATOM   2039  N N    . GLN A 1 37 ? 2.239   5.689   0.974   1.00 0.00 ? 37 GLN A N    3  
ATOM   2040  C CA   . GLN A 1 37 ? 3.076   6.664   0.287   1.00 0.00 ? 37 GLN A CA   3  
ATOM   2041  C C    . GLN A 1 37 ? 4.544   6.269   0.368   1.00 0.00 ? 37 GLN A C    3  
ATOM   2042  O O    . GLN A 1 37 ? 5.349   6.657   -0.474  1.00 0.00 ? 37 GLN A O    3  
ATOM   2043  C CB   . GLN A 1 37 ? 2.874   8.059   0.887   1.00 0.00 ? 37 GLN A CB   3  
ATOM   2044  C CG   . GLN A 1 37 ? 2.050   8.986   0.009   1.00 0.00 ? 37 GLN A CG   3  
ATOM   2045  C CD   . GLN A 1 37 ? 1.605   10.238  0.742   1.00 0.00 ? 37 GLN A CD   3  
ATOM   2046  O OE1  . GLN A 1 37 ? 0.432   10.609  0.704   1.00 0.00 ? 37 GLN A OE1  3  
ATOM   2047  N NE2  . GLN A 1 37 ? 2.544   10.896  1.412   1.00 0.00 ? 37 GLN A NE2  3  
ATOM   2048  H H    . GLN A 1 37 ? 1.636   5.995   1.680   1.00 0.00 ? 37 GLN A H    3  
ATOM   2049  H HA   . GLN A 1 37 ? 2.780   6.679   -0.752  1.00 0.00 ? 37 GLN A HA   3  
ATOM   2050  H HB2  . GLN A 1 37 ? 2.372   7.959   1.838   1.00 0.00 ? 37 GLN A HB2  3  
ATOM   2051  H HB3  . GLN A 1 37 ? 3.840   8.515   1.046   1.00 0.00 ? 37 GLN A HB3  3  
ATOM   2052  H HG2  . GLN A 1 37 ? 2.645   9.279   -0.843  1.00 0.00 ? 37 GLN A HG2  3  
ATOM   2053  H HG3  . GLN A 1 37 ? 1.173   8.456   -0.330  1.00 0.00 ? 37 GLN A HG3  3  
ATOM   2054  H HE21 . GLN A 1 37 ? 3.457   10.542  1.397   1.00 0.00 ? 37 GLN A HE21 3  
ATOM   2055  H HE22 . GLN A 1 37 ? 2.284   11.708  1.894   1.00 0.00 ? 37 GLN A HE22 3  
ATOM   2056  N N    . ARG A 1 38 ? 4.881   5.484   1.382   1.00 0.00 ? 38 ARG A N    3  
ATOM   2057  C CA   . ARG A 1 38 ? 6.246   5.026   1.567   1.00 0.00 ? 38 ARG A CA   3  
ATOM   2058  C C    . ARG A 1 38 ? 6.609   4.017   0.480   1.00 0.00 ? 38 ARG A C    3  
ATOM   2059  O O    . ARG A 1 38 ? 7.623   4.159   -0.201  1.00 0.00 ? 38 ARG A O    3  
ATOM   2060  C CB   . ARG A 1 38 ? 6.404   4.413   2.968   1.00 0.00 ? 38 ARG A CB   3  
ATOM   2061  C CG   . ARG A 1 38 ? 7.228   3.133   3.013   1.00 0.00 ? 38 ARG A CG   3  
ATOM   2062  C CD   . ARG A 1 38 ? 8.667   3.377   2.587   1.00 0.00 ? 38 ARG A CD   3  
ATOM   2063  N NE   . ARG A 1 38 ? 9.552   3.531   3.740   1.00 0.00 ? 38 ARG A NE   3  
ATOM   2064  C CZ   . ARG A 1 38 ? 9.813   4.696   4.329   1.00 0.00 ? 38 ARG A CZ   3  
ATOM   2065  N NH1  . ARG A 1 38 ? 9.267   5.819   3.877   1.00 0.00 ? 38 ARG A NH1  3  
ATOM   2066  N NH2  . ARG A 1 38 ? 10.625  4.739   5.378   1.00 0.00 ? 38 ARG A NH2  3  
ATOM   2067  H H    . ARG A 1 38 ? 4.192   5.201   2.017   1.00 0.00 ? 38 ARG A H    3  
ATOM   2068  H HA   . ARG A 1 38 ? 6.899   5.882   1.481   1.00 0.00 ? 38 ARG A HA   3  
ATOM   2069  H HB2  . ARG A 1 38 ? 6.879   5.138   3.610   1.00 0.00 ? 38 ARG A HB2  3  
ATOM   2070  H HB3  . ARG A 1 38 ? 5.421   4.194   3.360   1.00 0.00 ? 38 ARG A HB3  3  
ATOM   2071  H HG2  . ARG A 1 38 ? 7.223   2.751   4.023   1.00 0.00 ? 38 ARG A HG2  3  
ATOM   2072  H HG3  . ARG A 1 38 ? 6.781   2.408   2.349   1.00 0.00 ? 38 ARG A HG3  3  
ATOM   2073  H HD2  . ARG A 1 38 ? 8.990   2.536   1.990   1.00 0.00 ? 38 ARG A HD2  3  
ATOM   2074  H HD3  . ARG A 1 38 ? 8.698   4.270   1.983   1.00 0.00 ? 38 ARG A HD3  3  
ATOM   2075  H HE   . ARG A 1 38 ? 9.973   2.720   4.096   1.00 0.00 ? 38 ARG A HE   3  
ATOM   2076  H HH11 . ARG A 1 38 ? 8.655   5.796   3.088   1.00 0.00 ? 38 ARG A HH11 3  
ATOM   2077  H HH12 . ARG A 1 38 ? 9.470   6.688   4.328   1.00 0.00 ? 38 ARG A HH12 3  
ATOM   2078  H HH21 . ARG A 1 38 ? 11.040  3.897   5.722   1.00 0.00 ? 38 ARG A HH21 3  
ATOM   2079  H HH22 . ARG A 1 38 ? 10.821  5.613   5.822   1.00 0.00 ? 38 ARG A HH22 3  
ATOM   2080  N N    . TYR A 1 39 ? 5.768   2.999   0.323   1.00 0.00 ? 39 TYR A N    3  
ATOM   2081  C CA   . TYR A 1 39 ? 6.001   1.961   -0.668  1.00 0.00 ? 39 TYR A CA   3  
ATOM   2082  C C    . TYR A 1 39 ? 5.707   2.440   -2.081  1.00 0.00 ? 39 TYR A C    3  
ATOM   2083  O O    . TYR A 1 39 ? 6.462   2.148   -3.009  1.00 0.00 ? 39 TYR A O    3  
ATOM   2084  C CB   . TYR A 1 39 ? 5.160   0.720   -0.359  1.00 0.00 ? 39 TYR A CB   3  
ATOM   2085  C CG   . TYR A 1 39 ? 5.536   -0.468  -1.213  1.00 0.00 ? 39 TYR A CG   3  
ATOM   2086  C CD1  . TYR A 1 39 ? 6.646   -1.244  -0.902  1.00 0.00 ? 39 TYR A CD1  3  
ATOM   2087  C CD2  . TYR A 1 39 ? 4.798   -0.800  -2.341  1.00 0.00 ? 39 TYR A CD2  3  
ATOM   2088  C CE1  . TYR A 1 39 ? 7.010   -2.315  -1.694  1.00 0.00 ? 39 TYR A CE1  3  
ATOM   2089  C CE2  . TYR A 1 39 ? 5.153   -1.874  -3.135  1.00 0.00 ? 39 TYR A CE2  3  
ATOM   2090  C CZ   . TYR A 1 39 ? 6.260   -2.627  -2.807  1.00 0.00 ? 39 TYR A CZ   3  
ATOM   2091  O OH   . TYR A 1 39 ? 6.619   -3.695  -3.598  1.00 0.00 ? 39 TYR A OH   3  
ATOM   2092  H H    . TYR A 1 39 ? 4.981   2.938   0.892   1.00 0.00 ? 39 TYR A H    3  
ATOM   2093  H HA   . TYR A 1 39 ? 7.039   1.695   -0.614  1.00 0.00 ? 39 TYR A HA   3  
ATOM   2094  H HB2  . TYR A 1 39 ? 5.299   0.447   0.676   1.00 0.00 ? 39 TYR A HB2  3  
ATOM   2095  H HB3  . TYR A 1 39 ? 4.118   0.943   -0.533  1.00 0.00 ? 39 TYR A HB3  3  
ATOM   2096  H HD1  . TYR A 1 39 ? 7.229   -0.999  -0.027  1.00 0.00 ? 39 TYR A HD1  3  
ATOM   2097  H HD2  . TYR A 1 39 ? 3.930   -0.208  -2.595  1.00 0.00 ? 39 TYR A HD2  3  
ATOM   2098  H HE1  . TYR A 1 39 ? 7.875   -2.907  -1.435  1.00 0.00 ? 39 TYR A HE1  3  
ATOM   2099  H HE2  . TYR A 1 39 ? 4.566   -2.117  -4.008  1.00 0.00 ? 39 TYR A HE2  3  
ATOM   2100  H HH   . TYR A 1 39 ? 6.557   -3.444  -4.522  1.00 0.00 ? 39 TYR A HH   3  
ATOM   2101  N N    . CYS A 1 40 ? 4.614   3.171   -2.255  1.00 0.00 ? 40 CYS A N    3  
ATOM   2102  C CA   . CYS A 1 40 ? 4.258   3.667   -3.582  1.00 0.00 ? 40 CYS A CA   3  
ATOM   2103  C C    . CYS A 1 40 ? 5.385   4.513   -4.156  1.00 0.00 ? 40 CYS A C    3  
ATOM   2104  O O    . CYS A 1 40 ? 5.674   4.440   -5.351  1.00 0.00 ? 40 CYS A O    3  
ATOM   2105  C CB   . CYS A 1 40 ? 2.947   4.459   -3.551  1.00 0.00 ? 40 CYS A CB   3  
ATOM   2106  S SG   . CYS A 1 40 ? 2.354   4.983   -5.193  1.00 0.00 ? 40 CYS A SG   3  
ATOM   2107  H H    . CYS A 1 40 ? 4.042   3.377   -1.484  1.00 0.00 ? 40 CYS A H    3  
ATOM   2108  H HA   . CYS A 1 40 ? 4.133   2.807   -4.222  1.00 0.00 ? 40 CYS A HA   3  
ATOM   2109  H HB2  . CYS A 1 40 ? 2.173   3.847   -3.110  1.00 0.00 ? 40 CYS A HB2  3  
ATOM   2110  H HB3  . CYS A 1 40 ? 3.083   5.347   -2.952  1.00 0.00 ? 40 CYS A HB3  3  
ATOM   2111  N N    . ASN A 1 41 ? 6.040   5.294   -3.304  1.00 0.00 ? 41 ASN A N    3  
ATOM   2112  C CA   . ASN A 1 41 ? 7.151   6.114   -3.756  1.00 0.00 ? 41 ASN A CA   3  
ATOM   2113  C C    . ASN A 1 41 ? 8.347   5.230   -4.086  1.00 0.00 ? 41 ASN A C    3  
ATOM   2114  O O    . ASN A 1 41 ? 9.284   5.655   -4.761  1.00 0.00 ? 41 ASN A O    3  
ATOM   2115  C CB   . ASN A 1 41 ? 7.505   7.190   -2.715  1.00 0.00 ? 41 ASN A CB   3  
ATOM   2116  C CG   . ASN A 1 41 ? 8.873   7.004   -2.078  1.00 0.00 ? 41 ASN A CG   3  
ATOM   2117  O OD1  . ASN A 1 41 ? 9.731   7.883   -2.157  1.00 0.00 ? 41 ASN A OD1  3  
ATOM   2118  N ND2  . ASN A 1 41 ? 9.080   5.858   -1.442  1.00 0.00 ? 41 ASN A ND2  3  
ATOM   2119  H H    . ASN A 1 41 ? 5.788   5.304   -2.363  1.00 0.00 ? 41 ASN A H    3  
ATOM   2120  H HA   . ASN A 1 41 ? 6.837   6.589   -4.661  1.00 0.00 ? 41 ASN A HA   3  
ATOM   2121  H HB2  . ASN A 1 41 ? 7.489   8.157   -3.193  1.00 0.00 ? 41 ASN A HB2  3  
ATOM   2122  H HB3  . ASN A 1 41 ? 6.763   7.176   -1.932  1.00 0.00 ? 41 ASN A HB3  3  
ATOM   2123  H HD21 . ASN A 1 41 ? 8.351   5.204   -1.417  1.00 0.00 ? 41 ASN A HD21 3  
ATOM   2124  H HD22 . ASN A 1 41 ? 9.954   5.713   -1.023  1.00 0.00 ? 41 ASN A HD22 3  
ATOM   2125  N N    . ALA A 1 42 ? 8.285   3.988   -3.626  1.00 0.00 ? 42 ALA A N    3  
ATOM   2126  C CA   . ALA A 1 42 ? 9.339   3.023   -3.893  1.00 0.00 ? 42 ALA A CA   3  
ATOM   2127  C C    . ALA A 1 42 ? 8.942   2.117   -5.048  1.00 0.00 ? 42 ALA A C    3  
ATOM   2128  O O    . ALA A 1 42 ? 9.519   1.049   -5.254  1.00 0.00 ? 42 ALA A O    3  
ATOM   2129  C CB   . ALA A 1 42 ? 9.661   2.212   -2.648  1.00 0.00 ? 42 ALA A CB   3  
ATOM   2130  H H    . ALA A 1 42 ? 7.500   3.710   -3.113  1.00 0.00 ? 42 ALA A H    3  
ATOM   2131  H HA   . ALA A 1 42 ? 10.211  3.574   -4.183  1.00 0.00 ? 42 ALA A HA   3  
ATOM   2132  H HB1  . ALA A 1 42 ? 9.206   1.235   -2.727  1.00 0.00 ? 42 ALA A HB1  3  
ATOM   2133  H HB2  . ALA A 1 42 ? 9.275   2.719   -1.776  1.00 0.00 ? 42 ALA A HB2  3  
ATOM   2134  H HB3  . ALA A 1 42 ? 10.733  2.103   -2.556  1.00 0.00 ? 42 ALA A HB3  3  
ATOM   2135  N N    . SER A 1 43 ? 7.958   2.576   -5.803  1.00 0.00 ? 43 SER A N    3  
ATOM   2136  C CA   . SER A 1 43 ? 7.458   1.856   -6.962  1.00 0.00 ? 43 SER A CA   3  
ATOM   2137  C C    . SER A 1 43 ? 7.262   2.811   -8.140  1.00 0.00 ? 43 SER A C    3  
ATOM   2138  O O    . SER A 1 43 ? 6.612   2.468   -9.127  1.00 0.00 ? 43 SER A O    3  
ATOM   2139  C CB   . SER A 1 43 ? 6.139   1.155   -6.629  1.00 0.00 ? 43 SER A CB   3  
ATOM   2140  O OG   . SER A 1 43 ? 5.805   0.200   -7.621  1.00 0.00 ? 43 SER A OG   3  
ATOM   2141  H H    . SER A 1 43 ? 7.562   3.436   -5.579  1.00 0.00 ? 43 SER A H    3  
ATOM   2142  H HA   . SER A 1 43 ? 8.193   1.118   -7.230  1.00 0.00 ? 43 SER A HA   3  
ATOM   2143  H HB2  . SER A 1 43 ? 6.233   0.650   -5.679  1.00 0.00 ? 43 SER A HB2  3  
ATOM   2144  H HB3  . SER A 1 43 ? 5.349   1.888   -6.571  1.00 0.00 ? 43 SER A HB3  3  
ATOM   2145  H HG   . SER A 1 43 ? 5.846   0.611   -8.488  1.00 0.00 ? 43 SER A HG   3  
ATOM   2146  N N    . VAL A 1 44 ? 7.834   4.011   -8.027  1.00 0.00 ? 44 VAL A N    3  
ATOM   2147  C CA   . VAL A 1 44 ? 7.734   5.014   -9.072  1.00 0.00 ? 44 VAL A CA   3  
ATOM   2148  C C    . VAL A 1 44 ? 9.050   5.770   -9.218  1.00 0.00 ? 44 VAL A C    3  
ATOM   2149  O O    . VAL A 1 44 ? 9.098   6.991   -9.080  1.00 0.00 ? 44 VAL A O    3  
ATOM   2150  C CB   . VAL A 1 44 ? 6.598   6.018   -8.789  1.00 0.00 ? 44 VAL A CB   3  
ATOM   2151  C CG1  . VAL A 1 44 ? 6.406   6.958   -9.970  1.00 0.00 ? 44 VAL A CG1  3  
ATOM   2152  C CG2  . VAL A 1 44 ? 5.304   5.284   -8.466  1.00 0.00 ? 44 VAL A CG2  3  
ATOM   2153  H H    . VAL A 1 44 ? 8.340   4.225   -7.223  1.00 0.00 ? 44 VAL A H    3  
ATOM   2154  H HA   . VAL A 1 44 ? 7.519   4.506   -9.997  1.00 0.00 ? 44 VAL A HA   3  
ATOM   2155  H HB   . VAL A 1 44 ? 6.874   6.610   -7.929  1.00 0.00 ? 44 VAL A HB   3  
ATOM   2156  H HG11 . VAL A 1 44 ? 7.348   7.092   -10.480 1.00 0.00 ? 44 VAL A HG11 3  
ATOM   2157  H HG12 . VAL A 1 44 ? 6.049   7.913   -9.615  1.00 0.00 ? 44 VAL A HG12 3  
ATOM   2158  H HG13 . VAL A 1 44 ? 5.684   6.534   -10.653 1.00 0.00 ? 44 VAL A HG13 3  
ATOM   2159  H HG21 . VAL A 1 44 ? 4.579   5.986   -8.084  1.00 0.00 ? 44 VAL A HG21 3  
ATOM   2160  H HG22 . VAL A 1 44 ? 5.497   4.524   -7.725  1.00 0.00 ? 44 VAL A HG22 3  
ATOM   2161  H HG23 . VAL A 1 44 ? 4.919   4.822   -9.363  1.00 0.00 ? 44 VAL A HG23 3  
ATOM   2162  N N    . THR A 1 45 ? 10.115  5.017   -9.493  1.00 0.00 ? 45 THR A N    3  
ATOM   2163  C CA   . THR A 1 45 ? 11.462  5.564   -9.667  1.00 0.00 ? 45 THR A CA   3  
ATOM   2164  C C    . THR A 1 45 ? 12.159  5.781   -8.322  1.00 0.00 ? 45 THR A C    3  
ATOM   2165  O O    . THR A 1 45 ? 13.330  5.435   -8.165  1.00 0.00 ? 45 THR A O    3  
ATOM   2166  C CB   . THR A 1 45 ? 11.428  6.867   -10.473 1.00 0.00 ? 45 THR A CB   3  
ATOM   2167  O OG1  . THR A 1 45 ? 10.936  6.633   -11.780 1.00 0.00 ? 45 THR A OG1  3  
ATOM   2168  C CG2  . THR A 1 45 ? 12.784  7.529   -10.608 1.00 0.00 ? 45 THR A CG2  3  
ATOM   2169  H H    . THR A 1 45 ? 9.990   4.054   -9.583  1.00 0.00 ? 45 THR A H    3  
ATOM   2170  H HA   . THR A 1 45 ? 12.031  4.835   -10.222 1.00 0.00 ? 45 THR A HA   3  
ATOM   2171  H HB   . THR A 1 45 ? 10.768  7.562   -9.985  1.00 0.00 ? 45 THR A HB   3  
ATOM   2172  H HG1  . THR A 1 45 ? 10.920  7.460   -12.269 1.00 0.00 ? 45 THR A HG1  3  
ATOM   2173  H HG21 . THR A 1 45 ? 12.811  8.116   -11.514 1.00 0.00 ? 45 THR A HG21 3  
ATOM   2174  H HG22 . THR A 1 45 ? 13.553  6.771   -10.647 1.00 0.00 ? 45 THR A HG22 3  
ATOM   2175  H HG23 . THR A 1 45 ? 12.957  8.173   -9.757  1.00 0.00 ? 45 THR A HG23 3  
ATOM   2176  N N    . ASN A 1 46 ? 11.443  6.347   -7.351  1.00 0.00 ? 46 ASN A N    3  
ATOM   2177  C CA   . ASN A 1 46 ? 12.012  6.594   -6.028  1.00 0.00 ? 46 ASN A CA   3  
ATOM   2178  C C    . ASN A 1 46 ? 13.365  7.296   -6.131  1.00 0.00 ? 46 ASN A C    3  
ATOM   2179  O O    . ASN A 1 46 ? 13.722  7.826   -7.185  1.00 0.00 ? 46 ASN A O    3  
ATOM   2180  C CB   . ASN A 1 46 ? 12.162  5.275   -5.266  1.00 0.00 ? 46 ASN A CB   3  
ATOM   2181  C CG   . ASN A 1 46 ? 11.835  5.418   -3.792  1.00 0.00 ? 46 ASN A CG   3  
ATOM   2182  O OD1  . ASN A 1 46 ? 11.363  6.464   -3.348  1.00 0.00 ? 46 ASN A OD1  3  
ATOM   2183  N ND2  . ASN A 1 46 ? 12.087  4.363   -3.025  1.00 0.00 ? 46 ASN A ND2  3  
ATOM   2184  H H    . ASN A 1 46 ? 10.514  6.602   -7.525  1.00 0.00 ? 46 ASN A H    3  
ATOM   2185  H HA   . ASN A 1 46 ? 11.330  7.234   -5.488  1.00 0.00 ? 46 ASN A HA   3  
ATOM   2186  H HB2  . ASN A 1 46 ? 11.495  4.542   -5.694  1.00 0.00 ? 46 ASN A HB2  3  
ATOM   2187  H HB3  . ASN A 1 46 ? 13.181  4.927   -5.359  1.00 0.00 ? 46 ASN A HB3  3  
ATOM   2188  H HD21 . ASN A 1 46 ? 12.463  3.563   -3.446  1.00 0.00 ? 46 ASN A HD21 3  
ATOM   2189  H HD22 . ASN A 1 46 ? 11.884  4.429   -2.068  1.00 0.00 ? 46 ASN A HD22 3  
ATOM   2190  N N    . SER A 1 47 ? 14.117  7.292   -5.033  1.00 0.00 ? 47 SER A N    3  
ATOM   2191  C CA   . SER A 1 47 ? 15.433  7.924   -4.994  1.00 0.00 ? 47 SER A CA   3  
ATOM   2192  C C    . SER A 1 47 ? 15.310  9.443   -4.944  1.00 0.00 ? 47 SER A C    3  
ATOM   2193  O O    . SER A 1 47 ? 15.208  10.098  -5.979  1.00 0.00 ? 47 SER A O    3  
ATOM   2194  C CB   . SER A 1 47 ? 16.268  7.507   -6.209  1.00 0.00 ? 47 SER A CB   3  
ATOM   2195  O OG   . SER A 1 47 ? 17.653  7.522   -5.906  1.00 0.00 ? 47 SER A OG   3  
ATOM   2196  H H    . SER A 1 47 ? 13.777  6.852   -4.226  1.00 0.00 ? 47 SER A H    3  
ATOM   2197  H HA   . SER A 1 47 ? 15.931  7.589   -4.096  1.00 0.00 ? 47 SER A HA   3  
ATOM   2198  H HB2  . SER A 1 47 ? 15.989  6.509   -6.509  1.00 0.00 ? 47 SER A HB2  3  
ATOM   2199  H HB3  . SER A 1 47 ? 16.083  8.193   -7.022  1.00 0.00 ? 47 SER A HB3  3  
ATOM   2200  H HG   . SER A 1 47 ? 17.821  6.956   -5.149  1.00 0.00 ? 47 SER A HG   3  
ATOM   2201  N N    . VAL A 1 48 ? 15.333  9.990   -3.730  1.00 0.00 ? 48 VAL A N    3  
ATOM   2202  C CA   . VAL A 1 48 ? 15.237  11.428  -3.512  1.00 0.00 ? 48 VAL A CA   3  
ATOM   2203  C C    . VAL A 1 48 ? 15.004  11.726  -2.041  1.00 0.00 ? 48 VAL A C    3  
ATOM   2204  O O    . VAL A 1 48 ? 13.878  11.657  -1.548  1.00 0.00 ? 48 VAL A O    3  
ATOM   2205  C CB   . VAL A 1 48 ? 14.113  12.100  -4.314  1.00 0.00 ? 48 VAL A CB   3  
ATOM   2206  C CG1  . VAL A 1 48 ? 14.623  12.602  -5.658  1.00 0.00 ? 48 VAL A CG1  3  
ATOM   2207  C CG2  . VAL A 1 48 ? 12.926  11.163  -4.488  1.00 0.00 ? 48 VAL A CG2  3  
ATOM   2208  H H    . VAL A 1 48 ? 15.430  9.407   -2.950  1.00 0.00 ? 48 VAL A H    3  
ATOM   2209  H HA   . VAL A 1 48 ? 16.176  11.872  -3.810  1.00 0.00 ? 48 VAL A HA   3  
ATOM   2210  H HB   . VAL A 1 48 ? 13.790  12.955  -3.744  1.00 0.00 ? 48 VAL A HB   3  
ATOM   2211  H HG11 . VAL A 1 48 ? 15.697  12.488  -5.702  1.00 0.00 ? 48 VAL A HG11 3  
ATOM   2212  H HG12 . VAL A 1 48 ? 14.367  13.644  -5.773  1.00 0.00 ? 48 VAL A HG12 3  
ATOM   2213  H HG13 . VAL A 1 48 ? 14.168  12.029  -6.452  1.00 0.00 ? 48 VAL A HG13 3  
ATOM   2214  H HG21 . VAL A 1 48 ? 12.808  10.561  -3.600  1.00 0.00 ? 48 VAL A HG21 3  
ATOM   2215  H HG22 . VAL A 1 48 ? 13.096  10.520  -5.340  1.00 0.00 ? 48 VAL A HG22 3  
ATOM   2216  H HG23 . VAL A 1 48 ? 12.030  11.744  -4.651  1.00 0.00 ? 48 VAL A HG23 3  
ATOM   2217  N N    . LYS A 1 49 ? 16.081  12.073  -1.364  1.00 0.00 ? 49 LYS A N    3  
ATOM   2218  C CA   . LYS A 1 49 ? 16.063  12.407  0.051   1.00 0.00 ? 49 LYS A CA   3  
ATOM   2219  C C    . LYS A 1 49 ? 17.479  12.409  0.619   1.00 0.00 ? 49 LYS A C    3  
ATOM   2220  O O    . LYS A 1 49 ? 18.457  12.366  -0.128  1.00 0.00 ? 49 LYS A O    3  
ATOM   2221  C CB   . LYS A 1 49 ? 15.183  11.436  0.854   1.00 0.00 ? 49 LYS A CB   3  
ATOM   2222  C CG   . LYS A 1 49 ? 14.184  12.132  1.768   1.00 0.00 ? 49 LYS A CG   3  
ATOM   2223  C CD   . LYS A 1 49 ? 13.342  13.150  1.014   1.00 0.00 ? 49 LYS A CD   3  
ATOM   2224  C CE   . LYS A 1 49 ? 13.423  14.527  1.655   1.00 0.00 ? 49 LYS A CE   3  
ATOM   2225  N NZ   . LYS A 1 49 ? 12.194  15.330  1.404   1.00 0.00 ? 49 LYS A NZ   3  
ATOM   2226  H H    . LYS A 1 49 ? 16.918  12.122  -1.839  1.00 0.00 ? 49 LYS A H    3  
ATOM   2227  H HA   . LYS A 1 49 ? 15.662  13.396  0.131   1.00 0.00 ? 49 LYS A HA   3  
ATOM   2228  H HB2  . LYS A 1 49 ? 14.636  10.806  0.172   1.00 0.00 ? 49 LYS A HB2  3  
ATOM   2229  H HB3  . LYS A 1 49 ? 15.820  10.815  1.465   1.00 0.00 ? 49 LYS A HB3  3  
ATOM   2230  H HG2  . LYS A 1 49 ? 13.530  11.388  2.200   1.00 0.00 ? 49 LYS A HG2  3  
ATOM   2231  H HG3  . LYS A 1 49 ? 14.726  12.637  2.555   1.00 0.00 ? 49 LYS A HG3  3  
ATOM   2232  H HD2  . LYS A 1 49 ? 13.696  13.217  -0.003  1.00 0.00 ? 49 LYS A HD2  3  
ATOM   2233  H HD3  . LYS A 1 49 ? 12.312  12.822  1.017   1.00 0.00 ? 49 LYS A HD3  3  
ATOM   2234  H HE2  . LYS A 1 49 ? 13.553  14.407  2.720   1.00 0.00 ? 49 LYS A HE2  3  
ATOM   2235  H HE3  . LYS A 1 49 ? 14.275  15.050  1.245   1.00 0.00 ? 49 LYS A HE3  3  
ATOM   2236  H HZ1  . LYS A 1 49 ? 12.109  15.547  0.391   1.00 0.00 ? 49 LYS A HZ1  3  
ATOM   2237  H HZ2  . LYS A 1 49 ? 12.236  16.223  1.936   1.00 0.00 ? 49 LYS A HZ2  3  
ATOM   2238  H HZ3  . LYS A 1 49 ? 11.352  14.799  1.706   1.00 0.00 ? 49 LYS A HZ3  3  
HETATM 2239  N N    . CY1 A 1 50 ? 17.583  12.454  1.943   1.00 0.00 ? 50 CY1 A N    3  
HETATM 2240  C CA   . CY1 A 1 50 ? 18.880  12.458  2.608   1.00 0.00 ? 50 CY1 A CA   3  
HETATM 2241  C CB   . CY1 A 1 50 ? 19.452  13.876  2.651   1.00 0.00 ? 50 CY1 A CB   3  
HETATM 2242  S SG   . CY1 A 1 50 ? 21.253  13.891  2.722   1.00 0.00 ? 50 CY1 A SG   3  
HETATM 2243  C CD   . CY1 A 1 50 ? 21.574  14.840  4.221   1.00 0.00 ? 50 CY1 A CD   3  
HETATM 2244  N NE   . CY1 A 1 50 ? 22.962  14.670  4.639   1.00 0.00 ? 50 CY1 A NE   3  
HETATM 2245  C CZ   . CY1 A 1 50 ? 23.773  15.673  4.960   1.00 0.00 ? 50 CY1 A CZ   3  
HETATM 2246  O OAC  . CY1 A 1 50 ? 23.443  16.859  4.942   1.00 0.00 ? 50 CY1 A OAC  3  
HETATM 2247  C CM   . CY1 A 1 50 ? 25.179  15.276  5.368   1.00 0.00 ? 50 CY1 A CM   3  
HETATM 2248  C C    . CY1 A 1 50 ? 18.768  11.899  4.023   1.00 0.00 ? 50 CY1 A C    3  
HETATM 2249  O O    . CY1 A 1 50 ? 18.076  12.468  4.867   1.00 0.00 ? 50 CY1 A O    3  
HETATM 2250  H H    . CY1 A 1 50 ? 16.767  12.484  2.486   1.00 0.00 ? 50 CY1 A H    3  
HETATM 2251  H HA   . CY1 A 1 50 ? 19.547  11.828  2.038   1.00 0.00 ? 50 CY1 A HA   3  
HETATM 2252  H HB2  . CY1 A 1 50 ? 19.138  14.410  1.766   1.00 0.00 ? 50 CY1 A HB2  3  
HETATM 2253  H HB3  . CY1 A 1 50 ? 19.072  14.383  3.525   1.00 0.00 ? 50 CY1 A HB3  3  
HETATM 2254  H HD2  . CY1 A 1 50 ? 21.439  15.815  3.776   1.00 0.00 ? 50 CY1 A HD2  3  
HETATM 2255  H HD3  . CY1 A 1 50 ? 20.917  14.317  4.901   1.00 0.00 ? 50 CY1 A HD3  3  
HETATM 2256  H HE   . CY1 A 1 50 ? 23.318  13.758  4.699   1.00 0.00 ? 50 CY1 A HE   3  
HETATM 2257  H HM1  . CY1 A 1 50 ? 25.173  14.979  6.414   1.00 0.00 ? 50 CY1 A HM1  3  
HETATM 2258  H HM2  . CY1 A 1 50 ? 25.846  16.118  5.201   1.00 0.00 ? 50 CY1 A HM2  3  
HETATM 2259  H HM3  . CY1 A 1 50 ? 25.514  14.450  4.777   1.00 0.00 ? 50 CY1 A HM3  3  
HETATM 2260  N N    . NH2 A 1 51 ? 19.441  10.787  4.296   1.00 0.00 ? 51 NH2 A N    3  
HETATM 2261  H HN1  . NH2 A 1 51 ? 19.974  10.381  3.581   1.00 0.00 ? 51 NH2 A HN1  3  
HETATM 2262  H HN2  . NH2 A 1 51 ? 19.376  10.418  5.202   1.00 0.00 ? 51 NH2 A HN2  3  
ATOM   2263  N N    . LEU A 1 1  ? 3.115   2.273   17.641  1.00 0.00 ? 1  LEU A N    4  
ATOM   2264  C CA   . LEU A 1 1  ? 2.089   1.904   16.631  1.00 0.00 ? 1  LEU A CA   4  
ATOM   2265  C C    . LEU A 1 1  ? 1.516   0.518   16.909  1.00 0.00 ? 1  LEU A C    4  
ATOM   2266  O O    . LEU A 1 1  ? 2.169   -0.323  17.527  1.00 0.00 ? 1  LEU A O    4  
ATOM   2267  C CB   . LEU A 1 1  ? 2.734   1.940   15.244  1.00 0.00 ? 1  LEU A CB   4  
ATOM   2268  C CG   . LEU A 1 1  ? 3.433   3.255   14.890  1.00 0.00 ? 1  LEU A CG   4  
ATOM   2269  C CD1  . LEU A 1 1  ? 4.928   3.153   15.153  1.00 0.00 ? 1  LEU A CD1  4  
ATOM   2270  C CD2  . LEU A 1 1  ? 3.171   3.626   13.438  1.00 0.00 ? 1  LEU A CD2  4  
ATOM   2271  H H1   . LEU A 1 1  ? 2.654   2.285   18.572  1.00 0.00 ? 1  LEU A H1   4  
ATOM   2272  H H2   . LEU A 1 1  ? 3.480   3.214   17.390  1.00 0.00 ? 1  LEU A H2   4  
ATOM   2273  H H3   . LEU A 1 1  ? 3.867   1.556   17.606  1.00 0.00 ? 1  LEU A H3   4  
ATOM   2274  H HA   . LEU A 1 1  ? 1.290   2.630   16.671  1.00 0.00 ? 1  LEU A HA   4  
ATOM   2275  H HB2  . LEU A 1 1  ? 3.460   1.143   15.187  1.00 0.00 ? 1  LEU A HB2  4  
ATOM   2276  H HB3  . LEU A 1 1  ? 1.966   1.758   14.508  1.00 0.00 ? 1  LEU A HB3  4  
ATOM   2277  H HG   . LEU A 1 1  ? 3.038   4.044   15.514  1.00 0.00 ? 1  LEU A HG   4  
ATOM   2278  H HD11 . LEU A 1 1  ? 5.393   4.108   14.960  1.00 0.00 ? 1  LEU A HD11 4  
ATOM   2279  H HD12 . LEU A 1 1  ? 5.357   2.405   14.504  1.00 0.00 ? 1  LEU A HD12 4  
ATOM   2280  H HD13 . LEU A 1 1  ? 5.094   2.874   16.184  1.00 0.00 ? 1  LEU A HD13 4  
ATOM   2281  H HD21 . LEU A 1 1  ? 3.968   4.260   13.079  1.00 0.00 ? 1  LEU A HD21 4  
ATOM   2282  H HD22 . LEU A 1 1  ? 2.231   4.153   13.366  1.00 0.00 ? 1  LEU A HD22 4  
ATOM   2283  H HD23 . LEU A 1 1  ? 3.127   2.728   12.840  1.00 0.00 ? 1  LEU A HD23 4  
ATOM   2284  N N    . GLN A 1 2  ? 0.290   0.287   16.449  1.00 0.00 ? 2  GLN A N    4  
ATOM   2285  C CA   . GLN A 1 2  ? -0.373  -0.997  16.649  1.00 0.00 ? 2  GLN A CA   4  
ATOM   2286  C C    . GLN A 1 2  ? -0.475  -1.770  15.339  1.00 0.00 ? 2  GLN A C    4  
ATOM   2287  O O    . GLN A 1 2  ? -1.009  -1.266  14.350  1.00 0.00 ? 2  GLN A O    4  
ATOM   2288  C CB   . GLN A 1 2  ? -1.768  -0.787  17.242  1.00 0.00 ? 2  GLN A CB   4  
ATOM   2289  C CG   . GLN A 1 2  ? -1.751  -0.280  18.674  1.00 0.00 ? 2  GLN A CG   4  
ATOM   2290  C CD   . GLN A 1 2  ? -2.938  0.608   18.993  1.00 0.00 ? 2  GLN A CD   4  
ATOM   2291  O OE1  . GLN A 1 2  ? -2.830  1.835   18.987  1.00 0.00 ? 2  GLN A OE1  4  
ATOM   2292  N NE2  . GLN A 1 2  ? -4.081  -0.008  19.273  1.00 0.00 ? 2  GLN A NE2  4  
ATOM   2293  H H    . GLN A 1 2  ? -0.181  0.997   15.964  1.00 0.00 ? 2  GLN A H    4  
ATOM   2294  H HA   . GLN A 1 2  ? 0.221   -1.570  17.346  1.00 0.00 ? 2  GLN A HA   4  
ATOM   2295  H HB2  . GLN A 1 2  ? -2.300  -0.069  16.635  1.00 0.00 ? 2  GLN A HB2  4  
ATOM   2296  H HB3  . GLN A 1 2  ? -2.301  -1.727  17.222  1.00 0.00 ? 2  GLN A HB3  4  
ATOM   2297  H HG2  . GLN A 1 2  ? -1.767  -1.127  19.343  1.00 0.00 ? 2  GLN A HG2  4  
ATOM   2298  H HG3  . GLN A 1 2  ? -0.845  0.285   18.832  1.00 0.00 ? 2  GLN A HG3  4  
ATOM   2299  H HE21 . GLN A 1 2  ? -4.094  -0.988  19.260  1.00 0.00 ? 2  GLN A HE21 4  
ATOM   2300  H HE22 . GLN A 1 2  ? -4.864  0.542   19.483  1.00 0.00 ? 2  GLN A HE22 4  
ATOM   2301  N N    . MET A 1 3  ? 0.041   -3.000  15.341  1.00 0.00 ? 3  MET A N    4  
ATOM   2302  C CA   . MET A 1 3  ? 0.015   -3.861  14.156  1.00 0.00 ? 3  MET A CA   4  
ATOM   2303  C C    . MET A 1 3  ? 1.100   -3.491  13.155  1.00 0.00 ? 3  MET A C    4  
ATOM   2304  O O    . MET A 1 3  ? 1.300   -4.188  12.161  1.00 0.00 ? 3  MET A O    4  
ATOM   2305  C CB   . MET A 1 3  ? -1.354  -3.810  13.476  1.00 0.00 ? 3  MET A CB   4  
ATOM   2306  C CG   . MET A 1 3  ? -1.615  -4.980  12.541  1.00 0.00 ? 3  MET A CG   4  
ATOM   2307  S SD   . MET A 1 3  ? -1.541  -6.573  13.383  1.00 0.00 ? 3  MET A SD   4  
ATOM   2308  C CE   . MET A 1 3  ? -2.898  -7.435  12.595  1.00 0.00 ? 3  MET A CE   4  
ATOM   2309  H H    . MET A 1 3  ? 0.450   -3.339  16.166  1.00 0.00 ? 3  MET A H    4  
ATOM   2310  H HA   . MET A 1 3  ? 0.203   -4.863  14.487  1.00 0.00 ? 3  MET A HA   4  
ATOM   2311  H HB2  . MET A 1 3  ? -2.121  -3.806  14.237  1.00 0.00 ? 3  MET A HB2  4  
ATOM   2312  H HB3  . MET A 1 3  ? -1.422  -2.897  12.904  1.00 0.00 ? 3  MET A HB3  4  
ATOM   2313  H HG2  . MET A 1 3  ? -2.597  -4.864  12.107  1.00 0.00 ? 3  MET A HG2  4  
ATOM   2314  H HG3  . MET A 1 3  ? -0.873  -4.969  11.757  1.00 0.00 ? 3  MET A HG3  4  
ATOM   2315  H HE1  . MET A 1 3  ? -2.509  -8.237  11.985  1.00 0.00 ? 3  MET A HE1  4  
ATOM   2316  H HE2  . MET A 1 3  ? -3.449  -6.746  11.973  1.00 0.00 ? 3  MET A HE2  4  
ATOM   2317  H HE3  . MET A 1 3  ? -3.553  -7.843  13.350  1.00 0.00 ? 3  MET A HE3  4  
ATOM   2318  N N    . ALA A 1 4  ? 1.802   -2.402  13.417  1.00 0.00 ? 4  ALA A N    4  
ATOM   2319  C CA   . ALA A 1 4  ? 2.864   -1.955  12.535  1.00 0.00 ? 4  ALA A CA   4  
ATOM   2320  C C    . ALA A 1 4  ? 4.077   -2.881  12.623  1.00 0.00 ? 4  ALA A C    4  
ATOM   2321  O O    . ALA A 1 4  ? 5.163   -2.463  13.026  1.00 0.00 ? 4  ALA A O    4  
ATOM   2322  C CB   . ALA A 1 4  ? 3.244   -0.533  12.895  1.00 0.00 ? 4  ALA A CB   4  
ATOM   2323  H H    . ALA A 1 4  ? 1.602   -1.884  14.223  1.00 0.00 ? 4  ALA A H    4  
ATOM   2324  H HA   . ALA A 1 4  ? 2.485   -1.958  11.523  1.00 0.00 ? 4  ALA A HA   4  
ATOM   2325  H HB1  . ALA A 1 4  ? 4.200   -0.530  13.397  1.00 0.00 ? 4  ALA A HB1  4  
ATOM   2326  H HB2  . ALA A 1 4  ? 2.491   -0.125  13.554  1.00 0.00 ? 4  ALA A HB2  4  
ATOM   2327  H HB3  . ALA A 1 4  ? 3.303   0.064   11.998  1.00 0.00 ? 4  ALA A HB3  4  
ATOM   2328  N N    . GLY A 1 5  ? 3.888   -4.143  12.242  1.00 0.00 ? 5  GLY A N    4  
ATOM   2329  C CA   . GLY A 1 5  ? 4.975   -5.103  12.290  1.00 0.00 ? 5  GLY A CA   4  
ATOM   2330  C C    . GLY A 1 5  ? 4.493   -6.534  12.136  1.00 0.00 ? 5  GLY A C    4  
ATOM   2331  O O    . GLY A 1 5  ? 5.003   -7.442  12.793  1.00 0.00 ? 5  GLY A O    4  
ATOM   2332  H H    . GLY A 1 5  ? 3.004   -4.423  11.927  1.00 0.00 ? 5  GLY A H    4  
ATOM   2333  H HA2  . GLY A 1 5  ? 5.673   -4.883  11.493  1.00 0.00 ? 5  GLY A HA2  4  
ATOM   2334  H HA3  . GLY A 1 5  ? 5.485   -5.009  13.239  1.00 0.00 ? 5  GLY A HA3  4  
ATOM   2335  N N    . GLN A 1 6  ? 3.513   -6.737  11.259  1.00 0.00 ? 6  GLN A N    4  
ATOM   2336  C CA   . GLN A 1 6  ? 2.964   -8.058  11.008  1.00 0.00 ? 6  GLN A CA   4  
ATOM   2337  C C    . GLN A 1 6  ? 1.806   -7.967  10.031  1.00 0.00 ? 6  GLN A C    4  
ATOM   2338  O O    . GLN A 1 6  ? 0.642   -8.136  10.394  1.00 0.00 ? 6  GLN A O    4  
ATOM   2339  C CB   . GLN A 1 6  ? 2.514   -8.723  12.313  1.00 0.00 ? 6  GLN A CB   4  
ATOM   2340  C CG   . GLN A 1 6  ? 3.430   -9.847  12.768  1.00 0.00 ? 6  GLN A CG   4  
ATOM   2341  C CD   . GLN A 1 6  ? 3.042   -11.189 12.177  1.00 0.00 ? 6  GLN A CD   4  
ATOM   2342  O OE1  . GLN A 1 6  ? 3.016   -11.358 10.959  1.00 0.00 ? 6  GLN A OE1  4  
ATOM   2343  N NE2  . GLN A 1 6  ? 2.737   -12.150 13.041  1.00 0.00 ? 6  GLN A NE2  4  
ATOM   2344  H H    . GLN A 1 6  ? 3.156   -5.980  10.758  1.00 0.00 ? 6  GLN A H    4  
ATOM   2345  H HA   . GLN A 1 6  ? 3.740   -8.646  10.555  1.00 0.00 ? 6  GLN A HA   4  
ATOM   2346  H HB2  . GLN A 1 6  ? 2.484   -7.975  13.093  1.00 0.00 ? 6  GLN A HB2  4  
ATOM   2347  H HB3  . GLN A 1 6  ? 1.523   -9.128  12.177  1.00 0.00 ? 6  GLN A HB3  4  
ATOM   2348  H HG2  . GLN A 1 6  ? 4.440   -9.617  12.465  1.00 0.00 ? 6  GLN A HG2  4  
ATOM   2349  H HG3  . GLN A 1 6  ? 3.385   -9.917  13.845  1.00 0.00 ? 6  GLN A HG3  4  
ATOM   2350  H HE21 . GLN A 1 6  ? 2.778   -11.942 13.998  1.00 0.00 ? 6  GLN A HE21 4  
ATOM   2351  H HE22 . GLN A 1 6  ? 2.483   -13.026 12.687  1.00 0.00 ? 6  GLN A HE22 4  
ATOM   2352  N N    . CYS A 1 7  ? 2.149   -7.683  8.786   1.00 0.00 ? 7  CYS A N    4  
ATOM   2353  C CA   . CYS A 1 7  ? 1.158   -7.547  7.726   1.00 0.00 ? 7  CYS A CA   4  
ATOM   2354  C C    . CYS A 1 7  ? 1.514   -8.398  6.520   1.00 0.00 ? 7  CYS A C    4  
ATOM   2355  O O    . CYS A 1 7  ? 2.688   -8.582  6.202   1.00 0.00 ? 7  CYS A O    4  
ATOM   2356  C CB   . CYS A 1 7  ? 1.052   -6.088  7.290   1.00 0.00 ? 7  CYS A CB   4  
ATOM   2357  S SG   . CYS A 1 7  ? -0.169  -5.120  8.228   1.00 0.00 ? 7  CYS A SG   4  
ATOM   2358  H H    . CYS A 1 7  ? 3.098   -7.551  8.581   1.00 0.00 ? 7  CYS A H    4  
ATOM   2359  H HA   . CYS A 1 7  ? 0.208   -7.865  8.112   1.00 0.00 ? 7  CYS A HA   4  
ATOM   2360  H HB2  . CYS A 1 7  ? 2.012   -5.614  7.418   1.00 0.00 ? 7  CYS A HB2  4  
ATOM   2361  H HB3  . CYS A 1 7  ? 0.775   -6.050  6.245   1.00 0.00 ? 7  CYS A HB3  4  
ATOM   2362  N N    . SER A 1 8  ? 0.490   -8.893  5.830   1.00 0.00 ? 8  SER A N    4  
ATOM   2363  C CA   . SER A 1 8  ? 0.708   -9.694  4.635   1.00 0.00 ? 8  SER A CA   4  
ATOM   2364  C C    . SER A 1 8  ? 1.609   -8.932  3.676   1.00 0.00 ? 8  SER A C    4  
ATOM   2365  O O    . SER A 1 8  ? 1.707   -7.707  3.744   1.00 0.00 ? 8  SER A O    4  
ATOM   2366  C CB   . SER A 1 8  ? -0.622  -10.033 3.958   1.00 0.00 ? 8  SER A CB   4  
ATOM   2367  O OG   . SER A 1 8  ? -1.349  -10.987 4.713   1.00 0.00 ? 8  SER A OG   4  
ATOM   2368  H H    . SER A 1 8  ? -0.426  -8.699  6.120   1.00 0.00 ? 8  SER A H    4  
ATOM   2369  H HA   . SER A 1 8  ? 1.206   -10.607 4.923   1.00 0.00 ? 8  SER A HA   4  
ATOM   2370  H HB2  . SER A 1 8  ? -1.216  -9.137  3.867   1.00 0.00 ? 8  SER A HB2  4  
ATOM   2371  H HB3  . SER A 1 8  ? -0.430  -10.439 2.976   1.00 0.00 ? 8  SER A HB3  4  
ATOM   2372  H HG   . SER A 1 8  ? -1.695  -10.572 5.506   1.00 0.00 ? 8  SER A HG   4  
ATOM   2373  N N    . GLN A 1 9  ? 2.284   -9.654  2.804   1.00 0.00 ? 9  GLN A N    4  
ATOM   2374  C CA   . GLN A 1 9  ? 3.199   -9.036  1.858   1.00 0.00 ? 9  GLN A CA   4  
ATOM   2375  C C    . GLN A 1 9  ? 2.586   -7.832  1.162   1.00 0.00 ? 9  GLN A C    4  
ATOM   2376  O O    . GLN A 1 9  ? 1.460   -7.877  0.672   1.00 0.00 ? 9  GLN A O    4  
ATOM   2377  C CB   . GLN A 1 9  ? 3.687   -10.058 0.829   1.00 0.00 ? 9  GLN A CB   4  
ATOM   2378  C CG   . GLN A 1 9  ? 5.029   -10.679 1.178   1.00 0.00 ? 9  GLN A CG   4  
ATOM   2379  C CD   . GLN A 1 9  ? 4.888   -12.026 1.858   1.00 0.00 ? 9  GLN A CD   4  
ATOM   2380  O OE1  . GLN A 1 9  ? 4.366   -12.123 2.968   1.00 0.00 ? 9  GLN A OE1  4  
ATOM   2381  N NE2  . GLN A 1 9  ? 5.354   -13.076 1.191   1.00 0.00 ? 9  GLN A NE2  4  
ATOM   2382  H H    . GLN A 1 9  ? 2.185   -10.626 2.810   1.00 0.00 ? 9  GLN A H    4  
ATOM   2383  H HA   . GLN A 1 9  ? 4.037   -8.682  2.426   1.00 0.00 ? 9  GLN A HA   4  
ATOM   2384  H HB2  . GLN A 1 9  ? 2.956   -10.850 0.752   1.00 0.00 ? 9  GLN A HB2  4  
ATOM   2385  H HB3  . GLN A 1 9  ? 3.778   -9.571  -0.131  1.00 0.00 ? 9  GLN A HB3  4  
ATOM   2386  H HG2  . GLN A 1 9  ? 5.598   -10.809 0.269   1.00 0.00 ? 9  GLN A HG2  4  
ATOM   2387  H HG3  . GLN A 1 9  ? 5.559   -10.010 1.841   1.00 0.00 ? 9  GLN A HG3  4  
ATOM   2388  H HE21 . GLN A 1 9  ? 5.756   -12.925 0.311   1.00 0.00 ? 9  GLN A HE21 4  
ATOM   2389  H HE22 . GLN A 1 9  ? 5.277   -13.960 1.607   1.00 0.00 ? 9  GLN A HE22 4  
ATOM   2390  N N    . ASN A 1 10 ? 3.359   -6.752  1.144   1.00 0.00 ? 10 ASN A N    4  
ATOM   2391  C CA   . ASN A 1 10 ? 2.946   -5.497  0.530   1.00 0.00 ? 10 ASN A CA   4  
ATOM   2392  C C    . ASN A 1 10 ? 1.508   -5.156  0.879   1.00 0.00 ? 10 ASN A C    4  
ATOM   2393  O O    . ASN A 1 10 ? 0.799   -4.528  0.091   1.00 0.00 ? 10 ASN A O    4  
ATOM   2394  C CB   . ASN A 1 10 ? 3.124   -5.541  -1.002  1.00 0.00 ? 10 ASN A CB   4  
ATOM   2395  C CG   . ASN A 1 10 ? 2.494   -6.777  -1.625  1.00 0.00 ? 10 ASN A CG   4  
ATOM   2396  O OD1  . ASN A 1 10 ? 3.198   -7.668  -2.099  1.00 0.00 ? 10 ASN A OD1  4  
ATOM   2397  N ND2  . ASN A 1 10 ? 1.165   -6.838  -1.633  1.00 0.00 ? 10 ASN A ND2  4  
ATOM   2398  H H    . ASN A 1 10 ? 4.242   -6.800  1.570   1.00 0.00 ? 10 ASN A H    4  
ATOM   2399  H HA   . ASN A 1 10 ? 3.575   -4.727  0.944   1.00 0.00 ? 10 ASN A HA   4  
ATOM   2400  H HB2  . ASN A 1 10 ? 2.664   -4.666  -1.443  1.00 0.00 ? 10 ASN A HB2  4  
ATOM   2401  H HB3  . ASN A 1 10 ? 4.180   -5.542  -1.245  1.00 0.00 ? 10 ASN A HB3  4  
ATOM   2402  H HD21 . ASN A 1 10 ? 0.660   -6.096  -1.241  1.00 0.00 ? 10 ASN A HD21 4  
ATOM   2403  H HD22 . ASN A 1 10 ? 0.741   -7.628  -2.032  1.00 0.00 ? 10 ASN A HD22 4  
ATOM   2404  N N    . GLU A 1 11 ? 1.079   -5.563  2.063   1.00 0.00 ? 11 GLU A N    4  
ATOM   2405  C CA   . GLU A 1 11 ? -0.284  -5.268  2.488   1.00 0.00 ? 11 GLU A CA   4  
ATOM   2406  C C    . GLU A 1 11 ? -0.313  -4.154  3.516   1.00 0.00 ? 11 GLU A C    4  
ATOM   2407  O O    . GLU A 1 11 ? 0.593   -4.033  4.340   1.00 0.00 ? 11 GLU A O    4  
ATOM   2408  C CB   . GLU A 1 11 ? -1.002  -6.522  2.993   1.00 0.00 ? 11 GLU A CB   4  
ATOM   2409  C CG   . GLU A 1 11 ? -2.050  -7.055  2.019   1.00 0.00 ? 11 GLU A CG   4  
ATOM   2410  C CD   . GLU A 1 11 ? -1.777  -8.482  1.583   1.00 0.00 ? 11 GLU A CD   4  
ATOM   2411  O OE1  . GLU A 1 11 ? -0.855  -8.687  0.768   1.00 0.00 ? 11 GLU A OE1  4  
ATOM   2412  O OE2  . GLU A 1 11 ? -2.491  -9.392  2.054   1.00 0.00 ? 11 GLU A OE2  4  
ATOM   2413  H H    . GLU A 1 11 ? 1.697   -6.065  2.657   1.00 0.00 ? 11 GLU A H    4  
ATOM   2414  H HA   . GLU A 1 11 ? -0.793  -4.902  1.632   1.00 0.00 ? 11 GLU A HA   4  
ATOM   2415  H HB2  . GLU A 1 11 ? -0.273  -7.299  3.164   1.00 0.00 ? 11 GLU A HB2  4  
ATOM   2416  H HB3  . GLU A 1 11 ? -1.495  -6.292  3.927   1.00 0.00 ? 11 GLU A HB3  4  
ATOM   2417  H HG2  . GLU A 1 11 ? -3.013  -7.022  2.496   1.00 0.00 ? 11 GLU A HG2  4  
ATOM   2418  H HG3  . GLU A 1 11 ? -2.066  -6.426  1.143   1.00 0.00 ? 11 GLU A HG3  4  
ATOM   2419  N N    . TYR A 1 12 ? -1.360  -3.321  3.455   1.00 0.00 ? 12 TYR A N    4  
ATOM   2420  C CA   . TYR A 1 12 ? -1.473  -2.195  4.390   1.00 0.00 ? 12 TYR A CA   4  
ATOM   2421  C C    . TYR A 1 12 ? -2.633  -2.377  5.359   1.00 0.00 ? 12 TYR A C    4  
ATOM   2422  O O    . TYR A 1 12 ? -3.774  -2.593  4.952   1.00 0.00 ? 12 TYR A O    4  
ATOM   2423  C CB   . TYR A 1 12 ? -1.580  -0.860  3.634   1.00 0.00 ? 12 TYR A CB   4  
ATOM   2424  C CG   . TYR A 1 12 ? -2.990  -0.405  3.318   1.00 0.00 ? 12 TYR A CG   4  
ATOM   2425  C CD1  . TYR A 1 12 ? -3.761  0.245   4.272   1.00 0.00 ? 12 TYR A CD1  4  
ATOM   2426  C CD2  . TYR A 1 12 ? -3.542  -0.614  2.062   1.00 0.00 ? 12 TYR A CD2  4  
ATOM   2427  C CE1  . TYR A 1 12 ? -5.044  0.670   3.984   1.00 0.00 ? 12 TYR A CE1  4  
ATOM   2428  C CE2  . TYR A 1 12 ? -4.823  -0.192  1.765   1.00 0.00 ? 12 TYR A CE2  4  
ATOM   2429  C CZ   . TYR A 1 12 ? -5.570  0.448   2.729   1.00 0.00 ? 12 TYR A CZ   4  
ATOM   2430  O OH   . TYR A 1 12 ? -6.847  0.871   2.436   1.00 0.00 ? 12 TYR A OH   4  
ATOM   2431  H H    . TYR A 1 12 ? -2.067  -3.467  2.762   1.00 0.00 ? 12 TYR A H    4  
ATOM   2432  H HA   . TYR A 1 12 ? -0.558  -2.175  4.971   1.00 0.00 ? 12 TYR A HA   4  
ATOM   2433  H HB2  . TYR A 1 12 ? -1.120  -0.091  4.234   1.00 0.00 ? 12 TYR A HB2  4  
ATOM   2434  H HB3  . TYR A 1 12 ? -1.043  -0.944  2.701   1.00 0.00 ? 12 TYR A HB3  4  
ATOM   2435  H HD1  . TYR A 1 12 ? -3.347  0.415   5.254   1.00 0.00 ? 12 TYR A HD1  4  
ATOM   2436  H HD2  . TYR A 1 12 ? -2.952  -1.112  1.307   1.00 0.00 ? 12 TYR A HD2  4  
ATOM   2437  H HE1  . TYR A 1 12 ? -5.627  1.175   4.739   1.00 0.00 ? 12 TYR A HE1  4  
ATOM   2438  H HE2  . TYR A 1 12 ? -5.235  -0.367  0.782   1.00 0.00 ? 12 TYR A HE2  4  
ATOM   2439  H HH   . TYR A 1 12 ? -7.483  0.274   2.838   1.00 0.00 ? 12 TYR A HH   4  
ATOM   2440  N N    . PHE A 1 13 ? -2.317  -2.297  6.648   1.00 0.00 ? 13 PHE A N    4  
ATOM   2441  C CA   . PHE A 1 13 ? -3.305  -2.468  7.711   1.00 0.00 ? 13 PHE A CA   4  
ATOM   2442  C C    . PHE A 1 13 ? -4.194  -1.245  7.874   1.00 0.00 ? 13 PHE A C    4  
ATOM   2443  O O    . PHE A 1 13 ? -3.818  -0.278  8.535   1.00 0.00 ? 13 PHE A O    4  
ATOM   2444  C CB   . PHE A 1 13 ? -2.603  -2.752  9.040   1.00 0.00 ? 13 PHE A CB   4  
ATOM   2445  C CG   . PHE A 1 13 ? -3.516  -3.292  10.102  1.00 0.00 ? 13 PHE A CG   4  
ATOM   2446  C CD1  . PHE A 1 13 ? -4.253  -4.445  9.881   1.00 0.00 ? 13 PHE A CD1  4  
ATOM   2447  C CD2  . PHE A 1 13 ? -3.642  -2.643  11.319  1.00 0.00 ? 13 PHE A CD2  4  
ATOM   2448  C CE1  . PHE A 1 13 ? -5.098  -4.941  10.856  1.00 0.00 ? 13 PHE A CE1  4  
ATOM   2449  C CE2  . PHE A 1 13 ? -4.487  -3.134  12.297  1.00 0.00 ? 13 PHE A CE2  4  
ATOM   2450  C CZ   . PHE A 1 13 ? -5.215  -4.284  12.065  1.00 0.00 ? 13 PHE A CZ   4  
ATOM   2451  H H    . PHE A 1 13 ? -1.383  -2.126  6.891   1.00 0.00 ? 13 PHE A H    4  
ATOM   2452  H HA   . PHE A 1 13 ? -3.926  -3.319  7.458   1.00 0.00 ? 13 PHE A HA   4  
ATOM   2453  H HB2  . PHE A 1 13 ? -1.823  -3.473  8.879   1.00 0.00 ? 13 PHE A HB2  4  
ATOM   2454  H HB3  . PHE A 1 13 ? -2.168  -1.836  9.410   1.00 0.00 ? 13 PHE A HB3  4  
ATOM   2455  H HD1  . PHE A 1 13 ? -4.161  -4.958  8.936   1.00 0.00 ? 13 PHE A HD1  4  
ATOM   2456  H HD2  . PHE A 1 13 ? -3.071  -1.744  11.502  1.00 0.00 ? 13 PHE A HD2  4  
ATOM   2457  H HE1  . PHE A 1 13 ? -5.666  -5.840  10.671  1.00 0.00 ? 13 PHE A HE1  4  
ATOM   2458  H HE2  . PHE A 1 13 ? -4.576  -2.619  13.242  1.00 0.00 ? 13 PHE A HE2  4  
ATOM   2459  H HZ   . PHE A 1 13 ? -5.875  -4.669  12.828  1.00 0.00 ? 13 PHE A HZ   4  
ATOM   2460  N N    . ASP A 1 14 ? -5.389  -1.311  7.309   1.00 0.00 ? 14 ASP A N    4  
ATOM   2461  C CA   . ASP A 1 14 ? -6.345  -0.217  7.432   1.00 0.00 ? 14 ASP A CA   4  
ATOM   2462  C C    . ASP A 1 14 ? -7.022  -0.279  8.790   1.00 0.00 ? 14 ASP A C    4  
ATOM   2463  O O    . ASP A 1 14 ? -7.918  -1.089  9.005   1.00 0.00 ? 14 ASP A O    4  
ATOM   2464  C CB   . ASP A 1 14 ? -7.396  -0.287  6.325   1.00 0.00 ? 14 ASP A CB   4  
ATOM   2465  C CG   . ASP A 1 14 ? -7.837  1.087   5.860   1.00 0.00 ? 14 ASP A CG   4  
ATOM   2466  O OD1  . ASP A 1 14 ? -8.146  1.935   6.723   1.00 0.00 ? 14 ASP A OD1  4  
ATOM   2467  O OD2  . ASP A 1 14 ? -7.872  1.315   4.633   1.00 0.00 ? 14 ASP A OD2  4  
ATOM   2468  H H    . ASP A 1 14 ? -5.643  -2.127  6.819   1.00 0.00 ? 14 ASP A H    4  
ATOM   2469  H HA   . ASP A 1 14 ? -5.812  0.718   7.355   1.00 0.00 ? 14 ASP A HA   4  
ATOM   2470  H HB2  . ASP A 1 14 ? -6.986  -0.819  5.482   1.00 0.00 ? 14 ASP A HB2  4  
ATOM   2471  H HB3  . ASP A 1 14 ? -8.262  -0.816  6.695   1.00 0.00 ? 14 ASP A HB3  4  
ATOM   2472  N N    . SER A 1 15 ? -6.587  0.574   9.710   1.00 0.00 ? 15 SER A N    4  
ATOM   2473  C CA   . SER A 1 15 ? -7.159  0.604   11.049  1.00 0.00 ? 15 SER A CA   4  
ATOM   2474  C C    . SER A 1 15 ? -8.682  0.667   10.992  1.00 0.00 ? 15 SER A C    4  
ATOM   2475  O O    . SER A 1 15 ? -9.363  0.290   11.946  1.00 0.00 ? 15 SER A O    4  
ATOM   2476  C CB   . SER A 1 15 ? -6.613  1.795   11.838  1.00 0.00 ? 15 SER A CB   4  
ATOM   2477  O OG   . SER A 1 15 ? -6.837  3.011   11.148  1.00 0.00 ? 15 SER A OG   4  
ATOM   2478  H H    . SER A 1 15 ? -5.865  1.195   9.484   1.00 0.00 ? 15 SER A H    4  
ATOM   2479  H HA   . SER A 1 15 ? -6.872  -0.309  11.545  1.00 0.00 ? 15 SER A HA   4  
ATOM   2480  H HB2  . SER A 1 15 ? -7.106  1.844   12.798  1.00 0.00 ? 15 SER A HB2  4  
ATOM   2481  H HB3  . SER A 1 15 ? -5.550  1.669   11.986  1.00 0.00 ? 15 SER A HB3  4  
ATOM   2482  H HG   . SER A 1 15 ? -7.736  3.027   10.811  1.00 0.00 ? 15 SER A HG   4  
ATOM   2483  N N    . LEU A 1 16 ? -9.212  1.133   9.866   1.00 0.00 ? 16 LEU A N    4  
ATOM   2484  C CA   . LEU A 1 16 ? -10.655 1.226   9.693   1.00 0.00 ? 16 LEU A CA   4  
ATOM   2485  C C    . LEU A 1 16 ? -11.231 -0.120  9.268   1.00 0.00 ? 16 LEU A C    4  
ATOM   2486  O O    . LEU A 1 16 ? -12.388 -0.430  9.552   1.00 0.00 ? 16 LEU A O    4  
ATOM   2487  C CB   . LEU A 1 16 ? -11.002 2.296   8.655   1.00 0.00 ? 16 LEU A CB   4  
ATOM   2488  C CG   . LEU A 1 16 ? -12.497 2.571   8.486   1.00 0.00 ? 16 LEU A CG   4  
ATOM   2489  C CD1  . LEU A 1 16 ? -12.743 4.045   8.199   1.00 0.00 ? 16 LEU A CD1  4  
ATOM   2490  C CD2  . LEU A 1 16 ? -13.075 1.704   7.378   1.00 0.00 ? 16 LEU A CD2  4  
ATOM   2491  H H    . LEU A 1 16 ? -8.619  1.412   9.132   1.00 0.00 ? 16 LEU A H    4  
ATOM   2492  H HA   . LEU A 1 16 ? -11.084 1.505   10.643  1.00 0.00 ? 16 LEU A HA   4  
ATOM   2493  H HB2  . LEU A 1 16 ? -10.516 3.217   8.942   1.00 0.00 ? 16 LEU A HB2  4  
ATOM   2494  H HB3  . LEU A 1 16 ? -10.607 1.983   7.701   1.00 0.00 ? 16 LEU A HB3  4  
ATOM   2495  H HG   . LEU A 1 16 ? -13.007 2.323   9.406   1.00 0.00 ? 16 LEU A HG   4  
ATOM   2496  H HD11 . LEU A 1 16 ? -12.967 4.174   7.150   1.00 0.00 ? 16 LEU A HD11 4  
ATOM   2497  H HD12 . LEU A 1 16 ? -11.861 4.613   8.451   1.00 0.00 ? 16 LEU A HD12 4  
ATOM   2498  H HD13 . LEU A 1 16 ? -13.578 4.392   8.790   1.00 0.00 ? 16 LEU A HD13 4  
ATOM   2499  H HD21 . LEU A 1 16 ? -14.037 2.096   7.078   1.00 0.00 ? 16 LEU A HD21 4  
ATOM   2500  H HD22 . LEU A 1 16 ? -13.196 0.692   7.737   1.00 0.00 ? 16 LEU A HD22 4  
ATOM   2501  H HD23 . LEU A 1 16 ? -12.404 1.708   6.531   1.00 0.00 ? 16 LEU A HD23 4  
ATOM   2502  N N    . LEU A 1 17 ? -10.416 -0.915  8.580   1.00 0.00 ? 17 LEU A N    4  
ATOM   2503  C CA   . LEU A 1 17 ? -10.835 -2.225  8.104   1.00 0.00 ? 17 LEU A CA   4  
ATOM   2504  C C    . LEU A 1 17 ? -10.309 -3.345  9.001   1.00 0.00 ? 17 LEU A C    4  
ATOM   2505  O O    . LEU A 1 17 ? -10.855 -4.449  9.005   1.00 0.00 ? 17 LEU A O    4  
ATOM   2506  C CB   . LEU A 1 17 ? -10.336 -2.435  6.677   1.00 0.00 ? 17 LEU A CB   4  
ATOM   2507  C CG   . LEU A 1 17 ? -10.772 -1.365  5.677   1.00 0.00 ? 17 LEU A CG   4  
ATOM   2508  C CD1  . LEU A 1 17 ? -9.894  -1.404  4.436   1.00 0.00 ? 17 LEU A CD1  4  
ATOM   2509  C CD2  . LEU A 1 17 ? -12.235 -1.550  5.303   1.00 0.00 ? 17 LEU A CD2  4  
ATOM   2510  H H    . LEU A 1 17 ? -9.507  -0.609  8.378   1.00 0.00 ? 17 LEU A H    4  
ATOM   2511  H HA   . LEU A 1 17 ? -11.914 -2.253  8.105   1.00 0.00 ? 17 LEU A HA   4  
ATOM   2512  H HB2  . LEU A 1 17 ? -9.256  -2.458  6.701   1.00 0.00 ? 17 LEU A HB2  4  
ATOM   2513  H HB3  . LEU A 1 17 ? -10.694 -3.392  6.328   1.00 0.00 ? 17 LEU A HB3  4  
ATOM   2514  H HG   . LEU A 1 17 ? -10.662 -0.391  6.133   1.00 0.00 ? 17 LEU A HG   4  
ATOM   2515  H HD11 . LEU A 1 17 ? -9.875  -0.427  3.977   1.00 0.00 ? 17 LEU A HD11 4  
ATOM   2516  H HD12 . LEU A 1 17 ? -10.293 -2.123  3.736   1.00 0.00 ? 17 LEU A HD12 4  
ATOM   2517  H HD13 . LEU A 1 17 ? -8.891  -1.690  4.714   1.00 0.00 ? 17 LEU A HD13 4  
ATOM   2518  H HD21 . LEU A 1 17 ? -12.488 -2.599  5.344   1.00 0.00 ? 17 LEU A HD21 4  
ATOM   2519  H HD22 . LEU A 1 17 ? -12.402 -1.177  4.303   1.00 0.00 ? 17 LEU A HD22 4  
ATOM   2520  H HD23 . LEU A 1 17 ? -12.856 -1.003  5.999   1.00 0.00 ? 17 LEU A HD23 4  
ATOM   2521  N N    . HIS A 1 18 ? -9.240  -3.069  9.749   1.00 0.00 ? 18 HIS A N    4  
ATOM   2522  C CA   . HIS A 1 18 ? -8.651  -4.074  10.626  1.00 0.00 ? 18 HIS A CA   4  
ATOM   2523  C C    . HIS A 1 18 ? -8.155  -5.257  9.808   1.00 0.00 ? 18 HIS A C    4  
ATOM   2524  O O    . HIS A 1 18 ? -8.434  -6.415  10.121  1.00 0.00 ? 18 HIS A O    4  
ATOM   2525  C CB   . HIS A 1 18 ? -9.677  -4.551  11.646  1.00 0.00 ? 18 HIS A CB   4  
ATOM   2526  C CG   . HIS A 1 18 ? -9.645  -3.793  12.937  1.00 0.00 ? 18 HIS A CG   4  
ATOM   2527  N ND1  . HIS A 1 18 ? -8.474  -3.428  13.567  1.00 0.00 ? 18 HIS A ND1  4  
ATOM   2528  C CD2  . HIS A 1 18 ? -10.651 -3.331  13.717  1.00 0.00 ? 18 HIS A CD2  4  
ATOM   2529  C CE1  . HIS A 1 18 ? -8.760  -2.777  14.681  1.00 0.00 ? 18 HIS A CE1  4  
ATOM   2530  N NE2  . HIS A 1 18 ? -10.074 -2.704  14.794  1.00 0.00 ? 18 HIS A NE2  4  
ATOM   2531  H H    . HIS A 1 18 ? -8.833  -2.178  9.702   1.00 0.00 ? 18 HIS A H    4  
ATOM   2532  H HA   . HIS A 1 18 ? -7.817  -3.624  11.142  1.00 0.00 ? 18 HIS A HA   4  
ATOM   2533  H HB2  . HIS A 1 18 ? -10.661 -4.448  11.222  1.00 0.00 ? 18 HIS A HB2  4  
ATOM   2534  H HB3  . HIS A 1 18 ? -9.490  -5.590  11.864  1.00 0.00 ? 18 HIS A HB3  4  
ATOM   2535  H HD1  . HIS A 1 18 ? -7.568  -3.618  13.247  1.00 0.00 ? 18 HIS A HD1  4  
ATOM   2536  H HD2  . HIS A 1 18 ? -11.709 -3.437  13.528  1.00 0.00 ? 18 HIS A HD2  4  
ATOM   2537  H HE1  . HIS A 1 18 ? -8.043  -2.373  15.379  1.00 0.00 ? 18 HIS A HE1  4  
ATOM   2538  H HE2  . HIS A 1 18 ? -10.555 -2.360  15.576  1.00 0.00 ? 18 HIS A HE2  4  
ATOM   2539  N N    . ALA A 1 19 ? -7.425  -4.950  8.749   1.00 0.00 ? 19 ALA A N    4  
ATOM   2540  C CA   . ALA A 1 19 ? -6.893  -5.964  7.866   1.00 0.00 ? 19 ALA A CA   4  
ATOM   2541  C C    . ALA A 1 19 ? -5.833  -5.393  6.950   1.00 0.00 ? 19 ALA A C    4  
ATOM   2542  O O    . ALA A 1 19 ? -6.068  -4.413  6.243   1.00 0.00 ? 19 ALA A O    4  
ATOM   2543  C CB   . ALA A 1 19 ? -7.996  -6.560  7.013   1.00 0.00 ? 19 ALA A CB   4  
ATOM   2544  H H    . ALA A 1 19 ? -7.246  -4.017  8.555   1.00 0.00 ? 19 ALA A H    4  
ATOM   2545  H HA   . ALA A 1 19 ? -6.464  -6.752  8.466   1.00 0.00 ? 19 ALA A HA   4  
ATOM   2546  H HB1  . ALA A 1 19 ? -8.950  -6.167  7.329   1.00 0.00 ? 19 ALA A HB1  4  
ATOM   2547  H HB2  . ALA A 1 19 ? -7.993  -7.634  7.116   1.00 0.00 ? 19 ALA A HB2  4  
ATOM   2548  H HB3  . ALA A 1 19 ? -7.821  -6.294  5.975   1.00 0.00 ? 19 ALA A HB3  4  
ATOM   2549  N N    . CYS A 1 20 ? -4.683  -6.028  6.939   1.00 0.00 ? 20 CYS A N    4  
ATOM   2550  C CA   . CYS A 1 20 ? -3.616  -5.600  6.062   1.00 0.00 ? 20 CYS A CA   4  
ATOM   2551  C C    . CYS A 1 20 ? -4.028  -5.890  4.624   1.00 0.00 ? 20 CYS A C    4  
ATOM   2552  O O    . CYS A 1 20 ? -4.100  -7.044  4.204   1.00 0.00 ? 20 CYS A O    4  
ATOM   2553  C CB   . CYS A 1 20 ? -2.297  -6.296  6.400   1.00 0.00 ? 20 CYS A CB   4  
ATOM   2554  S SG   . CYS A 1 20 ? -1.858  -6.250  8.167   1.00 0.00 ? 20 CYS A SG   4  
ATOM   2555  H H    . CYS A 1 20 ? -4.567  -6.809  7.509   1.00 0.00 ? 20 CYS A H    4  
ATOM   2556  H HA   . CYS A 1 20 ? -3.511  -4.536  6.182   1.00 0.00 ? 20 CYS A HA   4  
ATOM   2557  H HB2  . CYS A 1 20 ? -2.358  -7.331  6.103   1.00 0.00 ? 20 CYS A HB2  4  
ATOM   2558  H HB3  . CYS A 1 20 ? -1.499  -5.817  5.850   1.00 0.00 ? 20 CYS A HB3  4  
ATOM   2559  N N    . ILE A 1 21 ? -4.354  -4.828  3.905   1.00 0.00 ? 21 ILE A N    4  
ATOM   2560  C CA   . ILE A 1 21 ? -4.828  -4.921  2.527   1.00 0.00 ? 21 ILE A CA   4  
ATOM   2561  C C    . ILE A 1 21 ? -3.855  -4.291  1.538   1.00 0.00 ? 21 ILE A C    4  
ATOM   2562  O O    . ILE A 1 21 ? -3.245  -3.266  1.827   1.00 0.00 ? 21 ILE A O    4  
ATOM   2563  C CB   . ILE A 1 21 ? -6.168  -4.189  2.411   1.00 0.00 ? 21 ILE A CB   4  
ATOM   2564  C CG1  . ILE A 1 21 ? -7.196  -4.823  3.350   1.00 0.00 ? 21 ILE A CG1  4  
ATOM   2565  C CG2  . ILE A 1 21 ? -6.689  -4.177  0.976   1.00 0.00 ? 21 ILE A CG2  4  
ATOM   2566  C CD1  . ILE A 1 21 ? -8.384  -3.935  3.646   1.00 0.00 ? 21 ILE A CD1  4  
ATOM   2567  H H    . ILE A 1 21 ? -4.315  -3.951  4.330   1.00 0.00 ? 21 ILE A H    4  
ATOM   2568  H HA   . ILE A 1 21 ? -4.978  -5.960  2.282   1.00 0.00 ? 21 ILE A HA   4  
ATOM   2569  H HB   . ILE A 1 21 ? -5.987  -3.169  2.715   1.00 0.00 ? 21 ILE A HB   4  
ATOM   2570  H HG12 . ILE A 1 21 ? -7.569  -5.731  2.902   1.00 0.00 ? 21 ILE A HG12 4  
ATOM   2571  H HG13 . ILE A 1 21 ? -6.717  -5.061  4.287   1.00 0.00 ? 21 ILE A HG13 4  
ATOM   2572  H HG21 . ILE A 1 21 ? -5.874  -3.994  0.293   1.00 0.00 ? 21 ILE A HG21 4  
ATOM   2573  H HG22 . ILE A 1 21 ? -7.427  -3.396  0.870   1.00 0.00 ? 21 ILE A HG22 4  
ATOM   2574  H HG23 . ILE A 1 21 ? -7.143  -5.130  0.750   1.00 0.00 ? 21 ILE A HG23 4  
ATOM   2575  H HD11 . ILE A 1 21 ? -8.492  -3.826  4.716   1.00 0.00 ? 21 ILE A HD11 4  
ATOM   2576  H HD12 . ILE A 1 21 ? -9.278  -4.384  3.237   1.00 0.00 ? 21 ILE A HD12 4  
ATOM   2577  H HD13 . ILE A 1 21 ? -8.231  -2.966  3.196   1.00 0.00 ? 21 ILE A HD13 4  
ATOM   2578  N N    . PRO A 1 22 ? -3.719  -4.881  0.341   1.00 0.00 ? 22 PRO A N    4  
ATOM   2579  C CA   . PRO A 1 22 ? -2.832  -4.362  -0.701  1.00 0.00 ? 22 PRO A CA   4  
ATOM   2580  C C    . PRO A 1 22 ? -2.958  -2.851  -0.895  1.00 0.00 ? 22 PRO A C    4  
ATOM   2581  O O    . PRO A 1 22 ? -3.885  -2.224  -0.386  1.00 0.00 ? 22 PRO A O    4  
ATOM   2582  C CB   . PRO A 1 22 ? -3.274  -5.117  -1.971  1.00 0.00 ? 22 PRO A CB   4  
ATOM   2583  C CG   . PRO A 1 22 ? -4.514  -5.862  -1.590  1.00 0.00 ? 22 PRO A CG   4  
ATOM   2584  C CD   . PRO A 1 22 ? -4.415  -6.092  -0.109  1.00 0.00 ? 22 PRO A CD   4  
ATOM   2585  H HA   . PRO A 1 22 ? -1.809  -4.594  -0.480  1.00 0.00 ? 22 PRO A HA   4  
ATOM   2586  H HB2  . PRO A 1 22 ? -3.473  -4.411  -2.763  1.00 0.00 ? 22 PRO A HB2  4  
ATOM   2587  H HB3  . PRO A 1 22 ? -2.491  -5.795  -2.280  1.00 0.00 ? 22 PRO A HB3  4  
ATOM   2588  H HG2  . PRO A 1 22 ? -5.385  -5.264  -1.823  1.00 0.00 ? 22 PRO A HG2  4  
ATOM   2589  H HG3  . PRO A 1 22 ? -4.554  -6.804  -2.119  1.00 0.00 ? 22 PRO A HG3  4  
ATOM   2590  H HD2  . PRO A 1 22 ? -5.394  -6.172  0.338   1.00 0.00 ? 22 PRO A HD2  4  
ATOM   2591  H HD3  . PRO A 1 22 ? -3.827  -6.974  0.104   1.00 0.00 ? 22 PRO A HD3  4  
ATOM   2592  N N    . CYS A 1 23 ? -2.003  -2.279  -1.629  1.00 0.00 ? 23 CYS A N    4  
ATOM   2593  C CA   . CYS A 1 23 ? -1.988  -0.834  -1.891  1.00 0.00 ? 23 CYS A CA   4  
ATOM   2594  C C    . CYS A 1 23 ? -1.499  -0.527  -3.310  1.00 0.00 ? 23 CYS A C    4  
ATOM   2595  O O    . CYS A 1 23 ? -1.747  0.557   -3.836  1.00 0.00 ? 23 CYS A O    4  
ATOM   2596  C CB   . CYS A 1 23 ? -1.089  -0.116  -0.872  1.00 0.00 ? 23 CYS A CB   4  
ATOM   2597  S SG   . CYS A 1 23 ? -1.912  1.222   0.050   1.00 0.00 ? 23 CYS A SG   4  
ATOM   2598  H H    . CYS A 1 23 ? -1.288  -2.841  -2.000  1.00 0.00 ? 23 CYS A H    4  
ATOM   2599  H HA   . CYS A 1 23 ? -2.999  -0.464  -1.789  1.00 0.00 ? 23 CYS A HA   4  
ATOM   2600  H HB2  . CYS A 1 23 ? -0.729  -0.830  -0.146  1.00 0.00 ? 23 CYS A HB2  4  
ATOM   2601  H HB3  . CYS A 1 23 ? -0.244  0.316   -1.391  1.00 0.00 ? 23 CYS A HB3  4  
ATOM   2602  N N    . GLN A 1 24 ? -0.792  -1.479  -3.916  1.00 0.00 ? 24 GLN A N    4  
ATOM   2603  C CA   . GLN A 1 24 ? -0.251  -1.307  -5.269  1.00 0.00 ? 24 GLN A CA   4  
ATOM   2604  C C    . GLN A 1 24 ? -1.271  -0.692  -6.219  1.00 0.00 ? 24 GLN A C    4  
ATOM   2605  O O    . GLN A 1 24 ? -1.038  0.362   -6.807  1.00 0.00 ? 24 GLN A O    4  
ATOM   2606  C CB   . GLN A 1 24 ? 0.232   -2.649  -5.843  1.00 0.00 ? 24 GLN A CB   4  
ATOM   2607  C CG   . GLN A 1 24 ? 0.673   -3.657  -4.793  1.00 0.00 ? 24 GLN A CG   4  
ATOM   2608  C CD   . GLN A 1 24 ? 1.479   -4.798  -5.382  1.00 0.00 ? 24 GLN A CD   4  
ATOM   2609  O OE1  . GLN A 1 24 ? 1.199   -5.266  -6.485  1.00 0.00 ? 24 GLN A OE1  4  
ATOM   2610  N NE2  . GLN A 1 24 ? 2.488   -5.252  -4.645  1.00 0.00 ? 24 GLN A NE2  4  
ATOM   2611  H H    . GLN A 1 24 ? -0.618  -2.311  -3.440  1.00 0.00 ? 24 GLN A H    4  
ATOM   2612  H HA   . GLN A 1 24 ? 0.583   -0.645  -5.202  1.00 0.00 ? 24 GLN A HA   4  
ATOM   2613  H HB2  . GLN A 1 24 ? -0.570  -3.090  -6.414  1.00 0.00 ? 24 GLN A HB2  4  
ATOM   2614  H HB3  . GLN A 1 24 ? 1.067   -2.461  -6.502  1.00 0.00 ? 24 GLN A HB3  4  
ATOM   2615  H HG2  . GLN A 1 24 ? 1.281   -3.149  -4.058  1.00 0.00 ? 24 GLN A HG2  4  
ATOM   2616  H HG3  . GLN A 1 24 ? -0.205  -4.064  -4.315  1.00 0.00 ? 24 GLN A HG3  4  
ATOM   2617  H HE21 . GLN A 1 24 ? 2.651   -4.832  -3.776  1.00 0.00 ? 24 GLN A HE21 4  
ATOM   2618  H HE22 . GLN A 1 24 ? 3.025   -5.990  -5.002  1.00 0.00 ? 24 GLN A HE22 4  
ATOM   2619  N N    . LEU A 1 25 ? -2.388  -1.376  -6.370  1.00 0.00 ? 25 LEU A N    4  
ATOM   2620  C CA   . LEU A 1 25 ? -3.457  -0.932  -7.260  1.00 0.00 ? 25 LEU A CA   4  
ATOM   2621  C C    . LEU A 1 25 ? -4.014  0.436   -6.866  1.00 0.00 ? 25 LEU A C    4  
ATOM   2622  O O    . LEU A 1 25 ? -4.728  1.069   -7.644  1.00 0.00 ? 25 LEU A O    4  
ATOM   2623  C CB   . LEU A 1 25 ? -4.590  -1.959  -7.279  1.00 0.00 ? 25 LEU A CB   4  
ATOM   2624  C CG   . LEU A 1 25 ? -4.977  -2.531  -5.910  1.00 0.00 ? 25 LEU A CG   4  
ATOM   2625  C CD1  . LEU A 1 25 ? -6.387  -2.102  -5.530  1.00 0.00 ? 25 LEU A CD1  4  
ATOM   2626  C CD2  . LEU A 1 25 ? -4.867  -4.049  -5.913  1.00 0.00 ? 25 LEU A CD2  4  
ATOM   2627  H H    . LEU A 1 25 ? -2.490  -2.212  -5.879  1.00 0.00 ? 25 LEU A H    4  
ATOM   2628  H HA   . LEU A 1 25 ? -3.043  -0.861  -8.252  1.00 0.00 ? 25 LEU A HA   4  
ATOM   2629  H HB2  . LEU A 1 25 ? -5.461  -1.487  -7.708  1.00 0.00 ? 25 LEU A HB2  4  
ATOM   2630  H HB3  . LEU A 1 25 ? -4.294  -2.777  -7.917  1.00 0.00 ? 25 LEU A HB3  4  
ATOM   2631  H HG   . LEU A 1 25 ? -4.301  -2.147  -5.162  1.00 0.00 ? 25 LEU A HG   4  
ATOM   2632  H HD11 . LEU A 1 25 ? -6.437  -1.935  -4.464  1.00 0.00 ? 25 LEU A HD11 4  
ATOM   2633  H HD12 . LEU A 1 25 ? -7.086  -2.877  -5.807  1.00 0.00 ? 25 LEU A HD12 4  
ATOM   2634  H HD13 . LEU A 1 25 ? -6.638  -1.189  -6.050  1.00 0.00 ? 25 LEU A HD13 4  
ATOM   2635  H HD21 . LEU A 1 25 ? -4.468  -4.383  -4.967  1.00 0.00 ? 25 LEU A HD21 4  
ATOM   2636  H HD22 . LEU A 1 25 ? -4.211  -4.362  -6.712  1.00 0.00 ? 25 LEU A HD22 4  
ATOM   2637  H HD23 . LEU A 1 25 ? -5.845  -4.481  -6.063  1.00 0.00 ? 25 LEU A HD23 4  
ATOM   2638  N N    . ARG A 1 26 ? -3.706  0.883   -5.655  1.00 0.00 ? 26 ARG A N    4  
ATOM   2639  C CA   . ARG A 1 26 ? -4.200  2.170   -5.167  1.00 0.00 ? 26 ARG A CA   4  
ATOM   2640  C C    . ARG A 1 26 ? -3.070  3.153   -4.877  1.00 0.00 ? 26 ARG A C    4  
ATOM   2641  O O    . ARG A 1 26 ? -3.306  4.259   -4.391  1.00 0.00 ? 26 ARG A O    4  
ATOM   2642  C CB   . ARG A 1 26 ? -5.022  1.964   -3.902  1.00 0.00 ? 26 ARG A CB   4  
ATOM   2643  C CG   . ARG A 1 26 ? -5.986  0.790   -3.976  1.00 0.00 ? 26 ARG A CG   4  
ATOM   2644  C CD   . ARG A 1 26 ? -7.421  1.256   -4.160  1.00 0.00 ? 26 ARG A CD   4  
ATOM   2645  N NE   . ARG A 1 26 ? -7.707  1.578   -5.557  1.00 0.00 ? 26 ARG A NE   4  
ATOM   2646  C CZ   . ARG A 1 26 ? -8.726  2.342   -5.948  1.00 0.00 ? 26 ARG A CZ   4  
ATOM   2647  N NH1  . ARG A 1 26 ? -9.554  2.864   -5.052  1.00 0.00 ? 26 ARG A NH1  4  
ATOM   2648  N NH2  . ARG A 1 26 ? -8.915  2.584   -7.237  1.00 0.00 ? 26 ARG A NH2  4  
ATOM   2649  H H    . ARG A 1 26 ? -3.149  0.333   -5.074  1.00 0.00 ? 26 ARG A H    4  
ATOM   2650  H HA   . ARG A 1 26 ? -4.824  2.583   -5.930  1.00 0.00 ? 26 ARG A HA   4  
ATOM   2651  H HB2  . ARG A 1 26 ? -4.343  1.797   -3.080  1.00 0.00 ? 26 ARG A HB2  4  
ATOM   2652  H HB3  . ARG A 1 26 ? -5.592  2.857   -3.709  1.00 0.00 ? 26 ARG A HB3  4  
ATOM   2653  H HG2  . ARG A 1 26 ? -5.713  0.164   -4.810  1.00 0.00 ? 26 ARG A HG2  4  
ATOM   2654  H HG3  . ARG A 1 26 ? -5.916  0.222   -3.059  1.00 0.00 ? 26 ARG A HG3  4  
ATOM   2655  H HD2  . ARG A 1 26 ? -8.081  0.469   -3.826  1.00 0.00 ? 26 ARG A HD2  4  
ATOM   2656  H HD3  . ARG A 1 26 ? -7.577  2.132   -3.548  1.00 0.00 ? 26 ARG A HD3  4  
ATOM   2657  H HE   . ARG A 1 26 ? -7.110  1.205   -6.238  1.00 0.00 ? 26 ARG A HE   4  
ATOM   2658  H HH11 . ARG A 1 26 ? -9.418  2.686   -4.078  1.00 0.00 ? 26 ARG A HH11 4  
ATOM   2659  H HH12 . ARG A 1 26 ? -10.317 3.438   -5.353  1.00 0.00 ? 26 ARG A HH12 4  
ATOM   2660  H HH21 . ARG A 1 26 ? -8.292  2.193   -7.916  1.00 0.00 ? 26 ARG A HH21 4  
ATOM   2661  H HH22 . ARG A 1 26 ? -9.679  3.157   -7.531  1.00 0.00 ? 26 ARG A HH22 4  
ATOM   2662  N N    . CYS A 1 27 ? -1.855  2.721   -5.151  1.00 0.00 ? 27 CYS A N    4  
ATOM   2663  C CA   . CYS A 1 27 ? -0.647  3.522   -4.911  1.00 0.00 ? 27 CYS A CA   4  
ATOM   2664  C C    . CYS A 1 27 ? -0.857  5.028   -5.126  1.00 0.00 ? 27 CYS A C    4  
ATOM   2665  O O    . CYS A 1 27 ? -1.369  5.712   -4.245  1.00 0.00 ? 27 CYS A O    4  
ATOM   2666  C CB   . CYS A 1 27 ? 0.516   3.015   -5.771  1.00 0.00 ? 27 CYS A CB   4  
ATOM   2667  S SG   . CYS A 1 27 ? 1.500   1.714   -4.965  1.00 0.00 ? 27 CYS A SG   4  
ATOM   2668  H H    . CYS A 1 27 ? -1.764  1.817   -5.507  1.00 0.00 ? 27 CYS A H    4  
ATOM   2669  H HA   . CYS A 1 27 ? -0.375  3.382   -3.877  1.00 0.00 ? 27 CYS A HA   4  
ATOM   2670  H HB2  . CYS A 1 27 ? 0.134   2.617   -6.698  1.00 0.00 ? 27 CYS A HB2  4  
ATOM   2671  H HB3  . CYS A 1 27 ? 1.180   3.840   -5.985  1.00 0.00 ? 27 CYS A HB3  4  
ATOM   2672  N N    . SER A 1 28 ? -0.421  5.551   -6.272  1.00 0.00 ? 28 SER A N    4  
ATOM   2673  C CA   . SER A 1 28 ? -0.518  6.962   -6.552  1.00 0.00 ? 28 SER A CA   4  
ATOM   2674  C C    . SER A 1 28 ? -1.744  7.322   -7.376  1.00 0.00 ? 28 SER A C    4  
ATOM   2675  O O    . SER A 1 28 ? -1.724  8.302   -8.122  1.00 0.00 ? 28 SER A O    4  
ATOM   2676  C CB   . SER A 1 28 ? 0.748   7.442   -7.267  1.00 0.00 ? 28 SER A CB   4  
ATOM   2677  O OG   . SER A 1 28 ? 1.284   8.593   -6.638  1.00 0.00 ? 28 SER A OG   4  
ATOM   2678  H H    . SER A 1 28 ? -0.004  4.990   -6.920  1.00 0.00 ? 28 SER A H    4  
ATOM   2679  H HA   . SER A 1 28 ? -0.577  7.448   -5.612  1.00 0.00 ? 28 SER A HA   4  
ATOM   2680  H HB2  . SER A 1 28 ? 1.491   6.657   -7.245  1.00 0.00 ? 28 SER A HB2  4  
ATOM   2681  H HB3  . SER A 1 28 ? 0.511   7.685   -8.292  1.00 0.00 ? 28 SER A HB3  4  
ATOM   2682  H HG   . SER A 1 28 ? 1.984   8.332   -6.035  1.00 0.00 ? 28 SER A HG   4  
ATOM   2683  N N    . SER A 1 29 ? -2.812  6.550   -7.246  1.00 0.00 ? 29 SER A N    4  
ATOM   2684  C CA   . SER A 1 29 ? -4.023  6.843   -7.996  1.00 0.00 ? 29 SER A CA   4  
ATOM   2685  C C    . SER A 1 29 ? -5.293  6.492   -7.235  1.00 0.00 ? 29 SER A C    4  
ATOM   2686  O O    . SER A 1 29 ? -5.423  5.418   -6.647  1.00 0.00 ? 29 SER A O    4  
ATOM   2687  C CB   . SER A 1 29 ? -4.029  6.126   -9.338  1.00 0.00 ? 29 SER A CB   4  
ATOM   2688  O OG   . SER A 1 29 ? -2.843  6.387   -10.068 1.00 0.00 ? 29 SER A OG   4  
ATOM   2689  H H    . SER A 1 29 ? -2.787  5.784   -6.639  1.00 0.00 ? 29 SER A H    4  
ATOM   2690  H HA   . SER A 1 29 ? -4.030  7.907   -8.183  1.00 0.00 ? 29 SER A HA   4  
ATOM   2691  H HB2  . SER A 1 29 ? -4.116  5.063   -9.176  1.00 0.00 ? 29 SER A HB2  4  
ATOM   2692  H HB3  . SER A 1 29 ? -4.878  6.475   -9.910  1.00 0.00 ? 29 SER A HB3  4  
ATOM   2693  H HG   . SER A 1 29 ? -2.876  7.278   -10.424 1.00 0.00 ? 29 SER A HG   4  
ATOM   2694  N N    . ASN A 1 30 ? -6.229  7.426   -7.288  1.00 0.00 ? 30 ASN A N    4  
ATOM   2695  C CA   . ASN A 1 30 ? -7.536  7.291   -6.653  1.00 0.00 ? 30 ASN A CA   4  
ATOM   2696  C C    . ASN A 1 30 ? -7.420  6.800   -5.220  1.00 0.00 ? 30 ASN A C    4  
ATOM   2697  O O    . ASN A 1 30 ? -8.343  6.172   -4.702  1.00 0.00 ? 30 ASN A O    4  
ATOM   2698  C CB   . ASN A 1 30 ? -8.417  6.334   -7.457  1.00 0.00 ? 30 ASN A CB   4  
ATOM   2699  C CG   . ASN A 1 30 ? -8.461  6.690   -8.931  1.00 0.00 ? 30 ASN A CG   4  
ATOM   2700  O OD1  . ASN A 1 30 ? -7.587  6.296   -9.703  1.00 0.00 ? 30 ASN A OD1  4  
ATOM   2701  N ND2  . ASN A 1 30 ? -9.484  7.438   -9.327  1.00 0.00 ? 30 ASN A ND2  4  
ATOM   2702  H H    . ASN A 1 30 ? -6.032  8.233   -7.789  1.00 0.00 ? 30 ASN A H    4  
ATOM   2703  H HA   . ASN A 1 30 ? -8.000  8.266   -6.646  1.00 0.00 ? 30 ASN A HA   4  
ATOM   2704  H HB2  . ASN A 1 30 ? -8.029  5.331   -7.361  1.00 0.00 ? 30 ASN A HB2  4  
ATOM   2705  H HB3  . ASN A 1 30 ? -9.423  6.366   -7.067  1.00 0.00 ? 30 ASN A HB3  4  
ATOM   2706  H HD21 . ASN A 1 30 ? -10.144 7.714   -8.657  1.00 0.00 ? 30 ASN A HD21 4  
ATOM   2707  H HD22 . ASN A 1 30 ? -9.538  7.683   -10.275 1.00 0.00 ? 30 ASN A HD22 4  
ATOM   2708  N N    . THR A 1 31 ? -6.293  7.090   -4.584  1.00 0.00 ? 31 THR A N    4  
ATOM   2709  C CA   . THR A 1 31 ? -6.075  6.664   -3.213  1.00 0.00 ? 31 THR A CA   4  
ATOM   2710  C C    . THR A 1 31 ? -4.751  7.186   -2.647  1.00 0.00 ? 31 THR A C    4  
ATOM   2711  O O    . THR A 1 31 ? -3.753  6.465   -2.662  1.00 0.00 ? 31 THR A O    4  
ATOM   2712  C CB   . THR A 1 31 ? -6.088  5.136   -3.136  1.00 0.00 ? 31 THR A CB   4  
ATOM   2713  O OG1  . THR A 1 31 ? -7.397  4.627   -3.319  1.00 0.00 ? 31 THR A OG1  4  
ATOM   2714  C CG2  . THR A 1 31 ? -5.570  4.583   -1.824  1.00 0.00 ? 31 THR A CG2  4  
ATOM   2715  H H    . THR A 1 31 ? -5.601  7.598   -5.043  1.00 0.00 ? 31 THR A H    4  
ATOM   2716  H HA   . THR A 1 31 ? -6.883  7.038   -2.630  1.00 0.00 ? 31 THR A HA   4  
ATOM   2717  H HB   . THR A 1 31 ? -5.463  4.752   -3.927  1.00 0.00 ? 31 THR A HB   4  
ATOM   2718  H HG1  . THR A 1 31 ? -8.022  5.166   -2.827  1.00 0.00 ? 31 THR A HG1  4  
ATOM   2719  H HG21 . THR A 1 31 ? -5.978  3.597   -1.662  1.00 0.00 ? 31 THR A HG21 4  
ATOM   2720  H HG22 . THR A 1 31 ? -5.871  5.235   -1.017  1.00 0.00 ? 31 THR A HG22 4  
ATOM   2721  H HG23 . THR A 1 31 ? -4.492  4.526   -1.857  1.00 0.00 ? 31 THR A HG23 4  
ATOM   2722  N N    . PRO A 1 32 ? -4.701  8.428   -2.122  1.00 0.00 ? 32 PRO A N    4  
ATOM   2723  C CA   . PRO A 1 32 ? -3.464  8.968   -1.546  1.00 0.00 ? 32 PRO A CA   4  
ATOM   2724  C C    . PRO A 1 32 ? -2.851  7.977   -0.555  1.00 0.00 ? 32 PRO A C    4  
ATOM   2725  O O    . PRO A 1 32 ? -3.406  7.737   0.517   1.00 0.00 ? 32 PRO A O    4  
ATOM   2726  C CB   . PRO A 1 32 ? -3.904  10.257  -0.835  1.00 0.00 ? 32 PRO A CB   4  
ATOM   2727  C CG   . PRO A 1 32 ? -5.397  10.222  -0.818  1.00 0.00 ? 32 PRO A CG   4  
ATOM   2728  C CD   . PRO A 1 32 ? -5.807  9.394   -2.024  1.00 0.00 ? 32 PRO A CD   4  
ATOM   2729  H HA   . PRO A 1 32 ? -2.742  9.201   -2.315  1.00 0.00 ? 32 PRO A HA   4  
ATOM   2730  H HB2  . PRO A 1 32 ? -3.502  10.271  0.167   1.00 0.00 ? 32 PRO A HB2  4  
ATOM   2731  H HB3  . PRO A 1 32 ? -3.539  11.113  -1.384  1.00 0.00 ? 32 PRO A HB3  4  
ATOM   2732  H HG2  . PRO A 1 32 ? -5.733  9.756   0.103   1.00 0.00 ? 32 PRO A HG2  4  
ATOM   2733  H HG3  . PRO A 1 32 ? -5.788  11.231  -0.889  1.00 0.00 ? 32 PRO A HG3  4  
ATOM   2734  H HD2  . PRO A 1 32 ? -6.751  8.898   -1.852  1.00 0.00 ? 32 PRO A HD2  4  
ATOM   2735  H HD3  . PRO A 1 32 ? -5.858  10.003  -2.921  1.00 0.00 ? 32 PRO A HD3  4  
ATOM   2736  N N    . PRO A 1 33 ? -1.709  7.363   -0.915  1.00 0.00 ? 33 PRO A N    4  
ATOM   2737  C CA   . PRO A 1 33 ? -1.041  6.369   -0.072  1.00 0.00 ? 33 PRO A CA   4  
ATOM   2738  C C    . PRO A 1 33 ? -0.150  6.976   0.989   1.00 0.00 ? 33 PRO A C    4  
ATOM   2739  O O    . PRO A 1 33 ? 1.071   6.972   0.865   1.00 0.00 ? 33 PRO A O    4  
ATOM   2740  C CB   . PRO A 1 33 ? -0.210  5.585   -1.082  1.00 0.00 ? 33 PRO A CB   4  
ATOM   2741  C CG   . PRO A 1 33 ? 0.162   6.595   -2.112  1.00 0.00 ? 33 PRO A CG   4  
ATOM   2742  C CD   . PRO A 1 33 ? -0.991  7.568   -2.189  1.00 0.00 ? 33 PRO A CD   4  
ATOM   2743  H HA   . PRO A 1 33 ? -1.744  5.710   0.407   1.00 0.00 ? 33 PRO A HA   4  
ATOM   2744  H HB2  . PRO A 1 33 ? 0.661   5.174   -0.594  1.00 0.00 ? 33 PRO A HB2  4  
ATOM   2745  H HB3  . PRO A 1 33 ? -0.806  4.789   -1.504  1.00 0.00 ? 33 PRO A HB3  4  
ATOM   2746  H HG2  . PRO A 1 33 ? 1.061   7.108   -1.808  1.00 0.00 ? 33 PRO A HG2  4  
ATOM   2747  H HG3  . PRO A 1 33 ? 0.311   6.111   -3.064  1.00 0.00 ? 33 PRO A HG3  4  
ATOM   2748  H HD2  . PRO A 1 33 ? -0.624  8.580   -2.262  1.00 0.00 ? 33 PRO A HD2  4  
ATOM   2749  H HD3  . PRO A 1 33 ? -1.628  7.338   -3.029  1.00 0.00 ? 33 PRO A HD3  4  
ATOM   2750  N N    . LEU A 1 34 ? -0.764  7.482   2.044   1.00 0.00 ? 34 LEU A N    4  
ATOM   2751  C CA   . LEU A 1 34 ? 0.002   8.070   3.133   1.00 0.00 ? 34 LEU A CA   4  
ATOM   2752  C C    . LEU A 1 34 ? 0.770   6.987   3.893   1.00 0.00 ? 34 LEU A C    4  
ATOM   2753  O O    . LEU A 1 34 ? 1.971   7.128   4.123   1.00 0.00 ? 34 LEU A O    4  
ATOM   2754  C CB   . LEU A 1 34 ? -0.893  8.889   4.077   1.00 0.00 ? 34 LEU A CB   4  
ATOM   2755  C CG   . LEU A 1 34 ? -1.885  9.825   3.381   1.00 0.00 ? 34 LEU A CG   4  
ATOM   2756  C CD1  . LEU A 1 34 ? -2.629  10.669  4.405   1.00 0.00 ? 34 LEU A CD1  4  
ATOM   2757  C CD2  . LEU A 1 34 ? -1.167  10.714  2.375   1.00 0.00 ? 34 LEU A CD2  4  
ATOM   2758  H H    . LEU A 1 34 ? -1.745  7.449   2.089   1.00 0.00 ? 34 LEU A H    4  
ATOM   2759  H HA   . LEU A 1 34 ? 0.727   8.724   2.682   1.00 0.00 ? 34 LEU A HA   4  
ATOM   2760  H HB2  . LEU A 1 34 ? -1.453  8.212   4.702   1.00 0.00 ? 34 LEU A HB2  4  
ATOM   2761  H HB3  . LEU A 1 34 ? -0.256  9.489   4.708   1.00 0.00 ? 34 LEU A HB3  4  
ATOM   2762  H HG   . LEU A 1 34 ? -2.614  9.235   2.846   1.00 0.00 ? 34 LEU A HG   4  
ATOM   2763  H HD11 . LEU A 1 34 ? -3.656  10.794  4.091   1.00 0.00 ? 34 LEU A HD11 4  
ATOM   2764  H HD12 . LEU A 1 34 ? -2.157  11.637  4.485   1.00 0.00 ? 34 LEU A HD12 4  
ATOM   2765  H HD13 . LEU A 1 34 ? -2.605  10.176  5.365   1.00 0.00 ? 34 LEU A HD13 4  
ATOM   2766  H HD21 . LEU A 1 34 ? -1.322  10.329  1.379   1.00 0.00 ? 34 LEU A HD21 4  
ATOM   2767  H HD22 . LEU A 1 34 ? -0.109  10.727  2.595   1.00 0.00 ? 34 LEU A HD22 4  
ATOM   2768  H HD23 . LEU A 1 34 ? -1.558  11.719  2.437   1.00 0.00 ? 34 LEU A HD23 4  
ATOM   2769  N N    . THR A 1 35 ? 0.097   5.892   4.253   1.00 0.00 ? 35 THR A N    4  
ATOM   2770  C CA   . THR A 1 35 ? 0.756   4.802   4.943   1.00 0.00 ? 35 THR A CA   4  
ATOM   2771  C C    . THR A 1 35 ? 1.355   3.824   3.932   1.00 0.00 ? 35 THR A C    4  
ATOM   2772  O O    . THR A 1 35 ? 1.930   2.803   4.311   1.00 0.00 ? 35 THR A O    4  
ATOM   2773  C CB   . THR A 1 35 ? -0.231  4.074   5.856   1.00 0.00 ? 35 THR A CB   4  
ATOM   2774  O OG1  . THR A 1 35 ? 0.424   3.058   6.596   1.00 0.00 ? 35 THR A OG1  4  
ATOM   2775  C CG2  . THR A 1 35 ? -1.377  3.428   5.106   1.00 0.00 ? 35 THR A CG2  4  
ATOM   2776  H H    . THR A 1 35 ? -0.849  5.803   4.034   1.00 0.00 ? 35 THR A H    4  
ATOM   2777  H HA   . THR A 1 35 ? 1.550   5.220   5.542   1.00 0.00 ? 35 THR A HA   4  
ATOM   2778  H HB   . THR A 1 35 ? -0.652  4.784   6.554   1.00 0.00 ? 35 THR A HB   4  
ATOM   2779  H HG1  . THR A 1 35 ? 1.237   3.407   6.969   1.00 0.00 ? 35 THR A HG1  4  
ATOM   2780  H HG21 . THR A 1 35 ? -2.307  3.651   5.609   1.00 0.00 ? 35 THR A HG21 4  
ATOM   2781  H HG22 . THR A 1 35 ? -1.230  2.359   5.077   1.00 0.00 ? 35 THR A HG22 4  
ATOM   2782  H HG23 . THR A 1 35 ? -1.411  3.815   4.099   1.00 0.00 ? 35 THR A HG23 4  
ATOM   2783  N N    . CYS A 1 36 ? 1.217   4.138   2.639   1.00 0.00 ? 36 CYS A N    4  
ATOM   2784  C CA   . CYS A 1 36 ? 1.747   3.273   1.591   1.00 0.00 ? 36 CYS A CA   4  
ATOM   2785  C C    . CYS A 1 36 ? 2.804   3.985   0.745   1.00 0.00 ? 36 CYS A C    4  
ATOM   2786  O O    . CYS A 1 36 ? 3.495   3.351   -0.053  1.00 0.00 ? 36 CYS A O    4  
ATOM   2787  C CB   . CYS A 1 36 ? 0.616   2.771   0.690   1.00 0.00 ? 36 CYS A CB   4  
ATOM   2788  S SG   . CYS A 1 36 ? -0.582  1.676   1.518   1.00 0.00 ? 36 CYS A SG   4  
ATOM   2789  H H    . CYS A 1 36 ? 0.747   4.967   2.385   1.00 0.00 ? 36 CYS A H    4  
ATOM   2790  H HA   . CYS A 1 36 ? 2.205   2.431   2.075   1.00 0.00 ? 36 CYS A HA   4  
ATOM   2791  H HB2  . CYS A 1 36 ? 0.068   3.617   0.310   1.00 0.00 ? 36 CYS A HB2  4  
ATOM   2792  H HB3  . CYS A 1 36 ? 1.043   2.224   -0.138  1.00 0.00 ? 36 CYS A HB3  4  
ATOM   2793  N N    . GLN A 1 37 ? 2.922   5.300   0.911   1.00 0.00 ? 37 GLN A N    4  
ATOM   2794  C CA   . GLN A 1 37 ? 3.888   6.088   0.151   1.00 0.00 ? 37 GLN A CA   4  
ATOM   2795  C C    . GLN A 1 37 ? 5.278   5.473   0.204   1.00 0.00 ? 37 GLN A C    4  
ATOM   2796  O O    . GLN A 1 37 ? 6.008   5.480   -0.782  1.00 0.00 ? 37 GLN A O    4  
ATOM   2797  C CB   . GLN A 1 37 ? 3.939   7.522   0.686   1.00 0.00 ? 37 GLN A CB   4  
ATOM   2798  C CG   . GLN A 1 37 ? 4.112   8.583   -0.390  1.00 0.00 ? 37 GLN A CG   4  
ATOM   2799  C CD   . GLN A 1 37 ? 3.108   8.447   -1.517  1.00 0.00 ? 37 GLN A CD   4  
ATOM   2800  O OE1  . GLN A 1 37 ? 3.295   7.654   -2.439  1.00 0.00 ? 37 GLN A OE1  4  
ATOM   2801  N NE2  . GLN A 1 37 ? 2.036   9.229   -1.451  1.00 0.00 ? 37 GLN A NE2  4  
ATOM   2802  H H    . GLN A 1 37 ? 2.340   5.757   1.551   1.00 0.00 ? 37 GLN A H    4  
ATOM   2803  H HA   . GLN A 1 37 ? 3.563   6.102   -0.871  1.00 0.00 ? 37 GLN A HA   4  
ATOM   2804  H HB2  . GLN A 1 37 ? 3.024   7.728   1.216   1.00 0.00 ? 37 GLN A HB2  4  
ATOM   2805  H HB3  . GLN A 1 37 ? 4.766   7.605   1.375   1.00 0.00 ? 37 GLN A HB3  4  
ATOM   2806  H HG2  . GLN A 1 37 ? 3.989   9.555   0.063   1.00 0.00 ? 37 GLN A HG2  4  
ATOM   2807  H HG3  . GLN A 1 37 ? 5.108   8.501   -0.800  1.00 0.00 ? 37 GLN A HG3  4  
ATOM   2808  H HE21 . GLN A 1 37 ? 1.954   9.839   -0.687  1.00 0.00 ? 37 GLN A HE21 4  
ATOM   2809  H HE22 . GLN A 1 37 ? 1.370   9.163   -2.167  1.00 0.00 ? 37 GLN A HE22 4  
ATOM   2810  N N    . ARG A 1 38 ? 5.637   4.951   1.361   1.00 0.00 ? 38 ARG A N    4  
ATOM   2811  C CA   . ARG A 1 38 ? 6.947   4.339   1.543   1.00 0.00 ? 38 ARG A CA   4  
ATOM   2812  C C    . ARG A 1 38 ? 7.150   3.188   0.561   1.00 0.00 ? 38 ARG A C    4  
ATOM   2813  O O    . ARG A 1 38 ? 8.125   3.162   -0.186  1.00 0.00 ? 38 ARG A O    4  
ATOM   2814  C CB   . ARG A 1 38 ? 7.110   3.838   2.981   1.00 0.00 ? 38 ARG A CB   4  
ATOM   2815  C CG   . ARG A 1 38 ? 7.920   4.775   3.866   1.00 0.00 ? 38 ARG A CG   4  
ATOM   2816  C CD   . ARG A 1 38 ? 9.409   4.486   3.777   1.00 0.00 ? 38 ARG A CD   4  
ATOM   2817  N NE   . ARG A 1 38 ? 10.037  5.228   2.685   1.00 0.00 ? 38 ARG A NE   4  
ATOM   2818  C CZ   . ARG A 1 38 ? 11.172  5.917   2.802   1.00 0.00 ? 38 ARG A CZ   4  
ATOM   2819  N NH1  . ARG A 1 38 ? 11.825  5.957   3.957   1.00 0.00 ? 38 ARG A NH1  4  
ATOM   2820  N NH2  . ARG A 1 38 ? 11.659  6.569   1.754   1.00 0.00 ? 38 ARG A NH2  4  
ATOM   2821  H H    . ARG A 1 38 ? 5.007   4.980   2.107   1.00 0.00 ? 38 ARG A H    4  
ATOM   2822  H HA   . ARG A 1 38 ? 7.692   5.094   1.348   1.00 0.00 ? 38 ARG A HA   4  
ATOM   2823  H HB2  . ARG A 1 38 ? 6.132   3.719   3.422   1.00 0.00 ? 38 ARG A HB2  4  
ATOM   2824  H HB3  . ARG A 1 38 ? 7.606   2.878   2.964   1.00 0.00 ? 38 ARG A HB3  4  
ATOM   2825  H HG2  . ARG A 1 38 ? 7.744   5.793   3.553   1.00 0.00 ? 38 ARG A HG2  4  
ATOM   2826  H HG3  . ARG A 1 38 ? 7.600   4.652   4.891   1.00 0.00 ? 38 ARG A HG3  4  
ATOM   2827  H HD2  . ARG A 1 38 ? 9.863   4.759   4.716   1.00 0.00 ? 38 ARG A HD2  4  
ATOM   2828  H HD3  . ARG A 1 38 ? 9.542   3.426   3.617   1.00 0.00 ? 38 ARG A HD3  4  
ATOM   2829  H HE   . ARG A 1 38 ? 9.587   5.216   1.815   1.00 0.00 ? 38 ARG A HE   4  
ATOM   2830  H HH11 . ARG A 1 38 ? 11.471  5.467   4.752   1.00 0.00 ? 38 ARG A HH11 4  
ATOM   2831  H HH12 . ARG A 1 38 ? 12.675  6.479   4.032   1.00 0.00 ? 38 ARG A HH12 4  
ATOM   2832  H HH21 . ARG A 1 38 ? 11.175  6.541   0.880   1.00 0.00 ? 38 ARG A HH21 4  
ATOM   2833  H HH22 . ARG A 1 38 ? 12.509  7.088   1.839   1.00 0.00 ? 38 ARG A HH22 4  
ATOM   2834  N N    . TYR A 1 39 ? 6.223   2.239   0.573   1.00 0.00 ? 39 TYR A N    4  
ATOM   2835  C CA   . TYR A 1 39 ? 6.302   1.080   -0.302  1.00 0.00 ? 39 TYR A CA   4  
ATOM   2836  C C    . TYR A 1 39 ? 5.974   1.431   -1.745  1.00 0.00 ? 39 TYR A C    4  
ATOM   2837  O O    . TYR A 1 39 ? 6.628   0.951   -2.671  1.00 0.00 ? 39 TYR A O    4  
ATOM   2838  C CB   . TYR A 1 39 ? 5.357   -0.018  0.194   1.00 0.00 ? 39 TYR A CB   4  
ATOM   2839  C CG   . TYR A 1 39 ? 5.370   -1.261  -0.666  1.00 0.00 ? 39 TYR A CG   4  
ATOM   2840  C CD1  . TYR A 1 39 ? 4.711   -1.291  -1.887  1.00 0.00 ? 39 TYR A CD1  4  
ATOM   2841  C CD2  . TYR A 1 39 ? 6.055   -2.399  -0.261  1.00 0.00 ? 39 TYR A CD2  4  
ATOM   2842  C CE1  . TYR A 1 39 ? 4.733   -2.421  -2.682  1.00 0.00 ? 39 TYR A CE1  4  
ATOM   2843  C CE2  . TYR A 1 39 ? 6.080   -3.533  -1.049  1.00 0.00 ? 39 TYR A CE2  4  
ATOM   2844  C CZ   . TYR A 1 39 ? 5.419   -3.539  -2.259  1.00 0.00 ? 39 TYR A CZ   4  
ATOM   2845  O OH   . TYR A 1 39 ? 5.444   -4.666  -3.047  1.00 0.00 ? 39 TYR A OH   4  
ATOM   2846  H H    . TYR A 1 39 ? 5.476   2.312   1.192   1.00 0.00 ? 39 TYR A H    4  
ATOM   2847  H HA   . TYR A 1 39 ? 7.311   0.715   -0.263  1.00 0.00 ? 39 TYR A HA   4  
ATOM   2848  H HB2  . TYR A 1 39 ? 5.643   -0.303  1.195   1.00 0.00 ? 39 TYR A HB2  4  
ATOM   2849  H HB3  . TYR A 1 39 ? 4.347   0.367   0.210   1.00 0.00 ? 39 TYR A HB3  4  
ATOM   2850  H HD1  . TYR A 1 39 ? 4.171   -0.415  -2.216  1.00 0.00 ? 39 TYR A HD1  4  
ATOM   2851  H HD2  . TYR A 1 39 ? 6.572   -2.392  0.687   1.00 0.00 ? 39 TYR A HD2  4  
ATOM   2852  H HE1  . TYR A 1 39 ? 4.214   -2.425  -3.630  1.00 0.00 ? 39 TYR A HE1  4  
ATOM   2853  H HE2  . TYR A 1 39 ? 6.618   -4.409  -0.717  1.00 0.00 ? 39 TYR A HE2  4  
ATOM   2854  H HH   . TYR A 1 39 ? 6.085   -4.551  -3.752  1.00 0.00 ? 39 TYR A HH   4  
ATOM   2855  N N    . CYS A 1 40 ? 4.958   2.257   -1.939  1.00 0.00 ? 40 CYS A N    4  
ATOM   2856  C CA   . CYS A 1 40 ? 4.558   2.641   -3.286  1.00 0.00 ? 40 CYS A CA   4  
ATOM   2857  C C    . CYS A 1 40 ? 5.681   3.383   -3.994  1.00 0.00 ? 40 CYS A C    4  
ATOM   2858  O O    . CYS A 1 40 ? 5.866   3.229   -5.201  1.00 0.00 ? 40 CYS A O    4  
ATOM   2859  C CB   . CYS A 1 40 ? 3.266   3.461   -3.259  1.00 0.00 ? 40 CYS A CB   4  
ATOM   2860  S SG   . CYS A 1 40 ? 1.782   2.427   -3.086  1.00 0.00 ? 40 CYS A SG   4  
ATOM   2861  H H    . CYS A 1 40 ? 4.466   2.605   -1.165  1.00 0.00 ? 40 CYS A H    4  
ATOM   2862  H HA   . CYS A 1 40 ? 4.374   1.727   -3.833  1.00 0.00 ? 40 CYS A HA   4  
ATOM   2863  H HB2  . CYS A 1 40 ? 3.290   4.150   -2.429  1.00 0.00 ? 40 CYS A HB2  4  
ATOM   2864  H HB3  . CYS A 1 40 ? 3.170   4.013   -4.181  1.00 0.00 ? 40 CYS A HB3  4  
ATOM   2865  N N    . ASN A 1 41 ? 6.459   4.154   -3.243  1.00 0.00 ? 41 ASN A N    4  
ATOM   2866  C CA   . ASN A 1 41 ? 7.581   4.867   -3.830  1.00 0.00 ? 41 ASN A CA   4  
ATOM   2867  C C    . ASN A 1 41 ? 8.734   3.903   -4.088  1.00 0.00 ? 41 ASN A C    4  
ATOM   2868  O O    . ASN A 1 41 ? 9.663   4.211   -4.833  1.00 0.00 ? 41 ASN A O    4  
ATOM   2869  C CB   . ASN A 1 41 ? 8.022   6.045   -2.943  1.00 0.00 ? 41 ASN A CB   4  
ATOM   2870  C CG   . ASN A 1 41 ? 9.391   5.853   -2.309  1.00 0.00 ? 41 ASN A CG   4  
ATOM   2871  O OD1  . ASN A 1 41 ? 10.305  6.646   -2.530  1.00 0.00 ? 41 ASN A OD1  4  
ATOM   2872  N ND2  . ASN A 1 41 ? 9.535   4.797   -1.519  1.00 0.00 ? 41 ASN A ND2  4  
ATOM   2873  H H    . ASN A 1 41 ? 6.292   4.224   -2.285  1.00 0.00 ? 41 ASN A H    4  
ATOM   2874  H HA   . ASN A 1 41 ? 7.247   5.243   -4.773  1.00 0.00 ? 41 ASN A HA   4  
ATOM   2875  H HB2  . ASN A 1 41 ? 8.054   6.941   -3.544  1.00 0.00 ? 41 ASN A HB2  4  
ATOM   2876  H HB3  . ASN A 1 41 ? 7.299   6.182   -2.155  1.00 0.00 ? 41 ASN A HB3  4  
ATOM   2877  H HD21 . ASN A 1 41 ? 8.764   4.206   -1.388  1.00 0.00 ? 41 ASN A HD21 4  
ATOM   2878  H HD22 . ASN A 1 41 ? 10.408  4.650   -1.097  1.00 0.00 ? 41 ASN A HD22 4  
ATOM   2879  N N    . ALA A 1 42 ? 8.649   2.728   -3.475  1.00 0.00 ? 42 ALA A N    4  
ATOM   2880  C CA   . ALA A 1 42 ? 9.667   1.702   -3.646  1.00 0.00 ? 42 ALA A CA   4  
ATOM   2881  C C    . ALA A 1 42 ? 9.109   0.523   -4.431  1.00 0.00 ? 42 ALA A C    4  
ATOM   2882  O O    . ALA A 1 42 ? 9.578   -0.608  -4.303  1.00 0.00 ? 42 ALA A O    4  
ATOM   2883  C CB   . ALA A 1 42 ? 10.202  1.246   -2.297  1.00 0.00 ? 42 ALA A CB   4  
ATOM   2884  H H    . ALA A 1 42 ? 7.874   2.545   -2.906  1.00 0.00 ? 42 ALA A H    4  
ATOM   2885  H HA   . ALA A 1 42 ? 10.477  2.133   -4.208  1.00 0.00 ? 42 ALA A HA   4  
ATOM   2886  H HB1  . ALA A 1 42 ? 9.734   0.314   -2.019  1.00 0.00 ? 42 ALA A HB1  4  
ATOM   2887  H HB2  . ALA A 1 42 ? 9.982   1.997   -1.551  1.00 0.00 ? 42 ALA A HB2  4  
ATOM   2888  H HB3  . ALA A 1 42 ? 11.271  1.106   -2.362  1.00 0.00 ? 42 ALA A HB3  4  
ATOM   2889  N N    . SER A 1 43 ? 8.104   0.808   -5.246  1.00 0.00 ? 43 SER A N    4  
ATOM   2890  C CA   . SER A 1 43 ? 7.465   -0.205  -6.069  1.00 0.00 ? 43 SER A CA   4  
ATOM   2891  C C    . SER A 1 43 ? 7.351   0.265   -7.517  1.00 0.00 ? 43 SER A C    4  
ATOM   2892  O O    . SER A 1 43 ? 7.509   -0.525  -8.450  1.00 0.00 ? 43 SER A O    4  
ATOM   2893  C CB   . SER A 1 43 ? 6.078   -0.546  -5.516  1.00 0.00 ? 43 SER A CB   4  
ATOM   2894  O OG   . SER A 1 43 ? 5.888   -1.948  -5.445  1.00 0.00 ? 43 SER A OG   4  
ATOM   2895  H H    . SER A 1 43 ? 7.787   1.728   -5.295  1.00 0.00 ? 43 SER A H    4  
ATOM   2896  H HA   . SER A 1 43 ? 8.082   -1.084  -6.036  1.00 0.00 ? 43 SER A HA   4  
ATOM   2897  H HB2  . SER A 1 43 ? 5.977   -0.132  -4.524  1.00 0.00 ? 43 SER A HB2  4  
ATOM   2898  H HB3  . SER A 1 43 ? 5.321   -0.124  -6.161  1.00 0.00 ? 43 SER A HB3  4  
ATOM   2899  H HG   . SER A 1 43 ? 6.175   -2.353  -6.267  1.00 0.00 ? 43 SER A HG   4  
ATOM   2900  N N    . VAL A 1 44 ? 7.082   1.556   -7.701  1.00 0.00 ? 44 VAL A N    4  
ATOM   2901  C CA   . VAL A 1 44 ? 6.953   2.129   -9.039  1.00 0.00 ? 44 VAL A CA   4  
ATOM   2902  C C    . VAL A 1 44 ? 5.707   1.606   -9.746  1.00 0.00 ? 44 VAL A C    4  
ATOM   2903  O O    . VAL A 1 44 ? 5.787   1.035   -10.833 1.00 0.00 ? 44 VAL A O    4  
ATOM   2904  C CB   . VAL A 1 44 ? 8.191   1.823   -9.906  1.00 0.00 ? 44 VAL A CB   4  
ATOM   2905  C CG1  . VAL A 1 44 ? 8.147   2.616   -11.202 1.00 0.00 ? 44 VAL A CG1  4  
ATOM   2906  C CG2  . VAL A 1 44 ? 9.469   2.117   -9.134  1.00 0.00 ? 44 VAL A CG2  4  
ATOM   2907  H H    . VAL A 1 44 ? 6.969   2.138   -6.918  1.00 0.00 ? 44 VAL A H    4  
ATOM   2908  H HA   . VAL A 1 44 ? 6.866   3.200   -8.936  1.00 0.00 ? 44 VAL A HA   4  
ATOM   2909  H HB   . VAL A 1 44 ? 8.180   0.772   -10.153 1.00 0.00 ? 44 VAL A HB   4  
ATOM   2910  H HG11 . VAL A 1 44 ? 8.730   2.107   -11.956 1.00 0.00 ? 44 VAL A HG11 4  
ATOM   2911  H HG12 . VAL A 1 44 ? 8.556   3.602   -11.036 1.00 0.00 ? 44 VAL A HG12 4  
ATOM   2912  H HG13 . VAL A 1 44 ? 7.124   2.703   -11.537 1.00 0.00 ? 44 VAL A HG13 4  
ATOM   2913  H HG21 . VAL A 1 44 ? 9.621   3.186   -9.082  1.00 0.00 ? 44 VAL A HG21 4  
ATOM   2914  H HG22 . VAL A 1 44 ? 10.307  1.659   -9.638  1.00 0.00 ? 44 VAL A HG22 4  
ATOM   2915  H HG23 . VAL A 1 44 ? 9.387   1.717   -8.135  1.00 0.00 ? 44 VAL A HG23 4  
ATOM   2916  N N    . THR A 1 45 ? 4.556   1.812   -9.116  1.00 0.00 ? 45 THR A N    4  
ATOM   2917  C CA   . THR A 1 45 ? 3.272   1.375   -9.664  1.00 0.00 ? 45 THR A CA   4  
ATOM   2918  C C    . THR A 1 45 ? 3.147   -0.155  -9.680  1.00 0.00 ? 45 THR A C    4  
ATOM   2919  O O    . THR A 1 45 ? 2.149   -0.699  -9.208  1.00 0.00 ? 45 THR A O    4  
ATOM   2920  C CB   . THR A 1 45 ? 3.055   1.961   -11.069 1.00 0.00 ? 45 THR A CB   4  
ATOM   2921  O OG1  . THR A 1 45 ? 2.866   3.363   -10.997 1.00 0.00 ? 45 THR A OG1  4  
ATOM   2922  C CG2  . THR A 1 45 ? 1.857   1.380   -11.790 1.00 0.00 ? 45 THR A CG2  4  
ATOM   2923  H H    . THR A 1 45 ? 4.569   2.277   -8.252  1.00 0.00 ? 45 THR A H    4  
ATOM   2924  H HA   . THR A 1 45 ? 2.503   1.764   -9.013  1.00 0.00 ? 45 THR A HA   4  
ATOM   2925  H HB   . THR A 1 45 ? 3.929   1.773   -11.674 1.00 0.00 ? 45 THR A HB   4  
ATOM   2926  H HG1  . THR A 1 45 ? 3.599   3.761   -10.521 1.00 0.00 ? 45 THR A HG1  4  
ATOM   2927  H HG21 . THR A 1 45 ? 0.968   1.544   -11.200 1.00 0.00 ? 45 THR A HG21 4  
ATOM   2928  H HG22 . THR A 1 45 ? 2.003   0.320   -11.935 1.00 0.00 ? 45 THR A HG22 4  
ATOM   2929  H HG23 . THR A 1 45 ? 1.745   1.863   -12.750 1.00 0.00 ? 45 THR A HG23 4  
ATOM   2930  N N    . ASN A 1 46 ? 4.152   -0.849  -10.217 1.00 0.00 ? 46 ASN A N    4  
ATOM   2931  C CA   . ASN A 1 46 ? 4.126   -2.309  -10.276 1.00 0.00 ? 46 ASN A CA   4  
ATOM   2932  C C    . ASN A 1 46 ? 2.820   -2.814  -10.883 1.00 0.00 ? 46 ASN A C    4  
ATOM   2933  O O    . ASN A 1 46 ? 1.978   -2.026  -11.315 1.00 0.00 ? 46 ASN A O    4  
ATOM   2934  C CB   . ASN A 1 46 ? 4.313   -2.898  -8.877  1.00 0.00 ? 46 ASN A CB   4  
ATOM   2935  C CG   . ASN A 1 46 ? 5.149   -4.164  -8.890  1.00 0.00 ? 46 ASN A CG   4  
ATOM   2936  O OD1  . ASN A 1 46 ? 4.742   -5.196  -8.356  1.00 0.00 ? 46 ASN A OD1  4  
ATOM   2937  N ND2  . ASN A 1 46 ? 6.325   -4.090  -9.502  1.00 0.00 ? 46 ASN A ND2  4  
ATOM   2938  H H    . ASN A 1 46 ? 4.927   -0.376  -10.577 1.00 0.00 ? 46 ASN A H    4  
ATOM   2939  H HA   . ASN A 1 46 ? 4.946   -2.630  -10.903 1.00 0.00 ? 46 ASN A HA   4  
ATOM   2940  H HB2  . ASN A 1 46 ? 4.807   -2.171  -8.250  1.00 0.00 ? 46 ASN A HB2  4  
ATOM   2941  H HB3  . ASN A 1 46 ? 3.345   -3.131  -8.458  1.00 0.00 ? 46 ASN A HB3  4  
ATOM   2942  H HD21 . ASN A 1 46 ? 6.584   -3.235  -9.905  1.00 0.00 ? 46 ASN A HD21 4  
ATOM   2943  H HD22 . ASN A 1 46 ? 6.885   -4.893  -9.526  1.00 0.00 ? 46 ASN A HD22 4  
ATOM   2944  N N    . SER A 1 47 ? 2.657   -4.134  -10.909 1.00 0.00 ? 47 SER A N    4  
ATOM   2945  C CA   . SER A 1 47 ? 1.454   -4.752  -11.459 1.00 0.00 ? 47 SER A CA   4  
ATOM   2946  C C    . SER A 1 47 ? 1.401   -4.593  -12.975 1.00 0.00 ? 47 SER A C    4  
ATOM   2947  O O    . SER A 1 47 ? 1.620   -3.501  -13.501 1.00 0.00 ? 47 SER A O    4  
ATOM   2948  C CB   . SER A 1 47 ? 0.199   -4.146  -10.822 1.00 0.00 ? 47 SER A CB   4  
ATOM   2949  O OG   . SER A 1 47 ? -0.580  -5.142  -10.184 1.00 0.00 ? 47 SER A OG   4  
ATOM   2950  H H    . SER A 1 47 ? 3.364   -4.708  -10.548 1.00 0.00 ? 47 SER A H    4  
ATOM   2951  H HA   . SER A 1 47 ? 1.490   -5.806  -11.225 1.00 0.00 ? 47 SER A HA   4  
ATOM   2952  H HB2  . SER A 1 47 ? 0.492   -3.411  -10.087 1.00 0.00 ? 47 SER A HB2  4  
ATOM   2953  H HB3  . SER A 1 47 ? -0.399  -3.672  -11.586 1.00 0.00 ? 47 SER A HB3  4  
ATOM   2954  H HG   . SER A 1 47 ? -0.741  -5.864  -10.796 1.00 0.00 ? 47 SER A HG   4  
ATOM   2955  N N    . VAL A 1 48 ? 1.132   -5.698  -13.669 1.00 0.00 ? 48 VAL A N    4  
ATOM   2956  C CA   . VAL A 1 48 ? 1.063   -5.719  -15.120 1.00 0.00 ? 48 VAL A CA   4  
ATOM   2957  C C    . VAL A 1 48 ? 2.286   -5.084  -15.742 1.00 0.00 ? 48 VAL A C    4  
ATOM   2958  O O    . VAL A 1 48 ? 2.361   -3.871  -15.945 1.00 0.00 ? 48 VAL A O    4  
ATOM   2959  C CB   . VAL A 1 48 ? -0.199  -5.061  -15.693 1.00 0.00 ? 48 VAL A CB   4  
ATOM   2960  C CG1  . VAL A 1 48 ? -1.419  -5.928  -15.432 1.00 0.00 ? 48 VAL A CG1  4  
ATOM   2961  C CG2  . VAL A 1 48 ? -0.408  -3.655  -15.146 1.00 0.00 ? 48 VAL A CG2  4  
ATOM   2962  H H    . VAL A 1 48 ? 0.999   -6.537  -13.191 1.00 0.00 ? 48 VAL A H    4  
ATOM   2963  H HA   . VAL A 1 48 ? 1.048   -6.760  -15.416 1.00 0.00 ? 48 VAL A HA   4  
ATOM   2964  H HB   . VAL A 1 48 ? -0.057  -4.993  -16.760 1.00 0.00 ? 48 VAL A HB   4  
ATOM   2965  H HG11 . VAL A 1 48 ? -2.082  -5.883  -16.283 1.00 0.00 ? 48 VAL A HG11 4  
ATOM   2966  H HG12 . VAL A 1 48 ? -1.935  -5.567  -14.554 1.00 0.00 ? 48 VAL A HG12 4  
ATOM   2967  H HG13 . VAL A 1 48 ? -1.107  -6.950  -15.272 1.00 0.00 ? 48 VAL A HG13 4  
ATOM   2968  H HG21 . VAL A 1 48 ? -1.258  -3.204  -15.637 1.00 0.00 ? 48 VAL A HG21 4  
ATOM   2969  H HG22 . VAL A 1 48 ? 0.471   -3.059  -15.333 1.00 0.00 ? 48 VAL A HG22 4  
ATOM   2970  H HG23 . VAL A 1 48 ? -0.591  -3.705  -14.084 1.00 0.00 ? 48 VAL A HG23 4  
ATOM   2971  N N    . LYS A 1 49 ? 3.235   -5.937  -16.038 1.00 0.00 ? 49 LYS A N    4  
ATOM   2972  C CA   . LYS A 1 49 ? 4.493   -5.528  -16.650 1.00 0.00 ? 49 LYS A CA   4  
ATOM   2973  C C    . LYS A 1 49 ? 5.186   -4.453  -15.819 1.00 0.00 ? 49 LYS A C    4  
ATOM   2974  O O    . LYS A 1 49 ? 4.788   -4.173  -14.688 1.00 0.00 ? 49 LYS A O    4  
ATOM   2975  C CB   . LYS A 1 49 ? 4.250   -5.014  -18.070 1.00 0.00 ? 49 LYS A CB   4  
ATOM   2976  C CG   . LYS A 1 49 ? 5.221   -5.580  -19.093 1.00 0.00 ? 49 LYS A CG   4  
ATOM   2977  C CD   . LYS A 1 49 ? 5.156   -4.817  -20.405 1.00 0.00 ? 49 LYS A CD   4  
ATOM   2978  C CE   . LYS A 1 49 ? 5.351   -5.741  -21.597 1.00 0.00 ? 49 LYS A CE   4  
ATOM   2979  N NZ   . LYS A 1 49 ? 4.333   -5.508  -22.657 1.00 0.00 ? 49 LYS A NZ   4  
ATOM   2980  H H    . LYS A 1 49 ? 3.074   -6.881  -15.838 1.00 0.00 ? 49 LYS A H    4  
ATOM   2981  H HA   . LYS A 1 49 ? 5.133   -6.395  -16.698 1.00 0.00 ? 49 LYS A HA   4  
ATOM   2982  H HB2  . LYS A 1 49 ? 3.247   -5.280  -18.370 1.00 0.00 ? 49 LYS A HB2  4  
ATOM   2983  H HB3  . LYS A 1 49 ? 4.343   -3.937  -18.075 1.00 0.00 ? 49 LYS A HB3  4  
ATOM   2984  H HG2  . LYS A 1 49 ? 6.223   -5.514  -18.699 1.00 0.00 ? 49 LYS A HG2  4  
ATOM   2985  H HG3  . LYS A 1 49 ? 4.971   -6.615  -19.276 1.00 0.00 ? 49 LYS A HG3  4  
ATOM   2986  H HD2  . LYS A 1 49 ? 4.192   -4.339  -20.487 1.00 0.00 ? 49 LYS A HD2  4  
ATOM   2987  H HD3  . LYS A 1 49 ? 5.933   -4.066  -20.413 1.00 0.00 ? 49 LYS A HD3  4  
ATOM   2988  H HE2  . LYS A 1 49 ? 6.333   -5.572  -22.010 1.00 0.00 ? 49 LYS A HE2  4  
ATOM   2989  H HE3  . LYS A 1 49 ? 5.276   -6.764  -21.257 1.00 0.00 ? 49 LYS A HE3  4  
ATOM   2990  H HZ1  . LYS A 1 49 ? 4.078   -4.500  -22.693 1.00 0.00 ? 49 LYS A HZ1  4  
ATOM   2991  H HZ2  . LYS A 1 49 ? 3.477   -6.063  -22.459 1.00 0.00 ? 49 LYS A HZ2  4  
ATOM   2992  H HZ3  . LYS A 1 49 ? 4.710   -5.791  -23.584 1.00 0.00 ? 49 LYS A HZ3  4  
HETATM 2993  N N    . CY1 A 1 50 ? 6.278   -3.866  -16.341 1.00 0.00 ? 50 CY1 A N    4  
HETATM 2994  C CA   . CY1 A 1 50 ? 6.991   -2.711  -15.727 1.00 0.00 ? 50 CY1 A CA   4  
HETATM 2995  C CB   . CY1 A 1 50 ? 8.486   -2.740  -16.120 1.00 0.00 ? 50 CY1 A CB   4  
HETATM 2996  S SG   . CY1 A 1 50 ? 9.447   -4.039  -15.270 1.00 0.00 ? 50 CY1 A SG   4  
HETATM 2997  C CD   . CY1 A 1 50 ? 9.536   -3.382  -13.570 1.00 0.00 ? 50 CY1 A CD   4  
HETATM 2998  N NE   . CY1 A 1 50 ? 10.102  -2.036  -13.587 1.00 0.00 ? 50 CY1 A NE   4  
HETATM 2999  C CZ   . CY1 A 1 50 ? 10.135  -1.243  -12.513 1.00 0.00 ? 50 CY1 A CZ   4  
HETATM 3000  O OAC  . CY1 A 1 50 ? 9.720   -1.632  -11.440 1.00 0.00 ? 50 CY1 A OAC  4  
HETATM 3001  C CM   . CY1 A 1 50 ? 10.726  0.119   -12.726 1.00 0.00 ? 50 CY1 A CM   4  
HETATM 3002  C C    . CY1 A 1 50 ? 6.432   -1.322  -16.056 1.00 0.00 ? 50 CY1 A C    4  
HETATM 3003  O O    . CY1 A 1 50 ? 7.042   -0.300  -15.851 1.00 0.00 ? 50 CY1 A O    4  
HETATM 3004  H H    . CY1 A 1 50 ? 6.635   -4.230  -17.202 1.00 0.00 ? 50 CY1 A H    4  
HETATM 3005  H HA   . CY1 A 1 50 ? 6.905   -2.775  -14.638 1.00 0.00 ? 50 CY1 A HA   4  
HETATM 3006  H HB2  . CY1 A 1 50 ? 8.950   -1.777  -15.891 1.00 0.00 ? 50 CY1 A HB2  4  
HETATM 3007  H HB3  . CY1 A 1 50 ? 8.573   -2.886  -17.199 1.00 0.00 ? 50 CY1 A HB3  4  
HETATM 3008  H HD2  . CY1 A 1 50 ? 10.179  -4.025  -12.946 1.00 0.00 ? 50 CY1 A HD2  4  
HETATM 3009  H HD3  . CY1 A 1 50 ? 8.534   -3.341  -13.113 1.00 0.00 ? 50 CY1 A HD3  4  
HETATM 3010  H HE   . CY1 A 1 50 ? 10.470  -1.686  -14.454 1.00 0.00 ? 50 CY1 A HE   4  
HETATM 3011  H HM1  . CY1 A 1 50 ? 11.724  0.038   -13.160 1.00 0.00 ? 50 CY1 A HM1  4  
HETATM 3012  H HM2  . CY1 A 1 50 ? 10.800  0.643   -11.773 1.00 0.00 ? 50 CY1 A HM2  4  
HETATM 3013  H HM3  . CY1 A 1 50 ? 10.093  0.697   -13.402 1.00 0.00 ? 50 CY1 A HM3  4  
HETATM 3014  N N    . NH2 A 1 51 ? 5.359   -1.239  -16.838 1.00 0.00 ? 51 NH2 A N    4  
HETATM 3015  H HN1  . NH2 A 1 51 ? 4.745   -2.030  -16.899 1.00 0.00 ? 51 NH2 A HN1  4  
HETATM 3016  H HN2  . NH2 A 1 51 ? 5.021   -0.307  -17.002 1.00 0.00 ? 51 NH2 A HN2  4  
ATOM   3017  N N    . LEU A 1 1  ? -8.274  0.835   14.442  1.00 0.00 ? 1  LEU A N    5  
ATOM   3018  C CA   . LEU A 1 1  ? -8.466  0.744   15.913  1.00 0.00 ? 1  LEU A CA   5  
ATOM   3019  C C    . LEU A 1 1  ? -7.193  0.269   16.607  1.00 0.00 ? 1  LEU A C    5  
ATOM   3020  O O    . LEU A 1 1  ? -6.772  0.843   17.611  1.00 0.00 ? 1  LEU A O    5  
ATOM   3021  C CB   . LEU A 1 1  ? -9.616  -0.227  16.193  1.00 0.00 ? 1  LEU A CB   5  
ATOM   3022  C CG   . LEU A 1 1  ? -10.526 0.166   17.359  1.00 0.00 ? 1  LEU A CG   5  
ATOM   3023  C CD1  . LEU A 1 1  ? -9.748  0.166   18.665  1.00 0.00 ? 1  LEU A CD1  5  
ATOM   3024  C CD2  . LEU A 1 1  ? -11.153 1.528   17.107  1.00 0.00 ? 1  LEU A CD2  5  
ATOM   3025  H H1   . LEU A 1 1  ? -9.088  1.348   14.046  1.00 0.00 ? 1  LEU A H1   5  
ATOM   3026  H H2   . LEU A 1 1  ? -8.222  -0.134  14.069  1.00 0.00 ? 1  LEU A H2   5  
ATOM   3027  H H3   . LEU A 1 1  ? -7.388  1.352   14.269  1.00 0.00 ? 1  LEU A H3   5  
ATOM   3028  H HA   . LEU A 1 1  ? -8.728  1.723   16.287  1.00 0.00 ? 1  LEU A HA   5  
ATOM   3029  H HB2  . LEU A 1 1  ? -10.220 -0.303  15.300  1.00 0.00 ? 1  LEU A HB2  5  
ATOM   3030  H HB3  . LEU A 1 1  ? -9.196  -1.198  16.406  1.00 0.00 ? 1  LEU A HB3  5  
ATOM   3031  H HG   . LEU A 1 1  ? -11.321 -0.561  17.445  1.00 0.00 ? 1  LEU A HG   5  
ATOM   3032  H HD11 . LEU A 1 1  ? -10.414 0.410   19.479  1.00 0.00 ? 1  LEU A HD11 5  
ATOM   3033  H HD12 . LEU A 1 1  ? -8.958  0.901   18.614  1.00 0.00 ? 1  LEU A HD12 5  
ATOM   3034  H HD13 . LEU A 1 1  ? -9.320  -0.811  18.830  1.00 0.00 ? 1  LEU A HD13 5  
ATOM   3035  H HD21 . LEU A 1 1  ? -10.421 2.301   17.287  1.00 0.00 ? 1  LEU A HD21 5  
ATOM   3036  H HD22 . LEU A 1 1  ? -11.994 1.666   17.773  1.00 0.00 ? 1  LEU A HD22 5  
ATOM   3037  H HD23 . LEU A 1 1  ? -11.493 1.585   16.084  1.00 0.00 ? 1  LEU A HD23 5  
ATOM   3038  N N    . GLN A 1 2  ? -6.586  -0.781  16.065  1.00 0.00 ? 2  GLN A N    5  
ATOM   3039  C CA   . GLN A 1 2  ? -5.362  -1.331  16.634  1.00 0.00 ? 2  GLN A CA   5  
ATOM   3040  C C    . GLN A 1 2  ? -4.553  -2.072  15.573  1.00 0.00 ? 2  GLN A C    5  
ATOM   3041  O O    . GLN A 1 2  ? -5.097  -2.887  14.829  1.00 0.00 ? 2  GLN A O    5  
ATOM   3042  C CB   . GLN A 1 2  ? -5.691  -2.275  17.791  1.00 0.00 ? 2  GLN A CB   5  
ATOM   3043  C CG   . GLN A 1 2  ? -6.601  -3.427  17.399  1.00 0.00 ? 2  GLN A CG   5  
ATOM   3044  C CD   . GLN A 1 2  ? -6.692  -4.491  18.475  1.00 0.00 ? 2  GLN A CD   5  
ATOM   3045  O OE1  . GLN A 1 2  ? -6.081  -5.555  18.365  1.00 0.00 ? 2  GLN A OE1  5  
ATOM   3046  N NE2  . GLN A 1 2  ? -7.456  -4.209  19.524  1.00 0.00 ? 2  GLN A NE2  5  
ATOM   3047  H H    . GLN A 1 2  ? -6.970  -1.196  15.264  1.00 0.00 ? 2  GLN A H    5  
ATOM   3048  H HA   . GLN A 1 2  ? -4.771  -0.509  17.008  1.00 0.00 ? 2  GLN A HA   5  
ATOM   3049  H HB2  . GLN A 1 2  ? -4.771  -2.687  18.178  1.00 0.00 ? 2  GLN A HB2  5  
ATOM   3050  H HB3  . GLN A 1 2  ? -6.178  -1.710  18.574  1.00 0.00 ? 2  GLN A HB3  5  
ATOM   3051  H HG2  . GLN A 1 2  ? -7.592  -3.040  17.214  1.00 0.00 ? 2  GLN A HG2  5  
ATOM   3052  H HG3  . GLN A 1 2  ? -6.219  -3.879  16.496  1.00 0.00 ? 2  GLN A HG3  5  
ATOM   3053  H HE21 . GLN A 1 2  ? -7.912  -3.342  19.544  1.00 0.00 ? 2  GLN A HE21 5  
ATOM   3054  H HE22 . GLN A 1 2  ? -7.532  -4.879  20.234  1.00 0.00 ? 2  GLN A HE22 5  
ATOM   3055  N N    . MET A 1 3  ? -3.248  -1.793  15.537  1.00 0.00 ? 3  MET A N    5  
ATOM   3056  C CA   . MET A 1 3  ? -2.318  -2.426  14.586  1.00 0.00 ? 3  MET A CA   5  
ATOM   3057  C C    . MET A 1 3  ? -1.051  -1.588  14.406  1.00 0.00 ? 3  MET A C    5  
ATOM   3058  O O    . MET A 1 3  ? 0.052   -2.120  14.524  1.00 0.00 ? 3  MET A O    5  
ATOM   3059  C CB   . MET A 1 3  ? -2.972  -2.698  13.214  1.00 0.00 ? 3  MET A CB   5  
ATOM   3060  C CG   . MET A 1 3  ? -2.995  -4.172  12.827  1.00 0.00 ? 3  MET A CG   5  
ATOM   3061  S SD   . MET A 1 3  ? -3.649  -5.242  14.125  1.00 0.00 ? 3  MET A SD   5  
ATOM   3062  C CE   . MET A 1 3  ? -2.285  -6.380  14.348  1.00 0.00 ? 3  MET A CE   5  
ATOM   3063  H H    . MET A 1 3  ? -2.892  -1.150  16.187  1.00 0.00 ? 3  MET A H    5  
ATOM   3064  H HA   . MET A 1 3  ? -2.022  -3.365  15.014  1.00 0.00 ? 3  MET A HA   5  
ATOM   3065  H HB2  . MET A 1 3  ? -3.989  -2.337  13.225  1.00 0.00 ? 3  MET A HB2  5  
ATOM   3066  H HB3  . MET A 1 3  ? -2.423  -2.167  12.450  1.00 0.00 ? 3  MET A HB3  5  
ATOM   3067  H HG2  . MET A 1 3  ? -3.608  -4.288  11.946  1.00 0.00 ? 3  MET A HG2  5  
ATOM   3068  H HG3  . MET A 1 3  ? -1.985  -4.482  12.601  1.00 0.00 ? 3  MET A HG3  5  
ATOM   3069  H HE1  . MET A 1 3  ? -1.476  -5.877  14.857  1.00 0.00 ? 3  MET A HE1  5  
ATOM   3070  H HE2  . MET A 1 3  ? -1.943  -6.725  13.383  1.00 0.00 ? 3  MET A HE2  5  
ATOM   3071  H HE3  . MET A 1 3  ? -2.612  -7.223  14.937  1.00 0.00 ? 3  MET A HE3  5  
ATOM   3072  N N    . ALA A 1 4  ? -1.212  -0.284  14.126  1.00 0.00 ? 4  ALA A N    5  
ATOM   3073  C CA   . ALA A 1 4  ? -0.085  0.637   13.934  1.00 0.00 ? 4  ALA A CA   5  
ATOM   3074  C C    . ALA A 1 4  ? 1.255   0.041   14.369  1.00 0.00 ? 4  ALA A C    5  
ATOM   3075  O O    . ALA A 1 4  ? 1.723   0.289   15.480  1.00 0.00 ? 4  ALA A O    5  
ATOM   3076  C CB   . ALA A 1 4  ? -0.354  1.918   14.699  1.00 0.00 ? 4  ALA A CB   5  
ATOM   3077  H H    . ALA A 1 4  ? -2.118  0.080   14.048  1.00 0.00 ? 4  ALA A H    5  
ATOM   3078  H HA   . ALA A 1 4  ? -0.033  0.882   12.884  1.00 0.00 ? 4  ALA A HA   5  
ATOM   3079  H HB1  . ALA A 1 4  ? -0.992  1.699   15.543  1.00 0.00 ? 4  ALA A HB1  5  
ATOM   3080  H HB2  . ALA A 1 4  ? -0.845  2.628   14.052  1.00 0.00 ? 4  ALA A HB2  5  
ATOM   3081  H HB3  . ALA A 1 4  ? 0.579   2.332   15.050  1.00 0.00 ? 4  ALA A HB3  5  
ATOM   3082  N N    . GLY A 1 5  ? 1.861   -0.750  13.487  1.00 0.00 ? 5  GLY A N    5  
ATOM   3083  C CA   . GLY A 1 5  ? 3.142   -1.374  13.798  1.00 0.00 ? 5  GLY A CA   5  
ATOM   3084  C C    . GLY A 1 5  ? 3.060   -2.888  13.803  1.00 0.00 ? 5  GLY A C    5  
ATOM   3085  O O    . GLY A 1 5  ? 3.649   -3.545  14.661  1.00 0.00 ? 5  GLY A O    5  
ATOM   3086  H H    . GLY A 1 5  ? 1.435   -0.914  12.617  1.00 0.00 ? 5  GLY A H    5  
ATOM   3087  H HA2  . GLY A 1 5  ? 3.873   -1.065  13.058  1.00 0.00 ? 5  GLY A HA2  5  
ATOM   3088  H HA3  . GLY A 1 5  ? 3.475   -1.040  14.773  1.00 0.00 ? 5  GLY A HA3  5  
ATOM   3089  N N    . GLN A 1 6  ? 2.336   -3.444  12.834  1.00 0.00 ? 6  GLN A N    5  
ATOM   3090  C CA   . GLN A 1 6  ? 2.182   -4.883  12.717  1.00 0.00 ? 6  GLN A CA   5  
ATOM   3091  C C    . GLN A 1 6  ? 1.276   -5.222  11.545  1.00 0.00 ? 6  GLN A C    5  
ATOM   3092  O O    . GLN A 1 6  ? 0.139   -5.662  11.716  1.00 0.00 ? 6  GLN A O    5  
ATOM   3093  C CB   . GLN A 1 6  ? 1.635   -5.481  14.017  1.00 0.00 ? 6  GLN A CB   5  
ATOM   3094  C CG   . GLN A 1 6  ? 2.449   -6.656  14.534  1.00 0.00 ? 6  GLN A CG   5  
ATOM   3095  C CD   . GLN A 1 6  ? 3.724   -6.219  15.230  1.00 0.00 ? 6  GLN A CD   5  
ATOM   3096  O OE1  . GLN A 1 6  ? 3.685   -5.632  16.311  1.00 0.00 ? 6  GLN A OE1  5  
ATOM   3097  N NE2  . GLN A 1 6  ? 4.864   -6.502  14.609  1.00 0.00 ? 6  GLN A NE2  5  
ATOM   3098  H H    . GLN A 1 6  ? 1.904   -2.872  12.173  1.00 0.00 ? 6  GLN A H    5  
ATOM   3099  H HA   . GLN A 1 6  ? 3.155   -5.290  12.517  1.00 0.00 ? 6  GLN A HA   5  
ATOM   3100  H HB2  . GLN A 1 6  ? 1.628   -4.715  14.777  1.00 0.00 ? 6  GLN A HB2  5  
ATOM   3101  H HB3  . GLN A 1 6  ? 0.623   -5.819  13.850  1.00 0.00 ? 6  GLN A HB3  5  
ATOM   3102  H HG2  . GLN A 1 6  ? 1.848   -7.213  15.237  1.00 0.00 ? 6  GLN A HG2  5  
ATOM   3103  H HG3  . GLN A 1 6  ? 2.710   -7.291  13.701  1.00 0.00 ? 6  GLN A HG3  5  
ATOM   3104  H HE21 . GLN A 1 6  ? 4.819   -6.970  13.750  1.00 0.00 ? 6  GLN A HE21 5  
ATOM   3105  H HE22 . GLN A 1 6  ? 5.703   -6.231  15.037  1.00 0.00 ? 6  GLN A HE22 5  
ATOM   3106  N N    . CYS A 1 7  ? 1.801   -4.994  10.354  1.00 0.00 ? 7  CYS A N    5  
ATOM   3107  C CA   . CYS A 1 7  ? 1.068   -5.253  9.120   1.00 0.00 ? 7  CYS A CA   5  
ATOM   3108  C C    . CYS A 1 7  ? 1.916   -6.045  8.139   1.00 0.00 ? 7  CYS A C    5  
ATOM   3109  O O    . CYS A 1 7  ? 3.134   -5.869  8.078   1.00 0.00 ? 7  CYS A O    5  
ATOM   3110  C CB   . CYS A 1 7  ? 0.648   -3.936  8.472   1.00 0.00 ? 7  CYS A CB   5  
ATOM   3111  S SG   . CYS A 1 7  ? -0.894  -3.239  9.139   1.00 0.00 ? 7  CYS A SG   5  
ATOM   3112  H H    . CYS A 1 7  ? 2.710   -4.631  10.306  1.00 0.00 ? 7  CYS A H    5  
ATOM   3113  H HA   . CYS A 1 7  ? 0.187   -5.822  9.365   1.00 0.00 ? 7  CYS A HA   5  
ATOM   3114  H HB2  . CYS A 1 7  ? 1.429   -3.207  8.623   1.00 0.00 ? 7  CYS A HB2  5  
ATOM   3115  H HB3  . CYS A 1 7  ? 0.510   -4.092  7.410   1.00 0.00 ? 7  CYS A HB3  5  
ATOM   3116  N N    . SER A 1 8  ? 1.272   -6.903  7.353   1.00 0.00 ? 8  SER A N    5  
ATOM   3117  C CA   . SER A 1 8  ? 1.986   -7.688  6.358   1.00 0.00 ? 8  SER A CA   5  
ATOM   3118  C C    . SER A 1 8  ? 2.842   -6.765  5.504   1.00 0.00 ? 8  SER A C    5  
ATOM   3119  O O    . SER A 1 8  ? 2.513   -5.594  5.322   1.00 0.00 ? 8  SER A O    5  
ATOM   3120  C CB   . SER A 1 8  ? 1.005   -8.465  5.477   1.00 0.00 ? 8  SER A CB   5  
ATOM   3121  O OG   . SER A 1 8  ? 0.328   -9.461  6.224   1.00 0.00 ? 8  SER A OG   5  
ATOM   3122  H H    . SER A 1 8  ? 0.299   -6.995  7.431   1.00 0.00 ? 8  SER A H    5  
ATOM   3123  H HA   . SER A 1 8  ? 2.630   -8.383  6.875   1.00 0.00 ? 8  SER A HA   5  
ATOM   3124  H HB2  . SER A 1 8  ? 0.275   -7.783  5.066   1.00 0.00 ? 8  SER A HB2  5  
ATOM   3125  H HB3  . SER A 1 8  ? 1.546   -8.940  4.673   1.00 0.00 ? 8  SER A HB3  5  
ATOM   3126  H HG   . SER A 1 8  ? -0.007  -9.078  7.038   1.00 0.00 ? 8  SER A HG   5  
ATOM   3127  N N    . GLN A 1 9  ? 3.950   -7.277  5.001   1.00 0.00 ? 9  GLN A N    5  
ATOM   3128  C CA   . GLN A 1 9  ? 4.847   -6.469  4.197   1.00 0.00 ? 9  GLN A CA   5  
ATOM   3129  C C    . GLN A 1 9  ? 4.114   -5.764  3.068   1.00 0.00 ? 9  GLN A C    5  
ATOM   3130  O O    . GLN A 1 9  ? 3.428   -6.388  2.259   1.00 0.00 ? 9  GLN A O    5  
ATOM   3131  C CB   . GLN A 1 9  ? 5.992   -7.317  3.643   1.00 0.00 ? 9  GLN A CB   5  
ATOM   3132  C CG   . GLN A 1 9  ? 7.130   -7.520  4.630   1.00 0.00 ? 9  GLN A CG   5  
ATOM   3133  C CD   . GLN A 1 9  ? 6.857   -8.641  5.613   1.00 0.00 ? 9  GLN A CD   5  
ATOM   3134  O OE1  . GLN A 1 9  ? 5.725   -8.831  6.059   1.00 0.00 ? 9  GLN A OE1  5  
ATOM   3135  N NE2  . GLN A 1 9  ? 7.898   -9.392  5.957   1.00 0.00 ? 9  GLN A NE2  5  
ATOM   3136  H H    . GLN A 1 9  ? 4.182   -8.205  5.190   1.00 0.00 ? 9  GLN A H    5  
ATOM   3137  H HA   . GLN A 1 9  ? 5.248   -5.713  4.845   1.00 0.00 ? 9  GLN A HA   5  
ATOM   3138  H HB2  . GLN A 1 9  ? 5.606   -8.287  3.368   1.00 0.00 ? 9  GLN A HB2  5  
ATOM   3139  H HB3  . GLN A 1 9  ? 6.390   -6.835  2.763   1.00 0.00 ? 9  GLN A HB3  5  
ATOM   3140  H HG2  . GLN A 1 9  ? 8.029   -7.756  4.080   1.00 0.00 ? 9  GLN A HG2  5  
ATOM   3141  H HG3  . GLN A 1 9  ? 7.277   -6.604  5.183   1.00 0.00 ? 9  GLN A HG3  5  
ATOM   3142  H HE21 . GLN A 1 9  ? 8.770   -9.184  5.563   1.00 0.00 ? 9  GLN A HE21 5  
ATOM   3143  H HE22 . GLN A 1 9  ? 7.751   -10.125 6.592   1.00 0.00 ? 9  GLN A HE22 5  
ATOM   3144  N N    . ASN A 1 10 ? 4.273   -4.449  3.037   1.00 0.00 ? 10 ASN A N    5  
ATOM   3145  C CA   . ASN A 1 10 ? 3.643   -3.617  2.030   1.00 0.00 ? 10 ASN A CA   5  
ATOM   3146  C C    . ASN A 1 10 ? 2.132   -3.655  2.151   1.00 0.00 ? 10 ASN A C    5  
ATOM   3147  O O    . ASN A 1 10 ? 1.416   -3.472  1.167   1.00 0.00 ? 10 ASN A O    5  
ATOM   3148  C CB   . ASN A 1 10 ? 4.075   -4.038  0.625   1.00 0.00 ? 10 ASN A CB   5  
ATOM   3149  C CG   . ASN A 1 10 ? 4.644   -2.876  -0.159  1.00 0.00 ? 10 ASN A CG   5  
ATOM   3150  O OD1  . ASN A 1 10 ? 4.302   -2.672  -1.324  1.00 0.00 ? 10 ASN A OD1  5  
ATOM   3151  N ND2  . ASN A 1 10 ? 5.513   -2.104  0.483   1.00 0.00 ? 10 ASN A ND2  5  
ATOM   3152  H H    . ASN A 1 10 ? 4.835   -4.024  3.722   1.00 0.00 ? 10 ASN A H    5  
ATOM   3153  H HA   . ASN A 1 10 ? 3.962   -2.607  2.206   1.00 0.00 ? 10 ASN A HA   5  
ATOM   3154  H HB2  . ASN A 1 10 ? 4.832   -4.805  0.698   1.00 0.00 ? 10 ASN A HB2  5  
ATOM   3155  H HB3  . ASN A 1 10 ? 3.222   -4.428  0.090   1.00 0.00 ? 10 ASN A HB3  5  
ATOM   3156  H HD21 . ASN A 1 10 ? 5.734   -2.330  1.410   1.00 0.00 ? 10 ASN A HD21 5  
ATOM   3157  H HD22 . ASN A 1 10 ? 5.893   -1.337  0.010   1.00 0.00 ? 10 ASN A HD22 5  
ATOM   3158  N N    . GLU A 1 11 ? 1.648   -3.878  3.364   1.00 0.00 ? 11 GLU A N    5  
ATOM   3159  C CA   . GLU A 1 11 ? 0.206   -3.918  3.582   1.00 0.00 ? 11 GLU A CA   5  
ATOM   3160  C C    . GLU A 1 11 ? -0.275  -2.740  4.403   1.00 0.00 ? 11 GLU A C    5  
ATOM   3161  O O    . GLU A 1 11 ? 0.417   -2.282  5.313   1.00 0.00 ? 11 GLU A O    5  
ATOM   3162  C CB   . GLU A 1 11 ? -0.233  -5.243  4.207   1.00 0.00 ? 11 GLU A CB   5  
ATOM   3163  C CG   . GLU A 1 11 ? -0.889  -6.187  3.211   1.00 0.00 ? 11 GLU A CG   5  
ATOM   3164  C CD   . GLU A 1 11 ? 0.084   -7.201  2.643   1.00 0.00 ? 11 GLU A CD   5  
ATOM   3165  O OE1  . GLU A 1 11 ? 1.006   -6.792  1.905   1.00 0.00 ? 11 GLU A OE1  5  
ATOM   3166  O OE2  . GLU A 1 11 ? -0.074  -8.404  2.936   1.00 0.00 ? 11 GLU A OE2  5  
ATOM   3167  H H    . GLU A 1 11 ? 2.275   -4.010  4.120   1.00 0.00 ? 11 GLU A H    5  
ATOM   3168  H HA   . GLU A 1 11 ? -0.246  -3.827  2.628   1.00 0.00 ? 11 GLU A HA   5  
ATOM   3169  H HB2  . GLU A 1 11 ? 0.627   -5.738  4.626   1.00 0.00 ? 11 GLU A HB2  5  
ATOM   3170  H HB3  . GLU A 1 11 ? -0.942  -5.041  4.995   1.00 0.00 ? 11 GLU A HB3  5  
ATOM   3171  H HG2  . GLU A 1 11 ? -1.686  -6.716  3.706   1.00 0.00 ? 11 GLU A HG2  5  
ATOM   3172  H HG3  . GLU A 1 11 ? -1.295  -5.605  2.394   1.00 0.00 ? 11 GLU A HG3  5  
ATOM   3173  N N    . TYR A 1 12 ? -1.472  -2.244  4.072   1.00 0.00 ? 12 TYR A N    5  
ATOM   3174  C CA   . TYR A 1 12 ? -2.027  -1.098  4.798   1.00 0.00 ? 12 TYR A CA   5  
ATOM   3175  C C    . TYR A 1 12 ? -3.292  -1.478  5.553   1.00 0.00 ? 12 TYR A C    5  
ATOM   3176  O O    . TYR A 1 12 ? -4.245  -1.999  4.975   1.00 0.00 ? 12 TYR A O    5  
ATOM   3177  C CB   . TYR A 1 12 ? -2.276  0.090   3.857   1.00 0.00 ? 12 TYR A CB   5  
ATOM   3178  C CG   . TYR A 1 12 ? -3.644  0.129   3.201   1.00 0.00 ? 12 TYR A CG   5  
ATOM   3179  C CD1  . TYR A 1 12 ? -4.702  0.791   3.808   1.00 0.00 ? 12 TYR A CD1  5  
ATOM   3180  C CD2  . TYR A 1 12 ? -3.869  -0.479  1.973   1.00 0.00 ? 12 TYR A CD2  5  
ATOM   3181  C CE1  . TYR A 1 12 ? -5.946  0.844   3.211   1.00 0.00 ? 12 TYR A CE1  5  
ATOM   3182  C CE2  . TYR A 1 12 ? -5.112  -0.432  1.371   1.00 0.00 ? 12 TYR A CE2  5  
ATOM   3183  C CZ   . TYR A 1 12 ? -6.147  0.231   1.993   1.00 0.00 ? 12 TYR A CZ   5  
ATOM   3184  O OH   . TYR A 1 12 ? -7.385  0.282   1.395   1.00 0.00 ? 12 TYR A OH   5  
ATOM   3185  H H    . TYR A 1 12 ? -1.993  -2.659  3.325   1.00 0.00 ? 12 TYR A H    5  
ATOM   3186  H HA   . TYR A 1 12 ? -1.286  -0.796  5.528   1.00 0.00 ? 12 TYR A HA   5  
ATOM   3187  H HB2  . TYR A 1 12 ? -2.166  1.001   4.424   1.00 0.00 ? 12 TYR A HB2  5  
ATOM   3188  H HB3  . TYR A 1 12 ? -1.535  0.073   3.074   1.00 0.00 ? 12 TYR A HB3  5  
ATOM   3189  H HD1  . TYR A 1 12 ? -4.544  1.270   4.762   1.00 0.00 ? 12 TYR A HD1  5  
ATOM   3190  H HD2  . TYR A 1 12 ? -3.057  -0.994  1.484   1.00 0.00 ? 12 TYR A HD2  5  
ATOM   3191  H HE1  . TYR A 1 12 ? -6.757  1.367   3.698   1.00 0.00 ? 12 TYR A HE1  5  
ATOM   3192  H HE2  . TYR A 1 12 ? -5.268  -0.914  0.417   1.00 0.00 ? 12 TYR A HE2  5  
ATOM   3193  H HH   . TYR A 1 12 ? -7.956  -0.384  1.785   1.00 0.00 ? 12 TYR A HH   5  
ATOM   3194  N N    . PHE A 1 13 ? -3.277  -1.218  6.857   1.00 0.00 ? 13 PHE A N    5  
ATOM   3195  C CA   . PHE A 1 13 ? -4.406  -1.533  7.728   1.00 0.00 ? 13 PHE A CA   5  
ATOM   3196  C C    . PHE A 1 13 ? -5.527  -0.524  7.566   1.00 0.00 ? 13 PHE A C    5  
ATOM   3197  O O    . PHE A 1 13 ? -5.592  0.468   8.292   1.00 0.00 ? 13 PHE A O    5  
ATOM   3198  C CB   . PHE A 1 13 ? -3.958  -1.564  9.189   1.00 0.00 ? 13 PHE A CB   5  
ATOM   3199  C CG   . PHE A 1 13 ? -5.045  -1.960  10.145  1.00 0.00 ? 13 PHE A CG   5  
ATOM   3200  C CD1  . PHE A 1 13 ? -5.547  -3.251  10.146  1.00 0.00 ? 13 PHE A CD1  5  
ATOM   3201  C CD2  . PHE A 1 13 ? -5.562  -1.042  11.045  1.00 0.00 ? 13 PHE A CD2  5  
ATOM   3202  C CE1  . PHE A 1 13 ? -6.547  -3.619  11.026  1.00 0.00 ? 13 PHE A CE1  5  
ATOM   3203  C CE2  . PHE A 1 13 ? -6.561  -1.404  11.927  1.00 0.00 ? 13 PHE A CE2  5  
ATOM   3204  C CZ   . PHE A 1 13 ? -7.055  -2.694  11.918  1.00 0.00 ? 13 PHE A CZ   5  
ATOM   3205  H H    . PHE A 1 13 ? -2.477  -0.804  7.245   1.00 0.00 ? 13 PHE A H    5  
ATOM   3206  H HA   . PHE A 1 13 ? -4.777  -2.512  7.455   1.00 0.00 ? 13 PHE A HA   5  
ATOM   3207  H HB2  . PHE A 1 13 ? -3.157  -2.272  9.295   1.00 0.00 ? 13 PHE A HB2  5  
ATOM   3208  H HB3  . PHE A 1 13 ? -3.605  -0.583  9.472   1.00 0.00 ? 13 PHE A HB3  5  
ATOM   3209  H HD1  . PHE A 1 13 ? -5.151  -3.974  9.450   1.00 0.00 ? 13 PHE A HD1  5  
ATOM   3210  H HD2  . PHE A 1 13 ? -5.176  -0.033  11.053  1.00 0.00 ? 13 PHE A HD2  5  
ATOM   3211  H HE1  . PHE A 1 13 ? -6.930  -4.628  11.018  1.00 0.00 ? 13 PHE A HE1  5  
ATOM   3212  H HE2  . PHE A 1 13 ? -6.957  -0.679  12.624  1.00 0.00 ? 13 PHE A HE2  5  
ATOM   3213  H HZ   . PHE A 1 13 ? -7.835  -2.980  12.607  1.00 0.00 ? 13 PHE A HZ   5  
ATOM   3214  N N    . ASP A 1 14 ? -6.425  -0.792  6.632   1.00 0.00 ? 14 ASP A N    5  
ATOM   3215  C CA   . ASP A 1 14 ? -7.559  0.096   6.406   1.00 0.00 ? 14 ASP A CA   5  
ATOM   3216  C C    . ASP A 1 14 ? -8.448  0.120   7.638   1.00 0.00 ? 14 ASP A C    5  
ATOM   3217  O O    . ASP A 1 14 ? -9.182  -0.829  7.897   1.00 0.00 ? 14 ASP A O    5  
ATOM   3218  C CB   . ASP A 1 14 ? -8.366  -0.357  5.189   1.00 0.00 ? 14 ASP A CB   5  
ATOM   3219  C CG   . ASP A 1 14 ? -9.044  0.799   4.480   1.00 0.00 ? 14 ASP A CG   5  
ATOM   3220  O OD1  . ASP A 1 14 ? -8.655  1.959   4.728   1.00 0.00 ? 14 ASP A OD1  5  
ATOM   3221  O OD2  . ASP A 1 14 ? -9.964  0.543   3.676   1.00 0.00 ? 14 ASP A OD2  5  
ATOM   3222  H H    . ASP A 1 14 ? -6.332  -1.614  6.096   1.00 0.00 ? 14 ASP A H    5  
ATOM   3223  H HA   . ASP A 1 14 ? -7.182  1.093   6.230   1.00 0.00 ? 14 ASP A HA   5  
ATOM   3224  H HB2  . ASP A 1 14 ? -7.706  -0.848  4.490   1.00 0.00 ? 14 ASP A HB2  5  
ATOM   3225  H HB3  . ASP A 1 14 ? -9.125  -1.051  5.512   1.00 0.00 ? 14 ASP A HB3  5  
ATOM   3226  N N    . SER A 1 15 ? -8.376  1.206   8.404   1.00 0.00 ? 15 SER A N    5  
ATOM   3227  C CA   . SER A 1 15 ? -9.184  1.325   9.615   1.00 0.00 ? 15 SER A CA   5  
ATOM   3228  C C    . SER A 1 15 ? -10.666 1.091   9.320   1.00 0.00 ? 15 SER A C    5  
ATOM   3229  O O    . SER A 1 15 ? -11.460 0.885   10.238  1.00 0.00 ? 15 SER A O    5  
ATOM   3230  C CB   . SER A 1 15 ? -8.982  2.688   10.301  1.00 0.00 ? 15 SER A CB   5  
