data_2KNT
# 
_entry.id   2KNT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KNT         
WWPDB D_1000178287 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2KNT 
_pdbx_database_status.recvd_initial_deposition_date   1997-01-15 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Merigeau, K.' 1 
'Arnoux, B.'   2 
'Ducruix, A.'  3 
# 
_citation.id                        primary 
_citation.title                     '1.2 A refinement of the Kunitz-type domain from the alpha3 chain of human type VI collagen.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            54 
_citation.page_first                306 
_citation.page_last                 312 
_citation.year                      1998 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9761897 
_citation.pdbx_database_id_DOI      10.1107/S0907444997010846 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Merigeau, K.' 1 
primary 'Arnoux, B.'   2 
primary 'Perahia, D.'  3 
primary 'Norris, K.'   4 
primary 'Norris, F.'   5 
primary 'Ducruix, A.'  6 
# 
_cell.entry_id           2KNT 
_cell.length_a           25.690 
_cell.length_b           38.040 
_cell.length_c           28.640 
_cell.angle_alpha        90.00 
_cell.angle_beta         109.20 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2KNT 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man COLLAGEN        6639.508 1  ? ? 'DOMAIN C5, C-TERMINUS OF TYPE VI COLLAGEN' KUNITZ-TYPE 
2 non-polymer syn 'PHOSPHATE ION' 94.971   1  ? ? ?                                           ?           
3 water       nat water           18.015   50 ? ? ?                                           ?           
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPV 
_entity_poly.pdbx_seq_one_letter_code_can   ETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPV 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLU n 
1 2  THR n 
1 3  ASP n 
1 4  ILE n 
1 5  CYS n 
1 6  LYS n 
1 7  LEU n 
1 8  PRO n 
1 9  LYS n 
1 10 ASP n 
1 11 GLU n 
1 12 GLY n 
1 13 THR n 
1 14 CYS n 
1 15 ARG n 
1 16 ASP n 
1 17 PHE n 
1 18 ILE n 
1 19 LEU n 
1 20 LYS n 
1 21 TRP n 
1 22 TYR n 
1 23 TYR n 
1 24 ASP n 
1 25 PRO n 
1 26 ASN n 
1 27 THR n 
1 28 LYS n 
1 29 SER n 
1 30 CYS n 
1 31 ALA n 
1 32 ARG n 
1 33 PHE n 
1 34 TRP n 
1 35 TYR n 
1 36 GLY n 
1 37 GLY n 
1 38 CYS n 
1 39 GLY n 
1 40 GLY n 
1 41 ASN n 
1 42 GLU n 
1 43 ASN n 
1 44 LYS n 
1 45 PHE n 
1 46 GLY n 
1 47 SER n 
1 48 GLN n 
1 49 LYS n 
1 50 GLU n 
1 51 CYS n 
1 52 GLU n 
1 53 LYS n 
1 54 VAL n 
1 55 CYS n 
1 56 ALA n 
1 57 PRO n 
1 58 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               
;baker's yeast
;
_entity_src_gen.pdbx_host_org_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4932 
_entity_src_gen.host_org_genus                     Saccharomyces 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               MT-663 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CO6A3_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P12111 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MRKHRHLPLVAVFCLFLSGFPTTHAQQQQADVKNGAAADIIFLVDSSWTIGEEHFQLVREFLYDVVKSLAVGENDFHFAL
VQFNGNPHTEFLLNTYRTKQEVLSHISNMSYIGGTNQTGKGLEYIMQSHLTKAAGSRAGDGVPQVIVVLTDGHSKDGLAL
PSAELKSADVNVFAIGVEDADEGALKEIASEPLNMHMFNLENFTSLHDIVGNLVSCVHSSVSPERAGDTETLKDITAQDS
ADIIFLIDGSNNTGSVNFAVILDFLVNLLEKLPIGTQQIRVGVVQFSDEPRTMFSLDTYSTKAQVLGAVKALGFAGGELA
NIGLALDFVVENHFTRAGGSRVEEGVPQVLVLISAGPSSDEIRYGVVALKQASVFSFGLGAQAASRAELQHIATDDNLVF
TVPEFRSFGDLQEKLLPYIVGVAQRHIVLKPPTIVTQVIEVNKRDIVFLVDGSSALGLANFNAIRDFIAKVIQRLEIGQD
LIQVAVAQYADTVRPEFYFNTHPTKREVITAVRKMKPLDGSALYTGSALDFVRNNLFTSSAGYRAAEGIPKLLVLITGGK
SLDEISQPAQELKRSSIMAFAIGNKGADQAELEEIAFDSSLVFIPAEFRAAPLQGMLPGLLAPLRTLSGTPEVHSNKRDI