ATOM   3231  O OG   . SER A 1 15 ? -10.043 2.967   11.197  1.00 0.00 ? 15 SER A OG   5  
ATOM   3232  H H    . SER A 1 15 ? -7.768  1.928   8.155   1.00 0.00 ? 15 SER A H    5  
ATOM   3233  H HA   . SER A 1 15 ? -8.853  0.549   10.286  1.00 0.00 ? 15 SER A HA   5  
ATOM   3234  H HB2  . SER A 1 15 ? -8.057  2.674   10.860  1.00 0.00 ? 15 SER A HB2  5  
ATOM   3235  H HB3  . SER A 1 15 ? -8.939  3.475   9.560   1.00 0.00 ? 15 SER A HB3  5  
ATOM   3236  H HG   . SER A 1 15 ? -9.732  2.879   12.100  1.00 0.00 ? 15 SER A HG   5  
ATOM   3237  N N    . LEU A 1 16 ? -11.036 1.096   8.038   1.00 0.00 ? 16 LEU A N    5  
ATOM   3238  C CA   . LEU A 1 16 ? -12.418 0.858   7.652   1.00 0.00 ? 16 LEU A CA   5  
ATOM   3239  C C    . LEU A 1 16 ? -12.635 -0.630  7.389   1.00 0.00 ? 16 LEU A C    5  
ATOM   3240  O O    . LEU A 1 16 ? -13.749 -1.139  7.510   1.00 0.00 ? 16 LEU A O    5  
ATOM   3241  C CB   . LEU A 1 16 ? -12.775 1.676   6.408   1.00 0.00 ? 16 LEU A CB   5  
ATOM   3242  C CG   . LEU A 1 16 ? -13.758 2.822   6.650   1.00 0.00 ? 16 LEU A CG   5  
ATOM   3243  C CD1  . LEU A 1 16 ? -13.025 4.056   7.155   1.00 0.00 ? 16 LEU A CD1  5  
ATOM   3244  C CD2  . LEU A 1 16 ? -14.527 3.140   5.376   1.00 0.00 ? 16 LEU A CD2  5  
ATOM   3245  H H    . LEU A 1 16 ? -10.368 1.246   7.337   1.00 0.00 ? 16 LEU A H    5  
ATOM   3246  H HA   . LEU A 1 16 ? -13.049 1.164   8.471   1.00 0.00 ? 16 LEU A HA   5  
ATOM   3247  H HB2  . LEU A 1 16 ? -11.863 2.089   6.002   1.00 0.00 ? 16 LEU A HB2  5  
ATOM   3248  H HB3  . LEU A 1 16 ? -13.206 1.011   5.674   1.00 0.00 ? 16 LEU A HB3  5  
ATOM   3249  H HG   . LEU A 1 16 ? -14.470 2.524   7.406   1.00 0.00 ? 16 LEU A HG   5  
ATOM   3250  H HD11 . LEU A 1 16 ? -13.522 4.943   6.791   1.00 0.00 ? 16 LEU A HD11 5  
ATOM   3251  H HD12 . LEU A 1 16 ? -12.006 4.041   6.797   1.00 0.00 ? 16 LEU A HD12 5  
ATOM   3252  H HD13 . LEU A 1 16 ? -13.027 4.058   8.235   1.00 0.00 ? 16 LEU A HD13 5  
ATOM   3253  H HD21 . LEU A 1 16 ? -14.752 4.196   5.346   1.00 0.00 ? 16 LEU A HD21 5  
ATOM   3254  H HD22 . LEU A 1 16 ? -15.448 2.576   5.362   1.00 0.00 ? 16 LEU A HD22 5  
ATOM   3255  H HD23 . LEU A 1 16 ? -13.928 2.874   4.518   1.00 0.00 ? 16 LEU A HD23 5  
ATOM   3256  N N    . LEU A 1 17 ? -11.555 -1.318  7.024   1.00 0.00 ? 17 LEU A N    5  
ATOM   3257  C CA   . LEU A 1 17 ? -11.606 -2.744  6.736   1.00 0.00 ? 17 LEU A CA   5  
ATOM   3258  C C    . LEU A 1 17 ? -11.065 -3.568  7.901   1.00 0.00 ? 17 LEU A C    5  
ATOM   3259  O O    . LEU A 1 17 ? -11.396 -4.746  8.039   1.00 0.00 ? 17 LEU A O    5  
ATOM   3260  C CB   . LEU A 1 17 ? -10.795 -3.037  5.476   1.00 0.00 ? 17 LEU A CB   5  
ATOM   3261  C CG   . LEU A 1 17 ? -11.215 -2.239  4.242   1.00 0.00 ? 17 LEU A CG   5  
ATOM   3262  C CD1  . LEU A 1 17 ? -10.114 -2.257  3.193   1.00 0.00 ? 17 LEU A CD1  5  
ATOM   3263  C CD2  . LEU A 1 17 ? -12.511 -2.791  3.667   1.00 0.00 ? 17 LEU A CD2  5  
ATOM   3264  H H    . LEU A 1 17 ? -10.697 -0.854  6.940   1.00 0.00 ? 17 LEU A H    5  
ATOM   3265  H HA   . LEU A 1 17 ? -12.637 -3.014  6.560   1.00 0.00 ? 17 LEU A HA   5  
ATOM   3266  H HB2  . LEU A 1 17 ? -9.757  -2.816  5.688   1.00 0.00 ? 17 LEU A HB2  5  
ATOM   3267  H HB3  . LEU A 1 17 ? -10.885 -4.088  5.249   1.00 0.00 ? 17 LEU A HB3  5  
ATOM   3268  H HG   . LEU A 1 17 ? -11.386 -1.212  4.529   1.00 0.00 ? 17 LEU A HG   5  
ATOM   3269  H HD11 . LEU A 1 17 ? -10.200 -3.151  2.594   1.00 0.00 ? 17 LEU A HD11 5  
ATOM   3270  H HD12 . LEU A 1 17 ? -9.151  -2.242  3.682   1.00 0.00 ? 17 LEU A HD12 5  
ATOM   3271  H HD13 . LEU A 1 17 ? -10.209 -1.388  2.557   1.00 0.00 ? 17 LEU A HD13 5  
ATOM   3272  H HD21 . LEU A 1 17 ? -13.053 -3.315  4.440   1.00 0.00 ? 17 LEU A HD21 5  
ATOM   3273  H HD22 . LEU A 1 17 ? -12.286 -3.473  2.860   1.00 0.00 ? 17 LEU A HD22 5  
ATOM   3274  H HD23 . LEU A 1 17 ? -13.114 -1.977  3.293   1.00 0.00 ? 17 LEU A HD23 5  
ATOM   3275  N N    . HIS A 1 18 ? -10.226 -2.955  8.736   1.00 0.00 ? 18 HIS A N    5  
ATOM   3276  C CA   . HIS A 1 18 ? -9.644  -3.656  9.875   1.00 0.00 ? 18 HIS A CA   5  
ATOM   3277  C C    . HIS A 1 18 ? -8.793  -4.822  9.396   1.00 0.00 ? 18 HIS A C    5  
ATOM   3278  O O    . HIS A 1 18 ? -8.893  -5.938  9.907   1.00 0.00 ? 18 HIS A O    5  
ATOM   3279  C CB   . HIS A 1 18 ? -10.743 -4.167  10.793  1.00 0.00 ? 18 HIS A CB   5  
ATOM   3280  C CG   . HIS A 1 18 ? -10.406 -4.076  12.249  1.00 0.00 ? 18 HIS A CG   5  
ATOM   3281  N ND1  . HIS A 1 18 ? -10.414 -2.889  12.951  1.00 0.00 ? 18 HIS A ND1  5  
ATOM   3282  C CD2  . HIS A 1 18 ? -10.048 -5.034  13.138  1.00 0.00 ? 18 HIS A CD2  5  
ATOM   3283  C CE1  . HIS A 1 18 ? -10.076 -3.120  14.208  1.00 0.00 ? 18 HIS A CE1  5  
ATOM   3284  N NE2  . HIS A 1 18 ? -9.850  -4.413  14.346  1.00 0.00 ? 18 HIS A NE2  5  
ATOM   3285  H H    . HIS A 1 18 ? -9.987  -2.015  8.579   1.00 0.00 ? 18 HIS A H    5  
ATOM   3286  H HA   . HIS A 1 18 ? -9.021  -2.960  10.416  1.00 0.00 ? 18 HIS A HA   5  
ATOM   3287  H HB2  . HIS A 1 18 ? -11.638 -3.592  10.620  1.00 0.00 ? 18 HIS A HB2  5  
ATOM   3288  H HB3  . HIS A 1 18 ? -10.934 -5.202  10.557  1.00 0.00 ? 18 HIS A HB3  5  
ATOM   3289  H HD1  . HIS A 1 18 ? -10.634 -2.007  12.583  1.00 0.00 ? 18 HIS A HD1  5  
ATOM   3290  H HD2  . HIS A 1 18 ? -9.940  -6.089  12.933  1.00 0.00 ? 18 HIS A HD2  5  
ATOM   3291  H HE1  . HIS A 1 18 ? -10.000 -2.378  14.988  1.00 0.00 ? 18 HIS A HE1  5  
ATOM   3292  H HE2  . HIS A 1 18 ? -9.665  -4.867  15.195  1.00 0.00 ? 18 HIS A HE2  5  
ATOM   3293  N N    . ALA A 1 19 ? -7.964  -4.551  8.405   1.00 0.00 ? 19 ALA A N    5  
ATOM   3294  C CA   . ALA A 1 19 ? -7.096  -5.556  7.831   1.00 0.00 ? 19 ALA A CA   5  
ATOM   3295  C C    . ALA A 1 19 ? -6.003  -4.918  7.003   1.00 0.00 ? 19 ALA A C    5  
ATOM   3296  O O    . ALA A 1 19 ? -6.276  -4.134  6.094   1.00 0.00 ? 19 ALA A O    5  
ATOM   3297  C CB   . ALA A 1 19 ? -7.886  -6.502  6.946   1.00 0.00 ? 19 ALA A CB   5  
ATOM   3298  H H    . ALA A 1 19 ? -7.939  -3.651  8.046   1.00 0.00 ? 19 ALA A H    5  
ATOM   3299  H HA   . ALA A 1 19 ? -6.653  -6.127  8.633   1.00 0.00 ? 19 ALA A HA   5  
ATOM   3300  H HB1  . ALA A 1 19 ? -7.582  -6.357  5.914   1.00 0.00 ? 19 ALA A HB1  5  
ATOM   3301  H HB2  . ALA A 1 19 ? -8.940  -6.292  7.045   1.00 0.00 ? 19 ALA A HB2  5  
ATOM   3302  H HB3  . ALA A 1 19 ? -7.689  -7.522  7.240   1.00 0.00 ? 19 ALA A HB3  5  
ATOM   3303  N N    . CYS A 1 20 ? -4.774  -5.273  7.299   1.00 0.00 ? 20 CYS A N    5  
ATOM   3304  C CA   . CYS A 1 20 ? -3.657  -4.753  6.539   1.00 0.00 ? 20 CYS A CA   5  
ATOM   3305  C C    . CYS A 1 20 ? -3.724  -5.317  5.123   1.00 0.00 ? 20 CYS A C    5  
ATOM   3306  O O    . CYS A 1 20 ? -3.469  -6.499  4.892   1.00 0.00 ? 20 CYS A O    5  
ATOM   3307  C CB   . CYS A 1 20 ? -2.315  -5.093  7.192   1.00 0.00 ? 20 CYS A CB   5  
ATOM   3308  S SG   . CYS A 1 20 ? -2.238  -4.757  8.981   1.00 0.00 ? 20 CYS A SG   5  
ATOM   3309  H H    . CYS A 1 20 ? -4.623  -5.907  8.022   1.00 0.00 ? 20 CYS A H    5  
ATOM   3310  H HA   . CYS A 1 20 ? -3.780  -3.686  6.487   1.00 0.00 ? 20 CYS A HA   5  
ATOM   3311  H HB2  . CYS A 1 20 ? -2.109  -6.142  7.047   1.00 0.00 ? 20 CYS A HB2  5  
ATOM   3312  H HB3  . CYS A 1 20 ? -1.541  -4.510  6.715   1.00 0.00 ? 20 CYS A HB3  5  
ATOM   3313  N N    . ILE A 1 21 ? -4.125  -4.462  4.198   1.00 0.00 ? 21 ILE A N    5  
ATOM   3314  C CA   . ILE A 1 21 ? -4.300  -4.831  2.798   1.00 0.00 ? 21 ILE A CA   5  
ATOM   3315  C C    . ILE A 1 21 ? -3.272  -4.156  1.902   1.00 0.00 ? 21 ILE A C    5  
ATOM   3316  O O    . ILE A 1 21 ? -2.903  -3.009  2.131   1.00 0.00 ? 21 ILE A O    5  
ATOM   3317  C CB   . ILE A 1 21 ? -5.699  -4.394  2.343   1.00 0.00 ? 21 ILE A CB   5  
ATOM   3318  C CG1  . ILE A 1 21 ? -6.765  -5.125  3.159   1.00 0.00 ? 21 ILE A CG1  5  
ATOM   3319  C CG2  . ILE A 1 21 ? -5.915  -4.622  0.849   1.00 0.00 ? 21 ILE A CG2  5  
ATOM   3320  C CD1  . ILE A 1 21 ? -8.133  -4.484  3.091   1.00 0.00 ? 21 ILE A CD1  5  
ATOM   3321  H H    . ILE A 1 21 ? -4.346  -3.554  4.472   1.00 0.00 ? 21 ILE A H    5  
ATOM   3322  H HA   . ILE A 1 21 ? -4.221  -5.900  2.707   1.00 0.00 ? 21 ILE A HA   5  
ATOM   3323  H HB   . ILE A 1 21 ? -5.767  -3.332  2.536   1.00 0.00 ? 21 ILE A HB   5  
ATOM   3324  H HG12 . ILE A 1 21 ? -6.858  -6.136  2.791   1.00 0.00 ? 21 ILE A HG12 5  
ATOM   3325  H HG13 . ILE A 1 21 ? -6.461  -5.152  4.194   1.00 0.00 ? 21 ILE A HG13 5  
ATOM   3326  H HG21 . ILE A 1 21 ? -6.155  -5.661  0.675   1.00 0.00 ? 21 ILE A HG21 5  
ATOM   3327  H HG22 . ILE A 1 21 ? -5.021  -4.361  0.305   1.00 0.00 ? 21 ILE A HG22 5  
ATOM   3328  H HG23 . ILE A 1 21 ? -6.734  -4.005  0.509   1.00 0.00 ? 21 ILE A HG23 5  
ATOM   3329  H HD11 . ILE A 1 21 ? -8.831  -5.172  2.640   1.00 0.00 ? 21 ILE A HD11 5  
ATOM   3330  H HD12 . ILE A 1 21 ? -8.080  -3.584  2.496   1.00 0.00 ? 21 ILE A HD12 5  
ATOM   3331  H HD13 . ILE A 1 21 ? -8.464  -4.239  4.090   1.00 0.00 ? 21 ILE A HD13 5  
ATOM   3332  N N    . PRO A 1 22 ? -2.806  -4.849  0.852   1.00 0.00 ? 22 PRO A N    5  
ATOM   3333  C CA   . PRO A 1 22 ? -1.826  -4.285  -0.077  1.00 0.00 ? 22 PRO A CA   5  
ATOM   3334  C C    . PRO A 1 22 ? -2.293  -2.970  -0.696  1.00 0.00 ? 22 PRO A C    5  
ATOM   3335  O O    . PRO A 1 22 ? -3.468  -2.807  -1.025  1.00 0.00 ? 22 PRO A O    5  
ATOM   3336  C CB   . PRO A 1 22 ? -1.669  -5.366  -1.156  1.00 0.00 ? 22 PRO A CB   5  
ATOM   3337  C CG   . PRO A 1 22 ? -2.846  -6.267  -0.985  1.00 0.00 ? 22 PRO A CG   5  
ATOM   3338  C CD   . PRO A 1 22 ? -3.181  -6.223  0.482   1.00 0.00 ? 22 PRO A CD   5  
ATOM   3339  H HA   . PRO A 1 22 ? -0.889  -4.125  0.415   1.00 0.00 ? 22 PRO A HA   5  
ATOM   3340  H HB2  . PRO A 1 22 ? -1.665  -4.904  -2.132  1.00 0.00 ? 22 PRO A HB2  5  
ATOM   3341  H HB3  . PRO A 1 22 ? -0.742  -5.899  -1.002  1.00 0.00 ? 22 PRO A HB3  5  
ATOM   3342  H HG2  . PRO A 1 22 ? -3.676  -5.901  -1.575  1.00 0.00 ? 22 PRO A HG2  5  
ATOM   3343  H HG3  . PRO A 1 22 ? -2.587  -7.273  -1.284  1.00 0.00 ? 22 PRO A HG3  5  
ATOM   3344  H HD2  . PRO A 1 22 ? -4.234  -6.399  0.642   1.00 0.00 ? 22 PRO A HD2  5  
ATOM   3345  H HD3  . PRO A 1 22 ? -2.589  -6.943  1.030   1.00 0.00 ? 22 PRO A HD3  5  
ATOM   3346  N N    . CYS A 1 23 ? -1.358  -2.034  -0.851  1.00 0.00 ? 23 CYS A N    5  
ATOM   3347  C CA   . CYS A 1 23 ? -1.662  -0.723  -1.426  1.00 0.00 ? 23 CYS A CA   5  
ATOM   3348  C C    . CYS A 1 23 ? -1.468  -0.721  -2.939  1.00 0.00 ? 23 CYS A C    5  
ATOM   3349  O O    . CYS A 1 23 ? -2.034  0.114   -3.636  1.00 0.00 ? 23 CYS A O    5  
ATOM   3350  C CB   . CYS A 1 23 ? -0.771  0.363   -0.810  1.00 0.00 ? 23 CYS A CB   5  
ATOM   3351  S SG   . CYS A 1 23 ? -0.148  -0.010  0.862   1.00 0.00 ? 23 CYS A SG   5  
ATOM   3352  H H    . CYS A 1 23 ? -0.440  -2.229  -0.568  1.00 0.00 ? 23 CYS A H    5  
ATOM   3353  H HA   . CYS A 1 23 ? -2.695  -0.491  -1.206  1.00 0.00 ? 23 CYS A HA   5  
ATOM   3354  H HB2  . CYS A 1 23 ? 0.087   0.513   -1.448  1.00 0.00 ? 23 CYS A HB2  5  
ATOM   3355  H HB3  . CYS A 1 23 ? -1.332  1.285   -0.753  1.00 0.00 ? 23 CYS A HB3  5  
ATOM   3356  N N    . GLN A 1 24 ? -0.649  -1.646  -3.436  1.00 0.00 ? 24 GLN A N    5  
ATOM   3357  C CA   . GLN A 1 24 ? -0.357  -1.742  -4.873  1.00 0.00 ? 24 GLN A CA   5  
ATOM   3358  C C    . GLN A 1 24 ? -1.591  -1.471  -5.725  1.00 0.00 ? 24 GLN A C    5  
ATOM   3359  O O    . GLN A 1 24 ? -1.558  -0.666  -6.656  1.00 0.00 ? 24 GLN A O    5  
ATOM   3360  C CB   . GLN A 1 24 ? 0.211   -3.123  -5.232  1.00 0.00 ? 24 GLN A CB   5  
ATOM   3361  C CG   . GLN A 1 24 ? 0.894   -3.840  -4.078  1.00 0.00 ? 24 GLN A CG   5  
ATOM   3362  C CD   . GLN A 1 24 ? 1.672   -5.062  -4.527  1.00 0.00 ? 24 GLN A CD   5  
ATOM   3363  O OE1  . GLN A 1 24 ? 2.903   -5.069  -4.510  1.00 0.00 ? 24 GLN A OE1  5  
ATOM   3364  N NE2  . GLN A 1 24 ? 0.956   -6.103  -4.934  1.00 0.00 ? 24 GLN A NE2  5  
ATOM   3365  H H    . GLN A 1 24 ? -0.216  -2.271  -2.820  1.00 0.00 ? 24 GLN A H    5  
ATOM   3366  H HA   . GLN A 1 24 ? 0.378   -0.998  -5.103  1.00 0.00 ? 24 GLN A HA   5  
ATOM   3367  H HB2  . GLN A 1 24 ? -0.595  -3.748  -5.585  1.00 0.00 ? 24 GLN A HB2  5  
ATOM   3368  H HB3  . GLN A 1 24 ? 0.932   -3.004  -6.027  1.00 0.00 ? 24 GLN A HB3  5  
ATOM   3369  H HG2  . GLN A 1 24 ? 1.575   -3.155  -3.596  1.00 0.00 ? 24 GLN A HG2  5  
ATOM   3370  H HG3  . GLN A 1 24 ? 0.139   -4.152  -3.371  1.00 0.00 ? 24 GLN A HG3  5  
ATOM   3371  H HE21 . GLN A 1 24 ? -0.021  -6.026  -4.922  1.00 0.00 ? 24 GLN A HE21 5  
ATOM   3372  H HE22 . GLN A 1 24 ? 1.434   -6.907  -5.230  1.00 0.00 ? 24 GLN A HE22 5  
ATOM   3373  N N    . LEU A 1 25 ? -2.667  -2.161  -5.403  1.00 0.00 ? 25 LEU A N    5  
ATOM   3374  C CA   . LEU A 1 25 ? -3.925  -2.024  -6.135  1.00 0.00 ? 25 LEU A CA   5  
ATOM   3375  C C    . LEU A 1 25 ? -4.380  -0.566  -6.226  1.00 0.00 ? 25 LEU A C    5  
ATOM   3376  O O    . LEU A 1 25 ? -5.093  -0.192  -7.157  1.00 0.00 ? 25 LEU A O    5  
ATOM   3377  C CB   . LEU A 1 25 ? -5.020  -2.871  -5.479  1.00 0.00 ? 25 LEU A CB   5  
ATOM   3378  C CG   . LEU A 1 25 ? -5.032  -2.850  -3.946  1.00 0.00 ? 25 LEU A CG   5  
ATOM   3379  C CD1  . LEU A 1 25 ? -6.296  -2.180  -3.427  1.00 0.00 ? 25 LEU A CD1  5  
ATOM   3380  C CD2  . LEU A 1 25 ? -4.914  -4.264  -3.391  1.00 0.00 ? 25 LEU A CD2  5  
ATOM   3381  H H    . LEU A 1 25 ? -2.611  -2.790  -4.656  1.00 0.00 ? 25 LEU A H    5  
ATOM   3382  H HA   . LEU A 1 25 ? -3.758  -2.392  -7.134  1.00 0.00 ? 25 LEU A HA   5  
ATOM   3383  H HB2  . LEU A 1 25 ? -5.978  -2.514  -5.832  1.00 0.00 ? 25 LEU A HB2  5  
ATOM   3384  H HB3  . LEU A 1 25 ? -4.895  -3.893  -5.803  1.00 0.00 ? 25 LEU A HB3  5  
ATOM   3385  H HG   . LEU A 1 25 ? -4.186  -2.280  -3.593  1.00 0.00 ? 25 LEU A HG   5  
ATOM   3386  H HD11 . LEU A 1 25 ? -6.976  -2.932  -3.053  1.00 0.00 ? 25 LEU A HD11 5  
ATOM   3387  H HD12 . LEU A 1 25 ? -6.771  -1.633  -4.228  1.00 0.00 ? 25 LEU A HD12 5  
ATOM   3388  H HD13 . LEU A 1 25 ? -6.040  -1.499  -2.629  1.00 0.00 ? 25 LEU A HD13 5  
ATOM   3389  H HD21 . LEU A 1 25 ? -4.502  -4.916  -4.147  1.00 0.00 ? 25 LEU A HD21 5  
ATOM   3390  H HD22 . LEU A 1 25 ? -5.891  -4.620  -3.102  1.00 0.00 ? 25 LEU A HD22 5  
ATOM   3391  H HD23 . LEU A 1 25 ? -4.264  -4.258  -2.528  1.00 0.00 ? 25 LEU A HD23 5  
ATOM   3392  N N    . ARG A 1 26 ? -3.979  0.252   -5.257  1.00 0.00 ? 26 ARG A N    5  
ATOM   3393  C CA   . ARG A 1 26 ? -4.371  1.662   -5.246  1.00 0.00 ? 26 ARG A CA   5  
ATOM   3394  C C    . ARG A 1 26 ? -3.176  2.609   -5.212  1.00 0.00 ? 26 ARG A C    5  
ATOM   3395  O O    . ARG A 1 26 ? -3.343  3.826   -5.238  1.00 0.00 ? 26 ARG A O    5  
ATOM   3396  C CB   . ARG A 1 26 ? -5.277  1.948   -4.051  1.00 0.00 ? 26 ARG A CB   5  
ATOM   3397  C CG   . ARG A 1 26 ? -6.417  0.953   -3.898  1.00 0.00 ? 26 ARG A CG   5  
ATOM   3398  C CD   . ARG A 1 26 ? -7.773  1.641   -3.942  1.00 0.00 ? 26 ARG A CD   5  
ATOM   3399  N NE   . ARG A 1 26 ? -8.228  1.850   -5.314  1.00 0.00 ? 26 ARG A NE   5  
ATOM   3400  C CZ   . ARG A 1 26 ? -9.494  2.097   -5.646  1.00 0.00 ? 26 ARG A CZ   5  
ATOM   3401  N NH1  . ARG A 1 26 ? -10.432 2.164   -4.710  1.00 0.00 ? 26 ARG A NH1  5  
ATOM   3402  N NH2  . ARG A 1 26 ? -9.822  2.278   -6.918  1.00 0.00 ? 26 ARG A NH2  5  
ATOM   3403  H H    . ARG A 1 26 ? -3.423  -0.099  -4.535  1.00 0.00 ? 26 ARG A H    5  
ATOM   3404  H HA   . ARG A 1 26 ? -4.913  1.842   -6.145  1.00 0.00 ? 26 ARG A HA   5  
ATOM   3405  H HB2  . ARG A 1 26 ? -4.678  1.920   -3.151  1.00 0.00 ? 26 ARG A HB2  5  
ATOM   3406  H HB3  . ARG A 1 26 ? -5.698  2.935   -4.162  1.00 0.00 ? 26 ARG A HB3  5  
ATOM   3407  H HG2  . ARG A 1 26 ? -6.364  0.235   -4.703  1.00 0.00 ? 26 ARG A HG2  5  
ATOM   3408  H HG3  . ARG A 1 26 ? -6.312  0.443   -2.952  1.00 0.00 ? 26 ARG A HG3  5  
ATOM   3409  H HD2  . ARG A 1 26 ? -8.484  1.024   -3.412  1.00 0.00 ? 26 ARG A HD2  5  
ATOM   3410  H HD3  . ARG A 1 26 ? -7.689  2.592   -3.439  1.00 0.00 ? 26 ARG A HD3  5  
ATOM   3411  H HE   . ARG A 1 26 ? -7.556  1.806   -6.026  1.00 0.00 ? 26 ARG A HE   5  
ATOM   3412  H HH11 . ARG A 1 26 ? -10.191 2.029   -3.748  1.00 0.00 ? 26 ARG A HH11 5  
ATOM   3413  H HH12 . ARG A 1 26 ? -11.381 2.350   -4.966  1.00 0.00 ? 26 ARG A HH12 5  
ATOM   3414  H HH21 . ARG A 1 26 ? -9.120  2.229   -7.628  1.00 0.00 ? 26 ARG A HH21 5  
ATOM   3415  H HH22 . ARG A 1 26 ? -10.773 2.463   -7.168  1.00 0.00 ? 26 ARG A HH22 5  
ATOM   3416  N N    . CYS A 1 27 ? -1.988  2.038   -5.146  1.00 0.00 ? 27 CYS A N    5  
ATOM   3417  C CA   . CYS A 1 27 ? -0.734  2.799   -5.097  1.00 0.00 ? 27 CYS A CA   5  
ATOM   3418  C C    . CYS A 1 27 ? -0.858  4.061   -4.238  1.00 0.00 ? 27 CYS A C    5  
ATOM   3419  O O    . CYS A 1 27 ? -0.511  4.049   -3.058  1.00 0.00 ? 27 CYS A O    5  
ATOM   3420  C CB   . CYS A 1 27 ? -0.258  3.158   -6.506  1.00 0.00 ? 27 CYS A CB   5  
ATOM   3421  S SG   . CYS A 1 27 ? 1.533   3.482   -6.616  1.00 0.00 ? 27 CYS A SG   5  
ATOM   3422  H H    . CYS A 1 27 ? -1.950  1.067   -5.125  1.00 0.00 ? 27 CYS A H    5  
ATOM   3423  H HA   . CYS A 1 27 ? 0.005   2.159   -4.643  1.00 0.00 ? 27 CYS A HA   5  
ATOM   3424  H HB2  . CYS A 1 27 ? -0.484  2.339   -7.173  1.00 0.00 ? 27 CYS A HB2  5  
ATOM   3425  H HB3  . CYS A 1 27 ? -0.775  4.042   -6.845  1.00 0.00 ? 27 CYS A HB3  5  
ATOM   3426  N N    . SER A 1 28 ? -1.351  5.149   -4.832  1.00 0.00 ? 28 SER A N    5  
ATOM   3427  C CA   . SER A 1 28 ? -1.511  6.392   -4.132  1.00 0.00 ? 28 SER A CA   5  
ATOM   3428  C C    . SER A 1 28 ? -2.768  7.130   -4.585  1.00 0.00 ? 28 SER A C    5  
ATOM   3429  O O    . SER A 1 28 ? -2.708  8.287   -5.000  1.00 0.00 ? 28 SER A O    5  
ATOM   3430  C CB   . SER A 1 28 ? -0.277  7.268   -4.331  1.00 0.00 ? 28 SER A CB   5  
ATOM   3431  O OG   . SER A 1 28 ? -0.519  8.601   -3.912  1.00 0.00 ? 28 SER A OG   5  
ATOM   3432  H H    . SER A 1 28 ? -1.610  5.111   -5.750  1.00 0.00 ? 28 SER A H    5  
ATOM   3433  H HA   . SER A 1 28 ? -1.607  6.150   -3.105  1.00 0.00 ? 28 SER A HA   5  
ATOM   3434  H HB2  . SER A 1 28 ? 0.544   6.867   -3.757  1.00 0.00 ? 28 SER A HB2  5  
ATOM   3435  H HB3  . SER A 1 28 ? -0.015  7.273   -5.379  1.00 0.00 ? 28 SER A HB3  5  
ATOM   3436  H HG   . SER A 1 28 ? 0.311   9.084   -3.887  1.00 0.00 ? 28 SER A HG   5  
ATOM   3437  N N    . SER A 1 29 ? -3.907  6.453   -4.489  1.00 0.00 ? 29 SER A N    5  
ATOM   3438  C CA   . SER A 1 29 ? -5.182  7.041   -4.871  1.00 0.00 ? 29 SER A CA   5  
ATOM   3439  C C    . SER A 1 29 ? -6.326  6.322   -4.175  1.00 0.00 ? 29 SER A C    5  
ATOM   3440  O O    . SER A 1 29 ? -6.311  5.101   -4.021  1.00 0.00 ? 29 SER A O    5  
ATOM   3441  C CB   . SER A 1 29 ? -5.383  6.989   -6.381  1.00 0.00 ? 29 SER A CB   5  
ATOM   3442  O OG   . SER A 1 29 ? -4.364  7.701   -7.060  1.00 0.00 ? 29 SER A OG   5  
ATOM   3443  H H    . SER A 1 29 ? -3.892  5.540   -4.142  1.00 0.00 ? 29 SER A H    5  
ATOM   3444  H HA   . SER A 1 29 ? -5.178  8.074   -4.553  1.00 0.00 ? 29 SER A HA   5  
ATOM   3445  H HB2  . SER A 1 29 ? -5.369  5.961   -6.709  1.00 0.00 ? 29 SER A HB2  5  
ATOM   3446  H HB3  . SER A 1 29 ? -6.340  7.432   -6.619  1.00 0.00 ? 29 SER A HB3  5  
ATOM   3447  H HG   . SER A 1 29 ? -3.572  7.161   -7.108  1.00 0.00 ? 29 SER A HG   5  
ATOM   3448  N N    . ASN A 1 30 ? -7.312  7.096   -3.749  1.00 0.00 ? 30 ASN A N    5  
ATOM   3449  C CA   . ASN A 1 30 ? -8.475  6.554   -3.053  1.00 0.00 ? 30 ASN A CA   5  
ATOM   3450  C C    . ASN A 1 30 ? -8.050  5.685   -1.869  1.00 0.00 ? 30 ASN A C    5  
ATOM   3451  O O    . ASN A 1 30 ? -8.824  4.859   -1.386  1.00 0.00 ? 30 ASN A O    5  
ATOM   3452  C CB   . ASN A 1 30 ? -9.335  5.735   -4.017  1.00 0.00 ? 30 ASN A CB   5  
ATOM   3453  C CG   . ASN A 1 30 ? -10.244 6.605   -4.864  1.00 0.00 ? 30 ASN A CG   5  
ATOM   3454  O OD1  . ASN A 1 30 ? -9.861  7.056   -5.943  1.00 0.00 ? 30 ASN A OD1  5  
ATOM   3455  N ND2  . ASN A 1 30 ? -11.456 6.845   -4.377  1.00 0.00 ? 30 ASN A ND2  5  
ATOM   3456  H H    . ASN A 1 30 ? -7.250  8.058   -3.904  1.00 0.00 ? 30 ASN A H    5  
ATOM   3457  H HA   . ASN A 1 30 ? -9.057  7.385   -2.683  1.00 0.00 ? 30 ASN A HA   5  
ATOM   3458  H HB2  . ASN A 1 30 ? -8.691  5.173   -4.676  1.00 0.00 ? 30 ASN A HB2  5  
ATOM   3459  H HB3  . ASN A 1 30 ? -9.950  5.051   -3.450  1.00 0.00 ? 30 ASN A HB3  5  
ATOM   3460  H HD21 . ASN A 1 30 ? -11.693 6.452   -3.510  1.00 0.00 ? 30 ASN A HD21 5  
ATOM   3461  H HD22 . ASN A 1 30 ? -12.064 7.405   -4.904  1.00 0.00 ? 30 ASN A HD22 5  
ATOM   3462  N N    . THR A 1 31 ? -6.817  5.887   -1.407  1.00 0.00 ? 31 THR A N    5  
ATOM   3463  C CA   . THR A 1 31 ? -6.273  5.134   -0.296  1.00 0.00 ? 31 THR A CA   5  
ATOM   3464  C C    . THR A 1 31 ? -4.940  5.735   0.159   1.00 0.00 ? 31 THR A C    5  
ATOM   3465  O O    . THR A 1 31 ? -3.880  5.211   -0.183  1.00 0.00 ? 31 THR A O    5  
ATOM   3466  C CB   . THR A 1 31 ? -6.067  3.673   -0.699  1.00 0.00 ? 31 THR A CB   5  
ATOM   3467  O OG1  . THR A 1 31 ? -7.297  3.066   -1.053  1.00 0.00 ? 31 THR A OG1  5  
ATOM   3468  C CG2  . THR A 1 31 ? -5.439  2.828   0.389   1.00 0.00 ? 31 THR A CG2  5  
ATOM   3469  H H    . THR A 1 31 ? -6.259  6.560   -1.825  1.00 0.00 ? 31 THR A H    5  
ATOM   3470  H HA   . THR A 1 31 ? -6.978  5.177   0.500   1.00 0.00 ? 31 THR A HA   5  
ATOM   3471  H HB   . THR A 1 31 ? -5.418  3.644   -1.558  1.00 0.00 ? 31 THR A HB   5  
ATOM   3472  H HG1  . THR A 1 31 ? -7.126  2.258   -1.542  1.00 0.00 ? 31 THR A HG1  5  
ATOM   3473  H HG21 . THR A 1 31 ? -6.169  2.631   1.159   1.00 0.00 ? 31 THR A HG21 5  
ATOM   3474  H HG22 . THR A 1 31 ? -4.599  3.356   0.815   1.00 0.00 ? 31 THR A HG22 5  
ATOM   3475  H HG23 . THR A 1 31 ? -5.099  1.893   -0.033  1.00 0.00 ? 31 THR A HG23 5  
ATOM   3476  N N    . PRO A 1 32 ? -4.956  6.853   0.920   1.00 0.00 ? 32 PRO A N    5  
ATOM   3477  C CA   . PRO A 1 32 ? -3.728  7.504   1.389   1.00 0.00 ? 32 PRO A CA   5  
ATOM   3478  C C    . PRO A 1 32 ? -2.691  6.503   1.900   1.00 0.00 ? 32 PRO A C    5  
ATOM   3479  O O    . PRO A 1 32 ? -2.807  5.986   3.011   1.00 0.00 ? 32 PRO A O    5  
ATOM   3480  C CB   . PRO A 1 32 ? -4.203  8.424   2.530   1.00 0.00 ? 32 PRO A CB   5  
ATOM   3481  C CG   . PRO A 1 32 ? -5.661  8.138   2.709   1.00 0.00 ? 32 PRO A CG   5  
ATOM   3482  C CD   . PRO A 1 32 ? -6.142  7.589   1.378   1.00 0.00 ? 32 PRO A CD   5  
ATOM   3483  H HA   . PRO A 1 32 ? -3.283  8.102   0.610   1.00 0.00 ? 32 PRO A HA   5  
ATOM   3484  H HB2  . PRO A 1 32 ? -3.647  8.200   3.428   1.00 0.00 ? 32 PRO A HB2  5  
ATOM   3485  H HB3  . PRO A 1 32 ? -4.038  9.454   2.251   1.00 0.00 ? 32 PRO A HB3  5  
ATOM   3486  H HG2  . PRO A 1 32 ? -5.787  7.404   3.498   1.00 0.00 ? 32 PRO A HG2  5  
ATOM   3487  H HG3  . PRO A 1 32 ? -6.185  9.053   2.963   1.00 0.00 ? 32 PRO A HG3  5  
ATOM   3488  H HD2  . PRO A 1 32 ? -6.993  6.934   1.510   1.00 0.00 ? 32 PRO A HD2  5  
ATOM   3489  H HD3  . PRO A 1 32 ? -6.384  8.391   0.688   1.00 0.00 ? 32 PRO A HD3  5  
ATOM   3490  N N    . PRO A 1 33 ? -1.660  6.214   1.083   1.00 0.00 ? 33 PRO A N    5  
ATOM   3491  C CA   . PRO A 1 33 ? -0.601  5.270   1.442   1.00 0.00 ? 33 PRO A CA   5  
ATOM   3492  C C    . PRO A 1 33 ? 0.484   5.899   2.292   1.00 0.00 ? 33 PRO A C    5  
ATOM   3493  O O    . PRO A 1 33 ? 1.567   6.209   1.805   1.00 0.00 ? 33 PRO A O    5  
ATOM   3494  C CB   . PRO A 1 33 ? -0.043  4.867   0.082   1.00 0.00 ? 33 PRO A CB   5  
ATOM   3495  C CG   . PRO A 1 33 ? -0.187  6.098   -0.743  1.00 0.00 ? 33 PRO A CG   5  
ATOM   3496  C CD   . PRO A 1 33 ? -1.445  6.779   -0.266  1.00 0.00 ? 33 PRO A CD   5  
ATOM   3497  H HA   . PRO A 1 33 ? -0.981  4.404   1.953   1.00 0.00 ? 33 PRO A HA   5  
ATOM   3498  H HB2  . PRO A 1 33 ? 0.992   4.574   0.185   1.00 0.00 ? 33 PRO A HB2  5  
ATOM   3499  H HB3  . PRO A 1 33 ? -0.620  4.049   -0.322  1.00 0.00 ? 33 PRO A HB3  5  
ATOM   3500  H HG2  . PRO A 1 33 ? 0.668   6.741   -0.593  1.00 0.00 ? 33 PRO A HG2  5  
ATOM   3501  H HG3  . PRO A 1 33 ? -0.276  5.832   -1.784  1.00 0.00 ? 33 PRO A HG3  5  
ATOM   3502  H HD2  . PRO A 1 33 ? -1.299  7.849   -0.215  1.00 0.00 ? 33 PRO A HD2  5  
ATOM   3503  H HD3  . PRO A 1 33 ? -2.272  6.543   -0.919  1.00 0.00 ? 33 PRO A HD3  5  
ATOM   3504  N N    . LEU A 1 34 ? 0.196   6.077   3.569   1.00 0.00 ? 34 LEU A N    5  
ATOM   3505  C CA   . LEU A 1 34 ? 1.181   6.661   4.468   1.00 0.00 ? 34 LEU A CA   5  
ATOM   3506  C C    . LEU A 1 34 ? 2.383   5.733   4.608   1.00 0.00 ? 34 LEU A C    5  
ATOM   3507  O O    . LEU A 1 34 ? 3.525   6.173   4.483   1.00 0.00 ? 34 LEU A O    5  
ATOM   3508  C CB   . LEU A 1 34 ? 0.572   6.998   5.838   1.00 0.00 ? 34 LEU A CB   5  
ATOM   3509  C CG   . LEU A 1 34 ? -0.765  7.740   5.791   1.00 0.00 ? 34 LEU A CG   5  
ATOM   3510  C CD1  . LEU A 1 34 ? -1.215  8.114   7.195   1.00 0.00 ? 34 LEU A CD1  5  
ATOM   3511  C CD2  . LEU A 1 34 ? -0.658  8.981   4.917   1.00 0.00 ? 34 LEU A CD2  5  
ATOM   3512  H H    . LEU A 1 34 ? -0.687  5.807   3.905   1.00 0.00 ? 34 LEU A H    5  
ATOM   3513  H HA   . LEU A 1 34 ? 1.525   7.568   4.002   1.00 0.00 ? 34 LEU A HA   5  
ATOM   3514  H HB2  . LEU A 1 34 ? 0.430   6.083   6.390   1.00 0.00 ? 34 LEU A HB2  5  
ATOM   3515  H HB3  . LEU A 1 34 ? 1.276   7.614   6.376   1.00 0.00 ? 34 LEU A HB3  5  
ATOM   3516  H HG   . LEU A 1 34 ? -1.515  7.090   5.365   1.00 0.00 ? 34 LEU A HG   5  
ATOM   3517  H HD11 . LEU A 1 34 ? -1.749  9.052   7.164   1.00 0.00 ? 34 LEU A HD11 5  
ATOM   3518  H HD12 . LEU A 1 34 ? -0.351  8.211   7.837   1.00 0.00 ? 34 LEU A HD12 5  
ATOM   3519  H HD13 . LEU A 1 34 ? -1.865  7.342   7.582   1.00 0.00 ? 34 LEU A HD13 5  
ATOM   3520  H HD21 . LEU A 1 34 ? -0.153  9.764   5.463   1.00 0.00 ? 34 LEU A HD21 5  
ATOM   3521  H HD22 . LEU A 1 34 ? -1.648  9.315   4.644   1.00 0.00 ? 34 LEU A HD22 5  
ATOM   3522  H HD23 . LEU A 1 34 ? -0.098  8.746   4.024   1.00 0.00 ? 34 LEU A HD23 5  
ATOM   3523  N N    . THR A 1 35 ? 2.131   4.445   4.828   1.00 0.00 ? 35 THR A N    5  
ATOM   3524  C CA   . THR A 1 35 ? 3.206   3.481   4.936   1.00 0.00 ? 35 THR A CA   5  
ATOM   3525  C C    . THR A 1 35 ? 3.536   2.909   3.558   1.00 0.00 ? 35 THR A C    5  
ATOM   3526  O O    . THR A 1 35 ? 4.369   2.012   3.436   1.00 0.00 ? 35 THR A O    5  
ATOM   3527  C CB   . THR A 1 35 ? 2.818   2.354   5.893   1.00 0.00 ? 35 THR A CB   5  
ATOM   3528  O OG1  . THR A 1 35 ? 3.870   1.413   6.014   1.00 0.00 ? 35 THR A OG1  5  
ATOM   3529  C CG2  . THR A 1 35 ? 1.578   1.602   5.460   1.00 0.00 ? 35 THR A CG2  5  
ATOM   3530  H H    . THR A 1 35 ? 1.211   4.131   4.897   1.00 0.00 ? 35 THR A H    5  
ATOM   3531  H HA   . THR A 1 35 ? 4.074   3.991   5.323   1.00 0.00 ? 35 THR A HA   5  
ATOM   3532  H HB   . THR A 1 35 ? 2.625   2.775   6.870   1.00 0.00 ? 35 THR A HB   5  
ATOM   3533  H HG1  . THR A 1 35 ? 3.606   0.713   6.616   1.00 0.00 ? 35 THR A HG1  5  
ATOM   3534  H HG21 . THR A 1 35 ? 1.557   1.533   4.383   1.00 0.00 ? 35 THR A HG21 5  
ATOM   3535  H HG22 . THR A 1 35 ? 0.699   2.129   5.804   1.00 0.00 ? 35 THR A HG22 5  
ATOM   3536  H HG23 . THR A 1 35 ? 1.591   0.609   5.885   1.00 0.00 ? 35 THR A HG23 5  
ATOM   3537  N N    . CYS A 1 36 ? 2.868   3.423   2.517   1.00 0.00 ? 36 CYS A N    5  
ATOM   3538  C CA   . CYS A 1 36 ? 3.101   2.937   1.162   1.00 0.00 ? 36 CYS A CA   5  
ATOM   3539  C C    . CYS A 1 36 ? 3.574   4.044   0.219   1.00 0.00 ? 36 CYS A C    5  
ATOM   3540  O O    . CYS A 1 36 ? 4.028   3.763   -0.890  1.00 0.00 ? 36 CYS A O    5  
ATOM   3541  C CB   . CYS A 1 36 ? 1.834   2.279   0.608   1.00 0.00 ? 36 CYS A CB   5  
ATOM   3542  S SG   . CYS A 1 36 ? 1.823   0.462   0.757   1.00 0.00 ? 36 CYS A SG   5  
ATOM   3543  H H    . CYS A 1 36 ? 2.203   4.134   2.665   1.00 0.00 ? 36 CYS A H    5  
ATOM   3544  H HA   . CYS A 1 36 ? 3.873   2.193   1.221   1.00 0.00 ? 36 CYS A HA   5  
ATOM   3545  H HB2  . CYS A 1 36 ? 0.977   2.657   1.144   1.00 0.00 ? 36 CYS A HB2  5  
ATOM   3546  H HB3  . CYS A 1 36 ? 1.736   2.525   -0.438  1.00 0.00 ? 36 CYS A HB3  5  
ATOM   3547  N N    . GLN A 1 37 ? 3.475   5.301   0.651   1.00 0.00 ? 37 GLN A N    5  
ATOM   3548  C CA   . GLN A 1 37 ? 3.902   6.427   -0.177  1.00 0.00 ? 37 GLN A CA   5  
ATOM   3549  C C    . GLN A 1 37 ? 5.295   6.188   -0.752  1.00 0.00 ? 37 GLN A C    5  
ATOM   3550  O O    . GLN A 1 37 ? 5.631   6.686   -1.825  1.00 0.00 ? 37 GLN A O    5  
ATOM   3551  C CB   . GLN A 1 37 ? 3.887   7.724   0.635   1.00 0.00 ? 37 GLN A CB   5  
ATOM   3552  C CG   . GLN A 1 37 ? 3.319   8.912   -0.125  1.00 0.00 ? 37 GLN A CG   5  
ATOM   3553  C CD   . GLN A 1 37 ? 4.053   10.203  0.180   1.00 0.00 ? 37 GLN A CD   5  
ATOM   3554  O OE1  . GLN A 1 37 ? 4.911   10.638  -0.587  1.00 0.00 ? 37 GLN A OE1  5  
ATOM   3555  N NE2  . GLN A 1 37 ? 3.717   10.823  1.306   1.00 0.00 ? 37 GLN A NE2  5  
ATOM   3556  H H    . GLN A 1 37 ? 3.104   5.479   1.543   1.00 0.00 ? 37 GLN A H    5  
ATOM   3557  H HA   . GLN A 1 37 ? 3.203   6.516   -0.994  1.00 0.00 ? 37 GLN A HA   5  
ATOM   3558  H HB2  . GLN A 1 37 ? 3.291   7.573   1.522   1.00 0.00 ? 37 GLN A HB2  5  
ATOM   3559  H HB3  . GLN A 1 37 ? 4.898   7.962   0.929   1.00 0.00 ? 37 GLN A HB3  5  
ATOM   3560  H HG2  . GLN A 1 37 ? 3.394   8.715   -1.184  1.00 0.00 ? 37 GLN A HG2  5  
ATOM   3561  H HG3  . GLN A 1 37 ? 2.280   9.032   0.145   1.00 0.00 ? 37 GLN A HG3  5  
ATOM   3562  H HE21 . GLN A 1 37 ? 3.024   10.417  1.868   1.00 0.00 ? 37 GLN A HE21 5  
ATOM   3563  H HE22 . GLN A 1 37 ? 4.175   11.660  1.528   1.00 0.00 ? 37 GLN A HE22 5  
ATOM   3564  N N    . ARG A 1 38 ? 6.094   5.414   -0.030  1.00 0.00 ? 38 ARG A N    5  
ATOM   3565  C CA   . ARG A 1 38 ? 7.449   5.096   -0.458  1.00 0.00 ? 38 ARG A CA   5  
ATOM   3566  C C    . ARG A 1 38 ? 7.427   3.965   -1.484  1.00 0.00 ? 38 ARG A C    5  
ATOM   3567  O O    . ARG A 1 38 ? 8.218   3.945   -2.419  1.00 0.00 ? 38 ARG A O    5  
ATOM   3568  C CB   . ARG A 1 38 ? 8.305   4.732   0.770   1.00 0.00 ? 38 ARG A CB   5  
ATOM   3569  C CG   . ARG A 1 38 ? 9.289   3.585   0.563   1.00 0.00 ? 38 ARG A CG   5  
ATOM   3570  C CD   . ARG A 1 38 ? 10.602  4.074   -0.023  1.00 0.00 ? 38 ARG A CD   5  
ATOM   3571  N NE   . ARG A 1 38 ? 11.525  4.513   1.021   1.00 0.00 ? 38 ARG A NE   5  
ATOM   3572  C CZ   . ARG A 1 38 ? 12.846  4.578   0.868   1.00 0.00 ? 38 ARG A CZ   5  
ATOM   3573  N NH1  . ARG A 1 38 ? 13.406  4.242   -0.287  1.00 0.00 ? 38 ARG A NH1  5  
ATOM   3574  N NH2  . ARG A 1 38 ? 13.609  4.981   1.874   1.00 0.00 ? 38 ARG A NH2  5  
ATOM   3575  H H    . ARG A 1 38 ? 5.762   5.044   0.812   1.00 0.00 ? 38 ARG A H    5  
ATOM   3576  H HA   . ARG A 1 38 ? 7.862   5.979   -0.928  1.00 0.00 ? 38 ARG A HA   5  
ATOM   3577  H HB2  . ARG A 1 38 ? 8.871   5.603   1.063   1.00 0.00 ? 38 ARG A HB2  5  
ATOM   3578  H HB3  . ARG A 1 38 ? 7.643   4.462   1.580   1.00 0.00 ? 38 ARG A HB3  5  
ATOM   3579  H HG2  . ARG A 1 38 ? 9.486   3.123   1.518   1.00 0.00 ? 38 ARG A HG2  5  
ATOM   3580  H HG3  . ARG A 1 38 ? 8.852   2.858   -0.103  1.00 0.00 ? 38 ARG A HG3  5  
ATOM   3581  H HD2  . ARG A 1 38 ? 11.046  3.265   -0.585  1.00 0.00 ? 38 ARG A HD2  5  
ATOM   3582  H HD3  . ARG A 1 38 ? 10.394  4.896   -0.692  1.00 0.00 ? 38 ARG A HD3  5  
ATOM   3583  H HE   . ARG A 1 38 ? 11.140  4.771   1.884   1.00 0.00 ? 38 ARG A HE   5  
ATOM   3584  H HH11 . ARG A 1 38 ? 12.837  3.938   -1.051  1.00 0.00 ? 38 ARG A HH11 5  
ATOM   3585  H HH12 . ARG A 1 38 ? 14.399  4.292   -0.395  1.00 0.00 ? 38 ARG A HH12 5  
ATOM   3586  H HH21 . ARG A 1 38 ? 13.193  5.237   2.747   1.00 0.00 ? 38 ARG A HH21 5  
ATOM   3587  H HH22 . ARG A 1 38 ? 14.602  5.029   1.761   1.00 0.00 ? 38 ARG A HH22 5  
ATOM   3588  N N    . TYR A 1 39 ? 6.511   3.026   -1.307  1.00 0.00 ? 39 TYR A N    5  
ATOM   3589  C CA   . TYR A 1 39 ? 6.393   1.905   -2.221  1.00 0.00 ? 39 TYR A CA   5  
ATOM   3590  C C    . TYR A 1 39 ? 5.700   2.329   -3.504  1.00 0.00 ? 39 TYR A C    5  
ATOM   3591  O O    . TYR A 1 39 ? 6.071   1.893   -4.594  1.00 0.00 ? 39 TYR A O    5  
ATOM   3592  C CB   . TYR A 1 39 ? 5.629   0.760   -1.556  1.00 0.00 ? 39 TYR A CB   5  
ATOM   3593  C CG   . TYR A 1 39 ? 5.570   -0.500  -2.386  1.00 0.00 ? 39 TYR A CG   5  
ATOM   3594  C CD1  . TYR A 1 39 ? 4.541   -0.706  -3.295  1.00 0.00 ? 39 TYR A CD1  5  
ATOM   3595  C CD2  . TYR A 1 39 ? 6.543   -1.484  -2.261  1.00 0.00 ? 39 TYR A CD2  5  
ATOM   3596  C CE1  . TYR A 1 39 ? 4.483   -1.856  -4.056  1.00 0.00 ? 39 TYR A CE1  5  
ATOM   3597  C CE2  . TYR A 1 39 ? 6.491   -2.637  -3.018  1.00 0.00 ? 39 TYR A CE2  5  
ATOM   3598  C CZ   . TYR A 1 39 ? 5.459   -2.819  -3.915  1.00 0.00 ? 39 TYR A CZ   5  
ATOM   3599  O OH   . TYR A 1 39 ? 5.405   -3.967  -4.672  1.00 0.00 ? 39 TYR A OH   5  
ATOM   3600  H H    . TYR A 1 39 ? 5.906   3.086   -0.548  1.00 0.00 ? 39 TYR A H    5  
ATOM   3601  H HA   . TYR A 1 39 ? 7.388   1.576   -2.465  1.00 0.00 ? 39 TYR A HA   5  
ATOM   3602  H HB2  . TYR A 1 39 ? 6.105   0.516   -0.619  1.00 0.00 ? 39 TYR A HB2  5  
ATOM   3603  H HB3  . TYR A 1 39 ? 4.614   1.079   -1.366  1.00 0.00 ? 39 TYR A HB3  5  
ATOM   3604  H HD1  . TYR A 1 39 ? 3.778   0.050   -3.403  1.00 0.00 ? 39 TYR A HD1  5  
ATOM   3605  H HD2  . TYR A 1 39 ? 7.349   -1.338  -1.558  1.00 0.00 ? 39 TYR A HD2  5  
ATOM   3606  H HE1  . TYR A 1 39 ? 3.674   -1.999  -4.756  1.00 0.00 ? 39 TYR A HE1  5  
ATOM   3607  H HE2  . TYR A 1 39 ? 7.254   -3.391  -2.902  1.00 0.00 ? 39 TYR A HE2  5  
ATOM   3608  H HH   . TYR A 1 39 ? 5.458   -4.733  -4.096  1.00 0.00 ? 39 TYR A HH   5  
ATOM   3609  N N    . CYS A 1 40 ? 4.703   3.195   -3.376  1.00 0.00 ? 40 CYS A N    5  
ATOM   3610  C CA   . CYS A 1 40 ? 3.981   3.682   -4.543  1.00 0.00 ? 40 CYS A CA   5  
ATOM   3611  C C    . CYS A 1 40 ? 4.949   4.352   -5.509  1.00 0.00 ? 40 CYS A C    5  
ATOM   3612  O O    . CYS A 1 40 ? 4.774   4.275   -6.725  1.00 0.00 ? 40 CYS A O    5  
ATOM   3613  C CB   . CYS A 1 40 ? 2.868   4.656   -4.144  1.00 0.00 ? 40 CYS A CB   5  
ATOM   3614  S SG   . CYS A 1 40 ? 1.800   5.177   -5.529  1.00 0.00 ? 40 CYS A SG   5  
ATOM   3615  H H    . CYS A 1 40 ? 4.458   3.516   -2.483  1.00 0.00 ? 40 CYS A H    5  
ATOM   3616  H HA   . CYS A 1 40 ? 3.546   2.828   -5.039  1.00 0.00 ? 40 CYS A HA   5  
ATOM   3617  H HB2  . CYS A 1 40 ? 2.236   4.186   -3.405  1.00 0.00 ? 40 CYS A HB2  5  
ATOM   3618  H HB3  . CYS A 1 40 ? 3.311   5.545   -3.719  1.00 0.00 ? 40 CYS A HB3  5  
ATOM   3619  N N    . ASN A 1 41 ? 5.987   4.988   -4.968  1.00 0.00 ? 41 ASN A N    5  
ATOM   3620  C CA   . ASN A 1 41 ? 6.977   5.634   -5.812  1.00 0.00 ? 41 ASN A CA   5  
ATOM   3621  C C    . ASN A 1 41 ? 7.766   4.590   -6.586  1.00 0.00 ? 41 ASN A C    5  
ATOM   3622  O O    . ASN A 1 41 ? 8.410   4.896   -7.589  1.00 0.00 ? 41 ASN A O    5  
ATOM   3623  C CB   . ASN A 1 41 ? 7.908   6.560   -5.004  1.00 0.00 ? 41 ASN A CB   5  
ATOM   3624  C CG   . ASN A 1 41 ? 8.794   5.845   -3.996  1.00 0.00 ? 41 ASN A CG   5  
ATOM   3625  O OD1  . ASN A 1 41 ? 8.833   6.226   -2.827  1.00 0.00 ? 41 ASN A OD1  5  
ATOM   3626  N ND2  . ASN A 1 41 ? 9.539   4.834   -4.434  1.00 0.00 ? 41 ASN A ND2  5  
ATOM   3627  H H    . ASN A 1 41 ? 6.094   5.008   -3.998  1.00 0.00 ? 41 ASN A H    5  
ATOM   3628  H HA   . ASN A 1 41 ? 6.434   6.223   -6.520  1.00 0.00 ? 41 ASN A HA   5  
ATOM   3629  H HB2  . ASN A 1 41 ? 8.548   7.096   -5.687  1.00 0.00 ? 41 ASN A HB2  5  
ATOM   3630  H HB3  . ASN A 1 41 ? 7.301   7.274   -4.464  1.00 0.00 ? 41 ASN A HB3  5  
ATOM   3631  H HD21 . ASN A 1 41 ? 9.496   4.598   -5.378  1.00 0.00 ? 41 ASN A HD21 5  
ATOM   3632  H HD22 . ASN A 1 41 ? 10.097  4.357   -3.783  1.00 0.00 ? 41 ASN A HD22 5  
ATOM   3633  N N    . ALA A 1 42 ? 7.695   3.351   -6.115  1.00 0.00 ? 42 ALA A N    5  
ATOM   3634  C CA   . ALA A 1 42 ? 8.385   2.244   -6.763  1.00 0.00 ? 42 ALA A CA   5  
ATOM   3635  C C    . ALA A 1 42 ? 7.390   1.328   -7.466  1.00 0.00 ? 42 ALA A C    5  
ATOM   3636  O O    . ALA A 1 42 ? 7.638   0.136   -7.643  1.00 0.00 ? 42 ALA A O    5  
ATOM   3637  C CB   . ALA A 1 42 ? 9.214   1.465   -5.755  1.00 0.00 ? 42 ALA A CB   5  
ATOM   3638  H H    . ALA A 1 42 ? 7.156   3.179   -5.315  1.00 0.00 ? 42 ALA A H    5  
ATOM   3639  H HA   . ALA A 1 42 ? 9.048   2.660   -7.504  1.00 0.00 ? 42 ALA A HA   5  
ATOM   3640  H HB1  . ALA A 1 42 ? 10.164  1.201   -6.198  1.00 0.00 ? 42 ALA A HB1  5  
ATOM   3641  H HB2  . ALA A 1 42 ? 8.687   0.564   -5.473  1.00 0.00 ? 42 ALA A HB2  5  
ATOM   3642  H HB3  . ALA A 1 42 ? 9.381   2.073   -4.878  1.00 0.00 ? 42 ALA A HB3  5  
ATOM   3643  N N    . SER A 1 43 ? 6.266   1.908   -7.865  1.00 0.00 ? 43 SER A N    5  
ATOM   3644  C CA   . SER A 1 43 ? 5.219   1.170   -8.556  1.00 0.00 ? 43 SER A CA   5  
ATOM   3645  C C    . SER A 1 43 ? 4.626   2.003   -9.691  1.00 0.00 ? 43 SER A C    5  
ATOM   3646  O O    . SER A 1 43 ? 4.283   1.472   -10.747 1.00 0.00 ? 43 SER A O    5  
ATOM   3647  C CB   . SER A 1 43 ? 4.118   0.763   -7.576  1.00 0.00 ? 43 SER A CB   5  
ATOM   3648  O OG   . SER A 1 43 ? 4.428   -0.466  -6.942  1.00 0.00 ? 43 SER A OG   5  
ATOM   3649  H H    . SER A 1 43 ? 6.142   2.857   -7.692  1.00 0.00 ? 43 SER A H    5  
ATOM   3650  H HA   . SER A 1 43 ? 5.666   0.284   -8.971  1.00 0.00 ? 43 SER A HA   5  
ATOM   3651  H HB2  . SER A 1 43 ? 4.011   1.526   -6.820  1.00 0.00 ? 43 SER A HB2  5  
ATOM   3652  H HB3  . SER A 1 43 ? 3.186   0.653   -8.111  1.00 0.00 ? 43 SER A HB3  5  
ATOM   3653  H HG   . SER A 1 43 ? 4.746   -1.092  -7.595  1.00 0.00 ? 43 SER A HG   5  
ATOM   3654  N N    . VAL A 1 44 ? 4.506   3.310   -9.459  1.00 0.00 ? 44 VAL A N    5  
ATOM   3655  C CA   . VAL A 1 44 ? 3.955   4.237   -10.448 1.00 0.00 ? 44 VAL A CA   5  
ATOM   3656  C C    . VAL A 1 44 ? 2.647   3.718   -11.031 1.00 0.00 ? 44 VAL A C    5  
ATOM   3657  O O    . VAL A 1 44 ? 2.450   3.688   -12.246 1.00 0.00 ? 44 VAL A O    5  
ATOM   3658  C CB   . VAL A 1 44 ? 4.965   4.538   -11.581 1.00 0.00 ? 44 VAL A CB   5  
ATOM   3659  C CG1  . VAL A 1 44 ? 5.230   3.305   -12.436 1.00 0.00 ? 44 VAL A CG1  5  
ATOM   3660  C CG2  . VAL A 1 44 ? 4.471   5.695   -12.436 1.00 0.00 ? 44 VAL A CG2  5  
ATOM   3661  H H    . VAL A 1 44 ? 4.793   3.662   -8.592  1.00 0.00 ? 44 VAL A H    5  
ATOM   3662  H HA   . VAL A 1 44 ? 3.740   5.163   -9.933  1.00 0.00 ? 44 VAL A HA   5  
ATOM   3663  H HB   . VAL A 1 44 ? 5.902   4.834   -11.130 1.00 0.00 ? 44 VAL A HB   5  
ATOM   3664  H HG11 . VAL A 1 44 ? 4.318   2.743   -12.558 1.00 0.00 ? 44 VAL A HG11 5  
ATOM   3665  H HG12 . VAL A 1 44 ? 5.972   2.686   -11.953 1.00 0.00 ? 44 VAL A HG12 5  
ATOM   3666  H HG13 . VAL A 1 44 ? 5.596   3.612   -13.405 1.00 0.00 ? 44 VAL A HG13 5  
ATOM   3667  H HG21 . VAL A 1 44 ? 4.868   5.600   -13.435 1.00 0.00 ? 44 VAL A HG21 5  
ATOM   3668  H HG22 . VAL A 1 44 ? 4.803   6.628   -12.004 1.00 0.00 ? 44 VAL A HG22 5  
ATOM   3669  H HG23 . VAL A 1 44 ? 3.392   5.680   -12.474 1.00 0.00 ? 44 VAL A HG23 5  
ATOM   3670  N N    . THR A 1 45 ? 1.753   3.328   -10.137 1.00 0.00 ? 45 THR A N    5  
ATOM   3671  C CA   . THR A 1 45 ? 0.442   2.817   -10.517 1.00 0.00 ? 45 THR A CA   5  
ATOM   3672  C C    . THR A 1 45 ? 0.556   1.472   -11.241 1.00 0.00 ? 45 THR A C    5  
ATOM   3673  O O    . THR A 1 45 ? 0.135   0.443   -10.713 1.00 0.00 ? 45 THR A O    5  
ATOM   3674  C CB   . THR A 1 45 ? -0.305  3.857   -11.373 1.00 0.00 ? 45 THR A CB   5  
ATOM   3675  O OG1  . THR A 1 45 ? -1.181  4.621   -10.565 1.00 0.00 ? 45 THR A OG1  5  
ATOM   3676  C CG2  . THR A 1 45 ? -1.133  3.264   -12.497 1.00 0.00 ? 45 THR A CG2  5  
ATOM   3677  H H    . THR A 1 45 ? 1.982   3.397   -9.188  1.00 0.00 ? 45 THR A H    5  
ATOM   3678  H HA   . THR A 1 45 ? -0.115  2.661   -9.606  1.00 0.00 ? 45 THR A HA   5  
ATOM   3679  H HB   . THR A 1 45 ? 0.417   4.531   -11.812 1.00 0.00 ? 45 THR A HB   5  
ATOM   3680  H HG1  . THR A 1 45 ? -0.989  5.554   -10.680 1.00 0.00 ? 45 THR A HG1  5  
ATOM   3681  H HG21 . THR A 1 45 ? -0.499  3.070   -13.348 1.00 0.00 ? 45 THR A HG21 5  
ATOM   3682  H HG22 . THR A 1 45 ? -1.909  3.960   -12.775 1.00 0.00 ? 45 THR A HG22 5  
ATOM   3683  H HG23 . THR A 1 45 ? -1.583  2.339   -12.164 1.00 0.00 ? 45 THR A HG23 5  
ATOM   3684  N N    . ASN A 1 46 ? 1.124   1.479   -12.447 1.00 0.00 ? 46 ASN A N    5  
ATOM   3685  C CA   . ASN A 1 46 ? 1.279   0.248   -13.219 1.00 0.00 ? 46 ASN A CA   5  
ATOM   3686  C C    . ASN A 1 46 ? 1.874   0.526   -14.601 1.00 0.00 ? 46 ASN A C    5  
ATOM   3687  O O    . ASN A 1 46 ? 1.156   0.903   -15.527 1.00 0.00 ? 46 ASN A O    5  
ATOM   3688  C CB   . ASN A 1 46 ? -0.073  -0.455  -13.372 1.00 0.00 ? 46 ASN A CB   5  
ATOM   3689  C CG   . ASN A 1 46 ? -0.189  -1.682  -12.490 1.00 0.00 ? 46 ASN A CG   5  
ATOM   3690  O OD1  . ASN A 1 46 ? 0.814   -2.231  -12.033 1.00 0.00 ? 46 ASN A OD1  5  
ATOM   3691  N ND2  . ASN A 1 46 ? -1.419  -2.120  -12.245 1.00 0.00 ? 46 ASN A ND2  5  
ATOM   3692  H H    . ASN A 1 46 ? 1.446   2.322   -12.824 1.00 0.00 ? 46 ASN A H    5  
ATOM   3693  H HA   . ASN A 1 46 ? 1.947   -0.401  -12.673 1.00 0.00 ? 46 ASN A HA   5  
ATOM   3694  H HB2  . ASN A 1 46 ? -0.861  0.232   -13.104 1.00 0.00 ? 46 ASN A HB2  5  
ATOM   3695  H HB3  . ASN A 1 46 ? -0.201  -0.760  -14.400 1.00 0.00 ? 46 ASN A HB3  5  
ATOM   3696  H HD21 . ASN A 1 46 ? -2.171  -1.634  -12.643 1.00 0.00 ? 46 ASN A HD21 5  
ATOM   3697  H HD22 . ASN A 1 46 ? -1.523  -2.912  -11.678 1.00 0.00 ? 46 ASN A HD22 5  
ATOM   3698  N N    . SER A 1 47 ? 3.184   0.330   -14.737 1.00 0.00 ? 47 SER A N    5  
ATOM   3699  C CA   . SER A 1 47 ? 3.862   0.551   -16.011 1.00 0.00 ? 47 SER A CA   5  
ATOM   3700  C C    . SER A 1 47 ? 3.713   1.998   -16.475 1.00 0.00 ? 47 SER A C    5  
ATOM   3701  O O    . SER A 1 47 ? 3.006   2.280   -17.442 1.00 0.00 ? 47 SER A O    5  
ATOM   3702  C CB   . SER A 1 47 ? 3.308   -0.400  -17.075 1.00 0.00 ? 47 SER A CB   5  
ATOM   3703  O OG   . SER A 1 47 ? 3.805   -1.714  -16.893 1.00 0.00 ? 47 SER A OG   5  
ATOM   3704  H H    . SER A 1 47 ? 3.706   0.023   -13.968 1.00 0.00 ? 47 SER A H    5  
ATOM   3705  H HA   . SER A 1 47 ? 4.910   0.340   -15.866 1.00 0.00 ? 47 SER A HA   5  
ATOM   3706  H HB2  . SER A 1 47 ? 2.230   -0.423  -17.007 1.00 0.00 ? 47 SER A HB2  5  
ATOM   3707  H HB3  . SER A 1 47 ? 3.600   -0.049  -18.055 1.00 0.00 ? 47 SER A HB3  5  
ATOM   3708  H HG   . SER A 1 47 ? 3.650   -1.993  -15.989 1.00 0.00 ? 47 SER A HG   5  
ATOM   3709  N N    . VAL A 1 48 ? 4.375   2.910   -15.764 1.00 0.00 ? 48 VAL A N    5  
ATOM   3710  C CA   . VAL A 1 48 ? 4.328   4.330   -16.069 1.00 0.00 ? 48 VAL A CA   5  
ATOM   3711  C C    . VAL A 1 48 ? 2.908   4.815   -16.254 1.00 0.00 ? 48 VAL A C    5  
ATOM   3712  O O    . VAL A 1 48 ? 2.343   4.781   -17.347 1.00 0.00 ? 48 VAL A O    5  
ATOM   3713  C CB   . VAL A 1 48 ? 5.156   4.730   -17.295 1.00 0.00 ? 48 VAL A CB   5  
ATOM   3714  C CG1  . VAL A 1 48 ? 6.642   4.700   -16.970 1.00 0.00 ? 48 VAL A CG1  5  
ATOM   3715  C CG2  . VAL A 1 48 ? 4.845   3.856   -18.501 1.00 0.00 ? 48 VAL A CG2  5  
ATOM   3716  H H    . VAL A 1 48 ? 4.898   2.622   -14.994 1.00 0.00 ? 48 VAL A H    5  
ATOM   3717  H HA   . VAL A 1 48 ? 4.744   4.847   -15.216 1.00 0.00 ? 48 VAL A HA   5  
ATOM   3718  H HB   . VAL A 1 48 ? 4.886   5.746   -17.532 1.00 0.00 ? 48 VAL A HB   5  
ATOM   3719  H HG11 . VAL A 1 48 ? 7.188   4.303   -17.813 1.00 0.00 ? 48 VAL A HG11 5  
ATOM   3720  H HG12 . VAL A 1 48 ? 6.809   4.073   -16.106 1.00 0.00 ? 48 VAL A HG12 5  
ATOM   3721  H HG13 . VAL A 1 48 ? 6.984   5.702   -16.759 1.00 0.00 ? 48 VAL A HG13 5  
ATOM   3722  H HG21 . VAL A 1 48 ? 5.395   4.216   -19.357 1.00 0.00 ? 48 VAL A HG21 5  
ATOM   3723  H HG22 . VAL A 1 48 ? 3.787   3.895   -18.712 1.00 0.00 ? 48 VAL A HG22 5  
ATOM   3724  H HG23 . VAL A 1 48 ? 5.133   2.836   -18.292 1.00 0.00 ? 48 VAL A HG23 5  
ATOM   3725  N N    . LYS A 1 49 ? 2.356   5.272   -15.157 1.00 0.00 ? 49 LYS A N    5  
ATOM   3726  C CA   . LYS A 1 49 ? 0.994   5.795   -15.122 1.00 0.00 ? 49 LYS A CA   5  
ATOM   3727  C C    . LYS A 1 49 ? 0.006   4.805   -15.733 1.00 0.00 ? 49 LYS A C    5  
ATOM   3728  O O    . LYS A 1 49 ? 0.360   3.665   -16.036 1.00 0.00 ? 49 LYS A O    5  
ATOM   3729  C CB   . LYS A 1 49 ? 0.923   7.133   -15.863 1.00 0.00 ? 49 LYS A CB   5  
ATOM   3730  C CG   . LYS A 1 49 ? 0.856   8.337   -14.937 1.00 0.00 ? 49 LYS A CG   5  
ATOM   3731  C CD   . LYS A 1 49 ? 2.162   9.116   -14.936 1.00 0.00 ? 49 LYS A CD   5  
ATOM   3732  C CE   . LYS A 1 49 ? 2.487   9.656   -13.552 1.00 0.00 ? 49 LYS A CE   5  
ATOM   3733  N NZ   . LYS A 1 49 ? 3.875   10.190  -13.477 1.00 0.00 ? 49 LYS A NZ   5  
ATOM   3734  H H    . LYS A 1 49 ? 2.895   5.263   -14.344 1.00 0.00 ? 49 LYS A H    5  
ATOM   3735  H HA   . LYS A 1 49 ? 0.730   5.954   -14.089 1.00 0.00 ? 49 LYS A HA   5  
ATOM   3736  H HB2  . LYS A 1 49 ? 1.800   7.232   -16.486 1.00 0.00 ? 49 LYS A HB2  5  
ATOM   3737  H HB3  . LYS A 1 49 ? 0.044   7.140   -16.491 1.00 0.00 ? 49 LYS A HB3  5  
ATOM   3738  H HG2  . LYS A 1 49 ? 0.061   8.990   -15.268 1.00 0.00 ? 49 LYS A HG2  5  
ATOM   3739  H HG3  . LYS A 1 49 ? 0.649   7.996   -13.933 1.00 0.00 ? 49 LYS A HG3  5  
ATOM   3740  H HD2  . LYS A 1 49 ? 2.960   8.462   -15.252 1.00 0.00 ? 49 LYS A HD2  5  
ATOM   3741  H HD3  . LYS A 1 49 ? 2.077   9.944   -15.624 1.00 0.00 ? 49 LYS A HD3  5  
ATOM   3742  H HE2  . LYS A 1 49 ? 1.793   10.450  -13.317 1.00 0.00 ? 49 LYS A HE2  5  
ATOM   3743  H HE3  . LYS A 1 49 ? 2.378   8.858   -12.833 1.00 0.00 ? 49 LYS A HE3  5  
ATOM   3744  H HZ1  . LYS A 1 49 ? 3.908   11.156  -13.860 1.00 0.00 ? 49 LYS A HZ1  5  
ATOM   3745  H HZ2  . LYS A 1 49 ? 4.520   9.590   -14.027 1.00 0.00 ? 49 LYS A HZ2  5  
ATOM   3746  H HZ3  . LYS A 1 49 ? 4.197   10.209  -12.488 1.00 0.00 ? 49 LYS A HZ3  5  
HETATM 3747  N N    . CY1 A 1 50 ? -1.235  5.249   -15.913 1.00 0.00 ? 50 CY1 A N    5  
HETATM 3748  C CA   . CY1 A 1 50 ? -2.277  4.405   -16.489 1.00 0.00 ? 50 CY1 A CA   5  
HETATM 3749  C CB   . CY1 A 1 50 ? -3.241  3.933   -15.400 1.00 0.00 ? 50 CY1 A CB   5  
HETATM 3750  S SG   . CY1 A 1 50 ? -4.261  2.545   -15.934 1.00 0.00 ? 50 CY1 A SG   5  
HETATM 3751  C CD   . CY1 A 1 50 ? -3.686  1.211   -14.866 1.00 0.00 ? 50 CY1 A CD   5  
HETATM 3752  N NE   . CY1 A 1 50 ? -3.497  -0.011  -15.641 1.00 0.00 ? 50 CY1 A NE   5  
HETATM 3753  C CZ   . CY1 A 1 50 ? -4.249  -1.100  -15.510 1.00 0.00 ? 50 CY1 A CZ   5  
HETATM 3754  O OAC  . CY1 A 1 50 ? -5.188  -1.198  -14.722 1.00 0.00 ? 50 CY1 A OAC  5  
HETATM 3755  C CM   . CY1 A 1 50 ? -3.882  -2.262  -16.413 1.00 0.00 ? 50 CY1 A CM   5  
HETATM 3756  C C    . CY1 A 1 50 ? -3.045  5.156   -17.572 1.00 0.00 ? 50 CY1 A C    5  
HETATM 3757  O O    . CY1 A 1 50 ? -4.083  5.759   -17.299 1.00 0.00 ? 50 CY1 A O    5  
HETATM 3758  H H    . CY1 A 1 50 ? -1.455  6.168   -15.652 1.00 0.00 ? 50 CY1 A H    5  
HETATM 3759  H HA   . CY1 A 1 50 ? -1.801  3.544   -16.935 1.00 0.00 ? 50 CY1 A HA   5  
HETATM 3760  H HB2  . CY1 A 1 50 ? -2.672  3.626   -14.535 1.00 0.00 ? 50 CY1 A HB2  5  
HETATM 3761  H HB3  . CY1 A 1 50 ? -3.893  4.749   -15.126 1.00 0.00 ? 50 CY1 A HB3  5  
HETATM 3762  H HD2  . CY1 A 1 50 ? -2.728  1.630   -14.596 1.00 0.00 ? 50 CY1 A HD2  5  
HETATM 3763  H HD3  . CY1 A 1 50 ? -4.607  1.152   -14.303 1.00 0.00 ? 50 CY1 A HD3  5  
HETATM 3764  H HE   . CY1 A 1 50 ? -2.696  -0.082  -16.202 1.00 0.00 ? 50 CY1 A HE   5  
HETATM 3765  H HM1  . CY1 A 1 50 ? -2.818  -2.464  -16.315 1.00 0.00 ? 50 CY1 A HM1  5  
HETATM 3766  H HM2  . CY1 A 1 50 ? -4.143  -2.009  -17.439 1.00 0.00 ? 50 CY1 A HM2  5  
HETATM 3767  H HM3  . CY1 A 1 50 ? -4.426  -3.138  -16.127 1.00 0.00 ? 50 CY1 A HM3  5  
HETATM 3768  N N    . NH2 A 1 51 ? -2.549  5.129   -18.804 1.00 0.00 ? 51 NH2 A N    5  
HETATM 3769  H HN1  . NH2 A 1 51 ? -1.720  4.631   -18.958 1.00 0.00 ? 51 NH2 A HN1  5  
HETATM 3770  H HN2  . NH2 A 1 51 ? -3.034  5.608   -19.509 1.00 0.00 ? 51 NH2 A HN2  5  
ATOM   3771  N N    . LEU A 1 1  ? -3.702  -9.540  8.829   1.00 0.00 ? 1  LEU A N    6  
ATOM   3772  C CA   . LEU A 1 1  ? -4.424  -10.221 9.935   1.00 0.00 ? 1  LEU A CA   6  
ATOM   3773  C C    . LEU A 1 1  ? -4.305  -9.438  11.237  1.00 0.00 ? 1  LEU A C    6  
ATOM   3774  O O    . LEU A 1 1  ? -5.305  -8.989  11.797  1.00 0.00 ? 1  LEU A O    6  
ATOM   3775  C CB   . LEU A 1 1  ? -3.838  -11.624 10.109  1.00 0.00 ? 1  LEU A CB   6  
ATOM   3776  C CG   . LEU A 1 1  ? -4.421  -12.690 9.179   1.00 0.00 ? 1  LEU A CG   6  
ATOM   3777  C CD1  . LEU A 1 1  ? -5.937  -12.729 9.298   1.00 0.00 ? 1  LEU A CD1  6  
ATOM   3778  C CD2  . LEU A 1 1  ? -4.003  -12.426 7.740   1.00 0.00 ? 1  LEU A CD2  6  
ATOM   3779  H H1   . LEU A 1 1  ? -2.688  -9.736  8.944   1.00 0.00 ? 1  LEU A H1   6  
ATOM   3780  H H2   . LEU A 1 1  ? -3.897  -8.520  8.904   1.00 0.00 ? 1  LEU A H2   6  
ATOM   3781  H H3   . LEU A 1 1  ? -4.058  -9.926  7.932   1.00 0.00 ? 1  LEU A H3   6  
ATOM   3782  H HA   . LEU A 1 1  ? -5.466  -10.302 9.666   1.00 0.00 ? 1  LEU A HA   6  
ATOM   3783  H HB2  . LEU A 1 1  ? -2.772  -11.570 9.938   1.00 0.00 ? 1  LEU A HB2  6  
ATOM   3784  H HB3  . LEU A 1 1  ? -4.006  -11.938 11.128  1.00 0.00 ? 1  LEU A HB3  6  
ATOM   3785  H HG   . LEU A 1 1  ? -4.039  -13.658 9.468   1.00 0.00 ? 1  LEU A HG   6  
ATOM   3786  H HD11 . LEU A 1 1  ? -6.304  -13.672 8.921   1.00 0.00 ? 1  LEU A HD11 6  
ATOM   3787  H HD12 . LEU A 1 1  ? -6.364  -11.921 8.722   1.00 0.00 ? 1  LEU A HD12 6  
ATOM   3788  H HD13 . LEU A 1 1  ? -6.220  -12.621 10.335  1.00 0.00 ? 1  LEU A HD13 6  
ATOM   3789  H HD21 . LEU A 1 1  ? -3.113  -11.814 7.729   1.00 0.00 ? 1  LEU A HD21 6  
ATOM   3790  H HD22 . LEU A 1 1  ? -4.800  -11.911 7.223   1.00 0.00 ? 1  LEU A HD22 6  
ATOM   3791  H HD23 . LEU A 1 1  ? -3.801  -13.365 7.246   1.00 0.00 ? 1  LEU A HD23 6  
ATOM   3792  N N    . GLN A 1 2  ? -3.075  -9.278  11.716  1.00 0.00 ? 2  GLN A N    6  
ATOM   3793  C CA   . GLN A 1 2  ? -2.826  -8.548  12.953  1.00 0.00 ? 2  GLN A CA   6  
ATOM   3794  C C    . GLN A 1 2  ? -1.744  -7.491  12.756  1.00 0.00 ? 2  GLN A C    6  
ATOM   3795  O O    . GLN A 1 2  ? -0.747  -7.738  12.079  1.00 0.00 ? 2  GLN A O    6  
ATOM   3796  C CB   . GLN A 1 2  ? -2.417  -9.513  14.070  1.00 0.00 ? 2  GLN A CB   6  
ATOM   3797  C CG   . GLN A 1 2  ? -1.469  -10.610 13.614  1.00 0.00 ? 2  GLN A CG   6  
ATOM   3798  C CD   . GLN A 1 2  ? -0.539  -11.074 14.719  1.00 0.00 ? 2  GLN A CD   6  
ATOM   3799  O OE1  . GLN A 1 2  ? -0.862  -11.992 15.473  1.00 0.00 ? 2  GLN A OE1  6  
ATOM   3800  N NE2  . GLN A 1 2  ? 0.623   -10.439 14.823  1.00 0.00 ? 2  GLN A NE2  6  
ATOM   3801  H H    . GLN A 1 2  ? -2.318  -9.659  11.225  1.00 0.00 ? 2  GLN A H    6  
ATOM   3802  H HA   . GLN A 1 2  ? -3.744  -8.055  13.236  1.00 0.00 ? 2  GLN A HA   6  
ATOM   3803  H HB2  . GLN A 1 2  ? -1.933  -8.951  14.854  1.00 0.00 ? 2  GLN A HB2  6  
ATOM   3804  H HB3  . GLN A 1 2  ? -3.307  -9.979  14.469  1.00 0.00 ? 2  GLN A HB3  6  
ATOM   3805  H HG2  . GLN A 1 2  ? -2.050  -11.454 13.277  1.00 0.00 ? 2  GLN A HG2  6  
ATOM   3806  H HG3  . GLN A 1 2  ? -0.872  -10.236 12.794  1.00 0.00 ? 2  GLN A HG3  6  
ATOM   3807  H HE21 . GLN A 1 2  ? 0.815   -9.717  14.190  1.00 0.00 ? 2  GLN A HE21 6  
ATOM   3808  H HE22 . GLN A 1 2  ? 1.242   -10.720 15.530  1.00 0.00 ? 2  GLN A HE22 6  
ATOM   3809  N N    . MET A 1 3  ? -1.965  -6.318  13.361  1.00 0.00 ? 3  MET A N    6  
ATOM   3810  C CA   . MET A 1 3  ? -1.047  -5.175  13.294  1.00 0.00 ? 3  MET A CA   6  
ATOM   3811  C C    . MET A 1 3  ? -1.831  -3.903  13.037  1.00 0.00 ? 3  MET A C    6  
ATOM   3812  O O    . MET A 1 3  ? -2.400  -3.706  11.964  1.00 0.00 ? 3  MET A O    6  
ATOM   3813  C CB   . MET A 1 3  ? 0.031   -5.306  12.217  1.00 0.00 ? 3  MET A CB   6  
ATOM   3814  C CG   . MET A 1 3  ? 1.332   -5.979  12.673  1.00 0.00 ? 3  MET A CG   6  
ATOM   3815  S SD   . MET A 1 3  ? 1.137   -7.065  14.105  1.00 0.00 ? 3  MET A SD   6  
ATOM   3816  C CE   . MET A 1 3  ? 2.792   -7.025  14.788  1.00 0.00 ? 3  MET A CE   6  
ATOM   3817  H H    . MET A 1 3  ? -2.792  -6.211  13.884  1.00 0.00 ? 3  MET A H    6  
ATOM   3818  H HA   . MET A 1 3  ? -0.571  -5.082  14.257  1.00 0.00 ? 3  MET A HA   6  
ATOM   3819  H HB2  . MET A 1 3  ? -0.367  -5.860  11.385  1.00 0.00 ? 3  MET A HB2  6  
ATOM   3820  H HB3  . MET A 1 3  ? 0.276   -4.308  11.886  1.00 0.00 ? 3  MET A HB3  6  
ATOM   3821  H HG2  . MET A 1 3  ? 1.720   -6.566  11.852  1.00 0.00 ? 3  MET A HG2  6  
ATOM   3822  H HG3  . MET A 1 3  ? 2.047   -5.207  12.922  1.00 0.00 ? 3  MET A HG3  6  
ATOM   3823  H HE1  . MET A 1 3  ? 2.793   -7.502  15.756  1.00 0.00 ? 3  MET A HE1  6  
ATOM   3824  H HE2  . MET A 1 3  ? 3.113   -5.999  14.892  1.00 0.00 ? 3  MET A HE2  6  
ATOM   3825  H HE3  . MET A 1 3  ? 3.467   -7.548  14.126  1.00 0.00 ? 3  MET A HE3  6  
ATOM   3826  N N    . ALA A 1 4  ? -1.843  -3.051  14.034  1.00 0.00 ? 4  ALA A N    6  
ATOM   3827  C CA   . ALA A 1 4  ? -2.547  -1.774  13.957  1.00 0.00 ? 4  ALA A CA   6  
ATOM   3828  C C    . ALA A 1 4  ? -1.569  -0.625  13.727  1.00 0.00 ? 4  ALA A C    6  
ATOM   3829  O O    . ALA A 1 4  ? -1.294  0.156   14.637  1.00 0.00 ? 4  ALA A O    6  
ATOM   3830  C CB   . ALA A 1 4  ? -3.349  -1.540  15.228  1.00 0.00 ? 4  ALA A CB   6  
ATOM   3831  H H    . ALA A 1 4  ? -1.360  -3.289  14.848  1.00 0.00 ? 4  ALA A H    6  
ATOM   3832  H HA   . ALA A 1 4  ? -3.241  -1.821  13.127  1.00 0.00 ? 4  ALA A HA   6  
ATOM   3833  H HB1  . ALA A 1 4  ? -2.882  -2.064  16.050  1.00 0.00 ? 4  ALA A HB1  6  
ATOM   3834  H HB2  . ALA A 1 4  ? -4.356  -1.909  15.092  1.00 0.00 ? 4  ALA A HB2  6  
ATOM   3835  H HB3  . ALA A 1 4  ? -3.380  -0.483  15.445  1.00 0.00 ? 4  ALA A HB3  6  
ATOM   3836  N N    . GLY A 1 5  ? -1.043  -0.529  12.507  1.00 0.00 ? 5  GLY A N    6  
ATOM   3837  C CA   . GLY A 1 5  ? -0.094  0.532   12.186  1.00 0.00 ? 5  GLY A CA   6  
ATOM   3838  C C    . GLY A 1 5  ? 1.300   -0.004  11.926  1.00 0.00 ? 5  GLY A C    6  
ATOM   3839  O O    . GLY A 1 5  ? 2.292   0.629   12.288  1.00 0.00 ? 5  GLY A O    6  
ATOM   3840  H H    . GLY A 1 5  ? -1.297  -1.185  11.819  1.00 0.00 ? 5  GLY A H    6  
ATOM   3841  H HA2  . GLY A 1 5  ? -0.437  1.060   11.302  1.00 0.00 ? 5  GLY A HA2  6  
ATOM   3842  H HA3  . GLY A 1 5  ? -0.050  1.232   13.011  1.00 0.00 ? 5  GLY A HA3  6  
ATOM   3843  N N    . GLN A 1 6  ? 1.378   -1.168  11.284  1.00 0.00 ? 6  GLN A N    6  
ATOM   3844  C CA   . GLN A 1 6  ? 2.652   -1.785  10.968  1.00 0.00 ? 6  GLN A CA   6  
ATOM   3845  C C    . GLN A 1 6  ? 2.437   -3.121  10.277  1.00 0.00 ? 6  GLN A C    6  
ATOM   3846  O O    . GLN A 1 6  ? 2.682   -4.186  10.844  1.00 0.00 ? 6  GLN A O    6  
ATOM   3847  C CB   . GLN A 1 6  ? 3.506   -1.957  12.229  1.00 0.00 ? 6  GLN A CB   6  
ATOM   3848  C CG   . GLN A 1 6  ? 4.920   -1.418  12.085  1.00 0.00 ? 6  GLN A CG   6  
ATOM   3849  C CD   . GLN A 1 6  ? 4.965   0.097   12.039  1.00 0.00 ? 6  GLN A CD   6  
ATOM   3850  O OE1  . GLN A 1 6  ? 4.537   0.713   11.063  1.00 0.00 ? 6  GLN A OE1  6  
ATOM   3851  N NE2  . GLN A 1 6  ? 5.485   0.705   13.098  1.00 0.00 ? 6  GLN A NE2  6  
ATOM   3852  H H    . GLN A 1 6  ? 0.558   -1.619  11.008  1.00 0.00 ? 6  GLN A H    6  
ATOM   3853  H HA   . GLN A 1 6  ? 3.158   -1.131  10.282  1.00 0.00 ? 6  GLN A HA   6  
ATOM   3854  H HB2  . GLN A 1 6  ? 3.028   -1.438  13.046  1.00 0.00 ? 6  GLN A HB2  6  
ATOM   3855  H HB3  . GLN A 1 6  ? 3.568   -3.008  12.470  1.00 0.00 ? 6  GLN A HB3  6  
ATOM   3856  H HG2  . GLN A 1 6  ? 5.508   -1.754  12.925  1.00 0.00 ? 6  GLN A HG2  6  
ATOM   3857  H HG3  . GLN A 1 6  ? 5.347   -1.803  11.171  1.00 0.00 ? 6  GLN A HG3  6  
ATOM   3858  H HE21 . GLN A 1 6  ? 5.805   0.152   13.840  1.00 0.00 ? 6  GLN A HE21 6  
ATOM   3859  H HE22 . GLN A 1 6  ? 5.525   1.686   13.096  1.00 0.00 ? 6  GLN A HE22 6  
ATOM   3860  N N    . CYS A 1 7  ? 1.970   -3.040  9.044   1.00 0.00 ? 7  CYS A N    6  
ATOM   3861  C CA   . CYS A 1 7  ? 1.708   -4.227  8.238   1.00 0.00 ? 7  CYS A CA   6  
ATOM   3862  C C    . CYS A 1 7  ? 2.876   -4.537  7.326   1.00 0.00 ? 7  CYS A C    6  
ATOM   3863  O O    . CYS A 1 7  ? 3.755   -3.701  7.115   1.00 0.00 ? 7  CYS A O    6  
ATOM   3864  C CB   . CYS A 1 7  ? 0.456   -4.046  7.384   1.00 0.00 ? 7  CYS A CB   6  
ATOM   3865  S SG   . CYS A 1 7  ? -0.402  -5.612  7.011   1.00 0.00 ? 7  CYS A SG   6  
ATOM   3866  H H    . CYS A 1 7  ? 1.797   -2.152  8.668   1.00 0.00 ? 7  CYS A H    6  
ATOM   3867  H HA   . CYS A 1 7  ? 1.559   -5.058  8.904   1.00 0.00 ? 7  CYS A HA   6  
ATOM   3868  H HB2  . CYS A 1 7  ? -0.238  -3.404  7.901   1.00 0.00 ? 7  CYS A HB2  6  
ATOM   3869  H HB3  . CYS A 1 7  ? 0.737   -3.589  6.437   1.00 0.00 ? 7  CYS A HB3  6  
ATOM   3870  N N    . SER A 1 8  ? 2.865   -5.738  6.764   1.00 0.00 ? 8  SER A N    6  
ATOM   3871  C CA   . SER A 1 8  ? 3.908   -6.149  5.841   1.00 0.00 ? 8  SER A CA   6  
ATOM   3872  C C    . SER A 1 8  ? 4.083   -5.085  4.770   1.00 0.00 ? 8  SER A C    6  
ATOM   3873  O O    . SER A 1 8  ? 3.149   -4.340  4.472   1.00 0.00 ? 8  SER A O    6  
ATOM   3874  C CB   . SER A 1 8  ? 3.560   -7.494  5.200   1.00 0.00 ? 8  SER A CB   6  
ATOM   3875  O OG   . SER A 1 8  ? 2.175   -7.576  4.909   1.00 0.00 ? 8  SER A OG   6  
ATOM   3876  H H    . SER A 1 8  ? 2.125   -6.350  6.960   1.00 0.00 ? 8  SER A H    6  
ATOM   3877  H HA   . SER A 1 8  ? 4.830   -6.244  6.393   1.00 0.00 ? 8  SER A HA   6  
ATOM   3878  H HB2  . SER A 1 8  ? 4.115   -7.608  4.281   1.00 0.00 ? 8  SER A HB2  6  
ATOM   3879  H HB3  . SER A 1 8  ? 3.820   -8.293  5.879   1.00 0.00 ? 8  SER A HB3  6  
ATOM   3880  H HG   . SER A 1 8  ? 1.892   -6.772  4.468   1.00 0.00 ? 8  SER A HG   6  
ATOM   3881  N N    . GLN A 1 9  ? 5.280   -5.000  4.211   1.00 0.00 ? 9  GLN A N    6  
ATOM   3882  C CA   . GLN A 1 9  ? 5.581   -4.004  3.189   1.00 0.00 ? 9  GLN A CA   6  
ATOM   3883  C C    . GLN A 1 9  ? 4.414   -3.782  2.234   1.00 0.00 ? 9  GLN A C    6  
ATOM   3884  O O    . GLN A 1 9  ? 3.669   -4.705  1.909   1.00 0.00 ? 9  GLN A O    6  
ATOM   3885  C CB   . GLN A 1 9  ? 6.834   -4.402  2.406   1.00 0.00 ? 9  GLN A CB   6  
ATOM   3886  C CG   . GLN A 1 9  ? 6.658   -5.660  1.571   1.00 0.00 ? 9  GLN A CG   6  
ATOM   3887  C CD   . GLN A 1 9  ? 7.601   -5.709  0.384   1.00 0.00 ? 9  GLN A CD   6  
ATOM   3888  O OE1  . GLN A 1 9  ? 7.252   -5.287  -0.718  1.00 0.00 ? 9  GLN A OE1  6  
ATOM   3889  N NE2  . GLN A 1 9  ? 8.803   -6.228  0.605   1.00 0.00 ? 9  GLN A NE2  6  
ATOM   3890  H H    . GLN A 1 9  ? 5.986   -5.611  4.506   1.00 0.00 ? 9  GLN A H    6  
ATOM   3891  H HA   . GLN A 1 9  ? 5.768   -3.073  3.698   1.00 0.00 ? 9  GLN A HA   6  
ATOM   3892  H HB2  . GLN A 1 9  ? 7.104   -3.592  1.746   1.00 0.00 ? 9  GLN A HB2  6  
ATOM   3893  H HB3  . GLN A 1 9  ? 7.642   -4.569  3.105   1.00 0.00 ? 9  GLN A HB3  6  
ATOM   3894  H HG2  . GLN A 1 9  ? 6.845   -6.521  2.195   1.00 0.00 ? 9  GLN A HG2  6  
ATOM   3895  H HG3  . GLN A 1 9  ? 5.642   -5.695  1.206   1.00 0.00 ? 9  GLN A HG3  6  
ATOM   3896  H HE21 . GLN A 1 9  ? 9.012   -6.546  1.509   1.00 0.00 ? 9  GLN A HE21 6  
ATOM   3897  H HE22 . GLN A 1 9  ? 9.433   -6.272  -0.144  1.00 0.00 ? 9  GLN A HE22 6  
ATOM   3898  N N    . ASN A 1 10 ? 4.271   -2.532  1.813   1.00 0.00 ? 10 ASN A N    6  
ATOM   3899  C CA   . ASN A 1 10 ? 3.208   -2.115  0.904   1.00 0.00 ? 10 ASN A CA   6  
ATOM   3900  C C    . ASN A 1 10 ? 1.845   -2.624  1.350   1.00 0.00 ? 10 ASN A C    6  
ATOM   3901  O O    . ASN A 1 10 ? 0.968   -2.868  0.523   1.00 0.00 ? 10 ASN A O    6  
ATOM   3902  C CB   . ASN A 1 10 ? 3.501   -2.567  -0.544  1.00 0.00 ? 10 ASN A CB   6  
ATOM   3903  C CG   . ASN A 1 10 ? 3.742   -4.063  -0.656  1.00 0.00 ? 10 ASN A CG   6  
ATOM   3904  O OD1  . ASN A 1 10 ? 4.864   -4.499  -0.914  1.00 0.00 ? 10 ASN A OD1  6  
ATOM   3905  N ND2  . ASN A 1 10 ? 2.694   -4.861  -0.467  1.00 0.00 ? 10 ASN A ND2  6  
ATOM   3906  H H    . ASN A 1 10 ? 4.904   -1.855  2.135   1.00 0.00 ? 10 ASN A H    6  
ATOM   3907  H HA   . ASN A 1 10 ? 3.177   -1.038  0.941   1.00 0.00 ? 10 ASN A HA   6  
ATOM   3908  H HB2  . ASN A 1 10 ? 2.660   -2.311  -1.176  1.00 0.00 ? 10 ASN A HB2  6  
ATOM   3909  H HB3  . ASN A 1 10 ? 4.382   -2.056  -0.910  1.00 0.00 ? 10 ASN A HB3  6  
ATOM   3910  H HD21 . ASN A 1 10 ? 1.826   -4.453  -0.266  1.00 0.00 ? 10 ASN A HD21 6  
ATOM   3911  H HD22 . ASN A 1 10 ? 2.832   -5.829  -0.536  1.00 0.00 ? 10 ASN A HD22 6  
ATOM   3912  N N    . GLU A 1 11 ? 1.663   -2.763  2.658   1.00 0.00 ? 11 GLU A N    6  
ATOM   3913  C CA   . GLU A 1 11 ? 0.384   -3.222  3.187   1.00 0.00 ? 11 GLU A CA   6  
ATOM   3914  C C    . GLU A 1 11 ? -0.128  -2.287  4.260   1.00 0.00 ? 11 GLU A C    6  
ATOM   3915  O O    . GLU A 1 11 ? 0.642   -1.820  5.098   1.00 0.00 ? 11 GLU A O    6  
ATOM   3916  C CB   . GLU A 1 11 ? 0.496   -4.652  3.714   1.00 0.00 ? 11 GLU A CB   6  
ATOM   3917  C CG   . GLU A 1 11 ? -0.654  -5.543  3.272   1.00 0.00 ? 11 GLU A CG   6  
ATOM   3918  C CD   . GLU A 1 11 ? -0.270  -7.009  3.220   1.00 0.00 ? 11 GLU A CD   6  
ATOM   3919  O OE1  . GLU A 1 11 ? 0.869   -7.310  2.807   1.00 0.00 ? 11 GLU A OE1  6  
ATOM   3920  O OE2  . GLU A 1 11 ? -1.111  -7.856  3.589   1.00 0.00 ? 11 GLU A OE2  6  
ATOM   3921  H H    . GLU A 1 11 ? 2.398   -2.539  3.278   1.00 0.00 ? 11 GLU A H    6  
ATOM   3922  H HA   . GLU A 1 11 ? -0.316  -3.203  2.392   1.00 0.00 ? 11 GLU A HA   6  
ATOM   3923  H HB2  . GLU A 1 11 ? 1.417   -5.085  3.355   1.00 0.00 ? 11 GLU A HB2  6  
ATOM   3924  H HB3  . GLU A 1 11 ? 0.514   -4.629  4.791   1.00 0.00 ? 11 GLU A HB3  6  
ATOM   3925  H HG2  . GLU A 1 11 ? -1.469  -5.425  3.969   1.00 0.00 ? 11 GLU A HG2  6  
ATOM   3926  H HG3  . GLU A 1 11 ? -0.974  -5.233  2.287   1.00 0.00 ? 11 GLU A HG3  6  
ATOM   3927  N N    . TYR A 1 12 ? -1.435  -1.989  4.230   1.00 0.00 ? 12 TYR A N    6  
ATOM   3928  C CA   . TYR A 1 12 ? -1.984  -1.075  5.238   1.00 0.00 ? 12 TYR A CA   6  
ATOM   3929  C C    . TYR A 1 12 ? -3.264  -1.605  5.876   1.00 0.00 ? 12 TYR A C    6  
ATOM   3930  O O    . TYR A 1 12 ? -4.240  -1.913  5.196   1.00 0.00 ? 12 TYR A O    6  
ATOM   3931  C CB   . TYR A 1 12 ? -2.198  0.325   4.648   1.00 0.00 ? 12 TYR A CB   6  
ATOM   3932  C CG   . TYR A 1 12 ? -3.448  0.485   3.813   1.00 0.00 ? 12 TYR A CG   6  
ATOM   3933  C CD1  . TYR A 1 12 ? -3.475  0.085   2.485   1.00 0.00 ? 12 TYR A CD1  6  
ATOM   3934  C CD2  . TYR A 1 12 ? -4.594  1.051   4.353   1.00 0.00 ? 12 TYR A CD2  6  
ATOM   3935  C CE1  . TYR A 1 12 ? -4.612  0.243   1.717   1.00 0.00 ? 12 TYR A CE1  6  
ATOM   3936  C CE2  . TYR A 1 12 ? -5.734  1.213   3.592   1.00 0.00 ? 12 TYR A CE2  6  
ATOM   3937  C CZ   . TYR A 1 12 ? -5.738  0.808   2.275   1.00 0.00 ? 12 TYR A CZ   6  
ATOM   3938  O OH   . TYR A 1 12 ? -6.873  0.968   1.512   1.00 0.00 ? 12 TYR A OH   6  
ATOM   3939  H H    . TYR A 1 12 ? -2.031  -2.381  3.519   1.00 0.00 ? 12 TYR A H    6  
ATOM   3940  H HA   . TYR A 1 12 ? -1.243  -0.993  6.024   1.00 0.00 ? 12 TYR A HA   6  
ATOM   3941  H HB2  . TYR A 1 12 ? -2.254  1.037   5.457   1.00 0.00 ? 12 TYR A HB2  6  
ATOM   3942  H HB3  . TYR A 1 12 ? -1.351  0.572   4.024   1.00 0.00 ? 12 TYR A HB3  6  
ATOM   3943  H HD1  . TYR A 1 12 ? -2.591  -0.358  2.052   1.00 0.00 ? 12 TYR A HD1  6  
ATOM   3944  H HD2  . TYR A 1 12 ? -4.588  1.367   5.385   1.00 0.00 ? 12 TYR A HD2  6  
ATOM   3945  H HE1  . TYR A 1 12 ? -4.613  -0.072  0.685   1.00 0.00 ? 12 TYR A HE1  6  
ATOM   3946  H HE2  . TYR A 1 12 ? -6.616  1.657   4.030   1.00 0.00 ? 12 TYR A HE2  6  
ATOM   3947  H HH   . TYR A 1 12 ? -6.834  1.811   1.053   1.00 0.00 ? 12 TYR A HH   6  
ATOM   3948  N N    . PHE A 1 13 ? -3.231  -1.698  7.206   1.00 0.00 ? 13 PHE A N    6  
ATOM   3949  C CA   . PHE A 1 13 ? -4.357  -2.185  7.996   1.00 0.00 ? 13 PHE A CA   6  
ATOM   3950  C C    . PHE A 1 13 ? -5.382  -1.083  8.233   1.00 0.00 ? 13 PHE A C    6  
ATOM   3951  O O    . PHE A 1 13 ? -5.124  -0.135  8.974   1.00 0.00 ? 13 PHE A O    6  
ATOM   3952  C CB   . PHE A 1 13 ? -3.852  -2.702  9.346   1.00 0.00 ? 13 PHE A CB   6  
ATOM   3953  C CG   . PHE A 1 13 ? -4.878  -3.480  10.118  1.00 0.00 ? 13 PHE A CG   6  
ATOM   3954  C CD1  . PHE A 1 13 ? -5.152  -4.799  9.794   1.00 0.00 ? 13 PHE A CD1  6  
ATOM   3955  C CD2  . PHE A 1 13 ? -5.566  -2.893  11.167  1.00 0.00 ? 13 PHE A CD2  6  
ATOM   3956  C CE1  . PHE A 1 13 ? -6.096  -5.518  10.503  1.00 0.00 ? 13 PHE A CE1  6  
ATOM   3957  C CE2  . PHE A 1 13 ? -6.510  -3.607  11.879  1.00 0.00 ? 13 PHE A CE2  6  
ATOM   3958  C CZ   . PHE A 1 13 ? -6.775  -4.921  11.548  1.00 0.00 ? 13 PHE A CZ   6  
ATOM   3959  H H    . PHE A 1 13 ? -2.412  -1.428  7.672   1.00 0.00 ? 13 PHE A H    6  
ATOM   3960  H HA   . PHE A 1 13 ? -4.828  -3.000  7.463   1.00 0.00 ? 13 PHE A HA   6  
ATOM   3961  H HB2  . PHE A 1 13 ? -3.001  -3.344  9.183   1.00 0.00 ? 13 PHE A HB2  6  
ATOM   3962  H HB3  . PHE A 1 13 ? -3.549  -1.861  9.953   1.00 0.00 ? 13 PHE A HB3  6  
ATOM   3963  H HD1  . PHE A 1 13 ? -4.622  -5.267  8.978   1.00 0.00 ? 13 PHE A HD1  6  
ATOM   3964  H HD2  . PHE A 1 13 ? -5.361  -1.866  11.427  1.00 0.00 ? 13 PHE A HD2  6  
ATOM   3965  H HE1  . PHE A 1 13 ? -6.301  -6.546  10.243  1.00 0.00 ? 13 PHE A HE1  6  
ATOM   3966  H HE2  . PHE A 1 13 ? -7.040  -3.138  12.695  1.00 0.00 ? 13 PHE A HE2  6  
ATOM   3967  H HZ   . PHE A 1 13 ? -7.513  -5.482  12.103  1.00 0.00 ? 13 PHE A HZ   6  
ATOM   3968  N N    . ASP A 1 14 ? -6.553  -1.221  7.624   1.00 0.00 ? 14 ASP A N    6  
ATOM   3969  C CA   . ASP A 1 14 ? -7.615  -0.239  7.803   1.00 0.00 ? 14 ASP A CA   6  
ATOM   3970  C C    . ASP A 1 14 ? -8.282  -0.451  9.146   1.00 0.00 ? 14 ASP A C    6  
ATOM   3971  O O    . ASP A 1 14 ? -9.174  -1.279  9.278   1.00 0.00 ? 14 ASP A O    6  
ATOM   3972  C CB   . ASP A 1 14 ? -8.650  -0.353  6.683   1.00 0.00 ? 14 ASP A CB   6  
ATOM   3973  C CG   . ASP A 1 14 ? -8.247  0.413   5.440   1.00 0.00 ? 14 ASP A CG   6  
ATOM   3974  O OD1  . ASP A 1 14 ? -8.313  1.660   5.462   1.00 0.00 ? 14 ASP A OD1  6  
ATOM   3975  O OD2  . ASP A 1 14 ? -7.868  -0.236  4.441   1.00 0.00 ? 14 ASP A OD2  6  
ATOM   3976  H H    . ASP A 1 14 ? -6.714  -2.011  7.059   1.00 0.00 ? 14 ASP A H    6  
ATOM   3977  H HA   . ASP A 1 14 ? -7.178  0.749   7.787   1.00 0.00 ? 14 ASP A HA   6  
ATOM   3978  H HB2  . ASP A 1 14 ? -8.768  -1.390  6.419   1.00 0.00 ? 14 ASP A HB2  6  
ATOM   3979  H HB3  . ASP A 1 14 ? -9.594  0.037   7.034   1.00 0.00 ? 14 ASP A HB3  6  
ATOM   3980  N N    . SER A 1 15 ? -7.840  0.294   10.149  1.00 0.00 ? 15 SER A N    6  
ATOM   3981  C CA   . SER A 1 15 ? -8.398  0.169   11.490  1.00 0.00 ? 15 SER A CA   6  
ATOM   3982  C C    . SER A 1 15 ? -9.921  0.212   11.457  1.00 0.00 ? 15 SER A C    6  
ATOM   3983  O O    . SER A 1 15 ? -10.585 -0.325  12.344  1.00 0.00 ? 15 SER A O    6  
ATOM   3984  C CB   . SER A 1 15 ? -7.859  1.274   12.400  1.00 0.00 ? 15 SER A CB   6  
ATOM   3985  O OG   . SER A 1 15 ? -8.365  2.541   12.017  1.00 0.00 ? 15 SER A OG   6  
ATOM   3986  H H    . SER A 1 15 ? -7.118  0.935   9.985   1.00 0.00 ? 15 SER A H    6  
ATOM   3987  H HA   . SER A 1 15 ? -8.091  -0.791  11.880  1.00 0.00 ? 15 SER A HA   6  
ATOM   3988  H HB2  . SER A 1 15 ? -8.156  1.075   13.418  1.00 0.00 ? 15 SER A HB2  6  
ATOM   3989  H HB3  . SER A 1 15 ? -6.781  1.296   12.337  1.00 0.00 ? 15 SER A HB3  6  
ATOM   3990  H HG   . SER A 1 15 ? -8.206  2.681   11.081  1.00 0.00 ? 15 SER A HG   6  
ATOM   3991  N N    . LEU A 1 16 ? -10.470 0.838   10.424  1.00 0.00 ? 16 LEU A N    6  
ATOM   3992  C CA   . LEU A 1 16 ? -11.917 0.930   10.277  1.00 0.00 ? 16 LEU A CA   6  
ATOM   3993  C C    . LEU A 1 16 ? -12.468 -0.332  9.619   1.00 0.00 ? 16 LEU A C    6  
ATOM   3994  O O    . LEU A 1 16 ? -13.631 -0.688  9.807   1.00 0.00 ? 16 LEU A O    6  
ATOM   3995  C CB   . LEU A 1 16 ? -12.294 2.160   9.450   1.00 0.00 ? 16 LEU A CB   6  
ATOM   3996  C CG   . LEU A 1 16 ? -13.792 2.466   9.390   1.00 0.00 ? 16 LEU A CG   6  
ATOM   3997  C CD1  . LEU A 1 16 ? -14.038 3.962   9.507   1.00 0.00 ? 16 LEU A CD1  6  
ATOM   3998  C CD2  . LEU A 1 16 ? -14.396 1.925   8.102   1.00 0.00 ? 16 LEU A CD2  6  
ATOM   3999  H H    . LEU A 1 16 ? -9.891  1.238   9.738   1.00 0.00 ? 16 LEU A H    6  
ATOM   4000  H HA   . LEU A 1 16 ? -12.346 1.025   11.264  1.00 0.00 ? 16 LEU A HA   6  
ATOM   4001  H HB2  . LEU A 1 16 ? -11.786 3.018   9.868   1.00 0.00 ? 16 LEU A HB2  6  
ATOM   4002  H HB3  . LEU A 1 16 ? -11.939 2.010   8.441   1.00 0.00 ? 16 LEU A HB3  6  
ATOM   4003  H HG   . LEU A 1 16 ? -14.284 1.982   10.220  1.00 0.00 ? 16 LEU A HG   6  
ATOM   4004  H HD11 . LEU A 1 16 ? -14.083 4.397   8.520   1.00 0.00 ? 16 LEU A HD11 6  
ATOM   4005  H HD12 . LEU A 1 16 ? -13.233 4.417   10.065  1.00 0.00 ? 16 LEU A HD12 6  
ATOM   4006  H HD13 . LEU A 1 16 ? -14.973 4.134   10.020  1.00 0.00 ? 16 LEU A HD13 6  
ATOM   4007  H HD21 . LEU A 1 16 ? -14.775 0.928   8.274   1.00 0.00 ? 16 LEU A HD21 6  
ATOM   4008  H HD22 . LEU A 1 16 ? -13.638 1.894   7.334   1.00 0.00 ? 16 LEU A HD22 6  
ATOM   4009  H HD23 . LEU A 1 16 ? -15.203 2.567   7.785   1.00 0.00 ? 16 LEU A HD23 6  
ATOM   4010  N N    . LEU A 1 17 ? -11.621 -0.996  8.839   1.00 0.00 ? 17 LEU A N    6  
ATOM   4011  C CA   . LEU A 1 17 ? -12.003 -2.210  8.135   1.00 0.00 ? 17 LEU A CA   6  
ATOM   4012  C C    . LEU A 1 17 ? -11.461 -3.465  8.818   1.00 0.00 ? 17 LEU A C    6  
ATOM   4013  O O    . LEU A 1 17 ? -11.957 -4.566  8.580   1.00 0.00 ? 17 LEU A O    6  
ATOM   4014  C CB   . LEU A 1 17 ? -11.476 -2.149  6.704   1.00 0.00 ? 17 LEU A CB   6  
ATOM   4015  C CG   . LEU A 1 17 ? -11.917 -0.921  5.907   1.00 0.00 ? 17 LEU A CG   6  
ATOM   4016  C CD1  . LEU A 1 17 ? -11.276 -0.921  4.528   1.00 0.00 ? 17 LEU A CD1  6  
ATOM   4017  C CD2  . LEU A 1 17 ? -13.434 -0.877  5.793   1.00 0.00 ? 17 LEU A CD2  6  
ATOM   4018  H H    . LEU A 1 17 ? -10.711 -0.654  8.723   1.00 0.00 ? 17 LEU A H    6  
ATOM   4019  H HA   . LEU A 1 17 ? -13.082 -2.260  8.108   1.00 0.00 ? 17 LEU A HA   6  
ATOM   4020  H HB2  . LEU A 1 17 ? -10.393 -2.156  6.747   1.00 0.00 ? 17 LEU A HB2  6  
ATOM   4021  H HB3  . LEU A 1 17 ? -11.806 -3.031  6.179   1.00 0.00 ? 17 LEU A HB3  6  
ATOM   4022  H HG   . LEU A 1 17 ? -11.594 -0.029  6.427   1.00 0.00 ? 17 LEU A HG   6  
ATOM   4023  H HD11 . LEU A 1 17 ? -10.382 -1.526  4.546   1.00 0.00 ? 17 LEU A HD11 6  
ATOM   4024  H HD12 . LEU A 1 17 ? -11.021 0.091   4.250   1.00 0.00 ? 17 LEU A HD12 6  
ATOM   4025  H HD13 . LEU A 1 17 ? -11.971 -1.327  3.808   1.00 0.00 ? 17 LEU A HD13 6  
ATOM   4026  H HD21 . LEU A 1 17 ? -13.714 -0.245  4.963   1.00 0.00 ? 17 LEU A HD21 6  
ATOM   4027  H HD22 . LEU A 1 17 ? -13.851 -0.479  6.706   1.00 0.00 ? 17 LEU A HD22 6  
ATOM   4028  H HD23 . LEU A 1 17 ? -13.811 -1.875  5.630   1.00 0.00 ? 17 LEU A HD23 6  
ATOM   4029  N N    . HIS A 1 18 ? -10.425 -3.309  9.644   1.00 0.00 ? 18 HIS A N    6  
ATOM   4030  C CA   . HIS A 1 18 ? -9.822  -4.451  10.315  1.00 0.00 ? 18 HIS A CA   6  
ATOM   4031  C C    . HIS A 1 18 ? -9.277  -5.420  9.276   1.00 0.00 ? 18 HIS A C    6  
ATOM   4032  O O    . HIS A 1 18 ? -9.567  -6.618  9.298   1.00 0.00 ? 18 HIS A O    6  
ATOM   4033  C CB   . HIS A 1 18 ? -10.845 -5.156  11.194  1.00 0.00 ? 18 HIS A CB   6  
ATOM   4034  C CG   . HIS A 1 18 ? -10.859 -4.668  12.610  1.00 0.00 ? 18 HIS A CG   6  
ATOM   4035  N ND1  . HIS A 1 18 ? -11.652 -3.625  13.039  1.00 0.00 ? 18 HIS A ND1  6  
ATOM   4036  C CD2  . HIS A 1 18 ? -10.170 -5.087  13.698  1.00 0.00 ? 18 HIS A CD2  6  
ATOM   4037  C CE1  . HIS A 1 18 ? -11.451 -3.423  14.329  1.00 0.00 ? 18 HIS A CE1  6  
ATOM   4038  N NE2  . HIS A 1 18 ? -10.557 -4.297  14.752  1.00 0.00 ? 18 HIS A NE2  6  
ATOM   4039  H H    . HIS A 1 18 ? -10.047 -2.414  9.787   1.00 0.00 ? 18 HIS A H    6  
ATOM   4040  H HA   . HIS A 1 18 ? -9.009  -4.092  10.927  1.00 0.00 ? 18 HIS A HA   6  
ATOM   4041  H HB2  . HIS A 1 18 ? -11.825 -5.001  10.777  1.00 0.00 ? 18 HIS A HB2  6  
ATOM   4042  H HB3  . HIS A 1 18 ? -10.623 -6.211  11.205  1.00 0.00 ? 18 HIS A HB3  6  
ATOM   4043  H HD1  . HIS A 1 18 ? -12.272 -3.109  12.481  1.00 0.00 ? 18 HIS A HD1  6  
ATOM   4044  H HD2  . HIS A 1 18 ? -9.450  -5.893  13.730  1.00 0.00 ? 18 HIS A HD2  6  
ATOM   4045  H HE1  . HIS A 1 18 ? -11.936 -2.672  14.934  1.00 0.00 ? 18 HIS A HE1  6  
ATOM   4046  H HE2  . HIS A 1 18 ? -10.294 -4.429  15.687  1.00 0.00 ? 18 HIS A HE2  6  
ATOM   4047  N N    . ALA A 1 19 ? -8.495  -4.878  8.360   1.00 0.00 ? 19 ALA A N    6  
ATOM   4048  C CA   . ALA A 1 19 ? -7.909  -5.642  7.292   1.00 0.00 ? 19 ALA A CA   6  
ATOM   4049  C C    . ALA A 1 19 ? -6.720  -4.923  6.706   1.00 0.00 ? 19 ALA A C    6  
ATOM   4050  O O    . ALA A 1 19 ? -6.743  -3.713  6.485   1.00 0.00 ? 19 ALA A O    6  
ATOM   4051  C CB   . ALA A 1 19 ? -8.913  -5.874  6.179   1.00 0.00 ? 19 ALA A CB   6  
ATOM   4052  H H    . ALA A 1 19 ? -8.311  -3.932  8.402   1.00 0.00 ? 19 ALA A H    6  
ATOM   4053  H HA   . ALA A 1 19 ? -7.601  -6.599  7.680   1.00 0.00 ? 19 ALA A HA   6  
ATOM   4054  H HB1  . ALA A 1 19 ? -8.521  -5.449  5.258   1.00 0.00 ? 19 ALA A HB1  6  
ATOM   4055  H HB2  . ALA A 1 19 ? -9.848  -5.397  6.429   1.00 0.00 ? 19 ALA A HB2  6  
ATOM   4056  H HB3  . ALA A 1 19 ? -9.069  -6.934  6.047   1.00 0.00 ? 19 ALA A HB3  6  
ATOM   4057  N N    . CYS A 1 20 ? -5.708  -5.692  6.420   1.00 0.00 ? 20 CYS A N    6  
ATOM   4058  C CA   . CYS A 1 20 ? -4.512  -5.167  5.803   1.00 0.00 ? 20 CYS A CA   6  
ATOM   4059  C C    . CYS A 1 20 ? -4.689  -5.166  4.287   1.00 0.00 ? 20 CYS A C    6  
ATOM   4060  O O    . CYS A 1 20 ? -4.796  -6.219  3.658   1.00 0.00 ? 20 CYS A O    6  
ATOM   4061  C CB   . CYS A 1 20 ? -3.288  -5.986  6.196   1.00 0.00 ? 20 CYS A CB   6  
ATOM   4062  S SG   . CYS A 1 20 ? -2.322  -5.270  7.562   1.00 0.00 ? 20 CYS A SG   6  
ATOM   4063  H H    . CYS A 1 20 ? -5.784  -6.640  6.604   1.00 0.00 ? 20 CYS A H    6  
ATOM   4064  H HA   . CYS A 1 20 ? -4.393  -4.149  6.139   1.00 0.00 ? 20 CYS A HA   6  
ATOM   4065  H HB2  . CYS A 1 20 ? -3.607  -6.972  6.500   1.00 0.00 ? 20 CYS A HB2  6  
ATOM   4066  H HB3  . CYS A 1 20 ? -2.637  -6.071  5.341   1.00 0.00 ? 20 CYS A HB3  6  
ATOM   4067  N N    . ILE A 1 21 ? -4.745  -3.975  3.722   1.00 0.00 ? 21 ILE A N    6  
ATOM   4068  C CA   . ILE A 1 21 ? -4.936  -3.801  2.288   1.00 0.00 ? 21 ILE A CA   6  
ATOM   4069  C C    . ILE A 1 21 ? -3.634  -3.401  1.621   1.00 0.00 ? 21 ILE A C    6  
ATOM   4070  O O    . ILE A 1 21 ? -2.865  -2.615  2.169   1.00 0.00 ? 21 ILE A O    6  
ATOM   4071  C CB   . ILE A 1 21 ? -5.996  -2.711  2.005   1.00 0.00 ? 21 ILE A CB   6  
ATOM   4072  C CG1  . ILE A 1 21 ? -7.391  -3.176  2.440   1.00 0.00 ? 21 ILE A CG1  6  
ATOM   4073  C CG2  . ILE A 1 21 ? -6.027  -2.324  0.527   1.00 0.00 ? 21 ILE A CG2  6  
ATOM   4074  C CD1  . ILE A 1 21 ? -7.445  -3.734  3.840   1.00 0.00 ? 21 ILE A CD1  6  
ATOM   4075  H H    . ILE A 1 21 ? -4.667  -3.185  4.289   1.00 0.00 ? 21 ILE A H    6  
ATOM   4076  H HA   . ILE A 1 21 ? -5.279  -4.736  1.876   1.00 0.00 ? 21 ILE A HA   6  
ATOM   4077  H HB   . ILE A 1 21 ? -5.717  -1.837  2.576   1.00 0.00 ? 21 ILE A HB   6  
ATOM   4078  H HG12 . ILE A 1 21 ? -8.070  -2.339  2.393   1.00 0.00 ? 21 ILE A HG12 6  
ATOM   4079  H HG13 . ILE A 1 21 ? -7.731  -3.946  1.762   1.00 0.00 ? 21 ILE A HG13 6  
ATOM   4080  H HG21 . ILE A 1 21 ? -5.022  -2.281  0.138   1.00 0.00 ? 21 ILE A HG21 6  
ATOM   4081  H HG22 . ILE A 1 21 ? -6.494  -1.356  0.421   1.00 0.00 ? 21 ILE A HG22 6  
ATOM   4082  H HG23 . ILE A 1 21 ? -6.596  -3.057  -0.023  1.00 0.00 ? 21 ILE A HG23 6  
ATOM   4083  H HD11 . ILE A 1 21 ? -6.793  -3.160  4.475   1.00 0.00 ? 21 ILE A HD11 6  
ATOM   4084  H HD12 . ILE A 1 21 ? -7.123  -4.765  3.830   1.00 0.00 ? 21 ILE A HD12 6  
ATOM   4085  H HD13 . ILE A 1 21 ? -8.457  -3.677  4.212   1.00 0.00 ? 21 ILE A HD13 6  
ATOM   4086  N N    . PRO A 1 22 ? -3.365  -3.924  0.419   1.00 0.00 ? 22 PRO A N    6  
ATOM   4087  C CA   . PRO A 1 22 ? -2.143  -3.592  -0.294  1.00 0.00 ? 22 PRO A CA   6  
ATOM   4088  C C    . PRO A 1 22 ? -2.174  -2.173  -0.863  1.00 0.00 ? 22 PRO A C    6  
ATOM   4089  O O    . PRO A 1 22 ? -3.237  -1.565  -0.975  1.00 0.00 ? 22 PRO A O    6  
ATOM   4090  C CB   . PRO A 1 22 ? -2.092  -4.631  -1.416  1.00 0.00 ? 22 PRO A CB   6  
ATOM   4091  C CG   . PRO A 1 22 ? -3.519  -4.978  -1.668  1.00 0.00 ? 22 PRO A CG   6  
ATOM   4092  C CD   . PRO A 1 22 ? -4.213  -4.874  -0.329  1.00 0.00 ? 22 PRO A CD   6  
ATOM   4093  H HA   . PRO A 1 22 ? -1.292  -3.705  0.353   1.00 0.00 ? 22 PRO A HA   6  
ATOM   4094  H HB2  . PRO A 1 22 ? -1.628  -4.199  -2.291  1.00 0.00 ? 22 PRO A HB2  6  
ATOM   4095  H HB3  . PRO A 1 22 ? -1.529  -5.492  -1.089  1.00 0.00 ? 22 PRO A HB3  6  
ATOM   4096  H HG2  . PRO A 1 22 ? -3.946  -4.276  -2.372  1.00 0.00 ? 22 PRO A HG2  6  
ATOM   4097  H HG3  . PRO A 1 22 ? -3.588  -5.985  -2.054  1.00 0.00 ? 22 PRO A HG3  6  
ATOM   4098  H HD2  . PRO A 1 22 ? -5.214  -4.490  -0.448  1.00 0.00 ? 22 PRO A HD2  6  
ATOM   4099  H HD3  . PRO A 1 22 ? -4.234  -5.836  0.163   1.00 0.00 ? 22 PRO A HD3  6  
ATOM   4100  N N    . CYS A 1 23 ? -1.001  -1.647  -1.212  1.00 0.00 ? 23 CYS A N    6  
ATOM   4101  C CA   . CYS A 1 23 ? -0.901  -0.289  -1.762  1.00 0.00 ? 23 CYS A CA   6  
ATOM   4102  C C    . CYS A 1 23 ? -0.442  -0.306  -3.219  1.00 0.00 ? 23 CYS A C    6  
ATOM   4103  O O    . CYS A 1 23 ? -0.667  0.654   -3.956  1.00 0.00 ? 23 CYS A O    6  
ATOM   4104  C CB   . CYS A 1 23 ? 0.060   0.564   -0.926  1.00 0.00 ? 23 CYS A CB   6  
ATOM   4105  S SG   . CYS A 1 23 ? -0.130  0.347   0.874   1.00 0.00 ? 23 CYS A SG   6  
ATOM   4106  H H    . CYS A 1 23 ? -0.185  -2.180  -1.095  1.00 0.00 ? 23 CYS A H    6  
ATOM   4107  H HA   . CYS A 1 23 ? -1.885  0.158   -1.720  1.00 0.00 ? 23 CYS A HA   6  
ATOM   4108  H HB2  . CYS A 1 23 ? 1.079   0.313   -1.183  1.00 0.00 ? 23 CYS A HB2  6  
ATOM   4109  H HB3  . CYS A 1 23 ? -0.113  1.606   -1.150  1.00 0.00 ? 23 CYS A HB3  6  
ATOM   4110  N N    . GLN A 1 24 ? 0.198   -1.396  -3.631  1.00 0.00 ? 24 GLN A N    6  
ATOM   4111  C CA   . GLN A 1 24 ? 0.680   -1.519  -5.008  1.00 0.00 ? 24 GLN A CA   6  
ATOM   4112  C C    . GLN A 1 24 ? -0.467  -1.359  -5.991  1.00 0.00 ? 24 GLN A C    6  
ATOM   4113  O O    . GLN A 1 24 ? -0.412  -0.541  -6.910  1.00 0.00 ? 24 GLN A O    6  
ATOM   4114  C CB   . GLN A 1 24 ? 1.371   -2.870  -5.236  1.00 0.00 ? 24 GLN A CB   6  
ATOM   4115  C CG   . GLN A 1 24 ? 1.988   -3.474  -3.985  1.00 0.00 ? 24 GLN A CG   6  
ATOM   4116  C CD   . GLN A 1 24 ? 3.042   -4.517  -4.299  1.00 0.00 ? 24 GLN A CD   6  
ATOM   4117  O OE1  . GLN A 1 24 ? 3.794   -4.385  -5.265  1.00 0.00 ? 24 GLN A OE1  6  
ATOM   4118  N NE2  . GLN A 1 24 ? 3.105   -5.561  -3.480  1.00 0.00 ? 24 GLN A NE2  6  
ATOM   4119  H H    . GLN A 1 24 ? 0.347   -2.129  -3.002  1.00 0.00 ? 24 GLN A H    6  
ATOM   4120  H HA   . GLN A 1 24 ? 1.384   -0.730  -5.179  1.00 0.00 ? 24 GLN A HA   6  
ATOM   4121  H HB2  . GLN A 1 24 ? 0.645   -3.569  -5.624  1.00 0.00 ? 24 GLN A HB2  6  
ATOM   4122  H HB3  . GLN A 1 24 ? 2.155   -2.738  -5.968  1.00 0.00 ? 24 GLN A HB3  6  
ATOM   4123  H HG2  . GLN A 1 24 ? 2.443   -2.686  -3.406  1.00 0.00 ? 24 GLN A HG2  6  
ATOM   4124  H HG3  . GLN A 1 24 ? 1.203   -3.939  -3.404  1.00 0.00 ? 24 GLN A HG3  6  
ATOM   4125  H HE21 . GLN A 1 24 ? 2.475   -5.601  -2.730  1.00 0.00 ? 24 GLN A HE21 6  
ATOM   4126  H HE22 . GLN A 1 24 ? 3.778   -6.251  -3.660  1.00 0.00 ? 24 GLN A HE22 6  
ATOM   4127  N N    . LEU A 1 25 ? -1.504  -2.147  -5.781  1.00 0.00 ? 25 LEU A N    6  
ATOM   4128  C CA   . LEU A 1 25 ? -2.685  -2.115  -6.632  1.00 0.00 ? 25 LEU A CA   6  
ATOM   4129  C C    . LEU A 1 25 ? -3.431  -0.785  -6.499  1.00 0.00 ? 25 LEU A C    6  
ATOM   4130  O O    . LEU A 1 25 ? -4.337  -0.495  -7.281  1.00 0.00 ? 25 LEU A O    6  
ATOM   4131  C CB   . LEU A 1 25 ? -3.621  -3.274  -6.285  1.00 0.00 ? 25 LEU A CB   6  
ATOM   4132  C CG   . LEU A 1 25 ? -4.507  -3.757  -7.436  1.00 0.00 ? 25 LEU A CG   6  
ATOM   4133  C CD1  . LEU A 1 25 ? -3.829  -4.889  -8.191  1.00 0.00 ? 25 LEU A CD1  6  
ATOM   4134  C CD2  . LEU A 1 25 ? -5.864  -4.203  -6.912  1.00 0.00 ? 25 LEU A CD2  6  
ATOM   4135  H H    . LEU A 1 25 ? -1.474  -2.768  -5.030  1.00 0.00 ? 25 LEU A H    6  
ATOM   4136  H HA   . LEU A 1 25 ? -2.354  -2.227  -7.649  1.00 0.00 ? 25 LEU A HA   6  
ATOM   4137  H HB2  . LEU A 1 25 ? -3.019  -4.105  -5.947  1.00 0.00 ? 25 LEU A HB2  6  
ATOM   4138  H HB3  . LEU A 1 25 ? -4.261  -2.962  -5.474  1.00 0.00 ? 25 LEU A HB3  6  
ATOM   4139  H HG   . LEU A 1 25 ? -4.665  -2.942  -8.126  1.00 0.00 ? 25 LEU A HG   6  
ATOM   4140  H HD11 . LEU A 1 25 ? -2.762  -4.838  -8.035  1.00 0.00 ? 25 LEU A HD11 6  
ATOM   4141  H HD12 . LEU A 1 25 ? -4.043  -4.795  -9.246  1.00 0.00 ? 25 LEU A HD12 6  
ATOM   4142  H HD13 . LEU A 1 25 ? -4.201  -5.836  -7.831  1.00 0.00 ? 25 LEU A HD13 6  
ATOM   4143  H HD21 . LEU A 1 25 ? -5.731  -5.008  -6.205  1.00 0.00 ? 25 LEU A HD21 6  
ATOM   4144  H HD22 . LEU A 1 25 ? -6.474  -4.544  -7.736  1.00 0.00 ? 25 LEU A HD22 6  
ATOM   4145  H HD23 . LEU A 1 25 ? -6.352  -3.372  -6.423  1.00 0.00 ? 25 LEU A HD23 6  
ATOM   4146  N N    . ARG A 1 26 ? -3.054  0.016   -5.504  1.00 0.00 ? 26 ARG A N    6  
ATOM   4147  C CA   . ARG A 1 26 ? -3.697  1.306   -5.280  1.00 0.00 ? 26 ARG A CA   6  
ATOM   4148  C C    . ARG A 1 26 ? -2.766  2.468   -5.605  1.00 0.00 ? 26 ARG A C    6  
ATOM   4149  O O    . ARG A 1 26 ? -3.155  3.634   -5.536  1.00 0.00 ? 26 ARG A O    6  
ATOM   4150  C CB   . ARG A 1 26 ? -4.180  1.416   -3.836  1.00 0.00 ? 26 ARG A CB   6  
ATOM   4151  C CG   . ARG A 1 26 ? -4.851  0.153   -3.319  1.00 0.00 ? 26 ARG A CG   6  
ATOM   4152  C CD   . ARG A 1 26 ? -6.111  -0.169  -4.107  1.00 0.00 ? 26 ARG A CD   6  
ATOM   4153  N NE   . ARG A 1 26 ? -7.098  0.904   -4.009  1.00 0.00 ? 26 ARG A NE   6  
ATOM   4154  C CZ   . ARG A 1 26 ? -7.938  1.049   -2.986  1.00 0.00 ? 26 ARG A CZ   6  
ATOM   4155  N NH1  . ARG A 1 26 ? -7.916  0.192   -1.972  1.00 0.00 ? 26 ARG A NH1  6  
ATOM   4156  N NH2  . ARG A 1 26 ? -8.804  2.052   -2.977  1.00 0.00 ? 26 ARG A NH2  6  
ATOM   4157  H H    . ARG A 1 26 ? -2.332  -0.266  -4.910  1.00 0.00 ? 26 ARG A H    6  
ATOM   4158  H HA   . ARG A 1 26 ? -4.536  1.356   -5.937  1.00 0.00 ? 26 ARG A HA   6  
ATOM   4159  H HB2  . ARG A 1 26 ? -3.333  1.637   -3.205  1.00 0.00 ? 26 ARG A HB2  6  
ATOM   4160  H HB3  . ARG A 1 26 ? -4.888  2.225   -3.769  1.00 0.00 ? 26 ARG A HB3  6  
ATOM   4161  H HG2  . ARG A 1 26 ? -4.161  -0.672  -3.409  1.00 0.00 ? 26 ARG A HG2  6  
ATOM   4162  H HG3  . ARG A 1 26 ? -5.112  0.295   -2.280  1.00 0.00 ? 26 ARG A HG3  6  
ATOM   4163  H HD2  . ARG A 1 26 ? -5.837  -0.317  -5.141  1.00 0.00 ? 26 ARG A HD2  6  
ATOM   4164  H HD3  . ARG A 1 26 ? -6.531  -1.084  -3.719  1.00 0.00 ? 26 ARG A HD3  6  
ATOM   4165  H HE   . ARG A 1 26 ? -7.136  1.551   -4.743  1.00 0.00 ? 26 ARG A HE   6  
ATOM   4166  H HH11 . ARG A 1 26 ? -7.266  -0.567  -1.971  1.00 0.00 ? 26 ARG A HH11 6  
ATOM   4167  H HH12 . ARG A 1 26 ? -8.551  0.306   -1.208  1.00 0.00 ? 26 ARG A HH12 6  
ATOM   4168  H HH21 . ARG A 1 26 ? -8.825  2.701   -3.738  1.00 0.00 ? 26 ARG A HH21 6  
ATOM   4169  H HH22 . ARG A 1 26 ? -9.436  2.162   -2.211  1.00 0.00 ? 26 ARG A HH22 6  
ATOM   4170  N N    . CYS A 1 27 ? -1.544  2.134   -5.964  1.00 0.00 ? 27 CYS A N    6  
ATOM   4171  C CA   . CYS A 1 27 ? -0.532  3.137   -6.318  1.00 0.00 ? 27 CYS A CA   6  
ATOM   4172  C C    . CYS A 1 27 ? -1.049  4.022   -7.462  1.00 0.00 ? 27 CYS A C    6  
ATOM   4173  O O    . CYS A 1 27 ? -2.110  3.756   -8.027  1.00 0.00 ? 27 CYS A O    6  
ATOM   4174  C CB   . CYS A 1 27 ? 0.788   2.445   -6.724  1.00 0.00 ? 27 CYS A CB   6  
ATOM   4175  S SG   . CYS A 1 27 ? 2.243   3.540   -6.853  1.00 0.00 ? 27 CYS A SG   6  
ATOM   4176  H H    . CYS A 1 27 ? -1.322  1.185   -5.995  1.00 0.00 ? 27 CYS A H    6  
ATOM   4177  H HA   . CYS A 1 27 ? -0.357  3.754   -5.449  1.00 0.00 ? 27 CYS A HA   6  
ATOM   4178  H HB2  . CYS A 1 27 ? 1.031   1.689   -5.992  1.00 0.00 ? 27 CYS A HB2  6  
ATOM   4179  H HB3  . CYS A 1 27 ? 0.653   1.972   -7.687  1.00 0.00 ? 27 CYS A HB3  6  
ATOM   4180  N N    . SER A 1 28 ? -0.287  5.056   -7.813  1.00 0.00 ? 28 SER A N    6  
ATOM   4181  C CA   . SER A 1 28 ? -0.644  5.955   -8.893  1.00 0.00 ? 28 SER A CA   6  
ATOM   4182  C C    . SER A 1 28 ? -1.933  6.728   -8.620  1.00 0.00 ? 28 SER A C    6  
ATOM   4183  O O    . SER A 1 28 ? -2.866  6.711   -9.424  1.00 0.00 ? 28 SER A O    6  
ATOM   4184  C CB   . SER A 1 28 ? -0.734  5.149   -10.170 1.00 0.00 ? 28 SER A CB   6  
ATOM   4185  O OG   . SER A 1 28 ? -2.045  4.657   -10.390 1.00 0.00 ? 28 SER A OG   6  
ATOM   4186  H H    . SER A 1 28 ? 0.544   5.205   -7.360  1.00 0.00 ? 28 SER A H    6  
ATOM   4187  H HA   . SER A 1 28 ? 0.161   6.666   -8.996  1.00 0.00 ? 28 SER A HA   6  
ATOM   4188  H HB2  . SER A 1 28 ? -0.440  5.763   -11.007 1.00 0.00 ? 28 SER A HB2  6  
ATOM   4189  H HB3  . SER A 1 28 ? -0.058  4.314   -10.075 1.00 0.00 ? 28 SER A HB3  6  
ATOM   4190  H HG   . SER A 1 28 ? -2.080  4.203   -11.236 1.00 0.00 ? 28 SER A HG   6  
ATOM   4191  N N    . SER A 1 29 ? -1.959  7.437   -7.495  1.00 0.00 ? 29 SER A N    6  
ATOM   4192  C CA   . SER A 1 29 ? -3.106  8.254   -7.126  1.00 0.00 ? 29 SER A CA   6  
ATOM   4193  C C    . SER A 1 29 ? -4.355  7.422   -6.891  1.00 0.00 ? 29 SER A C    6  
ATOM   4194  O O    . SER A 1 29 ? -4.468  6.284   -7.347  1.00 0.00 ? 29 SER A O    6  
ATOM   4195  C CB   . SER A 1 29 ? -3.370  9.294   -8.215  1.00 0.00 ? 29 SER A CB   6  
ATOM   4196  O OG   . SER A 1 29 ? -4.231  8.784   -9.219  1.00 0.00 ? 29 SER A OG   6  
ATOM   4197  H H    . SER A 1 29 ? -1.179  7.429   -6.912  1.00 0.00 ? 29 SER A H    6  
ATOM   4198  H HA   . SER A 1 29 ? -2.868  8.777   -6.208  1.00 0.00 ? 29 SER A HA   6  
ATOM   4199  H HB2  . SER A 1 29 ? -3.828  10.166  -7.773  1.00 0.00 ? 29 SER A HB2  6  
ATOM   4200  H HB3  . SER A 1 29 ? -2.431  9.573   -8.670  1.00 0.00 ? 29 SER A HB3  6  
ATOM   4201  H HG   . SER A 1 29 ? -3.805  8.858   -10.075 1.00 0.00 ? 29 SER A HG   6  
ATOM   4202  N N    . ASN A 1 30 ? -5.287  8.033   -6.172  1.00 0.00 ? 30 ASN A N    6  
ATOM   4203  C CA   . ASN A 1 30 ? -6.576  7.421   -5.832  1.00 0.00 ? 30 ASN A CA   6  
ATOM   4204  C C    . ASN A 1 30 ? -6.484  6.580   -4.561  1.00 0.00 ? 30 ASN A C    6  
ATOM   4205  O O    . ASN A 1 30 ? -7.392  5.806   -4.257  1.00 0.00 ? 30 ASN A O    6  
ATOM   4206  C CB   . ASN A 1 30 ? -7.108  6.566   -6.991  1.00 0.00 ? 30 ASN A CB   6  
ATOM   4207  C CG   . ASN A 1 30 ? -8.564  6.856   -7.306  1.00 0.00 ? 30 ASN A CG   6  
ATOM   4208  O OD1  . ASN A 1 30 ? -8.965  6.875   -8.470  1.00 0.00 ? 30 ASN A OD1  6  
ATOM   4209  N ND2  . ASN A 1 30 ? -9.363  7.083   -6.271  1.00 0.00 ? 30 ASN A ND2  6  
ATOM   4210  H H    . ASN A 1 30 ? -5.096  8.937   -5.857  1.00 0.00 ? 30 ASN A H    6  
ATOM   4211  H HA   . ASN A 1 30 ? -7.274  8.226   -5.653  1.00 0.00 ? 30 ASN A HA   6  
ATOM   4212  H HB2  . ASN A 1 30 ? -6.524  6.768   -7.876  1.00 0.00 ? 30 ASN A HB2  6  
ATOM   4213  H HB3  . ASN A 1 30 ? -7.014  5.522   -6.734  1.00 0.00 ? 30 ASN A HB3  6  
ATOM   4214  H HD21 . ASN A 1 30 ? -8.976  7.052   -5.371  1.00 0.00 ? 30 ASN A HD21 6  
ATOM   4215  H HD22 . ASN A 1 30 ? -10.308 7.274   -6.449  1.00 0.00 ? 30 ASN A HD22 6  
ATOM   4216  N N    . THR A 1 31 ? -5.395  6.746   -3.814  1.00 0.00 ? 31 THR A N    6  
ATOM   4217  C CA   . THR A 1 31 ? -5.192  6.012   -2.582  1.00 0.00 ? 31 THR A CA   6  
ATOM   4218  C C    . THR A 1 31 ? -3.999  6.571   -1.802  1.00 0.00 ? 31 THR A C    6  
ATOM   4219  O O    . THR A 1 31 ? -2.930  5.962   -1.786  1.00 0.00 ? 31 THR A O    6  
ATOM   4220  C CB   . THR A 1 31 ? -4.969  4.530   -2.884  1.00 0.00 ? 31 THR A CB   6  
ATOM   4221  O OG1  . THR A 1 31 ? -6.105  3.971   -3.516  1.00 0.00 ? 31 THR A OG1  6  
ATOM   4222  C CG2  . THR A 1 31 ? -4.675  3.696   -1.655  1.00 0.00 ? 31 THR A CG2  6  
ATOM   4223  H H    . THR A 1 31 ? -4.716  7.380   -4.094  1.00 0.00 ? 31 THR A H    6  
ATOM   4224  H HA   . THR A 1 31 ? -6.076  6.113   -1.998  1.00 0.00 ? 31 THR A HA   6  
ATOM   4225  H HB   . THR A 1 31 ? -4.129  4.440   -3.554  1.00 0.00 ? 31 THR A HB   6  
ATOM   4226  H HG1  . THR A 1 31 ? -6.888  4.156   -2.990  1.00 0.00 ? 31 THR A HG1  6  
ATOM   4227  H HG21 . THR A 1 31 ? -5.563  3.152   -1.369  1.00 0.00 ? 31 THR A HG21 6  
ATOM   4228  H HG22 . THR A 1 31 ? -4.372  4.341   -0.843  1.00 0.00 ? 31 THR A HG22 6  
ATOM   4229  H HG23 . THR A 1 31 ? -3.881  2.998   -1.875  1.00 0.00 ? 31 THR A HG23 6  
ATOM   4230  N N    . PRO A 1 32 ? -4.152  7.745   -1.148  1.00 0.00 ? 32 PRO A N    6  
ATOM   4231  C CA   . PRO A 1 32 ? -3.068  8.368   -0.378  1.00 0.00 ? 32 PRO A CA   6  
ATOM   4232  C C    . PRO A 1 32 ? -2.303  7.357   0.477   1.00 0.00 ? 32 PRO A C    6  
ATOM   4233  O O    . PRO A 1 32 ? -2.755  6.971   1.555   1.00 0.00 ? 32 PRO A O    6  
ATOM   4234  C CB   . PRO A 1 32 ? -3.788  9.399   0.513   1.00 0.00 ? 32 PRO A CB   6  
ATOM   4235  C CG   . PRO A 1 32 ? -5.252  9.192   0.281   1.00 0.00 ? 32 PRO A CG   6  
ATOM   4236  C CD   . PRO A 1 32 ? -5.367  8.570   -1.098  1.00 0.00 ? 32 PRO A CD   6  
ATOM   4237  H HA   . PRO A 1 32 ? -2.374  8.879   -1.027  1.00 0.00 ? 32 PRO A HA   6  
ATOM   4238  H HB2  . PRO A 1 32 ? -3.527  9.226   1.547   1.00 0.00 ? 32 PRO A HB2  6  
ATOM   4239  H HB3  . PRO A 1 32 ? -3.484  10.395  0.227   1.00 0.00 ? 32 PRO A HB3  6  
ATOM   4240  H HG2  . PRO A 1 32 ? -5.643  8.523   1.041   1.00 0.00 ? 32 PRO A HG2  6  
ATOM   4241  H HG3  . PRO A 1 32 ? -5.766  10.146  0.322   1.00 0.00 ? 32 PRO A HG3  6  
ATOM   4242  H HD2  . PRO A 1 32 ? -6.261  7.967   -1.182  1.00 0.00 ? 32 PRO A HD2  6  
ATOM   4243  H HD3  . PRO A 1 32 ? -5.344  9.327   -1.873  1.00 0.00 ? 32 PRO A HD3  6  
ATOM   4244  N N    . PRO A 1 33 ? -1.128  6.910   -0.004  1.00 0.00 ? 33 PRO A N    6  
ATOM   4245  C CA   . PRO A 1 33 ? -0.295  5.943   0.698   1.00 0.00 ? 33 PRO A CA   6  
ATOM   4246  C C    . PRO A 1 33 ? 0.718   6.594   1.612   1.00 0.00 ? 33 PRO A C    6  
ATOM   4247  O O    . PRO A 1 33 ? 1.900   6.668   1.295   1.00 0.00 ? 33 PRO A O    6  
ATOM   4248  C CB   . PRO A 1 33 ? 0.402   5.224   -0.453  1.00 0.00 ? 33 PRO A CB   6  
ATOM   4249  C CG   . PRO A 1 33 ? 0.550   6.260   -1.523  1.00 0.00 ? 33 PRO A CG   6  
ATOM   4250  C CD   . PRO A 1 33 ? -0.513  7.310   -1.283  1.00 0.00 ? 33 PRO A CD   6  
ATOM   4251  H HA   . PRO A 1 33 ? -0.874  5.242   1.270   1.00 0.00 ? 33 PRO A HA   6  
ATOM   4252  H HB2  . PRO A 1 33 ? 1.362   4.857   -0.122  1.00 0.00 ? 33 PRO A HB2  6  
ATOM   4253  H HB3  . PRO A 1 33 ? -0.210  4.398   -0.788  1.00 0.00 ? 33 PRO A HB3  6  
ATOM   4254  H HG2  . PRO A 1 33 ? 1.531   6.706   -1.461  1.00 0.00 ? 33 PRO A HG2  6  
ATOM   4255  H HG3  . PRO A 1 33 ? 0.410   5.804   -2.491  1.00 0.00 ? 33 PRO A HG3  6  
ATOM   4256  H HD2  . PRO A 1 33 ? -0.063  8.288   -1.201  1.00 0.00 ? 33 PRO A HD2  6  
ATOM   4257  H HD3  . PRO A 1 33 ? -1.240  7.297   -2.080  1.00 0.00 ? 33 PRO A HD3  6  
ATOM   4258  N N    . LEU A 1 34 ? 0.259   7.060   2.760   1.00 0.00 ? 34 LEU A N    6  
ATOM   4259  C CA   . LEU A 1 34 ? 1.173   7.693   3.703   1.00 0.00 ? 34 LEU A CA   6  
ATOM   4260  C C    . LEU A 1 34 ? 2.225   6.700   4.187   1.00 0.00 ? 34 LEU A C    6  
ATOM   4261  O O    . LEU A 1 34 ? 3.403   7.042   4.281   1.00 0.00 ? 34 LEU A O    6  
ATOM   4262  C CB   . LEU A 1 34 ? 0.452   8.382   4.885   1.00 0.00 ? 34 LEU A CB   6  
ATOM   4263  C CG   . LEU A 1 34 ? -0.725  7.639   5.544   1.00 0.00 ? 34 LEU A CG   6  
ATOM   4264  C CD1  . LEU A 1 34 ? -0.266  6.334   6.178   1.00 0.00 ? 34 LEU A CD1  6  
ATOM   4265  C CD2  . LEU A 1 34 ? -1.373  8.530   6.594   1.00 0.00 ? 34 LEU A CD2  6  
ATOM   4266  H H    . LEU A 1 34 ? -0.695  6.978   2.963   1.00 0.00 ? 34 LEU A H    6  
ATOM   4267  H HA   . LEU A 1 34 ? 1.699   8.445   3.140   1.00 0.00 ? 34 LEU A HA   6  
ATOM   4268  H HB2  . LEU A 1 34 ? 1.187   8.573   5.651   1.00 0.00 ? 34 LEU A HB2  6  
ATOM   4269  H HB3  . LEU A 1 34 ? 0.083   9.335   4.532   1.00 0.00 ? 34 LEU A HB3  6  
ATOM   4270  H HG   . LEU A 1 34 ? -1.475  7.412   4.802   1.00 0.00 ? 34 LEU A HG   6  
ATOM   4271  H HD11 . LEU A 1 34 ? -0.723  6.227   7.152   1.00 0.00 ? 34 LEU A HD11 6  
ATOM   4272  H HD12 . LEU A 1 34 ? 0.808   6.344   6.287   1.00 0.00 ? 34 LEU A HD12 6  
ATOM   4273  H HD13 . LEU A 1 34 ? -0.558  5.504   5.553   1.00 0.00 ? 34 LEU A HD13 6  
ATOM   4274  H HD21 . LEU A 1 34 ? -1.199  9.567   6.342   1.00 0.00 ? 34 LEU A HD21 6  
ATOM   4275  H HD22 . LEU A 1 34 ? -0.943  8.317   7.561   1.00 0.00 ? 34 LEU A HD22 6  
ATOM   4276  H HD23 . LEU A 1 34 ? -2.436  8.340   6.621   1.00 0.00 ? 34 LEU A HD23 6  
ATOM   4277  N N    . THR A 1 35 ? 1.818   5.465   4.458   1.00 0.00 ? 35 THR A N    6  
ATOM   4278  C CA   . THR A 1 35 ? 2.753   4.444   4.884   1.00 0.00 ? 35 THR A CA   6  
ATOM   4279  C C    . THR A 1 35 ? 3.237   3.634   3.681   1.00 0.00 ? 35 THR A C    6  
ATOM   4280  O O    . THR A 1 35 ? 3.990   2.672   3.839   1.00 0.00 ? 35 THR A O    6  
ATOM   4281  C CB   . THR A 1 35 ? 2.099   3.518   5.910   1.00 0.00 ? 35 THR A CB   6  
ATOM   4282  O OG1  . THR A 1 35 ? 3.033   2.573   6.401   1.00 0.00 ? 35 THR A OG1  6  
ATOM   4283  C CG2  . THR A 1 35 ? 0.918   2.751   5.356   1.00 0.00 ? 35 THR A CG2  6  
ATOM   4284  H H    . THR A 1 35 ? 0.880   5.226   4.350   1.00 0.00 ? 35 THR A H    6  
ATOM   4285  H HA   . THR A 1 35 ? 3.597   4.936   5.340   1.00 0.00 ? 35 THR A HA   6  
ATOM   4286  H HB   . THR A 1 35 ? 1.747   4.110   6.743   1.00 0.00 ? 35 THR A HB   6  
ATOM   4287  H HG1  . THR A 1 35 ? 3.446   2.119   5.663   1.00 0.00 ? 35 THR A HG1  6  
ATOM   4288  H HG21 . THR A 1 35 ? 1.150   2.402   4.361   1.00 0.00 ? 35 THR A HG21 6  
ATOM   4289  H HG22 . THR A 1 35 ? 0.054   3.398   5.318   1.00 0.00 ? 35 THR A HG22 6  
ATOM   4290  H HG23 . THR A 1 35 ? 0.706   1.906   5.995   1.00 0.00 ? 35 THR A HG23 6  
ATOM   4291  N N    . CYS A 1 36 ? 2.797   4.016   2.473   1.00 0.00 ? 36 CYS A N    6  
ATOM   4292  C CA   . CYS A 1 36 ? 3.194   3.295   1.268   1.00 0.00 ? 36 CYS A CA   6  
ATOM   4293  C C    . CYS A 1 36 ? 3.755   4.222   0.184   1.00 0.00 ? 36 CYS A C    6  
ATOM   4294  O O    . CYS A 1 36 ? 4.215   3.751   -0.855  1.00 0.00 ? 36 CYS A O    6  
ATOM   4295  C CB   . CYS A 1 36 ? 2.007   2.505   0.715   1.00 0.00 ? 36 CYS A CB   6  
ATOM   4296  S SG   . CYS A 1 36 ? 1.642   0.978   1.639   1.00 0.00 ? 36 CYS A SG   6  
ATOM   4297  H H    . CYS A 1 36 ? 2.188   4.785   2.393   1.00 0.00 ? 36 CYS A H    6  
ATOM   4298  H HA   . CYS A 1 36 ? 3.964   2.601   1.552   1.00 0.00 ? 36 CYS A HA   6  
ATOM   4299  H HB2  . CYS A 1 36 ? 1.123   3.125   0.746   1.00 0.00 ? 36 CYS A HB2  6  
ATOM   4300  H HB3  . CYS A 1 36 ? 2.211   2.230   -0.309  1.00 0.00 ? 36 CYS A HB3  6  
ATOM   4301  N N    . GLN A 1 37 ? 3.717   5.532   0.417   1.00 0.00 ? 37 GLN A N    6  
ATOM   4302  C CA   . GLN A 1 37 ? 4.218   6.496   -0.558  1.00 0.00 ? 37 GLN A CA   6  
ATOM   4303  C C    . GLN A 1 37 ? 5.626   6.138   -1.016  1.00 0.00 ? 37 GLN A C    6  
ATOM   4304  O O    . GLN A 1 37 ? 6.014   6.428   -2.147  1.00 0.00 ? 37 GLN A O    6  
ATOM   4305  C CB   . GLN A 1 37 ? 4.201   7.908   0.032   1.00 0.00 ? 37 GLN A CB   6  
ATOM   4306  C CG   . GLN A 1 37 ? 3.436   8.912   -0.815  1.00 0.00 ? 37 GLN A CG   6  
ATOM   4307  C CD   . GLN A 1 37 ? 3.782   10.347  -0.470  1.00 0.00 ? 37 GLN A CD   6  
ATOM   4308  O OE1  . GLN A 1 37 ? 4.893   10.810  -0.731  1.00 0.00 ? 37 GLN A OE1  6  
ATOM   4309  N NE2  . GLN A 1 37 ? 2.830   11.061  0.120   1.00 0.00 ? 37 GLN A NE2  6  
ATOM   4310  H H    . GLN A 1 37 ? 3.336   5.863   1.258   1.00 0.00 ? 37 GLN A H    6  
ATOM   4311  H HA   . GLN A 1 37 ? 3.563   6.465   -1.412  1.00 0.00 ? 37 GLN A HA   6  
ATOM   4312  H HB2  . GLN A 1 37 ? 3.743   7.872   1.009   1.00 0.00 ? 37 GLN A HB2  6  
ATOM   4313  H HB3  . GLN A 1 37 ? 5.218   8.259   0.134   1.00 0.00 ? 37 GLN A HB3  6  
ATOM   4314  H HG2  . GLN A 1 37 ? 3.672   8.742   -1.855  1.00 0.00 ? 37 GLN A HG2  6  
ATOM   4315  H HG3  . GLN A 1 37 ? 2.378   8.765   -0.658  1.00 0.00 ? 37 GLN A HG3  6  
ATOM   4316  H HE21 . GLN A 1 37 ? 1.969   10.627  0.297   1.00 0.00 ? 37 GLN A HE21 6  
ATOM   4317  H HE22 . GLN A 1 37 ? 3.027   11.992  0.353   1.00 0.00 ? 37 GLN A HE22 6  
ATOM   4318  N N    . ARG A 1 38 ? 6.384   5.509   -0.133  1.00 0.00 ? 38 ARG A N    6  
ATOM   4319  C CA   . ARG A 1 38 ? 7.749   5.111   -0.453  1.00 0.00 ? 38 ARG A CA   6  
ATOM   4320  C C    . ARG A 1 38 ? 7.754   3.929   -1.417  1.00 0.00 ? 38 ARG A C    6  
ATOM   4321  O O    . ARG A 1 38 ? 8.530   3.895   -2.369  1.00 0.00 ? 38 ARG A O    6  
ATOM   4322  C CB   . ARG A 1 38 ? 8.532   4.774   0.825   1.00 0.00 ? 38 ARG A CB   6  
ATOM   4323  C CG   . ARG A 1 38 ? 8.155   3.445   1.467   1.00 0.00 ? 38 ARG A CG   6  
ATOM   4324  C CD   . ARG A 1 38 ? 6.837   3.538   2.220   1.00 0.00 ? 38 ARG A CD   6  
ATOM   4325  N NE   . ARG A 1 38 ? 6.832   2.686   3.407   1.00 0.00 ? 38 ARG A NE   6  
ATOM   4326  C CZ   . ARG A 1 38 ? 7.514   2.957   4.518   1.00 0.00 ? 38 ARG A CZ   6  
ATOM   4327  N NH1  . ARG A 1 38 ? 8.256   4.055   4.599   1.00 0.00 ? 38 ARG A NH1  6  
ATOM   4328  N NH2  . ARG A 1 38 ? 7.454   2.127   5.551   1.00 0.00 ? 38 ARG A NH2  6  
ATOM   4329  H H    . ARG A 1 38 ? 6.016   5.305   0.749   1.00 0.00 ? 38 ARG A H    6  
ATOM   4330  H HA   . ARG A 1 38 ? 8.226   5.951   -0.941  1.00 0.00 ? 38 ARG A HA   6  
ATOM   4331  H HB2  . ARG A 1 38 ? 9.585   4.743   0.587   1.00 0.00 ? 38 ARG A HB2  6  
ATOM   4332  H HB3  . ARG A 1 38 ? 8.363   5.558   1.549   1.00 0.00 ? 38 ARG A HB3  6  
ATOM   4333  H HG2  . ARG A 1 38 ? 8.067   2.694   0.700   1.00 0.00 ? 38 ARG A HG2  6  
ATOM   4334  H HG3  . ARG A 1 38 ? 8.933   3.162   2.161   1.00 0.00 ? 38 ARG A HG3  6  
ATOM   4335  H HD2  . ARG A 1 38 ? 6.684   4.568   2.511   1.00 0.00 ? 38 ARG A HD2  6  
ATOM   4336  H HD3  . ARG A 1 38 ? 6.042   3.237   1.556   1.00 0.00 ? 38 ARG A HD3  6  
ATOM   4337  H HE   . ARG A 1 38 ? 6.293   1.869   3.375   1.00 0.00 ? 38 ARG A HE   6  
ATOM   4338  H HH11 . ARG A 1 38 ? 8.305   4.685   3.825   1.00 0.00 ? 38 ARG A HH11 6  
ATOM   4339  H HH12 . ARG A 1 38 ? 8.766   4.253   5.437   1.00 0.00 ? 38 ARG A HH12 6  
ATOM   4340  H HH21 . ARG A 1 38 ? 6.897   1.299   5.495   1.00 0.00 ? 38 ARG A HH21 6  
ATOM   4341  H HH22 . ARG A 1 38 ? 7.967   2.330   6.385   1.00 0.00 ? 38 ARG A HH22 6  
ATOM   4342  N N    . TYR A 1 39 ? 6.874   2.964   -1.170  1.00 0.00 ? 39 TYR A N    6  
ATOM   4343  C CA   . TYR A 1 39 ? 6.778   1.786   -2.016  1.00 0.00 ? 39 TYR A CA   6  
ATOM   4344  C C    . TYR A 1 39 ? 6.041   2.104   -3.307  1.00 0.00 ? 39 TYR A C    6  
ATOM   4345  O O    . TYR A 1 39 ? 6.454   1.687   -4.389  1.00 0.00 ? 39 TYR A O    6  
ATOM   4346  C CB   . TYR A 1 39 ? 6.072   0.651   -1.272  1.00 0.00 ? 39 TYR A CB   6  
ATOM   4347  C CG   . TYR A 1 39 ? 6.126   -0.668  -2.005  1.00 0.00 ? 39 TYR A CG   6  
ATOM   4348  C CD1  . TYR A 1 39 ? 5.260   -0.934  -3.057  1.00 0.00 ? 39 TYR A CD1  6  
ATOM   4349  C CD2  . TYR A 1 39 ? 7.054   -1.641  -1.655  1.00 0.00 ? 39 TYR A CD2  6  
ATOM   4350  C CE1  . TYR A 1 39 ? 5.314   -2.134  -3.739  1.00 0.00 ? 39 TYR A CE1  6  
ATOM   4351  C CE2  . TYR A 1 39 ? 7.116   -2.842  -2.334  1.00 0.00 ? 39 TYR A CE2  6  
ATOM   4352  C CZ   . TYR A 1 39 ? 6.244   -3.085  -3.375  1.00 0.00 ? 39 TYR A CZ   6  
ATOM   4353  O OH   . TYR A 1 39 ? 6.303   -4.281  -4.054  1.00 0.00 ? 39 TYR A OH   6  
ATOM   4354  H H    . TYR A 1 39 ? 6.280   3.044   -0.406  1.00 0.00 ? 39 TYR A H    6  
ATOM   4355  H HA   . TYR A 1 39 ? 7.778   1.480   -2.258  1.00 0.00 ? 39 TYR A HA   6  
ATOM   4356  H HB2  . TYR A 1 39 ? 6.539   0.515   -0.308  1.00 0.00 ? 39 TYR A HB2  6  
ATOM   4357  H HB3  . TYR A 1 39 ? 5.033   0.912   -1.131  1.00 0.00 ? 39 TYR A HB3  6  
ATOM   4358  H HD1  . TYR A 1 39 ? 4.534   -0.187  -3.341  1.00 0.00 ? 39 TYR A HD1  6  
ATOM   4359  H HD2  . TYR A 1 39 ? 7.734   -1.449  -0.839  1.00 0.00 ? 39 TYR A HD2  6  
ATOM   4360  H HE1  . TYR A 1 39 ? 4.630   -2.322  -4.554  1.00 0.00 ? 39 TYR A HE1  6  
ATOM   4361  H HE2  . TYR A 1 39 ? 7.844   -3.587  -2.048  1.00 0.00 ? 39 TYR A HE2  6  
ATOM   4362  H HH   . TYR A 1 39 ? 5.504   -4.785  -3.885  1.00 0.00 ? 39 TYR A HH   6  
ATOM   4363  N N    . CYS A 1 40 ? 4.956   2.856   -3.190  1.00 0.00 ? 40 CYS A N    6  
ATOM   4364  C CA   . CYS A 1 40 ? 4.169   3.240   -4.359  1.00 0.00 ? 40 CYS A CA   6  
ATOM   4365  C C    . CYS A 1 40 ? 5.058   3.965   -5.362  1.00 0.00 ? 40 CYS A C    6  
ATOM   4366  O O    . CYS A 1 40 ? 5.069   3.635   -6.547  1.00 0.00 ? 40 CYS A O    6  
ATOM   4367  C CB   . CYS A 1 40 ? 2.977   4.117   -3.943  1.00 0.00 ? 40 CYS A CB   6  
ATOM   4368  S SG   . CYS A 1 40 ? 2.042   4.859   -5.322  1.00 0.00 ? 40 CYS A SG   6  
ATOM   4369  H H    . CYS A 1 40 ? 4.685   3.166   -2.300  1.00 0.00 ? 40 CYS A H    6  
ATOM   4370  H HA   . CYS A 1 40 ? 3.802   2.334   -4.820  1.00 0.00 ? 40 CYS A HA   6  
ATOM   4371  H HB2  . CYS A 1 40 ? 2.282   3.517   -3.375  1.00 0.00 ? 40 CYS A HB2  6  
ATOM   4372  H HB3  . CYS A 1 40 ? 3.334   4.925   -3.322  1.00 0.00 ? 40 CYS A HB3  6  
ATOM   4373  N N    . ASN A 1 41 ? 5.822   4.937   -4.879  1.00 0.00 ? 41 ASN A N    6  
ATOM   4374  C CA   . ASN A 1 41 ? 6.723   5.679   -5.745  1.00 0.00 ? 41 ASN A CA   6  
ATOM   4375  C C    . ASN A 1 41 ? 7.858   4.785   -6.229  1.00 0.00 ? 41 ASN A C    6  
ATOM   4376  O O    . ASN A 1 41 ? 8.522   5.082   -7.222  1.00 0.00 ? 41 ASN A O    6  
ATOM   4377  C CB   . ASN A 1 41 ? 7.259   6.931   -5.027  1.00 0.00 ? 41 ASN A CB   6  
ATOM   4378  C CG   . ASN A 1 41 ? 8.731   6.840   -4.659  1.00 0.00 ? 41 ASN A CG   6  
ATOM   4379  O OD1  . ASN A 1 41 ? 9.532   7.693   -5.040  1.00 0.00 ? 41 ASN A OD1  6  
ATOM   4380  N ND2  . ASN A 1 41 ? 9.093   5.801   -3.913  1.00 0.00 ? 41 ASN A ND2  6  
ATOM   4381  H H    . ASN A 1 41 ? 5.789   5.150   -3.927  1.00 0.00 ? 41 ASN A H    6  
ATOM   4382  H HA   . ASN A 1 41 ? 6.153   5.978   -6.598  1.00 0.00 ? 41 ASN A HA   6  
ATOM   4383  H HB2  . ASN A 1 41 ? 7.126   7.787   -5.671  1.00 0.00 ? 41 ASN A HB2  6  
ATOM   4384  H HB3  . ASN A 1 41 ? 6.691   7.083   -4.120  1.00 0.00 ? 41 ASN A HB3  6  
ATOM   4385  H HD21 . ASN A 1 41 ? 8.403   5.158   -3.645  1.00 0.00 ? 41 ASN A HD21 6  
ATOM   4386  H HD22 . ASN A 1 41 ? 10.037  5.720   -3.662  1.00 0.00 ? 41 ASN A HD22 6  
ATOM   4387  N N    . ALA A 1 42 ? 8.054   3.682   -5.527  1.00 0.00 ? 42 ALA A N    6  
ATOM   4388  C CA   . ALA A 1 42 ? 9.088   2.720   -5.881  1.00 0.00 ? 42 ALA A CA   6  
ATOM   4389  C C    . ALA A 1 42 ? 8.458   1.418   -6.348  1.00 0.00 ? 42 ALA A C    6  
ATOM   4390  O O    . ALA A 1 42 ? 9.049   0.345   -6.231  1.00 0.00 ? 42 ALA A O    6  
ATOM   4391  C CB   . ALA A 1 42 ? 10.022  2.479   -4.706  1.00 0.00 ? 42 ALA A CB   6  
ATOM   4392  H H    . ALA A 1 42 ? 7.478   3.504   -4.759  1.00 0.00 ? 42 ALA A H    6  
ATOM   4393  H HA   . ALA A 1 42 ? 9.659   3.137   -6.694  1.00 0.00 ? 42 ALA A HA   6  
ATOM   4394  H HB1  . ALA A 1 42 ? 10.725  3.295   -4.630  1.00 0.00 ? 42 ALA A HB1  6  
ATOM   4395  H HB2  . ALA A 1 42 ? 10.560  1.555   -4.859  1.00 0.00 ? 42 ALA A HB2  6  
ATOM   4396  H HB3  . ALA A 1 42 ? 9.446   2.414   -3.794  1.00 0.00 ? 42 ALA A HB3  6  
ATOM   4397  N N    . SER A 1 43 ? 7.250   1.533   -6.883  1.00 0.00 ? 43 SER A N    6  
ATOM   4398  C CA   . SER A 1 43 ? 6.513   0.386   -7.383  1.00 0.00 ? 43 SER A CA   6  
ATOM   4399  C C    . SER A 1 43 ? 5.803   0.730   -8.689  1.00 0.00 ? 43 SER A C    6  
ATOM   4400  O O    . SER A 1 43 ? 5.773   -0.076  -9.620  1.00 0.00 ? 43 SER A O    6  
ATOM   4401  C CB   . SER A 1 43 ? 5.497   -0.090  -6.342  1.00 0.00 ? 43 SER A CB   6  
ATOM   4402  O OG   . SER A 1 43 ? 4.864   -1.287  -6.757  1.00 0.00 ? 43 SER A OG   6  
ATOM   4403  H H    . SER A 1 43 ? 6.846   2.418   -6.944  1.00 0.00 ? 43 SER A H    6  
ATOM   4404  H HA   . SER A 1 43 ? 7.221   -0.401  -7.569  1.00 0.00 ? 43 SER A HA   6  
ATOM   4405  H HB2  . SER A 1 43 ? 6.003   -0.272  -5.405  1.00 0.00 ? 43 SER A HB2  6  
ATOM   4406  H HB3  . SER A 1 43 ? 4.744   0.672   -6.202  1.00 0.00 ? 43 SER A HB3  6  
ATOM   4407  H HG   . SER A 1 43 ? 5.350   -2.042  -6.418  1.00 0.00 ? 43 SER A HG   6  
ATOM   4408  N N    . VAL A 1 44 ? 5.233   1.933   -8.754  1.00 0.00 ? 44 VAL A N    6  
ATOM   4409  C CA   . VAL A 1 44 ? 4.524   2.379   -9.951  1.00 0.00 ? 44 VAL A CA   6  
ATOM   4410  C C    . VAL A 1 44 ? 3.433   1.390   -10.341 1.00 0.00 ? 44 VAL A C    6  
ATOM   4411  O O    . VAL A 1 44 ? 3.384   0.909   -11.474 1.00 0.00 ? 44 VAL A O    6  
ATOM   4412  C CB   . VAL A 1 44 ? 5.488   2.570   -11.138 1.00 0.00 ? 44 VAL A CB   6  
ATOM   4413  C CG1  . VAL A 1 44 ? 4.768   3.213   -12.313 1.00 0.00 ? 44 VAL A CG1  6  
ATOM   4414  C CG2  . VAL A 1 44 ? 6.693   3.400   -10.722 1.00 0.00 ? 44 VAL A CG2  6  
ATOM   4415  H H    . VAL A 1 44 ? 5.290   2.535   -7.978  1.00 0.00 ? 44 VAL A H    6  
ATOM   4416  H HA   . VAL A 1 44 ? 4.064   3.330   -9.729  1.00 0.00 ? 44 VAL A HA   6  
ATOM   4417  H HB   . VAL A 1 44 ? 5.839   1.597   -11.450 1.00 0.00 ? 44 VAL A HB   6  
ATOM   4418  H HG11 . VAL A 1 44 ? 5.176   2.832   -13.238 1.00 0.00 ? 44 VAL A HG11 6  
ATOM   4419  H HG12 . VAL A 1 44 ? 4.902   4.284   -12.275 1.00 0.00 ? 44 VAL A HG12 6  
ATOM   4420  H HG13 . VAL A 1 44 ? 3.714   2.981   -12.262 1.00 0.00 ? 44 VAL A HG13 6  
ATOM   4421  H HG21 . VAL A 1 44 ? 7.495   3.252   -11.430 1.00 0.00 ? 44 VAL A HG21 6  
ATOM   4422  H HG22 . VAL A 1 44 ? 7.019   3.094   -9.739  1.00 0.00 ? 44 VAL A HG22 6  
ATOM   4423  H HG23 . VAL A 1 44 ? 6.420   4.445   -10.701 1.00 0.00 ? 44 VAL A HG23 6  
ATOM   4424  N N    . THR A 1 45 ? 2.556   1.101   -9.390  1.00 0.00 ? 45 THR A N    6  
ATOM   4425  C CA   . THR A 1 45 ? 1.450   0.178   -9.612  1.00 0.00 ? 45 THR A CA   6  
ATOM   4426  C C    . THR A 1 45 ? 1.950   -1.168  -10.135 1.00 0.00 ? 45 THR A C    6  
ATOM   4427  O O    . THR A 1 45 ? 3.126   -1.321  -10.464 1.00 0.00 ? 45 THR A O    6  
ATOM   4428  C CB   . THR A 1 45 ? 0.463   0.794   -10.601 1.00 0.00 ? 45 THR A CB   6  
ATOM   4429  O OG1  . THR A 1 45 ? 0.181   2.137   -10.254 1.00 0.00 ? 45 THR A OG1  6  
ATOM   4430  C CG2  . THR A 1 45 ? -0.857  0.057   -10.683 1.00 0.00 ? 45 THR A CG2  6  
ATOM   4431  H H    . THR A 1 45 ? 2.653   1.527   -8.517  1.00 0.00 ? 45 THR A H    6  
ATOM   4432  H HA   . THR A 1 45 ? 0.951   0.024   -8.668  1.00 0.00 ? 45 THR A HA   6  
ATOM   4433  H HB   . THR A 1 45 ? 0.910   0.786   -11.582 1.00 0.00 ? 45 THR A HB   6  
ATOM   4434  H HG1  . THR A 1 45 ? -0.391  2.527   -10.918 1.00 0.00 ? 45 THR A HG1  6  
ATOM   4435  H HG21 . THR A 1 45 ? -1.638  0.747   -10.968 1.00 0.00 ? 45 THR A HG21 6  
ATOM   4436  H HG22 . THR A 1 45 ? -1.092  -0.372  -9.720  1.00 0.00 ? 45 THR A HG22 6  
ATOM   4437  H HG23 . THR A 1 45 ? -0.786  -0.730  -11.420 1.00 0.00 ? 45 THR A HG23 6  
ATOM   4438  N N    . ASN A 1 46 ? 1.048   -2.141  -10.207 1.00 0.00 ? 46 ASN A N    6  
ATOM   4439  C CA   . ASN A 1 46 ? 1.389   -3.469  -10.688 1.00 0.00 ? 46 ASN A CA   6  
ATOM   4440  C C    . ASN A 1 46 ? 0.259   -4.037  -11.545 1.00 0.00 ? 46 ASN A C    6  
ATOM   4441  O O    . ASN A 1 46 ? -0.672  -4.654  -11.029 1.00 0.00 ? 46 ASN A O    6  
ATOM   4442  C CB   . ASN A 1 46 ? 1.680   -4.404  -9.511  1.00 0.00 ? 46 ASN A CB   6  
ATOM   4443  C CG   . ASN A 1 46 ? 3.124   -4.863  -9.485  1.00 0.00 ? 46 ASN A CG   6  
ATOM   4444  O OD1  . ASN A 1 46 ? 3.652   -5.351  -10.484 1.00 0.00 ? 46 ASN A OD1  6  
ATOM   4445  N ND2  . ASN A 1 46 ? 3.773   -4.711  -8.335  1.00 0.00 ? 46 ASN A ND2  6  
ATOM   4446  H H    . ASN A 1 46 ? 0.133   -1.962  -9.934  1.00 0.00 ? 46 ASN A H    6  
ATOM   4447  H HA   . ASN A 1 46 ? 2.272   -3.376  -11.291 1.00 0.00 ? 46 ASN A HA   6  
ATOM   4448  H HB2  . ASN A 1 46 ? 1.470   -3.886  -8.588  1.00 0.00 ? 46 ASN A HB2  6  
ATOM   4449  H HB3  . ASN A 1 46 ? 1.046   -5.275  -9.583  1.00 0.00 ? 46 ASN A HB3  6  
ATOM   4450  H HD21 . ASN A 1 46 ? 3.290   -4.315  -7.581  1.00 0.00 ? 46 ASN A HD21 6  
ATOM   4451  H HD22 . ASN A 1 46 ? 4.708   -5.000  -8.290  1.00 0.00 ? 46 ASN A HD22 6  
ATOM   4452  N N    . SER A 1 47 ? 0.344   -3.821  -12.857 1.00 0.00 ? 47 SER A N    6  
ATOM   4453  C CA   . SER A 1 47 ? -0.674  -4.307  -13.785 1.00 0.00 ? 47 SER A CA   6  
ATOM   4454  C C    . SER A 1 47 ? -1.944  -3.470  -13.677 1.00 0.00 ? 47 SER A C    6  
ATOM   4455  O O    . SER A 1 47 ? -2.340  -3.070  -12.585 1.00 0.00 ? 47 SER A O    6  
ATOM   4456  C CB   . SER A 1 47 ? -0.993  -5.780  -13.514 1.00 0.00 ? 47 SER A CB   6  
ATOM   4457  O OG   . SER A 1 47 ? -1.626  -6.379  -14.632 1.00 0.00 ? 47 SER A OG   6  
ATOM   4458  H H    . SER A 1 47 ? 1.108   -3.318  -13.210 1.00 0.00 ? 47 SER A H    6  
ATOM   4459  H HA   . SER A 1 47 ? -0.280  -4.211  -14.786 1.00 0.00 ? 47 SER A HA   6  
ATOM   4460  H HB2  . SER A 1 47 ? -0.076  -6.313  -13.310 1.00 0.00 ? 47 SER A HB2  6  
ATOM   4461  H HB3  . SER A 1 47 ? -1.650  -5.854  -12.660 1.00 0.00 ? 47 SER A HB3  6  
ATOM   4462  H HG   . SER A 1 47 ? -2.498  -5.993  -14.751 1.00 0.00 ? 47 SER A HG   6  
ATOM   4463  N N    . VAL A 1 48 ? -2.579  -3.221  -14.822 1.00 0.00 ? 48 VAL A N    6  
ATOM   4464  C CA   . VAL A 1 48 ? -3.809  -2.441  -14.886 1.00 0.00 ? 48 VAL A CA   6  
ATOM   4465  C C    . VAL A 1 48 ? -4.121  -2.074  -16.326 1.00 0.00 ? 48 VAL A C    6  
ATOM   4466  O O    . VAL A 1 48 ? -3.530  -1.154  -16.892 1.00 0.00 ? 48 VAL A O    6  
ATOM   4467  C CB   . VAL A 1 48 ? -3.759  -1.141  -14.067 1.00 0.00 ? 48 VAL A CB   6  
ATOM   4468  C CG1  . VAL A 1 48 ? -4.283  -1.363  -12.654 1.00 0.00 ? 48 VAL A CG1  6  
ATOM   4469  C CG2  . VAL A 1 48 ? -2.353  -0.554  -14.049 1.00 0.00 ? 48 VAL A CG2  6  
ATOM   4470  H H    . VAL A 1 48 ? -2.214  -3.579  -15.656 1.00 0.00 ? 48 VAL A H    6  
ATOM   4471  H HA   . VAL A 1 48 ? -4.611  -3.053  -14.502 1.00 0.00 ? 48 VAL A HA   6  
ATOM   4472  H HB   . VAL A 1 48 ? -4.413  -0.437  -14.554 1.00 0.00 ? 48 VAL A HB   6  
ATOM   4473  H HG11 . VAL A 1 48 ? -4.689  -2.361  -12.573 1.00 0.00 ? 48 VAL A HG11 6  
ATOM   4474  H HG12 . VAL A 1 48 ? -5.056  -0.641  -12.441 1.00 0.00 ? 48 VAL A HG12 6  
ATOM   4475  H HG13 . VAL A 1 48 ? -3.475  -1.245  -11.947 1.00 0.00 ? 48 VAL A HG13 6  
ATOM   4476  H HG21 . VAL A 1 48 ? -1.844  -0.812  -14.965 1.00 0.00 ? 48 VAL A HG21 6  
ATOM   4477  H HG22 . VAL A 1 48 ? -1.807  -0.956  -13.208 1.00 0.00 ? 48 VAL A HG22 6  
ATOM   4478  H HG23 . VAL A 1 48 ? -2.414  0.520   -13.959 1.00 0.00 ? 48 VAL A HG23 6  
ATOM   4479  N N    . LYS A 1 49 ? -5.045  -2.816  -16.903 1.00 0.00 ? 49 LYS A N    6  
ATOM   4480  C CA   . LYS A 1 49 ? -5.475  -2.624  -18.280 1.00 0.00 ? 49 LYS A CA   6  
ATOM   4481  C C    . LYS A 1 49 ? -5.475  -1.148  -18.679 1.00 0.00 ? 49 LYS A C    6  
ATOM   4482  O O    . LYS A 1 49 ? -4.864  -0.763  -19.675 1.00 0.00 ? 49 LYS A O    6  
ATOM   4483  C CB   . LYS A 1 49 ? -6.872  -3.214  -18.483 1.00 0.00 ? 49 LYS A CB   6  
ATOM   4484  C CG   . LYS A 1 49 ? -6.857  -4.646  -18.996 1.00 0.00 ? 49 LYS A CG   6  
ATOM   4485  C CD   . LYS A 1 49 ? -7.186  -5.639  -17.891 1.00 0.00 ? 49 LYS A CD   6  
ATOM   4486  C CE   . LYS A 1 49 ? -7.635  -6.978  -18.457 1.00 0.00 ? 49 LYS A CE   6  
ATOM   4487  N NZ   . LYS A 1 49 ? -9.042  -7.295  -18.086 1.00 0.00 ? 49 LYS A NZ   6  
ATOM   4488  H H    . LYS A 1 49 ? -5.444  -3.528  -16.387 1.00 0.00 ? 49 LYS A H    6  
ATOM   4489  H HA   . LYS A 1 49 ? -4.784  -3.153  -18.903 1.00 0.00 ? 49 LYS A HA   6  
ATOM   4490  H HB2  . LYS A 1 49 ? -7.399  -3.196  -17.541 1.00 0.00 ? 49 LYS A HB2  6  
ATOM   4491  H HB3  . LYS A 1 49 ? -7.408  -2.606  -19.197 1.00 0.00 ? 49 LYS A HB3  6  
ATOM   4492  H HG2  . LYS A 1 49 ? -7.589  -4.744  -19.784 1.00 0.00 ? 49 LYS A HG2  6  
ATOM   4493  H HG3  . LYS A 1 49 ? -5.874  -4.867  -19.386 1.00 0.00 ? 49 LYS A HG3  6  
ATOM   4494  H HD2  . LYS A 1 49 ? -6.306  -5.792  -17.286 1.00 0.00 ? 49 LYS A HD2  6  
ATOM   4495  H HD3  . LYS A 1 49 ? -7.979  -5.232  -17.281 1.00 0.00 ? 49 LYS A HD3  6  
ATOM   4496  H HE2  . LYS A 1 49 ? -7.554  -6.948  -19.533 1.00 0.00 ? 49 LYS A HE2  6  
ATOM   4497  H HE3  . LYS A 1 49 ? -6.987  -7.751  -18.071 1.00 0.00 ? 49 LYS A HE3  6  
ATOM   4498  H HZ1  . LYS A 1 49 ? -9.154  -8.321  -17.953 1.00 0.00 ? 49 LYS A HZ1  6  
ATOM   4499  H HZ2  . LYS A 1 49 ? -9.689  -6.983  -18.838 1.00 0.00 ? 49 LYS A HZ2  6  
ATOM   4500  H HZ3  . LYS A 1 49 ? -9.297  -6.811  -17.202 1.00 0.00 ? 49 LYS A HZ3  6  
HETATM 4501  N N    . CY1 A 1 50 ? -6.191  -0.299  -17.930 1.00 0.00 ? 50 CY1 A N    6  
HETATM 4502  C CA   . CY1 A 1 50 ? -6.351  1.155   -18.181 1.00 0.00 ? 50 CY1 A CA   6  
HETATM 4503  C CB   . CY1 A 1 50 ? -7.684  1.597   -17.542 1.00 0.00 ? 50 CY1 A CB   6  
HETATM 4504  S SG   . CY1 A 1 50 ? -7.908  0.875   -15.869 1.00 0.00 ? 50 CY1 A SG   6  
HETATM 4505  C CD   . CY1 A 1 50 ? -9.678  0.488   -15.883 1.00 0.00 ? 50 CY1 A CD   6  
HETATM 4506  N NE   . CY1 A 1 50 ? -9.926  -0.441  -14.787 1.00 0.00 ? 50 CY1 A NE   6  
HETATM 4507  C CZ   . CY1 A 1 50 ? -10.371 -1.698  -14.955 1.00 0.00 ? 50 CY1 A CZ   6  
HETATM 4508  O OAC  . CY1 A 1 50 ? -10.577 -2.168  -16.047 1.00 0.00 ? 50 CY1 A OAC  6  
HETATM 4509  C CM   . CY1 A 1 50 ? -10.447 -2.517  -13.697 1.00 0.00 ? 50 CY1 A CM   6  
HETATM 4510  C C    . CY1 A 1 50 ? -5.209  2.085   -17.747 1.00 0.00 ? 50 CY1 A C    6  
HETATM 4511  O O    . CY1 A 1 50 ? -5.336  3.283   -17.653 1.00 0.00 ? 50 CY1 A O    6  
HETATM 4512  H H    . CY1 A 1 50 ? -6.610  -0.649  -17.087 1.00 0.00 ? 50 CY1 A H    6  
HETATM 4513  H HA   . CY1 A 1 50 ? -6.408  1.317   -19.261 1.00 0.00 ? 50 CY1 A HA   6  
HETATM 4514  H HB2  . CY1 A 1 50 ? -8.496  1.248   -18.184 1.00 0.00 ? 50 CY1 A HB2  6  
HETATM 4515  H HB3  . CY1 A 1 50 ? -7.742  2.691   -17.488 1.00 0.00 ? 50 CY1 A HB3  6  
HETATM 4516  H HD2  . CY1 A 1 50 ? -9.963  0.022   -16.841 1.00 0.00 ? 50 CY1 A HD2  6  
HETATM 4517  H HD3  . CY1 A 1 50 ? -10.274 1.404   -15.733 1.00 0.00 ? 50 CY1 A HD3  6  
HETATM 4518  H HE   . CY1 A 1 50 ? -9.641  -0.148  -13.870 1.00 0.00 ? 50 CY1 A HE   6  
HETATM 4519  H HM1  . CY1 A 1 50 ? -11.206 -2.108  -13.030 1.00 0.00 ? 50 CY1 A HM1  6  
HETATM 4520  H HM2  . CY1 A 1 50 ? -9.483  -2.513  -13.186 1.00 0.00 ? 50 CY1 A HM2  6  
HETATM 4521  H HM3  . CY1 A 1 50 ? -10.714 -3.544  -13.949 1.00 0.00 ? 50 CY1 A HM3  6  
HETATM 4522  N N    . NH2 A 1 51 ? -4.037  1.566   -17.394 1.00 0.00 ? 51 NH2 A N    6  
HETATM 4523  H HN1  . NH2 A 1 51 ? -3.862  0.574   -17.484 1.00 0.00 ? 51 NH2 A HN1  6  
HETATM 4524  H HN2  . NH2 A 1 51 ? -3.306  2.205   -17.144 1.00 0.00 ? 51 NH2 A HN2  6  
ATOM   4525  N N    . LEU A 1 1  ? -3.746  2.192   15.836  1.00 0.00 ? 1  LEU A N    7  
ATOM   4526  C CA   . LEU A 1 1  ? -2.894  1.629   16.917  1.00 0.00 ? 1  LEU A CA   7  
ATOM   4527  C C    . LEU A 1 1  ? -3.051  0.116   17.011  1.00 0.00 ? 1  LEU A C    7  
ATOM   4528  O O    . LEU A 1 1  ? -2.100  -0.599  17.330  1.00 0.00 ? 1  LEU A O    7  
ATOM   4529  C CB   . LEU A 1 1  ? -3.290  2.281   18.244  1.00 0.00 ? 1  LEU A CB   7  
ATOM   4530  C CG   . LEU A 1 1  ? -2.944  3.768   18.369  1.00 0.00 ? 1  LEU A CG   7  
ATOM   4531  C CD1  . LEU A 1 1  ? -4.177  4.625   18.127  1.00 0.00 ? 1  LEU A CD1  7  
ATOM   4532  C CD2  . LEU A 1 1  ? -2.346  4.064   19.738  1.00 0.00 ? 1  LEU A CD2  7  
ATOM   4533  H H1   . LEU A 1 1  ? -3.763  1.505   15.056  1.00 0.00 ? 1  LEU A H1   7  
ATOM   4534  H H2   . LEU A 1 1  ? -3.320  3.092   15.535  1.00 0.00 ? 1  LEU A H2   7  
ATOM   4535  H H3   . LEU A 1 1  ? -4.699  2.339   16.226  1.00 0.00 ? 1  LEU A H3   7  
ATOM   4536  H HA   . LEU A 1 1  ? -1.862  1.863   16.699  1.00 0.00 ? 1  LEU A HA   7  
ATOM   4537  H HB2  . LEU A 1 1  ? -4.357  2.168   18.372  1.00 0.00 ? 1  LEU A HB2  7  
ATOM   4538  H HB3  . LEU A 1 1  ? -2.792  1.751   19.043  1.00 0.00 ? 1  LEU A HB3  7  
ATOM   4539  H HG   . LEU A 1 1  ? -2.208  4.022   17.620  1.00 0.00 ? 1  LEU A HG   7  
ATOM   4540  H HD11 . LEU A 1 1  ? -4.876  4.487   18.938  1.00 0.00 ? 1  LEU A HD11 7  
ATOM   4541  H HD12 . LEU A 1 1  ? -4.642  4.334   17.197  1.00 0.00 ? 1  LEU A HD12 7  
ATOM   4542  H HD13 . LEU A 1 1  ? -3.887  5.665   18.074  1.00 0.00 ? 1  LEU A HD13 7  
ATOM   4543  H HD21 . LEU A 1 1  ? -2.745  4.996   20.111  1.00 0.00 ? 1  LEU A HD21 7  
ATOM   4544  H HD22 . LEU A 1 1  ? -1.273  4.140   19.653  1.00 0.00 ? 1  LEU A HD22 7  
ATOM   4545  H HD23 . LEU A 1 1  ? -2.597  3.265   20.421  1.00 0.00 ? 1  LEU A HD23 7  
ATOM   4546  N N    . GLN A 1 2  ? -4.258  -0.367  16.739  1.00 0.00 ? 2  GLN A N    7  
ATOM   4547  C CA   . GLN A 1 2  ? -4.541  -1.796  16.799  1.00 0.00 ? 2  GLN A CA   7  
ATOM   4548  C C    . GLN A 1 2  ? -4.038  -2.508  15.547  1.00 0.00 ? 2  GLN A C    7  
ATOM   4549  O O    . GLN A 1 2  ? -4.220  -2.024  14.431  1.00 0.00 ? 2  GLN A O    7  
ATOM   4550  C CB   . GLN A 1 2  ? -6.043  -2.031  16.966  1.00 0.00 ? 2  GLN A CB   7  
ATOM   4551  C CG   . GLN A 1 2  ? -6.559  -1.680  18.352  1.00 0.00 ? 2  GLN A CG   7  
ATOM   4552  C CD   . GLN A 1 2  ? -5.876  -2.478  19.446  1.00 0.00 ? 2  GLN A CD   7  
ATOM   4553  O OE1  . GLN A 1 2  ? -4.875  -2.041  20.016  1.00 0.00 ? 2  GLN A OE1  7  
ATOM   4554  N NE2  . GLN A 1 2  ? -6.413  -3.656  19.742  1.00 0.00 ? 2  GLN A NE2  7  
ATOM   4555  H H    . GLN A 1 2  ? -4.977  0.252   16.495  1.00 0.00 ? 2  GLN A H    7  
ATOM   4556  H HA   . GLN A 1 2  ? -4.026  -2.199  17.659  1.00 0.00 ? 2  GLN A HA   7  
ATOM   4557  H HB2  . GLN A 1 2  ? -6.574  -1.429  16.243  1.00 0.00 ? 2  GLN A HB2  7  
ATOM   4558  H HB3  . GLN A 1 2  ? -6.257  -3.073  16.780  1.00 0.00 ? 2  GLN A HB3  7  
ATOM   4559  H HG2  . GLN A 1 2  ? -6.385  -0.629  18.531  1.00 0.00 ? 2  GLN A HG2  7  
ATOM   4560  H HG3  . GLN A 1 2  ? -7.620  -1.880  18.390  1.00 0.00 ? 2  GLN A HG3  7  
ATOM   4561  H HE21 . GLN A 1 2  ? -7.208  -3.939  19.245  1.00 0.00 ? 2  GLN A HE21 7  
ATOM   4562  H HE22 . GLN A 1 2  ? -5.990  -4.193  20.443  1.00 0.00 ? 2  GLN A HE22 7  
ATOM   4563  N N    . MET A 1 3  ? -3.407  -3.666  15.745  1.00 0.00 ? 3  MET A N    7  
ATOM   4564  C CA   . MET A 1 3  ? -2.875  -4.461  14.637  1.00 0.00 ? 3  MET A CA   7  
ATOM   4565  C C    . MET A 1 3  ? -1.572  -3.891  14.090  1.00 0.00 ? 3  MET A C    7  
ATOM   4566  O O    . MET A 1 3  ? -0.969  -4.472  13.189  1.00 0.00 ? 3  MET A O    7  
ATOM   4567  C CB   . MET A 1 3  ? -3.900  -4.564  13.510  1.00 0.00 ? 3  MET A CB   7  
ATOM   4568  C CG   . MET A 1 3  ? -3.645  -5.714  12.547  1.00 0.00 ? 3  MET A CG   7  
ATOM   4569  S SD   . MET A 1 3  ? -3.577  -7.315  13.373  1.00 0.00 ? 3  MET A SD   7  
ATOM   4570  C CE   . MET A 1 3  ? -5.243  -7.431  14.017  1.00 0.00 ? 3  MET A CE   7  
ATOM   4571  H H    . MET A 1 3  ? -3.300  -3.998  16.662  1.00 0.00 ? 3  MET A H    7  
ATOM   4572  H HA   . MET A 1 3  ? -2.673  -5.443  15.017  1.00 0.00 ? 3  MET A HA   7  
ATOM   4573  H HB2  . MET A 1 3  ? -4.881  -4.694  13.943  1.00 0.00 ? 3  MET A HB2  7  
ATOM   4574  H HB3  . MET A 1 3  ? -3.882  -3.642  12.950  1.00 0.00 ? 3  MET A HB3  7  
ATOM   4575  H HG2  . MET A 1 3  ? -4.441  -5.736  11.818  1.00 0.00 ? 3  MET A HG2  7  
ATOM   4576  H HG3  . MET A 1 3  ? -2.705  -5.543  12.045  1.00 0.00 ? 3  MET A HG3  7  
ATOM   4577  H HE1  . MET A 1 3  ? -5.855  -6.662  13.571  1.00 0.00 ? 3  MET A HE1  7  
ATOM   4578  H HE2  . MET A 1 3  ? -5.225  -7.299  15.089  1.00 0.00 ? 3  MET A HE2  7  
ATOM   4579  H HE3  . MET A 1 3  ? -5.653  -8.401  13.780  1.00 0.00 ? 3  MET A HE3  7  
ATOM   4580  N N    . ALA A 1 4  ? -1.142  -2.763  14.633  1.00 0.00 ? 4  ALA A N    7  
ATOM   4581  C CA   . ALA A 1 4  ? 0.092   -2.127  14.198  1.00 0.00 ? 4  ALA A CA   7  
ATOM   4582  C C    . ALA A 1 4  ? 1.309   -2.982  14.559  1.00 0.00 ? 4  ALA A C    7  
ATOM   4583  O O    . ALA A 1 4  ? 2.175   -2.557  15.326  1.00 0.00 ? 4  ALA A O    7  
ATOM   4584  C CB   . ALA A 1 4  ? 0.199   -0.753  14.828  1.00 0.00 ? 4  ALA A CB   7  
ATOM   4585  H H    . ALA A 1 4  ? -1.667  -2.345  15.344  1.00 0.00 ? 4  ALA A H    7  
ATOM   4586  H HA   . ALA A 1 4  ? 0.049   -2.006  13.125  1.00 0.00 ? 4  ALA A HA   7  
ATOM   4587  H HB1  . ALA A 1 4  ? 0.871   -0.795  15.671  1.00 0.00 ? 4  ALA A HB1  7  
ATOM   4588  H HB2  . ALA A 1 4  ? -0.779  -0.443  15.164  1.00 0.00 ? 4  ALA A HB2  7  
ATOM   4589  H HB3  . ALA A 1 4  ? 0.572   -0.050  14.102  1.00 0.00 ? 4  ALA A HB3  7  
ATOM   4590  N N    . GLY A 1 5  ? 1.365   -4.190  14.005  1.00 0.00 ? 5  GLY A N    7  
ATOM   4591  C CA   . GLY A 1 5  ? 2.467   -5.090  14.279  1.00 0.00 ? 5  GLY A CA   7  
ATOM   4592  C C    . GLY A 1 5  ? 2.145   -6.517  13.881  1.00 0.00 ? 5  GLY A C    7  
ATOM   4593  O O    . GLY A 1 5  ? 2.477   -7.459  14.600  1.00 0.00 ? 5  GLY A O    7  
ATOM   4594  H H    . GLY A 1 5  ? 0.650   -4.474  13.401  1.00 0.00 ? 5  GLY A H    7  
ATOM   4595  H HA2  . GLY A 1 5  ? 3.338   -4.760  13.730  1.00 0.00 ? 5  GLY A HA2  7  
ATOM   4596  H HA3  . GLY A 1 5  ? 2.685   -5.064  15.338  1.00 0.00 ? 5  GLY A HA3  7  
ATOM   4597  N N    . GLN A 1 6  ? 1.500   -6.678  12.727  1.00 0.00 ? 6  GLN A N    7  
ATOM   4598  C CA   . GLN A 1 6  ? 1.134   -7.993  12.228  1.00 0.00 ? 6  GLN A CA   7  
ATOM   4599  C C    . GLN A 1 6  ? 0.345   -7.877  10.933  1.00 0.00 ? 6  GLN A C    7  
ATOM   4600  O O    . GLN A 1 6  ? -0.853  -8.153  10.884  1.00 0.00 ? 6  GLN A O    7  
ATOM   4601  C CB   . GLN A 1 6  ? 0.327   -8.768  13.275  1.00 0.00 ? 6  GLN A CB   7  
ATOM   4602  C CG   . GLN A 1 6  ? 1.142   -9.795  14.046  1.00 0.00 ? 6  GLN A CG   7  
ATOM   4603  C CD   . GLN A 1 6  ? 0.639   -11.210 13.843  1.00 0.00 ? 6  GLN A CD   7  
ATOM   4604  O OE1  . GLN A 1 6  ? -0.508  -11.525 14.165  1.00 0.00 ? 6  GLN A OE1  7  
ATOM   4605  N NE2  . GLN A 1 6  ? 1.493   -12.073 13.307  1.00 0.00 ? 6  GLN A NE2  7  
ATOM   4606  H H    . GLN A 1 6  ? 1.271   -5.896  12.194  1.00 0.00 ? 6  GLN A H    7  
ATOM   4607  H HA   . GLN A 1 6  ? 2.047   -8.519  12.018  1.00 0.00 ? 6  GLN A HA   7  
ATOM   4608  H HB2  . GLN A 1 6  ? -0.085  -8.065  13.985  1.00 0.00 ? 6  GLN A HB2  7  
ATOM   4609  H HB3  . GLN A 1 6  ? -0.485  -9.281  12.781  1.00 0.00 ? 6  GLN A HB3  7  
ATOM   4610  H HG2  . GLN A 1 6  ? 2.169   -9.744  13.715  1.00 0.00 ? 6  GLN A HG2  7  
ATOM   4611  H HG3  . GLN A 1 6  ? 1.092   -9.558  15.099  1.00 0.00 ? 6  GLN A HG3  7  
ATOM   4612  H HE21 . GLN A 1 6  ? 2.390   -11.752 13.076  1.00 0.00 ? 6  GLN A HE21 7  
ATOM   4613  H HE22 . GLN A 1 6  ? 1.192   -12.995 13.164  1.00 0.00 ? 6  GLN A HE22 7  
ATOM   4614  N N    . CYS A 1 7  ? 1.043   -7.468  9.887   1.00 0.00 ? 7  CYS A N    7  
ATOM   4615  C CA   . CYS A 1 7  ? 0.441   -7.311  8.565   1.00 0.00 ? 7  CYS A CA   7  
ATOM   4616  C C    . CYS A 1 7  ? 1.285   -7.997  7.505   1.00 0.00 ? 7  CYS A C    7  
ATOM   4617  O O    . CYS A 1 7  ? 2.511   -8.045  7.613   1.00 0.00 ? 7  CYS A O    7  
ATOM   4618  C CB   . CYS A 1 7  ? 0.307   -5.832  8.193   1.00 0.00 ? 7  CYS A CB   7  
ATOM   4619  S SG   . CYS A 1 7  ? -1.320  -5.082  8.550   1.00 0.00 ? 7  CYS A SG   7  
ATOM   4620  H H    . CYS A 1 7  ? 1.996   -7.273  10.010  1.00 0.00 ? 7  CYS A H    7  
ATOM   4621  H HA   . CYS A 1 7  ? -0.534  -7.759  8.583   1.00 0.00 ? 7  CYS A HA   7  
ATOM   4622  H HB2  . CYS A 1 7  ? 1.046   -5.270  8.741   1.00 0.00 ? 7  CYS A HB2  7  
ATOM   4623  H HB3  . CYS A 1 7  ? 0.496   -5.718  7.132   1.00 0.00 ? 7  CYS A HB3  7  
ATOM   4624  N N    . SER A 1 8  ? 0.633   -8.500  6.465   1.00 0.00 ? 8  SER A N    7  
ATOM   4625  C CA   . SER A 1 8  ? 1.348   -9.141  5.376   1.00 0.00 ? 8  SER A CA   7  
ATOM   4626  C C    . SER A 1 8  ? 2.302   -8.138  4.747   1.00 0.00 ? 8  SER A C    7  
ATOM   4627  O O    . SER A 1 8  ? 2.074   -6.932  4.808   1.00 0.00 ? 8  SER A O    7  
ATOM   4628  C CB   . SER A 1 8  ? 0.371   -9.674  4.328   1.00 0.00 ? 8  SER A CB   7  
ATOM   4629  O OG   . SER A 1 8  ? -0.483  -10.661 4.881   1.00 0.00 ? 8  SER A OG   7  
ATOM   4630  H H    . SER A 1 8  ? -0.343  -8.415  6.417   1.00 0.00 ? 8  SER A H    7  
ATOM   4631  H HA   . SER A 1 8  ? 1.921   -9.959  5.782   1.00 0.00 ? 8  SER A HA   7  
ATOM   4632  H HB2  . SER A 1 8  ? -0.233  -8.860  3.956   1.00 0.00 ? 8  SER A HB2  7  
ATOM   4633  H HB3  . SER A 1 8  ? 0.927   -10.112 3.511   1.00 0.00 ? 8  SER A HB3  7  
ATOM   4634  H HG   . SER A 1 8  ? 0.007   -11.193 5.513   1.00 0.00 ? 8  SER A HG   7  
ATOM   4635  N N    . GLN A 1 9  ? 3.378   -8.634  4.165   1.00 0.00 ? 9  GLN A N    7  
ATOM   4636  C CA   . GLN A 1 9  ? 4.376   -7.771  3.555   1.00 0.00 ? 9  GLN A CA   7  
ATOM   4637  C C    . GLN A 1 9  ? 3.754   -6.722  2.645   1.00 0.00 ? 9  GLN A C    7  
ATOM   4638  O O    . GLN A 1 9  ? 2.883   -7.016  1.827   1.00 0.00 ? 9  GLN A O    7  
ATOM   4639  C CB   . GLN A 1 9  ? 5.404   -8.599  2.782   1.00 0.00 ? 9  GLN A CB   7  
ATOM   4640  C CG   . GLN A 1 9  ? 6.846   -8.225  3.091   1.00 0.00 ? 9  GLN A CG   7  
ATOM   4641  C CD   . GLN A 1 9  ? 7.792   -8.569  1.957   1.00 0.00 ? 9  GLN A CD   7  
ATOM   4642  O OE1  . GLN A 1 9  ? 7.949   -9.736  1.597   1.00 0.00 ? 9  GLN A OE1  7  
ATOM   4643  N NE2  . GLN A 1 9  ? 8.428   -7.553  1.387   1.00 0.00 ? 9  GLN A NE2  7  
ATOM   4644  H H    . GLN A 1 9  ? 3.519   -9.600  4.163   1.00 0.00 ? 9  GLN A H    7  
ATOM   4645  H HA   . GLN A 1 9  ? 4.872   -7.253  4.356   1.00 0.00 ? 9  GLN A HA   7  
ATOM   4646  H HB2  . GLN A 1 9  ? 5.266   -9.641  3.026   1.00 0.00 ? 9  GLN A HB2  7  
ATOM   4647  H HB3  . GLN A 1 9  ? 5.239   -8.461  1.725   1.00 0.00 ? 9  GLN A HB3  7  
ATOM   4648  H HG2  . GLN A 1 9  ? 6.897   -7.162  3.273   1.00 0.00 ? 9  GLN A HG2  7  
ATOM   4649  H HG3  . GLN A 1 9  ? 7.160   -8.757  3.978   1.00 0.00 ? 9  GLN A HG3  7  
ATOM   4650  H HE21 . GLN A 1 9  ? 8.254   -6.650  1.725   1.00 0.00 ? 9  GLN A HE21 7  
ATOM   4651  H HE22 . GLN A 1 9  ? 9.045   -7.748  0.652   1.00 0.00 ? 9  GLN A HE22 7  
ATOM   4652  N N    . ASN A 1 10 ? 4.223   -5.494  2.810   1.00 0.00 ? 10 ASN A N    7  
ATOM   4653  C CA   . ASN A 1 10 ? 3.749   -4.365  2.025   1.00 0.00 ? 10 ASN A CA   7  
ATOM   4654  C C    . ASN A 1 10 ? 2.240   -4.223  2.105   1.00 0.00 ? 10 ASN A C    7  
ATOM   4655  O O    . ASN A 1 10 ? 1.604   -3.725  1.175   1.00 0.00 ? 10 ASN A O    7  
ATOM   4656  C CB   . ASN A 1 10 ? 4.189   -4.495  0.564   1.00 0.00 ? 10 ASN A CB   7  
ATOM   4657  C CG   . ASN A 1 10 ? 5.186   -3.424  0.167   1.00 0.00 ? 10 ASN A CG   7  
ATOM   4658  O OD1  . ASN A 1 10 ? 4.928   -2.624  -0.732  1.00 0.00 ? 10 ASN A OD1  7  
ATOM   4659  N ND2  . ASN A 1 10 ? 6.329   -3.401  0.842   1.00 0.00 ? 10 ASN A ND2  7  
ATOM   4660  H H    . ASN A 1 10 ? 4.919   -5.340  3.488   1.00 0.00 ? 10 ASN A H    7  
ATOM   4661  H HA   . ASN A 1 10 ? 4.185   -3.479  2.448   1.00 0.00 ? 10 ASN A HA   7  
ATOM   4662  H HB2  . ASN A 1 10 ? 4.648   -5.460  0.410   1.00 0.00 ? 10 ASN A HB2  7  
ATOM   4663  H HB3  . ASN A 1 10 ? 3.324   -4.408  -0.077  1.00 0.00 ? 10 ASN A HB3  7  
ATOM   4664  H HD21 . ASN A 1 10 ? 6.464   -4.067  1.549   1.00 0.00 ? 10 ASN A HD21 7  
ATOM   4665  H HD22 . ASN A 1 10 ? 6.991   -2.718  0.606   1.00 0.00 ? 10 ASN A HD22 7  
ATOM   4666  N N    . GLU A 1 11 ? 1.669   -4.649  3.220   1.00 0.00 ? 11 GLU A N    7  
ATOM   4667  C CA   . GLU A 1 11 ? 0.225   -4.543  3.396   1.00 0.00 ? 11 GLU A CA   7  
ATOM   4668  C C    . GLU A 1 11 ? -0.127  -3.606  4.540   1.00 0.00 ? 11 GLU A C    7  
ATOM   4669  O O    . GLU A 1 11 ? 0.585   -3.540  5.542   1.00 0.00 ? 11 GLU A O    7  
ATOM   4670  C CB   . GLU A 1 11 ? -0.405  -5.928  3.573   1.00 0.00 ? 11 GLU A CB   7  
ATOM   4671  C CG   . GLU A 1 11 ? -1.471  -6.241  2.531   1.00 0.00 ? 11 GLU A CG   7  
ATOM   4672  C CD   . GLU A 1 11 ? -1.587  -7.720  2.224   1.00 0.00 ? 11 GLU A CD   7  
ATOM   4673  O OE1  . GLU A 1 11 ? -0.750  -8.232  1.452   1.00 0.00 ? 11 GLU A OE1  7  
ATOM   4674  O OE2  . GLU A 1 11 ? -2.519  -8.365  2.750   1.00 0.00 ? 11 GLU A OE2  7  
ATOM   4675  H H    . GLU A 1 11 ? 2.234   -5.034  3.936   1.00 0.00 ? 11 GLU A H    7  
ATOM   4676  H HA   . GLU A 1 11 ? -0.162  -4.103  2.505   1.00 0.00 ? 11 GLU A HA   7  
ATOM   4677  H HB2  . GLU A 1 11 ? 0.370   -6.676  3.494   1.00 0.00 ? 11 GLU A HB2  7  
ATOM   4678  H HB3  . GLU A 1 11 ? -0.855  -5.988  4.549   1.00 0.00 ? 11 GLU A HB3  7  
ATOM   4679  H HG2  . GLU A 1 11 ? -2.424  -5.891  2.894   1.00 0.00 ? 11 GLU A HG2  7  
ATOM   4680  H HG3  . GLU A 1 11 ? -1.225  -5.722  1.618   1.00 0.00 ? 11 GLU A HG3  7  
ATOM   4681  N N    . TYR A 1 12 ? -1.222  -2.851  4.371   1.00 0.00 ? 12 TYR A N    7  
ATOM   4682  C CA   . TYR A 1 12 ? -1.630  -1.883  5.403   1.00 0.00 ? 12 TYR A CA   7  
ATOM   4683  C C    . TYR A 1 12 ? -2.996  -2.207  5.999   1.00 0.00 ? 12 TYR A C    7  
ATOM   4684  O O    . TYR A 1 12 ? -3.990  -2.307  5.284   1.00 0.00 ? 12 TYR A O    7  
ATOM   4685  C CB   . TYR A 1 12 ? -1.623  -0.456  4.842   1.00 0.00 ? 12 TYR A CB   7  
ATOM   4686  C CG   . TYR A 1 12 ? -2.737  -0.164  3.858   1.00 0.00 ? 12 TYR A CG   7  
ATOM   4687  C CD1  . TYR A 1 12 ? -3.970  0.303   4.294   1.00 0.00 ? 12 TYR A CD1  7  
ATOM   4688  C CD2  . TYR A 1 12 ? -2.552  -0.351  2.494   1.00 0.00 ? 12 TYR A CD2  7  
ATOM   4689  C CE1  . TYR A 1 12 ? -4.987  0.575   3.399   1.00 0.00 ? 12 TYR A CE1  7  
ATOM   4690  C CE2  . TYR A 1 12 ? -3.564  -0.081  1.594   1.00 0.00 ? 12 TYR A CE2  7  
ATOM   4691  C CZ   . TYR A 1 12 ? -4.779  0.380   2.051   1.00 0.00 ? 12 TYR A CZ   7  
ATOM   4692  O OH   . TYR A 1 12 ? -5.788  0.650   1.157   1.00 0.00 ? 12 TYR A OH   7  
ATOM   4693  H H    . TYR A 1 12 ? -1.755  -2.934  3.528   1.00 0.00 ? 12 TYR A H    7  
ATOM   4694  H HA   . TYR A 1 12 ? -0.897  -1.934  6.198   1.00 0.00 ? 12 TYR A HA   7  
ATOM   4695  H HB2  . TYR A 1 12 ? -1.720  0.240   5.662   1.00 0.00 ? 12 TYR A HB2  7  
ATOM   4696  H HB3  . TYR A 1 12 ? -0.682  -0.280  4.341   1.00 0.00 ? 12 TYR A HB3  7  
ATOM   4697  H HD1  . TYR A 1 12 ? -4.130  0.453   5.352   1.00 0.00 ? 12 TYR A HD1  7  
ATOM   4698  H HD2  . TYR A 1 12 ? -1.599  -0.713  2.137   1.00 0.00 ? 12 TYR A HD2  7  
ATOM   4699  H HE1  . TYR A 1 12 ? -5.940  0.937   3.758   1.00 0.00 ? 12 TYR A HE1  7  
ATOM   4700  H HE2  . TYR A 1 12 ? -3.402  -0.234  0.537   1.00 0.00 ? 12 TYR A HE2  7  
ATOM   4701  H HH   . TYR A 1 12 ? -6.144  1.526   1.330   1.00 0.00 ? 12 TYR A HH   7  
ATOM   4702  N N    . PHE A 1 13 ? -3.028  -2.358  7.323   1.00 0.00 ? 13 PHE A N    7  
ATOM   4703  C CA   . PHE A 1 13 ? -4.261  -2.669  8.048   1.00 0.00 ? 13 PHE A CA   7  
ATOM   4704  C C    . PHE A 1 13 ? -5.134  -1.437  8.214   1.00 0.00 ? 13 PHE A C    7  
ATOM   4705  O O    . PHE A 1 13 ? -4.956  -0.662  9.154   1.00 0.00 ? 13 PHE A O    7  
ATOM   4706  C CB   . PHE A 1 13 ? -3.933  -3.230  9.433   1.00 0.00 ? 13 PHE A CB   7  
ATOM   4707  C CG   . PHE A 1 13 ? -5.102  -3.844  10.150  1.00 0.00 ? 13 PHE A CG   7  
ATOM   4708  C CD1  . PHE A 1 13 ? -5.640  -5.049  9.726   1.00 0.00 ? 13 PHE A CD1  7  
ATOM   4709  C CD2  . PHE A 1 13 ? -5.652  -3.224  11.259  1.00 0.00 ? 13 PHE A CD2  7  
ATOM   4710  C CE1  . PHE A 1 13 ? -6.705  -5.622  10.397  1.00 0.00 ? 13 PHE A CE1  7  
ATOM   4711  C CE2  . PHE A 1 13 ? -6.718  -3.790  11.931  1.00 0.00 ? 13 PHE A CE2  7  
ATOM   4712  C CZ   . PHE A 1 13 ? -7.244  -4.991  11.499  1.00 0.00 ? 13 PHE A CZ   7  
ATOM   4713  H H    . PHE A 1 13 ? -2.194  -2.254  7.829   1.00 0.00 ? 13 PHE A H    7  
ATOM   4714  H HA   . PHE A 1 13 ? -4.804  -3.414  7.486   1.00 0.00 ? 13 PHE A HA   7  
ATOM   4715  H HB2  . PHE A 1 13 ? -3.181  -3.988  9.333   1.00 0.00 ? 13 PHE A HB2  7  
ATOM   4716  H HB3  . PHE A 1 13 ? -3.548  -2.432  10.051  1.00 0.00 ? 13 PHE A HB3  7  
ATOM   4717  H HD1  . PHE A 1 13 ? -5.220  -5.543  8.861   1.00 0.00 ? 13 PHE A HD1  7  
ATOM   4718  H HD2  . PHE A 1 13 ? -5.241  -2.283  11.598  1.00 0.00 ? 13 PHE A HD2  7  
ATOM   4719  H HE1  . PHE A 1 13 ? -7.116  -6.561  10.060  1.00 0.00 ? 13 PHE A HE1  7  
ATOM   4720  H HE2  . PHE A 1 13 ? -7.137  -3.295  12.794  1.00 0.00 ? 13 PHE A HE2  7  
ATOM   4721  H HZ   . PHE A 1 13 ? -8.077  -5.437  12.024  1.00 0.00 ? 13 PHE A HZ   7  
ATOM   4722  N N    . ASP A 1 14 ? -6.099  -1.273  7.324   1.00 0.00 ? 14 ASP A N    7  
ATOM   4723  C CA   . ASP A 1 14 ? -7.011  -0.145  7.413   1.00 0.00 ? 14 ASP A CA   7  
ATOM   4724  C C    . ASP A 1 14 ? -7.876  -0.297  8.649   1.00 0.00 ? 14 ASP A C    7  
ATOM   4725  O O    . ASP A 1 14 ? -8.853  -1.034  8.640   1.00 0.00 ? 14 ASP A O    7  
ATOM   4726  C CB   . ASP A 1 14 ? -7.886  -0.059  6.163   1.00 0.00 ? 14 ASP A CB   7  
ATOM   4727  C CG   . ASP A 1 14 ? -8.185  1.373   5.767   1.00 0.00 ? 14 ASP A CG   7  
ATOM   4728  O OD1  . ASP A 1 14 ? -7.254  2.065   5.300   1.00 0.00 ? 14 ASP A OD1  7  
ATOM   4729  O OD2  . ASP A 1 14 ? -9.346  1.805   5.924   1.00 0.00 ? 14 ASP A OD2  7  
ATOM   4730  H H    . ASP A 1 14 ? -6.214  -1.936  6.611   1.00 0.00 ? 14 ASP A H    7  
ATOM   4731  H HA   . ASP A 1 14 ? -6.432  0.762   7.505   1.00 0.00 ? 14 ASP A HA   7  
ATOM   4732  H HB2  . ASP A 1 14 ? -7.379  -0.543  5.343   1.00 0.00 ? 14 ASP A HB2  7  
ATOM   4733  H HB3  . ASP A 1 14 ? -8.821  -0.566  6.353   1.00 0.00 ? 14 ASP A HB3  7  
ATOM   4734  N N    . SER A 1 15 ? -7.508  0.400   9.718   1.00 0.00 ? 15 SER A N    7  
ATOM   4735  C CA   . SER A 1 15 ? -8.258  0.331   10.967  1.00 0.00 ? 15 SER A CA   7  
ATOM   4736  C C    . SER A 1 15 ? -9.754  0.477   10.713  1.00 0.00 ? 15 SER A C    7  
ATOM   4737  O O    . SER A 1 15 ? -10.576 0.023   11.508  1.00 0.00 ? 15 SER A O    7  
ATOM   4738  C CB   . SER A 1 15 ? -7.782  1.415   11.936  1.00 0.00 ? 15 SER A CB   7  
ATOM   4739  O OG   . SER A 1 15 ? -7.783  2.690   11.316  1.00 0.00 ? 15 SER A OG   7  
ATOM   4740  H H    . SER A 1 15 ? -6.712  0.970   9.668   1.00 0.00 ? 15 SER A H    7  
ATOM   4741  H HA   . SER A 1 15 ? -8.076  -0.639  11.403  1.00 0.00 ? 15 SER A HA   7  
ATOM   4742  H HB2  . SER A 1 15 ? -8.441  1.446   12.791  1.00 0.00 ? 15 SER A HB2  7  
ATOM   4743  H HB3  . SER A 1 15 ? -6.778  1.190   12.263  1.00 0.00 ? 15 SER A HB3  7  
ATOM   4744  H HG   . SER A 1 15 ? -8.609  2.814   10.841  1.00 0.00 ? 15 SER A HG   7  
ATOM   4745  N N    . LEU A 1 16 ? -10.096 1.105   9.595   1.00 0.00 ? 16 LEU A N    7  
ATOM   4746  C CA   . LEU A 1 16 ? -11.490 1.301   9.229   1.00 0.00 ? 16 LEU A CA   7  
ATOM   4747  C C    . LEU A 1 16 ? -12.059 0.041   8.582   1.00 0.00 ? 16 LEU A C    7  
ATOM   4748  O O    . LEU A 1 16 ? -13.257 -0.226  8.666   1.00 0.00 ? 16 LEU A O    7  
ATOM   4749  C CB   . LEU A 1 16 ? -11.621 2.484   8.270   1.00 0.00 ? 16 LEU A CB   7  
ATOM   4750  C CG   . LEU A 1 16 ? -13.043 2.772   7.789   1.00 0.00 ? 16 LEU A CG   7  
ATOM   4751  C CD1  . LEU A 1 16 ? -13.235 4.263   7.555   1.00 0.00 ? 16 LEU A CD1  7  
ATOM   4752  C CD2  . LEU A 1 16 ? -13.343 1.984   6.524   1.00 0.00 ? 16 LEU A CD2  7  
ATOM   4753  H H    . LEU A 1 16 ? -9.393  1.437   8.995   1.00 0.00 ? 16 LEU A H    7  
ATOM   4754  H HA   . LEU A 1 16 ? -12.045 1.514   10.130  1.00 0.00 ? 16 LEU A HA   7  
ATOM   4755  H HB2  . LEU A 1 16 ? -11.243 3.367   8.766   1.00 0.00 ? 16 LEU A HB2  7  
ATOM   4756  H HB3  . LEU A 1 16 ? -11.005 2.289   7.404   1.00 0.00 ? 16 LEU A HB3  7  
ATOM   4757  H HG   . LEU A 1 16 ? -13.742 2.462   8.552   1.00 0.00 ? 16 LEU A HG   7  
ATOM   4758  H HD11 . LEU A 1 16 ? -13.139 4.790   8.493   1.00 0.00 ? 16 LEU A HD11 7  
ATOM   4759  H HD12 . LEU A 1 16 ? -14.216 4.438   7.142   1.00 0.00 ? 16 LEU A HD12 7  
ATOM   4760  H HD13 . LEU A 1 16 ? -12.484 4.618   6.864   1.00 0.00 ? 16 LEU A HD13 7  
ATOM   4761  H HD21 . LEU A 1 16 ? -12.443 1.892   5.934   1.00 0.00 ? 16 LEU A HD21 7  
ATOM   4762  H HD22 . LEU A 1 16 ? -14.098 2.500   5.949   1.00 0.00 ? 16 LEU A HD22 7  
ATOM   4763  H HD23 . LEU A 1 16 ? -13.702 1.001   6.789   1.00 0.00 ? 16 LEU A HD23 7  
ATOM   4764  N N    . LEU A 1 17 ? -11.188 -0.723  7.932   1.00 0.00 ? 17 LEU A N    7  
ATOM   4765  C CA   . LEU A 1 17 ? -11.592 -1.949  7.257   1.00 0.00 ? 17 LEU A CA   7  
ATOM   4766  C C    . LEU A 1 17 ? -11.253 -3.190  8.080   1.00 0.00 ? 17 LEU A C    7  
ATOM   4767  O O    . LEU A 1 17 ? -11.846 -4.250  7.881   1.00 0.00 ? 17 LEU A O    7  
ATOM   4768  C CB   . LEU A 1 17 ? -10.898 -2.039  5.902   1.00 0.00 ? 17 LEU A CB   7  
ATOM   4769  C CG   . LEU A 1 17 ? -11.111 -0.838  4.982   1.00 0.00 ? 17 LEU A CG   7  
ATOM   4770  C CD1  . LEU A 1 17 ? -10.052 -0.814  3.892   1.00 0.00 ? 17 LEU A CD1  7  
ATOM   4771  C CD2  . LEU A 1 17 ? -12.507 -0.871  4.376   1.00 0.00 ? 17 LEU A CD2  7  
ATOM   4772  H H    . LEU A 1 17 ? -10.246 -0.452  7.894   1.00 0.00 ? 17 LEU A H    7  
ATOM   4773  H HA   . LEU A 1 17 ? -12.660 -1.912  7.101   1.00 0.00 ? 17 LEU A HA   7  
ATOM   4774  H HB2  . LEU A 1 17 ? -9.836  -2.148  6.079   1.00 0.00 ? 17 LEU A HB2  7  
ATOM   4775  H HB3  . LEU A 1 17 ? -11.255 -2.923  5.396   1.00 0.00 ? 17 LEU A HB3  7  
ATOM   4776  H HG   . LEU A 1 17 ? -11.016 0.071   5.559   1.00 0.00 ? 17 LEU A HG   7  
ATOM   4777  H HD11 . LEU A 1 17 ? -9.822  0.210   3.636   1.00 0.00 ? 17 LEU A HD11 7  
ATOM   4778  H HD12 . LEU A 1 17 ? -10.422 -1.329  3.018   1.00 0.00 ? 17 LEU A HD12 7  
ATOM   4779  H HD13 . LEU A 1 17 ? -9.159  -1.306  4.248   1.00 0.00 ? 17 LEU A HD13 7  
ATOM   4780  H HD21 . LEU A 1 17 ? -13.205 -0.399  5.052   1.00 0.00 ? 17 LEU A HD21 7  
ATOM   4781  H HD22 . LEU A 1 17 ? -12.804 -1.896  4.211   1.00 0.00 ? 17 LEU A HD22 7  
ATOM   4782  H HD23 . LEU A 1 17 ? -12.503 -0.341  3.434   1.00 0.00 ? 17 LEU A HD23 7  
ATOM   4783  N N    . HIS A 1 18 ? -10.285 -3.067  8.988   1.00 0.00 ? 18 HIS A N    7  
ATOM   4784  C CA   . HIS A 1 18 ? -9.868  -4.197  9.808   1.00 0.00 ? 18 HIS A CA   7  
ATOM   4785  C C    . HIS A 1 18 ? -9.272  -5.292  8.933   1.00 0.00 ? 18 HIS A C    7  
ATOM   4786  O O    . HIS A 1 18 ? -9.668  -6.455  9.004   1.00 0.00 ? 18 HIS A O    7  
ATOM   4787  C CB   . HIS A 1 18 ? -11.046 -4.757  10.592  1.00 0.00 ? 18 HIS A CB   7  
ATOM   4788  C CG   . HIS A 1 18 ? -11.614 -3.803  11.597  1.00 0.00 ? 18 HIS A CG   7  
ATOM   4789  N ND1  . HIS A 1 18 ? -11.077 -3.625  12.855  1.00 0.00 ? 18 HIS A ND1  7  
ATOM   4790  C CD2  . HIS A 1 18 ? -12.683 -2.973  11.526  1.00 0.00 ? 18 HIS A CD2  7  
ATOM   4791  C CE1  . HIS A 1 18 ? -11.791 -2.730  13.514  1.00 0.00 ? 18 HIS A CE1  7  
ATOM   4792  N NE2  . HIS A 1 18 ? -12.769 -2.318  12.729  1.00 0.00 ? 18 HIS A NE2  7  
ATOM   4793  H H    . HIS A 1 18 ? -9.830  -2.204  9.097   1.00 0.00 ? 18 HIS A H    7  
ATOM   4794  H HA   . HIS A 1 18 ? -9.116  -3.848  10.498  1.00 0.00 ? 18 HIS A HA   7  
ATOM   4795  H HB2  . HIS A 1 18 ? -11.827 -5.020  9.901   1.00 0.00 ? 18 HIS A HB2  7  
ATOM   4796  H HB3  . HIS A 1 18 ? -10.721 -5.642  11.115  1.00 0.00 ? 18 HIS A HB3  7  
ATOM   4797  H HD1  . HIS A 1 18 ? -10.291 -4.089  13.212  1.00 0.00 ? 18 HIS A HD1  7  
ATOM   4798  H HD2  . HIS A 1 18 ? -13.343 -2.851  10.679  1.00 0.00 ? 18 HIS A HD2  7  
ATOM   4799  H HE1  . HIS A 1 18 ? -11.603 -2.390  14.522  1.00 0.00 ? 18 HIS A HE1  7  
ATOM   4800  H HE2  . HIS A 1 18 ? -13.494 -1.716  12.999  1.00 0.00 ? 18 HIS A HE2  7  
ATOM   4801  N N    . ALA A 1 19 ? -8.319  -4.898  8.107   1.00 0.00 ? 19 ALA A N    7  
ATOM   4802  C CA   . ALA A 1 19 ? -7.650  -5.801  7.199   1.00 0.00 ? 19 ALA A CA   7  
ATOM   4803  C C    . ALA A 1 19 ? -6.440  -5.132  6.597   1.00 0.00 ? 19 ALA A C    7  
ATOM   4804  O O    . ALA A 1 19 ? -6.468  -3.947  6.271   1.00 0.00 ? 19 ALA A O    7  
ATOM   4805  C CB   . ALA A 1 19 ? -8.572  -6.222  6.070   1.00 0.00 ? 19 ALA A CB   7  
ATOM   4806  H H    . ALA A 1 19 ? -8.054  -3.968  8.105   1.00 0.00 ? 19 ALA A H    7  
ATOM   4807  H HA   . ALA A 1 19 ? -7.342  -6.682  7.740   1.00 0.00 ? 19 ALA A HA   7  
ATOM   4808  H HB1  . ALA A 1 19 ? -9.563  -5.836  6.247   1.00 0.00 ? 19 ALA A HB1  7  
ATOM   4809  H HB2  . ALA A 1 19 ? -8.606  -7.300  6.015   1.00 0.00 ? 19 ALA A HB2  7  
ATOM   4810  H HB3  . ALA A 1 19 ? -8.188  -5.823  5.135   1.00 0.00 ? 19 ALA A HB3  7  
ATOM   4811  N N    . CYS A 1 20 ? -5.399  -5.904  6.423   1.00 0.00 ? 20 CYS A N    7  
ATOM   4812  C CA   . CYS A 1 20 ? -4.189  -5.396  5.808   1.00 0.00 ? 20 CYS A CA   7  
ATOM   4813  C C    . CYS A 1 20 ? -4.354  -5.406  4.286   1.00 0.00 ? 20 CYS A C    7  
ATOM   4814  O O    . CYS A 1 20 ? -4.405  -6.464  3.658   1.00 0.00 ? 20 CYS A O    7  
ATOM   4815  C CB   . CYS A 1 20 ? -2.942  -6.202  6.208   1.00 0.00 ? 20 CYS A CB   7  
ATOM   4816  S SG   . CYS A 1 20 ? -2.717  -6.464  8.002   1.00 0.00 ? 20 CYS A SG   7  
ATOM   4817  H H    . CYS A 1 20 ? -5.463  -6.834  6.692   1.00 0.00 ? 20 CYS A H    7  
ATOM   4818  H HA   . CYS A 1 20 ? -4.080  -4.376  6.131   1.00 0.00 ? 20 CYS A HA   7  
ATOM   4819  H HB2  . CYS A 1 20 ? -2.990  -7.174  5.744   1.00 0.00 ? 20 CYS A HB2  7  
ATOM   4820  H HB3  . CYS A 1 20 ? -2.066  -5.684  5.846   1.00 0.00 ? 20 CYS A HB3  7  
ATOM   4821  N N    . ILE A 1 21 ? -4.457  -4.213  3.715   1.00 0.00 ? 21 ILE A N    7  
ATOM   4822  C CA   . ILE A 1 21 ? -4.635  -4.034  2.272   1.00 0.00 ? 21 ILE A CA   7  
ATOM   4823  C C    . ILE A 1 21 ? -3.309  -3.688  1.606   1.00 0.00 ? 21 ILE A C    7  
ATOM   4824  O O    . ILE A 1 21 ? -2.462  -3.038  2.209   1.00 0.00 ? 21 ILE A O    7  
ATOM   4825  C CB   . ILE A 1 21 ? -5.647  -2.893  1.996   1.00 0.00 ? 21 ILE A CB   7  
ATOM   4826  C CG1  . ILE A 1 21 ? -7.079  -3.346  2.297   1.00 0.00 ? 21 ILE A CG1  7  
ATOM   4827  C CG2  . ILE A 1 21 ? -5.564  -2.385  0.559   1.00 0.00 ? 21 ILE A CG2  7  
ATOM   4828  C CD1  . ILE A 1 21 ? -7.249  -3.969  3.659   1.00 0.00 ? 21 ILE A CD1  7  
ATOM   4829  H H    . ILE A 1 21 ? -4.424  -3.423  4.287   1.00 0.00 ? 21 ILE A H    7  
ATOM   4830  H HA   . ILE A 1 21 ? -5.016  -4.951  1.858   1.00 0.00 ? 21 ILE A HA   7  
ATOM   4831  H HB   . ILE A 1 21 ? -5.388  -2.074  2.653   1.00 0.00 ? 21 ILE A HB   7  
ATOM   4832  H HG12 . ILE A 1 21 ? -7.735  -2.491  2.242   1.00 0.00 ? 21 ILE A HG12 7  
ATOM   4833  H HG13 . ILE A 1 21 ? -7.381  -4.073  1.557   1.00 0.00 ? 21 ILE A HG13 7  
ATOM   4834  H HG21 . ILE A 1 21 ? -6.193  -1.515  0.455   1.00 0.00 ? 21 ILE A HG21 7  
ATOM   4835  H HG22 . ILE A 1 21 ? -5.908  -3.153  -0.112  1.00 0.00 ? 21 ILE A HG22 7  
ATOM   4836  H HG23 . ILE A 1 21 ? -4.545  -2.123  0.321   1.00 0.00 ? 21 ILE A HG23 7  
ATOM   4837  H HD11 . ILE A 1 21 ? -6.550  -3.518  4.340   1.00 0.00 ? 21 ILE A HD11 7  
ATOM   4838  H HD12 . ILE A 1 21 ? -7.059  -5.030  3.597   1.00 0.00 ? 21 ILE A HD12 7  
ATOM   4839  H HD13 . ILE A 1 21 ? -8.255  -3.801  4.010   1.00 0.00 ? 21 ILE A HD13 7  
ATOM   4840  N N    . PRO A 1 22 ? -3.098  -4.104  0.348   1.00 0.00 ? 22 PRO A N    7  
ATOM   4841  C CA   . PRO A 1 22 ? -1.862  -3.812  -0.360  1.00 0.00 ? 22 PRO A CA   7  
ATOM   4842  C C    . PRO A 1 22 ? -1.844  -2.406  -0.951  1.00 0.00 ? 22 PRO A C    7  
ATOM   4843  O O    . PRO A 1 22 ? -2.786  -1.987  -1.622  1.00 0.00 ? 22 PRO A O    7  
ATOM   4844  C CB   . PRO A 1 22 ? -1.812  -4.873  -1.475  1.00 0.00 ? 22 PRO A CB   7  
ATOM   4845  C CG   . PRO A 1 22 ? -3.052  -5.703  -1.320  1.00 0.00 ? 22 PRO A CG   7  
ATOM   4846  C CD   . PRO A 1 22 ? -4.011  -4.889  -0.487  1.00 0.00 ? 22 PRO A CD   7  
ATOM   4847  H HA   . PRO A 1 22 ? -1.016  -3.925  0.291   1.00 0.00 ? 22 PRO A HA   7  
ATOM   4848  H HB2  . PRO A 1 22 ? -1.790  -4.382  -2.437  1.00 0.00 ? 22 PRO A HB2  7  
ATOM   4849  H HB3  . PRO A 1 22 ? -0.922  -5.473  -1.357  1.00 0.00 ? 22 PRO A HB3  7  
ATOM   4850  H HG2  . PRO A 1 22 ? -3.478  -5.909  -2.293  1.00 0.00 ? 22 PRO A HG2  7  
ATOM   4851  H HG3  . PRO A 1 22 ? -2.809  -6.629  -0.818  1.00 0.00 ? 22 PRO A HG3  7  
ATOM   4852  H HD2  . PRO A 1 22 ? -4.610  -4.249  -1.118  1.00 0.00 ? 22 PRO A HD2  7  
ATOM   4853  H HD3  . PRO A 1 22 ? -4.639  -5.529  0.117   1.00 0.00 ? 22 PRO A HD3  7  
ATOM   4854  N N    . CYS A 1 23 ? -0.756  -1.685  -0.695  1.00 0.00 ? 23 CYS A N    7  
ATOM   4855  C CA   . CYS A 1 23 ? -0.603  -0.321  -1.200  1.00 0.00 ? 23 CYS A CA   7  
ATOM   4856  C C    . CYS A 1 23 ? -0.634  -0.301  -2.724  1.00 0.00 ? 23 CYS A C    7  
ATOM   4857  O O    . CYS A 1 23 ? -1.053  0.682   -3.332  1.00 0.00 ? 23 CYS A O    7  
ATOM   4858  C CB   . CYS A 1 23 ? 0.702   0.311   -0.697  1.00 0.00 ? 23 CYS A CB   7  
ATOM   4859  S SG   . CYS A 1 23 ? 1.111   -0.079  1.036   1.00 0.00 ? 23 CYS A SG   7  
ATOM   4860  H H    . CYS A 1 23 ? -0.041  -2.085  -0.156  1.00 0.00 ? 23 CYS A H    7  
ATOM   4861  H HA   . CYS A 1 23 ? -1.436  0.261   -0.830  1.00 0.00 ? 23 CYS A HA   7  
ATOM   4862  H HB2  . CYS A 1 23 ? 1.523   -0.028  -1.313  1.00 0.00 ? 23 CYS A HB2  7  
ATOM   4863  H HB3  . CYS A 1 23 ? 0.624   1.386   -0.780  1.00 0.00 ? 23 CYS A HB3  7  
ATOM   4864  N N    . GLN A 1 24 ? -0.189  -1.393  -3.336  1.00 0.00 ? 24 GLN A N    7  
ATOM   4865  C CA   . GLN A 1 24 ? -0.170  -1.498  -4.795  1.00 0.00 ? 24 GLN A CA   7  
ATOM   4866  C C    . GLN A 1 24 ? -1.572  -1.342  -5.362  1.00 0.00 ? 24 GLN A C    7  
ATOM   4867  O O    . GLN A 1 24 ? -1.793  -0.606  -6.323  1.00 0.00 ? 24 GLN A O    7  
ATOM   4868  C CB   . GLN A 1 24 ? 0.416   -2.843  -5.256  1.00 0.00 ? 24 GLN A CB   7  
ATOM   4869  C CG   . GLN A 1 24 ? 1.358   -3.499  -4.258  1.00 0.00 ? 24 GLN A CG   7  
ATOM   4870  C CD   . GLN A 1 24 ? 1.977   -4.775  -4.795  1.00 0.00 ? 24 GLN A CD   7  
ATOM   4871  O OE1  . GLN A 1 24 ? 1.382   -5.850  -4.711  1.00 0.00 ? 24 GLN A OE1  7  
ATOM   4872  N NE2  . GLN A 1 24 ? 3.176   -4.662  -5.351  1.00 0.00 ? 24 GLN A NE2  7  
ATOM   4873  H H    . GLN A 1 24 ? 0.130   -2.142  -2.796  1.00 0.00 ? 24 GLN A H    7  
ATOM   4874  H HA   . GLN A 1 24 ? 0.441   -0.702  -5.172  1.00 0.00 ? 24 GLN A HA   7  
ATOM   4875  H HB2  . GLN A 1 24 ? -0.396  -3.527  -5.447  1.00 0.00 ? 24 GLN A HB2  7  
ATOM   4876  H HB3  . GLN A 1 24 ? 0.960   -2.683  -6.176  1.00 0.00 ? 24 GLN A HB3  7  
ATOM   4877  H HG2  . GLN A 1 24 ? 2.150   -2.806  -4.017  1.00 0.00 ? 24 GLN A HG2  7  
ATOM   4878  H HG3  . GLN A 1 24 ? 0.802   -3.737  -3.363  1.00 0.00 ? 24 GLN A HG3  7  
ATOM   4879  H HE21 . GLN A 1 24 ? 3.590   -3.775  -5.383  1.00 0.00 ? 24 GLN A HE21 7  
ATOM   4880  H HE22 . GLN A 1 24 ? 3.600   -5.472  -5.707  1.00 0.00 ? 24 GLN A HE22 7  
ATOM   4881  N N    . LEU A 1 25 ? -2.508  -2.054  -4.758  1.00 0.00 ? 25 LEU A N    7  
ATOM   4882  C CA   . LEU A 1 25 ? -3.899  -2.024  -5.185  1.00 0.00 ? 25 LEU A CA   7  
ATOM   4883  C C    . LEU A 1 25 ? -4.497  -0.622  -5.076  1.00 0.00 ? 25 LEU A C    7  
ATOM   4884  O O    . LEU A 1 25 ? -5.530  -0.333  -5.679  1.00 0.00 ? 25 LEU A O    7  
ATOM   4885  C CB   . LEU A 1 25 ? -4.728  -3.007  -4.356  1.00 0.00 ? 25 LEU A CB   7  
ATOM   4886  C CG   . LEU A 1 25 ? -5.796  -3.777  -5.140  1.00 0.00 ? 25 LEU A CG   7  
ATOM   4887  C CD1  . LEU A 1 25 ? -5.523  -5.273  -5.093  1.00 0.00 ? 25 LEU A CD1  7  
ATOM   4888  C CD2  . LEU A 1 25 ? -7.184  -3.470  -4.597  1.00 0.00 ? 25 LEU A CD2  7  
ATOM   4889  H H    . LEU A 1 25 ? -2.251  -2.620  -4.007  1.00 0.00 ? 25 LEU A H    7  
ATOM   4890  H HA   . LEU A 1 25 ? -3.928  -2.331  -6.216  1.00 0.00 ? 25 LEU A HA   7  
ATOM   4891  H HB2  . LEU A 1 25 ? -4.052  -3.722  -3.906  1.00 0.00 ? 25 LEU A HB2  7  
ATOM   4892  H HB3  . LEU A 1 25 ? -5.218  -2.457  -3.566  1.00 0.00 ? 25 LEU A HB3  7  
ATOM   4893  H HG   . LEU A 1 25 ? -5.765  -3.467  -6.174  1.00 0.00 ? 25 LEU A HG   7  
ATOM   4894  H HD11 . LEU A 1 25 ? -5.233  -5.556  -4.092  1.00 0.00 ? 25 LEU A HD11 7  
ATOM   4895  H HD12 . LEU A 1 25 ? -4.726  -5.516  -5.781  1.00 0.00 ? 25 LEU A HD12 7  
ATOM   4896  H HD13 . LEU A 1 25 ? -6.417  -5.811  -5.375  1.00 0.00 ? 25 LEU A HD13 7  
ATOM   4897  H HD21 . LEU A 1 25 ? -7.795  -4.360  -4.645  1.00 0.00 ? 25 LEU A HD21 7  
ATOM   4898  H HD22 . LEU A 1 25 ? -7.638  -2.690  -5.191  1.00 0.00 ? 25 LEU A HD22 7  
ATOM   4899  H HD23 . LEU A 1 25 ? -7.105  -3.143  -3.571  1.00 0.00 ? 25 LEU A HD23 7  
ATOM   4900  N N    . ARG A 1 26 ? -3.853  0.247   -4.302  1.00 0.00 ? 26 ARG A N    7  
ATOM   4901  C CA   . ARG A 1 26 ? -4.345  1.609   -4.122  1.00 0.00 ? 26 ARG A CA   7  
ATOM   4902  C C    . ARG A 1 26 ? -3.345  2.653   -4.607  1.00 0.00 ? 26 ARG A C    7  
ATOM   4903  O O    . ARG A 1 26 ? -3.616  3.852   -4.575  1.00 0.00 ? 26 ARG A O    7  
ATOM   4904  C CB   . ARG A 1 26 ? -4.685  1.861   -2.658  1.00 0.00 ? 26 ARG A CB   7  
ATOM   4905  C CG   . ARG A 1 26 ? -5.466  0.726   -2.012  1.00 0.00 ? 26 ARG A CG   7  
ATOM   4906  C CD   . ARG A 1 26 ? -6.801  1.205   -1.462  1.00 0.00 ? 26 ARG A CD   7  
ATOM   4907  N NE   . ARG A 1 26 ? -7.721  1.593   -2.529  1.00 0.00 ? 26 ARG A NE   7  
ATOM   4908  C CZ   . ARG A 1 26 ? -8.762  2.403   -2.351  1.00 0.00 ? 26 ARG A CZ   7  
ATOM   4909  N NH1  . ARG A 1 26 ? -9.023  2.907   -1.150  1.00 0.00 ? 26 ARG A NH1  7  
ATOM   4910  N NH2  . ARG A 1 26 ? -9.548  2.707   -3.375  1.00 0.00 ? 26 ARG A NH2  7  
ATOM   4911  H H    . ARG A 1 26 ? -3.039  -0.033  -3.840  1.00 0.00 ? 26 ARG A H    7  
ATOM   4912  H HA   . ARG A 1 26 ? -5.232  1.700   -4.708  1.00 0.00 ? 26 ARG A HA   7  
ATOM   4913  H HB2  . ARG A 1 26 ? -3.763  1.996   -2.112  1.00 0.00 ? 26 ARG A HB2  7  
ATOM   4914  H HB3  . ARG A 1 26 ? -5.273  2.764   -2.587  1.00 0.00 ? 26 ARG A HB3  7  
ATOM   4915  H HG2  . ARG A 1 26 ? -5.649  -0.039  -2.752  1.00 0.00 ? 26 ARG A HG2  7  
ATOM   4916  H HG3  . ARG A 1 26 ? -4.880  0.315   -1.202  1.00 0.00 ? 26 ARG A HG3  7  
ATOM   4917  H HD2  . ARG A 1 26 ? -7.236  0.403   -0.881  1.00 0.00 ? 26 ARG A HD2  7  
ATOM   4918  H HD3  . ARG A 1 26 ? -6.619  2.050   -0.815  1.00 0.00 ? 26 ARG A HD3  7  
ATOM   4919  H HE   . ARG A 1 26 ? -7.553  1.232   -3.425  1.00 0.00 ? 26 ARG A HE   7  
ATOM   4920  H HH11 . ARG A 1 26 ? -8.437  2.681   -0.374  1.00 0.00 ? 26 ARG A HH11 7  
ATOM   4921  H HH12 . ARG A 1 26 ? -9.807  3.514   -1.024  1.00 0.00 ? 26 ARG A HH12 7  
ATOM   4922  H HH21 . ARG A 1 26 ? -9.356  2.330   -4.281  1.00 0.00 ? 26 ARG A HH21 7  
ATOM   4923  H HH22 . ARG A 1 26 ? -10.331 3.315   -3.242  1.00 0.00 ? 26 ARG A HH22 7  
ATOM   4924  N N    . CYS A 1 27 ? -2.200  2.187   -5.057  1.00 0.00 ? 27 CYS A N    7  
ATOM   4925  C CA   . CYS A 1 27 ? -1.151  3.075   -5.561  1.00 0.00 ? 27 CYS A CA   7  
ATOM   4926  C C    . CYS A 1 27 ? -1.645  3.829   -6.801  1.00 0.00 ? 27 CYS A C    7  
ATOM   4927  O O    . CYS A 1 27 ? -2.571  3.384   -7.478  1.00 0.00 ? 27 CYS A O    7  
ATOM   4928  C CB   . CYS A 1 27 ? 0.123   2.286   -5.899  1.00 0.00 ? 27 CYS A CB   7  
ATOM   4929  S SG   . CYS A 1 27 ? 1.544   3.326   -6.371  1.00 0.00 ? 27 CYS A SG   7  
ATOM   4930  H H    . CYS A 1 27 ? -2.064  1.223   -5.053  1.00 0.00 ? 27 CYS A H    7  
ATOM   4931  H HA   . CYS A 1 27 ? -0.918  3.792   -4.782  1.00 0.00 ? 27 CYS A HA   7  
ATOM   4932  H HB2  . CYS A 1 27 ? 0.422   1.705   -5.038  1.00 0.00 ? 27 CYS A HB2  7  
ATOM   4933  H HB3  . CYS A 1 27 ? -0.081  1.619   -6.724  1.00 0.00 ? 27 CYS A HB3  7  
ATOM   4934  N N    . SER A 1 28 ? -1.013  4.961   -7.098  1.00 0.00 ? 28 SER A N    7  
ATOM   4935  C CA   . SER A 1 28 ? -1.362  5.774   -8.250  1.00 0.00 ? 28 SER A CA   7  
ATOM   4936  C C    . SER A 1 28 ? -2.866  6.021   -8.346  1.00 0.00 ? 28 SER A C    7  
ATOM   4937  O O    . SER A 1 28 ? -3.407  6.219   -9.434  1.00 0.00 ? 28 SER A O    7  
ATOM   4938  C CB   . SER A 1 28 ? -0.835  5.102   -9.505  1.00 0.00 ? 28 SER A CB   7  
ATOM   4939  O OG   . SER A 1 28 ? -0.444  6.057   -10.477 1.00 0.00 ? 28 SER A OG   7  
ATOM   4940  H H    . SER A 1 28 ? -0.281  5.252   -6.539  1.00 0.00 ? 28 SER A H    7  
ATOM   4941  H HA   . SER A 1 28 ? -0.867  6.726   -8.136  1.00 0.00 ? 28 SER A HA   7  
ATOM   4942  H HB2  . SER A 1 28 ? 0.026   4.509   -9.232  1.00 0.00 ? 28 SER A HB2  7  
ATOM   4943  H HB3  . SER A 1 28 ? -1.598  4.463   -9.921  1.00 0.00 ? 28 SER A HB3  7  
ATOM   4944  H HG   . SER A 1 28 ? 0.141   6.704   -10.075 1.00 0.00 ? 28 SER A HG   7  
ATOM   4945  N N    . SER A 1 29 ? -3.531  6.026   -7.195  1.00 0.00 ? 29 SER A N    7  
ATOM   4946  C CA   . SER A 1 29 ? -4.965  6.273   -7.137  1.00 0.00 ? 29 SER A CA   7  
ATOM   4947  C C    . SER A 1 29 ? -5.411  6.539   -5.708  1.00 0.00 ? 29 SER A C    7  
ATOM   4948  O O    . SER A 1 29 ? -4.980  5.868   -4.775  1.00 0.00 ? 29 SER A O    7  
ATOM   4949  C CB   . SER A 1 29 ? -5.747  5.100   -7.700  1.00 0.00 ? 29 SER A CB   7  
ATOM   4950  O OG   . SER A 1 29 ? -5.519  4.949   -9.089  1.00 0.00 ? 29 SER A OG   7  
ATOM   4951  H H    . SER A 1 29 ? -3.041  5.873   -6.363  1.00 0.00 ? 29 SER A H    7  
ATOM   4952  H HA   . SER A 1 29 ? -5.173  7.151   -7.734  1.00 0.00 ? 29 SER A HA   7  
ATOM   4953  H HB2  . SER A 1 29 ? -5.444  4.197   -7.193  1.00 0.00 ? 29 SER A HB2  7  
ATOM   4954  H HB3  . SER A 1 29 ? -6.799  5.277   -7.533  1.00 0.00 ? 29 SER A HB3  7  
ATOM   4955  H HG   . SER A 1 29 ? -5.661  4.033   -9.340  1.00 0.00 ? 29 SER A HG   7  
ATOM   4956  N N    . ASN A 1 30 ? -6.282  7.524   -5.553  1.00 0.00 ? 30 ASN A N    7  
ATOM   4957  C CA   . ASN A 1 30 ? -6.805  7.903   -4.239  1.00 0.00 ? 30 ASN A CA   7  
ATOM   4958  C C    . ASN A 1 30 ? -5.700  8.444   -3.320  1.00 0.00 ? 30 ASN A C    7  
ATOM   4959  O O    . ASN A 1 30 ? -5.953  8.736   -2.151  1.00 0.00 ? 30 ASN A O    7  
ATOM   4960  C CB   . ASN A 1 30 ? -7.491  6.705   -3.579  1.00 0.00 ? 30 ASN A CB   7  
ATOM   4961  C CG   . ASN A 1 30 ? -9.002  6.775   -3.688  1.00 0.00 ? 30 ASN A CG   7  
ATOM   4962  O OD1  . ASN A 1 30 ? -9.607  6.103   -4.522  1.00 0.00 ? 30 ASN A OD1  7  
ATOM   4963  N ND2  . ASN A 1 30 ? -9.617  7.592   -2.841  1.00 0.00 ? 30 ASN A ND2  7  
ATOM   4964  H H    . ASN A 1 30 ? -6.588  8.007   -6.346  1.00 0.00 ? 30 ASN A H    7  
ATOM   4965  H HA   . ASN A 1 30 ? -7.538  8.681   -4.393  1.00 0.00 ? 30 ASN A HA   7  
ATOM   4966  H HB2  . ASN A 1 30 ? -7.156  5.798   -4.059  1.00 0.00 ? 30 ASN A HB2  7  
ATOM   4967  H HB3  . ASN A 1 30 ? -7.223  6.674   -2.534  1.00 0.00 ? 30 ASN A HB3  7  
ATOM   4968  H HD21 . ASN A 1 30 ? -9.070  8.097   -2.203  1.00 0.00 ? 30 ASN A HD21 7  
ATOM   4969  H HD22 . ASN A 1 30 ? -10.594 7.658   -2.889  1.00 0.00 ? 30 ASN A HD22 7  
ATOM   4970  N N    . THR A 1 31 ? -4.482  8.576   -3.862  1.00 0.00 ? 31 THR A N    7  
ATOM   4971  C CA   . THR A 1 31 ? -3.322  9.083   -3.117  1.00 0.00 ? 31 THR A CA   7  
ATOM   4972  C C    . THR A 1 31 ? -3.394  8.800   -1.612  1.00 0.00 ? 31 THR A C    7  
ATOM   4973  O O    . THR A 1 31 ? -3.299  9.722   -0.801  1.00 0.00 ? 31 THR A O    7  
ATOM   4974  C CB   . THR A 1 31 ? -3.174  10.587  -3.355  1.00 0.00 ? 31 THR A CB   7  
ATOM   4975  O OG1  . THR A 1 31 ? -2.003  11.085  -2.727  1.00 0.00 ? 31 THR A OG1  7  
ATOM   4976  C CG2  . THR A 1 31 ? -4.353  11.392  -2.845  1.00 0.00 ? 31 THR A CG2  7  
ATOM   4977  H H    . THR A 1 31 ? -4.357  8.331   -4.799  1.00 0.00 ? 31 THR A H    7  
ATOM   4978  H HA   . THR A 1 31 ? -2.450  8.587   -3.510  1.00 0.00 ? 31 THR A HA   7  
ATOM   4979  H HB   . THR A 1 31 ? -3.087  10.765  -4.417  1.00 0.00 ? 31 THR A HB   7  
ATOM   4980  H HG1  . THR A 1 31 ? -2.197  11.314  -1.815  1.00 0.00 ? 31 THR A HG1  7  
ATOM   4981  H HG21 . THR A 1 31 ? -4.993  11.655  -3.674  1.00 0.00 ? 31 THR A HG21 7  
ATOM   4982  H HG22 . THR A 1 31 ? -3.994  12.291  -2.366  1.00 0.00 ? 31 THR A HG22 7  
ATOM   4983  H HG23 . THR A 1 31 ? -4.909  10.803  -2.132  1.00 0.00 ? 31 THR A HG23 7  
ATOM   4984  N N    . PRO A 1 32 ? -3.589  7.529   -1.208  1.00 0.00 ? 32 PRO A N    7  
ATOM   4985  C CA   . PRO A 1 32 ? -3.696  7.146   0.183   1.00 0.00 ? 32 PRO A CA   7  
ATOM   4986  C C    . PRO A 1 32 ? -2.487  6.364   0.732   1.00 0.00 ? 32 PRO A C    7  
ATOM   4987  O O    . PRO A 1 32 ? -2.637  5.624   1.704   1.00 0.00 ? 32 PRO A O    7  
ATOM   4988  C CB   . PRO A 1 32 ? -4.910  6.223   0.113   1.00 0.00 ? 32 PRO A CB   7  
ATOM   4989  C CG   . PRO A 1 32 ? -4.803  5.549   -1.233  1.00 0.00 ? 32 PRO A CG   7  
ATOM   4990  C CD   . PRO A 1 32 ? -3.770  6.348   -2.048  1.00 0.00 ? 32 PRO A CD   7  
ATOM   4991  H HA   . PRO A 1 32 ? -3.911  7.986   0.817   1.00 0.00 ? 32 PRO A HA   7  
ATOM   4992  H HB2  . PRO A 1 32 ? -4.870  5.507   0.923   1.00 0.00 ? 32 PRO A HB2  7  
ATOM   4993  H HB3  . PRO A 1 32 ? -5.815  6.808   0.188   1.00 0.00 ? 32 PRO A HB3  7  
ATOM   4994  H HG2  . PRO A 1 32 ? -4.479  4.522   -1.097  1.00 0.00 ? 32 PRO A HG2  7  
ATOM   4995  H HG3  . PRO A 1 32 ? -5.771  5.566   -1.720  1.00 0.00 ? 32 PRO A HG3  7  
ATOM   4996  H HD2  . PRO A 1 32 ? -2.839  5.801   -2.147  1.00 0.00 ? 32 PRO A HD2  7  
ATOM   4997  H HD3  . PRO A 1 32 ? -4.150  6.619   -3.021  1.00 0.00 ? 32 PRO A HD3  7  
ATOM   4998  N N    . PRO A 1 33 ? -1.279  6.486   0.140   1.00 0.00 ? 33 PRO A N    7  
ATOM   4999  C CA   . PRO A 1 33 ? -0.108  5.754   0.612   1.00 0.00 ? 33 PRO A CA   7  
ATOM   5000  C C    . PRO A 1 33 ? 0.734   6.536   1.602   1.00 0.00 ? 33 PRO A C    7  
ATOM   5001  O O    . PRO A 1 33 ? 1.795   7.056   1.258   1.00 0.00 ? 33 PRO A O    7  
ATOM   5002  C CB   . PRO A 1 33 ? 0.662   5.538   -0.681  1.00 0.00 ? 33 PRO A CB   7  
ATOM   5003  C CG   . PRO A 1 33 ? 0.436   6.805   -1.440  1.00 0.00 ? 33 PRO A CG   7  
ATOM   5004  C CD   . PRO A 1 33 ? -0.934  7.311   -1.035  1.00 0.00 ? 33 PRO A CD   7  
ATOM   5005  H HA   . PRO A 1 33 ? -0.372  4.805   1.047   1.00 0.00 ? 33 PRO A HA   7  
ATOM   5006  H HB2  . PRO A 1 33 ? 1.710   5.382   -0.462  1.00 0.00 ? 33 PRO A HB2  7  
ATOM   5007  H HB3  . PRO A 1 33 ? 0.262   4.684   -1.206  1.00 0.00 ? 33 PRO A HB3  7  
ATOM   5008  H HG2  . PRO A 1 33 ? 1.193   7.528   -1.177  1.00 0.00 ? 33 PRO A HG2  7  
ATOM   5009  H HG3  . PRO A 1 33 ? 0.462   6.604   -2.501  1.00 0.00 ? 33 PRO A HG3  7  
ATOM   5010  H HD2  . PRO A 1 33 ? -0.894  8.356   -0.770  1.00 0.00 ? 33 PRO A HD2  7  
ATOM   5011  H HD3  . PRO A 1 33 ? -1.631  7.153   -1.835  1.00 0.00 ? 33 PRO A HD3  7  
ATOM   5012  N N    . LEU A 1 34 ? 0.272   6.609   2.837   1.00 0.00 ? 34 LEU A N    7  
ATOM   5013  C CA   . LEU A 1 34 ? 1.022   7.325   3.862   1.00 0.00 ? 34 LEU A CA   7  
ATOM   5014  C C    . LEU A 1 34 ? 2.255   6.528   4.286   1.00 0.00 ? 34 LEU A C    7  
ATOM   5015  O O    . LEU A 1 34 ? 3.367   7.057   4.266   1.00 0.00 ? 34 LEU A O    7  
ATOM   5016  C CB   . LEU A 1 34 ? 0.141   7.686   5.069   1.00 0.00 ? 34 LEU A CB   7  
ATOM   5017  C CG   . LEU A 1 34 ? -1.250  8.218   4.724   1.00 0.00 ? 34 LEU A CG   7  
ATOM   5018  C CD1  . LEU A 1 34 ? -1.982  8.641   5.989   1.00 0.00 ? 34 LEU A CD1  7  
ATOM   5019  C CD2  . LEU A 1 34 ? -1.152  9.383   3.748   1.00 0.00 ? 34 LEU A CD2  7  
ATOM   5020  H H    . LEU A 1 34 ? -0.580  6.172   3.057   1.00 0.00 ? 34 LEU A H    7  
ATOM   5021  H HA   . LEU A 1 34 ? 1.375   8.233   3.404   1.00 0.00 ? 34 LEU A HA   7  
ATOM   5022  H HB2  . LEU A 1 34 ? 0.021   6.815   5.692   1.00 0.00 ? 34 LEU A HB2  7  
ATOM   5023  H HB3  . LEU A 1 34 ? 0.654   8.444   5.642   1.00 0.00 ? 34 LEU A HB3  7  
ATOM   5024  H HG   . LEU A 1 34 ? -1.822  7.432   4.253   1.00 0.00 ? 34 LEU A HG   7  
ATOM   5025  H HD11 . LEU A 1 34 ? -1.630  9.613   6.302   1.00 0.00 ? 34 LEU A HD11 7  
ATOM   5026  H HD12 . LEU A 1 34 ? -1.793  7.921   6.770   1.00 0.00 ? 34 LEU A HD12 7  
ATOM   5027  H HD13 . LEU A 1 34 ? -3.043  8.689   5.791   1.00 0.00 ? 34 LEU A HD13 7  
ATOM   5028  H HD21 . LEU A 1 34 ? -0.325  9.219   3.073   1.00 0.00 ? 34 LEU A HD21 7  
ATOM   5029  H HD22 . LEU A 1 34 ? -0.992  10.299  4.297   1.00 0.00 ? 34 LEU A HD22 7  
ATOM   5030  H HD23 . LEU A 1 34 ? -2.069  9.456   3.184   1.00 0.00 ? 34 LEU A HD23 7  
ATOM   5031  N N    . THR A 1 35 ? 2.082   5.252   4.628   1.00 0.00 ? 35 THR A N    7  
ATOM   5032  C CA   . THR A 1 35 ? 3.208   4.425   4.998   1.00 0.00 ? 35 THR A CA   7  
ATOM   5033  C C    . THR A 1 35 ? 3.773   3.744   3.755   1.00 0.00 ? 35 THR A C    7  
ATOM   5034  O O    . THR A 1 35 ? 4.669   2.906   3.852   1.00 0.00 ? 35 THR A O    7  
ATOM   5035  C CB   . THR A 1 35 ? 2.787   3.375   6.026   1.00 0.00 ? 35 THR A CB   7  
ATOM   5036  O OG1  . THR A 1 35 ? 3.891   2.571   6.401   1.00 0.00 ? 35 THR A OG1  7  
ATOM   5037  C CG2  . THR A 1 35 ? 1.696   2.452   5.528   1.00 0.00 ? 35 THR A CG2  7  
ATOM   5038  H H    . THR A 1 35 ? 1.194   4.851   4.605   1.00 0.00 ? 35 THR A H    7  
ATOM   5039  H HA   . THR A 1 35 ? 3.964   5.062   5.427   1.00 0.00 ? 35 THR A HA   7  
ATOM   5040  H HB   . THR A 1 35 ? 2.417   3.878   6.909   1.00 0.00 ? 35 THR A HB   7  
ATOM   5041  H HG1  . THR A 1 35 ? 4.051   2.664   7.344   1.00 0.00 ? 35 THR A HG1  7  
ATOM   5042  H HG21 . THR A 1 35 ? 0.791   2.627   6.091   1.00 0.00 ? 35 THR A HG21 7  
ATOM   5043  H HG22 . THR A 1 35 ? 2.006   1.425   5.655   1.00 0.00 ? 35 THR A HG22 7  
ATOM   5044  H HG23 . THR A 1 35 ? 1.511   2.644   4.481   1.00 0.00 ? 35 THR A HG23 7  
ATOM   5045  N N    . CYS A 1 36 ? 3.238   4.103   2.580   1.00 0.00 ? 36 CYS A N    7  
ATOM   5046  C CA   . CYS A 1 36 ? 3.696   3.505   1.338   1.00 0.00 ? 36 CYS A CA   7  
ATOM   5047  C C    . CYS A 1 36 ? 4.017   4.553   0.268   1.00 0.00 ? 36 CYS A C    7  
ATOM   5048  O O    . CYS A 1 36 ? 4.403   4.198   -0.842  1.00 0.00 ? 36 CYS A O    7  
ATOM   5049  C CB   . CYS A 1 36 ? 2.648   2.528   0.807   1.00 0.00 ? 36 CYS A CB   7  
ATOM   5050  S SG   . CYS A 1 36 ? 2.919   0.798   1.314   1.00 0.00 ? 36 CYS A SG   7  
ATOM   5051  H H    . CYS A 1 36 ? 2.519   4.773   2.553   1.00 0.00 ? 36 CYS A H    7  
ATOM   5052  H HA   . CYS A 1 36 ? 4.593   2.957   1.561   1.00 0.00 ? 36 CYS A HA   7  
ATOM   5053  H HB2  . CYS A 1 36 ? 1.674   2.825   1.166   1.00 0.00 ? 36 CYS A HB2  7  
ATOM   5054  H HB3  . CYS A 1 36 ? 2.652   2.558   -0.274  1.00 0.00 ? 36 CYS A HB3  7  
ATOM   5055  N N    . GLN A 1 37 ? 3.862   5.838   0.592   1.00 0.00 ? 37 GLN A N    7  
ATOM   5056  C CA   . GLN A 1 37 ? 4.144   6.900   -0.375  1.00 0.00 ? 37 GLN A CA   7  
ATOM   5057  C C    . GLN A 1 37 ? 5.493   6.674   -1.047  1.00 0.00 ? 37 GLN A C    7  
ATOM   5058  O O    . GLN A 1 37 ? 5.695   7.031   -2.208  1.00 0.00 ? 37 GLN A O    7  
ATOM   5059  C CB   . GLN A 1 37 ? 4.124   8.267   0.314   1.00 0.00 ? 37 GLN A CB   7  
ATOM   5060  C CG   . GLN A 1 37 ? 3.291   9.311   -0.415  1.00 0.00 ? 37 GLN A CG   7  
ATOM   5061  C CD   . GLN A 1 37 ? 3.708   10.730  -0.073  1.00 0.00 ? 37 GLN A CD   7  
ATOM   5062  O OE1  . GLN A 1 37 ? 4.668   11.258  -0.635  1.00 0.00 ? 37 GLN A OE1  7  
ATOM   5063  N NE2  . GLN A 1 37 ? 2.988   11.353  0.852   1.00 0.00 ? 37 GLN A NE2  7  
ATOM   5064  H H    . GLN A 1 37 ? 3.552   6.082   1.492   1.00 0.00 ? 37 GLN A H    7  
ATOM   5065  H HA   . GLN A 1 37 ? 3.376   6.869   -1.131  1.00 0.00 ? 37 GLN A HA   7  
ATOM   5066  H HB2  . GLN A 1 37 ? 3.721   8.149   1.308   1.00 0.00 ? 37 GLN A HB2  7  
ATOM   5067  H HB3  . GLN A 1 37 ? 5.136   8.636   0.388   1.00 0.00 ? 37 GLN A HB3  7  
ATOM   5068  H HG2  . GLN A 1 37 ? 3.405   9.165   -1.479  1.00 0.00 ? 37 GLN A HG2  7  
ATOM   5069  H HG3  . GLN A 1 37 ? 2.255   9.181   -0.143  1.00 0.00 ? 37 GLN A HG3  7  
ATOM   5070  H HE21 . GLN A 1 37 ? 2.238   10.871  1.259   1.00 0.00 ? 37 GLN A HE21 7  
ATOM   5071  H HE22 . GLN A 1 37 ? 3.237   12.272  1.091   1.00 0.00 ? 37 GLN A HE22 7  
ATOM   5072  N N    . ARG A 1 38 ? 6.400   6.064   -0.304  1.00 0.00 ? 38 ARG A N    7  
ATOM   5073  C CA   . ARG A 1 38 ? 7.736   5.762   -0.804  1.00 0.00 ? 38 ARG A CA   7  
ATOM   5074  C C    . ARG A 1 38 ? 7.702   4.535   -1.710  1.00 0.00 ? 38 ARG A C    7  
ATOM   5075  O O    . ARG A 1 38 ? 8.385   4.481   -2.731  1.00 0.00 ? 38 ARG A O    7  
ATOM   5076  C CB   . ARG A 1 38 ? 8.712   5.548   0.362   1.00 0.00 ? 38 ARG A CB   7  
ATOM   5077  C CG   . ARG A 1 38 ? 8.504   4.248   1.133   1.00 0.00 ? 38 ARG A CG   7  
ATOM   5078  C CD   . ARG A 1 38 ? 7.295   4.325   2.057   1.00 0.00 ? 38 ARG A CD   7  
ATOM   5079  N NE   . ARG A 1 38 ? 7.623   3.968   3.435   1.00 0.00 ? 38 ARG A NE   7  
ATOM   5080  C CZ   . ARG A 1 38 ? 7.660   2.719   3.895   1.00 0.00 ? 38 ARG A CZ   7  
ATOM   5081  N NH1  . ARG A 1 38 ? 7.491   1.696   3.069   1.00 0.00 ? 38 ARG A NH1  7  
ATOM   5082  N NH2  . ARG A 1 38 ? 7.882   2.495   5.184   1.00 0.00 ? 38 ARG A NH2  7  
ATOM   5083  H H    . ARG A 1 38 ? 6.160   5.803   0.603   1.00 0.00 ? 38 ARG A H    7  
ATOM   5084  H HA   . ARG A 1 38 ? 8.068   6.611   -1.387  1.00 0.00 ? 38 ARG A HA   7  
ATOM   5085  H HB2  . ARG A 1 38 ? 9.719   5.548   -0.028  1.00 0.00 ? 38 ARG A HB2  7  
ATOM   5086  H HB3  . ARG A 1 38 ? 8.607   6.371   1.054   1.00 0.00 ? 38 ARG A HB3  7  
ATOM   5087  H HG2  . ARG A 1 38 ? 8.355   3.444   0.430   1.00 0.00 ? 38 ARG A HG2  7  
ATOM   5088  H HG3  . ARG A 1 38 ? 9.385   4.049   1.725   1.00 0.00 ? 38 ARG A HG3  7  
ATOM   5089  H HD2  . ARG A 1 38 ? 6.915   5.335   2.033   1.00 0.00 ? 38 ARG A HD2  7  
ATOM   5090  H HD3  . ARG A 1 38 ? 6.536   3.655   1.681   1.00 0.00 ? 38 ARG A HD3  7  
ATOM   5091  H HE   . ARG A 1 38 ? 7.793   4.703   4.062   1.00 0.00 ? 38 ARG A HE   7  
ATOM   5092  H HH11 . ARG A 1 38 ? 7.334   1.857   2.095   1.00 0.00 ? 38 ARG A HH11 7  
ATOM   5093  H HH12 . ARG A 1 38 ? 7.521   0.759   3.420   1.00 0.00 ? 38 ARG A HH12 7  
ATOM   5094  H HH21 . ARG A 1 38 ? 8.021   3.263   5.809   1.00 0.00 ? 38 ARG A HH21 7  
ATOM   5095  H HH22 . ARG A 1 38 ? 7.907   1.558   5.531   1.00 0.00 ? 38 ARG A HH22 7  
ATOM   5096  N N    . TYR A 1 39 ? 6.897   3.550   -1.331  1.00 0.00 ? 39 TYR A N    7  
ATOM   5097  C CA   . TYR A 1 39 ? 6.773   2.325   -2.104  1.00 0.00 ? 39 TYR A CA   7  
ATOM   5098  C C    . TYR A 1 39 ? 5.886   2.529   -3.322  1.00 0.00 ? 39 TYR A C    7  
ATOM   5099  O O    . TYR A 1 39 ? 6.179   2.025   -4.406  1.00 0.00 ? 39 TYR A O    7  
ATOM   5100  C CB   . TYR A 1 39 ? 6.207   1.201   -1.234  1.00 0.00 ? 39 TYR A CB   7  
ATOM   5101  C CG   . TYR A 1 39 ? 6.223   -0.146  -1.914  1.00 0.00 ? 39 TYR A CG   7  
ATOM   5102  C CD1  . TYR A 1 39 ? 5.297   -0.457  -2.902  1.00 0.00 ? 39 TYR A CD1  7  
ATOM   5103  C CD2  . TYR A 1 39 ? 7.175   -1.102  -1.582  1.00 0.00 ? 39 TYR A CD2  7  
ATOM   5104  C CE1  . TYR A 1 39 ? 5.315   -1.683  -3.537  1.00 0.00 ? 39 TYR A CE1  7  
ATOM   5105  C CE2  . TYR A 1 39 ? 7.202   -2.331  -2.214  1.00 0.00 ? 39 TYR A CE2  7  
ATOM   5106  C CZ   . TYR A 1 39 ? 6.270   -2.617  -3.191  1.00 0.00 ? 39 TYR A CZ   7  
ATOM   5107  O OH   . TYR A 1 39 ? 6.296   -3.841  -3.822  1.00 0.00 ? 39 TYR A OH   7  
ATOM   5108  H H    . TYR A 1 39 ? 6.378   3.646   -0.514  1.00 0.00 ? 39 TYR A H    7  
ATOM   5109  H HA   . TYR A 1 39 ? 7.758   2.051   -2.437  1.00 0.00 ? 39 TYR A HA   7  
ATOM   5110  H HB2  . TYR A 1 39 ? 6.792   1.124   -0.329  1.00 0.00 ? 39 TYR A HB2  7  
ATOM   5111  H HB3  . TYR A 1 39 ? 5.182   1.434   -0.977  1.00 0.00 ? 39 TYR A HB3  7  
ATOM   5112  H HD1  . TYR A 1 39 ? 4.551   0.277   -3.171  1.00 0.00 ? 39 TYR A HD1  7  
ATOM   5113  H HD2  . TYR A 1 39 ? 7.901   -0.875  -0.816  1.00 0.00 ? 39 TYR A HD2  7  
ATOM   5114  H HE1  . TYR A 1 39 ? 4.586   -1.906  -4.301  1.00 0.00 ? 39 TYR A HE1  7  
ATOM   5115  H HE2  . TYR A 1 39 ? 7.949   -3.061  -1.942  1.00 0.00 ? 39 TYR A HE2  7  
ATOM   5116  H HH   . TYR A 1 39 ? 5.478   -3.969  -4.312  1.00 0.00 ? 39 TYR A HH   7  
ATOM   5117  N N    . CYS A 1 40 ? 4.805   3.276   -3.141  1.00 0.00 ? 40 CYS A N    7  
ATOM   5118  C CA   . CYS A 1 40 ? 3.882   3.544   -4.233  1.00 0.00 ? 40 CYS A CA   7  
ATOM   5119  C C    . CYS A 1 40 ? 4.588   4.324   -5.335  1.00 0.00 ? 40 CYS A C    7  
ATOM   5120  O O    . CYS A 1 40 ? 4.397   4.047   -6.519  1.00 0.00 ? 40 CYS A O    7  
ATOM   5121  C CB   . CYS A 1 40 ? 2.644   4.302   -3.728  1.00 0.00 ? 40 CYS A CB   7  
ATOM   5122  S SG   . CYS A 1 40 ? 1.520   4.857   -5.040  1.00 0.00 ? 40 CYS A SG   7  
ATOM   5123  H H    . CYS A 1 40 ? 4.630   3.657   -2.256  1.00 0.00 ? 40 CYS A H    7  
ATOM   5124  H HA   . CYS A 1 40 ? 3.571   2.594   -4.640  1.00 0.00 ? 40 CYS A HA   7  
ATOM   5125  H HB2  . CYS A 1 40 ? 2.076   3.657   -3.076  1.00 0.00 ? 40 CYS A HB2  7  
ATOM   5126  H HB3  . CYS A 1 40 ? 2.961   5.176   -3.178  1.00 0.00 ? 40 CYS A HB3  7  
ATOM   5127  N N    . ASN A 1 41 ? 5.421   5.280   -4.946  1.00 0.00 ? 41 ASN A N    7  
ATOM   5128  C CA   . ASN A 1 41 ? 6.160   6.062   -5.918  1.00 0.00 ? 41 ASN A CA   7  
ATOM   5129  C C    . ASN A 1 41 ? 7.319   5.245   -6.483  1.00 0.00 ? 41 ASN A C    7  
ATOM   5130  O O    . ASN A 1 41 ? 7.909   5.602   -7.503  1.00 0.00 ? 41 ASN A O    7  
ATOM   5131  C CB   . ASN A 1 41 ? 6.650   7.385   -5.303  1.00 0.00 ? 41 ASN A CB   7  
ATOM   5132  C CG   . ASN A 1 41 ? 8.141   7.395   -5.009  1.00 0.00 ? 41 ASN A CG   7  
ATOM   5133  O OD1  . ASN A 1 41 ? 8.867   8.288   -5.451  1.00 0.00 ? 41 ASN A OD1  7  
ATOM   5134  N ND2  . ASN A 1 41 ? 8.604   6.401   -4.263  1.00 0.00 ? 41 ASN A ND2  7  
ATOM   5135  H H    . ASN A 1 41 ? 5.551   5.450   -3.994  1.00 0.00 ? 41 ASN A H    7  
ATOM   5136  H HA   . ASN A 1 41 ? 5.484   6.277   -6.718  1.00 0.00 ? 41 ASN A HA   7  
ATOM   5137  H HB2  . ASN A 1 41 ? 6.436   8.192   -5.989  1.00 0.00 ? 41 ASN A HB2  7  
ATOM   5138  H HB3  . ASN A 1 41 ? 6.120   7.560   -4.377  1.00 0.00 ? 41 ASN A HB3  7  
ATOM   5139  H HD21 . ASN A 1 41 ? 7.968   5.724   -3.947  1.00 0.00 ? 41 ASN A HD21 7  
ATOM   5140  H HD22 . ASN A 1 41 ? 9.563   6.382   -4.060  1.00 0.00 ? 41 ASN A HD22 7  
ATOM   5141  N N    . ALA A 1 42 ? 7.622   4.138   -5.818  1.00 0.00 ? 42 ALA A N    7  
ATOM   5142  C CA   . ALA A 1 42 ? 8.692   3.252   -6.256  1.00 0.00 ? 42 ALA A CA   7  
ATOM   5143  C C    . ALA A 1 42 ? 8.134   1.892   -6.645  1.00 0.00 ? 42 ALA A C    7  
ATOM   5144  O O    . ALA A 1 42 ? 8.829   0.877   -6.580  1.00 0.00 ? 42 ALA A O    7  
ATOM   5145  C CB   . ALA A 1 42 ? 9.754   3.114   -5.171  1.00 0.00 ? 42 ALA A CB   7  
ATOM   5146  H H    . ALA A 1 42 ? 7.103   3.904   -5.022  1.00 0.00 ? 42 ALA A H    7  
ATOM   5147  H HA   . ALA A 1 42 ? 9.149   3.694   -7.125  1.00 0.00 ? 42 ALA A HA   7  
ATOM   5148  H HB1  . ALA A 1 42 ? 9.576   2.211   -4.605  1.00 0.00 ? 42 ALA A HB1  7  
ATOM   5149  H HB2  . ALA A 1 42 ? 9.708   3.967   -4.510  1.00 0.00 ? 42 ALA A HB2  7  
ATOM   5150  H HB3  . ALA A 1 42 ? 10.731  3.065   -5.628  1.00 0.00 ? 42 ALA A HB3  7  
ATOM   5151  N N    . SER A 1 43 ? 6.870   1.884   -7.052  1.00 0.00 ? 43 SER A N    7  
ATOM   5152  C CA   . SER A 1 43 ? 6.201   0.656   -7.459  1.00 0.00 ? 43 SER A CA   7  
ATOM   5153  C C    . SER A 1 43 ? 5.264   0.887   -8.649  1.00 0.00 ? 43 SER A C    7  
ATOM   5154  O O    . SER A 1 43 ? 5.004   -0.033  -9.426  1.00 0.00 ? 43 SER A O    7  
ATOM   5155  C CB   . SER A 1 43 ? 5.422   0.060   -6.287  1.00 0.00 ? 43 SER A CB   7  
ATOM   5156  O OG   . SER A 1 43 ? 4.966   -1.248  -6.591  1.00 0.00 ? 43 SER A OG   7  
ATOM   5157  H H    . SER A 1 43 ? 6.379   2.725   -7.079  1.00 0.00 ? 43 SER A H    7  
ATOM   5158  H HA   . SER A 1 43 ? 6.964   -0.041  -7.759  1.00 0.00 ? 43 SER A HA   7  
ATOM   5159  H HB2  . SER A 1 43 ? 6.063   0.012   -5.421  1.00 0.00 ? 43 SER A HB2  7  
ATOM   5160  H HB3  . SER A 1 43 ? 4.569   0.685   -6.071  1.00 0.00 ? 43 SER A HB3  7  
ATOM   5161  H HG   . SER A 1 43 ? 5.714   -1.804  -6.819  1.00 0.00 ? 43 SER A HG   7  
ATOM   5162  N N    . VAL A 1 44 ? 4.762   2.113   -8.798  1.00 0.00 ? 44 VAL A N    7  
ATOM   5163  C CA   . VAL A 1 44 ? 3.869   2.440   -9.901  1.00 0.00 ? 44 VAL A CA   7  
ATOM   5164  C C    . VAL A 1 44 ? 4.145   3.845   -10.417 1.00 0.00 ? 44 VAL A C    7  
ATOM   5165  O O    . VAL A 1 44 ? 3.268   4.706   -10.388 1.00 0.00 ? 44 VAL A O    7  
ATOM   5166  C CB   . VAL A 1 44 ? 2.384   2.342   -9.503  1.00 0.00 ? 44 VAL A CB   7  
ATOM   5167  C CG1  . VAL A 1 44 ? 1.495   2.453   -10.733 1.00 0.00 ? 44 VAL A CG1  7  
ATOM   5168  C CG2  . VAL A 1 44 ? 2.105   1.052   -8.748  1.00 0.00 ? 44 VAL A CG2  7  
ATOM   5169  H H    . VAL A 1 44 ? 5.003   2.812   -8.164  1.00 0.00 ? 44 VAL A H    7  
ATOM   5170  H HA   . VAL A 1 44 ? 4.056   1.734   -10.692 1.00 0.00 ? 44 VAL A HA   7  
ATOM   5171  H HB   . VAL A 1 44 ? 2.156   3.172   -8.854  1.00 0.00 ? 44 VAL A HB   7  
ATOM   5172  H HG11 . VAL A 1 44 ? 1.938   3.141   -11.437 1.00 0.00 ? 44 VAL A HG11 7  
ATOM   5173  H HG12 . VAL A 1 44 ? 0.520   2.814   -10.442 1.00 0.00 ? 44 VAL A HG12 7  
ATOM   5174  H HG13 . VAL A 1 44 ? 1.394   1.480   -11.193 1.00 0.00 ? 44 VAL A HG13 7  
ATOM   5175  H HG21 . VAL A 1 44 ? 2.148   0.219   -9.433  1.00 0.00 ? 44 VAL A HG21 7  
ATOM   5176  H HG22 . VAL A 1 44 ? 1.123   1.102   -8.304  1.00 0.00 ? 44 VAL A HG22 7  
ATOM   5177  H HG23 . VAL A 1 44 ? 2.845   0.922   -7.974  1.00 0.00 ? 44 VAL A HG23 7  
ATOM   5178  N N    . THR A 1 45 ? 5.383   4.062   -10.861 1.00 0.00 ? 45 THR A N    7  
ATOM   5179  C CA   . THR A 1 45 ? 5.835   5.341   -11.376 1.00 0.00 ? 45 THR A CA   7  
ATOM   5180  C C    . THR A 1 45 ? 4.692   6.186   -11.941 1.00 0.00 ? 45 THR A C    7  
ATOM   5181  O O    . THR A 1 45 ? 3.692   5.657   -12.428 1.00 0.00 ? 45 THR A O    7  
ATOM   5182  C CB   . THR A 1 45 ? 6.899   5.131   -12.450 1.00 0.00 ? 45 THR A CB   7  
ATOM   5183  O OG1  . THR A 1 45 ? 7.402   3.804   -12.406 1.00 0.00 ? 45 THR A OG1  7  
ATOM   5184  C CG2  . THR A 1 45 ? 8.073   6.080   -12.324 1.00 0.00 ? 45 THR A CG2  7  
ATOM   5185  H H    . THR A 1 45 ? 6.025   3.340   -10.818 1.00 0.00 ? 45 THR A H    7  
ATOM   5186  H HA   . THR A 1 45 ? 6.281   5.855   -10.554 1.00 0.00 ? 45 THR A HA   7  
ATOM   5187  H HB   . THR A 1 45 ? 6.450   5.292   -13.419 1.00 0.00 ? 45 THR A HB   7  
ATOM   5188  H HG1  . THR A 1 45 ? 8.311   3.788   -12.717 1.00 0.00 ? 45 THR A HG1  7  
ATOM   5189  H HG21 . THR A 1 45 ? 8.825   5.636   -11.688 1.00 0.00 ? 45 THR A HG21 7  
ATOM   5190  H HG22 . THR A 1 45 ? 7.739   7.010   -11.892 1.00 0.00 ? 45 THR A HG22 7  
ATOM   5191  H HG23 . THR A 1 45 ? 8.493   6.266   -13.302 1.00 0.00 ? 45 THR A HG23 7  
ATOM   5192  N N    . ASN A 1 46 ? 4.852   7.502   -11.879 1.00 0.00 ? 46 ASN A N    7  
ATOM   5193  C CA   . ASN A 1 46 ? 3.843   8.419   -12.384 1.00 0.00 ? 46 ASN A CA   7  
ATOM   5194  C C    . ASN A 1 46 ? 4.467   9.758   -12.760 1.00 0.00 ? 46 ASN A C    7  
ATOM   5195  O O    . ASN A 1 46 ? 5.687   9.912   -12.725 1.00 0.00 ? 46 ASN A O    7  
ATOM   5196  C CB   . ASN A 1 46 ? 2.750   8.629   -11.333 1.00 0.00 ? 46 ASN A CB   7  
ATOM   5197  C CG   . ASN A 1 46 ? 3.295   9.220   -10.049 1.00 0.00 ? 46 ASN A CG   7  
ATOM   5198  O OD1  . ASN A 1 46 ? 4.201   8.660   -9.430  1.00 0.00 ? 46 ASN A OD1  7  
ATOM   5199  N ND2  . ASN A 1 46 ? 2.745   10.357  -9.640  1.00 0.00 ? 46 ASN A ND2  7  
ATOM   5200  H H    . ASN A 1 46 ? 5.670   7.863   -11.493 1.00 0.00 ? 46 ASN A H    7  
ATOM   5201  H HA   . ASN A 1 46 ? 3.409   7.976   -13.261 1.00 0.00 ? 46 ASN A HA   7  
ATOM   5202  H HB2  . ASN A 1 46 ? 2.002   9.302   -11.726 1.00 0.00 ? 46 ASN A HB2  7  
ATOM   5203  H HB3  . ASN A 1 46 ? 2.288   7.680   -11.105 1.00 0.00 ? 46 ASN A HB3  7  
ATOM   5204  H HD21 . ASN A 1 46 ? 2.026   10.745  -10.182 1.00 0.00 ? 46 ASN A HD21 7  
ATOM   5205  H HD22 . ASN A 1 46 ? 3.081   10.762  -8.813  1.00 0.00 ? 46 ASN A HD22 7  
ATOM   5206  N N    . SER A 1 47 ? 3.626   10.724  -13.114 1.00 0.00 ? 47 SER A N    7  
ATOM   5207  C CA   . SER A 1 47 ? 4.102   12.053  -13.491 1.00 0.00 ? 47 SER A CA   7  
ATOM   5208  C C    . SER A 1 47 ? 4.912   11.994  -14.781 1.00 0.00 ? 47 SER A C    7  
ATOM   5209  O O    . SER A 1 47 ? 6.123   12.206  -14.774 1.00 0.00 ? 47 SER A O    7  
ATOM   5210  C CB   . SER A 1 47 ? 4.951   12.654  -12.367 1.00 0.00 ? 47 SER A CB   7  
ATOM   5211  O OG   . SER A 1 47 ? 4.364   12.412  -11.100 1.00 0.00 ? 47 SER A OG   7  
ATOM   5212  H H    . SER A 1 47 ? 2.661   10.542  -13.123 1.00 0.00 ? 47 SER A H    7  
ATOM   5213  H HA   . SER A 1 47 ? 3.239   12.681  -13.651 1.00 0.00 ? 47 SER A HA   7  
ATOM   5214  H HB2  . SER A 1 47 ? 5.935   12.207  -12.383 1.00 0.00 ? 47 SER A HB2  7  
ATOM   5215  H HB3  . SER A 1 47 ? 5.037   13.720  -12.514 1.00 0.00 ? 47 SER A HB3  7  
ATOM   5216  H HG   . SER A 1 47 ? 5.019   12.027  -10.514 1.00 0.00 ? 47 SER A HG   7  
ATOM   5217  N N    . VAL A 1 48 ? 4.226   11.717  -15.885 1.00 0.00 ? 48 VAL A N    7  
ATOM   5218  C CA   . VAL A 1 48 ? 4.843   11.628  -17.202 1.00 0.00 ? 48 VAL A CA   7  
ATOM   5219  C C    . VAL A 1 48 ? 3.888   10.957  -18.173 1.00 0.00 ? 48 VAL A C    7  
ATOM   5220  O O    . VAL A 1 48 ? 3.738   9.736   -18.181 1.00 0.00 ? 48 VAL A O    7  
ATOM   5221  C CB   . VAL A 1 48 ? 6.167   10.846  -17.229 1.00 0.00 ? 48 VAL A CB   7  
ATOM   5222  C CG1  . VAL A 1 48 ? 7.361   11.787  -17.171 1.00 0.00 ? 48 VAL A CG1  7  
ATOM   5223  C CG2  . VAL A 1 48 ? 6.227   9.799   -16.123 1.00 0.00 ? 48 VAL A CG2  7  
ATOM   5224  H H    . VAL A 1 48 ? 3.261   11.572  -15.818 1.00 0.00 ? 48 VAL A H    7  
ATOM   5225  H HA   . VAL A 1 48 ? 5.038   12.632  -17.545 1.00 0.00 ? 48 VAL A HA   7  
ATOM   5226  H HB   . VAL A 1 48 ? 6.204   10.335  -18.176 1.00 0.00 ? 48 VAL A HB   7  
ATOM   5227  H HG11 . VAL A 1 48 ? 7.602   12.007  -16.145 1.00 0.00 ? 48 VAL A HG11 7  
ATOM   5228  H HG12 . VAL A 1 48 ? 7.122   12.703  -17.688 1.00 0.00 ? 48 VAL A HG12 7  
ATOM   5229  H HG13 . VAL A 1 48 ? 8.209   11.317  -17.646 1.00 0.00 ? 48 VAL A HG13 7  
ATOM   5230  H HG21 . VAL A 1 48 ? 5.244   9.670   -15.694 1.00 0.00 ? 48 VAL A HG21 7  
ATOM   5231  H HG22 . VAL A 1 48 ? 6.915   10.124  -15.356 1.00 0.00 ? 48 VAL A HG22 7  
ATOM   5232  H HG23 . VAL A 1 48 ? 6.564   8.858   -16.534 1.00 0.00 ? 48 VAL A HG23 7  
ATOM   5233  N N    . LYS A 1 49 ? 3.248   11.771  -18.982 1.00 0.00 ? 49 LYS A N    7  
ATOM   5234  C CA   . LYS A 1 49 ? 2.291   11.282  -19.968 1.00 0.00 ? 49 LYS A CA   7  
ATOM   5235  C C    . LYS A 1 49 ? 1.144   10.541  -19.282 1.00 0.00 ? 49 LYS A C    7  
ATOM   5236  O O    . LYS A 1 49 ? 1.148   10.369  -18.064 1.00 0.00 ? 49 LYS A O    7  
ATOM   5237  C CB   . LYS A 1 49 ? 2.987   10.358  -20.976 1.00 0.00 ? 49 LYS A CB   7  
ATOM   5238  C CG   . LYS A 1 49 ? 3.555   11.085  -22.186 1.00 0.00 ? 49 LYS A CG   7  
ATOM   5239  C CD   . LYS A 1 49 ? 2.460   11.731  -23.024 1.00 0.00 ? 49 LYS A CD   7  
ATOM   5240  C CE   . LYS A 1 49 ? 2.398   11.131  -24.421 1.00 0.00 ? 49 LYS A CE   7  
ATOM   5241  N NZ   . LYS A 1 49 ? 1.467   9.972   -24.486 1.00 0.00 ? 49 LYS A NZ   7  
ATOM   5242  H H    . LYS A 1 49 ? 3.423   12.725  -18.909 1.00 0.00 ? 49 LYS A H    7  
ATOM   5243  H HA   . LYS A 1 49 ? 1.892   12.137  -20.492 1.00 0.00 ? 49 LYS A HA   7  
ATOM   5244  H HB2  . LYS A 1 49 ? 3.800   9.850   -20.476 1.00 0.00 ? 49 LYS A HB2  7  
ATOM   5245  H HB3  . LYS A 1 49 ? 2.277   9.623   -21.324 1.00 0.00 ? 49 LYS A HB3  7  
ATOM   5246  H HG2  . LYS A 1 49 ? 4.231   11.855  -21.846 1.00 0.00 ? 49 LYS A HG2  7  
ATOM   5247  H HG3  . LYS A 1 49 ? 4.094   10.375  -22.798 1.00 0.00 ? 49 LYS A HG3  7  
ATOM   5248  H HD2  . LYS A 1 49 ? 1.506   11.583  -22.537 1.00 0.00 ? 49 LYS A HD2  7  
ATOM   5249  H HD3  . LYS A 1 49 ? 2.663   12.788  -23.106 1.00 0.00 ? 49 LYS A HD3  7  
ATOM   5250  H HE2  . LYS A 1 49 ? 2.062   11.892  -25.111 1.00 0.00 ? 49 LYS A HE2  7  
ATOM   5251  H HE3  . LYS A 1 49 ? 3.388   10.804  -24.703 1.00 0.00 ? 49 LYS A HE3  7  
ATOM   5252  H HZ1  . LYS A 1 49 ? 1.192   9.679   -23.527 1.00 0.00 ? 49 LYS A HZ1  7  
ATOM   5253  H HZ2  . LYS A 1 49 ? 1.926   9.172   -24.963 1.00 0.00 ? 49 LYS A HZ2  7  
ATOM   5254  H HZ3  . LYS A 1 49 ? 0.611   10.231  -25.017 1.00 0.00 ? 49 LYS A HZ3  7  
HETATM 5255  N N    . CY1 A 1 50 ? 0.165   10.108  -20.072 1.00 0.00 ? 50 CY1 A N    7  
HETATM 5256  C CA   . CY1 A 1 50 ? -0.986  9.387   -19.536 1.00 0.00 ? 50 CY1 A CA   7  
HETATM 5257  C CB   . CY1 A 1 50 ? -2.229  10.279  -19.556 1.00 0.00 ? 50 CY1 A CB   7  
HETATM 5258  S SG   . CY1 A 1 50 ? -3.385  9.895   -18.223 1.00 0.00 ? 50 CY1 A SG   7  
HETATM 5259  C CD   . CY1 A 1 50 ? -4.623  8.871   -19.043 1.00 0.00 ? 50 CY1 A CD   7  
HETATM 5260  N NE   . CY1 A 1 50 ? -4.909  7.694   -18.228 1.00 0.00 ? 50 CY1 A NE   7  
HETATM 5261  C CZ   . CY1 A 1 50 ? -6.080  7.440   -17.641 1.00 0.00 ? 50 CY1 A CZ   7  
HETATM 5262  O OAC  . CY1 A 1 50 ? -7.092  8.139   -17.685 1.00 0.00 ? 50 CY1 A OAC  7  
HETATM 5263  C CM   . CY1 A 1 50 ? -6.119  6.149   -16.843 1.00 0.00 ? 50 CY1 A CM   7  
HETATM 5264  C C    . CY1 A 1 50 ? -1.248  8.111   -20.332 1.00 0.00 ? 50 CY1 A C    7  
HETATM 5265  O O    . CY1 A 1 50 ? -1.234  7.013   -19.776 1.00 0.00 ? 50 CY1 A O    7  
HETATM 5266  H H    . CY1 A 1 50 ? 0.217   10.277  -21.036 1.00 0.00 ? 50 CY1 A H    7  
HETATM 5267  H HA   . CY1 A 1 50 ? -0.764  9.117   -18.513 1.00 0.00 ? 50 CY1 A HA   7  
HETATM 5268  H HB2  . CY1 A 1 50 ? -1.921  11.310  -19.456 1.00 0.00 ? 50 CY1 A HB2  7  
HETATM 5269  H HB3  . CY1 A 1 50 ? -2.739  10.155  -20.499 1.00 0.00 ? 50 CY1 A HB3  7  
HETATM 5270  H HD2  . CY1 A 1 50 ? -5.375  9.624   -18.876 1.00 0.00 ? 50 CY1 A HD2  7  
HETATM 5271  H HD3  . CY1 A 1 50 ? -4.244  8.568   -20.012 1.00 0.00 ? 50 CY1 A HD3  7  
HETATM 5272  H HE   . CY1 A 1 50 ? -4.213  7.385   -17.607 1.00 0.00 ? 50 CY1 A HE   7  
HETATM 5273  H HM1  . CY1 A 1 50 ? -5.259  5.542   -17.112 1.00 0.00 ? 50 CY1 A HM1  7  
HETATM 5274  H HM2  . CY1 A 1 50 ? -7.050  5.630   -17.055 1.00 0.00 ? 50 CY1 A HM2  7  
HETATM 5275  H HM3  . CY1 A 1 50 ? -6.076  6.366   -15.795 1.00 0.00 ? 50 CY1 A HM3  7  
HETATM 5276  N N    . NH2 A 1 51 ? -1.496  8.241   -21.628 1.00 0.00 ? 51 NH2 A N    7  
HETATM 5277  H HN1  . NH2 A 1 51 ? -1.493  9.142   -22.011 1.00 0.00 ? 51 NH2 A HN1  7  
HETATM 5278  H HN2  . NH2 A 1 51 ? -1.676  7.433   -22.150 1.00 0.00 ? 51 NH2 A HN2  7  
ATOM   5279  N N    . LEU A 1 1  ? -1.210  -3.760  18.024  1.00 0.00 ? 1  LEU A N    8  
ATOM   5280  C CA   . LEU A 1 1  ? -2.424  -2.902  18.006  1.00 0.00 ? 1  LEU A CA   8  
ATOM   5281  C C    . LEU A 1 1  ? -3.100  -2.940  16.638  1.00 0.00 ? 1  LEU A C    8  
ATOM   5282  O O    . LEU A 1 1  ? -4.182  -3.507  16.482  1.00 0.00 ? 1  LEU A O    8  
ATOM   5283  C CB   . LEU A 1 1  ? -2.020  -1.467  18.361  1.00 0.00 ? 1  LEU A CB   8  
ATOM   5284  C CG   . LEU A 1 1  ? -1.103  -1.330  19.582  1.00 0.00 ? 1  LEU A CG   8  
ATOM   5285  C CD1  . LEU A 1 1  ? 0.031   -0.357  19.294  1.00 0.00 ? 1  LEU A CD1  8  
ATOM   5286  C CD2  . LEU A 1 1  ? -1.897  -0.880  20.802  1.00 0.00 ? 1  LEU A CD2  8  
ATOM   5287  H H1   . LEU A 1 1  ? -1.000  -3.992  19.015  1.00 0.00 ? 1  LEU A H1   8  
ATOM   5288  H H2   . LEU A 1 1  ? -0.433  -3.219  17.590  1.00 0.00 ? 1  LEU A H2   8  
ATOM   5289  H H3   . LEU A 1 1  ? -1.420  -4.618  17.477  1.00 0.00 ? 1  LEU A H3   8  
ATOM   5290  H HA   . LEU A 1 1  ? -3.116  -3.270  18.749  1.00 0.00 ? 1  LEU A HA   8  
ATOM   5291  H HB2  . LEU A 1 1  ? -1.515  -1.037  17.509  1.00 0.00 ? 1  LEU A HB2  8  
ATOM   5292  H HB3  . LEU A 1 1  ? -2.918  -0.899  18.548  1.00 0.00 ? 1  LEU A HB3  8  
ATOM   5293  H HG   . LEU A 1 1  ? -0.665  -2.291  19.804  1.00 0.00 ? 1  LEU A HG   8  
ATOM   5294  H HD11 . LEU A 1 1  ? -0.359  0.506   18.774  1.00 0.00 ? 1  LEU A HD11 8  
ATOM   5295  H HD12 . LEU A 1 1  ? 0.774   -0.842  18.678  1.00 0.00 ? 1  LEU A HD12 8  
ATOM   5296  H HD13 . LEU A 1 1  ? 0.482   -0.044  20.224  1.00 0.00 ? 1  LEU A HD13 8  
ATOM   5297  H HD21 . LEU A 1 1  ? -1.759  -1.591  21.603  1.00 0.00 ? 1  LEU A HD21 8  
ATOM   5298  H HD22 . LEU A 1 1  ? -2.946  -0.824  20.550  1.00 0.00 ? 1  LEU A HD22 8  
ATOM   5299  H HD23 . LEU A 1 1  ? -1.551  0.092   21.120  1.00 0.00 ? 1  LEU A HD23 8  
ATOM   5300  N N    . GLN A 1 2  ? -2.451  -2.336  15.646  1.00 0.00 ? 2  GLN A N    8  
ATOM   5301  C CA   . GLN A 1 2  ? -2.981  -2.304  14.287  1.00 0.00 ? 2  GLN A CA   8  
ATOM   5302  C C    . GLN A 1 2  ? -1.844  -2.327  13.270  1.00 0.00 ? 2  GLN A C    8  
ATOM   5303  O O    . GLN A 1 2  ? -0.901  -1.543  13.369  1.00 0.00 ? 2  GLN A O    8  
ATOM   5304  C CB   . GLN A 1 2  ? -3.845  -1.058  14.077  1.00 0.00 ? 2  GLN A CB   8  
ATOM   5305  C CG   . GLN A 1 2  ? -5.161  -1.092  14.839  1.00 0.00 ? 2  GLN A CG   8  
ATOM   5306  C CD   . GLN A 1 2  ? -6.244  -1.858  14.104  1.00 0.00 ? 2  GLN A CD   8  
ATOM   5307  O OE1  . GLN A 1 2  ? -6.047  -2.304  12.972  1.00 0.00 ? 2  GLN A OE1  8  
ATOM   5308  N NE2  . GLN A 1 2  ? -7.397  -2.013  14.743  1.00 0.00 ? 2  GLN A NE2  8  
ATOM   5309  H H    . GLN A 1 2  ? -1.590  -1.907  15.830  1.00 0.00 ? 2  GLN A H    8  
ATOM   5310  H HA   . GLN A 1 2  ? -3.590  -3.184  14.148  1.00 0.00 ? 2  GLN A HA   8  
ATOM   5311  H HB2  . GLN A 1 2  ? -3.290  -0.190  14.400  1.00 0.00 ? 2  GLN A HB2  8  
ATOM   5312  H HB3  . GLN A 1 2  ? -4.067  -0.961  13.024  1.00 0.00 ? 2  GLN A HB3  8  
ATOM   5313  H HG2  . GLN A 1 2  ? -4.996  -1.563  15.796  1.00 0.00 ? 2  GLN A HG2  8  
ATOM   5314  H HG3  . GLN A 1 2  ? -5.498  -0.077  14.992  1.00 0.00 ? 2  GLN A HG3  8  
ATOM   5315  H HE21 . GLN A 1 2  ? -7.483  -1.630  15.642  1.00 0.00 ? 2  GLN A HE21 8  
ATOM   5316  H HE22 . GLN A 1 2  ? -8.115  -2.504  14.291  1.00 0.00 ? 2  GLN A HE22 8  
ATOM   5317  N N    . MET A 1 3  ? -1.937  -3.244  12.304  1.00 0.00 ? 3  MET A N    8  
ATOM   5318  C CA   . MET A 1 3  ? -0.908  -3.394  11.257  1.00 0.00 ? 3  MET A CA   8  
ATOM   5319  C C    . MET A 1 3  ? 0.293   -4.182  11.767  1.00 0.00 ? 3  MET A C    8  
ATOM   5320  O O    . MET A 1 3  ? 1.160   -4.576  10.987  1.00 0.00 ? 3  MET A O    8  
ATOM   5321  C CB   . MET A 1 3  ? -0.455  -2.025  10.718  1.00 0.00 ? 3  MET A CB   8  
ATOM   5322  C CG   . MET A 1 3  ? 0.686   -2.088  9.701   1.00 0.00 ? 3  MET A CG   8  
ATOM   5323  S SD   . MET A 1 3  ? 2.308   -1.935  10.476  1.00 0.00 ? 3  MET A SD   8  
ATOM   5324  C CE   . MET A 1 3  ? 2.365   -0.172  10.786  1.00 0.00 ? 3  MET A CE   8  
ATOM   5325  H H    . MET A 1 3  ? -2.718  -3.846  12.301  1.00 0.00 ? 3  MET A H    8  
ATOM   5326  H HA   . MET A 1 3  ? -1.346  -3.955  10.451  1.00 0.00 ? 3  MET A HA   8  
ATOM   5327  H HB2  . MET A 1 3  ? -1.296  -1.542  10.247  1.00 0.00 ? 3  MET A HB2  8  
ATOM   5328  H HB3  . MET A 1 3  ? -0.126  -1.419  11.548  1.00 0.00 ? 3  MET A HB3  8  
ATOM   5329  H HG2  . MET A 1 3  ? 0.645   -3.028  9.172   1.00 0.00 ? 3  MET A HG2  8  
ATOM   5330  H HG3  . MET A 1 3  ? 0.567   -1.276  8.996   1.00 0.00 ? 3  MET A HG3  8  
ATOM   5331  H HE1  . MET A 1 3  ? 3.190   0.263   10.241  1.00 0.00 ? 3  MET A HE1  8  
ATOM   5332  H HE2  . MET A 1 3  ? 2.500   0.004   11.843  1.00 0.00 ? 3  MET A HE2  8  
ATOM   5333  H HE3  . MET A 1 3  ? 1.441   0.282   10.461  1.00 0.00 ? 3  MET A HE3  8  
ATOM   5334  N N    . ALA A 1 4  ? 0.335   -4.422  13.070  1.00 0.00 ? 4  ALA A N    8  
ATOM   5335  C CA   . ALA A 1 4  ? 1.425   -5.176  13.671  1.00 0.00 ? 4  ALA A CA   8  
ATOM   5336  C C    . ALA A 1 4  ? 0.885   -6.360  14.462  1.00 0.00 ? 4  ALA A C    8  
ATOM   5337  O O    . ALA A 1 4  ? 0.680   -6.271  15.673  1.00 0.00 ? 4  ALA A O    8  
ATOM   5338  C CB   . ALA A 1 4  ? 2.255   -4.269  14.561  1.00 0.00 ? 4  ALA A CB   8  
ATOM   5339  H H    . ALA A 1 4  ? -0.386  -4.091  13.642  1.00 0.00 ? 4  ALA A H    8  
ATOM   5340  H HA   . ALA A 1 4  ? 2.060   -5.547  12.877  1.00 0.00 ? 4  ALA A HA   8  
ATOM   5341  H HB1  . ALA A 1 4  ? 1.978   -4.424  15.592  1.00 0.00 ? 4  ALA A HB1  8  
ATOM   5342  H HB2  . ALA A 1 4  ? 2.073   -3.239  14.289  1.00 0.00 ? 4  ALA A HB2  8  
ATOM   5343  H HB3  . ALA A 1 4  ? 3.302   -4.497  14.430  1.00 0.00 ? 4  ALA A HB3  8  
ATOM   5344  N N    . GLY A 1 5  ? 0.655   -7.472  13.770  1.00 0.00 ? 5  GLY A N    8  
ATOM   5345  C CA   . GLY A 1 5  ? 0.137   -8.658  14.424  1.00 0.00 ? 5  GLY A CA   8  
ATOM   5346  C C    . GLY A 1 5  ? -0.146  -9.791  13.453  1.00 0.00 ? 5  GLY A C    8  
ATOM   5347  O O    . GLY A 1 5  ? -0.113  -10.960 13.836  1.00 0.00 ? 5  GLY A O    8  
ATOM   5348  H H    . GLY A 1 5  ? 0.839   -7.486  12.807  1.00 0.00 ? 5  GLY A H    8  
ATOM   5349  H HA2  . GLY A 1 5  ? 0.862   -8.998  15.151  1.00 0.00 ? 5  GLY A HA2  8  
ATOM   5350  H HA3  . GLY A 1 5  ? -0.780  -8.402  14.936  1.00 0.00 ? 5  GLY A HA3  8  
ATOM   5351  N N    . GLN A 1 6  ? -0.418  -9.453  12.191  1.00 0.00 ? 6  GLN A N    8  
ATOM   5352  C CA   . GLN A 1 6  ? -0.698  -10.461 11.180  1.00 0.00 ? 6  GLN A CA   8  
ATOM   5353  C C    . GLN A 1 6  ? -1.101  -9.815  9.863   1.00 0.00 ? 6  GLN A C    8  
ATOM   5354  O O    . GLN A 1 6  ? -2.258  -9.875  9.445   1.00 0.00 ? 6  GLN A O    8  
ATOM   5355  C CB   . GLN A 1 6  ? -1.784  -11.429 11.660  1.00 0.00 ? 6  GLN A CB   8  
ATOM   5356  C CG   . GLN A 1 6  ? -1.318  -12.875 11.735  1.00 0.00 ? 6  GLN A CG   8  
ATOM   5357  C CD   . GLN A 1 6  ? -1.759  -13.694 10.538  1.00 0.00 ? 6  GLN A CD   8  
ATOM   5358  O OE1  . GLN A 1 6  ? -1.249  -13.520 9.431   1.00 0.00 ? 6  GLN A OE1  8  
ATOM   5359  N NE2  . GLN A 1 6  ? -2.714  -14.592 10.753  1.00 0.00 ? 6  GLN A NE2  8  
ATOM   5360  H H    . GLN A 1 6  ? -0.422  -8.511  11.931  1.00 0.00 ? 6  GLN A H    8  
ATOM   5361  H HA   . GLN A 1 6  ? 0.214   -11.005 11.017  1.00 0.00 ? 6  GLN A HA   8  
ATOM   5362  H HB2  . GLN A 1 6  ? -2.108  -11.128 12.644  1.00 0.00 ? 6  GLN A HB2  8  
ATOM   5363  H HB3  . GLN A 1 6  ? -2.625  -11.380 10.984  1.00 0.00 ? 6  GLN A HB3  8  
ATOM   5364  H HG2  . GLN A 1 6  ? -0.240  -12.891 11.784  1.00 0.00 ? 6  GLN A HG2  8  
ATOM   5365  H HG3  . GLN A 1 6  ? -1.725  -13.324 12.630  1.00 0.00 ? 6  GLN A HG3  8  
ATOM   5366  H HE21 . GLN A 1 6  ? -3.076  -14.674 11.660  1.00 0.00 ? 6  GLN A HE21 8  
ATOM   5367  H HE22 . GLN A 1 6  ? -3.017  -15.136 9.997   1.00 0.00 ? 6  GLN A HE22 8  
ATOM   5368  N N    . CYS A 1 7  ? -0.123  -9.206  9.216   1.00 0.00 ? 7  CYS A N    8  
ATOM   5369  C CA   . CYS A 1 7  ? -0.339  -8.549  7.931   1.00 0.00 ? 7  CYS A CA   8  
ATOM   5370  C C    . CYS A 1 7  ? 0.627   -9.077  6.884   1.00 0.00 ? 7  CYS A C    8  
ATOM   5371  O O    . CYS A 1 7  ? 1.798   -9.323  7.176   1.00 0.00 ? 7  CYS A O    8  
ATOM   5372  C CB   . CYS A 1 7  ? -0.163  -7.032  8.050   1.00 0.00 ? 7  CYS A CB   8  
ATOM   5373  S SG   . CYS A 1 7  ? -1.586  -6.154  8.779   1.00 0.00 ? 7  CYS A SG   8  
ATOM   5374  H H    . CYS A 1 7  ? 0.772   -9.206  9.613   1.00 0.00 ? 7  CYS A H    8  
ATOM   5375  H HA   . CYS A 1 7  ? -1.345  -8.763  7.614   1.00 0.00 ? 7  CYS A HA   8  
ATOM   5376  H HB2  . CYS A 1 7  ? 0.697   -6.828  8.670   1.00 0.00 ? 7  CYS A HB2  8  
ATOM   5377  H HB3  . CYS A 1 7  ? 0.012   -6.619  7.062   1.00 0.00 ? 7  CYS A HB3  8  
ATOM   5378  N N    . SER A 1 8  ? 0.141   -9.227  5.659   1.00 0.00 ? 8  SER A N    8  
ATOM   5379  C CA   . SER A 1 8  ? 0.983   -9.695  4.572   1.00 0.00 ? 8  SER A CA   8  
ATOM   5380  C C    . SER A 1 8  ? 2.090   -8.689  4.328   1.00 0.00 ? 8  SER A C    8  
ATOM   5381  O O    . SER A 1 8  ? 2.002   -7.539  4.754   1.00 0.00 ? 8  SER A O    8  
ATOM   5382  C CB   . SER A 1 8  ? 0.164   -9.900  3.296   1.00 0.00 ? 8  SER A CB   8  
ATOM   5383  O OG   . SER A 1 8  ? -1.168  -10.271 3.600   1.00 0.00 ? 8  SER A OG   8  
ATOM   5384  H H    . SER A 1 8  ? -0.796  -8.999  5.480   1.00 0.00 ? 8  SER A H    8  
ATOM   5385  H HA   . SER A 1 8  ? 1.430   -10.631 4.862   1.00 0.00 ? 8  SER A HA   8  
ATOM   5386  H HB2  . SER A 1 8  ? 0.149   -8.982  2.729   1.00 0.00 ? 8  SER A HB2  8  
ATOM   5387  H HB3  . SER A 1 8  ? 0.615   -10.682 2.703   1.00 0.00 ? 8  SER A HB3  8  
ATOM   5388  H HG   . SER A 1 8  ? -1.192  -11.195 3.860   1.00 0.00 ? 8  SER A HG   8  
ATOM   5389  N N    . GLN A 1 9  ? 3.136   -9.125  3.660   1.00 0.00 ? 9  GLN A N    8  
ATOM   5390  C CA   . GLN A 1 9  ? 4.265   -8.256  3.381   1.00 0.00 ? 9  GLN A CA   8  
ATOM   5391  C C    . GLN A 1 9  ? 3.813   -6.924  2.805   1.00 0.00 ? 9  GLN A C    8  
ATOM   5392  O O    . GLN A 1 9  ? 2.907   -6.861  1.974   1.00 0.00 ? 9  GLN A O    8  
ATOM   5393  C CB   . GLN A 1 9  ? 5.256   -8.938  2.439   1.00 0.00 ? 9  GLN A CB   8  
ATOM   5394  C CG   . GLN A 1 9  ? 4.645   -9.355  1.110   1.00 0.00 ? 9  GLN A CG   8  
ATOM   5395  C CD   . GLN A 1 9  ? 4.301   -10.831 1.067   1.00 0.00 ? 9  GLN A CD   8  
ATOM   5396  O OE1  . GLN A 1 9  ? 5.177   -11.688 1.173   1.00 0.00 ? 9  GLN A OE1  8  
ATOM   5397  N NE2  . GLN A 1 9  ? 3.018   -11.135 0.908   1.00 0.00 ? 9  GLN A NE2  8  
ATOM   5398  H H    . GLN A 1 9  ? 3.159   -10.054 3.363   1.00 0.00 ? 9  GLN A H    8  
ATOM   5399  H HA   . GLN A 1 9  ? 4.747   -8.058  4.320   1.00 0.00 ? 9  GLN A HA   8  
ATOM   5400  H HB2  . GLN A 1 9  ? 6.071   -8.258  2.237   1.00 0.00 ? 9  GLN A HB2  8  
ATOM   5401  H HB3  . GLN A 1 9  ? 5.648   -9.821  2.922   1.00 0.00 ? 9  GLN A HB3  8  
ATOM   5402  H HG2  . GLN A 1 9  ? 3.743   -8.786  0.949   1.00 0.00 ? 9  GLN A HG2  8  
ATOM   5403  H HG3  . GLN A 1 9  ? 5.352   -9.142  0.321   1.00 0.00 ? 9  GLN A HG3  8  
ATOM   5404  H HE21 . GLN A 1 9  ? 2.374   -10.400 0.830   1.00 0.00 ? 9  GLN A HE21 8  
ATOM   5405  H HE22 . GLN A 1 9  ? 2.767   -12.081 0.877   1.00 0.00 ? 9  GLN A HE22 8  
ATOM   5406  N N    . ASN A 1 10 ? 4.453   -5.861  3.279   1.00 0.00 ? 10 ASN A N    8  
ATOM   5407  C CA   . ASN A 1 10 ? 4.146   -4.500  2.853   1.00 0.00 ? 10 ASN A CA   8  
ATOM   5408  C C    . ASN A 1 10 ? 2.647   -4.249  2.825   1.00 0.00 ? 10 ASN A C    8  
ATOM   5409  O O    . ASN A 1 10 ? 2.157   -3.451  2.026   1.00 0.00 ? 10 ASN A O    8  
ATOM   5410  C CB   . ASN A 1 10 ? 4.761   -4.195  1.471   1.00 0.00 ? 10 ASN A CB   8  
ATOM   5411  C CG   . ASN A 1 10 ? 4.378   -5.225  0.421   1.00 0.00 ? 10 ASN A CG   8  
ATOM   5412  O OD1  . ASN A 1 10 ? 5.214   -6.011  -0.022  1.00 0.00 ? 10 ASN A OD1  8  
ATOM   5413  N ND2  . ASN A 1 10 ? 3.109   -5.229  0.015   1.00 0.00 ? 10 ASN A ND2  8  
ATOM   5414  H H    . ASN A 1 10 ? 5.153   -5.999  3.953   1.00 0.00 ? 10 ASN A H    8  
ATOM   5415  H HA   . ASN A 1 10 ? 4.573   -3.837  3.590   1.00 0.00 ? 10 ASN A HA   8  
ATOM   5416  H HB2  . ASN A 1 10 ? 4.423   -3.223  1.133   1.00 0.00 ? 10 ASN A HB2  8  
ATOM   5417  H HB3  . ASN A 1 10 ? 5.842   -4.182  1.551   1.00 0.00 ? 10 ASN A HB3  8  
ATOM   5418  H HD21 . ASN A 1 10 ? 2.491   -4.578  0.406   1.00 0.00 ? 10 ASN A HD21 8  
ATOM   5419  H HD22 . ASN A 1 10 ? 2.844   -5.888  -0.661  1.00 0.00 ? 10 ASN A HD22 8  
ATOM   5420  N N    . GLU A 1 11 ? 1.921   -4.915  3.714   1.00 0.00 ? 11 GLU A N    8  
ATOM   5421  C CA   . GLU A 1 11 ? 0.478   -4.718  3.781   1.00 0.00 ? 11 GLU A CA   8  
ATOM   5422  C C    . GLU A 1 11 ? 0.123   -3.793  4.925   1.00 0.00 ? 11 GLU A C    8  
ATOM   5423  O O    . GLU A 1 11 ? 0.811   -3.763  5.945   1.00 0.00 ? 11 GLU A O    8  
ATOM   5424  C CB   . GLU A 1 11 ? -0.268  -6.049  3.887   1.00 0.00 ? 11 GLU A CB   8  
ATOM   5425  C CG   . GLU A 1 11 ? -1.382  -6.193  2.861   1.00 0.00 ? 11 GLU A CG   8  
ATOM   5426  C CD   . GLU A 1 11 ? -1.884  -7.619  2.735   1.00 0.00 ? 11 GLU A CD   8  
ATOM   5427  O OE1  . GLU A 1 11 ? -2.430  -8.146  3.726   1.00 0.00 ? 11 GLU A OE1  8  
ATOM   5428  O OE2  . GLU A 1 11 ? -1.730  -8.207  1.644   1.00 0.00 ? 11 GLU A OE2  8  
ATOM   5429  H H    . GLU A 1 11 ? 2.370   -5.533  4.345   1.00 0.00 ? 11 GLU A H    8  
ATOM   5430  H HA   . GLU A 1 11 ? 0.186   -4.227  2.882   1.00 0.00 ? 11 GLU A HA   8  
ATOM   5431  H HB2  . GLU A 1 11 ? 0.430   -6.855  3.737   1.00 0.00 ? 11 GLU A HB2  8  
ATOM   5432  H HB3  . GLU A 1 11 ? -0.700  -6.134  4.872   1.00 0.00 ? 11 GLU A HB3  8  
ATOM   5433  H HG2  . GLU A 1 11 ? -2.206  -5.562  3.151   1.00 0.00 ? 11 GLU A HG2  8  
ATOM   5434  H HG3  . GLU A 1 11 ? -1.010  -5.873  1.900   1.00 0.00 ? 11 GLU A HG3  8  
ATOM   5435  N N    . TYR A 1 12 ? -0.945  -3.014  4.749   1.00 0.00 ? 12 TYR A N    8  
ATOM   5436  C CA   . TYR A 1 12 ? -1.349  -2.070  5.794   1.00 0.00 ? 12 TYR A CA   8  
ATOM   5437  C C    . TYR A 1 12 ? -2.751  -2.356  6.306   1.00 0.00 ? 12 TYR A C    8  
ATOM   5438  O O    . TYR A 1 12 ? -3.724  -2.354  5.555   1.00 0.00 ? 12 TYR A O    8  
ATOM   5439  C CB   . TYR A 1 12 ? -1.224  -0.619  5.316   1.00 0.00 ? 12 TYR A CB   8  
ATOM   5440  C CG   . TYR A 1 12 ? -2.291  -0.170  4.343   1.00 0.00 ? 12 TYR A CG   8  
ATOM   5441  C CD1  . TYR A 1 12 ? -3.493  0.356   4.796   1.00 0.00 ? 12 TYR A CD1  8  
ATOM   5442  C CD2  . TYR A 1 12 ? -2.086  -0.253  2.974   1.00 0.00 ? 12 TYR A CD2  8  
ATOM   5443  C CE1  . TYR A 1 12 ? -4.462  0.784   3.911   1.00 0.00 ? 12 TYR A CE1  8  
ATOM   5444  C CE2  . TYR A 1 12 ? -3.050  0.171   2.082   1.00 0.00 ? 12 TYR A CE2  8  
ATOM   5445  C CZ   . TYR A 1 12 ? -4.236  0.690   2.554   1.00 0.00 ? 12 TYR A CZ   8  
ATOM   5446  O OH   . TYR A 1 12 ? -5.198  1.117   1.665   1.00 0.00 ? 12 TYR A OH   8  
ATOM   5447  H H    . TYR A 1 12 ? -1.463  -3.071  3.900   1.00 0.00 ? 12 TYR A H    8  
ATOM   5448  H HA   . TYR A 1 12 ? -0.664  -2.206  6.623   1.00 0.00 ? 12 TYR A HA   8  
ATOM   5449  H HB2  . TYR A 1 12 ? -1.271  0.031   6.175   1.00 0.00 ? 12 TYR A HB2  8  
ATOM   5450  H HB3  . TYR A 1 12 ? -0.264  -0.494  4.834   1.00 0.00 ? 12 TYR A HB3  8  
ATOM   5451  H HD1  . TYR A 1 12 ? -3.667  0.428   5.860   1.00 0.00 ? 12 TYR A HD1  8  
ATOM   5452  H HD2  . TYR A 1 12 ? -1.155  -0.659  2.606   1.00 0.00 ? 12 TYR A HD2  8  
ATOM   5453  H HE1  . TYR A 1 12 ? -5.391  1.191   4.283   1.00 0.00 ? 12 TYR A HE1  8  
ATOM   5454  H HE2  . TYR A 1 12 ? -2.872  0.095   1.020   1.00 0.00 ? 12 TYR A HE2  8  
ATOM   5455  H HH   . TYR A 1 12 ? -6.063  1.075   2.081   1.00 0.00 ? 12 TYR A HH   8  
ATOM   5456  N N    . PHE A 1 13 ? -2.821  -2.608  7.608   1.00 0.00 ? 13 PHE A N    8  
ATOM   5457  C CA   . PHE A 1 13 ? -4.071  -2.917  8.293   1.00 0.00 ? 13 PHE A CA   8  
ATOM   5458  C C    . PHE A 1 13 ? -4.936  -1.670  8.458   1.00 0.00 ? 13 PHE A C    8  
ATOM   5459  O O    . PHE A 1 13 ? -4.849  -0.981  9.474   1.00 0.00 ? 13 PHE A O    8  
ATOM   5460  C CB   . PHE A 1 13 ? -3.739  -3.490  9.674   1.00 0.00 ? 13 PHE A CB   8  
ATOM   5461  C CG   . PHE A 1 13 ? -4.702  -4.522  10.187  1.00 0.00 ? 13 PHE A CG   8  
ATOM   5462  C CD1  . PHE A 1 13 ? -6.048  -4.464  9.873   1.00 0.00 ? 13 PHE A CD1  8  
ATOM   5463  C CD2  . PHE A 1 13 ? -4.250  -5.552  10.999  1.00 0.00 ? 13 PHE A CD2  8  
ATOM   5464  C CE1  . PHE A 1 13 ? -6.927  -5.413  10.357  1.00 0.00 ? 13 PHE A CE1  8  
ATOM   5465  C CE2  . PHE A 1 13 ? -5.124  -6.502  11.486  1.00 0.00 ? 13 PHE A CE2  8  
ATOM   5466  C CZ   . PHE A 1 13 ? -6.464  -6.432  11.165  1.00 0.00 ? 13 PHE A CZ   8  
ATOM   5467  H H    . PHE A 1 13 ? -1.993  -2.591  8.130   1.00 0.00 ? 13 PHE A H    8  
ATOM   5468  H HA   . PHE A 1 13 ? -4.609  -3.658  7.715   1.00 0.00 ? 13 PHE A HA   8  
ATOM   5469  H HB2  . PHE A 1 13 ? -2.769  -3.951  9.628   1.00 0.00 ? 13 PHE A HB2  8  
ATOM   5470  H HB3  . PHE A 1 13 ? -3.710  -2.681  10.389  1.00 0.00 ? 13 PHE A HB3  8  
ATOM   5471  H HD1  . PHE A 1 13 ? -6.411  -3.667  9.241   1.00 0.00 ? 13 PHE A HD1  8  
ATOM   5472  H HD2  . PHE A 1 13 ? -3.198  -5.606  11.251  1.00 0.00 ? 13 PHE A HD2  8  
ATOM   5473  H HE1  . PHE A 1 13 ? -7.974  -5.356  10.108  1.00 0.00 ? 13 PHE A HE1  8  
ATOM   5474  H HE2  . PHE A 1 13 ? -4.760  -7.298  12.117  1.00 0.00 ? 13 PHE A HE2  8  
ATOM   5475  H HZ   . PHE A 1 13 ? -7.151  -7.175  11.545  1.00 0.00 ? 13 PHE A HZ   8  
ATOM   5476  N N    . ASP A 1 14 ? -5.785  -1.390  7.475   1.00 0.00 ? 14 ASP A N    8  
ATOM   5477  C CA   . ASP A 1 14 ? -6.664  -0.230  7.557   1.00 0.00 ? 14 ASP A CA   8  
ATOM   5478  C C    . ASP A 1 14 ? -7.679  -0.431  8.668   1.00 0.00 ? 14 ASP A C    8  
ATOM   5479  O O    . ASP A 1 14 ? -8.678  -1.118  8.487   1.00 0.00 ? 14 ASP A O    8  
ATOM   5480  C CB   . ASP A 1 14 ? -7.383  0.001   6.225   1.00 0.00 ? 14 ASP A CB   8  
ATOM   5481  C CG   . ASP A 1 14 ? -7.454  1.470   5.857   1.00 0.00 ? 14 ASP A CG   8  
ATOM   5482  O OD1  . ASP A 1 14 ? -7.480  2.312   6.779   1.00 0.00 ? 14 ASP A OD1  8  
ATOM   5483  O OD2  . ASP A 1 14 ? -7.489  1.779   4.647   1.00 0.00 ? 14 ASP A OD2  8  
ATOM   5484  H H    . ASP A 1 14 ? -5.835  -1.980  6.692   1.00 0.00 ? 14 ASP A H    8  
ATOM   5485  H HA   . ASP A 1 14 ? -6.065  0.638   7.789   1.00 0.00 ? 14 ASP A HA   8  
ATOM   5486  H HB2  . ASP A 1 14 ? -6.857  -0.524  5.442   1.00 0.00 ? 14 ASP A HB2  8  
ATOM   5487  H HB3  . ASP A 1 14 ? -8.389  -0.381  6.297   1.00 0.00 ? 14 ASP A HB3  8  
ATOM   5488  N N    . SER A 1 15 ? -7.418  0.170   9.824   1.00 0.00 ? 15 SER A N    8  
ATOM   5489  C CA   . SER A 1 15 ? -8.316  0.046   10.964  1.00 0.00 ? 15 SER A CA   8  
ATOM   5490  C C    . SER A 1 15 ? -9.755  0.344   10.558  1.00 0.00 ? 15 SER A C    8  
ATOM   5491  O O    . SER A 1 15 ? -10.699 -0.112  11.204  1.00 0.00 ? 15 SER A O    8  
ATOM   5492  C CB   . SER A 1 15 ? -7.883  0.984   12.091  1.00 0.00 ? 15 SER A CB   8  
ATOM   5493  O OG   . SER A 1 15 ? -7.801  2.325   11.638  1.00 0.00 ? 15 SER A OG   8  
ATOM   5494  H H    . SER A 1 15 ? -6.601  0.704   9.912   1.00 0.00 ? 15 SER A H    8  
ATOM   5495  H HA   . SER A 1 15 ? -8.260  -0.972  11.313  1.00 0.00 ? 15 SER A HA   8  
ATOM   5496  H HB2  . SER A 1 15 ? -8.600  0.933   12.896  1.00 0.00 ? 15 SER A HB2  8  
ATOM   5497  H HB3  . SER A 1 15 ? -6.912  0.682   12.455  1.00 0.00 ? 15 SER A HB3  8  
ATOM   5498  H HG   . SER A 1 15 ? -8.578  2.535   11.115  1.00 0.00 ? 15 SER A HG   8  
ATOM   5499  N N    . LEU A 1 16 ? -9.916  1.100   9.478   1.00 0.00 ? 16 LEU A N    8  
ATOM   5500  C CA   . LEU A 1 16 ? -11.244 1.441   8.985   1.00 0.00 ? 16 LEU A CA   8  
ATOM   5501  C C    . LEU A 1 16 ? -11.804 0.307   8.132   1.00 0.00 ? 16 LEU A C    8  
ATOM   5502  O O    . LEU A 1 16 ? -13.019 0.134   8.026   1.00 0.00 ? 16 LEU A O    8  
ATOM   5503  C CB   . LEU A 1 16 ? -11.197 2.734   8.171   1.00 0.00 ? 16 LEU A CB   8  
ATOM   5504  C CG   . LEU A 1 16 ? -12.559 3.270   7.730   1.00 0.00 ? 16 LEU A CG   8  
ATOM   5505  C CD1  . LEU A 1 16 ? -12.529 4.788   7.632   1.00 0.00 ? 16 LEU A CD1  8  
ATOM   5506  C CD2  . LEU A 1 16 ? -12.966 2.654   6.400   1.00 0.00 ? 16 LEU A CD2  8  
ATOM   5507  H H    . LEU A 1 16 ? -9.125  1.429   8.996   1.00 0.00 ? 16 LEU A H    8  
ATOM   5508  H HA   . LEU A 1 16 ? -11.888 1.584   9.839   1.00 0.00 ? 16 LEU A HA   8  
ATOM   5509  H HB2  . LEU A 1 16 ? -10.710 3.492   8.768   1.00 0.00 ? 16 LEU A HB2  8  
ATOM   5510  H HB3  . LEU A 1 16 ? -10.602 2.559   7.288   1.00 0.00 ? 16 LEU A HB3  8  
ATOM   5511  H HG   . LEU A 1 16 ? -13.301 2.998   8.467   1.00 0.00 ? 16 LEU A HG   8  
ATOM   5512  H HD11 . LEU A 1 16 ? -13.467 5.141   7.231   1.00 0.00 ? 16 LEU A HD11 8  
ATOM   5513  H HD12 . LEU A 1 16 ? -11.722 5.089   6.980   1.00 0.00 ? 16 LEU A HD12 8  
ATOM   5514  H HD13 . LEU A 1 16 ? -12.375 5.209   8.614   1.00 0.00 ? 16 LEU A HD13 8  
ATOM   5515  H HD21 . LEU A 1 16 ? -12.081 2.393   5.840   1.00 0.00 ? 16 LEU A HD21 8  
ATOM   5516  H HD22 . LEU A 1 16 ? -13.552 3.366   5.838   1.00 0.00 ? 16 LEU A HD22 8  
ATOM   5517  H HD23 . LEU A 1 16 ? -13.554 1.766   6.580   1.00 0.00 ? 16 LEU A HD23 8  
ATOM   5518  N N    . LEU A 1 17 ? -10.906 -0.463  7.523   1.00 0.00 ? 17 LEU A N    8  
ATOM   5519  C CA   . LEU A 1 17 ? -11.292 -1.580  6.672   1.00 0.00 ? 17 LEU A CA   8  
ATOM   5520  C C    . LEU A 1 17 ? -11.181 -2.914  7.409   1.00 0.00 ? 17 LEU A C    8  
ATOM   5521  O O    . LEU A 1 17 ? -11.809 -3.897  7.016   1.00 0.00 ? 17 LEU A O    8  
ATOM   5522  C CB   . LEU A 1 17 ? -10.400 -1.611  5.433   1.00 0.00 ? 17 LEU A CB   8  
ATOM   5523  C CG   . LEU A 1 17 ? -10.406 -0.325  4.603   1.00 0.00 ? 17 LEU A CG   8  
ATOM   5524  C CD1  . LEU A 1 17 ? -9.356  -0.393  3.505   1.00 0.00 ? 17 LEU A CD1  8  
ATOM   5525  C CD2  . LEU A 1 17 ? -11.786 -0.082  4.011   1.00 0.00 ? 17 LEU A CD2  8  
ATOM   5526  H H    . LEU A 1 17 ? -9.953  -0.271  7.644   1.00 0.00 ? 17 LEU A H    8  
ATOM   5527  H HA   . LEU A 1 17 ? -12.316 -1.431  6.363   1.00 0.00 ? 17 LEU A HA   8  
ATOM   5528  H HB2  . LEU A 1 17 ? -9.384  -1.804  5.753   1.00 0.00 ? 17 LEU A HB2  8  
ATOM   5529  H HB3  . LEU A 1 17 ? -10.722 -2.423  4.800   1.00 0.00 ? 17 LEU A HB3  8  
ATOM   5530  H HG   . LEU A 1 17 ? -10.165 0.509   5.246   1.00 0.00 ? 17 LEU A HG   8  
ATOM   5531  H HD11 . LEU A 1 17 ? -9.316  -1.395  3.106   1.00 0.00 ? 17 LEU A HD11 8  
ATOM   5532  H HD12 . LEU A 1 17 ? -8.392  -0.129  3.913   1.00 0.00 ? 17 LEU A HD12 8  
ATOM   5533  H HD13 . LEU A 1 17 ? -9.615  0.299   2.717   1.00 0.00 ? 17 LEU A HD13 8  
ATOM   5534  H HD21 . LEU A 1 17 ? -12.440 0.316   4.774   1.00 0.00 ? 17 LEU A HD21 8  
ATOM   5535  H HD22 . LEU A 1 17 ? -12.190 -1.014  3.643   1.00 0.00 ? 17 LEU A HD22 8  
ATOM   5536  H HD23 . LEU A 1 17 ? -11.709 0.624   3.198   1.00 0.00 ? 17 LEU A HD23 8  
ATOM   5537  N N    . HIS A 1 18 ? -10.363 -2.954  8.462   1.00 0.00 ? 18 HIS A N    8  
ATOM   5538  C CA   . HIS A 1 18 ? -10.167 -4.185  9.218   1.00 0.00 ? 18 HIS A CA   8  
ATOM   5539  C C    . HIS A 1 18 ? -9.601  -5.261  8.305   1.00 0.00 ? 18 HIS A C    8  
ATOM   5540  O O    . HIS A 1 18 ? -10.099 -6.386  8.251   1.00 0.00 ? 18 HIS A O    8  
ATOM   5541  C CB   . HIS A 1 18 ? -11.481 -4.657  9.820   1.00 0.00 ? 18 HIS A CB   8  
ATOM   5542  C CG   . HIS A 1 18 ? -11.993 -3.776  10.918  1.00 0.00 ? 18 HIS A CG   8  
ATOM   5543  N ND1  . HIS A 1 18 ? -11.237 -3.427  12.018  1.00 0.00 ? 18 HIS A ND1  8  
ATOM   5544  C CD2  . HIS A 1 18 ? -13.193 -3.169  11.081  1.00 0.00 ? 18 HIS A CD2  8  
ATOM   5545  C CE1  . HIS A 1 18 ? -11.950 -2.646  12.810  1.00 0.00 ? 18 HIS A CE1  8  
ATOM   5546  N NE2  . HIS A 1 18 ? -13.139 -2.474  12.263  1.00 0.00 ? 18 HIS A NE2  8  
ATOM   5547  H H    . HIS A 1 18 ? -9.871  -2.148  8.723   1.00 0.00 ? 18 HIS A H    8  
ATOM   5548  H HA   . HIS A 1 18 ? -9.461  -3.984  10.010  1.00 0.00 ? 18 HIS A HA   8  
ATOM   5549  H HB2  . HIS A 1 18 ? -12.225 -4.691  9.043   1.00 0.00 ? 18 HIS A HB2  8  
ATOM   5550  H HB3  . HIS A 1 18 ? -11.341 -5.648  10.222  1.00 0.00 ? 18 HIS A HB3  8  
ATOM   5551  H HD1  . HIS A 1 18 ? -10.315 -3.710  12.193  1.00 0.00 ? 18 HIS A HD1  8  
ATOM   5552  H HD2  . HIS A 1 18 ? -14.036 -3.223  10.406  1.00 0.00 ? 18 HIS A HD2  8  
ATOM   5553  H HE1  . HIS A 1 18 ? -11.616 -2.220  13.745  1.00 0.00 ? 18 HIS A HE1  8  
ATOM   5554  H HE2  . HIS A 1 18 ? -13.839 -1.879  12.607  1.00 0.00 ? 18 HIS A HE2  8  
ATOM   5555  N N    . ALA A 1 19 ? -8.559  -4.889  7.583   1.00 0.00 ? 19 ALA A N    8  
ATOM   5556  C CA   . ALA A 1 19 ? -7.909  -5.775  6.650   1.00 0.00 ? 19 ALA A CA   8  
ATOM   5557  C C    . ALA A 1 19 ? -6.585  -5.205  6.198   1.00 0.00 ? 19 ALA A C    8  
ATOM   5558  O O    . ALA A 1 19 ? -6.507  -4.058  5.760   1.00 0.00 ? 19 ALA A O    8  
ATOM   5559  C CB   . ALA A 1 19 ? -8.776  -5.988  5.424   1.00 0.00 ? 19 ALA A CB   8  
ATOM   5560  H H    . ALA A 1 19 ? -8.222  -3.985  7.679   1.00 0.00 ? 19 ALA A H    8  
ATOM   5561  H HA   . ALA A 1 19 ? -7.753  -6.726  7.127   1.00 0.00 ? 19 ALA A HA   8  
ATOM   5562  H HB1  . ALA A 1 19 ? -9.730  -5.506  5.567   1.00 0.00 ? 19 ALA A HB1  8  
ATOM   5563  H HB2  . ALA A 1 19 ? -8.922  -7.045  5.264   1.00 0.00 ? 19 ALA A HB2  8  
ATOM   5564  H HB3  . ALA A 1 19 ? -8.278  -5.556  4.562   1.00 0.00 ? 19 ALA A HB3  8  
ATOM   5565  N N    . CYS A 1 20 ? -5.559  -6.017  6.269   1.00 0.00 ? 20 CYS A N    8  
ATOM   5566  C CA   . CYS A 1 20 ? -4.254  -5.595  5.809   1.00 0.00 ? 20 CYS A CA   8  
ATOM   5567  C C    . CYS A 1 20 ? -4.305  -5.435  4.295   1.00 0.00 ? 20 CYS A C    8  
ATOM   5568  O O    . CYS A 1 20 ? -4.396  -6.413  3.550   1.00 0.00 ? 20 CYS A O    8  
ATOM   5569  C CB   . CYS A 1 20 ? -3.168  -6.589  6.220   1.00 0.00 ? 20 CYS A CB   8  
ATOM   5570  S SG   . CYS A 1 20 ? -3.218  -7.063  7.978   1.00 0.00 ? 20 CYS A SG   8  
ATOM   5571  H H    . CYS A 1 20 ? -5.694  -6.919  6.604   1.00 0.00 ? 20 CYS A H    8  
ATOM   5572  H HA   . CYS A 1 20 ? -4.052  -4.634  6.243   1.00 0.00 ? 20 CYS A HA   8  
ATOM   5573  H HB2  . CYS A 1 20 ? -3.275  -7.489  5.635   1.00 0.00 ? 20 CYS A HB2  8  
ATOM   5574  H HB3  . CYS A 1 20 ? -2.202  -6.151  6.024   1.00 0.00 ? 20 CYS A HB3  8  
ATOM   5575  N N    . ILE A 1 21 ? -4.292  -4.186  3.857   1.00 0.00 ? 21 ILE A N    8  
ATOM   5576  C CA   . ILE A 1 21 ? -4.381  -3.851  2.448   1.00 0.00 ? 21 ILE A CA   8  
ATOM   5577  C C    . ILE A 1 21 ? -3.009  -3.552  1.857   1.00 0.00 ? 21 ILE A C    8  
ATOM   5578  O O    . ILE A 1 21 ? -2.181  -2.913  2.500   1.00 0.00 ? 21 ILE A O    8  
ATOM   5579  C CB   . ILE A 1 21 ? -5.261  -2.604  2.254   1.00 0.00 ? 21 ILE A CB   8  
ATOM   5580  C CG1  . ILE A 1 21 ? -6.395  -2.543  3.289   1.00 0.00 ? 21 ILE A CG1  8  
ATOM   5581  C CG2  . ILE A 1 21 ? -5.819  -2.547  0.841   1.00 0.00 ? 21 ILE A CG2  8  
ATOM   5582  C CD1  . ILE A 1 21 ? -7.386  -3.684  3.206   1.00 0.00 ? 21 ILE A CD1  8  
ATOM   5583  H H    . ILE A 1 21 ? -4.246  -3.460  4.507   1.00 0.00 ? 21 ILE A H    8  
ATOM   5584  H HA   . ILE A 1 21 ? -4.826  -4.679  1.923   1.00 0.00 ? 21 ILE A HA   8  
ATOM   5585  H HB   . ILE A 1 21 ? -4.622  -1.748  2.397   1.00 0.00 ? 21 ILE A HB   8  
ATOM   5586  H HG12 . ILE A 1 21 ? -5.966  -2.553  4.279   1.00 0.00 ? 21 ILE A HG12 8  
ATOM   5587  H HG13 . ILE A 1 21 ? -6.941  -1.621  3.153   1.00 0.00 ? 21 ILE A HG13 8  
ATOM   5588  H HG21 . ILE A 1 21 ? -6.168  -3.527  0.551   1.00 0.00 ? 21 ILE A HG21 8  
ATOM   5589  H HG22 . ILE A 1 21 ? -5.046  -2.223  0.160   1.00 0.00 ? 21 ILE A HG22 8  
ATOM   5590  H HG23 . ILE A 1 21 ? -6.643  -1.849  0.807   1.00 0.00 ? 21 ILE A HG23 8  
ATOM   5591  H HD11 . ILE A 1 21 ? -6.889  -4.614  3.439   1.00 0.00 ? 21 ILE A HD11 8  
ATOM   5592  H HD12 . ILE A 1 21 ? -7.799  -3.734  2.209   1.00 0.00 ? 21 ILE A HD12 8  
ATOM   5593  H HD13 . ILE A 1 21 ? -8.183  -3.519  3.915   1.00 0.00 ? 21 ILE A HD13 8  
ATOM   5594  N N    . PRO A 1 22 ? -2.739  -3.998  0.615   1.00 0.00 ? 22 PRO A N    8  
ATOM   5595  C CA   . PRO A 1 22 ? -1.460  -3.750  -0.030  1.00 0.00 ? 22 PRO A CA   8  
ATOM   5596  C C    . PRO A 1 22 ? -1.442  -2.431  -0.798  1.00 0.00 ? 22 PRO A C    8  
ATOM   5597  O O    . PRO A 1 22 ? -2.405  -2.081  -1.481  1.00 0.00 ? 22 PRO A O    8  
ATOM   5598  C CB   . PRO A 1 22 ? -1.336  -4.933  -0.980  1.00 0.00 ? 22 PRO A CB   8  
ATOM   5599  C CG   . PRO A 1 22 ? -2.740  -5.224  -1.397  1.00 0.00 ? 22 PRO A CG   8  
ATOM   5600  C CD   . PRO A 1 22 ? -3.640  -4.773  -0.257  1.00 0.00 ? 22 PRO A CD   8  
ATOM   5601  H HA   . PRO A 1 22 ? -0.656  -3.760  0.684   1.00 0.00 ? 22 PRO A HA   8  
ATOM   5602  H HB2  . PRO A 1 22 ? -0.719  -4.658  -1.823  1.00 0.00 ? 22 PRO A HB2  8  
ATOM   5603  H HB3  . PRO A 1 22 ? -0.897  -5.773  -0.462  1.00 0.00 ? 22 PRO A HB3  8  
ATOM   5604  H HG2  . PRO A 1 22 ? -2.970  -4.673  -2.300  1.00 0.00 ? 22 PRO A HG2  8  
ATOM   5605  H HG3  . PRO A 1 22 ? -2.855  -6.285  -1.570  1.00 0.00 ? 22 PRO A HG3  8  
ATOM   5606  H HD2  . PRO A 1 22 ? -4.440  -4.152  -0.633  1.00 0.00 ? 22 PRO A HD2  8  
ATOM   5607  H HD3  . PRO A 1 22 ? -4.040  -5.629  0.267   1.00 0.00 ? 22 PRO A HD3  8  
ATOM   5608  N N    . CYS A 1 23 ? -0.340  -1.703  -0.671  1.00 0.00 ? 23 CYS A N    8  
ATOM   5609  C CA   . CYS A 1 23 ? -0.187  -0.409  -1.343  1.00 0.00 ? 23 CYS A CA   8  
ATOM   5610  C C    . CYS A 1 23 ? -0.381  -0.529  -2.851  1.00 0.00 ? 23 CYS A C    8  
ATOM   5611  O O    . CYS A 1 23 ? -0.960  0.356   -3.478  1.00 0.00 ? 23 CYS A O    8  
ATOM   5612  C CB   . CYS A 1 23 ? 1.190   0.199   -1.053  1.00 0.00 ? 23 CYS A CB   8  
ATOM   5613  S SG   . CYS A 1 23 ? 1.705   0.079   0.689   1.00 0.00 ? 23 CYS A SG   8  
ATOM   5614  H H    . CYS A 1 23 ? 0.385   -2.039  -0.105  1.00 0.00 ? 23 CYS A H    8  