IFLLDGSANVGKTNFPYVRDFVMNLVNSLDIGNDNIRVGLVQFSDTPVTEFSLNTYQTKSDILGHLRQLQLQGGSGLNTG
SALSYVYANHFTEAGGSRIREHVPQLLLLLTAGQSEDSYLQAANALTRAGILTFCVGASQANKAELEQIAFNPSLVYLMD
DFSSLPALPQQLIQPLTTYVSGGVEEVPLAQPESKRDILFLFDGSANLVGQFPVVRDFLYKIIDELNVKPEGTRIAVAQY
SDDVKVESRFDEHQSKPEILNLVKRMKIKTGKALNLGYALDYAQRYIFVKSAGSRIEDGVLQFLVLLVAGRSSDRVDGPA
SNLKQSGVVPFIFQAKNADPAELEQIVLSPAFILAAESLPKIGDLHPQIVNLLKSVHNGAPAPVSGEKDVVFLLDGSEGV
RSGFPLLKEFVQRVVESLDVGQDRVRVAVVQYSDRTRPEFYLNSYMNKQDVVNAVRQLTLLGGPTPNTGAALEFVLRNIL
VSSAGSRITEGVPQLLIVLTADRSGDDVRNPSVVVKRGGAVPIGIGIGNADITEMQTISFIPDFAVAIPTFRQLGTVQQV
ISERVTQLTREELSRLQPVLQPLPSPGVGGKRDVVFLIDGSQSAGPEFQYVRTLIERLVDYLDVGFDTTRVAVIQFSDDP
KAEFLLNAHSSKDEVQNAVQRLRPKGGRQINVGNALEYVSRNIFKRPLGSRIEEGVPQFLVLISSGKSDDEVVVPAVELK
QFGVAPFTIARNADQEELVKISLSPEYVFSVSTFRELPSLEQKLLTPITTLTSEQIQKLLASTRYPPPAVESDAADIVFL
IDSSEGVRPDGFAHIRDFVSRIVRRLNIGPSKVRVGVVQFSNDVFPEFYLKTYRSQAPVLDAIRRLRLRGGSPLNTGKAL
EFVARNLFVKSAGSRIEDGVPQHLVLVLGGKSQDDVSRFAQVIRSSGIVSLGVGDRNIDRTELQTITNDPRLVFTVREFR
ELPNIEERIMNSFGPSAATPAPPGVDTPPPSRPEKKKADIVFLLDGSINFRRDSFQEVLRFVSEIVDTVYEDGDSIQVGL
VQYNSDPTDEFFLKDFSTKRQIIDAINKVVYKGGRHANTKVGLEHLRVNHFVPEAGSRLDQRVPQIAFVITGGKSVEDAQ
DVSLALTQRGVKVFAVGVRNIDSEEVGKIASNSATAFRVGNVQELSELSEQVLETLHDAMHETLCPGVTDAAKACNLDVI
LGFDGSRDQNVFVAQKGFESKVDAILNRISQMHRVSCSGGRSPTVRVSVVANTPSGPVEAFDFDEYQPEMLEKFRNMRSQ
HPYVLTEDTLKVYLNKFRQSSPDSVKVVIHFTDGADGDLADLHRASENLRQEGVRALILVGLERVVNLERLMHLEFGRGF
MYDRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGQRGDRGPIGSIGPKGIPGEDGYRGYPGDEGGPGERGPPGVNG
TQGFQGCPGQRGVKGSRGFPGEKGEVGEIGLDGLDGEDGDKGLPGSSGEKGNPGRRGDKGPRGEKGERGDVGIRGDPGNP
GQDSQERGPKGETGDLGPMGVPGRDGVPGGPGETGKNGGFGRRGPPGAKGNKGGPGQPGFEGEQGTRGAQGPAGPAGPPG
LIGEQGISGPRGSGGARGAPGERGRTGPLGRKGEPGEPGPKGGIGNPGPRGETGDDGRDGVGSEGRRGKKGERGFPGYPG
PKGNPGEPGLNGTTGPKGIRGRRGNSGPPGIVGQKGRPGYPGPAGPRGNRGDSIDQCALIQSIKDKCPCCYGPLECPVFP
TELAFALDTSEGVNQDTFGRMRDVVLSIVNVLTIAESNCPTGARVAVVTYNNEVTTEIRFADSKRKSVLLDKIKNLQVAL
TSKQQSLETAMSFVARNTFKRVRNGFLMRKVAVFFSNTPTRASPQLREAVLKLSDAGITPLFLTRQEDRQLINALQINNT
AVGHALVLPAGRDLTDFLENVLTCHVCLDICNIDPSCGFGSWRPSFRDRRAAGSDVDIDMAFILDSAETTTLFQFNEMKK
YIAYLVRQLDMSPDPKASQHFARVAVVQHAPSESVDNASMPPVKVEFSLTDYGSKEKLVDFLSRGMTQLQGTRALGSAIE
YTIENVFESAPNPRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDK
STELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVTTT
KPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKTATVRPPVAVKPATAAKPVAAKPAAVRPPAAAAK
PVATKPEVPRPQAAKPAATKPATTKPVVKMLREVQVFEITENSAKLHWERPEPPGPYFYDLTVTSAHDQSLVLKQNLTVT
DRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTC
RDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KNT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 58 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P12111 
_struct_ref_seq.db_align_beg                  3107 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  3164 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       58 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2KNT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.99 
_exptl_crystal.density_percent_sol   39. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              3.3 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.2M LI2SO4, 0.1M CITRIC ACID, 0.074M NA2HPO4, 1.6M (NH4)2SO4, 10MG/ML, PH3.3' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           291 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1995-12-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    YES 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.901 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'LURE BEAMLINE DW32' 
_diffrn_source.pdbx_synchrotron_site       LURE 
_diffrn_source.pdbx_synchrotron_beamline   DW32 