ATOM   5615  H HA   . CYS A 1 23 ? -0.946  0.252   -0.952  1.00 0.00 ? 23 CYS A HA   8  
ATOM   5616  H HB2  . CYS A 1 23 ? 1.936   -0.300  -1.656  1.00 0.00 ? 23 CYS A HB2  8  
ATOM   5617  H HB3  . CYS A 1 23 ? 1.170   1.246   -1.319  1.00 0.00 ? 23 CYS A HB3  8  
ATOM   5618  N N    . GLN A 1 24 ? 0.118   -1.615  -3.431  1.00 0.00 ? 24 GLN A N    8  
ATOM   5619  C CA   . GLN A 1 24 ? 0.007   -1.834  -4.872  1.00 0.00 ? 24 GLN A CA   8  
ATOM   5620  C C    . GLN A 1 24 ? -1.406  -1.574  -5.378  1.00 0.00 ? 24 GLN A C    8  
ATOM   5621  O O    . GLN A 1 24 ? -1.614  -0.808  -6.319  1.00 0.00 ? 24 GLN A O    8  
ATOM   5622  C CB   . GLN A 1 24 ? 0.436   -3.259  -5.224  1.00 0.00 ? 24 GLN A CB   8  
ATOM   5623  C CG   . GLN A 1 24 ? 0.276   -3.599  -6.697  1.00 0.00 ? 24 GLN A CG   8  
ATOM   5624  C CD   . GLN A 1 24 ? 0.919   -4.922  -7.065  1.00 0.00 ? 24 GLN A CD   8  
ATOM   5625  O OE1  . GLN A 1 24 ? 2.116   -5.121  -6.861  1.00 0.00 ? 24 GLN A OE1  8  
ATOM   5626  N NE2  . GLN A 1 24 ? 0.125   -5.833  -7.613  1.00 0.00 ? 24 GLN A NE2  8  
ATOM   5627  H H    . GLN A 1 24 ? 0.581   -2.281  -2.881  1.00 0.00 ? 24 GLN A H    8  
ATOM   5628  H HA   . GLN A 1 24 ? 0.668   -1.144  -5.356  1.00 0.00 ? 24 GLN A HA   8  
ATOM   5629  H HB2  . GLN A 1 24 ? 1.476   -3.385  -4.960  1.00 0.00 ? 24 GLN A HB2  8  
ATOM   5630  H HB3  . GLN A 1 24 ? -0.159  -3.954  -4.650  1.00 0.00 ? 24 GLN A HB3  8  
ATOM   5631  H HG2  . GLN A 1 24 ? -0.777  -3.652  -6.928  1.00 0.00 ? 24 GLN A HG2  8  
ATOM   5632  H HG3  . GLN A 1 24 ? 0.733   -2.817  -7.285  1.00 0.00 ? 24 GLN A HG3  8  
ATOM   5633  H HE21 . GLN A 1 24 ? -0.819  -5.604  -7.748  1.00 0.00 ? 24 GLN A HE21 8  
ATOM   5634  H HE22 . GLN A 1 24 ? 0.514   -6.698  -7.861  1.00 0.00 ? 24 GLN A HE22 8  
ATOM   5635  N N    . LEU A 1 25 ? -2.366  -2.225  -4.751  1.00 0.00 ? 25 LEU A N    8  
ATOM   5636  C CA   . LEU A 1 25 ? -3.765  -2.086  -5.128  1.00 0.00 ? 25 LEU A CA   8  
ATOM   5637  C C    . LEU A 1 25 ? -4.301  -0.686  -4.827  1.00 0.00 ? 25 LEU A C    8  
ATOM   5638  O O    . LEU A 1 25 ? -5.409  -0.339  -5.242  1.00 0.00 ? 25 LEU A O    8  
ATOM   5639  C CB   . LEU A 1 25 ? -4.616  -3.138  -4.412  1.00 0.00 ? 25 LEU A CB   8  
ATOM   5640  C CG   . LEU A 1 25 ? -5.484  -3.998  -5.331  1.00 0.00 ? 25 LEU A CG   8  
ATOM   5641  C CD1  . LEU A 1 25 ? -6.382  -3.120  -6.191  1.00 0.00 ? 25 LEU A CD1  8  
ATOM   5642  C CD2  . LEU A 1 25 ? -4.614  -4.891  -6.204  1.00 0.00 ? 25 LEU A CD2  8  
ATOM   5643  H H    . LEU A 1 25 ? -2.125  -2.822  -4.021  1.00 0.00 ? 25 LEU A H    8  
ATOM   5644  H HA   . LEU A 1 25 ? -3.828  -2.257  -6.188  1.00 0.00 ? 25 LEU A HA   8  
ATOM   5645  H HB2  . LEU A 1 25 ? -3.953  -3.790  -3.862  1.00 0.00 ? 25 LEU A HB2  8  
ATOM   5646  H HB3  . LEU A 1 25 ? -5.263  -2.634  -3.709  1.00 0.00 ? 25 LEU A HB3  8  
ATOM   5647  H HG   . LEU A 1 25 ? -6.117  -4.632  -4.728  1.00 0.00 ? 25 LEU A HG   8  
ATOM   5648  H HD11 . LEU A 1 25 ? -6.773  -3.701  -7.012  1.00 0.00 ? 25 LEU A HD11 8  
ATOM   5649  H HD12 . LEU A 1 25 ? -5.810  -2.291  -6.578  1.00 0.00 ? 25 LEU A HD12 8  
ATOM   5650  H HD13 . LEU A 1 25 ? -7.200  -2.746  -5.593  1.00 0.00 ? 25 LEU A HD13 8  
ATOM   5651  H HD21 . LEU A 1 25 ? -5.048  -5.879  -6.253  1.00 0.00 ? 25 LEU A HD21 8  
ATOM   5652  H HD22 . LEU A 1 25 ? -3.622  -4.953  -5.781  1.00 0.00 ? 25 LEU A HD22 8  
ATOM   5653  H HD23 . LEU A 1 25 ? -4.555  -4.475  -7.199  1.00 0.00 ? 25 LEU A HD23 8  
ATOM   5654  N N    . ARG A 1 26 ? -3.524  0.118   -4.104  1.00 0.00 ? 26 ARG A N    8  
ATOM   5655  C CA   . ARG A 1 26 ? -3.949  1.472   -3.763  1.00 0.00 ? 26 ARG A CA   8  
ATOM   5656  C C    . ARG A 1 26 ? -3.020  2.528   -4.349  1.00 0.00 ? 26 ARG A C    8  
ATOM   5657  O O    . ARG A 1 26 ? -3.255  3.726   -4.204  1.00 0.00 ? 26 ARG A O    8  
ATOM   5658  C CB   . ARG A 1 26 ? -4.035  1.646   -2.250  1.00 0.00 ? 26 ARG A CB   8  
ATOM   5659  C CG   . ARG A 1 26 ? -4.787  0.526   -1.548  1.00 0.00 ? 26 ARG A CG   8  
ATOM   5660  C CD   . ARG A 1 26 ? -6.289  0.639   -1.760  1.00 0.00 ? 26 ARG A CD   8  
ATOM   5661  N NE   . ARG A 1 26 ? -6.817  -0.497  -2.511  1.00 0.00 ? 26 ARG A NE   8  
ATOM   5662  C CZ   . ARG A 1 26 ? -8.060  -0.959  -2.387  1.00 0.00 ? 26 ARG A CZ   8  
ATOM   5663  N NH1  . ARG A 1 26 ? -8.912  -0.380  -1.548  1.00 0.00 ? 26 ARG A NH1  8  
ATOM   5664  N NH2  . ARG A 1 26 ? -8.455  -2.000  -3.107  1.00 0.00 ? 26 ARG A NH2  8  
ATOM   5665  H H    . ARG A 1 26 ? -2.655  -0.204  -3.797  1.00 0.00 ? 26 ARG A H    8  
ATOM   5666  H HA   . ARG A 1 26 ? -4.918  1.610   -4.187  1.00 0.00 ? 26 ARG A HA   8  
ATOM   5667  H HB2  . ARG A 1 26 ? -3.032  1.689   -1.850  1.00 0.00 ? 26 ARG A HB2  8  
ATOM   5668  H HB3  . ARG A 1 26 ? -4.537  2.577   -2.036  1.00 0.00 ? 26 ARG A HB3  8  
ATOM   5669  H HG2  . ARG A 1 26 ? -4.449  -0.423  -1.938  1.00 0.00 ? 26 ARG A HG2  8  
ATOM   5670  H HG3  . ARG A 1 26 ? -4.579  0.576   -0.489  1.00 0.00 ? 26 ARG A HG3  8  
ATOM   5671  H HD2  . ARG A 1 26 ? -6.764  0.687   -0.792  1.00 0.00 ? 26 ARG A HD2  8  
ATOM   5672  H HD3  . ARG A 1 26 ? -6.491  1.554   -2.298  1.00 0.00 ? 26 ARG A HD3  8  
ATOM   5673  H HE   . ARG A 1 26 ? -6.212  -0.943  -3.142  1.00 0.00 ? 26 ARG A HE   8  
ATOM   5674  H HH11 . ARG A 1 26 ? -8.625  0.408   -1.005  1.00 0.00 ? 26 ARG A HH11 8  
ATOM   5675  H HH12 . ARG A 1 26 ? -9.843  -0.734  -1.461  1.00 0.00 ? 26 ARG A HH12 8  
ATOM   5676  H HH21 . ARG A 1 26 ? -7.820  -2.439  -3.742  1.00 0.00 ? 26 ARG A HH21 8  
ATOM   5677  H HH22 . ARG A 1 26 ? -9.387  -2.347  -3.013  1.00 0.00 ? 26 ARG A HH22 8  
ATOM   5678  N N    . CYS A 1 27 ? -1.978  2.074   -5.010  1.00 0.00 ? 27 CYS A N    8  
ATOM   5679  C CA   . CYS A 1 27 ? -1.011  2.976   -5.633  1.00 0.00 ? 27 CYS A CA   8  
ATOM   5680  C C    . CYS A 1 27 ? -1.635  3.621   -6.883  1.00 0.00 ? 27 CYS A C    8  
ATOM   5681  O O    . CYS A 1 27 ? -2.659  4.295   -6.781  1.00 0.00 ? 27 CYS A O    8  
ATOM   5682  C CB   . CYS A 1 27 ? 0.292   2.222   -5.967  1.00 0.00 ? 27 CYS A CB   8  
ATOM   5683  S SG   . CYS A 1 27 ? 1.676   3.279   -6.516  1.00 0.00 ? 27 CYS A SG   8  
ATOM   5684  H H    . CYS A 1 27 ? -1.863  1.112   -5.084  1.00 0.00 ? 27 CYS A H    8  
ATOM   5685  H HA   . CYS A 1 27 ? -0.789  3.754   -4.917  1.00 0.00 ? 27 CYS A HA   8  
ATOM   5686  H HB2  . CYS A 1 27 ? 0.628   1.691   -5.088  1.00 0.00 ? 27 CYS A HB2  8  
ATOM   5687  H HB3  . CYS A 1 27 ? 0.095   1.508   -6.755  1.00 0.00 ? 27 CYS A HB3  8  
ATOM   5688  N N    . SER A 1 28 ? -1.037  3.397   -8.057  1.00 0.00 ? 28 SER A N    8  
ATOM   5689  C CA   . SER A 1 28 ? -1.548  3.933   -9.313  1.00 0.00 ? 28 SER A CA   8  
ATOM   5690  C C    . SER A 1 28 ? -2.011  5.381   -9.187  1.00 0.00 ? 28 SER A C    8  
ATOM   5691  O O    . SER A 1 28 ? -2.855  5.840   -9.957  1.00 0.00 ? 28 SER A O    8  
ATOM   5692  C CB   . SER A 1 28 ? -2.685  3.051   -9.802  1.00 0.00 ? 28 SER A CB   8  
ATOM   5693  O OG   . SER A 1 28 ? -2.795  3.090   -11.215 1.00 0.00 ? 28 SER A OG   8  
ATOM   5694  H H    . SER A 1 28 ? -0.248  2.843   -8.088  1.00 0.00 ? 28 SER A H    8  
ATOM   5695  H HA   . SER A 1 28 ? -0.747  3.890   -10.034 1.00 0.00 ? 28 SER A HA   8  
ATOM   5696  H HB2  . SER A 1 28 ? -2.490  2.035   -9.493  1.00 0.00 ? 28 SER A HB2  8  
ATOM   5697  H HB3  . SER A 1 28 ? -3.614  3.390   -9.369  1.00 0.00 ? 28 SER A HB3  8  
ATOM   5698  H HG   . SER A 1 28 ? -3.498  2.502   -11.498 1.00 0.00 ? 28 SER A HG   8  
ATOM   5699  N N    . SER A 1 29 ? -1.445  6.098   -8.227  1.00 0.00 ? 29 SER A N    8  
ATOM   5700  C CA   . SER A 1 29 ? -1.793  7.497   -8.016  1.00 0.00 ? 29 SER A CA   8  
ATOM   5701  C C    . SER A 1 29 ? -3.276  7.663   -7.713  1.00 0.00 ? 29 SER A C    8  
ATOM   5702  O O    . SER A 1 29 ? -4.103  6.830   -8.086  1.00 0.00 ? 29 SER A O    8  
ATOM   5703  C CB   . SER A 1 29 ? -1.417  8.319   -9.249  1.00 0.00 ? 29 SER A CB   8  
ATOM   5704  O OG   . SER A 1 29 ? -2.452  8.299   -10.217 1.00 0.00 ? 29 SER A OG   8  
ATOM   5705  H H    . SER A 1 29 ? -0.772  5.681   -7.655  1.00 0.00 ? 29 SER A H    8  
ATOM   5706  H HA   . SER A 1 29 ? -1.228  7.864   -7.170  1.00 0.00 ? 29 SER A HA   8  
ATOM   5707  H HB2  . SER A 1 29 ? -1.234  9.341   -8.956  1.00 0.00 ? 29 SER A HB2  8  
ATOM   5708  H HB3  . SER A 1 29 ? -0.521  7.906   -9.690  1.00 0.00 ? 29 SER A HB3  8  
ATOM   5709  H HG   . SER A 1 29 ? -2.187  7.752   -10.960 1.00 0.00 ? 29 SER A HG   8  
ATOM   5710  N N    . ASN A 1 30 ? -3.584  8.754   -7.032  1.00 0.00 ? 30 ASN A N    8  
ATOM   5711  C CA   . ASN A 1 30 ? -4.957  9.095   -6.648  1.00 0.00 ? 30 ASN A CA   8  
ATOM   5712  C C    . ASN A 1 30 ? -5.448  8.210   -5.508  1.00 0.00 ? 30 ASN A C    8  
ATOM   5713  O O    . ASN A 1 30 ? -6.501  7.578   -5.604  1.00 0.00 ? 30 ASN A O    8  
ATOM   5714  C CB   . ASN A 1 30 ? -5.907  8.988   -7.846  1.00 0.00 ? 30 ASN A CB   8  
ATOM   5715  C CG   . ASN A 1 30 ? -5.715  10.119  -8.837  1.00 0.00 ? 30 ASN A CG   8  
ATOM   5716  O OD1  . ASN A 1 30 ? -6.576  10.987  -8.979  1.00 0.00 ? 30 ASN A OD1  8  
ATOM   5717  N ND2  . ASN A 1 30 ? -4.582  10.114  -9.529  1.00 0.00 ? 30 ASN A ND2  8  
ATOM   5718  H H    . ASN A 1 30 ? -2.856  9.354   -6.776  1.00 0.00 ? 30 ASN A H    8  
ATOM   5719  H HA   . ASN A 1 30 ? -4.950  10.119  -6.304  1.00 0.00 ? 30 ASN A HA   8  
ATOM   5720  H HB2  . ASN A 1 30 ? -5.736  8.054   -8.358  1.00 0.00 ? 30 ASN A HB2  8  
ATOM   5721  H HB3  . ASN A 1 30 ? -6.926  9.015   -7.491  1.00 0.00 ? 30 ASN A HB3  8  
ATOM   5722  H HD21 . ASN A 1 30 ? -3.942  9.391   -9.365  1.00 0.00 ? 30 ASN A HD21 8  
ATOM   5723  H HD22 . ASN A 1 30 ? -4.433  10.834  -10.177 1.00 0.00 ? 30 ASN A HD22 8  
ATOM   5724  N N    . THR A 1 31 ? -4.679  8.183   -4.425  1.00 0.00 ? 31 THR A N    8  
ATOM   5725  C CA   . THR A 1 31 ? -5.011  7.395   -3.257  1.00 0.00 ? 31 THR A CA   8  
ATOM   5726  C C    . THR A 1 31 ? -4.090  7.762   -2.092  1.00 0.00 ? 31 THR A C    8  
ATOM   5727  O O    . THR A 1 31 ? -3.154  7.021   -1.798  1.00 0.00 ? 31 THR A O    8  
ATOM   5728  C CB   . THR A 1 31 ? -4.872  5.907   -3.571  1.00 0.00 ? 31 THR A CB   8  
ATOM   5729  O OG1  . THR A 1 31 ? -5.715  5.533   -4.644  1.00 0.00 ? 31 THR A OG1  8  
ATOM   5730  C CG2  . THR A 1 31 ? -5.198  5.011   -2.395  1.00 0.00 ? 31 THR A CG2  8  
ATOM   5731  H H    . THR A 1 31 ? -3.868  8.713   -4.410  1.00 0.00 ? 31 THR A H    8  
ATOM   5732  H HA   . THR A 1 31 ? -6.022  7.604   -2.998  1.00 0.00 ? 31 THR A HA   8  
ATOM   5733  H HB   . THR A 1 31 ? -3.852  5.717   -3.859  1.00 0.00 ? 31 THR A HB   8  
ATOM   5734  H HG1  . THR A 1 31 ? -5.197  5.462   -5.449  1.00 0.00 ? 31 THR A HG1  8  
ATOM   5735  H HG21 . THR A 1 31 ? -5.658  4.102   -2.753  1.00 0.00 ? 31 THR A HG21 8  
ATOM   5736  H HG22 . THR A 1 31 ? -5.881  5.523   -1.732  1.00 0.00 ? 31 THR A HG22 8  
ATOM   5737  H HG23 . THR A 1 31 ? -4.290  4.770   -1.862  1.00 0.00 ? 31 THR A HG23 8  
ATOM   5738  N N    . PRO A 1 32 ? -4.320  8.919   -1.421  1.00 0.00 ? 32 PRO A N    8  
ATOM   5739  C CA   . PRO A 1 32 ? -3.495  9.380   -0.302  1.00 0.00 ? 32 PRO A CA   8  
ATOM   5740  C C    . PRO A 1 32 ? -2.874  8.242   0.507   1.00 0.00 ? 32 PRO A C    8  
ATOM   5741  O O    . PRO A 1 32 ? -3.461  7.758   1.476   1.00 0.00 ? 32 PRO A O    8  
ATOM   5742  C CB   . PRO A 1 32 ? -4.481  10.190  0.557   1.00 0.00 ? 32 PRO A CB   8  
ATOM   5743  C CG   . PRO A 1 32 ? -5.730  10.348  -0.266  1.00 0.00 ? 32 PRO A CG   8  
ATOM   5744  C CD   . PRO A 1 32 ? -5.383  9.895   -1.680  1.00 0.00 ? 32 PRO A CD   8  
ATOM   5745  H HA   . PRO A 1 32 ? -2.707  10.032  -0.646  1.00 0.00 ? 32 PRO A HA   8  
ATOM   5746  H HB2  . PRO A 1 32 ? -4.683  9.654   1.473   1.00 0.00 ? 32 PRO A HB2  8  
ATOM   5747  H HB3  . PRO A 1 32 ? -4.045  11.151  0.793   1.00 0.00 ? 32 PRO A HB3  8  
ATOM   5748  H HG2  . PRO A 1 32 ? -6.513  9.726   0.155   1.00 0.00 ? 32 PRO A HG2  8  
ATOM   5749  H HG3  . PRO A 1 32 ? -6.040  11.388  -0.257  1.00 0.00 ? 32 PRO A HG3  8  
ATOM   5750  H HD2  . PRO A 1 32 ? -6.233  9.439   -2.167  1.00 0.00 ? 32 PRO A HD2  8  
ATOM   5751  H HD3  . PRO A 1 32 ? -5.005  10.721  -2.274  1.00 0.00 ? 32 PRO A HD3  8  
ATOM   5752  N N    . PRO A 1 33 ? -1.668  7.802   0.106   1.00 0.00 ? 33 PRO A N    8  
ATOM   5753  C CA   . PRO A 1 33 ? -0.941  6.727   0.762   1.00 0.00 ? 33 PRO A CA   8  
ATOM   5754  C C    . PRO A 1 33 ? 0.053   7.240   1.785   1.00 0.00 ? 33 PRO A C    8  
ATOM   5755  O O    . PRO A 1 33 ? 1.239   7.367   1.502   1.00 0.00 ? 33 PRO A O    8  
ATOM   5756  C CB   . PRO A 1 33 ? -0.219  6.073   -0.412  1.00 0.00 ? 33 PRO A CB   8  
ATOM   5757  C CG   . PRO A 1 33 ? 0.040   7.187   -1.383  1.00 0.00 ? 33 PRO A CG   8  
ATOM   5758  C CD   . PRO A 1 33 ? -0.903  8.321   -1.038  1.00 0.00 ? 33 PRO A CD   8  
ATOM   5759  H HA   . PRO A 1 33 ? -1.593  6.012   1.234   1.00 0.00 ? 33 PRO A HA   8  
ATOM   5760  H HB2  . PRO A 1 33 ? 0.701   5.630   -0.066  1.00 0.00 ? 33 PRO A HB2  8  
ATOM   5761  H HB3  . PRO A 1 33 ? -0.850  5.313   -0.845  1.00 0.00 ? 33 PRO A HB3  8  
ATOM   5762  H HG2  . PRO A 1 33 ? 1.062   7.518   -1.293  1.00 0.00 ? 33 PRO A HG2  8  
ATOM   5763  H HG3  . PRO A 1 33 ? -0.149  6.840   -2.389  1.00 0.00 ? 33 PRO A HG3  8  
ATOM   5764  H HD2  . PRO A 1 33 ? -0.344  9.202   -0.759  1.00 0.00 ? 33 PRO A HD2  8  
ATOM   5765  H HD3  . PRO A 1 33 ? -1.554  8.536   -1.872  1.00 0.00 ? 33 PRO A HD3  8  
ATOM   5766  N N    . LEU A 1 34 ? -0.435  7.536   2.977   1.00 0.00 ? 34 LEU A N    8  
ATOM   5767  C CA   . LEU A 1 34 ? 0.447   8.029   4.025   1.00 0.00 ? 34 LEU A CA   8  
ATOM   5768  C C    . LEU A 1 34 ? 1.404   6.930   4.476   1.00 0.00 ? 34 LEU A C    8  
ATOM   5769  O O    . LEU A 1 34 ? 2.613   7.150   4.540   1.00 0.00 ? 34 LEU A O    8  
ATOM   5770  C CB   . LEU A 1 34 ? -0.342  8.614   5.209   1.00 0.00 ? 34 LEU A CB   8  
ATOM   5771  C CG   . LEU A 1 34 ? -1.530  9.507   4.834   1.00 0.00 ? 34 LEU A CG   8  
ATOM   5772  C CD1  . LEU A 1 34 ? -2.149  10.117  6.082   1.00 0.00 ? 34 LEU A CD1  8  
ATOM   5773  C CD2  . LEU A 1 34 ? -1.099  10.599  3.864   1.00 0.00 ? 34 LEU A CD2  8  
ATOM   5774  H H    . LEU A 1 34 ? -1.393  7.424   3.150   1.00 0.00 ? 34 LEU A H    8  
ATOM   5775  H HA   . LEU A 1 34 ? 1.043   8.804   3.582   1.00 0.00 ? 34 LEU A HA   8  
ATOM   5776  H HB2  . LEU A 1 34 ? -0.710  7.803   5.817   1.00 0.00 ? 34 LEU A HB2  8  
ATOM   5777  H HB3  . LEU A 1 34 ? 0.340   9.202   5.806   1.00 0.00 ? 34 LEU A HB3  8  
ATOM   5778  H HG   . LEU A 1 34 ? -2.286  8.908   4.349   1.00 0.00 ? 34 LEU A HG   8  
ATOM   5779  H HD11 . LEU A 1 34 ? -1.807  11.135  6.193   1.00 0.00 ? 34 LEU A HD11 8  
ATOM   5780  H HD12 . LEU A 1 34 ? -1.857  9.542   6.947   1.00 0.00 ? 34 LEU A HD12 8  
ATOM   5781  H HD13 . LEU A 1 34 ? -3.226  10.108  5.991   1.00 0.00 ? 34 LEU A HD13 8  
ATOM   5782  H HD21 . LEU A 1 34 ? -1.011  11.537  4.393   1.00 0.00 ? 34 LEU A HD21 8  
ATOM   5783  H HD22 . LEU A 1 34 ? -1.837  10.697  3.081   1.00 0.00 ? 34 LEU A HD22 8  
ATOM   5784  H HD23 . LEU A 1 34 ? -0.146  10.342  3.428   1.00 0.00 ? 34 LEU A HD23 8  
ATOM   5785  N N    . THR A 1 35 ? 0.882   5.737   4.751   1.00 0.00 ? 35 THR A N    8  
ATOM   5786  C CA   . THR A 1 35 ? 1.727   4.631   5.146   1.00 0.00 ? 35 THR A CA   8  
ATOM   5787  C C    . THR A 1 35 ? 2.179   3.855   3.910   1.00 0.00 ? 35 THR A C    8  
ATOM   5788  O O    . THR A 1 35 ? 2.843   2.825   4.027   1.00 0.00 ? 35 THR A O    8  
ATOM   5789  C CB   . THR A 1 35 ? 0.980   3.702   6.104   1.00 0.00 ? 35 THR A CB   8  
ATOM   5790  O OG1  . THR A 1 35 ? 0.425   4.435   7.181   1.00 0.00 ? 35 THR A OG1  8  
ATOM   5791  C CG2  . THR A 1 35 ? 1.858   2.618   6.692   1.00 0.00 ? 35 THR A CG2  8  
ATOM   5792  H H    . THR A 1 35 ? -0.078  5.589   4.666   1.00 0.00 ? 35 THR A H    8  
ATOM   5793  H HA   . THR A 1 35 ? 2.593   5.034   5.646   1.00 0.00 ? 35 THR A HA   8  
ATOM   5794  H HB   . THR A 1 35 ? 0.174   3.221   5.569   1.00 0.00 ? 35 THR A HB   8  
ATOM   5795  H HG1  . THR A 1 35 ? 1.108   4.968   7.594   1.00 0.00 ? 35 THR A HG1  8  
ATOM   5796  H HG21 . THR A 1 35 ? 1.537   1.655   6.323   1.00 0.00 ? 35 THR A HG21 8  
ATOM   5797  H HG22 . THR A 1 35 ? 1.779   2.635   7.768   1.00 0.00 ? 35 THR A HG22 8  
ATOM   5798  H HG23 . THR A 1 35 ? 2.884   2.790   6.403   1.00 0.00 ? 35 THR A HG23 8  
ATOM   5799  N N    . CYS A 1 36 ? 1.808   4.343   2.719   1.00 0.00 ? 36 CYS A N    8  
ATOM   5800  C CA   . CYS A 1 36 ? 2.177   3.663   1.484   1.00 0.00 ? 36 CYS A CA   8  
ATOM   5801  C C    . CYS A 1 36 ? 2.831   4.601   0.471   1.00 0.00 ? 36 CYS A C    8  
ATOM   5802  O O    . CYS A 1 36 ? 3.218   4.167   -0.614  1.00 0.00 ? 36 CYS A O    8  
ATOM   5803  C CB   . CYS A 1 36 ? 0.945   3.005   0.865   1.00 0.00 ? 36 CYS A CB   8  
ATOM   5804  S SG   . CYS A 1 36 ? 0.497   1.413   1.628   1.00 0.00 ? 36 CYS A SG   8  
ATOM   5805  H H    . CYS A 1 36 ? 1.263   5.165   2.672   1.00 0.00 ? 36 CYS A H    8  
ATOM   5806  H HA   . CYS A 1 36 ? 2.883   2.897   1.739   1.00 0.00 ? 36 CYS A HA   8  
ATOM   5807  H HB2  . CYS A 1 36 ? 0.100   3.670   0.970   1.00 0.00 ? 36 CYS A HB2  8  
ATOM   5808  H HB3  . CYS A 1 36 ? 1.129   2.828   -0.185  1.00 0.00 ? 36 CYS A HB3  8  
ATOM   5809  N N    . GLN A 1 37 ? 2.950   5.882   0.809   1.00 0.00 ? 37 GLN A N    8  
ATOM   5810  C CA   . GLN A 1 37 ? 3.548   6.854   -0.102  1.00 0.00 ? 37 GLN A CA   8  
ATOM   5811  C C    . GLN A 1 37 ? 4.871   6.348   -0.657  1.00 0.00 ? 37 GLN A C    8  
ATOM   5812  O O    . GLN A 1 37 ? 5.042   6.239   -1.868  1.00 0.00 ? 37 GLN A O    8  
ATOM   5813  C CB   . GLN A 1 37 ? 3.752   8.212   0.597   1.00 0.00 ? 37 GLN A CB   8  
ATOM   5814  C CG   . GLN A 1 37 ? 4.401   8.108   1.970   1.00 0.00 ? 37 GLN A CG   8  
ATOM   5815  C CD   . GLN A 1 37 ? 4.146   9.332   2.828   1.00 0.00 ? 37 GLN A CD   8  
ATOM   5816  O OE1  . GLN A 1 37 ? 3.869   9.222   4.022   1.00 0.00 ? 37 GLN A OE1  8  
ATOM   5817  N NE2  . GLN A 1 37 ? 4.237   10.510  2.220   1.00 0.00 ? 37 GLN A NE2  8  
ATOM   5818  H H    . GLN A 1 37 ? 2.618   6.188   1.680   1.00 0.00 ? 37 GLN A H    8  
ATOM   5819  H HA   . GLN A 1 37 ? 2.871   6.978   -0.929  1.00 0.00 ? 37 GLN A HA   8  
ATOM   5820  H HB2  . GLN A 1 37 ? 4.383   8.834   -0.022  1.00 0.00 ? 37 GLN A HB2  8  
ATOM   5821  H HB3  . GLN A 1 37 ? 2.793   8.697   0.717   1.00 0.00 ? 37 GLN A HB3  8  
ATOM   5822  H HG2  . GLN A 1 37 ? 4.007   7.242   2.479   1.00 0.00 ? 37 GLN A HG2  8  
ATOM   5823  H HG3  . GLN A 1 37 ? 5.468   7.994   1.841   1.00 0.00 ? 37 GLN A HG3  8  
ATOM   5824  H HE21 . GLN A 1 37 ? 4.462   10.522  1.267   1.00 0.00 ? 37 GLN A HE21 8  
ATOM   5825  H HE22 . GLN A 1 37 ? 4.077   11.318  2.750   1.00 0.00 ? 37 GLN A HE22 8  
ATOM   5826  N N    . ARG A 1 38 ? 5.794   6.041   0.238   1.00 0.00 ? 38 ARG A N    8  
ATOM   5827  C CA   . ARG A 1 38 ? 7.115   5.547   -0.144  1.00 0.00 ? 38 ARG A CA   8  
ATOM   5828  C C    . ARG A 1 38 ? 7.016   4.263   -0.958  1.00 0.00 ? 38 ARG A C    8  
ATOM   5829  O O    . ARG A 1 38 ? 7.816   4.041   -1.867  1.00 0.00 ? 38 ARG A O    8  
ATOM   5830  C CB   . ARG A 1 38 ? 7.976   5.314   1.100   1.00 0.00 ? 38 ARG A CB   8  
ATOM   5831  C CG   . ARG A 1 38 ? 9.268   6.116   1.105   1.00 0.00 ? 38 ARG A CG   8  
ATOM   5832  C CD   . ARG A 1 38 ? 10.477  5.234   1.384   1.00 0.00 ? 38 ARG A CD   8  
ATOM   5833  N NE   . ARG A 1 38 ? 10.801  4.386   0.239   1.00 0.00 ? 38 ARG A NE   8  
ATOM   5834  C CZ   . ARG A 1 38 ? 10.471  3.097   0.145   1.00 0.00 ? 38 ARG A CZ   8  
ATOM   5835  N NH1  . ARG A 1 38 ? 9.802   2.498   1.122   1.00 0.00 ? 38 ARG A NH1  8  
ATOM   5836  N NH2  . ARG A 1 38 ? 10.813  2.406   -0.934  1.00 0.00 ? 38 ARG A NH2  8  
ATOM   5837  H H    . ARG A 1 38 ? 5.579   6.151   1.182   1.00 0.00 ? 38 ARG A H    8  
ATOM   5838  H HA   . ARG A 1 38 ? 7.588   6.301   -0.758  1.00 0.00 ? 38 ARG A HA   8  
ATOM   5839  H HB2  . ARG A 1 38 ? 7.404   5.587   1.975   1.00 0.00 ? 38 ARG A HB2  8  
ATOM   5840  H HB3  . ARG A 1 38 ? 8.228   4.265   1.161   1.00 0.00 ? 38 ARG A HB3  8  
ATOM   5841  H HG2  . ARG A 1 38 ? 9.393   6.584   0.141   1.00 0.00 ? 38 ARG A HG2  8  
ATOM   5842  H HG3  . ARG A 1 38 ? 9.204   6.876   1.871   1.00 0.00 ? 38 ARG A HG3  8  
ATOM   5843  H HD2  . ARG A 1 38 ? 11.318  5.874   1.610   1.00 0.00 ? 38 ARG A HD2  8  
ATOM   5844  H HD3  . ARG A 1 38 ? 10.261  4.620   2.243   1.00 0.00 ? 38 ARG A HD3  8  
ATOM   5845  H HE   . ARG A 1 38 ? 11.293  4.798   -0.502  1.00 0.00 ? 38 ARG A HE   8  
ATOM   5846  H HH11 . ARG A 1 38 ? 9.537   3.009   1.938   1.00 0.00 ? 38 ARG A HH11 8  
ATOM   5847  H HH12 . ARG A 1 38 ? 9.561   1.531   1.040   1.00 0.00 ? 38 ARG A HH12 8  
ATOM   5848  H HH21 . ARG A 1 38 ? 11.316  2.852   -1.674  1.00 0.00 ? 38 ARG A HH21 8  
ATOM   5849  H HH22 . ARG A 1 38 ? 10.567  1.439   -1.006  1.00 0.00 ? 38 ARG A HH22 8  
ATOM   5850  N N    . TYR A 1 39 ? 6.042   3.421   -0.643  1.00 0.00 ? 39 TYR A N    8  
ATOM   5851  C CA   . TYR A 1 39 ? 5.884   2.170   -1.363  1.00 0.00 ? 39 TYR A CA   8  
ATOM   5852  C C    . TYR A 1 39 ? 5.260   2.381   -2.734  1.00 0.00 ? 39 TYR A C    8  
ATOM   5853  O O    . TYR A 1 39 ? 5.667   1.749   -3.708  1.00 0.00 ? 39 TYR A O    8  
ATOM   5854  C CB   . TYR A 1 39 ? 5.054   1.172   -0.553  1.00 0.00 ? 39 TYR A CB   8  
ATOM   5855  C CG   . TYR A 1 39 ? 5.224   -0.253  -1.024  1.00 0.00 ? 39 TYR A CG   8  
ATOM   5856  C CD1  . TYR A 1 39 ? 4.597   -0.700  -2.179  1.00 0.00 ? 39 TYR A CD1  8  
ATOM   5857  C CD2  . TYR A 1 39 ? 6.030   -1.144  -0.326  1.00 0.00 ? 39 TYR A CD2  8  
ATOM   5858  C CE1  . TYR A 1 39 ? 4.766   -1.997  -2.626  1.00 0.00 ? 39 TYR A CE1  8  
ATOM   5859  C CE2  . TYR A 1 39 ? 6.202   -2.443  -0.766  1.00 0.00 ? 39 TYR A CE2  8  
ATOM   5860  C CZ   . TYR A 1 39 ? 5.569   -2.863  -1.917  1.00 0.00 ? 39 TYR A CZ   8  
ATOM   5861  O OH   . TYR A 1 39 ? 5.741   -4.155  -2.360  1.00 0.00 ? 39 TYR A OH   8  
ATOM   5862  H H    . TYR A 1 39 ? 5.432   3.637   0.084   1.00 0.00 ? 39 TYR A H    8  
ATOM   5863  H HA   . TYR A 1 39 ? 6.869   1.770   -1.504  1.00 0.00 ? 39 TYR A HA   8  
ATOM   5864  H HB2  . TYR A 1 39 ? 5.353   1.218   0.483   1.00 0.00 ? 39 TYR A HB2  8  
ATOM   5865  H HB3  . TYR A 1 39 ? 4.008   1.428   -0.635  1.00 0.00 ? 39 TYR A HB3  8  
ATOM   5866  H HD1  . TYR A 1 39 ? 3.968   -0.019  -2.732  1.00 0.00 ? 39 TYR A HD1  8  
ATOM   5867  H HD2  . TYR A 1 39 ? 6.524   -0.811  0.575   1.00 0.00 ? 39 TYR A HD2  8  
ATOM   5868  H HE1  . TYR A 1 39 ? 4.270   -2.326  -3.528  1.00 0.00 ? 39 TYR A HE1  8  
ATOM   5869  H HE2  . TYR A 1 39 ? 6.831   -3.122  -0.209  1.00 0.00 ? 39 TYR A HE2  8  
ATOM   5870  H HH   . TYR A 1 39 ? 5.695   -4.758  -1.616  1.00 0.00 ? 39 TYR A HH   8  
ATOM   5871  N N    . CYS A 1 40 ? 4.281   3.269   -2.814  1.00 0.00 ? 40 CYS A N    8  
ATOM   5872  C CA   . CYS A 1 40 ? 3.627   3.548   -4.094  1.00 0.00 ? 40 CYS A CA   8  
ATOM   5873  C C    . CYS A 1 40 ? 4.675   3.882   -5.155  1.00 0.00 ? 40 CYS A C    8  
ATOM   5874  O O    . CYS A 1 40 ? 4.476   3.631   -6.342  1.00 0.00 ? 40 CYS A O    8  
ATOM   5875  C CB   . CYS A 1 40 ? 2.610   4.691   -3.948  1.00 0.00 ? 40 CYS A CB   8  
ATOM   5876  S SG   . CYS A 1 40 ? 1.523   4.966   -5.394  1.00 0.00 ? 40 CYS A SG   8  
ATOM   5877  H H    . CYS A 1 40 ? 4.000   3.746   -2.003  1.00 0.00 ? 40 CYS A H    8  
ATOM   5878  H HA   . CYS A 1 40 ? 3.112   2.650   -4.401  1.00 0.00 ? 40 CYS A HA   8  
ATOM   5879  H HB2  . CYS A 1 40 ? 1.966   4.481   -3.108  1.00 0.00 ? 40 CYS A HB2  8  
ATOM   5880  H HB3  . CYS A 1 40 ? 3.146   5.610   -3.762  1.00 0.00 ? 40 CYS A HB3  8  
ATOM   5881  N N    . ASN A 1 41 ? 5.808   4.425   -4.717  1.00 0.00 ? 41 ASN A N    8  
ATOM   5882  C CA   . ASN A 1 41 ? 6.891   4.756   -5.635  1.00 0.00 ? 41 ASN A CA   8  
ATOM   5883  C C    . ASN A 1 41 ? 7.483   3.492   -6.230  1.00 0.00 ? 41 ASN A C    8  
ATOM   5884  O O    . ASN A 1 41 ? 8.055   3.504   -7.319  1.00 0.00 ? 41 ASN A O    8  
ATOM   5885  C CB   . ASN A 1 41 ? 7.986   5.563   -4.932  1.00 0.00 ? 41 ASN A CB   8  
ATOM   5886  C CG   . ASN A 1 41 ? 7.442   6.766   -4.206  1.00 0.00 ? 41 ASN A CG   8  
ATOM   5887  O OD1  . ASN A 1 41 ? 7.356   7.863   -4.757  1.00 0.00 ? 41 ASN A OD1  8  
ATOM   5888  N ND2  . ASN A 1 41 ? 7.073   6.555   -2.956  1.00 0.00 ? 41 ASN A ND2  8  
ATOM   5889  H H    . ASN A 1 41 ? 5.925   4.587   -3.760  1.00 0.00 ? 41 ASN A H    8  
ATOM   5890  H HA   . ASN A 1 41 ? 6.471   5.336   -6.424  1.00 0.00 ? 41 ASN A HA   8  
ATOM   5891  H HB2  . ASN A 1 41 ? 8.478   4.931   -4.204  1.00 0.00 ? 41 ASN A HB2  8  
ATOM   5892  H HB3  . ASN A 1 41 ? 8.707   5.898   -5.662  1.00 0.00 ? 41 ASN A HB3  8  
ATOM   5893  H HD21 . ASN A 1 41 ? 7.173   5.647   -2.595  1.00 0.00 ? 41 ASN A HD21 8  
ATOM   5894  H HD22 . ASN A 1 41 ? 6.714   7.309   -2.443  1.00 0.00 ? 41 ASN A HD22 8  
ATOM   5895  N N    . ALA A 1 42 ? 7.326   2.402   -5.502  1.00 0.00 ? 42 ALA A N    8  
ATOM   5896  C CA   . ALA A 1 42 ? 7.824   1.107   -5.941  1.00 0.00 ? 42 ALA A CA   8  
ATOM   5897  C C    . ALA A 1 42 ? 6.709   0.281   -6.560  1.00 0.00 ? 42 ALA A C    8  
ATOM   5898  O O    . ALA A 1 42 ? 6.774   -0.947  -6.602  1.00 0.00 ? 42 ALA A O    8  
ATOM   5899  C CB   . ALA A 1 42 ? 8.471   0.359   -4.785  1.00 0.00 ? 42 ALA A CB   8  
ATOM   5900  H H    . ALA A 1 42 ? 6.851   2.474   -4.650  1.00 0.00 ? 42 ALA A H    8  
ATOM   5901  H HA   . ALA A 1 42 ? 8.571   1.286   -6.694  1.00 0.00 ? 42 ALA A HA   8  
ATOM   5902  H HB1  . ALA A 1 42 ? 9.338   0.904   -4.443  1.00 0.00 ? 42 ALA A HB1  8  
ATOM   5903  H HB2  . ALA A 1 42 ? 8.772   -0.624  -5.116  1.00 0.00 ? 42 ALA A HB2  8  
ATOM   5904  H HB3  . ALA A 1 42 ? 7.761   0.264   -3.976  1.00 0.00 ? 42 ALA A HB3  8  
ATOM   5905  N N    . SER A 1 43 ? 5.692   0.975   -7.046  1.00 0.00 ? 43 SER A N    8  
ATOM   5906  C CA   . SER A 1 43 ? 4.552   0.337   -7.681  1.00 0.00 ? 43 SER A CA   8  
ATOM   5907  C C    . SER A 1 43 ? 4.329   0.917   -9.074  1.00 0.00 ? 43 SER A C    8  
ATOM   5908  O O    . SER A 1 43 ? 4.182   0.179   -10.047 1.00 0.00 ? 43 SER A O    8  
ATOM   5909  C CB   . SER A 1 43 ? 3.294   0.514   -6.828  1.00 0.00 ? 43 SER A CB   8  
ATOM   5910  O OG   . SER A 1 43 ? 2.882   -0.720  -6.265  1.00 0.00 ? 43 SER A OG   8  
ATOM   5911  H H    . SER A 1 43 ? 5.712   1.946   -6.982  1.00 0.00 ? 43 SER A H    8  
ATOM   5912  H HA   . SER A 1 43 ? 4.771   -0.713  -7.774  1.00 0.00 ? 43 SER A HA   8  
ATOM   5913  H HB2  . SER A 1 43 ? 3.500   1.209   -6.027  1.00 0.00 ? 43 SER A HB2  8  
ATOM   5914  H HB3  . SER A 1 43 ? 2.494   0.901   -7.441  1.00 0.00 ? 43 SER A HB3  8  
ATOM   5915  H HG   . SER A 1 43 ? 2.111   -1.044  -6.735  1.00 0.00 ? 43 SER A HG   8  
ATOM   5916  N N    . VAL A 1 44 ? 4.318   2.246   -9.163  1.00 0.00 ? 44 VAL A N    8  
ATOM   5917  C CA   . VAL A 1 44 ? 4.122   2.926   -10.440 1.00 0.00 ? 44 VAL A CA   8  
ATOM   5918  C C    . VAL A 1 44 ? 4.493   4.404   -10.339 1.00 0.00 ? 44 VAL A C    8  
ATOM   5919  O O    . VAL A 1 44 ? 3.661   5.281   -10.576 1.00 0.00 ? 44 VAL A O    8  
ATOM   5920  C CB   . VAL A 1 44 ? 2.663   2.807   -10.957 1.00 0.00 ? 44 VAL A CB   8  
ATOM   5921  C CG1  . VAL A 1 44 ? 2.520   1.656   -11.945 1.00 0.00 ? 44 VAL A CG1  8  
ATOM   5922  C CG2  . VAL A 1 44 ? 1.674   2.653   -9.805  1.00 0.00 ? 44 VAL A CG2  8  
ATOM   5923  H H    . VAL A 1 44 ? 4.453   2.781   -8.352  1.00 0.00 ? 44 VAL A H    8  
ATOM   5924  H HA   . VAL A 1 44 ? 4.776   2.460   -11.159 1.00 0.00 ? 44 VAL A HA   8  
ATOM   5925  H HB   . VAL A 1 44 ? 2.420   3.720   -11.482 1.00 0.00 ? 44 VAL A HB   8  
ATOM   5926  H HG11 . VAL A 1 44 ? 1.545   1.700   -12.407 1.00 0.00 ? 44 VAL A HG11 8  
ATOM   5927  H HG12 . VAL A 1 44 ? 2.628   0.717   -11.425 1.00 0.00 ? 44 VAL A HG12 8  
ATOM   5928  H HG13 . VAL A 1 44 ? 3.281   1.736   -12.709 1.00 0.00 ? 44 VAL A HG13 8  
ATOM   5929  H HG21 . VAL A 1 44 ? 0.777   2.173   -10.166 1.00 0.00 ? 44 VAL A HG21 8  
ATOM   5930  H HG22 . VAL A 1 44 ? 1.427   3.627   -9.410  1.00 0.00 ? 44 VAL A HG22 8  
ATOM   5931  H HG23 . VAL A 1 44 ? 2.115   2.050   -9.027  1.00 0.00 ? 44 VAL A HG23 8  
ATOM   5932  N N    . THR A 1 45 ? 5.747   4.670   -9.979  1.00 0.00 ? 45 THR A N    8  
ATOM   5933  C CA   . THR A 1 45 ? 6.244   6.041   -9.840  1.00 0.00 ? 45 THR A CA   8  
ATOM   5934  C C    . THR A 1 45 ? 5.220   6.940   -9.127  1.00 0.00 ? 45 THR A C    8  
ATOM   5935  O O    . THR A 1 45 ? 4.850   6.669   -7.985  1.00 0.00 ? 45 THR A O    8  
ATOM   5936  C CB   . THR A 1 45 ? 6.632   6.613   -11.215 1.00 0.00 ? 45 THR A CB   8  
ATOM   5937  O OG1  . THR A 1 45 ? 6.960   7.986   -11.106 1.00 0.00 ? 45 THR A OG1  8  
ATOM   5938  C CG2  . THR A 1 45 ? 5.549   6.487   -12.273 1.00 0.00 ? 45 THR A CG2  8  
ATOM   5939  H H    . THR A 1 45 ? 6.358   3.922   -9.797  1.00 0.00 ? 45 THR A H    8  
ATOM   5940  H HA   . THR A 1 45 ? 7.133   5.995   -9.228  1.00 0.00 ? 45 THR A HA   8  
ATOM   5941  H HB   . THR A 1 45 ? 7.505   6.090   -11.574 1.00 0.00 ? 45 THR A HB   8  
ATOM   5942  H HG1  . THR A 1 45 ? 7.648   8.099   -10.447 1.00 0.00 ? 45 THR A HG1  8  
ATOM   5943  H HG21 . THR A 1 45 ? 5.558   5.488   -12.683 1.00 0.00 ? 45 THR A HG21 8  
ATOM   5944  H HG22 . THR A 1 45 ? 5.735   7.200   -13.061 1.00 0.00 ? 45 THR A HG22 8  
ATOM   5945  H HG23 . THR A 1 45 ? 4.585   6.687   -11.831 1.00 0.00 ? 45 THR A HG23 8  
ATOM   5946  N N    . ASN A 1 46 ? 4.771   8.005   -9.794  1.00 0.00 ? 46 ASN A N    8  
ATOM   5947  C CA   . ASN A 1 46 ? 3.798   8.928   -9.213  1.00 0.00 ? 46 ASN A CA   8  
ATOM   5948  C C    . ASN A 1 46 ? 4.268   9.440   -7.851  1.00 0.00 ? 46 ASN A C    8  
ATOM   5949  O O    . ASN A 1 46 ? 5.320   9.038   -7.355  1.00 0.00 ? 46 ASN A O    8  
ATOM   5950  C CB   . ASN A 1 46 ? 2.419   8.259   -9.104  1.00 0.00 ? 46 ASN A CB   8  
ATOM   5951  C CG   . ASN A 1 46 ? 2.238   7.449   -7.835  1.00 0.00 ? 46 ASN A CG   8  
ATOM   5952  O OD1  . ASN A 1 46 ? 2.488   6.245   -7.810  1.00 0.00 ? 46 ASN A OD1  8  
ATOM   5953  N ND2  . ASN A 1 46 ? 1.789   8.110   -6.776  1.00 0.00 ? 46 ASN A ND2  8  
ATOM   5954  H H    . ASN A 1 46 ? 5.103   8.178   -10.697 1.00 0.00 ? 46 ASN A H    8  
ATOM   5955  H HA   . ASN A 1 46 ? 3.715   9.774   -9.881  1.00 0.00 ? 46 ASN A HA   8  
ATOM   5956  H HB2  . ASN A 1 46 ? 1.657   9.021   -9.127  1.00 0.00 ? 46 ASN A HB2  8  
ATOM   5957  H HB3  . ASN A 1 46 ? 2.283   7.599   -9.950  1.00 0.00 ? 46 ASN A HB3  8  
ATOM   5958  H HD21 . ASN A 1 46 ? 1.603   9.068   -6.873  1.00 0.00 ? 46 ASN A HD21 8  
ATOM   5959  H HD22 . ASN A 1 46 ? 1.661   7.615   -5.940  1.00 0.00 ? 46 ASN A HD22 8  
ATOM   5960  N N    . SER A 1 47 ? 3.484   10.337  -7.256  1.00 0.00 ? 47 SER A N    8  
ATOM   5961  C CA   . SER A 1 47 ? 3.824   10.913  -5.959  1.00 0.00 ? 47 SER A CA   8  
ATOM   5962  C C    . SER A 1 47 ? 4.970   11.909  -6.097  1.00 0.00 ? 47 SER A C    8  
ATOM   5963  O O    . SER A 1 47 ? 5.895   11.693  -6.878  1.00 0.00 ? 47 SER A O    8  
ATOM   5964  C CB   . SER A 1 47 ? 4.203   9.814   -4.962  1.00 0.00 ? 47 SER A CB   8  
ATOM   5965  O OG   . SER A 1 47 ? 3.715   10.109  -3.664  1.00 0.00 ? 47 SER A OG   8  
ATOM   5966  H H    . SER A 1 47 ? 2.662   10.625  -7.706  1.00 0.00 ? 47 SER A H    8  
ATOM   5967  H HA   . SER A 1 47 ? 2.954   11.435  -5.591  1.00 0.00 ? 47 SER A HA   8  
ATOM   5968  H HB2  . SER A 1 47 ? 3.780   8.875   -5.285  1.00 0.00 ? 47 SER A HB2  8  
ATOM   5969  H HB3  . SER A 1 47 ? 5.279   9.729   -4.916  1.00 0.00 ? 47 SER A HB3  8  
ATOM   5970  H HG   . SER A 1 47 ? 4.400   9.933   -3.016  1.00 0.00 ? 47 SER A HG   8  
ATOM   5971  N N    . VAL A 1 48 ? 4.884   13.008  -5.350  1.00 0.00 ? 48 VAL A N    8  
ATOM   5972  C CA   . VAL A 1 48 ? 5.884   14.058  -5.381  1.00 0.00 ? 48 VAL A CA   8  
ATOM   5973  C C    . VAL A 1 48 ? 6.077   14.598  -6.783  1.00 0.00 ? 48 VAL A C    8  
ATOM   5974  O O    . VAL A 1 48 ? 6.803   14.046  -7.608  1.00 0.00 ? 48 VAL A O    8  
ATOM   5975  C CB   . VAL A 1 48 ? 7.238   13.639  -4.774  1.00 0.00 ? 48 VAL A CB   8  
ATOM   5976  C CG1  . VAL A 1 48 ? 7.058   13.185  -3.333  1.00 0.00 ? 48 VAL A CG1  8  
ATOM   5977  C CG2  . VAL A 1 48 ? 7.929   12.552  -5.588  1.00 0.00 ? 48 VAL A CG2  8  
ATOM   5978  H H    . VAL A 1 48 ? 4.107   13.131  -4.774  1.00 0.00 ? 48 VAL A H    8  
ATOM   5979  H HA   . VAL A 1 48 ? 5.498   14.866  -4.772  1.00 0.00 ? 48 VAL A HA   8  
ATOM   5980  H HB   . VAL A 1 48 ? 7.870   14.514  -4.774  1.00 0.00 ? 48 VAL A HB   8  
ATOM   5981  H HG11 . VAL A 1 48 ? 6.129   13.576  -2.947  1.00 0.00 ? 48 VAL A HG11 8  
ATOM   5982  H HG12 . VAL A 1 48 ? 7.879   13.551  -2.735  1.00 0.00 ? 48 VAL A HG12 8  
ATOM   5983  H HG13 . VAL A 1 48 ? 7.038   12.106  -3.296  1.00 0.00 ? 48 VAL A HG13 8  
ATOM   5984  H HG21 . VAL A 1 48 ? 7.853   12.777  -6.638  1.00 0.00 ? 48 VAL A HG21 8  
ATOM   5985  H HG22 . VAL A 1 48 ? 7.460   11.601  -5.389  1.00 0.00 ? 48 VAL A HG22 8  
ATOM   5986  H HG23 . VAL A 1 48 ? 8.970   12.503  -5.306  1.00 0.00 ? 48 VAL A HG23 8  
ATOM   5987  N N    . LYS A 1 49 ? 5.393   15.695  -7.029  1.00 0.00 ? 49 LYS A N    8  
ATOM   5988  C CA   . LYS A 1 49 ? 5.432   16.375  -8.322  1.00 0.00 ? 49 LYS A CA   8  
ATOM   5989  C C    . LYS A 1 49 ? 4.644   15.593  -9.371  1.00 0.00 ? 49 LYS A C    8  
ATOM   5990  O O    . LYS A 1 49 ? 3.579   16.026  -9.809  1.00 0.00 ? 49 LYS A O    8  
ATOM   5991  C CB   . LYS A 1 49 ? 6.879   16.569  -8.791  1.00 0.00 ? 49 LYS A CB   8  
ATOM   5992  C CG   . LYS A 1 49 ? 7.806   17.106  -7.711  1.00 0.00 ? 49 LYS A CG   8  
ATOM   5993  C CD   . LYS A 1 49 ? 8.077   18.592  -7.894  1.00 0.00 ? 49 LYS A CD   8  
ATOM   5994  C CE   . LYS A 1 49 ? 7.003   19.439  -7.228  1.00 0.00 ? 49 LYS A CE   8  
ATOM   5995  N NZ   . LYS A 1 49 ? 5.786   19.572  -8.078  1.00 0.00 ? 49 LYS A NZ   8  
ATOM   5996  H H    . LYS A 1 49 ? 4.836   16.054  -6.309  1.00 0.00 ? 49 LYS A H    8  
ATOM   5997  H HA   . LYS A 1 49 ? 4.972   17.344  -8.195  1.00 0.00 ? 49 LYS A HA   8  
ATOM   5998  H HB2  . LYS A 1 49 ? 7.266   15.619  -9.126  1.00 0.00 ? 49 LYS A HB2  8  
ATOM   5999  H HB3  . LYS A 1 49 ? 6.887   17.264  -9.619  1.00 0.00 ? 49 LYS A HB3  8  
ATOM   6000  H HG2  . LYS A 1 49 ? 7.346   16.951  -6.746  1.00 0.00 ? 49 LYS A HG2  8  
ATOM   6001  H HG3  . LYS A 1 49 ? 8.743   16.569  -7.755  1.00 0.00 ? 49 LYS A HG3  8  
ATOM   6002  H HD2  . LYS A 1 49 ? 9.034   18.831  -7.455  1.00 0.00 ? 49 LYS A HD2  8  
ATOM   6003  H HD3  . LYS A 1 49 ? 8.098   18.816  -8.951  1.00 0.00 ? 49 LYS A HD3  8  
ATOM   6004  H HE2  . LYS A 1 49 ? 6.727   18.977  -6.292  1.00 0.00 ? 49 LYS A HE2  8  
ATOM   6005  H HE3  . LYS A 1 49 ? 7.407   20.423  -7.036  1.00 0.00 ? 49 LYS A HE3  8  
ATOM   6006  H HZ1  . LYS A 1 49 ? 5.889   19.002  -8.943  1.00 0.00 ? 49 LYS A HZ1  8  
ATOM   6007  H HZ2  . LYS A 1 49 ? 5.643   20.566  -8.347  1.00 0.00 ? 49 LYS A HZ2  8  
ATOM   6008  H HZ3  . LYS A 1 49 ? 4.949   19.242  -7.556  1.00 0.00 ? 49 LYS A HZ3  8  
HETATM 6009  N N    . CY1 A 1 50 ? 5.175   14.439  -9.765  1.00 0.00 ? 50 CY1 A N    8  
HETATM 6010  C CA   . CY1 A 1 50 ? 4.521   13.593  -10.760 1.00 0.00 ? 50 CY1 A CA   8  
HETATM 6011  C CB   . CY1 A 1 50 ? 5.512   13.195  -11.856 1.00 0.00 ? 50 CY1 A CB   8  
HETATM 6012  S SG   . CY1 A 1 50 ? 6.286   14.622  -12.640 1.00 0.00 ? 50 CY1 A SG   8  
HETATM 6013  C CD   . CY1 A 1 50 ? 7.881   13.961  -13.157 1.00 0.00 ? 50 CY1 A CD   8  
HETATM 6014  N NE   . CY1 A 1 50 ? 8.903   14.263  -12.160 1.00 0.00 ? 50 CY1 A NE   8  
HETATM 6015  C CZ   . CY1 A 1 50 ? 9.931   15.077  -12.371 1.00 0.00 ? 50 CY1 A CZ   8  
HETATM 6016  O OAC  . CY1 A 1 50 ? 10.139  15.665  -13.432 1.00 0.00 ? 50 CY1 A OAC  8  
HETATM 6017  C CM   . CY1 A 1 50 ? 10.881  15.255  -11.200 1.00 0.00 ? 50 CY1 A CM   8  
HETATM 6018  C C    . CY1 A 1 50 ? 3.942   12.344  -10.107 1.00 0.00 ? 50 CY1 A C    8  
HETATM 6019  O O    . CY1 A 1 50 ? 4.613   11.687  -9.312  1.00 0.00 ? 50 CY1 A O    8  
HETATM 6020  H H    . CY1 A 1 50 ? 6.024   14.146  -9.375  1.00 0.00 ? 50 CY1 A H    8  
HETATM 6021  H HA   . CY1 A 1 50 ? 3.715   14.160  -11.202 1.00 0.00 ? 50 CY1 A HA   8  
HETATM 6022  H HB2  . CY1 A 1 50 ? 6.287   12.579  -11.425 1.00 0.00 ? 50 CY1 A HB2  8  
HETATM 6023  H HB3  . CY1 A 1 50 ? 4.992   12.631  -12.616 1.00 0.00 ? 50 CY1 A HB3  8  
HETATM 6024  H HD2  . CY1 A 1 50 ? 7.622   12.914  -13.115 1.00 0.00 ? 50 CY1 A HD2  8  
HETATM 6025  H HD3  . CY1 A 1 50 ? 8.035   14.569  -14.034 1.00 0.00 ? 50 CY1 A HD3  8  
HETATM 6026  H HE   . CY1 A 1 50 ? 8.941   13.704  -11.355 1.00 0.00 ? 50 CY1 A HE   8  
HETATM 6027  H HM1  . CY1 A 1 50 ? 10.569  16.120  -10.620 1.00 0.00 ? 50 CY1 A HM1  8  
HETATM 6028  H HM2  . CY1 A 1 50 ? 11.890  15.379  -11.583 1.00 0.00 ? 50 CY1 A HM2  8  
HETATM 6029  H HM3  . CY1 A 1 50 ? 10.856  14.390  -10.571 1.00 0.00 ? 50 CY1 A HM3  8  
HETATM 6030  N N    . NH2 A 1 51 ? 2.698   12.005  -10.430 1.00 0.00 ? 51 NH2 A N    8  
HETATM 6031  H HN1  . NH2 A 1 51 ? 2.216   12.570  -11.069 1.00 0.00 ? 51 NH2 A HN1  8  
HETATM 6032  H HN2  . NH2 A 1 51 ? 2.314   11.204  -10.016 1.00 0.00 ? 51 NH2 A HN2  8  
ATOM   6033  N N    . LEU A 1 1  ? -1.192  -9.360  17.363  1.00 0.00 ? 1  LEU A N    9  
ATOM   6034  C CA   . LEU A 1 1  ? -2.061  -10.369 18.024  1.00 0.00 ? 1  LEU A CA   9  
ATOM   6035  C C    . LEU A 1 1  ? -3.145  -10.870 17.074  1.00 0.00 ? 1  LEU A C    9  
ATOM   6036  O O    . LEU A 1 1  ? -3.423  -12.068 17.011  1.00 0.00 ? 1  LEU A O    9  
ATOM   6037  C CB   . LEU A 1 1  ? -2.691  -9.731  19.266  1.00 0.00 ? 1  LEU A CB   9  
ATOM   6038  C CG   . LEU A 1 1  ? -2.391  -10.446 20.584  1.00 0.00 ? 1  LEU A CG   9  
ATOM   6039  C CD1  . LEU A 1 1  ? -2.896  -11.880 20.542  1.00 0.00 ? 1  LEU A CD1  9  
ATOM   6040  C CD2  . LEU A 1 1  ? -0.898  -10.414 20.879  1.00 0.00 ? 1  LEU A CD2  9  
ATOM   6041  H H1   . LEU A 1 1  ? -0.316  -9.284  17.918  1.00 0.00 ? 1  LEU A H1   9  
ATOM   6042  H H2   . LEU A 1 1  ? -1.708  -8.457  17.352  1.00 0.00 ? 1  LEU A H2   9  
ATOM   6043  H H3   . LEU A 1 1  ? -0.997  -9.694  16.399  1.00 0.00 ? 1  LEU A H3   9  
ATOM   6044  H HA   . LEU A 1 1  ? -1.447  -11.203 18.327  1.00 0.00 ? 1  LEU A HA   9  
ATOM   6045  H HB2  . LEU A 1 1  ? -2.334  -8.714  19.342  1.00 0.00 ? 1  LEU A HB2  9  
ATOM   6046  H HB3  . LEU A 1 1  ? -3.763  -9.708  19.132  1.00 0.00 ? 1  LEU A HB3  9  
ATOM   6047  H HG   . LEU A 1 1  ? -2.902  -9.936  21.387  1.00 0.00 ? 1  LEU A HG   9  
ATOM   6048  H HD11 . LEU A 1 1  ? -3.658  -11.971 19.781  1.00 0.00 ? 1  LEU A HD11 9  
ATOM   6049  H HD12 . LEU A 1 1  ? -3.313  -12.142 21.502  1.00 0.00 ? 1  LEU A HD12 9  
ATOM   6050  H HD13 . LEU A 1 1  ? -2.076  -12.544 20.311  1.00 0.00 ? 1  LEU A HD13 9  
ATOM   6051  H HD21 . LEU A 1 1  ? -0.572  -9.389  20.973  1.00 0.00 ? 1  LEU A HD21 9  
ATOM   6052  H HD22 . LEU A 1 1  ? -0.361  -10.889 20.071  1.00 0.00 ? 1  LEU A HD22 9  
ATOM   6053  H HD23 . LEU A 1 1  ? -0.702  -10.940 21.801  1.00 0.00 ? 1  LEU A HD23 9  
ATOM   6054  N N    . GLN A 1 2  ? -3.754  -9.948  16.336  1.00 0.00 ? 2  GLN A N    9  
ATOM   6055  C CA   . GLN A 1 2  ? -4.805  -10.302 15.389  1.00 0.00 ? 2  GLN A CA   9  
ATOM   6056  C C    . GLN A 1 2  ? -4.541  -9.687  14.019  1.00 0.00 ? 2  GLN A C    9  
ATOM   6057  O O    . GLN A 1 2  ? -4.556  -8.467  13.859  1.00 0.00 ? 2  GLN A O    9  
ATOM   6058  C CB   . GLN A 1 2  ? -6.168  -9.845  15.902  1.00 0.00 ? 2  GLN A CB   9  
ATOM   6059  C CG   . GLN A 1 2  ? -6.202  -8.385  16.325  1.00 0.00 ? 2  GLN A CG   9  
ATOM   6060  C CD   . GLN A 1 2  ? -7.272  -8.101  17.361  1.00 0.00 ? 2  GLN A CD   9  
ATOM   6061  O OE1  . GLN A 1 2  ? -8.167  -7.287  17.138  1.00 0.00 ? 2  GLN A OE1  9  
ATOM   6062  N NE2  . GLN A 1 2  ? -7.183  -8.774  18.502  1.00 0.00 ? 2  GLN A NE2  9  
ATOM   6063  H H    . GLN A 1 2  ? -3.489  -9.009  16.428  1.00 0.00 ? 2  GLN A H    9  
ATOM   6064  H HA   . GLN A 1 2  ? -4.811  -11.377 15.290  1.00 0.00 ? 2  GLN A HA   9  
ATOM   6065  H HB2  . GLN A 1 2  ? -6.897  -9.989  15.118  1.00 0.00 ? 2  GLN A HB2  9  
ATOM   6066  H HB3  . GLN A 1 2  ? -6.442  -10.452 16.753  1.00 0.00 ? 2  GLN A HB3  9  
ATOM   6067  H HG2  . GLN A 1 2  ? -5.241  -8.121  16.740  1.00 0.00 ? 2  GLN A HG2  9  
ATOM   6068  H HG3  . GLN A 1 2  ? -6.395  -7.776  15.453  1.00 0.00 ? 2  GLN A HG3  9  
ATOM   6069  H HE21 . GLN A 1 2  ? -6.442  -9.406  18.611  1.00 0.00 ? 2  GLN A HE21 9  
ATOM   6070  H HE22 . GLN A 1 2  ? -7.861  -8.610  19.190  1.00 0.00 ? 2  GLN A HE22 9  
ATOM   6071  N N    . MET A 1 3  ? -4.302  -10.547 13.035  1.00 0.00 ? 3  MET A N    9  
ATOM   6072  C CA   . MET A 1 3  ? -4.032  -10.106 11.665  1.00 0.00 ? 3  MET A CA   9  
ATOM   6073  C C    . MET A 1 3  ? -2.655  -9.473  11.528  1.00 0.00 ? 3  MET A C    9  
ATOM   6074  O O    . MET A 1 3  ? -2.216  -9.164  10.420  1.00 0.00 ? 3  MET A O    9  
ATOM   6075  C CB   . MET A 1 3  ? -5.105  -9.121  11.198  1.00 0.00 ? 3  MET A CB   9  
ATOM   6076  C CG   . MET A 1 3  ? -5.145  -8.933  9.689   1.00 0.00 ? 3  MET A CG   9  
ATOM   6077  S SD   . MET A 1 3  ? -5.456  -10.474 8.804   1.00 0.00 ? 3  MET A SD   9  
ATOM   6078  C CE   . MET A 1 3  ? -3.782  -11.032 8.497   1.00 0.00 ? 3  MET A CE   9  
ATOM   6079  H H    . MET A 1 3  ? -4.310  -11.507 13.236  1.00 0.00 ? 3  MET A H    9  
ATOM   6080  H HA   . MET A 1 3  ? -4.058  -10.974 11.036  1.00 0.00 ? 3  MET A HA   9  
ATOM   6081  H HB2  . MET A 1 3  ? -6.071  -9.478  11.520  1.00 0.00 ? 3  MET A HB2  9  
ATOM   6082  H HB3  . MET A 1 3  ? -4.915  -8.161  11.654  1.00 0.00 ? 3  MET A HB3  9  
ATOM   6083  H HG2  . MET A 1 3  ? -5.932  -8.233  9.447   1.00 0.00 ? 3  MET A HG2  9  
ATOM   6084  H HG3  . MET A 1 3  ? -4.197  -8.531  9.362   1.00 0.00 ? 3  MET A HG3  9  
ATOM   6085  H HE1  . MET A 1 3  ? -3.539  -11.832 9.180   1.00 0.00 ? 3  MET A HE1  9  
ATOM   6086  H HE2  . MET A 1 3  ? -3.096  -10.211 8.644   1.00 0.00 ? 3  MET A HE2  9  
ATOM   6087  H HE3  . MET A 1 3  ? -3.703  -11.389 7.481   1.00 0.00 ? 3  MET A HE3  9  
ATOM   6088  N N    . ALA A 1 4  ? -1.975  -9.281  12.645  1.00 0.00 ? 4  ALA A N    9  
ATOM   6089  C CA   . ALA A 1 4  ? -0.653  -8.684  12.628  1.00 0.00 ? 4  ALA A CA   9  
ATOM   6090  C C    . ALA A 1 4  ? 0.431   -9.760  12.576  1.00 0.00 ? 4  ALA A C    9  
ATOM   6091  O O    . ALA A 1 4  ? 1.173   -9.956  13.538  1.00 0.00 ? 4  ALA A O    9  
ATOM   6092  C CB   . ALA A 1 4  ? -0.488  -7.810  13.854  1.00 0.00 ? 4  ALA A CB   9  
ATOM   6093  H H    . ALA A 1 4  ? -2.369  -9.543  13.502  1.00 0.00 ? 4  ALA A H    9  
ATOM   6094  H HA   . ALA A 1 4  ? -0.577  -8.055  11.750  1.00 0.00 ? 4  ALA A HA   9  
ATOM   6095  H HB1  . ALA A 1 4  ? -1.461  -7.623  14.284  1.00 0.00 ? 4  ALA A HB1  9  
ATOM   6096  H HB2  . ALA A 1 4  ? -0.032  -6.874  13.570  1.00 0.00 ? 4  ALA A HB2  9  
ATOM   6097  H HB3  . ALA A 1 4  ? 0.134   -8.314  14.576  1.00 0.00 ? 4  ALA A HB3  9  
ATOM   6098  N N    . GLY A 1 5  ? 0.516   -10.460 11.446  1.00 0.00 ? 5  GLY A N    9  
ATOM   6099  C CA   . GLY A 1 5  ? 1.508   -11.509 11.293  1.00 0.00 ? 5  GLY A CA   9  
ATOM   6100  C C    . GLY A 1 5  ? 1.187   -12.449 10.147  1.00 0.00 ? 5  GLY A C    9  
ATOM   6101  O O    . GLY A 1 5  ? 1.461   -13.647 10.220  1.00 0.00 ? 5  GLY A O    9  
ATOM   6102  H H    . GLY A 1 5  ? -0.099  -10.263 10.710  1.00 0.00 ? 5  GLY A H    9  
ATOM   6103  H HA2  . GLY A 1 5  ? 2.473   -11.055 11.114  1.00 0.00 ? 5  GLY A HA2  9  
ATOM   6104  H HA3  . GLY A 1 5  ? 1.556   -12.081 12.210  1.00 0.00 ? 5  GLY A HA3  9  
ATOM   6105  N N    . GLN A 1 6  ? 0.612   -11.901 9.080   1.00 0.00 ? 6  GLN A N    9  
ATOM   6106  C CA   . GLN A 1 6  ? 0.258   -12.681 7.908   1.00 0.00 ? 6  GLN A CA   9  
ATOM   6107  C C    . GLN A 1 6  ? -0.405  -11.787 6.874   1.00 0.00 ? 6  GLN A C    9  
ATOM   6108  O O    . GLN A 1 6  ? -1.609  -11.870 6.628   1.00 0.00 ? 6  GLN A O    9  
ATOM   6109  C CB   . GLN A 1 6  ? -0.659  -13.850 8.285   1.00 0.00 ? 6  GLN A CB   9  
ATOM   6110  C CG   . GLN A 1 6  ? -0.213  -15.182 7.703   1.00 0.00 ? 6  GLN A CG   9  
ATOM   6111  C CD   . GLN A 1 6  ? 0.964   -15.779 8.449   1.00 0.00 ? 6  GLN A CD   9  
ATOM   6112  O OE1  . GLN A 1 6  ? 0.792   -16.451 9.466   1.00 0.00 ? 6  GLN A OE1  9  
ATOM   6113  N NE2  . GLN A 1 6  ? 2.169   -15.532 7.948   1.00 0.00 ? 6  GLN A NE2  9  
ATOM   6114  H H    . GLN A 1 6  ? 0.428   -10.945 9.075   1.00 0.00 ? 6  GLN A H    9  
ATOM   6115  H HA   . GLN A 1 6  ? 1.170   -13.059 7.490   1.00 0.00 ? 6  GLN A HA   9  
ATOM   6116  H HB2  . GLN A 1 6  ? -0.681  -13.941 9.360   1.00 0.00 ? 6  GLN A HB2  9  
ATOM   6117  H HB3  . GLN A 1 6  ? -1.657  -13.643 7.928   1.00 0.00 ? 6  GLN A HB3  9  
ATOM   6118  H HG2  . GLN A 1 6  ? -1.039  -15.875 7.752   1.00 0.00 ? 6  GLN A HG2  9  
ATOM   6119  H HG3  . GLN A 1 6  ? 0.071   -15.033 6.672   1.00 0.00 ? 6  GLN A HG3  9  
ATOM   6120  H HE21 . GLN A 1 6  ? 2.229   -14.988 7.135   1.00 0.00 ? 6  GLN A HE21 9  
ATOM   6121  H HE22 . GLN A 1 6  ? 2.947   -15.906 8.411   1.00 0.00 ? 6  GLN A HE22 9  
ATOM   6122  N N    . CYS A 1 7  ? 0.404   -10.920 6.291   1.00 0.00 ? 7  CYS A N    9  
ATOM   6123  C CA   . CYS A 1 7  ? -0.069  -9.974  5.287   1.00 0.00 ? 7  CYS A CA   9  
ATOM   6124  C C    . CYS A 1 7  ? 0.925   -9.842  4.144   1.00 0.00 ? 7  CYS A C    9  
ATOM   6125  O O    . CYS A 1 7  ? 2.137   -9.873  4.360   1.00 0.00 ? 7  CYS A O    9  
ATOM   6126  C CB   . CYS A 1 7  ? -0.287  -8.602  5.929   1.00 0.00 ? 7  CYS A CB   9  
ATOM   6127  S SG   . CYS A 1 7  ? -1.702  -8.547  7.074   1.00 0.00 ? 7  CYS A SG   9  
ATOM   6128  H H    . CYS A 1 7  ? 1.347   -10.910 6.556   1.00 0.00 ? 7  CYS A H    9  
ATOM   6129  H HA   . CYS A 1 7  ? -1.009  -10.336 4.899   1.00 0.00 ? 7  CYS A HA   9  
ATOM   6130  H HB2  . CYS A 1 7  ? 0.599   -8.331  6.486   1.00 0.00 ? 7  CYS A HB2  9  
ATOM   6131  H HB3  . CYS A 1 7  ? -0.451  -7.864  5.154   1.00 0.00 ? 7  CYS A HB3  9  
ATOM   6132  N N    . SER A 1 8  ? 0.411   -9.676  2.928   1.00 0.00 ? 8  SER A N    9  
ATOM   6133  C CA   . SER A 1 8  ? 1.271   -9.510  1.766   1.00 0.00 ? 8  SER A CA   9  
ATOM   6134  C C    . SER A 1 8  ? 2.294   -8.421  2.047   1.00 0.00 ? 8  SER A C    9  
ATOM   6135  O O    . SER A 1 8  ? 2.012   -7.472  2.771   1.00 0.00 ? 8  SER A O    9  
ATOM   6136  C CB   . SER A 1 8  ? 0.447   -9.152  0.528   1.00 0.00 ? 8  SER A CB   9  
ATOM   6137  O OG   . SER A 1 8  ? -0.742  -9.920  0.465   1.00 0.00 ? 8  SER A OG   9  
ATOM   6138  H H    . SER A 1 8  ? -0.562  -9.648  2.816   1.00 0.00 ? 8  SER A H    9  
ATOM   6139  H HA   . SER A 1 8  ? 1.788   -10.441 1.593   1.00 0.00 ? 8  SER A HA   9  
ATOM   6140  H HB2  . SER A 1 8  ? 0.183   -8.105  0.565   1.00 0.00 ? 8  SER A HB2  9  
ATOM   6141  H HB3  . SER A 1 8  ? 1.033   -9.344  -0.358  1.00 0.00 ? 8  SER A HB3  9  
ATOM   6142  H HG   . SER A 1 8  ? -0.520  -10.853 0.435   1.00 0.00 ? 8  SER A HG   9  
ATOM   6143  N N    . GLN A 1 9  ? 3.487   -8.568  1.504   1.00 0.00 ? 9  GLN A N    9  
ATOM   6144  C CA   . GLN A 1 9  ? 4.542   -7.598  1.742   1.00 0.00 ? 9  GLN A CA   9  
ATOM   6145  C C    . GLN A 1 9  ? 4.064   -6.166  1.570   1.00 0.00 ? 9  GLN A C    9  
ATOM   6146  O O    . GLN A 1 9  ? 3.445   -5.805  0.570   1.00 0.00 ? 9  GLN A O    9  
ATOM   6147  C CB   . GLN A 1 9  ? 5.746   -7.872  0.839   1.00 0.00 ? 9  GLN A CB   9  
ATOM   6148  C CG   . GLN A 1 9  ? 6.767   -8.814  1.455   1.00 0.00 ? 9  GLN A CG   9  
ATOM   6149  C CD   . GLN A 1 9  ? 7.431   -9.709  0.427   1.00 0.00 ? 9  GLN A CD   9  
ATOM   6150  O OE1  . GLN A 1 9  ? 7.558   -10.916 0.628   1.00 0.00 ? 9  GLN A OE1  9  
ATOM   6151  N NE2  . GLN A 1 9  ? 7.859   -9.118  -0.683  1.00 0.00 ? 9  GLN A NE2  9  
ATOM   6152  H H    . GLN A 1 9  ? 3.671   -9.351  0.951   1.00 0.00 ? 9  GLN A H    9  
ATOM   6153  H HA   . GLN A 1 9  ? 4.838   -7.713  2.769   1.00 0.00 ? 9  GLN A HA   9  
ATOM   6154  H HB2  . GLN A 1 9  ? 5.396   -8.309  -0.084  1.00 0.00 ? 9  GLN A HB2  9  
ATOM   6155  H HB3  . GLN A 1 9  ? 6.237   -6.935  0.620   1.00 0.00 ? 9  GLN A HB3  9  
ATOM   6156  H HG2  . GLN A 1 9  ? 7.531   -8.226  1.944   1.00 0.00 ? 9  GLN A HG2  9  
ATOM   6157  H HG3  . GLN A 1 9  ? 6.270   -9.436  2.185   1.00 0.00 ? 9  GLN A HG3  9  
ATOM   6158  H HE21 . GLN A 1 9  ? 7.725   -8.152  -0.774  1.00 0.00 ? 9  GLN A HE21 9  
ATOM   6159  H HE22 . GLN A 1 9  ? 8.292   -9.673  -1.364  1.00 0.00 ? 9  GLN A HE22 9  
ATOM   6160  N N    . ASN A 1 10 ? 4.372   -5.363  2.580   1.00 0.00 ? 10 ASN A N    9  
ATOM   6161  C CA   . ASN A 1 10 ? 4.007   -3.961  2.604   1.00 0.00 ? 10 ASN A CA   9  
ATOM   6162  C C    . ASN A 1 10 ? 2.502   -3.771  2.540   1.00 0.00 ? 10 ASN A C    9  
ATOM   6163  O O    . ASN A 1 10 ? 2.017   -2.776  1.998   1.00 0.00 ? 10 ASN A O    9  
ATOM   6164  C CB   . ASN A 1 10 ? 4.693   -3.202  1.466   1.00 0.00 ? 10 ASN A CB   9  
ATOM   6165  C CG   . ASN A 1 10 ? 5.799   -2.293  1.970   1.00 0.00 ? 10 ASN A CG   9  
ATOM   6166  O OD1  . ASN A 1 10 ? 5.695   -1.069  1.886   1.00 0.00 ? 10 ASN A OD1  9  
ATOM   6167  N ND2  . ASN A 1 10 ? 6.862   -2.885  2.505   1.00 0.00 ? 10 ASN A ND2  9  
ATOM   6168  H H    . ASN A 1 10 ? 4.868   -5.733  3.340   1.00 0.00 ? 10 ASN A H    9  
ATOM   6169  H HA   . ASN A 1 10 ? 4.347   -3.563  3.543   1.00 0.00 ? 10 ASN A HA   9  
ATOM   6170  H HB2  . ASN A 1 10 ? 5.119   -3.911  0.771   1.00 0.00 ? 10 ASN A HB2  9  
ATOM   6171  H HB3  . ASN A 1 10 ? 3.962   -2.597  0.951   1.00 0.00 ? 10 ASN A HB3  9  
ATOM   6172  H HD21 . ASN A 1 10 ? 6.878   -3.864  2.547   1.00 0.00 ? 10 ASN A HD21 9  
ATOM   6173  H HD22 . ASN A 1 10 ? 7.589   -2.317  2.836   1.00 0.00 ? 10 ASN A HD22 9  
ATOM   6174  N N    . GLU A 1 11 ? 1.761   -4.711  3.109   1.00 0.00 ? 11 GLU A N    9  
ATOM   6175  C CA   . GLU A 1 11 ? 0.308   -4.580  3.121   1.00 0.00 ? 11 GLU A CA   9  
ATOM   6176  C C    . GLU A 1 11 ? -0.109  -3.543  4.143   1.00 0.00 ? 11 GLU A C    9  
ATOM   6177  O O    . GLU A 1 11 ? 0.538   -3.394  5.180   1.00 0.00 ? 11 GLU A O    9  
ATOM   6178  C CB   . GLU A 1 11 ? -0.385  -5.918  3.383   1.00 0.00 ? 11 GLU A CB   9  
ATOM   6179  C CG   . GLU A 1 11 ? -1.489  -6.221  2.382   1.00 0.00 ? 11 GLU A CG   9  
ATOM   6180  C CD   . GLU A 1 11 ? -1.933  -7.670  2.410   1.00 0.00 ? 11 GLU A CD   9  
ATOM   6181  O OE1  . GLU A 1 11 ? -1.742  -8.331  3.451   1.00 0.00 ? 11 GLU A OE1  9  
ATOM   6182  O OE2  . GLU A 1 11 ? -2.472  -8.144  1.388   1.00 0.00 ? 11 GLU A OE2  9  
ATOM   6183  H H    . GLU A 1 11 ? 2.203   -5.490  3.542   1.00 0.00 ? 11 GLU A H    9  
ATOM   6184  H HA   . GLU A 1 11 ? 0.012   -4.210  2.168   1.00 0.00 ? 11 GLU A HA   9  
ATOM   6185  H HB2  . GLU A 1 11 ? 0.345   -6.708  3.333   1.00 0.00 ? 11 GLU A HB2  9  
ATOM   6186  H HB3  . GLU A 1 11 ? -0.816  -5.902  4.368   1.00 0.00 ? 11 GLU A HB3  9  
ATOM   6187  H HG2  . GLU A 1 11 ? -2.339  -5.598  2.608   1.00 0.00 ? 11 GLU A HG2  9  
ATOM   6188  H HG3  . GLU A 1 11 ? -1.130  -5.989  1.390   1.00 0.00 ? 11 GLU A HG3  9  
ATOM   6189  N N    . TYR A 1 12 ? -1.186  -2.808  3.852   1.00 0.00 ? 12 TYR A N    9  
ATOM   6190  C CA   . TYR A 1 12 ? -1.637  -1.772  4.783   1.00 0.00 ? 12 TYR A CA   9  
ATOM   6191  C C    . TYR A 1 12 ? -2.941  -2.152  5.454   1.00 0.00 ? 12 TYR A C    9  
ATOM   6192  O O    . TYR A 1 12 ? -3.970  -2.323  4.804   1.00 0.00 ? 12 TYR A O    9  
ATOM   6193  C CB   . TYR A 1 12 ? -1.744  -0.404  4.102   1.00 0.00 ? 12 TYR A CB   9  
ATOM   6194  C CG   . TYR A 1 12 ? -3.014  -0.169  3.313   1.00 0.00 ? 12 TYR A CG   9  
ATOM   6195  C CD1  . TYR A 1 12 ? -4.156  0.319   3.933   1.00 0.00 ? 12 TYR A CD1  9  
ATOM   6196  C CD2  . TYR A 1 12 ? -3.063  -0.416  1.948   1.00 0.00 ? 12 TYR A CD2  9  
ATOM   6197  C CE1  . TYR A 1 12 ? -5.312  0.551   3.216   1.00 0.00 ? 12 TYR A CE1  9  
ATOM   6198  C CE2  . TYR A 1 12 ? -4.216  -0.189  1.224   1.00 0.00 ? 12 TYR A CE2  9  
ATOM   6199  C CZ   . TYR A 1 12 ? -5.338  0.294   1.861   1.00 0.00 ? 12 TYR A CZ   9  
ATOM   6200  O OH   . TYR A 1 12 ? -6.489  0.525   1.143   1.00 0.00 ? 12 TYR A OH   9  
ATOM   6201  H H    . TYR A 1 12 ? -1.682  -2.965  2.998   1.00 0.00 ? 12 TYR A H    9  
ATOM   6202  H HA   . TYR A 1 12 ? -0.881  -1.696  5.558   1.00 0.00 ? 12 TYR A HA   9  
ATOM   6203  H HB2  . TYR A 1 12 ? -1.692  0.356   4.866   1.00 0.00 ? 12 TYR A HB2  9  
ATOM   6204  H HB3  . TYR A 1 12 ? -0.907  -0.284  3.430   1.00 0.00 ? 12 TYR A HB3  9  
ATOM   6205  H HD1  . TYR A 1 12 ? -4.133  0.517   4.995   1.00 0.00 ? 12 TYR A HD1  9  
ATOM   6206  H HD2  . TYR A 1 12 ? -2.182  -0.795  1.451   1.00 0.00 ? 12 TYR A HD2  9  
ATOM   6207  H HE1  . TYR A 1 12 ? -6.190  0.932   3.716   1.00 0.00 ? 12 TYR A HE1  9  
ATOM   6208  H HE2  . TYR A 1 12 ? -4.236  -0.391  0.163   1.00 0.00 ? 12 TYR A HE2  9  
ATOM   6209  H HH   . TYR A 1 12 ? -6.700  1.461   1.168   1.00 0.00 ? 12 TYR A HH   9  
ATOM   6210  N N    . PHE A 1 13 ? -2.871  -2.284  6.770   1.00 0.00 ? 13 PHE A N    9  
ATOM   6211  C CA   . PHE A 1 13 ? -4.018  -2.658  7.588   1.00 0.00 ? 13 PHE A CA   9  
ATOM   6212  C C    . PHE A 1 13 ? -4.855  -1.440  7.956   1.00 0.00 ? 13 PHE A C    9  
ATOM   6213  O O    . PHE A 1 13 ? -4.570  -0.754  8.937   1.00 0.00 ? 13 PHE A O    9  
ATOM   6214  C CB   . PHE A 1 13 ? -3.526  -3.363  8.856   1.00 0.00 ? 13 PHE A CB   9  
ATOM   6215  C CG   . PHE A 1 13 ? -4.625  -3.836  9.764   1.00 0.00 ? 13 PHE A CG   9  
ATOM   6216  C CD1  . PHE A 1 13 ? -5.178  -5.096  9.605   1.00 0.00 ? 13 PHE A CD1  9  
ATOM   6217  C CD2  . PHE A 1 13 ? -5.100  -3.022  10.779  1.00 0.00 ? 13 PHE A CD2  9  
ATOM   6218  C CE1  . PHE A 1 13 ? -6.188  -5.535  10.441  1.00 0.00 ? 13 PHE A CE1  9  
ATOM   6219  C CE2  . PHE A 1 13 ? -6.110  -3.455  11.618  1.00 0.00 ? 13 PHE A CE2  9  
ATOM   6220  C CZ   . PHE A 1 13 ? -6.655  -4.713  11.448  1.00 0.00 ? 13 PHE A CZ   9  
ATOM   6221  H H    . PHE A 1 13 ? -2.009  -2.126  7.207   1.00 0.00 ? 13 PHE A H    9  
ATOM   6222  H HA   . PHE A 1 13 ? -4.630  -3.346  7.018   1.00 0.00 ? 13 PHE A HA   9  
ATOM   6223  H HB2  . PHE A 1 13 ? -2.940  -4.224  8.574   1.00 0.00 ? 13 PHE A HB2  9  
ATOM   6224  H HB3  . PHE A 1 13 ? -2.903  -2.681  9.417   1.00 0.00 ? 13 PHE A HB3  9  
ATOM   6225  H HD1  . PHE A 1 13 ? -4.810  -5.742  8.820   1.00 0.00 ? 13 PHE A HD1  9  
ATOM   6226  H HD2  . PHE A 1 13 ? -4.676  -2.037  10.912  1.00 0.00 ? 13 PHE A HD2  9  
ATOM   6227  H HE1  . PHE A 1 13 ? -6.611  -6.519  10.306  1.00 0.00 ? 13 PHE A HE1  9  
ATOM   6228  H HE2  . PHE A 1 13 ? -6.472  -2.811  12.406  1.00 0.00 ? 13 PHE A HE2  9  
ATOM   6229  H HZ   . PHE A 1 13 ? -7.443  -5.054  12.103  1.00 0.00 ? 13 PHE A HZ   9  
ATOM   6230  N N    . ASP A 1 14 ? -5.899  -1.185  7.175   1.00 0.00 ? 14 ASP A N    9  
ATOM   6231  C CA   . ASP A 1 14 ? -6.784  -0.055  7.436   1.00 0.00 ? 14 ASP A CA   9  
ATOM   6232  C C    . ASP A 1 14 ? -7.560  -0.285  8.719   1.00 0.00 ? 14 ASP A C    9  
ATOM   6233  O O    . ASP A 1 14 ? -8.536  -1.026  8.734   1.00 0.00 ? 14 ASP A O    9  
ATOM   6234  C CB   . ASP A 1 14 ? -7.755  0.153   6.272   1.00 0.00 ? 14 ASP A CB   9  
ATOM   6235  C CG   . ASP A 1 14 ? -7.841  1.606   5.844   1.00 0.00 ? 14 ASP A CG   9  
ATOM   6236  O OD1  . ASP A 1 14 ? -7.760  2.488   6.724   1.00 0.00 ? 14 ASP A OD1  9  
ATOM   6237  O OD2  . ASP A 1 14 ? -7.992  1.860   4.631   1.00 0.00 ? 14 ASP A OD2  9  
ATOM   6238  H H    . ASP A 1 14 ? -6.087  -1.777  6.415   1.00 0.00 ? 14 ASP A H    9  
ATOM   6239  H HA   . ASP A 1 14 ? -6.179  0.832   7.554   1.00 0.00 ? 14 ASP A HA   9  
ATOM   6240  H HB2  . ASP A 1 14 ? -7.429  -0.432  5.427   1.00 0.00 ? 14 ASP A HB2  9  
ATOM   6241  H HB3  . ASP A 1 14 ? -8.741  -0.172  6.569   1.00 0.00 ? 14 ASP A HB3  9  
ATOM   6242  N N    . SER A 1 15 ? -7.125  0.355   9.798   1.00 0.00 ? 15 SER A N    9  
ATOM   6243  C CA   . SER A 1 15 ? -7.791  0.210   11.084  1.00 0.00 ? 15 SER A CA   9  
ATOM   6244  C C    . SER A 1 15 ? -9.293  0.434   10.946  1.00 0.00 ? 15 SER A C    9  
ATOM   6245  O O    . SER A 1 15 ? -10.081 -0.053  11.758  1.00 0.00 ? 15 SER A O    9  
ATOM   6246  C CB   . SER A 1 15 ? -7.205  1.189   12.103  1.00 0.00 ? 15 SER A CB   9  
ATOM   6247  O OG   . SER A 1 15 ? -7.251  2.519   11.617  1.00 0.00 ? 15 SER A OG   9  
ATOM   6248  H H    . SER A 1 15 ? -6.340  0.935   9.727   1.00 0.00 ? 15 SER A H    9  
ATOM   6249  H HA   . SER A 1 15 ? -7.623  -0.800  11.427  1.00 0.00 ? 15 SER A HA   9  
ATOM   6250  H HB2  . SER A 1 15 ? -7.774  1.135   13.019  1.00 0.00 ? 15 SER A HB2  9  
ATOM   6251  H HB3  . SER A 1 15 ? -6.177  0.926   12.302  1.00 0.00 ? 15 SER A HB3  9  
ATOM   6252  H HG   . SER A 1 15 ? -8.123  2.699   11.255  1.00 0.00 ? 15 SER A HG   9  
ATOM   6253  N N    . LEU A 1 16 ? -9.685  1.161   9.905   1.00 0.00 ? 16 LEU A N    9  
ATOM   6254  C CA   . LEU A 1 16 ? -11.095 1.432   9.657   1.00 0.00 ? 16 LEU A CA   9  
ATOM   6255  C C    . LEU A 1 16 ? -11.746 0.256   8.935   1.00 0.00 ? 16 LEU A C    9  
ATOM   6256  O O    . LEU A 1 16 ? -12.949 0.025   9.060   1.00 0.00 ? 16 LEU A O    9  
ATOM   6257  C CB   . LEU A 1 16 ? -11.255 2.708   8.828   1.00 0.00 ? 16 LEU A CB   9  
ATOM   6258  C CG   . LEU A 1 16 ? -12.510 3.528   9.136   1.00 0.00 ? 16 LEU A CG   9  
ATOM   6259  C CD1  . LEU A 1 16 ? -13.756 2.668   8.993   1.00 0.00 ? 16 LEU A CD1  9  
ATOM   6260  C CD2  . LEU A 1 16 ? -12.428 4.123   10.533  1.00 0.00 ? 16 LEU A CD2  9  
ATOM   6261  H H    . LEU A 1 16 ? -9.010  1.516   9.283   1.00 0.00 ? 16 LEU A H    9  
ATOM   6262  H HA   . LEU A 1 16 ? -11.580 1.568   10.612  1.00 0.00 ? 16 LEU A HA   9  
ATOM   6263  H HB2  . LEU A 1 16 ? -10.391 3.334   9.000   1.00 0.00 ? 16 LEU A HB2  9  
ATOM   6264  H HB3  . LEU A 1 16 ? -11.279 2.435   7.785   1.00 0.00 ? 16 LEU A HB3  9  
ATOM   6265  H HG   . LEU A 1 16 ? -12.584 4.341   8.428   1.00 0.00 ? 16 LEU A HG   9  
ATOM   6266  H HD11 . LEU A 1 16 ? -13.912 2.105   9.901   1.00 0.00 ? 16 LEU A HD11 9  
ATOM   6267  H HD12 . LEU A 1 16 ? -13.631 1.987   8.164   1.00 0.00 ? 16 LEU A HD12 9  
ATOM   6268  H HD13 . LEU A 1 16 ? -14.612 3.301   8.812   1.00 0.00 ? 16 LEU A HD13 9  
ATOM   6269  H HD21 . LEU A 1 16 ? -11.523 4.704   10.624  1.00 0.00 ? 16 LEU A HD21 9  
ATOM   6270  H HD22 . LEU A 1 16 ? -12.420 3.327   11.263  1.00 0.00 ? 16 LEU A HD22 9  
ATOM   6271  H HD23 . LEU A 1 16 ? -13.284 4.760   10.703  1.00 0.00 ? 16 LEU A HD23 9  
ATOM   6272  N N    . LEU A 1 17 ? -10.940 -0.479  8.175   1.00 0.00 ? 17 LEU A N    9  
ATOM   6273  C CA   . LEU A 1 17 ? -11.424 -1.627  7.419   1.00 0.00 ? 17 LEU A CA   9  
ATOM   6274  C C    . LEU A 1 17 ? -11.087 -2.947  8.113   1.00 0.00 ? 17 LEU A C    9  
ATOM   6275  O O    . LEU A 1 17 ? -11.710 -3.972  7.837   1.00 0.00 ? 17 LEU A O    9  
ATOM   6276  C CB   . LEU A 1 17 ? -10.806 -1.615  6.023   1.00 0.00 ? 17 LEU A CB   9  
ATOM   6277  C CG   . LEU A 1 17 ? -11.053 -0.338  5.219   1.00 0.00 ? 17 LEU A CG   9  
ATOM   6278  C CD1  . LEU A 1 17 ? -10.237 -0.348  3.936   1.00 0.00 ? 17 LEU A CD1  9  
ATOM   6279  C CD2  . LEU A 1 17 ? -12.534 -0.182  4.909   1.00 0.00 ? 17 LEU A CD2  9  
ATOM   6280  H H    . LEU A 1 17 ? -9.992  -0.240  8.110   1.00 0.00 ? 17 LEU A H    9  
ATOM   6281  H HA   . LEU A 1 17 ? -12.496 -1.542  7.328   1.00 0.00 ? 17 LEU A HA   9  
ATOM   6282  H HB2  . LEU A 1 17 ? -9.737  -1.748  6.128   1.00 0.00 ? 17 LEU A HB2  9  
ATOM   6283  H HB3  . LEU A 1 17 ? -11.204 -2.449  5.466   1.00 0.00 ? 17 LEU A HB3  9  
ATOM   6284  H HG   . LEU A 1 17 ? -10.742 0.514   5.807   1.00 0.00 ? 17 LEU A HG   9  
ATOM   6285  H HD11 . LEU A 1 17 ? -10.270 -1.334  3.496   1.00 0.00 ? 17 LEU A HD11 9  
ATOM   6286  H HD12 . LEU A 1 17 ? -9.212  -0.088  4.160   1.00 0.00 ? 17 LEU A HD12 9  
ATOM   6287  H HD13 . LEU A 1 17 ? -10.647 0.370   3.242   1.00 0.00 ? 17 LEU A HD13 9  
ATOM   6288  H HD21 . LEU A 1 17 ? -12.791 -0.793  4.056   1.00 0.00 ? 17 LEU A HD21 9  
ATOM   6289  H HD22 . LEU A 1 17 ? -12.749 0.852   4.688   1.00 0.00 ? 17 LEU A HD22 9  
ATOM   6290  H HD23 . LEU A 1 17 ? -13.117 -0.496  5.763   1.00 0.00 ? 17 LEU A HD23 9  
ATOM   6291  N N    . HIS A 1 18 ? -10.087 -2.928  8.994   1.00 0.00 ? 18 HIS A N    9  
ATOM   6292  C CA   . HIS A 1 18 ? -9.670  -4.139  9.691   1.00 0.00 ? 18 HIS A CA   9  
ATOM   6293  C C    . HIS A 1 18 ? -9.199  -5.174  8.682   1.00 0.00 ? 18 HIS A C    9  
ATOM   6294  O O    . HIS A 1 18 ? -9.646  -6.322  8.682   1.00 0.00 ? 18 HIS A O    9  
ATOM   6295  C CB   . HIS A 1 18 ? -10.817 -4.705  10.514  1.00 0.00 ? 18 HIS A CB   9  
ATOM   6296  C CG   . HIS A 1 18 ? -11.131 -3.906  11.741  1.00 0.00 ? 18 HIS A CG   9  
ATOM   6297  N ND1  . HIS A 1 18 ? -12.010 -2.843  11.741  1.00 0.00 ? 18 HIS A ND1  9  
ATOM   6298  C CD2  . HIS A 1 18 ? -10.678 -4.018  13.012  1.00 0.00 ? 18 HIS A CD2  9  
ATOM   6299  C CE1  . HIS A 1 18 ? -12.083 -2.336  12.960  1.00 0.00 ? 18 HIS A CE1  9  
ATOM   6300  N NE2  . HIS A 1 18 ? -11.286 -3.031  13.748  1.00 0.00 ? 18 HIS A NE2  9  
ATOM   6301  H H    . HIS A 1 18 ? -9.607  -2.091  9.166   1.00 0.00 ? 18 HIS A H    9  
ATOM   6302  H HA   . HIS A 1 18 ? -8.850  -3.886  10.347  1.00 0.00 ? 18 HIS A HA   9  
ATOM   6303  H HB2  . HIS A 1 18 ? -11.701 -4.739  9.900   1.00 0.00 ? 18 HIS A HB2  9  
ATOM   6304  H HB3  . HIS A 1 18 ? -10.559 -5.707  10.822  1.00 0.00 ? 18 HIS A HB3  9  
ATOM   6305  H HD1  . HIS A 1 18 ? -12.505 -2.509  10.965  1.00 0.00 ? 18 HIS A HD1  9  
ATOM   6306  H HD2  . HIS A 1 18 ? -9.971  -4.749  13.379  1.00 0.00 ? 18 HIS A HD2  9  
ATOM   6307  H HE1  . HIS A 1 18 ? -12.693 -1.496  13.259  1.00 0.00 ? 18 HIS A HE1  9  
ATOM   6308  H HE2  . HIS A 1 18 ? -11.090 -2.817  14.684  1.00 0.00 ? 18 HIS A HE2  9  
ATOM   6309  N N    . ALA A 1 19 ? -8.299  -4.741  7.819   1.00 0.00 ? 19 ALA A N    9  
ATOM   6310  C CA   . ALA A 1 19 ? -7.753  -5.581  6.783   1.00 0.00 ? 19 ALA A CA   9  
ATOM   6311  C C    . ALA A 1 19 ? -6.506  -4.960  6.199   1.00 0.00 ? 19 ALA A C    9  
ATOM   6312  O O    . ALA A 1 19 ? -6.473  -3.769  5.888   1.00 0.00 ? 19 ALA A O    9  
ATOM   6313  C CB   . ALA A 1 19 ? -8.760  -5.786  5.666   1.00 0.00 ? 19 ALA A CB   9  
ATOM   6314  H H    . ALA A 1 19 ? -7.995  -3.825  7.880   1.00 0.00 ? 19 ALA A H    9  
ATOM   6315  H HA   . ALA A 1 19 ? -7.513  -6.543  7.208   1.00 0.00 ? 19 ALA A HA   9  
ATOM   6316  H HB1  . ALA A 1 19 ? -9.669  -5.253  5.897   1.00 0.00 ? 19 ALA A HB1  9  
ATOM   6317  H HB2  . ALA A 1 19 ? -8.972  -6.838  5.559   1.00 0.00 ? 19 ALA A HB2  9  
ATOM   6318  H HB3  . ALA A 1 19 ? -8.342  -5.402  4.739   1.00 0.00 ? 19 ALA A HB3  9  
ATOM   6319  N N    . CYS A 1 20 ? -5.502  -5.777  6.027   1.00 0.00 ? 20 CYS A N    9  
ATOM   6320  C CA   . CYS A 1 20 ? -4.265  -5.320  5.438   1.00 0.00 ? 20 CYS A CA   9  
ATOM   6321  C C    . CYS A 1 20 ? -4.351  -5.432  3.917   1.00 0.00 ? 20 CYS A C    9  
ATOM   6322  O O    . CYS A 1 20 ? -4.407  -6.528  3.358   1.00 0.00 ? 20 CYS A O    9  
ATOM   6323  C CB   . CYS A 1 20 ? -3.068  -6.092  5.986   1.00 0.00 ? 20 CYS A CB   9  
ATOM   6324  S SG   . CYS A 1 20 ? -3.238  -7.901  5.918   1.00 0.00 ? 20 CYS A SG   9  
ATOM   6325  H H    . CYS A 1 20 ? -5.607  -6.708  6.283   1.00 0.00 ? 20 CYS A H    9  
ATOM   6326  H HA   . CYS A 1 20 ? -4.164  -4.282  5.694   1.00 0.00 ? 20 CYS A HA   9  
ATOM   6327  H HB2  . CYS A 1 20 ? -2.192  -5.827  5.420   1.00 0.00 ? 20 CYS A HB2  9  
ATOM   6328  H HB3  . CYS A 1 20 ? -2.917  -5.816  7.020   1.00 0.00 ? 20 CYS A HB3  9  
ATOM   6329  N N    . ILE A 1 21 ? -4.398  -4.276  3.268   1.00 0.00 ? 21 ILE A N    9  
ATOM   6330  C CA   . ILE A 1 21 ? -4.519  -4.187  1.815   1.00 0.00 ? 21 ILE A CA   9  
ATOM   6331  C C    . ILE A 1 21 ? -3.196  -3.812  1.163   1.00 0.00 ? 21 ILE A C    9  
ATOM   6332  O O    . ILE A 1 21 ? -2.437  -3.012  1.701   1.00 0.00 ? 21 ILE A O    9  
ATOM   6333  C CB   . ILE A 1 21 ? -5.570  -3.119  1.446   1.00 0.00 ? 21 ILE A CB   9  
ATOM   6334  C CG1  . ILE A 1 21 ? -6.970  -3.585  1.845   1.00 0.00 ? 21 ILE A CG1  9  
ATOM   6335  C CG2  . ILE A 1 21 ? -5.542  -2.767  -0.041  1.00 0.00 ? 21 ILE A CG2  9  
ATOM   6336  C CD1  . ILE A 1 21 ? -7.171  -3.696  3.338   1.00 0.00 ? 21 ILE A CD1  9  
ATOM   6337  H H    . ILE A 1 21 ? -4.375  -3.449  3.789   1.00 0.00 ? 21 ILE A H    9  
ATOM   6338  H HA   . ILE A 1 21 ? -4.848  -5.141  1.440   1.00 0.00 ? 21 ILE A HA   9  
ATOM   6339  H HB   . ILE A 1 21 ? -5.323  -2.228  2.004   1.00 0.00 ? 21 ILE A HB   9  
ATOM   6340  H HG12 . ILE A 1 21 ? -7.699  -2.883  1.466   1.00 0.00 ? 21 ILE A HG12 9  
ATOM   6341  H HG13 . ILE A 1 21 ? -7.156  -4.557  1.411   1.00 0.00 ? 21 ILE A HG13 9  
ATOM   6342  H HG21 . ILE A 1 21 ? -6.101  -3.504  -0.596  1.00 0.00 ? 21 ILE A HG21 9  
ATOM   6343  H HG22 . ILE A 1 21 ? -4.523  -2.744  -0.393  1.00 0.00 ? 21 ILE A HG22 9  
ATOM   6344  H HG23 . ILE A 1 21 ? -5.991  -1.795  -0.186  1.00 0.00 ? 21 ILE A HG23 9  
ATOM   6345  H HD11 . ILE A 1 21 ? -6.596  -2.930  3.834   1.00 0.00 ? 21 ILE A HD11 9  
ATOM   6346  H HD12 . ILE A 1 21 ? -6.841  -4.669  3.673   1.00 0.00 ? 21 ILE A HD12 9  
ATOM   6347  H HD13 . ILE A 1 21 ? -8.217  -3.570  3.571   1.00 0.00 ? 21 ILE A HD13 9  
ATOM   6348  N N    . PRO A 1 22 ? -2.900  -4.373  -0.020  1.00 0.00 ? 22 PRO A N    9  
ATOM   6349  C CA   . PRO A 1 22 ? -1.662  -4.062  -0.729  1.00 0.00 ? 22 PRO A CA   9  
ATOM   6350  C C    . PRO A 1 22 ? -1.681  -2.665  -1.344  1.00 0.00 ? 22 PRO A C    9  
ATOM   6351  O O    . PRO A 1 22 ? -2.632  -2.286  -2.029  1.00 0.00 ? 22 PRO A O    9  
ATOM   6352  C CB   . PRO A 1 22 ? -1.596  -5.134  -1.816  1.00 0.00 ? 22 PRO A CB   9  
ATOM   6353  C CG   . PRO A 1 22 ? -3.020  -5.479  -2.083  1.00 0.00 ? 22 PRO A CG   9  
ATOM   6354  C CD   . PRO A 1 22 ? -3.736  -5.342  -0.759  1.00 0.00 ? 22 PRO A CD   9  
ATOM   6355  H HA   . PRO A 1 22 ? -0.814  -4.146  -0.076  1.00 0.00 ? 22 PRO A HA   9  
ATOM   6356  H HB2  . PRO A 1 22 ? -1.114  -4.732  -2.695  1.00 0.00 ? 22 PRO A HB2  9  
ATOM   6357  H HB3  . PRO A 1 22 ? -1.046  -5.988  -1.452  1.00 0.00 ? 22 PRO A HB3  9  
ATOM   6358  H HG2  . PRO A 1 22 ? -3.432  -4.791  -2.809  1.00 0.00 ? 22 PRO A HG2  9  
ATOM   6359  H HG3  . PRO A 1 22 ? -3.089  -6.495  -2.447  1.00 0.00 ? 22 PRO A HG3  9  
ATOM   6360  H HD2  . PRO A 1 22 ? -4.735  -4.961  -0.902  1.00 0.00 ? 22 PRO A HD2  9  
ATOM   6361  H HD3  . PRO A 1 22 ? -3.765  -6.291  -0.242  1.00 0.00 ? 22 PRO A HD3  9  
ATOM   6362  N N    . CYS A 1 23 ? -0.622  -1.906  -1.087  1.00 0.00 ? 23 CYS A N    9  
ATOM   6363  C CA   . CYS A 1 23 ? -0.505  -0.539  -1.602  1.00 0.00 ? 23 CYS A CA   9  
ATOM   6364  C C    . CYS A 1 23 ? -0.617  -0.500  -3.123  1.00 0.00 ? 23 CYS A C    9  
ATOM   6365  O O    . CYS A 1 23 ? -1.144  0.457   -3.689  1.00 0.00 ? 23 CYS A O    9  
ATOM   6366  C CB   . CYS A 1 23 ? 0.825   0.094   -1.173  1.00 0.00 ? 23 CYS A CB   9  
ATOM   6367  S SG   . CYS A 1 23 ? 1.323   -0.284  0.539   1.00 0.00 ? 23 CYS A SG   9  
ATOM   6368  H H    . CYS A 1 23 ? 0.096   -2.273  -0.531  1.00 0.00 ? 23 CYS A H    9  
ATOM   6369  H HA   . CYS A 1 23 ? -1.314  0.041   -1.182  1.00 0.00 ? 23 CYS A HA   9  
ATOM   6370  H HB2  . CYS A 1 23 ? 1.612   -0.252  -1.828  1.00 0.00 ? 23 CYS A HB2  9  
ATOM   6371  H HB3  . CYS A 1 23 ? 0.744   1.168   -1.260  1.00 0.00 ? 23 CYS A HB3  9  
ATOM   6372  N N    . GLN A 1 24 ? -0.107  -1.536  -3.781  1.00 0.00 ? 24 GLN A N    9  
ATOM   6373  C CA   . GLN A 1 24 ? -0.146  -1.607  -5.245  1.00 0.00 ? 24 GLN A CA   9  
ATOM   6374  C C    . GLN A 1 24 ? -1.543  -1.305  -5.767  1.00 0.00 ? 24 GLN A C    9  
ATOM   6375  O O    . GLN A 1 24 ? -1.712  -0.600  -6.762  1.00 0.00 ? 24 GLN A O    9  
ATOM   6376  C CB   . GLN A 1 24 ? 0.299   -2.988  -5.752  1.00 0.00 ? 24 GLN A CB   9  
ATOM   6377  C CG   . GLN A 1 24 ? 1.154   -3.773  -4.771  1.00 0.00 ? 24 GLN A CG   9  
ATOM   6378  C CD   . GLN A 1 24 ? 1.801   -4.989  -5.407  1.00 0.00 ? 24 GLN A CD   9  
ATOM   6379  O OE1  . GLN A 1 24 ? 2.904   -4.909  -5.946  1.00 0.00 ? 24 GLN A OE1  9  
ATOM   6380  N NE2  . GLN A 1 24 ? 1.114   -6.124  -5.347  1.00 0.00 ? 24 GLN A NE2  9  
ATOM   6381  H H    . GLN A 1 24 ? 0.308   -2.262  -3.275  1.00 0.00 ? 24 GLN A H    9  
ATOM   6382  H HA   . GLN A 1 24 ? 0.525   -0.863  -5.624  1.00 0.00 ? 24 GLN A HA   9  
ATOM   6383  H HB2  . GLN A 1 24 ? -0.579  -3.575  -5.975  1.00 0.00 ? 24 GLN A HB2  9  
ATOM   6384  H HB3  . GLN A 1 24 ? 0.867   -2.854  -6.662  1.00 0.00 ? 24 GLN A HB3  9  
ATOM   6385  H HG2  . GLN A 1 24 ? 1.931   -3.127  -4.392  1.00 0.00 ? 24 GLN A HG2  9  
ATOM   6386  H HG3  . GLN A 1 24 ? 0.528   -4.103  -3.954  1.00 0.00 ? 24 GLN A HG3  9  
ATOM   6387  H HE21 . GLN A 1 24 ? 0.241   -6.113  -4.903  1.00 0.00 ? 24 GLN A HE21 9  
ATOM   6388  H HE22 . GLN A 1 24 ? 1.508   -6.925  -5.749  1.00 0.00 ? 24 GLN A HE22 9  
ATOM   6389  N N    . LEU A 1 25 ? -2.533  -1.853  -5.088  1.00 0.00 ? 25 LEU A N    9  
ATOM   6390  C CA   . LEU A 1 25 ? -3.925  -1.665  -5.467  1.00 0.00 ? 25 LEU A CA   9  
ATOM   6391  C C    . LEU A 1 25 ? -4.369  -0.211  -5.301  1.00 0.00 ? 25 LEU A C    9  
ATOM   6392  O O    . LEU A 1 25 ? -5.420  0.181   -5.806  1.00 0.00 ? 25 LEU A O    9  
ATOM   6393  C CB   . LEU A 1 25 ? -4.827  -2.579  -4.636  1.00 0.00 ? 25 LEU A CB   9  
ATOM   6394  C CG   . LEU A 1 25 ? -6.046  -3.133  -5.377  1.00 0.00 ? 25 LEU A CG   9  
ATOM   6395  C CD1  . LEU A 1 25 ? -5.609  -4.004  -6.546  1.00 0.00 ? 25 LEU A CD1  9  
ATOM   6396  C CD2  . LEU A 1 25 ? -6.938  -3.919  -4.426  1.00 0.00 ? 25 LEU A CD2  9  
ATOM   6397  H H    . LEU A 1 25 ? -2.320  -2.407  -4.314  1.00 0.00 ? 25 LEU A H    9  
ATOM   6398  H HA   . LEU A 1 25 ? -4.017  -1.937  -6.503  1.00 0.00 ? 25 LEU A HA   9  
ATOM   6399  H HB2  . LEU A 1 25 ? -4.235  -3.413  -4.287  1.00 0.00 ? 25 LEU A HB2  9  
ATOM   6400  H HB3  . LEU A 1 25 ? -5.177  -2.024  -3.779  1.00 0.00 ? 25 LEU A HB3  9  
ATOM   6401  H HG   . LEU A 1 25 ? -6.621  -2.309  -5.774  1.00 0.00 ? 25 LEU A HG   9  
ATOM   6402  H HD11 . LEU A 1 25 ? -4.709  -4.538  -6.279  1.00 0.00 ? 25 LEU A HD11 9  
ATOM   6403  H HD12 . LEU A 1 25 ? -5.417  -3.382  -7.406  1.00 0.00 ? 25 LEU A HD12 9  
ATOM   6404  H HD13 . LEU A 1 25 ? -6.391  -4.712  -6.779  1.00 0.00 ? 25 LEU A HD13 9  
ATOM   6405  H HD21 . LEU A 1 25 ? -7.966  -3.615  -4.565  1.00 0.00 ? 25 LEU A HD21 9  
ATOM   6406  H HD22 . LEU A 1 25 ? -6.640  -3.724  -3.407  1.00 0.00 ? 25 LEU A HD22 9  
ATOM   6407  H HD23 . LEU A 1 25 ? -6.846  -4.974  -4.633  1.00 0.00 ? 25 LEU A HD23 9  
ATOM   6408  N N    . ARG A 1 26 ? -3.574  0.586   -4.588  1.00 0.00 ? 26 ARG A N    9  
ATOM   6409  C CA   . ARG A 1 26 ? -3.918  1.989   -4.367  1.00 0.00 ? 26 ARG A CA   9  
ATOM   6410  C C    . ARG A 1 26 ? -2.859  2.940   -4.908  1.00 0.00 ? 26 ARG A C    9  
ATOM   6411  O O    . ARG A 1 26 ? -3.024  4.160   -4.863  1.00 0.00 ? 26 ARG A O    9  
ATOM   6412  C CB   . ARG A 1 26 ? -4.142  2.262   -2.881  1.00 0.00 ? 26 ARG A CB   9  
ATOM   6413  C CG   . ARG A 1 26 ? -5.104  1.287   -2.220  1.00 0.00 ? 26 ARG A CG   9  
ATOM   6414  C CD   . ARG A 1 26 ? -6.451  1.271   -2.925  1.00 0.00 ? 26 ARG A CD   9  
ATOM   6415  N NE   . ARG A 1 26 ? -7.188  2.516   -2.714  1.00 0.00 ? 26 ARG A NE   9  
ATOM   6416  C CZ   . ARG A 1 26 ? -7.956  2.755   -1.654  1.00 0.00 ? 26 ARG A CZ   9  
ATOM   6417  N NH1  . ARG A 1 26 ? -8.089  1.841   -0.699  1.00 0.00 ? 26 ARG A NH1  9  
ATOM   6418  N NH2  . ARG A 1 26 ? -8.594  3.913   -1.547  1.00 0.00 ? 26 ARG A NH2  9  
ATOM   6419  H H    . ARG A 1 26 ? -2.752  0.225   -4.202  1.00 0.00 ? 26 ARG A H    9  
ATOM   6420  H HA   . ARG A 1 26 ? -4.825  2.172   -4.894  1.00 0.00 ? 26 ARG A HA   9  
ATOM   6421  H HB2  . ARG A 1 26 ? -3.193  2.206   -2.371  1.00 0.00 ? 26 ARG A HB2  9  
ATOM   6422  H HB3  . ARG A 1 26 ? -4.542  3.260   -2.769  1.00 0.00 ? 26 ARG A HB3  9  
ATOM   6423  H HG2  . ARG A 1 26 ? -4.677  0.296   -2.258  1.00 0.00 ? 26 ARG A HG2  9  
ATOM   6424  H HG3  . ARG A 1 26 ? -5.248  1.581   -1.191  1.00 0.00 ? 26 ARG A HG3  9  
ATOM   6425  H HD2  . ARG A 1 26 ? -6.279  1.125   -3.981  1.00 0.00 ? 26 ARG A HD2  9  
ATOM   6426  H HD3  . ARG A 1 26 ? -7.026  0.440   -2.543  1.00 0.00 ? 26 ARG A HD3  9  
ATOM   6427  H HE   . ARG A 1 26 ? -7.106  3.210   -3.401  1.00 0.00 ? 26 ARG A HE   9  
ATOM   6428  H HH11 . ARG A 1 26 ? -7.610  0.967   -0.771  1.00 0.00 ? 26 ARG A HH11 9  
ATOM   6429  H HH12 . ARG A 1 26 ? -8.668  2.029   0.094   1.00 0.00 ? 26 ARG A HH12 9  
ATOM   6430  H HH21 . ARG A 1 26 ? -8.497  4.604   -2.262  1.00 0.00 ? 26 ARG A HH21 9  
ATOM   6431  H HH22 . ARG A 1 26 ? -9.172  4.093   -0.750  1.00 0.00 ? 26 ARG A HH22 9  
ATOM   6432  N N    . CYS A 1 27 ? -1.785  2.380   -5.418  1.00 0.00 ? 27 CYS A N    9  
ATOM   6433  C CA   . CYS A 1 27 ? -0.700  3.179   -5.977  1.00 0.00 ? 27 CYS A CA   9  
ATOM   6434  C C    . CYS A 1 27 ? -1.085  3.734   -7.348  1.00 0.00 ? 27 CYS A C    9  
ATOM   6435  O O    . CYS A 1 27 ? -0.481  4.692   -7.830  1.00 0.00 ? 27 CYS A O    9  
ATOM   6436  C CB   . CYS A 1 27 ? 0.587   2.354   -6.095  1.00 0.00 ? 27 CYS A CB   9  
ATOM   6437  S SG   . CYS A 1 27 ? 1.349   1.898   -4.501  1.00 0.00 ? 27 CYS A SG   9  
ATOM   6438  H H    . CYS A 1 27 ? -1.724  1.413   -5.423  1.00 0.00 ? 27 CYS A H    9  
ATOM   6439  H HA   . CYS A 1 27 ? -0.526  4.003   -5.307  1.00 0.00 ? 27 CYS A HA   9  
ATOM   6440  H HB2  . CYS A 1 27 ? 0.371   1.439   -6.626  1.00 0.00 ? 27 CYS A HB2  9  
ATOM   6441  H HB3  . CYS A 1 27 ? 1.316   2.922   -6.655  1.00 0.00 ? 27 CYS A HB3  9  
ATOM   6442  N N    . SER A 1 28 ? -2.086  3.118   -7.978  1.00 0.00 ? 28 SER A N    9  
ATOM   6443  C CA   . SER A 1 28 ? -2.542  3.534   -9.284  1.00 0.00 ? 28 SER A CA   9  
ATOM   6444  C C    . SER A 1 28 ? -3.456  4.759   -9.219  1.00 0.00 ? 28 SER A C    9  
ATOM   6445  O O    . SER A 1 28 ? -4.120  5.098   -10.198 1.00 0.00 ? 28 SER A O    9  
ATOM   6446  C CB   . SER A 1 28 ? -3.264  2.382   -9.987  1.00 0.00 ? 28 SER A CB   9  
ATOM   6447  O OG   . SER A 1 28 ? -4.453  2.031   -9.301  1.00 0.00 ? 28 SER A OG   9  
ATOM   6448  H H    . SER A 1 28 ? -2.514  2.363   -7.564  1.00 0.00 ? 28 SER A H    9  
ATOM   6449  H HA   . SER A 1 28 ? -1.672  3.780   -9.837  1.00 0.00 ? 28 SER A HA   9  
ATOM   6450  H HB2  . SER A 1 28 ? -3.518  2.680   -10.993 1.00 0.00 ? 28 SER A HB2  9  
ATOM   6451  H HB3  . SER A 1 28 ? -2.613  1.520   -10.020 1.00 0.00 ? 28 SER A HB3  9  
ATOM   6452  H HG   . SER A 1 28 ? -5.014  2.805   -9.216  1.00 0.00 ? 28 SER A HG   9  
ATOM   6453  N N    . SER A 1 29 ? -3.482  5.422   -8.069  1.00 0.00 ? 29 SER A N    9  
ATOM   6454  C CA   . SER A 1 29 ? -4.298  6.603   -7.880  1.00 0.00 ? 29 SER A CA   9  
ATOM   6455  C C    . SER A 1 29 ? -3.435  7.845   -7.938  1.00 0.00 ? 29 SER A C    9  
ATOM   6456  O O    . SER A 1 29 ? -2.264  7.793   -8.316  1.00 0.00 ? 29 SER A O    9  
ATOM   6457  C CB   . SER A 1 29 ? -5.027  6.531   -6.537  1.00 0.00 ? 29 SER A CB   9  
ATOM   6458  O OG   . SER A 1 29 ? -5.908  7.629   -6.374  1.00 0.00 ? 29 SER A OG   9  
ATOM   6459  H H    . SER A 1 29 ? -2.934  5.119   -7.329  1.00 0.00 ? 29 SER A H    9  
ATOM   6460  H HA   . SER A 1 29 ? -5.024  6.655   -8.669  1.00 0.00 ? 29 SER A HA   9  
ATOM   6461  H HB2  . SER A 1 29 ? -5.599  5.616   -6.488  1.00 0.00 ? 29 SER A HB2  9  
ATOM   6462  H HB3  . SER A 1 29 ? -4.302  6.545   -5.737  1.00 0.00 ? 29 SER A HB3  9  
ATOM   6463  H HG   . SER A 1 29 ? -6.434  7.503   -5.581  1.00 0.00 ? 29 SER A HG   9  
ATOM   6464  N N    . ASN A 1 30 ? -4.025  8.952   -7.556  1.00 0.00 ? 30 ASN A N    9  
ATOM   6465  C CA   . ASN A 1 30 ? -3.339  10.216  -7.548  1.00 0.00 ? 30 ASN A CA   9  
ATOM   6466  C C    . ASN A 1 30 ? -2.203  10.166  -6.547  1.00 0.00 ? 30 ASN A C    9  
ATOM   6467  O O    . ASN A 1 30 ? -1.029  10.183  -6.917  1.00 0.00 ? 30 ASN A O    9  
ATOM   6468  C CB   . ASN A 1 30 ? -4.303  11.353  -7.204  1.00 0.00 ? 30 ASN A CB   9  
ATOM   6469  C CG   . ASN A 1 30 ? -3.878  12.675  -7.815  1.00 0.00 ? 30 ASN A CG   9  
ATOM   6470  O OD1  . ASN A 1 30 ? -4.560  13.219  -8.683  1.00 0.00 ? 30 ASN A OD1  9  
ATOM   6471  N ND2  . ASN A 1 30 ? -2.744  13.198  -7.363  1.00 0.00 ? 30 ASN A ND2  9  
ATOM   6472  H H    . ASN A 1 30 ? -4.939  8.911   -7.269  1.00 0.00 ? 30 ASN A H    9  
ATOM   6473  H HA   . ASN A 1 30 ? -2.947  10.368  -8.528  1.00 0.00 ? 30 ASN A HA   9  
ATOM   6474  H HB2  . ASN A 1 30 ? -5.287  11.108  -7.575  1.00 0.00 ? 30 ASN A HB2  9  
ATOM   6475  H HB3  . ASN A 1 30 ? -4.347  11.471  -6.133  1.00 0.00 ? 30 ASN A HB3  9  
ATOM   6476  H HD21 . ASN A 1 30 ? -2.252  12.708  -6.670  1.00 0.00 ? 30 ASN A HD21 9  
ATOM   6477  H HD22 . ASN A 1 30 ? -2.445  14.052  -7.740  1.00 0.00 ? 30 ASN A HD22 9  
ATOM   6478  N N    . THR A 1 31 ? -2.571  10.077  -5.275  1.00 0.00 ? 31 THR A N    9  
ATOM   6479  C CA   . THR A 1 31 ? -1.597  10.001  -4.200  1.00 0.00 ? 31 THR A CA   9  
ATOM   6480  C C    . THR A 1 31 ? -2.264  9.724   -2.849  1.00 0.00 ? 31 THR A C    9  
ATOM   6481  O O    . THR A 1 31 ? -2.252  10.578  -1.962  1.00 0.00 ? 31 THR A O    9  
ATOM   6482  C CB   . THR A 1 31 ? -0.793  11.301  -4.128  1.00 0.00 ? 31 THR A CB   9  
ATOM   6483  O OG1  . THR A 1 31 ? 0.002   11.472  -5.286  1.00 0.00 ? 31 THR A OG1  9  
ATOM   6484  C CG2  . THR A 1 31 ? 0.130   11.382  -2.929  1.00 0.00 ? 31 THR A CG2  9  
ATOM   6485  H H    . THR A 1 31 ? -3.520  10.050  -5.062  1.00 0.00 ? 31 THR A H    9  
ATOM   6486  H HA   . THR A 1 31 ? -0.937  9.196   -4.429  1.00 0.00 ? 31 THR A HA   9  
ATOM   6487  H HB   . THR A 1 31 ? -1.485  12.124  -4.069  1.00 0.00 ? 31 THR A HB   9  
ATOM   6488  H HG1  . THR A 1 31 ? 0.211   12.403  -5.397  1.00 0.00 ? 31 THR A HG1  9  
ATOM   6489  H HG21 . THR A 1 31 ? -0.185  12.189  -2.285  1.00 0.00 ? 31 THR A HG21 9  
ATOM   6490  H HG22 . THR A 1 31 ? 1.141   11.562  -3.264  1.00 0.00 ? 31 THR A HG22 9  
ATOM   6491  H HG23 . THR A 1 31 ? 0.093   10.450  -2.383  1.00 0.00 ? 31 THR A HG23 9  
ATOM   6492  N N    . PRO A 1 32 ? -2.878  8.534   -2.665  1.00 0.00 ? 32 PRO A N    9  
ATOM   6493  C CA   . PRO A 1 32 ? -3.550  8.176   -1.432  1.00 0.00 ? 32 PRO A CA   9  
ATOM   6494  C C    . PRO A 1 32 ? -2.784  7.180   -0.539  1.00 0.00 ? 32 PRO A C    9  
ATOM   6495  O O    . PRO A 1 32 ? -3.399  6.512   0.291   1.00 0.00 ? 32 PRO A O    9  
ATOM   6496  C CB   . PRO A 1 32 ? -4.819  7.516   -1.974  1.00 0.00 ? 32 PRO A CB   9  
ATOM   6497  C CG   . PRO A 1 32 ? -4.436  6.945   -3.319  1.00 0.00 ? 32 PRO A CG   9  
ATOM   6498  C CD   . PRO A 1 32 ? -3.016  7.441   -3.627  1.00 0.00 ? 32 PRO A CD   9  
ATOM   6499  H HA   . PRO A 1 32 ? -3.811  9.047   -0.858  1.00 0.00 ? 32 PRO A HA   9  
ATOM   6500  H HB2  . PRO A 1 32 ? -5.140  6.740   -1.294  1.00 0.00 ? 32 PRO A HB2  9  
ATOM   6501  H HB3  . PRO A 1 32 ? -5.598  8.257   -2.072  1.00 0.00 ? 32 PRO A HB3  9  
ATOM   6502  H HG2  . PRO A 1 32 ? -4.466  5.861   -3.271  1.00 0.00 ? 32 PRO A HG2  9  
ATOM   6503  H HG3  . PRO A 1 32 ? -5.136  7.299   -4.067  1.00 0.00 ? 32 PRO A HG3  9  
ATOM   6504  H HD2  . PRO A 1 32 ? -2.281  6.666   -3.436  1.00 0.00 ? 32 PRO A HD2  9  
ATOM   6505  H HD3  . PRO A 1 32 ? -2.929  7.799   -4.645  1.00 0.00 ? 32 PRO A HD3  9  
ATOM   6506  N N    . PRO A 1 33 ? -1.445  7.042   -0.680  1.00 0.00 ? 33 PRO A N    9  
ATOM   6507  C CA   . PRO A 1 33 ? -0.662  6.111   0.126   1.00 0.00 ? 33 PRO A CA   9  
ATOM   6508  C C    . PRO A 1 33 ? 0.004   6.771   1.319   1.00 0.00 ? 33 PRO A C    9  
ATOM   6509  O O    . PRO A 1 33 ? 1.181   7.123   1.268   1.00 0.00 ? 33 PRO A O    9  
ATOM   6510  C CB   . PRO A 1 33 ? 0.387   5.676   -0.878  1.00 0.00 ? 33 PRO A CB   9  
ATOM   6511  C CG   . PRO A 1 33 ? 0.710   6.939   -1.607  1.00 0.00 ? 33 PRO A CG   9  
ATOM   6512  C CD   . PRO A 1 33 ? -0.568  7.752   -1.629  1.00 0.00 ? 33 PRO A CD   9  
ATOM   6513  H HA   . PRO A 1 33 ? -1.233  5.262   0.457   1.00 0.00 ? 33 PRO A HA   9  
ATOM   6514  H HB2  . PRO A 1 33 ? 1.246   5.277   -0.361  1.00 0.00 ? 33 PRO A HB2  9  
ATOM   6515  H HB3  . PRO A 1 33 ? -0.027  4.932   -1.540  1.00 0.00 ? 33 PRO A HB3  9  
ATOM   6516  H HG2  . PRO A 1 33 ? 1.485   7.477   -1.082  1.00 0.00 ? 33 PRO A HG2  9  
ATOM   6517  H HG3  . PRO A 1 33 ? 1.026   6.711   -2.614  1.00 0.00 ? 33 PRO A HG3  9  
ATOM   6518  H HD2  . PRO A 1 33 ? -0.383  8.764   -1.300  1.00 0.00 ? 33 PRO A HD2  9  
ATOM   6519  H HD3  . PRO A 1 33 ? -0.983  7.747   -2.617  1.00 0.00 ? 33 PRO A HD3  9  
ATOM   6520  N N    . LEU A 1 34 ? -0.741  6.932   2.399   1.00 0.00 ? 34 LEU A N    9  
ATOM   6521  C CA   . LEU A 1 34 ? -0.161  7.550   3.591   1.00 0.00 ? 34 LEU A CA   9  
ATOM   6522  C C    . LEU A 1 34 ? 0.873   6.626   4.226   1.00 0.00 ? 34 LEU A C    9  
ATOM   6523  O O    . LEU A 1 34 ? 2.007   7.041   4.466   1.00 0.00 ? 34 LEU A O    9  
ATOM   6524  C CB   . LEU A 1 34 ? -1.208  8.033   4.628   1.00 0.00 ? 34 LEU A CB   9  
ATOM   6525  C CG   . LEU A 1 34 ? -2.492  7.202   4.826   1.00 0.00 ? 34 LEU A CG   9  
ATOM   6526  C CD1  . LEU A 1 34 ? -2.190  5.873   5.506   1.00 0.00 ? 34 LEU A CD1  9  
ATOM   6527  C CD2  . LEU A 1 34 ? -3.489  7.996   5.660   1.00 0.00 ? 34 LEU A CD2  9  
ATOM   6528  H H    . LEU A 1 34 ? -1.669  6.637   2.385   1.00 0.00 ? 34 LEU A H    9  
ATOM   6529  H HA   . LEU A 1 34 ? 0.383   8.409   3.233   1.00 0.00 ? 34 LEU A HA   9  
ATOM   6530  H HB2  . LEU A 1 34 ? -0.713  8.094   5.584   1.00 0.00 ? 34 LEU A HB2  9  
ATOM   6531  H HB3  . LEU A 1 34 ? -1.505  9.033   4.346   1.00 0.00 ? 34 LEU A HB3  9  
ATOM   6532  H HG   . LEU A 1 34 ? -2.956  7.004   3.873   1.00 0.00 ? 34 LEU A HG   9  
ATOM   6533  H HD11 . LEU A 1 34 ? -2.275  5.070   4.789   1.00 0.00 ? 34 LEU A HD11 9  
ATOM   6534  H HD12 . LEU A 1 34 ? -2.895  5.711   6.309   1.00 0.00 ? 34 LEU A HD12 9  
ATOM   6535  H HD13 . LEU A 1 34 ? -1.189  5.893   5.909   1.00 0.00 ? 34 LEU A HD13 9  
ATOM   6536  H HD21 . LEU A 1 34 ? -3.377  7.732   6.701   1.00 0.00 ? 34 LEU A HD21 9  
ATOM   6537  H HD22 . LEU A 1 34 ? -4.493  7.767   5.336   1.00 0.00 ? 34 LEU A HD22 9  
ATOM   6538  H HD23 . LEU A 1 34 ? -3.303  9.052   5.535   1.00 0.00 ? 34 LEU A HD23 9  
ATOM   6539  N N    . THR A 1 35 ? 0.512   5.371   4.463   1.00 0.00 ? 35 THR A N    9  
ATOM   6540  C CA   . THR A 1 35 ? 1.449   4.419   5.021   1.00 0.00 ? 35 THR A CA   9  
ATOM   6541  C C    . THR A 1 35 ? 2.172   3.686   3.892   1.00 0.00 ? 35 THR A C    9  
ATOM   6542  O O    . THR A 1 35 ? 2.924   2.743   4.137   1.00 0.00 ? 35 THR A O    9  
ATOM   6543  C CB   . THR A 1 35 ? 0.725   3.417   5.923   1.00 0.00 ? 35 THR A CB   9  
ATOM   6544  O OG1  . THR A 1 35 ? 1.652   2.557   6.561   1.00 0.00 ? 35 THR A OG1  9  
ATOM   6545  C CG2  . THR A 1 35 ? -0.270  2.551   5.180   1.00 0.00 ? 35 THR A CG2  9  
ATOM   6546  H H    . THR A 1 35 ? -0.383  5.069   4.234   1.00 0.00 ? 35 THR A H    9  
ATOM   6547  H HA   . THR A 1 35 ? 2.170   4.966   5.607   1.00 0.00 ? 35 THR A HA   9  
ATOM   6548  H HB   . THR A 1 35 ? 0.185   3.960   6.686   1.00 0.00 ? 35 THR A HB   9  
ATOM   6549  H HG1  . THR A 1 35 ? 1.238   2.149   7.325   1.00 0.00 ? 35 THR A HG1  9  
ATOM   6550  H HG21 . THR A 1 35 ? -0.861  1.992   5.890   1.00 0.00 ? 35 THR A HG21 9  
ATOM   6551  H HG22 . THR A 1 35 ? 0.260   1.867   4.535   1.00 0.00 ? 35 THR A HG22 9  
ATOM   6552  H HG23 . THR A 1 35 ? -0.918  3.177   4.585   1.00 0.00 ? 35 THR A HG23 9  
ATOM   6553  N N    . CYS A 1 36 ? 1.931   4.119   2.647   1.00 0.00 ? 36 CYS A N    9  
ATOM   6554  C CA   . CYS A 1 36 ? 2.555   3.486   1.495   1.00 0.00 ? 36 CYS A CA   9  
ATOM   6555  C C    . CYS A 1 36 ? 3.278   4.491   0.599   1.00 0.00 ? 36 CYS A C    9  
ATOM   6556  O O    . CYS A 1 36 ? 3.883   4.105   -0.400  1.00 0.00 ? 36 CYS A O    9  
ATOM   6557  C CB   . CYS A 1 36 ? 1.504   2.732   0.683   1.00 0.00 ? 36 CYS A CB   9  
ATOM   6558  S SG   . CYS A 1 36 ? 0.727   1.351   1.580   1.00 0.00 ? 36 CYS A SG   9  
ATOM   6559  H H    . CYS A 1 36 ? 1.314   4.872   2.501   1.00 0.00 ? 36 CYS A H    9  
ATOM   6560  H HA   . CYS A 1 36 ? 3.275   2.779   1.865   1.00 0.00 ? 36 CYS A HA   9  
ATOM   6561  H HB2  . CYS A 1 36 ? 0.722   3.419   0.395   1.00 0.00 ? 36 CYS A HB2  9  
ATOM   6562  H HB3  . CYS A 1 36 ? 1.967   2.330   -0.206  1.00 0.00 ? 36 CYS A HB3  9  
ATOM   6563  N N    . GLN A 1 37 ? 3.214   5.778   0.942   1.00 0.00 ? 37 GLN A N    9  
ATOM   6564  C CA   . GLN A 1 37 ? 3.867   6.807   0.137   1.00 0.00 ? 37 GLN A CA   9  
ATOM   6565  C C    . GLN A 1 37 ? 5.306   6.426   -0.190  1.00 0.00 ? 37 GLN A C    9  
ATOM   6566  O O    . GLN A 1 37 ? 5.853   6.844   -1.209  1.00 0.00 ? 37 GLN A O    9  
ATOM   6567  C CB   . GLN A 1 37 ? 3.830   8.156   0.857   1.00 0.00 ? 37 GLN A CB   9  
ATOM   6568  C CG   . GLN A 1 37 ? 3.406   9.312   -0.035  1.00 0.00 ? 37 GLN A CG   9  
ATOM   6569  C CD   . GLN A 1 37 ? 3.699   10.664  0.584   1.00 0.00 ? 37 GLN A CD   9  
ATOM   6570  O OE1  . GLN A 1 37 ? 4.808   11.185  0.472   1.00 0.00 ? 37 GLN A OE1  9  
ATOM   6571  N NE2  . GLN A 1 37 ? 2.702   11.241  1.245   1.00 0.00 ? 37 GLN A NE2  9  
ATOM   6572  H H    . GLN A 1 37 ? 2.712   6.046   1.744   1.00 0.00 ? 37 GLN A H    9  
ATOM   6573  H HA   . GLN A 1 37 ? 3.321   6.886   -0.790  1.00 0.00 ? 37 GLN A HA   9  
ATOM   6574  H HB2  . GLN A 1 37 ? 3.135   8.093   1.681   1.00 0.00 ? 37 GLN A HB2  9  
ATOM   6575  H HB3  . GLN A 1 37 ? 4.815   8.373   1.245   1.00 0.00 ? 37 GLN A HB3  9  
ATOM   6576  H HG2  . GLN A 1 37 ? 3.939   9.240   -0.972  1.00 0.00 ? 37 GLN A HG2  9  
ATOM   6577  H HG3  . GLN A 1 37 ? 2.345   9.237   -0.219  1.00 0.00 ? 37 GLN A HG3  9  
ATOM   6578  H HE21 . GLN A 1 37 ? 1.845   10.767  1.296   1.00 0.00 ? 37 GLN A HE21 9  
ATOM   6579  H HE22 . GLN A 1 37 ? 2.862   12.116  1.656   1.00 0.00 ? 37 GLN A HE22 9  
ATOM   6580  N N    . ARG A 1 38 ? 5.910   5.622   0.673   1.00 0.00 ? 38 ARG A N    9  
ATOM   6581  C CA   . ARG A 1 38 ? 7.278   5.176   0.468   1.00 0.00 ? 38 ARG A CA   9  
ATOM   6582  C C    . ARG A 1 38 ? 7.306   4.012   -0.521  1.00 0.00 ? 38 ARG A C    9  
ATOM   6583  O O    . ARG A 1 38 ? 8.239   3.875   -1.311  1.00 0.00 ? 38 ARG A O    9  
ATOM   6584  C CB   . ARG A 1 38 ? 7.905   4.776   1.812   1.00 0.00 ? 38 ARG A CB   9  
ATOM   6585  C CG   . ARG A 1 38 ? 8.794   3.542   1.750   1.00 0.00 ? 38 ARG A CG   9  
ATOM   6586  C CD   . ARG A 1 38 ? 9.606   3.376   3.025   1.00 0.00 ? 38 ARG A CD   9  
ATOM   6587  N NE   . ARG A 1 38 ? 10.766  4.263   3.047   1.00 0.00 ? 38 ARG A NE   9  
ATOM   6588  C CZ   . ARG A 1 38 ? 11.935  3.973   2.476   1.00 0.00 ? 38 ARG A CZ   9  
ATOM   6589  N NH1  . ARG A 1 38 ? 12.102  2.824   1.832   1.00 0.00 ? 38 ARG A NH1  9  
ATOM   6590  N NH2  . ARG A 1 38 ? 12.939  4.837   2.547   1.00 0.00 ? 38 ARG A NH2  9  
ATOM   6591  H H    . ARG A 1 38 ? 5.420   5.315   1.461   1.00 0.00 ? 38 ARG A H    9  
ATOM   6592  H HA   . ARG A 1 38 ? 7.837   6.002   0.049   1.00 0.00 ? 38 ARG A HA   9  
ATOM   6593  H HB2  . ARG A 1 38 ? 8.501   5.599   2.174   1.00 0.00 ? 38 ARG A HB2  9  
ATOM   6594  H HB3  . ARG A 1 38 ? 7.112   4.583   2.519   1.00 0.00 ? 38 ARG A HB3  9  
ATOM   6595  H HG2  . ARG A 1 38 ? 8.171   2.670   1.616   1.00 0.00 ? 38 ARG A HG2  9  
ATOM   6596  H HG3  . ARG A 1 38 ? 9.469   3.639   0.913   1.00 0.00 ? 38 ARG A HG3  9  
ATOM   6597  H HD2  . ARG A 1 38 ? 8.965   3.597   3.867   1.00 0.00 ? 38 ARG A HD2  9  
ATOM   6598  H HD3  . ARG A 1 38 ? 9.932   2.349   3.091   1.00 0.00 ? 38 ARG A HD3  9  
ATOM   6599  H HE   . ARG A 1 38 ? 10.672  5.120   3.512   1.00 0.00 ? 38 ARG A HE   9  
ATOM   6600  H HH11 . ARG A 1 38 ? 11.350  2.169   1.771   1.00 0.00 ? 38 ARG A HH11 9  
ATOM   6601  H HH12 . ARG A 1 38 ? 12.982  2.614   1.406   1.00 0.00 ? 38 ARG A HH12 9  
ATOM   6602  H HH21 . ARG A 1 38 ? 12.818  5.705   3.029   1.00 0.00 ? 38 ARG A HH21 9  
ATOM   6603  H HH22 . ARG A 1 38 ? 13.816  4.620   2.119   1.00 0.00 ? 38 ARG A HH22 9  
ATOM   6604  N N    . TYR A 1 39 ? 6.272   3.177   -0.470  1.00 0.00 ? 39 TYR A N    9  
ATOM   6605  C CA   . TYR A 1 39 ? 6.174   2.024   -1.350  1.00 0.00 ? 39 TYR A CA   9  
ATOM   6606  C C    . TYR A 1 39 ? 5.643   2.404   -2.723  1.00 0.00 ? 39 TYR A C    9  
ATOM   6607  O O    . TYR A 1 39 ? 6.172   1.960   -3.742  1.00 0.00 ? 39 TYR A O    9  
ATOM   6608  C CB   . TYR A 1 39 ? 5.285   0.947   -0.725  1.00 0.00 ? 39 TYR A CB   9  
ATOM   6609  C CG   . TYR A 1 39 ? 5.535   -0.431  -1.292  1.00 0.00 ? 39 TYR A CG   9  
ATOM   6610  C CD1  . TYR A 1 39 ? 6.494   -1.267  -0.736  1.00 0.00 ? 39 TYR A CD1  9  
ATOM   6611  C CD2  . TYR A 1 39 ? 4.825   -0.888  -2.394  1.00 0.00 ? 39 TYR A CD2  9  
ATOM   6612  C CE1  . TYR A 1 39 ? 6.736   -2.522  -1.259  1.00 0.00 ? 39 TYR A CE1  9  
ATOM   6613  C CE2  . TYR A 1 39 ? 5.063   -2.141  -2.926  1.00 0.00 ? 39 TYR A CE2  9  
ATOM   6614  C CZ   . TYR A 1 39 ? 6.019   -2.954  -2.354  1.00 0.00 ? 39 TYR A CZ   9  
ATOM   6615  O OH   . TYR A 1 39 ? 6.258   -4.202  -2.880  1.00 0.00 ? 39 TYR A OH   9  
ATOM   6616  H H    . TYR A 1 39 ? 5.564   3.336   0.177   1.00 0.00 ? 39 TYR A H    9  
ATOM   6617  H HA   . TYR A 1 39 ? 7.164   1.628   -1.470  1.00 0.00 ? 39 TYR A HA   9  
ATOM   6618  H HB2  . TYR A 1 39 ? 5.468   0.908   0.338   1.00 0.00 ? 39 TYR A HB2  9  
ATOM   6619  H HB3  . TYR A 1 39 ? 4.249   1.197   -0.900  1.00 0.00 ? 39 TYR A HB3  9  
ATOM   6620  H HD1  . TYR A 1 39 ? 7.054   -0.926  0.122   1.00 0.00 ? 39 TYR A HD1  9  
ATOM   6621  H HD2  . TYR A 1 39 ? 4.076   -0.249  -2.838  1.00 0.00 ? 39 TYR A HD2  9  
ATOM   6622  H HE1  . TYR A 1 39 ? 7.485   -3.159  -0.812  1.00 0.00 ? 39 TYR A HE1  9  
ATOM   6623  H HE2  . TYR A 1 39 ? 4.500   -2.479  -3.783  1.00 0.00 ? 39 TYR A HE2  9  
ATOM   6624  H HH   . TYR A 1 39 ? 5.439   -4.703  -2.905  1.00 0.00 ? 39 TYR A HH   9  
ATOM   6625  N N    . CYS A 1 40 ? 4.605   3.228   -2.757  1.00 0.00 ? 40 CYS A N    9  
ATOM   6626  C CA   . CYS A 1 40 ? 4.034   3.650   -4.030  1.00 0.00 ? 40 CYS A CA   9  
ATOM   6627  C C    . CYS A 1 40 ? 5.079   4.403   -4.842  1.00 0.00 ? 40 CYS A C    9  
ATOM   6628  O O    . CYS A 1 40 ? 5.202   4.199   -6.049  1.00 0.00 ? 40 CYS A O    9  
ATOM   6629  C CB   . CYS A 1 40 ? 2.791   4.520   -3.824  1.00 0.00 ? 40 CYS A CB   9  
ATOM   6630  S SG   . CYS A 1 40 ? 1.273   3.600   -3.392  1.00 0.00 ? 40 CYS A SG   9  
ATOM   6631  H H    . CYS A 1 40 ? 4.223   3.561   -1.915  1.00 0.00 ? 40 CYS A H    9  
ATOM   6632  H HA   . CYS A 1 40 ? 3.761   2.762   -4.576  1.00 0.00 ? 40 CYS A HA   9  
ATOM   6633  H HB2  . CYS A 1 40 ? 2.983   5.221   -3.026  1.00 0.00 ? 40 CYS A HB2  9  
ATOM   6634  H HB3  . CYS A 1 40 ? 2.593   5.069   -4.734  1.00 0.00 ? 40 CYS A HB3  9  
ATOM   6635  N N    . ASN A 1 41 ? 5.846   5.255   -4.170  1.00 0.00 ? 41 ASN A N    9  
ATOM   6636  C CA   . ASN A 1 41 ? 6.890   6.009   -4.840  1.00 0.00 ? 41 ASN A CA   9  
ATOM   6637  C C    . ASN A 1 41 ? 8.059   5.096   -5.192  1.00 0.00 ? 41 ASN A C    9  
ATOM   6638  O O    . ASN A 1 41 ? 8.921   5.448   -5.997  1.00 0.00 ? 41 ASN A O    9  
ATOM   6639  C CB   . ASN A 1 41 ? 7.342   7.201   -3.979  1.00 0.00 ? 41 ASN A CB   9  
ATOM   6640  C CG   . ASN A 1 41 ? 8.720   7.020   -3.364  1.00 0.00 ? 41 ASN A CG   9  
ATOM   6641  O OD1  . ASN A 1 41 ? 9.613   7.843   -3.562  1.00 0.00 ? 41 ASN A OD1  9  
ATOM   6642  N ND2  . ASN A 1 41 ? 8.896   5.941   -2.614  1.00 0.00 ? 41 ASN A ND2  9  
ATOM   6643  H H    . ASN A 1 41 ? 5.716   5.367   -3.210  1.00 0.00 ? 41 ASN A H    9  
ATOM   6644  H HA   . ASN A 1 41 ? 6.470   6.375   -5.753  1.00 0.00 ? 41 ASN A HA   9  
ATOM   6645  H HB2  . ASN A 1 41 ? 7.364   8.089   -4.594  1.00 0.00 ? 41 ASN A HB2  9  
ATOM   6646  H HB3  . ASN A 1 41 ? 6.630   7.346   -3.181  1.00 0.00 ? 41 ASN A HB3  9  
ATOM   6647  H HD21 . ASN A 1 41 ? 8.140   5.328   -2.498  1.00 0.00 ? 41 ASN A HD21 9  
ATOM   6648  H HD22 . ASN A 1 41 ? 9.776   5.800   -2.205  1.00 0.00 ? 41 ASN A HD22 9  
ATOM   6649  N N    . ALA A 1 42 ? 8.062   3.911   -4.595  1.00 0.00 ? 42 ALA A N    9  
ATOM   6650  C CA   . ALA A 1 42 ? 9.100   2.926   -4.854  1.00 0.00 ? 42 ALA A CA   9  
ATOM   6651  C C    . ALA A 1 42 ? 8.512   1.712   -5.556  1.00 0.00 ? 42 ALA A C    9  
ATOM   6652  O O    . ALA A 1 42 ? 9.039   0.603   -5.470  1.00 0.00 ? 42 ALA A O    9  
ATOM   6653  C CB   . ALA A 1 42 ? 9.791   2.519   -3.560  1.00 0.00 ? 42 ALA A CB   9  
ATOM   6654  H H    . ALA A 1 42 ? 7.335   3.689   -3.978  1.00 0.00 ? 42 ALA A H    9  
ATOM   6655  H HA   . ALA A 1 42 ? 9.828   3.379   -5.504  1.00 0.00 ? 42 ALA A HA   9  
ATOM   6656  H HB1  . ALA A 1 42 ? 9.237   1.720   -3.092  1.00 0.00 ? 42 ALA A HB1  9  
ATOM   6657  H HB2  . ALA A 1 42 ? 9.835   3.367   -2.894  1.00 0.00 ? 42 ALA A HB2  9  
ATOM   6658  H HB3  . ALA A 1 42 ? 10.794  2.182   -3.779  1.00 0.00 ? 42 ALA A HB3  9  
ATOM   6659  N N    . SER A 1 43 ? 7.410   1.945   -6.257  1.00 0.00 ? 43 SER A N    9  
ATOM   6660  C CA   . SER A 1 43 ? 6.723   0.897   -6.993  1.00 0.00 ? 43 SER A CA   9  
ATOM   6661  C C    . SER A 1 43 ? 6.418   1.349   -8.419  1.00 0.00 ? 43 SER A C    9  
ATOM   6662  O O    . SER A 1 43 ? 6.473   0.552   -9.356  1.00 0.00 ? 43 SER A O    9  
ATOM   6663  C CB   . SER A 1 43 ? 5.428   0.505   -6.279  1.00 0.00 ? 43 SER A CB   9  
ATOM   6664  O OG   . SER A 1 43 ? 5.634   -0.606  -5.423  1.00 0.00 ? 43 SER A OG   9  
ATOM   6665  H H    . SER A 1 43 ? 7.053   2.850   -6.280  1.00 0.00 ? 43 SER A H    9  
ATOM   6666  H HA   . SER A 1 43 ? 7.376   0.045   -7.030  1.00 0.00 ? 43 SER A HA   9  
ATOM   6667  H HB2  . SER A 1 43 ? 5.078   1.338   -5.688  1.00 0.00 ? 43 SER A HB2  9  
ATOM   6668  H HB3  . SER A 1 43 ? 4.679   0.244   -7.012  1.00 0.00 ? 43 SER A HB3  9  
ATOM   6669  H HG   . SER A 1 43 ? 6.412   -0.453  -4.880  1.00 0.00 ? 43 SER A HG   9  
ATOM   6670  N N    . VAL A 1 44 ? 6.094   2.631   -8.578  1.00 0.00 ? 44 VAL A N    9  
ATOM   6671  C CA   . VAL A 1 44 ? 5.782   3.184   -9.892  1.00 0.00 ? 44 VAL A CA   9  
ATOM   6672  C C    . VAL A 1 44 ? 4.588   2.469   -10.515 1.00 0.00 ? 44 VAL A C    9  
ATOM   6673  O O    . VAL A 1 44 ? 4.690   1.897   -11.601 1.00 0.00 ? 44 VAL A O    9  
ATOM   6674  C CB   . VAL A 1 44 ? 6.989   3.083   -10.845 1.00 0.00 ? 44 VAL A CB   9  
ATOM   6675  C CG1  . VAL A 1 44 ? 6.706   3.819   -12.146 1.00 0.00 ? 44 VAL A CG1  9  
ATOM   6676  C CG2  . VAL A 1 44 ? 8.243   3.627   -10.178 1.00 0.00 ? 44 VAL A CG2  9  
ATOM   6677  H H    . VAL A 1 44 ? 6.063   3.218   -7.791  1.00 0.00 ? 44 VAL A H    9  
ATOM   6678  H HA   . VAL A 1 44 ? 5.534   4.228   -9.766  1.00 0.00 ? 44 VAL A HA   9  
ATOM   6679  H HB   . VAL A 1 44 ? 7.153   2.042   -11.077 1.00 0.00 ? 44 VAL A HB   9  
ATOM   6680  H HG11 . VAL A 1 44 ? 7.027   4.847   -12.055 1.00 0.00 ? 44 VAL A HG11 9  
ATOM   6681  H HG12 . VAL A 1 44 ? 5.646   3.790   -12.354 1.00 0.00 ? 44 VAL A HG12 9  
ATOM   6682  H HG13 . VAL A 1 44 ? 7.244   3.344   -12.952 1.00 0.00 ? 44 VAL A HG13 9  
ATOM   6683  H HG21 . VAL A 1 44 ? 8.264   4.703   -10.273 1.00 0.00 ? 44 VAL A HG21 9  
ATOM   6684  H HG22 . VAL A 1 44 ? 9.116   3.208   -10.657 1.00 0.00 ? 44 VAL A HG22 9  
ATOM   6685  H HG23 . VAL A 1 44 ? 8.242   3.358   -9.133  1.00 0.00 ? 44 VAL A HG23 9  
ATOM   6686  N N    . THR A 1 45 ? 3.458   2.510   -9.814  1.00 0.00 ? 45 THR A N    9  
ATOM   6687  C CA   . THR A 1 45 ? 2.223   1.876   -10.277 1.00 0.00 ? 45 THR A CA   9  
ATOM   6688  C C    . THR A 1 45 ? 2.275   0.350   -10.145 1.00 0.00 ? 45 THR A C    9  
ATOM   6689  O O    . THR A 1 45 ? 1.244   -0.318  -10.237 1.00 0.00 ? 45 THR A O    9  
ATOM   6690  C CB   . THR A 1 45 ? 1.934   2.271   -11.725 1.00 0.00 ? 45 THR A CB   9  
ATOM   6691  O OG1  . THR A 1 45 ? 1.792   3.675   -11.842 1.00 0.00 ? 45 THR A OG1  9  
ATOM   6692  C CG2  . THR A 1 45 ? 0.681   1.634   -12.285 1.00 0.00 ? 45 THR A CG2  9  
ATOM   6693  H H    . THR A 1 45 ? 3.452   2.984   -8.960  1.00 0.00 ? 45 THR A H    9  
ATOM   6694  H HA   . THR A 1 45 ? 1.423   2.243   -9.655  1.00 0.00 ? 45 THR A HA   9  
ATOM   6695  H HB   . THR A 1 45 ? 2.765   1.963   -12.338 1.00 0.00 ? 45 THR A HB   9  
ATOM   6696  H HG1  . THR A 1 45 ? 1.615   3.904   -12.757 1.00 0.00 ? 45 THR A HG1  9  
ATOM   6697  H HG21 . THR A 1 45 ? 0.061   1.283   -11.473 1.00 0.00 ? 45 THR A HG21 9  
ATOM   6698  H HG22 . THR A 1 45 ? 0.953   0.803   -12.917 1.00 0.00 ? 45 THR A HG22 9  
ATOM   6699  H HG23 . THR A 1 45 ? 0.135   2.364   -12.865 1.00 0.00 ? 45 THR A HG23 9  
ATOM   6700  N N    . ASN A 1 46 ? 3.466   -0.197  -9.926  1.00 0.00 ? 46 ASN A N    9  
ATOM   6701  C CA   . ASN A 1 46 ? 3.633   -1.640  -9.782  1.00 0.00 ? 46 ASN A CA   9  
ATOM   6702  C C    . ASN A 1 46 ? 3.203   -2.375  -11.046 1.00 0.00 ? 46 ASN A C    9  
ATOM   6703  O O    . ASN A 1 46 ? 2.681   -3.488  -10.984 1.00 0.00 ? 46 ASN A O    9  
ATOM   6704  C CB   . ASN A 1 46 ? 2.838   -2.148  -8.577  1.00 0.00 ? 46 ASN A CB   9  
ATOM   6705  C CG   . ASN A 1 46 ? 3.680   -2.227  -7.318  1.00 0.00 ? 46 ASN A CG   9  
ATOM   6706  O OD1  . ASN A 1 46 ? 4.744   -2.846  -7.306  1.00 0.00 ? 46 ASN A OD1  9  
ATOM   6707  N ND2  . ASN A 1 46 ? 3.209   -1.593  -6.251  1.00 0.00 ? 46 ASN A ND2  9  
ATOM   6708  H H    . ASN A 1 46 ? 4.252   0.379   -9.858  1.00 0.00 ? 46 ASN A H    9  
ATOM   6709  H HA   . ASN A 1 46 ? 4.679   -1.832  -9.619  1.00 0.00 ? 46 ASN A HA   9  
ATOM   6710  H HB2  . ASN A 1 46 ? 2.010   -1.480  -8.392  1.00 0.00 ? 46 ASN A HB2  9  
ATOM   6711  H HB3  . ASN A 1 46 ? 2.456   -3.135  -8.795  1.00 0.00 ? 46 ASN A HB3  9  
ATOM   6712  H HD21 . ASN A 1 46 ? 2.357   -1.116  -6.335  1.00 0.00 ? 46 ASN A HD21 9  
ATOM   6713  H HD22 . ASN A 1 46 ? 3.733   -1.627  -5.424  1.00 0.00 ? 46 ASN A HD22 9  
ATOM   6714  N N    . SER A 1 47 ? 3.445   -1.746  -12.187 1.00 0.00 ? 47 SER A N    9  
ATOM   6715  C CA   . SER A 1 47 ? 3.104   -2.329  -13.483 1.00 0.00 ? 47 SER A CA   9  
ATOM   6716  C C    . SER A 1 47 ? 1.618   -2.675  -13.578 1.00 0.00 ? 47 SER A C    9  
ATOM   6717  O O    . SER A 1 47 ? 1.100   -3.449  -12.777 1.00 0.00 ? 47 SER A O    9  
ATOM   6718  C CB   . SER A 1 47 ? 3.945   -3.585  -13.730 1.00 0.00 ? 47 SER A CB   9  
ATOM   6719  O OG   . SER A 1 47 ? 3.364   -4.720  -13.113 1.00 0.00 ? 47 SER A OG   9  
ATOM   6720  H H    . SER A 1 47 ? 3.877   -0.868  -12.158 1.00 0.00 ? 47 SER A H    9  
ATOM   6721  H HA   . SER A 1 47 ? 3.338   -1.600  -14.243 1.00 0.00 ? 47 SER A HA   9  
ATOM   6722  H HB2  . SER A 1 47 ? 4.015   -3.766  -14.792 1.00 0.00 ? 47 SER A HB2  9  
ATOM   6723  H HB3  . SER A 1 47 ? 4.936   -3.437  -13.325 1.00 0.00 ? 47 SER A HB3  9  
ATOM   6724  H HG   . SER A 1 47 ? 3.474   -4.659  -12.160 1.00 0.00 ? 47 SER A HG   9  
ATOM   6725  N N    . VAL A 1 48 ? 0.950   -2.109  -14.583 1.00 0.00 ? 48 VAL A N    9  
ATOM   6726  C CA   . VAL A 1 48 ? -0.467  -2.354  -14.822 1.00 0.00 ? 48 VAL A CA   9  
ATOM   6727  C C    . VAL A 1 48 ? -0.973  -1.470  -15.948 1.00 0.00 ? 48 VAL A C    9  
ATOM   6728  O O    . VAL A 1 48 ? -1.298  -0.301  -15.746 1.00 0.00 ? 48 VAL A O    9  
ATOM   6729  C CB   . VAL A 1 48 ? -1.354  -2.105  -13.594 1.00 0.00 ? 48 VAL A CB   9  
ATOM   6730  C CG1  . VAL A 1 48 ? -1.477  -3.358  -12.740 1.00 0.00 ? 48 VAL A CG1  9  
ATOM   6731  C CG2  . VAL A 1 48 ? -0.846  -0.926  -12.777 1.00 0.00 ? 48 VAL A CG2  9  
ATOM   6732  H H    . VAL A 1 48 ? 1.429   -1.520  -15.200 1.00 0.00 ? 48 VAL A H    9  
ATOM   6733  H HA   . VAL A 1 48 ? -0.578  -3.388  -15.117 1.00 0.00 ? 48 VAL A HA   9  
ATOM   6734  H HB   . VAL A 1 48 ? -2.337  -1.861  -13.964 1.00 0.00 ? 48 VAL A HB   9  
ATOM   6735  H HG11 . VAL A 1 48 ? -2.520  -3.577  -12.570 1.00 0.00 ? 48 VAL A HG11 9  
ATOM   6736  H HG12 . VAL A 1 48 ? -0.982  -3.199  -11.792 1.00 0.00 ? 48 VAL A HG12 9  
ATOM   6737  H HG13 . VAL A 1 48 ? -1.013  -4.190  -13.251 1.00 0.00 ? 48 VAL A HG13 9  
ATOM   6738  H HG21 . VAL A 1 48 ? -0.729  -0.067  -13.421 1.00 0.00 ? 48 VAL A HG21 9  
ATOM   6739  H HG22 . VAL A 1 48 ? 0.106   -1.176  -12.335 1.00 0.00 ? 48 VAL A HG22 9  
ATOM   6740  H HG23 . VAL A 1 48 ? -1.556  -0.696  -11.996 1.00 0.00 ? 48 VAL A HG23 9  
ATOM   6741  N N    . LYS A 1 49 ? -1.034  -2.049  -17.125 1.00 0.00 ? 49 LYS A N    9  
ATOM   6742  C CA   . LYS A 1 49 ? -1.500  -1.347  -18.317 1.00 0.00 ? 49 LYS A CA   9  
ATOM   6743  C C    . LYS A 1 49 ? -0.609  -0.147  -18.632 1.00 0.00 ? 49 LYS A C    9  
ATOM   6744  O O    . LYS A 1 49 ? -0.249  0.624   -17.744 1.00 0.00 ? 49 LYS A O    9  
ATOM   6745  C CB   . LYS A 1 49 ? -2.949  -0.891  -18.132 1.00 0.00 ? 49 LYS A CB   9  
ATOM   6746  C CG   . LYS A 1 49 ? -3.851  -1.243  -19.303 1.00 0.00 ? 49 LYS A CG   9  
ATOM   6747  C CD   . LYS A 1 49 ? -5.259  -1.580  -18.839 1.00 0.00 ? 49 LYS A CD   9  
ATOM   6748  C CE   . LYS A 1 49 ? -5.342  -2.993  -18.287 1.00 0.00 ? 49 LYS A CE   9  
ATOM   6749  N NZ   . LYS A 1 49 ? -6.750  -3.455  -18.148 1.00 0.00 ? 49 LYS A NZ   9  
ATOM   6750  H H    . LYS A 1 49 ? -0.761  -2.980  -17.192 1.00 0.00 ? 49 LYS A H    9  
ATOM   6751  H HA   . LYS A 1 49 ? -1.455  -2.038  -19.145 1.00 0.00 ? 49 LYS A HA   9  
ATOM   6752  H HB2  . LYS A 1 49 ? -3.350  -1.356  -17.244 1.00 0.00 ? 49 LYS A HB2  9  
ATOM   6753  H HB3  . LYS A 1 49 ? -2.965  0.182   -18.003 1.00 0.00 ? 49 LYS A HB3  9  
ATOM   6754  H HG2  . LYS A 1 49 ? -3.897  -0.401  -19.977 1.00 0.00 ? 49 LYS A HG2  9  
ATOM   6755  H HG3  . LYS A 1 49 ? -3.438  -2.098  -19.818 1.00 0.00 ? 49 LYS A HG3  9  
ATOM   6756  H HD2  . LYS A 1 49 ? -5.550  -0.885  -18.066 1.00 0.00 ? 49 LYS A HD2  9  
ATOM   6757  H HD3  . LYS A 1 49 ? -5.935  -1.491  -19.678 1.00 0.00 ? 49 LYS A HD3  9  
ATOM   6758  H HE2  . LYS A 1 49 ? -4.819  -3.660  -18.957 1.00 0.00 ? 49 LYS A HE2  9  
ATOM   6759  H HE3  . LYS A 1 49 ? -4.866  -3.016  -17.316 1.00 0.00 ? 49 LYS A HE3  9  
ATOM   6760  H HZ1  . LYS A 1 49 ? -6.775  -4.478  -17.960 1.00 0.00 ? 49 LYS A HZ1  9  
ATOM   6761  H HZ2  . LYS A 1 49 ? -7.278  -3.261  -19.022 1.00 0.00 ? 49 LYS A HZ2  9  
ATOM   6762  H HZ3  . LYS A 1 49 ? -7.213  -2.957  -17.359 1.00 0.00 ? 49 LYS A HZ3  9  
HETATM 6763  N N    . CY1 A 1 50 ? -0.261  0.006   -19.906 1.00 0.00 ? 50 CY1 A N    9  
HETATM 6764  C CA   . CY1 A 1 50 ? 0.586   1.112   -20.338 1.00 0.00 ? 50 CY1 A CA   9  
HETATM 6765  C CB   . CY1 A 1 50 ? 2.021   0.907   -19.845 1.00 0.00 ? 50 CY1 A CB   9  
HETATM 6766  S SG   . CY1 A 1 50 ? 2.737   2.416   -19.168 1.00 0.00 ? 50 CY1 A SG   9  
HETATM 6767  C CD   . CY1 A 1 50 ? 4.507   2.109   -19.323 1.00 0.00 ? 50 CY1 A CD   9  
HETATM 6768  N NE   . CY1 A 1 50 ? 4.802   0.707   -19.044 1.00 0.00 ? 50 CY1 A NE   9  
HETATM 6769  C CZ   . CY1 A 1 50 ? 5.504   0.286   -17.996 1.00 0.00 ? 50 CY1 A CZ   9  
HETATM 6770  O OAC  . CY1 A 1 50 ? 5.984   1.031   -17.143 1.00 0.00 ? 50 CY1 A OAC  9  
HETATM 6771  C CM   . CY1 A 1 50 ? 5.695   -1.215  -17.896 1.00 0.00 ? 50 CY1 A CM   9  
HETATM 6772  C C    . CY1 A 1 50 ? 0.569   1.247   -21.857 1.00 0.00 ? 50 CY1 A C    9  
HETATM 6773  O O    . CY1 A 1 50 ? 1.083   0.384   -22.568 1.00 0.00 ? 50 CY1 A O    9  
HETATM 6774  H H    . CY1 A 1 50 ? -0.580  -0.641  -20.571 1.00 0.00 ? 50 CY1 A H    9  
HETATM 6775  H HA   . CY1 A 1 50 ? 0.192   2.018   -19.904 1.00 0.00 ? 50 CY1 A HA   9  
HETATM 6776  H HB2  . CY1 A 1 50 ? 2.025   0.150   -19.076 1.00 0.00 ? 50 CY1 A HB2  9  
HETATM 6777  H HB3  . CY1 A 1 50 ? 2.635   0.579   -20.670 1.00 0.00 ? 50 CY1 A HB3  9  
HETATM 6778  H HD2  . CY1 A 1 50 ? 4.267   2.235   -20.368 1.00 0.00 ? 50 CY1 A HD2  9  
HETATM 6779  H HD3  . CY1 A 1 50 ? 5.387   2.712   -19.154 1.00 0.00 ? 50 CY1 A HD3  9  
HETATM 6780  H HE   . CY1 A 1 50 ? 4.589   0.044   -19.735 1.00 0.00 ? 50 CY1 A HE   9  
HETATM 6781  H HM1  . CY1 A 1 50 ? 6.753   -1.444  -17.997 1.00 0.00 ? 50 CY1 A HM1  9  
HETATM 6782  H HM2  . CY1 A 1 50 ? 5.111   -1.699  -18.675 1.00 0.00 ? 50 CY1 A HM2  9  
HETATM 6783  H HM3  . CY1 A 1 50 ? 5.358   -1.566  -16.944 1.00 0.00 ? 50 CY1 A HM3  9  
HETATM 6784  N N    . NH2 A 1 51 ? -0.017  2.324   -22.369 1.00 0.00 ? 51 NH2 A N    9  
HETATM 6785  H HN1  . NH2 A 1 51 ? -0.408  2.976   -21.750 1.00 0.00 ? 51 NH2 A HN1  9  
HETATM 6786  H HN2  . NH2 A 1 51 ? -0.033  2.423   -23.343 1.00 0.00 ? 51 NH2 A HN2  9  
ATOM   6787  N N    . LEU A 1 1  ? -0.646  1.282   17.955  1.00 0.00 ? 1  LEU A N    10 
ATOM   6788  C CA   . LEU A 1 1  ? -1.895  0.479   18.007  1.00 0.00 ? 1  LEU A CA   10 
ATOM   6789  C C    . LEU A 1 1  ? -2.206  -0.146  16.650  1.00 0.00 ? 1  LEU A C    10 
ATOM   6790  O O    . LEU A 1 1  ? -2.795  -1.223  16.572  1.00 0.00 ? 1  LEU A O    10 
ATOM   6791  C CB   . LEU A 1 1  ? -3.044  1.390   18.443  1.00 0.00 ? 1  LEU A CB   10 
ATOM   6792  C CG   . LEU A 1 1  ? -4.181  0.688   19.187  1.00 0.00 ? 1  LEU A CG   10 
ATOM   6793  C CD1  . LEU A 1 1  ? -3.823  0.503   20.653  1.00 0.00 ? 1  LEU A CD1  10 
ATOM   6794  C CD2  . LEU A 1 1  ? -5.475  1.476   19.047  1.00 0.00 ? 1  LEU A CD2  10 
ATOM   6795  H H1   . LEU A 1 1  ? 0.051   0.749   17.398  1.00 0.00 ? 1  LEU A H1   10 
ATOM   6796  H H2   . LEU A 1 1  ? -0.320  1.423   18.932  1.00 0.00 ? 1  LEU A H2   10 
ATOM   6797  H H3   . LEU A 1 1  ? -0.872  2.190   17.500  1.00 0.00 ? 1  LEU A H3   10 
ATOM   6798  H HA   . LEU A 1 1  ? -1.768  -0.307  18.736  1.00 0.00 ? 1  LEU A HA   10 
ATOM   6799  H HB2  . LEU A 1 1  ? -2.641  2.159   19.086  1.00 0.00 ? 1  LEU A HB2  10 
ATOM   6800  H HB3  . LEU A 1 1  ? -3.457  1.860   17.563  1.00 0.00 ? 1  LEU A HB3  10 
ATOM   6801  H HG   . LEU A 1 1  ? -4.335  -0.291  18.755  1.00 0.00 ? 1  LEU A HG   10 
ATOM   6802  H HD11 . LEU A 1 1  ? -3.122  1.268   20.952  1.00 0.00 ? 1  LEU A HD11 10 
ATOM   6803  H HD12 . LEU A 1 1  ? -3.378  -0.470  20.795  1.00 0.00 ? 1  LEU A HD12 10 
ATOM   6804  H HD13 . LEU A 1 1  ? -4.717  0.581   21.254  1.00 0.00 ? 1  LEU A HD13 10 
ATOM   6805  H HD21 . LEU A 1 1  ? -5.437  2.073   18.148  1.00 0.00 ? 1  LEU A HD21 10 
ATOM   6806  H HD22 . LEU A 1 1  ? -5.599  2.121   19.903  1.00 0.00 ? 1  LEU A HD22 10 
ATOM   6807  H HD23 . LEU A 1 1  ? -6.308  0.790   18.988  1.00 0.00 ? 1  LEU A HD23 10 
ATOM   6808  N N    . GLN A 1 2  ? -1.805  0.538   15.583  1.00 0.00 ? 2  GLN A N    10 
ATOM   6809  C CA   . GLN A 1 2  ? -2.041  0.049   14.230  1.00 0.00 ? 2  GLN A CA   10 
ATOM   6810  C C    . GLN A 1 2  ? -0.976  -0.966  13.826  1.00 0.00 ? 2  GLN A C    10 
ATOM   6811  O O    . GLN A 1 2  ? 0.212   -0.649  13.786  1.00 0.00 ? 2  GLN A O    10 
ATOM   6812  C CB   . GLN A 1 2  ? -2.054  1.215   13.238  1.00 0.00 ? 2  GLN A CB   10 
ATOM   6813  C CG   . GLN A 1 2  ? -0.866  2.151   13.381  1.00 0.00 ? 2  GLN A CG   10 
ATOM   6814  C CD   . GLN A 1 2  ? -0.724  3.096   12.204  1.00 0.00 ? 2  GLN A CD   10 
ATOM   6815  O OE1  . GLN A 1 2  ? -1.128  4.256   12.272  1.00 0.00 ? 2  GLN A OE1  10 
ATOM   6816  N NE2  . GLN A 1 2  ? -0.148  2.601   11.114  1.00 0.00 ? 2  GLN A NE2  10 
ATOM   6817  H H    . GLN A 1 2  ? -1.340  1.391   15.710  1.00 0.00 ? 2  GLN A H    10 
ATOM   6818  H HA   . GLN A 1 2  ? -3.006  -0.435  14.216  1.00 0.00 ? 2  GLN A HA   10 
ATOM   6819  H HB2  . GLN A 1 2  ? -2.052  0.817   12.234  1.00 0.00 ? 2  GLN A HB2  10 
ATOM   6820  H HB3  . GLN A 1 2  ? -2.957  1.788   13.386  1.00 0.00 ? 2  GLN A HB3  10 
ATOM   6821  H HG2  . GLN A 1 2  ? -0.991  2.738   14.279  1.00 0.00 ? 2  GLN A HG2  10 
ATOM   6822  H HG3  . GLN A 1 2  ? 0.035   1.561   13.460  1.00 0.00 ? 2  GLN A HG3  10 
ATOM   6823  H HE21 . GLN A 1 2  ? 0.149   1.668   11.130  1.00 0.00 ? 2  GLN A HE21 10 
ATOM   6824  H HE22 . GLN A 1 2  ? -0.044  3.190   10.338  1.00 0.00 ? 2  GLN A HE22 10 
ATOM   6825  N N    . MET A 1 3  ? -1.418  -2.186  13.521  1.00 0.00 ? 3  MET A N    10 
ATOM   6826  C CA   . MET A 1 3  ? -0.530  -3.266  13.109  1.00 0.00 ? 3  MET A CA   10 
ATOM   6827  C C    . MET A 1 3  ? -1.191  -4.595  13.418  1.00 0.00 ? 3  MET A C    10 
ATOM   6828  O O    . MET A 1 3  ? -1.434  -4.942  14.573  1.00 0.00 ? 3  MET A O    10 
ATOM   6829  C CB   . MET A 1 3  ? 0.841   -3.233  13.801  1.00 0.00 ? 3  MET A CB   10 
ATOM   6830  C CG   . MET A 1 3  ? 2.024   -2.765  12.935  1.00 0.00 ? 3  MET A CG   10 
ATOM   6831  S SD   . MET A 1 3  ? 1.914   -3.284  11.208  1.00 0.00 ? 3  MET A SD   10 
ATOM   6832  C CE   . MET A 1 3  ? 1.066   -1.882  10.487  1.00 0.00 ? 3  MET A CE   10 
ATOM   6833  H H    . MET A 1 3  ? -2.389  -2.374  13.561  1.00 0.00 ? 3  MET A H    10 
ATOM   6834  H HA   . MET A 1 3  ? -0.396  -3.188  12.042  1.00 0.00 ? 3  MET A HA   10 
ATOM   6835  H HB2  . MET A 1 3  ? 0.779   -2.592  14.663  1.00 0.00 ? 3  MET A HB2  10 
ATOM   6836  H HB3  . MET A 1 3  ? 1.054   -4.239  14.128  1.00 0.00 ? 3  MET A HB3  10 
ATOM   6837  H HG2  . MET A 1 3  ? 2.089   -1.686  12.966  1.00 0.00 ? 3  MET A HG2  10 
ATOM   6838  H HG3  . MET A 1 3  ? 2.934   -3.178  13.355  1.00 0.00 ? 3  MET A HG3  10 
ATOM   6839  H HE1  . MET A 1 3  ? 0.010   -2.099  10.412  1.00 0.00 ? 3  MET A HE1  10 
ATOM   6840  H HE2  . MET A 1 3  ? 1.464   -1.687  9.502   1.00 0.00 ? 3  MET A HE2  10 
ATOM   6841  H HE3  . MET A 1 3  ? 1.211   -1.012  11.112  1.00 0.00 ? 3  MET A HE3  10 
ATOM   6842  N N    . ALA A 1 4  ? -1.477  -5.316  12.369  1.00 0.00 ? 4  ALA A N    10 
ATOM   6843  C CA   . ALA A 1 4  ? -2.117  -6.621  12.469  1.00 0.00 ? 4  ALA A CA   10 
ATOM   6844  C C    . ALA A 1 4  ? -1.082  -7.733  12.593  1.00 0.00 ? 4  ALA A C    10 
ATOM   6845  O O    . ALA A 1 4  ? -0.749  -8.398  11.612  1.00 0.00 ? 4  ALA A O    10 
ATOM   6846  C CB   . ALA A 1 4  ? -3.016  -6.861  11.265  1.00 0.00 ? 4  ALA A CB   10 
ATOM   6847  H H    . ALA A 1 4  ? -1.249  -4.953  11.500  1.00 0.00 ? 4  ALA A H    10 
ATOM   6848  H HA   . ALA A 1 4  ? -2.736  -6.620  13.356  1.00 0.00 ? 4  ALA A HA   10 
ATOM   6849  H HB1  . ALA A 1 4  ? -4.040  -6.958  11.595  1.00 0.00 ? 4  ALA A HB1  10 
ATOM   6850  H HB2  . ALA A 1 4  ? -2.713  -7.768  10.762  1.00 0.00 ? 4  ALA A HB2  10 
ATOM   6851  H HB3  . ALA A 1 4  ? -2.934  -6.028  10.584  1.00 0.00 ? 4  ALA A HB3  10 
ATOM   6852  N N    . GLY A 1 5  ? -0.573  -7.927  13.808  1.00 0.00 ? 5  GLY A N    10 
ATOM   6853  C CA   . GLY A 1 5  ? 0.429   -8.971  14.043  1.00 0.00 ? 5  GLY A CA   10 
ATOM   6854  C C    . GLY A 1 5  ? 1.521   -8.987  12.989  1.00 0.00 ? 5  GLY A C    10 
ATOM   6855  O O    . GLY A 1 5  ? 2.101   -10.038 12.709  1.00 0.00 ? 5  GLY A O    10 
ATOM   6856  H H    . GLY A 1 5  ? -0.882  -7.356  14.549  1.00 0.00 ? 5  GLY A H    10 
ATOM   6857  H HA2  . GLY A 1 5  ? 0.891   -8.821  15.012  1.00 0.00 ? 5  GLY A HA2  10 
ATOM   6858  H HA3  . GLY A 1 5  ? -0.066  -9.935  14.040  1.00 0.00 ? 5  GLY A HA3  10 
ATOM   6859  N N    . GLN A 1 6  ? 1.796   -7.823  12.398  1.00 0.00 ? 6  GLN A N    10 
ATOM   6860  C CA   . GLN A 1 6  ? 2.819   -7.695  11.364  1.00 0.00 ? 6  GLN A CA   10 
ATOM   6861  C C    . GLN A 1 6  ? 2.237   -8.030  10.004  1.00 0.00 ? 6  GLN A C    10 
ATOM   6862  O O    . GLN A 1 6  ? 2.517   -9.082  9.429   1.00 0.00 ? 6  GLN A O    10 
ATOM   6863  C CB   . GLN A 1 6  ? 4.036   -8.578  11.663  1.00 0.00 ? 6  GLN A CB   10 
ATOM   6864  C CG   . GLN A 1 6  ? 5.365   -7.895  11.385  1.00 0.00 ? 6  GLN A CG   10 
ATOM   6865  C CD   . GLN A 1 6  ? 5.649   -6.759  12.348  1.00 0.00 ? 6  GLN A CD   10 
ATOM   6866  O OE1  . GLN A 1 6  ? 6.265   -6.958  13.395  1.00 0.00 ? 6  GLN A OE1  10 
ATOM   6867  N NE2  . GLN A 1 6  ? 5.200   -5.560  11.997  1.00 0.00 ? 6  GLN A NE2  10 
ATOM   6868  H H    . GLN A 1 6  ? 1.291   -7.025  12.660  1.00 0.00 ? 6  GLN A H    10 
ATOM   6869  H HA   . GLN A 1 6  ? 3.129   -6.661  11.347  1.00 0.00 ? 6  GLN A HA   10 
ATOM   6870  H HB2  . GLN A 1 6  ? 4.013   -8.861  12.705  1.00 0.00 ? 6  GLN A HB2  10 
ATOM   6871  H HB3  . GLN A 1 6  ? 3.978   -9.469  11.055  1.00 0.00 ? 6  GLN A HB3  10 
ATOM   6872  H HG2  . GLN A 1 6  ? 6.156   -8.626  11.471  1.00 0.00 ? 6  GLN A HG2  10 
ATOM   6873  H HG3  . GLN A 1 6  ? 5.348   -7.500  10.379  1.00 0.00 ? 6  GLN A HG3  10 
ATOM   6874  H HE21 . GLN A 1 6  ? 4.719   -5.476  11.148  1.00 0.00 ? 6  GLN A HE21 10 
ATOM   6875  H HE22 . GLN A 1 6  ? 5.371   -4.807  12.602  1.00 0.00 ? 6  GLN A HE22 10 
ATOM   6876  N N    . CYS A 1 7  ? 1.415   -7.116  9.507   1.00 0.00 ? 7  CYS A N    10 
ATOM   6877  C CA   . CYS A 1 7  ? 0.762   -7.272  8.205   1.00 0.00 ? 7  CYS A CA   10 
ATOM   6878  C C    . CYS A 1 7  ? 1.707   -7.874  7.178   1.00 0.00 ? 7  CYS A C    10 
ATOM   6879  O O    . CYS A 1 7  ? 2.900   -7.569  7.165   1.00 0.00 ? 7  CYS A O    10 
ATOM   6880  C CB   . CYS A 1 7  ? 0.272   -5.920  7.684   1.00 0.00 ? 7  CYS A CB   10 
ATOM   6881  S SG   . CYS A 1 7  ? -1.333  -5.386  8.358   1.00 0.00 ? 7  CYS A SG   10 
ATOM   6882  H H    . CYS A 1 7  ? 1.239   -6.309  10.040  1.00 0.00 ? 7  CYS A H    10 
ATOM   6883  H HA   . CYS A 1 7  ? -0.081  -7.927  8.326   1.00 0.00 ? 7  CYS A HA   10 
ATOM   6884  H HB2  . CYS A 1 7  ? 0.999   -5.164  7.936   1.00 0.00 ? 7  CYS A HB2  10 
ATOM   6885  H HB3  . CYS A 1 7  ? 0.178   -5.972  6.607   1.00 0.00 ? 7  CYS A HB3  10 
ATOM   6886  N N    . SER A 1 8  ? 1.165   -8.707  6.297   1.00 0.00 ? 8  SER A N    10 
ATOM   6887  C CA   . SER A 1 8  ? 1.970   -9.315  5.250   1.00 0.00 ? 8  SER A CA   10 
ATOM   6888  C C    . SER A 1 8  ? 2.639   -8.220  4.434   1.00 0.00 ? 8  SER A C    10 
ATOM   6889  O O    . SER A 1 8  ? 2.126   -7.108  4.339   1.00 0.00 ? 8  SER A O    10 
ATOM   6890  C CB   . SER A 1 8  ? 1.108   -10.200 4.347   1.00 0.00 ? 8  SER A CB   10 
ATOM   6891  O OG   . SER A 1 8  ? -0.221  -10.288 4.831   1.00 0.00 ? 8  SER A OG   10 
ATOM   6892  H H    . SER A 1 8  ? 0.205   -8.899  6.341   1.00 0.00 ? 8  SER A H    10 
ATOM   6893  H HA   . SER A 1 8  ? 2.734   -9.916  5.719   1.00 0.00 ? 8  SER A HA   10 
ATOM   6894  H HB2  . SER A 1 8  ? 1.088   -9.785  3.350   1.00 0.00 ? 8  SER A HB2  10 
ATOM   6895  H HB3  . SER A 1 8  ? 1.532   -11.194 4.312   1.00 0.00 ? 8  SER A HB3  10 
ATOM   6896  H HG   . SER A 1 8  ? -0.690  -9.475  4.629   1.00 0.00 ? 8  SER A HG   10 
ATOM   6897  N N    . GLN A 1 9  ? 3.791   -8.525  3.863   1.00 0.00 ? 9  GLN A N    10 
ATOM   6898  C CA   . GLN A 1 9  ? 4.522   -7.545  3.079   1.00 0.00 ? 9  GLN A CA   10 
ATOM   6899  C C    . GLN A 1 9  ? 3.617   -6.836  2.082   1.00 0.00 ? 9  GLN A C    10 
ATOM   6900  O O    . GLN A 1 9  ? 2.820   -7.462  1.385   1.00 0.00 ? 9  GLN A O    10 
ATOM   6901  C CB   . GLN A 1 9  ? 5.700   -8.201  2.356   1.00 0.00 ? 9  GLN A CB   10 
ATOM   6902  C CG   . GLN A 1 9  ? 7.019   -7.472  2.557   1.00 0.00 ? 9  GLN A CG   10 
ATOM   6903  C CD   . GLN A 1 9  ? 7.358   -6.552  1.401   1.00 0.00 ? 9  GLN A CD   10 
ATOM   6904  O OE1  . GLN A 1 9  ? 6.883   -5.418  1.335   1.00 0.00 ? 9  GLN A OE1  10 
ATOM   6905  N NE2  . GLN A 1 9  ? 8.183   -7.038  0.481   1.00 0.00 ? 9  GLN A NE2  10 
ATOM   6906  H H    . GLN A 1 9  ? 4.165   -9.418  3.983   1.00 0.00 ? 9  GLN A H    10 
ATOM   6907  H HA   . GLN A 1 9  ? 4.898   -6.806  3.767   1.00 0.00 ? 9  GLN A HA   10 
ATOM   6908  H HB2  . GLN A 1 9  ? 5.813   -9.212  2.722   1.00 0.00 ? 9  GLN A HB2  10 
ATOM   6909  H HB3  . GLN A 1 9  ? 5.489   -8.233  1.297   1.00 0.00 ? 9  GLN A HB3  10 
ATOM   6910  H HG2  . GLN A 1 9  ? 6.956   -6.883  3.459   1.00 0.00 ? 9  GLN A HG2  10 
ATOM   6911  H HG3  . GLN A 1 9  ? 7.808   -8.203  2.659   1.00 0.00 ? 9  GLN A HG3  10 
ATOM   6912  H HE21 . GLN A 1 9  ? 8.523   -7.949  0.598   1.00 0.00 ? 9  GLN A HE21 10 
ATOM   6913  H HE22 . GLN A 1 9  ? 8.420   -6.464  -0.278  1.00 0.00 ? 9  GLN A HE22 10 
ATOM   6914  N N    . ASN A 1 10 ? 3.753   -5.518  2.035   1.00 0.00 ? 10 ASN A N    10 
ATOM   6915  C CA   . ASN A 1 10 ? 2.959   -4.690  1.140   1.00 0.00 ? 10 ASN A CA   10 
ATOM   6916  C C    . ASN A 1 10 ? 1.491   -4.695  1.535   1.00 0.00 ? 10 ASN A C    10 
ATOM   6917  O O    . ASN A 1 10 ? 0.613   -4.527  0.690   1.00 0.00 ? 10 ASN A O    10 
ATOM   6918  C CB   . ASN A 1 10 ? 3.118   -5.157  -0.309  1.00 0.00 ? 10 ASN A CB   10 
ATOM   6919  C CG   . ASN A 1 10 ? 3.572   -4.046  -1.232  1.00 0.00 ? 10 ASN A CG   10 
ATOM   6920  O OD1  . ASN A 1 10 ? 4.502   -4.219  -2.017  1.00 0.00 ? 10 ASN A OD1  10 
ATOM   6921  N ND2  . ASN A 1 10 ? 2.913   -2.896  -1.144  1.00 0.00 ? 10 ASN A ND2  10 
ATOM   6922  H H    . ASN A 1 10 ? 4.409   -5.087  2.624   1.00 0.00 ? 10 ASN A H    10 
ATOM   6923  H HA   . ASN A 1 10 ? 3.324   -3.685  1.231   1.00 0.00 ? 10 ASN A HA   10 
ATOM   6924  H HB2  . ASN A 1 10 ? 3.850   -5.950  -0.346  1.00 0.00 ? 10 ASN A HB2  10 
ATOM   6925  H HB3  . ASN A 1 10 ? 2.170   -5.533  -0.666  1.00 0.00 ? 10 ASN A HB3  10 
ATOM   6926  H HD21 . ASN A 1 10 ? 2.181   -2.830  -0.495  1.00 0.00 ? 10 ASN A HD21 10 
ATOM   6927  H HD22 . ASN A 1 10 ? 3.187   -2.160  -1.730  1.00 0.00 ? 10 ASN A HD22 10 
ATOM   6928  N N    . GLU A 1 11 ? 1.229   -4.877  2.821   1.00 0.00 ? 11 GLU A N    10 
ATOM   6929  C CA   . GLU A 1 11 ? -0.146  -4.888  3.304   1.00 0.00 ? 11 GLU A CA   10 
ATOM   6930  C C    . GLU A 1 11 ? -0.358  -3.875  4.413   1.00 0.00 ? 11 GLU A C    10 
ATOM   6931  O O    . GLU A 1 11 ? 0.529   -3.649  5.234   1.00 0.00 ? 11 GLU A O    10 
ATOM   6932  C CB   . GLU A 1 11 ? -0.552  -6.293  3.756   1.00 0.00 ? 11 GLU A CB   10 
ATOM   6933  C CG   . GLU A 1 11 ? -1.844  -6.792  3.123   1.00 0.00 ? 11 GLU A CG   10 
ATOM   6934  C CD   . GLU A 1 11 ? -1.740  -8.226  2.642   1.00 0.00 ? 11 GLU A CD   10 
ATOM   6935  O OE1  . GLU A 1 11 ? -0.738  -8.557  1.974   1.00 0.00 ? 11 GLU A OE1  10 
ATOM   6936  O OE2  . GLU A 1 11 ? -2.662  -9.018  2.933   1.00 0.00 ? 11 GLU A OE2  10 
ATOM   6937  H H    . GLU A 1 11 ? 1.977   -4.999  3.453   1.00 0.00 ? 11 GLU A H    10 
ATOM   6938  H HA   . GLU A 1 11 ? -0.762  -4.596  2.491   1.00 0.00 ? 11 GLU A HA   10 
ATOM   6939  H HB2  . GLU A 1 11 ? 0.235   -6.981  3.493   1.00 0.00 ? 11 GLU A HB2  10 
ATOM   6940  H HB3  . GLU A 1 11 ? -0.676  -6.294  4.828   1.00 0.00 ? 11 GLU A HB3  10 
ATOM   6941  H HG2  . GLU A 1 11 ? -2.633  -6.733  3.855   1.00 0.00 ? 11 GLU A HG2  10 
ATOM   6942  H HG3  . GLU A 1 11 ? -2.089  -6.162  2.277   1.00 0.00 ? 11 GLU A HG3  10 
ATOM   6943  N N    . TYR A 1 12 ? -1.543  -3.252  4.428   1.00 0.00 ? 12 TYR A N    10 
ATOM   6944  C CA   . TYR A 1 12 ? -1.837  -2.248  5.456   1.00 0.00 ? 12 TYR A CA   10 
ATOM   6945  C C    . TYR A 1 12 ? -3.144  -2.546  6.182   1.00 0.00 ? 12 TYR A C    10 
ATOM   6946  O O    . TYR A 1 12 ? -4.206  -2.635  5.568   1.00 0.00 ? 12 TYR A O    10 
ATOM   6947  C CB   . TYR A 1 12 ? -1.860  -0.837  4.860   1.00 0.00 ? 12 TYR A CB   10 
ATOM   6948  C CG   . TYR A 1 12 ? -3.154  -0.457  4.169   1.00 0.00 ? 12 TYR A CG   10 
ATOM   6949  C CD1  . TYR A 1 12 ? -4.226  0.043   4.896   1.00 0.00 ? 12 TYR A CD1  10 
ATOM   6950  C CD2  . TYR A 1 12 ? -3.298  -0.588  2.795   1.00 0.00 ? 12 TYR A CD2  10 
ATOM   6951  C CE1  . TYR A 1 12 ? -5.406  0.399   4.273   1.00 0.00 ? 12 TYR A CE1  10 
ATOM   6952  C CE2  . TYR A 1 12 ? -4.476  -0.236  2.164   1.00 0.00 ? 12 TYR A CE2  10 
ATOM   6953  C CZ   . TYR A 1 12 ? -5.526  0.257   2.907   1.00 0.00 ? 12 TYR A CZ   10 
ATOM   6954  O OH   . TYR A 1 12 ? -6.700  0.611   2.283   1.00 0.00 ? 12 TYR A OH   10 
ATOM   6955  H H    . TYR A 1 12 ? -2.227  -3.471  3.733   1.00 0.00 ? 12 TYR A H    10 
ATOM   6956  H HA   . TYR A 1 12 ? -1.037  -2.292  6.185   1.00 0.00 ? 12 TYR A HA   10 
ATOM   6957  H HB2  . TYR A 1 12 ? -1.696  -0.128  5.656   1.00 0.00 ? 12 TYR A HB2  10 
ATOM   6958  H HB3  . TYR A 1 12 ? -1.060  -0.749  4.139   1.00 0.00 ? 12 TYR A HB3  10 
ATOM   6959  H HD1  . TYR A 1 12 ? -4.130  0.152   5.966   1.00 0.00 ? 12 TYR A HD1  10 
ATOM   6960  H HD2  . TYR A 1 12 ? -2.473  -0.974  2.214   1.00 0.00 ? 12 TYR A HD2  10 
ATOM   6961  H HE1  . TYR A 1 12 ? -6.227  0.787   4.855   1.00 0.00 ? 12 TYR A HE1  10 
ATOM   6962  H HE2  . TYR A 1 12 ? -4.570  -0.347  1.094   1.00 0.00 ? 12 TYR A HE2  10 
ATOM   6963  H HH   . TYR A 1 12 ? -7.399  0.007   2.548   1.00 0.00 ? 12 TYR A HH   10 
ATOM   6964  N N    . PHE A 1 13 ? -3.047  -2.690  7.501   1.00 0.00 ? 13 PHE A N    10 
ATOM   6965  C CA   . PHE A 1 13 ? -4.207  -2.979  8.342   1.00 0.00 ? 13 PHE A CA   10 
ATOM   6966  C C    . PHE A 1 13 ? -5.138  -1.779  8.429   1.00 0.00 ? 13 PHE A C    10 
ATOM   6967  O O    . PHE A 1 13 ? -4.952  -0.901  9.270   1.00 0.00 ? 13 PHE A O    10 
ATOM   6968  C CB   . PHE A 1 13 ? -3.755  -3.376  9.751   1.00 0.00 ? 13 PHE A CB   10 
ATOM   6969  C CG   . PHE A 1 13 ? -4.891  -3.664  10.690  1.00 0.00 ? 13 PHE A CG   10 
ATOM   6970  C CD1  . PHE A 1 13 ? -5.684  -4.787  10.516  1.00 0.00 ? 13 PHE A CD1  10 
ATOM   6971  C CD2  . PHE A 1 13 ? -5.166  -2.811  11.746  1.00 0.00 ? 13 PHE A CD2  10 
ATOM   6972  C CE1  . PHE A 1 13 ? -6.729  -5.054  11.379  1.00 0.00 ? 13 PHE A CE1  10 
ATOM   6973  C CE2  . PHE A 1 13 ? -6.210  -3.072  12.612  1.00 0.00 ? 13 PHE A CE2  10 
ATOM   6974  C CZ   . PHE A 1 13 ? -6.992  -4.196  12.428  1.00 0.00 ? 13 PHE A CZ   10 
ATOM   6975  H H    . PHE A 1 13 ? -2.167  -2.594  7.919   1.00 0.00 ? 13 PHE A H    10 
ATOM   6976  H HA   . PHE A 1 13 ? -4.745  -3.809  7.903   1.00 0.00 ? 13 PHE A HA   10 
ATOM   6977  H HB2  . PHE A 1 13 ? -3.148  -4.262  9.690   1.00 0.00 ? 13 PHE A HB2  10 
ATOM   6978  H HB3  . PHE A 1 13 ? -3.169  -2.572  10.173  1.00 0.00 ? 13 PHE A HB3  10 
ATOM   6979  H HD1  . PHE A 1 13 ? -5.480  -5.458  9.695   1.00 0.00 ? 13 PHE A HD1  10 
ATOM   6980  H HD2  . PHE A 1 13 ? -4.554  -1.932  11.891  1.00 0.00 ? 13 PHE A HD2  10 
ATOM   6981  H HE1  . PHE A 1 13 ? -7.340  -5.933  11.233  1.00 0.00 ? 13 PHE A HE1  10 
ATOM   6982  H HE2  . PHE A 1 13 ? -6.414  -2.399  13.432  1.00 0.00 ? 13 PHE A HE2  10 
ATOM   6983  H HZ   . PHE A 1 13 ? -7.810  -4.402  13.104  1.00 0.00 ? 13 PHE A HZ   10 
ATOM   6984  N N    . ASP A 1 14 ? -6.156  -1.760  7.580   1.00 0.00 ? 14 ASP A N    10 
ATOM   6985  C CA   . ASP A 1 14 ? -7.123  -0.669  7.597   1.00 0.00 ? 14 ASP A CA   10 
ATOM   6986  C C    . ASP A 1 14 ? -7.941  -0.727  8.874   1.00 0.00 ? 14 ASP A C    10 
ATOM   6987  O O    . ASP A 1 14 ? -8.867  -1.523  8.987   1.00 0.00 ? 14 ASP A O    10 
ATOM   6988  C CB   . ASP A 1 14 ? -8.046  -0.746  6.380   1.00 0.00 ? 14 ASP A CB   10 
ATOM   6989  C CG   . ASP A 1 14 ? -8.459  0.625   5.882   1.00 0.00 ? 14 ASP A CG   10 
ATOM   6990  O OD1  . ASP A 1 14 ? -8.768  1.494   6.725   1.00 0.00 ? 14 ASP A OD1  10 
ATOM   6991  O OD2  . ASP A 1 14 ? -8.473  0.829   4.650   1.00 0.00 ? 14 ASP A OD2  10 
ATOM   6992  H H    . ASP A 1 14 ? -6.270  -2.501  6.943   1.00 0.00 ? 14 ASP A H    10 
ATOM   6993  H HA   . ASP A 1 14 ? -6.585  0.267   7.575   1.00 0.00 ? 14 ASP A HA   10 
ATOM   6994  H HB2  . ASP A 1 14 ? -7.536  -1.261  5.580   1.00 0.00 ? 14 ASP A HB2  10 
ATOM   6995  H HB3  . ASP A 1 14 ? -8.935  -1.294  6.648   1.00 0.00 ? 14 ASP A HB3  10 
ATOM   6996  N N    . SER A 1 15 ? -7.591  0.114   9.840   1.00 0.00 ? 15 SER A N    10 
ATOM   6997  C CA   . SER A 1 15 ? -8.299  0.147   11.113  1.00 0.00 ? 15 SER A CA   10 
ATOM   6998  C C    . SER A 1 15 ? -9.806  0.240   10.898  1.00 0.00 ? 15 SER A C    10 
ATOM   6999  O O    . SER A 1 15 ? -10.590 -0.139  11.767  1.00 0.00 ? 15 SER A O    10 
ATOM   7000  C CB   . SER A 1 15 ? -7.817  1.324   11.963  1.00 0.00 ? 15 SER A CB   10 
ATOM   7001  O OG   . SER A 1 15 ? -7.951  2.548   11.262  1.00 0.00 ? 15 SER A OG   10 
ATOM   7002  H H    . SER A 1 15 ? -6.837  0.723   9.696   1.00 0.00 ? 15 SER A H    10 
ATOM   7003  H HA   . SER A 1 15 ? -8.083  -0.773  11.630  1.00 0.00 ? 15 SER A HA   10 
ATOM   7004  H HB2  . SER A 1 15 ? -8.403  1.376   12.867  1.00 0.00 ? 15 SER A HB2  10 
ATOM   7005  H HB3  . SER A 1 15 ? -6.776  1.179   12.215  1.00 0.00 ? 15 SER A HB3  10 
ATOM   7006  H HG   . SER A 1 15 ? -8.882  2.751   11.147  1.00 0.00 ? 15 SER A HG   10 
ATOM   7007  N N    . LEU A 1 16 ? -10.205 0.733   9.730   1.00 0.00 ? 16 LEU A N    10 
ATOM   7008  C CA   . LEU A 1 16 ? -11.619 0.857   9.406   1.00 0.00 ? 16 LEU A CA   10 
ATOM   7009  C C    . LEU A 1 16 ? -12.164 -0.462  8.867   1.00 0.00 ? 16 LEU A C    10 
ATOM   7010  O O    . LEU A 1 16 ? -13.362 -0.732  8.950   1.00 0.00 ? 16 LEU A O    10 
ATOM   7011  C CB   . LEU A 1 16 ? -11.837 1.972   8.381   1.00 0.00 ? 16 LEU A CB   10 
ATOM   7012  C CG   . LEU A 1 16 ? -13.187 2.684   8.478   1.00 0.00 ? 16 LEU A CG   10 
ATOM   7013  C CD1  . LEU A 1 16 ? -13.102 3.862   9.436   1.00 0.00 ? 16 LEU A CD1  10 
ATOM   7014  C CD2  . LEU A 1 16 ? -13.643 3.146   7.102   1.00 0.00 ? 16 LEU A CD2  10 
ATOM   7015  H H    . LEU A 1 16 ? -9.533  1.013   9.069   1.00 0.00 ? 16 LEU A H    10 
ATOM   7016  H HA   . LEU A 1 16 ? -12.147 1.106   10.315  1.00 0.00 ? 16 LEU A HA   10 
ATOM   7017  H HB2  . LEU A 1 16 ? -11.054 2.706   8.509   1.00 0.00 ? 16 LEU A HB2  10 
ATOM   7018  H HB3  . LEU A 1 16 ? -11.750 1.546   7.393   1.00 0.00 ? 16 LEU A HB3  10 
ATOM   7019  H HG   . LEU A 1 16 ? -13.925 1.994   8.861   1.00 0.00 ? 16 LEU A HG   10 
ATOM   7020  H HD11 . LEU A 1 16 ? -14.077 4.053   9.859   1.00 0.00 ? 16 LEU A HD11 10 
ATOM   7021  H HD12 . LEU A 1 16 ? -12.763 4.737   8.902   1.00 0.00 ? 16 LEU A HD12 10 
ATOM   7022  H HD13 . LEU A 1 16 ? -12.406 3.631   10.228  1.00 0.00 ? 16 LEU A HD13 10 
ATOM   7023  H HD21 . LEU A 1 16 ? -12.819 3.619   6.589   1.00 0.00 ? 16 LEU A HD21 10 
ATOM   7024  H HD22 . LEU A 1 16 ? -14.452 3.853   7.210   1.00 0.00 ? 16 LEU A HD22 10 
ATOM   7025  H HD23 . LEU A 1 16 ? -13.983 2.295   6.530   1.00 0.00 ? 16 LEU A HD23 10 
ATOM   7026  N N    . LEU A 1 17 ? -11.273 -1.278  8.307   1.00 0.00 ? 17 LEU A N    10 
ATOM   7027  C CA   . LEU A 1 17 ? -11.652 -2.564  7.743   1.00 0.00 ? 17 LEU A CA   10 
ATOM   7028  C C    . LEU A 1 17 ? -11.256 -3.721  8.659   1.00 0.00 ? 17 LEU A C    10 
ATOM   7029  O O    . LEU A 1 17 ? -11.815 -4.813  8.559   1.00 0.00 ? 17 LEU A O    10 
ATOM   7030  C CB   . LEU A 1 17 ? -10.978 -2.740  6.385   1.00 0.00 ? 17 LEU A CB   10 
ATOM   7031  C CG   . LEU A 1 17 ? -11.243 -1.617  5.384   1.00 0.00 ? 17 LEU A CG   10 
ATOM   7032  C CD1  . LEU A 1 17 ? -10.365 -1.780  4.152   1.00 0.00 ? 17 LEU A CD1  10 
ATOM   7033  C CD2  . LEU A 1 17 ? -12.714 -1.587  4.993   1.00 0.00 ? 17 LEU A CD2  10 
ATOM   7034  H H    . LEU A 1 17 ? -10.334 -1.004  8.263   1.00 0.00 ? 17 LEU A H    10 
ATOM   7035  H HA   . LEU A 1 17 ? -12.722 -2.572  7.607   1.00 0.00 ? 17 LEU A HA   10 
ATOM   7036  H HB2  . LEU A 1 17 ? -9.909  -2.806  6.549   1.00 0.00 ? 17 LEU A HB2  10 
ATOM   7037  H HB3  . LEU A 1 17 ? -11.317 -3.668  5.953   1.00 0.00 ? 17 LEU A HB3  10 
ATOM   7038  H HG   . LEU A 1 17 ? -10.999 -0.669  5.844   1.00 0.00 ? 17 LEU A HG   10 
ATOM   7039  H HD11 . LEU A 1 17 ? -9.479  -1.172  4.259   1.00 0.00 ? 17 LEU A HD11 10 
ATOM   7040  H HD12 . LEU A 1 17 ? -10.914 -1.467  3.275   1.00 0.00 ? 17 LEU A HD12 10 
ATOM   7041  H HD13 . LEU A 1 17 ? -10.081 -2.816  4.048   1.00 0.00 ? 17 LEU A HD13 10 
ATOM   7042  H HD21 . LEU A 1 17 ? -13.300 -2.064  5.765   1.00 0.00 ? 17 LEU A HD21 10 
ATOM   7043  H HD22 . LEU A 1 17 ? -12.850 -2.112  4.060   1.00 0.00 ? 17 LEU A HD22 10 
ATOM   7044  H HD23 . LEU A 1 17 ? -13.035 -0.562  4.879   1.00 0.00 ? 17 LEU A HD23 10 
ATOM   7045  N N    . HIS A 1 18 ? -10.274 -3.492  9.532   1.00 0.00 ? 18 HIS A N    10 
ATOM   7046  C CA   . HIS A 1 18 ? -9.802  -4.537  10.430  1.00 0.00 ? 18 HIS A CA   10 
ATOM   7047  C C    . HIS A 1 18 ? -9.239  -5.689  9.614   1.00 0.00 ? 18 HIS A C    10 
ATOM   7048  O O    . HIS A 1 18 ? -9.652  -6.841  9.758   1.00 0.00 ? 18 HIS A O    10 
ATOM   7049  C CB   . HIS A 1 18 ? -10.931 -5.038  11.318  1.00 0.00 ? 18 HIS A CB   10 
ATOM   7050  C CG   . HIS A 1 18 ? -11.410 -4.028  12.313  1.00 0.00 ? 18 HIS A CG   10 
ATOM   7051  N ND1  . HIS A 1 18 ? -10.571 -3.385  13.198  1.00 0.00 ? 18 HIS A ND1  10 
ATOM   7052  C CD2  . HIS A 1 18 ? -12.653 -3.549  12.561  1.00 0.00 ? 18 HIS A CD2  10 
ATOM   7053  C CE1  . HIS A 1 18 ? -11.274 -2.555  13.947  1.00 0.00 ? 18 HIS A CE1  10 
ATOM   7054  N NE2  . HIS A 1 18 ? -12.540 -2.636  13.580  1.00 0.00 ? 18 HIS A NE2  10 
ATOM   7055  H H    . HIS A 1 18 ? -9.844  -2.611  9.558   1.00 0.00 ? 18 HIS A H    10 
ATOM   7056  H HA   . HIS A 1 18 ? -9.018  -4.123  11.045  1.00 0.00 ? 18 HIS A HA   10 
ATOM   7057  H HB2  . HIS A 1 18 ? -11.764 -5.318  10.696  1.00 0.00 ? 18 HIS A HB2  10 
ATOM   7058  H HB3  . HIS A 1 18 ? -10.586 -5.905  11.859  1.00 0.00 ? 18 HIS A HB3  10 
ATOM   7059  H HD1  . HIS A 1 18 ? -9.602  -3.518  13.267  1.00 0.00 ? 18 HIS A HD1  10 
ATOM   7060  H HD2  . HIS A 1 18 ? -13.563 -3.833  12.052  1.00 0.00 ? 18 HIS A HD2  10 
ATOM   7061  H HE1  . HIS A 1 18 ? -10.882 -1.919  14.727  1.00 0.00 ? 18 HIS A HE1  10 
ATOM   7062  H HE2  . HIS A 1 18 ? -13.287 -2.184  14.026  1.00 0.00 ? 18 HIS A HE2  10 
ATOM   7063  N N    . ALA A 1 19 ? -8.306  -5.354  8.745   1.00 0.00 ? 19 ALA A N    10 
ATOM   7064  C CA   . ALA A 1 19 ? -7.679  -6.319  7.875   1.00 0.00 ? 19 ALA A CA   10 
ATOM   7065  C C    . ALA A 1 19 ? -6.551  -5.685  7.098   1.00 0.00 ? 19 ALA A C    10 
ATOM   7066  O O    . ALA A 1 19 ? -6.667  -4.564  6.603   1.00 0.00 ? 19 ALA A O    10 
ATOM   7067  C CB   . ALA A 1 19 ? -8.683  -6.875  6.884   1.00 0.00 ? 19 ALA A CB   10 
ATOM   7068  H H    . ALA A 1 19 ? -8.035  -4.428  8.680   1.00 0.00 ? 19 ALA A H    10 
ATOM   7069  H HA   . ALA A 1 19 ? -7.298  -7.131  8.471   1.00 0.00 ? 19 ALA A HA   10 
ATOM   7070  H HB1  . ALA A 1 19 ? -8.434  -6.511  5.891   1.00 0.00 ? 19 ALA A HB1  10 
ATOM   7071  H HB2  . ALA A 1 19 ? -9.675  -6.546  7.152   1.00 0.00 ? 19 ALA A HB2  10 
ATOM   7072  H HB3  . ALA A 1 19 ? -8.640  -7.953  6.893   1.00 0.00 ? 19 ALA A HB3  10 
ATOM   7073  N N    . CYS A 1 20 ? -5.479  -6.422  6.969   1.00 0.00 ? 20 CYS A N    10 
ATOM   7074  C CA   . CYS A 1 20 ? -4.344  -5.951  6.207   1.00 0.00 ? 20 CYS A CA   10 
ATOM   7075  C C    . CYS A 1 20 ? -4.730  -5.882  4.734   1.00 0.00 ? 20 CYS A C    10 
ATOM   7076  O O    . CYS A 1 20 ? -4.862  -6.903  4.057   1.00 0.00 ? 20 CYS A O    10 
ATOM   7077  C CB   . CYS A 1 20 ? -3.127  -6.856  6.395   1.00 0.00 ? 20 CYS A CB   10 
ATOM   7078  S SG   . CYS A 1 20 ? -2.548  -6.996  8.117   1.00 0.00 ? 20 CYS A SG   10 
ATOM   7079  H H    . CYS A 1 20 ? -5.466  -7.304  7.373   1.00 0.00 ? 20 CYS A H    10 
ATOM   7080  H HA   . CYS A 1 20 ? -4.117  -4.955  6.548   1.00 0.00 ? 20 CYS A HA   10 
ATOM   7081  H HB2  . CYS A 1 20 ? -3.370  -7.849  6.050   1.00 0.00 ? 20 CYS A HB2  10 
ATOM   7082  H HB3  . CYS A 1 20 ? -2.312  -6.466  5.805   1.00 0.00 ? 20 CYS A HB3  10 
ATOM   7083  N N    . ILE A 1 21 ? -4.928  -4.666  4.264   1.00 0.00 ? 21 ILE A N    10 
ATOM   7084  C CA   . ILE A 1 21 ? -5.320  -4.404  2.894   1.00 0.00 ? 21 ILE A CA   10 
ATOM   7085  C C    . ILE A 1 21 ? -4.106  -4.029  2.057   1.00 0.00 ? 21 ILE A C    10 
ATOM   7086  O O    . ILE A 1 21 ? -3.246  -3.284  2.520   1.00 0.00 ? 21 ILE A O    10 
ATOM   7087  C CB   . ILE A 1 21 ? -6.312  -3.230  2.845   1.00 0.00 ? 21 ILE A CB   10 
ATOM   7088  C CG1  . ILE A 1 21 ? -7.229  -3.215  4.078   1.00 0.00 ? 21 ILE A CG1  10 
ATOM   7089  C CG2  . ILE A 1 21 ? -7.133  -3.261  1.565   1.00 0.00 ? 21 ILE A CG2  10 
ATOM   7090  C CD1  . ILE A 1 21 ? -8.048  -4.476  4.269   1.00 0.00 ? 21 ILE A CD1  10 
ATOM   7091  H H    . ILE A 1 21 ? -4.817  -3.909  4.863   1.00 0.00 ? 21 ILE A H    10 
ATOM   7092  H HA   . ILE A 1 21 ? -5.789  -5.284  2.487   1.00 0.00 ? 21 ILE A HA   10 
ATOM   7093  H HB   . ILE A 1 21 ? -5.722  -2.325  2.846   1.00 0.00 ? 21 ILE A HB   10 
ATOM   7094  H HG12 . ILE A 1 21 ? -6.626  -3.079  4.961   1.00 0.00 ? 21 ILE A HG12 10 
ATOM   7095  H HG13 . ILE A 1 21 ? -7.917  -2.385  3.991   1.00 0.00 ? 21 ILE A HG13 10 
ATOM   7096  H HG21 . ILE A 1 21 ? -7.563  -4.243  1.437   1.00 0.00 ? 21 ILE A HG21 10 
ATOM   7097  H HG22 . ILE A 1 21 ? -6.496  -3.034  0.723   1.00 0.00 ? 21 ILE A HG22 10 
ATOM   7098  H HG23 . ILE A 1 21 ? -7.923  -2.528  1.627   1.00 0.00 ? 21 ILE A HG23 10 
ATOM   7099  H HD11 . ILE A 1 21 ? -8.710  -4.610  3.428   1.00 0.00 ? 21 ILE A HD11 10 
ATOM   7100  H HD12 . ILE A 1 21 ? -8.633  -4.388  5.173   1.00 0.00 ? 21 ILE A HD12 10 
ATOM   7101  H HD13 . ILE A 1 21 ? -7.389  -5.327  4.352   1.00 0.00 ? 21 ILE A HD13 10 
ATOM   7102  N N    . PRO A 1 22 ? -4.002  -4.520  0.814   1.00 0.00 ? 22 PRO A N    10 
ATOM   7103  C CA   . PRO A 1 22 ? -2.862  -4.191  -0.036  1.00 0.00 ? 22 PRO A CA   10 
ATOM   7104  C C    . PRO A 1 22 ? -2.827  -2.706  -0.392  1.00 0.00 ? 22 PRO A C    10 
ATOM   7105  O O    . PRO A 1 22 ? -3.815  -1.996  -0.202  1.00 0.00 ? 22 PRO A O    10 
ATOM   7106  C CB   . PRO A 1 22 ? -3.071  -5.056  -1.285  1.00 0.00 ? 22 PRO A CB   10 
ATOM   7107  C CG   . PRO A 1 22 ? -4.531  -5.349  -1.306  1.00 0.00 ? 22 PRO A CG   10 
ATOM   7108  C CD   . PRO A 1 22 ? -4.957  -5.420  0.139   1.00 0.00 ? 22 PRO A CD   10 
ATOM   7109  H HA   . PRO A 1 22 ? -1.943  -4.462  0.450   1.00 0.00 ? 22 PRO A HA   10 
ATOM   7110  H HB2  . PRO A 1 22 ? -2.769  -4.508  -2.165  1.00 0.00 ? 22 PRO A HB2  10 
ATOM   7111  H HB3  . PRO A 1 22 ? -2.490  -5.962  -1.201  1.00 0.00 ? 22 PRO A HB3  10 
ATOM   7112  H HG2  . PRO A 1 22 ? -5.055  -4.553  -1.818  1.00 0.00 ? 22 PRO A HG2  10 
ATOM   7113  H HG3  . PRO A 1 22 ? -4.708  -6.294  -1.800  1.00 0.00 ? 22 PRO A HG3  10 
ATOM   7114  H HD2  . PRO A 1 22 ? -5.968  -5.066  0.250   1.00 0.00 ? 22 PRO A HD2  10 
ATOM   7115  H HD3  . PRO A 1 22 ? -4.864  -6.430  0.514   1.00 0.00 ? 22 PRO A HD3  10 
ATOM   7116  N N    . CYS A 1 23 ? -1.688  -2.235  -0.903  1.00 0.00 ? 23 CYS A N    10 
ATOM   7117  C CA   . CYS A 1 23 ? -1.551  -0.820  -1.273  1.00 0.00 ? 23 CYS A CA   10 
ATOM   7118  C C    . CYS A 1 23 ? -1.028  -0.659  -2.699  1.00 0.00 ? 23 CYS A C    10 
ATOM   7119  O O    . CYS A 1 23 ? -1.284  0.357   -3.345  1.00 0.00 ? 23 CYS A O    10 
ATOM   7120  C CB   . CYS A 1 23 ? -0.632  -0.072  -0.294  1.00 0.00 ? 23 CYS A CB   10 
ATOM   7121  S SG   . CYS A 1 23 ? -1.082  1.676   -0.054  1.00 0.00 ? 23 CYS A SG   10 
ATOM   7122  H H    . CYS A 1 23 ? -0.929  -2.848  -1.032  1.00 0.00 ? 23 CYS A H    10 
ATOM   7123  H HA   . CYS A 1 23 ? -2.537  -0.372  -1.227  1.00 0.00 ? 23 CYS A HA   10 
ATOM   7124  H HB2  . CYS A 1 23 ? -0.673  -0.550  0.675   1.00 0.00 ? 23 CYS A HB2  10 
ATOM   7125  H HB3  . CYS A 1 23 ? 0.383   -0.100  -0.664  1.00 0.00 ? 23 CYS A HB3  10 
ATOM   7126  N N    . GLN A 1 24 ? -0.307  -1.660  -3.195  1.00 0.00 ? 24 GLN A N    10 
ATOM   7127  C CA   . GLN A 1 24 ? 0.230   -1.607  -4.552  1.00 0.00 ? 24 GLN A CA   10 
ATOM   7128  C C    . GLN A 1 24 ? -0.887  -1.356  -5.554  1.00 0.00 ? 24 GLN A C    10 
ATOM   7129  O O    . GLN A 1 24 ? -0.758  -0.531  -6.459  1.00 0.00 ? 24 GLN A O    10 
ATOM   7130  C CB   . GLN A 1 24 ? 0.968   -2.910  -4.882  1.00 0.00 ? 24 GLN A CB   10 
ATOM   7131  C CG   . GLN A 1 24 ? 1.281   -3.085  -6.360  1.00 0.00 ? 24 GLN A CG   10 
ATOM   7132  C CD   . GLN A 1 24 ? 2.268   -2.056  -6.876  1.00 0.00 ? 24 GLN A CD   10 
ATOM   7133  O OE1  . GLN A 1 24 ? 3.461   -2.117  -6.574  1.00 0.00 ? 24 GLN A OE1  10 
ATOM   7134  N NE2  . GLN A 1 24 ? 1.776   -1.103  -7.658  1.00 0.00 ? 24 GLN A NE2  10 
ATOM   7135  H H    . GLN A 1 24 ? -0.135  -2.450  -2.644  1.00 0.00 ? 24 GLN A H    10 
ATOM   7136  H HA   . GLN A 1 24 ? 0.918   -0.786  -4.600  1.00 0.00 ? 24 GLN A HA   10 
ATOM   7137  H HB2  . GLN A 1 24 ? 1.900   -2.929  -4.337  1.00 0.00 ? 24 GLN A HB2  10 
ATOM   7138  H HB3  . GLN A 1 24 ? 0.359   -3.743  -4.565  1.00 0.00 ? 24 GLN A HB3  10 
ATOM   7139  H HG2  . GLN A 1 24 ? 1.698   -4.069  -6.512  1.00 0.00 ? 24 GLN A HG2  10 
ATOM   7140  H HG3  . GLN A 1 24 ? 0.362   -2.994  -6.922  1.00 0.00 ? 24 GLN A HG3  10 
ATOM   7141  H HE21 . GLN A 1 24 ? 0.816   -1.116  -7.856  1.00 0.00 ? 24 GLN A HE21 10 
ATOM   7142  H HE22 . GLN A 1 24 ? 2.393   -0.424  -8.005  1.00 0.00 ? 24 GLN A HE22 10 
ATOM   7143  N N    . LEU A 1 25 ? -1.984  -2.068  -5.371  1.00 0.00 ? 25 LEU A N    10 
ATOM   7144  C CA   . LEU A 1 25 ? -3.142  -1.931  -6.237  1.00 0.00 ? 25 LEU A CA   10 
ATOM   7145  C C    . LEU A 1 25 ? -3.826  -0.579  -6.035  1.00 0.00 ? 25 LEU A C    10 
ATOM   7146  O O    . LEU A 1 25 ? -4.739  -0.219  -6.779  1.00 0.00 ? 25 LEU A O    10 
ATOM   7147  C CB   . LEU A 1 25 ? -4.136  -3.066  -5.977  1.00 0.00 ? 25 LEU A CB   10 
ATOM   7148  C CG   . LEU A 1 25 ? -3.959  -4.299  -6.865  1.00 0.00 ? 25 LEU A CG   10 
ATOM   7149  C CD1  . LEU A 1 25 ? -4.301  -5.565  -6.095  1.00 0.00 ? 25 LEU A CD1  10 
ATOM   7150  C CD2  . LEU A 1 25 ? -4.819  -4.184  -8.114  1.00 0.00 ? 25 LEU A CD2  10 
ATOM   7151  H H    . LEU A 1 25 ? -2.015  -2.696  -4.630  1.00 0.00 ? 25 LEU A H    10 
ATOM   7152  H HA   . LEU A 1 25 ? -2.795  -1.997  -7.253  1.00 0.00 ? 25 LEU A HA   10 
ATOM   7153  H HB2  . LEU A 1 25 ? -4.039  -3.371  -4.946  1.00 0.00 ? 25 LEU A HB2  10 
ATOM   7154  H HB3  . LEU A 1 25 ? -5.136  -2.683  -6.129  1.00 0.00 ? 25 LEU A HB3  10 
ATOM   7155  H HG   . LEU A 1 25 ? -2.925  -4.366  -7.174  1.00 0.00 ? 25 LEU A HG   10 
ATOM   7156  H HD11 . LEU A 1 25 ? -4.745  -6.286  -6.765  1.00 0.00 ? 25 LEU A HD11 10 
ATOM   7157  H HD12 . LEU A 1 25 ? -5.000  -5.329  -5.306  1.00 0.00 ? 25 LEU A HD12 10 
ATOM   7158  H HD13 . LEU A 1 25 ? -3.400  -5.980  -5.666  1.00 0.00 ? 25 LEU A HD13 10 
ATOM   7159  H HD21 . LEU A 1 25 ? -5.029  -3.143  -8.312  1.00 0.00 ? 25 LEU A HD21 10 
ATOM   7160  H HD22 . LEU A 1 25 ? -5.747  -4.716  -7.963  1.00 0.00 ? 25 LEU A HD22 10 
ATOM   7161  H HD23 . LEU A 1 25 ? -4.293  -4.612  -8.954  1.00 0.00 ? 25 LEU A HD23 10 
ATOM   7162  N N    . ARG A 1 26 ? -3.387  0.168   -5.021  1.00 0.00 ? 26 ARG A N    10 
ATOM   7163  C CA   . ARG A 1 26 ? -3.966  1.474   -4.733  1.00 0.00 ? 26 ARG A CA   10 
ATOM   7164  C C    . ARG A 1 26 ? -3.035  2.606   -5.145  1.00 0.00 ? 26 ARG A C    10 
ATOM   7165  O O    . ARG A 1 26 ? -3.401  3.779   -5.086  1.00 0.00 ? 26 ARG A O    10 
ATOM   7166  C CB   . ARG A 1 26 ? -4.308  1.598   -3.247  1.00 0.00 ? 26 ARG A CB   10 
ATOM   7167  C CG   . ARG A 1 26 ? -4.899  0.333   -2.646  1.00 0.00 ? 26 ARG A CG   10 
ATOM   7168  C CD   . ARG A 1 26 ? -6.183  -0.071  -3.351  1.00 0.00 ? 26 ARG A CD   10 
ATOM   7169  N NE   . ARG A 1 26 ? -7.213  0.958   -3.229  1.00 0.00 ? 26 ARG A NE   10 
ATOM   7170  C CZ   . ARG A 1 26 ? -7.955  1.138   -2.139  1.00 0.00 ? 26 ARG A CZ   10 
ATOM   7171  N NH1  . ARG A 1 26 ? -7.788  0.359   -1.078  1.00 0.00 ? 26 ARG A NH1  10 
ATOM   7172  N NH2  . ARG A 1 26 ? -8.867  2.099   -2.109  1.00 0.00 ? 26 ARG A NH2  10 
ATOM   7173  H H    . ARG A 1 26 ? -2.664  -0.166  -4.458  1.00 0.00 ? 26 ARG A H    10 
ATOM   7174  H HA   . ARG A 1 26 ? -4.858  1.551   -5.307  1.00 0.00 ? 26 ARG A HA   10 
ATOM   7175  H HB2  . ARG A 1 26 ? -3.406  1.843   -2.704  1.00 0.00 ? 26 ARG A HB2  10 
ATOM   7176  H HB3  . ARG A 1 26 ? -5.020  2.399   -3.121  1.00 0.00 ? 26 ARG A HB3  10 
ATOM   7177  H HG2  . ARG A 1 26 ? -4.182  -0.468  -2.739  1.00 0.00 ? 26 ARG A HG2  10 
ATOM   7178  H HG3  . ARG A 1 26 ? -5.112  0.509   -1.601  1.00 0.00 ? 26 ARG A HG3  10 
ATOM   7179  H HD2  . ARG A 1 26 ? -5.960  -0.240  -4.395  1.00 0.00 ? 26 ARG A HD2  10 
ATOM   7180  H HD3  . ARG A 1 26 ? -6.538  -0.992  -2.913  1.00 0.00 ? 26 ARG A HD3  10 
ATOM   7181  H HE   . ARG A 1 26 ? -7.358  1.546   -3.999  1.00 0.00 ? 26 ARG A HE   10 
ATOM   7182  H HH11 . ARG A 1 26 ? -7.102  -0.369  -1.092  1.00 0.00 ? 26 ARG A HH11 10 
ATOM   7183  H HH12 . ARG A 1 26 ? -8.349  0.499   -0.261  1.00 0.00 ? 26 ARG A HH12 10 
ATOM   7184  H HH21 . ARG A 1 26 ? -8.998  2.689   -2.906  1.00 0.00 ? 26 ARG A HH21 10 
ATOM   7185  H HH22 . ARG A 1 26 ? -9.426  2.235   -1.292  1.00 0.00 ? 26 ARG A HH22 10 
ATOM   7186  N N    . CYS A 1 27 ? -1.840  2.242   -5.564  1.00 0.00 ? 27 CYS A N    10 
ATOM   7187  C CA   . CYS A 1 27 ? -0.853  3.228   -6.001  1.00 0.00 ? 27 CYS A CA   10 
ATOM   7188  C C    . CYS A 1 27 ? -1.274  3.840   -7.342  1.00 0.00 ? 27 CYS A C    10 
ATOM   7189  O O    . CYS A 1 27 ? -2.048  4.797   -7.375  1.00 0.00 ? 27 CYS A O    10 
ATOM   7190  C CB   . CYS A 1 27 ? 0.552   2.608   -6.103  1.00 0.00 ? 27 CYS A CB   10 
ATOM   7191  S SG   . CYS A 1 27 ? 1.808   3.732   -6.795  1.00 0.00 ? 27 CYS A SG   10 
ATOM   7192  H H    . CYS A 1 27 ? -1.625  1.294   -5.585  1.00 0.00 ? 27 CYS A H    10 
ATOM   7193  H HA   . CYS A 1 27 ? -0.831  4.011   -5.259  1.00 0.00 ? 27 CYS A HA   10 
ATOM   7194  H HB2  . CYS A 1 27 ? 0.883   2.319   -5.117  1.00 0.00 ? 27 CYS A HB2  10 
ATOM   7195  H HB3  . CYS A 1 27 ? 0.513   1.733   -6.736  1.00 0.00 ? 27 CYS A HB3  10 
ATOM   7196  N N    . SER A 1 28 ? -0.773  3.274   -8.444  1.00 0.00 ? 28 SER A N    10 
ATOM   7197  C CA   . SER A 1 28 ? -1.102  3.741   -9.784  1.00 0.00 ? 28 SER A CA   10 
ATOM   7198  C C    . SER A 1 28 ? -1.139  5.263   -9.864  1.00 0.00 ? 28 SER A C    10 
ATOM   7199  O O    . SER A 1 28 ? -1.874  5.835   -10.668 1.00 0.00 ? 28 SER A O    10 
ATOM   7200  C CB   . SER A 1 28 ? -2.438  3.150   -10.205 1.00 0.00 ? 28 SER A CB   10 
ATOM   7201  O OG   . SER A 1 28 ? -2.512  2.994   -11.613 1.00 0.00 ? 28 SER A OG   10 
ATOM   7202  H H    . SER A 1 28 ? -0.180  2.513   -8.355  1.00 0.00 ? 28 SER A H    10 
ATOM   7203  H HA   . SER A 1 28 ? -0.337  3.380   -10.454 1.00 0.00 ? 28 SER A HA   10 
ATOM   7204  H HB2  . SER A 1 28 ? -2.547  2.182   -9.740  1.00 0.00 ? 28 SER A HB2  10 
ATOM   7205  H HB3  . SER A 1 28 ? -3.236  3.799   -9.881  1.00 0.00 ? 28 SER A HB3  10 
ATOM   7206  H HG   . SER A 1 28 ? -1.903  2.306   -11.891 1.00 0.00 ? 28 SER A HG   10 
ATOM   7207  N N    . SER A 1 29 ? -0.335  5.905   -9.027  1.00 0.00 ? 29 SER A N    10 
ATOM   7208  C CA   . SER A 1 29 ? -0.264  7.361   -8.997  1.00 0.00 ? 29 SER A CA   10 
ATOM   7209  C C    . SER A 1 29 ? -1.618  7.971   -8.667  1.00 0.00 ? 29 SER A C    10 
ATOM   7210  O O    . SER A 1 29 ? -2.667  7.425   -9.010  1.00 0.00 ? 29 SER A O    10 
ATOM   7211  C CB   . SER A 1 29 ? 0.234   7.892   -10.337 1.00 0.00 ? 29 SER A CB   10 
ATOM   7212  O OG   . SER A 1 29 ? -0.822  7.988   -11.278 1.00 0.00 ? 29 SER A OG   10 
ATOM   7213  H H    . SER A 1 29 ? 0.229   5.385   -8.418  1.00 0.00 ? 29 SER A H    10 
ATOM   7214  H HA   . SER A 1 29 ? 0.438   7.652   -8.228  1.00 0.00 ? 29 SER A HA   10 
ATOM   7215  H HB2  . SER A 1 29 ? 0.662   8.873   -10.193 1.00 0.00 ? 29 SER A HB2  10 
ATOM   7216  H HB3  . SER A 1 29 ? 0.988   7.222   -10.725 1.00 0.00 ? 29 SER A HB3  10 
ATOM   7217  H HG   . SER A 1 29 ? -1.253  8.842   -11.190 1.00 0.00 ? 29 SER A HG   10 
ATOM   7218  N N    . ASN A 1 30 ? -1.576  9.109   -7.996  1.00 0.00 ? 30 ASN A N    10 
ATOM   7219  C CA   . ASN A 1 30 ? -2.789  9.822   -7.601  1.00 0.00 ? 30 ASN A CA   10 
ATOM   7220  C C    . ASN A 1 30 ? -3.509  9.086   -6.476  1.00 0.00 ? 30 ASN A C    10 
ATOM   7221  O O    . ASN A 1 30 ? -4.691  8.755   -6.588  1.00 0.00 ? 30 ASN A O    10 
ATOM   7222  C CB   . ASN A 1 30 ? -3.725  9.994   -8.801  1.00 0.00 ? 30 ASN A CB   10 
ATOM   7223  C CG   . ASN A 1 30 ? -4.692  11.147  -8.621  1.00 0.00 ? 30 ASN A CG   10 
ATOM   7224  O OD1  . ASN A 1 30 ? -4.331  12.310  -8.808  1.00 0.00 ? 30 ASN A OD1  10 
ATOM   7225  N ND2  . ASN A 1 30 ? -5.929  10.831  -8.257  1.00 0.00 ? 30 ASN A ND2  10 
ATOM   7226  H H    . ASN A 1 30 ? -0.702  9.478   -7.757  1.00 0.00 ? 30 ASN A H    10 
ATOM   7227  H HA   . ASN A 1 30 ? -2.495  10.798  -7.243  1.00 0.00 ? 30 ASN A HA   10 
ATOM   7228  H HB2  . ASN A 1 30 ? -3.135  10.180  -9.686  1.00 0.00 ? 30 ASN A HB2  10 
ATOM   7229  H HB3  . ASN A 1 30 ? -4.295  9.087   -8.939  1.00 0.00 ? 30 ASN A HB3  10 
ATOM   7230  H HD21 . ASN A 1 30 ? -6.145  9.884   -8.127  1.00 0.00 ? 30 ASN A HD21 10 
ATOM   7231  H HD22 . ASN A 1 30 ? -6.575  11.557  -8.133  1.00 0.00 ? 30 ASN A HD22 10 
ATOM   7232  N N    . THR A 1 31 ? -2.787  8.841   -5.388  1.00 0.00 ? 31 THR A N    10 
ATOM   7233  C CA   . THR A 1 31 ? -3.335  8.153   -4.237  1.00 0.00 ? 31 THR A CA   10 
ATOM   7234  C C    . THR A 1 31 ? -2.410  8.309   -3.030  1.00 0.00 ? 31 THR A C    10 
ATOM   7235  O O    . THR A 1 31 ? -1.825  7.333   -2.564  1.00 0.00 ? 31 THR A O    10 
ATOM   7236  C CB   . THR A 1 31 ? -3.542  6.671   -4.552  1.00 0.00 ? 31 THR A CB   10 
ATOM   7237  O OG1  . THR A 1 31 ? -4.441  6.508   -5.635  1.00 0.00 ? 31 THR A OG1  10 
ATOM   7238  C CG2  . THR A 1 31 ? -4.084  5.878   -3.382  1.00 0.00 ? 31 THR A CG2  10 
ATOM   7239  H H    . THR A 1 31 ? -1.864  9.135   -5.357  1.00 0.00 ? 31 THR A H    10 
ATOM   7240  H HA   . THR A 1 31 ? -4.278  8.597   -4.018  1.00 0.00 ? 31 THR A HA   10 
ATOM   7241  H HB   . THR A 1 31 ? -2.595  6.243   -4.832  1.00 0.00 ? 31 THR A HB   10 
ATOM   7242  H HG1  . THR A 1 31 ? -4.519  5.575   -5.848  1.00 0.00 ? 31 THR A HG1  10 
ATOM   7243  H HG21 . THR A 1 31 ? -4.724  5.088   -3.748  1.00 0.00 ? 31 THR A HG21 10 
ATOM   7244  H HG22 . THR A 1 31 ? -4.651  6.531   -2.736  1.00 0.00 ? 31 THR A HG22 10 
ATOM   7245  H HG23 . THR A 1 31 ? -3.262  5.448   -2.828  1.00 0.00 ? 31 THR A HG23 10 
ATOM   7246  N N    . PRO A 1 32 ? -2.253  9.549   -2.517  1.00 0.00 ? 32 PRO A N    10 
ATOM   7247  C CA   . PRO A 1 32 ? -1.388  9.847   -1.372  1.00 0.00 ? 32 PRO A CA   10 
ATOM   7248  C C    . PRO A 1 32 ? -1.396  8.753   -0.306  1.00 0.00 ? 32 PRO A C    10 
ATOM   7249  O O    . PRO A 1 32 ? -2.224  8.762   0.605   1.00 0.00 ? 32 PRO A O    10 
ATOM   7250  C CB   . PRO A 1 32 ? -1.965  11.160  -0.809  1.00 0.00 ? 32 PRO A CB   10 
ATOM   7251  C CG   . PRO A 1 32 ? -3.107  11.535  -1.708  1.00 0.00 ? 32 PRO A CG   10 
ATOM   7252  C CD   . PRO A 1 32 ? -2.889  10.774  -3.005  1.00 0.00 ? 32 PRO A CD   10 
ATOM   7253  H HA   . PRO A 1 32 ? -0.372  10.015  -1.690  1.00 0.00 ? 32 PRO A HA   10 
ATOM   7254  H HB2  . PRO A 1 32 ? -2.304  10.999  0.203   1.00 0.00 ? 32 PRO A HB2  10 
ATOM   7255  H HB3  . PRO A 1 32 ? -1.198  11.921  -0.816  1.00 0.00 ? 32 PRO A HB3  10 
ATOM   7256  H HG2  . PRO A 1 32 ? -4.040  11.241  -1.240  1.00 0.00 ? 32 PRO A HG2  10 
ATOM   7257  H HG3  . PRO A 1 32 ? -3.098  12.606  -1.881  1.00 0.00 ? 32 PRO A HG3  10 
ATOM   7258  H HD2  . PRO A 1 32 ? -3.828  10.560  -3.502  1.00 0.00 ? 32 PRO A HD2  10 
ATOM   7259  H HD3  . PRO A 1 32 ? -2.222  11.311  -3.669  1.00 0.00 ? 32 PRO A HD3  10 
ATOM   7260  N N    . PRO A 1 33 ? -0.455  7.798   -0.408  1.00 0.00 ? 33 PRO A N    10 
ATOM   7261  C CA   . PRO A 1 33 ? -0.314  6.692   0.525   1.00 0.00 ? 33 PRO A CA   10 
ATOM   7262  C C    . PRO A 1 33 ? 0.634   7.015   1.656   1.00 0.00 ? 33 PRO A C    10 
ATOM   7263  O O    . PRO A 1 33 ? 1.814   6.713   1.588   1.00 0.00 ? 33 PRO A O    10 
ATOM   7264  C CB   . PRO A 1 33 ? 0.253   5.571   -0.355  1.00 0.00 ? 33 PRO A CB   10 
ATOM   7265  C CG   . PRO A 1 33 ? 0.728   6.225   -1.625  1.00 0.00 ? 33 PRO A CG   10 
ATOM   7266  C CD   . PRO A 1 33 ? 0.569   7.712   -1.448  1.00 0.00 ? 33 PRO A CD   10 
ATOM   7267  H HA   . PRO A 1 33 ? -1.245  6.377   0.942   1.00 0.00 ? 33 PRO A HA   10 
ATOM   7268  H HB2  . PRO A 1 33 ? 1.063   5.091   0.163   1.00 0.00 ? 33 PRO A HB2  10 
ATOM   7269  H HB3  . PRO A 1 33 ? -0.523  4.847   -0.557  1.00 0.00 ? 33 PRO A HB3  10 
ATOM   7270  H HG2  . PRO A 1 33 ? 1.764   5.980   -1.794  1.00 0.00 ? 33 PRO A HG2  10 
ATOM   7271  H HG3  . PRO A 1 33 ? 0.126   5.883   -2.455  1.00 0.00 ? 33 PRO A HG3  10 
ATOM   7272  H HD2  . PRO A 1 33 ? 1.497   8.157   -1.119  1.00 0.00 ? 33 PRO A HD2  10 
ATOM   7273  H HD3  . PRO A 1 33 ? 0.231   8.171   -2.366  1.00 0.00 ? 33 PRO A HD3  10 
ATOM   7274  N N    . LEU A 1 34 ? 0.120   7.618   2.717   1.00 0.00 ? 34 LEU A N    10 
ATOM   7275  C CA   . LEU A 1 34 ? 0.972   7.947   3.851   1.00 0.00 ? 34 LEU A CA   10 
ATOM   7276  C C    . LEU A 1 34 ? 1.729   6.710   4.304   1.00 0.00 ? 34 LEU A C    10 
ATOM   7277  O O    . LEU A 1 34 ? 2.918   6.776   4.615   1.00 0.00 ? 34 LEU A O    10 
ATOM   7278  C CB   . LEU A 1 34 ? 0.169   8.540   5.016   1.00 0.00 ? 34 LEU A CB   10 
ATOM   7279  C CG   . LEU A 1 34 ? -0.768  9.693   4.650   1.00 0.00 ? 34 LEU A CG   10 
ATOM   7280  C CD1  . LEU A 1 34 ? -1.403  10.279  5.903   1.00 0.00 ? 34 LEU A CD1  10 
ATOM   7281  C CD2  . LEU A 1 34 ? -0.019  10.771  3.875   1.00 0.00 ? 34 LEU A CD2  10 
ATOM   7282  H H    . LEU A 1 34 ? -0.836  7.836   2.738   1.00 0.00 ? 34 LEU A H    10 
ATOM   7283  H HA   . LEU A 1 34 ? 1.692   8.661   3.507   1.00 0.00 ? 34 LEU A HA   10 
ATOM   7284  H HB2  . LEU A 1 34 ? -0.423  7.753   5.458   1.00 0.00 ? 34 LEU A HB2  10 
ATOM   7285  H HB3  . LEU A 1 34 ? 0.868   8.898   5.758   1.00 0.00 ? 34 LEU A HB3  10 
ATOM   7286  H HG   . LEU A 1 34 ? -1.560  9.315   4.023   1.00 0.00 ? 34 LEU A HG   10 
ATOM   7287  H HD11 . LEU A 1 34 ? -2.241  9.667   6.201   1.00 0.00 ? 34 LEU A HD11 10 
ATOM   7288  H HD12 . LEU A 1 34 ? -1.744  11.283  5.698   1.00 0.00 ? 34 LEU A HD12 10 
ATOM   7289  H HD13 . LEU A 1 34 ? -0.673  10.302  6.699   1.00 0.00 ? 34 LEU A HD13 10 
ATOM   7290  H HD21 . LEU A 1 34 ? -0.453  10.876  2.891   1.00 0.00 ? 34 LEU A HD21 10 
ATOM   7291  H HD22 . LEU A 1 34 ? 1.021   10.495  3.782   1.00 0.00 ? 34 LEU A HD22 10 
ATOM   7292  H HD23 . LEU A 1 34 ? -0.094  11.712  4.402   1.00 0.00 ? 34 LEU A HD23 10 
ATOM   7293  N N    . THR A 1 35 ? 1.041   5.579   4.311   1.00 0.00 ? 35 THR A N    10 
ATOM   7294  C CA   . THR A 1 35 ? 1.662   4.330   4.694   1.00 0.00 ? 35 THR A CA   10 
ATOM   7295  C C    . THR A 1 35 ? 2.315   3.652   3.487   1.00 0.00 ? 35 THR A C    10 
ATOM   7296  O O    . THR A 1 35 ? 2.950   2.607   3.634   1.00 0.00 ? 35 THR A O    10 
ATOM   7297  C CB   . THR A 1 35 ? 0.635   3.394   5.336   1.00 0.00 ? 35 THR A CB   10 
ATOM   7298  O OG1  . THR A 1 35 ? 1.270   2.249   5.878   1.00 0.00 ? 35 THR A OG1  10 
ATOM   7299  C CG2  . THR A 1 35 ? -0.431  2.914   4.376   1.00 0.00 ? 35 THR A CG2  10 
ATOM   7300  H H    . THR A 1 35 ? 0.102   5.583   4.039   1.00 0.00 ? 35 THR A H    10 
ATOM   7301  H HA   . THR A 1 35 ? 2.428   4.555   5.420   1.00 0.00 ? 35 THR A HA   10 
ATOM   7302  H HB   . THR A 1 35 ? 0.140   3.919   6.142   1.00 0.00 ? 35 THR A HB   10 
ATOM   7303  H HG1  . THR A 1 35 ? 1.611   1.704   5.165   1.00 0.00 ? 35 THR A HG1  10 
ATOM   7304  H HG21 . THR A 1 35 ? -0.511  3.606   3.550   1.00 0.00 ? 35 THR A HG21 10 
ATOM   7305  H HG22 . THR A 1 35 ? -1.379  2.855   4.890   1.00 0.00 ? 35 THR A HG22 10 
ATOM   7306  H HG23 . THR A 1 35 ? -0.164  1.935   4.001   1.00 0.00 ? 35 THR A HG23 10 
ATOM   7307  N N    . CYS A 1 36 ? 2.159   4.232   2.285   1.00 0.00 ? 36 CYS A N    10 
ATOM   7308  C CA   . CYS A 1 36 ? 2.753   3.618   1.091   1.00 0.00 ? 36 CYS A CA   10 
ATOM   7309  C C    . CYS A 1 36 ? 3.343   4.638   0.110   1.00 0.00 ? 36 CYS A C    10 
ATOM   7310  O O    . CYS A 1 36 ? 3.747   4.272   -0.990  1.00 0.00 ? 36 CYS A O    10 
ATOM   7311  C CB   . CYS A 1 36 ? 1.724   2.745   0.360   1.00 0.00 ? 36 CYS A CB   10 
ATOM   7312  S SG   . CYS A 1 36 ? 0.244   2.322   1.338   1.00 0.00 ? 36 CYS A SG   10 
ATOM   7313  H H    . CYS A 1 36 ? 1.632   5.068   2.203   1.00 0.00 ? 36 CYS A H    10 
ATOM   7314  H HA   . CYS A 1 36 ? 3.551   2.984   1.429   1.00 0.00 ? 36 CYS A HA   10 
ATOM   7315  H HB2  . CYS A 1 36 ? 1.389   3.265   -0.526  1.00 0.00 ? 36 CYS A HB2  10 
ATOM   7316  H HB3  . CYS A 1 36 ? 2.198   1.819   0.066   1.00 0.00 ? 36 CYS A HB3  10 
ATOM   7317  N N    . GLN A 1 37 ? 3.382   5.909   0.492   1.00 0.00 ? 37 GLN A N    10 
ATOM   7318  C CA   . GLN A 1 37 ? 3.912   6.955   -0.381  1.00 0.00 ? 37 GLN A CA   10 
ATOM   7319  C C    . GLN A 1 37 ? 5.263   6.559   -0.950  1.00 0.00 ? 37 GLN A C    10 
ATOM   7320  O O    . GLN A 1 37 ? 5.496   6.633   -2.157  1.00 0.00 ? 37 GLN A O    10 
ATOM   7321  C CB   . GLN A 1 37 ? 4.016   8.291   0.388   1.00 0.00 ? 37 GLN A CB   10 
ATOM   7322  C CG   . GLN A 1 37 ? 5.223   8.420   1.312   1.00 0.00 ? 37 GLN A CG   10 
ATOM   7323  C CD   . GLN A 1 37 ? 5.081   7.610   2.587   1.00 0.00 ? 37 GLN A CD   10 
ATOM   7324  O OE1  . GLN A 1 37 ? 4.806   6.411   2.549   1.00 0.00 ? 37 GLN A OE1  10 
ATOM   7325  N NE2  . GLN A 1 37 ? 5.270   8.264   3.726   1.00 0.00 ? 37 GLN A NE2  10 
ATOM   7326  H H    . GLN A 1 37 ? 3.035   6.156   1.373   1.00 0.00 ? 37 GLN A H    10 
ATOM   7327  H HA   . GLN A 1 37 ? 3.223   7.068   -1.202  1.00 0.00 ? 37 GLN A HA   10 
ATOM   7328  H HB2  . GLN A 1 37 ? 4.064   9.099   -0.321  1.00 0.00 ? 37 GLN A HB2  10 
ATOM   7329  H HB3  . GLN A 1 37 ? 3.130   8.406   0.990   1.00 0.00 ? 37 GLN A HB3  10 
ATOM   7330  H HG2  . GLN A 1 37 ? 6.105   8.092   0.789   1.00 0.00 ? 37 GLN A HG2  10 
ATOM   7331  H HG3  . GLN A 1 37 ? 5.337   9.460   1.580   1.00 0.00 ? 37 GLN A HG3  10 
ATOM   7332  H HE21 . GLN A 1 37 ? 5.488   9.219   3.682   1.00 0.00 ? 37 GLN A HE21 10 
ATOM   7333  H HE22 . GLN A 1 37 ? 5.185   7.766   4.566   1.00 0.00 ? 37 GLN A HE22 10 
ATOM   7334  N N    . ARG A 1 38 ? 6.138   6.144   -0.065  1.00 0.00 ? 38 ARG A N    10 
ATOM   7335  C CA   . ARG A 1 38 ? 7.481   5.729   -0.447  1.00 0.00 ? 38 ARG A CA   10 
ATOM   7336  C C    . ARG A 1 38 ? 7.428   4.562   -1.433  1.00 0.00 ? 38 ARG A C    10 
ATOM   7337  O O    . ARG A 1 38 ? 8.155   4.546   -2.425  1.00 0.00 ? 38 ARG A O    10 
ATOM   7338  C CB   . ARG A 1 38 ? 8.305   5.367   0.801   1.00 0.00 ? 38 ARG A CB   10 
ATOM   7339  C CG   . ARG A 1 38 ? 8.399   3.875   1.101   1.00 0.00 ? 38 ARG A CG   10 
ATOM   7340  C CD   . ARG A 1 38 ? 8.872   3.626   2.524   1.00 0.00 ? 38 ARG A CD   10 
ATOM   7341  N NE   . ARG A 1 38 ? 10.029  4.454   2.859   1.00 0.00 ? 38 ARG A NE   10 
ATOM   7342  C CZ   . ARG A 1 38 ? 10.308  4.885   4.087   1.00 0.00 ? 38 ARG A CZ   10 
ATOM   7343  N NH1  . ARG A 1 38 ? 9.526   4.560   5.110   1.00 0.00 ? 38 ARG A NH1  10 
ATOM   7344  N NH2  . ARG A 1 38 ? 11.377  5.642   4.296   1.00 0.00 ? 38 ARG A NH2  10 
ATOM   7345  H H    . ARG A 1 38 ? 5.870   6.125   0.873   1.00 0.00 ? 38 ARG A H    10 
ATOM   7346  H HA   . ARG A 1 38 ? 7.951   6.568   -0.940  1.00 0.00 ? 38 ARG A HA   10 
ATOM   7347  H HB2  . ARG A 1 38 ? 9.308   5.743   0.671   1.00 0.00 ? 38 ARG A HB2  10 
ATOM   7348  H HB3  . ARG A 1 38 ? 7.861   5.854   1.658   1.00 0.00 ? 38 ARG A HB3  10 
ATOM   7349  H HG2  . ARG A 1 38 ? 7.427   3.426   0.974   1.00 0.00 ? 38 ARG A HG2  10 
ATOM   7350  H HG3  . ARG A 1 38 ? 9.100   3.423   0.414   1.00 0.00 ? 38 ARG A HG3  10 
ATOM   7351  H HD2  . ARG A 1 38 ? 8.056   3.852   3.195   1.00 0.00 ? 38 ARG A HD2  10 
ATOM   7352  H HD3  . ARG A 1 38 ? 9.132   2.584   2.621   1.00 0.00 ? 38 ARG A HD3  10 
ATOM   7353  H HE   . ARG A 1 38 ? 10.630  4.706   2.127   1.00 0.00 ? 38 ARG A HE   10 
ATOM   7354  H HH11 . ARG A 1 38 ? 8.721   3.987   4.963   1.00 0.00 ? 38 ARG A HH11 10 
ATOM   7355  H HH12 . ARG A 1 38 ? 9.744   4.889   6.030   1.00 0.00 ? 38 ARG A HH12 10 
ATOM   7356  H HH21 . ARG A 1 38 ? 11.973  5.888   3.531   1.00 0.00 ? 38 ARG A HH21 10 
ATOM   7357  H HH22 . ARG A 1 38 ? 11.588  5.966   5.219   1.00 0.00 ? 38 ARG A HH22 10 
ATOM   7358  N N    . TYR A 1 39 ? 6.563   3.591   -1.158  1.00 0.00 ? 39 TYR A N    10 
ATOM   7359  C CA   . TYR A 1 39 ? 6.428   2.427   -2.019  1.00 0.00 ? 39 TYR A CA   10 
ATOM   7360  C C    . TYR A 1 39 ? 5.736   2.776   -3.328  1.00 0.00 ? 39 TYR A C    10 
ATOM   7361  O O    . TYR A 1 39 ? 6.177   2.359   -4.399  1.00 0.00 ? 39 TYR A O    10 
ATOM   7362  C CB   . TYR A 1 39 ? 5.666   1.306   -1.305  1.00 0.00 ? 39 TYR A CB   10 
ATOM   7363  C CG   . TYR A 1 39 ? 5.844   -0.041  -1.963  1.00 0.00 ? 39 TYR A CG   10 
ATOM   7364  C CD1  . TYR A 1 39 ? 7.015   -0.768  -1.790  1.00 0.00 ? 39 TYR A CD1  10 
ATOM   7365  C CD2  . TYR A 1 39 ? 4.851   -0.578  -2.775  1.00 0.00 ? 39 TYR A CD2  10 
ATOM   7366  C CE1  . TYR A 1 39 ? 7.194   -1.990  -2.409  1.00 0.00 ? 39 TYR A CE1  10 
ATOM   7367  C CE2  . TYR A 1 39 ? 5.022   -1.801  -3.393  1.00 0.00 ? 39 TYR A CE2  10 
ATOM   7368  C CZ   . TYR A 1 39 ? 6.195   -2.502  -3.209  1.00 0.00 ? 39 TYR A CZ   10 
ATOM   7369  O OH   . TYR A 1 39 ? 6.369   -3.719  -3.827  1.00 0.00 ? 39 TYR A OH   10 
ATOM   7370  H H    . TYR A 1 39 ? 6.010   3.656   -0.360  1.00 0.00 ? 39 TYR A H    10 
ATOM   7371  H HA   . TYR A 1 39 ? 7.419   2.081   -2.246  1.00 0.00 ? 39 TYR A HA   10 
ATOM   7372  H HB2  . TYR A 1 39 ? 6.020   1.230   -0.286  1.00 0.00 ? 39 TYR A HB2  10 
ATOM   7373  H HB3  . TYR A 1 39 ? 4.612   1.539   -1.300  1.00 0.00 ? 39 TYR A HB3  10 
ATOM   7374  H HD1  . TYR A 1 39 ? 7.795   -0.364  -1.161  1.00 0.00 ? 39 TYR A HD1  10 
ATOM   7375  H HD2  . TYR A 1 39 ? 3.932   -0.027  -2.917  1.00 0.00 ? 39 TYR A HD2  10 
ATOM   7376  H HE1  . TYR A 1 39 ? 8.111   -2.540  -2.263  1.00 0.00 ? 39 TYR A HE1  10 
ATOM   7377  H HE2  . TYR A 1 39 ? 4.239   -2.202  -4.020  1.00 0.00 ? 39 TYR A HE2  10 
ATOM   7378  H HH   . TYR A 1 39 ? 6.069   -3.663  -4.737  1.00 0.00 ? 39 TYR A HH   10 
ATOM   7379  N N    . CYS A 1 40 ? 4.662   3.545   -3.245  1.00 0.00 ? 40 CYS A N    10 
ATOM   7380  C CA   . CYS A 1 40 ? 3.937   3.944   -4.446  1.00 0.00 ? 40 CYS A CA   10 
ATOM   7381  C C    . CYS A 1 40 ? 4.862   4.713   -5.374  1.00 0.00 ? 40 CYS A C    10 
ATOM   7382  O O    . CYS A 1 40 ? 4.818   4.542   -6.592  1.00 0.00 ? 40 CYS A O    10 
ATOM   7383  C CB   . CYS A 1 40 ? 2.703   4.785   -4.101  1.00 0.00 ? 40 CYS A CB   10 
ATOM   7384  S SG   . CYS A 1 40 ? 1.759   5.340   -5.556  1.00 0.00 ? 40 CYS A SG   10 
ATOM   7385  H H    . CYS A 1 40 ? 4.359   3.856   -2.365  1.00 0.00 ? 40 CYS A H    10 
ATOM   7386  H HA   . CYS A 1 40 ? 3.624   3.044   -4.953  1.00 0.00 ? 40 CYS A HA   10 
ATOM   7387  H HB2  . CYS A 1 40 ? 2.034   4.199   -3.487  1.00 0.00 ? 40 CYS A HB2  10 
ATOM   7388  H HB3  . CYS A 1 40 ? 3.011   5.663   -3.554  1.00 0.00 ? 40 CYS A HB3  10 
ATOM   7389  N N    . ASN A 1 41 ? 5.723   5.539   -4.791  1.00 0.00 ? 41 ASN A N    10 
ATOM   7390  C CA   . ASN A 1 41 ? 6.675   6.304   -5.575  1.00 0.00 ? 41 ASN A CA   10 
ATOM   7391  C C    . ASN A 1 41 ? 7.695   5.369   -6.209  1.00 0.00 ? 41 ASN A C    10 
ATOM   7392  O O    . ASN A 1 41 ? 8.358   5.717   -7.185  1.00 0.00 ? 41 ASN A O    10 
ATOM   7393  C CB   . ASN A 1 41 ? 7.351   7.380   -4.709  1.00 0.00 ? 41 ASN A CB   10 
ATOM   7394  C CG   . ASN A 1 41 ? 8.864   7.245   -4.645  1.00 0.00 ? 41 ASN A CG   10 
ATOM   7395  O OD1  . ASN A 1 41 ? 9.597   8.100   -5.139  1.00 0.00 ? 41 ASN A OD1  10 
ATOM   7396  N ND2  . ASN A 1 41 ? 9.337   6.164   -4.034  1.00 0.00 ? 41 ASN A ND2  10 
ATOM   7397  H H    . ASN A 1 41 ? 5.729   5.622   -3.818  1.00 0.00 ? 41 ASN A H    10 
ATOM   7398  H HA   . ASN A 1 41 ? 6.127   6.774   -6.361  1.00 0.00 ? 41 ASN A HA   10 
ATOM   7399  H HB2  . ASN A 1 41 ? 7.118   8.352   -5.113  1.00 0.00 ? 41 ASN A HB2  10 
ATOM   7400  H HB3  . ASN A 1 41 ? 6.962   7.314   -3.703  1.00 0.00 ? 41 ASN A HB3  10 
ATOM   7401  H HD21 . ASN A 1 41 ? 8.694   5.522   -3.663  1.00 0.00 ? 41 ASN A HD21 10 
ATOM   7402  H HD22 . ASN A 1 41 ? 10.309  6.052   -3.978  1.00 0.00 ? 41 ASN A HD22 10 
ATOM   7403  N N    . ALA A 1 42 ? 7.793   4.172   -5.652  1.00 0.00 ? 42 ALA A N    10 
ATOM   7404  C CA   . ALA A 1 42 ? 8.708   3.165   -6.165  1.00 0.00 ? 42 ALA A CA   10 
ATOM   7405  C C    . ALA A 1 42 ? 7.952   2.132   -6.986  1.00 0.00 ? 42 ALA A C    10 
ATOM   7406  O O    . ALA A 1 42 ? 8.407   1.004   -7.170  1.00 0.00 ? 42 ALA A O    10 
ATOM   7407  C CB   . ALA A 1 42 ? 9.472   2.501   -5.030  1.00 0.00 ? 42 ALA A CB   10 
ATOM   7408  H H    . ALA A 1 42 ? 7.223   3.959   -4.888  1.00 0.00 ? 42 ALA A H    10 
ATOM   7409  H HA   . ALA A 1 42 ? 9.411   3.661   -6.809  1.00 0.00 ? 42 ALA A HA   10 
ATOM   7410  H HB1  . ALA A 1 42 ? 9.420   3.124   -4.149  1.00 0.00 ? 42 ALA A HB1  10 
ATOM   7411  H HB2  . ALA A 1 42 ? 10.506  2.372   -5.319  1.00 0.00 ? 42 ALA A HB2  10 
ATOM   7412  H HB3  . ALA A 1 42 ? 9.035   1.537   -4.816  1.00 0.00 ? 42 ALA A HB3  10 
ATOM   7413  N N    . SER A 1 43 ? 6.792   2.542   -7.480  1.00 0.00 ? 43 SER A N    10 
ATOM   7414  C CA   . SER A 1 43 ? 5.949   1.681   -8.296  1.00 0.00 ? 43 SER A CA   10 
ATOM   7415  C C    . SER A 1 43 ? 5.219   2.480   -9.377  1.00 0.00 ? 43 SER A C    10 
ATOM   7416  O O    . SER A 1 43 ? 4.307   1.966   -10.025 1.00 0.00 ? 43 SER A O    10 
ATOM   7417  C CB   . SER A 1 43 ? 4.936   0.944   -7.418  1.00 0.00 ? 43 SER A CB   10 
ATOM   7418  O OG   . SER A 1 43 ? 5.548   -0.128  -6.721  1.00 0.00 ? 43 SER A OG   10 
ATOM   7419  H H    . SER A 1 43 ? 6.499   3.452   -7.292  1.00 0.00 ? 43 SER A H    10 
ATOM   7420  H HA   . SER A 1 43 ? 6.588   0.958   -8.773  1.00 0.00 ? 43 SER A HA   10 
ATOM   7421  H HB2  . SER A 1 43 ? 4.518   1.632   -6.698  1.00 0.00 ? 43 SER A HB2  10 
ATOM   7422  H HB3  . SER A 1 43 ? 4.145   0.549   -8.039  1.00 0.00 ? 43 SER A HB3  10 
ATOM   7423  H HG   . SER A 1 43 ? 6.108   -0.623  -7.323  1.00 0.00 ? 43 SER A HG   10 
ATOM   7424  N N    . VAL A 1 44 ? 5.627   3.735   -9.577  1.00 0.00 ? 44 VAL A N    10 
ATOM   7425  C CA   . VAL A 1 44 ? 5.011   4.586   -10.585 1.00 0.00 ? 44 VAL A CA   10 
ATOM   7426  C C    . VAL A 1 44 ? 5.976   5.672   -11.047 1.00 0.00 ? 44 VAL A C    10 
ATOM   7427  O O    . VAL A 1 44 ? 5.731   6.863   -10.853 1.00 0.00 ? 44 VAL A O    10 
ATOM   7428  C CB   . VAL A 1 44 ? 3.718   5.246   -10.062 1.00 0.00 ? 44 VAL A CB   10 
ATOM   7429  C CG1  . VAL A 1 44 ? 2.617   4.210   -9.899  1.00 0.00 ? 44 VAL A CG1  10 
ATOM   7430  C CG2  . VAL A 1 44 ? 3.980   5.974   -8.751  1.00 0.00 ? 44 VAL A CG2  10 
ATOM   7431  H H    . VAL A 1 44 ? 6.361   4.096   -9.043  1.00 0.00 ? 44 VAL A H    10 
ATOM   7432  H HA   . VAL A 1 44 ? 4.758   3.963   -11.428 1.00 0.00 ? 44 VAL A HA   10 
ATOM   7433  H HB   . VAL A 1 44 ? 3.390   5.973   -10.791 1.00 0.00 ? 44 VAL A HB   10 
ATOM   7434  H HG11 . VAL A 1 44 ? 2.928   3.463   -9.185  1.00 0.00 ? 44 VAL A HG11 10 
ATOM   7435  H HG12 . VAL A 1 44 ? 2.422   3.739   -10.851 1.00 0.00 ? 44 VAL A HG12 10 
ATOM   7436  H HG13 . VAL A 1 44 ? 1.718   4.693   -9.546  1.00 0.00 ? 44 VAL A HG13 10 
ATOM   7437  H HG21 . VAL A 1 44 ? 4.999   5.800   -8.438  1.00 0.00 ? 44 VAL A HG21 10 
ATOM   7438  H HG22 . VAL A 1 44 ? 3.302   5.609   -7.993  1.00 0.00 ? 44 VAL A HG22 10 
ATOM   7439  H HG23 . VAL A 1 44 ? 3.824   7.033   -8.891  1.00 0.00 ? 44 VAL A HG23 10 
ATOM   7440  N N    . THR A 1 45 ? 7.075   5.250   -11.663 1.00 0.00 ? 45 THR A N    10 
ATOM   7441  C CA   . THR A 1 45 ? 8.081   6.176   -12.159 1.00 0.00 ? 45 THR A CA   10 
ATOM   7442  C C    . THR A 1 45 ? 8.726   6.944   -11.008 1.00 0.00 ? 45 THR A C    10 
ATOM   7443  O O    . THR A 1 45 ? 8.275   6.860   -9.866  1.00 0.00 ? 45 THR A O    10 
ATOM   7444  C CB   . THR A 1 45 ? 7.442   7.144   -13.151 1.00 0.00 ? 45 THR A CB   10 
ATOM   7445  O OG1  . THR A 1 45 ? 6.656   6.444   -14.097 1.00 0.00 ? 45 THR A OG1  10 
ATOM   7446  C CG2  . THR A 1 45 ? 8.442   7.983   -13.916 1.00 0.00 ? 45 THR A CG2  10 
ATOM   7447  H H    . THR A 1 45 ? 7.209   4.294   -11.787 1.00 0.00 ? 45 THR A H    10 
ATOM   7448  H HA   . THR A 1 45 ? 8.841   5.602   -12.666 1.00 0.00 ? 45 THR A HA   10 
ATOM   7449  H HB   . THR A 1 45 ? 6.799   7.810   -12.604 1.00 0.00 ? 45 THR A HB   10 
ATOM   7450  H HG1  . THR A 1 45 ? 7.190   5.771   -14.525 1.00 0.00 ? 45 THR A HG1  10 
ATOM   7451  H HG21 . THR A 1 45 ? 7.993   8.327   -14.837 1.00 0.00 ? 45 THR A HG21 10 
ATOM   7452  H HG22 . THR A 1 45 ? 9.315   7.388   -14.141 1.00 0.00 ? 45 THR A HG22 10 
ATOM   7453  H HG23 . THR A 1 45 ? 8.731   8.835   -13.318 1.00 0.00 ? 45 THR A HG23 10 
ATOM   7454  N N    . ASN A 1 46 ? 9.783   7.690   -11.319 1.00 0.00 ? 46 ASN A N    10 
ATOM   7455  C CA   . ASN A 1 46 ? 10.499  8.473   -10.314 1.00 0.00 ? 46 ASN A CA   10 
ATOM   7456  C C    . ASN A 1 46 ? 11.391  7.571   -9.466  1.00 0.00 ? 46 ASN A C    10 
ATOM   7457  O O    . ASN A 1 46 ? 11.051  6.417   -9.205  1.00 0.00 ? 46 ASN A O    10 
ATOM   7458  C CB   . ASN A 1 46 ? 9.519   9.236   -9.418  1.00 0.00 ? 46 ASN A CB   10 
ATOM   7459  C CG   . ASN A 1 46 ? 10.017  10.625  -9.066  1.00 0.00 ? 46 ASN A CG   10 
ATOM   7460  O OD1  . ASN A 1 46 ? 10.918  10.783  -8.244  1.00 0.00 ? 46 ASN A OD1  10 
ATOM   7461  N ND2  . ASN A 1 46 ? 9.427   11.639  -9.688  1.00 0.00 ? 46 ASN A ND2  10 
ATOM   7462  H H    . ASN A 1 46 ? 10.092  7.711   -12.247 1.00 0.00 ? 46 ASN A H    10 
ATOM   7463  H HA   . ASN A 1 46 ? 11.123  9.184   -10.836 1.00 0.00 ? 46 ASN A HA   10 
ATOM   7464  H HB2  . ASN A 1 46 ? 8.573   9.332   -9.931  1.00 0.00 ? 46 ASN A HB2  10 
ATOM   7465  H HB3  . ASN A 1 46 ? 9.373   8.682   -8.502  1.00 0.00 ? 46 ASN A HB3  10 
ATOM   7466  H HD21 . ASN A 1 46 ? 8.715   11.438  -10.330 1.00 0.00 ? 46 ASN A HD21 10 
ATOM   7467  H HD22 . ASN A 1 46 ? 9.729   12.548  -9.479  1.00 0.00 ? 46 ASN A HD22 10 
ATOM   7468  N N    . SER A 1 47 ? 12.535  8.101   -9.043  1.00 0.00 ? 47 SER A N    10 
ATOM   7469  C CA   . SER A 1 47 ? 13.473  7.336   -8.228  1.00 0.00 ? 47 SER A CA   10 
ATOM   7470  C C    . SER A 1 47 ? 13.908  6.064   -8.951  1.00 0.00 ? 47 SER A C    10 
ATOM   7471  O O    . SER A 1 47 ? 13.428  4.973   -8.645  1.00 0.00 ? 47 SER A O    10 
ATOM   7472  C CB   . SER A 1 47 ? 12.841  6.983   -6.879  1.00 0.00 ? 47 SER A CB   10 
ATOM   7473  O OG   . SER A 1 47 ? 13.273  7.874   -5.865  1.00 0.00 ? 47 SER A OG   10 
ATOM   7474  H H    . SER A 1 47 ? 12.755  9.024   -9.284  1.00 0.00 ? 47 SER A H    10 
ATOM   7475  H HA   . SER A 1 47 ? 14.342  7.954   -8.058  1.00 0.00 ? 47 SER A HA   10 
ATOM   7476  H HB2  . SER A 1 47 ? 11.766  7.045   -6.961  1.00 0.00 ? 47 SER A HB2  10 
ATOM   7477  H HB3  . SER A 1 47 ? 13.124  5.978   -6.603  1.00 0.00 ? 47 SER A HB3  10 
ATOM   7478  H HG   . SER A 1 47 ? 12.693  7.798   -5.104  1.00 0.00 ? 47 SER A HG   10 
ATOM   7479  N N    . VAL A 1 48 ? 14.802  6.223   -9.927  1.00 0.00 ? 48 VAL A N    10 
ATOM   7480  C CA   . VAL A 1 48 ? 15.303  5.115   -10.724 1.00 0.00 ? 48 VAL A CA   10 
ATOM   7481  C C    . VAL A 1 48 ? 14.172  4.289   -11.295 1.00 0.00 ? 48 VAL A C    10 
ATOM   7482  O O    . VAL A 1 48 ? 13.634  3.388   -10.652 1.00 0.00 ? 48 VAL A O    10 
ATOM   7483  C CB   . VAL A 1 48 ? 16.278  4.196   -9.970  1.00 0.00 ? 48 VAL A CB   10 
ATOM   7484  C CG1  . VAL A 1 48 ? 17.606  4.902   -9.741  1.00 0.00 ? 48 VAL A CG1  10 
ATOM   7485  C CG2  . VAL A 1 48 ? 15.697  3.700   -8.654  1.00 0.00 ? 48 VAL A CG2  10 
ATOM   7486  H H    . VAL A 1 48 ? 15.119  7.120   -10.139 1.00 0.00 ? 48 VAL A H    10 
ATOM   7487  H HA   . VAL A 1 48 ? 15.844  5.549   -11.554 1.00 0.00 ? 48 VAL A HA   10 
ATOM   7488  H HB   . VAL A 1 48 ? 16.457  3.344   -10.606 1.00 0.00 ? 48 VAL A HB   10 
ATOM   7489  H HG11 . VAL A 1 48 ? 18.403  4.172   -9.723  1.00 0.00 ? 48 VAL A HG11 10 
ATOM   7490  H HG12 . VAL A 1 48 ? 17.576  5.425   -8.797  1.00 0.00 ? 48 VAL A HG12 10 
ATOM   7491  H HG13 . VAL A 1 48 ? 17.781  5.607   -10.539 1.00 0.00 ? 48 VAL A HG13 10 
ATOM   7492  H HG21 . VAL A 1 48 ? 16.381  2.996   -8.203  1.00 0.00 ? 48 VAL A HG21 10 
ATOM   7493  H HG22 . VAL A 1 48 ? 14.751  3.213   -8.836  1.00 0.00 ? 48 VAL A HG22 10 
ATOM   7494  H HG23 . VAL A 1 48 ? 15.550  4.535   -7.987  1.00 0.00 ? 48 VAL A HG23 10 
ATOM   7495  N N    . LYS A 1 49 ? 13.822  4.642   -12.514 1.00 0.00 ? 49 LYS A N    10 
ATOM   7496  C CA   . LYS A 1 49 ? 12.753  3.993   -13.262 1.00 0.00 ? 49 LYS A CA   10 
ATOM   7497  C C    . LYS A 1 49 ? 12.646  2.504   -12.933 1.00 0.00 ? 49 LYS A C    10 
ATOM   7498  O O    . LYS A 1 49 ? 11.745  2.081   -12.209 1.00 0.00 ? 49 LYS A O    10 
ATOM   7499  C CB   . LYS A 1 49 ? 12.974  4.178   -14.764 1.00 0.00 ? 49 LYS A CB   10 
ATOM   7500  C CG   . LYS A 1 49 ? 12.246  5.382   -15.342 1.00 0.00 ? 49 LYS A CG   10 
ATOM   7501  C CD   . LYS A 1 49 ? 13.218  6.437   -15.844 1.00 0.00 ? 49 LYS A CD   10 
ATOM   7502  C CE   . LYS A 1 49 ? 12.500  7.538   -16.608 1.00 0.00 ? 49 LYS A CE   10 
ATOM   7503  N NZ   . LYS A 1 49 ? 13.348  8.753   -16.759 1.00 0.00 ? 49 LYS A NZ   10 
ATOM   7504  H H    . LYS A 1 49 ? 14.301  5.381   -12.922 1.00 0.00 ? 49 LYS A H    10 
ATOM   7505  H HA   . LYS A 1 49 ? 11.839  4.476   -12.987 1.00 0.00 ? 49 LYS A HA   10 
ATOM   7506  H HB2  . LYS A 1 49 ? 14.032  4.300   -14.948 1.00 0.00 ? 49 LYS A HB2  10 
ATOM   7507  H HB3  . LYS A 1 49 ? 12.628  3.294   -15.280 1.00 0.00 ? 49 LYS A HB3  10 
ATOM   7508  H HG2  . LYS A 1 49 ? 11.629  5.056   -16.165 1.00 0.00 ? 49 LYS A HG2  10 
ATOM   7509  H HG3  . LYS A 1 49 ? 11.622  5.816   -14.573 1.00 0.00 ? 49 LYS A HG3  10 
ATOM   7510  H HD2  . LYS A 1 49 ? 13.728  6.874   -14.999 1.00 0.00 ? 49 LYS A HD2  10 
ATOM   7511  H HD3  . LYS A 1 49 ? 13.938  5.967   -16.498 1.00 0.00 ? 49 LYS A HD3  10 
ATOM   7512  H HE2  . LYS A 1 49 ? 12.241  7.168   -17.588 1.00 0.00 ? 49 LYS A HE2  10 
ATOM   7513  H HE3  . LYS A 1 49 ? 11.600  7.802   -16.073 1.00 0.00 ? 49 LYS A HE3  10 
ATOM   7514  H HZ1  . LYS A 1 49 ? 14.344  8.481   -16.880 1.00 0.00 ? 49 LYS A HZ1  10 
ATOM   7515  H HZ2  . LYS A 1 49 ? 13.265  9.354   -15.914 1.00 0.00 ? 49 LYS A HZ2  10 
ATOM   7516  H HZ3  . LYS A 1 49 ? 13.044  9.300   -17.591 1.00 0.00 ? 49 LYS A HZ3  10 
HETATM 7517  N N    . CY1 A 1 50 ? 13.571  1.717   -13.471 1.00 0.00 ? 50 CY1 A N    10 
HETATM 7518  C CA   . CY1 A 1 50 ? 13.581  0.277   -13.237 1.00 0.00 ? 50 CY1 A CA   10 
HETATM 7519  C CB   . CY1 A 1 50 ? 13.732  -0.477  -14.560 1.00 0.00 ? 50 CY1 A CB   10 
HETATM 7520  S SG   . CY1 A 1 50 ? 15.238  -0.024  -15.444 1.00 0.00 ? 50 CY1 A SG   10 
HETATM 7521  C CD   . CY1 A 1 50 ? 14.934  -0.690  -17.091 1.00 0.00 ? 50 CY1 A CD   10 
HETATM 7522  N NE   . CY1 A 1 50 ? 15.800  -1.838  -17.341 1.00 0.00 ? 50 CY1 A NE   10 
HETATM 7523  C CZ   . CY1 A 1 50 ? 15.682  -2.649  -18.388 1.00 0.00 ? 50 CY1 A CZ   10 
HETATM 7524  O OAC  . CY1 A 1 50 ? 14.828  -2.522  -19.265 1.00 0.00 ? 50 CY1 A OAC  10 
HETATM 7525  C CM   . CY1 A 1 50 ? 16.688  -3.782  -18.457 1.00 0.00 ? 50 CY1 A CM   10 
HETATM 7526  C C    . CY1 A 1 50 ? 14.709  -0.113  -12.286 1.00 0.00 ? 50 CY1 A C    10 
HETATM 7527  O O    . CY1 A 1 50 ? 15.269  -1.203  -12.393 1.00 0.00 ? 50 CY1 A O    10 
HETATM 7528  H H    . CY1 A 1 50 ? 14.264  2.112   -14.040 1.00 0.00 ? 50 CY1 A H    10 
HETATM 7529  H HA   . CY1 A 1 50 ? 12.637  0.006   -12.785 1.00 0.00 ? 50 CY1 A HA   10 
HETATM 7530  H HB2  . CY1 A 1 50 ? 13.757  -1.538  -14.362 1.00 0.00 ? 50 CY1 A HB2  10 
HETATM 7531  H HB3  . CY1 A 1 50 ? 12.886  -0.252  -15.192 1.00 0.00 ? 50 CY1 A HB3  10 
HETATM 7532  H HD2  . CY1 A 1 50 ? 13.903  -1.011  -17.032 1.00 0.00 ? 50 CY1 A HD2  10 
HETATM 7533  H HD3  . CY1 A 1 50 ? 15.444  0.224   -17.356 1.00 0.00 ? 50 CY1 A HD3  10 
HETATM 7534  H HE   . CY1 A 1 50 ? 16.483  -2.054  -16.672 1.00 0.00 ? 50 CY1 A HE   10 
HETATM 7535  H HM1  . CY1 A 1 50 ? 17.538  -3.538  -17.824 1.00 0.00 ? 50 CY1 A HM1  10 
HETATM 7536  H HM2  . CY1 A 1 50 ? 16.993  -3.921  -19.491 1.00 0.00 ? 50 CY1 A HM2  10 
HETATM 7537  H HM3  . CY1 A 1 50 ? 16.245  -4.689  -18.103 1.00 0.00 ? 50 CY1 A HM3  10 
HETATM 7538  N N    . NH2 A 1 51 ? 15.052  0.767   -11.352 1.00 0.00 ? 51 NH2 A N    10 
HETATM 7539  H HN1  . NH2 A 1 51 ? 14.568  1.619   -11.319 1.00 0.00 ? 51 NH2 A HN1  10 
HETATM 7540  H HN2  . NH2 A 1 51 ? 15.776  0.530   -10.736 1.00 0.00 ? 51 NH2 A HN2  10 
ATOM   7541  N N    . LEU A 1 1  ? 2.445   -3.025  14.263  1.00 0.00 ? 1  LEU A N    11 
ATOM   7542  C CA   . LEU A 1 1  ? 2.344   -3.402  15.697  1.00 0.00 ? 1  LEU A CA   11 
ATOM   7543  C C    . LEU A 1 1  ? 1.213   -4.399  15.929  1.00 0.00 ? 1  LEU A C    11 
ATOM   7544  O O    . LEU A 1 1  ? 1.274   -5.222  16.843  1.00 0.00 ? 1  LEU A O    11 
ATOM   7545  C CB   . LEU A 1 1  ? 2.108   -2.133  16.519  1.00 0.00 ? 1  LEU A CB   11 
ATOM   7546  C CG   . LEU A 1 1  ? 3.377   -1.443  17.024  1.00 0.00 ? 1  LEU A CG   11 
ATOM   7547  C CD1  . LEU A 1 1  ? 3.845   -0.392  16.027  1.00 0.00 ? 1  LEU A CD1  11 
ATOM   7548  C CD2  . LEU A 1 1  ? 3.136   -0.815  18.388  1.00 0.00 ? 1  LEU A CD2  11 
ATOM   7549  H H1   . LEU A 1 1  ? 2.341   -3.892  13.699  1.00 0.00 ? 1  LEU A H1   11 
ATOM   7550  H H2   . LEU A 1 1  ? 3.377   -2.589  14.115  1.00 0.00 ? 1  LEU A H2   11 
ATOM   7551  H H3   . LEU A 1 1  ? 1.678   -2.352  14.058  1.00 0.00 ? 1  LEU A H3   11 
ATOM   7552  H HA   . LEU A 1 1  ? 3.277   -3.853  16.000  1.00 0.00 ? 1  LEU A HA   11 
ATOM   7553  H HB2  . LEU A 1 1  ? 1.558   -1.432  15.909  1.00 0.00 ? 1  LEU A HB2  11 
ATOM   7554  H HB3  . LEU A 1 1  ? 1.502   -2.392  17.375  1.00 0.00 ? 1  LEU A HB3  11 
ATOM   7555  H HG   . LEU A 1 1  ? 4.162   -2.178  17.126  1.00 0.00 ? 1  LEU A HG   11 
ATOM   7556  H HD11 . LEU A 1 1  ? 2.986   0.068   15.559  1.00 0.00 ? 1  LEU A HD11 11 
ATOM   7557  H HD12 . LEU A 1 1  ? 4.459   -0.861  15.273  1.00 0.00 ? 1  LEU A HD12 11 
ATOM   7558  H HD13 . LEU A 1 1  ? 4.421   0.362   16.543  1.00 0.00 ? 1  LEU A HD13 11 
ATOM   7559  H HD21 . LEU A 1 1  ? 2.582   0.104   18.271  1.00 0.00 ? 1  LEU A HD21 11 
ATOM   7560  H HD22 . LEU A 1 1  ? 4.085   -0.605  18.860  1.00 0.00 ? 1  LEU A HD22 11 
ATOM   7561  H HD23 . LEU A 1 1  ? 2.572   -1.500  19.005  1.00 0.00 ? 1  LEU A HD23 11 
ATOM   7562  N N    . GLN A 1 2  ? 0.178   -4.320  15.097  1.00 0.00 ? 2  GLN A N    11 
ATOM   7563  C CA   . GLN A 1 2  ? -0.969  -5.215  15.214  1.00 0.00 ? 2  GLN A CA   11 
ATOM   7564  C C    . GLN A 1 2  ? -1.209  -5.971  13.909  1.00 0.00 ? 2  GLN A C    11 
ATOM   7565  O O    . GLN A 1 2  ? -1.450  -5.365  12.866  1.00 0.00 ? 2  GLN A O    11 
ATOM   7566  C CB   . GLN A 1 2  ? -2.222  -4.425  15.595  1.00 0.00 ? 2  GLN A CB   11 
ATOM   7567  C CG   . GLN A 1 2  ? -2.075  -3.638  16.887  1.00 0.00 ? 2  GLN A CG   11 
ATOM   7568  C CD   . GLN A 1 2  ? -1.766  -2.174  16.645  1.00 0.00 ? 2  GLN A CD   11 
ATOM   7569  O OE1  . GLN A 1 2  ? -1.400  -1.778  15.538  1.00 0.00 ? 2  GLN A OE1  11 
ATOM   7570  N NE2  . GLN A 1 2  ? -1.909  -1.359  17.685  1.00 0.00 ? 2  GLN A NE2  11 
ATOM   7571  H H    . GLN A 1 2  ? 0.185   -3.643  14.388  1.00 0.00 ? 2  GLN A H    11 
ATOM   7572  H HA   . GLN A 1 2  ? -0.752  -5.929  15.994  1.00 0.00 ? 2  GLN A HA   11 
ATOM   7573  H HB2  . GLN A 1 2  ? -2.453  -3.733  14.800  1.00 0.00 ? 2  GLN A HB2  11 
ATOM   7574  H HB3  . GLN A 1 2  ? -3.046  -5.115  15.711  1.00 0.00 ? 2  GLN A HB3  11 
ATOM   7575  H HG2  . GLN A 1 2  ? -2.999  -3.707  17.442  1.00 0.00 ? 2  GLN A HG2  11 
ATOM   7576  H HG3  . GLN A 1 2  ? -1.274  -4.069  17.468  1.00 0.00 ? 2  GLN A HG3  11 
ATOM   7577  H HE21 . GLN A 1 2  ? -2.203  -1.744  18.536  1.00 0.00 ? 2  GLN A HE21 11 
ATOM   7578  H HE22 . GLN A 1 2  ? -1.716  -0.407  17.557  1.00 0.00 ? 2  GLN A HE22 11 
ATOM   7579  N N    . MET A 1 3  ? -1.140  -7.301  13.980  1.00 0.00 ? 3  MET A N    11 
ATOM   7580  C CA   . MET A 1 3  ? -1.349  -8.155  12.807  1.00 0.00 ? 3  MET A CA   11 
ATOM   7581  C C    . MET A 1 3  ? -0.136  -8.171  11.891  1.00 0.00 ? 3  MET A C    11 
ATOM   7582  O O    . MET A 1 3  ? -0.104  -8.910  10.907  1.00 0.00 ? 3  MET A O    11 
ATOM   7583  C CB   . MET A 1 3  ? -2.579  -7.705  12.020  1.00 0.00 ? 3  MET A CB   11 
ATOM   7584  C CG   . MET A 1 3  ? -3.101  -8.756  11.051  1.00 0.00 ? 3  MET A CG   11 
ATOM   7585  S SD   . MET A 1 3  ? -3.571  -10.288 11.877  1.00 0.00 ? 3  MET A SD   11 
ATOM   7586  C CE   . MET A 1 3  ? -4.740  -9.673  13.087  1.00 0.00 ? 3  MET A CE   11 
ATOM   7587  H H    . MET A 1 3  ? -0.945  -7.721  14.845  1.00 0.00 ? 3  MET A H    11 
ATOM   7588  H HA   . MET A 1 3  ? -1.507  -9.155  13.159  1.00 0.00 ? 3  MET A HA   11 
ATOM   7589  H HB2  . MET A 1 3  ? -3.369  -7.461  12.715  1.00 0.00 ? 3  MET A HB2  11 
ATOM   7590  H HB3  . MET A 1 3  ? -2.322  -6.822  11.455  1.00 0.00 ? 3  MET A HB3  11 
ATOM   7591  H HG2  . MET A 1 3  ? -3.965  -8.360  10.541  1.00 0.00 ? 3  MET A HG2  11 
ATOM   7592  H HG3  . MET A 1 3  ? -2.327  -8.975  10.329  1.00 0.00 ? 3  MET A HG3  11 
ATOM   7593  H HE1  . MET A 1 3  ? -5.613  -10.310 13.100  1.00 0.00 ? 3  MET A HE1  11 
ATOM   7594  H HE2  . MET A 1 3  ? -5.034  -8.667  12.824  1.00 0.00 ? 3  MET A HE2  11 
ATOM   7595  H HE3  . MET A 1 3  ? -4.280  -9.670  14.064  1.00 0.00 ? 3  MET A HE3  11 
ATOM   7596  N N    . ALA A 1 4  ? 0.859   -7.364  12.212  1.00 0.00 ? 4  ALA A N    11 
ATOM   7597  C CA   . ALA A 1 4  ? 2.066   -7.298  11.410  1.00 0.00 ? 4  ALA A CA   11 
ATOM   7598  C C    . ALA A 1 4  ? 2.906   -8.568  11.575  1.00 0.00 ? 4  ALA A C    11 
ATOM   7599  O O    . ALA A 1 4  ? 4.044   -8.517  12.042  1.00 0.00 ? 4  ALA A O    11 
ATOM   7600  C CB   . ALA A 1 4  ? 2.862   -6.070  11.806  1.00 0.00 ? 4  ALA A CB   11 
ATOM   7601  H H    . ALA A 1 4  ? 0.782   -6.795  13.005  1.00 0.00 ? 4  ALA A H    11 
ATOM   7602  H HA   . ALA A 1 4  ? 1.772   -7.194  10.374  1.00 0.00 ? 4  ALA A HA   11 
ATOM   7603  H HB1  . ALA A 1 4  ? 2.240   -5.430  12.414  1.00 0.00 ? 4  ALA A HB1  11 
ATOM   7604  H HB2  . ALA A 1 4  ? 3.170   -5.539  10.918  1.00 0.00 ? 4  ALA A HB2  11 
ATOM   7605  H HB3  . ALA A 1 4  ? 3.731   -6.368  12.370  1.00 0.00 ? 4  ALA A HB3  11 
ATOM   7606  N N    . GLY A 1 5  ? 2.336   -9.707  11.189  1.00 0.00 ? 5  GLY A N    11 
ATOM   7607  C CA   . GLY A 1 5  ? 3.039   -10.973 11.302  1.00 0.00 ? 5  GLY A CA   11 
ATOM   7608  C C    . GLY A 1 5  ? 2.309   -12.108 10.605  1.00 0.00 ? 5  GLY A C    11 
ATOM   7609  O O    . GLY A 1 5  ? 2.552   -13.280 10.889  1.00 0.00 ? 5  GLY A O    11 
ATOM   7610  H H    . GLY A 1 5  ? 1.428   -9.689  10.823  1.00 0.00 ? 5  GLY A H    11 
ATOM   7611  H HA2  . GLY A 1 5  ? 4.022   -10.869 10.862  1.00 0.00 ? 5  GLY A HA2  11 
ATOM   7612  H HA3  . GLY A 1 5  ? 3.149   -11.221 12.349  1.00 0.00 ? 5  GLY A HA3  11 
ATOM   7613  N N    . GLN A 1 6  ? 1.424   -11.753 9.678   1.00 0.00 ? 6  GLN A N    11 
ATOM   7614  C CA   . GLN A 1 6  ? 0.660   -12.726 8.923   1.00 0.00 ? 6  GLN A CA   11 
ATOM   7615  C C    . GLN A 1 6  ? -0.193  -12.011 7.892   1.00 0.00 ? 6  GLN A C    11 
ATOM   7616  O O    . GLN A 1 6  ? -1.419  -11.962 7.990   1.00 0.00 ? 6  GLN A O    11 
ATOM   7617  C CB   . GLN A 1 6  ? -0.211  -13.581 9.846   1.00 0.00 ? 6  GLN A CB   11 
ATOM   7618  C CG   . GLN A 1 6  ? 0.421   -14.915 10.216  1.00 0.00 ? 6  GLN A CG   11 
ATOM   7619  C CD   . GLN A 1 6  ? 0.642   -15.063 11.708  1.00 0.00 ? 6  GLN A CD   11 
ATOM   7620  O OE1  . GLN A 1 6  ? 0.019   -14.369 12.512  1.00 0.00 ? 6  GLN A OE1  11 
ATOM   7621  N NE2  . GLN A 1 6  ? 1.538   -15.968 12.087  1.00 0.00 ? 6  GLN A NE2  11 
ATOM   7622  H H    . GLN A 1 6  ? 1.287   -10.809 9.488   1.00 0.00 ? 6  GLN A H    11 
ATOM   7623  H HA   . GLN A 1 6  ? 1.362   -13.350 8.405   1.00 0.00 ? 6  GLN A HA   11 
ATOM   7624  H HB2  . GLN A 1 6  ? -0.398  -13.031 10.756  1.00 0.00 ? 6  GLN A HB2  11 
ATOM   7625  H HB3  . GLN A 1 6  ? -1.152  -13.778 9.353   1.00 0.00 ? 6  GLN A HB3  11 
ATOM   7626  H HG2  . GLN A 1 6  ? -0.231  -15.710 9.884   1.00 0.00 ? 6  GLN A HG2  11 
ATOM   7627  H HG3  . GLN A 1 6  ? 1.373   -14.999 9.714   1.00 0.00 ? 6  GLN A HG3  11 
ATOM   7628  H HE21 . GLN A 1 6  ? 1.997   -16.483 11.391  1.00 0.00 ? 6  GLN A HE21 11 
ATOM   7629  H HE22 . GLN A 1 6  ? 1.701   -16.084 13.046  1.00 0.00 ? 6  GLN A HE22 11 
ATOM   7630  N N    . CYS A 1 7  ? 0.489   -11.440 6.915   1.00 0.00 ? 7  CYS A N    11 
ATOM   7631  C CA   . CYS A 1 7  ? -0.161  -10.692 5.847   1.00 0.00 ? 7  CYS A CA   11 
ATOM   7632  C C    . CYS A 1 7  ? 0.629   -10.795 4.554   1.00 0.00 ? 7  CYS A C    11 
ATOM   7633  O O    . CYS A 1 7  ? 1.860   -10.837 4.576   1.00 0.00 ? 7  CYS A O    11 
ATOM   7634  C CB   . CYS A 1 7  ? -0.281  -9.221  6.251   1.00 0.00 ? 7  CYS A CB   11 
ATOM   7635  S SG   . CYS A 1 7  ? -1.549  -8.916  7.523   1.00 0.00 ? 7  CYS A SG   11 
ATOM   7636  H H    . CYS A 1 7  ? 1.466   -11.516 6.922   1.00 0.00 ? 7  CYS A H    11 
ATOM   7637  H HA   . CYS A 1 7  ? -1.147  -11.100 5.696   1.00 0.00 ? 7  CYS A HA   11 
ATOM   7638  H HB2  . CYS A 1 7  ? 0.668   -8.888  6.646   1.00 0.00 ? 7  CYS A HB2  11 
ATOM   7639  H HB3  . CYS A 1 7  ? -0.527  -8.627  5.381   1.00 0.00 ? 7  CYS A HB3  11 
ATOM   7640  N N    . SER A 1 8  ? -0.073  -10.819 3.422   1.00 0.00 ? 8  SER A N    11 
ATOM   7641  C CA   . SER A 1 8  ? 0.597   -10.890 2.131   1.00 0.00 ? 8  SER A CA   11 
ATOM   7642  C C    . SER A 1 8  ? 1.683   -9.828  2.073   1.00 0.00 ? 8  SER A C    11 
ATOM   7643  O O    . SER A 1 8  ? 1.512   -8.729  2.591   1.00 0.00 ? 8  SER A O    11 
ATOM   7644  C CB   . SER A 1 8  ? -0.389  -10.694 0.983   1.00 0.00 ? 8  SER A CB   11 
ATOM   7645  O OG   . SER A 1 8  ? -1.511  -11.550 1.118   1.00 0.00 ? 8  SER A OG   11 
ATOM   7646  H H    . SER A 1 8  ? -1.050  -10.775 3.457   1.00 0.00 ? 8  SER A H    11 
ATOM   7647  H HA   . SER A 1 8  ? 1.057   -11.863 2.046   1.00 0.00 ? 8  SER A HA   11 
ATOM   7648  H HB2  . SER A 1 8  ? -0.730  -9.671  0.975   1.00 0.00 ? 8  SER A HB2  11 
ATOM   7649  H HB3  . SER A 1 8  ? 0.109   -10.916 0.051   1.00 0.00 ? 8  SER A HB3  11 
ATOM   7650  H HG   . SER A 1 8  ? -1.216  -12.429 1.365   1.00 0.00 ? 8  SER A HG   11 
ATOM   7651  N N    . GLN A 1 9  ? 2.802   -10.165 1.467   1.00 0.00 ? 9  GLN A N    11 
ATOM   7652  C CA   . GLN A 1 9  ? 3.922   -9.242  1.385   1.00 0.00 ? 9  GLN A CA   11 
ATOM   7653  C C    . GLN A 1 9  ? 3.495   -7.834  1.012   1.00 0.00 ? 9  GLN A C    11 
ATOM   7654  O O    . GLN A 1 9  ? 2.761   -7.613  0.049   1.00 0.00 ? 9  GLN A O    11 
ATOM   7655  C CB   . GLN A 1 9  ? 4.979   -9.757  0.407   1.00 0.00 ? 9  GLN A CB   11 
ATOM   7656  C CG   . GLN A 1 9  ? 6.406   -9.487  0.853   1.00 0.00 ? 9  GLN A CG   11 
ATOM   7657  C CD   . GLN A 1 9  ? 7.390   -9.497  -0.300  1.00 0.00 ? 9  GLN A CD   11 
ATOM   7658  O OE1  . GLN A 1 9  ? 8.390   -10.215 -0.272  1.00 0.00 ? 9  GLN A OE1  11 
ATOM   7659  N NE2  . GLN A 1 9  ? 7.112   -8.698  -1.323  1.00 0.00 ? 9  GLN A NE2  11 
ATOM   7660  H H    . GLN A 1 9  ? 2.889   -11.060 1.088   1.00 0.00 ? 9  GLN A H    11 
ATOM   7661  H HA   . GLN A 1 9  ? 4.351   -9.190  2.372   1.00 0.00 ? 9  GLN A HA   11 
ATOM   7662  H HB2  . GLN A 1 9  ? 4.856   -10.824 0.292   1.00 0.00 ? 9  GLN A HB2  11 
ATOM   7663  H HB3  . GLN A 1 9  ? 4.828   -9.281  -0.550  1.00 0.00 ? 9  GLN A HB3  11 
ATOM   7664  H HG2  . GLN A 1 9  ? 6.445   -8.520  1.330   1.00 0.00 ? 9  GLN A HG2  11 
ATOM   7665  H HG3  . GLN A 1 9  ? 6.697   -10.248 1.563   1.00 0.00 ? 9  GLN A HG3  11 
ATOM   7666  H HE21 . GLN A 1 9  ? 6.299   -8.153  -1.276  1.00 0.00 ? 9  GLN A HE21 11 
ATOM   7667  H HE22 . GLN A 1 9  ? 7.731   -8.684  -2.082  1.00 0.00 ? 9  GLN A HE22 11 
ATOM   7668  N N    . ASN A 1 10 ? 3.978   -6.890  1.805   1.00 0.00 ? 10 ASN A N    11 
ATOM   7669  C CA   . ASN A 1 10 ? 3.691   -5.483  1.614   1.00 0.00 ? 10 ASN A CA   11 
ATOM   7670  C C    . ASN A 1 10 ? 2.217   -5.178  1.799   1.00 0.00 ? 10 ASN A C    11 
ATOM   7671  O O    . ASN A 1 10 ? 1.679   -4.274  1.159   1.00 0.00 ? 10 ASN A O    11 
ATOM   7672  C CB   . ASN A 1 10 ? 4.163   -5.019  0.235   1.00 0.00 ? 10 ASN A CB   11 
ATOM   7673  C CG   . ASN A 1 10 ? 5.677   -5.025  0.111   1.00 0.00 ? 10 ASN A CG   11 
ATOM   7674  O OD1  . ASN A 1 10 ? 6.303   -3.973  -0.010  1.00 0.00 ? 10 ASN A OD1  11 
ATOM   7675  N ND2  . ASN A 1 10 ? 6.274   -6.213  0.145   1.00 0.00 ? 10 ASN A ND2  11 
ATOM   7676  H H    . ASN A 1 10 ? 4.557   -7.153  2.552   1.00 0.00 ? 10 ASN A H    11 
ATOM   7677  H HA   . ASN A 1 10 ? 4.236   -4.943  2.369   1.00 0.00 ? 10 ASN A HA   11 
ATOM   7678  H HB2  . ASN A 1 10 ? 3.752   -5.673  -0.521  1.00 0.00 ? 10 ASN A HB2  11 
ATOM   7679  H HB3  . ASN A 1 10 ? 3.811   -4.012  0.064   1.00 0.00 ? 10 ASN A HB3  11 
ATOM   7680  H HD21 . ASN A 1 10 ? 5.717   -7.012  0.249   1.00 0.00 ? 10 ASN A HD21 11 
ATOM   7681  H HD22 . ASN A 1 10 ? 7.251   -6.241  0.066   1.00 0.00 ? 10 ASN A HD22 11 
ATOM   7682  N N    . GLU A 1 11 ? 1.564   -5.915  2.688   1.00 0.00 ? 11 GLU A N    11 
ATOM   7683  C CA   . GLU A 1 11 ? 0.153   -5.651  2.944   1.00 0.00 ? 11 GLU A CA   11 
ATOM   7684  C C    . GLU A 1 11 ? 0.003   -4.478  3.891   1.00 0.00 ? 11 GLU A C    11 
ATOM   7685  O O    . GLU A 1 11 ? 0.797   -4.318  4.817   1.00 0.00 ? 11 GLU A O    11 
ATOM   7686  C CB   . GLU A 1 11 ? -0.581  -6.885  3.471   1.00 0.00 ? 11 GLU A CB   11 
ATOM   7687  C CG   . GLU A 1 11 ? -1.751  -7.296  2.588   1.00 0.00 ? 11 GLU A CG   11 
ATOM   7688  C CD   . GLU A 1 11 ? -2.207  -8.722  2.829   1.00 0.00 ? 11 GLU A CD   11 
ATOM   7689  O OE1  . GLU A 1 11 ? -2.039  -9.216  3.962   1.00 0.00 ? 11 GLU A OE1  11 
ATOM   7690  O OE2  . GLU A 1 11 ? -2.735  -9.343  1.884   1.00 0.00 ? 11 GLU A OE2  11 
ATOM   7691  H H    . GLU A 1 11 ? 2.045   -6.630  3.186   1.00 0.00 ? 11 GLU A H    11 
ATOM   7692  H HA   . GLU A 1 11 ? -0.281  -5.356  2.024   1.00 0.00 ? 11 GLU A HA   11 
ATOM   7693  H HB2  . GLU A 1 11 ? 0.109   -7.709  3.530   1.00 0.00 ? 11 GLU A HB2  11 
ATOM   7694  H HB3  . GLU A 1 11 ? -0.961  -6.674  4.457   1.00 0.00 ? 11 GLU A HB3  11 
ATOM   7695  H HG2  . GLU A 1 11 ? -2.581  -6.634  2.782   1.00 0.00 ? 11 GLU A HG2  11 
ATOM   7696  H HG3  . GLU A 1 11 ? -1.454  -7.200  1.554   1.00 0.00 ? 11 GLU A HG3  11 
ATOM   7697  N N    . TYR A 1 12 ? -1.014  -3.640  3.655   1.00 0.00 ? 12 TYR A N    11 
ATOM   7698  C CA   . TYR A 1 12 ? -1.212  -2.467  4.517   1.00 0.00 ? 12 TYR A CA   11 
ATOM   7699  C C    . TYR A 1 12 ? -2.497  -2.567  5.324   1.00 0.00 ? 12 TYR A C    11 
ATOM   7700  O O    . TYR A 1 12 ? -3.593  -2.681  4.778   1.00 0.00 ? 12 TYR A O    11 
ATOM   7701  C CB   . TYR A 1 12 ? -1.144  -1.156  3.719   1.00 0.00 ? 12 TYR A CB   11 
ATOM   7702  C CG   . TYR A 1 12 ? -2.419  -0.742  3.015   1.00 0.00 ? 12 TYR A CG   11 
ATOM   7703  C CD1  . TYR A 1 12 ? -3.453  -0.127  3.708   1.00 0.00 ? 12 TYR A CD1  11 
ATOM   7704  C CD2  . TYR A 1 12 ? -2.573  -0.940  1.652   1.00 0.00 ? 12 TYR A CD2  11 
ATOM   7705  C CE1  . TYR A 1 12 ? -4.605  0.273   3.060   1.00 0.00 ? 12 TYR A CE1  11 
ATOM   7706  C CE2  . TYR A 1 12 ? -3.723  -0.545  0.997   1.00 0.00 ? 12 TYR A CE2  11 
ATOM   7707  C CZ   . TYR A 1 12 ? -4.736  0.059   1.705   1.00 0.00 ? 12 TYR A CZ   11 
ATOM   7708  O OH   . TYR A 1 12 ? -5.883  0.458   1.056   1.00 0.00 ? 12 TYR A OH   11 
ATOM   7709  H H    . TYR A 1 12 ? -1.635  -3.813  2.889   1.00 0.00 ? 12 TYR A H    11 
ATOM   7710  H HA   . TYR A 1 12 ? -0.390  -2.460  5.224   1.00 0.00 ? 12 TYR A HA   11 
ATOM   7711  H HB2  . TYR A 1 12 ? -0.880  -0.361  4.398   1.00 0.00 ? 12 TYR A HB2  11 
ATOM   7712  H HB3  . TYR A 1 12 ? -0.369  -1.248  2.972   1.00 0.00 ? 12 TYR A HB3  11 
ATOM   7713  H HD1  . TYR A 1 12 ? -3.349  0.036   4.769   1.00 0.00 ? 12 TYR A HD1  11 
ATOM   7714  H HD2  . TYR A 1 12 ? -1.774  -1.408  1.099   1.00 0.00 ? 12 TYR A HD2  11 
ATOM   7715  H HE1  . TYR A 1 12 ? -5.394  0.754   3.615   1.00 0.00 ? 12 TYR A HE1  11 
ATOM   7716  H HE2  . TYR A 1 12 ? -3.824  -0.714  -0.065  1.00 0.00 ? 12 TYR A HE2  11 
ATOM   7717  H HH   . TYR A 1 12 ? -6.644  0.034   1.460   1.00 0.00 ? 12 TYR A HH   11 
ATOM   7718  N N    . PHE A 1 13 ? -2.323  -2.543  6.640   1.00 0.00 ? 13 PHE A N    11 
ATOM   7719  C CA   . PHE A 1 13 ? -3.423  -2.652  7.596   1.00 0.00 ? 13 PHE A CA   11 
ATOM   7720  C C    . PHE A 1 13 ? -4.200  -1.346  7.725   1.00 0.00 ? 13 PHE A C    11 
ATOM   7721  O O    . PHE A 1 13 ? -3.697  -0.368  8.278   1.00 0.00 ? 13 PHE A O    11 
ATOM   7722  C CB   . PHE A 1 13 ? -2.852  -3.050  8.960   1.00 0.00 ? 13 PHE A CB   11 
ATOM   7723  C CG   . PHE A 1 13 ? -3.845  -3.698  9.880   1.00 0.00 ? 13 PHE A CG   11 
ATOM   7724  C CD1  . PHE A 1 13 ? -4.028  -5.070  9.863   1.00 0.00 ? 13 PHE A CD1  11 
ATOM   7725  C CD2  . PHE A 1 13 ? -4.590  -2.935  10.763  1.00 0.00 ? 13 PHE A CD2  11 
ATOM   7726  C CE1  . PHE A 1 13 ? -4.939  -5.670  10.710  1.00 0.00 ? 13 PHE A CE1  11 
ATOM   7727  C CE2  . PHE A 1 13 ? -5.503  -3.530  11.612  1.00 0.00 ? 13 PHE A CE2  11 
ATOM   7728  C CZ   . PHE A 1 13 ? -5.677  -4.900  11.586  1.00 0.00 ? 13 PHE A CZ   11 
ATOM   7729  H H    . PHE A 1 13 ? -1.410  -2.461  6.986   1.00 0.00 ? 13 PHE A H    11 
ATOM   7730  H HA   . PHE A 1 13 ? -4.093  -3.429  7.255   1.00 0.00 ? 13 PHE A HA   11 
ATOM   7731  H HB2  . PHE A 1 13 ? -2.040  -3.744  8.812   1.00 0.00 ? 13 PHE A HB2  11 
ATOM   7732  H HB3  . PHE A 1 13 ? -2.473  -2.165  9.452   1.00 0.00 ? 13 PHE A HB3  11 
ATOM   7733  H HD1  . PHE A 1 13 ? -3.445  -5.676  9.182   1.00 0.00 ? 13 PHE A HD1  11 
ATOM   7734  H HD2  . PHE A 1 13 ? -4.455  -1.865  10.784  1.00 0.00 ? 13 PHE A HD2  11 
ATOM   7735  H HE1  . PHE A 1 13 ? -5.074  -6.742  10.688  1.00 0.00 ? 13 PHE A HE1  11 
ATOM   7736  H HE2  . PHE A 1 13 ? -6.079  -2.925  12.296  1.00 0.00 ? 13 PHE A HE2  11 
ATOM   7737  H HZ   . PHE A 1 13 ? -6.391  -5.367  12.249  1.00 0.00 ? 13 PHE A HZ   11 
ATOM   7738  N N    . ASP A 1 14 ? -5.441  -1.343  7.244   1.00 0.00 ? 14 ASP A N    11 
ATOM   7739  C CA   . ASP A 1 14 ? -6.293  -0.165  7.337   1.00 0.00 ? 14 ASP A CA   11 
ATOM   7740  C C    . ASP A 1 14 ? -6.944  -0.117  8.705   1.00 0.00 ? 14 ASP A C    11 
ATOM   7741  O O    . ASP A 1 14 ? -7.931  -0.799  8.947   1.00 0.00 ? 14 ASP A O    11 
ATOM   7742  C CB   . ASP A 1 14 ? -7.382  -0.195  6.263   1.00 0.00 ? 14 ASP A CB   11 
ATOM   7743  C CG   . ASP A 1 14 ? -6.873  -0.620  4.900   1.00 0.00 ? 14 ASP A CG   11 
ATOM   7744  O OD1  . ASP A 1 14 ? -6.004  -1.513  4.836   1.00 0.00 ? 14 ASP A OD1  11 
ATOM   7745  O OD2  . ASP A 1 14 ? -7.355  -0.061  3.892   1.00 0.00 ? 14 ASP A OD2  11 
ATOM   7746  H H    . ASP A 1 14 ? -5.803  -2.159  6.835   1.00 0.00 ? 14 ASP A H    11 
ATOM   7747  H HA   . ASP A 1 14 ? -5.685  0.719   7.207   1.00 0.00 ? 14 ASP A HA   11 
ATOM   7748  H HB2  . ASP A 1 14 ? -8.146  -0.889  6.566   1.00 0.00 ? 14 ASP A HB2  11 
ATOM   7749  H HB3  . ASP A 1 14 ? -7.815  0.791   6.175   1.00 0.00 ? 14 ASP A HB3  11 
ATOM   7750  N N    . SER A 1 15 ? -6.398  0.691   9.602   1.00 0.00 ? 15 SER A N    11 
ATOM   7751  C CA   . SER A 1 15 ? -6.948  0.805   10.946  1.00 0.00 ? 15 SER A CA   11 
ATOM   7752  C C    . SER A 1 15 ? -8.456  1.037   10.904  1.00 0.00 ? 15 SER A C    11 
ATOM   7753  O O    . SER A 1 15 ? -9.165  0.745   11.867  1.00 0.00 ? 15 SER A O    11 
ATOM   7754  C CB   . SER A 1 15 ? -6.262  1.936   11.714  1.00 0.00 ? 15 SER A CB   11 
ATOM   7755  O OG   . SER A 1 15 ? -6.268  3.139   10.964  1.00 0.00 ? 15 SER A OG   11 
ATOM   7756  H H    . SER A 1 15 ? -5.610  1.218   9.357   1.00 0.00 ? 15 SER A H    11 
ATOM   7757  H HA   . SER A 1 15 ? -6.761  -0.131  11.452  1.00 0.00 ? 15 SER A HA   11 
ATOM   7758  H HB2  . SER A 1 15 ? -6.782  2.105   12.644  1.00 0.00 ? 15 SER A HB2  11 
ATOM   7759  H HB3  . SER A 1 15 ? -5.238  1.659   11.919  1.00 0.00 ? 15 SER A HB3  11 
ATOM   7760  H HG   . SER A 1 15 ? -7.144  3.286   10.602  1.00 0.00 ? 15 SER A HG   11 
ATOM   7761  N N    . LEU A 1 16 ? -8.943  1.550   9.779   1.00 0.00 ? 16 LEU A N    11 
ATOM   7762  C CA   . LEU A 1 16 ? -10.368 1.801   9.617   1.00 0.00 ? 16 LEU A CA   11 
ATOM   7763  C C    . LEU A 1 16 ? -11.091 0.536   9.161   1.00 0.00 ? 16 LEU A C    11 
ATOM   7764  O O    . LEU A 1 16 ? -12.282 0.364   9.418   1.00 0.00 ? 16 LEU A O    11 
ATOM   7765  C CB   . LEU A 1 16 ? -10.599 2.929   8.609   1.00 0.00 ? 16 LEU A CB   11 
ATOM   7766  C CG   . LEU A 1 16 ? -12.012 3.519   8.607   1.00 0.00 ? 16 LEU A CG   11 
ATOM   7767  C CD1  . LEU A 1 16 ? -11.964 5.034   8.727   1.00 0.00 ? 16 LEU A CD1  11 
ATOM   7768  C CD2  . LEU A 1 16 ? -12.761 3.106   7.348   1.00 0.00 ? 16 LEU A CD2  11 
ATOM   7769  H H    . LEU A 1 16 ? -8.331  1.755   9.036   1.00 0.00 ? 16 LEU A H    11 
ATOM   7770  H HA   . LEU A 1 16 ? -10.762 2.102   10.575  1.00 0.00 ? 16 LEU A HA   11 
ATOM   7771  H HB2  . LEU A 1 16 ? -9.898  3.723   8.825   1.00 0.00 ? 16 LEU A HB2  11 
ATOM   7772  H HB3  . LEU A 1 16 ? -10.389 2.547   7.620   1.00 0.00 ? 16 LEU A HB3  11 
ATOM   7773  H HG   . LEU A 1 16 ? -12.554 3.135   9.459   1.00 0.00 ? 16 LEU A HG   11 
ATOM   7774  H HD11 . LEU A 1 16 ? -11.930 5.472   7.740   1.00 0.00 ? 16 LEU A HD11 11 
ATOM   7775  H HD12 . LEU A 1 16 ? -11.083 5.323   9.280   1.00 0.00 ? 16 LEU A HD12 11 
ATOM   7776  H HD13 . LEU A 1 16 ? -12.845 5.383   9.246   1.00 0.00 ? 16 LEU A HD13 11 
ATOM   7777  H HD21 . LEU A 1 16 ? -13.326 2.207   7.544   1.00 0.00 ? 16 LEU A HD21 11 
ATOM   7778  H HD22 . LEU A 1 16 ? -12.053 2.921   6.553   1.00 0.00 ? 16 LEU A HD22 11 
ATOM   7779  H HD23 . LEU A 1 16 ? -13.434 3.898   7.054   1.00 0.00 ? 16 LEU A HD23 11 
ATOM   7780  N N    . LEU A 1 17 ? -10.363 -0.342  8.474   1.00 0.00 ? 17 LEU A N    11 
ATOM   7781  C CA   . LEU A 1 17 ? -10.929 -1.585  7.967   1.00 0.00 ? 17 LEU A CA   11 
ATOM   7782  C C    . LEU A 1 17 ? -10.456 -2.800  8.766   1.00 0.00 ? 17 LEU A C    11 
ATOM   7783  O O    . LEU A 1 17 ? -11.056 -3.872  8.678   1.00 0.00 ? 17 LEU A O    11 
ATOM   7784  C CB   . LEU A 1 17 ? -10.530 -1.762  6.506   1.00 0.00 ? 17 LEU A CB   11 
ATOM   7785  C CG   . LEU A 1 17 ? -10.867 -0.579  5.595   1.00 0.00 ? 17 LEU A CG   11 
ATOM   7786  C CD1  . LEU A 1 17 ? -10.150 -0.712  4.260   1.00 0.00 ? 17 LEU A CD1  11 
ATOM   7787  C CD2  . LEU A 1 17 ? -12.370 -0.477  5.388   1.00 0.00 ? 17 LEU A CD2  11 
ATOM   7788  H H    . LEU A 1 17 ? -9.421  -0.147  8.290   1.00 0.00 ? 17 LEU A H    11 
ATOM   7789  H HA   . LEU A 1 17 ? -12.006 -1.518  8.031   1.00 0.00 ? 17 LEU A HA   11 
ATOM   7790  H HB2  . LEU A 1 17 ? -9.462  -1.924  6.471   1.00 0.00 ? 17 LEU A HB2  11 
ATOM   7791  H HB3  . LEU A 1 17 ? -11.025 -2.639  6.120   1.00 0.00 ? 17 LEU A HB3  11 
ATOM   7792  H HG   . LEU A 1 17 ? -10.529 0.335   6.065   1.00 0.00 ? 17 LEU A HG   11 
ATOM   7793  H HD11 . LEU A 1 17 ? -9.825  0.262   3.928   1.00 0.00 ? 17 LEU A HD11 11 
ATOM   7794  H HD12 . LEU A 1 17 ? -10.826 -1.134  3.531   1.00 0.00 ? 17 LEU A HD12 11 
ATOM   7795  H HD13 . LEU A 1 17 ? -9.293  -1.360  4.374   1.00 0.00 ? 17 LEU A HD13 11 
ATOM   7796  H HD21 . LEU A 1 17 ? -12.580 0.268   4.634   1.00 0.00 ? 17 LEU A HD21 11 
ATOM   7797  H HD22 . LEU A 1 17 ? -12.844 -0.192  6.316   1.00 0.00 ? 17 LEU A HD22 11 
ATOM   7798  H HD23 . LEU A 1 17 ? -12.755 -1.434  5.065   1.00 0.00 ? 17 LEU A HD23 11 
ATOM   7799  N N    . HIS A 1 18 ? -9.372  -2.649  9.527   1.00 0.00 ? 18 HIS A N    11 
ATOM   7800  C CA   . HIS A 1 18 ? -8.839  -3.763  10.304  1.00 0.00 ? 18 HIS A CA   11 
ATOM   7801  C C    . HIS A 1 18 ? -8.497  -4.925  9.379   1.00 0.00 ? 18 HIS A C    11 
ATOM   7802  O O    . HIS A 1 18 ? -8.756  -6.088  9.691   1.00 0.00 ? 18 HIS A O    11 
ATOM   7803  C CB   . HIS A 1 18 ? -9.856  -4.216  11.342  1.00 0.00 ? 18 HIS A CB   11 
ATOM   7804  C CG   . HIS A 1 18 ? -10.073 -3.226  12.445  1.00 0.00 ? 18 HIS A CG   11 
ATOM   7805  N ND1  . HIS A 1 18 ? -11.179 -2.403  12.511  1.00 0.00 ? 18 HIS A ND1  11 
ATOM   7806  C CD2  . HIS A 1 18 ? -9.318  -2.927  13.529  1.00 0.00 ? 18 HIS A CD2  11 
ATOM   7807  C CE1  . HIS A 1 18 ? -11.095 -1.642  13.588  1.00 0.00 ? 18 HIS A CE1  11 
ATOM   7808  N NE2  . HIS A 1 18 ? -9.976  -1.940  14.222  1.00 0.00 ? 18 HIS A NE2  11 
ATOM   7809  H H    . HIS A 1 18 ? -8.915  -1.781  9.558   1.00 0.00 ? 18 HIS A H    11 
ATOM   7810  H HA   . HIS A 1 18 ? -7.941  -3.429  10.802  1.00 0.00 ? 18 HIS A HA   11 
ATOM   7811  H HB2  . HIS A 1 18 ? -10.801 -4.381  10.852  1.00 0.00 ? 18 HIS A HB2  11 
ATOM   7812  H HB3  . HIS A 1 18 ? -9.516  -5.140  11.782  1.00 0.00 ? 18 HIS A HB3  11 
ATOM   7813  H HD1  . HIS A 1 18 ? -11.915 -2.381  11.865  1.00 0.00 ? 18 HIS A HD1  11 
ATOM   7814  H HD2  . HIS A 1 18 ? -8.375  -3.380  13.798  1.00 0.00 ? 18 HIS A HD2  11 
ATOM   7815  H HE1  . HIS A 1 18 ? -11.818 -0.902  13.897  1.00 0.00 ? 18 HIS A HE1  11 
ATOM   7816  H HE2  . HIS A 1 18 ? -9.656  -1.506  15.040  1.00 0.00 ? 18 HIS A HE2  11 
ATOM   7817  N N    . ALA A 1 19 ? -7.923  -4.590  8.234   1.00 0.00 ? 19 ALA A N    11 
ATOM   7818  C CA   . ALA A 1 19 ? -7.552  -5.575  7.239   1.00 0.00 ? 19 ALA A CA   11 
ATOM   7819  C C    . ALA A 1 19 ? -6.317  -5.151  6.475   1.00 0.00 ? 19 ALA A C    11 
ATOM   7820  O O    . ALA A 1 19 ? -6.340  -4.169  5.733   1.00 0.00 ? 19 ALA A O    11 
ATOM   7821  C CB   . ALA A 1 19 ? -8.680  -5.783  6.247   1.00 0.00 ? 19 ALA A CB   11 
ATOM   7822  H H    . ALA A 1 19 ? -7.749  -3.653  8.053   1.00 0.00 ? 19 ALA A H    11 
ATOM   7823  H HA   . ALA A 1 19 ? -7.363  -6.511  7.739   1.00 0.00 ? 19 ALA A HA   11 
ATOM   7824  H HB1  . ALA A 1 19 ? -8.955  -6.826  6.227   1.00 0.00 ? 19 ALA A HB1  11 
ATOM   7825  H HB2  . ALA A 1 19 ? -8.342  -5.477  5.260   1.00 0.00 ? 19 ALA A HB2  11 
ATOM   7826  H HB3  . ALA A 1 19 ? -9.531  -5.186  6.538   1.00 0.00 ? 19 ALA A HB3  11 
ATOM   7827  N N    . CYS A 1 20 ? -5.254  -5.908  6.629   1.00 0.00 ? 20 CYS A N    11 
ATOM   7828  C CA   . CYS A 1 20 ? -4.036  -5.616  5.905   1.00 0.00 ? 20 CYS A CA   11 
ATOM   7829  C C    . CYS A 1 20 ? -4.266  -5.886  4.422   1.00 0.00 ? 20 CYS A C    11 
ATOM   7830  O O    . CYS A 1 20 ? -4.409  -7.033  3.994   1.00 0.00 ? 20 CYS A O    11 
ATOM   7831  C CB   . CYS A 1 20 ? -2.862  -6.428  6.441   1.00 0.00 ? 20 CYS A CB   11 
ATOM   7832  S SG   . CYS A 1 20 ? -3.138  -8.225  6.469   1.00 0.00 ? 20 CYS A SG   11 
ATOM   7833  H H    . CYS A 1 20 ? -5.303  -6.684  7.218   1.00 0.00 ? 20 CYS A H    11 
ATOM   7834  H HA   . CYS A 1 20 ? -3.833  -4.569  6.029   1.00 0.00 ? 20 CYS A HA   11 
ATOM   7835  H HB2  . CYS A 1 20 ? -1.997  -6.240  5.828   1.00 0.00 ? 20 CYS A HB2  11 
ATOM   7836  H HB3  . CYS A 1 20 ? -2.649  -6.114  7.452   1.00 0.00 ? 20 CYS A HB3  11 
ATOM   7837  N N    . ILE A 1 21 ? -4.345  -4.807  3.659   1.00 0.00 ? 21 ILE A N    11 
ATOM   7838  C CA   . ILE A 1 21 ? -4.607  -4.866  2.228   1.00 0.00 ? 21 ILE A CA   11 
ATOM   7839  C C    . ILE A 1 21 ? -3.366  -4.540  1.418   1.00 0.00 ? 21 ILE A C    11 
ATOM   7840  O O    . ILE A 1 21 ? -2.593  -3.664  1.793   1.00 0.00 ? 21 ILE A O    11 
ATOM   7841  C CB   . ILE A 1 21 ? -5.692  -3.846  1.858   1.00 0.00 ? 21 ILE A CB   11 
ATOM   7842  C CG1  . ILE A 1 21 ? -6.955  -4.086  2.687   1.00 0.00 ? 21 ILE A CG1  11 
ATOM   7843  C CG2  . ILE A 1 21 ? -6.014  -3.883  0.369   1.00 0.00 ? 21 ILE A CG2  11 
ATOM   7844  C CD1  . ILE A 1 21 ? -7.682  -2.815  3.066   1.00 0.00 ? 21 ILE A CD1  11 
ATOM   7845  H H    . ILE A 1 21 ? -4.248  -3.931  4.080   1.00 0.00 ? 21 ILE A H    11 
ATOM   7846  H HA   . ILE A 1 21 ? -4.955  -5.853  1.980   1.00 0.00 ? 21 ILE A HA   11 
ATOM   7847  H HB   . ILE A 1 21 ? -5.296  -2.868  2.092   1.00 0.00 ? 21 ILE A HB   11 
ATOM   7848  H HG12 . ILE A 1 21 ? -7.638  -4.700  2.120   1.00 0.00 ? 21 ILE A HG12 11 
ATOM   7849  H HG13 . ILE A 1 21 ? -6.687  -4.602  3.597   1.00 0.00 ? 21 ILE A HG13 11 
ATOM   7850  H HG21 . ILE A 1 21 ? -6.632  -4.742  0.155   1.00 0.00 ? 21 ILE A HG21 11 
ATOM   7851  H HG22 . ILE A 1 21 ? -5.098  -3.946  -0.199  1.00 0.00 ? 21 ILE A HG22 11 
ATOM   7852  H HG23 . ILE A 1 21 ? -6.545  -2.984  0.094   1.00 0.00 ? 21 ILE A HG23 11 
ATOM   7853  H HD11 . ILE A 1 21 ? -8.635  -2.781  2.559   1.00 0.00 ? 21 ILE A HD11 11 
ATOM   7854  H HD12 . ILE A 1 21 ? -7.088  -1.962  2.775   1.00 0.00 ? 21 ILE A HD12 11 
ATOM   7855  H HD13 . ILE A 1 21 ? -7.841  -2.797  4.135   1.00 0.00 ? 21 ILE A HD13 11 
ATOM   7856  N N    . PRO A 1 22 ? -3.161  -5.222  0.283   1.00 0.00 ? 22 PRO A N    11 
ATOM   7857  C CA   . PRO A 1 22 ? -2.011  -4.975  -0.578  1.00 0.00 ? 22 PRO A CA   11 
ATOM   7858  C C    . PRO A 1 22 ? -1.736  -3.487  -0.768  1.00 0.00 ? 22 PRO A C    11 
ATOM   7859  O O    . PRO A 1 22 ? -2.575  -2.647  -0.446  1.00 0.00 ? 22 PRO A O    11 
ATOM   7860  C CB   . PRO A 1 22 ? -2.390  -5.648  -1.911  1.00 0.00 ? 22 PRO A CB   11 
ATOM   7861  C CG   . PRO A 1 22 ? -3.803  -6.113  -1.747  1.00 0.00 ? 22 PRO A CG   11 
ATOM   7862  C CD   . PRO A 1 22 ? -4.019  -6.276  -0.267  1.00 0.00 ? 22 PRO A CD   11 
ATOM   7863  H HA   . PRO A 1 22 ? -1.134  -5.432  -0.173  1.00 0.00 ? 22 PRO A HA   11 
ATOM   7864  H HB2  . PRO A 1 22 ? -2.306  -4.931  -2.715  1.00 0.00 ? 22 PRO A HB2  11 
ATOM   7865  H HB3  . PRO A 1 22 ? -1.724  -6.478  -2.096  1.00 0.00 ? 22 PRO A HB3  11 
ATOM   7866  H HG2  . PRO A 1 22 ? -4.480  -5.371  -2.148  1.00 0.00 ? 22 PRO A HG2  11 
ATOM   7867  H HG3  . PRO A 1 22 ? -3.939  -7.059  -2.256  1.00 0.00 ? 22 PRO A HG3  11 
ATOM   7868  H HD2  . PRO A 1 22 ? -5.055  -6.118  -0.006  1.00 0.00 ? 22 PRO A HD2  11 
ATOM   7869  H HD3  . PRO A 1 22 ? -3.689  -7.252  0.063   1.00 0.00 ? 22 PRO A HD3  11 
ATOM   7870  N N    . CYS A 1 23 ? -0.558  -3.171  -1.298  1.00 0.00 ? 23 CYS A N    11 
ATOM   7871  C CA   . CYS A 1 23 ? -0.174  -1.767  -1.521  1.00 0.00 ? 23 CYS A CA   11 
ATOM   7872  C C    . CYS A 1 23 ? -0.047  -1.451  -3.008  1.00 0.00 ? 23 CYS A C    11 
ATOM   7873  O O    . CYS A 1 23 ? -0.195  -0.301  -3.419  1.00 0.00 ? 23 CYS A O    11 
ATOM   7874  C CB   . CYS A 1 23 ? 1.140   -1.408  -0.789  1.00 0.00 ? 23 CYS A CB   11 
ATOM   7875  S SG   . CYS A 1 23 ? 1.047   0.143   0.158   1.00 0.00 ? 23 CYS A SG   11 
ATOM   7876  H H    . CYS A 1 23 ? 0.058   -3.897  -1.551  1.00 0.00 ? 23 CYS A H    11 
ATOM   7877  H HA   . CYS A 1 23 ? -0.965  -1.147  -1.118  1.00 0.00 ? 23 CYS A HA   11 
ATOM   7878  H HB2  . CYS A 1 23 ? 1.403   -2.186  -0.088  1.00 0.00 ? 23 CYS A HB2  11 
ATOM   7879  H HB3  . CYS A 1 23 ? 1.933   -1.298  -1.516  1.00 0.00 ? 23 CYS A HB3  11 
ATOM   7880  N N    . GLN A 1 24 ? 0.212   -2.473  -3.815  1.00 0.00 ? 24 GLN A N    11 
ATOM   7881  C CA   . GLN A 1 24 ? 0.336   -2.282  -5.260  1.00 0.00 ? 24 GLN A CA   11 
ATOM   7882  C C    . GLN A 1 24 ? -0.993  -1.840  -5.837  1.00 0.00 ? 24 GLN A C    11 
ATOM   7883  O O    . GLN A 1 24 ? -1.055  -0.995  -6.731  1.00 0.00 ? 24 GLN A O    11 
ATOM   7884  C CB   . GLN A 1 24 ? 0.794   -3.571  -5.956  1.00 0.00 ? 24 GLN A CB   11 
ATOM   7885  C CG   . GLN A 1 24 ? 1.527   -4.545  -5.049  1.00 0.00 ? 24 GLN A CG   11 
ATOM   7886  C CD   . GLN A 1 24 ? 2.256   -5.625  -5.823  1.00 0.00 ? 24 GLN A CD   11 
ATOM   7887  O OE1  . GLN A 1 24 ? 1.691   -6.677  -6.126  1.00 0.00 ? 24 GLN A OE1  11 
ATOM   7888  N NE2  . GLN A 1 24 ? 3.518   -5.372  -6.149  1.00 0.00 ? 24 GLN A NE2  11 
ATOM   7889  H H    . GLN A 1 24 ? 0.309   -3.369  -3.435  1.00 0.00 ? 24 GLN A H    11 
ATOM   7890  H HA   . GLN A 1 24 ? 1.057   -1.504  -5.431  1.00 0.00 ? 24 GLN A HA   11 
ATOM   7891  H HB2  . GLN A 1 24 ? -0.077  -4.074  -6.351  1.00 0.00 ? 24 GLN A HB2  11 
ATOM   7892  H HB3  . GLN A 1 24 ? 1.449   -3.310  -6.774  1.00 0.00 ? 24 GLN A HB3  11 
ATOM   7893  H HG2  . GLN A 1 24 ? 2.246   -3.998  -4.459  1.00 0.00 ? 24 GLN A HG2  11 
ATOM   7894  H HG3  . GLN A 1 24 ? 0.807   -5.015  -4.394  1.00 0.00 ? 24 GLN A HG3  11 
ATOM   7895  H HE21 . GLN A 1 24 ? 3.903   -4.513  -5.876  1.00 0.00 ? 24 GLN A HE21 11 
ATOM   7896  H HE22 . GLN A 1 24 ? 4.013   -6.054  -6.650  1.00 0.00 ? 24 GLN A HE22 11 
ATOM   7897  N N    . LEU A 1 25 ? -2.055  -2.420  -5.306  1.00 0.00 ? 25 LEU A N    11 
ATOM   7898  C CA   . LEU A 1 25 ? -3.404  -2.102  -5.741  1.00 0.00 ? 25 LEU A CA   11 
ATOM   7899  C C    . LEU A 1 25 ? -3.845  -0.723  -5.242  1.00 0.00 ? 25 LEU A C    11 
ATOM   7900  O O    . LEU A 1 25 ? -4.998  -0.331  -5.426  1.00 0.00 ? 25 LEU A O    11 
ATOM   7901  C CB   . LEU A 1 25 ? -4.382  -3.173  -5.252  1.00 0.00 ? 25 LEU A CB   11 
ATOM   7902  C CG   . LEU A 1 25 ? -5.383  -3.663  -6.300  1.00 0.00 ? 25 LEU A CG   11 
ATOM   7903  C CD1  . LEU A 1 25 ? -6.226  -2.506  -6.816  1.00 0.00 ? 25 LEU A CD1  11 
ATOM   7904  C CD2  . LEU A 1 25 ? -4.658  -4.351  -7.447  1.00 0.00 ? 25 LEU A CD2  11 
ATOM   7905  H H    . LEU A 1 25 ? -1.923  -3.080  -4.604  1.00 0.00 ? 25 LEU A H    11 
ATOM   7906  H HA   . LEU A 1 25 ? -3.402  -2.098  -6.814  1.00 0.00 ? 25 LEU A HA   11 
ATOM   7907  H HB2  . LEU A 1 25 ? -3.810  -4.022  -4.907  1.00 0.00 ? 25 LEU A HB2  11 
ATOM   7908  H HB3  . LEU A 1 25 ? -4.938  -2.772  -4.418  1.00 0.00 ? 25 LEU A HB3  11 
ATOM   7909  H HG   . LEU A 1 25 ? -6.048  -4.382  -5.844  1.00 0.00 ? 25 LEU A HG   11 
ATOM   7910  H HD11 . LEU A 1 25 ? -6.841  -2.125  -6.016  1.00 0.00 ? 25 LEU A HD11 11 
ATOM   7911  H HD12 . LEU A 1 25 ? -6.855  -2.852  -7.623  1.00 0.00 ? 25 LEU A HD12 11 
ATOM   7912  H HD13 . LEU A 1 25 ? -5.576  -1.721  -7.177  1.00 0.00 ? 25 LEU A HD13 11 
ATOM   7913  H HD21 . LEU A 1 25 ? -5.186  -4.165  -8.370  1.00 0.00 ? 25 LEU A HD21 11 
ATOM   7914  H HD22 . LEU A 1 25 ? -4.619  -5.414  -7.262  1.00 0.00 ? 25 LEU A HD22 11 
ATOM   7915  H HD23 . LEU A 1 25 ? -3.653  -3.961  -7.522  1.00 0.00 ? 25 LEU A HD23 11 
ATOM   7916  N N    . ARG A 1 26 ? -2.929  0.015   -4.614  1.00 0.00 ? 26 ARG A N    11 
ATOM   7917  C CA   . ARG A 1 26 ? -3.254  1.351   -4.107  1.00 0.00 ? 26 ARG A CA   11 
ATOM   7918  C C    . ARG A 1 26 ? -2.361  2.430   -4.716  1.00 0.00 ? 26 ARG A C    11 
ATOM   7919  O O    . ARG A 1 26 ? -2.575  3.622   -4.499  1.00 0.00 ? 26 ARG A O    11 
ATOM   7920  C CB   . ARG A 1 26 ? -3.176  1.414   -2.571  1.00 0.00 ? 26 ARG A CB   11 
ATOM   7921  C CG   . ARG A 1 26 ? -4.423  1.991   -1.918  1.00 0.00 ? 26 ARG A CG   11 
ATOM   7922  C CD   . ARG A 1 26 ? -4.820  3.326   -2.528  1.00 0.00 ? 26 ARG A CD   11 
ATOM   7923  N NE   . ARG A 1 26 ? -6.264  3.532   -2.475  1.00 0.00 ? 26 ARG A NE   11 
ATOM   7924  C CZ   . ARG A 1 26 ? -6.899  4.103   -1.453  1.00 0.00 ? 26 ARG A CZ   11 
ATOM   7925  N NH1  . ARG A 1 26 ? -6.226  4.508   -0.384  1.00 0.00 ? 26 ARG A NH1  11 
ATOM   7926  N NH2  . ARG A 1 26 ? -8.215  4.266   -1.498  1.00 0.00 ? 26 ARG A NH2  11 
ATOM   7927  H H    . ARG A 1 26 ? -2.025  -0.340  -4.500  1.00 0.00 ? 26 ARG A H    11 
ATOM   7928  H HA   . ARG A 1 26 ? -4.255  1.553   -4.409  1.00 0.00 ? 26 ARG A HA   11 
ATOM   7929  H HB2  . ARG A 1 26 ? -3.025  0.421   -2.177  1.00 0.00 ? 26 ARG A HB2  11 
ATOM   7930  H HB3  . ARG A 1 26 ? -2.334  2.032   -2.294  1.00 0.00 ? 26 ARG A HB3  11 
ATOM   7931  H HG2  . ARG A 1 26 ? -5.237  1.294   -2.045  1.00 0.00 ? 26 ARG A HG2  11 
ATOM   7932  H HG3  . ARG A 1 26 ? -4.230  2.131   -0.864  1.00 0.00 ? 26 ARG A HG3  11 
ATOM   7933  H HD2  . ARG A 1 26 ? -4.319  4.114   -1.986  1.00 0.00 ? 26 ARG A HD2  11 
ATOM   7934  H HD3  . ARG A 1 26 ? -4.493  3.344   -3.555  1.00 0.00 ? 26 ARG A HD3  11 
ATOM   7935  H HE   . ARG A 1 26 ? -6.790  3.232   -3.247  1.00 0.00 ? 26 ARG A HE   11 
ATOM   7936  H HH11 . ARG A 1 26 ? -5.235  4.384   -0.338  1.00 0.00 ? 26 ARG A HH11 11 
ATOM   7937  H HH12 . ARG A 1 26 ? -6.710  4.937   0.379   1.00 0.00 ? 26 ARG A HH12 11 
ATOM   7938  H HH21 . ARG A 1 26 ? -8.729  3.959   -2.299  1.00 0.00 ? 26 ARG A HH21 11 
ATOM   7939  H HH22 . ARG A 1 26 ? -8.692  4.695   -0.733  1.00 0.00 ? 26 ARG A HH22 11 
ATOM   7940  N N    . CYS A 1 27 ? -1.372  2.005   -5.478  1.00 0.00 ? 27 CYS A N    11 
ATOM   7941  C CA   . CYS A 1 27 ? -0.451  2.928   -6.127  1.00 0.00 ? 27 CYS A CA   11 
ATOM   7942  C C    . CYS A 1 27 ? -0.757  3.042   -7.619  1.00 0.00 ? 27 CYS A C    11 
ATOM   7943  O O    . CYS A 1 27 ? -0.178  2.321   -8.433  1.00 0.00 ? 27 CYS A O    11 
ATOM   7944  C CB   . CYS A 1 27 ? 0.995   2.472   -5.929  1.00 0.00 ? 27 CYS A CB   11 
ATOM   7945  S SG   . CYS A 1 27 ? 2.225   3.556   -6.727  1.00 0.00 ? 27 CYS A SG   11 
ATOM   7946  H H    . CYS A 1 27 ? -1.264  1.055   -5.610  1.00 0.00 ? 27 CYS A H    11 
ATOM   7947  H HA   . CYS A 1 27 ? -0.576  3.892   -5.667  1.00 0.00 ? 27 CYS A HA   11 
ATOM   7948  H HB2  . CYS A 1 27 ? 1.217   2.447   -4.872  1.00 0.00 ? 27 CYS A HB2  11 
ATOM   7949  H HB3  . CYS A 1 27 ? 1.114   1.482   -6.342  1.00 0.00 ? 27 CYS A HB3  11 
ATOM   7950  N N    . SER A 1 28 ? -1.662  3.949   -7.976  1.00 0.00 ? 28 SER A N    11 
ATOM   7951  C CA   . SER A 1 28 ? -2.032  4.147   -9.353  1.00 0.00 ? 28 SER A CA   11 
ATOM   7952  C C    . SER A 1 28 ? -2.353  5.611   -9.646  1.00 0.00 ? 28 SER A C    11 
ATOM   7953  O O    . SER A 1 28 ? -3.215  5.911   -10.473 1.00 0.00 ? 28 SER A O    11 
ATOM   7954  C CB   . SER A 1 28 ? -3.226  3.263   -9.704  1.00 0.00 ? 28 SER A CB   11 
ATOM   7955  O OG   . SER A 1 28 ? -2.807  2.052   -10.309 1.00 0.00 ? 28 SER A OG   11 
ATOM   7956  H H    . SER A 1 28 ? -2.084  4.488   -7.309  1.00 0.00 ? 28 SER A H    11 
ATOM   7957  H HA   . SER A 1 28 ? -1.197  3.855   -9.935  1.00 0.00 ? 28 SER A HA   11 
ATOM   7958  H HB2  . SER A 1 28 ? -3.769  3.032   -8.800  1.00 0.00 ? 28 SER A HB2  11 
ATOM   7959  H HB3  . SER A 1 28 ? -3.875  3.790   -10.388 1.00 0.00 ? 28 SER A HB3  11 
ATOM   7960  H HG   . SER A 1 28 ? -2.180  2.245   -11.010 1.00 0.00 ? 28 SER A HG   11 
ATOM   7961  N N    . SER A 1 29 ? -1.652  6.519   -8.972  1.00 0.00 ? 29 SER A N    11 
ATOM   7962  C CA   . SER A 1 29 ? -1.858  7.950   -9.167  1.00 0.00 ? 29 SER A CA   11 
ATOM   7963  C C    . SER A 1 29 ? -3.289  8.353   -8.842  1.00 0.00 ? 29 SER A C    11 
ATOM   7964  O O    . SER A 1 29 ? -4.230  7.585   -9.034  1.00 0.00 ? 29 SER A O    11 
ATOM   7965  C CB   . SER A 1 29 ? -1.521  8.341   -10.602 1.00 0.00 ? 29 SER A CB   11 
ATOM   7966  O OG   . SER A 1 29 ? -2.605  8.076   -11.476 1.00 0.00 ? 29 SER A OG   11 
ATOM   7967  H H    . SER A 1 29 ? -0.975  6.218   -8.333  1.00 0.00 ? 29 SER A H    11 
ATOM   7968  H HA   . SER A 1 29 ? -1.194  8.482   -8.499  1.00 0.00 ? 29 SER A HA   11 
ATOM   7969  H HB2  . SER A 1 29 ? -1.296  9.397   -10.637 1.00 0.00 ? 29 SER A HB2  11 
ATOM   7970  H HB3  . SER A 1 29 ? -0.662  7.776   -10.929 1.00 0.00 ? 29 SER A HB3  11 
ATOM   7971  H HG   . SER A 1 29 ? -2.904  8.897   -11.873 1.00 0.00 ? 29 SER A HG   11 
ATOM   7972  N N    . ASN A 1 30 ? -3.432  9.570   -8.344  1.00 0.00 ? 30 ASN A N    11 
ATOM   7973  C CA   . ASN A 1 30 ? -4.739  10.105  -7.978  1.00 0.00 ? 30 ASN A CA   11 
ATOM   7974  C C    . ASN A 1 30 ? -5.367  9.272   -6.868  1.00 0.00 ? 30 ASN A C    11 
ATOM   7975  O O    . ASN A 1 30 ? -6.525  8.863   -6.959  1.00 0.00 ? 30 ASN A O    11 
ATOM   7976  C CB   . ASN A 1 30 ? -5.663  10.136  -9.199  1.00 0.00 ? 30 ASN A CB   11 
ATOM   7977  C CG   . ASN A 1 30 ? -5.537  11.425  -9.988  1.00 0.00 ? 30 ASN A CG   11 
ATOM   7978  O OD1  . ASN A 1 30 ? -4.782  11.502  -10.957 1.00 0.00 ? 30 ASN A OD1  11 
ATOM   7979  N ND2  . ASN A 1 30 ? -6.279  12.446  -9.575  1.00 0.00 ? 30 ASN A ND2  11 
ATOM   7980  H H    . ASN A 1 30 ? -2.634  10.121  -8.216  1.00 0.00 ? 30 ASN A H    11 
ATOM   7981  H HA   . ASN A 1 30 ? -4.597  11.114  -7.620  1.00 0.00 ? 30 ASN A HA   11 
ATOM   7982  H HB2  . ASN A 1 30 ? -5.416  9.312   -9.851  1.00 0.00 ? 30 ASN A HB2  11 
ATOM   7983  H HB3  . ASN A 1 30 ? -6.688  10.035  -8.870  1.00 0.00 ? 30 ASN A HB3  11 
ATOM   7984  H HD21 . ASN A 1 30 ? -6.858  12.313  -8.796  1.00 0.00 ? 30 ASN A HD21 11 
ATOM   7985  H HD22 . ASN A 1 30 ? -6.218  13.291  -10.067 1.00 0.00 ? 30 ASN A HD22 11 
ATOM   7986  N N    . THR A 1 31 ? -4.590  9.027   -5.820  1.00 0.00 ? 31 THR A N    11 
ATOM   7987  C CA   . THR A 1 31 ? -5.048  8.246   -4.692  1.00 0.00 ? 31 THR A CA   11 
ATOM   7988  C C    . THR A 1 31 ? -4.108  8.416   -3.497  1.00 0.00 ? 31 THR A C    11 
ATOM   7989  O O    . THR A 1 31 ? -3.348  7.505   -3.175  1.00 0.00 ? 31 THR A O    11 
ATOM   7990  C CB   . THR A 1 31 ? -5.138  6.771   -5.077  1.00 0.00 ? 31 THR A CB   11 
ATOM   7991  O OG1  . THR A 1 31 ? -5.998  6.592   -6.188  1.00 0.00 ? 31 THR A OG1  11 
ATOM   7992  C CG2  . THR A 1 31 ? -5.647  5.887   -3.960  1.00 0.00 ? 31 THR A CG2  11 
ATOM   7993  H H    . THR A 1 31 ? -3.687  9.381   -5.806  1.00 0.00 ? 31 THR A H    11 
ATOM   7994  H HA   . THR A 1 31 ? -6.018  8.595   -4.432  1.00 0.00 ? 31 THR A HA   11 
ATOM   7995  H HB   . THR A 1 31 ? -4.155  6.425   -5.351  1.00 0.00 ? 31 THR A HB   11 
ATOM   7996  H HG1  . THR A 1 31 ? -6.801  7.102   -6.058  1.00 0.00 ? 31 THR A HG1  11 
ATOM   7997  H HG21 . THR A 1 31 ? -6.615  6.239   -3.635  1.00 0.00 ? 31 THR A HG21 11 
ATOM   7998  H HG22 . THR A 1 31 ? -4.954  5.920   -3.132  1.00 0.00 ? 31 THR A HG22 11 