_diffrn_source.pdbx_wavelength             0.901 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2KNT 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.4 
_reflns.d_resolution_high            1.18 
_reflns.number_obs                   16657 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96. 
_reflns.pdbx_Rmerge_I_obs            0.055 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        46.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.9 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.18 
_reflns_shell.d_res_low              1.21 
_reflns_shell.percent_possible_all   52.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.75 
_reflns_shell.meanI_over_sigI_obs    1.09 
_reflns_shell.pdbx_redundancy        2.4 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2KNT 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     16307 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             7.0 
_refine.ls_d_res_high                            1.20 
_refine.ls_percent_reflns_obs                    96.0 
_refine.ls_R_factor_obs                          0.1455 
_refine.ls_R_factor_all                          0.1489 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.2057 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  1600 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     5876 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    BABINET 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1AAP' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'EVERY 10TH REFLECTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2KNT 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      5 
_refine_analyze.occupancy_sum_hydrogen          630 
_refine_analyze.occupancy_sum_non_hydrogen      476 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        476 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             51 
_refine_hist.number_atoms_total               532 
_refine_hist.d_res_high                       1.20 
_refine_hist.d_res_low                        7.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.024 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.033 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.148 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.13  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.043 ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.108 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    2KNT 
_pdbx_refine.R_factor_all_no_cutoff                      0.1489 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1455 
_pdbx_refine.free_R_factor_no_cutoff                     0.2057 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     10.0 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1600 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1395 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1361 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               11902 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  2KNT 
_struct.title                     'THE 1.2 ANGSTROM STRUCTURE OF KUNITZ TYPE DOMAIN C5' 
_struct.pdbx_descriptor           COLLAGEN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KNT 
_struct_keywords.pdbx_keywords   'KUNITZ INHIBITOR' 
_struct_keywords.text            'KUNITZ INHIBITOR, EXTRACELLULAR MATRIX, CONNECTIVE TISSUE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 3  ? LYS A 6  ? ASP A 3  LYS A 6  5 ? 4 
HELX_P HELX_P2 2 GLN A 48 ? CYS A 55 ? GLN A 48 CYS A 55 1 ? 8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 5  SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 5  A CYS 55 1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 14 A CYS 38 1_555 ? ? ? ? ? ? ? 1.997 ? 
disulf3 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 30 A CYS 51 1_555 ? ? ? ? ? ? ? 2.023 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 18 ? ASP A 24 ? ILE A 18 ASP A 24 
A 2 SER A 29 ? TYR A 35 ? SER A 29 TYR A 35 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    18 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     18 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    35 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     35 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'BINDING SITE FOR RESIDUE PO4 A 59' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 TRP A 21 ? TRP A 21  . ? 1_555 ? 
2 AC1 8 LYS A 28 ? LYS A 28  . ? 1_655 ? 
3 AC1 8 GLY A 46 ? GLY A 46  . ? 1_555 ? 
4 AC1 8 SER A 47 ? SER A 47  . ? 1_555 ? 
5 AC1 8 GLN A 48 ? GLN A 48  . ? 1_555 ? 
6 AC1 8 HOH C .  ? HOH A 215 . ? 1_555 ? 
7 AC1 8 HOH C .  ? HOH A 240 . ? 1_555 ? 
8 AC1 8 HOH C .  ? HOH A 242 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2KNT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2KNT 
_atom_sites.fract_transf_matrix[1][1]   0.038926 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.013555 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026288 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.036973 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLU A 1 1  ? -6.001  6.587   17.690 1.00 46.82 ? 1   GLU A N   1 
ATOM   2   C CA  . GLU A 1 1  ? -6.042  8.067   17.709 1.00 43.68 ? 1   GLU A CA  1 
ATOM   3   C C   . GLU A 1 1  ? -6.263  8.684   16.310 1.00 39.68 ? 1   GLU A C   1 
ATOM   4   O O   . GLU A 1 1  ? -7.393  8.599   15.782 1.00 41.95 ? 1   GLU A O   1 
ATOM   5   C CB  . GLU A 1 1  ? -4.652  8.481   18.213 1.00 47.71 ? 1   GLU A CB  1 
ATOM   6   C CG  . GLU A 1 1  ? -4.133  9.770   17.622 1.00 49.07 ? 1   GLU A CG  1 
ATOM   7   C CD  . GLU A 1 1  ? -3.046  10.405  18.466 1.00 53.05 ? 1   GLU A CD  1 
ATOM   8   O OE1 . GLU A 1 1  ? -2.928  10.099  19.673 1.00 58.22 ? 1   GLU A OE1 1 
ATOM   9   O OE2 . GLU A 1 1  ? -2.267  11.216  17.906 1.00 53.46 ? 1   GLU A OE2 1 
ATOM   10  N N   . THR A 1 2  ? -5.217  9.195   15.734 1.00 38.24 ? 2   THR A N   1 
ATOM   11  C CA  . THR A 1 2  ? -5.192  9.704   14.353 1.00 31.77 ? 2   THR A CA  1 
ATOM   12  C C   . THR A 1 2  ? -5.412  8.472   13.419 1.00 30.74 ? 2   THR A C   1 
ATOM   13  O O   . THR A 1 2  ? -4.873  7.421   13.776 1.00 33.96 ? 2   THR A O   1 