ATOM   7999  H HG23 . THR A 1 31 ? -5.734  4.871   -4.316  1.00 0.00 ? 31 THR A HG23 11 
ATOM   8000  N N    . PRO A 1 32 ? -4.131  9.593   -2.828  1.00 0.00 ? 32 PRO A N    11 
ATOM   8001  C CA   . PRO A 1 32 ? -3.270  9.877   -1.675  1.00 0.00 ? 32 PRO A CA   11 
ATOM   8002  C C    . PRO A 1 32 ? -3.048  8.659   -0.779  1.00 0.00 ? 32 PRO A C    11 
ATOM   8003  O O    . PRO A 1 32 ? -3.835  8.387   0.128   1.00 0.00 ? 32 PRO A O    11 
ATOM   8004  C CB   . PRO A 1 32 ? -4.028  10.981  -0.914  1.00 0.00 ? 32 PRO A CB   11 
ATOM   8005  C CG   . PRO A 1 32 ? -5.250  11.290  -1.728  1.00 0.00 ? 32 PRO A CG   11 
ATOM   8006  C CD   . PRO A 1 32 ? -4.978  10.752  -3.124  1.00 0.00 ? 32 PRO A CD   11 
ATOM   8007  H HA   . PRO A 1 32 ? -2.312  10.256  -1.993  1.00 0.00 ? 32 PRO A HA   11 
ATOM   8008  H HB2  . PRO A 1 32 ? -4.297  10.621  0.069   1.00 0.00 ? 32 PRO A HB2  11 
ATOM   8009  H HB3  . PRO A 1 32 ? -3.393  11.850  -0.818  1.00 0.00 ? 32 PRO A HB3  11 
ATOM   8010  H HG2  . PRO A 1 32 ? -6.108  10.797  -1.285  1.00 0.00 ? 32 PRO A HG2  11 
ATOM   8011  H HG3  . PRO A 1 32 ? -5.409  12.363  -1.752  1.00 0.00 ? 32 PRO A HG3  11 
ATOM   8012  H HD2  . PRO A 1 32 ? -5.895  10.460  -3.618  1.00 0.00 ? 32 PRO A HD2  11 
ATOM   8013  H HD3  . PRO A 1 32 ? -4.437  11.474  -3.725  1.00 0.00 ? 32 PRO A HD3  11 
ATOM   8014  N N    . PRO A 1 33 ? -1.959  7.909   -1.029  1.00 0.00 ? 33 PRO A N    11 
ATOM   8015  C CA   . PRO A 1 33 ? -1.605  6.716   -0.266  1.00 0.00 ? 33 PRO A CA   11 
ATOM   8016  C C    . PRO A 1 33 ? -0.826  7.045   0.993   1.00 0.00 ? 33 PRO A C    11 
ATOM   8017  O O    . PRO A 1 33 ? 0.401   7.021   0.997   1.00 0.00 ? 33 PRO A O    11 
ATOM   8018  C CB   . PRO A 1 33 ? -0.733  5.910   -1.241  1.00 0.00 ? 33 PRO A CB   11 
ATOM   8019  C CG   . PRO A 1 33 ? -0.550  6.767   -2.459  1.00 0.00 ? 33 PRO A CG   11 
ATOM   8020  C CD   . PRO A 1 33 ? -0.975  8.158   -2.082  1.00 0.00 ? 33 PRO A CD   11 
ATOM   8021  H HA   . PRO A 1 33 ? -2.468  6.131   0.006   1.00 0.00 ? 33 PRO A HA   11 
ATOM   8022  H HB2  . PRO A 1 33 ? 0.216   5.691   -0.773  1.00 0.00 ? 33 PRO A HB2  11 
ATOM   8023  H HB3  . PRO A 1 33 ? -1.237  4.985   -1.485  1.00 0.00 ? 33 PRO A HB3  11 
ATOM   8024  H HG2  . PRO A 1 33 ? 0.488   6.764   -2.755  1.00 0.00 ? 33 PRO A HG2  11 
ATOM   8025  H HG3  . PRO A 1 33 ? -1.168  6.394   -3.263  1.00 0.00 ? 33 PRO A HG3  11 
ATOM   8026  H HD2  . PRO A 1 33 ? -0.135  8.723   -1.704  1.00 0.00 ? 33 PRO A HD2  11 
ATOM   8027  H HD3  . PRO A 1 33 ? -1.426  8.660   -2.925  1.00 0.00 ? 33 PRO A HD3  11 
ATOM   8028  N N    . LEU A 1 34 ? -1.539  7.345   2.066   1.00 0.00 ? 34 LEU A N    11 
ATOM   8029  C CA   . LEU A 1 34 ? -0.871  7.660   3.322   1.00 0.00 ? 34 LEU A CA   11 
ATOM   8030  C C    . LEU A 1 34 ? -0.148  6.432   3.851   1.00 0.00 ? 34 LEU A C    11 
ATOM   8031  O O    . LEU A 1 34 ? 1.016   6.511   4.242   1.00 0.00 ? 34 LEU A O    11 
ATOM   8032  C CB   . LEU A 1 34 ? -1.844  8.216   4.376   1.00 0.00 ? 34 LEU A CB   11 
ATOM   8033  C CG   . LEU A 1 34 ? -2.862  9.231   3.854   1.00 0.00 ? 34 LEU A CG   11 
ATOM   8034  C CD1  . LEU A 1 34 ? -4.260  8.892   4.348   1.00 0.00 ? 34 LEU A CD1  11 
ATOM   8035  C CD2  . LEU A 1 34 ? -2.476  10.642  4.275   1.00 0.00 ? 34 LEU A CD2  11 
ATOM   8036  H H    . LEU A 1 34 ? -2.521  7.350   2.009   1.00 0.00 ? 34 LEU A H    11 
ATOM   8037  H HA   . LEU A 1 34 ? -0.128  8.401   3.100   1.00 0.00 ? 34 LEU A HA   11 
ATOM   8038  H HB2  . LEU A 1 34 ? -2.383  7.393   4.819   1.00 0.00 ? 34 LEU A HB2  11 
ATOM   8039  H HB3  . LEU A 1 34 ? -1.261  8.695   5.150   1.00 0.00 ? 34 LEU A HB3  11 
ATOM   8040  H HG   . LEU A 1 34 ? -2.872  9.194   2.779   1.00 0.00 ? 34 LEU A HG   11 
ATOM   8041  H HD11 . LEU A 1 34 ? -4.481  9.472   5.232   1.00 0.00 ? 34 LEU A HD11 11 
ATOM   8042  H HD12 . LEU A 1 34 ? -4.314  7.840   4.586   1.00 0.00 ? 34 LEU A HD12 11 
ATOM   8043  H HD13 . LEU A 1 34 ? -4.981  9.124   3.577   1.00 0.00 ? 34 LEU A HD13 11 
ATOM   8044  H HD21 . LEU A 1 34 ? -3.002  10.905  5.181   1.00 0.00 ? 34 LEU A HD21 11 
ATOM   8045  H HD22 . LEU A 1 34 ? -2.738  11.336  3.490   1.00 0.00 ? 34 LEU A HD22 11 
ATOM   8046  H HD23 . LEU A 1 34 ? -1.411  10.685  4.452   1.00 0.00 ? 34 LEU A HD23 11 
ATOM   8047  N N    . THR A 1 35 ? -0.825  5.292   3.836   1.00 0.00 ? 35 THR A N    11 
ATOM   8048  C CA   . THR A 1 35 ? -0.219  4.058   4.288   1.00 0.00 ? 35 THR A CA   11 
ATOM   8049  C C    . THR A 1 35 ? 0.536   3.381   3.144   1.00 0.00 ? 35 THR A C    11 
ATOM   8050  O O    . THR A 1 35 ? 1.142   2.328   3.338   1.00 0.00 ? 35 THR A O    11 
ATOM   8051  C CB   . THR A 1 35 ? -1.284  3.116   4.853   1.00 0.00 ? 35 THR A CB   11 
ATOM   8052  O OG1  . THR A 1 35 ? -0.681  2.019   5.517   1.00 0.00 ? 35 THR A OG1  11 
ATOM   8053  C CG2  . THR A 1 35 ? -2.213  2.556   3.798   1.00 0.00 ? 35 THR A CG2  11 
ATOM   8054  H H    . THR A 1 35 ? -1.741  5.274   3.500   1.00 0.00 ? 35 THR A H    11 
ATOM   8055  H HA   . THR A 1 35 ? 0.481   4.305   5.071   1.00 0.00 ? 35 THR A HA   11 
ATOM   8056  H HB   . THR A 1 35 ? -1.886  3.657   5.569   1.00 0.00 ? 35 THR A HB   11 
ATOM   8057  H HG1  . THR A 1 35 ? -0.114  2.344   6.220   1.00 0.00 ? 35 THR A HG1  11 
ATOM   8058  H HG21 . THR A 1 35 ? -3.167  2.322   4.246   1.00 0.00 ? 35 THR A HG21 11 
ATOM   8059  H HG22 . THR A 1 35 ? -1.782  1.658   3.380   1.00 0.00 ? 35 THR A HG22 11 
ATOM   8060  H HG23 . THR A 1 35 ? -2.353  3.288   3.016   1.00 0.00 ? 35 THR A HG23 11 
ATOM   8061  N N    . CYS A 1 36 ? 0.502   3.979   1.945   1.00 0.00 ? 36 CYS A N    11 
ATOM   8062  C CA   . CYS A 1 36 ? 1.199   3.386   0.804   1.00 0.00 ? 36 CYS A CA   11 
ATOM   8063  C C    . CYS A 1 36 ? 2.285   4.300   0.246   1.00 0.00 ? 36 CYS A C    11 
ATOM   8064  O O    . CYS A 1 36 ? 3.115   3.859   -0.542  1.00 0.00 ? 36 CYS A O    11 
ATOM   8065  C CB   . CYS A 1 36 ? 0.222   3.028   -0.316  1.00 0.00 ? 36 CYS A CB   11 
ATOM   8066  S SG   . CYS A 1 36 ? 0.675   1.539   -1.262  1.00 0.00 ? 36 CYS A SG   11 
ATOM   8067  H H    . CYS A 1 36 ? 0.000   4.826   1.825   1.00 0.00 ? 36 CYS A H    11 
ATOM   8068  H HA   . CYS A 1 36 ? 1.663   2.485   1.157   1.00 0.00 ? 36 CYS A HA   11 
ATOM   8069  H HB2  . CYS A 1 36 ? -0.759  2.869   0.101   1.00 0.00 ? 36 CYS A HB2  11 
ATOM   8070  H HB3  . CYS A 1 36 ? 0.184   3.846   -1.013  1.00 0.00 ? 36 CYS A HB3  11 
ATOM   8071  N N    . GLN A 1 37 ? 2.274   5.571   0.642   1.00 0.00 ? 37 GLN A N    11 
ATOM   8072  C CA   . GLN A 1 37 ? 3.259   6.539   0.157   1.00 0.00 ? 37 GLN A CA   11 
ATOM   8073  C C    . GLN A 1 37 ? 4.639   5.913   0.041   1.00 0.00 ? 37 GLN A C    11 
ATOM   8074  O O    . GLN A 1 37 ? 5.288   5.988   -1.001  1.00 0.00 ? 37 GLN A O    11 
ATOM   8075  C CB   . GLN A 1 37 ? 3.322   7.751   1.098   1.00 0.00 ? 37 GLN A CB   11 
ATOM   8076  C CG   . GLN A 1 37 ? 3.379   7.373   2.570   1.00 0.00 ? 37 GLN A CG   11 
ATOM   8077  C CD   . GLN A 1 37 ? 2.947   8.505   3.481   1.00 0.00 ? 37 GLN A CD   11 
ATOM   8078  O OE1  . GLN A 1 37 ? 2.657   9.610   3.021   1.00 0.00 ? 37 GLN A OE1  11 
ATOM   8079  N NE2  . GLN A 1 37 ? 2.902   8.235   4.780   1.00 0.00 ? 37 GLN A NE2  11 
ATOM   8080  H H    . GLN A 1 37 ? 1.581   5.873   1.263   1.00 0.00 ? 37 GLN A H    11 
ATOM   8081  H HA   . GLN A 1 37 ? 2.949   6.857   -0.824  1.00 0.00 ? 37 GLN A HA   11 
ATOM   8082  H HB2  . GLN A 1 37 ? 4.207   8.327   0.869   1.00 0.00 ? 37 GLN A HB2  11 
ATOM   8083  H HB3  . GLN A 1 37 ? 2.447   8.370   0.944   1.00 0.00 ? 37 GLN A HB3  11 
ATOM   8084  H HG2  . GLN A 1 37 ? 2.728   6.528   2.738   1.00 0.00 ? 37 GLN A HG2  11 
ATOM   8085  H HG3  . GLN A 1 37 ? 4.393   7.099   2.818   1.00 0.00 ? 37 GLN A HG3  11 
ATOM   8086  H HE21 . GLN A 1 37 ? 3.146   7.333   5.074   1.00 0.00 ? 37 GLN A HE21 11 
ATOM   8087  H HE22 . GLN A 1 37 ? 2.625   8.949   5.392   1.00 0.00 ? 37 GLN A HE22 11 
ATOM   8088  N N    . ARG A 1 38 ? 5.072   5.295   1.120   1.00 0.00 ? 38 ARG A N    11 
ATOM   8089  C CA   . ARG A 1 38 ? 6.372   4.641   1.159   1.00 0.00 ? 38 ARG A CA   11 
ATOM   8090  C C    . ARG A 1 38 ? 6.486   3.593   0.056   1.00 0.00 ? 38 ARG A C    11 
ATOM   8091  O O    . ARG A 1 38 ? 7.523   3.471   -0.592  1.00 0.00 ? 38 ARG A O    11 
ATOM   8092  C CB   . ARG A 1 38 ? 6.599   3.992   2.527   1.00 0.00 ? 38 ARG A CB   11 
ATOM   8093  C CG   . ARG A 1 38 ? 7.683   4.670   3.350   1.00 0.00 ? 38 ARG A CG   11 
ATOM   8094  C CD   . ARG A 1 38 ? 9.001   3.917   3.265   1.00 0.00 ? 38 ARG A CD   11 
ATOM   8095  N NE   . ARG A 1 38 ? 9.871   4.228   4.396   1.00 0.00 ? 38 ARG A NE   11 
ATOM   8096  C CZ   . ARG A 1 38 ? 10.489  5.396   4.557   1.00 0.00 ? 38 ARG A CZ   11 
ATOM   8097  N NH1  . ARG A 1 38 ? 10.334  6.365   3.663   1.00 0.00 ? 38 ARG A NH1  11 
ATOM   8098  N NH2  . ARG A 1 38 ? 11.261  5.597   5.615   1.00 0.00 ? 38 ARG A NH2  11 
ATOM   8099  H H    . ARG A 1 38 ? 4.497   5.276   1.908   1.00 0.00 ? 38 ARG A H    11 
ATOM   8100  H HA   . ARG A 1 38 ? 7.127   5.397   0.998   1.00 0.00 ? 38 ARG A HA   11 
ATOM   8101  H HB2  . ARG A 1 38 ? 5.676   4.029   3.087   1.00 0.00 ? 38 ARG A HB2  11 
ATOM   8102  H HB3  . ARG A 1 38 ? 6.880   2.958   2.382   1.00 0.00 ? 38 ARG A HB3  11 
ATOM   8103  H HG2  . ARG A 1 38 ? 7.829   5.672   2.977   1.00 0.00 ? 38 ARG A HG2  11 
ATOM   8104  H HG3  . ARG A 1 38 ? 7.365   4.709   4.381   1.00 0.00 ? 38 ARG A HG3  11 
ATOM   8105  H HD2  . ARG A 1 38 ? 8.788   2.857   3.251   1.00 0.00 ? 38 ARG A HD2  11 
ATOM   8106  H HD3  . ARG A 1 38 ? 9.492   4.190   2.344   1.00 0.00 ? 38 ARG A HD3  11 
ATOM   8107  H HE   . ARG A 1 38 ? 10.004  3.530   5.070   1.00 0.00 ? 38 ARG A HE   11 
ATOM   8108  H HH11 . ARG A 1 38 ? 9.752   6.220   2.863   1.00 0.00 ? 38 ARG A HH11 11 
ATOM   8109  H HH12 . ARG A 1 38 ? 10.799  7.240   3.791   1.00 0.00 ? 38 ARG A HH12 11 
ATOM   8110  H HH21 . ARG A 1 38 ? 11.382  4.870   6.292   1.00 0.00 ? 38 ARG A HH21 11 
ATOM   8111  H HH22 . ARG A 1 38 ? 11.725  6.475   5.737   1.00 0.00 ? 38 ARG A HH22 11 
ATOM   8112  N N    . TYR A 1 39 ? 5.413   2.837   -0.152  1.00 0.00 ? 39 TYR A N    11 
ATOM   8113  C CA   . TYR A 1 39 ? 5.401   1.796   -1.165  1.00 0.00 ? 39 TYR A CA   11 
ATOM   8114  C C    . TYR A 1 39 ? 5.198   2.360   -2.563  1.00 0.00 ? 39 TYR A C    11 
ATOM   8115  O O    . TYR A 1 39 ? 5.919   1.998   -3.493  1.00 0.00 ? 39 TYR A O    11 
ATOM   8116  C CB   . TYR A 1 39 ? 4.325   0.750   -0.858  1.00 0.00 ? 39 TYR A CB   11 
ATOM   8117  C CG   . TYR A 1 39 ? 4.342   -0.422  -1.811  1.00 0.00 ? 39 TYR A CG   11 
ATOM   8118  C CD1  . TYR A 1 39 ? 3.938   -0.272  -3.132  1.00 0.00 ? 39 TYR A CD1  11 
ATOM   8119  C CD2  . TYR A 1 39 ? 4.781   -1.673  -1.397  1.00 0.00 ? 39 TYR A CD2  11 
ATOM   8120  C CE1  . TYR A 1 39 ? 3.967   -1.337  -4.012  1.00 0.00 ? 39 TYR A CE1  11 
ATOM   8121  C CE2  . TYR A 1 39 ? 4.816   -2.741  -2.272  1.00 0.00 ? 39 TYR A CE2  11 
ATOM   8122  C CZ   . TYR A 1 39 ? 4.407   -2.569  -3.577  1.00 0.00 ? 39 TYR A CZ   11 
ATOM   8123  O OH   . TYR A 1 39 ? 4.442   -3.631  -4.450  1.00 0.00 ? 39 TYR A OH   11 
ATOM   8124  H H    . TYR A 1 39 ? 4.619   2.973   0.393   1.00 0.00 ? 39 TYR A H    11 
ATOM   8125  H HA   . TYR A 1 39 ? 6.362   1.319   -1.138  1.00 0.00 ? 39 TYR A HA   11 
ATOM   8126  H HB2  . TYR A 1 39 ? 4.479   0.368   0.141   1.00 0.00 ? 39 TYR A HB2  11 
ATOM   8127  H HB3  . TYR A 1 39 ? 3.351   1.212   -0.913  1.00 0.00 ? 39 TYR A HB3  11 
ATOM   8128  H HD1  . TYR A 1 39 ? 3.593   0.694   -3.470  1.00 0.00 ? 39 TYR A HD1  11 
ATOM   8129  H HD2  . TYR A 1 39 ? 5.098   -1.805  -0.374  1.00 0.00 ? 39 TYR A HD2  11 
ATOM   8130  H HE1  . TYR A 1 39 ? 3.647   -1.201  -5.034  1.00 0.00 ? 39 TYR A HE1  11 
ATOM   8131  H HE2  . TYR A 1 39 ? 5.159   -3.707  -1.931  1.00 0.00 ? 39 TYR A HE2  11 
ATOM   8132  H HH   . TYR A 1 39 ? 5.232   -4.153  -4.289  1.00 0.00 ? 39 TYR A HH   11 
ATOM   8133  N N    . CYS A 1 40 ? 4.221   3.243   -2.721  1.00 0.00 ? 40 CYS A N    11 
ATOM   8134  C CA   . CYS A 1 40 ? 3.959   3.830   -4.029  1.00 0.00 ? 40 CYS A CA   11 
ATOM   8135  C C    . CYS A 1 40 ? 5.194   4.562   -4.532  1.00 0.00 ? 40 CYS A C    11 
ATOM   8136  O O    . CYS A 1 40 ? 5.564   4.440   -5.699  1.00 0.00 ? 40 CYS A O    11 
ATOM   8137  C CB   . CYS A 1 40 ? 2.750   4.772   -3.991  1.00 0.00 ? 40 CYS A CB   11 
ATOM   8138  S SG   . CYS A 1 40 ? 2.148   5.270   -5.638  1.00 0.00 ? 40 CYS A SG   11 
ATOM   8139  H H    . CYS A 1 40 ? 3.673   3.502   -1.949  1.00 0.00 ? 40 CYS A H    11 
ATOM   8140  H HA   . CYS A 1 40 ? 3.751   3.018   -4.708  1.00 0.00 ? 40 CYS A HA   11 
ATOM   8141  H HB2  . CYS A 1 40 ? 1.933   4.281   -3.483  1.00 0.00 ? 40 CYS A HB2  11 
ATOM   8142  H HB3  . CYS A 1 40 ? 3.017   5.669   -3.452  1.00 0.00 ? 40 CYS A HB3  11 
ATOM   8143  N N    . ASN A 1 41 ? 5.848   5.303   -3.643  1.00 0.00 ? 41 ASN A N    11 
ATOM   8144  C CA   . ASN A 1 41 ? 7.055   6.019   -4.015  1.00 0.00 ? 41 ASN A CA   11 
ATOM   8145  C C    . ASN A 1 41 ? 8.185   5.035   -4.285  1.00 0.00 ? 41 ASN A C    11 
ATOM   8146  O O    . ASN A 1 41 ? 9.167   5.362   -4.949  1.00 0.00 ? 41 ASN A O    11 
ATOM   8147  C CB   . ASN A 1 41 ? 7.443   7.044   -2.936  1.00 0.00 ? 41 ASN A CB   11 
ATOM   8148  C CG   . ASN A 1 41 ? 8.700   6.670   -2.167  1.00 0.00 ? 41 ASN A CG   11 
ATOM   8149  O OD1  . ASN A 1 41 ? 9.679   7.416   -2.156  1.00 0.00 ? 41 ASN A OD1  11 
ATOM   8150  N ND2  . ASN A 1 41 ? 8.678   5.511   -1.522  1.00 0.00 ? 41 ASN A ND2  11 
ATOM   8151  H H    . ASN A 1 41 ? 5.525   5.352   -2.723  1.00 0.00 ? 41 ASN A H    11 
ATOM   8152  H HA   . ASN A 1 41 ? 6.841   6.532   -4.927  1.00 0.00 ? 41 ASN A HA   11 
ATOM   8153  H HB2  . ASN A 1 41 ? 7.610   8.001   -3.406  1.00 0.00 ? 41 ASN A HB2  11 
ATOM   8154  H HB3  . ASN A 1 41 ? 6.631   7.136   -2.231  1.00 0.00 ? 41 ASN A HB3  11 
ATOM   8155  H HD21 . ASN A 1 41 ? 7.865   4.966   -1.577  1.00 0.00 ? 41 ASN A HD21 11 
ATOM   8156  H HD22 . ASN A 1 41 ? 9.476   5.246   -1.018  1.00 0.00 ? 41 ASN A HD22 11 
ATOM   8157  N N    . ALA A 1 42 ? 8.017   3.821   -3.784  1.00 0.00 ? 42 ALA A N    11 
ATOM   8158  C CA   . ALA A 1 42 ? 8.999   2.767   -3.983  1.00 0.00 ? 42 ALA A CA   11 
ATOM   8159  C C    . ALA A 1 42 ? 8.470   1.732   -4.962  1.00 0.00 ? 42 ALA A C    11 
ATOM   8160  O O    . ALA A 1 42 ? 8.870   0.568   -4.939  1.00 0.00 ? 42 ALA A O    11 
ATOM   8161  C CB   . ALA A 1 42 ? 9.370   2.119   -2.658  1.00 0.00 ? 42 ALA A CB   11 
ATOM   8162  H H    . ALA A 1 42 ? 7.199   3.626   -3.281  1.00 0.00 ? 42 ALA A H    11 
ATOM   8163  H HA   . ALA A 1 42 ? 9.883   3.217   -4.405  1.00 0.00 ? 42 ALA A HA   11 
ATOM   8164  H HB1  . ALA A 1 42 ? 8.627   1.381   -2.398  1.00 0.00 ? 42 ALA A HB1  11 
ATOM   8165  H HB2  . ALA A 1 42 ? 9.414   2.875   -1.887  1.00 0.00 ? 42 ALA A HB2  11 
ATOM   8166  H HB3  . ALA A 1 42 ? 10.335  1.642   -2.749  1.00 0.00 ? 42 ALA A HB3  11 
ATOM   8167  N N    . SER A 1 43 ? 7.562   2.176   -5.822  1.00 0.00 ? 43 SER A N    11 
ATOM   8168  C CA   . SER A 1 43 ? 6.960   1.311   -6.825  1.00 0.00 ? 43 SER A CA   11 
ATOM   8169  C C    . SER A 1 43 ? 6.547   2.098   -8.071  1.00 0.00 ? 43 SER A C    11 
ATOM   8170  O O    . SER A 1 43 ? 5.881   1.560   -8.955  1.00 0.00 ? 43 SER A O    11 
ATOM   8171  C CB   . SER A 1 43 ? 5.745   0.588   -6.241  1.00 0.00 ? 43 SER A CB   11 
ATOM   8172  O OG   . SER A 1 43 ? 5.357   -0.504  -7.057  1.00 0.00 ? 43 SER A OG   11 
ATOM   8173  H H    . SER A 1 43 ? 7.294   3.113   -5.778  1.00 0.00 ? 43 SER A H    11 
ATOM   8174  H HA   . SER A 1 43 ? 7.697   0.578   -7.109  1.00 0.00 ? 43 SER A HA   11 
ATOM   8175  H HB2  . SER A 1 43 ? 5.988   0.217   -5.257  1.00 0.00 ? 43 SER A HB2  11 
ATOM   8176  H HB3  . SER A 1 43 ? 4.917   1.280   -6.170  1.00 0.00 ? 43 SER A HB3  11 
ATOM   8177  H HG   . SER A 1 43 ? 5.180   -0.190  -7.947  1.00 0.00 ? 43 SER A HG   11 
ATOM   8178  N N    . VAL A 1 44 ? 6.944   3.370   -8.145  1.00 0.00 ? 44 VAL A N    11 
ATOM   8179  C CA   . VAL A 1 44 ? 6.607   4.202   -9.292  1.00 0.00 ? 44 VAL A CA   11 
ATOM   8180  C C    . VAL A 1 44 ? 7.528   5.416   -9.387  1.00 0.00 ? 44 VAL A C    11 
ATOM   8181  O O    . VAL A 1 44 ? 7.070   6.560   -9.407  1.00 0.00 ? 44 VAL A O    11 
ATOM   8182  C CB   . VAL A 1 44 ? 5.136   4.672   -9.237  1.00 0.00 ? 44 VAL A CB   11 
ATOM   8183  C CG1  . VAL A 1 44 ? 4.915   5.632   -8.075  1.00 0.00 ? 44 VAL A CG1  11 
ATOM   8184  C CG2  . VAL A 1 44 ? 4.736   5.317   -10.556 1.00 0.00 ? 44 VAL A CG2  11 
ATOM   8185  H H    . VAL A 1 44 ? 7.475   3.756   -7.420  1.00 0.00 ? 44 VAL A H    11 
ATOM   8186  H HA   . VAL A 1 44 ? 6.740   3.603   -10.178 1.00 0.00 ? 44 VAL A HA   11 
ATOM   8187  H HB   . VAL A 1 44 ? 4.507   3.808   -9.079  1.00 0.00 ? 44 VAL A HB   11 
ATOM   8188  H HG11 . VAL A 1 44 ? 5.831   5.737   -7.514  1.00 0.00 ? 44 VAL A HG11 11 
ATOM   8189  H HG12 . VAL A 1 44 ? 4.141   5.245   -7.429  1.00 0.00 ? 44 VAL A HG12 11 
ATOM   8190  H HG13 . VAL A 1 44 ? 4.614   6.598   -8.455  1.00 0.00 ? 44 VAL A HG13 11 
ATOM   8191  H HG21 . VAL A 1 44 ? 5.221   6.277   -10.649 1.00 0.00 ? 44 VAL A HG21 11 
ATOM   8192  H HG22 . VAL A 1 44 ? 3.665   5.451   -10.581 1.00 0.00 ? 44 VAL A HG22 11 
ATOM   8193  H HG23 . VAL A 1 44 ? 5.039   4.680   -11.373 1.00 0.00 ? 44 VAL A HG23 11 
ATOM   8194  N N    . THR A 1 45 ? 8.829   5.153   -9.451  1.00 0.00 ? 45 THR A N    11 
ATOM   8195  C CA   . THR A 1 45 ? 9.832   6.212   -9.551  1.00 0.00 ? 45 THR A CA   11 
ATOM   8196  C C    . THR A 1 45 ? 9.521   7.369   -8.598  1.00 0.00 ? 45 THR A C    11 
ATOM   8197  O O    . THR A 1 45 ? 8.886   7.176   -7.561  1.00 0.00 ? 45 THR A O    11 
ATOM   8198  C CB   . THR A 1 45 ? 9.920   6.722   -10.994 1.00 0.00 ? 45 THR A CB   11 
ATOM   8199  O OG1  . THR A 1 45 ? 10.959  7.676   -11.131 1.00 0.00 ? 45 THR A OG1  11 
ATOM   8200  C CG2  . THR A 1 45 ? 8.640   7.366   -11.482 1.00 0.00 ? 45 THR A CG2  11 
ATOM   8201  H H    . THR A 1 45 ? 9.124   4.218   -9.436  1.00 0.00 ? 45 THR A H    11 
ATOM   8202  H HA   . THR A 1 45 ? 10.784  5.787   -9.275  1.00 0.00 ? 45 THR A HA   11 
ATOM   8203  H HB   . THR A 1 45 ? 10.140  5.892   -11.643 1.00 0.00 ? 45 THR A HB   11 
ATOM   8204  H HG1  . THR A 1 45 ? 11.299  7.652   -12.027 1.00 0.00 ? 45 THR A HG1  11 
ATOM   8205  H HG21 . THR A 1 45 ? 8.835   7.910   -12.394 1.00 0.00 ? 45 THR A HG21 11 
ATOM   8206  H HG22 . THR A 1 45 ? 8.270   8.046   -10.729 1.00 0.00 ? 45 THR A HG22 11 
ATOM   8207  H HG23 . THR A 1 45 ? 7.901   6.601   -11.669 1.00 0.00 ? 45 THR A HG23 11 
ATOM   8208  N N    . ASN A 1 46 ? 9.970   8.569   -8.959  1.00 0.00 ? 46 ASN A N    11 
ATOM   8209  C CA   . ASN A 1 46 ? 9.740   9.757   -8.140  1.00 0.00 ? 46 ASN A CA   11 
ATOM   8210  C C    . ASN A 1 46 ? 10.568  9.705   -6.859  1.00 0.00 ? 46 ASN A C    11 
ATOM   8211  O O    . ASN A 1 46 ? 10.793  8.632   -6.298  1.00 0.00 ? 46 ASN A O    11 
ATOM   8212  C CB   . ASN A 1 46 ? 8.255   9.890   -7.794  1.00 0.00 ? 46 ASN A CB   11 
ATOM   8213  C CG   . ASN A 1 46 ? 7.790   11.333  -7.787  1.00 0.00 ? 46 ASN A CG   11 
ATOM   8214  O OD1  . ASN A 1 46 ? 7.676   11.956  -6.730  1.00 0.00 ? 46 ASN A OD1  11 
ATOM   8215  N ND2  . ASN A 1 46 ? 7.520   11.874  -8.970  1.00 0.00 ? 46 ASN A ND2  11 
ATOM   8216  H H    . ASN A 1 46 ? 10.470  8.657   -9.798  1.00 0.00 ? 46 ASN A H    11 
ATOM   8217  H HA   . ASN A 1 46 ? 10.043  10.618  -8.716  1.00 0.00 ? 46 ASN A HA   11 
ATOM   8218  H HB2  . ASN A 1 46 ? 7.671   9.348   -8.523  1.00 0.00 ? 46 ASN A HB2  11 
ATOM   8219  H HB3  . ASN A 1 46 ? 8.080   9.469   -6.814  1.00 0.00 ? 46 ASN A HB3  11 
ATOM   8220  H HD21 . ASN A 1 46 ? 7.635   11.318  -9.769  1.00 0.00 ? 46 ASN A HD21 11 
ATOM   8221  H HD22 . ASN A 1 46 ? 7.217   12.805  -8.994  1.00 0.00 ? 46 ASN A HD22 11 
ATOM   8222  N N    . SER A 1 47 ? 11.021  10.870  -6.400  1.00 0.00 ? 47 SER A N    11 
ATOM   8223  C CA   . SER A 1 47 ? 11.825  10.956  -5.184  1.00 0.00 ? 47 SER A CA   11 
ATOM   8224  C C    . SER A 1 47 ? 12.995  9.976   -5.228  1.00 0.00 ? 47 SER A C    11 
ATOM   8225  O O    . SER A 1 47 ? 12.855  8.817   -4.847  1.00 0.00 ? 47 SER A O    11 
ATOM   8226  C CB   . SER A 1 47 ? 10.959  10.677  -3.956  1.00 0.00 ? 47 SER A CB   11 
ATOM   8227  O OG   . SER A 1 47 ? 9.745   11.407  -4.009  1.00 0.00 ? 47 SER A OG   11 
ATOM   8228  H H    . SER A 1 47 ? 10.811  11.693  -6.890  1.00 0.00 ? 47 SER A H    11 
ATOM   8229  H HA   . SER A 1 47 ? 12.216  11.961  -5.116  1.00 0.00 ? 47 SER A HA   11 
ATOM   8230  H HB2  . SER A 1 47 ? 10.727  9.623   -3.913  1.00 0.00 ? 47 SER A HB2  11 
ATOM   8231  H HB3  . SER A 1 47 ? 11.498  10.963  -3.064  1.00 0.00 ? 47 SER A HB3  11 
ATOM   8232  H HG   . SER A 1 47 ? 9.837   12.219  -3.506  1.00 0.00 ? 47 SER A HG   11 
ATOM   8233  N N    . VAL A 1 48 ? 14.147  10.462  -5.689  1.00 0.00 ? 48 VAL A N    11 
ATOM   8234  C CA   . VAL A 1 48 ? 15.357  9.655   -5.785  1.00 0.00 ? 48 VAL A CA   11 
ATOM   8235  C C    . VAL A 1 48 ? 16.406  10.381  -6.606  1.00 0.00 ? 48 VAL A C    11 
ATOM   8236  O O    . VAL A 1 48 ? 16.362  10.394  -7.837  1.00 0.00 ? 48 VAL A O    11 
ATOM   8237  C CB   . VAL A 1 48 ? 15.129  8.275   -6.420  1.00 0.00 ? 48 VAL A CB   11 
ATOM   8238  C CG1  . VAL A 1 48 ? 14.837  7.227   -5.357  1.00 0.00 ? 48 VAL A CG1  11 
ATOM   8239  C CG2  . VAL A 1 48 ? 14.023  8.324   -7.464  1.00 0.00 ? 48 VAL A CG2  11 
ATOM   8240  H H    . VAL A 1 48 ? 14.192  11.399  -5.964  1.00 0.00 ? 48 VAL A H    11 
ATOM   8241  H HA   . VAL A 1 48 ? 15.739  9.510   -4.787  1.00 0.00 ? 48 VAL A HA   11 
ATOM   8242  H HB   . VAL A 1 48 ? 16.048  7.999   -6.911  1.00 0.00 ? 48 VAL A HB   11 
ATOM   8243  H HG11 . VAL A 1 48 ? 15.509  6.391   -5.481  1.00 0.00 ? 48 VAL A HG11 11 
ATOM   8244  H HG12 . VAL A 1 48 ? 13.817  6.886   -5.457  1.00 0.00 ? 48 VAL A HG12 11 
ATOM   8245  H HG13 . VAL A 1 48 ? 14.977  7.659   -4.376  1.00 0.00 ? 48 VAL A HG13 11 
ATOM   8246  H HG21 . VAL A 1 48 ? 13.101  7.971   -7.028  1.00 0.00 ? 48 VAL A HG21 11 
ATOM   8247  H HG22 . VAL A 1 48 ? 14.290  7.693   -8.300  1.00 0.00 ? 48 VAL A HG22 11 
ATOM   8248  H HG23 . VAL A 1 48 ? 13.894  9.340   -7.806  1.00 0.00 ? 48 VAL A HG23 11 
ATOM   8249  N N    . LYS A 1 49 ? 17.346  10.978  -5.907  1.00 0.00 ? 49 LYS A N    11 
ATOM   8250  C CA   . LYS A 1 49 ? 18.432  11.719  -6.537  1.00 0.00 ? 49 LYS A CA   11 
ATOM   8251  C C    . LYS A 1 49 ? 17.896  12.911  -7.325  1.00 0.00 ? 49 LYS A C    11 
ATOM   8252  O O    . LYS A 1 49 ? 16.802  12.857  -7.886  1.00 0.00 ? 49 LYS A O    11 
ATOM   8253  C CB   . LYS A 1 49 ? 19.234  10.801  -7.464  1.00 0.00 ? 49 LYS A CB   11 
ATOM   8254  C CG   . LYS A 1 49 ? 20.475  10.211  -6.812  1.00 0.00 ? 49 LYS A CG   11 
ATOM   8255  C CD   . LYS A 1 49 ? 21.326  9.452   -7.817  1.00 0.00 ? 49 LYS A CD   11 
ATOM   8256  C CE   . LYS A 1 49 ? 22.663  9.044   -7.221  1.00 0.00 ? 49 LYS A CE   11 
ATOM   8257  N NZ   . LYS A 1 49 ? 23.560  8.418   -8.233  1.00 0.00 ? 49 LYS A NZ   11 
ATOM   8258  H H    . LYS A 1 49 ? 17.304  10.918  -4.936  1.00 0.00 ? 49 LYS A H    11 
ATOM   8259  H HA   . LYS A 1 49 ? 19.081  12.082  -5.756  1.00 0.00 ? 49 LYS A HA   11 
ATOM   8260  H HB2  . LYS A 1 49 ? 18.600  9.988   -7.783  1.00 0.00 ? 49 LYS A HB2  11 
ATOM   8261  H HB3  . LYS A 1 49 ? 19.545  11.365  -8.330  1.00 0.00 ? 49 LYS A HB3  11 
ATOM   8262  H HG2  . LYS A 1 49 ? 21.063  11.011  -6.389  1.00 0.00 ? 49 LYS A HG2  11 
ATOM   8263  H HG3  . LYS A 1 49 ? 20.169  9.533   -6.027  1.00 0.00 ? 49 LYS A HG3  11 
ATOM   8264  H HD2  . LYS A 1 49 ? 20.795  8.564   -8.126  1.00 0.00 ? 49 LYS A HD2  11 
ATOM   8265  H HD3  . LYS A 1 49 ? 21.502  10.084  -8.675  1.00 0.00 ? 49 LYS A HD3  11 
ATOM   8266  H HE2  . LYS A 1 49 ? 23.147  9.923   -6.820  1.00 0.00 ? 49 LYS A HE2  11 
ATOM   8267  H HE3  . LYS A 1 49 ? 22.486  8.338   -6.422  1.00 0.00 ? 49 LYS A HE3  11 
ATOM   8268  H HZ1  . LYS A 1 49 ? 23.842  7.466   -7.920  1.00 0.00 ? 49 LYS A HZ1  11 
ATOM   8269  H HZ2  . LYS A 1 49 ? 24.414  8.996   -8.359  1.00 0.00 ? 49 LYS A HZ2  11 
ATOM   8270  H HZ3  . LYS A 1 49 ? 23.069  8.340   -9.147  1.00 0.00 ? 49 LYS A HZ3  11 
HETATM 8271  N N    . CY1 A 1 50 ? 13.784  9.762   -11.675 1.00 0.00 ? 50 CY1 A N    11 
HETATM 8272  C CA   . CY1 A 1 50 ? 13.391  11.088  -12.193 1.00 0.00 ? 50 CY1 A CA   11 
HETATM 8273  C CB   . CY1 A 1 50 ? 13.942  12.226  -11.310 1.00 0.00 ? 50 CY1 A CB   11 
HETATM 8274  S SG   . CY1 A 1 50 ? 12.976  13.761  -11.524 1.00 0.00 ? 50 CY1 A SG   11 
HETATM 8275  C CD   . CY1 A 1 50 ? 14.166  14.867  -12.343 1.00 0.00 ? 50 CY1 A CD   11 
HETATM 8276  N NE   . CY1 A 1 50 ? 13.418  15.970  -12.940 1.00 0.00 ? 50 CY1 A NE   11 
HETATM 8277  C CZ   . CY1 A 1 50 ? 13.287  17.169  -12.355 1.00 0.00 ? 50 CY1 A CZ   11 
HETATM 8278  O OAC  . CY1 A 1 50 ? 13.884  17.442  -11.342 1.00 0.00 ? 50 CY1 A OAC  11 
HETATM 8279  C CM   . CY1 A 1 50 ? 12.339  18.118  -13.033 1.00 0.00 ? 50 CY1 A CM   11 
HETATM 8280  C C    . CY1 A 1 50 ? 13.765  11.290  -13.660 1.00 0.00 ? 50 CY1 A C    11 
HETATM 8281  O O    . CY1 A 1 50 ? 14.763  10.840  -14.173 1.00 0.00 ? 50 CY1 A O    11 
HETATM 8282  H H    . CY1 A 1 50 ? 14.751  9.609   -11.458 1.00 0.00 ? 50 CY1 A H    11 
HETATM 8283  H HA   . CY1 A 1 50 ? 12.299  11.155  -12.160 1.00 0.00 ? 50 CY1 A HA   11 
HETATM 8284  H HB2  . CY1 A 1 50 ? 14.999  12.404  -11.532 1.00 0.00 ? 50 CY1 A HB2  11 
HETATM 8285  H HB3  . CY1 A 1 50 ? 13.853  11.934  -10.260 1.00 0.00 ? 50 CY1 A HB3  11 
HETATM 8286  H HD2  . CY1 A 1 50 ? 14.702  14.331  -13.141 1.00 0.00 ? 50 CY1 A HD2  11 
HETATM 8287  H HD3  . CY1 A 1 50 ? 14.896  15.259  -11.611 1.00 0.00 ? 50 CY1 A HD3  11 
HETATM 8288  H HE   . CY1 A 1 50 ? 12.865  15.782  -13.753 1.00 0.00 ? 50 CY1 A HE   11 
HETATM 8289  H HM1  . CY1 A 1 50 ? 11.491  17.582  -13.462 1.00 0.00 ? 50 CY1 A HM1  11 
HETATM 8290  H HM2  . CY1 A 1 50 ? 12.859  18.655  -13.827 1.00 0.00 ? 50 CY1 A HM2  11 
HETATM 8291  H HM3  . CY1 A 1 50 ? 11.962  18.838  -12.304 1.00 0.00 ? 50 CY1 A HM3  11 
HETATM 8292  N N    . NH2 A 1 51 ? 13.017  12.153  -14.338 1.00 0.00 ? 51 NH2 A N    11 
HETATM 8293  H HN1  . NH2 A 1 51 ? 12.199  12.554  -13.915 1.00 0.00 ? 51 NH2 A HN1  11 
HETATM 8294  H HN2  . NH2 A 1 51 ? 13.241  12.289  -15.307 1.00 0.00 ? 51 NH2 A HN2  11 
ATOM   8295  N N    . LEU A 1 1  ? 1.074   4.404   13.302  1.00 0.00 ? 1  LEU A N    12 
ATOM   8296  C CA   . LEU A 1 1  ? -0.393  4.568   13.133  1.00 0.00 ? 1  LEU A CA   12 
ATOM   8297  C C    . LEU A 1 1  ? -1.044  3.272   12.664  1.00 0.00 ? 1  LEU A C    12 
ATOM   8298  O O    . LEU A 1 1  ? -2.028  2.812   13.245  1.00 0.00 ? 1  LEU A O    12 
ATOM   8299  C CB   . LEU A 1 1  ? -0.647  5.682   12.112  1.00 0.00 ? 1  LEU A CB   12 
ATOM   8300  C CG   . LEU A 1 1  ? -0.422  7.104   12.628  1.00 0.00 ? 1  LEU A CG   12 
ATOM   8301  C CD1  . LEU A 1 1  ? -1.168  7.324   13.936  1.00 0.00 ? 1  LEU A CD1  12 
ATOM   8302  C CD2  . LEU A 1 1  ? 1.064   7.376   12.807  1.00 0.00 ? 1  LEU A CD2  12 
ATOM   8303  H H1   . LEU A 1 1  ? 1.513   4.482   12.363  1.00 0.00 ? 1  LEU A H1   12 
ATOM   8304  H H2   . LEU A 1 1  ? 1.242   3.464   13.718  1.00 0.00 ? 1  LEU A H2   12 
ATOM   8305  H H3   . LEU A 1 1  ? 1.408   5.159   13.934  1.00 0.00 ? 1  LEU A H3   12 
ATOM   8306  H HA   . LEU A 1 1  ? -0.820  4.854   14.083  1.00 0.00 ? 1  LEU A HA   12 
ATOM   8307  H HB2  . LEU A 1 1  ? 0.007   5.520   11.268  1.00 0.00 ? 1  LEU A HB2  12 
ATOM   8308  H HB3  . LEU A 1 1  ? -1.669  5.604   11.774  1.00 0.00 ? 1  LEU A HB3  12 
ATOM   8309  H HG   . LEU A 1 1  ? -0.807  7.807   11.905  1.00 0.00 ? 1  LEU A HG   12 
ATOM   8310  H HD11 . LEU A 1 1  ? -2.051  6.702   13.955  1.00 0.00 ? 1  LEU A HD11 12 
ATOM   8311  H HD12 . LEU A 1 1  ? -1.455  8.361   14.017  1.00 0.00 ? 1  LEU A HD12 12 
ATOM   8312  H HD13 . LEU A 1 1  ? -0.525  7.062   14.764  1.00 0.00 ? 1  LEU A HD13 12 
ATOM   8313  H HD21 . LEU A 1 1  ? 1.287   8.382   12.482  1.00 0.00 ? 1  LEU A HD21 12 
ATOM   8314  H HD22 . LEU A 1 1  ? 1.633   6.673   12.216  1.00 0.00 ? 1  LEU A HD22 12 
ATOM   8315  H HD23 . LEU A 1 1  ? 1.328   7.268   13.848  1.00 0.00 ? 1  LEU A HD23 12 
ATOM   8316  N N    . GLN A 1 2  ? -0.492  2.691   11.606  1.00 0.00 ? 2  GLN A N    12 
ATOM   8317  C CA   . GLN A 1 2  ? -1.019  1.450   11.050  1.00 0.00 ? 2  GLN A CA   12 
ATOM   8318  C C    . GLN A 1 2  ? 0.022   0.337   11.110  1.00 0.00 ? 2  GLN A C    12 
ATOM   8319  O O    . GLN A 1 2  ? 1.209   0.584   10.897  1.00 0.00 ? 2  GLN A O    12 
ATOM   8320  C CB   . GLN A 1 2  ? -1.465  1.671   9.604   1.00 0.00 ? 2  GLN A CB   12 
ATOM   8321  C CG   . GLN A 1 2  ? -2.486  2.788   9.445   1.00 0.00 ? 2  GLN A CG   12 
ATOM   8322  C CD   . GLN A 1 2  ? -3.665  2.642   10.386  1.00 0.00 ? 2  GLN A CD   12 
ATOM   8323  O OE1  . GLN A 1 2  ? -4.112  3.612   10.997  1.00 0.00 ? 2  GLN A OE1  12 
ATOM   8324  N NE2  . GLN A 1 2  ? -4.177  1.422   10.508  1.00 0.00 ? 2  GLN A NE2  12 
ATOM   8325  H H    . GLN A 1 2  ? 0.288   3.109   11.184  1.00 0.00 ? 2  GLN A H    12 
ATOM   8326  H HA   . GLN A 1 2  ? -1.874  1.159   11.641  1.00 0.00 ? 2  GLN A HA   12 
ATOM   8327  H HB2  . GLN A 1 2  ? -0.600  1.917   9.006   1.00 0.00 ? 2  GLN A HB2  12 
ATOM   8328  H HB3  . GLN A 1 2  ? -1.902  0.758   9.230   1.00 0.00 ? 2  GLN A HB3  12 
ATOM   8329  H HG2  . GLN A 1 2  ? -2.000  3.732   9.645   1.00 0.00 ? 2  GLN A HG2  12 
ATOM   8330  H HG3  . GLN A 1 2  ? -2.852  2.780   8.428   1.00 0.00 ? 2  GLN A HG3  12 
ATOM   8331  H HE21 . GLN A 1 2  ? -3.769  0.695   9.991   1.00 0.00 ? 2  GLN A HE21 12 
ATOM   8332  H HE22 . GLN A 1 2  ? -4.941  1.298   11.109  1.00 0.00 ? 2  GLN A HE22 12 
ATOM   8333  N N    . MET A 1 3  ? -0.446  -0.885  11.380  1.00 0.00 ? 3  MET A N    12 
ATOM   8334  C CA   . MET A 1 3  ? 0.413   -2.082  11.463  1.00 0.00 ? 3  MET A CA   12 
ATOM   8335  C C    . MET A 1 3  ? -0.193  -3.140  12.380  1.00 0.00 ? 3  MET A C    12 
ATOM   8336  O O    . MET A 1 3  ? -0.275  -4.312  12.011  1.00 0.00 ? 3  MET A O    12 
ATOM   8337  C CB   . MET A 1 3  ? 1.848   -1.754  11.925  1.00 0.00 ? 3  MET A CB   12 
ATOM   8338  C CG   . MET A 1 3  ? 2.913   -2.029  10.869  1.00 0.00 ? 3  MET A CG   12 
ATOM   8339  S SD   . MET A 1 3  ? 2.504   -1.345  9.249   1.00 0.00 ? 3  MET A SD   12 
ATOM   8340  C CE   . MET A 1 3  ? 3.918   -0.284  8.964   1.00 0.00 ? 3  MET A CE   12 
ATOM   8341  H H    . MET A 1 3  ? -1.414  -0.993  11.512  1.00 0.00 ? 3  MET A H    12 
ATOM   8342  H HA   . MET A 1 3  ? 0.456   -2.501  10.482  1.00 0.00 ? 3  MET A HA   12 
ATOM   8343  H HB2  . MET A 1 3  ? 1.908   -0.713  12.199  1.00 0.00 ? 3  MET A HB2  12 
ATOM   8344  H HB3  . MET A 1 3  ? 2.083   -2.354  12.792  1.00 0.00 ? 3  MET A HB3  12 
ATOM   8345  H HG2  . MET A 1 3  ? 3.845   -1.596  11.198  1.00 0.00 ? 3  MET A HG2  12 
ATOM   8346  H HG3  . MET A 1 3  ? 3.031   -3.099  10.771  1.00 0.00 ? 3  MET A HG3  12 
ATOM   8347  H HE1  . MET A 1 3  ? 4.261   0.119   9.906   1.00 0.00 ? 3  MET A HE1  12 
ATOM   8348  H HE2  . MET A 1 3  ? 3.635   0.526   8.308   1.00 0.00 ? 3  MET A HE2  12 
ATOM   8349  H HE3  . MET A 1 3  ? 4.711   -0.856  8.508   1.00 0.00 ? 3  MET A HE3  12 
ATOM   8350  N N    . ALA A 1 4  ? -0.617  -2.727  13.570  1.00 0.00 ? 4  ALA A N    12 
ATOM   8351  C CA   . ALA A 1 4  ? -1.216  -3.631  14.540  1.00 0.00 ? 4  ALA A CA   12 
ATOM   8352  C C    . ALA A 1 4  ? -2.132  -4.664  13.882  1.00 0.00 ? 4  ALA A C    12 
ATOM   8353  O O    . ALA A 1 4  ? -3.242  -4.343  13.463  1.00 0.00 ? 4  ALA A O    12 
ATOM   8354  C CB   . ALA A 1 4  ? -1.988  -2.810  15.546  1.00 0.00 ? 4  ALA A CB   12 
ATOM   8355  H H    . ALA A 1 4  ? -0.524  -1.782  13.813  1.00 0.00 ? 4  ALA A H    12 
ATOM   8356  H HA   . ALA A 1 4  ? -0.421  -4.141  15.061  1.00 0.00 ? 4  ALA A HA   12 
ATOM   8357  H HB1  . ALA A 1 4  ? -1.400  -2.691  16.441  1.00 0.00 ? 4  ALA A HB1  12 
ATOM   8358  H HB2  . ALA A 1 4  ? -2.917  -3.305  15.781  1.00 0.00 ? 4  ALA A HB2  12 
ATOM   8359  H HB3  . ALA A 1 4  ? -2.192  -1.839  15.116  1.00 0.00 ? 4  ALA A HB3  12 
ATOM   8360  N N    . GLY A 1 5  ? -1.659  -5.904  13.801  1.00 0.00 ? 5  GLY A N    12 
ATOM   8361  C CA   . GLY A 1 5  ? -2.450  -6.966  13.201  1.00 0.00 ? 5  GLY A CA   12 
ATOM   8362  C C    . GLY A 1 5  ? -1.606  -7.985  12.457  1.00 0.00 ? 5  GLY A C    12 
ATOM   8363  O O    . GLY A 1 5  ? -2.097  -9.058  12.103  1.00 0.00 ? 5  GLY A O    12 
ATOM   8364  H H    . GLY A 1 5  ? -0.767  -6.103  14.158  1.00 0.00 ? 5  GLY A H    12 
ATOM   8365  H HA2  . GLY A 1 5  ? -2.999  -7.474  13.983  1.00 0.00 ? 5  GLY A HA2  12 
ATOM   8366  H HA3  . GLY A 1 5  ? -3.157  -6.530  12.505  1.00 0.00 ? 5  GLY A HA3  12 
ATOM   8367  N N    . GLN A 1 6  ? -0.343  -7.645  12.201  1.00 0.00 ? 6  GLN A N    12 
ATOM   8368  C CA   . GLN A 1 6  ? 0.562   -8.529  11.477  1.00 0.00 ? 6  GLN A CA   12 
ATOM   8369  C C    . GLN A 1 6  ? 0.169   -8.572  10.016  1.00 0.00 ? 6  GLN A C    12 
ATOM   8370  O O    . GLN A 1 6  ? -0.292  -9.590  9.499   1.00 0.00 ? 6  GLN A O    12 
ATOM   8371  C CB   . GLN A 1 6  ? 0.575   -9.939  12.080  1.00 0.00 ? 6  GLN A CB   12 
ATOM   8372  C CG   . GLN A 1 6  ? 1.724   -10.178 13.046  1.00 0.00 ? 6  GLN A CG   12 
ATOM   8373  C CD   . GLN A 1 6  ? 1.253   -10.619 14.417  1.00 0.00 ? 6  GLN A CD   12 
ATOM   8374  O OE1  . GLN A 1 6  ? 1.200   -9.822  15.354  1.00 0.00 ? 6  GLN A OE1  12 
ATOM   8375  N NE2  . GLN A 1 6  ? 0.908   -11.895 14.543  1.00 0.00 ? 6  GLN A NE2  12 
ATOM   8376  H H    . GLN A 1 6  ? -0.015  -6.768  12.485  1.00 0.00 ? 6  GLN A H    12 
ATOM   8377  H HA   . GLN A 1 6  ? 1.551   -8.103  11.544  1.00 0.00 ? 6  GLN A HA   12 
ATOM   8378  H HB2  . GLN A 1 6  ? -0.351  -10.104 12.610  1.00 0.00 ? 6  GLN A HB2  12 
ATOM   8379  H HB3  . GLN A 1 6  ? 0.652   -10.660 11.279  1.00 0.00 ? 6  GLN A HB3  12 
ATOM   8380  H HG2  . GLN A 1 6  ? 2.365   -10.945 12.638  1.00 0.00 ? 6  GLN A HG2  12 
ATOM   8381  H HG3  . GLN A 1 6  ? 2.285   -9.260  13.151  1.00 0.00 ? 6  GLN A HG3  12 
ATOM   8382  H HE21 . GLN A 1 6  ? 0.978   -12.473 13.754  1.00 0.00 ? 6  GLN A HE21 12 
ATOM   8383  H HE22 . GLN A 1 6  ? 0.601   -12.208 15.419  1.00 0.00 ? 6  GLN A HE22 12 
ATOM   8384  N N    . CYS A 1 7  ? 0.348   -7.435  9.370   1.00 0.00 ? 7  CYS A N    12 
ATOM   8385  C CA   . CYS A 1 7  ? 0.018   -7.283  7.958   1.00 0.00 ? 7  CYS A CA   12 
ATOM   8386  C C    . CYS A 1 7  ? 0.996   -8.037  7.076   1.00 0.00 ? 7  CYS A C    12 
ATOM   8387  O O    . CYS A 1 7  ? 2.199   -8.053  7.336   1.00 0.00 ? 7  CYS A O    12 
ATOM   8388  C CB   . CYS A 1 7  ? 0.029   -5.804  7.562   1.00 0.00 ? 7  CYS A CB   12 
ATOM   8389  S SG   . CYS A 1 7  ? -1.212  -4.796  8.431   1.00 0.00 ? 7  CYS A SG   12 
ATOM   8390  H H    . CYS A 1 7  ? 0.709   -6.669  9.869   1.00 0.00 ? 7  CYS A H    12 
ATOM   8391  H HA   . CYS A 1 7  ? -0.969  -7.682  7.802   1.00 0.00 ? 7  CYS A HA   12 
ATOM   8392  H HB2  . CYS A 1 7  ? 1.001   -5.389  7.783   1.00 0.00 ? 7  CYS A HB2  12 
ATOM   8393  H HB3  . CYS A 1 7  ? -0.155  -5.718  6.498   1.00 0.00 ? 7  CYS A HB3  12 
ATOM   8394  N N    . SER A 1 8  ? 0.477   -8.640  6.013   1.00 0.00 ? 8  SER A N    12 
ATOM   8395  C CA   . SER A 1 8  ? 1.319   -9.361  5.076   1.00 0.00 ? 8  SER A CA   12 
ATOM   8396  C C    . SER A 1 8  ? 2.321   -8.399  4.464   1.00 0.00 ? 8  SER A C    12 
ATOM   8397  O O    . SER A 1 8  ? 2.102   -7.190  4.447   1.00 0.00 ? 8  SER A O    12 
ATOM   8398  C CB   . SER A 1 8  ? 0.473   -10.017 3.982   1.00 0.00 ? 8  SER A CB   12 
ATOM   8399  O OG   . SER A 1 8  ? -0.624  -10.718 4.539   1.00 0.00 ? 8  SER A OG   12 
ATOM   8400  H H    . SER A 1 8  ? -0.486  -8.576  5.845   1.00 0.00 ? 8  SER A H    12 
ATOM   8401  H HA   . SER A 1 8  ? 1.857   -10.124 5.617   1.00 0.00 ? 8  SER A HA   12 
ATOM   8402  H HB2  . SER A 1 8  ? 0.098   -9.255  3.316   1.00 0.00 ? 8  SER A HB2  12 
ATOM   8403  H HB3  . SER A 1 8  ? 1.085   -10.711 3.426   1.00 0.00 ? 8  SER A HB3  12 
ATOM   8404  H HG   . SER A 1 8  ? -0.300  -11.411 5.118   1.00 0.00 ? 8  SER A HG   12 
ATOM   8405  N N    . GLN A 1 9  ? 3.427   -8.929  3.985   1.00 0.00 ? 9  GLN A N    12 
ATOM   8406  C CA   . GLN A 1 9  ? 4.461   -8.096  3.401   1.00 0.00 ? 9  GLN A CA   12 
ATOM   8407  C C    . GLN A 1 9  ? 3.902   -7.156  2.345   1.00 0.00 ? 9  GLN A C    12 
ATOM   8408  O O    . GLN A 1 9  ? 3.187   -7.566  1.431   1.00 0.00 ? 9  GLN A O    12 
ATOM   8409  C CB   . GLN A 1 9  ? 5.581   -8.957  2.813   1.00 0.00 ? 9  GLN A CB   12 
ATOM   8410  C CG   . GLN A 1 9  ? 6.943   -8.690  3.432   1.00 0.00 ? 9  GLN A CG   12 
ATOM   8411  C CD   . GLN A 1 9  ? 7.100   -9.335  4.795   1.00 0.00 ? 9  GLN A CD   12 
ATOM   8412  O OE1  . GLN A 1 9  ? 6.144   -9.430  5.564   1.00 0.00 ? 9  GLN A OE1  12 
ATOM   8413  N NE2  . GLN A 1 9  ? 8.312   -9.783  5.100   1.00 0.00 ? 9  GLN A NE2  12 
ATOM   8414  H H    . GLN A 1 9  ? 3.562   -9.892  4.044   1.00 0.00 ? 9  GLN A H    12 
ATOM   8415  H HA   . GLN A 1 9  ? 4.859   -7.491  4.195   1.00 0.00 ? 9  GLN A HA   12 
ATOM   8416  H HB2  . GLN A 1 9  ? 5.338   -9.998  2.970   1.00 0.00 ? 9  GLN A HB2  12 
ATOM   8417  H HB3  . GLN A 1 9  ? 5.648   -8.769  1.752   1.00 0.00 ? 9  GLN A HB3  12 
ATOM   8418  H HG2  . GLN A 1 9  ? 7.706   -9.081  2.776   1.00 0.00 ? 9  GLN A HG2  12 
ATOM   8419  H HG3  . GLN A 1 9  ? 7.072   -7.623  3.538   1.00 0.00 ? 9  GLN A HG3  12 
ATOM   8420  H HE21 . GLN A 1 9  ? 9.027   -9.675  4.438   1.00 0.00 ? 9  GLN A HE21 12 
ATOM   8421  H HE22 . GLN A 1 9  ? 8.444   -10.205 5.975   1.00 0.00 ? 9  GLN A HE22 12 
ATOM   8422  N N    . ASN A 1 10 ? 4.246   -5.884  2.495   1.00 0.00 ? 10 ASN A N    12 
ATOM   8423  C CA   . ASN A 1 10 ? 3.809   -4.843  1.583   1.00 0.00 ? 10 ASN A CA   12 
ATOM   8424  C C    . ASN A 1 10 ? 2.305   -4.645  1.637   1.00 0.00 ? 10 ASN A C    12 
ATOM   8425  O O    . ASN A 1 10 ? 1.688   -4.233  0.653   1.00 0.00 ? 10 ASN A O    12 
ATOM   8426  C CB   . ASN A 1 10 ? 4.254   -5.150  0.153   1.00 0.00 ? 10 ASN A CB   12 
ATOM   8427  C CG   . ASN A 1 10 ? 5.682   -4.714  -0.112  1.00 0.00 ? 10 ASN A CG   12 
ATOM   8428  O OD1  . ASN A 1 10 ? 6.507   -5.499  -0.580  1.00 0.00 ? 10 ASN A OD1  12 
ATOM   8429  N ND2  . ASN A 1 10 ? 5.981   -3.454  0.187   1.00 0.00 ? 10 ASN A ND2  12 
ATOM   8430  H H    . ASN A 1 10 ? 4.819   -5.638  3.251   1.00 0.00 ? 10 ASN A H    12 
ATOM   8431  H HA   . ASN A 1 10 ? 4.271   -3.929  1.906   1.00 0.00 ? 10 ASN A HA   12 
ATOM   8432  H HB2  . ASN A 1 10 ? 4.186   -6.213  -0.019  1.00 0.00 ? 10 ASN A HB2  12 
ATOM   8433  H HB3  . ASN A 1 10 ? 3.605   -4.634  -0.538  1.00 0.00 ? 10 ASN A HB3  12 
ATOM   8434  H HD21 . ASN A 1 10 ? 5.273   -2.885  0.555   1.00 0.00 ? 10 ASN A HD21 12 
ATOM   8435  H HD22 . ASN A 1 10 ? 6.898   -3.146  0.028   1.00 0.00 ? 10 ASN A HD22 12 
ATOM   8436  N N    . GLU A 1 11 ? 1.719   -4.916  2.792   1.00 0.00 ? 11 GLU A N    12 
ATOM   8437  C CA   . GLU A 1 11 ? 0.280   -4.729  2.949   1.00 0.00 ? 11 GLU A CA   12 
ATOM   8438  C C    . GLU A 1 11 ? -0.019  -3.479  3.749   1.00 0.00 ? 11 GLU A C    12 
ATOM   8439  O O    . GLU A 1 11 ? 0.737   -3.114  4.648   1.00 0.00 ? 11 GLU A O    12 
ATOM   8440  C CB   . GLU A 1 11 ? -0.386  -5.955  3.572   1.00 0.00 ? 11 GLU A CB   12 
ATOM   8441  C CG   . GLU A 1 11 ? -1.552  -6.478  2.751   1.00 0.00 ? 11 GLU A CG   12 
ATOM   8442  C CD   . GLU A 1 11 ? -1.962  -7.885  3.141   1.00 0.00 ? 11 GLU A CD   12 
ATOM   8443  O OE1  . GLU A 1 11 ? -2.401  -8.078  4.293   1.00 0.00 ? 11 GLU A OE1  12 
ATOM   8444  O OE2  . GLU A 1 11 ? -1.841  -8.793  2.293   1.00 0.00 ? 11 GLU A OE2  12 
ATOM   8445  H H    . GLU A 1 11 ? 2.269   -5.232  3.554   1.00 0.00 ? 11 GLU A H    12 
ATOM   8446  H HA   . GLU A 1 11 ? -0.123  -4.576  1.977   1.00 0.00 ? 11 GLU A HA   12 
ATOM   8447  H HB2  . GLU A 1 11 ? 0.343   -6.742  3.660   1.00 0.00 ? 11 GLU A HB2  12 
ATOM   8448  H HB3  . GLU A 1 11 ? -0.749  -5.698  4.555   1.00 0.00 ? 11 GLU A HB3  12 
ATOM   8449  H HG2  . GLU A 1 11 ? -2.397  -5.822  2.892   1.00 0.00 ? 11 GLU A HG2  12 
ATOM   8450  H HG3  . GLU A 1 11 ? -1.269  -6.476  1.707   1.00 0.00 ? 11 GLU A HG3  12 
ATOM   8451  N N    . TYR A 1 12 ? -1.127  -2.809  3.415   1.00 0.00 ? 12 TYR A N    12 
ATOM   8452  C CA   . TYR A 1 12 ? -1.484  -1.581  4.126   1.00 0.00 ? 12 TYR A CA   12 
ATOM   8453  C C    . TYR A 1 12 ? -2.757  -1.760  4.932   1.00 0.00 ? 12 TYR A C    12 
ATOM   8454  O O    . TYR A 1 12 ? -3.805  -2.127  4.404   1.00 0.00 ? 12 TYR A O    12 
ATOM   8455  C CB   . TYR A 1 12 ? -1.567  -0.379  3.169   1.00 0.00 ? 12 TYR A CB   12 
ATOM   8456  C CG   . TYR A 1 12 ? -2.958  0.178   2.907   1.00 0.00 ? 12 TYR A CG   12 
ATOM   8457  C CD1  . TYR A 1 12 ? -3.882  -0.534  2.153   1.00 0.00 ? 12 TYR A CD1  12 
ATOM   8458  C CD2  . TYR A 1 12 ? -3.345  1.419   3.416   1.00 0.00 ? 12 TYR A CD2  12 
ATOM   8459  C CE1  . TYR A 1 12 ? -5.145  -0.031  1.909   1.00 0.00 ? 12 TYR A CE1  12 
ATOM   8460  C CE2  . TYR A 1 12 ? -4.611  1.920   3.178   1.00 0.00 ? 12 TYR A CE2  12 
ATOM   8461  C CZ   . TYR A 1 12 ? -5.504  1.194   2.424   1.00 0.00 ? 12 TYR A CZ   12 
ATOM   8462  O OH   . TYR A 1 12 ? -6.762  1.693   2.185   1.00 0.00 ? 12 TYR A OH   12 
ATOM   8463  H H    . TYR A 1 12 ? -1.712  -3.149  2.677   1.00 0.00 ? 12 TYR A H    12 
ATOM   8464  H HA   . TYR A 1 12 ? -0.683  -1.385  4.831   1.00 0.00 ? 12 TYR A HA   12 
ATOM   8465  H HB2  . TYR A 1 12 ? -0.983  0.417   3.594   1.00 0.00 ? 12 TYR A HB2  12 
ATOM   8466  H HB3  . TYR A 1 12 ? -1.137  -0.660  2.219   1.00 0.00 ? 12 TYR A HB3  12 
ATOM   8467  H HD1  . TYR A 1 12 ? -3.599  -1.490  1.747   1.00 0.00 ? 12 TYR A HD1  12 
ATOM   8468  H HD2  . TYR A 1 12 ? -2.637  2.001   3.996   1.00 0.00 ? 12 TYR A HD2  12 
ATOM   8469  H HE1  . TYR A 1 12 ? -5.844  -0.596  1.313   1.00 0.00 ? 12 TYR A HE1  12 
ATOM   8470  H HE2  . TYR A 1 12 ? -4.894  2.881   3.581   1.00 0.00 ? 12 TYR A HE2  12 
ATOM   8471  H HH   . TYR A 1 12 ? -6.989  1.559   1.262   1.00 0.00 ? 12 TYR A HH   12 
ATOM   8472  N N    . PHE A 1 13 ? -2.632  -1.502  6.223   1.00 0.00 ? 13 PHE A N    12 
ATOM   8473  C CA   . PHE A 1 13 ? -3.743  -1.628  7.156   1.00 0.00 ? 13 PHE A CA   12 
ATOM   8474  C C    . PHE A 1 13 ? -4.624  -0.393  7.111   1.00 0.00 ? 13 PHE A C    12 
ATOM   8475  O O    . PHE A 1 13 ? -4.294  0.635   7.701   1.00 0.00 ? 13 PHE A O    12 
ATOM   8476  C CB   . PHE A 1 13 ? -3.210  -1.824  8.582   1.00 0.00 ? 13 PHE A CB   12 
ATOM   8477  C CG   . PHE A 1 13 ? -4.229  -2.332  9.569   1.00 0.00 ? 13 PHE A CG   12 
ATOM   8478  C CD1  . PHE A 1 13 ? -5.437  -1.677  9.748   1.00 0.00 ? 13 PHE A CD1  12 
ATOM   8479  C CD2  . PHE A 1 13 ? -3.972  -3.466  10.324  1.00 0.00 ? 13 PHE A CD2  12 
ATOM   8480  C CE1  . PHE A 1 13 ? -6.366  -2.143  10.656  1.00 0.00 ? 13 PHE A CE1  12 
ATOM   8481  C CE2  . PHE A 1 13 ? -4.899  -3.935  11.234  1.00 0.00 ? 13 PHE A CE2  12 
ATOM   8482  C CZ   . PHE A 1 13 ? -6.097  -3.273  11.399  1.00 0.00 ? 13 PHE A CZ   12 
ATOM   8483  H H    . PHE A 1 13 ? -1.756  -1.218  6.558   1.00 0.00 ? 13 PHE A H    12 
ATOM   8484  H HA   . PHE A 1 13 ? -4.326  -2.494  6.869   1.00 0.00 ? 13 PHE A HA   12 
ATOM   8485  H HB2  . PHE A 1 13 ? -2.397  -2.528  8.557   1.00 0.00 ? 13 PHE A HB2  12 
ATOM   8486  H HB3  . PHE A 1 13 ? -2.842  -0.877  8.947   1.00 0.00 ? 13 PHE A HB3  12 
ATOM   8487  H HD1  . PHE A 1 13 ? -5.653  -0.793  9.171   1.00 0.00 ? 13 PHE A HD1  12 
ATOM   8488  H HD2  . PHE A 1 13 ? -3.033  -3.986  10.200  1.00 0.00 ? 13 PHE A HD2  12 
ATOM   8489  H HE1  . PHE A 1 13 ? -7.304  -1.622  10.786  1.00 0.00 ? 13 PHE A HE1  12 
ATOM   8490  H HE2  . PHE A 1 13 ? -4.686  -4.819  11.815  1.00 0.00 ? 13 PHE A HE2  12 
ATOM   8491  H HZ   . PHE A 1 13 ? -6.823  -3.638  12.110  1.00 0.00 ? 13 PHE A HZ   12 
ATOM   8492  N N    . ASP A 1 14 ? -5.751  -0.497  6.426   1.00 0.00 ? 14 ASP A N    12 
ATOM   8493  C CA   . ASP A 1 14 ? -6.675  0.627   6.338   1.00 0.00 ? 14 ASP A CA   12 
ATOM   8494  C C    . ASP A 1 14 ? -7.540  0.690   7.584   1.00 0.00 ? 14 ASP A C    12 
ATOM   8495  O O    . ASP A 1 14 ? -8.533  -0.021  7.695   1.00 0.00 ? 14 ASP A O    12 
ATOM   8496  C CB   . ASP A 1 14 ? -7.554  0.515   5.093   1.00 0.00 ? 14 ASP A CB   12 
ATOM   8497  C CG   . ASP A 1 14 ? -8.388  1.760   4.863   1.00 0.00 ? 14 ASP A CG   12 
ATOM   8498  O OD1  . ASP A 1 14 ? -8.759  2.418   5.858   1.00 0.00 ? 14 ASP A OD1  12 
ATOM   8499  O OD2  . ASP A 1 14 ? -8.671  2.079   3.689   1.00 0.00 ? 14 ASP A OD2  12 
ATOM   8500  H H    . ASP A 1 14 ? -5.973  -1.351  5.984   1.00 0.00 ? 14 ASP A H    12 
ATOM   8501  H HA   . ASP A 1 14 ? -6.096  1.536   6.277   1.00 0.00 ? 14 ASP A HA   12 
ATOM   8502  H HB2  . ASP A 1 14 ? -6.926  0.361   4.229   1.00 0.00 ? 14 ASP A HB2  12 
ATOM   8503  H HB3  . ASP A 1 14 ? -8.218  -0.326  5.205   1.00 0.00 ? 14 ASP A HB3  12 
ATOM   8504  N N    . SER A 1 15 ? -7.158  1.549   8.522   1.00 0.00 ? 15 SER A N    12 
ATOM   8505  C CA   . SER A 1 15 ? -7.902  1.706   9.766   1.00 0.00 ? 15 SER A CA   12 
ATOM   8506  C C    . SER A 1 15 ? -9.392  1.877   9.492   1.00 0.00 ? 15 SER A C    12 
ATOM   8507  O O    . SER A 1 15 ? -10.229 1.577   10.343  1.00 0.00 ? 15 SER A O    12 
ATOM   8508  C CB   . SER A 1 15 ? -7.373  2.905   10.552  1.00 0.00 ? 15 SER A CB   12 
ATOM   8509  O OG   . SER A 1 15 ? -7.671  4.121   9.888   1.00 0.00 ? 15 SER A OG   12 
ATOM   8510  H H    . SER A 1 15 ? -6.357  2.092   8.375   1.00 0.00 ? 15 SER A H    12 
ATOM   8511  H HA   . SER A 1 15 ? -7.757  0.808   10.351  1.00 0.00 ? 15 SER A HA   12 
ATOM   8512  H HB2  . SER A 1 15 ? -7.831  2.924   11.531  1.00 0.00 ? 15 SER A HB2  12 
ATOM   8513  H HB3  . SER A 1 15 ? -6.302  2.820   10.657  1.00 0.00 ? 15 SER A HB3  12 
ATOM   8514  H HG   . SER A 1 15 ? -8.613  4.300   9.953   1.00 0.00 ? 15 SER A HG   12 
ATOM   8515  N N    . LEU A 1 16 ? -9.716  2.352   8.295   1.00 0.00 ? 16 LEU A N    12 
ATOM   8516  C CA   . LEU A 1 16 ? -11.106 2.551   7.908   1.00 0.00 ? 16 LEU A CA   12 
ATOM   8517  C C    . LEU A 1 16 ? -11.734 1.232   7.472   1.00 0.00 ? 16 LEU A C    12 
ATOM   8518  O O    . LEU A 1 16 ? -12.944 1.038   7.587   1.00 0.00 ? 16 LEU A O    12 
ATOM   8519  C CB   . LEU A 1 16 ? -11.197 3.575   6.774   1.00 0.00 ? 16 LEU A CB   12 
ATOM   8520  C CG   . LEU A 1 16 ? -12.442 4.463   6.802   1.00 0.00 ? 16 LEU A CG   12 
ATOM   8521  C CD1  . LEU A 1 16 ? -13.690 3.636   6.533   1.00 0.00 ? 16 LEU A CD1  12 
ATOM   8522  C CD2  . LEU A 1 16 ? -12.552 5.187   8.137   1.00 0.00 ? 16 LEU A CD2  12 
ATOM   8523  H H    . LEU A 1 16 ? -9.004  2.564   7.651   1.00 0.00 ? 16 LEU A H    12 
ATOM   8524  H HA   . LEU A 1 16 ? -11.641 2.927   8.767   1.00 0.00 ? 16 LEU A HA   12 
ATOM   8525  H HB2  . LEU A 1 16 ? -10.325 4.211   6.823   1.00 0.00 ? 16 LEU A HB2  12 
ATOM   8526  H HB3  . LEU A 1 16 ? -11.182 3.044   5.835   1.00 0.00 ? 16 LEU A HB3  12 
ATOM   8527  H HG   . LEU A 1 16 ? -12.362 5.207   6.023   1.00 0.00 ? 16 LEU A HG   12 
ATOM   8528  H HD11 . LEU A 1 16 ? -14.365 4.197   5.904   1.00 0.00 ? 16 LEU A HD11 12 
ATOM   8529  H HD12 . LEU A 1 16 ? -14.177 3.406   7.470   1.00 0.00 ? 16 LEU A HD12 12 
ATOM   8530  H HD13 . LEU A 1 16 ? -13.414 2.719   6.037   1.00 0.00 ? 16 LEU A HD13 12 
ATOM   8531  H HD21 . LEU A 1 16 ? -13.427 4.838   8.666   1.00 0.00 ? 16 LEU A HD21 12 
ATOM   8532  H HD22 . LEU A 1 16 ? -12.636 6.250   7.964   1.00 0.00 ? 16 LEU A HD22 12 
ATOM   8533  H HD23 . LEU A 1 16 ? -11.670 4.989   8.729   1.00 0.00 ? 16 LEU A HD23 12 
ATOM   8534  N N    . LEU A 1 17 ? -10.899 0.329   6.966   1.00 0.00 ? 17 LEU A N    12 
ATOM   8535  C CA   . LEU A 1 17 ? -11.358 -0.973  6.501   1.00 0.00 ? 17 LEU A CA   12 
ATOM   8536  C C    . LEU A 1 17 ? -11.091 -2.069  7.533   1.00 0.00 ? 17 LEU A C    12 
ATOM   8537  O O    . LEU A 1 17 ? -11.754 -3.106  7.524   1.00 0.00 ? 17 LEU A O    12 
ATOM   8538  C CB   . LEU A 1 17 ? -10.652 -1.328  5.194   1.00 0.00 ? 17 LEU A CB   12 
ATOM   8539  C CG   . LEU A 1 17 ? -10.813 -0.302  4.071   1.00 0.00 ? 17 LEU A CG   12 
ATOM   8540  C CD1  . LEU A 1 17 ? -9.852  -0.603  2.930   1.00 0.00 ? 17 LEU A CD1  12 
ATOM   8541  C CD2  . LEU A 1 17 ? -12.249 -0.280  3.570   1.00 0.00 ? 17 LEU A CD2  12 
ATOM   8542  H H    . LEU A 1 17 ? -9.945  0.546   6.896   1.00 0.00 ? 17 LEU A H    12 
ATOM   8543  H HA   . LEU A 1 17 ? -12.421 -0.911  6.320   1.00 0.00 ? 17 LEU A HA   12 
ATOM   8544  H HB2  . LEU A 1 17 ? -9.597  -1.440  5.404   1.00 0.00 ? 17 LEU A HB2  12 
ATOM   8545  H HB3  . LEU A 1 17 ? -11.038 -2.275  4.846   1.00 0.00 ? 17 LEU A HB3  12 
ATOM   8546  H HG   . LEU A 1 17 ? -10.577 0.681   4.456   1.00 0.00 ? 17 LEU A HG   12 
ATOM   8547  H HD11 . LEU A 1 17 ? -9.444  0.322   2.550   1.00 0.00 ? 17 LEU A HD11 12 
ATOM   8548  H HD12 . LEU A 1 17 ? -10.381 -1.114  2.140   1.00 0.00 ? 17 LEU A HD12 12 
ATOM   8549  H HD13 . LEU A 1 17 ? -9.049  -1.229  3.290   1.00 0.00 ? 17 LEU A HD13 12 
ATOM   8550  H HD21 . LEU A 1 17 ? -12.785 0.526   4.050   1.00 0.00 ? 17 LEU A HD21 12 
ATOM   8551  H HD22 . LEU A 1 17 ? -12.727 -1.220  3.803   1.00 0.00 ? 17 LEU A HD22 12 
ATOM   8552  H HD23 . LEU A 1 17 ? -12.256 -0.128  2.501   1.00 0.00 ? 17 LEU A HD23 12 
ATOM   8553  N N    . HIS A 1 18 ? -10.105 -1.850  8.404   1.00 0.00 ? 18 HIS A N    12 
ATOM   8554  C CA   . HIS A 1 18 ? -9.750  -2.842  9.414   1.00 0.00 ? 18 HIS A CA   12 
ATOM   8555  C C    . HIS A 1 18 ? -9.253  -4.108  8.735   1.00 0.00 ? 18 HIS A C    12 
ATOM   8556  O O    . HIS A 1 18 ? -9.745  -5.209  8.986   1.00 0.00 ? 18 HIS A O    12 
ATOM   8557  C CB   . HIS A 1 18 ? -10.945 -3.164  10.298  1.00 0.00 ? 18 HIS A CB   12 
ATOM   8558  C CG   . HIS A 1 18 ? -11.434 -1.996  11.099  1.00 0.00 ? 18 HIS A CG   12 
ATOM   8559  N ND1  . HIS A 1 18 ? -12.482 -1.194  10.699  1.00 0.00 ? 18 HIS A ND1  12 
ATOM   8560  C CD2  . HIS A 1 18 ? -11.011 -1.495  12.285  1.00 0.00 ? 18 HIS A CD2  12 
ATOM   8561  C CE1  . HIS A 1 18 ? -12.681 -0.250  11.602  1.00 0.00 ? 18 HIS A CE1  12 
ATOM   8562  N NE2  . HIS A 1 18 ? -11.802 -0.412  12.575  1.00 0.00 ? 18 HIS A NE2  12 
ATOM   8563  H H    . HIS A 1 18 ? -9.594  -1.015  8.354   1.00 0.00 ? 18 HIS A H    12 
ATOM   8564  H HA   . HIS A 1 18 ? -8.956  -2.432  10.020  1.00 0.00 ? 18 HIS A HA   12 
ATOM   8565  H HB2  . HIS A 1 18 ? -11.754 -3.506  9.675   1.00 0.00 ? 18 HIS A HB2  12 
ATOM   8566  H HB3  . HIS A 1 18 ? -10.667 -3.948  10.982  1.00 0.00 ? 18 HIS A HB3  12 
ATOM   8567  H HD1  . HIS A 1 18 ? -13.001 -1.299  9.875   1.00 0.00 ? 18 HIS A HD1  12 
ATOM   8568  H HD2  . HIS A 1 18 ? -10.201 -1.878  12.890  1.00 0.00 ? 18 HIS A HD2  12 
ATOM   8569  H HE1  . HIS A 1 18 ? -13.436 0.521   11.555  1.00 0.00 ? 18 HIS A HE1  12 
ATOM   8570  H HE2  . HIS A 1 18 ? -11.663 0.213   13.317  1.00 0.00 ? 18 HIS A HE2  12 
ATOM   8571  N N    . ALA A 1 19 ? -8.274  -3.927  7.869   1.00 0.00 ? 19 ALA A N    12 
ATOM   8572  C CA   . ALA A 1 19 ? -7.689  -5.004  7.119   1.00 0.00 ? 19 ALA A CA   12 
ATOM   8573  C C    . ALA A 1 19 ? -6.434  -4.533  6.427   1.00 0.00 ? 19 ALA A C    12 
ATOM   8574  O O    . ALA A 1 19 ? -6.358  -3.409  5.930   1.00 0.00 ? 19 ALA A O    12 
ATOM   8575  C CB   . ALA A 1 19 ? -8.660  -5.519  6.072   1.00 0.00 ? 19 ALA A CB   12 
ATOM   8576  H H    . ALA A 1 19 ? -7.935  -3.034  7.728   1.00 0.00 ? 19 ALA A H    12 
ATOM   8577  H HA   . ALA A 1 19 ? -7.454  -5.810  7.791   1.00 0.00 ? 19 ALA A HA   12 
ATOM   8578  H HB1  . ALA A 1 19 ? -8.185  -5.473  5.096   1.00 0.00 ? 19 ALA A HB1  12 
ATOM   8579  H HB2  . ALA A 1 19 ? -9.547  -4.905  6.069   1.00 0.00 ? 19 ALA A HB2  12 
ATOM   8580  H HB3  . ALA A 1 19 ? -8.925  -6.540  6.295   1.00 0.00 ? 19 ALA A HB3  12 
ATOM   8581  N N    . CYS A 1 20 ? -5.475  -5.414  6.369   1.00 0.00 ? 20 CYS A N    12 
ATOM   8582  C CA   . CYS A 1 20 ? -4.232  -5.121  5.690   1.00 0.00 ? 20 CYS A CA   12 
ATOM   8583  C C    . CYS A 1 20 ? -4.388  -5.452  4.209   1.00 0.00 ? 20 CYS A C    12 
ATOM   8584  O O    . CYS A 1 20 ? -4.527  -6.614  3.826   1.00 0.00 ? 20 CYS A O    12 
ATOM   8585  C CB   . CYS A 1 20 ? -3.066  -5.901  6.301   1.00 0.00 ? 20 CYS A CB   12 
ATOM   8586  S SG   . CYS A 1 20 ? -2.956  -5.785  8.116   1.00 0.00 ? 20 CYS A SG   12 
ATOM   8587  H H    . CYS A 1 20 ? -5.622  -6.284  6.769   1.00 0.00 ? 20 CYS A H    12 
ATOM   8588  H HA   . CYS A 1 20 ? -4.059  -4.059  5.790   1.00 0.00 ? 20 CYS A HA   12 
ATOM   8589  H HB2  . CYS A 1 20 ? -3.168  -6.945  6.047   1.00 0.00 ? 20 CYS A HB2  12 
ATOM   8590  H HB3  . CYS A 1 20 ? -2.140  -5.527  5.892   1.00 0.00 ? 20 CYS A HB3  12 
ATOM   8591  N N    . ILE A 1 21 ? -4.405  -4.410  3.393   1.00 0.00 ? 21 ILE A N    12 
ATOM   8592  C CA   . ILE A 1 21 ? -4.590  -4.547  1.949   1.00 0.00 ? 21 ILE A CA   12 
ATOM   8593  C C    . ILE A 1 21 ? -3.320  -4.222  1.179   1.00 0.00 ? 21 ILE A C    12 
ATOM   8594  O O    . ILE A 1 21 ? -2.576  -3.324  1.552   1.00 0.00 ? 21 ILE A O    12 
ATOM   8595  C CB   . ILE A 1 21 ? -5.697  -3.582  1.480   1.00 0.00 ? 21 ILE A CB   12 
ATOM   8596  C CG1  . ILE A 1 21 ? -7.062  -4.048  1.984   1.00 0.00 ? 21 ILE A CG1  12 
ATOM   8597  C CG2  . ILE A 1 21 ? -5.725  -3.424  -0.040  1.00 0.00 ? 21 ILE A CG2  12 
ATOM   8598  C CD1  . ILE A 1 21 ? -7.236  -3.906  3.474   1.00 0.00 ? 21 ILE A CD1  12 
ATOM   8599  H H    . ILE A 1 21 ? -4.317  -3.515  3.779   1.00 0.00 ? 21 ILE A H    12 
ATOM   8600  H HA   . ILE A 1 21 ? -4.898  -5.556  1.734   1.00 0.00 ? 21 ILE A HA   12 
ATOM   8601  H HB   . ILE A 1 21 ? -5.470  -2.621  1.912   1.00 0.00 ? 21 ILE A HB   12 
ATOM   8602  H HG12 . ILE A 1 21 ? -7.833  -3.465  1.503   1.00 0.00 ? 21 ILE A HG12 12 
ATOM   8603  H HG13 . ILE A 1 21 ? -7.194  -5.090  1.731   1.00 0.00 ? 21 ILE A HG13 12 
ATOM   8604  H HG21 . ILE A 1 21 ? -6.239  -2.507  -0.292  1.00 0.00 ? 21 ILE A HG21 12 
ATOM   8605  H HG22 . ILE A 1 21 ? -6.249  -4.257  -0.479  1.00 0.00 ? 21 ILE A HG22 12 
ATOM   8606  H HG23 . ILE A 1 21 ? -4.719  -3.385  -0.425  1.00 0.00 ? 21 ILE A HG23 12 
ATOM   8607  H HD11 . ILE A 1 21 ? -6.796  -2.976  3.801   1.00 0.00 ? 21 ILE A HD11 12 
ATOM   8608  H HD12 . ILE A 1 21 ? -6.749  -4.730  3.973   1.00 0.00 ? 21 ILE A HD12 12 
ATOM   8609  H HD13 . ILE A 1 21 ? -8.289  -3.910  3.717   1.00 0.00 ? 21 ILE A HD13 12 
ATOM   8610  N N    . PRO A 1 22 ? -3.067  -4.923  0.067   1.00 0.00 ? 22 PRO A N    12 
ATOM   8611  C CA   . PRO A 1 22 ? -1.890  -4.656  -0.752  1.00 0.00 ? 22 PRO A CA   12 
ATOM   8612  C C    . PRO A 1 22 ? -1.845  -3.204  -1.218  1.00 0.00 ? 22 PRO A C    12 
ATOM   8613  O O    . PRO A 1 22 ? -2.860  -2.642  -1.628  1.00 0.00 ? 22 PRO A O    12 
ATOM   8614  C CB   . PRO A 1 22 ? -2.041  -5.608  -1.947  1.00 0.00 ? 22 PRO A CB   12 
ATOM   8615  C CG   . PRO A 1 22 ? -3.477  -6.014  -1.940  1.00 0.00 ? 22 PRO A CG   12 
ATOM   8616  C CD   . PRO A 1 22 ? -3.898  -5.999  -0.495  1.00 0.00 ? 22 PRO A CD   12 
ATOM   8617  H HA   . PRO A 1 22 ? -0.991  -4.882  -0.210  1.00 0.00 ? 22 PRO A HA   12 
ATOM   8618  H HB2  . PRO A 1 22 ? -1.781  -5.089  -2.857  1.00 0.00 ? 22 PRO A HB2  12 
ATOM   8619  H HB3  . PRO A 1 22 ? -1.391  -6.461  -1.815  1.00 0.00 ? 22 PRO A HB3  12 
ATOM   8620  H HG2  . PRO A 1 22 ? -4.059  -5.305  -2.513  1.00 0.00 ? 22 PRO A HG2  12 
ATOM   8621  H HG3  . PRO A 1 22 ? -3.579  -7.008  -2.355  1.00 0.00 ? 22 PRO A HG3  12 
ATOM   8622  H HD2  . PRO A 1 22 ? -4.949  -5.771  -0.402  1.00 0.00 ? 22 PRO A HD2  12 
ATOM   8623  H HD3  . PRO A 1 22 ? -3.672  -6.944  -0.022  1.00 0.00 ? 22 PRO A HD3  12 
ATOM   8624  N N    . CYS A 1 23 ? -0.665  -2.598  -1.138  1.00 0.00 ? 23 CYS A N    12 
ATOM   8625  C CA   . CYS A 1 23 ? -0.491  -1.202  -1.536  1.00 0.00 ? 23 CYS A CA   12 
ATOM   8626  C C    . CYS A 1 23 ? -0.545  -1.037  -3.053  1.00 0.00 ? 23 CYS A C    12 
ATOM   8627  O O    . CYS A 1 23 ? -0.911  0.025   -3.553  1.00 0.00 ? 23 CYS A O    12 
ATOM   8628  C CB   . CYS A 1 23 ? 0.836   -0.641  -1.006  1.00 0.00 ? 23 CYS A CB   12 
ATOM   8629  S SG   . CYS A 1 23 ? 1.350   -1.307  0.613   1.00 0.00 ? 23 CYS A SG   12 
ATOM   8630  H H    . CYS A 1 23 ? 0.104   -3.101  -0.794  1.00 0.00 ? 23 CYS A H    12 
ATOM   8631  H HA   . CYS A 1 23 ? -1.305  -0.637  -1.100  1.00 0.00 ? 23 CYS A HA   12 
ATOM   8632  H HB2  . CYS A 1 23 ? 1.621   -0.861  -1.715  1.00 0.00 ? 23 CYS A HB2  12 
ATOM   8633  H HB3  . CYS A 1 23 ? 0.745   0.432   -0.905  1.00 0.00 ? 23 CYS A HB3  12 
ATOM   8634  N N    . GLN A 1 24 ? -0.175  -2.084  -3.783  1.00 0.00 ? 24 GLN A N    12 
ATOM   8635  C CA   . GLN A 1 24 ? -0.184  -2.029  -5.246  1.00 0.00 ? 24 GLN A CA   12 
ATOM   8636  C C    . GLN A 1 24 ? -1.600  -1.877  -5.770  1.00 0.00 ? 24 GLN A C    12 
ATOM   8637  O O    . GLN A 1 24 ? -1.886  -1.010  -6.595  1.00 0.00 ? 24 GLN A O    12 
ATOM   8638  C CB   . GLN A 1 24 ? 0.459   -3.282  -5.857  1.00 0.00 ? 24 GLN A CB   12 
ATOM   8639  C CG   . GLN A 1 24 ? 1.475   -3.966  -4.957  1.00 0.00 ? 24 GLN A CG   12 
ATOM   8640  C CD   . GLN A 1 24 ? 2.344   -4.956  -5.707  1.00 0.00 ? 24 GLN A CD   12 
ATOM   8641  O OE1  . GLN A 1 24 ? 2.102   -6.164  -5.671  1.00 0.00 ? 24 GLN A OE1  12 
ATOM   8642  N NE2  . GLN A 1 24 ? 3.364   -4.450  -6.391  1.00 0.00 ? 24 GLN A NE2  12 
ATOM   8643  H H    . GLN A 1 24 ? 0.109   -2.905  -3.332  1.00 0.00 ? 24 GLN A H    12 
ATOM   8644  H HA   . GLN A 1 24 ? 0.380   -1.165  -5.541  1.00 0.00 ? 24 GLN A HA   12 
ATOM   8645  H HB2  . GLN A 1 24 ? -0.320  -3.993  -6.085  1.00 0.00 ? 24 GLN A HB2  12 
ATOM   8646  H HB3  . GLN A 1 24 ? 0.956   -3.002  -6.775  1.00 0.00 ? 24 GLN A HB3  12 
ATOM   8647  H HG2  . GLN A 1 24 ? 2.111   -3.214  -4.515  1.00 0.00 ? 24 GLN A HG2  12 
ATOM   8648  H HG3  . GLN A 1 24 ? 0.945   -4.491  -4.177  1.00 0.00 ? 24 GLN A HG3  12 
ATOM   8649  H HE21 . GLN A 1 24 ? 3.496   -3.480  -6.373  1.00 0.00 ? 24 GLN A HE21 12 
ATOM   8650  H HE22 . GLN A 1 24 ? 3.942   -5.069  -6.885  1.00 0.00 ? 24 GLN A HE22 12 
ATOM   8651  N N    . LEU A 1 25 ? -2.477  -2.731  -5.279  1.00 0.00 ? 25 LEU A N    12 
ATOM   8652  C CA   . LEU A 1 25 ? -3.873  -2.714  -5.682  1.00 0.00 ? 25 LEU A CA   12 
ATOM   8653  C C    . LEU A 1 25 ? -4.612  -1.508  -5.100  1.00 0.00 ? 25 LEU A C    12 
ATOM   8654  O O    . LEU A 1 25 ? -5.790  -1.296  -5.392  1.00 0.00 ? 25 LEU A O    12 
ATOM   8655  C CB   . LEU A 1 25 ? -4.567  -4.006  -5.246  1.00 0.00 ? 25 LEU A CB   12 
ATOM   8656  C CG   . LEU A 1 25 ? -5.810  -4.379  -6.059  1.00 0.00 ? 25 LEU A CG   12 
ATOM   8657  C CD1  . LEU A 1 25 ? -5.563  -5.644  -6.867  1.00 0.00 ? 25 LEU A CD1  12 
ATOM   8658  C CD2  . LEU A 1 25 ? -7.015  -4.553  -5.147  1.00 0.00 ? 25 LEU A CD2  12 
ATOM   8659  H H    . LEU A 1 25 ? -2.176  -3.390  -4.631  1.00 0.00 ? 25 LEU A H    12 
ATOM   8660  H HA   . LEU A 1 25 ? -3.899  -2.652  -6.754  1.00 0.00 ? 25 LEU A HA   12 
ATOM   8661  H HB2  . LEU A 1 25 ? -3.853  -4.815  -5.321  1.00 0.00 ? 25 LEU A HB2  12 
ATOM   8662  H HB3  . LEU A 1 25 ? -4.858  -3.902  -4.211  1.00 0.00 ? 25 LEU A HB3  12 
ATOM   8663  H HG   . LEU A 1 25 ? -6.029  -3.580  -6.753  1.00 0.00 ? 25 LEU A HG   12 
ATOM   8664  H HD11 . LEU A 1 25 ? -5.986  -6.491  -6.348  1.00 0.00 ? 25 LEU A HD11 12 
ATOM   8665  H HD12 . LEU A 1 25 ? -4.501  -5.792  -6.991  1.00 0.00 ? 25 LEU A HD12 12 
ATOM   8666  H HD13 . LEU A 1 25 ? -6.028  -5.548  -7.838  1.00 0.00 ? 25 LEU A HD13 12 
ATOM   8667  H HD21 . LEU A 1 25 ? -7.404  -3.584  -4.876  1.00 0.00 ? 25 LEU A HD21 12 
ATOM   8668  H HD22 . LEU A 1 25 ? -6.718  -5.085  -4.255  1.00 0.00 ? 25 LEU A HD22 12 
ATOM   8669  H HD23 . LEU A 1 25 ? -7.778  -5.117  -5.663  1.00 0.00 ? 25 LEU A HD23 12 
ATOM   8670  N N    . ARG A 1 26 ? -3.926  -0.722  -4.273  1.00 0.00 ? 26 ARG A N    12 
ATOM   8671  C CA   . ARG A 1 26 ? -4.547  0.451   -3.660  1.00 0.00 ? 26 ARG A CA   12 
ATOM   8672  C C    . ARG A 1 26 ? -3.733  1.727   -3.873  1.00 0.00 ? 26 ARG A C    12 
ATOM   8673  O O    . ARG A 1 26 ? -4.095  2.795   -3.380  1.00 0.00 ? 26 ARG A O    12 
ATOM   8674  C CB   . ARG A 1 26 ? -4.763  0.229   -2.164  1.00 0.00 ? 26 ARG A CB   12 
ATOM   8675  C CG   . ARG A 1 26 ? -6.068  0.809   -1.649  1.00 0.00 ? 26 ARG A CG   12 
ATOM   8676  C CD   . ARG A 1 26 ? -7.166  -0.241  -1.592  1.00 0.00 ? 26 ARG A CD   12 
ATOM   8677  N NE   . ARG A 1 26 ? -8.239  0.060   -2.537  1.00 0.00 ? 26 ARG A NE   12 
ATOM   8678  C CZ   . ARG A 1 26 ? -9.144  -0.829  -2.941  1.00 0.00 ? 26 ARG A CZ   12 
ATOM   8679  N NH1  . ARG A 1 26 ? -9.115  -2.073  -2.480  1.00 0.00 ? 26 ARG A NH1  12 
ATOM   8680  N NH2  . ARG A 1 26 ? -10.082 -0.470  -3.807  1.00 0.00 ? 26 ARG A NH2  12 
ATOM   8681  H H    . ARG A 1 26 ? -2.993  -0.936  -4.071  1.00 0.00 ? 26 ARG A H    12 
ATOM   8682  H HA   . ARG A 1 26 ? -5.497  0.579   -4.132  1.00 0.00 ? 26 ARG A HA   12 
ATOM   8683  H HB2  . ARG A 1 26 ? -4.762  -0.831  -1.958  1.00 0.00 ? 26 ARG A HB2  12 
ATOM   8684  H HB3  . ARG A 1 26 ? -3.949  0.695   -1.628  1.00 0.00 ? 26 ARG A HB3  12 
ATOM   8685  H HG2  . ARG A 1 26 ? -5.911  1.206   -0.658  1.00 0.00 ? 26 ARG A HG2  12 
ATOM   8686  H HG3  . ARG A 1 26 ? -6.378  1.601   -2.313  1.00 0.00 ? 26 ARG A HG3  12 
ATOM   8687  H HD2  . ARG A 1 26 ? -6.734  -1.203  -1.825  1.00 0.00 ? 26 ARG A HD2  12 
ATOM   8688  H HD3  . ARG A 1 26 ? -7.564  -0.264  -0.589  1.00 0.00 ? 26 ARG A HD3  12 
ATOM   8689  H HE   . ARG A 1 26 ? -8.286  0.971   -2.892  1.00 0.00 ? 26 ARG A HE   12 
ATOM   8690  H HH11 . ARG A 1 26 ? -8.410  -2.348  -1.826  1.00 0.00 ? 26 ARG A HH11 12 
ATOM   8691  H HH12 . ARG A 1 26 ? -9.798  -2.735  -2.786  1.00 0.00 ? 26 ARG A HH12 12 
ATOM   8692  H HH21 . ARG A 1 26 ? -10.109 0.465   -4.156  1.00 0.00 ? 26 ARG A HH21 12 
ATOM   8693  H HH22 . ARG A 1 26 ? -10.762 -1.137  -4.111  1.00 0.00 ? 26 ARG A HH22 12 
ATOM   8694  N N    . CYS A 1 27 ? -2.631  1.599   -4.593  1.00 0.00 ? 27 CYS A N    12 
ATOM   8695  C CA   . CYS A 1 27 ? -1.731  2.737   -4.876  1.00 0.00 ? 27 CYS A CA   12 
ATOM   8696  C C    . CYS A 1 27 ? -2.501  4.036   -5.136  1.00 0.00 ? 27 CYS A C    12 
ATOM   8697  O O    . CYS A 1 27 ? -1.985  5.126   -4.889  1.00 0.00 ? 27 CYS A O    12 
ATOM   8698  C CB   . CYS A 1 27 ? -0.803  2.463   -6.078  1.00 0.00 ? 27 CYS A CB   12 
ATOM   8699  S SG   . CYS A 1 27 ? 0.967   2.660   -5.700  1.00 0.00 ? 27 CYS A SG   12 
ATOM   8700  H H    . CYS A 1 27 ? -2.412  0.714   -4.928  1.00 0.00 ? 27 CYS A H    12 
ATOM   8701  H HA   . CYS A 1 27 ? -1.115  2.883   -3.999  1.00 0.00 ? 27 CYS A HA   12 
ATOM   8702  H HB2  . CYS A 1 27 ? -0.947  1.459   -6.441  1.00 0.00 ? 27 CYS A HB2  12 
ATOM   8703  H HB3  . CYS A 1 27 ? -1.043  3.159   -6.870  1.00 0.00 ? 27 CYS A HB3  12 
ATOM   8704  N N    . SER A 1 28 ? -3.726  3.924   -5.646  1.00 0.00 ? 28 SER A N    12 
ATOM   8705  C CA   . SER A 1 28 ? -4.532  5.081   -5.937  1.00 0.00 ? 28 SER A CA   12 
ATOM   8706  C C    . SER A 1 28 ? -5.992  4.853   -5.557  1.00 0.00 ? 28 SER A C    12 
ATOM   8707  O O    . SER A 1 28 ? -6.895  5.027   -6.377  1.00 0.00 ? 28 SER A O    12 
ATOM   8708  C CB   . SER A 1 28 ? -4.415  5.451   -7.416  1.00 0.00 ? 28 SER A CB   12 
ATOM   8709  O OG   . SER A 1 28 ? -3.413  6.431   -7.622  1.00 0.00 ? 28 SER A OG   12 
ATOM   8710  H H    . SER A 1 28 ? -4.087  3.059   -5.828  1.00 0.00 ? 28 SER A H    12 
ATOM   8711  H HA   . SER A 1 28 ? -4.146  5.872   -5.348  1.00 0.00 ? 28 SER A HA   12 
ATOM   8712  H HB2  . SER A 1 28 ? -4.160  4.569   -7.984  1.00 0.00 ? 28 SER A HB2  12 
ATOM   8713  H HB3  . SER A 1 28 ? -5.361  5.842   -7.764  1.00 0.00 ? 28 SER A HB3  12 
ATOM   8714  H HG   . SER A 1 28 ? -3.061  6.349   -8.512  1.00 0.00 ? 28 SER A HG   12 
ATOM   8715  N N    . SER A 1 29 ? -6.215  4.471   -4.306  1.00 0.00 ? 29 SER A N    12 
ATOM   8716  C CA   . SER A 1 29 ? -7.559  4.227   -3.805  1.00 0.00 ? 29 SER A CA   12 
ATOM   8717  C C    . SER A 1 29 ? -7.539  4.035   -2.294  1.00 0.00 ? 29 SER A C    12 
ATOM   8718  O O    . SER A 1 29 ? -6.561  3.547   -1.729  1.00 0.00 ? 29 SER A O    12 
ATOM   8719  C CB   . SER A 1 29 ? -8.168  2.998   -4.479  1.00 0.00 ? 29 SER A CB   12 
ATOM   8720  O OG   . SER A 1 29 ? -8.771  3.336   -5.716  1.00 0.00 ? 29 SER A OG   12 
ATOM   8721  H H    . SER A 1 29 ? -5.458  4.354   -3.700  1.00 0.00 ? 29 SER A H    12 
ATOM   8722  H HA   . SER A 1 29 ? -8.162  5.092   -4.038  1.00 0.00 ? 29 SER A HA   12 
ATOM   8723  H HB2  . SER A 1 29 ? -7.394  2.268   -4.658  1.00 0.00 ? 29 SER A HB2  12 
ATOM   8724  H HB3  . SER A 1 29 ? -8.921  2.573   -3.830  1.00 0.00 ? 29 SER A HB3  12 
ATOM   8725  H HG   . SER A 1 29 ? -8.205  3.945   -6.194  1.00 0.00 ? 29 SER A HG   12 
ATOM   8726  N N    . ASN A 1 30 ? -8.623  4.428   -1.646  1.00 0.00 ? 30 ASN A N    12 
ATOM   8727  C CA   . ASN A 1 30 ? -8.746  4.306   -0.195  1.00 0.00 ? 30 ASN A CA   12 
ATOM   8728  C C    . ASN A 1 30 ? -7.565  4.958   0.520   1.00 0.00 ? 30 ASN A C    12 
ATOM   8729  O O    . ASN A 1 30 ? -7.266  4.629   1.668   1.00 0.00 ? 30 ASN A O    12 
ATOM   8730  C CB   . ASN A 1 30 ? -8.846  2.831   0.202   1.00 0.00 ? 30 ASN A CB   12 
ATOM   8731  C CG   . ASN A 1 30 ? -10.224 2.255   -0.057  1.00 0.00 ? 30 ASN A CG   12 
ATOM   8732  O OD1  . ASN A 1 30 ? -10.391 1.366   -0.892  1.00 0.00 ? 30 ASN A OD1  12 
ATOM   8733  N ND2  . ASN A 1 30 ? -11.221 2.759   0.661   1.00 0.00 ? 30 ASN A ND2  12 
ATOM   8734  H H    . ASN A 1 30 ? -9.361  4.814   -2.156  1.00 0.00 ? 30 ASN A H    12 
ATOM   8735  H HA   . ASN A 1 30 ? -9.653  4.809   0.104   1.00 0.00 ? 30 ASN A HA   12 
ATOM   8736  H HB2  . ASN A 1 30 ? -8.126  2.261   -0.366  1.00 0.00 ? 30 ASN A HB2  12 
ATOM   8737  H HB3  . ASN A 1 30 ? -8.626  2.732   1.256   1.00 0.00 ? 30 ASN A HB3  12 
ATOM   8738  H HD21 . ASN A 1 30 ? -11.014 3.465   1.309   1.00 0.00 ? 30 ASN A HD21 12 
ATOM   8739  H HD22 . ASN A 1 30 ? -12.123 2.405   0.514   1.00 0.00 ? 30 ASN A HD22 12 
ATOM   8740  N N    . THR A 1 31 ? -6.905  5.893   -0.166  1.00 0.00 ? 31 THR A N    12 
ATOM   8741  C CA   . THR A 1 31 ? -5.755  6.618   0.385   1.00 0.00 ? 31 THR A CA   12 
ATOM   8742  C C    . THR A 1 31 ? -4.934  5.763   1.355   1.00 0.00 ? 31 THR A C    12 
ATOM   8743  O O    . THR A 1 31 ? -5.172  5.779   2.563   1.00 0.00 ? 31 THR A O    12 
ATOM   8744  C CB   . THR A 1 31 ? -6.223  7.898   1.086   1.00 0.00 ? 31 THR A CB   12 
ATOM   8745  O OG1  . THR A 1 31 ? -5.113  8.668   1.511   1.00 0.00 ? 31 THR A OG1  12 
ATOM   8746  C CG2  . THR A 1 31 ? -7.095  7.646   2.298   1.00 0.00 ? 31 THR A CG2  12 
ATOM   8747  H H    . THR A 1 31 ? -7.204  6.111   -1.074  1.00 0.00 ? 31 THR A H    12 
ATOM   8748  H HA   . THR A 1 31 ? -5.123  6.893   -0.442  1.00 0.00 ? 31 THR A HA   12 
ATOM   8749  H HB   . THR A 1 31 ? -6.795  8.489   0.384   1.00 0.00 ? 31 THR A HB   12 
ATOM   8750  H HG1  . THR A 1 31 ? -4.468  8.720   0.801   1.00 0.00 ? 31 THR A HG1  12 
ATOM   8751  H HG21 . THR A 1 31 ? -7.717  6.782   2.122   1.00 0.00 ? 31 THR A HG21 12 
ATOM   8752  H HG22 . THR A 1 31 ? -7.722  8.508   2.475   1.00 0.00 ? 31 THR A HG22 12 
ATOM   8753  H HG23 . THR A 1 31 ? -6.471  7.472   3.161   1.00 0.00 ? 31 THR A HG23 12 
ATOM   8754  N N    . PRO A 1 32 ? -3.964  4.984   0.837   1.00 0.00 ? 32 PRO A N    12 
ATOM   8755  C CA   . PRO A 1 32 ? -3.117  4.113   1.640   1.00 0.00 ? 32 PRO A CA   12 
ATOM   8756  C C    . PRO A 1 32 ? -1.702  4.663   1.852   1.00 0.00 ? 32 PRO A C    12 
ATOM   8757  O O    . PRO A 1 32 ? -0.724  4.032   1.447   1.00 0.00 ? 32 PRO A O    12 
ATOM   8758  C CB   . PRO A 1 32 ? -3.064  2.882   0.748   1.00 0.00 ? 32 PRO A CB   12 
ATOM   8759  C CG   . PRO A 1 32 ? -2.996  3.441   -0.642  1.00 0.00 ? 32 PRO A CG   12 
ATOM   8760  C CD   . PRO A 1 32 ? -3.622  4.846   -0.585  1.00 0.00 ? 32 PRO A CD   12 
ATOM   8761  H HA   . PRO A 1 32 ? -3.565  3.870   2.587   1.00 0.00 ? 32 PRO A HA   12 
ATOM   8762  H HB2  . PRO A 1 32 ? -2.188  2.296   0.987   1.00 0.00 ? 32 PRO A HB2  12 
ATOM   8763  H HB3  . PRO A 1 32 ? -3.953  2.289   0.888   1.00 0.00 ? 32 PRO A HB3  12 
ATOM   8764  H HG2  . PRO A 1 32 ? -1.959  3.491   -0.957  1.00 0.00 ? 32 PRO A HG2  12 
ATOM   8765  H HG3  . PRO A 1 32 ? -3.553  2.798   -1.312  1.00 0.00 ? 32 PRO A HG3  12 
ATOM   8766  H HD2  . PRO A 1 32 ? -2.910  5.608   -0.883  1.00 0.00 ? 32 PRO A HD2  12 
ATOM   8767  H HD3  . PRO A 1 32 ? -4.514  4.904   -1.200  1.00 0.00 ? 32 PRO A HD3  12 
ATOM   8768  N N    . PRO A 1 33 ? -1.561  5.849   2.468   1.00 0.00 ? 33 PRO A N    12 
ATOM   8769  C CA   . PRO A 1 33 ? -0.257  6.468   2.693   1.00 0.00 ? 33 PRO A CA   12 
ATOM   8770  C C    . PRO A 1 33 ? 0.395   6.095   4.014   1.00 0.00 ? 33 PRO A C    12 
ATOM   8771  O O    . PRO A 1 33 ? -0.185  5.395   4.843   1.00 0.00 ? 33 PRO A O    12 
ATOM   8772  C CB   . PRO A 1 33 ? -0.618  7.937   2.699   1.00 0.00 ? 33 PRO A CB   12 
ATOM   8773  C CG   . PRO A 1 33 ? -1.936  7.970   3.390   1.00 0.00 ? 33 PRO A CG   12 
ATOM   8774  C CD   . PRO A 1 33 ? -2.651  6.711   2.968   1.00 0.00 ? 33 PRO A CD   12 
ATOM   8775  H HA   . PRO A 1 33 ? 0.433   6.264   1.889   1.00 0.00 ? 33 PRO A HA   12 
ATOM   8776  H HB2  . PRO A 1 33 ? 0.131   8.492   3.240   1.00 0.00 ? 33 PRO A HB2  12 
ATOM   8777  H HB3  . PRO A 1 33 ? -0.693  8.294   1.687   1.00 0.00 ? 33 PRO A HB3  12 
ATOM   8778  H HG2  . PRO A 1 33 ? -1.792  7.980   4.461   1.00 0.00 ? 33 PRO A HG2  12 
ATOM   8779  H HG3  . PRO A 1 33 ? -2.494  8.840   3.077   1.00 0.00 ? 33 PRO A HG3  12 
ATOM   8780  H HD2  . PRO A 1 33 ? -3.151  6.256   3.810   1.00 0.00 ? 33 PRO A HD2  12 
ATOM   8781  H HD3  . PRO A 1 33 ? -3.352  6.936   2.184   1.00 0.00 ? 33 PRO A HD3  12 
ATOM   8782  N N    . LEU A 1 34 ? 1.621   6.583   4.178   1.00 0.00 ? 34 LEU A N    12 
ATOM   8783  C CA   . LEU A 1 34 ? 2.428   6.339   5.370   1.00 0.00 ? 34 LEU A CA   12 
ATOM   8784  C C    . LEU A 1 34 ? 2.822   4.874   5.462   1.00 0.00 ? 34 LEU A C    12 
ATOM   8785  O O    . LEU A 1 34 ? 3.999   4.552   5.629   1.00 0.00 ? 34 LEU A O    12 
ATOM   8786  C CB   . LEU A 1 34 ? 1.713   6.805   6.651   1.00 0.00 ? 34 LEU A CB   12 
ATOM   8787  C CG   . LEU A 1 34 ? 0.671   7.917   6.462   1.00 0.00 ? 34 LEU A CG   12 
ATOM   8788  C CD1  . LEU A 1 34 ? -0.687  7.477   6.990   1.00 0.00 ? 34 LEU A CD1  12 
ATOM   8789  C CD2  . LEU A 1 34 ? 1.122   9.195   7.156   1.00 0.00 ? 34 LEU A CD2  12 
ATOM   8790  H H    . LEU A 1 34 ? 2.003   7.129   3.460   1.00 0.00 ? 34 LEU A H    12 
ATOM   8791  H HA   . LEU A 1 34 ? 3.333   6.908   5.251   1.00 0.00 ? 34 LEU A HA   12 
ATOM   8792  H HB2  . LEU A 1 34 ? 1.226   5.956   7.105   1.00 0.00 ? 34 LEU A HB2  12 
ATOM   8793  H HB3  . LEU A 1 34 ? 2.464   7.168   7.337   1.00 0.00 ? 34 LEU A HB3  12 
ATOM   8794  H HG   . LEU A 1 34 ? 0.564   8.129   5.409   1.00 0.00 ? 34 LEU A HG   12 
ATOM   8795  H HD11 . LEU A 1 34 ? -1.450  8.149   6.626   1.00 0.00 ? 34 LEU A HD11 12 
ATOM   8796  H HD12 . LEU A 1 34 ? -0.676  7.496   8.070   1.00 0.00 ? 34 LEU A HD12 12 
ATOM   8797  H HD13 . LEU A 1 34 ? -0.899  6.474   6.650   1.00 0.00 ? 34 LEU A HD13 12 
ATOM   8798  H HD21 . LEU A 1 34 ? 0.870   10.046  6.540   1.00 0.00 ? 34 LEU A HD21 12 
ATOM   8799  H HD22 . LEU A 1 34 ? 2.190   9.164   7.308   1.00 0.00 ? 34 LEU A HD22 12 
ATOM   8800  H HD23 . LEU A 1 34 ? 0.625   9.281   8.111   1.00 0.00 ? 34 LEU A HD23 12 
ATOM   8801  N N    . THR A 1 35 ? 1.850   3.988   5.323   1.00 0.00 ? 35 THR A N    12 
ATOM   8802  C CA   . THR A 1 35 ? 2.117   2.570   5.362   1.00 0.00 ? 35 THR A CA   12 
ATOM   8803  C C    . THR A 1 35 ? 2.629   2.092   4.006   1.00 0.00 ? 35 THR A C    12 
ATOM   8804  O O    . THR A 1 35 ? 2.994   0.926   3.854   1.00 0.00 ? 35 THR A O    12 
ATOM   8805  C CB   . THR A 1 35 ? 0.848   1.814   5.748   1.00 0.00 ? 35 THR A CB   12 
ATOM   8806  O OG1  . THR A 1 35 ? 1.000   0.424   5.520   1.00 0.00 ? 35 THR A OG1  12 
ATOM   8807  C CG2  . THR A 1 35 ? -0.379  2.275   4.990   1.00 0.00 ? 35 THR A CG2  12 
ATOM   8808  H H    . THR A 1 35 ? 0.937   4.289   5.172   1.00 0.00 ? 35 THR A H    12 
ATOM   8809  H HA   . THR A 1 35 ? 2.876   2.392   6.109   1.00 0.00 ? 35 THR A HA   12 
ATOM   8810  H HB   . THR A 1 35 ? 0.660   1.969   6.799   1.00 0.00 ? 35 THR A HB   12 
ATOM   8811  H HG1  . THR A 1 35 ? 1.847   0.134   5.866   1.00 0.00 ? 35 THR A HG1  12 
ATOM   8812  H HG21 . THR A 1 35 ? -0.668  3.257   5.334   1.00 0.00 ? 35 THR A HG21 12 
ATOM   8813  H HG22 . THR A 1 35 ? -1.188  1.584   5.163   1.00 0.00 ? 35 THR A HG22 12 
ATOM   8814  H HG23 . THR A 1 35 ? -0.157  2.314   3.934   1.00 0.00 ? 35 THR A HG23 12 
ATOM   8815  N N    . CYS A 1 36 ? 2.666   2.998   3.017   1.00 0.00 ? 36 CYS A N    12 
ATOM   8816  C CA   . CYS A 1 36 ? 3.140   2.625   1.686   1.00 0.00 ? 36 CYS A CA   12 
ATOM   8817  C C    . CYS A 1 36 ? 3.212   3.823   0.741   1.00 0.00 ? 36 CYS A C    12 
ATOM   8818  O O    . CYS A 1 36 ? 2.981   3.684   -0.461  1.00 0.00 ? 36 CYS A O    12 
ATOM   8819  C CB   . CYS A 1 36 ? 2.224   1.552   1.092   1.00 0.00 ? 36 CYS A CB   12 
ATOM   8820  S SG   . CYS A 1 36 ? 2.917   -0.131  1.142   1.00 0.00 ? 36 CYS A SG   12 
ATOM   8821  H H    . CYS A 1 36 ? 2.370   3.929   3.187   1.00 0.00 ? 36 CYS A H    12 
ATOM   8822  H HA   . CYS A 1 36 ? 4.127   2.210   1.796   1.00 0.00 ? 36 CYS A HA   12 
ATOM   8823  H HB2  . CYS A 1 36 ? 1.295   1.538   1.643   1.00 0.00 ? 36 CYS A HB2  12 
ATOM   8824  H HB3  . CYS A 1 36 ? 2.018   1.793   0.059   1.00 0.00 ? 36 CYS A HB3  12 
ATOM   8825  N N    . GLN A 1 37 ? 3.534   4.996   1.274   1.00 0.00 ? 37 GLN A N    12 
ATOM   8826  C CA   . GLN A 1 37 ? 3.627   6.196   0.448   1.00 0.00 ? 37 GLN A CA   12 
ATOM   8827  C C    . GLN A 1 37 ? 4.886   6.168   -0.405  1.00 0.00 ? 37 GLN A C    12 
ATOM   8828  O O    . GLN A 1 37 ? 4.884   6.603   -1.556  1.00 0.00 ? 37 GLN A O    12 
ATOM   8829  C CB   . GLN A 1 37 ? 3.609   7.454   1.320   1.00 0.00 ? 37 GLN A CB   12 
ATOM   8830  C CG   . GLN A 1 37 ? 2.418   8.360   1.054   1.00 0.00 ? 37 GLN A CG   12 
ATOM   8831  C CD   . GLN A 1 37 ? 2.823   9.800   0.803   1.00 0.00 ? 37 GLN A CD   12 
ATOM   8832  O OE1  . GLN A 1 37 ? 2.755   10.290  -0.324  1.00 0.00 ? 37 GLN A OE1  12 
ATOM   8833  N NE2  . GLN A 1 37 ? 3.249   10.486  1.858   1.00 0.00 ? 37 GLN A NE2  12 
ATOM   8834  H H    . GLN A 1 37 ? 3.713   5.058   2.235   1.00 0.00 ? 37 GLN A H    12 
ATOM   8835  H HA   . GLN A 1 37 ? 2.773   6.208   -0.209  1.00 0.00 ? 37 GLN A HA   12 
ATOM   8836  H HB2  . GLN A 1 37 ? 3.584   7.157   2.357   1.00 0.00 ? 37 GLN A HB2  12 
ATOM   8837  H HB3  . GLN A 1 37 ? 4.511   8.020   1.139   1.00 0.00 ? 37 GLN A HB3  12 
ATOM   8838  H HG2  . GLN A 1 37 ? 1.891   7.996   0.185   1.00 0.00 ? 37 GLN A HG2  12 
ATOM   8839  H HG3  . GLN A 1 37 ? 1.759   8.331   1.910   1.00 0.00 ? 37 GLN A HG3  12 
ATOM   8840  H HE21 . GLN A 1 37 ? 3.277   10.032  2.726   1.00 0.00 ? 37 GLN A HE21 12 
ATOM   8841  H HE22 . GLN A 1 37 ? 3.518   11.419  1.725   1.00 0.00 ? 37 GLN A HE22 12 
ATOM   8842  N N    . ARG A 1 38 ? 5.954   5.644   0.169   1.00 0.00 ? 38 ARG A N    12 
ATOM   8843  C CA   . ARG A 1 38 ? 7.224   5.543   -0.534  1.00 0.00 ? 38 ARG A CA   12 
ATOM   8844  C C    . ARG A 1 38 ? 7.193   4.373   -1.508  1.00 0.00 ? 38 ARG A C    12 
ATOM   8845  O O    . ARG A 1 38 ? 7.691   4.469   -2.627  1.00 0.00 ? 38 ARG A O    12 
ATOM   8846  C CB   . ARG A 1 38 ? 8.371   5.368   0.465   1.00 0.00 ? 38 ARG A CB   12 
ATOM   8847  C CG   . ARG A 1 38 ? 9.112   6.660   0.771   1.00 0.00 ? 38 ARG A CG   12 
ATOM   8848  C CD   . ARG A 1 38 ? 9.745   6.623   2.153   1.00 0.00 ? 38 ARG A CD   12 
ATOM   8849  N NE   . ARG A 1 38 ? 11.005  7.363   2.189   1.00 0.00 ? 38 ARG A NE   12 
ATOM   8850  C CZ   . ARG A 1 38 ? 11.221  8.444   2.940   1.00 0.00 ? 38 ARG A CZ   12 
ATOM   8851  N NH1  . ARG A 1 38 ? 10.265  8.924   3.727   1.00 0.00 ? 38 ARG A NH1  12 
ATOM   8852  N NH2  . ARG A 1 38 ? 12.401  9.047   2.904   1.00 0.00 ? 38 ARG A NH2  12 
ATOM   8853  H H    . ARG A 1 38 ? 5.883   5.310   1.084   1.00 0.00 ? 38 ARG A H    12 
ATOM   8854  H HA   . ARG A 1 38 ? 7.373   6.459   -1.088  1.00 0.00 ? 38 ARG A HA   12 
ATOM   8855  H HB2  . ARG A 1 38 ? 7.972   4.979   1.390   1.00 0.00 ? 38 ARG A HB2  12 
ATOM   8856  H HB3  . ARG A 1 38 ? 9.080   4.659   0.062   1.00 0.00 ? 38 ARG A HB3  12 
ATOM   8857  H HG2  . ARG A 1 38 ? 9.890   6.801   0.035   1.00 0.00 ? 38 ARG A HG2  12 
ATOM   8858  H HG3  . ARG A 1 38 ? 8.415   7.483   0.725   1.00 0.00 ? 38 ARG A HG3  12 
ATOM   8859  H HD2  . ARG A 1 38 ? 9.048   7.049   2.857   1.00 0.00 ? 38 ARG A HD2  12 
ATOM   8860  H HD3  . ARG A 1 38 ? 9.925   5.591   2.418   1.00 0.00 ? 38 ARG A HD3  12 
ATOM   8861  H HE   . ARG A 1 38 ? 11.734  7.038   1.620   1.00 0.00 ? 38 ARG A HE   12 
ATOM   8862  H HH11 . ARG A 1 38 ? 9.372   8.480   3.763   1.00 0.00 ? 38 ARG A HH11 12 
ATOM   8863  H HH12 . ARG A 1 38 ? 10.441  9.736   4.286   1.00 0.00 ? 38 ARG A HH12 12 
ATOM   8864  H HH21 . ARG A 1 38 ? 13.126  8.692   2.315   1.00 0.00 ? 38 ARG A HH21 12 
ATOM   8865  H HH22 . ARG A 1 38 ? 12.566  9.858   3.466   1.00 0.00 ? 38 ARG A HH22 12 
ATOM   8866  N N    . TYR A 1 39 ? 6.598   3.267   -1.070  1.00 0.00 ? 39 TYR A N    12 
ATOM   8867  C CA   . TYR A 1 39 ? 6.502   2.075   -1.894  1.00 0.00 ? 39 TYR A CA   12 
ATOM   8868  C C    . TYR A 1 39 ? 5.543   2.269   -3.058  1.00 0.00 ? 39 TYR A C    12 
ATOM   8869  O O    . TYR A 1 39 ? 5.771   1.744   -4.148  1.00 0.00 ? 39 TYR A O    12 
ATOM   8870  C CB   . TYR A 1 39 ? 6.065   0.873   -1.054  1.00 0.00 ? 39 TYR A CB   12 
ATOM   8871  C CG   . TYR A 1 39 ? 6.200   -0.444  -1.783  1.00 0.00 ? 39 TYR A CG   12 
ATOM   8872  C CD1  . TYR A 1 39 ? 5.217   -0.873  -2.667  1.00 0.00 ? 39 TYR A CD1  12 
ATOM   8873  C CD2  . TYR A 1 39 ? 7.318   -1.248  -1.604  1.00 0.00 ? 39 TYR A CD2  12 
ATOM   8874  C CE1  . TYR A 1 39 ? 5.343   -2.069  -3.348  1.00 0.00 ? 39 TYR A CE1  12 
ATOM   8875  C CE2  . TYR A 1 39 ? 7.451   -2.446  -2.280  1.00 0.00 ? 39 TYR A CE2  12 
ATOM   8876  C CZ   . TYR A 1 39 ? 6.460   -2.852  -3.153  1.00 0.00 ? 39 TYR A CZ   12 
ATOM   8877  O OH   . TYR A 1 39 ? 6.588   -4.044  -3.832  1.00 0.00 ? 39 TYR A OH   12 
ATOM   8878  H H    . TYR A 1 39 ? 6.221   3.252   -0.172  1.00 0.00 ? 39 TYR A H    12 
ATOM   8879  H HA   . TYR A 1 39 ? 7.483   1.880   -2.292  1.00 0.00 ? 39 TYR A HA   12 
ATOM   8880  H HB2  . TYR A 1 39 ? 6.671   0.822   -0.162  1.00 0.00 ? 39 TYR A HB2  12 
ATOM   8881  H HB3  . TYR A 1 39 ? 5.029   0.994   -0.774  1.00 0.00 ? 39 TYR A HB3  12 
ATOM   8882  H HD1  . TYR A 1 39 ? 4.341   -0.259  -2.818  1.00 0.00 ? 39 TYR A HD1  12 
ATOM   8883  H HD2  . TYR A 1 39 ? 8.089   -0.928  -0.919  1.00 0.00 ? 39 TYR A HD2  12 
ATOM   8884  H HE1  . TYR A 1 39 ? 4.568   -2.385  -4.031  1.00 0.00 ? 39 TYR A HE1  12 
ATOM   8885  H HE2  . TYR A 1 39 ? 8.327   -3.058  -2.125  1.00 0.00 ? 39 TYR A HE2  12 
ATOM   8886  H HH   . TYR A 1 39 ? 7.408   -4.475  -3.579  1.00 0.00 ? 39 TYR A HH   12 
ATOM   8887  N N    . CYS A 1 40 ? 4.473   3.026   -2.837  1.00 0.00 ? 40 CYS A N    12 
ATOM   8888  C CA   . CYS A 1 40 ? 3.507   3.267   -3.902  1.00 0.00 ? 40 CYS A CA   12 
ATOM   8889  C C    . CYS A 1 40 ? 4.191   3.936   -5.083  1.00 0.00 ? 40 CYS A C    12 
ATOM   8890  O O    . CYS A 1 40 ? 4.032   3.509   -6.226  1.00 0.00 ? 40 CYS A O    12 
ATOM   8891  C CB   . CYS A 1 40 ? 2.330   4.117   -3.412  1.00 0.00 ? 40 CYS A CB   12 
ATOM   8892  S SG   . CYS A 1 40 ? 1.059   4.417   -4.683  1.00 0.00 ? 40 CYS A SG   12 
ATOM   8893  H H    . CYS A 1 40 ? 4.337   3.429   -1.950  1.00 0.00 ? 40 CYS A H    12 
ATOM   8894  H HA   . CYS A 1 40 ? 3.137   2.306   -4.225  1.00 0.00 ? 40 CYS A HA   12 
ATOM   8895  H HB2  . CYS A 1 40 ? 1.850   3.615   -2.585  1.00 0.00 ? 40 CYS A HB2  12 
ATOM   8896  H HB3  . CYS A 1 40 ? 2.699   5.077   -3.082  1.00 0.00 ? 40 CYS A HB3  12 
ATOM   8897  N N    . ASN A 1 41 ? 4.973   4.973   -4.804  1.00 0.00 ? 41 ASN A N    12 
ATOM   8898  C CA   . ASN A 1 41 ? 5.691   5.673   -5.855  1.00 0.00 ? 41 ASN A CA   12 
ATOM   8899  C C    . ASN A 1 41 ? 6.703   4.746   -6.513  1.00 0.00 ? 41 ASN A C    12 
ATOM   8900  O O    . ASN A 1 41 ? 7.151   4.986   -7.633  1.00 0.00 ? 41 ASN A O    12 
ATOM   8901  C CB   . ASN A 1 41 ? 6.363   6.943   -5.301  1.00 0.00 ? 41 ASN A CB   12 
ATOM   8902  C CG   . ASN A 1 41 ? 7.883   6.888   -5.321  1.00 0.00 ? 41 ASN A CG   12 
ATOM   8903  O OD1  . ASN A 1 41 ? 8.535   7.701   -5.975  1.00 0.00 ? 41 ASN A OD1  12 
ATOM   8904  N ND2  . ASN A 1 41 ? 8.450   5.926   -4.604  1.00 0.00 ? 41 ASN A ND2  12 
ATOM   8905  H H    . ASN A 1 41 ? 5.077   5.262   -3.876  1.00 0.00 ? 41 ASN A H    12 
ATOM   8906  H HA   . ASN A 1 41 ? 4.971   5.949   -6.594  1.00 0.00 ? 41 ASN A HA   12 
ATOM   8907  H HB2  . ASN A 1 41 ? 6.050   7.790   -5.892  1.00 0.00 ? 41 ASN A HB2  12 
ATOM   8908  H HB3  . ASN A 1 41 ? 6.042   7.090   -4.280  1.00 0.00 ? 41 ASN A HB3  12 
ATOM   8909  H HD21 . ASN A 1 41 ? 7.868   5.312   -4.110  1.00 0.00 ? 41 ASN A HD21 12 
ATOM   8910  H HD22 . ASN A 1 41 ? 9.429   5.868   -4.600  1.00 0.00 ? 41 ASN A HD22 12 
ATOM   8911  N N    . ALA A 1 42 ? 7.033   3.673   -5.814  1.00 0.00 ? 42 ALA A N    12 
ATOM   8912  C CA   . ALA A 1 42 ? 7.965   2.683   -6.326  1.00 0.00 ? 42 ALA A CA   12 
ATOM   8913  C C    . ALA A 1 42 ? 7.220   1.416   -6.719  1.00 0.00 ? 42 ALA A C    12 
ATOM   8914  O O    . ALA A 1 42 ? 7.782   0.321   -6.733  1.00 0.00 ? 42 ALA A O    12 
ATOM   8915  C CB   . ALA A 1 42 ? 9.047   2.382   -5.300  1.00 0.00 ? 42 ALA A CB   12 
ATOM   8916  H H    . ALA A 1 42 ? 6.622   3.537   -4.936  1.00 0.00 ? 42 ALA A H    12 
ATOM   8917  H HA   . ALA A 1 42 ? 8.430   3.094   -7.207  1.00 0.00 ? 42 ALA A HA   12 
ATOM   8918  H HB1  . ALA A 1 42 ? 9.923   1.997   -5.802  1.00 0.00 ? 42 ALA A HB1  12 
ATOM   8919  H HB2  . ALA A 1 42 ? 8.683   1.645   -4.598  1.00 0.00 ? 42 ALA A HB2  12 
ATOM   8920  H HB3  . ALA A 1 42 ? 9.303   3.288   -4.771  1.00 0.00 ? 42 ALA A HB3  12 
ATOM   8921  N N    . SER A 1 43 ? 5.945   1.587   -7.037  1.00 0.00 ? 43 SER A N    12 
ATOM   8922  C CA   . SER A 1 43 ? 5.090   0.477   -7.436  1.00 0.00 ? 43 SER A CA   12 
ATOM   8923  C C    . SER A 1 43 ? 3.756   0.982   -7.985  1.00 0.00 ? 43 SER A C    12 
ATOM   8924  O O    . SER A 1 43 ? 2.748   0.278   -7.922  1.00 0.00 ? 43 SER A O    12 
ATOM   8925  C CB   . SER A 1 43 ? 4.846   -0.455  -6.250  1.00 0.00 ? 43 SER A CB   12 
ATOM   8926  O OG   . SER A 1 43 ? 4.441   -1.742  -6.685  1.00 0.00 ? 43 SER A OG   12 
ATOM   8927  H H    . SER A 1 43 ? 5.569   2.490   -7.003  1.00 0.00 ? 43 SER A H    12 
ATOM   8928  H HA   . SER A 1 43 ? 5.601   -0.070  -8.212  1.00 0.00 ? 43 SER A HA   12 
ATOM   8929  H HB2  . SER A 1 43 ? 5.757   -0.554  -5.678  1.00 0.00 ? 43 SER A HB2  12 
ATOM   8930  H HB3  . SER A 1 43 ? 4.071   -0.041  -5.622  1.00 0.00 ? 43 SER A HB3  12 
ATOM   8931  H HG   . SER A 1 43 ? 3.768   -1.653  -7.363  1.00 0.00 ? 43 SER A HG   12 
ATOM   8932  N N    . VAL A 1 44 ? 3.755   2.198   -8.530  1.00 0.00 ? 44 VAL A N    12 
ATOM   8933  C CA   . VAL A 1 44 ? 2.549   2.781   -9.095  1.00 0.00 ? 44 VAL A CA   12 
ATOM   8934  C C    . VAL A 1 44 ? 2.649   2.841   -10.608 1.00 0.00 ? 44 VAL A C    12 
ATOM   8935  O O    . VAL A 1 44 ? 2.316   3.845   -11.238 1.00 0.00 ? 44 VAL A O    12 
ATOM   8936  C CB   . VAL A 1 44 ? 2.267   4.192   -8.529  1.00 0.00 ? 44 VAL A CB   12 
ATOM   8937  C CG1  . VAL A 1 44 ? 3.307   5.195   -9.013  1.00 0.00 ? 44 VAL A CG1  12 
ATOM   8938  C CG2  . VAL A 1 44 ? 0.861   4.642   -8.902  1.00 0.00 ? 44 VAL A CG2  12 
ATOM   8939  H H    . VAL A 1 44 ? 4.580   2.709   -8.563  1.00 0.00 ? 44 VAL A H    12 
ATOM   8940  H HA   . VAL A 1 44 ? 1.730   2.135   -8.837  1.00 0.00 ? 44 VAL A HA   12 
ATOM   8941  H HB   . VAL A 1 44 ? 2.327   4.143   -7.452  1.00 0.00 ? 44 VAL A HB   12 
ATOM   8942  H HG11 . VAL A 1 44 ? 3.904   4.749   -9.795  1.00 0.00 ? 44 VAL A HG11 12 
ATOM   8943  H HG12 . VAL A 1 44 ? 3.947   5.474   -8.190  1.00 0.00 ? 44 VAL A HG12 12 
ATOM   8944  H HG13 . VAL A 1 44 ? 2.810   6.074   -9.397  1.00 0.00 ? 44 VAL A HG13 12 
ATOM   8945  H HG21 . VAL A 1 44 ? 0.146   4.172   -8.243  1.00 0.00 ? 44 VAL A HG21 12 
ATOM   8946  H HG22 . VAL A 1 44 ? 0.649   4.360   -9.922  1.00 0.00 ? 44 VAL A HG22 12 
ATOM   8947  H HG23 . VAL A 1 44 ? 0.789   5.716   -8.803  1.00 0.00 ? 44 VAL A HG23 12 
ATOM   8948  N N    . THR A 1 45 ? 3.112   1.743   -11.173 1.00 0.00 ? 45 THR A N    12 
ATOM   8949  C CA   . THR A 1 45 ? 3.270   1.623   -12.613 1.00 0.00 ? 45 THR A CA   12 
ATOM   8950  C C    . THR A 1 45 ? 4.194   2.711   -13.152 1.00 0.00 ? 45 THR A C    12 
ATOM   8951  O O    . THR A 1 45 ? 4.539   3.655   -12.441 1.00 0.00 ? 45 THR A O    12 
ATOM   8952  C CB   . THR A 1 45 ? 1.906   1.712   -13.289 1.00 0.00 ? 45 THR A CB   12 
ATOM   8953  O OG1  . THR A 1 45 ? 0.962   0.890   -12.625 1.00 0.00 ? 45 THR A OG1  12 
ATOM   8954  C CG2  . THR A 1 45 ? 1.922   1.307   -14.747 1.00 0.00 ? 45 THR A CG2  12 
ATOM   8955  H H    . THR A 1 45 ? 3.348   0.992   -10.599 1.00 0.00 ? 45 THR A H    12 
ATOM   8956  H HA   . THR A 1 45 ? 3.705   0.659   -12.822 1.00 0.00 ? 45 THR A HA   12 
ATOM   8957  H HB   . THR A 1 45 ? 1.567   2.730   -13.231 1.00 0.00 ? 45 THR A HB   12 
ATOM   8958  H HG1  . THR A 1 45 ? 0.082   1.077   -12.960 1.00 0.00 ? 45 THR A HG1  12 
ATOM   8959  H HG21 . THR A 1 45 ? 0.919   1.061   -15.063 1.00 0.00 ? 45 THR A HG21 12 
ATOM   8960  H HG22 . THR A 1 45 ? 2.561   0.446   -14.874 1.00 0.00 ? 45 THR A HG22 12 
ATOM   8961  H HG23 . THR A 1 45 ? 2.298   2.124   -15.343 1.00 0.00 ? 45 THR A HG23 12 
ATOM   8962  N N    . ASN A 1 46 ? 4.583   2.574   -14.413 1.00 0.00 ? 46 ASN A N    12 
ATOM   8963  C CA   . ASN A 1 46 ? 5.461   3.543   -15.055 1.00 0.00 ? 46 ASN A CA   12 
ATOM   8964  C C    . ASN A 1 46 ? 5.499   3.320   -16.564 1.00 0.00 ? 46 ASN A C    12 
ATOM   8965  O O    . ASN A 1 46 ? 6.274   2.501   -17.059 1.00 0.00 ? 46 ASN A O    12 
ATOM   8966  C CB   . ASN A 1 46 ? 6.874   3.445   -14.478 1.00 0.00 ? 46 ASN A CB   12 
ATOM   8967  C CG   . ASN A 1 46 ? 7.585   4.785   -14.465 1.00 0.00 ? 46 ASN A CG   12 
ATOM   8968  O OD1  . ASN A 1 46 ? 7.661   5.450   -13.433 1.00 0.00 ? 46 ASN A OD1  12 
ATOM   8969  N ND2  . ASN A 1 46 ? 8.113   5.185   -15.616 1.00 0.00 ? 46 ASN A ND2  12 
ATOM   8970  H H    . ASN A 1 46 ? 4.269   1.807   -14.927 1.00 0.00 ? 46 ASN A H    12 
ATOM   8971  H HA   . ASN A 1 46 ? 5.067   4.526   -14.854 1.00 0.00 ? 46 ASN A HA   12 
ATOM   8972  H HB2  . ASN A 1 46 ? 6.819   3.078   -13.465 1.00 0.00 ? 46 ASN A HB2  12 
ATOM   8973  H HB3  . ASN A 1 46 ? 7.453   2.756   -15.076 1.00 0.00 ? 46 ASN A HB3  12 
ATOM   8974  H HD21 . ASN A 1 46 ? 8.015   4.603   -16.398 1.00 0.00 ? 46 ASN A HD21 12 
ATOM   8975  H HD22 . ASN A 1 46 ? 8.578   6.047   -15.637 1.00 0.00 ? 46 ASN A HD22 12 
ATOM   8976  N N    . SER A 1 47 ? 4.656   4.049   -17.292 1.00 0.00 ? 47 SER A N    12 
ATOM   8977  C CA   . SER A 1 47 ? 4.595   3.923   -18.743 1.00 0.00 ? 47 SER A CA   12 
ATOM   8978  C C    . SER A 1 47 ? 4.171   2.514   -19.143 1.00 0.00 ? 47 SER A C    12 
ATOM   8979  O O    . SER A 1 47 ? 4.997   1.605   -19.206 1.00 0.00 ? 47 SER A O    12 
ATOM   8980  C CB   . SER A 1 47 ? 5.951   4.258   -19.367 1.00 0.00 ? 47 SER A CB   12 
ATOM   8981  O OG   . SER A 1 47 ? 6.109   5.658   -19.522 1.00 0.00 ? 47 SER A OG   12 
ATOM   8982  H H    . SER A 1 47 ? 4.059   4.683   -16.843 1.00 0.00 ? 47 SER A H    12 
ATOM   8983  H HA   . SER A 1 47 ? 3.858   4.623   -19.104 1.00 0.00 ? 47 SER A HA   12 
ATOM   8984  H HB2  . SER A 1 47 ? 6.741   3.888   -18.732 1.00 0.00 ? 47 SER A HB2  12 
ATOM   8985  H HB3  . SER A 1 47 ? 6.022   3.792   -20.340 1.00 0.00 ? 47 SER A HB3  12 
ATOM   8986  H HG   . SER A 1 47 ? 7.043   5.876   -19.535 1.00 0.00 ? 47 SER A HG   12 
ATOM   8987  N N    . VAL A 1 48 ? 2.878   2.349   -19.419 1.00 0.00 ? 48 VAL A N    12 
ATOM   8988  C CA   . VAL A 1 48 ? 2.315   1.068   -19.822 1.00 0.00 ? 48 VAL A CA   12 
ATOM   8989  C C    . VAL A 1 48 ? 0.799   1.121   -19.763 1.00 0.00 ? 48 VAL A C    12 
ATOM   8990  O O    . VAL A 1 48 ? 0.196   1.015   -18.695 1.00 0.00 ? 48 VAL A O    12 
ATOM   8991  C CB   . VAL A 1 48 ? 2.781   -0.112  -18.953 1.00 0.00 ? 48 VAL A CB   12 
ATOM   8992  C CG1  . VAL A 1 48 ? 4.027   -0.763  -19.538 1.00 0.00 ? 48 VAL A CG1  12 
ATOM   8993  C CG2  . VAL A 1 48 ? 3.011   0.321   -17.511 1.00 0.00 ? 48 VAL A CG2  12 
ATOM   8994  H H    . VAL A 1 48 ? 2.279   3.120   -19.358 1.00 0.00 ? 48 VAL A H    12 
ATOM   8995  H HA   . VAL A 1 48 ? 2.616   0.879   -20.840 1.00 0.00 ? 48 VAL A HA   12 
ATOM   8996  H HB   . VAL A 1 48 ? 1.991   -0.843  -18.967 1.00 0.00 ? 48 VAL A HB   12 
ATOM   8997  H HG11 . VAL A 1 48 ? 4.862   -0.607  -18.872 1.00 0.00 ? 48 VAL A HG11 12 
ATOM   8998  H HG12 . VAL A 1 48 ? 4.247   -0.322  -20.500 1.00 0.00 ? 48 VAL A HG12 12 
ATOM   8999  H HG13 . VAL A 1 48 ? 3.855   -1.823  -19.659 1.00 0.00 ? 48 VAL A HG13 12 
ATOM   9000  H HG21 . VAL A 1 48 ? 4.020   0.690   -17.402 1.00 0.00 ? 48 VAL A HG21 12 
ATOM   9001  H HG22 . VAL A 1 48 ? 2.862   -0.524  -16.855 1.00 0.00 ? 48 VAL A HG22 12 
ATOM   9002  H HG23 . VAL A 1 48 ? 2.311   1.103   -17.255 1.00 0.00 ? 48 VAL A HG23 12 
ATOM   9003  N N    . LYS A 1 49 ? 0.200   1.287   -20.922 1.00 0.00 ? 49 LYS A N    12 
ATOM   9004  C CA   . LYS A 1 49 ? -1.253  1.361   -21.041 1.00 0.00 ? 49 LYS A CA   12 
ATOM   9005  C C    . LYS A 1 49 ? -1.792  2.592   -20.319 1.00 0.00 ? 49 LYS A C    12 
ATOM   9006  O O    . LYS A 1 49 ? -2.287  2.498   -19.196 1.00 0.00 ? 49 LYS A O    12 
ATOM   9007  C CB   . LYS A 1 49 ? -1.899  0.094   -20.473 1.00 0.00 ? 49 LYS A CB   12 
ATOM   9008  C CG   . LYS A 1 49 ? -2.310  -0.909  -21.540 1.00 0.00 ? 49 LYS A CG   12 
ATOM   9009  C CD   . LYS A 1 49 ? -3.320  -1.909  -21.002 1.00 0.00 ? 49 LYS A CD   12 
ATOM   9010  C CE   . LYS A 1 49 ? -2.646  -3.198  -20.558 1.00 0.00 ? 49 LYS A CE   12 
ATOM   9011  N NZ   . LYS A 1 49 ? -3.499  -4.390  -20.819 1.00 0.00 ? 49 LYS A NZ   12 
ATOM   9012  H H    . LYS A 1 49 ? 0.753   1.365   -21.718 1.00 0.00 ? 49 LYS A H    12 
ATOM   9013  H HA   . LYS A 1 49 ? -1.495  1.440   -22.090 1.00 0.00 ? 49 LYS A HA   12 
ATOM   9014  H HB2  . LYS A 1 49 ? -1.198  -0.387  -19.809 1.00 0.00 ? 49 LYS A HB2  12 
ATOM   9015  H HB3  . LYS A 1 49 ? -2.780  0.372   -19.913 1.00 0.00 ? 49 LYS A HB3  12 
ATOM   9016  H HG2  . LYS A 1 49 ? -2.752  -0.378  -22.369 1.00 0.00 ? 49 LYS A HG2  12 
ATOM   9017  H HG3  . LYS A 1 49 ? -1.432  -1.441  -21.875 1.00 0.00 ? 49 LYS A HG3  12 
ATOM   9018  H HD2  . LYS A 1 49 ? -3.831  -1.473  -20.158 1.00 0.00 ? 49 LYS A HD2  12 
ATOM   9019  H HD3  . LYS A 1 49 ? -4.034  -2.137  -21.780 1.00 0.00 ? 49 LYS A HD3  12 
ATOM   9020  H HE2  . LYS A 1 49 ? -1.716  -3.306  -21.095 1.00 0.00 ? 49 LYS A HE2  12 
ATOM   9021  H HE3  . LYS A 1 49 ? -2.443  -3.135  -19.498 1.00 0.00 ? 49 LYS A HE3  12 
ATOM   9022  H HZ1  . LYS A 1 49 ? -4.489  -4.181  -20.578 1.00 0.00 ? 49 LYS A HZ1  12 
ATOM   9023  H HZ2  . LYS A 1 49 ? -3.175  -5.194  -20.244 1.00 0.00 ? 49 LYS A HZ2  12 
ATOM   9024  H HZ3  . LYS A 1 49 ? -3.446  -4.652  -21.824 1.00 0.00 ? 49 LYS A HZ3  12 
HETATM 9025  N N    . CY1 A 1 50 ? -1.598  3.745   -20.958 1.00 0.00 ? 50 CY1 A N    12 
HETATM 9026  C CA   . CY1 A 1 50 ? -2.093  5.018   -20.431 1.00 0.00 ? 50 CY1 A CA   12 
HETATM 9027  C CB   . CY1 A 1 50 ? -1.163  6.140   -20.915 1.00 0.00 ? 50 CY1 A CB   12 
HETATM 9028  S SG   . CY1 A 1 50 ? -1.187  7.506   -19.736 1.00 0.00 ? 50 CY1 A SG   12 
HETATM 9029  C CD   . CY1 A 1 50 ? 0.528   8.284   -19.941 1.00 0.00 ? 50 CY1 A CD   12 
HETATM 9030  N NE   . CY1 A 1 50 ? 0.334   9.717   -19.765 1.00 0.00 ? 50 CY1 A NE   12 
HETATM 9031  C CZ   . CY1 A 1 50 ? 1.337   10.600  -19.831 1.00 0.00 ? 50 CY1 A CZ   12 
HETATM 9032  O OAC  . CY1 A 1 50 ? 2.471   10.234  -20.043 1.00 0.00 ? 50 CY1 A OAC  12 
HETATM 9033  C CM   . CY1 A 1 50 ? 0.964   12.039  -19.622 1.00 0.00 ? 50 CY1 A CM   12 
HETATM 9034  C C    . CY1 A 1 50 ? -3.557  5.277   -20.779 1.00 0.00 ? 50 CY1 A C    12 
HETATM 9035  O O    . CY1 A 1 50 ? -4.117  4.770   -21.723 1.00 0.00 ? 50 CY1 A O    12 
HETATM 9036  H H    . CY1 A 1 50 ? -1.344  3.702   -21.928 1.00 0.00 ? 50 CY1 A H    12 
HETATM 9037  H HA   . CY1 A 1 50 ? -2.052  4.980   -19.338 1.00 0.00 ? 50 CY1 A HA   12 
HETATM 9038  H HB2  . CY1 A 1 50 ? -1.464  6.494   -21.907 1.00 0.00 ? 50 CY1 A HB2  12 
HETATM 9039  H HB3  . CY1 A 1 50 ? -0.138  5.765   -20.967 1.00 0.00 ? 50 CY1 A HB3  12 
HETATM 9040  H HD2  . CY1 A 1 50 ? 1.197   8.160   -20.866 1.00 0.00 ? 50 CY1 A HD2  12 
HETATM 9041  H HD3  . CY1 A 1 50 ? 1.145   7.939   -19.095 1.00 0.00 ? 50 CY1 A HD3  12 
HETATM 9042  H HE   . CY1 A 1 50 ? -0.599  10.043  -19.584 1.00 0.00 ? 50 CY1 A HE   12 
HETATM 9043  H HM1  . CY1 A 1 50 ? 0.238   12.136  -18.813 1.00 0.00 ? 50 CY1 A HM1  12 
HETATM 9044  H HM2  . CY1 A 1 50 ? 0.533   12.447  -20.538 1.00 0.00 ? 50 CY1 A HM2  12 
HETATM 9045  H HM3  . CY1 A 1 50 ? 1.856   12.613  -19.364 1.00 0.00 ? 50 CY1 A HM3  12 
HETATM 9046  N N    . NH2 A 1 51 ? -4.232  6.139   -20.024 1.00 0.00 ? 51 NH2 A N    12 
HETATM 9047  H HN1  . NH2 A 1 51 ? -3.777  6.621   -19.268 1.00 0.00 ? 51 NH2 A HN1  12 
HETATM 9048  H HN2  . NH2 A 1 51 ? -5.194  6.306   -20.260 1.00 0.00 ? 51 NH2 A HN2  12 
ATOM   9049  N N    . LEU A 1 1  ? 1.653   -6.501  16.005  1.00 0.00 ? 1  LEU A N    13 
ATOM   9050  C CA   . LEU A 1 1  ? 0.221   -6.290  16.346  1.00 0.00 ? 1  LEU A CA   13 
ATOM   9051  C C    . LEU A 1 1  ? -0.643  -7.440  15.839  1.00 0.00 ? 1  LEU A C    13 
ATOM   9052  O O    . LEU A 1 1  ? -0.131  -8.436  15.329  1.00 0.00 ? 1  LEU A O    13 
ATOM   9053  C CB   . LEU A 1 1  ? -0.238  -4.968  15.724  1.00 0.00 ? 1  LEU A CB   13 
ATOM   9054  C CG   . LEU A 1 1  ? 0.006   -4.841  14.219  1.00 0.00 ? 1  LEU A CG   13 
ATOM   9055  C CD1  . LEU A 1 1  ? -1.209  -4.241  13.527  1.00 0.00 ? 1  LEU A CD1  13 
ATOM   9056  C CD2  . LEU A 1 1  ? 1.245   -4.000  13.947  1.00 0.00 ? 1  LEU A CD2  13 
ATOM   9057  H H1   . LEU A 1 1  ? 1.937   -7.424  16.391  1.00 0.00 ? 1  LEU A H1   13 
ATOM   9058  H H2   . LEU A 1 1  ? 2.199   -5.728  16.436  1.00 0.00 ? 1  LEU A H2   13 
ATOM   9059  H H3   . LEU A 1 1  ? 1.737   -6.488  14.969  1.00 0.00 ? 1  LEU A H3   13 
ATOM   9060  H HA   . LEU A 1 1  ? 0.130   -6.227  17.420  1.00 0.00 ? 1  LEU A HA   13 
ATOM   9061  H HB2  . LEU A 1 1  ? -1.296  -4.857  15.909  1.00 0.00 ? 1  LEU A HB2  13 
ATOM   9062  H HB3  . LEU A 1 1  ? 0.284   -4.162  16.220  1.00 0.00 ? 1  LEU A HB3  13 
ATOM   9063  H HG   . LEU A 1 1  ? 0.172   -5.825  13.804  1.00 0.00 ? 1  LEU A HG   13 
ATOM   9064  H HD11 . LEU A 1 1  ? -1.199  -4.510  12.483  1.00 0.00 ? 1  LEU A HD11 13 
ATOM   9065  H HD12 . LEU A 1 1  ? -1.182  -3.165  13.623  1.00 0.00 ? 1  LEU A HD12 13 
ATOM   9066  H HD13 . LEU A 1 1  ? -2.109  -4.620  13.989  1.00 0.00 ? 1  LEU A HD13 13 
ATOM   9067  H HD21 . LEU A 1 1  ? 1.061   -2.980  14.250  1.00 0.00 ? 1  LEU A HD21 13 
ATOM   9068  H HD22 . LEU A 1 1  ? 1.473   -4.025  12.892  1.00 0.00 ? 1  LEU A HD22 13 
ATOM   9069  H HD23 . LEU A 1 1  ? 2.079   -4.397  14.506  1.00 0.00 ? 1  LEU A HD23 13 
ATOM   9070  N N    . GLN A 1 2  ? -1.957  -7.298  15.986  1.00 0.00 ? 2  GLN A N    13 
ATOM   9071  C CA   . GLN A 1 2  ? -2.892  -8.328  15.545  1.00 0.00 ? 2  GLN A CA   13 
ATOM   9072  C C    . GLN A 1 2  ? -2.967  -8.382  14.022  1.00 0.00 ? 2  GLN A C    13 
ATOM   9073  O O    . GLN A 1 2  ? -3.083  -7.350  13.360  1.00 0.00 ? 2  GLN A O    13 
ATOM   9074  C CB   . GLN A 1 2  ? -4.281  -8.067  16.128  1.00 0.00 ? 2  GLN A CB   13 
ATOM   9075  C CG   . GLN A 1 2  ? -4.349  -8.242  17.636  1.00 0.00 ? 2  GLN A CG   13 
ATOM   9076  C CD   . GLN A 1 2  ? -5.141  -7.142  18.317  1.00 0.00 ? 2  GLN A CD   13 
ATOM   9077  O OE1  . GLN A 1 2  ? -6.350  -7.261  18.512  1.00 0.00 ? 2  GLN A OE1  13 
ATOM   9078  N NE2  . GLN A 1 2  ? -4.460  -6.060  18.680  1.00 0.00 ? 2  GLN A NE2  13 
ATOM   9079  H H    . GLN A 1 2  ? -2.306  -6.484  16.402  1.00 0.00 ? 2  GLN A H    13 
ATOM   9080  H HA   . GLN A 1 2  ? -2.532  -9.279  15.908  1.00 0.00 ? 2  GLN A HA   13 
ATOM   9081  H HB2  . GLN A 1 2  ? -4.574  -7.054  15.891  1.00 0.00 ? 2  GLN A HB2  13 
ATOM   9082  H HB3  . GLN A 1 2  ? -4.983  -8.751  15.675  1.00 0.00 ? 2  GLN A HB3  13 
ATOM   9083  H HG2  . GLN A 1 2  ? -4.821  -9.189  17.854  1.00 0.00 ? 2  GLN A HG2  13 
ATOM   9084  H HG3  . GLN A 1 2  ? -3.345  -8.241  18.032  1.00 0.00 ? 2  GLN A HG3  13 
ATOM   9085  H HE21 . GLN A 1 2  ? -3.498  -6.033  18.492  1.00 0.00 ? 2  GLN A HE21 13 
ATOM   9086  H HE22 . GLN A 1 2  ? -4.947  -5.333  19.122  1.00 0.00 ? 2  GLN A HE22 13 
ATOM   9087  N N    . MET A 1 3  ? -2.898  -9.596  13.474  1.00 0.00 ? 3  MET A N    13 
ATOM   9088  C CA   . MET A 1 3  ? -2.957  -9.804  12.025  1.00 0.00 ? 3  MET A CA   13 
ATOM   9089  C C    . MET A 1 3  ? -1.625  -9.501  11.354  1.00 0.00 ? 3  MET A C    13 
ATOM   9090  O O    . MET A 1 3  ? -1.454  -9.751  10.161  1.00 0.00 ? 3  MET A O    13 
ATOM   9091  C CB   . MET A 1 3  ? -4.062  -8.953  11.397  1.00 0.00 ? 3  MET A CB   13 
ATOM   9092  C CG   . MET A 1 3  ? -4.490  -9.428  10.017  1.00 0.00 ? 3  MET A CG   13 
ATOM   9093  S SD   . MET A 1 3  ? -5.094  -11.127 10.022  1.00 0.00 ? 3  MET A SD   13 
ATOM   9094  C CE   . MET A 1 3  ? -6.556  -10.965 11.044  1.00 0.00 ? 3  MET A CE   13 
ATOM   9095  H H    . MET A 1 3  ? -2.805  -10.375 14.062  1.00 0.00 ? 3  MET A H    13 
ATOM   9096  H HA   . MET A 1 3  ? -3.176  -10.839 11.858  1.00 0.00 ? 3  MET A HA   13 
ATOM   9097  H HB2  . MET A 1 3  ? -4.925  -8.971  12.044  1.00 0.00 ? 3  MET A HB2  13 
ATOM   9098  H HB3  . MET A 1 3  ? -3.709  -7.937  11.310  1.00 0.00 ? 3  MET A HB3  13 
ATOM   9099  H HG2  . MET A 1 3  ? -5.277  -8.783  9.657   1.00 0.00 ? 3  MET A HG2  13 
ATOM   9100  H HG3  . MET A 1 3  ? -3.642  -9.364  9.350   1.00 0.00 ? 3  MET A HG3  13 
ATOM   9101  H HE1  . MET A 1 3  ? -6.315  -10.396 11.929  1.00 0.00 ? 3  MET A HE1  13 
ATOM   9102  H HE2  . MET A 1 3  ? -6.906  -11.945 11.330  1.00 0.00 ? 3  MET A HE2  13 
ATOM   9103  H HE3  . MET A 1 3  ? -7.329  -10.454 10.488  1.00 0.00 ? 3  MET A HE3  13 
ATOM   9104  N N    . ALA A 1 4  ? -0.685  -8.970  12.116  1.00 0.00 ? 4  ALA A N    13 
ATOM   9105  C CA   . ALA A 1 4  ? 0.623   -8.649  11.581  1.00 0.00 ? 4  ALA A CA   13 
ATOM   9106  C C    . ALA A 1 4  ? 1.484   -9.905  11.458  1.00 0.00 ? 4  ALA A C    13 
ATOM   9107  O O    . ALA A 1 4  ? 2.520   -10.026 12.112  1.00 0.00 ? 4  ALA A O    13 
ATOM   9108  C CB   . ALA A 1 4  ? 1.289   -7.627  12.478  1.00 0.00 ? 4  ALA A CB   13 
ATOM   9109  H H    . ALA A 1 4  ? -0.872  -8.791  13.061  1.00 0.00 ? 4  ALA A H    13 
ATOM   9110  H HA   . ALA A 1 4  ? 0.488   -8.208  10.603  1.00 0.00 ? 4  ALA A HA   13 
ATOM   9111  H HB1  . ALA A 1 4  ? 0.833   -7.669  13.457  1.00 0.00 ? 4  ALA A HB1  13 
ATOM   9112  H HB2  . ALA A 1 4  ? 1.156   -6.641  12.060  1.00 0.00 ? 4  ALA A HB2  13 
ATOM   9113  H HB3  . ALA A 1 4  ? 2.342   -7.849  12.560  1.00 0.00 ? 4  ALA A HB3  13 
ATOM   9114  N N    . GLY A 1 5  ? 1.048   -10.844 10.619  1.00 0.00 ? 5  GLY A N    13 
ATOM   9115  C CA   . GLY A 1 5  ? 1.793   -12.078 10.436  1.00 0.00 ? 5  GLY A CA   13 
ATOM   9116  C C    . GLY A 1 5  ? 1.125   -13.027 9.459   1.00 0.00 ? 5  GLY A C    13 
ATOM   9117  O O    . GLY A 1 5  ? 1.289   -14.244 9.556   1.00 0.00 ? 5  GLY A O    13 
ATOM   9118  H H    . GLY A 1 5  ? 0.215   -10.699 10.122  1.00 0.00 ? 5  GLY A H    13 
ATOM   9119  H HA2  . GLY A 1 5  ? 2.780   -11.838 10.068  1.00 0.00 ? 5  GLY A HA2  13 
ATOM   9120  H HA3  . GLY A 1 5  ? 1.886   -12.573 11.393  1.00 0.00 ? 5  GLY A HA3  13 
ATOM   9121  N N    . GLN A 1 6  ? 0.381   -12.472 8.506   1.00 0.00 ? 6  GLN A N    13 
ATOM   9122  C CA   . GLN A 1 6  ? -0.300  -13.269 7.503   1.00 0.00 ? 6  GLN A CA   13 
ATOM   9123  C C    . GLN A 1 6  ? -1.027  -12.359 6.527   1.00 0.00 ? 6  GLN A C    13 
ATOM   9124  O O    . GLN A 1 6  ? -2.256  -12.304 6.492   1.00 0.00 ? 6  GLN A O    13 
ATOM   9125  C CB   . GLN A 1 6  ? -1.289  -14.258 8.161   1.00 0.00 ? 6  GLN A CB   13 
ATOM   9126  C CG   . GLN A 1 6  ? -2.217  -13.594 9.165   1.00 0.00 ? 6  GLN A CG   13 
ATOM   9127  C CD   . GLN A 1 6  ? -2.472  -14.462 10.382  1.00 0.00 ? 6  GLN A CD   13 
ATOM   9128  O OE1  . GLN A 1 6  ? -1.653  -15.311 10.736  1.00 0.00 ? 6  GLN A OE1  13 
ATOM   9129  N NE2  . GLN A 1 6  ? -3.613  -14.255 11.029  1.00 0.00 ? 6  GLN A NE2  13 
ATOM   9130  H H    . GLN A 1 6  ? 0.298   -11.503 8.470   1.00 0.00 ? 6  GLN A H    13 
ATOM   9131  H HA   . GLN A 1 6  ? 0.463   -13.801 6.952   1.00 0.00 ? 6  GLN A HA   13 
ATOM   9132  H HB2  . GLN A 1 6  ? -1.904  -14.715 7.393   1.00 0.00 ? 6  GLN A HB2  13 
ATOM   9133  H HB3  . GLN A 1 6  ? -0.738  -15.035 8.680   1.00 0.00 ? 6  GLN A HB3  13 
ATOM   9134  H HG2  . GLN A 1 6  ? -1.771  -12.667 9.491   1.00 0.00 ? 6  GLN A HG2  13 
ATOM   9135  H HG3  . GLN A 1 6  ? -3.161  -13.390 8.683   1.00 0.00 ? 6  GLN A HG3  13 
ATOM   9136  H HE21 . GLN A 1 6  ? -4.218  -13.563 10.689  1.00 0.00 ? 6  GLN A HE21 13 
ATOM   9137  H HE22 . GLN A 1 6  ? -3.803  -14.802 11.819  1.00 0.00 ? 6  GLN A HE22 13 
ATOM   9138  N N    . CYS A 1 7  ? -0.238  -11.643 5.746   1.00 0.00 ? 7  CYS A N    13 
ATOM   9139  C CA   . CYS A 1 7  ? -0.762  -10.711 4.758   1.00 0.00 ? 7  CYS A CA   13 
ATOM   9140  C C    . CYS A 1 7  ? 0.160   -10.630 3.554   1.00 0.00 ? 7  CYS A C    13 
ATOM   9141  O O    . CYS A 1 7  ? 1.382   -10.658 3.701   1.00 0.00 ? 7  CYS A O    13 
ATOM   9142  C CB   . CYS A 1 7  ? -0.903  -9.321  5.376   1.00 0.00 ? 7  CYS A CB   13 
ATOM   9143  S SG   . CYS A 1 7  ? -1.830  -9.305  6.943   1.00 0.00 ? 7  CYS A SG   13 
ATOM   9144  H H    . CYS A 1 7  ? 0.731   -11.742 5.844   1.00 0.00 ? 7  CYS A H    13 
ATOM   9145  H HA   . CYS A 1 7  ? -1.732  -11.061 4.443   1.00 0.00 ? 7  CYS A HA   13 
ATOM   9146  H HB2  . CYS A 1 7  ? 0.083   -8.919  5.569   1.00 0.00 ? 7  CYS A HB2  13 
ATOM   9147  H HB3  . CYS A 1 7  ? -1.413  -8.672  4.679   1.00 0.00 ? 7  CYS A HB3  13 
ATOM   9148  N N    . SER A 1 8  ? -0.417  -10.505 2.361   1.00 0.00 ? 8  SER A N    13 
ATOM   9149  C CA   . SER A 1 8  ? 0.394   -10.389 1.159   1.00 0.00 ? 8  SER A CA   13 
ATOM   9150  C C    . SER A 1 8  ? 1.389   -9.258  1.342   1.00 0.00 ? 8  SER A C    13 
ATOM   9151  O O    . SER A 1 8  ? 1.070   -8.232  1.938   1.00 0.00 ? 8  SER A O    13 
ATOM   9152  C CB   . SER A 1 8  ? -0.468  -10.135 -0.075  1.00 0.00 ? 8  SER A CB   13 
ATOM   9153  O OG   . SER A 1 8  ? -1.562  -11.033 -0.132  1.00 0.00 ? 8  SER A OG   13 
ATOM   9154  H H    . SER A 1 8  ? -1.393  -10.470 2.294   1.00 0.00 ? 8  SER A H    13 
ATOM   9155  H HA   . SER A 1 8  ? 0.936   -11.313 1.033   1.00 0.00 ? 8  SER A HA   13 
ATOM   9156  H HB2  . SER A 1 8  ? -0.846  -9.124  -0.047  1.00 0.00 ? 8  SER A HB2  13 
ATOM   9157  H HB3  . SER A 1 8  ? 0.140   -10.267 -0.959  1.00 0.00 ? 8  SER A HB3  13 
ATOM   9158  H HG   . SER A 1 8  ? -2.319  -10.645 0.313   1.00 0.00 ? 8  SER A HG   13 
ATOM   9159  N N    . GLN A 1 9  ? 2.597   -9.458  0.856   1.00 0.00 ? 9  GLN A N    13 
ATOM   9160  C CA   . GLN A 1 9  ? 3.649   -8.462  1.003   1.00 0.00 ? 9  GLN A CA   13 
ATOM   9161  C C    . GLN A 1 9  ? 3.154   -7.049  0.754   1.00 0.00 ? 9  GLN A C    13 
ATOM   9162  O O    . GLN A 1 9  ? 2.489   -6.761  -0.241  1.00 0.00 ? 9  GLN A O    13 
ATOM   9163  C CB   . GLN A 1 9  ? 4.830   -8.784  0.085   1.00 0.00 ? 9  GLN A CB   13 
ATOM   9164  C CG   . GLN A 1 9  ? 6.097   -8.020  0.432   1.00 0.00 ? 9  GLN A CG   13 
ATOM   9165  C CD   . GLN A 1 9  ? 6.965   -7.748  -0.781  1.00 0.00 ? 9  GLN A CD   13 
ATOM   9166  O OE1  . GLN A 1 9  ? 7.533   -6.665  -0.923  1.00 0.00 ? 9  GLN A OE1  13 
ATOM   9167  N NE2  . GLN A 1 9  ? 7.072   -8.733  -1.667  1.00 0.00 ? 9  GLN A NE2  13 
ATOM   9168  H H    . GLN A 1 9  ? 2.796   -10.303 0.408   1.00 0.00 ? 9  GLN A H    13 
ATOM   9169  H HA   . GLN A 1 9  ? 3.978   -8.506  2.028   1.00 0.00 ? 9  GLN A HA   13 
ATOM   9170  H HB2  . GLN A 1 9  ? 5.044   -9.841  0.151   1.00 0.00 ? 9  GLN A HB2  13 
ATOM   9171  H HB3  . GLN A 1 9  ? 4.556   -8.543  -0.931  1.00 0.00 ? 9  GLN A HB3  13 
ATOM   9172  H HG2  . GLN A 1 9  ? 5.822   -7.075  0.877   1.00 0.00 ? 9  GLN A HG2  13 
ATOM   9173  H HG3  . GLN A 1 9  ? 6.668   -8.599  1.143   1.00 0.00 ? 9  GLN A HG3  13 
ATOM   9174  H HE21 . GLN A 1 9  ? 6.592   -9.568  -1.489  1.00 0.00 ? 9  GLN A HE21 13 
ATOM   9175  H HE22 . GLN A 1 9  ? 7.627   -8.584  -2.460  1.00 0.00 ? 9  GLN A HE22 13 
ATOM   9176  N N    . ASN A 1 10 ? 3.503   -6.178  1.689   1.00 0.00 ? 10 ASN A N    13 
ATOM   9177  C CA   . ASN A 1 10 ? 3.131   -4.778  1.633   1.00 0.00 ? 10 ASN A CA   13 
ATOM   9178  C C    . ASN A 1 10 ? 1.642   -4.576  1.841   1.00 0.00 ? 10 ASN A C    13 
ATOM   9179  O O    . ASN A 1 10 ? 1.055   -3.638  1.299   1.00 0.00 ? 10 ASN A O    13 
ATOM   9180  C CB   . ASN A 1 10 ? 3.576   -4.151  0.309   1.00 0.00 ? 10 ASN A CB   13 
ATOM   9181  C CG   . ASN A 1 10 ? 4.488   -2.960  0.517   1.00 0.00 ? 10 ASN A CG   13 
ATOM   9182  O OD1  . ASN A 1 10 ? 5.665   -2.999  0.166   1.00 0.00 ? 10 ASN A OD1  13 
ATOM   9183  N ND2  . ASN A 1 10 ? 3.951   -1.892  1.101   1.00 0.00 ? 10 ASN A ND2  13 
ATOM   9184  H H    . ASN A 1 10 ? 4.037   -6.491  2.449   1.00 0.00 ? 10 ASN A H    13 
ATOM   9185  H HA   . ASN A 1 10 ? 3.643   -4.286  2.438   1.00 0.00 ? 10 ASN A HA   13 
ATOM   9186  H HB2  . ASN A 1 10 ? 4.109   -4.892  -0.270  1.00 0.00 ? 10 ASN A HB2  13 
ATOM   9187  H HB3  . ASN A 1 10 ? 2.706   -3.828  -0.244  1.00 0.00 ? 10 ASN A HB3  13 
ATOM   9188  H HD21 . ASN A 1 10 ? 3.008   -1.930  1.364   1.00 0.00 ? 10 ASN A HD21 13 
ATOM   9189  H HD22 . ASN A 1 10 ? 4.523   -1.108  1.246   1.00 0.00 ? 10 ASN A HD22 13 
ATOM   9190  N N    . GLU A 1 11 ? 1.030   -5.439  2.641   1.00 0.00 ? 11 GLU A N    13 
ATOM   9191  C CA   . GLU A 1 11 ? -0.393  -5.284  2.917   1.00 0.00 ? 11 GLU A CA   13 
ATOM   9192  C C    . GLU A 1 11 ? -0.608  -4.225  3.979   1.00 0.00 ? 11 GLU A C    13 
ATOM   9193  O O    . GLU A 1 11 ? 0.182   -4.113  4.917   1.00 0.00 ? 11 GLU A O    13 
ATOM   9194  C CB   . GLU A 1 11 ? -1.056  -6.604  3.309   1.00 0.00 ? 11 GLU A CB   13 
ATOM   9195  C CG   . GLU A 1 11 ? -2.269  -6.930  2.449   1.00 0.00 ? 11 GLU A CG   13 
ATOM   9196  C CD   . GLU A 1 11 ? -2.664  -8.392  2.509   1.00 0.00 ? 11 GLU A CD   13 
ATOM   9197  O OE1  . GLU A 1 11 ? -3.223  -8.817  3.541   1.00 0.00 ? 11 GLU A OE1  13 
ATOM   9198  O OE2  . GLU A 1 11 ? -2.420  -9.113  1.520   1.00 0.00 ? 11 GLU A OE2  13 
ATOM   9199  H H    . GLU A 1 11 ? 1.549   -6.175  3.061   1.00 0.00 ? 11 GLU A H    13 
ATOM   9200  H HA   . GLU A 1 11 ? -0.844  -4.920  2.028   1.00 0.00 ? 11 GLU A HA   13 
ATOM   9201  H HB2  . GLU A 1 11 ? -0.339  -7.403  3.208   1.00 0.00 ? 11 GLU A HB2  13 
ATOM   9202  H HB3  . GLU A 1 11 ? -1.375  -6.545  4.337   1.00 0.00 ? 11 GLU A HB3  13 
ATOM   9203  H HG2  . GLU A 1 11 ? -3.102  -6.336  2.788   1.00 0.00 ? 11 GLU A HG2  13 
ATOM   9204  H HG3  . GLU A 1 11 ? -2.043  -6.674  1.422   1.00 0.00 ? 11 GLU A HG3  13 
ATOM   9205  N N    . TYR A 1 12 ? -1.674  -3.432  3.832   1.00 0.00 ? 12 TYR A N    13 
ATOM   9206  C CA   . TYR A 1 12 ? -1.936  -2.372  4.808   1.00 0.00 ? 12 TYR A CA   13 
ATOM   9207  C C    . TYR A 1 12 ? -3.130  -2.708  5.684   1.00 0.00 ? 12 TYR A C    13 
ATOM   9208  O O    . TYR A 1 12 ? -4.245  -2.891  5.203   1.00 0.00 ? 12 TYR A O    13 
ATOM   9209  C CB   . TYR A 1 12 ? -2.101  -1.004  4.133   1.00 0.00 ? 12 TYR A CB   13 
ATOM   9210  C CG   . TYR A 1 12 ? -3.465  -0.726  3.533   1.00 0.00 ? 12 TYR A CG   13 
ATOM   9211  C CD1  . TYR A 1 12 ? -4.528  -0.325  4.330   1.00 0.00 ? 12 TYR A CD1  13 
ATOM   9212  C CD2  . TYR A 1 12 ? -3.679  -0.842  2.166   1.00 0.00 ? 12 TYR A CD2  13 
ATOM   9213  C CE1  . TYR A 1 12 ? -5.767  -0.053  3.783   1.00 0.00 ? 12 TYR A CE1  13 
ATOM   9214  C CE2  . TYR A 1 12 ? -4.916  -0.572  1.612   1.00 0.00 ? 12 TYR A CE2  13 
ATOM   9215  C CZ   . TYR A 1 12 ? -5.955  -0.179  2.425   1.00 0.00 ? 12 TYR A CZ   13 
ATOM   9216  O OH   . TYR A 1 12 ? -7.188  0.092   1.877   1.00 0.00 ? 12 TYR A OH   13 
ATOM   9217  H H    . TYR A 1 12 ? -2.290  -3.561  3.054   1.00 0.00 ? 12 TYR A H    13 
ATOM   9218  H HA   . TYR A 1 12 ? -1.065  -2.318  5.452   1.00 0.00 ? 12 TYR A HA   13 
ATOM   9219  H HB2  . TYR A 1 12 ? -1.913  -0.240  4.871   1.00 0.00 ? 12 TYR A HB2  13 
ATOM   9220  H HB3  . TYR A 1 12 ? -1.369  -0.916  3.344   1.00 0.00 ? 12 TYR A HB3  13 
ATOM   9221  H HD1  . TYR A 1 12 ? -4.378  -0.230  5.396   1.00 0.00 ? 12 TYR A HD1  13 
ATOM   9222  H HD2  . TYR A 1 12 ? -2.862  -1.148  1.530   1.00 0.00 ? 12 TYR A HD2  13 
ATOM   9223  H HE1  . TYR A 1 12 ? -6.579  0.259   4.420   1.00 0.00 ? 12 TYR A HE1  13 
ATOM   9224  H HE2  . TYR A 1 12 ? -5.064  -0.672  0.547   1.00 0.00 ? 12 TYR A HE2  13 
ATOM   9225  H HH   . TYR A 1 12 ? -7.862  -0.416  2.333   1.00 0.00 ? 12 TYR A HH   13 
ATOM   9226  N N    . PHE A 1 13 ? -2.861  -2.797  6.979   1.00 0.00 ? 13 PHE A N    13 
ATOM   9227  C CA   . PHE A 1 13 ? -3.877  -3.131  7.971   1.00 0.00 ? 13 PHE A CA   13 
ATOM   9228  C C    . PHE A 1 13 ? -4.634  -1.891  8.432   1.00 0.00 ? 13 PHE A C    13 
ATOM   9229  O O    . PHE A 1 13 ? -4.205  -1.196  9.351   1.00 0.00 ? 13 PHE A O    13 
ATOM   9230  C CB   . PHE A 1 13 ? -3.215  -3.813  9.171   1.00 0.00 ? 13 PHE A CB   13 
ATOM   9231  C CG   . PHE A 1 13 ? -4.189  -4.408  10.144  1.00 0.00 ? 13 PHE A CG   13 
ATOM   9232  C CD1  . PHE A 1 13 ? -4.783  -5.634  9.886   1.00 0.00 ? 13 PHE A CD1  13 
ATOM   9233  C CD2  . PHE A 1 13 ? -4.510  -3.744  11.316  1.00 0.00 ? 13 PHE A CD2  13 
ATOM   9234  C CE1  . PHE A 1 13 ? -5.682  -6.184  10.781  1.00 0.00 ? 13 PHE A CE1  13 
ATOM   9235  C CE2  . PHE A 1 13 ? -5.408  -4.288  12.214  1.00 0.00 ? 13 PHE A CE2  13 
ATOM   9236  C CZ   . PHE A 1 13 ? -5.994  -5.510  11.946  1.00 0.00 ? 13 PHE A CZ   13 
ATOM   9237  H H    . PHE A 1 13 ? -1.941  -2.641  7.277   1.00 0.00 ? 13 PHE A H    13 
ATOM   9238  H HA   . PHE A 1 13 ? -4.579  -3.820  7.519   1.00 0.00 ? 13 PHE A HA   13 
ATOM   9239  H HB2  . PHE A 1 13 ? -2.575  -4.606  8.814   1.00 0.00 ? 13 PHE A HB2  13 
ATOM   9240  H HB3  . PHE A 1 13 ? -2.615  -3.086  9.701   1.00 0.00 ? 13 PHE A HB3  13 
ATOM   9241  H HD1  . PHE A 1 13 ? -4.535  -6.162  8.977   1.00 0.00 ? 13 PHE A HD1  13 
ATOM   9242  H HD2  . PHE A 1 13 ? -4.052  -2.789  11.525  1.00 0.00 ? 13 PHE A HD2  13 
ATOM   9243  H HE1  . PHE A 1 13 ? -6.139  -7.139  10.570  1.00 0.00 ? 13 PHE A HE1  13 
ATOM   9244  H HE2  . PHE A 1 13 ? -5.650  -3.760  13.124  1.00 0.00 ? 13 PHE A HE2  13 
ATOM   9245  H HZ   . PHE A 1 13 ? -6.696  -5.938  12.646  1.00 0.00 ? 13 PHE A HZ   13 
ATOM   9246  N N    . ASP A 1 14 ? -5.772  -1.635  7.801   1.00 0.00 ? 14 ASP A N    13 
ATOM   9247  C CA   . ASP A 1 14 ? -6.600  -0.488  8.164   1.00 0.00 ? 14 ASP A CA   13 
ATOM   9248  C C    . ASP A 1 14 ? -7.242  -0.717  9.520   1.00 0.00 ? 14 ASP A C    13 
ATOM   9249  O O    . ASP A 1 14 ? -8.221  -1.444  9.632   1.00 0.00 ? 14 ASP A O    13 
ATOM   9250  C CB   . ASP A 1 14 ? -7.683  -0.240  7.111   1.00 0.00 ? 14 ASP A CB   13 
ATOM   9251  C CG   . ASP A 1 14 ? -7.576  1.137   6.486   1.00 0.00 ? 14 ASP A CG   13 
ATOM   9252  O OD1  . ASP A 1 14 ? -6.439  1.577   6.213   1.00 0.00 ? 14 ASP A OD1  13 
ATOM   9253  O OD2  . ASP A 1 14 ? -8.627  1.775   6.270   1.00 0.00 ? 14 ASP A OD2  13 
ATOM   9254  H H    . ASP A 1 14 ? -6.070  -2.238  7.085   1.00 0.00 ? 14 ASP A H    13 
ATOM   9255  H HA   . ASP A 1 14 ? -5.966  0.385   8.229   1.00 0.00 ? 14 ASP A HA   13 
ATOM   9256  H HB2  . ASP A 1 14 ? -7.595  -0.978  6.332   1.00 0.00 ? 14 ASP A HB2  13 
ATOM   9257  H HB3  . ASP A 1 14 ? -8.655  -0.328  7.572   1.00 0.00 ? 14 ASP A HB3  13 
ATOM   9258  N N    . SER A 1 15 ? -6.689  -0.090  10.549  1.00 0.00 ? 15 SER A N    13 
ATOM   9259  C CA   . SER A 1 15 ? -7.220  -0.235  11.898  1.00 0.00 ? 15 SER A CA   13 
ATOM   9260  C C    . SER A 1 15 ? -8.727  0.004   11.917  1.00 0.00 ? 15 SER A C    13 
ATOM   9261  O O    . SER A 1 15 ? -9.432  -0.479  12.803  1.00 0.00 ? 15 SER A O    13 
ATOM   9262  C CB   . SER A 1 15 ? -6.523  0.733   12.856  1.00 0.00 ? 15 SER A CB   13 
ATOM   9263  O OG   . SER A 1 15 ? -6.606  2.067   12.384  1.00 0.00 ? 15 SER A OG   13 
ATOM   9264  H H    . SER A 1 15 ? -5.907  0.480   10.400  1.00 0.00 ? 15 SER A H    13 
ATOM   9265  H HA   . SER A 1 15 ? -7.028  -1.248  12.218  1.00 0.00 ? 15 SER A HA   13 
ATOM   9266  H HB2  . SER A 1 15 ? -6.995  0.679   13.826  1.00 0.00 ? 15 SER A HB2  13 
ATOM   9267  H HB3  . SER A 1 15 ? -5.482  0.460   12.946  1.00 0.00 ? 15 SER A HB3  13 
ATOM   9268  H HG   . SER A 1 15 ? -7.498  2.243   12.076  1.00 0.00 ? 15 SER A HG   13 
ATOM   9269  N N    . LEU A 1 16 ? -9.217  0.742   10.925  1.00 0.00 ? 16 LEU A N    13 
ATOM   9270  C CA   . LEU A 1 16 ? -10.643 1.029   10.825  1.00 0.00 ? 16 LEU A CA   13 
ATOM   9271  C C    . LEU A 1 16 ? -11.374 -0.123  10.143  1.00 0.00 ? 16 LEU A C    13 
ATOM   9272  O O    . LEU A 1 16 ? -12.557 -0.357  10.388  1.00 0.00 ? 16 LEU A O    13 
ATOM   9273  C CB   . LEU A 1 16 ? -10.872 2.327   10.047  1.00 0.00 ? 16 LEU A CB   13 
ATOM   9274  C CG   . LEU A 1 16 ? -12.329 2.784   9.966   1.00 0.00 ? 16 LEU A CG   13 
ATOM   9275  C CD1  . LEU A 1 16 ? -12.413 4.302   9.939   1.00 0.00 ? 16 LEU A CD1  13 
ATOM   9276  C CD2  . LEU A 1 16 ? -13.008 2.190   8.742   1.00 0.00 ? 16 LEU A CD2  13 
ATOM   9277  H H    . LEU A 1 16 ? -8.607  1.095   10.239  1.00 0.00 ? 16 LEU A H    13 
ATOM   9278  H HA   . LEU A 1 16 ? -11.030 1.145   11.827  1.00 0.00 ? 16 LEU A HA   13 
ATOM   9279  H HB2  . LEU A 1 16 ? -10.296 3.110   10.516  1.00 0.00 ? 16 LEU A HB2  13 
ATOM   9280  H HB3  . LEU A 1 16 ? -10.506 2.187   9.041   1.00 0.00 ? 16 LEU A HB3  13 
ATOM   9281  H HG   . LEU A 1 16 ? -12.857 2.437   10.843  1.00 0.00 ? 16 LEU A HG   13 
ATOM   9282  H HD11 . LEU A 1 16 ? -12.051 4.666   8.988   1.00 0.00 ? 16 LEU A HD11 13 
ATOM   9283  H HD12 . LEU A 1 16 ? -11.806 4.711   10.733  1.00 0.00 ? 16 LEU A HD12 13 
ATOM   9284  H HD13 . LEU A 1 16 ? -13.439 4.609   10.074  1.00 0.00 ? 16 LEU A HD13 13 
ATOM   9285  H HD21 . LEU A 1 16 ? -12.462 1.316   8.415   1.00 0.00 ? 16 LEU A HD21 13 
ATOM   9286  H HD22 . LEU A 1 16 ? -13.023 2.921   7.947   1.00 0.00 ? 16 LEU A HD22 13 
ATOM   9287  H HD23 . LEU A 1 16 ? -14.021 1.908   8.992   1.00 0.00 ? 16 LEU A HD23 13 
ATOM   9288  N N    . LEU A 1 17 ? -10.656 -0.834  9.278   1.00 0.00 ? 17 LEU A N    13 
ATOM   9289  C CA   . LEU A 1 17 ? -11.217 -1.960  8.545   1.00 0.00 ? 17 LEU A CA   13 
ATOM   9290  C C    . LEU A 1 17 ? -10.783 -3.299  9.141   1.00 0.00 ? 17 LEU A C    13 
ATOM   9291  O O    . LEU A 1 17 ? -11.335 -4.342  8.792   1.00 0.00 ? 17 LEU A O    13 
ATOM   9292  C CB   . LEU A 1 17 ? -10.776 -1.881  7.086   1.00 0.00 ? 17 LEU A CB   13 
ATOM   9293  C CG   . LEU A 1 17 ? -11.130 -0.576  6.375   1.00 0.00 ? 17 LEU A CG   13 
ATOM   9294  C CD1  . LEU A 1 17 ? -10.388 -0.469  5.052   1.00 0.00 ? 17 LEU A CD1  13 
ATOM   9295  C CD2  . LEU A 1 17 ? -12.632 -0.479  6.156   1.00 0.00 ? 17 LEU A CD2  13 
ATOM   9296  H H    . LEU A 1 17 ? -9.721  -0.592  9.123   1.00 0.00 ? 17 LEU A H    13 
ATOM   9297  H HA   . LEU A 1 17 ? -12.294 -1.886  8.590   1.00 0.00 ? 17 LEU A HA   13 
ATOM   9298  H HB2  . LEU A 1 17 ? -9.702  -2.004  7.054   1.00 0.00 ? 17 LEU A HB2  13 
ATOM   9299  H HB3  . LEU A 1 17 ? -11.233 -2.697  6.546   1.00 0.00 ? 17 LEU A HB3  13 
ATOM   9300  H HG   . LEU A 1 17 ? -10.827 0.255   6.996   1.00 0.00 ? 17 LEU A HG   13 
ATOM   9301  H HD11 . LEU A 1 17 ? -9.356  -0.208  5.238   1.00 0.00 ? 17 LEU A HD11 13 
ATOM   9302  H HD12 . LEU A 1 17 ? -10.847 0.294   4.442   1.00 0.00 ? 17 LEU A HD12 13 
ATOM   9303  H HD13 . LEU A 1 17 ? -10.432 -1.417  4.537   1.00 0.00 ? 17 LEU A HD13 13 
ATOM   9304  H HD21 . LEU A 1 17 ? -13.147 -0.728  7.072   1.00 0.00 ? 17 LEU A HD21 13 
ATOM   9305  H HD22 . LEU A 1 17 ? -12.928 -1.168  5.378   1.00 0.00 ? 17 LEU A HD22 13 
ATOM   9306  H HD23 . LEU A 1 17 ? -12.889 0.528   5.861   1.00 0.00 ? 17 LEU A HD23 13 
ATOM   9307  N N    . HIS A 1 18 ? -9.772  -3.271  10.015  1.00 0.00 ? 18 HIS A N    13 
ATOM   9308  C CA   . HIS A 1 18 ? -9.249  -4.486  10.633  1.00 0.00 ? 18 HIS A CA   13 
ATOM   9309  C C    . HIS A 1 18 ? -8.995  -5.540  9.577   1.00 0.00 ? 18 HIS A C    13 
ATOM   9310  O O    . HIS A 1 18 ? -9.373  -6.705  9.716   1.00 0.00 ? 18 HIS A O    13 
ATOM   9311  C CB   . HIS A 1 18 ? -10.192 -5.021  11.696  1.00 0.00 ? 18 HIS A CB   13 
ATOM   9312  C CG   . HIS A 1 18 ? -11.580 -5.300  11.209  1.00 0.00 ? 18 HIS A CG   13 
ATOM   9313  N ND1  . HIS A 1 18 ? -12.643 -4.452  11.438  1.00 0.00 ? 18 HIS A ND1  13 
ATOM   9314  C CD2  . HIS A 1 18 ? -12.077 -6.341  10.500  1.00 0.00 ? 18 HIS A CD2  13 
ATOM   9315  C CE1  . HIS A 1 18 ? -13.734 -4.960  10.893  1.00 0.00 ? 18 HIS A CE1  13 
ATOM   9316  N NE2  . HIS A 1 18 ? -13.418 -6.106  10.317  1.00 0.00 ? 18 HIS A NE2  13 
ATOM   9317  H H    . HIS A 1 18 ? -9.351  -2.416  10.232  1.00 0.00 ? 18 HIS A H    13 
ATOM   9318  H HA   . HIS A 1 18 ? -8.306  -4.234  11.098  1.00 0.00 ? 18 HIS A HA   13 
ATOM   9319  H HB2  . HIS A 1 18 ? -9.785  -5.940  12.075  1.00 0.00 ? 18 HIS A HB2  13 
ATOM   9320  H HB3  . HIS A 1 18 ? -10.255 -4.301  12.494  1.00 0.00 ? 18 HIS A HB3  13 
ATOM   9321  H HD1  . HIS A 1 18 ? -12.604 -3.605  11.929  1.00 0.00 ? 18 HIS A HD1  13 
ATOM   9322  H HD2  . HIS A 1 18 ? -11.522 -7.198  10.144  1.00 0.00 ? 18 HIS A HD2  13 
ATOM   9323  H HE1  . HIS A 1 18 ? -14.718 -4.515  10.914  1.00 0.00 ? 18 HIS A HE1  13 
ATOM   9324  H HE2  . HIS A 1 18 ? -14.021 -6.648  9.768   1.00 0.00 ? 18 HIS A HE2  13 
ATOM   9325  N N    . ALA A 1 19 ? -8.354  -5.098  8.521   1.00 0.00 ? 19 ALA A N    13 
ATOM   9326  C CA   . ALA A 1 19 ? -8.028  -5.955  7.397   1.00 0.00 ? 19 ALA A CA   13 
ATOM   9327  C C    . ALA A 1 19 ? -6.798  -5.470  6.661   1.00 0.00 ? 19 ALA A C    13 
ATOM   9328  O O    . ALA A 1 19 ? -6.824  -4.423  6.013   1.00 0.00 ? 19 ALA A O    13 
ATOM   9329  C CB   . ALA A 1 19 ? -9.184  -6.015  6.418   1.00 0.00 ? 19 ALA A CB   13 
ATOM   9330  H H    . ALA A 1 19 ? -8.097  -4.160  8.500   1.00 0.00 ? 19 ALA A H    13 
ATOM   9331  H HA   . ALA A 1 19 ? -7.848  -6.952  7.770   1.00 0.00 ? 19 ALA A HA   13 
ATOM   9332  H HB1  . ALA A 1 19 ? -8.859  -5.616  5.461   1.00 0.00 ? 19 ALA A HB1  13 
ATOM   9333  H HB2  . ALA A 1 19 ? -10.007 -5.426  6.794   1.00 0.00 ? 19 ALA A HB2  13 
ATOM   9334  H HB3  . ALA A 1 19 ? -9.500  -7.039  6.292   1.00 0.00 ? 19 ALA A HB3  13 
ATOM   9335  N N    . CYS A 1 20 ? -5.735  -6.244  6.728   1.00 0.00 ? 20 CYS A N    13 
ATOM   9336  C CA   . CYS A 1 20 ? -4.528  -5.891  6.015   1.00 0.00 ? 20 CYS A CA   13 
ATOM   9337  C C    . CYS A 1 20 ? -4.783  -6.056  4.522   1.00 0.00 ? 20 CYS A C    13 
ATOM   9338  O O    . CYS A 1 20 ? -4.950  -7.167  4.021   1.00 0.00 ? 20 CYS A O    13 
ATOM   9339  C CB   . CYS A 1 20 ? -3.342  -6.735  6.474   1.00 0.00 ? 20 CYS A CB   13 
ATOM   9340  S SG   . CYS A 1 20 ? -3.633  -8.531  6.426   1.00 0.00 ? 20 CYS A SG   13 
ATOM   9341  H H    . CYS A 1 20 ? -5.779  -7.076  7.237   1.00 0.00 ? 20 CYS A H    13 
ATOM   9342  H HA   . CYS A 1 20 ? -4.330  -4.852  6.215   1.00 0.00 ? 20 CYS A HA   13 
ATOM   9343  H HB2  . CYS A 1 20 ? -2.495  -6.525  5.840   1.00 0.00 ? 20 CYS A HB2  13 
ATOM   9344  H HB3  . CYS A 1 20 ? -3.094  -6.470  7.491   1.00 0.00 ? 20 CYS A HB3  13 
ATOM   9345  N N    . ILE A 1 21 ? -4.871  -4.928  3.835   1.00 0.00 ? 21 ILE A N    13 
ATOM   9346  C CA   . ILE A 1 21 ? -5.174  -4.900  2.410   1.00 0.00 ? 21 ILE A CA   13 
ATOM   9347  C C    . ILE A 1 21 ? -4.020  -4.357  1.582   1.00 0.00 ? 21 ILE A C    13 
ATOM   9348  O O    . ILE A 1 21 ? -3.341  -3.424  1.997   1.00 0.00 ? 21 ILE A O    13 
ATOM   9349  C CB   . ILE A 1 21 ? -6.386  -3.990  2.177   1.00 0.00 ? 21 ILE A CB   13 
ATOM   9350  C CG1  . ILE A 1 21 ? -7.574  -4.462  3.018   1.00 0.00 ? 21 ILE A CG1  13 
ATOM   9351  C CG2  . ILE A 1 21 ? -6.766  -3.922  0.702   1.00 0.00 ? 21 ILE A CG2  13 
ATOM   9352  C CD1  . ILE A 1 21 ? -8.462  -3.338  3.504   1.00 0.00 ? 21 ILE A CD1  13 
ATOM   9353  H H    . ILE A 1 21 ? -4.769  -4.080  4.311   1.00 0.00 ? 21 ILE A H    13 
ATOM   9354  H HA   . ILE A 1 21 ? -5.420  -5.896  2.087   1.00 0.00 ? 21 ILE A HA   13 
ATOM   9355  H HB   . ILE A 1 21 ? -6.096  -2.998  2.496   1.00 0.00 ? 21 ILE A HB   13 
ATOM   9356  H HG12 . ILE A 1 21 ? -8.182  -5.130  2.426   1.00 0.00 ? 21 ILE A HG12 13 
ATOM   9357  H HG13 . ILE A 1 21 ? -7.205  -4.992  3.883   1.00 0.00 ? 21 ILE A HG13 13 
ATOM   9358  H HG21 . ILE A 1 21 ? -7.299  -4.820  0.426   1.00 0.00 ? 21 ILE A HG21 13 
ATOM   9359  H HG22 . ILE A 1 21 ? -5.876  -3.829  0.100   1.00 0.00 ? 21 ILE A HG22 13 
ATOM   9360  H HG23 . ILE A 1 21 ? -7.401  -3.063  0.535   1.00 0.00 ? 21 ILE A HG23 13 
ATOM   9361  H HD11 . ILE A 1 21 ? -9.402  -3.368  2.974   1.00 0.00 ? 21 ILE A HD11 13 
ATOM   9362  H HD12 . ILE A 1 21 ? -7.975  -2.391  3.322   1.00 0.00 ? 21 ILE A HD12 13 
ATOM   9363  H HD13 . ILE A 1 21 ? -8.641  -3.454  4.563   1.00 0.00 ? 21 ILE A HD13 13 
ATOM   9364  N N    . PRO A 1 22 ? -3.794  -4.910  0.381   1.00 0.00 ? 22 PRO A N    13 
ATOM   9365  C CA   . PRO A 1 22 ? -2.730  -4.438  -0.503  1.00 0.00 ? 22 PRO A CA   13 
ATOM   9366  C C    . PRO A 1 22 ? -2.770  -2.921  -0.679  1.00 0.00 ? 22 PRO A C    13 
ATOM   9367  O O    . PRO A 1 22 ? -3.746  -2.274  -0.301  1.00 0.00 ? 22 PRO A O    13 
ATOM   9368  C CB   . PRO A 1 22 ? -3.010  -5.154  -1.838  1.00 0.00 ? 22 PRO A CB   13 
ATOM   9369  C CG   . PRO A 1 22 ? -4.375  -5.748  -1.693  1.00 0.00 ? 22 PRO A CG   13 
ATOM   9370  C CD   . PRO A 1 22 ? -4.550  -6.014  -0.224  1.00 0.00 ? 22 PRO A CD   13 
ATOM   9371  H HA   . PRO A 1 22 ? -1.767  -4.721  -0.129  1.00 0.00 ? 22 PRO A HA   13 
ATOM   9372  H HB2  . PRO A 1 22 ? -2.980  -4.440  -2.647  1.00 0.00 ? 22 PRO A HB2  13 
ATOM   9373  H HB3  . PRO A 1 22 ? -2.265  -5.920  -1.999  1.00 0.00 ? 22 PRO A HB3  13 
ATOM   9374  H HG2  . PRO A 1 22 ? -5.117  -5.045  -2.043  1.00 0.00 ? 22 PRO A HG2  13 
ATOM   9375  H HG3  . PRO A 1 22 ? -4.435  -6.670  -2.255  1.00 0.00 ? 22 PRO A HG3  13 
ATOM   9376  H HD2  . PRO A 1 22 ? -5.592  -5.977  0.054   1.00 0.00 ? 22 PRO A HD2  13 
ATOM   9377  H HD3  . PRO A 1 22 ? -4.119  -6.967  0.046   1.00 0.00 ? 22 PRO A HD3  13 
ATOM   9378  N N    . CYS A 1 23 ? -1.704  -2.355  -1.243  1.00 0.00 ? 23 CYS A N    13 
ATOM   9379  C CA   . CYS A 1 23 ? -1.635  -0.902  -1.450  1.00 0.00 ? 23 CYS A CA   13 
ATOM   9380  C C    . CYS A 1 23 ? -1.097  -0.542  -2.834  1.00 0.00 ? 23 CYS A C    13 
ATOM   9381  O O    . CYS A 1 23 ? -1.304  0.574   -3.310  1.00 0.00 ? 23 CYS A O    13 
ATOM   9382  C CB   . CYS A 1 23 ? -0.764  -0.242  -0.376  1.00 0.00 ? 23 CYS A CB   13 
ATOM   9383  S SG   . CYS A 1 23 ? -1.229  1.480   -0.006  1.00 0.00 ? 23 CYS A SG   13 
ATOM   9384  H H    . CYS A 1 23 ? -0.951  -2.922  -1.520  1.00 0.00 ? 23 CYS A H    13 
ATOM   9385  H HA   . CYS A 1 23 ? -2.640  -0.508  -1.368  1.00 0.00 ? 23 CYS A HA   13 
ATOM   9386  H HB2  . CYS A 1 23 ? -0.841  -0.803  0.544   1.00 0.00 ? 23 CYS A HB2  13 
ATOM   9387  H HB3  . CYS A 1 23 ? 0.266   -0.239  -0.707  1.00 0.00 ? 23 CYS A HB3  13 
ATOM   9388  N N    . GLN A 1 24 ? -0.409  -1.478  -3.479  1.00 0.00 ? 24 GLN A N    13 
ATOM   9389  C CA   . GLN A 1 24 ? 0.147   -1.227  -4.811  1.00 0.00 ? 24 GLN A CA   13 
ATOM   9390  C C    . GLN A 1 24 ? -0.911  -0.647  -5.734  1.00 0.00 ? 24 GLN A C    13 
ATOM   9391  O O    . GLN A 1 24 ? -0.673  0.330   -6.444  1.00 0.00 ? 24 GLN A O    13 
ATOM   9392  C CB   . GLN A 1 24 ? 0.729   -2.506  -5.431  1.00 0.00 ? 24 GLN A CB   13 
ATOM   9393  C CG   . GLN A 1 24 ? 1.136   -3.565  -4.418  1.00 0.00 ? 24 GLN A CG   13 
ATOM   9394  C CD   . GLN A 1 24 ? 1.990   -4.659  -5.028  1.00 0.00 ? 24 GLN A CD   13 
ATOM   9395  O OE1  . GLN A 1 24 ? 3.211   -4.529  -5.123  1.00 0.00 ? 24 GLN A OE1  13 
ATOM   9396  N NE2  . GLN A 1 24 ? 1.350   -5.744  -5.447  1.00 0.00 ? 24 GLN A NE2  13 
ATOM   9397  H H    . GLN A 1 24 ? -0.270  -2.347  -3.056  1.00 0.00 ? 24 GLN A H    13 
ATOM   9398  H HA   . GLN A 1 24 ? 0.926   -0.502  -4.705  1.00 0.00 ? 24 GLN A HA   13 
ATOM   9399  H HB2  . GLN A 1 24 ? -0.010  -2.939  -6.089  1.00 0.00 ? 24 GLN A HB2  13 
ATOM   9400  H HB3  . GLN A 1 24 ? 1.600   -2.243  -6.011  1.00 0.00 ? 24 GLN A HB3  13 
ATOM   9401  H HG2  . GLN A 1 24 ? 1.697   -3.090  -3.626  1.00 0.00 ? 24 GLN A HG2  13 
ATOM   9402  H HG3  . GLN A 1 24 ? 0.242   -4.012  -4.008  1.00 0.00 ? 24 GLN A HG3  13 
ATOM   9403  H HE21 . GLN A 1 24 ? 0.377   -5.778  -5.340  1.00 0.00 ? 24 GLN A HE21 13 
ATOM   9404  H HE22 . GLN A 1 24 ? 1.878   -6.468  -5.845  1.00 0.00 ? 24 GLN A HE22 13 
ATOM   9405  N N    . LEU A 1 25 ? -2.081  -1.257  -5.708  1.00 0.00 ? 25 LEU A N    13 
ATOM   9406  C CA   . LEU A 1 25 ? -3.196  -0.810  -6.529  1.00 0.00 ? 25 LEU A CA   13 
ATOM   9407  C C    . LEU A 1 25 ? -3.570  0.635   -6.202  1.00 0.00 ? 25 LEU A C    13 
ATOM   9408  O O    . LEU A 1 25 ? -4.221  1.312   -6.998  1.00 0.00 ? 25 LEU A O    13 
ATOM   9409  C CB   . LEU A 1 25 ? -4.407  -1.721  -6.324  1.00 0.00 ? 25 LEU A CB   13 
ATOM   9410  C CG   . LEU A 1 25 ? -4.762  -2.009  -4.862  1.00 0.00 ? 25 LEU A CG   13 
ATOM   9411  C CD1  . LEU A 1 25 ? -6.031  -1.271  -4.462  1.00 0.00 ? 25 LEU A CD1  13 
ATOM   9412  C CD2  . LEU A 1 25 ? -4.920  -3.506  -4.634  1.00 0.00 ? 25 LEU A CD2  13 
ATOM   9413  H H    . LEU A 1 25 ? -2.198  -2.024  -5.115  1.00 0.00 ? 25 LEU A H    13 
ATOM   9414  H HA   . LEU A 1 25 ? -2.886  -0.864  -7.558  1.00 0.00 ? 25 LEU A HA   13 
ATOM   9415  H HB2  . LEU A 1 25 ? -5.261  -1.259  -6.797  1.00 0.00 ? 25 LEU A HB2  13 
ATOM   9416  H HB3  . LEU A 1 25 ? -4.209  -2.661  -6.816  1.00 0.00 ? 25 LEU A HB3  13 
ATOM   9417  H HG   . LEU A 1 25 ? -3.959  -1.658  -4.229  1.00 0.00 ? 25 LEU A HG   13 
ATOM   9418  H HD11 . LEU A 1 25 ? -5.917  -0.873  -3.465  1.00 0.00 ? 25 LEU A HD11 13 
ATOM   9419  H HD12 . LEU A 1 25 ? -6.867  -1.956  -4.483  1.00 0.00 ? 25 LEU A HD12 13 
ATOM   9420  H HD13 . LEU A 1 25 ? -6.211  -0.463  -5.155  1.00 0.00 ? 25 LEU A HD13 13 
ATOM   9421  H HD21 . LEU A 1 25 ? -4.600  -3.754  -3.633  1.00 0.00 ? 25 LEU A HD21 13 
ATOM   9422  H HD22 . LEU A 1 25 ? -4.314  -4.044  -5.348  1.00 0.00 ? 25 LEU A HD22 13 
ATOM   9423  H HD23 . LEU A 1 25 ? -5.956  -3.782  -4.760  1.00 0.00 ? 25 LEU A HD23 13 
ATOM   9424  N N    . ARG A 1 26 ? -3.162  1.098   -5.023  1.00 0.00 ? 26 ARG A N    13 
ATOM   9425  C CA   . ARG A 1 26 ? -3.465  2.463   -4.593  1.00 0.00 ? 26 ARG A CA   13 
ATOM   9426  C C    . ARG A 1 26 ? -2.385  3.447   -5.024  1.00 0.00 ? 26 ARG A C    13 
ATOM   9427  O O    . ARG A 1 26 ? -2.517  4.656   -4.834  1.00 0.00 ? 26 ARG A O    13 
ATOM   9428  C CB   . ARG A 1 26 ? -3.641  2.532   -3.076  1.00 0.00 ? 26 ARG A CB   13 
ATOM   9429  C CG   . ARG A 1 26 ? -4.393  1.348   -2.484  1.00 0.00 ? 26 ARG A CG   13 
ATOM   9430  C CD   . ARG A 1 26 ? -5.811  1.729   -2.083  1.00 0.00 ? 26 ARG A CD   13 
ATOM   9431  N NE   . ARG A 1 26 ? -6.785  1.319   -3.092  1.00 0.00 ? 26 ARG A NE   13 
ATOM   9432  C CZ   . ARG A 1 26 ? -8.083  1.160   -2.848  1.00 0.00 ? 26 ARG A CZ   13 
ATOM   9433  N NH1  . ARG A 1 26 ? -8.570  1.380   -1.632  1.00 0.00 ? 26 ARG A NH1  13 
ATOM   9434  N NH2  . ARG A 1 26 ? -8.899  0.780   -3.822  1.00 0.00 ? 26 ARG A NH2  13 
ATOM   9435  H H    . ARG A 1 26 ? -2.654  0.511   -4.430  1.00 0.00 ? 26 ARG A H    13 
ATOM   9436  H HA   . ARG A 1 26 ? -4.379  2.744   -5.065  1.00 0.00 ? 26 ARG A HA   13 
ATOM   9437  H HB2  . ARG A 1 26 ? -2.664  2.578   -2.616  1.00 0.00 ? 26 ARG A HB2  13 
ATOM   9438  H HB3  . ARG A 1 26 ? -4.183  3.435   -2.832  1.00 0.00 ? 26 ARG A HB3  13 
ATOM   9439  H HG2  . ARG A 1 26 ? -4.439  0.557   -3.217  1.00 0.00 ? 26 ARG A HG2  13 
ATOM   9440  H HG3  . ARG A 1 26 ? -3.865  1.001   -1.610  1.00 0.00 ? 26 ARG A HG3  13 
ATOM   9441  H HD2  . ARG A 1 26 ? -6.038  1.250   -1.143  1.00 0.00 ? 26 ARG A HD2  13 
ATOM   9442  H HD3  . ARG A 1 26 ? -5.853  2.800   -1.954  1.00 0.00 ? 26 ARG A HD3  13 
ATOM   9443  H HE   . ARG A 1 26 ? -6.453  1.150   -3.999  1.00 0.00 ? 26 ARG A HE   13 
ATOM   9444  H HH11 . ARG A 1 26 ? -7.960  1.667   -0.893  1.00 0.00 ? 26 ARG A HH11 13 
ATOM   9445  H HH12 . ARG A 1 26 ? -9.546  1.260   -1.456  1.00 0.00 ? 26 ARG A HH12 13 
ATOM   9446  H HH21 . ARG A 1 26 ? -8.538  0.613   -4.739  1.00 0.00 ? 26 ARG A HH21 13 
ATOM   9447  H HH22 . ARG A 1 26 ? -9.874  0.661   -3.639  1.00 0.00 ? 26 ARG A HH22 13 
ATOM   9448  N N    . CYS A 1 27 ? -1.323  2.923   -5.597  1.00 0.00 ? 27 CYS A N    13 
ATOM   9449  C CA   . CYS A 1 27 ? -0.209  3.750   -6.057  1.00 0.00 ? 27 CYS A CA   13 
ATOM   9450  C C    . CYS A 1 27 ? -0.668  4.797   -7.072  1.00 0.00 ? 27 CYS A C    13 
ATOM   9451  O O    . CYS A 1 27 ? -1.267  4.470   -8.096  1.00 0.00 ? 27 CYS A O    13 
ATOM   9452  C CB   . CYS A 1 27 ? 0.885   2.874   -6.668  1.00 0.00 ? 27 CYS A CB   13 
ATOM   9453  S SG   . CYS A 1 27 ? 1.768   1.839   -5.455  1.00 0.00 ? 27 CYS A SG   13 
ATOM   9454  H H    . CYS A 1 27 ? -1.285  1.953   -5.709  1.00 0.00 ? 27 CYS A H    13 
ATOM   9455  H HA   . CYS A 1 27 ? 0.198   4.262   -5.197  1.00 0.00 ? 27 CYS A HA   13 
ATOM   9456  H HB2  . CYS A 1 27 ? 0.442   2.217   -7.401  1.00 0.00 ? 27 CYS A HB2  13 
ATOM   9457  H HB3  . CYS A 1 27 ? 1.613   3.507   -7.152  1.00 0.00 ? 27 CYS A HB3  13 
ATOM   9458  N N    . SER A 1 28 ? -0.359  6.060   -6.778  1.00 0.00 ? 28 SER A N    13 
ATOM   9459  C CA   . SER A 1 28 ? -0.702  7.179   -7.644  1.00 0.00 ? 28 SER A CA   13 
ATOM   9460  C C    . SER A 1 28 ? -2.137  7.102   -8.154  1.00 0.00 ? 28 SER A C    13 
ATOM   9461  O O    . SER A 1 28 ? -2.454  7.618   -9.226  1.00 0.00 ? 28 SER A O    13 
ATOM   9462  C CB   . SER A 1 28 ? 0.278   7.220   -8.805  1.00 0.00 ? 28 SER A CB   13 
ATOM   9463  O OG   . SER A 1 28 ? 0.444   8.541   -9.292  1.00 0.00 ? 28 SER A OG   13 
ATOM   9464  H H    . SER A 1 28 ? 0.130   6.243   -5.962  1.00 0.00 ? 28 SER A H    13 
ATOM   9465  H HA   . SER A 1 28 ? -0.590  8.083   -7.067  1.00 0.00 ? 28 SER A HA   13 
ATOM   9466  H HB2  . SER A 1 28 ? 1.232   6.852   -8.458  1.00 0.00 ? 28 SER A HB2  13 
ATOM   9467  H HB3  . SER A 1 28 ? -0.084  6.592   -9.603  1.00 0.00 ? 28 SER A HB3  13 
ATOM   9468  H HG   . SER A 1 28 ? 0.892   9.073   -8.630  1.00 0.00 ? 28 SER A HG   13 
ATOM   9469  N N    . SER A 1 29 ? -3.002  6.466   -7.374  1.00 0.00 ? 29 SER A N    13 
ATOM   9470  C CA   . SER A 1 29 ? -4.405  6.329   -7.739  1.00 0.00 ? 29 SER A CA   13 
ATOM   9471  C C    . SER A 1 29 ? -5.158  5.508   -6.703  1.00 0.00 ? 29 SER A C    13 
ATOM   9472  O O    . SER A 1 29 ? -4.597  4.609   -6.084  1.00 0.00 ? 29 SER A O    13 
ATOM   9473  C CB   . SER A 1 29 ? -4.535  5.663   -9.103  1.00 0.00 ? 29 SER A CB   13 
ATOM   9474  O OG   . SER A 1 29 ? -4.545  6.623   -10.146 1.00 0.00 ? 29 SER A OG   13 
ATOM   9475  H H    . SER A 1 29 ? -2.690  6.080   -6.533  1.00 0.00 ? 29 SER A H    13 
ATOM   9476  H HA   . SER A 1 29 ? -4.838  7.316   -7.787  1.00 0.00 ? 29 SER A HA   13 
ATOM   9477  H HB2  . SER A 1 29 ? -3.700  4.996   -9.249  1.00 0.00 ? 29 SER A HB2  13 
ATOM   9478  H HB3  . SER A 1 29 ? -5.458  5.102   -9.135  1.00 0.00 ? 29 SER A HB3  13 
ATOM   9479  H HG   . SER A 1 29 ? -3.893  7.303   -9.963  1.00 0.00 ? 29 SER A HG   13 
ATOM   9480  N N    . ASN A 1 30 ? -6.433  5.820   -6.525  1.00 0.00 ? 30 ASN A N    13 
ATOM   9481  C CA   . ASN A 1 30 ? -7.269  5.108   -5.565  1.00 0.00 ? 30 ASN A CA   13 
ATOM   9482  C C    . ASN A 1 30 ? -6.836  5.432   -4.140  1.00 0.00 ? 30 ASN A C    13 
ATOM   9483  O O    . ASN A 1 30 ? -6.416  4.553   -3.389  1.00 0.00 ? 30 ASN A O    13 
ATOM   9484  C CB   . ASN A 1 30 ? -7.200  3.597   -5.810  1.00 0.00 ? 30 ASN A CB   13 
ATOM   9485  C CG   . ASN A 1 30 ? -8.552  2.926   -5.665  1.00 0.00 ? 30 ASN A CG   13 
ATOM   9486  O OD1  . ASN A 1 30 ? -8.916  2.061   -6.461  1.00 0.00 ? 30 ASN A OD1  13 
ATOM   9487  N ND2  . ASN A 1 30 ? -9.304  3.323   -4.646  1.00 0.00 ? 30 ASN A ND2  13 
ATOM   9488  H H    . ASN A 1 30 ? -6.821  6.546   -7.050  1.00 0.00 ? 30 ASN A H    13 
ATOM   9489  H HA   . ASN A 1 30 ? -8.287  5.440   -5.703  1.00 0.00 ? 30 ASN A HA   13 
ATOM   9490  H HB2  . ASN A 1 30 ? -6.835  3.417   -6.810  1.00 0.00 ? 30 ASN A HB2  13 
ATOM   9491  H HB3  . ASN A 1 30 ? -6.519  3.152   -5.098  1.00 0.00 ? 30 ASN A HB3  13 
ATOM   9492  H HD21 . ASN A 1 30 ? -8.950  4.018   -4.052  1.00 0.00 ? 30 ASN A HD21 13 
ATOM   9493  H HD22 . ASN A 1 30 ? -10.183 2.906   -4.528  1.00 0.00 ? 30 ASN A HD22 13 
ATOM   9494  N N    . THR A 1 31 ? -6.949  6.705   -3.780  1.00 0.00 ? 31 THR A N    13 
ATOM   9495  C CA   . THR A 1 31 ? -6.576  7.167   -2.450  1.00 0.00 ? 31 THR A CA   13 
ATOM   9496  C C    . THR A 1 31 ? -5.048  7.208   -2.303  1.00 0.00 ? 31 THR A C    13 
ATOM   9497  O O    . THR A 1 31 ? -4.396  6.166   -2.229  1.00 0.00 ? 31 THR A O    13 
ATOM   9498  C CB   . THR A 1 31 ? -7.235  6.272   -1.392  1.00 0.00 ? 31 THR A CB   13 
ATOM   9499  O OG1  . THR A 1 31 ? -7.959  7.054   -0.460  1.00 0.00 ? 31 THR A OG1  13 
ATOM   9500  C CG2  . THR A 1 31 ? -6.276  5.399   -0.603  1.00 0.00 ? 31 THR A CG2  13 
ATOM   9501  H H    . THR A 1 31 ? -7.294  7.350   -4.425  1.00 0.00 ? 31 THR A H    13 
ATOM   9502  H HA   . THR A 1 31 ? -6.963  8.165   -2.340  1.00 0.00 ? 31 THR A HA   13 
ATOM   9503  H HB   . THR A 1 31 ? -7.934  5.622   -1.898  1.00 0.00 ? 31 THR A HB   13 
ATOM   9504  H HG1  . THR A 1 31 ? -8.873  7.129   -0.745  1.00 0.00 ? 31 THR A HG1  13 
ATOM   9505  H HG21 . THR A 1 31 ? -5.811  4.685   -1.265  1.00 0.00 ? 31 THR A HG21 13 
ATOM   9506  H HG22 . THR A 1 31 ? -6.820  4.873   0.168   1.00 0.00 ? 31 THR A HG22 13 
ATOM   9507  H HG23 . THR A 1 31 ? -5.516  6.018   -0.150  1.00 0.00 ? 31 THR A HG23 13 
ATOM   9508  N N    . PRO A 1 32 ? -4.448  8.417   -2.283  1.00 0.00 ? 32 PRO A N    13 
ATOM   9509  C CA   . PRO A 1 32 ? -2.992  8.572   -2.163  1.00 0.00 ? 32 PRO A CA   13 
ATOM   9510  C C    . PRO A 1 32 ? -2.380  7.695   -1.069  1.00 0.00 ? 32 PRO A C    13 
ATOM   9511  O O    . PRO A 1 32 ? -2.750  7.799   0.101   1.00 0.00 ? 32 PRO A O    13 
ATOM   9512  C CB   . PRO A 1 32 ? -2.830  10.051  -1.815  1.00 0.00 ? 32 PRO A CB   13 
ATOM   9513  C CG   . PRO A 1 32 ? -3.970  10.710  -2.504  1.00 0.00 ? 32 PRO A CG   13 
ATOM   9514  C CD   . PRO A 1 32 ? -5.130  9.727   -2.396  1.00 0.00 ? 32 PRO A CD   13 
ATOM   9515  H HA   . PRO A 1 32 ? -2.499  8.370   -3.100  1.00 0.00 ? 32 PRO A HA   13 
ATOM   9516  H HB2  . PRO A 1 32 ? -2.883  10.181  -0.744  1.00 0.00 ? 32 PRO A HB2  13 
ATOM   9517  H HB3  . PRO A 1 32 ? -1.882  10.412  -2.184  1.00 0.00 ? 32 PRO A HB3  13 
ATOM   9518  H HG2  . PRO A 1 32 ? -4.201  11.650  -2.011  1.00 0.00 ? 32 PRO A HG2  13 
ATOM   9519  H HG3  . PRO A 1 32 ? -3.711  10.887  -3.542  1.00 0.00 ? 32 PRO A HG3  13 
ATOM   9520  H HD2  . PRO A 1 32 ? -5.722  9.924   -1.510  1.00 0.00 ? 32 PRO A HD2  13 
ATOM   9521  H HD3  . PRO A 1 32 ? -5.755  9.759   -3.285  1.00 0.00 ? 32 PRO A HD3  13 
ATOM   9522  N N    . PRO A 1 33 ? -1.423  6.821   -1.439  1.00 0.00 ? 33 PRO A N    13 
ATOM   9523  C CA   . PRO A 1 33 ? -0.747  5.929   -0.490  1.00 0.00 ? 33 PRO A CA   13 
ATOM   9524  C C    . PRO A 1 33 ? 0.124   6.682   0.491   1.00 0.00 ? 33 PRO A C    13 
ATOM   9525  O O    . PRO A 1 33 ? 1.339   6.730   0.346   1.00 0.00 ? 33 PRO A O    13 
ATOM   9526  C CB   . PRO A 1 33 ? 0.111   5.032   -1.383  1.00 0.00 ? 33 PRO A CB   13 
ATOM   9527  C CG   . PRO A 1 33 ? 0.326   5.823   -2.625  1.00 0.00 ? 33 PRO A CG   13 
ATOM   9528  C CD   . PRO A 1 33 ? -0.920  6.641   -2.815  1.00 0.00 ? 33 PRO A CD   13 
ATOM   9529  H HA   . PRO A 1 33 ? -1.438  5.327   0.068   1.00 0.00 ? 33 PRO A HA   13 
ATOM   9530  H HB2  . PRO A 1 33 ? 1.045   4.816   -0.886  1.00 0.00 ? 33 PRO A HB2  13 
ATOM   9531  H HB3  . PRO A 1 33 ? -0.417  4.110   -1.586  1.00 0.00 ? 33 PRO A HB3  13 
ATOM   9532  H HG2  . PRO A 1 33 ? 1.183   6.468   -2.506  1.00 0.00 ? 33 PRO A HG2  13 
ATOM   9533  H HG3  . PRO A 1 33 ? 0.467   5.160   -3.464  1.00 0.00 ? 33 PRO A HG3  13 
ATOM   9534  H HD2  . PRO A 1 33 ? -0.681  7.593   -3.266  1.00 0.00 ? 33 PRO A HD2  13 
ATOM   9535  H HD3  . PRO A 1 33 ? -1.635  6.105   -3.418  1.00 0.00 ? 33 PRO A HD3  13 
ATOM   9536  N N    . LEU A 1 34 ? -0.500  7.261   1.502   1.00 0.00 ? 34 LEU A N    13 
ATOM   9537  C CA   . LEU A 1 34 ? 0.255   7.996   2.506   1.00 0.00 ? 34 LEU A CA   13 
ATOM   9538  C C    . LEU A 1 34 ? 1.189   7.055   3.259   1.00 0.00 ? 34 LEU A C    13 
ATOM   9539  O O    . LEU A 1 34 ? 2.362   7.370   3.459   1.00 0.00 ? 34 LEU A O    13 
ATOM   9540  C CB   . LEU A 1 34 ? -0.670  8.743   3.477   1.00 0.00 ? 34 LEU A CB   13 
ATOM   9541  C CG   . LEU A 1 34 ? -1.785  9.558   2.819   1.00 0.00 ? 34 LEU A CG   13 
ATOM   9542  C CD1  . LEU A 1 34 ? -2.560  10.343  3.866   1.00 0.00 ? 34 LEU A CD1  13 
ATOM   9543  C CD2  . LEU A 1 34 ? -1.212  10.494  1.763   1.00 0.00 ? 34 LEU A CD2  13 
ATOM   9544  H H    . LEU A 1 34 ? -1.476  7.189   1.570   1.00 0.00 ? 34 LEU A H    13 
ATOM   9545  H HA   . LEU A 1 34 ? 0.864   8.708   1.979   1.00 0.00 ? 34 LEU A HA   13 
ATOM   9546  H HB2  . LEU A 1 34 ? -1.126  8.026   4.142   1.00 0.00 ? 34 LEU A HB2  13 
ATOM   9547  H HB3  . LEU A 1 34 ? -0.067  9.418   4.065   1.00 0.00 ? 34 LEU A HB3  13 
ATOM   9548  H HG   . LEU A 1 34 ? -2.474  8.883   2.333   1.00 0.00 ? 34 LEU A HG   13 
ATOM   9549  H HD11 . LEU A 1 34 ? -1.923  11.106  4.288   1.00 0.00 ? 34 LEU A HD11 13 
ATOM   9550  H HD12 . LEU A 1 34 ? -2.886  9.674   4.649   1.00 0.00 ? 34 LEU A HD12 13 
ATOM   9551  H HD13 . LEU A 1 34 ? -3.421  10.806  3.406   1.00 0.00 ? 34 LEU A HD13 13 
ATOM   9552  H HD21 . LEU A 1 34 ? -1.377  10.074  0.781   1.00 0.00 ? 34 LEU A HD21 13 
ATOM   9553  H HD22 . LEU A 1 34 ? -0.152  10.618  1.928   1.00 0.00 ? 34 LEU A HD22 13 
ATOM   9554  H HD23 . LEU A 1 34 ? -1.701  11.455  1.830   1.00 0.00 ? 34 LEU A HD23 13 
ATOM   9555  N N    . THR A 1 35 ? 0.682   5.891   3.650   1.00 0.00 ? 35 THR A N    13 
ATOM   9556  C CA   . THR A 1 35 ? 1.494   4.916   4.345   1.00 0.00 ? 35 THR A CA   13 
ATOM   9557  C C    . THR A 1 35 ? 2.213   4.008   3.348   1.00 0.00 ? 35 THR A C    13 
ATOM   9558  O O    . THR A 1 35 ? 2.956   3.111   3.746   1.00 0.00 ? 35 THR A O    13 
ATOM   9559  C CB   . THR A 1 35 ? 0.630   4.075   5.288   1.00 0.00 ? 35 THR A CB   13 
ATOM   9560  O OG1  . THR A 1 35 ? 1.431   3.187   6.045   1.00 0.00 ? 35 THR A OG1  13 
ATOM   9561  C CG2  . THR A 1 35 ? -0.416  3.251   4.568   1.00 0.00 ? 35 THR A CG2  13 
ATOM   9562  H H    . THR A 1 35 ? -0.251  5.674   3.455   1.00 0.00 ? 35 THR A H    13 
ATOM   9563  H HA   . THR A 1 35 ? 2.229   5.451   4.926   1.00 0.00 ? 35 THR A HA   13 
ATOM   9564  H HB   . THR A 1 35 ? 0.116   4.736   5.973   1.00 0.00 ? 35 THR A HB   13 
ATOM   9565  H HG1  . THR A 1 35 ? 1.564   3.544   6.926   1.00 0.00 ? 35 THR A HG1  13 
ATOM   9566  H HG21 . THR A 1 35 ? -1.378  3.400   5.037   1.00 0.00 ? 35 THR A HG21 13 
ATOM   9567  H HG22 . THR A 1 35 ? -0.148  2.206   4.620   1.00 0.00 ? 35 THR A HG22 13 
ATOM   9568  H HG23 . THR A 1 35 ? -0.467  3.558   3.534   1.00 0.00 ? 35 THR A HG23 13 
ATOM   9569  N N    . CYS A 1 36 ? 1.989   4.231   2.045   1.00 0.00 ? 36 CYS A N    13 
ATOM   9570  C CA   . CYS A 1 36 ? 2.632   3.398   1.029   1.00 0.00 ? 36 CYS A CA   13 
ATOM   9571  C C    . CYS A 1 36 ? 3.389   4.220   -0.014  1.00 0.00 ? 36 CYS A C    13 
ATOM   9572  O O    . CYS A 1 36 ? 4.047   3.657   -0.888  1.00 0.00 ? 36 CYS A O    13 
ATOM   9573  C CB   . CYS A 1 36 ? 1.608   2.497   0.333   1.00 0.00 ? 36 CYS A CB   13 
ATOM   9574  S SG   . CYS A 1 36 ? 0.158   2.069   1.353   1.00 0.00 ? 36 CYS A SG   13 
ATOM   9575  H H    . CYS A 1 36 ? 1.378   4.958   1.767   1.00 0.00 ? 36 CYS A H    13 
ATOM   9576  H HA   . CYS A 1 36 ? 3.341   2.773   1.540   1.00 0.00 ? 36 CYS A HA   13 
ATOM   9577  H HB2  . CYS A 1 36 ? 1.248   2.992   -0.555  1.00 0.00 ? 36 CYS A HB2  13 
ATOM   9578  H HB3  . CYS A 1 36 ? 2.093   1.575   0.048   1.00 0.00 ? 36 CYS A HB3  13 
ATOM   9579  N N    . GLN A 1 37 ? 3.292   5.544   0.066   1.00 0.00 ? 37 GLN A N    13 
ATOM   9580  C CA   . GLN A 1 37 ? 3.972   6.421   -0.885  1.00 0.00 ? 37 GLN A CA   13 
ATOM   9581  C C    . GLN A 1 37 ? 5.421   6.003   -1.082  1.00 0.00 ? 37 GLN A C    13 
ATOM   9582  O O    . GLN A 1 37 ? 5.914   5.930   -2.206  1.00 0.00 ? 37 GLN A O    13 
ATOM   9583  C CB   . GLN A 1 37 ? 3.915   7.874   -0.405  1.00 0.00 ? 37 GLN A CB   13 
ATOM   9584  C CG   . GLN A 1 37 ? 3.745   8.888   -1.525  1.00 0.00 ? 37 GLN A CG   13 
ATOM   9585  C CD   . GLN A 1 37 ? 2.579   8.568   -2.439  1.00 0.00 ? 37 GLN A CD   13 
ATOM   9586  O OE1  . GLN A 1 37 ? 2.720   7.817   -3.403  1.00 0.00 ? 37 GLN A OE1  13 
ATOM   9587  N NE2  . GLN A 1 37 ? 1.419   9.141   -2.142  1.00 0.00 ? 37 GLN A NE2  13 
ATOM   9588  H H    . GLN A 1 37 ? 2.745   5.944   0.772   1.00 0.00 ? 37 GLN A H    13 
ATOM   9589  H HA   . GLN A 1 37 ? 3.464   6.339   -1.825  1.00 0.00 ? 37 GLN A HA   13 
ATOM   9590  H HB2  . GLN A 1 37 ? 3.086   7.984   0.277   1.00 0.00 ? 37 GLN A HB2  13 
ATOM   9591  H HB3  . GLN A 1 37 ? 4.830   8.102   0.119   1.00 0.00 ? 37 GLN A HB3  13 
ATOM   9592  H HG2  . GLN A 1 37 ? 3.579   9.861   -1.086  1.00 0.00 ? 37 GLN A HG2  13 
ATOM   9593  H HG3  . GLN A 1 37 ? 4.651   8.911   -2.112  1.00 0.00 ? 37 GLN A HG3  13 
ATOM   9594  H HE21 . GLN A 1 37 ? 1.381   9.730   -1.359  1.00 0.00 ? 37 GLN A HE21 13 
ATOM   9595  H HE22 . GLN A 1 37 ? 0.649   8.954   -2.717  1.00 0.00 ? 37 GLN A HE22 13 
ATOM   9596  N N    . ARG A 1 38 ? 6.091   5.732   0.024   1.00 0.00 ? 38 ARG A N    13 
ATOM   9597  C CA   . ARG A 1 38 ? 7.490   5.321   0.002   1.00 0.00 ? 38 ARG A CA   13 
ATOM   9598  C C    . ARG A 1 38 ? 7.676   4.040   -0.795  1.00 0.00 ? 38 ARG A C    13 
ATOM   9599  O O    . ARG A 1 38 ? 8.547   3.965   -1.661  1.00 0.00 ? 38 ARG A O    13 
ATOM   9600  C CB   . ARG A 1 38 ? 8.010   5.133   1.429   1.00 0.00 ? 38 ARG A CB   13 
ATOM   9601  C CG   . ARG A 1 38 ? 8.903   6.266   1.907   1.00 0.00 ? 38 ARG A CG   13 
ATOM   9602  C CD   . ARG A 1 38 ? 9.588   5.919   3.218   1.00 0.00 ? 38 ARG A CD   13 
ATOM   9603  N NE   . ARG A 1 38 ? 8.620   5.565   4.254   1.00 0.00 ? 38 ARG A NE   13 
ATOM   9604  C CZ   . ARG A 1 38 ? 8.921   4.856   5.340   1.00 0.00 ? 38 ARG A CZ   13 
ATOM   9605  N NH1  . ARG A 1 38 ? 10.161  4.423   5.537   1.00 0.00 ? 38 ARG A NH1  13 
ATOM   9606  N NH2  . ARG A 1 38 ? 7.980   4.577   6.230   1.00 0.00 ? 38 ARG A NH2  13 
ATOM   9607  H H    . ARG A 1 38 ? 5.629   5.813   0.881   1.00 0.00 ? 38 ARG A H    13 
ATOM   9608  H HA   . ARG A 1 38 ? 8.061   6.102   -0.479  1.00 0.00 ? 38 ARG A HA   13 
ATOM   9609  H HB2  . ARG A 1 38 ? 7.167   5.062   2.101   1.00 0.00 ? 38 ARG A HB2  13 
ATOM   9610  H HB3  . ARG A 1 38 ? 8.575   4.214   1.478   1.00 0.00 ? 38 ARG A HB3  13 
ATOM   9611  H HG2  . ARG A 1 38 ? 9.658   6.457   1.158   1.00 0.00 ? 38 ARG A HG2  13 
ATOM   9612  H HG3  . ARG A 1 38 ? 8.301   7.152   2.047   1.00 0.00 ? 38 ARG A HG3  13 
ATOM   9613  H HD2  . ARG A 1 38 ? 10.255  5.089   3.045   1.00 0.00 ? 38 ARG A HD2  13 
ATOM   9614  H HD3  . ARG A 1 38 ? 10.164  6.775   3.539   1.00 0.00 ? 38 ARG A HD3  13 
ATOM   9615  H HE   . ARG A 1 38 ? 7.696   5.871   4.134   1.00 0.00 ? 38 ARG A HE   13 
ATOM   9616  H HH11 . ARG A 1 38 ? 10.875  4.630   4.869   1.00 0.00 ? 38 ARG A HH11 13 
ATOM   9617  H HH12 . ARG A 1 38 ? 10.380  3.891   6.355   1.00 0.00 ? 38 ARG A HH12 13 
ATOM   9618  H HH21 . ARG A 1 38 ? 7.044   4.900   6.087   1.00 0.00 ? 38 ARG A HH21 13 
ATOM   9619  H HH22 . ARG A 1 38 ? 8.205   4.044   7.046   1.00 0.00 ? 38 ARG A HH22 13 
ATOM   9620  N N    . TYR A 1 39 ? 6.872   3.031   -0.507  1.00 0.00 ? 39 TYR A N    13 
ATOM   9621  C CA   . TYR A 1 39 ? 6.999   1.769   -1.208  1.00 0.00 ? 39 TYR A CA   13 
ATOM   9622  C C    . TYR A 1 39 ? 6.462   1.856   -2.626  1.00 0.00 ? 39 TYR A C    13 
ATOM   9623  O O    . TYR A 1 39 ? 7.026   1.255   -3.540  1.00 0.00 ? 39 TYR A O    13 
ATOM   9624  C CB   . TYR A 1 39 ? 6.307   0.641   -0.439  1.00 0.00 ? 39 TYR A CB   13 
ATOM   9625  C CG   . TYR A 1 39 ? 6.393   -0.698  -1.135  1.00 0.00 ? 39 TYR A CG   13 
ATOM   9626  C CD1  . TYR A 1 39 ? 7.540   -1.475  -1.046  1.00 0.00 ? 39 TYR A CD1  13 
ATOM   9627  C CD2  . TYR A 1 39 ? 5.332   -1.176  -1.893  1.00 0.00 ? 39 TYR A CD2  13 
ATOM   9628  C CE1  . TYR A 1 39 ? 7.628   -2.694  -1.694  1.00 0.00 ? 39 TYR A CE1  13 
ATOM   9629  C CE2  . TYR A 1 39 ? 5.410   -2.392  -2.541  1.00 0.00 ? 39 TYR A CE2  13 
ATOM   9630  C CZ   . TYR A 1 39 ? 6.559   -3.147  -2.439  1.00 0.00 ? 39 TYR A CZ   13 
ATOM   9631  O OH   . TYR A 1 39 ? 6.642   -4.359  -3.087  1.00 0.00 ? 39 TYR A OH   13 
ATOM   9632  H H    . TYR A 1 39 ? 6.199   3.129   0.190   1.00 0.00 ? 39 TYR A H    13 
ATOM   9633  H HA   . TYR A 1 39 ? 8.053   1.561   -1.268  1.00 0.00 ? 39 TYR A HA   13 
ATOM   9634  H HB2  . TYR A 1 39 ? 6.768   0.541   0.532   1.00 0.00 ? 39 TYR A HB2  13 
ATOM   9635  H HB3  . TYR A 1 39 ? 5.262   0.886   -0.314  1.00 0.00 ? 39 TYR A HB3  13 
ATOM   9636  H HD1  . TYR A 1 39 ? 8.374   -1.118  -0.460  1.00 0.00 ? 39 TYR A HD1  13 
ATOM   9637  H HD2  . TYR A 1 39 ? 4.433   -0.581  -1.970  1.00 0.00 ? 39 TYR A HD2  13 
ATOM   9638  H HE1  . TYR A 1 39 ? 8.527   -3.285  -1.613  1.00 0.00 ? 39 TYR A HE1  13 
ATOM   9639  H HE2  . TYR A 1 39 ? 4.573   -2.747  -3.124  1.00 0.00 ? 39 TYR A HE2  13 
ATOM   9640  H HH   . TYR A 1 39 ? 6.224   -4.291  -3.948  1.00 0.00 ? 39 TYR A HH   13 
ATOM   9641  N N    . CYS A 1 40 ? 5.386   2.609   -2.823  1.00 0.00 ? 40 CYS A N    13 
ATOM   9642  C CA   . CYS A 1 40 ? 4.824   2.759   -4.163  1.00 0.00 ? 40 CYS A CA   13 
ATOM   9643  C C    . CYS A 1 40 ? 5.926   3.158   -5.137  1.00 0.00 ? 40 CYS A C    13 
ATOM   9644  O O    . CYS A 1 40 ? 5.882   2.822   -6.321  1.00 0.00 ? 40 CYS A O    13 
ATOM   9645  C CB   . CYS A 1 40 ? 3.695   3.790   -4.185  1.00 0.00 ? 40 CYS A CB   13 
ATOM   9646  S SG   . CYS A 1 40 ? 2.054   3.074   -3.868  1.00 0.00 ? 40 CYS A SG   13 
ATOM   9647  H H    . CYS A 1 40 ? 4.978   3.075   -2.061  1.00 0.00 ? 40 CYS A H    13 
ATOM   9648  H HA   . CYS A 1 40 ? 4.434   1.800   -4.465  1.00 0.00 ? 40 CYS A HA   13 
ATOM   9649  H HB2  . CYS A 1 40 ? 3.882   4.543   -3.436  1.00 0.00 ? 40 CYS A HB2  13 
ATOM   9650  H HB3  . CYS A 1 40 ? 3.664   4.259   -5.158  1.00 0.00 ? 40 CYS A HB3  13 
ATOM   9651  N N    . ASN A 1 41 ? 6.929   3.856   -4.612  1.00 0.00 ? 41 ASN A N    13 
ATOM   9652  C CA   . ASN A 1 41 ? 8.069   4.281   -5.412  1.00 0.00 ? 41 ASN A CA   13 
ATOM   9653  C C    . ASN A 1 41 ? 8.758   3.079   -6.031  1.00 0.00 ? 41 ASN A C    13 
ATOM   9654  O O    . ASN A 1 41 ? 9.331   3.155   -7.118  1.00 0.00 ? 41 ASN A O    13 
ATOM   9655  C CB   . ASN A 1 41 ? 9.061   5.065   -4.551  1.00 0.00 ? 41 ASN A CB   13 
ATOM   9656  C CG   . ASN A 1 41 ? 8.458   6.309   -3.953  1.00 0.00 ? 41 ASN A CG   13 
ATOM   9657  O OD1  . ASN A 1 41 ? 8.095   7.253   -4.656  1.00 0.00 ? 41 ASN A OD1  13 
ATOM   9658  N ND2  . ASN A 1 41 ? 8.351   6.305   -2.636  1.00 0.00 ? 41 ASN A ND2  13 
ATOM   9659  H H    . ASN A 1 41 ? 6.910   4.075   -3.659  1.00 0.00 ? 41 ASN A H    13 
ATOM   9660  H HA   . ASN A 1 41 ? 7.704   4.902   -6.195  1.00 0.00 ? 41 ASN A HA   13 
ATOM   9661  H HB2  . ASN A 1 41 ? 9.392   4.440   -3.732  1.00 0.00 ? 41 ASN A HB2  13 
ATOM   9662  H HB3  . ASN A 1 41 ? 9.911   5.350   -5.152  1.00 0.00 ? 41 ASN A HB3  13 
ATOM   9663  H HD21 . ASN A 1 41 ? 8.666   5.506   -2.154  1.00 0.00 ? 41 ASN A HD21 13 
ATOM   9664  H HD22 . ASN A 1 41 ? 7.965   7.090   -2.197  1.00 0.00 ? 41 ASN A HD22 13 
ATOM   9665  N N    . ALA A 1 42 ? 8.681   1.969   -5.324  1.00 0.00 ? 42 ALA A N    13 
ATOM   9666  C CA   . ALA A 1 42 ? 9.275   0.719   -5.779  1.00 0.00 ? 42 ALA A CA   13 
ATOM   9667  C C    . ALA A 1 42 ? 8.207   -0.201  -6.352  1.00 0.00 ? 42 ALA A C    13 
ATOM   9668  O O    . ALA A 1 42 ? 8.322   -1.425  -6.294  1.00 0.00 ? 42 ALA A O    13 
ATOM   9669  C CB   . ALA A 1 42 ? 10.019  0.037   -4.639  1.00 0.00 ? 42 ALA A CB   13 
ATOM   9670  H H    . ALA A 1 42 ? 8.199   1.994   -4.474  1.00 0.00 ? 42 ALA A H    13 
ATOM   9671  H HA   . ALA A 1 42 ? 9.984   0.953   -6.556  1.00 0.00 ? 42 ALA A HA   13 
ATOM   9672  H HB1  . ALA A 1 42 ? 9.694   -0.989  -4.558  1.00 0.00 ? 42 ALA A HB1  13 
ATOM   9673  H HB2  . ALA A 1 42 ? 9.812   0.554   -3.714  1.00 0.00 ? 42 ALA A HB2  13 
ATOM   9674  H HB3  . ALA A 1 42 ? 11.081  0.063   -4.836  1.00 0.00 ? 42 ALA A HB3  13 
ATOM   9675  N N    . SER A 1 43 ? 7.167   0.408   -6.906  1.00 0.00 ? 43 SER A N    13 
ATOM   9676  C CA   . SER A 1 43 ? 6.063   -0.330  -7.500  1.00 0.00 ? 43 SER A CA   13 
ATOM   9677  C C    . SER A 1 43 ? 5.634   0.291   -8.831  1.00 0.00 ? 43 SER A C    13 
ATOM   9678  O O    . SER A 1 43 ? 5.049   -0.385  -9.677  1.00 0.00 ? 43 SER A O    13 
ATOM   9679  C CB   . SER A 1 43 ? 4.876   -0.376  -6.537  1.00 0.00 ? 43 SER A CB   13 
ATOM   9680  O OG   . SER A 1 43 ? 4.904   -1.553  -5.749  1.00 0.00 ? 43 SER A OG   13 
ATOM   9681  H H    . SER A 1 43 ? 7.146   1.382   -6.915  1.00 0.00 ? 43 SER A H    13 
ATOM   9682  H HA   . SER A 1 43 ? 6.405   -1.334  -7.682  1.00 0.00 ? 43 SER A HA   13 
ATOM   9683  H HB2  . SER A 1 43 ? 4.911   0.482   -5.882  1.00 0.00 ? 43 SER A HB2  13 
ATOM   9684  H HB3  . SER A 1 43 ? 3.955   -0.359  -7.103  1.00 0.00 ? 43 SER A HB3  13 
ATOM   9685  H HG   . SER A 1 43 ? 4.868   -2.323  -6.321  1.00 0.00 ? 43 SER A HG   13 
ATOM   9686  N N    . VAL A 1 44 ? 5.928   1.576   -9.013  1.00 0.00 ? 44 VAL A N    13 
ATOM   9687  C CA   . VAL A 1 44 ? 5.576   2.274   -10.239 1.00 0.00 ? 44 VAL A CA   13 
ATOM   9688  C C    . VAL A 1 44 ? 6.617   3.336   -10.576 1.00 0.00 ? 44 VAL A C    13 
ATOM   9689  O O    . VAL A 1 44 ? 6.302   4.521   -10.690 1.00 0.00 ? 44 VAL A O    13 
ATOM   9690  C CB   . VAL A 1 44 ? 4.188   2.937   -10.136 1.00 0.00 ? 44 VAL A CB   13 
ATOM   9691  C CG1  . VAL A 1 44 ? 3.760   3.499   -11.482 1.00 0.00 ? 44 VAL A CG1  13 
ATOM   9692  C CG2  . VAL A 1 44 ? 3.159   1.945   -9.611  1.00 0.00 ? 44 VAL A CG2  13 
ATOM   9693  H H    . VAL A 1 44 ? 6.397   2.066   -8.313  1.00 0.00 ? 44 VAL A H    13 
ATOM   9694  H HA   . VAL A 1 44 ? 5.550   1.548   -11.033 1.00 0.00 ? 44 VAL A HA   13 
ATOM   9695  H HB   . VAL A 1 44 ? 4.255   3.757   -9.434  1.00 0.00 ? 44 VAL A HB   13 
ATOM   9696  H HG11 . VAL A 1 44 ? 3.259   2.729   -12.050 1.00 0.00 ? 44 VAL A HG11 13 
ATOM   9697  H HG12 . VAL A 1 44 ? 4.631   3.836   -12.025 1.00 0.00 ? 44 VAL A HG12 13 
ATOM   9698  H HG13 . VAL A 1 44 ? 3.087   4.329   -11.329 1.00 0.00 ? 44 VAL A HG13 13 
ATOM   9699  H HG21 . VAL A 1 44 ? 2.209   2.446   -9.485  1.00 0.00 ? 44 VAL A HG21 13 
ATOM   9700  H HG22 . VAL A 1 44 ? 3.488   1.554   -8.660  1.00 0.00 ? 44 VAL A HG22 13 
ATOM   9701  H HG23 . VAL A 1 44 ? 3.047   1.135   -10.317 1.00 0.00 ? 44 VAL A HG23 13 
ATOM   9702  N N    . THR A 1 45 ? 7.860   2.894   -10.746 1.00 0.00 ? 45 THR A N    13 
ATOM   9703  C CA   . THR A 1 45 ? 8.952   3.762   -11.078 1.00 0.00 ? 45 THR A CA   13 
ATOM   9704  C C    . THR A 1 45 ? 10.246  2.968   -11.234 1.00 0.00 ? 45 THR A C    13 
ATOM   9705  O O    . THR A 1 45 ? 11.068  3.267   -12.101 1.00 0.00 ? 45 THR A O    13 
ATOM   9706  C CB   . THR A 1 45 ? 9.133   4.863   -10.028 1.00 0.00 ? 45 THR A CB   13 
ATOM   9707  O OG1  . THR A 1 45 ? 8.108   4.818   -9.051  1.00 0.00 ? 45 THR A OG1  13 
ATOM   9708  C CG2  . THR A 1 45 ? 9.148   6.256   -10.616 1.00 0.00 ? 45 THR A CG2  13 
ATOM   9709  H H    . THR A 1 45 ? 8.040   1.963   -10.664 1.00 0.00 ? 45 THR A H    13 
ATOM   9710  H HA   . THR A 1 45 ? 8.706   4.195   -12.010 1.00 0.00 ? 45 THR A HA   13 
ATOM   9711  H HB   . THR A 1 45 ? 10.077  4.706   -9.528  1.00 0.00 ? 45 THR A HB   13 
ATOM   9712  H HG1  . THR A 1 45 ? 8.328   4.163   -8.385  1.00 0.00 ? 45 THR A HG1  13 
ATOM   9713  H HG21 . THR A 1 45 ? 9.868   6.862   -10.087 1.00 0.00 ? 45 THR A HG21 13 
ATOM   9714  H HG22 . THR A 1 45 ? 8.167   6.698   -10.521 1.00 0.00 ? 45 THR A HG22 13 
ATOM   9715  H HG23 . THR A 1 45 ? 9.420   6.204   -11.660 1.00 0.00 ? 45 THR A HG23 13 
ATOM   9716  N N    . ASN A 1 46 ? 10.420  1.956   -10.391 1.00 0.00 ? 46 ASN A N    13 
ATOM   9717  C CA   . ASN A 1 46 ? 11.613  1.116   -10.435 1.00 0.00 ? 46 ASN A CA   13 
ATOM   9718  C C    . ASN A 1 46 ? 11.769  0.464   -11.807 1.00 0.00 ? 46 ASN A C    13 
ATOM   9719  O O    . ASN A 1 46 ? 11.102  0.858   -12.763 1.00 0.00 ? 46 ASN A O    13 
ATOM   9720  C CB   . ASN A 1 46 ? 11.544  0.046   -9.341  1.00 0.00 ? 46 ASN A CB   13 
ATOM   9721  C CG   . ASN A 1 46 ? 10.443  -0.968  -9.590  1.00 0.00 ? 46 ASN A CG   13 
ATOM   9722  O OD1  . ASN A 1 46 ? 10.669  -2.010  -10.206 1.00 0.00 ? 46 ASN A OD1  13 
ATOM   9723  N ND2  . ASN A 1 46 ? 9.241   -0.667  -9.110  1.00 0.00 ? 46 ASN A ND2  13 
ATOM   9724  H H    . ASN A 1 46 ? 9.729   1.767   -9.721  1.00 0.00 ? 46 ASN A H    13 
ATOM   9725  H HA   . ASN A 1 46 ? 12.469  1.749   -10.252 1.00 0.00 ? 46 ASN A HA   13 
ATOM   9726  H HB2  . ASN A 1 46 ? 12.487  -0.478  -9.298  1.00 0.00 ? 46 ASN A HB2  13 
ATOM   9727  H HB3  . ASN A 1 46 ? 11.360  0.524   -8.391  1.00 0.00 ? 46 ASN A HB3  13 
ATOM   9728  H HD21 . ASN A 1 46 ? 9.134   0.181   -8.631  1.00 0.00 ? 46 ASN A HD21 13 
ATOM   9729  H HD22 . ASN A 1 46 ? 8.512   -1.304  -9.256  1.00 0.00 ? 46 ASN A HD22 13 
ATOM   9730  N N    . SER A 1 47 ? 12.646  -0.545  -11.882 1.00 0.00 ? 47 SER A N    13 
ATOM   9731  C CA   . SER A 1 47 ? 12.916  -1.288  -13.108 1.00 0.00 ? 47 SER A CA   13 
ATOM   9732  C C    . SER A 1 47 ? 14.412  -1.537  -13.266 1.00 0.00 ? 47 SER A C    13 
ATOM   9733  O O    . SER A 1 47 ? 15.228  -0.675  -12.945 1.00 0.00 ? 47 SER A O    13 
ATOM   9734  C CB   . SER A 1 47 ? 12.379  -0.574  -14.354 1.00 0.00 ? 47 SER A CB   13 
ATOM   9735  O OG   . SER A 1 47 ? 12.909  -1.146  -15.538 1.00 0.00 ? 47 SER A OG   13 
ATOM   9736  H H    . SER A 1 47 ? 13.124  -0.810  -11.078 1.00 0.00 ? 47 SER A H    13 
ATOM   9737  H HA   . SER A 1 47 ? 12.426  -2.237  -13.005 1.00 0.00 ? 47 SER A HA   13 
ATOM   9738  H HB2  . SER A 1 47 ? 11.303  -0.659  -14.380 1.00 0.00 ? 47 SER A HB2  13 
ATOM   9739  H HB3  . SER A 1 47 ? 12.658  0.469   -14.317 1.00 0.00 ? 47 SER A HB3  13 
ATOM   9740  H HG   . SER A 1 47 ? 13.019  -0.462  -16.203 1.00 0.00 ? 47 SER A HG   13 
ATOM   9741  N N    . VAL A 1 48 ? 14.756  -2.721  -13.771 1.00 0.00 ? 48 VAL A N    13 
ATOM   9742  C CA   . VAL A 1 48 ? 16.142  -3.112  -13.991 1.00 0.00 ? 48 VAL A CA   13 
ATOM   9743  C C    . VAL A 1 48 ? 16.226  -4.602  -14.273 1.00 0.00 ? 48 VAL A C    13 
ATOM   9744  O O    . VAL A 1 48 ? 16.182  -5.427  -13.360 1.00 0.00 ? 48 VAL A O    13 
ATOM   9745  C CB   . VAL A 1 48 ? 17.068  -2.800  -12.805 1.00 0.00 ? 48 VAL A CB   13 
ATOM   9746  C CG1  . VAL A 1 48 ? 17.704  -1.425  -12.954 1.00 0.00 ? 48 VAL A CG1  13 
ATOM   9747  C CG2  . VAL A 1 48 ? 16.329  -2.925  -11.481 1.00 0.00 ? 48 VAL A CG2  13 
ATOM   9748  H H    . VAL A 1 48 ? 14.053  -3.354  -14.015 1.00 0.00 ? 48 VAL A H    13 
ATOM   9749  H HA   . VAL A 1 48 ? 16.505  -2.575  -14.854 1.00 0.00 ? 48 VAL A HA   13 
ATOM   9750  H HB   . VAL A 1 48 ? 17.859  -3.532  -12.822 1.00 0.00 ? 48 VAL A HB   13 
ATOM   9751  H HG11 . VAL A 1 48 ? 17.448  -1.012  -13.918 1.00 0.00 ? 48 VAL A HG11 13 
ATOM   9752  H HG12 . VAL A 1 48 ? 18.778  -1.514  -12.875 1.00 0.00 ? 48 VAL A HG12 13 
ATOM   9753  H HG13 . VAL A 1 48 ? 17.340  -0.773  -12.175 1.00 0.00 ? 48 VAL A HG13 13 
ATOM   9754  H HG21 . VAL A 1 48 ? 16.089  -1.941  -11.108 1.00 0.00 ? 48 VAL A HG21 13 
ATOM   9755  H HG22 . VAL A 1 48 ? 16.955  -3.437  -10.766 1.00 0.00 ? 48 VAL A HG22 13 
ATOM   9756  H HG23 . VAL A 1 48 ? 15.418  -3.485  -11.628 1.00 0.00 ? 48 VAL A HG23 13 
ATOM   9757  N N    . LYS A 1 49 ? 16.358  -4.923  -15.545 1.00 0.00 ? 49 LYS A N    13 
ATOM   9758  C CA   . LYS A 1 49 ? 16.463  -6.298  -16.006 1.00 0.00 ? 49 LYS A CA   13 
ATOM   9759  C C    . LYS A 1 49 ? 16.162  -6.391  -17.499 1.00 0.00 ? 49 LYS A C    13 
ATOM   9760  O O    . LYS A 1 49 ? 15.113  -5.945  -17.960 1.00 0.00 ? 49 LYS A O    13 
ATOM   9761  C CB   . LYS A 1 49 ? 15.519  -7.221  -15.224 1.00 0.00 ? 49 LYS A CB   13 
ATOM   9762  C CG   . LYS A 1 49 ? 16.234  -8.116  -14.224 1.00 0.00 ? 49 LYS A CG   13 
ATOM   9763  C CD   . LYS A 1 49 ? 15.713  -9.543  -14.277 1.00 0.00 ? 49 LYS A CD   13 
ATOM   9764  C CE   . LYS A 1 49 ? 14.305  -9.644  -13.710 1.00 0.00 ? 49 LYS A CE   13 
ATOM   9765  N NZ   . LYS A 1 49 ? 14.295  -10.250 -12.350 1.00 0.00 ? 49 LYS A NZ   13 
ATOM   9766  H H    . LYS A 1 49 ? 16.397  -4.211  -16.192 1.00 0.00 ? 49 LYS A H    13 
ATOM   9767  H HA   . LYS A 1 49 ? 17.475  -6.605  -15.841 1.00 0.00 ? 49 LYS A HA   13 
ATOM   9768  H HB2  . LYS A 1 49 ? 14.806  -6.615  -14.685 1.00 0.00 ? 49 LYS A HB2  13 
ATOM   9769  H HB3  . LYS A 1 49 ? 14.988  -7.851  -15.923 1.00 0.00 ? 49 LYS A HB3  13 
ATOM   9770  H HG2  . LYS A 1 49 ? 17.290  -8.121  -14.451 1.00 0.00 ? 49 LYS A HG2  13 
ATOM   9771  H HG3  . LYS A 1 49 ? 16.081  -7.722  -13.230 1.00 0.00 ? 49 LYS A HG3  13 
ATOM   9772  H HD2  . LYS A 1 49 ? 15.700  -9.874  -15.304 1.00 0.00 ? 49 LYS A HD2  13 
ATOM   9773  H HD3  . LYS A 1 49 ? 16.370  -10.177 -13.699 1.00 0.00 ? 49 LYS A HD3  13 
ATOM   9774  H HE2  . LYS A 1 49 ? 13.880  -8.653  -13.655 1.00 0.00 ? 49 LYS A HE2  13 
ATOM   9775  H HE3  . LYS A 1 49 ? 13.708  -10.255 -14.371 1.00 0.00 ? 49 LYS A HE3  13 
ATOM   9776  H HZ1  . LYS A 1 49 ? 13.440  -10.828 -12.222 1.00 0.00 ? 49 LYS A HZ1  13 
ATOM   9777  H HZ2  . LYS A 1 49 ? 14.306  -9.504  -11.625 1.00 0.00 ? 49 LYS A HZ2  13 
ATOM   9778  H HZ3  . LYS A 1 49 ? 15.132  -10.854 -12.221 1.00 0.00 ? 49 LYS A HZ3  13 
HETATM 9779  N N    . CY1 A 1 50 ? 17.091  -6.977  -18.248 1.00 0.00 ? 50 CY1 A N    13 
HETATM 9780  C CA   . CY1 A 1 50 ? 16.927  -7.130  -19.690 1.00 0.00 ? 50 CY1 A CA   13 
HETATM 9781  C CB   . CY1 A 1 50 ? 18.267  -6.924  -20.399 1.00 0.00 ? 50 CY1 A CB   13 
HETATM 9782  S SG   . CY1 A 1 50 ? 18.786  -5.198  -20.405 1.00 0.00 ? 50 CY1 A SG   13 
HETATM 9783  C CD   . CY1 A 1 50 ? 19.691  -5.070  -21.959 1.00 0.00 ? 50 CY1 A CD   13 
HETATM 9784  N NE   . CY1 A 1 50 ? 18.857  -5.525  -23.068 1.00 0.00 ? 50 CY1 A NE   13 
HETATM 9785  C CZ   . CY1 A 1 50 ? 19.324  -6.146  -24.146 1.00 0.00 ? 50 CY1 A CZ   13 
HETATM 9786  O OAC  . CY1 A 1 50 ? 20.513  -6.409  -24.330 1.00 0.00 ? 50 CY1 A OAC  13 
HETATM 9787  C CM   . CY1 A 1 50 ? 18.285  -6.535  -25.181 1.00 0.00 ? 50 CY1 A CM   13 
HETATM 9788  C C    . CY1 A 1 50 ? 16.366  -8.508  -20.033 1.00 0.00 ? 50 CY1 A C    13 
HETATM 9789  O O    . CY1 A 1 50 ? 16.632  -9.041  -21.110 1.00 0.00 ? 50 CY1 A O    13 
HETATM 9790  H H    . CY1 A 1 50 ? 17.906  -7.314  -17.822 1.00 0.00 ? 50 CY1 A H    13 
HETATM 9791  H HA   . CY1 A 1 50 ? 16.231  -6.376  -20.029 1.00 0.00 ? 50 CY1 A HA   13 
HETATM 9792  H HB2  . CY1 A 1 50 ? 19.025  -7.509  -19.899 1.00 0.00 ? 50 CY1 A HB2  13 
HETATM 9793  H HB3  . CY1 A 1 50 ? 18.180  -7.257  -21.423 1.00 0.00 ? 50 CY1 A HB3  13 
HETATM 9794  H HD2  . CY1 A 1 50 ? 19.347  -4.109  -21.607 1.00 0.00 ? 50 CY1 A HD2  13 
HETATM 9795  H HD3  . CY1 A 1 50 ? 20.667  -4.786  -22.324 1.00 0.00 ? 50 CY1 A HD3  13 
HETATM 9796  H HE   . CY1 A 1 50 ? 17.885  -5.427  -22.984 1.00 0.00 ? 50 CY1 A HE   13 
HETATM 9797  H HM1  . CY1 A 1 50 ? 18.784  -6.716  -26.130 1.00 0.00 ? 50 CY1 A HM1  13 
HETATM 9798  H HM2  . CY1 A 1 50 ? 17.555  -5.734  -25.265 1.00 0.00 ? 50 CY1 A HM2  13 
HETATM 9799  H HM3  . CY1 A 1 50 ? 17.782  -7.430  -24.881 1.00 0.00 ? 50 CY1 A HM3  13 
HETATM 9800  N N    . NH2 A 1 51 ? 15.591  -9.097  -19.128 1.00 0.00 ? 51 NH2 A N    13 
HETATM 9801  H HN1  . NH2 A 1 51 ? 15.416  -8.622  -18.289 1.00 0.00 ? 51 NH2 A HN1  13 
HETATM 9802  H HN2  . NH2 A 1 51 ? 15.227  -9.982  -19.337 1.00 0.00 ? 51 NH2 A HN2  13 
ATOM   9803  N N    . LEU A 1 1  ? -0.067  3.792   14.008  1.00 0.00 ? 1  LEU A N    14 
ATOM   9804  C CA   . LEU A 1 1  ? -1.526  3.559   14.169  1.00 0.00 ? 1  LEU A CA   14 
ATOM   9805  C C    . LEU A 1 1  ? -2.026  2.499   13.192  1.00 0.00 ? 1  LEU A C    14 
ATOM   9806  O O    . LEU A 1 1  ? -2.781  1.603   13.566  1.00 0.00 ? 1  LEU A O    14 
ATOM   9807  C CB   . LEU A 1 1  ? -2.260  4.880   13.932  1.00 0.00 ? 1  LEU A CB   14 
ATOM   9808  C CG   . LEU A 1 1  ? -2.069  5.931   15.030  1.00 0.00 ? 1  LEU A CG   14 
ATOM   9809  C CD1  . LEU A 1 1  ? -1.027  6.958   14.609  1.00 0.00 ? 1  LEU A CD1  14 
ATOM   9810  C CD2  . LEU A 1 1  ? -3.391  6.613   15.352  1.00 0.00 ? 1  LEU A CD2  14 
ATOM   9811  H H1   . LEU A 1 1  ? 0.395   2.866   13.916  1.00 0.00 ? 1  LEU A H1   14 
ATOM   9812  H H2   . LEU A 1 1  ? 0.267   4.296   14.854  1.00 0.00 ? 1  LEU A H2   14 
ATOM   9813  H H3   . LEU A 1 1  ? 0.071   4.364   13.151  1.00 0.00 ? 1  LEU A H3   14 
ATOM   9814  H HA   . LEU A 1 1  ? -1.712  3.224   15.178  1.00 0.00 ? 1  LEU A HA   14 
ATOM   9815  H HB2  . LEU A 1 1  ? -1.914  5.297   12.997  1.00 0.00 ? 1  LEU A HB2  14 
ATOM   9816  H HB3  . LEU A 1 1  ? -3.315  4.671   13.845  1.00 0.00 ? 1  LEU A HB3  14 
ATOM   9817  H HG   . LEU A 1 1  ? -1.715  5.445   15.927  1.00 0.00 ? 1  LEU A HG   14 
ATOM   9818  H HD11 . LEU A 1 1  ? -0.122  6.451   14.313  1.00 0.00 ? 1  LEU A HD11 14 
ATOM   9819  H HD12 . LEU A 1 1  ? -0.817  7.617   15.439  1.00 0.00 ? 1  LEU A HD12 14 
ATOM   9820  H HD13 . LEU A 1 1  ? -1.406  7.536   13.779  1.00 0.00 ? 1  LEU A HD13 14 
ATOM   9821  H HD21 . LEU A 1 1  ? -3.906  6.853   14.433  1.00 0.00 ? 1  LEU A HD21 14 
ATOM   9822  H HD22 . LEU A 1 1  ? -3.203  7.519   15.907  1.00 0.00 ? 1  LEU A HD22 14 
ATOM   9823  H HD23 . LEU A 1 1  ? -4.003  5.948   15.944  1.00 0.00 ? 1  LEU A HD23 14 
ATOM   9824  N N    . GLN A 1 2  ? -1.599  2.608   11.938  1.00 0.00 ? 2  GLN A N    14 
ATOM   9825  C CA   . GLN A 1 2  ? -2.003  1.659   10.907  1.00 0.00 ? 2  GLN A CA   14 
ATOM   9826  C C    . GLN A 1 2  ? -0.797  0.902   10.360  1.00 0.00 ? 2  GLN A C    14 
ATOM   9827  O O    . GLN A 1 2  ? 0.289   1.466   10.227  1.00 0.00 ? 2  GLN A O    14 
ATOM   9828  C CB   . GLN A 1 2  ? -2.724  2.386   9.770   1.00 0.00 ? 2  GLN A CB   14 
ATOM   9829  C CG   . GLN A 1 2  ? -3.824  3.320   10.247  1.00 0.00 ? 2  GLN A CG   14 
ATOM   9830  C CD   . GLN A 1 2  ? -3.833  4.640   9.502   1.00 0.00 ? 2  GLN A CD   14 
ATOM   9831  O OE1  . GLN A 1 2  ? -3.473  5.681   10.052  1.00 0.00 ? 2  GLN A OE1  14 
ATOM   9832  N NE2  . GLN A 1 2  ? -4.249  4.604   8.241   1.00 0.00 ? 2  GLN A NE2  14 
ATOM   9833  H H    . GLN A 1 2  ? -0.998  3.345   11.700  1.00 0.00 ? 2  GLN A H    14 
ATOM   9834  H HA   . GLN A 1 2  ? -2.683  0.951   11.356  1.00 0.00 ? 2  GLN A HA   14 
ATOM   9835  H HB2  . GLN A 1 2  ? -2.002  2.968   9.215   1.00 0.00 ? 2  GLN A HB2  14 
ATOM   9836  H HB3  . GLN A 1 2  ? -3.165  1.653   9.112   1.00 0.00 ? 2  GLN A HB3  14 
ATOM   9837  H HG2  . GLN A 1 2  ? -4.778  2.837   10.103  1.00 0.00 ? 2  GLN A HG2  14 
ATOM   9838  H HG3  . GLN A 1 2  ? -3.679  3.519   11.300  1.00 0.00 ? 2  GLN A HG3  14 
ATOM   9839  H HE21 . GLN A 1 2  ? -4.521  3.740   7.868   1.00 0.00 ? 2  GLN A HE21 14 
ATOM   9840  H HE22 . GLN A 1 2  ? -4.266  5.443   7.734   1.00 0.00 ? 2  GLN A HE22 14 
ATOM   9841  N N    . MET A 1 3  ? -1.000  -0.381  10.056  1.00 0.00 ? 3  MET A N    14 
ATOM   9842  C CA   . MET A 1 3  ? 0.069   -1.246  9.523   1.00 0.00 ? 3  MET A CA   14 
ATOM   9843  C C    . MET A 1 3  ? 1.003   -1.734  10.623  1.00 0.00 ? 3  MET A C    14 
ATOM   9844  O O    . MET A 1 3  ? 1.853   -2.594  10.393  1.00 0.00 ? 3  MET A O    14 
ATOM   9845  C CB   . MET A 1 3  ? 0.874   -0.519  8.430   1.00 0.00 ? 3  MET A CB   14 
ATOM   9846  C CG   . MET A 1 3  ? 2.082   -1.295  7.903   1.00 0.00 ? 3  MET A CG   14 
ATOM   9847  S SD   . MET A 1 3  ? 3.597   -0.909  8.803   1.00 0.00 ? 3  MET A SD   14 
ATOM   9848  C CE   . MET A 1 3  ? 4.480   -2.461  8.659   1.00 0.00 ? 3  MET A CE   14 
ATOM   9849  H H    . MET A 1 3  ? -1.899  -0.761  10.199  1.00 0.00 ? 3  MET A H    14 
ATOM   9850  H HA   . MET A 1 3  ? -0.403  -2.106  9.090   1.00 0.00 ? 3  MET A HA   14 
ATOM   9851  H HB2  . MET A 1 3  ? 0.220   -0.314  7.597   1.00 0.00 ? 3  MET A HB2  14 
ATOM   9852  H HB3  . MET A 1 3  ? 1.230   0.417   8.832   1.00 0.00 ? 3  MET A HB3  14 
ATOM   9853  H HG2  . MET A 1 3  ? 1.892   -2.355  7.987   1.00 0.00 ? 3  MET A HG2  14 
ATOM   9854  H HG3  . MET A 1 3  ? 2.230   -1.041  6.862   1.00 0.00 ? 3  MET A HG3  14 
ATOM   9855  H HE1  . MET A 1 3  ? 5.078   -2.452  7.759   1.00 0.00 ? 3  MET A HE1  14 
ATOM   9856  H HE2  . MET A 1 3  ? 3.771   -3.274  8.612   1.00 0.00 ? 3  MET A HE2  14 
ATOM   9857  H HE3  . MET A 1 3  ? 5.122   -2.591  9.517   1.00 0.00 ? 3  MET A HE3  14 
ATOM   9858  N N    . ALA A 1 4  ? 0.839   -1.190  11.817  1.00 0.00 ? 4  ALA A N    14 
ATOM   9859  C CA   . ALA A 1 4  ? 1.664   -1.568  12.951  1.00 0.00 ? 4  ALA A CA   14 
ATOM   9860  C C    . ALA A 1 4  ? 1.082   -2.770  13.690  1.00 0.00 ? 4  ALA A C    14 
ATOM   9861  O O    . ALA A 1 4  ? 0.268   -2.616  14.599  1.00 0.00 ? 4  ALA A O    14 
ATOM   9862  C CB   . ALA A 1 4  ? 1.793   -0.381  13.882  1.00 0.00 ? 4  ALA A CB   14 
ATOM   9863  H H    . ALA A 1 4  ? 0.145   -0.515  11.943  1.00 0.00 ? 4  ALA A H    14 
ATOM   9864  H HA   . ALA A 1 4  ? 2.652   -1.816  12.585  1.00 0.00 ? 4  ALA A HA   14 
ATOM   9865  H HB1  . ALA A 1 4  ? 1.303   0.471   13.432  1.00 0.00 ? 4  ALA A HB1  14 
ATOM   9866  H HB2  . ALA A 1 4  ? 2.836   -0.156  14.037  1.00 0.00 ? 4  ALA A HB2  14 
ATOM   9867  H HB3  . ALA A 1 4  ? 1.324   -0.608  14.826  1.00 0.00 ? 4  ALA A HB3  14 
ATOM   9868  N N    . GLY A 1 5  ? 1.509   -3.968  13.298  1.00 0.00 ? 5  GLY A N    14 
ATOM   9869  C CA   . GLY A 1 5  ? 1.018   -5.173  13.943  1.00 0.00 ? 5  GLY A CA   14 
ATOM   9870  C C    . GLY A 1 5  ? 1.579   -6.441  13.323  1.00 0.00 ? 5  GLY A C    14 
ATOM   9871  O O    . GLY A 1 5  ? 2.136   -7.285  14.025  1.00 0.00 ? 5  GLY A O    14 
ATOM   9872  H H    . GLY A 1 5  ? 2.163   -4.034  12.572  1.00 0.00 ? 5  GLY A H    14 
ATOM   9873  H HA2  . GLY A 1 5  ? 1.296   -5.146  14.987  1.00 0.00 ? 5  GLY A HA2  14 
ATOM   9874  H HA3  . GLY A 1 5  ? -0.060  -5.195  13.871  1.00 0.00 ? 5  GLY A HA3  14 
ATOM   9875  N N    . GLN A 1 6  ? 1.437   -6.573  12.003  1.00 0.00 ? 6  GLN A N    14 
ATOM   9876  C CA   . GLN A 1 6  ? 1.931   -7.739  11.279  1.00 0.00 ? 6  GLN A CA   14 
ATOM   9877  C C    . GLN A 1 6  ? 1.306   -7.799  9.896   1.00 0.00 ? 6  GLN A C    14 
ATOM   9878  O O    . GLN A 1 6  ? 0.414   -8.608  9.630   1.00 0.00 ? 6  GLN A O    14 
ATOM   9879  C CB   . GLN A 1 6  ? 1.639   -9.034  12.048  1.00 0.00 ? 6  GLN A CB   14 
ATOM   9880  C CG   . GLN A 1 6  ? 2.876   -9.666  12.666  1.00 0.00 ? 6  GLN A CG   14 
ATOM   9881  C CD   . GLN A 1 6  ? 2.552   -10.527 13.870  1.00 0.00 ? 6  GLN A CD   14 
ATOM   9882  O OE1  . GLN A 1 6  ? 1.396   -10.885 14.098  1.00 0.00 ? 6  GLN A OE1  14 
ATOM   9883  N NE2  . GLN A 1 6  ? 3.573   -10.863 14.649  1.00 0.00 ? 6  GLN A NE2  14 
ATOM   9884  H H    . GLN A 1 6  ? 0.993   -5.862  11.497  1.00 0.00 ? 6  GLN A H    14 
ATOM   9885  H HA   . GLN A 1 6  ? 2.996   -7.624  11.164  1.00 0.00 ? 6  GLN A HA   14 
ATOM   9886  H HB2  . GLN A 1 6  ? 0.938   -8.818  12.840  1.00 0.00 ? 6  GLN A HB2  14 
ATOM   9887  H HB3  . GLN A 1 6  ? 1.195   -9.751  11.372  1.00 0.00 ? 6  GLN A HB3  14 
ATOM   9888  H HG2  . GLN A 1 6  ? 3.360   -10.281 11.922  1.00 0.00 ? 6  GLN A HG2  14 
ATOM   9889  H HG3  . GLN A 1 6  ? 3.550   -8.879  12.974  1.00 0.00 ? 6  GLN A HG3  14 
ATOM   9890  H HE21 . GLN A 1 6  ? 4.466   -10.542 14.406  1.00 0.00 ? 6  GLN A HE21 14 
ATOM   9891  H HE22 . GLN A 1 6  ? 3.391   -11.421 15.435  1.00 0.00 ? 6  GLN A HE22 14 
ATOM   9892  N N    . CYS A 1 7  ? 1.777   -6.925  9.025   1.00 0.00 ? 7  CYS A N    14 
ATOM   9893  C CA   . CYS A 1 7  ? 1.271   -6.850  7.661   1.00 0.00 ? 7  CYS A CA   14 
ATOM   9894  C C    . CYS A 1 7  ? 2.316   -7.309  6.656   1.00 0.00 ? 7  CYS A C    14 
ATOM   9895  O O    . CYS A 1 7  ? 3.508   -7.044  6.819   1.00 0.00 ? 7  CYS A O    14 
ATOM   9896  C CB   . CYS A 1 7  ? 0.849   -5.418  7.328   1.00 0.00 ? 7  CYS A CB   14 
ATOM   9897  S SG   . CYS A 1 7  ? -0.736  -4.907  8.062   1.00 0.00 ? 7  CYS A SG   14 
ATOM   9898  H H    . CYS A 1 7  ? 2.480   -6.305  9.313   1.00 0.00 ? 7  CYS A H    14 
ATOM   9899  H HA   . CYS A 1 7  ? 0.414   -7.496  7.588   1.00 0.00 ? 7  CYS A HA   14 
ATOM   9900  H HB2  . CYS A 1 7  ? 1.607   -4.739  7.688   1.00 0.00 ? 7  CYS A HB2  14 
ATOM   9901  H HB3  . CYS A 1 7  ? 0.766   -5.315  6.256   1.00 0.00 ? 7  CYS A HB3  14 
ATOM   9902  N N    . SER A 1 8  ? 1.860   -7.979  5.604   1.00 0.00 ? 8  SER A N    14 
ATOM   9903  C CA   . SER A 1 8  ? 2.757   -8.444  4.560   1.00 0.00 ? 8  SER A CA   14 
ATOM   9904  C C    . SER A 1 8  ? 3.420   -7.252  3.890   1.00 0.00 ? 8  SER A C    14 
ATOM   9905  O O    . SER A 1 8  ? 2.895   -6.141  3.920   1.00 0.00 ? 8  SER A O    14 
ATOM   9906  C CB   . SER A 1 8  ? 1.993   -9.274  3.527   1.00 0.00 ? 8  SER A CB   14 
ATOM   9907  O OG   . SER A 1 8  ? 1.348   -10.379 4.135   1.00 0.00 ? 8  SER A OG   14 
ATOM   9908  H H    . SER A 1 8  ? 0.898   -8.147  5.521   1.00 0.00 ? 8  SER A H    14 
ATOM   9909  H HA   . SER A 1 8  ? 3.520   -9.056  5.015   1.00 0.00 ? 8  SER A HA   14 
ATOM   9910  H HB2  . SER A 1 8  ? 1.248   -8.656  3.051   1.00 0.00 ? 8  SER A HB2  14 
ATOM   9911  H HB3  . SER A 1 8  ? 2.684   -9.642  2.782   1.00 0.00 ? 8  SER A HB3  14 
ATOM   9912  H HG   . SER A 1 8  ? 0.855   -10.080 4.902   1.00 0.00 ? 8  SER A HG   14 
ATOM   9913  N N    . GLN A 1 9  ? 4.581   -7.480  3.302   1.00 0.00 ? 9  GLN A N    14 
ATOM   9914  C CA   . GLN A 1 9  ? 5.321   -6.415  2.644   1.00 0.00 ? 9  GLN A CA   14 
ATOM   9915  C C    . GLN A 1 9  ? 4.424   -5.573  1.744   1.00 0.00 ? 9  GLN A C    14 
ATOM   9916  O O    . GLN A 1 9  ? 3.694   -6.096  0.904   1.00 0.00 ? 9  GLN A O    14 
ATOM   9917  C CB   . GLN A 1 9  ? 6.487   -6.990  1.839   1.00 0.00 ? 9  GLN A CB   14 
ATOM   9918  C CG   . GLN A 1 9  ? 6.063   -8.038  0.823   1.00 0.00 ? 9  GLN A CG   14 
ATOM   9919  C CD   . GLN A 1 9  ? 6.412   -9.448  1.260   1.00 0.00 ? 9  GLN A CD   14 
ATOM   9920  O OE1  . GLN A 1 9  ? 7.569   -9.863  1.193   1.00 0.00 ? 9  GLN A OE1  14 
ATOM   9921  N NE2  . GLN A 1 9  ? 5.409   -10.193 1.709   1.00 0.00 ? 9  GLN A NE2  14 
ATOM   9922  H H    . GLN A 1 9  ? 4.959   -8.381  3.323   1.00 0.00 ? 9  GLN A H    14 
ATOM   9923  H HA   . GLN A 1 9  ? 5.711   -5.776  3.418   1.00 0.00 ? 9  GLN A HA   14 
ATOM   9924  H HB2  . GLN A 1 9  ? 6.976   -6.185  1.311   1.00 0.00 ? 9  GLN A HB2  14 
ATOM   9925  H HB3  . GLN A 1 9  ? 7.191   -7.443  2.520   1.00 0.00 ? 9  GLN A HB3  14 
ATOM   9926  H HG2  . GLN A 1 9  ? 4.994   -7.975  0.685   1.00 0.00 ? 9  GLN A HG2  14 
ATOM   9927  H HG3  . GLN A 1 9  ? 6.559   -7.834  -0.114  1.00 0.00 ? 9  GLN A HG3  14 
ATOM   9928  H HE21 . GLN A 1 9  ? 4.513   -9.798  1.733   1.00 0.00 ? 9  GLN A HE21 14 
ATOM   9929  H HE22 . GLN A 1 9  ? 5.606   -11.109 1.999   1.00 0.00 ? 9  GLN A HE22 14 
ATOM   9930  N N    . ASN A 1 10 ? 4.496   -4.263  1.941   1.00 0.00 ? 10 ASN A N    14 
ATOM   9931  C CA   . ASN A 1 10 ? 3.707   -3.312  1.166   1.00 0.00 ? 10 ASN A CA   14 
ATOM   9932  C C    . ASN A 1 10 ? 2.215   -3.458  1.465   1.00 0.00 ? 10 ASN A C    14 
ATOM   9933  O O    . ASN A 1 10 ? 1.360   -3.067  0.669   1.00 0.00 ? 10 ASN A O    14 
ATOM   9934  C CB   . ASN A 1 10 ? 4.018   -3.463  -0.351  1.00 0.00 ? 10 ASN A CB   14 
ATOM   9935  C CG   . ASN A 1 10 ? 2.814   -3.849  -1.194  1.00 0.00 ? 10 ASN A CG   14 
ATOM   9936  O OD1  . ASN A 1 10 ? 2.395   -3.098  -2.073  1.00 0.00 ? 10 ASN A OD1  14 
ATOM   9937  N ND2  . ASN A 1 10 ? 2.251   -5.022  -0.928  1.00 0.00 ? 10 ASN A ND2  14 
ATOM   9938  H H    . ASN A 1 10 ? 5.106   -3.921  2.633   1.00 0.00 ? 10 ASN A H    14 
ATOM   9939  H HA   . ASN A 1 10 ? 4.000   -2.334  1.500   1.00 0.00 ? 10 ASN A HA   14 
ATOM   9940  H HB2  . ASN A 1 10 ? 4.402   -2.528  -0.737  1.00 0.00 ? 10 ASN A HB2  14 
ATOM   9941  H HB3  . ASN A 1 10 ? 4.774   -4.227  -0.480  1.00 0.00 ? 10 ASN A HB3  14 
ATOM   9942  H HD21 . ASN A 1 10 ? 2.636   -5.569  -0.213  1.00 0.00 ? 10 ASN A HD21 14 
ATOM   9943  H HD22 . ASN A 1 10 ? 1.473   -5.293  -1.459  1.00 0.00 ? 10 ASN A HD22 14 
ATOM   9944  N N    . GLU A 1 11 ? 1.910   -3.995  2.633   1.00 0.00 ? 11 GLU A N    14 
ATOM   9945  C CA   . GLU A 1 11 ? 0.519   -4.161  3.042   1.00 0.00 ? 11 GLU A CA   14 
ATOM   9946  C C    . GLU A 1 11 ? 0.187   -3.241  4.199   1.00 0.00 ? 11 GLU A C    14 
ATOM   9947  O O    . GLU A 1 11 ? 1.023   -3.006  5.071   1.00 0.00 ? 11 GLU A O    14 
ATOM   9948  C CB   . GLU A 1 11 ? 0.221   -5.621  3.396   1.00 0.00 ? 11 GLU A CB   14 
ATOM   9949  C CG   . GLU A 1 11 ? -1.086  -6.138  2.816   1.00 0.00 ? 11 GLU A CG   14 
ATOM   9950  C CD   . GLU A 1 11 ? -0.998  -7.587  2.384   1.00 0.00 ? 11 GLU A CD   14 
ATOM   9951  O OE1  . GLU A 1 11 ? -0.171  -7.896  1.500   1.00 0.00 ? 11 GLU A OE1  14 
ATOM   9952  O OE2  . GLU A 1 11 ? -1.757  -8.417  2.928   1.00 0.00 ? 11 GLU A OE2  14 
ATOM   9953  H H    . GLU A 1 11 ? 2.637   -4.265  3.238   1.00 0.00 ? 11 GLU A H    14 
ATOM   9954  H HA   . GLU A 1 11 ? -0.090  -3.869  2.221   1.00 0.00 ? 11 GLU A HA   14 
ATOM   9955  H HB2  . GLU A 1 11 ? 1.021   -6.239  3.019   1.00 0.00 ? 11 GLU A HB2  14 
ATOM   9956  H HB3  . GLU A 1 11 ? 0.177   -5.719  4.470   1.00 0.00 ? 11 GLU A HB3  14 
ATOM   9957  H HG2  . GLU A 1 11 ? -1.857  -6.049  3.564   1.00 0.00 ? 11 GLU A HG2  14 
ATOM   9958  H HG3  . GLU A 1 11 ? -1.348  -5.537  1.957   1.00 0.00 ? 11 GLU A HG3  14 
ATOM   9959  N N    . TYR A 1 12 ? -1.036  -2.700  4.204   1.00 0.00 ? 12 TYR A N    14 
ATOM   9960  C CA   . TYR A 1 12 ? -1.424  -1.784  5.283   1.00 0.00 ? 12 TYR A CA   14 
ATOM   9961  C C    . TYR A 1 12 ? -2.700  -2.220  5.991   1.00 0.00 ? 12 TYR A C    14 
ATOM   9962  O O    . TYR A 1 12 ? -3.767  -2.318  5.386   1.00 0.00 ? 12 TYR A O    14 
ATOM   9963  C CB   . TYR A 1 12 ? -1.556  -0.346  4.771   1.00 0.00 ? 12 TYR A CB   14 
ATOM   9964  C CG   . TYR A 1 12 ? -2.795  -0.069  3.945   1.00 0.00 ? 12 TYR A CG   14 
ATOM   9965  C CD1  . TYR A 1 12 ? -2.786  -0.234  2.567   1.00 0.00 ? 12 TYR A CD1  14 
ATOM   9966  C CD2  . TYR A 1 12 ? -3.968  0.372   4.545   1.00 0.00 ? 12 TYR A CD2  14 
ATOM   9967  C CE1  . TYR A 1 12 ? -3.911  0.030   1.809   1.00 0.00 ? 12 TYR A CE1  14 
ATOM   9968  C CE2  . TYR A 1 12 ? -5.096  0.640   3.794   1.00 0.00 ? 12 TYR A CE2  14 
ATOM   9969  C CZ   . TYR A 1 12 ? -5.063  0.467   2.428   1.00 0.00 ? 12 TYR A CZ   14 
ATOM   9970  O OH   . TYR A 1 12 ? -6.185  0.734   1.676   1.00 0.00 ? 12 TYR A OH   14 
ATOM   9971  H H    . TYR A 1 12 ? -1.678  -2.914  3.467   1.00 0.00 ? 12 TYR A H    14 
ATOM   9972  H HA   . TYR A 1 12 ? -0.625  -1.801  6.014   1.00 0.00 ? 12 TYR A HA   14 
ATOM   9973  H HB2  . TYR A 1 12 ? -1.577  0.319   5.620   1.00 0.00 ? 12 TYR A HB2  14 
ATOM   9974  H HB3  . TYR A 1 12 ? -0.694  -0.113  4.163   1.00 0.00 ? 12 TYR A HB3  14 
ATOM   9975  H HD1  . TYR A 1 12 ? -1.883  -0.577  2.085   1.00 0.00 ? 12 TYR A HD1  14 
ATOM   9976  H HD2  . TYR A 1 12 ? -3.992  0.504   5.616   1.00 0.00 ? 12 TYR A HD2  14 
ATOM   9977  H HE1  . TYR A 1 12 ? -3.885  -0.106  0.738   1.00 0.00 ? 12 TYR A HE1  14 
ATOM   9978  H HE2  . TYR A 1 12 ? -5.997  0.982   4.279   1.00 0.00 ? 12 TYR A HE2  14 
ATOM   9979  H HH   . TYR A 1 12 ? -6.613  1.526   2.009   1.00 0.00 ? 12 TYR A HH   14 
ATOM   9980  N N    . PHE A 1 13 ? -2.565  -2.463  7.294   1.00 0.00 ? 13 PHE A N    14 
ATOM   9981  C CA   . PHE A 1 13 ? -3.678  -2.884  8.142   1.00 0.00 ? 13 PHE A CA   14 
ATOM   9982  C C    . PHE A 1 13 ? -4.590  -1.701  8.449   1.00 0.00 ? 13 PHE A C    14 
ATOM   9983  O O    . PHE A 1 13 ? -4.407  -0.997  9.441   1.00 0.00 ? 13 PHE A O    14 
ATOM   9984  C CB   . PHE A 1 13 ? -3.132  -3.512  9.439   1.00 0.00 ? 13 PHE A CB   14 
ATOM   9985  C CG   . PHE A 1 13 ? -3.997  -3.331  10.657  1.00 0.00 ? 13 PHE A CG   14 
ATOM   9986  C CD1  . PHE A 1 13 ? -5.163  -4.063  10.812  1.00 0.00 ? 13 PHE A CD1  14 
ATOM   9987  C CD2  . PHE A 1 13 ? -3.639  -2.430  11.648  1.00 0.00 ? 13 PHE A CD2  14 
ATOM   9988  C CE1  . PHE A 1 13 ? -5.955  -3.899  11.932  1.00 0.00 ? 13 PHE A CE1  14 
ATOM   9989  C CE2  . PHE A 1 13 ? -4.428  -2.263  12.770  1.00 0.00 ? 13 PHE A CE2  14 
ATOM   9990  C CZ   . PHE A 1 13 ? -5.587  -2.998  12.911  1.00 0.00 ? 13 PHE A CZ   14 
ATOM   9991  H H    . PHE A 1 13 ? -1.682  -2.346  7.698   1.00 0.00 ? 13 PHE A H    14 
ATOM   9992  H HA   . PHE A 1 13 ? -4.247  -3.631  7.607   1.00 0.00 ? 13 PHE A HA   14 
ATOM   9993  H HB2  . PHE A 1 13 ? -3.014  -4.572  9.287   1.00 0.00 ? 13 PHE A HB2  14 
ATOM   9994  H HB3  . PHE A 1 13 ? -2.165  -3.079  9.655   1.00 0.00 ? 13 PHE A HB3  14 
ATOM   9995  H HD1  . PHE A 1 13 ? -5.451  -4.767  10.046  1.00 0.00 ? 13 PHE A HD1  14 
ATOM   9996  H HD2  . PHE A 1 13 ? -2.731  -1.855  11.540  1.00 0.00 ? 13 PHE A HD2  14 
ATOM   9997  H HE1  . PHE A 1 13 ? -6.860  -4.477  12.042  1.00 0.00 ? 13 PHE A HE1  14 
ATOM   9998  H HE2  . PHE A 1 13 ? -4.137  -1.559  13.535  1.00 0.00 ? 13 PHE A HE2  14 
ATOM   9999  H HZ   . PHE A 1 13 ? -6.205  -2.869  13.787  1.00 0.00 ? 13 PHE A HZ   14 
ATOM   10000 N N    . ASP A 1 14 ? -5.580  -1.495  7.591   1.00 0.00 ? 14 ASP A N    14 
ATOM   10001 C CA   . ASP A 1 14 ? -6.527  -0.403  7.774   1.00 0.00 ? 14 ASP A CA   14 
ATOM   10002 C C    . ASP A 1 14 ? -7.322  -0.602  9.052   1.00 0.00 ? 14 ASP A C    14 
ATOM   10003 O O    . ASP A 1 14 ? -8.202  -1.452  9.115   1.00 0.00 ? 14 ASP A O    14 
ATOM   10004 C CB   . ASP A 1 14 ? -7.479  -0.313  6.580   1.00 0.00 ? 14 ASP A CB   14 
ATOM   10005 C CG   . ASP A 1 14 ? -7.781  1.121   6.189   1.00 0.00 ? 14 ASP A CG   14 
ATOM   10006 O OD1  . ASP A 1 14 ? -7.727  2.001   7.074   1.00 0.00 ? 14 ASP A OD1  14 
ATOM   10007 O OD2  . ASP A 1 14 ? -8.074  1.363   4.999   1.00 0.00 ? 14 ASP A OD2  14 
ATOM   10008 H H    . ASP A 1 14 ? -5.678  -2.098  6.819   1.00 0.00 ? 14 ASP A H    14 
ATOM   10009 H HA   . ASP A 1 14 ? -5.975  0.520   7.854   1.00 0.00 ? 14 ASP A HA   14 
ATOM   10010 H HB2  . ASP A 1 14 ? -7.034  -0.812  5.733   1.00 0.00 ? 14 ASP A HB2  14 
ATOM   10011 H HB3  . ASP A 1 14 ? -8.408  -0.801  6.832   1.00 0.00 ? 14 ASP A HB3  14 
ATOM   10012 N N    . SER A 1 15 ? -7.007  0.186   10.074  1.00 0.00 ? 15 SER A N    14 
ATOM   10013 C CA   . SER A 1 15 ? -7.706  0.088   11.347  1.00 0.00 ? 15 SER A CA   14 
ATOM   10014 C C    . SER A 1 15 ? -9.214  0.175   11.144  1.00 0.00 ? 15 SER A C    14 
ATOM   10015 O O    . SER A 1 15 ? -9.991  -0.274  11.988  1.00 0.00 ? 15 SER A O    14 
ATOM   10016 C CB   . SER A 1 15 ? -7.236  1.188   12.303  1.00 0.00 ? 15 SER A CB   14 
ATOM   10017 O OG   . SER A 1 15 ? -6.662  2.270   11.592  1.00 0.00 ? 15 SER A OG   14 
ATOM   10018 H H    . SER A 1 15 ? -6.294  0.847   9.970   1.00 0.00 ? 15 SER A H    14 
ATOM   10019 H HA   . SER A 1 15 ? -7.474  -0.871  11.773  1.00 0.00 ? 15 SER A HA   14 
ATOM   10020 H HB2  . SER A 1 15 ? -8.079  1.553   12.871  1.00 0.00 ? 15 SER A HB2  14 
ATOM   10021 H HB3  . SER A 1 15 ? -6.496  0.782   12.978  1.00 0.00 ? 15 SER A HB3  14 
ATOM   10022 H HG   . SER A 1 15 ? -5.761  2.408   11.892  1.00 0.00 ? 15 SER A HG   14 
ATOM   10023 N N    . LEU A 1 16 ? -9.623  0.740   10.013  1.00 0.00 ? 16 LEU A N    14 
ATOM   10024 C CA   . LEU A 1 16 ? -11.039 0.865   9.699   1.00 0.00 ? 16 LEU A CA   14 
ATOM   10025 C C    . LEU A 1 16 ? -11.552 -0.408  9.031   1.00 0.00 ? 16 LEU A C    14 
ATOM   10026 O O    . LEU A 1 16 ? -12.738 -0.727  9.106   1.00 0.00 ? 16 LEU A O    14 
ATOM   10027 C CB   . LEU A 1 16 ? -11.281 2.069   8.788   1.00 0.00 ? 16 LEU A CB   14 
ATOM   10028 C CG   . LEU A 1 16 ? -12.755 2.389   8.519   1.00 0.00 ? 16 LEU A CG   14 
ATOM   10029 C CD1  . LEU A 1 16 ? -13.093 3.798   8.983   1.00 0.00 ? 16 LEU A CD1  14 
ATOM   10030 C CD2  . LEU A 1 16 ? -13.077 2.223   7.041   1.00 0.00 ? 16 LEU A CD2  14 
ATOM   10031 H H    . LEU A 1 16 ? -8.958  1.072   9.371   1.00 0.00 ? 16 LEU A H    14 
ATOM   10032 H HA   . LEU A 1 16 ? -11.572 1.011   10.626  1.00 0.00 ? 16 LEU A HA   14 
ATOM   10033 H HB2  . LEU A 1 16 ? -10.820 2.935   9.242   1.00 0.00 ? 16 LEU A HB2  14 
ATOM   10034 H HB3  . LEU A 1 16 ? -10.797 1.880   7.842   1.00 0.00 ? 16 LEU A HB3  14 
ATOM   10035 H HG   . LEU A 1 16 ? -13.373 1.698   9.076   1.00 0.00 ? 16 LEU A HG   14 
ATOM   10036 H HD11 . LEU A 1 16 ? -12.349 4.487   8.610   1.00 0.00 ? 16 LEU A HD11 14 
ATOM   10037 H HD12 . LEU A 1 16 ? -13.103 3.828   10.062  1.00 0.00 ? 16 LEU A HD12 14 
ATOM   10038 H HD13 . LEU A 1 16 ? -14.064 4.078   8.605   1.00 0.00 ? 16 LEU A HD13 14 
ATOM   10039 H HD21 . LEU A 1 16 ? -14.093 1.874   6.931   1.00 0.00 ? 16 LEU A HD21 14 
ATOM   10040 H HD22 . LEU A 1 16 ? -12.400 1.503   6.603   1.00 0.00 ? 16 LEU A HD22 14 
ATOM   10041 H HD23 . LEU A 1 16 ? -12.966 3.173   6.539   1.00 0.00 ? 16 LEU A HD23 14 
ATOM   10042 N N    . LEU A 1 17 ? -10.648 -1.127  8.370   1.00 0.00 ? 17 LEU A N    14 
ATOM   10043 C CA   . LEU A 1 17 ? -10.999 -2.358  7.678   1.00 0.00 ? 17 LEU A CA   14 
ATOM   10044 C C    . LEU A 1 17 ? -10.536 -3.592  8.454   1.00 0.00 ? 17 LEU A C    14 
ATOM   10045 O O    . LEU A 1 17 ? -10.969 -4.706  8.163   1.00 0.00 ? 17 LEU A O    14 
ATOM   10046 C CB   . LEU A 1 17 ? -10.360 -2.360  6.293   1.00 0.00 ? 17 LEU A CB   14 
ATOM   10047 C CG   . LEU A 1 17 ? -10.688 -1.142  5.429   1.00 0.00 ? 17 LEU A CG   14 
ATOM   10048 C CD1  . LEU A 1 17 ? -9.871  -1.161  4.146   1.00 0.00 ? 17 LEU A CD1  14 
ATOM   10049 C CD2  . LEU A 1 17 ? -12.176 -1.097  5.115   1.00 0.00 ? 17 LEU A CD2  14 
ATOM   10050 H H    . LEU A 1 17 ? -9.719  -0.818  8.336   1.00 0.00 ? 17 LEU A H    14 
ATOM   10051 H HA   . LEU A 1 17 ? -12.072 -2.391  7.571   1.00 0.00 ? 17 LEU A HA   14 
ATOM   10052 H HB2  . LEU A 1 17 ? -9.288  -2.407  6.419   1.00 0.00 ? 17 LEU A HB2  14 
ATOM   10053 H HB3  . LEU A 1 17 ? -10.685 -3.245  5.767   1.00 0.00 ? 17 LEU A HB3  14 
ATOM   10054 H HG   . LEU A 1 17 ? -10.432 -0.245  5.975   1.00 0.00 ? 17 LEU A HG   14 
ATOM   10055 H HD11 . LEU A 1 17 ? -10.452 -0.730  3.343   1.00 0.00 ? 17 LEU A HD11 14 
ATOM   10056 H HD12 . LEU A 1 17 ? -9.614  -2.180  3.899   1.00 0.00 ? 17 LEU A HD12 14 
ATOM   10057 H HD13 . LEU A 1 17 ? -8.968  -0.585  4.286   1.00 0.00 ? 17 LEU A HD13 14 
ATOM   10058 H HD21 . LEU A 1 17 ? -12.474 -2.024  4.650   1.00 0.00 ? 17 LEU A HD21 14 
ATOM   10059 H HD22 . LEU A 1 17 ? -12.378 -0.275  4.444   1.00 0.00 ? 17 LEU A HD22 14 
ATOM   10060 H HD23 . LEU A 1 17 ? -12.733 -0.958  6.030   1.00 0.00 ? 17 LEU A HD23 14 
ATOM   10061 N N    . HIS A 1 18 ? -9.628  -3.395  9.415   1.00 0.00 ? 18 HIS A N    14 
ATOM   10062 C CA   . HIS A 1 18 ? -9.083  -4.493  10.204  1.00 0.00 ? 18 HIS A CA   14 
ATOM   10063 C C    . HIS A 1 18 ? -8.585  -5.582  9.281   1.00 0.00 ? 18 HIS A C    14 
ATOM   10064 O O    . HIS A 1 18 ? -8.996  -6.740  9.357   1.00 0.00 ? 18 HIS A O    14 
ATOM   10065 C CB   . HIS A 1 18 ? -10.102 -5.048  11.187  1.00 0.00 ? 18 HIS A CB   14 
ATOM   10066 C CG   . HIS A 1 18 ? -11.378 -5.517  10.562  1.00 0.00 ? 18 HIS A CG   14 
ATOM   10067 N ND1  . HIS A 1 18 ? -11.510 -6.749  9.955   1.00 0.00 ? 18 HIS A ND1  14 
ATOM   10068 C CD2  . HIS A 1 18 ? -12.586 -4.914  10.453  1.00 0.00 ? 18 HIS A CD2  14 
ATOM   10069 C CE1  . HIS A 1 18 ? -12.743 -6.882  9.499   1.00 0.00 ? 18 HIS A CE1  14 
ATOM   10070 N NE2  . HIS A 1 18 ? -13.416 -5.783  9.789   1.00 0.00 ? 18 HIS A NE2  14 
ATOM   10071 H H    . HIS A 1 18 ? -9.291  -2.492  9.577   1.00 0.00 ? 18 HIS A H    14 
ATOM   10072 H HA   . HIS A 1 18 ? -8.241  -4.104  10.757  1.00 0.00 ? 18 HIS A HA   14 
ATOM   10073 H HB2  . HIS A 1 18 ? -9.658  -5.885  11.696  1.00 0.00 ? 18 HIS A HB2  14 
ATOM   10074 H HB3  . HIS A 1 18 ? -10.341 -4.281  11.905  1.00 0.00 ? 18 HIS A HB3  14 
ATOM   10075 H HD1  . HIS A 1 18 ? -10.805 -7.424  9.870   1.00 0.00 ? 18 HIS A HD1  14 
ATOM   10076 H HD2  . HIS A 1 18 ? -12.847 -3.933  10.820  1.00 0.00 ? 18 HIS A HD2  14 
ATOM   10077 H HE1  . HIS A 1 18 ? -13.135 -7.744  8.980   1.00 0.00 ? 18 HIS A HE1  14 
ATOM   10078 H HE2  . HIS A 1 18 ? -14.376 -5.654  9.642   1.00 0.00 ? 18 HIS A HE2  14 
ATOM   10079 N N    . ALA A 1 19 ? -7.699  -5.171  8.403   1.00 0.00 ? 19 ALA A N    14 
ATOM   10080 C CA   . ALA A 1 19 ? -7.115  -6.054  7.419   1.00 0.00 ? 19 ALA A CA   14 
ATOM   10081 C C    . ALA A 1 19 ? -5.987  -5.375  6.677   1.00 0.00 ? 19 ALA A C    14 
ATOM   10082 O O    . ALA A 1 19 ? -6.134  -4.257  6.183   1.00 0.00 ? 19 ALA A O    14 
ATOM   10083 C CB   . ALA A 1 19 ? -8.158  -6.490  6.410   1.00 0.00 ? 19 ALA A CB   14 
ATOM   10084 H H    . ALA A 1 19 ? -7.438  -4.234  8.415   1.00 0.00 ? 19 ALA A H    14 
ATOM   10085 H HA   . ALA A 1 19 ? -6.740  -6.930  7.923   1.00 0.00 ? 19 ALA A HA   14 
ATOM   10086 H HB1  . ALA A 1 19 ? -8.164  -7.567  6.339   1.00 0.00 ? 19 ALA A HB1  14 
ATOM   10087 H HB2  . ALA A 1 19 ? -7.912  -6.063  5.442   1.00 0.00 ? 19 ALA A HB2  14 
ATOM   10088 H HB3  . ALA A 1 19 ? -9.131  -6.141  6.721   1.00 0.00 ? 19 ALA A HB3  14 
ATOM   10089 N N    . CYS A 1 20 ? -4.877  -6.066  6.571   1.00 0.00 ? 20 CYS A N    14 
ATOM   10090 C CA   . CYS A 1 20 ? -3.747  -5.539  5.839   1.00 0.00 ? 20 CYS A CA   14 
ATOM   10091 C C    . CYS A 1 20 ? -4.098  -5.488  4.359   1.00 0.00 ? 20 CYS A C    14 
ATOM   10092 O O    . CYS A 1 20 ? -4.175  -6.513  3.682   1.00 0.00 ? 20 CYS A O    14 
ATOM   10093 C CB   . CYS A 1 20 ? -2.488  -6.379  6.061   1.00 0.00 ? 20 CYS A CB   14 
ATOM   10094 S SG   . CYS A 1 20 ? -1.964  -6.506  7.802   1.00 0.00 ? 20 CYS A SG   14 
ATOM   10095 H H    . CYS A 1 20 ? -4.834  -6.953  6.971   1.00 0.00 ? 20 CYS A H    14 
ATOM   10096 H HA   . CYS A 1 20 ? -3.581  -4.535  6.186   1.00 0.00 ? 20 CYS A HA   14 
ATOM   10097 H HB2  . CYS A 1 20 ? -2.665  -7.380  5.699   1.00 0.00 ? 20 CYS A HB2  14 
ATOM   10098 H HB3  . CYS A 1 20 ? -1.675  -5.938  5.505   1.00 0.00 ? 20 CYS A HB3  14 
ATOM   10099 N N    . ILE A 1 21 ? -4.337  -4.280  3.881   1.00 0.00 ? 21 ILE A N    14 
ATOM   10100 C CA   . ILE A 1 21 ? -4.709  -4.039  2.501   1.00 0.00 ? 21 ILE A CA   14 
ATOM   10101 C C    . ILE A 1 21 ? -3.487  -3.636  1.686   1.00 0.00 ? 21 ILE A C    14 
ATOM   10102 O O    . ILE A 1 21 ? -2.635  -2.898  2.177   1.00 0.00 ? 21 ILE A O    14 
ATOM   10103 C CB   . ILE A 1 21 ? -5.739  -2.899  2.427   1.00 0.00 ? 21 ILE A CB   14 
ATOM   10104 C CG1  . ILE A 1 21 ? -6.678  -2.911  3.642   1.00 0.00 ? 21 ILE A CG1  14 
ATOM   10105 C CG2  . ILE A 1 21 ? -6.536  -2.962  1.133   1.00 0.00 ? 21 ILE A CG2  14 
ATOM   10106 C CD1  . ILE A 1 21 ? -7.465  -4.194  3.812   1.00 0.00 ? 21 ILE A CD1  14 
ATOM   10107 H H    . ILE A 1 21 ? -4.272  -3.518  4.481   1.00 0.00 ? 21 ILE A H    14 
ATOM   10108 H HA   . ILE A 1 21 ? -5.142  -4.937  2.093   1.00 0.00 ? 21 ILE A HA   14 
ATOM   10109 H HB   . ILE A 1 21 ? -5.181  -1.976  2.435   1.00 0.00 ? 21 ILE A HB   14 
ATOM   10110 H HG12 . ILE A 1 21 ? -6.095  -2.762  4.538   1.00 0.00 ? 21 ILE A HG12 14 
ATOM   10111 H HG13 . ILE A 1 21 ? -7.385  -2.099  3.545   1.00 0.00 ? 21 ILE A HG13 14 
ATOM   10112 H HG21 . ILE A 1 21 ? -5.913  -2.648  0.310   1.00 0.00 ? 21 ILE A HG21 14 
ATOM   10113 H HG22 . ILE A 1 21 ? -7.390  -2.306  1.206   1.00 0.00 ? 21 ILE A HG22 14 
ATOM   10114 H HG23 . ILE A 1 21 ? -6.874  -3.974  0.967   1.00 0.00 ? 21 ILE A HG23 14 
ATOM   10115 H HD11 . ILE A 1 21 ? -8.090  -4.116  4.689   1.00 0.00 ? 21 ILE A HD11 14 
ATOM   10116 H HD12 . ILE A 1 21 ? -6.784  -5.023  3.931   1.00 0.00 ? 21 ILE A HD12 14 
ATOM   10117 H HD13 . ILE A 1 21 ? -8.086  -4.356  2.943   1.00 0.00 ? 21 ILE A HD13 14 
ATOM   10118 N N    . PRO A 1 22 ? -3.363  -4.106  0.435   1.00 0.00 ? 22 PRO A N    14 
ATOM   10119 C CA   . PRO A 1 22 ? -2.213  -3.759  -0.392  1.00 0.00 ? 22 PRO A CA   14 
ATOM   10120 C C    . PRO A 1 22 ? -2.301  -2.343  -0.955  1.00 0.00 ? 22 PRO A C    14 
ATOM   10121 O O    . PRO A 1 22 ? -3.376  -1.874  -1.327  1.00 0.00 ? 22 PRO A O    14 
ATOM   10122 C CB   . PRO A 1 22 ? -2.254  -4.802  -1.507  1.00 0.00 ? 22 PRO A CB   14 
ATOM   10123 C CG   . PRO A 1 22 ? -3.698  -5.138  -1.649  1.00 0.00 ? 22 PRO A CG   14 
ATOM   10124 C CD   . PRO A 1 22 ? -4.298  -5.009  -0.266  1.00 0.00 ? 22 PRO A CD   14 
ATOM   10125 H HA   . PRO A 1 22 ? -1.301  -3.859  0.171   1.00 0.00 ? 22 PRO A HA   14 
ATOM   10126 H HB2  . PRO A 1 22 ? -1.855  -4.379  -2.416  1.00 0.00 ? 22 PRO A HB2  14 
ATOM   10127 H HB3  . PRO A 1 22 ? -1.675  -5.666  -1.220  1.00 0.00 ? 22 PRO A HB3  14 
ATOM   10128 H HG2  . PRO A 1 22 ? -4.168  -4.443  -2.333  1.00 0.00 ? 22 PRO A HG2  14 
ATOM   10129 H HG3  . PRO A 1 22 ? -3.803  -6.150  -2.015  1.00 0.00 ? 22 PRO A HG3  14 
ATOM   10130 H HD2  . PRO A 1 22 ? -5.284  -4.576  -0.324  1.00 0.00 ? 22 PRO A HD2  14 
ATOM   10131 H HD3  . PRO A 1 22 ? -4.338  -5.975  0.220   1.00 0.00 ? 22 PRO A HD3  14 
ATOM   10132 N N    . CYS A 1 23 ? -1.156  -1.665  -1.002  1.00 0.00 ? 23 CYS A N    14 
ATOM   10133 C CA   . CYS A 1 23 ? -1.088  -0.289  -1.500  1.00 0.00 ? 23 CYS A CA   14 
ATOM   10134 C C    . CYS A 1 23 ? -0.964  -0.243  -3.022  1.00 0.00 ? 23 CYS A C    14 
ATOM   10135 O O    . CYS A 1 23 ? -1.306  0.761   -3.646  1.00 0.00 ? 23 CYS A O    14 
ATOM   10136 C CB   . CYS A 1 23 ? 0.093   0.456   -0.867  1.00 0.00 ? 23 CYS A CB   14 
ATOM   10137 S SG   . CYS A 1 23 ? 0.513   -0.092  0.823   1.00 0.00 ? 23 CYS A SG   14 
ATOM   10138 H H    . CYS A 1 23 ? -0.337  -2.097  -0.682  1.00 0.00 ? 23 CYS A H    14 
ATOM   10139 H HA   . CYS A 1 23 ? -2.004  0.211   -1.214  1.00 0.00 ? 23 CYS A HA   14 
ATOM   10140 H HB2  . CYS A 1 23 ? 0.970   0.319   -1.482  1.00 0.00 ? 23 CYS A HB2  14 
ATOM   10141 H HB3  . CYS A 1 23 ? -0.142  1.509   -0.819  1.00 0.00 ? 23 CYS A HB3  14 
ATOM   10142 N N    . GLN A 1 24 ? -0.469  -1.326  -3.618  1.00 0.00 ? 24 GLN A N    14 
ATOM   10143 C CA   . GLN A 1 24 ? -0.301  -1.394  -5.074  1.00 0.00 ? 24 GLN A CA   14 
ATOM   10144 C C    . GLN A 1 24 ? -1.548  -0.901  -5.793  1.00 0.00 ? 24 GLN A C    14 
ATOM   10145 O O    . GLN A 1 24 ? -1.474  -0.105  -6.729  1.00 0.00 ? 24 GLN A O    14 
ATOM   10146 C CB   . GLN A 1 24 ? 0.012   -2.826  -5.537  1.00 0.00 ? 24 GLN A CB   14 
ATOM   10147 C CG   . GLN A 1 24 ? 0.667   -3.700  -4.481  1.00 0.00 ? 24 GLN A CG   14 
ATOM   10148 C CD   . GLN A 1 24 ? 1.194   -5.003  -5.048  1.00 0.00 ? 24 GLN A CD   14 
ATOM   10149 O OE1  . GLN A 1 24 ? 2.314   -5.066  -5.555  1.00 0.00 ? 24 GLN A OE1  14 
ATOM   10150 N NE2  . GLN A 1 24 ? 0.387   -6.055  -4.963  1.00 0.00 ? 24 GLN A NE2  14 
ATOM   10151 H H    . GLN A 1 24 ? -0.209  -2.091  -3.068  1.00 0.00 ? 24 GLN A H    14 
ATOM   10152 H HA   . GLN A 1 24 ? 0.519   -0.755  -5.337  1.00 0.00 ? 24 GLN A HA   14 
ATOM   10153 H HB2  . GLN A 1 24 ? -0.909  -3.301  -5.840  1.00 0.00 ? 24 GLN A HB2  14 
ATOM   10154 H HB3  . GLN A 1 24 ? 0.674   -2.775  -6.390  1.00 0.00 ? 24 GLN A HB3  14 
ATOM   10155 H HG2  . GLN A 1 24 ? 1.489   -3.156  -4.043  1.00 0.00 ? 24 GLN A HG2  14 
ATOM   10156 H HG3  . GLN A 1 24 ? -0.065  -3.924  -3.718  1.00 0.00 ? 24 GLN A HG3  14 
ATOM   10157 H HE21 . GLN A 1 24 ? -0.491  -5.932  -4.545  1.00 0.00 ? 24 GLN A HE21 14 
ATOM   10158 H HE22 . GLN A 1 24 ? 0.703   -6.911  -5.321  1.00 0.00 ? 24 GLN A HE22 14 
ATOM   10159 N N    . LEU A 1 25 ? -2.689  -1.396  -5.347  1.00 0.00 ? 25 LEU A N    14 
ATOM   10160 C CA   . LEU A 1 25 ? -3.972  -1.035  -5.932  1.00 0.00 ? 25 LEU A CA   14 
ATOM   10161 C C    . LEU A 1 25 ? -4.329  0.430   -5.674  1.00 0.00 ? 25 LEU A C    14 
ATOM   10162 O O    . LEU A 1 25 ? -5.287  0.948   -6.248  1.00 0.00 ? 25 LEU A O    14 
ATOM   10163 C CB   . LEU A 1 25 ? -5.075  -1.942  -5.382  1.00 0.00 ? 25 LEU A CB   14 
ATOM   10164 C CG   . LEU A 1 25 ? -6.408  -1.867  -6.130  1.00 0.00 ? 25 LEU A CG   14 
ATOM   10165 C CD1  . LEU A 1 25 ? -7.008  -3.255  -6.296  1.00 0.00 ? 25 LEU A CD1  14 
ATOM   10166 C CD2  . LEU A 1 25 ? -7.377  -0.950  -5.399  1.00 0.00 ? 25 LEU A CD2  14 
ATOM   10167 H H    . LEU A 1 25 ? -2.663  -2.030  -4.607  1.00 0.00 ? 25 LEU A H    14 
ATOM   10168 H HA   . LEU A 1 25 ? -3.895  -1.190  -6.993  1.00 0.00 ? 25 LEU A HA   14 
ATOM   10169 H HB2  . LEU A 1 25 ? -4.720  -2.962  -5.416  1.00 0.00 ? 25 LEU A HB2  14 
ATOM   10170 H HB3  . LEU A 1 25 ? -5.250  -1.675  -4.351  1.00 0.00 ? 25 LEU A HB3  14 
ATOM   10171 H HG   . LEU A 1 25 ? -6.238  -1.458  -7.114  1.00 0.00 ? 25 LEU A HG   14 
ATOM   10172 H HD11 . LEU A 1 25 ? -6.715  -3.661  -7.253  1.00 0.00 ? 25 LEU A HD11 14 
ATOM   10173 H HD12 . LEU A 1 25 ? -8.085  -3.189  -6.246  1.00 0.00 ? 25 LEU A HD12 14 
ATOM   10174 H HD13 . LEU A 1 25 ? -6.649  -3.899  -5.506  1.00 0.00 ? 25 LEU A HD13 14 
ATOM   10175 H HD21 . LEU A 1 25 ? -6.822  -0.216  -4.833  1.00 0.00 ? 25 LEU A HD21 14 
ATOM   10176 H HD22 . LEU A 1 25 ? -7.989  -1.534  -4.728  1.00 0.00 ? 25 LEU A HD22 14 
ATOM   10177 H HD23 . LEU A 1 25 ? -8.009  -0.448  -6.117  1.00 0.00 ? 25 LEU A HD23 14 
ATOM   10178 N N    . ARG A 1 26 ? -3.569  1.095   -4.806  1.00 0.00 ? 26 ARG A N    14 
ATOM   10179 C CA   . ARG A 1 26 ? -3.831  2.494   -4.485  1.00 0.00 ? 26 ARG A CA   14 
ATOM   10180 C C    . ARG A 1 26 ? -2.675  3.401   -4.883  1.00 0.00 ? 26 ARG A C    14 
ATOM   10181 O O    . ARG A 1 26 ? -2.751  4.623   -4.751  1.00 0.00 ? 26 ARG A O    14 
ATOM   10182 C CB   . ARG A 1 26 ? -4.119  2.654   -2.994  1.00 0.00 ? 26 ARG A CB   14 
ATOM   10183 C CG   . ARG A 1 26 ? -5.043  1.586   -2.432  1.00 0.00 ? 26 ARG A CG   14 
ATOM   10184 C CD   . ARG A 1 26 ? -6.473  1.775   -2.915  1.00 0.00 ? 26 ARG A CD   14 
ATOM   10185 N NE   . ARG A 1 26 ? -6.953  3.130   -2.659  1.00 0.00 ? 26 ARG A NE   14 
ATOM   10186 C CZ   . ARG A 1 26 ? -7.354  3.563   -1.466  1.00 0.00 ? 26 ARG A CZ   14 
ATOM   10187 N NH1  . ARG A 1 26 ? -7.332  2.749   -0.417  1.00 0.00 ? 26 ARG A NH1  14 
ATOM   10188 N NH2  . ARG A 1 26 ? -7.776  4.811   -1.321  1.00 0.00 ? 26 ARG A NH2  14 
ATOM   10189 H H    . ARG A 1 26 ? -2.825  0.637   -4.372  1.00 0.00 ? 26 ARG A H    14 
ATOM   10190 H HA   . ARG A 1 26 ? -4.691  2.788   -5.042  1.00 0.00 ? 26 ARG A HA   14 
ATOM   10191 H HB2  . ARG A 1 26 ? -3.182  2.610   -2.458  1.00 0.00 ? 26 ARG A HB2  14 
ATOM   10192 H HB3  . ARG A 1 26 ? -4.574  3.618   -2.829  1.00 0.00 ? 26 ARG A HB3  14 
ATOM   10193 H HG2  . ARG A 1 26 ? -4.692  0.616   -2.751  1.00 0.00 ? 26 ARG A HG2  14 
ATOM   10194 H HG3  . ARG A 1 26 ? -5.027  1.641   -1.354  1.00 0.00 ? 26 ARG A HG3  14 
ATOM   10195 H HD2  . ARG A 1 26 ? -6.503  1.571   -3.976  1.00 0.00 ? 26 ARG A HD2  14 
ATOM   10196 H HD3  . ARG A 1 26 ? -7.102  1.064   -2.401  1.00 0.00 ? 26 ARG A HD3  14 
ATOM   10197 H HE   . ARG A 1 26 ? -6.980  3.751   -3.417  1.00 0.00 ? 26 ARG A HE   14 
ATOM   10198 H HH11 . ARG A 1 26 ? -7.015  1.807   -0.520  1.00 0.00 ? 26 ARG A HH11 14 
ATOM   10199 H HH12 . ARG A 1 26 ? -7.634  3.080   0.477   1.00 0.00 ? 26 ARG A HH12 14 
ATOM   10200 H HH21 . ARG A 1 26 ? -7.794  5.427   -2.108  1.00 0.00 ? 26 ARG A HH21 14 
ATOM   10201 H HH22 . ARG A 1 26 ? -8.077  5.136   -0.424  1.00 0.00 ? 26 ARG A HH22 14 
ATOM   10202 N N    . CYS A 1 27 ? -1.611  2.796   -5.366  1.00 0.00 ? 27 CYS A N    14 
ATOM   10203 C CA   . CYS A 1 27 ? -0.431  3.539   -5.788  1.00 0.00 ? 27 CYS A CA   14 
ATOM   10204 C C    . CYS A 1 27 ? -0.653  4.189   -7.150  1.00 0.00 ? 27 CYS A C    14 
ATOM   10205 O O    . CYS A 1 27 ? -0.368  5.371   -7.340  1.00 0.00 ? 27 CYS A O    14 
ATOM   10206 C CB   . CYS A 1 27 ? 0.794   2.620   -5.858  1.00 0.00 ? 27 CYS A CB   14 
ATOM   10207 S SG   . CYS A 1 27 ? 1.310   1.910   -4.260  1.00 0.00 ? 27 CYS A SG   14 
ATOM   10208 H H    . CYS A 1 27 ? -1.621  1.829   -5.441  1.00 0.00 ? 27 CYS A H    14 
ATOM   10209 H HA   . CYS A 1 27 ? -0.251  4.309   -5.057  1.00 0.00 ? 27 CYS A HA   14 
ATOM   10210 H HB2  . CYS A 1 27 ? 0.576   1.798   -6.522  1.00 0.00 ? 27 CYS A HB2  14 
ATOM   10211 H HB3  . CYS A 1 27 ? 1.629   3.181   -6.253  1.00 0.00 ? 27 CYS A HB3  14 
ATOM   10212 N N    . SER A 1 28 ? -1.142  3.399   -8.102  1.00 0.00 ? 28 SER A N    14 
ATOM   10213 C CA   . SER A 1 28 ? -1.377  3.868   -9.445  1.00 0.00 ? 28 SER A CA   14 
ATOM   10214 C C    . SER A 1 28 ? -2.724  4.575   -9.602  1.00 0.00 ? 28 SER A C    14 
ATOM   10215 O O    . SER A 1 28 ? -3.191  4.775   -10.723 1.00 0.00 ? 28 SER A O    14 
ATOM   10216 C CB   . SER A 1 28 ? -1.285  2.705   -10.433 1.00 0.00 ? 28 SER A CB   14 
ATOM   10217 O OG   . SER A 1 28 ? -1.529  3.140   -11.759 1.00 0.00 ? 28 SER A OG   14 
ATOM   10218 H H    . SER A 1 28 ? -1.323  2.478   -7.901  1.00 0.00 ? 28 SER A H    14 
ATOM   10219 H HA   . SER A 1 28 ? -0.602  4.557   -9.658  1.00 0.00 ? 28 SER A HA   14 
ATOM   10220 H HB2  . SER A 1 28 ? -0.297  2.272   -10.386 1.00 0.00 ? 28 SER A HB2  14 
ATOM   10221 H HB3  . SER A 1 28 ? -2.018  1.955   -10.172 1.00 0.00 ? 28 SER A HB3  14 
ATOM   10222 H HG   . SER A 1 28 ? -2.323  2.717   -12.094 1.00 0.00 ? 28 SER A HG   14 
ATOM   10223 N N    . SER A 1 29 ? -3.347  4.955   -8.492  1.00 0.00 ? 29 SER A N    14 
ATOM   10224 C CA   . SER A 1 29 ? -4.631  5.641   -8.553  1.00 0.00 ? 29 SER A CA   14 
ATOM   10225 C C    . SER A 1 29 ? -4.982  6.308   -7.229  1.00 0.00 ? 29 SER A C    14 
ATOM   10226 O O    . SER A 1 29 ? -4.737  5.762   -6.153  1.00 0.00 ? 29 SER A O    14 
ATOM   10227 C CB   . SER A 1 29 ? -5.740  4.672   -8.941  1.00 0.00 ? 29 SER A CB   14 
ATOM   10228 O OG   . SER A 1 29 ? -5.568  4.198   -10.266 1.00 0.00 ? 29 SER A OG   14 
ATOM   10229 H H    . SER A 1 29 ? -2.939  4.779   -7.624  1.00 0.00 ? 29 SER A H    14 
ATOM   10230 H HA   . SER A 1 29 ? -4.558  6.405   -9.313  1.00 0.00 ? 29 SER A HA   14 
ATOM   10231 H HB2  . SER A 1 29 ? -5.731  3.831   -8.265  1.00 0.00 ? 29 SER A HB2  14 
ATOM   10232 H HB3  . SER A 1 29 ? -6.690  5.183   -8.873  1.00 0.00 ? 29 SER A HB3  14 
ATOM   10233 H HG   . SER A 1 29 ? -4.929  3.482   -10.269 1.00 0.00 ? 29 SER A HG   14 
ATOM   10234 N N    . ASN A 1 30 ? -5.562  7.497   -7.335  1.00 0.00 ? 30 ASN A N    14 
ATOM   10235 C CA   . ASN A 1 30 ? -5.973  8.282   -6.170  1.00 0.00 ? 30 ASN A CA   14 
ATOM   10236 C C    . ASN A 1 30 ? -4.777  8.718   -5.322  1.00 0.00 ? 30 ASN A C    14 
ATOM   10237 O O    . ASN A 1 30 ? -4.950  9.391   -4.307  1.00 0.00 ? 30 ASN A O    14 
ATOM   10238 C CB   . ASN A 1 30 ? -6.953  7.481   -5.310  1.00 0.00 ? 30 ASN A CB   14 
ATOM   10239 C CG   . ASN A 1 30 ? -8.307  7.320   -5.972  1.00 0.00 ? 30 ASN A CG   14 
ATOM   10240 O OD1  . ASN A 1 30 ? -9.296  7.914   -5.544  1.00 0.00 ? 30 ASN A OD1  14 
ATOM   10241 N ND2  . ASN A 1 30 ? -8.357  6.511   -7.025  1.00 0.00 ? 30 ASN A ND2  14 
ATOM   10242 H H    . ASN A 1 30 ? -5.722  7.855   -8.227  1.00 0.00 ? 30 ASN A H    14 
ATOM   10243 H HA   . ASN A 1 30 ? -6.476  9.165   -6.534  1.00 0.00 ? 30 ASN A HA   14 
ATOM   10244 H HB2  . ASN A 1 30 ? -6.544  6.500   -5.127  1.00 0.00 ? 30 ASN A HB2  14 
ATOM   10245 H HB3  . ASN A 1 30 ? -7.092  7.990   -4.367  1.00 0.00 ? 30 ASN A HB3  14 
ATOM   10246 H HD21 . ASN A 1 30 ? -7.530  6.071   -7.310  1.00 0.00 ? 30 ASN A HD21 14 
ATOM   10247 H HD22 . ASN A 1 30 ? -9.221  6.389   -7.473  1.00 0.00 ? 30 ASN A HD22 14 
ATOM   10248 N N    . THR A 1 31 ? -3.572  8.323   -5.743  1.00 0.00 ? 31 THR A N    14 
ATOM   10249 C CA   . THR A 1 31 ? -2.331  8.655   -5.033  1.00 0.00 ? 31 THR A CA   14 
ATOM   10250 C C    . THR A 1 31 ? -2.562  8.969   -3.551  1.00 0.00 ? 31 THR A C    14 
ATOM   10251 O O    . THR A 1 31 ? -2.174  10.035  -3.070  1.00 0.00 ? 31 THR A O    14 
ATOM   10252 C CB   . THR A 1 31 ? -1.639  9.838   -5.714  1.00 0.00 ? 31 THR A CB   14 
ATOM   10253 O OG1  . THR A 1 31 ? -0.466  10.206  -5.010  1.00 0.00 ? 31 THR A OG1  14 
ATOM   10254 C CG2  . THR A 1 31 ? -2.518  11.067  -5.814  1.00 0.00 ? 31 THR A CG2  14 
ATOM   10255 H H    . THR A 1 31 ? -3.510  7.791   -6.560  1.00 0.00 ? 31 THR A H    14 
ATOM   10256 H HA   . THR A 1 31 ? -1.684  7.794   -5.099  1.00 0.00 ? 31 THR A HA   14 
ATOM   10257 H HB   . THR A 1 31 ? -1.358  9.551   -6.717  1.00 0.00 ? 31 THR A HB   14 
ATOM   10258 H HG1  . THR A 1 31 ? -0.706  10.574  -4.158  1.00 0.00 ? 31 THR A HG1  14 
ATOM   10259 H HG21 . THR A 1 31 ? -2.038  11.802  -6.445  1.00 0.00 ? 31 THR A HG21 14 
ATOM   10260 H HG22 . THR A 1 31 ? -2.670  11.482  -4.829  1.00 0.00 ? 31 THR A HG22 14 
ATOM   10261 H HG23 . THR A 1 31 ? -3.472  10.794  -6.241  1.00 0.00 ? 31 THR A HG23 14 
ATOM   10262 N N    . PRO A 1 32 ? -3.214  8.054   -2.803  1.00 0.00 ? 32 PRO A N    14 
ATOM   10263 C CA   . PRO A 1 32 ? -3.513  8.232   -1.394  1.00 0.00 ? 32 PRO A CA   14 
ATOM   10264 C C    . PRO A 1 32 ? -2.668  7.353   -0.455  1.00 0.00 ? 32 PRO A C    14 
ATOM   10265 O O    . PRO A 1 32 ? -3.127  7.009   0.633   1.00 0.00 ? 32 PRO A O    14 
ATOM   10266 C CB   . PRO A 1 32 ? -4.965  7.759   -1.361  1.00 0.00 ? 32 PRO A CB   14 
ATOM   10267 C CG   . PRO A 1 32 ? -5.060  6.699   -2.434  1.00 0.00 ? 32 PRO A CG   14 
ATOM   10268 C CD   . PRO A 1 32 ? -3.758  6.772   -3.245  1.00 0.00 ? 32 PRO A CD   14 
ATOM   10269 H HA   . PRO A 1 32 ? -3.458  9.265   -1.090  1.00 0.00 ? 32 PRO A HA   14 
ATOM   10270 H HB2  . PRO A 1 32 ? -5.192  7.355   -0.384  1.00 0.00 ? 32 PRO A HB2  14 
ATOM   10271 H HB3  . PRO A 1 32 ? -5.623  8.590   -1.572  1.00 0.00 ? 32 PRO A HB3  14 
ATOM   10272 H HG2  . PRO A 1 32 ? -5.173  5.726   -1.968  1.00 0.00 ? 32 PRO A HG2  14 
ATOM   10273 H HG3  . PRO A 1 32 ? -5.918  6.907   -3.065  1.00 0.00 ? 32 PRO A HG3  14 
ATOM   10274 H HD2  . PRO A 1 32 ? -3.086  5.962   -2.983  1.00 0.00 ? 32 PRO A HD2  14 
ATOM   10275 H HD3  . PRO A 1 32 ? -3.949  6.773   -4.309  1.00 0.00 ? 32 PRO A HD3  14 
ATOM   10276 N N    . PRO A 1 33 ? -1.438  6.955   -0.846  1.00 0.00 ? 33 PRO A N    14 
ATOM   10277 C CA   . PRO A 1 33 ? -0.596  6.103   -0.006  1.00 0.00 ? 33 PRO A CA   14 
ATOM   10278 C C    . PRO A 1 33 ? 0.228   6.868   1.009   1.00 0.00 ? 33 PRO A C    14 
ATOM   10279 O O    . PRO A 1 33 ? 1.422   7.072   0.823   1.00 0.00 ? 33 PRO A O    14 
ATOM   10280 C CB   . PRO A 1 33 ? 0.315   5.439   -1.028  1.00 0.00 ? 33 PRO A CB   14 
ATOM   10281 C CG   . PRO A 1 33 ? 0.526   6.494   -2.055  1.00 0.00 ? 33 PRO A CG   14 
ATOM   10282 C CD   . PRO A 1 33 ? -0.767  7.268   -2.127  1.00 0.00 ? 33 PRO A CD   14 
ATOM   10283 H HA   . PRO A 1 33 ? -1.168  5.354   0.510   1.00 0.00 ? 33 PRO A HA   14 
ATOM   10284 H HB2  . PRO A 1 33 ? 1.242   5.149   -0.557  1.00 0.00 ? 33 PRO A HB2  14 
ATOM   10285 H HB3  . PRO A 1 33 ? -0.175  4.572   -1.447  1.00 0.00 ? 33 PRO A HB3  14 
ATOM   10286 H HG2  . PRO A 1 33 ? 1.336   7.143   -1.752  1.00 0.00 ? 33 PRO A HG2  14 
ATOM   10287 H HG3  . PRO A 1 33 ? 0.744   6.040   -3.009  1.00 0.00 ? 33 PRO A HG3  14 
ATOM   10288 H HD2  . PRO A 1 33 ? -0.568  8.327   -2.209  1.00 0.00 ? 33 PRO A HD2  14 
ATOM   10289 H HD3  . PRO A 1 33 ? -1.352  6.925   -2.963  1.00 0.00 ? 33 PRO A HD3  14 
ATOM   10290 N N    . LEU A 1 34 ? -0.402  7.271   2.097   1.00 0.00 ? 34 LEU A N    14 
ATOM   10291 C CA   . LEU A 1 34 ? 0.321   7.988   3.141   1.00 0.00 ? 34 LEU A CA   14 
ATOM   10292 C C    . LEU A 1 34 ? 1.302   7.050   3.841   1.00 0.00 ? 34 LEU A C    14 
ATOM   10293 O O    . LEU A 1 34 ? 2.470   7.389   4.008   1.00 0.00 ? 34 LEU A O    14 
ATOM   10294 C CB   . LEU A 1 34 ? -0.635  8.649   4.144   1.00 0.00 ? 34 LEU A CB   14 
ATOM   10295 C CG   . LEU A 1 34 ? -1.800  9.416   3.518   1.00 0.00 ? 34 LEU A CG   14 
ATOM   10296 C CD1  . LEU A 1 34 ? -2.624  10.106  4.594   1.00 0.00 ? 34 LEU A CD1  14 
ATOM   10297 C CD2  . LEU A 1 34 ? -1.288  10.431  2.507   1.00 0.00 ? 34 LEU A CD2  14 
ATOM   10298 H H    . LEU A 1 34 ? -1.360  7.075   2.201   1.00 0.00 ? 34 LEU A H    14 
ATOM   10299 H HA   . LEU A 1 34 ? 0.905   8.753   2.651   1.00 0.00 ? 34 LEU A HA   14 
ATOM   10300 H HB2  . LEU A 1 34 ? -1.043  7.887   4.790   1.00 0.00 ? 34 LEU A HB2  14 
ATOM   10301 H HB3  . LEU A 1 34 ? -0.066  9.339   4.748   1.00 0.00 ? 34 LEU A HB3  14 
ATOM   10302 H HG   . LEU A 1 34 ? -2.443  8.721   3.000   1.00 0.00 ? 34 LEU A HG   14 
ATOM   10303 H HD11 . LEU A 1 34 ? -3.658  10.144  4.286   1.00 0.00 ? 34 LEU A HD11 14 
ATOM   10304 H HD12 . LEU A 1 34 ? -2.256  11.110  4.743   1.00 0.00 ? 34 LEU A HD12 14 
ATOM   10305 H HD13 . LEU A 1 34 ? -2.544  9.552   5.519   1.00 0.00 ? 34 LEU A HD13 14 
ATOM   10306 H HD21 . LEU A 1 34 ? -0.645  9.937   1.794   1.00 0.00 ? 34 LEU A HD21 14 
ATOM   10307 H HD22 . LEU A 1 34 ? -0.731  11.202  3.020   1.00 0.00 ? 34 LEU A HD22 14 
ATOM   10308 H HD23 . LEU A 1 34 ? -2.124  10.877  1.988   1.00 0.00 ? 34 LEU A HD23 14 
ATOM   10309 N N    . THR A 1 35 ? 0.848   5.854   4.219   1.00 0.00 ? 35 THR A N    14 
ATOM   10310 C CA   . THR A 1 35 ? 1.724   4.888   4.850   1.00 0.00 ? 35 THR A CA   14 
ATOM   10311 C C    . THR A 1 35 ? 2.402   4.021   3.785   1.00 0.00 ? 35 THR A C    14 
ATOM   10312 O O    . THR A 1 35 ? 3.148   3.097   4.108   1.00 0.00 ? 35 THR A O    14 
ATOM   10313 C CB   . THR A 1 35 ? 0.938   4.008   5.823   1.00 0.00 ? 35 THR A CB   14 
ATOM   10314 O OG1  . THR A 1 35 ? 1.794   3.078   6.463   1.00 0.00 ? 35 THR A OG1  14 
ATOM   10315 C CG2  . THR A 1 35 ? -0.173  3.226   5.157   1.00 0.00 ? 35 THR A CG2  14 
ATOM   10316 H H    . THR A 1 35 ? -0.080  5.606   4.052   1.00 0.00 ? 35 THR A H    14 
ATOM   10317 H HA   . THR A 1 35 ? 2.480   5.431   5.395   1.00 0.00 ? 35 THR A HA   14 
ATOM   10318 H HB   . THR A 1 35 ? 0.492   4.636   6.580   1.00 0.00 ? 35 THR A HB   14 
ATOM   10319 H HG1  . THR A 1 35 ? 1.705   3.164   7.415   1.00 0.00 ? 35 THR A HG1  14 
ATOM   10320 H HG21 . THR A 1 35 ? -0.359  3.630   4.173   1.00 0.00 ? 35 THR A HG21 14 
ATOM   10321 H HG22 . THR A 1 35 ? -1.072  3.299   5.752   1.00 0.00 ? 35 THR A HG22 14 
ATOM   10322 H HG23 . THR A 1 35 ? 0.118   2.189   5.071   1.00 0.00 ? 35 THR A HG23 14 
ATOM   10323 N N    . CYS A 1 36 ? 2.132   4.323   2.508   1.00 0.00 ? 36 CYS A N    14 
ATOM   10324 C CA   . CYS A 1 36 ? 2.713   3.561   1.407   1.00 0.00 ? 36 CYS A CA   14 
ATOM   10325 C C    . CYS A 1 36 ? 3.394   4.464   0.380   1.00 0.00 ? 36 CYS A C    14 
ATOM   10326 O O    . CYS A 1 36 ? 3.934   3.979   -0.613  1.00 0.00 ? 36 CYS A O    14 
ATOM   10327 C CB   . CYS A 1 36 ? 1.636   2.720   0.724   1.00 0.00 ? 36 CYS A CB   14 
ATOM   10328 S SG   . CYS A 1 36 ? 0.706   1.641   1.860   1.00 0.00 ? 36 CYS A SG   14 
ATOM   10329 H H    . CYS A 1 36 ? 1.525   5.070   2.303   1.00 0.00 ? 36 CYS A H    14 
ATOM   10330 H HA   . CYS A 1 36 ? 3.452   2.904   1.822   1.00 0.00 ? 36 CYS A HA   14 
ATOM   10331 H HB2  . CYS A 1 36 ? 0.926   3.377   0.243   1.00 0.00 ? 36 CYS A HB2  14 
ATOM   10332 H HB3  . CYS A 1 36 ? 2.099   2.092   -0.022  1.00 0.00 ? 36 CYS A HB3  14 
ATOM   10333 N N    . GLN A 1 37 ? 3.370   5.773   0.616   1.00 0.00 ? 37 GLN A N    14 
ATOM   10334 C CA   . GLN A 1 37 ? 3.983   6.731   -0.297  1.00 0.00 ? 37 GLN A CA   14 
ATOM   10335 C C    . GLN A 1 37 ? 5.371   6.277   -0.709  1.00 0.00 ? 37 GLN A C    14 
ATOM   10336 O O    . GLN A 1 37 ? 5.713   6.253   -1.891  1.00 0.00 ? 37 GLN A O    14 
ATOM   10337 C CB   . GLN A 1 37 ? 4.042   8.127   0.353   1.00 0.00 ? 37 GLN A CB   14 
ATOM   10338 C CG   . GLN A 1 37 ? 5.104   8.304   1.433   1.00 0.00 ? 37 GLN A CG   14 
ATOM   10339 C CD   . GLN A 1 37 ? 4.841   7.493   2.689   1.00 0.00 ? 37 GLN A CD   14 
ATOM   10340 O OE1  . GLN A 1 37 ? 4.629   6.283   2.634   1.00 0.00 ? 37 GLN A OE1  14 
ATOM   10341 N NE2  . GLN A 1 37 ? 4.866   8.163   3.835   1.00 0.00 ? 37 GLN A NE2  14 
ATOM   10342 H H    . GLN A 1 37 ? 2.924   6.107   1.419   1.00 0.00 ? 37 GLN A H    14 
ATOM   10343 H HA   . GLN A 1 37 ? 3.367   6.773   -1.182  1.00 0.00 ? 37 GLN A HA   14 
ATOM   10344 H HB2  . GLN A 1 37 ? 4.240   8.857   -0.412  1.00 0.00 ? 37 GLN A HB2  14 
ATOM   10345 H HB3  . GLN A 1 37 ? 3.087   8.339   0.798   1.00 0.00 ? 37 GLN A HB3  14 
ATOM   10346 H HG2  . GLN A 1 37 ? 6.062   8.020   1.032   1.00 0.00 ? 37 GLN A HG2  14 
ATOM   10347 H HG3  . GLN A 1 37 ? 5.127   9.349   1.707   1.00 0.00 ? 37 GLN A HG3  14 
ATOM   10348 H HE21 . GLN A 1 37 ? 5.048   9.125   3.806   1.00 0.00 ? 37 GLN A HE21 14 
ATOM   10349 H HE22 . GLN A 1 37 ? 4.699   7.667   4.664   1.00 0.00 ? 37 GLN A HE22 14 
ATOM   10350 N N    . ARG A 1 38 ? 6.155   5.917   0.281   1.00 0.00 ? 38 ARG A N    14 
ATOM   10351 C CA   . ARG A 1 38 ? 7.515   5.450   0.050   1.00 0.00 ? 38 ARG A CA   14 
ATOM   10352 C C    . ARG A 1 38 ? 7.518   4.246   -0.891  1.00 0.00 ? 38 ARG A C    14 
ATOM   10353 O O    . ARG A 1 38 ? 8.276   4.210   -1.860  1.00 0.00 ? 38 ARG A O    14 
ATOM   10354 C CB   . ARG A 1 38 ? 8.213   5.113   1.378   1.00 0.00 ? 38 ARG A CB   14 
ATOM   10355 C CG   . ARG A 1 38 ? 7.780   3.798   2.014   1.00 0.00 ? 38 ARG A CG   14 
ATOM   10356 C CD   . ARG A 1 38 ? 6.412   3.912   2.669   1.00 0.00 ? 38 ARG A CD   14 
ATOM   10357 N NE   . ARG A 1 38 ? 6.021   2.664   3.320   1.00 0.00 ? 38 ARG A NE   14 
ATOM   10358 C CZ   . ARG A 1 38 ? 6.583   2.199   4.435   1.00 0.00 ? 38 ARG A CZ   14 
ATOM   10359 N NH1  . ARG A 1 38 ? 7.555   2.879   5.030   1.00 0.00 ? 38 ARG A NH1  14 
ATOM   10360 N NH2  . ARG A 1 38 ? 6.169   1.052   4.957   1.00 0.00 ? 38 ARG A NH2  14 
ATOM   10361 H H    . ARG A 1 38 ? 5.805   5.969   1.189   1.00 0.00 ? 38 ARG A H    14 
ATOM   10362 H HA   . ARG A 1 38 ? 8.055   6.255   -0.429  1.00 0.00 ? 38 ARG A HA   14 
ATOM   10363 H HB2  . ARG A 1 38 ? 9.277   5.065   1.204   1.00 0.00 ? 38 ARG A HB2  14 
ATOM   10364 H HB3  . ARG A 1 38 ? 8.014   5.909   2.082   1.00 0.00 ? 38 ARG A HB3  14 
ATOM   10365 H HG2  . ARG A 1 38 ? 7.744   3.033   1.256   1.00 0.00 ? 38 ARG A HG2  14 
ATOM   10366 H HG3  . ARG A 1 38 ? 8.504   3.522   2.766   1.00 0.00 ? 38 ARG A HG3  14 
ATOM   10367 H HD2  . ARG A 1 38 ? 6.450   4.707   3.400   1.00 0.00 ? 38 ARG A HD2  14 
ATOM   10368 H HD3  . ARG A 1 38 ? 5.689   4.165   1.909   1.00 0.00 ? 38 ARG A HD3  14 
ATOM   10369 H HE   . ARG A 1 38 ? 5.304   2.142   2.904   1.00 0.00 ? 38 ARG A HE   14 
ATOM   10370 H HH11 . ARG A 1 38 ? 7.870   3.745   4.643   1.00 0.00 ? 38 ARG A HH11 14 
ATOM   10371 H HH12 . ARG A 1 38 ? 7.972   2.523   5.868   1.00 0.00 ? 38 ARG A HH12 14 
ATOM   10372 H HH21 . ARG A 1 38 ? 5.435   0.536   4.513   1.00 0.00 ? 38 ARG A HH21 14 
ATOM   10373 H HH22 . ARG A 1 38 ? 6.590   0.703   5.794   1.00 0.00 ? 38 ARG A HH22 14 
ATOM   10374 N N    . TYR A 1 39 ? 6.659   3.266   -0.611  1.00 0.00 ? 39 TYR A N    14 
ATOM   10375 C CA   . TYR A 1 39 ? 6.575   2.072   -1.440  1.00 0.00 ? 39 TYR A CA   14 
ATOM   10376 C C    . TYR A 1 39 ? 6.000   2.393   -2.810  1.00 0.00 ? 39 TYR A C    14 
ATOM   10377 O O    . TYR A 1 39 ? 6.547   1.974   -3.830  1.00 0.00 ? 39 TYR A O    14 
ATOM   10378 C CB   . TYR A 1 39 ? 5.742   0.986   -0.753  1.00 0.00 ? 39 TYR A CB   14 
ATOM   10379 C CG   . TYR A 1 39 ? 5.872   -0.367  -1.413  1.00 0.00 ? 39 TYR A CG   14 
ATOM   10380 C CD1  . TYR A 1 39 ? 5.232   -0.636  -2.616  1.00 0.00 ? 39 TYR A CD1  14 
ATOM   10381 C CD2  . TYR A 1 39 ? 6.651   -1.367  -0.844  1.00 0.00 ? 39 TYR A CD2  14 
ATOM   10382 C CE1  . TYR A 1 39 ? 5.362   -1.866  -3.233  1.00 0.00 ? 39 TYR A CE1  14 
ATOM   10383 C CE2  . TYR A 1 39 ? 6.784   -2.601  -1.455  1.00 0.00 ? 39 TYR A CE2  14 
ATOM   10384 C CZ   . TYR A 1 39 ? 6.139   -2.844  -2.648  1.00 0.00 ? 39 TYR A CZ   14 
ATOM   10385 O OH   . TYR A 1 39 ? 6.271   -4.069  -3.260  1.00 0.00 ? 39 TYR A OH   14 
ATOM   10386 H H    . TYR A 1 39 ? 6.076   3.345   0.166   1.00 0.00 ? 39 TYR A H    14 
ATOM   10387 H HA   . TYR A 1 39 ? 7.578   1.708   -1.575  1.00 0.00 ? 39 TYR A HA   14 
ATOM   10388 H HB2  . TYR A 1 39 ? 6.065   0.887   0.273   1.00 0.00 ? 39 TYR A HB2  14 
ATOM   10389 H HB3  . TYR A 1 39 ? 4.700   1.266   -0.771  1.00 0.00 ? 39 TYR A HB3  14 
ATOM   10390 H HD1  . TYR A 1 39 ? 4.624   0.131   -3.070  1.00 0.00 ? 39 TYR A HD1  14 
ATOM   10391 H HD2  . TYR A 1 39 ? 7.154   -1.173  0.091   1.00 0.00 ? 39 TYR A HD2  14 
ATOM   10392 H HE1  . TYR A 1 39 ? 4.856   -2.056  -4.168  1.00 0.00 ? 39 TYR A HE1  14 
ATOM   10393 H HE2  . TYR A 1 39 ? 7.392   -3.366  -0.997  1.00 0.00 ? 39 TYR A HE2  14 
ATOM   10394 H HH   . TYR A 1 39 ? 7.197   -4.318  -3.283  1.00 0.00 ? 39 TYR A HH   14 
ATOM   10395 N N    . CYS A 1 40 ? 4.913   3.152   -2.840  1.00 0.00 ? 40 CYS A N    14 
ATOM   10396 C CA   . CYS A 1 40 ? 4.303   3.528   -4.111  1.00 0.00 ? 40 CYS A CA   14 
ATOM   10397 C C    . CYS A 1 40 ? 5.321   4.276   -4.959  1.00 0.00 ? 40 CYS A C    14 
ATOM   10398 O O    . CYS A 1 40 ? 5.333   4.156   -6.184  1.00 0.00 ? 40 CYS A O    14 
ATOM   10399 C CB   . CYS A 1 40 ? 3.056   4.390   -3.896  1.00 0.00 ? 40 CYS A CB   14 
ATOM   10400 S SG   . CYS A 1 40 ? 1.673   3.525   -3.081  1.00 0.00 ? 40 CYS A SG   14 
ATOM   10401 H H    . CYS A 1 40 ? 4.527   3.475   -1.997  1.00 0.00 ? 40 CYS A H    14 
ATOM   10402 H HA   . CYS A 1 40 ? 4.029   2.622   -4.631  1.00 0.00 ? 40 CYS A HA   14 
ATOM   10403 H HB2  . CYS A 1 40 ? 3.317   5.238   -3.283  1.00 0.00 ? 40 CYS A HB2  14 
ATOM   10404 H HB3  . CYS A 1 40 ? 2.704   4.742   -4.855  1.00 0.00 ? 40 CYS A HB3  14 
ATOM   10405 N N    . ASN A 1 41 ? 6.193   5.026   -4.293  1.00 0.00 ? 41 ASN A N    14 
ATOM   10406 C CA   . ASN A 1 41 ? 7.230   5.763   -4.985  1.00 0.00 ? 41 ASN A CA   14 
ATOM   10407 C C    . ASN A 1 41 ? 8.216   4.792   -5.619  1.00 0.00 ? 41 ASN A C    14 
ATOM   10408 O O    . ASN A 1 41 ? 8.941   5.140   -6.552  1.00 0.00 ? 41 ASN A O    14 
ATOM   10409 C CB   . ASN A 1 41 ? 7.935   6.737   -4.025  1.00 0.00 ? 41 ASN A CB   14 
ATOM   10410 C CG   . ASN A 1 41 ? 9.450   6.608   -4.037  1.00 0.00 ? 41 ASN A CG   14 
ATOM   10411 O OD1  . ASN A 1 41 ? 10.155  7.484   -4.540  1.00 0.00 ? 41 ASN A OD1  14 
ATOM   10412 N ND2  . ASN A 1 41 ? 9.955   5.513   -3.482  1.00 0.00 ? 41 ASN A ND2  14 
ATOM   10413 H H    . ASN A 1 41 ? 6.145   5.069   -3.319  1.00 0.00 ? 41 ASN A H    14 
ATOM   10414 H HA   . ASN A 1 41 ? 6.755   6.314   -5.766  1.00 0.00 ? 41 ASN A HA   14 
ATOM   10415 H HB2  . ASN A 1 41 ? 7.682   7.749   -4.303  1.00 0.00 ? 41 ASN A HB2  14 
ATOM   10416 H HB3  . ASN A 1 41 ? 7.587   6.551   -3.020  1.00 0.00 ? 41 ASN A HB3  14 
ATOM   10417 H HD21 . ASN A 1 41 ? 9.332   4.857   -3.101  1.00 0.00 ? 41 ASN A HD21 14 
ATOM   10418 H HD22 . ASN A 1 41 ? 10.929  5.403   -3.474  1.00 0.00 ? 41 ASN A HD22 14 
ATOM   10419 N N    . ALA A 1 42 ? 8.212   3.568   -5.116  1.00 0.00 ? 42 ALA A N    14 
ATOM   10420 C CA   . ALA A 1 42 ? 9.079   2.526   -5.643  1.00 0.00 ? 42 ALA A CA   14 
ATOM   10421 C C    . ALA A 1 42 ? 8.326   1.666   -6.647  1.00 0.00 ? 42 ALA A C    14 
ATOM   10422 O O    . ALA A 1 42 ? 8.725   0.543   -6.955  1.00 0.00 ? 42 ALA A O    14 
ATOM   10423 C CB   . ALA A 1 42 ? 9.650   1.676   -4.518  1.00 0.00 ? 42 ALA A CB   14 
ATOM   10424 H H    . ALA A 1 42 ? 7.596   3.358   -4.387  1.00 0.00 ? 42 ALA A H    14 
ATOM   10425 H HA   . ALA A 1 42 ? 9.888   3.011   -6.155  1.00 0.00 ? 42 ALA A HA   14 
ATOM   10426 H HB1  . ALA A 1 42 ? 8.980   0.857   -4.310  1.00 0.00 ? 42 ALA A HB1  14 
ATOM   10427 H HB2  . ALA A 1 42 ? 9.764   2.283   -3.631  1.00 0.00 ? 42 ALA A HB2  14 
ATOM   10428 H HB3  . ALA A 1 42 ? 10.613  1.288   -4.814  1.00 0.00 ? 42 ALA A HB3  14 
ATOM   10429 N N    . SER A 1 43 ? 7.236   2.222   -7.154  1.00 0.00 ? 43 SER A N    14 
ATOM   10430 C CA   . SER A 1 43 ? 6.404   1.550   -8.134  1.00 0.00 ? 43 SER A CA   14 
ATOM   10431 C C    . SER A 1 43 ? 5.908   2.550   -9.175  1.00 0.00 ? 43 SER A C    14 
ATOM   10432 O O    . SER A 1 43 ? 6.189   2.410   -10.365 1.00 0.00 ? 43 SER A O    14 
ATOM   10433 C CB   . SER A 1 43 ? 5.217   0.869   -7.449  1.00 0.00 ? 43 SER A CB   14 
ATOM   10434 O OG   . SER A 1 43 ? 5.564   -0.427  -6.995  1.00 0.00 ? 43 SER A OG   14 
ATOM   10435 H H    . SER A 1 43 ? 6.990   3.117   -6.863  1.00 0.00 ? 43 SER A H    14 
ATOM   10436 H HA   . SER A 1 43 ? 7.007   0.804   -8.623  1.00 0.00 ? 43 SER A HA   14 
ATOM   10437 H HB2  . SER A 1 43 ? 4.906   1.461   -6.601  1.00 0.00 ? 43 SER A HB2  14 
ATOM   10438 H HB3  . SER A 1 43 ? 4.399   0.785   -8.150  1.00 0.00 ? 43 SER A HB3  14 
ATOM   10439 H HG   . SER A 1 43 ? 5.032   -0.652  -6.229  1.00 0.00 ? 43 SER A HG   14 
ATOM   10440 N N    . VAL A 1 44 ? 5.171   3.561   -8.708  1.00 0.00 ? 44 VAL A N    14 
ATOM   10441 C CA   . VAL A 1 44 ? 4.625   4.602   -9.580  1.00 0.00 ? 44 VAL A CA   14 
ATOM   10442 C C    . VAL A 1 44 ? 4.145   4.018   -10.898 1.00 0.00 ? 44 VAL A C    14 
ATOM   10443 O O    . VAL A 1 44 ? 4.415   4.550   -11.975 1.00 0.00 ? 44 VAL A O    14 
ATOM   10444 C CB   . VAL A 1 44 ? 5.650   5.731   -9.841  1.00 0.00 ? 44 VAL A CB   14 
ATOM   10445 C CG1  . VAL A 1 44 ? 6.838   5.216   -10.644 1.00 0.00 ? 44 VAL A CG1  14 
ATOM   10446 C CG2  . VAL A 1 44 ? 4.985   6.902   -10.549 1.00 0.00 ? 44 VAL A CG2  14 
ATOM   10447 H H    . VAL A 1 44 ? 4.986   3.607   -7.748  1.00 0.00 ? 44 VAL A H    14 
ATOM   10448 H HA   . VAL A 1 44 ? 3.770   5.027   -9.076  1.00 0.00 ? 44 VAL A HA   14 
ATOM   10449 H HB   . VAL A 1 44 ? 6.021   6.081   -8.888  1.00 0.00 ? 44 VAL A HB   14 
ATOM   10450 H HG11 . VAL A 1 44 ? 6.513   4.939   -11.634 1.00 0.00 ? 44 VAL A HG11 14 
ATOM   10451 H HG12 . VAL A 1 44 ? 7.262   4.356   -10.150 1.00 0.00 ? 44 VAL A HG12 14 
ATOM   10452 H HG13 . VAL A 1 44 ? 7.586   5.992   -10.716 1.00 0.00 ? 44 VAL A HG13 14 
ATOM   10453 H HG21 . VAL A 1 44 ? 4.118   6.554   -11.089 1.00 0.00 ? 44 VAL A HG21 14 
ATOM   10454 H HG22 . VAL A 1 44 ? 5.685   7.350   -11.241 1.00 0.00 ? 44 VAL A HG22 14 
ATOM   10455 H HG23 . VAL A 1 44 ? 4.682   7.638   -9.818  1.00 0.00 ? 44 VAL A HG23 14 
ATOM   10456 N N    . THR A 1 45 ? 3.431   2.913   -10.784 1.00 0.00 ? 45 THR A N    14 
ATOM   10457 C CA   . THR A 1 45 ? 2.883   2.204   -11.941 1.00 0.00 ? 45 THR A CA   14 
ATOM   10458 C C    . THR A 1 45 ? 3.986   1.544   -12.777 1.00 0.00 ? 45 THR A C    14 
ATOM   10459 O O    . THR A 1 45 ? 3.855   0.388   -13.179 1.00 0.00 ? 45 THR A O    14 
ATOM   10460 C CB   . THR A 1 45 ? 2.045   3.153   -12.809 1.00 0.00 ? 45 THR A CB   14 
ATOM   10461 O OG1  . THR A 1 45 ? 0.903   3.600   -12.100 1.00 0.00 ? 45 THR A OG1  14 
ATOM   10462 C CG2  . THR A 1 45 ? 1.562   2.524   -14.099 1.00 0.00 ? 45 THR A CG2  14 
ATOM   10463 H H    . THR A 1 45 ? 3.266   2.562   -9.883  1.00 0.00 ? 45 THR A H    14 
ATOM   10464 H HA   . THR A 1 45 ? 2.236   1.427   -11.562 1.00 0.00 ? 45 THR A HA   14 
ATOM   10465 H HB   . THR A 1 45 ? 2.641   4.016   -13.065 1.00 0.00 ? 45 THR A HB   14 
ATOM   10466 H HG1  . THR A 1 45 ? 1.158   3.862   -11.213 1.00 0.00 ? 45 THR A HG1  14 
ATOM   10467 H HG21 . THR A 1 45 ? 1.026   1.614   -13.878 1.00 0.00 ? 45 THR A HG21 14 
ATOM   10468 H HG22 . THR A 1 45 ? 2.411   2.299   -14.730 1.00 0.00 ? 45 THR A HG22 14 
ATOM   10469 H HG23 . THR A 1 45 ? 0.907   3.212   -14.612 1.00 0.00 ? 45 THR A HG23 14 
ATOM   10470 N N    . ASN A 1 46 ? 5.067   2.276   -13.039 1.00 0.00 ? 46 ASN A N    14 
ATOM   10471 C CA   . ASN A 1 46 ? 6.172   1.750   -13.823 1.00 0.00 ? 46 ASN A CA   14 
ATOM   10472 C C    . ASN A 1 46 ? 7.471   2.474   -13.482 1.00 0.00 ? 46 ASN A C    14 
ATOM   10473 O O    . ASN A 1 46 ? 7.560   3.151   -12.458 1.00 0.00 ? 46 ASN A O    14 
ATOM   10474 C CB   . ASN A 1 46 ? 5.870   1.878   -15.319 1.00 0.00 ? 46 ASN A CB   14 
ATOM   10475 C CG   . ASN A 1 46 ? 6.257   0.634   -16.094 1.00 0.00 ? 46 ASN A CG   14 
ATOM   10476 O OD1  . ASN A 1 46 ? 7.135   -0.122  -15.678 1.00 0.00 ? 46 ASN A OD1  14 
ATOM   10477 N ND2  . ASN A 1 46 ? 5.603   0.416   -17.229 1.00 0.00 ? 46 ASN A ND2  14 
ATOM   10478 H H    . ASN A 1 46 ? 5.125   3.185   -12.700 1.00 0.00 ? 46 ASN A H    14 
ATOM   10479 H HA   . ASN A 1 46 ? 6.283   0.711   -13.577 1.00 0.00 ? 46 ASN A HA   14 
ATOM   10480 H HB2  . ASN A 1 46 ? 4.810   2.047   -15.452 1.00 0.00 ? 46 ASN A HB2  14 
ATOM   10481 H HB3  . ASN A 1 46 ? 6.417   2.717   -15.722 1.00 0.00 ? 46 ASN A HB3  14 
ATOM   10482 H HD21 . ASN A 1 46 ? 4.916   1.060   -17.498 1.00 0.00 ? 46 ASN A HD21 14 
ATOM   10483 H HD22 . ASN A 1 46 ? 5.833   -0.382  -17.751 1.00 0.00 ? 46 ASN A HD22 14 
ATOM   10484 N N    . SER A 1 47 ? 8.466   2.339   -14.358 1.00 0.00 ? 47 SER A N    14 
ATOM   10485 C CA   . SER A 1 47 ? 9.757   2.975   -14.183 1.00 0.00 ? 47 SER A CA   14 
ATOM   10486 C C    . SER A 1 47 ? 10.833  2.247   -14.984 1.00 0.00 ? 47 SER A C    14 
ATOM   10487 O O    . SER A 1 47 ? 11.104  1.071   -14.749 1.00 0.00 ? 47 SER A O    14 
ATOM   10488 C CB   . SER A 1 47 ? 10.160  3.039   -12.705 1.00 0.00 ? 47 SER A CB   14 
ATOM   10489 O OG   . SER A 1 47 ? 9.757   1.868   -12.016 1.00 0.00 ? 47 SER A OG   14 
ATOM   10490 H H    . SER A 1 47 ? 8.324   1.811   -15.154 1.00 0.00 ? 47 SER A H    14 
ATOM   10491 H HA   . SER A 1 47 ? 9.659   3.963   -14.570 1.00 0.00 ? 47 SER A HA   14 
ATOM   10492 H HB2  . SER A 1 47 ? 11.232  3.135   -12.627 1.00 0.00 ? 47 SER A HB2  14 
ATOM   10493 H HB3  . SER A 1 47 ? 9.688   3.894   -12.242 1.00 0.00 ? 47 SER A HB3  14 
ATOM   10494 H HG   . SER A 1 47 ? 10.195  1.103   -12.400 1.00 0.00 ? 47 SER A HG   14 
ATOM   10495 N N    . VAL A 1 48 ? 11.446  2.967   -15.924 1.00 0.00 ? 48 VAL A N    14 
ATOM   10496 C CA   . VAL A 1 48 ? 12.500  2.423   -16.768 1.00 0.00 ? 48 VAL A CA   14 
ATOM   10497 C C    . VAL A 1 48 ? 12.828  3.393   -17.890 1.00 0.00 ? 48 VAL A C    14 
ATOM   10498 O O    . VAL A 1 48 ? 12.127  3.465   -18.900 1.00 0.00 ? 48 VAL A O    14 
ATOM   10499 C CB   . VAL A 1 48 ? 12.144  1.070   -17.399 1.00 0.00 ? 48 VAL A CB   14 
ATOM   10500 C CG1  . VAL A 1 48 ? 12.615  -0.083  -16.525 1.00 0.00 ? 48 VAL A CG1  14 
ATOM   10501 C CG2  . VAL A 1 48 ? 10.652  0.973   -17.685 1.00 0.00 ? 48 VAL A CG2  14 
ATOM   10502 H H    . VAL A 1 48 ? 11.189  3.903   -16.050 1.00 0.00 ? 48 VAL A H    14 
ATOM   10503 H HA   . VAL A 1 48 ? 13.380  2.290   -16.156 1.00 0.00 ? 48 VAL A HA   14 
ATOM   10504 H HB   . VAL A 1 48 ? 12.673  1.013   -18.336 1.00 0.00 ? 48 VAL A HB   14 
ATOM   10505 H HG11 . VAL A 1 48 ? 13.186  -0.778  -17.122 1.00 0.00 ? 48 VAL A HG11 14 
ATOM   10506 H HG12 . VAL A 1 48 ? 11.758  -0.590  -16.105 1.00 0.00 ? 48 VAL A HG12 14 
ATOM   10507 H HG13 . VAL A 1 48 ? 13.233  0.298   -15.726 1.00 0.00 ? 48 VAL A HG13 14 
ATOM   10508 H HG21 . VAL A 1 48 ? 10.176  0.378   -16.919 1.00 0.00 ? 48 VAL A HG21 14 
ATOM   10509 H HG22 . VAL A 1 48 ? 10.499  0.508   -18.649 1.00 0.00 ? 48 VAL A HG22 14 
ATOM   10510 H HG23 . VAL A 1 48 ? 10.221  1.963   -17.692 1.00 0.00 ? 48 VAL A HG23 14 
ATOM   10511 N N    . LYS A 1 49 ? 13.897  4.132   -17.695 1.00 0.00 ? 49 LYS A N    14 
ATOM   10512 C CA   . LYS A 1 49 ? 14.352  5.115   -18.673 1.00 0.00 ? 49 LYS A CA   14 
ATOM   10513 C C    . LYS A 1 49 ? 13.308  6.209   -18.874 1.00 0.00 ? 49 LYS A C    14 
ATOM   10514 O O    . LYS A 1 49 ? 12.106  5.946   -18.844 1.00 0.00 ? 49 LYS A O    14 
ATOM   10515 C CB   . LYS A 1 49 ? 14.660  4.436   -20.009 1.00 0.00 ? 49 LYS A CB   14 
ATOM   10516 C CG   . LYS A 1 49 ? 16.099  3.963   -20.133 1.00 0.00 ? 49 LYS A CG   14 
ATOM   10517 C CD   . LYS A 1 49 ? 16.536  3.881   -21.588 1.00 0.00 ? 49 LYS A CD   14 
ATOM   10518 C CE   . LYS A 1 49 ? 17.409  5.063   -21.979 1.00 0.00 ? 49 LYS A CE   14 
ATOM   10519 N NZ   . LYS A 1 49 ? 18.561  4.649   -22.826 1.00 0.00 ? 49 LYS A NZ   14 
ATOM   10520 H H    . LYS A 1 49 ? 14.393  4.010   -16.868 1.00 0.00 ? 49 LYS A H    14 
ATOM   10521 H HA   . LYS A 1 49 ? 15.257  5.565   -18.292 1.00 0.00 ? 49 LYS A HA   14 
ATOM   10522 H HB2  . LYS A 1 49 ? 14.012  3.581   -20.122 1.00 0.00 ? 49 LYS A HB2  14 
ATOM   10523 H HB3  . LYS A 1 49 ? 14.462  5.135   -20.808 1.00 0.00 ? 49 LYS A HB3  14 
ATOM   10524 H HG2  . LYS A 1 49 ? 16.743  4.658   -19.614 1.00 0.00 ? 49 LYS A HG2  14 
ATOM   10525 H HG3  . LYS A 1 49 ? 16.186  2.984   -19.684 1.00 0.00 ? 49 LYS A HG3  14 
ATOM   10526 H HD2  . LYS A 1 49 ? 17.097  2.970   -21.734 1.00 0.00 ? 49 LYS A HD2  14 
ATOM   10527 H HD3  . LYS A 1 49 ? 15.658  3.869   -22.218 1.00 0.00 ? 49 LYS A HD3  14 
ATOM   10528 H HE2  . LYS A 1 49 ? 16.807  5.772   -22.529 1.00 0.00 ? 49 LYS A HE2  14 
ATOM   10529 H HE3  . LYS A 1 49 ? 17.783  5.532   -21.081 1.00 0.00 ? 49 LYS A HE3  14 
ATOM   10530 H HZ1  . LYS A 1 49 ? 19.409  4.521   -22.237 1.00 0.00 ? 49 LYS A HZ1  14 
ATOM   10531 H HZ2  . LYS A 1 49 ? 18.757  5.374   -23.544 1.00 0.00 ? 49 LYS A HZ2  14 
ATOM   10532 H HZ3  . LYS A 1 49 ? 18.347  3.751   -23.306 1.00 0.00 ? 49 LYS A HZ3  14 
HETATM 10533 N N    . CY1 A 1 50 ? 13.776  7.435   -19.078 1.00 0.00 ? 50 CY1 A N    14 
HETATM 10534 C CA   . CY1 A 1 50 ? 12.883  8.570   -19.284 1.00 0.00 ? 50 CY1 A CA   14 
HETATM 10535 C CB   . CY1 A 1 50 ? 13.439  9.816   -18.591 1.00 0.00 ? 50 CY1 A CB   14 
HETATM 10536 S SG   . CY1 A 1 50 ? 13.164  9.793   -16.810 1.00 0.00 ? 50 CY1 A SG   14 
HETATM 10537 C CD   . CY1 A 1 50 ? 14.310  11.057  -16.225 1.00 0.00 ? 50 CY1 A CD   14 
HETATM 10538 N NE   . CY1 A 1 50 ? 13.609  12.321  -16.020 1.00 0.00 ? 50 CY1 A NE   14 
HETATM 10539 C CZ   . CY1 A 1 50 ? 13.599  12.989  -14.872 1.00 0.00 ? 50 CY1 A CZ   14 
HETATM 10540 O OAC  . CY1 A 1 50 ? 14.180  12.617  -13.851 1.00 0.00 ? 50 CY1 A OAC  14 
HETATM 10541 C CM   . CY1 A 1 50 ? 12.809  14.284  -14.873 1.00 0.00 ? 50 CY1 A CM   14 
HETATM 10542 C C    . CY1 A 1 50 ? 12.684  8.846   -20.771 1.00 0.00 ? 50 CY1 A C    14 
HETATM 10543 O O    . CY1 A 1 50 ? 11.553  8.979   -21.237 1.00 0.00 ? 50 CY1 A O    14 
HETATM 10544 H H    . CY1 A 1 50 ? 14.745  7.583   -19.091 1.00 0.00 ? 50 CY1 A H    14 
HETATM 10545 H HA   . CY1 A 1 50 ? 11.927  8.323   -18.846 1.00 0.00 ? 50 CY1 A HA   14 
HETATM 10546 H HB2  . CY1 A 1 50 ? 14.501  9.877   -18.774 1.00 0.00 ? 50 CY1 A HB2  14 
HETATM 10547 H HB3  . CY1 A 1 50 ? 12.957  10.692  -18.999 1.00 0.00 ? 50 CY1 A HB3  14 
HETATM 10548 H HD2  . CY1 A 1 50 ? 14.397  10.526  -15.288 1.00 0.00 ? 50 CY1 A HD2  14 
HETATM 10549 H HD3  . CY1 A 1 50 ? 15.226  11.226  -16.772 1.00 0.00 ? 50 CY1 A HD3  14 
HETATM 10550 H HE   . CY1 A 1 50 ? 13.001  12.629  -16.723 1.00 0.00 ? 50 CY1 A HE   14 
HETATM 10551 H HM1  . CY1 A 1 50 ? 12.100  14.266  -14.048 1.00 0.00 ? 50 CY1 A HM1  14 
HETATM 10552 H HM2  . CY1 A 1 50 ? 12.298  14.385  -15.827 1.00 0.00 ? 50 CY1 A HM2  14 
HETATM 10553 H HM3  . CY1 A 1 50 ? 13.465  15.118  -14.743 1.00 0.00 ? 50 CY1 A HM3  14 
HETATM 10554 N N    . NH2 A 1 51 ? 13.772  8.932   -21.529 1.00 0.00 ? 51 NH2 A N    14 
HETATM 10555 H HN1  . NH2 A 1 51 ? 14.646  8.816   -21.099 1.00 0.00 ? 51 NH2 A HN1  14 
HETATM 10556 H HN2  . NH2 A 1 51 ? 13.656  9.107   -22.486 1.00 0.00 ? 51 NH2 A HN2  14 
ATOM   10557 N N    . LEU A 1 1  ? -5.754  -3.125  15.082  1.00 0.00 ? 1  LEU A N    15 
ATOM   10558 C CA   . LEU A 1 1  ? -4.673  -2.289  15.667  1.00 0.00 ? 1  LEU A CA   15 
ATOM   10559 C C    . LEU A 1 1  ? -3.537  -2.081  14.672  1.00 0.00 ? 1  LEU A C    15 
ATOM   10560 O O    . LEU A 1 1  ? -3.434  -2.794  13.673  1.00 0.00 ? 1  LEU A O    15 
ATOM   10561 C CB   . LEU A 1 1  ? -4.151  -2.981  16.928  1.00 0.00 ? 1  LEU A CB   15 
ATOM   10562 C CG   . LEU A 1 1  ? -3.691  -4.427  16.729  1.00 0.00 ? 1  LEU A CG   15 
ATOM   10563 C CD1  . LEU A 1 1  ? -2.611  -4.788  17.737  1.00 0.00 ? 1  LEU A CD1  15 
ATOM   10564 C CD2  . LEU A 1 1  ? -4.873  -5.380  16.844  1.00 0.00 ? 1  LEU A CD2  15 
ATOM   10565 H H1   . LEU A 1 1  ? -5.306  -3.930  14.600  1.00 0.00 ? 1  LEU A H1   15 
ATOM   10566 H H2   . LEU A 1 1  ? -6.284  -2.532  14.411  1.00 0.00 ? 1  LEU A H2   15 
ATOM   10567 H H3   . LEU A 1 1  ? -6.362  -3.447  15.861  1.00 0.00 ? 1  LEU A H3   15 
ATOM   10568 H HA   . LEU A 1 1  ? -5.088  -1.329  15.935  1.00 0.00 ? 1  LEU A HA   15 
ATOM   10569 H HB2  . LEU A 1 1  ? -3.317  -2.409  17.307  1.00 0.00 ? 1  LEU A HB2  15 
ATOM   10570 H HB3  . LEU A 1 1  ? -4.936  -2.975  17.669  1.00 0.00 ? 1  LEU A HB3  15 
ATOM   10571 H HG   . LEU A 1 1  ? -3.273  -4.531  15.739  1.00 0.00 ? 1  LEU A HG   15 
ATOM   10572 H HD11 . LEU A 1 1  ? -1.824  -5.336  17.240  1.00 0.00 ? 1  LEU A HD11 15 
ATOM   10573 H HD12 . LEU A 1 1  ? -3.037  -5.400  18.518  1.00 0.00 ? 1  LEU A HD12 15 
ATOM   10574 H HD13 . LEU A 1 1  ? -2.204  -3.886  18.169  1.00 0.00 ? 1  LEU A HD13 15 
ATOM   10575 H HD21 . LEU A 1 1  ? -5.317  -5.522  15.870  1.00 0.00 ? 1  LEU A HD21 15 
ATOM   10576 H HD22 . LEU A 1 1  ? -5.607  -4.962  17.517  1.00 0.00 ? 1  LEU A HD22 15 
ATOM   10577 H HD23 . LEU A 1 1  ? -4.532  -6.330  17.227  1.00 0.00 ? 1  LEU A HD23 15 
ATOM   10578 N N    . GLN A 1 2  ? -2.686  -1.099  14.952  1.00 0.00 ? 2  GLN A N    15 
ATOM   10579 C CA   . GLN A 1 2  ? -1.557  -0.796  14.080  1.00 0.00 ? 2  GLN A CA   15 
ATOM   10580 C C    . GLN A 1 2  ? -0.575  -1.964  14.032  1.00 0.00 ? 2  GLN A C    15 
ATOM   10581 O O    . GLN A 1 2  ? -0.291  -2.588  15.054  1.00 0.00 ? 2  GLN A O    15 
ATOM   10582 C CB   . GLN A 1 2  ? -0.842  0.468   14.560  1.00 0.00 ? 2  GLN A CB   15 
ATOM   10583 C CG   . GLN A 1 2  ? -0.350  0.382   15.995  1.00 0.00 ? 2  GLN A CG   15 
ATOM   10584 C CD   . GLN A 1 2  ? -1.287  1.061   16.975  1.00 0.00 ? 2  GLN A CD   15 
ATOM   10585 O OE1  . GLN A 1 2  ? -1.889  0.410   17.829  1.00 0.00 ? 2  GLN A OE1  15 
ATOM   10586 N NE2  . GLN A 1 2  ? -1.416  2.376   16.857  1.00 0.00 ? 2  GLN A NE2  15 
ATOM   10587 H H    . GLN A 1 2  ? -2.820  -0.566  15.762  1.00 0.00 ? 2  GLN A H    15 
ATOM   10588 H HA   . GLN A 1 2  ? -1.942  -0.625  13.087  1.00 0.00 ? 2  GLN A HA   15 
ATOM   10589 H HB2  . GLN A 1 2  ? 0.008   0.653   13.921  1.00 0.00 ? 2  GLN A HB2  15 
ATOM   10590 H HB3  . GLN A 1 2  ? -1.524  1.302   14.486  1.00 0.00 ? 2  GLN A HB3  15 
ATOM   10591 H HG2  . GLN A 1 2  ? -0.259  -0.659  16.270  1.00 0.00 ? 2  GLN A HG2  15 
ATOM   10592 H HG3  . GLN A 1 2  ? 0.619   0.855   16.060  1.00 0.00 ? 2  GLN A HG3  15 
ATOM   10593 H HE21 . GLN A 1 2  ? -0.906  2.830   16.153  1.00 0.00 ? 2  GLN A HE21 15 
ATOM   10594 H HE22 . GLN A 1 2  ? -2.016  2.842   17.477  1.00 0.00 ? 2  GLN A HE22 15 
ATOM   10595 N N    . MET A 1 3  ? -0.065  -2.250  12.832  1.00 0.00 ? 3  MET A N    15 
ATOM   10596 C CA   . MET A 1 3  ? 0.889   -3.343  12.619  1.00 0.00 ? 3  MET A CA   15 
ATOM   10597 C C    . MET A 1 3  ? 0.175   -4.680  12.419  1.00 0.00 ? 3  MET A C    15 
ATOM   10598 O O    . MET A 1 3  ? 0.608   -5.504  11.618  1.00 0.00 ? 3  MET A O    15 
ATOM   10599 C CB   . MET A 1 3  ? 1.885   -3.446  13.782  1.00 0.00 ? 3  MET A CB   15 
ATOM   10600 C CG   . MET A 1 3  ? 3.148   -4.220  13.434  1.00 0.00 ? 3  MET A CG   15 
ATOM   10601 S SD   . MET A 1 3  ? 4.053   -3.493  12.055  1.00 0.00 ? 3  MET A SD   15 
ATOM   10602 C CE   . MET A 1 3  ? 4.848   -2.107  12.865  1.00 0.00 ? 3  MET A CE   15 
ATOM   10603 H H    . MET A 1 3  ? -0.341  -1.710  12.063  1.00 0.00 ? 3  MET A H    15 
ATOM   10604 H HA   . MET A 1 3  ? 1.437   -3.116  11.717  1.00 0.00 ? 3  MET A HA   15 
ATOM   10605 H HB2  . MET A 1 3  ? 2.172   -2.450  14.084  1.00 0.00 ? 3  MET A HB2  15 
ATOM   10606 H HB3  . MET A 1 3  ? 1.405   -3.941  14.612  1.00 0.00 ? 3  MET A HB3  15 
ATOM   10607 H HG2  . MET A 1 3  ? 3.793   -4.236  14.300  1.00 0.00 ? 3  MET A HG2  15 
ATOM   10608 H HG3  . MET A 1 3  ? 2.873   -5.231  13.173  1.00 0.00 ? 3  MET A HG3  15 
ATOM   10609 H HE1  . MET A 1 3  ? 5.919   -2.182  12.738  1.00 0.00 ? 3  MET A HE1  15 
ATOM   10610 H HE2  . MET A 1 3  ? 4.609   -2.120  13.917  1.00 0.00 ? 3  MET A HE2  15 
ATOM   10611 H HE3  . MET A 1 3  ? 4.498   -1.185  12.426  1.00 0.00 ? 3  MET A HE3  15 
ATOM   10612 N N    . ALA A 1 4  ? -0.926  -4.885  13.140  1.00 0.00 ? 4  ALA A N    15 
ATOM   10613 C CA   . ALA A 1 4  ? -1.706  -6.122  13.033  1.00 0.00 ? 4  ALA A CA   15 
ATOM   10614 C C    . ALA A 1 4  ? -0.817  -7.371  12.965  1.00 0.00 ? 4  ALA A C    15 
ATOM   10615 O O    . ALA A 1 4  ? -0.361  -7.757  11.889  1.00 0.00 ? 4  ALA A O    15 
ATOM   10616 C CB   . ALA A 1 4  ? -2.615  -6.060  11.815  1.00 0.00 ? 4  ALA A CB   15 
ATOM   10617 H H    . ALA A 1 4  ? -1.230  -4.185  13.754  1.00 0.00 ? 4  ALA A H    15 
ATOM   10618 H HA   . ALA A 1 4  ? -2.331  -6.192  13.910  1.00 0.00 ? 4  ALA A HA   15 
ATOM   10619 H HB1  . ALA A 1 4  ? -3.588  -5.695  12.112  1.00 0.00 ? 4  ALA A HB1  15 
ATOM   10620 H HB2  . ALA A 1 4  ? -2.716  -7.047  11.389  1.00 0.00 ? 4  ALA A HB2  15 
ATOM   10621 H HB3  . ALA A 1 4  ? -2.190  -5.393  11.082  1.00 0.00 ? 4  ALA A HB3  15 
ATOM   10622 N N    . GLY A 1 5  ? -0.595  -8.003  14.122  1.00 0.00 ? 5  GLY A N    15 
ATOM   10623 C CA   . GLY A 1 5  ? 0.224   -9.225  14.188  1.00 0.00 ? 5  GLY A CA   15 
ATOM   10624 C C    . GLY A 1 5  ? 1.399   -9.245  13.222  1.00 0.00 ? 5  GLY A C    15 
ATOM   10625 O O    . GLY A 1 5  ? 1.784   -10.310 12.738  1.00 0.00 ? 5  GLY A O    15 
ATOM   10626 H H    . GLY A 1 5  ? -1.008  -7.645  14.943  1.00 0.00 ? 5  GLY A H    15 
ATOM   10627 H HA2  . GLY A 1 5  ? 0.614   -9.340  15.193  1.00 0.00 ? 5  GLY A HA2  15 
ATOM   10628 H HA3  . GLY A 1 5  ? -0.411  -10.077 13.971  1.00 0.00 ? 5  GLY A HA3  15 
ATOM   10629 N N    . GLN A 1 6  ? 1.971   -8.077  12.935  1.00 0.00 ? 6  GLN A N    15 
ATOM   10630 C CA   . GLN A 1 6  ? 3.103   -7.984  12.019  1.00 0.00 ? 6  GLN A CA   15 
ATOM   10631 C C    . GLN A 1 6  ? 2.626   -8.097  10.585  1.00 0.00 ? 6  GLN A C    15 
ATOM   10632 O O    . GLN A 1 6  ? 2.867   -9.093  9.902   1.00 0.00 ? 6  GLN A O    15 
ATOM   10633 C CB   . GLN A 1 6  ? 4.154   -9.058  12.322  1.00 0.00 ? 6  GLN A CB   15 
ATOM   10634 C CG   . GLN A 1 6  ? 5.584   -8.581  12.127  1.00 0.00 ? 6  GLN A CG   15 
ATOM   10635 C CD   . GLN A 1 6  ? 6.011   -7.573  13.177  1.00 0.00 ? 6  GLN A CD   15 
ATOM   10636 O OE1  . GLN A 1 6  ? 5.253   -6.670  13.531  1.00 0.00 ? 6  GLN A OE1  15 
ATOM   10637 N NE2  . GLN A 1 6  ? 7.231   -7.722  13.678  1.00 0.00 ? 6  GLN A NE2  15 
ATOM   10638 H H    . GLN A 1 6  ? 1.622   -7.257  13.340  1.00 0.00 ? 6  GLN A H    15 
ATOM   10639 H HA   . GLN A 1 6  ? 3.545   -7.009  12.149  1.00 0.00 ? 6  GLN A HA   15 
ATOM   10640 H HB2  . GLN A 1 6  ? 4.040   -9.378  13.347  1.00 0.00 ? 6  GLN A HB2  15 
ATOM   10641 H HB3  . GLN A 1 6  ? 3.987   -9.903  11.670  1.00 0.00 ? 6  GLN A HB3  15 
ATOM   10642 H HG2  . GLN A 1 6  ? 6.244   -9.434  12.181  1.00 0.00 ? 6  GLN A HG2  15 
ATOM   10643 H HG3  . GLN A 1 6  ? 5.667   -8.122  11.153  1.00 0.00 ? 6  GLN A HG3  15 
ATOM   10644 H HE21 . GLN A 1 6  ? 7.780   -8.464  13.348  1.00 0.00 ? 6  GLN A HE21 15 
ATOM   10645 H HE22 . GLN A 1 6  ? 7.534   -7.084  14.358  1.00 0.00 ? 6  GLN A HE22 15 
ATOM   10646 N N    . CYS A 1 7  ? 1.931   -7.058  10.157  1.00 0.00 ? 7  CYS A N    15 
ATOM   10647 C CA   . CYS A 1 7  ? 1.376   -6.980  8.804   1.00 0.00 ? 7  CYS A CA   15 
ATOM   10648 C C    . CYS A 1 7  ? 2.323   -7.553  7.763   1.00 0.00 ? 7  CYS A C    15 
ATOM   10649 O O    . CYS A 1 7  ? 3.539   -7.384  7.852   1.00 0.00 ? 7  CYS A O    15 
ATOM   10650 C CB   . CYS A 1 7  ? 1.064   -5.530  8.435   1.00 0.00 ? 7  CYS A CB   15 
ATOM   10651 S SG   . CYS A 1 7  ? -0.569  -4.963  8.999   1.00 0.00 ? 7  CYS A SG   15 
ATOM   10652 H H    . CYS A 1 7  ? 1.779   -6.316  10.783  1.00 0.00 ? 7  CYS A H    15 
ATOM   10653 H HA   . CYS A 1 7  ? 0.462   -7.544  8.787   1.00 0.00 ? 7  CYS A HA   15 
ATOM   10654 H HB2  . CYS A 1 7  ? 1.808   -4.884  8.873   1.00 0.00 ? 7  CYS A HB2  15 
ATOM   10655 H HB3  . CYS A 1 7  ? 1.098   -5.427  7.354   1.00 0.00 ? 7  CYS A HB3  15 
ATOM   10656 N N    . SER A 1 8  ? 1.753   -8.205  6.756   1.00 0.00 ? 8  SER A N    15 
ATOM   10657 C CA   . SER A 1 8  ? 2.551   -8.765  5.681   1.00 0.00 ? 8  SER A CA   15 
ATOM   10658 C C    . SER A 1 8  ? 3.283   -7.636  4.973   1.00 0.00 ? 8  SER A C    15 
ATOM   10659 O O    . SER A 1 8  ? 2.782   -6.516  4.896   1.00 0.00 ? 8  SER A O    15 
ATOM   10660 C CB   . SER A 1 8  ? 1.669   -9.531  4.693   1.00 0.00 ? 8  SER A CB   15 
ATOM   10661 O OG   . SER A 1 8  ? 1.099   -10.678 5.301   1.00 0.00 ? 8  SER A OG   15 
ATOM   10662 H H    . SER A 1 8  ? 0.778   -8.287  6.727   1.00 0.00 ? 8  SER A H    15 
ATOM   10663 H HA   . SER A 1 8  ? 3.274   -9.437  6.114   1.00 0.00 ? 8  SER A HA   15 
ATOM   10664 H HB2  . SER A 1 8  ? 0.873   -8.889  4.351   1.00 0.00 ? 8  SER A HB2  15 
ATOM   10665 H HB3  . SER A 1 8  ? 2.266   -9.844  3.850   1.00 0.00 ? 8  SER A HB3  15 
ATOM   10666 H HG   . SER A 1 8  ? 0.465   -10.406 5.968   1.00 0.00 ? 8  SER A HG   15 
ATOM   10667 N N    . GLN A 1 9  ? 4.477   -7.914  4.483   1.00 0.00 ? 9  GLN A N    15 
ATOM   10668 C CA   . GLN A 1 9  ? 5.269   -6.896  3.818   1.00 0.00 ? 9  GLN A CA   15 
ATOM   10669 C C    . GLN A 1 9  ? 4.476   -6.150  2.757   1.00 0.00 ? 9  GLN A C    15 
ATOM   10670 O O    . GLN A 1 9  ? 3.837   -6.747  1.891   1.00 0.00 ? 9  GLN A O    15 
ATOM   10671 C CB   . GLN A 1 9  ? 6.530   -7.511  3.209   1.00 0.00 ? 9  GLN A CB   15 
ATOM   10672 C CG   . GLN A 1 9  ? 7.570   -6.485  2.793   1.00 0.00 ? 9  GLN A CG   15 
ATOM   10673 C CD   . GLN A 1 9  ? 8.440   -6.968  1.649   1.00 0.00 ? 9  GLN A CD   15 
ATOM   10674 O OE1  . GLN A 1 9  ? 9.547   -7.463  1.862   1.00 0.00 ? 9  GLN A OE1  15 
ATOM   10675 N NE2  . GLN A 1 9  ? 7.943   -6.827  0.426   1.00 0.00 ? 9  GLN A NE2  15 
ATOM   10676 H H    . GLN A 1 9  ? 4.844   -8.811  4.590   1.00 0.00 ? 9  GLN A H    15 
ATOM   10677 H HA   . GLN A 1 9  ? 5.554   -6.183  4.571   1.00 0.00 ? 9  GLN A HA   15 
ATOM   10678 H HB2  . GLN A 1 9  ? 6.979   -8.174  3.933   1.00 0.00 ? 9  GLN A HB2  15 
ATOM   10679 H HB3  . GLN A 1 9  ? 6.251   -8.082  2.335   1.00 0.00 ? 9  GLN A HB3  15 
ATOM   10680 H HG2  . GLN A 1 9  ? 7.065   -5.583  2.485   1.00 0.00 ? 9  GLN A HG2  15 
ATOM   10681 H HG3  . GLN A 1 9  ? 8.203   -6.270  3.642   1.00 0.00 ? 9  GLN A HG3  15 
ATOM   10682 H HE21 . GLN A 1 9  ? 7.054   -6.424  0.332   1.00 0.00 ? 9  GLN A HE21 15 
ATOM   10683 H HE22 . GLN A 1 9  ? 8.484   -7.132  -0.331  1.00 0.00 ? 9  GLN A HE22 15 
ATOM   10684 N N    . ASN A 1 10 ? 4.542   -4.828  2.846   1.00 0.00 ? 10 ASN A N    15 
ATOM   10685 C CA   . ASN A 1 10 ? 3.860   -3.943  1.917   1.00 0.00 ? 10 ASN A CA   15 
ATOM   10686 C C    . ASN A 1 10 ? 2.352   -3.996  2.079   1.00 0.00 ? 10 ASN A C    15 
ATOM   10687 O O    . ASN A 1 10 ? 1.612   -3.721  1.135   1.00 0.00 ? 10 ASN A O    15 
ATOM   10688 C CB   . ASN A 1 10 ? 4.247   -4.269  0.472   1.00 0.00 ? 10 ASN A CB   15 
ATOM   10689 C CG   . ASN A 1 10 ? 5.755   -4.220  0.258   1.00 0.00 ? 10 ASN A CG   15 
ATOM   10690 O OD1  . ASN A 1 10 ? 6.502   -3.869  1.171   1.00 0.00 ? 10 ASN A OD1  15 
ATOM   10691 N ND2  . ASN A 1 10 ? 6.220   -4.568  -0.946  1.00 0.00 ? 10 ASN A ND2  15 
ATOM   10692 H H    . ASN A 1 10 ? 5.081   -4.432  3.563   1.00 0.00 ? 10 ASN A H    15 
ATOM   10693 H HA   . ASN A 1 10 ? 4.177   -2.944  2.147   1.00 0.00 ? 10 ASN A HA   15 
ATOM   10694 H HB2  . ASN A 1 10 ? 3.893   -5.262  0.232   1.00 0.00 ? 10 ASN A HB2  15 
ATOM   10695 H HB3  . ASN A 1 10 ? 3.780   -3.550  -0.186  1.00 0.00 ? 10 ASN A HB3  15 
ATOM   10696 H HD21 . ASN A 1 10 ? 5.582   -4.839  -1.639  1.00 0.00 ? 10 ASN A HD21 15 
ATOM   10697 H HD22 . ASN A 1 10 ? 7.191   -4.539  -1.088  1.00 0.00 ? 10 ASN A HD22 15 
ATOM   10698 N N    . GLU A 1 11 ? 1.895   -4.318  3.280   1.00 0.00 ? 11 GLU A N    15 
ATOM   10699 C CA   . GLU A 1 11 ? 0.456   -4.363  3.527   1.00 0.00 ? 11 GLU A CA   15 
ATOM   10700 C C    . GLU A 1 11 ? 0.027   -3.242  4.448   1.00 0.00 ? 11 GLU A C    15 
ATOM   10701 O O    . GLU A 1 11 ? 0.741   -2.900  5.390   1.00 0.00 ? 11 GLU A O    15 
ATOM   10702 C CB   . GLU A 1 11 ? 0.018   -5.726  4.072   1.00 0.00 ? 11 GLU A CB   15 
ATOM   10703 C CG   . GLU A 1 11 ? -1.056  -6.407  3.231   1.00 0.00 ? 11 GLU A CG   15 
ATOM   10704 C CD   . GLU A 1 11 ? -0.648  -7.795  2.774   1.00 0.00 ? 11 GLU A CD   15 
ATOM   10705 O OE1  . GLU A 1 11 ? 0.459   -7.933  2.211   1.00 0.00 ? 11 GLU A OE1  15 
ATOM   10706 O OE2  . GLU A 1 11 ? -1.434  -8.743  2.981   1.00 0.00 ? 11 GLU A OE2  15 
ATOM   10707 H H    . GLU A 1 11 ? 2.538   -4.511  4.011   1.00 0.00 ? 11 GLU A H    15 
ATOM   10708 H HA   . GLU A 1 11 ? -0.022  -4.193  2.596   1.00 0.00 ? 11 GLU A HA   15 
ATOM   10709 H HB2  . GLU A 1 11 ? 0.877   -6.377  4.110   1.00 0.00 ? 11 GLU A HB2  15 
ATOM   10710 H HB3  . GLU A 1 11 ? -0.368  -5.597  5.072   1.00 0.00 ? 11 GLU A HB3  15 
ATOM   10711 H HG2  . GLU A 1 11 ? -1.956  -6.492  3.819   1.00 0.00 ? 11 GLU A HG2  15 
ATOM   10712 H HG3  . GLU A 1 11 ? -1.256  -5.804  2.355   1.00 0.00 ? 11 GLU A HG3  15 
ATOM   10713 N N    . TYR A 1 12 ? -1.144  -2.649  4.172   1.00 0.00 ? 12 TYR A N    15 
ATOM   10714 C CA   . TYR A 1 12 ? -1.613  -1.544  5.016   1.00 0.00 ? 12 TYR A CA   15 
ATOM   10715 C C    . TYR A 1 12 ? -2.961  -1.849  5.651   1.00 0.00 ? 12 TYR A C    15 
ATOM   10716 O O    . TYR A 1 12 ? -3.947  -2.116  4.963   1.00 0.00 ? 12 TYR A O    15 
ATOM   10717 C CB   . TYR A 1 12 ? -1.651  -0.218  4.244   1.00 0.00 ? 12 TYR A CB   15 
ATOM   10718 C CG   . TYR A 1 12 ? -2.780  -0.086  3.245   1.00 0.00 ? 12 TYR A CG   15 
ATOM   10719 C CD1  . TYR A 1 12 ? -2.752  -0.769  2.041   1.00 0.00 ? 12 TYR A CD1  15 
ATOM   10720 C CD2  . TYR A 1 12 ? -3.870  0.729   3.508   1.00 0.00 ? 12 TYR A CD2  15 
ATOM   10721 C CE1  . TYR A 1 12 ? -3.780  -0.648  1.127   1.00 0.00 ? 12 TYR A CE1  15 
ATOM   10722 C CE2  . TYR A 1 12 ? -4.900  0.855   2.597   1.00 0.00 ? 12 TYR A CE2  15 
ATOM   10723 C CZ   . TYR A 1 12 ? -4.849  0.166   1.410   1.00 0.00 ? 12 TYR A CZ   15 
ATOM   10724 O OH   . TYR A 1 12 ? -5.878  0.291   0.507   1.00 0.00 ? 12 TYR A OH   15 
ATOM   10725 H H    . TYR A 1 12 ? -1.696  -2.960  3.390   1.00 0.00 ? 12 TYR A H    15 
ATOM   10726 H HA   . TYR A 1 12 ? -0.894  -1.438  5.820   1.00 0.00 ? 12 TYR A HA   15 
ATOM   10727 H HB2  . TYR A 1 12 ? -1.750  0.589   4.952   1.00 0.00 ? 12 TYR A HB2  15 
ATOM   10728 H HB3  . TYR A 1 12 ? -0.721  -0.101  3.708   1.00 0.00 ? 12 TYR A HB3  15 
ATOM   10729 H HD1  . TYR A 1 12 ? -1.908  -1.403  1.819   1.00 0.00 ? 12 TYR A HD1  15 
ATOM   10730 H HD2  . TYR A 1 12 ? -3.909  1.272   4.441   1.00 0.00 ? 12 TYR A HD2  15 
ATOM   10731 H HE1  . TYR A 1 12 ? -3.740  -1.191  0.194   1.00 0.00 ? 12 TYR A HE1  15 
ATOM   10732 H HE2  . TYR A 1 12 ? -5.734  1.494   2.813   1.00 0.00 ? 12 TYR A HE2  15 
ATOM   10733 H HH   . TYR A 1 12 ? -5.918  1.196   0.189   1.00 0.00 ? 12 TYR A HH   15 
ATOM   10734 N N    . PHE A 1 13 ? -2.977  -1.809  6.982   1.00 0.00 ? 13 PHE A N    15 
ATOM   10735 C CA   . PHE A 1 13 ? -4.177  -2.079  7.764   1.00 0.00 ? 13 PHE A CA   15 
ATOM   10736 C C    . PHE A 1 13 ? -5.094  -0.867  7.778   1.00 0.00 ? 13 PHE A C    15 
ATOM   10737 O O    . PHE A 1 13 ? -4.985  -0.001  8.646   1.00 0.00 ? 13 PHE A O    15 
ATOM   10738 C CB   . PHE A 1 13 ? -3.790  -2.465  9.196   1.00 0.00 ? 13 PHE A CB   15 
ATOM   10739 C CG   . PHE A 1 13 ? -4.962  -2.651  10.116  1.00 0.00 ? 13 PHE A CG   15 
ATOM   10740 C CD1  . PHE A 1 13 ? -5.743  -3.794  10.045  1.00 0.00 ? 13 PHE A CD1  15 
ATOM   10741 C CD2  . PHE A 1 13 ? -5.286  -1.679  11.048  1.00 0.00 ? 13 PHE A CD2  15 
ATOM   10742 C CE1  . PHE A 1 13 ? -6.824  -3.964  10.890  1.00 0.00 ? 13 PHE A CE1  15 
ATOM   10743 C CE2  . PHE A 1 13 ? -6.364  -1.843  11.896  1.00 0.00 ? 13 PHE A CE2  15 
ATOM   10744 C CZ   . PHE A 1 13 ? -7.135  -2.988  11.816  1.00 0.00 ? 13 PHE A CZ   15 
ATOM   10745 H H    . PHE A 1 13 ? -2.146  -1.590  7.454   1.00 0.00 ? 13 PHE A H    15 
ATOM   10746 H HA   . PHE A 1 13 ? -4.700  -2.907  7.308   1.00 0.00 ? 13 PHE A HA   15 
ATOM   10747 H HB2  . PHE A 1 13 ? -3.238  -3.393  9.173   1.00 0.00 ? 13 PHE A HB2  15 
ATOM   10748 H HB3  . PHE A 1 13 ? -3.160  -1.691  9.610   1.00 0.00 ? 13 PHE A HB3  15 
ATOM   10749 H HD1  . PHE A 1 13 ? -5.499  -4.559  9.322   1.00 0.00 ? 13 PHE A HD1  15 
ATOM   10750 H HD2  . PHE A 1 13 ? -4.684  -0.785  11.112  1.00 0.00 ? 13 PHE A HD2  15 
ATOM   10751 H HE1  . PHE A 1 13 ? -7.425  -4.859  10.825  1.00 0.00 ? 13 PHE A HE1  15 
ATOM   10752 H HE2  . PHE A 1 13 ? -6.604  -1.078  12.620  1.00 0.00 ? 13 PHE A HE2  15 
ATOM   10753 H HZ   . PHE A 1 13 ? -7.979  -3.119  12.478  1.00 0.00 ? 13 PHE A HZ   15 
ATOM   10754 N N    . ASP A 1 14 ? -6.004  -0.818  6.816   1.00 0.00 ? 14 ASP A N    15 
ATOM   10755 C CA   . ASP A 1 14 ? -6.949  0.286   6.725   1.00 0.00 ? 14 ASP A CA   15 
ATOM   10756 C C    . ASP A 1 14 ? -7.849  0.311   7.948   1.00 0.00 ? 14 ASP A C    15 
ATOM   10757 O O    . ASP A 1 14 ? -8.706  -0.551  8.110   1.00 0.00 ? 14 ASP A O    15 
ATOM   10758 C CB   . ASP A 1 14 ? -7.796  0.157   5.460   1.00 0.00 ? 14 ASP A CB   15 
ATOM   10759 C CG   . ASP A 1 14 ? -8.125  1.503   4.843   1.00 0.00 ? 14 ASP A CG   15 
ATOM   10760 O OD1  . ASP A 1 14 ? -7.186  2.197   4.398   1.00 0.00 ? 14 ASP A OD1  15 
ATOM   10761 O OD2  . ASP A 1 14 ? -9.320  1.862   4.804   1.00 0.00 ? 14 ASP A OD2  15 
ATOM   10762 H H    . ASP A 1 14 ? -6.046  -1.547  6.158   1.00 0.00 ? 14 ASP A H    15 
ATOM   10763 H HA   . ASP A 1 14 ? -6.393  1.208   6.687   1.00 0.00 ? 14 ASP A HA   15 
ATOM   10764 H HB2  . ASP A 1 14 ? -7.256  -0.429  4.733   1.00 0.00 ? 14 ASP A HB2  15 
ATOM   10765 H HB3  . ASP A 1 14 ? -8.721  -0.342  5.705   1.00 0.00 ? 14 ASP A HB3  15 
ATOM   10766 N N    . SER A 1 15 ? -7.654  1.302   8.812   1.00 0.00 ? 15 SER A N    15 
ATOM   10767 C CA   . SER A 1 15 ? -8.466  1.414   10.018  1.00 0.00 ? 15 SER A CA   15 
ATOM   10768 C C    . SER A 1 15 ? -9.952  1.509   9.671   1.00 0.00 ? 15 SER A C    15 
ATOM   10769 O O    . SER A 1 15 ? -10.808 1.376   10.545  1.00 0.00 ? 15 SER A O    15 
ATOM   10770 C CB   . SER A 1 15 ? -8.039  2.611   10.884  1.00 0.00 ? 15 SER A CB   15 
ATOM   10771 O OG   . SER A 1 15 ? -9.039  2.925   11.838  1.00 0.00 ? 15 SER A OG   15 
ATOM   10772 H H    . SER A 1 15 ? -6.954  1.960   8.637   1.00 0.00 ? 15 SER A H    15 
ATOM   10773 H HA   . SER A 1 15 ? -8.313  0.508   10.580  1.00 0.00 ? 15 SER A HA   15 
ATOM   10774 H HB2  . SER A 1 15 ? -7.128  2.365   11.411  1.00 0.00 ? 15 SER A HB2  15 
ATOM   10775 H HB3  . SER A 1 15 ? -7.871  3.479   10.262  1.00 0.00 ? 15 SER A HB3  15 
ATOM   10776 H HG   . SER A 1 15 ? -9.320  2.121   12.283  1.00 0.00 ? 15 SER A HG   15 
ATOM   10777 N N    . LEU A 1 16 ? -10.257 1.716   8.389   1.00 0.00 ? 16 LEU A N    15 
ATOM   10778 C CA   . LEU A 1 16 ? -11.639 1.797   7.944   1.00 0.00 ? 16 LEU A CA   15 
ATOM   10779 C C    . LEU A 1 16 ? -12.117 0.421   7.489   1.00 0.00 ? 16 LEU A C    15 
ATOM   10780 O O    . LEU A 1 16 ? -13.310 0.119   7.531   1.00 0.00 ? 16 LEU A O    15 
ATOM   10781 C CB   . LEU A 1 16 ? -11.775 2.805   6.802   1.00 0.00 ? 16 LEU A CB   15 
ATOM   10782 C CG   . LEU A 1 16 ? -13.186 2.953   6.231   1.00 0.00 ? 16 LEU A CG   15 
ATOM   10783 C CD1  . LEU A 1 16 ? -13.417 4.373   5.739   1.00 0.00 ? 16 LEU A CD1  15 
ATOM   10784 C CD2  . LEU A 1 16 ? -13.415 1.954   5.106   1.00 0.00 ? 16 LEU A CD2  15 
ATOM   10785 H H    . LEU A 1 16 ? -9.541  1.798   7.724   1.00 0.00 ? 16 LEU A H    15 
ATOM   10786 H HA   . LEU A 1 16 ? -12.239 2.120   8.779   1.00 0.00 ? 16 LEU A HA   15 
ATOM   10787 H HB2  . LEU A 1 16 ? -11.451 3.771   7.163   1.00 0.00 ? 16 LEU A HB2  15 
ATOM   10788 H HB3  . LEU A 1 16 ? -11.117 2.501   6.000   1.00 0.00 ? 16 LEU A HB3  15 
ATOM   10789 H HG   . LEU A 1 16 ? -13.906 2.750   7.011   1.00 0.00 ? 16 LEU A HG   15 
ATOM   10790 H HD11 . LEU A 1 16 ? -14.133 4.362   4.931   1.00 0.00 ? 16 LEU A HD11 15 
ATOM   10791 H HD12 . LEU A 1 16 ? -12.485 4.789   5.389   1.00 0.00 ? 16 LEU A HD12 15 
ATOM   10792 H HD13 . LEU A 1 16 ? -13.799 4.977   6.550   1.00 0.00 ? 16 LEU A HD13 15 
ATOM   10793 H HD21 . LEU A 1 16 ? -14.410 1.542   5.187   1.00 0.00 ? 16 LEU A HD21 15 
ATOM   10794 H HD22 . LEU A 1 16 ? -12.689 1.157   5.179   1.00 0.00 ? 16 LEU A HD22 15 
ATOM   10795 H HD23 . LEU A 1 16 ? -13.308 2.452   4.154   1.00 0.00 ? 16 LEU A HD23 15 
ATOM   10796 N N    . LEU A 1 17 ? -11.169 -0.405  7.052   1.00 0.00 ? 17 LEU A N    15 
ATOM   10797 C CA   . LEU A 1 17 ? -11.468 -1.748  6.582   1.00 0.00 ? 17 LEU A CA   15 
ATOM   10798 C C    . LEU A 1 17 ? -11.130 -2.798  7.638   1.00 0.00 ? 17 LEU A C    15 
ATOM   10799 O O    . LEU A 1 17 ? -11.680 -3.899  7.625   1.00 0.00 ? 17 LEU A O    15 
ATOM   10800 C CB   . LEU A 1 17 ? -10.678 -2.023  5.305   1.00 0.00 ? 17 LEU A CB   15 
ATOM   10801 C CG   . LEU A 1 17 ? -10.901 -1.007  4.184   1.00 0.00 ? 17 LEU A CG   15 
ATOM   10802 C CD1  . LEU A 1 17 ? -9.705  -0.969  3.244   1.00 0.00 ? 17 LEU A CD1  15 
ATOM   10803 C CD2  . LEU A 1 17 ? -12.178 -1.328  3.419   1.00 0.00 ? 17 LEU A CD2  15 
ATOM   10804 H H    . LEU A 1 17 ? -10.239 -0.100  7.038   1.00 0.00 ? 17 LEU A H    15 
ATOM   10805 H HA   . LEU A 1 17 ? -12.524 -1.799  6.359   1.00 0.00 ? 17 LEU A HA   15 
ATOM   10806 H HB2  . LEU A 1 17 ? -9.625  -2.027  5.555   1.00 0.00 ? 17 LEU A HB2  15 
ATOM   10807 H HB3  . LEU A 1 17 ? -10.951 -3.000  4.936   1.00 0.00 ? 17 LEU A HB3  15 
ATOM   10808 H HG   . LEU A 1 17 ? -11.012 -0.023  4.620   1.00 0.00 ? 17 LEU A HG   15 
ATOM   10809 H HD11 . LEU A 1 17 ? -10.001 -1.326  2.268   1.00 0.00 ? 17 LEU A HD11 15 
ATOM   10810 H HD12 . LEU A 1 17 ? -8.919  -1.598  3.634   1.00 0.00 ? 17 LEU A HD12 15 
ATOM   10811 H HD13 . LEU A 1 17 ? -9.344  0.046   3.162   1.00 0.00 ? 17 LEU A HD13 15 
ATOM   10812 H HD21 . LEU A 1 17 ? -12.000 -2.166  2.761   1.00 0.00 ? 17 LEU A HD21 15 
ATOM   10813 H HD22 . LEU A 1 17 ? -12.475 -0.470  2.837   1.00 0.00 ? 17 LEU A HD22 15 
ATOM   10814 H HD23 . LEU A 1 17 ? -12.962 -1.579  4.118   1.00 0.00 ? 17 LEU A HD23 15 
ATOM   10815 N N    . HIS A 1 18 ? -10.215 -2.460  8.548   1.00 0.00 ? 18 HIS A N    15 
ATOM   10816 C CA   . HIS A 1 18 ? -9.808  -3.388  9.594   1.00 0.00 ? 18 HIS A CA   15 
ATOM   10817 C C    . HIS A 1 18 ? -9.161  -4.620  8.983   1.00 0.00 ? 18 HIS A C    15 
ATOM   10818 O O    . HIS A 1 18 ? -9.525  -5.754  9.294   1.00 0.00 ? 18 HIS A O    15 
ATOM   10819 C CB   . HIS A 1 18 ? -11.006 -3.804  10.432  1.00 0.00 ? 18 HIS A CB   15 
ATOM   10820 C CG   . HIS A 1 18 ? -11.791 -2.652  10.976  1.00 0.00 ? 18 HIS A CG   15 
ATOM   10821 N ND1  . HIS A 1 18 ? -11.260 -1.722  11.846  1.00 0.00 ? 18 HIS A ND1  15 
ATOM   10822 C CD2  . HIS A 1 18 ? -13.077 -2.279  10.769  1.00 0.00 ? 18 HIS A CD2  15 
ATOM   10823 C CE1  . HIS A 1 18 ? -12.186 -0.828  12.150  1.00 0.00 ? 18 HIS A CE1  15 
ATOM   10824 N NE2  . HIS A 1 18 ? -13.295 -1.143  11.509  1.00 0.00 ? 18 HIS A NE2  15 
ATOM   10825 H H    . HIS A 1 18 ? -9.799  -1.572  8.510   1.00 0.00 ? 18 HIS A H    15 
ATOM   10826 H HA   . HIS A 1 18 ? -9.088  -2.888  10.225  1.00 0.00 ? 18 HIS A HA   15 
ATOM   10827 H HB2  . HIS A 1 18 ? -11.664 -4.398  9.819   1.00 0.00 ? 18 HIS A HB2  15 
ATOM   10828 H HB3  . HIS A 1 18 ? -10.660 -4.398  11.262  1.00 0.00 ? 18 HIS A HB3  15 
ATOM   10829 H HD1  . HIS A 1 18 ? -10.344 -1.719  12.190  1.00 0.00 ? 18 HIS A HD1  15 
ATOM   10830 H HD2  . HIS A 1 18 ? -13.797 -2.781  10.137  1.00 0.00 ? 18 HIS A HD2  15 
ATOM   10831 H HE1  . HIS A 1 18 ? -12.054 0.017   12.809  1.00 0.00 ? 18 HIS A HE1  15 
ATOM   10832 H HE2  . HIS A 1 18 ? -14.113 -0.602  11.495  1.00 0.00 ? 18 HIS A HE2  15 
ATOM   10833 N N    . ALA A 1 19 ? -8.206  -4.381  8.104   1.00 0.00 ? 19 ALA A N    15 
ATOM   10834 C CA   . ALA A 1 19 ? -7.503  -5.450  7.426   1.00 0.00 ? 19 ALA A CA   15 
ATOM   10835 C C    . ALA A 1 19 ? -6.290  -4.929  6.694   1.00 0.00 ? 19 ALA A C    15 
ATOM   10836 O O    . ALA A 1 19 ? -6.395  -4.024  5.866   1.00 0.00 ? 19 ALA A O    15 
ATOM   10837 C CB   . ALA A 1 19 ? -8.408  -6.131  6.418   1.00 0.00 ? 19 ALA A CB   15 
ATOM   10838 H H    . ALA A 1 19 ? -7.972  -3.459  7.902   1.00 0.00 ? 19 ALA A H    15 
ATOM   10839 H HA   . ALA A 1 19 ? -7.196  -6.181  8.159   1.00 0.00 ? 19 ALA A HA   15 
ATOM   10840 H HB1  . ALA A 1 19 ? -8.442  -7.190  6.622   1.00 0.00 ? 19 ALA A HB1  15 
ATOM   10841 H HB2  . ALA A 1 19 ? -8.009  -5.967  5.421   1.00 0.00 ? 19 ALA A HB2  15 
ATOM   10842 H HB3  . ALA A 1 19 ? -9.400  -5.714  6.483   1.00 0.00 ? 19 ALA A HB3  15 
ATOM   10843 N N    . CYS A 1 20 ? -5.149  -5.522  6.966   1.00 0.00 ? 20 CYS A N    15 
ATOM   10844 C CA   . CYS A 1 20 ? -3.949  -5.124  6.272   1.00 0.00 ? 20 CYS A CA   15 
ATOM   10845 C C    . CYS A 1 20 ? -4.036  -5.602  4.832   1.00 0.00 ? 20 CYS A C    15 
ATOM   10846 O O    . CYS A 1 20 ? -4.023  -6.800  4.546   1.00 0.00 ? 20 CYS A O    15 
ATOM   10847 C CB   . CYS A 1 20 ? -2.687  -5.650  6.932   1.00 0.00 ? 20 CYS A CB   15 
ATOM   10848 S SG   . CYS A 1 20 ? -1.463  -4.349  7.289   1.00 0.00 ? 20 CYS A SG   15 
ATOM   10849 H H    . CYS A 1 20 ? -5.130  -6.248  7.615   1.00 0.00 ? 20 CYS A H    15 
ATOM   10850 H HA   . CYS A 1 20 ? -3.930  -4.047  6.273   1.00 0.00 ? 20 CYS A HA   15 
ATOM   10851 H HB2  . CYS A 1 20 ? -2.944  -6.134  7.860   1.00 0.00 ? 20 CYS A HB2  15 
ATOM   10852 H HB3  . CYS A 1 20 ? -2.225  -6.361  6.269   1.00 0.00 ? 20 CYS A HB3  15 
ATOM   10853 N N    . ILE A 1 21 ? -4.175  -4.641  3.952   1.00 0.00 ? 21 ILE A N    15 
ATOM   10854 C CA   . ILE A 1 21 ? -4.330  -4.877  2.527   1.00 0.00 ? 21 ILE A CA   15 
ATOM   10855 C C    . ILE A 1 21 ? -3.173  -4.286  1.746   1.00 0.00 ? 21 ILE A C    15 
ATOM   10856 O O    . ILE A 1 21 ? -2.647  -3.250  2.122   1.00 0.00 ? 21 ILE A O    15 
ATOM   10857 C CB   . ILE A 1 21 ? -5.612  -4.174  2.067   1.00 0.00 ? 21 ILE A CB   15 
ATOM   10858 C CG1  . ILE A 1 21 ? -6.817  -4.722  2.832   1.00 0.00 ? 21 ILE A CG1  15 
ATOM   10859 C CG2  . ILE A 1 21 ? -5.830  -4.292  0.563   1.00 0.00 ? 21 ILE A CG2  15 
ATOM   10860 C CD1  . ILE A 1 21 ? -7.999  -3.778  2.865   1.00 0.00 ? 21 ILE A CD1  15 
ATOM   10861 H H    . ILE A 1 21 ? -4.211  -3.728  4.278   1.00 0.00 ? 21 ILE A H    15 
ATOM   10862 H HA   . ILE A 1 21 ? -4.413  -5.934  2.342   1.00 0.00 ? 21 ILE A HA   15 
ATOM   10863 H HB   . ILE A 1 21 ? -5.485  -3.127  2.308   1.00 0.00 ? 21 ILE A HB   15 
ATOM   10864 H HG12 . ILE A 1 21 ? -7.142  -5.640  2.368   1.00 0.00 ? 21 ILE A HG12 15 
ATOM   10865 H HG13 . ILE A 1 21 ? -6.525  -4.925  3.852   1.00 0.00 ? 21 ILE A HG13 15 
ATOM   10866 H HG21 . ILE A 1 21 ? -6.541  -3.545  0.246   1.00 0.00 ? 21 ILE A HG21 15 
ATOM   10867 H HG22 . ILE A 1 21 ? -6.216  -5.273  0.330   1.00 0.00 ? 21 ILE A HG22 15 
ATOM   10868 H HG23 . ILE A 1 21 ? -4.895  -4.137  0.045   1.00 0.00 ? 21 ILE A HG23 15 
ATOM   10869 H HD11 . ILE A 1 21 ? -8.862  -4.268  2.439   1.00 0.00 ? 21 ILE A HD11 15 
ATOM   10870 H HD12 . ILE A 1 21 ? -7.768  -2.891  2.294   1.00 0.00 ? 21 ILE A HD12 15 
ATOM   10871 H HD13 . ILE A 1 21 ? -8.211  -3.503  3.888   1.00 0.00 ? 21 ILE A HD13 15 
ATOM   10872 N N    . PRO A 1 22 ? -2.763  -4.911  0.635   1.00 0.00 ? 22 PRO A N    15 
ATOM   10873 C CA   . PRO A 1 22 ? -1.675  -4.377  -0.176  1.00 0.00 ? 22 PRO A CA   15 
ATOM   10874 C C    . PRO A 1 22 ? -1.994  -2.975  -0.697  1.00 0.00 ? 22 PRO A C    15 
ATOM   10875 O O    . PRO A 1 22 ? -3.063  -2.740  -1.261  1.00 0.00 ? 22 PRO A O    15 
ATOM   10876 C CB   . PRO A 1 22 ? -1.550  -5.372  -1.335  1.00 0.00 ? 22 PRO A CB   15 
ATOM   10877 C CG   . PRO A 1 22 ? -2.850  -6.103  -1.359  1.00 0.00 ? 22 PRO A CG   15 
ATOM   10878 C CD   . PRO A 1 22 ? -3.306  -6.161  0.076   1.00 0.00 ? 22 PRO A CD   15 
ATOM   10879 H HA   . PRO A 1 22 ? -0.761  -4.348  0.385   1.00 0.00 ? 22 PRO A HA   15 
ATOM   10880 H HB2  . PRO A 1 22 ? -1.381  -4.834  -2.257  1.00 0.00 ? 22 PRO A HB2  15 
ATOM   10881 H HB3  . PRO A 1 22 ? -0.724  -6.042  -1.149  1.00 0.00 ? 22 PRO A HB3  15 
ATOM   10882 H HG2  . PRO A 1 22 ? -3.565  -5.560  -1.962  1.00 0.00 ? 22 PRO A HG2  15 
ATOM   10883 H HG3  . PRO A 1 22 ? -2.706  -7.100  -1.751  1.00 0.00 ? 22 PRO A HG3  15 
ATOM   10884 H HD2  . PRO A 1 22 ? -4.382  -6.188  0.137   1.00 0.00 ? 22 PRO A HD2  15 
ATOM   10885 H HD3  . PRO A 1 22 ? -2.879  -7.020  0.576   1.00 0.00 ? 22 PRO A HD3  15 
ATOM   10886 N N    . CYS A 1 23 ? -1.061  -2.048  -0.499  1.00 0.00 ? 23 CYS A N    15 
ATOM   10887 C CA   . CYS A 1 23 ? -1.240  -0.660  -0.939  1.00 0.00 ? 23 CYS A CA   15 
ATOM   10888 C C    . CYS A 1 23 ? -1.209  -0.552  -2.462  1.00 0.00 ? 23 CYS A C    15 
ATOM   10889 O O    . CYS A 1 23 ? -1.885  0.293   -3.046  1.00 0.00 ? 23 CYS A O    15 
ATOM   10890 C CB   . CYS A 1 23 ? -0.150  0.247   -0.350  1.00 0.00 ? 23 CYS A CB   15 
ATOM   10891 S SG   . CYS A 1 23 ? 0.408   -0.213  1.323   1.00 0.00 ? 23 CYS A SG   15 
ATOM   10892 H H    . CYS A 1 23 ? -0.234  -2.304  -0.042  1.00 0.00 ? 23 CYS A H    15 
ATOM   10893 H HA   . CYS A 1 23 ? -2.205  -0.317  -0.583  1.00 0.00 ? 23 CYS A HA   15 
ATOM   10894 H HB2  . CYS A 1 23 ? 0.713   0.226   -0.999  1.00 0.00 ? 23 CYS A HB2  15 
ATOM   10895 H HB3  . CYS A 1 23 ? -0.527  1.259   -0.302  1.00 0.00 ? 23 CYS A HB3  15 
ATOM   10896 N N    . GLN A 1 24 ? -0.401  -1.403  -3.095  1.00 0.00 ? 24 GLN A N    15 
ATOM   10897 C CA   . GLN A 1 24 ? -0.251  -1.403  -4.557  1.00 0.00 ? 24 GLN A CA   15 
ATOM   10898 C C    . GLN A 1 24 ? -1.587  -1.229  -5.266  1.00 0.00 ? 24 GLN A C    15 
ATOM   10899 O O    . GLN A 1 24 ? -1.754  -0.336  -6.097  1.00 0.00 ? 24 GLN A O    15 
ATOM   10900 C CB   . GLN A 1 24 ? 0.412   -2.699  -5.043  1.00 0.00 ? 24 GLN A CB   15 
ATOM   10901 C CG   . GLN A 1 24 ? 1.314   -3.366  -4.017  1.00 0.00 ? 24 GLN A CG   15 
ATOM   10902 C CD   . GLN A 1 24 ? 2.199   -4.436  -4.625  1.00 0.00 ? 24 GLN A CD   15 
ATOM   10903 O OE1  . GLN A 1 24 ? 2.214   -5.579  -4.169  1.00 0.00 ? 24 GLN A OE1  15 
ATOM   10904 N NE2  . GLN A 1 24 ? 2.945   -4.069  -5.661  1.00 0.00 ? 24 GLN A NE2  15 
ATOM   10905 H H    . GLN A 1 24 ? 0.119   -2.038  -2.563  1.00 0.00 ? 24 GLN A H    15 
ATOM   10906 H HA   . GLN A 1 24 ? 0.377   -0.575  -4.816  1.00 0.00 ? 24 GLN A HA   15 
ATOM   10907 H HB2  . GLN A 1 24 ? -0.361  -3.401  -5.317  1.00 0.00 ? 24 GLN A HB2  15 
ATOM   10908 H HB3  . GLN A 1 24 ? 1.005   -2.476  -5.918  1.00 0.00 ? 24 GLN A HB3  15 
ATOM   10909 H HG2  . GLN A 1 24 ? 1.943   -2.613  -3.565  1.00 0.00 ? 24 GLN A HG2  15 
ATOM   10910 H HG3  . GLN A 1 24 ? 0.694   -3.819  -3.257  1.00 0.00 ? 24 GLN A HG3  15 
ATOM   10911 H HE21 . GLN A 1 24 ? 2.882   -3.141  -5.971  1.00 0.00 ? 24 GLN A HE21 15 
ATOM   10912 H HE22 . GLN A 1 24 ? 3.527   -4.740  -6.073  1.00 0.00 ? 24 GLN A HE22 15 
ATOM   10913 N N    . LEU A 1 25 ? -2.519  -2.101  -4.941  1.00 0.00 ? 25 LEU A N    15 
ATOM   10914 C CA   . LEU A 1 25 ? -3.846  -2.079  -5.545  1.00 0.00 ? 25 LEU A CA   15 
ATOM   10915 C C    . LEU A 1 25 ? -4.619  -0.804  -5.201  1.00 0.00 ? 25 LEU A C    15 
ATOM   10916 O O    . LEU A 1 25 ? -5.704  -0.572  -5.734  1.00 0.00 ? 25 LEU A O    15 
ATOM   10917 C CB   . LEU A 1 25 ? -4.647  -3.304  -5.099  1.00 0.00 ? 25 LEU A CB   15 
ATOM   10918 C CG   . LEU A 1 25 ? -4.400  -4.572  -5.915  1.00 0.00 ? 25 LEU A CG   15 
ATOM   10919 C CD1  . LEU A 1 25 ? -4.589  -5.809  -5.050  1.00 0.00 ? 25 LEU A CD1  15 
ATOM   10920 C CD2  . LEU A 1 25 ? -5.324  -4.617  -7.122  1.00 0.00 ? 25 LEU A CD2  15 
ATOM   10921 H H    . LEU A 1 25 ? -2.304  -2.788  -4.284  1.00 0.00 ? 25 LEU A H    15 
ATOM   10922 H HA   . LEU A 1 25 ? -3.714  -2.125  -6.611  1.00 0.00 ? 25 LEU A HA   15 
ATOM   10923 H HB2  . LEU A 1 25 ? -4.403  -3.510  -4.067  1.00 0.00 ? 25 LEU A HB2  15 
ATOM   10924 H HB3  . LEU A 1 25 ? -5.697  -3.062  -5.162  1.00 0.00 ? 25 LEU A HB3  15 
ATOM   10925 H HG   . LEU A 1 25 ? -3.380  -4.569  -6.273  1.00 0.00 ? 25 LEU A HG   15 
ATOM   10926 H HD11 . LEU A 1 25 ? -3.866  -6.560  -5.332  1.00 0.00 ? 25 LEU A HD11 15 
ATOM   10927 H HD12 . LEU A 1 25 ? -5.586  -6.197  -5.191  1.00 0.00 ? 25 LEU A HD12 15 
ATOM   10928 H HD13 . LEU A 1 25 ? -4.449  -5.547  -4.012  1.00 0.00 ? 25 LEU A HD13 15 
ATOM   10929 H HD21 . LEU A 1 25 ? -5.483  -5.645  -7.416  1.00 0.00 ? 25 LEU A HD21 15 
ATOM   10930 H HD22 . LEU A 1 25 ? -4.874  -4.076  -7.942  1.00 0.00 ? 25 LEU A HD22 15 
ATOM   10931 H HD23 . LEU A 1 25 ? -6.271  -4.165  -6.868  1.00 0.00 ? 25 LEU A HD23 15 
ATOM   10932 N N    . ARG A 1 26 ? -4.075  0.012   -4.302  1.00 0.00 ? 26 ARG A N    15 
ATOM   10933 C CA   . ARG A 1 26 ? -4.744  1.244   -3.896  1.00 0.00 ? 26 ARG A CA   15 
ATOM   10934 C C    . ARG A 1 26 ? -3.854  2.472   -4.038  1.00 0.00 ? 26 ARG A C    15 
ATOM   10935 O O    . ARG A 1 26 ? -4.254  3.584   -3.691  1.00 0.00 ? 26 ARG A O    15 
ATOM   10936 C CB   . ARG A 1 26 ? -5.217  1.122   -2.457  1.00 0.00 ? 26 ARG A CB   15 
ATOM   10937 C CG   . ARG A 1 26 ? -5.978  -0.166  -2.181  1.00 0.00 ? 26 ARG A CG   15 
ATOM   10938 C CD   . ARG A 1 26 ? -7.428  0.108   -1.810  1.00 0.00 ? 26 ARG A CD   15 
ATOM   10939 N NE   . ARG A 1 26 ? -8.326  -0.131  -2.937  1.00 0.00 ? 26 ARG A NE   15 
ATOM   10940 C CZ   . ARG A 1 26 ? -9.580  0.313   -2.995  1.00 0.00 ? 26 ARG A CZ   15 
ATOM   10941 N NH1  . ARG A 1 26 ? -10.088 1.019   -1.993  1.00 0.00 ? 26 ARG A NH1  15 
ATOM   10942 N NH2  . ARG A 1 26 ? -10.326 0.049   -4.058  1.00 0.00 ? 26 ARG A NH2  15 
ATOM   10943 H H    . ARG A 1 26 ? -3.219  -0.222  -3.897  1.00 0.00 ? 26 ARG A H    15 
ATOM   10944 H HA   . ARG A 1 26 ? -5.593  1.368   -4.533  1.00 0.00 ? 26 ARG A HA   15 
ATOM   10945 H HB2  . ARG A 1 26 ? -4.351  1.155   -1.812  1.00 0.00 ? 26 ARG A HB2  15 
ATOM   10946 H HB3  . ARG A 1 26 ? -5.860  1.958   -2.229  1.00 0.00 ? 26 ARG A HB3  15 
ATOM   10947 H HG2  . ARG A 1 26 ? -5.957  -0.780  -3.068  1.00 0.00 ? 26 ARG A HG2  15 
ATOM   10948 H HG3  . ARG A 1 26 ? -5.499  -0.690  -1.368  1.00 0.00 ? 26 ARG A HG3  15 
ATOM   10949 H HD2  . ARG A 1 26 ? -7.697  -0.538  -0.987  1.00 0.00 ? 26 ARG A HD2  15 
ATOM   10950 H HD3  . ARG A 1 26 ? -7.511  1.137   -1.493  1.00 0.00 ? 26 ARG A HD3  15 
ATOM   10951 H HE   . ARG A 1 26 ? -7.976  -0.649  -3.691  1.00 0.00 ? 26 ARG A HE   15 
ATOM   10952 H HH11 . ARG A 1 26 ? -9.531  1.222   -1.189  1.00 0.00 ? 26 ARG A HH11 15 
ATOM   10953 H HH12 . ARG A 1 26 ? -11.031 1.349   -2.043  1.00 0.00 ? 26 ARG A HH12 15 
ATOM   10954 H HH21 . ARG A 1 26 ? -9.948  -0.483  -4.816  1.00 0.00 ? 26 ARG A HH21 15 
ATOM   10955 H HH22 . ARG A 1 26 ? -11.269 0.381   -4.103  1.00 0.00 ? 26 ARG A HH22 15 
ATOM   10956 N N    . CYS A 1 27 ? -2.657  2.266   -4.544  1.00 0.00 ? 27 CYS A N    15 
ATOM   10957 C CA   . CYS A 1 27 ? -1.699  3.354   -4.742  1.00 0.00 ? 27 CYS A CA   15 
ATOM   10958 C C    . CYS A 1 27 ? -2.148  4.285   -5.873  1.00 0.00 ? 27 CYS A C    15 
ATOM   10959 O O    . CYS A 1 27 ? -1.405  4.523   -6.825  1.00 0.00 ? 27 CYS A O    15 
ATOM   10960 C CB   . CYS A 1 27 ? -0.311  2.788   -5.053  1.00 0.00 ? 27 CYS A CB   15 
ATOM   10961 S SG   . CYS A 1 27 ? 0.440   1.858   -3.677  1.00 0.00 ? 27 CYS A SG   15 
ATOM   10962 H H    . CYS A 1 27 ? -2.410  1.360   -4.790  1.00 0.00 ? 27 CYS A H    15 
ATOM   10963 H HA   . CYS A 1 27 ? -1.647  3.921   -3.827  1.00 0.00 ? 27 CYS A HA   15 
ATOM   10964 H HB2  . CYS A 1 27 ? -0.384  2.121   -5.899  1.00 0.00 ? 27 CYS A HB2  15 
ATOM   10965 H HB3  . CYS A 1 27 ? 0.354   3.603   -5.301  1.00 0.00 ? 27 CYS A HB3  15 
ATOM   10966 N N    . SER A 1 28 ? -3.371  4.800   -5.765  1.00 0.00 ? 28 SER A N    15 
ATOM   10967 C CA   . SER A 1 28 ? -3.924  5.677   -6.758  1.00 0.00 ? 28 SER A CA   15 
ATOM   10968 C C    . SER A 1 28 ? -5.246  6.276   -6.276  1.00 0.00 ? 28 SER A C    15 
ATOM   10969 O O    . SER A 1 28 ? -6.312  5.940   -6.790  1.00 0.00 ? 28 SER A O    15 
ATOM   10970 C CB   . SER A 1 28 ? -4.139  4.888   -8.034  1.00 0.00 ? 28 SER A CB   15 
ATOM   10971 O OG   . SER A 1 28 ? -3.094  5.114   -8.964  1.00 0.00 ? 28 SER A OG   15 
ATOM   10972 H H    . SER A 1 28 ? -3.914  4.579   -5.015  1.00 0.00 ? 28 SER A H    15 
ATOM   10973 H HA   . SER A 1 28 ? -3.218  6.454   -6.929  1.00 0.00 ? 28 SER A HA   15 
ATOM   10974 H HB2  . SER A 1 28 ? -4.162  3.840   -7.777  1.00 0.00 ? 28 SER A HB2  15 
ATOM   10975 H HB3  . SER A 1 28 ? -5.079  5.173   -8.480  1.00 0.00 ? 28 SER A HB3  15 
ATOM   10976 H HG   . SER A 1 28 ? -3.469  5.357   -9.814  1.00 0.00 ? 28 SER A HG   15 
ATOM   10977 N N    . SER A 1 29 ? -5.173  7.157   -5.279  1.00 0.00 ? 29 SER A N    15 
ATOM   10978 C CA   . SER A 1 29 ? -6.364  7.789   -4.726  1.00 0.00 ? 29 SER A CA   15 
ATOM   10979 C C    . SER A 1 29 ? -7.214  6.774   -3.980  1.00 0.00 ? 29 SER A C    15 
ATOM   10980 O O    . SER A 1 29 ? -7.198  5.583   -4.294  1.00 0.00 ? 29 SER A O    15 
ATOM   10981 C CB   . SER A 1 29 ? -7.176  8.452   -5.832  1.00 0.00 ? 29 SER A CB   15 
ATOM   10982 O OG   . SER A 1 29 ? -8.118  7.554   -6.396  1.00 0.00 ? 29 SER A OG   15 
ATOM   10983 H H    . SER A 1 29 ? -4.302  7.382   -4.904  1.00 0.00 ? 29 SER A H    15 
ATOM   10984 H HA   . SER A 1 29 ? -6.049  8.552   -4.023  1.00 0.00 ? 29 SER A HA   15 
ATOM   10985 H HB2  . SER A 1 29 ? -7.705  9.300   -5.423  1.00 0.00 ? 29 SER A HB2  15 
ATOM   10986 H HB3  . SER A 1 29 ? -6.502  8.785   -6.606  1.00 0.00 ? 29 SER A HB3  15 
ATOM   10987 H HG   . SER A 1 29 ? -8.866  7.461   -5.802  1.00 0.00 ? 29 SER A HG   15 
ATOM   10988 N N    . ASN A 1 30 ? -7.932  7.258   -2.975  1.00 0.00 ? 30 ASN A N    15 
ATOM   10989 C CA   . ASN A 1 30 ? -8.783  6.414   -2.139  1.00 0.00 ? 30 ASN A CA   15 
ATOM   10990 C C    . ASN A 1 30 ? -7.959  5.841   -0.999  1.00 0.00 ? 30 ASN A C    15 
ATOM   10991 O O    . ASN A 1 30 ? -7.551  4.681   -1.032  1.00 0.00 ? 30 ASN A O    15 
ATOM   10992 C CB   . ASN A 1 30 ? -9.428  5.284   -2.950  1.00 0.00 ? 30 ASN A CB   15 
ATOM   10993 C CG   . ASN A 1 30 ? -10.804 4.912   -2.430  1.00 0.00 ? 30 ASN A CG   15 
ATOM   10994 O OD1  . ASN A 1 30 ? -11.049 3.766   -2.055  1.00 0.00 ? 30 ASN A OD1  15 
ATOM   10995 N ND2  . ASN A 1 30 ? -11.710 5.882   -2.404  1.00 0.00 ? 30 ASN A ND2  15 
ATOM   10996 H H    . ASN A 1 30 ? -7.869  8.214   -2.774  1.00 0.00 ? 30 ASN A H    15 
ATOM   10997 H HA   . ASN A 1 30 ? -9.562  7.040   -1.724  1.00 0.00 ? 30 ASN A HA   15 
ATOM   10998 H HB2  . ASN A 1 30 ? -9.526  5.597   -3.978  1.00 0.00 ? 30 ASN A HB2  15 
ATOM   10999 H HB3  . ASN A 1 30 ? -8.797  4.409   -2.902  1.00 0.00 ? 30 ASN A HB3  15 
ATOM   11000 H HD21 . ASN A 1 30 ? -11.443 6.773   -2.718  1.00 0.00 ? 30 ASN A HD21 15 
ATOM   11001 H HD22 . ASN A 1 30 ? -12.606 5.670   -2.072  1.00 0.00 ? 30 ASN A HD22 15 
ATOM   11002 N N    . THR A 1 31 ? -7.706  6.681   0.002   1.00 0.00 ? 31 THR A N    15 
ATOM   11003 C CA   . THR A 1 31 ? -6.915  6.306   1.162   1.00 0.00 ? 31 THR A CA   15 
ATOM   11004 C C    . THR A 1 31 ? -5.422  6.417   0.830   1.00 0.00 ? 31 THR A C    15 
ATOM   11005 O O    . THR A 1 31 ? -4.891  5.614   0.061   1.00 0.00 ? 31 THR A O    15 
ATOM   11006 C CB   . THR A 1 31 ? -7.307  4.900   1.632   1.00 0.00 ? 31 THR A CB   15 
ATOM   11007 O OG1  . THR A 1 31 ? -7.567  4.895   3.024   1.00 0.00 ? 31 THR A OG1  15 
ATOM   11008 C CG2  . THR A 1 31 ? -6.279  3.820   1.356   1.00 0.00 ? 31 THR A CG2  15 
ATOM   11009 H H    . THR A 1 31 ? -8.053  7.587   -0.052  1.00 0.00 ? 31 THR A H    15 
ATOM   11010 H HA   . THR A 1 31 ? -7.152  7.005   1.943   1.00 0.00 ? 31 THR A HA   15 
ATOM   11011 H HB   . THR A 1 31 ? -8.218  4.631   1.118   1.00 0.00 ? 31 THR A HB   15 
ATOM   11012 H HG1  . THR A 1 31 ? -6.818  5.273   3.491   1.00 0.00 ? 31 THR A HG1  15 
ATOM   11013 H HG21 . THR A 1 31 ? -6.097  3.755   0.294   1.00 0.00 ? 31 THR A HG21 15 
ATOM   11014 H HG22 . THR A 1 31 ? -6.649  2.871   1.717   1.00 0.00 ? 31 THR A HG22 15 
ATOM   11015 H HG23 . THR A 1 31 ? -5.357  4.063   1.864   1.00 0.00 ? 31 THR A HG23 15 
ATOM   11016 N N    . PRO A 1 32 ? -4.724  7.443   1.363   1.00 0.00 ? 32 PRO A N    15 
ATOM   11017 C CA   . PRO A 1 32 ? -3.303  7.651   1.066   1.00 0.00 ? 32 PRO A CA   15 
ATOM   11018 C C    . PRO A 1 32 ? -2.389  6.639   1.752   1.00 0.00 ? 32 PRO A C    15 
ATOM   11019 O O    . PRO A 1 32 ? -2.674  6.167   2.853   1.00 0.00 ? 32 PRO A O    15 
ATOM   11020 C CB   . PRO A 1 32 ? -3.029  9.065   1.583   1.00 0.00 ? 32 PRO A CB   15 
ATOM   11021 C CG   . PRO A 1 32 ? -4.017  9.266   2.674   1.00 0.00 ? 32 PRO A CG   15 
ATOM   11022 C CD   . PRO A 1 32 ? -5.263  8.497   2.252   1.00 0.00 ? 32 PRO A CD   15 
ATOM   11023 H HA   . PRO A 1 32 ? -3.125  7.620   0.003   1.00 0.00 ? 32 PRO A HA   15 
ATOM   11024 H HB2  . PRO A 1 32 ? -2.014  9.125   1.951   1.00 0.00 ? 32 PRO A HB2  15 
ATOM   11025 H HB3  . PRO A 1 32 ? -3.171  9.777   0.784   1.00 0.00 ? 32 PRO A HB3  15 
ATOM   11026 H HG2  . PRO A 1 32 ? -3.612  8.872   3.601   1.00 0.00 ? 32 PRO A HG2  15 
ATOM   11027 H HG3  . PRO A 1 32 ? -4.233  10.323  2.781   1.00 0.00 ? 32 PRO A HG3  15 
ATOM   11028 H HD2  . PRO A 1 32 ? -5.754  8.060   3.114   1.00 0.00 ? 32 PRO A HD2  15 
ATOM   11029 H HD3  . PRO A 1 32 ? -5.954  9.136   1.707   1.00 0.00 ? 32 PRO A HD3  15 
ATOM   11030 N N    . PRO A 1 33 ? -1.267  6.296   1.093   1.00 0.00 ? 33 PRO A N    15 
ATOM   11031 C CA   . PRO A 1 33 ? -0.288  5.342   1.611   1.00 0.00 ? 33 PRO A CA   15 
ATOM   11032 C C    . PRO A 1 33 ? 0.738   5.991   2.519   1.00 0.00 ? 33 PRO A C    15 
ATOM   11033 O O    . PRO A 1 33 ? 1.827   6.351   2.082   1.00 0.00 ? 33 PRO A O    15 
ATOM   11034 C CB   . PRO A 1 33 ? 0.372   4.833   0.335   1.00 0.00 ? 33 PRO A CB   15 
ATOM   11035 C CG   . PRO A 1 33 ? 0.363   6.012   -0.578  1.00 0.00 ? 33 PRO A CG   15 
ATOM   11036 C CD   . PRO A 1 33 ? -0.862  6.819   -0.228  1.00 0.00 ? 33 PRO A CD   15 
ATOM   11037 H HA   . PRO A 1 33 ? -0.748  4.523   2.133   1.00 0.00 ? 33 PRO A HA   15 
ATOM   11038 H HB2  . PRO A 1 33 ? 1.377   4.504   0.552   1.00 0.00 ? 33 PRO A HB2  15 
ATOM   11039 H HB3  . PRO A 1 33 ? -0.203  4.015   -0.072  1.00 0.00 ? 33 PRO A HB3  15 
ATOM   11040 H HG2  . PRO A 1 33 ? 1.253   6.601   -0.422  1.00 0.00 ? 33 PRO A HG2  15 
ATOM   11041 H HG3  . PRO A 1 33 ? 0.310   5.683   -1.605  1.00 0.00 ? 33 PRO A HG3  15 
ATOM   11042 H HD2  . PRO A 1 33 ? -0.615  7.868   -0.165  1.00 0.00 ? 33 PRO A HD2  15 
ATOM   11043 H HD3  . PRO A 1 33 ? -1.639  6.658   -0.960  1.00 0.00 ? 33 PRO A HD3  15 
ATOM   11044 N N    . LEU A 1 34 ? 0.392   6.139   3.788   1.00 0.00 ? 34 LEU A N    15 
ATOM   11045 C CA   . LEU A 1 34 ? 1.320   6.741   4.733   1.00 0.00 ? 34 LEU A CA   15 
ATOM   11046 C C    . LEU A 1 34 ? 2.527   5.833   4.938   1.00 0.00 ? 34 LEU A C    15 
ATOM   11047 O O    . LEU A 1 34 ? 3.669   6.288   4.855   1.00 0.00 ? 34 LEU A O    15 
ATOM   11048 C CB   . LEU A 1 34 ? 0.639   7.082   6.067   1.00 0.00 ? 34 LEU A CB   15 
ATOM   11049 C CG   . LEU A 1 34 ? -0.717  7.782   5.950   1.00 0.00 ? 34 LEU A CG   15 
ATOM   11050 C CD1  . LEU A 1 34 ? -1.242  8.162   7.327   1.00 0.00 ? 34 LEU A CD1  15 
ATOM   11051 C CD2  . LEU A 1 34 ? -0.609  9.013   5.062   1.00 0.00 ? 34 LEU A CD2  15 
ATOM   11052 H H    . LEU A 1 34 ? -0.493  5.841   4.088   1.00 0.00 ? 34 LEU A H    15 
ATOM   11053 H HA   . LEU A 1 34 ? 1.677   7.645   4.277   1.00 0.00 ? 34 LEU A HA   15 
ATOM   11054 H HB2  . LEU A 1 34 ? 0.500   6.172   6.629   1.00 0.00 ? 34 LEU A HB2  15 
ATOM   11055 H HB3  . LEU A 1 34 ? 1.300   7.728   6.626   1.00 0.00 ? 34 LEU A HB3  15 
ATOM   11056 H HG   . LEU A 1 34 ? -1.428  7.105   5.500   1.00 0.00 ? 34 LEU A HG   15 
ATOM   11057 H HD11 . LEU A 1 34 ? -0.698  7.615   8.084   1.00 0.00 ? 34 LEU A HD11 15 
ATOM   11058 H HD12 . LEU A 1 34 ? -2.292  7.917   7.392   1.00 0.00 ? 34 LEU A HD12 15 
ATOM   11059 H HD13 . LEU A 1 34 ? -1.109  9.222   7.484   1.00 0.00 ? 34 LEU A HD13 15 
ATOM   11060 H HD21 . LEU A 1 34 ? 0.052   8.805   4.234   1.00 0.00 ? 34 LEU A HD21 15 
ATOM   11061 H HD22 . LEU A 1 34 ? -0.215  9.839   5.638   1.00 0.00 ? 34 LEU A HD22 15 
ATOM   11062 H HD23 . LEU A 1 34 ? -1.587  9.272   4.685   1.00 0.00 ? 34 LEU A HD23 15 
ATOM   11063 N N    . THR A 1 35 ? 2.289   4.545   5.167   1.00 0.00 ? 35 THR A N    15 
ATOM   11064 C CA   . THR A 1 35 ? 3.375   3.604   5.333   1.00 0.00 ? 35 THR A CA   15 
ATOM   11065 C C    . THR A 1 35 ? 3.774   3.022   3.978   1.00 0.00 ? 35 THR A C    15 
ATOM   11066 O O    . THR A 1 35 ? 4.642   2.152   3.903   1.00 0.00 ? 35 THR A O    15 
ATOM   11067 C CB   . THR A 1 35 ? 2.968   2.481   6.288   1.00 0.00 ? 35 THR A CB   15 
ATOM   11068 O OG1  . THR A 1 35 ? 4.055   1.604   6.525   1.00 0.00 ? 35 THR A OG1  15 
ATOM   11069 C CG2  . THR A 1 35 ? 1.811   1.649   5.777   1.00 0.00 ? 35 THR A CG2  15 
ATOM   11070 H H    . THR A 1 35 ? 1.371   4.214   5.202   1.00 0.00 ? 35 THR A H    15 
ATOM   11071 H HA   . THR A 1 35 ? 4.215   4.136   5.750   1.00 0.00 ? 35 THR A HA   15 
ATOM   11072 H HB   . THR A 1 35 ? 2.671   2.915   7.232   1.00 0.00 ? 35 THR A HB   15 
ATOM   11073 H HG1  . THR A 1 35 ? 3.836   1.008   7.244   1.00 0.00 ? 35 THR A HG1  15 
ATOM   11074 H HG21 . THR A 1 35 ? 1.815   0.687   6.267   1.00 0.00 ? 35 THR A HG21 15 
ATOM   11075 H HG22 . THR A 1 35 ? 1.912   1.510   4.710   1.00 0.00 ? 35 THR A HG22 15 
ATOM   11076 H HG23 . THR A 1 35 ? 0.881   2.157   5.988   1.00 0.00 ? 35 THR A HG23 15 
ATOM   11077 N N    . CYS A 1 36 ? 3.128   3.492   2.901   1.00 0.00 ? 36 CYS A N    15 
ATOM   11078 C CA   . CYS A 1 36 ? 3.432   2.985   1.569   1.00 0.00 ? 36 CYS A CA   15 
ATOM   11079 C C    . CYS A 1 36 ? 3.790   4.098   0.582   1.00 0.00 ? 36 CYS A C    15 
ATOM   11080 O O    . CYS A 1 36 ? 4.153   3.820   -0.560  1.00 0.00 ? 36 CYS A O    15 
ATOM   11081 C CB   . CYS A 1 36 ? 2.246   2.181   1.032   1.00 0.00 ? 36 CYS A CB   15 
ATOM   11082 S SG   . CYS A 1 36 ? 2.345   0.394   1.372   1.00 0.00 ? 36 CYS A SG   15 
ATOM   11083 H H    . CYS A 1 36 ? 2.429   4.182   3.007   1.00 0.00 ? 36 CYS A H    15 
ATOM   11084 H HA   . CYS A 1 36 ? 4.276   2.328   1.665   1.00 0.00 ? 36 CYS A HA   15 
ATOM   11085 H HB2  . CYS A 1 36 ? 1.338   2.550   1.481   1.00 0.00 ? 36 CYS A HB2  15 
ATOM   11086 H HB3  . CYS A 1 36 ? 2.190   2.309   -0.040  1.00 0.00 ? 36 CYS A HB3  15 
ATOM   11087 N N    . GLN A 1 37 ? 3.679   5.354   1.010   1.00 0.00 ? 37 GLN A N    15 
ATOM   11088 C CA   . GLN A 1 37 ? 3.979   6.492   0.139   1.00 0.00 ? 37 GLN A CA   15 
ATOM   11089 C C    . GLN A 1 37 ? 5.279   6.292   -0.632  1.00 0.00 ? 37 GLN A C    15 
ATOM   11090 O O    . GLN A 1 37 ? 5.441   6.809   -1.737  1.00 0.00 ? 37 GLN A O    15 
ATOM   11091 C CB   . GLN A 1 37 ? 4.048   7.784   0.959   1.00 0.00 ? 37 GLN A CB   15 
ATOM   11092 C CG   . GLN A 1 37 ? 2.916   8.756   0.666   1.00 0.00 ? 37 GLN A CG   15 
ATOM   11093 C CD   . GLN A 1 37 ? 2.587   9.641   1.851   1.00 0.00 ? 37 GLN A CD   15 
ATOM   11094 O OE1  . GLN A 1 37 ? 1.431   9.745   2.262   1.00 0.00 ? 37 GLN A OE1  15 
ATOM   11095 N NE2  . GLN A 1 37 ? 3.605   10.288  2.407   1.00 0.00 ? 37 GLN A NE2  15 
ATOM   11096 H H    . GLN A 1 37 ? 3.372   5.527   1.924   1.00 0.00 ? 37 GLN A H    15 
ATOM   11097 H HA   . GLN A 1 37 ? 3.176   6.572   -0.574  1.00 0.00 ? 37 GLN A HA   15 
ATOM   11098 H HB2  . GLN A 1 37 ? 4.013   7.531   2.009   1.00 0.00 ? 37 GLN A HB2  15 
ATOM   11099 H HB3  . GLN A 1 37 ? 4.983   8.283   0.750   1.00 0.00 ? 37 GLN A HB3  15 
ATOM   11100 H HG2  . GLN A 1 37 ? 3.203   9.382   -0.165  1.00 0.00 ? 37 GLN A HG2  15 
ATOM   11101 H HG3  . GLN A 1 37 ? 2.034   8.191   0.401   1.00 0.00 ? 37 GLN A HG3  15 
ATOM   11102 H HE21 . GLN A 1 37 ? 4.500   10.158  2.027   1.00 0.00 ? 37 GLN A HE21 15 
ATOM   11103 H HE22 . GLN A 1 37 ? 3.422   10.868  3.175   1.00 0.00 ? 37 GLN A HE22 15 
ATOM   11104 N N    . ARG A 1 38 ? 6.194   5.535   -0.051  1.00 0.00 ? 38 ARG A N    15 
ATOM   11105 C CA   . ARG A 1 38 ? 7.470   5.265   -0.691  1.00 0.00 ? 38 ARG A CA   15 
ATOM   11106 C C    . ARG A 1 38 ? 7.303   4.166   -1.739  1.00 0.00 ? 38 ARG A C    15 
ATOM   11107 O O    . ARG A 1 38 ? 7.842   4.260   -2.841  1.00 0.00 ? 38 ARG A O    15 
ATOM   11108 C CB   . ARG A 1 38 ? 8.509   4.879   0.376   1.00 0.00 ? 38 ARG A CB   15 
ATOM   11109 C CG   . ARG A 1 38 ? 9.522   3.830   -0.061  1.00 0.00 ? 38 ARG A CG   15 
ATOM   11110 C CD   . ARG A 1 38 ? 10.953  4.295   0.168   1.00 0.00 ? 38 ARG A CD   15 
ATOM   11111 N NE   . ARG A 1 38 ? 11.234  4.515   1.585   1.00 0.00 ? 38 ARG A NE   15 
ATOM   11112 C CZ   . ARG A 1 38 ? 11.255  5.715   2.167   1.00 0.00 ? 38 ARG A CZ   15 
ATOM   11113 N NH1  . ARG A 1 38 ? 10.990  6.812   1.467   1.00 0.00 ? 38 ARG A NH1  15 
ATOM   11114 N NH2  . ARG A 1 38 ? 11.539  5.816   3.458   1.00 0.00 ? 38 ARG A NH2  15 
ATOM   11115 H H    . ARG A 1 38 ? 6.008   5.144   0.824   1.00 0.00 ? 38 ARG A H    15 
ATOM   11116 H HA   . ARG A 1 38 ? 7.792   6.171   -1.184  1.00 0.00 ? 38 ARG A HA   15 
ATOM   11117 H HB2  . ARG A 1 38 ? 9.051   5.768   0.663   1.00 0.00 ? 38 ARG A HB2  15 
ATOM   11118 H HB3  . ARG A 1 38 ? 7.986   4.500   1.242   1.00 0.00 ? 38 ARG A HB3  15 
ATOM   11119 H HG2  . ARG A 1 38 ? 9.352   2.929   0.507   1.00 0.00 ? 38 ARG A HG2  15 
ATOM   11120 H HG3  . ARG A 1 38 ? 9.386   3.624   -1.110  1.00 0.00 ? 38 ARG A HG3  15 
ATOM   11121 H HD2  . ARG A 1 38 ? 11.620  3.539   -0.220  1.00 0.00 ? 38 ARG A HD2  15 
ATOM   11122 H HD3  . ARG A 1 38 ? 11.106  5.211   -0.381  1.00 0.00 ? 38 ARG A HD3  15 
ATOM   11123 H HE   . ARG A 1 38 ? 11.426  3.726   2.133   1.00 0.00 ? 38 ARG A HE   15 
ATOM   11124 H HH11 . ARG A 1 38 ? 10.771  6.747   0.495   1.00 0.00 ? 38 ARG A HH11 15 
ATOM   11125 H HH12 . ARG A 1 38 ? 11.010  7.705   1.915   1.00 0.00 ? 38 ARG A HH12 15 
ATOM   11126 H HH21 . ARG A 1 38 ? 11.737  4.995   3.993   1.00 0.00 ? 38 ARG A HH21 15 
ATOM   11127 H HH22 . ARG A 1 38 ? 11.557  6.714   3.896   1.00 0.00 ? 38 ARG A HH22 15 
ATOM   11128 N N    . TYR A 1 39 ? 6.553   3.128   -1.386  1.00 0.00 ? 39 TYR A N    15 
ATOM   11129 C CA   . TYR A 1 39 ? 6.321   2.008   -2.285  1.00 0.00 ? 39 TYR A CA   15 
ATOM   11130 C C    . TYR A 1 39 ? 5.315   2.350   -3.374  1.00 0.00 ? 39 TYR A C    15 
ATOM   11131 O O    . TYR A 1 39 ? 5.456   1.909   -4.515  1.00 0.00 ? 39 TYR A O    15 
ATOM   11132 C CB   . TYR A 1 39 ? 5.842   0.786   -1.500  1.00 0.00 ? 39 TYR A CB   15 
ATOM   11133 C CG   . TYR A 1 39 ? 5.827   -0.481  -2.320  1.00 0.00 ? 39 TYR A CG   15 
ATOM   11134 C CD1  . TYR A 1 39 ? 4.842   -0.696  -3.277  1.00 0.00 ? 39 TYR A CD1  15 
ATOM   11135 C CD2  . TYR A 1 39 ? 6.804   -1.453  -2.152  1.00 0.00 ? 39 TYR A CD2  15 
ATOM   11136 C CE1  . TYR A 1 39 ? 4.831   -1.848  -4.040  1.00 0.00 ? 39 TYR A CE1  15 
ATOM   11137 C CE2  . TYR A 1 39 ? 6.801   -2.606  -2.915  1.00 0.00 ? 39 TYR A CE2  15 
ATOM   11138 C CZ   . TYR A 1 39 ? 5.812   -2.799  -3.856  1.00 0.00 ? 39 TYR A CZ   15 
ATOM   11139 O OH   . TYR A 1 39 ? 5.807   -3.946  -4.618  1.00 0.00 ? 39 TYR A OH   15 
ATOM   11140 H H    . TYR A 1 39 ? 6.154   3.108   -0.499  1.00 0.00 ? 39 TYR A H    15 
ATOM   11141 H HA   . TYR A 1 39 ? 7.259   1.772   -2.753  1.00 0.00 ? 39 TYR A HA   15 
ATOM   11142 H HB2  . TYR A 1 39 ? 6.497   0.628   -0.656  1.00 0.00 ? 39 TYR A HB2  15 
ATOM   11143 H HB3  . TYR A 1 39 ? 4.839   0.965   -1.143  1.00 0.00 ? 39 TYR A HB3  15 
ATOM   11144 H HD1  . TYR A 1 39 ? 4.076   0.050   -3.420  1.00 0.00 ? 39 TYR A HD1  15 
ATOM   11145 H HD2  . TYR A 1 39 ? 7.575   -1.300  -1.413  1.00 0.00 ? 39 TYR A HD2  15 
ATOM   11146 H HE1  . TYR A 1 39 ? 4.056   -1.999  -4.778  1.00 0.00 ? 39 TYR A HE1  15 
ATOM   11147 H HE2  . TYR A 1 39 ? 7.569   -3.351  -2.770  1.00 0.00 ? 39 TYR A HE2  15 
ATOM   11148 H HH   . TYR A 1 39 ? 4.981   -4.415  -4.482  1.00 0.00 ? 39 TYR A HH   15 
ATOM   11149 N N    . CYS A 1 40 ? 4.302   3.133   -3.029  1.00 0.00 ? 40 CYS A N    15 
ATOM   11150 C CA   . CYS A 1 40 ? 3.294   3.513   -4.007  1.00 0.00 ? 40 CYS A CA   15 
ATOM   11151 C C    . CYS A 1 40 ? 3.938   4.295   -5.139  1.00 0.00 ? 40 CYS A C    15 
ATOM   11152 O O    . CYS A 1 40 ? 3.644   4.060   -6.311  1.00 0.00 ? 40 CYS A O    15 
ATOM   11153 C CB   . CYS A 1 40 ? 2.171   4.321   -3.352  1.00 0.00 ? 40 CYS A CB   15 
ATOM   11154 S SG   . CYS A 1 40 ? 1.019   3.302   -2.374  1.00 0.00 ? 40 CYS A SG   15 
ATOM   11155 H H    . CYS A 1 40 ? 4.235   3.463   -2.109  1.00 0.00 ? 40 CYS A H    15 
ATOM   11156 H HA   . CYS A 1 40 ? 2.880   2.605   -4.418  1.00 0.00 ? 40 CYS A HA   15 
ATOM   11157 H HB2  . CYS A 1 40 ? 2.601   5.058   -2.691  1.00 0.00 ? 40 CYS A HB2  15 
ATOM   11158 H HB3  . CYS A 1 40 ? 1.595   4.819   -4.119  1.00 0.00 ? 40 CYS A HB3  15 
ATOM   11159 N N    . ASN A 1 41 ? 4.846   5.199   -4.792  1.00 0.00 ? 41 ASN A N    15 
ATOM   11160 C CA   . ASN A 1 41 ? 5.548   5.975   -5.798  1.00 0.00 ? 41 ASN A CA   15 
ATOM   11161 C C    . ASN A 1 41 ? 6.393   5.054   -6.667  1.00 0.00 ? 41 ASN A C    15 
ATOM   11162 O O    . ASN A 1 41 ? 6.749   5.392   -7.795  1.00 0.00 ? 41 ASN A O    15 
ATOM   11163 C CB   . ASN A 1 41 ? 6.394   7.081   -5.145  1.00 0.00 ? 41 ASN A CB   15 
ATOM   11164 C CG   . ASN A 1 41 ? 7.891   6.895   -5.335  1.00 0.00 ? 41 ASN A CG   15 
ATOM   11165 O OD1  . ASN A 1 41 ? 8.560   7.733   -5.938  1.00 0.00 ? 41 ASN A OD1  15 
ATOM   11166 N ND2  . ASN A 1 41 ? 8.420   5.792   -4.820  1.00 0.00 ? 41 ASN A ND2  15 
ATOM   11167 H H    . ASN A 1 41 ? 5.062   5.329   -3.848  1.00 0.00 ? 41 ASN A H    15 
ATOM   11168 H HA   . ASN A 1 41 ? 4.803   6.420   -6.422  1.00 0.00 ? 41 ASN A HA   15 
ATOM   11169 H HB2  . ASN A 1 41 ? 6.118   8.033   -5.573  1.00 0.00 ? 41 ASN A HB2  15 
ATOM   11170 H HB3  . ASN A 1 41 ? 6.185   7.100   -4.085  1.00 0.00 ? 41 ASN A HB3  15 
ATOM   11171 H HD21 . ASN A 1 41 ? 7.826   5.168   -4.352  1.00 0.00 ? 41 ASN A HD21 15 
ATOM   11172 H HD22 . ASN A 1 41 ? 9.383   5.647   -4.927  1.00 0.00 ? 41 ASN A HD22 15 
ATOM   11173 N N    . ALA A 1 42 ? 6.677   3.875   -6.136  1.00 0.00 ? 42 ALA A N    15 
ATOM   11174 C CA   . ALA A 1 42 ? 7.445   2.877   -6.862  1.00 0.00 ? 42 ALA A CA   15 
ATOM   11175 C C    . ALA A 1 42 ? 6.517   1.806   -7.415  1.00 0.00 ? 42 ALA A C    15 
ATOM   11176 O O    . ALA A 1 42 ? 6.922   0.671   -7.665  1.00 0.00 ? 42 ALA A O    15 
ATOM   11177 C CB   . ALA A 1 42 ? 8.511   2.261   -5.969  1.00 0.00 ? 42 ALA A CB   15 
ATOM   11178 H H    . ALA A 1 42 ? 6.339   3.665   -5.242  1.00 0.00 ? 42 ALA A H    15 
ATOM   11179 H HA   . ALA A 1 42 ? 7.929   3.371   -7.687  1.00 0.00 ? 42 ALA A HA   15 
ATOM   11180 H HB1  . ALA A 1 42 ? 9.402   2.072   -6.549  1.00 0.00 ? 42 ALA A HB1  15 
ATOM   11181 H HB2  . ALA A 1 42 ? 8.144   1.331   -5.560  1.00 0.00 ? 42 ALA A HB2  15 
ATOM   11182 H HB3  . ALA A 1 42 ? 8.744   2.941   -5.163  1.00 0.00 ? 42 ALA A HB3  15 
ATOM   11183 N N    . SER A 1 43 ? 5.262   2.195   -7.604  1.00 0.00 ? 43 SER A N    15 
ATOM   11184 C CA   . SER A 1 43 ? 4.239   1.301   -8.127  1.00 0.00 ? 43 SER A CA   15 
ATOM   11185 C C    . SER A 1 43 ? 3.004   2.089   -8.557  1.00 0.00 ? 43 SER A C    15 
ATOM   11186 O O    . SER A 1 43 ? 1.886   1.577   -8.517  1.00 0.00 ? 43 SER A O    15 
ATOM   11187 C CB   . SER A 1 43 ? 3.855   0.259   -7.075  1.00 0.00 ? 43 SER A CB   15 
ATOM   11188 O OG   . SER A 1 43 ? 3.343   0.879   -5.908  1.00 0.00 ? 43 SER A OG   15 
ATOM   11189 H H    . SER A 1 43 ? 5.019   3.116   -7.384  1.00 0.00 ? 43 SER A H    15 
ATOM   11190 H HA   . SER A 1 43 ? 4.649   0.796   -8.989  1.00 0.00 ? 43 SER A HA   15 
ATOM   11191 H HB2  . SER A 1 43 ? 3.097   -0.396  -7.480  1.00 0.00 ? 43 SER A HB2  15 
ATOM   11192 H HB3  . SER A 1 43 ? 4.727   -0.319  -6.808  1.00 0.00 ? 43 SER A HB3  15 
ATOM   11193 H HG   . SER A 1 43 ? 2.485   0.503   -5.694  1.00 0.00 ? 43 SER A HG   15 
ATOM   11194 N N    . VAL A 1 44 ? 3.215   3.339   -8.971  1.00 0.00 ? 44 VAL A N    15 
ATOM   11195 C CA   . VAL A 1 44 ? 2.126   4.195   -9.414  1.00 0.00 ? 44 VAL A CA   15 
ATOM   11196 C C    . VAL A 1 44 ? 2.252   4.488   -10.896 1.00 0.00 ? 44 VAL A C    15 
ATOM   11197 O O    . VAL A 1 44 ? 2.113   5.627   -11.343 1.00 0.00 ? 44 VAL A O    15 
ATOM   11198 C CB   . VAL A 1 44 ? 2.075   5.522   -8.632  1.00 0.00 ? 44 VAL A CB   15 
ATOM   11199 C CG1  . VAL A 1 44 ? 1.444   5.318   -7.262  1.00 0.00 ? 44 VAL A CG1  15 
ATOM   11200 C CG2  . VAL A 1 44 ? 3.469   6.123   -8.504  1.00 0.00 ? 44 VAL A CG2  15 
ATOM   11201 H H    . VAL A 1 44 ? 4.120   3.689   -8.987  1.00 0.00 ? 44 VAL A H    15 
ATOM   11202 H HA   . VAL A 1 44 ? 1.208   3.662   -9.250  1.00 0.00 ? 44 VAL A HA   15 
ATOM   11203 H HB   . VAL A 1 44 ? 1.459   6.217   -9.184  1.00 0.00 ? 44 VAL A HB   15 
ATOM   11204 H HG11 . VAL A 1 44 ? 2.024   5.842   -6.515  1.00 0.00 ? 44 VAL A HG11 15 
ATOM   11205 H HG12 . VAL A 1 44 ? 1.424   4.265   -7.028  1.00 0.00 ? 44 VAL A HG12 15 
ATOM   11206 H HG13 . VAL A 1 44 ? 0.436   5.705   -7.270  1.00 0.00 ? 44 VAL A HG13 15 
ATOM   11207 H HG21 . VAL A 1 44 ? 3.854   6.348   -9.487  1.00 0.00 ? 44 VAL A HG21 15 
ATOM   11208 H HG22 . VAL A 1 44 ? 4.122   5.416   -8.014  1.00 0.00 ? 44 VAL A HG22 15 
ATOM   11209 H HG23 . VAL A 1 44 ? 3.418   7.030   -7.920  1.00 0.00 ? 44 VAL A HG23 15 
ATOM   11210 N N    . THR A 1 45 ? 2.504   3.434   -11.650 1.00 0.00 ? 45 THR A N    15 
ATOM   11211 C CA   . THR A 1 45 ? 2.643   3.529   -13.092 1.00 0.00 ? 45 THR A CA   15 
ATOM   11212 C C    . THR A 1 45 ? 3.795   4.466   -13.462 1.00 0.00 ? 45 THR A C    15 
ATOM   11213 O O    . THR A 1 45 ? 4.604   4.826   -12.606 1.00 0.00 ? 45 THR A O    15 
ATOM   11214 C CB   . THR A 1 45 ? 1.326   4.018   -13.683 1.00 0.00 ? 45 THR A CB   15 
ATOM   11215 O OG1  . THR A 1 45 ? 0.229   3.468   -12.974 1.00 0.00 ? 45 THR A OG1  15 
ATOM   11216 C CG2  . THR A 1 45 ? 1.139   3.673   -15.146 1.00 0.00 ? 45 THR A CG2  15 
ATOM   11217 H H    . THR A 1 45 ? 2.586   2.568   -11.220 1.00 0.00 ? 45 THR A H    15 
ATOM   11218 H HA   . THR A 1 45 ? 2.857   2.543   -13.472 1.00 0.00 ? 45 THR A HA   15 
ATOM   11219 H HB   . THR A 1 45 ? 1.287   5.086   -13.581 1.00 0.00 ? 45 THR A HB   15 
ATOM   11220 H HG1  . THR A 1 45 ? 0.238   2.512   -13.063 1.00 0.00 ? 45 THR A HG1  15 
ATOM   11221 H HG21 . THR A 1 45 ? 1.229   4.570   -15.742 1.00 0.00 ? 45 THR A HG21 15 
ATOM   11222 H HG22 . THR A 1 45 ? 0.160   3.240   -15.291 1.00 0.00 ? 45 THR A HG22 15 
ATOM   11223 H HG23 . THR A 1 45 ? 1.896   2.964   -15.447 1.00 0.00 ? 45 THR A HG23 15 
ATOM   11224 N N    . ASN A 1 46 ? 3.869   4.853   -14.737 1.00 0.00 ? 46 ASN A N    15 
ATOM   11225 C CA   . ASN A 1 46 ? 4.925   5.742   -15.223 1.00 0.00 ? 46 ASN A CA   15 
ATOM   11226 C C    . ASN A 1 46 ? 6.197   4.954   -15.524 1.00 0.00 ? 46 ASN A C    15 
ATOM   11227 O O    . ASN A 1 46 ? 7.062   4.797   -14.661 1.00 0.00 ? 46 ASN A O    15 
ATOM   11228 C CB   . ASN A 1 46 ? 5.221   6.853   -14.209 1.00 0.00 ? 46 ASN A CB   15 
ATOM   11229 C CG   . ASN A 1 46 ? 5.377   8.210   -14.868 1.00 0.00 ? 46 ASN A CG   15 
ATOM   11230 O OD1  . ASN A 1 46 ? 4.634   9.146   -14.572 1.00 0.00 ? 46 ASN A OD1  15 
ATOM   11231 N ND2  . ASN A 1 46 ? 6.347   8.323   -15.768 1.00 0.00 ? 46 ASN A ND2  15 
ATOM   11232 H H    . ASN A 1 46 ? 3.201   4.528   -15.371 1.00 0.00 ? 46 ASN A H    15 
ATOM   11233 H HA   . ASN A 1 46 ? 4.574   6.192   -16.139 1.00 0.00 ? 46 ASN A HA   15 
ATOM   11234 H HB2  . ASN A 1 46 ? 4.409   6.910   -13.499 1.00 0.00 ? 46 ASN A HB2  15 
ATOM   11235 H HB3  . ASN A 1 46 ? 6.136   6.620   -13.684 1.00 0.00 ? 46 ASN A HB3  15 
ATOM   11236 H HD21 . ASN A 1 46 ? 6.900   7.536   -15.954 1.00 0.00 ? 46 ASN A HD21 15 
ATOM   11237 H HD22 . ASN A 1 46 ? 6.470   9.189   -16.209 1.00 0.00 ? 46 ASN A HD22 15 
ATOM   11238 N N    . SER A 1 47 ? 6.302   4.457   -16.755 1.00 0.00 ? 47 SER A N    15 
ATOM   11239 C CA   . SER A 1 47 ? 7.463   3.680   -17.179 1.00 0.00 ? 47 SER A CA   15 
ATOM   11240 C C    . SER A 1 47 ? 7.437   2.284   -16.567 1.00 0.00 ? 47 SER A C    15 
ATOM   11241 O O    . SER A 1 47 ? 8.326   1.909   -15.803 1.00 0.00 ? 47 SER A O    15 
ATOM   11242 C CB   . SER A 1 47 ? 8.763   4.398   -16.808 1.00 0.00 ? 47 SER A CB   15 
ATOM   11243 O OG   . SER A 1 47 ? 9.842   3.945   -17.607 1.00 0.00 ? 47 SER A OG   15 
ATOM   11244 H H    . SER A 1 47 ? 5.577   4.614   -17.395 1.00 0.00 ? 47 SER A H    15 
ATOM   11245 H HA   . SER A 1 47 ? 7.410   3.580   -18.252 1.00 0.00 ? 47 SER A HA   15 
ATOM   11246 H HB2  . SER A 1 47 ? 8.641   5.460   -16.958 1.00 0.00 ? 47 SER A HB2  15 
ATOM   11247 H HB3  . SER A 1 47 ? 8.994   4.205   -15.770 1.00 0.00 ? 47 SER A HB3  15 
ATOM   11248 H HG   . SER A 1 47 ? 10.665  4.301   -17.265 1.00 0.00 ? 47 SER A HG   15 
ATOM   11249 N N    . VAL A 1 48 ? 6.393   1.533   -16.901 1.00 0.00 ? 48 VAL A N    15 
ATOM   11250 C CA   . VAL A 1 48 ? 6.200   0.182   -16.400 1.00 0.00 ? 48 VAL A CA   15 
ATOM   11251 C C    . VAL A 1 48 ? 6.401   0.111   -14.903 1.00 0.00 ? 48 VAL A C    15 
ATOM   11252 O O    . VAL A 1 48 ? 7.505   -0.101  -14.405 1.00 0.00 ? 48 VAL A O    15 
ATOM   11253 C CB   . VAL A 1 48 ? 7.098   -0.860  -17.071 1.00 0.00 ? 48 VAL A CB   15 
ATOM   11254 C CG1  . VAL A 1 48 ? 6.606   -1.165  -18.477 1.00 0.00 ? 48 VAL A CG1  15 
ATOM   11255 C CG2  . VAL A 1 48 ? 8.556   -0.423  -17.087 1.00 0.00 ? 48 VAL A CG2  15 
ATOM   11256 H H    . VAL A 1 48 ? 5.714   1.907   -17.492 1.00 0.00 ? 48 VAL A H    15 
ATOM   11257 H HA   . VAL A 1 48 ? 5.174   -0.088  -16.610 1.00 0.00 ? 48 VAL A HA   15 
ATOM   11258 H HB   . VAL A 1 48 ? 7.018   -1.759  -16.483 1.00 0.00 ? 48 VAL A HB   15 
ATOM   11259 H HG11 . VAL A 1 48 ? 7.115   -0.526  -19.184 1.00 0.00 ? 48 VAL A HG11 15 
ATOM   11260 H HG12 . VAL A 1 48 ? 5.542   -0.989  -18.532 1.00 0.00 ? 48 VAL A HG12 15 
ATOM   11261 H HG13 . VAL A 1 48 ? 6.812   -2.198  -18.714 1.00 0.00 ? 48 VAL A HG13 15 
ATOM   11262 H HG21 . VAL A 1 48 ? 8.882   -0.214  -16.079 1.00 0.00 ? 48 VAL A HG21 15 
ATOM   11263 H HG22 . VAL A 1 48 ? 8.659   0.466   -17.690 1.00 0.00 ? 48 VAL A HG22 15 
ATOM   11264 H HG23 . VAL A 1 48 ? 9.162   -1.213  -17.504 1.00 0.00 ? 48 VAL A HG23 15 
ATOM   11265 N N    . LYS A 1 49 ? 5.304   0.287   -14.213 1.00 0.00 ? 49 LYS A N    15 
ATOM   11266 C CA   . LYS A 1 49 ? 5.280   0.252   -12.756 1.00 0.00 ? 49 LYS A CA   15 
ATOM   11267 C C    . LYS A 1 49 ? 6.258   1.267   -12.163 1.00 0.00 ? 49 LYS A C    15 
ATOM   11268 O O    . LYS A 1 49 ? 5.868   2.376   -11.797 1.00 0.00 ? 49 LYS A O    15 
ATOM   11269 C CB   . LYS A 1 49 ? 5.605   -1.161  -12.256 1.00 0.00 ? 49 LYS A CB   15 
ATOM   11270 C CG   . LYS A 1 49 ? 5.699   -1.269  -10.742 1.00 0.00 ? 49 LYS A CG   15 
ATOM   11271 C CD   . LYS A 1 49 ? 5.567   -2.712  -10.279 1.00 0.00 ? 49 LYS A CD   15 
ATOM   11272 C CE   . LYS A 1 49 ? 4.141   -3.218  -10.434 1.00 0.00 ? 49 LYS A CE   15 
ATOM   11273 N NZ   . LYS A 1 49 ? 3.976   -4.590  -9.880  1.00 0.00 ? 49 LYS A NZ   15 
ATOM   11274 H H    . LYS A 1 49 ? 4.477   0.443   -14.711 1.00 0.00 ? 49 LYS A H    15 
ATOM   11275 H HA   . LYS A 1 49 ? 4.282   0.511   -12.440 1.00 0.00 ? 49 LYS A HA   15 
ATOM   11276 H HB2  . LYS A 1 49 ? 4.833   -1.834  -12.594 1.00 0.00 ? 49 LYS A HB2  15 
ATOM   11277 H HB3  . LYS A 1 49 ? 6.549   -1.472  -12.677 1.00 0.00 ? 49 LYS A HB3  15 
ATOM   11278 H HG2  . LYS A 1 49 ? 6.655   -0.886  -10.421 1.00 0.00 ? 49 LYS A HG2  15 
ATOM   11279 H HG3  . LYS A 1 49 ? 4.906   -0.684  -10.299 1.00 0.00 ? 49 LYS A HG3  15 
ATOM   11280 H HD2  . LYS A 1 49 ? 6.224   -3.331  -10.871 1.00 0.00 ? 49 LYS A HD2  15 
ATOM   11281 H HD3  . LYS A 1 49 ? 5.850   -2.774  -9.239  1.00 0.00 ? 49 LYS A HD3  15 
ATOM   11282 H HE2  . LYS A 1 49 ? 3.475   -2.547  -9.914  1.00 0.00 ? 49 LYS A HE2  15 
ATOM   11283 H HE3  . LYS A 1 49 ? 3.891   -3.231  -11.486 1.00 0.00 ? 49 LYS A HE3  15 
ATOM   11284 H HZ1  . LYS A 1 49 ? 4.162   -5.299  -10.619 1.00 0.00 ? 49 LYS A HZ1  15 
ATOM   11285 H HZ2  . LYS A 1 49 ? 3.006   -4.719  -9.529  1.00 0.00 ? 49 LYS A HZ2  15 
ATOM   11286 H HZ3  . LYS A 1 49 ? 4.640   -4.741  -9.095  1.00 0.00 ? 49 LYS A HZ3  15 
HETATM 11287 N N    . CY1 A 1 50 ? 7.529   0.883   -12.071 1.00 0.00 ? 50 CY1 A N    15 
HETATM 11288 C CA   . CY1 A 1 50 ? 8.557   1.762   -11.525 1.00 0.00 ? 50 CY1 A CA   15 
HETATM 11289 C CB   . CY1 A 1 50 ? 9.287   1.070   -10.371 1.00 0.00 ? 50 CY1 A CB   15 
HETATM 11290 S SG   . CY1 A 1 50 ? 10.505  2.140   -9.581  1.00 0.00 ? 50 CY1 A SG   15 
HETATM 11291 C CD   . CY1 A 1 50 ? 12.051  1.267   -9.907  1.00 0.00 ? 50 CY1 A CD   15 
HETATM 11292 N NE   . CY1 A 1 50 ? 13.122  2.221   -10.176 1.00 0.00 ? 50 CY1 A NE   15 
HETATM 11293 C CZ   . CY1 A 1 50 ? 13.727  2.946   -9.241  1.00 0.00 ? 50 CY1 A CZ   15 
HETATM 11294 O OAC  . CY1 A 1 50 ? 13.451  2.892   -8.042  1.00 0.00 ? 50 CY1 A OAC  15 
HETATM 11295 C CM   . CY1 A 1 50 ? 14.817  3.878   -9.735  1.00 0.00 ? 50 CY1 A CM   15 
HETATM 11296 C C    . CY1 A 1 50 ? 9.557   2.166   -12.604 1.00 0.00 ? 50 CY1 A C    15 
HETATM 11297 O O    . CY1 A 1 50 ? 9.653   3.340   -12.960 1.00 0.00 ? 50 CY1 A O    15 
HETATM 11298 H H    . CY1 A 1 50 ? 7.783   -0.011  -12.380 1.00 0.00 ? 50 CY1 A H    15 
HETATM 11299 H HA   . CY1 A 1 50 ? 8.071   2.650   -11.151 1.00 0.00 ? 50 CY1 A HA   15 
HETATM 11300 H HB2  . CY1 A 1 50 ? 8.563   0.769   -9.627  1.00 0.00 ? 50 CY1 A HB2  15 
HETATM 11301 H HB3  . CY1 A 1 50 ? 9.794   0.195   -10.747 1.00 0.00 ? 50 CY1 A HB3  15 
HETATM 11302 H HD2  . CY1 A 1 50 ? 12.155  0.867   -8.908  1.00 0.00 ? 50 CY1 A HD2  15 
HETATM 11303 H HD3  . CY1 A 1 50 ? 11.815  0.712   -10.802 1.00 0.00 ? 50 CY1 A HD3  15 
HETATM 11304 H HE   . CY1 A 1 50 ? 13.524  2.222   -11.070 1.00 0.00 ? 50 CY1 A HE   15 
HETATM 11305 H HM1  . CY1 A 1 50 ? 14.558  4.226   -10.732 1.00 0.00 ? 50 CY1 A HM1  15 
HETATM 11306 H HM2  . CY1 A 1 50 ? 15.764  3.344   -9.738  1.00 0.00 ? 50 CY1 A HM2  15 
HETATM 11307 H HM3  . CY1 A 1 50 ? 14.900  4.723   -9.086  1.00 0.00 ? 50 CY1 A HM3  15 
HETATM 11308 N N    . NH2 A 1 51 ? 10.306  1.206   -13.133 1.00 0.00 ? 51 NH2 A N    15 
HETATM 11309 H HN1  . NH2 A 1 51 ? 10.184  0.290   -12.808 1.00 0.00 ? 51 NH2 A HN1  15 
HETATM 11310 H HN2  . NH2 A 1 51 ? 10.952  1.453   -13.828 1.00 0.00 ? 51 NH2 A HN2  15 
ATOM   11311 N N    . LEU A 1 1  ? -2.936  -10.402 14.377  1.00 0.00 ? 1  LEU A N    16 
ATOM   11312 C CA   . LEU A 1 1  ? -3.954  -10.540 13.304  1.00 0.00 ? 1  LEU A CA   16 
ATOM   11313 C C    . LEU A 1 1  ? -3.598  -9.681  12.094  1.00 0.00 ? 1  LEU A C    16 
ATOM   11314 O O    . LEU A 1 1  ? -3.203  -10.197 11.048  1.00 0.00 ? 1  LEU A O    16 
ATOM   11315 C CB   . LEU A 1 1  ? -5.315  -10.127 13.872  1.00 0.00 ? 1  LEU A CB   16 
ATOM   11316 C CG   . LEU A 1 1  ? -6.297  -11.280 14.104  1.00 0.00 ? 1  LEU A CG   16 
ATOM   11317 C CD1  . LEU A 1 1  ? -6.757  -11.312 15.555  1.00 0.00 ? 1  LEU A CD1  16 
ATOM   11318 C CD2  . LEU A 1 1  ? -7.489  -11.164 13.168  1.00 0.00 ? 1  LEU A CD2  16 
ATOM   11319 H H1   . LEU A 1 1  ? -2.072  -10.885 14.058  1.00 0.00 ? 1  LEU A H1   16 
ATOM   11320 H H2   . LEU A 1 1  ? -3.319  -10.848 15.237  1.00 0.00 ? 1  LEU A H2   16 
ATOM   11321 H H3   . LEU A 1 1  ? -2.764  -9.387  14.524  1.00 0.00 ? 1  LEU A H3   16 
ATOM   11322 H HA   . LEU A 1 1  ? -3.996  -11.576 13.001  1.00 0.00 ? 1  LEU A HA   16 
ATOM   11323 H HB2  . LEU A 1 1  ? -5.148  -9.625  14.815  1.00 0.00 ? 1  LEU A HB2  16 
ATOM   11324 H HB3  . LEU A 1 1  ? -5.772  -9.426  13.189  1.00 0.00 ? 1  LEU A HB3  16 
ATOM   11325 H HG   . LEU A 1 1  ? -5.797  -12.215 13.895  1.00 0.00 ? 1  LEU A HG   16 
ATOM   11326 H HD11 . LEU A 1 1  ? -6.728  -10.313 15.963  1.00 0.00 ? 1  LEU A HD11 16 
ATOM   11327 H HD12 . LEU A 1 1  ? -6.103  -11.954 16.126  1.00 0.00 ? 1  LEU A HD12 16 
ATOM   11328 H HD13 . LEU A 1 1  ? -7.767  -11.691 15.603  1.00 0.00 ? 1  LEU A HD13 16 
ATOM   11329 H HD21 . LEU A 1 1  ? -7.150  -11.211 12.143  1.00 0.00 ? 1  LEU A HD21 16 
ATOM   11330 H HD22 . LEU A 1 1  ? -7.991  -10.223 13.338  1.00 0.00 ? 1  LEU A HD22 16 
ATOM   11331 H HD23 . LEU A 1 1  ? -8.176  -11.977 13.356  1.00 0.00 ? 1  LEU A HD23 16 
ATOM   11332 N N    . GLN A 1 2  ? -3.737  -8.367  12.244  1.00 0.00 ? 2  GLN A N    16 
ATOM   11333 C CA   . GLN A 1 2  ? -3.425  -7.436  11.163  1.00 0.00 ? 2  GLN A CA   16 
ATOM   11334 C C    . GLN A 1 2  ? -2.615  -6.254  11.681  1.00 0.00 ? 2  GLN A C    16 
ATOM   11335 O O    . GLN A 1 2  ? -3.090  -5.482  12.512  1.00 0.00 ? 2  GLN A O    16 
ATOM   11336 C CB   . GLN A 1 2  ? -4.705  -6.936  10.494  1.00 0.00 ? 2  GLN A CB   16 
ATOM   11337 C CG   . GLN A 1 2  ? -5.849  -6.676  11.465  1.00 0.00 ? 2  GLN A CG   16 
ATOM   11338 C CD   . GLN A 1 2  ? -7.072  -7.521  11.166  1.00 0.00 ? 2  GLN A CD   16 
ATOM   11339 O OE1  . GLN A 1 2  ? -7.224  -8.623  11.694  1.00 0.00 ? 2  GLN A OE1  16 
ATOM   11340 N NE2  . GLN A 1 2  ? -7.953  -7.007  10.317  1.00 0.00 ? 2  GLN A NE2  16 
ATOM   11341 H H    . GLN A 1 2  ? -4.051  -8.016  13.102  1.00 0.00 ? 2  GLN A H    16 
ATOM   11342 H HA   . GLN A 1 2  ? -2.833  -7.968  10.432  1.00 0.00 ? 2  GLN A HA   16 
ATOM   11343 H HB2  . GLN A 1 2  ? -4.486  -6.015  9.975   1.00 0.00 ? 2  GLN A HB2  16 
ATOM   11344 H HB3  . GLN A 1 2  ? -5.032  -7.673  9.775   1.00 0.00 ? 2  GLN A HB3  16 
ATOM   11345 H HG2  . GLN A 1 2  ? -5.513  -6.897  12.466  1.00 0.00 ? 2  GLN A HG2  16 
ATOM   11346 H HG3  . GLN A 1 2  ? -6.125  -5.635  11.402  1.00 0.00 ? 2  GLN A HG3  16 
ATOM   11347 H HE21 . GLN A 1 2  ? -7.766  -6.124  9.936   1.00 0.00 ? 2  GLN A HE21 16 
ATOM   11348 H HE22 . GLN A 1 2  ? -8.753  -7.532  10.105  1.00 0.00 ? 2  GLN A HE22 16 
ATOM   11349 N N    . MET A 1 3  ? -1.381  -6.137  11.197  1.00 0.00 ? 3  MET A N    16 
ATOM   11350 C CA   . MET A 1 3  ? -0.470  -5.063  11.609  1.00 0.00 ? 3  MET A CA   16 
ATOM   11351 C C    . MET A 1 3  ? 0.011   -5.296  13.025  1.00 0.00 ? 3  MET A C    16 
ATOM   11352 O O    . MET A 1 3  ? 1.203   -5.198  13.315  1.00 0.00 ? 3  MET A O    16 
ATOM   11353 C CB   . MET A 1 3  ? -1.130  -3.682  11.472  1.00 0.00 ? 3  MET A CB   16 
ATOM   11354 C CG   . MET A 1 3  ? -0.588  -2.613  12.421  1.00 0.00 ? 3  MET A CG   16 
ATOM   11355 S SD   . MET A 1 3  ? -1.375  -2.650  14.043  1.00 0.00 ? 3  MET A SD   16 
ATOM   11356 C CE   . MET A 1 3  ? -1.397  -0.906  14.448  1.00 0.00 ? 3  MET A CE   16 
ATOM   11357 H H    . MET A 1 3  ? -1.068  -6.803  10.550  1.00 0.00 ? 3  MET A H    16 
ATOM   11358 H HA   . MET A 1 3  ? 0.382   -5.100  10.966  1.00 0.00 ? 3  MET A HA   16 
ATOM   11359 H HB2  . MET A 1 3  ? -0.977  -3.333  10.462  1.00 0.00 ? 3  MET A HB2  16 
ATOM   11360 H HB3  . MET A 1 3  ? -2.186  -3.785  11.644  1.00 0.00 ? 3  MET A HB3  16 
ATOM   11361 H HG2  . MET A 1 3  ? 0.474   -2.766  12.552  1.00 0.00 ? 3  MET A HG2  16 
ATOM   11362 H HG3  . MET A 1 3  ? -0.756  -1.641  11.979  1.00 0.00 ? 3  MET A HG3  16 
ATOM   11363 H HE1  . MET A 1 3  ? -1.404  -0.325  13.537  1.00 0.00 ? 3  MET A HE1  16 
ATOM   11364 H HE2  . MET A 1 3  ? -0.518  -0.658  15.025  1.00 0.00 ? 3  MET A HE2  16 
ATOM   11365 H HE3  . MET A 1 3  ? -2.282  -0.680  15.025  1.00 0.00 ? 3  MET A HE3  16 
ATOM   11366 N N    . ALA A 1 4  ? -0.919  -5.613  13.899  1.00 0.00 ? 4  ALA A N    16 
ATOM   11367 C CA   . ALA A 1 4  ? -0.597  -5.868  15.279  1.00 0.00 ? 4  ALA A CA   16 
ATOM   11368 C C    . ALA A 1 4  ? 0.021   -7.256  15.437  1.00 0.00 ? 4  ALA A C    16 
ATOM   11369 O O    . ALA A 1 4  ? -0.537  -8.124  16.108  1.00 0.00 ? 4  ALA A O    16 
ATOM   11370 C CB   . ALA A 1 4  ? -1.855  -5.731  16.103  1.00 0.00 ? 4  ALA A CB   16 
ATOM   11371 H H    . ALA A 1 4  ? -1.853  -5.681  13.607  1.00 0.00 ? 4  ALA A H    16 
ATOM   11372 H HA   . ALA A 1 4  ? 0.106   -5.114  15.602  1.00 0.00 ? 4  ALA A HA   16 
ATOM   11373 H HB1  . ALA A 1 4  ? -2.609  -5.241  15.501  1.00 0.00 ? 4  ALA A HB1  16 
ATOM   11374 H HB2  . ALA A 1 4  ? -1.650  -5.140  16.979  1.00 0.00 ? 4  ALA A HB2  16 
ATOM   11375 H HB3  . ALA A 1 4  ? -2.205  -6.708  16.393  1.00 0.00 ? 4  ALA A HB3  16 
ATOM   11376 N N    . GLY A 1 5  ? 1.174   -7.465  14.799  1.00 0.00 ? 5  GLY A N    16 
ATOM   11377 C CA   . GLY A 1 5  ? 1.841   -8.750  14.867  1.00 0.00 ? 5  GLY A CA   16 
ATOM   11378 C C    . GLY A 1 5  ? 2.702   -9.012  13.643  1.00 0.00 ? 5  GLY A C    16 
ATOM   11379 O O    . GLY A 1 5  ? 3.892   -9.299  13.771  1.00 0.00 ? 5  GLY A O    16 
ATOM   11380 H H    . GLY A 1 5  ? 1.574   -6.739  14.275  1.00 0.00 ? 5  GLY A H    16 
ATOM   11381 H HA2  . GLY A 1 5  ? 2.467   -8.773  15.747  1.00 0.00 ? 5  GLY A HA2  16 
ATOM   11382 H HA3  . GLY A 1 5  ? 1.097   -9.531  14.946  1.00 0.00 ? 5  GLY A HA3  16 
ATOM   11383 N N    . GLN A 1 6  ? 2.106   -8.902  12.450  1.00 0.00 ? 6  GLN A N    16 
ATOM   11384 C CA   . GLN A 1 6  ? 2.837   -9.120  11.211  1.00 0.00 ? 6  GLN A CA   16 
ATOM   11385 C C    . GLN A 1 6  ? 1.922   -9.025  9.996   1.00 0.00 ? 6  GLN A C    16 
ATOM   11386 O O    . GLN A 1 6  ? 1.631   -10.025 9.338   1.00 0.00 ? 6  GLN A O    16 
ATOM   11387 C CB   . GLN A 1 6  ? 3.553   -10.475 11.227  1.00 0.00 ? 6  GLN A CB   16 
ATOM   11388 C CG   . GLN A 1 6  ? 4.972   -10.418 10.685  1.00 0.00 ? 6  GLN A CG   16 
ATOM   11389 C CD   . GLN A 1 6  ? 5.917   -9.661  11.598  1.00 0.00 ? 6  GLN A CD   16 
ATOM   11390 O OE1  . GLN A 1 6  ? 5.652   -8.519  11.974  1.00 0.00 ? 6  GLN A OE1  16 
ATOM   11391 N NE2  . GLN A 1 6  ? 7.026   -10.296 11.957  1.00 0.00 ? 6  GLN A NE2  16 
ATOM   11392 H H    . GLN A 1 6  ? 1.165   -8.659  12.402  1.00 0.00 ? 6  GLN A H    16 
ATOM   11393 H HA   . GLN A 1 6  ? 3.567   -8.335  11.134  1.00 0.00 ? 6  GLN A HA   16 
ATOM   11394 H HB2  . GLN A 1 6  ? 3.595   -10.838 12.242  1.00 0.00 ? 6  GLN A HB2  16 
ATOM   11395 H HB3  . GLN A 1 6  ? 2.991   -11.175 10.628  1.00 0.00 ? 6  GLN A HB3  16 
ATOM   11396 H HG2  . GLN A 1 6  ? 5.340   -11.426 10.568  1.00 0.00 ? 6  GLN A HG2  16 
ATOM   11397 H HG3  . GLN A 1 6  ? 4.956   -9.928  9.722   1.00 0.00 ? 6  GLN A HG3  16 
ATOM   11398 H HE21 . GLN A 1 6  ? 7.171   -11.203 11.618  1.00 0.00 ? 6  GLN A HE21 16 
ATOM   11399 H HE22 . GLN A 1 6  ? 7.654   -9.830  12.548  1.00 0.00 ? 6  GLN A HE22 16 
ATOM   11400 N N    . CYS A 1 7  ? 1.481   -7.804  9.706   1.00 0.00 ? 7  CYS A N    16 
ATOM   11401 C CA   . CYS A 1 7  ? 0.602   -7.543  8.547   1.00 0.00 ? 7  CYS A CA   16 
ATOM   11402 C C    . CYS A 1 7  ? 1.031   -8.381  7.348   1.00 0.00 ? 7  CYS A C    16 
ATOM   11403 O O    . CYS A 1 7  ? 2.208   -8.716  7.211   1.00 0.00 ? 7  CYS A O    16 
ATOM   11404 C CB   . CYS A 1 7  ? 0.634   -6.061  8.118   1.00 0.00 ? 7  CYS A CB   16 
ATOM   11405 S SG   . CYS A 1 7  ? -0.874  -5.093  8.483   1.00 0.00 ? 7  CYS A SG   16 
ATOM   11406 H H    . CYS A 1 7  ? 1.762   -7.066  10.287  1.00 0.00 ? 7  CYS A H    16 
ATOM   11407 H HA   . CYS A 1 7  ? -0.398  -7.809  8.818   1.00 0.00 ? 7  CYS A HA   16 
ATOM   11408 H HB2  . CYS A 1 7  ? 1.455   -5.566  8.605   1.00 0.00 ? 7  CYS A HB2  16 
ATOM   11409 H HB3  . CYS A 1 7  ? 0.793   -6.016  7.047   1.00 0.00 ? 7  CYS A HB3  16 
ATOM   11410 N N    . SER A 1 8  ? 0.089   -8.694  6.465   1.00 0.00 ? 8  SER A N    16 
ATOM   11411 C CA   . SER A 1 8  ? 0.415   -9.462  5.269   1.00 0.00 ? 8  SER A CA   16 
ATOM   11412 C C    . SER A 1 8  ? 1.544   -8.767  4.516   1.00 0.00 ? 8  SER A C    16 
ATOM   11413 O O    . SER A 1 8  ? 1.668   -7.544  4.564   1.00 0.00 ? 8  SER A O    16 
ATOM   11414 C CB   . SER A 1 8  ? -0.814  -9.611  4.365   1.00 0.00 ? 8  SER A CB   16 
ATOM   11415 O OG   . SER A 1 8  ? -1.759  -10.502 4.932   1.00 0.00 ? 8  SER A OG   16 
ATOM   11416 H H    . SER A 1 8  ? -0.832  -8.387  6.608   1.00 0.00 ? 8  SER A H    16 
ATOM   11417 H HA   . SER A 1 8  ? 0.751   -10.438 5.580   1.00 0.00 ? 8  SER A HA   16 
ATOM   11418 H HB2  . SER A 1 8  ? -1.282  -8.648  4.231   1.00 0.00 ? 8  SER A HB2  16 
ATOM   11419 H HB3  . SER A 1 8  ? -0.505  -9.998  3.404   1.00 0.00 ? 8  SER A HB3  16 
ATOM   11420 H HG   . SER A 1 8  ? -2.607  -10.060 5.012   1.00 0.00 ? 8  SER A HG   16 
ATOM   11421 N N    . GLN A 1 9  ? 2.381   -9.540  3.844   1.00 0.00 ? 9  GLN A N    16 
ATOM   11422 C CA   . GLN A 1 9  ? 3.507   -8.976  3.117   1.00 0.00 ? 9  GLN A CA   16 
ATOM   11423 C C    . GLN A 1 9  ? 3.069   -7.866  2.173   1.00 0.00 ? 9  GLN A C    16 
ATOM   11424 O O    . GLN A 1 9  ? 2.184   -8.049  1.339   1.00 0.00 ? 9  GLN A O    16 
ATOM   11425 C CB   . GLN A 1 9  ? 4.254   -10.068 2.348   1.00 0.00 ? 9  GLN A CB   16 
ATOM   11426 C CG   . GLN A 1 9  ? 5.477   -10.596 3.080   1.00 0.00 ? 9  GLN A CG   16 
ATOM   11427 C CD   . GLN A 1 9  ? 5.492   -12.109 3.176   1.00 0.00 ? 9  GLN A CD   16 
ATOM   11428 O OE1  . GLN A 1 9  ? 6.022   -12.793 2.300   1.00 0.00 ? 9  GLN A OE1  16 
ATOM   11429 N NE2  . GLN A 1 9  ? 4.908   -12.639 4.244   1.00 0.00 ? 9  GLN A NE2  16 
ATOM   11430 H H    . GLN A 1 9  ? 2.255   -10.507 3.853   1.00 0.00 ? 9  GLN A H    16 
ATOM   11431 H HA   . GLN A 1 9  ? 4.165   -8.546  3.848   1.00 0.00 ? 9  GLN A HA   16 
ATOM   11432 H HB2  . GLN A 1 9  ? 3.580   -10.894 2.175   1.00 0.00 ? 9  GLN A HB2  16 
ATOM   11433 H HB3  . GLN A 1 9  ? 4.573   -9.669  1.396   1.00 0.00 ? 9  GLN A HB3  16 
ATOM   11434 H HG2  . GLN A 1 9  ? 6.363   -10.275 2.551   1.00 0.00 ? 9  GLN A HG2  16 
ATOM   11435 H HG3  . GLN A 1 9  ? 5.489   -10.186 4.079   1.00 0.00 ? 9  GLN A HG3  16 
ATOM   11436 H HE21 . GLN A 1 9  ? 4.506   -12.033 4.900   1.00 0.00 ? 9  GLN A HE21 16 
ATOM   11437 H HE22 . GLN A 1 9  ? 4.902   -13.616 4.331   1.00 0.00 ? 9  GLN A HE22 16 
ATOM   11438 N N    . ASN A 1 10 ? 3.698   -6.707  2.332   1.00 0.00 ? 10 ASN A N    16 
ATOM   11439 C CA   . ASN A 1 10 ? 3.384   -5.543  1.516   1.00 0.00 ? 10 ASN A CA   16 
ATOM   11440 C C    . ASN A 1 10 ? 1.937   -5.136  1.710   1.00 0.00 ? 10 ASN A C    16 
ATOM   11441 O O    . ASN A 1 10 ? 1.315   -4.566  0.814   1.00 0.00 ? 10 ASN A O    16 
ATOM   11442 C CB   . ASN A 1 10 ? 3.658   -5.814  0.031   1.00 0.00 ? 10 ASN A CB   16 
ATOM   11443 C CG   . ASN A 1 10 ? 4.114   -4.569  -0.703  1.00 0.00 ? 10 ASN A CG   16 
ATOM   11444 O OD1  . ASN A 1 10 ? 3.596   -4.238  -1.770  1.00 0.00 ? 10 ASN A OD1  16 
ATOM   11445 N ND2  . ASN A 1 10 ? 5.092   -3.872  -0.135  1.00 0.00 ? 10 ASN A ND2  16 
ATOM   11446 H H    . ASN A 1 10 ? 4.387   -6.630  3.030   1.00 0.00 ? 10 ASN A H    16 
ATOM   11447 H HA   . ASN A 1 10 ? 4.005   -4.731  1.850   1.00 0.00 ? 10 ASN A HA   16 
ATOM   11448 H HB2  . ASN A 1 10 ? 4.429   -6.565  -0.062  1.00 0.00 ? 10 ASN A HB2  16 
ATOM   11449 H HB3  . ASN A 1 10 ? 2.753   -6.173  -0.437  1.00 0.00 ? 10 ASN A HB3  16 
ATOM   11450 H HD21 . ASN A 1 10 ? 5.461   -4.197  0.712   1.00 0.00 ? 10 ASN A HD21 16 
ATOM   11451 H HD22 . ASN A 1 10 ? 5.400   -3.057  -0.582  1.00 0.00 ? 10 ASN A HD22 16 
ATOM   11452 N N    . GLU A 1 11 ? 1.406   -5.427  2.888   1.00 0.00 ? 11 GLU A N    16 
ATOM   11453 C CA   . GLU A 1 11 ? 0.025   -5.075  3.183   1.00 0.00 ? 11 GLU A CA   16 
ATOM   11454 C C    . GLU A 1 11 ? -0.072  -4.073  4.312   1.00 0.00 ? 11 GLU A C    16 
ATOM   11455 O O    . GLU A 1 11 ? 0.735   -4.091  5.241   1.00 0.00 ? 11 GLU A O    16 
ATOM   11456 C CB   . GLU A 1 11 ? -0.814  -6.320  3.479   1.00 0.00 ? 11 GLU A CB   16 
ATOM   11457 C CG   . GLU A 1 11 ? -1.705  -6.742  2.319   1.00 0.00 ? 11 GLU A CG   16 
ATOM   11458 C CD   . GLU A 1 11 ? -1.129  -7.901  1.530   1.00 0.00 ? 11 GLU A CD   16 
ATOM   11459 O OE1  . GLU A 1 11 ? -0.187  -7.675  0.743   1.00 0.00 ? 11 GLU A OE1  16 
ATOM   11460 O OE2  . GLU A 1 11 ? -1.621  -9.037  1.700   1.00 0.00 ? 11 GLU A OE2  16 
ATOM   11461 H H    . GLU A 1 11 ? 1.962   -5.882  3.569   1.00 0.00 ? 11 GLU A H    16 
ATOM   11462 H HA   . GLU A 1 11 ? -0.362  -4.601  2.320   1.00 0.00 ? 11 GLU A HA   16 
ATOM   11463 H HB2  . GLU A 1 11 ? -0.155  -7.138  3.711   1.00 0.00 ? 11 GLU A HB2  16 
ATOM   11464 H HB3  . GLU A 1 11 ? -1.444  -6.123  4.330   1.00 0.00 ? 11 GLU A HB3  16 
ATOM   11465 H HG2  . GLU A 1 11 ? -2.666  -7.037  2.710   1.00 0.00 ? 11 GLU A HG2  16 
ATOM   11466 H HG3  . GLU A 1 11 ? -1.833  -5.901  1.653   1.00 0.00 ? 11 GLU A HG3  16 
ATOM   11467 N N    . TYR A 1 12 ? -1.066  -3.183  4.225   1.00 0.00 ? 12 TYR A N    16 
ATOM   11468 C CA   . TYR A 1 12 ? -1.238  -2.162  5.262   1.00 0.00 ? 12 TYR A CA   16 
ATOM   11469 C C    . TYR A 1 12 ? -2.584  -2.292  5.965   1.00 0.00 ? 12 TYR A C    16 
ATOM   11470 O O    . TYR A 1 12 ? -3.640  -2.275  5.332   1.00 0.00 ? 12 TYR A O    16 
ATOM   11471 C CB   . TYR A 1 12 ? -1.042  -0.752  4.689   1.00 0.00 ? 12 TYR A CB   16 
ATOM   11472 C CG   . TYR A 1 12 ? -2.280  -0.117  4.085   1.00 0.00 ? 12 TYR A CG   16 
ATOM   11473 C CD1  . TYR A 1 12 ? -2.629  -0.344  2.761   1.00 0.00 ? 12 TYR A CD1  16 
ATOM   11474 C CD2  . TYR A 1 12 ? -3.085  0.725   4.841   1.00 0.00 ? 12 TYR A CD2  16 
ATOM   11475 C CE1  . TYR A 1 12 ? -3.748  0.246   2.207   1.00 0.00 ? 12 TYR A CE1  16 
ATOM   11476 C CE2  . TYR A 1 12 ? -4.205  1.320   4.294   1.00 0.00 ? 12 TYR A CE2  16 
ATOM   11477 C CZ   . TYR A 1 12 ? -4.533  1.076   2.977   1.00 0.00 ? 12 TYR A CZ   16 
ATOM   11478 O OH   . TYR A 1 12 ? -5.647  1.668   2.427   1.00 0.00 ? 12 TYR A OH   16 
ATOM   11479 H H    . TYR A 1 12 ? -1.693  -3.215  3.444   1.00 0.00 ? 12 TYR A H    16 
ATOM   11480 H HA   . TYR A 1 12 ? -0.464  -2.331  6.002   1.00 0.00 ? 12 TYR A HA   16 
ATOM   11481 H HB2  . TYR A 1 12 ? -0.703  -0.106  5.483   1.00 0.00 ? 12 TYR A HB2  16 
ATOM   11482 H HB3  . TYR A 1 12 ? -0.283  -0.791  3.922   1.00 0.00 ? 12 TYR A HB3  16 
ATOM   11483 H HD1  . TYR A 1 12 ? -2.010  -0.991  2.158   1.00 0.00 ? 12 TYR A HD1  16 
ATOM   11484 H HD2  . TYR A 1 12 ? -2.827  0.912   5.872   1.00 0.00 ? 12 TYR A HD2  16 
ATOM   11485 H HE1  . TYR A 1 12 ? -4.005  0.055   1.176   1.00 0.00 ? 12 TYR A HE1  16 
ATOM   11486 H HE2  . TYR A 1 12 ? -4.817  1.974   4.897   1.00 0.00 ? 12 TYR A HE2  16 
ATOM   11487 H HH   . TYR A 1 12 ? -6.181  1.001   1.989   1.00 0.00 ? 12 TYR A HH   16 
ATOM   11488 N N    . PHE A 1 13 ? -2.519  -2.427  7.289   1.00 0.00 ? 13 PHE A N    16 
ATOM   11489 C CA   . PHE A 1 13 ? -3.709  -2.572  8.125   1.00 0.00 ? 13 PHE A CA   16 
ATOM   11490 C C    . PHE A 1 13 ? -4.479  -1.261  8.205   1.00 0.00 ? 13 PHE A C    16 
ATOM   11491 O O    . PHE A 1 13 ? -4.260  -0.457  9.111   1.00 0.00 ? 13 PHE A O    16 
ATOM   11492 C CB   . PHE A 1 13 ? -3.296  -3.026  9.535   1.00 0.00 ? 13 PHE A CB   16 
ATOM   11493 C CG   . PHE A 1 13 ? -4.382  -2.934  10.574  1.00 0.00 ? 13 PHE A CG   16 
ATOM   11494 C CD1  . PHE A 1 13 ? -5.680  -3.312  10.277  1.00 0.00 ? 13 PHE A CD1  16 
ATOM   11495 C CD2  . PHE A 1 13 ? -4.100  -2.466  11.853  1.00 0.00 ? 13 PHE A CD2  16 
ATOM   11496 C CE1  . PHE A 1 13 ? -6.675  -3.226  11.232  1.00 0.00 ? 13 PHE A CE1  16 
ATOM   11497 C CE2  . PHE A 1 13 ? -5.093  -2.379  12.808  1.00 0.00 ? 13 PHE A CE2  16 
ATOM   11498 C CZ   . PHE A 1 13 ? -6.381  -2.760  12.498  1.00 0.00 ? 13 PHE A CZ   16 
ATOM   11499 H H    . PHE A 1 13 ? -1.637  -2.431  7.716   1.00 0.00 ? 13 PHE A H    16 
ATOM   11500 H HA   . PHE A 1 13 ? -4.344  -3.330  7.679   1.00 0.00 ? 13 PHE A HA   16 
ATOM   11501 H HB2  . PHE A 1 13 ? -2.978  -4.055  9.492   1.00 0.00 ? 13 PHE A HB2  16 
ATOM   11502 H HB3  . PHE A 1 13 ? -2.472  -2.414  9.865   1.00 0.00 ? 13 PHE A HB3  16 
ATOM   11503 H HD1  . PHE A 1 13 ? -5.913  -3.677  9.289   1.00 0.00 ? 13 PHE A HD1  16 
ATOM   11504 H HD2  . PHE A 1 13 ? -3.088  -2.172  12.101  1.00 0.00 ? 13 PHE A HD2  16 
ATOM   11505 H HE1  . PHE A 1 13 ? -7.680  -3.528  10.991  1.00 0.00 ? 13 PHE A HE1  16 
ATOM   11506 H HE2  . PHE A 1 13 ? -4.859  -2.013  13.797  1.00 0.00 ? 13 PHE A HE2  16 
ATOM   11507 H HZ   . PHE A 1 13 ? -7.160  -2.693  13.244  1.00 0.00 ? 13 PHE A HZ   16 
ATOM   11508 N N    . ASP A 1 14 ? -5.390  -1.057  7.264   1.00 0.00 ? 14 ASP A N    16 
ATOM   11509 C CA   . ASP A 1 14 ? -6.196  0.159   7.248   1.00 0.00 ? 14 ASP A CA   16 
ATOM   11510 C C    . ASP A 1 14 ? -7.221  0.134   8.367   1.00 0.00 ? 14 ASP A C    16 
ATOM   11511 O O    . ASP A 1 14 ? -8.214  -0.582  8.289   1.00 0.00 ? 14 ASP A O    16 
ATOM   11512 C CB   . ASP A 1 14 ? -6.905  0.315   5.905   1.00 0.00 ? 14 ASP A CB   16 
ATOM   11513 C CG   . ASP A 1 14 ? -7.223  1.763   5.587   1.00 0.00 ? 14 ASP A CG   16 
ATOM   11514 O OD1  . ASP A 1 14 ? -7.721  2.471   6.488   1.00 0.00 ? 14 ASP A OD1  16 
ATOM   11515 O OD2  . ASP A 1 14 ? -6.975  2.189   4.440   1.00 0.00 ? 14 ASP A OD2  16 
ATOM   11516 H H    . ASP A 1 14 ? -5.529  -1.742  6.571   1.00 0.00 ? 14 ASP A H    16 
ATOM   11517 H HA   . ASP A 1 14 ? -5.542  1.004   7.399   1.00 0.00 ? 14 ASP A HA   16 
ATOM   11518 H HB2  . ASP A 1 14 ? -6.275  -0.079  5.122   1.00 0.00 ? 14 ASP A HB2  16 
ATOM   11519 H HB3  . ASP A 1 14 ? -7.829  -0.240  5.931   1.00 0.00 ? 14 ASP A HB3  16 
ATOM   11520 N N    . SER A 1 15 ? -6.980  0.922   9.409   1.00 0.00 ? 15 SER A N    16 
ATOM   11521 C CA   . SER A 1 15 ? -7.897  0.985   10.537  1.00 0.00 ? 15 SER A CA   16 
ATOM   11522 C C    . SER A 1 15 ? -9.312  1.295   10.065  1.00 0.00 ? 15 SER A C    16 
ATOM   11523 O O    . SER A 1 15 ? -10.286 1.008   10.760  1.00 0.00 ? 15 SER A O    16 
ATOM   11524 C CB   . SER A 1 15 ? -7.435  2.040   11.545  1.00 0.00 ? 15 SER A CB   16 
ATOM   11525 O OG   . SER A 1 15 ? -7.228  3.292   10.916  1.00 0.00 ? 15 SER A OG   16 
ATOM   11526 H H    . SER A 1 15 ? -6.171  1.472   9.419   1.00 0.00 ? 15 SER A H    16 
ATOM   11527 H HA   . SER A 1 15 ? -7.899  0.021   11.009  1.00 0.00 ? 15 SER A HA   16 
ATOM   11528 H HB2  . SER A 1 15 ? -8.187  2.155   12.312  1.00 0.00 ? 15 SER A HB2  16 
ATOM   11529 H HB3  . SER A 1 15 ? -6.507  1.719   11.997  1.00 0.00 ? 15 SER A HB3  16 
ATOM   11530 H HG   . SER A 1 15 ? -6.291  3.505   10.926  1.00 0.00 ? 15 SER A HG   16 
ATOM   11531 N N    . LEU A 1 16 ? -9.420  1.873   8.872   1.00 0.00 ? 16 LEU A N    16 
ATOM   11532 C CA   . LEU A 1 16 ? -10.721 2.205   8.308   1.00 0.00 ? 16 LEU A CA   16 
ATOM   11533 C C    . LEU A 1 16 ? -11.336 0.980   7.636   1.00 0.00 ? 16 LEU A C    16 
ATOM   11534 O O    . LEU A 1 16 ? -12.558 0.842   7.567   1.00 0.00 ? 16 LEU A O    16 
ATOM   11535 C CB   . LEU A 1 16 ? -10.591 3.351   7.302   1.00 0.00 ? 16 LEU A CB   16 
ATOM   11536 C CG   . LEU A 1 16 ? -11.652 4.447   7.429   1.00 0.00 ? 16 LEU A CG   16 
ATOM   11537 C CD1  . LEU A 1 16 ? -13.041 3.876   7.183   1.00 0.00 ? 16 LEU A CD1  16 
ATOM   11538 C CD2  . LEU A 1 16 ? -11.578 5.102   8.799   1.00 0.00 ? 16 LEU A CD2  16 
ATOM   11539 H H    . LEU A 1 16 ? -8.607  2.073   8.356   1.00 0.00 ? 16 LEU A H    16 
ATOM   11540 H HA   . LEU A 1 16 ? -11.364 2.517   9.118   1.00 0.00 ? 16 LEU A HA   16 
ATOM   11541 H HB2  . LEU A 1 16 ? -9.618  3.803   7.428   1.00 0.00 ? 16 LEU A HB2  16 
ATOM   11542 H HB3  . LEU A 1 16 ? -10.651 2.938   6.306   1.00 0.00 ? 16 LEU A HB3  16 
ATOM   11543 H HG   . LEU A 1 16 ? -11.467 5.206   6.683   1.00 0.00 ? 16 LEU A HG   16 
ATOM   11544 H HD11 . LEU A 1 16 ? -13.641 4.603   6.658   1.00 0.00 ? 16 LEU A HD11 16 
ATOM   11545 H HD12 . LEU A 1 16 ? -13.505 3.642   8.130   1.00 0.00 ? 16 LEU A HD12 16 
ATOM   11546 H HD13 . LEU A 1 16 ? -12.961 2.978   6.590   1.00 0.00 ? 16 LEU A HD13 16 
ATOM   11547 H HD21 . LEU A 1 16 ? -11.782 6.159   8.704   1.00 0.00 ? 16 LEU A HD21 16 
ATOM   11548 H HD22 . LEU A 1 16 ? -10.589 4.963   9.212   1.00 0.00 ? 16 LEU A HD22 16 
ATOM   11549 H HD23 . LEU A 1 16 ? -12.308 4.651   9.454   1.00 0.00 ? 16 LEU A HD23 16 
ATOM   11550 N N    . LEU A 1 17 ? -10.476 0.094   7.138   1.00 0.00 ? 17 LEU A N    16 
ATOM   11551 C CA   . LEU A 1 17 ? -10.920 -1.120  6.467   1.00 0.00 ? 17 LEU A CA   16 
ATOM   11552 C C    . LEU A 1 17 ? -10.851 -2.330  7.397   1.00 0.00 ? 17 LEU A C    16 
ATOM   11553 O O    . LEU A 1 17 ? -11.550 -3.321  7.188   1.00 0.00 ? 17 LEU A O    16 
ATOM   11554 C CB   . LEU A 1 17 ? -10.059 -1.355  5.228   1.00 0.00 ? 17 LEU A CB   16 
ATOM   11555 C CG   . LEU A 1 17 ? -10.042 -0.187  4.241   1.00 0.00 ? 17 LEU A CG   16 
ATOM   11556 C CD1  . LEU A 1 17 ? -8.746  -0.168  3.446   1.00 0.00 ? 17 LEU A CD1  16 
ATOM   11557 C CD2  . LEU A 1 17 ? -11.243 -0.260  3.309   1.00 0.00 ? 17 LEU A CD2  16 
ATOM   11558 H H    . LEU A 1 17 ? -9.515  0.263   7.220   1.00 0.00 ? 17 LEU A H    16 
ATOM   11559 H HA   . LEU A 1 17 ? -11.945 -0.974  6.157   1.00 0.00 ? 17 LEU A HA   16 
ATOM   11560 H HB2  . LEU A 1 17 ? -9.045  -1.547  5.554   1.00 0.00 ? 17 LEU A HB2  16 
ATOM   11561 H HB3  . LEU A 1 17 ? -10.430 -2.229  4.714   1.00 0.00 ? 17 LEU A HB3  16 
ATOM   11562 H HG   . LEU A 1 17 ? -10.105 0.739   4.795   1.00 0.00 ? 17 LEU A HG   16 
ATOM   11563 H HD11 . LEU A 1 17 ? -8.013  -0.791  3.936   1.00 0.00 ? 17 LEU A HD11 16 
ATOM   11564 H HD12 . LEU A 1 17 ? -8.376  0.844   3.386   1.00 0.00 ? 17 LEU A HD12 16 
ATOM   11565 H HD13 . LEU A 1 17 ? -8.930  -0.543  2.450   1.00 0.00 ? 17 LEU A HD13 16 
ATOM   11566 H HD21 . LEU A 1 17 ? -11.063 0.358   2.442   1.00 0.00 ? 17 LEU A HD21 16 
ATOM   11567 H HD22 . LEU A 1 17 ? -12.122 0.093   3.826   1.00 0.00 ? 17 LEU A HD22 16 
ATOM   11568 H HD23 . LEU A 1 17 ? -11.395 -1.283  2.998   1.00 0.00 ? 17 LEU A HD23 16 
ATOM   11569 N N    . HIS A 1 18 ? -10.003 -2.245  8.422   1.00 0.00 ? 18 HIS A N    16 
ATOM   11570 C CA   . HIS A 1 18 ? -9.844  -3.331  9.381   1.00 0.00 ? 18 HIS A CA   16 
ATOM   11571 C C    . HIS A 1 18 ? -9.260  -4.567  8.711   1.00 0.00 ? 18 HIS A C    16 
ATOM   11572 O O    . HIS A 1 18 ? -9.794  -5.670  8.836   1.00 0.00 ? 18 HIS A O    16 
ATOM   11573 C CB   . HIS A 1 18 ? -11.182 -3.678  10.019  1.00 0.00 ? 18 HIS A CB   16 
ATOM   11574 C CG   . HIS A 1 18 ? -11.455 -2.937  11.291  1.00 0.00 ? 18 HIS A CG   16 
ATOM   11575 N ND1  . HIS A 1 18 ? -12.428 -1.967  11.404