ATOM   14  C CB  . THR A 1 2  ? -3.799  10.232  14.044 1.00 33.46 ? 2   THR A CB  1 
ATOM   15  O OG1 A THR A 1 2  ? -3.531  11.274  14.949 0.37 38.79 ? 2   THR A OG1 1 
ATOM   16  O OG1 B THR A 1 2  ? -3.475  9.974   12.706 0.63 25.92 ? 2   THR A OG1 1 
ATOM   17  C CG2 A THR A 1 2  ? -3.652  10.656  12.623 0.37 30.26 ? 2   THR A CG2 1 
ATOM   18  C CG2 B THR A 1 2  ? -2.850  9.704   15.056 0.63 31.50 ? 2   THR A CG2 1 
ATOM   19  N N   . ASP A 1 3  ? -5.944  8.680   12.232 1.00 31.11 ? 3   ASP A N   1 
ATOM   20  C CA  . ASP A 1 3  ? -6.088  7.654   11.247 1.00 28.70 ? 3   ASP A CA  1 
ATOM   21  C C   . ASP A 1 3  ? -4.773  6.993   10.862 1.00 28.53 ? 3   ASP A C   1 
ATOM   22  O O   . ASP A 1 3  ? -4.805  5.958   10.269 1.00 28.78 ? 3   ASP A O   1 
ATOM   23  C CB  . ASP A 1 3  ? -6.911  7.921   10.044 1.00 32.96 ? 3   ASP A CB  1 
ATOM   24  C CG  A ASP A 1 3  ? -6.313  7.420   8.744  0.44 36.50 ? 3   ASP A CG  1 
ATOM   25  C CG  B ASP A 1 3  ? -8.389  7.671   10.186 0.56 34.34 ? 3   ASP A CG  1 
ATOM   26  O OD1 A ASP A 1 3  ? -5.477  8.159   8.170  0.44 37.04 ? 3   ASP A OD1 1 
ATOM   27  O OD1 B ASP A 1 3  ? -9.003  8.431   10.940 0.56 35.63 ? 3   ASP A OD1 1 
ATOM   28  O OD2 A ASP A 1 3  ? -6.560  6.257   8.384  0.44 40.64 ? 3   ASP A OD2 1 
ATOM   29  O OD2 B ASP A 1 3  ? -8.913  6.820   9.430  0.56 39.01 ? 3   ASP A OD2 1 
ATOM   30  N N   . ILE A 1 4  ? -3.607  7.615   11.160 1.00 22.35 ? 4   ILE A N   1 
ATOM   31  C CA  . ILE A 1 4  ? -2.334  6.870   10.852 1.00 19.91 ? 4   ILE A CA  1 
ATOM   32  C C   . ILE A 1 4  ? -2.305  5.587   11.673 1.00 18.99 ? 4   ILE A C   1 
ATOM   33  O O   . ILE A 1 4  ? -1.800  4.566   11.194 1.00 18.15 ? 4   ILE A O   1 
ATOM   34  C CB  . ILE A 1 4  ? -1.146  7.763   11.264 1.00 20.85 ? 4   ILE A CB  1 
ATOM   35  C CG1 . ILE A 1 4  ? -0.968  9.039   10.427 1.00 22.09 ? 4   ILE A CG1 1 
ATOM   36  C CG2 . ILE A 1 4  ? 0.094   7.037   11.577 1.00 25.90 ? 4   ILE A CG2 1 
ATOM   37  C CD1 . ILE A 1 4  ? -1.246  8.866   8.973  1.00 35.71 ? 4   ILE A CD1 1 
ATOM   38  N N   . CYS A 1 5  ? -2.889  5.536   12.863 1.00 18.10 ? 5   CYS A N   1 
ATOM   39  C CA  . CYS A 1 5  ? -2.874  4.314   13.660 1.00 18.66 ? 5   CYS A CA  1 
ATOM   40  C C   . CYS A 1 5  ? -3.727  3.190   13.072 1.00 19.42 ? 5   CYS A C   1 
ATOM   41  O O   . CYS A 1 5  ? -3.613  2.028   13.506 1.00 23.21 ? 5   CYS A O   1 
ATOM   42  C CB  . CYS A 1 5  ? -3.348  4.593   15.067 1.00 20.08 ? 5   CYS A CB  1 
ATOM   43  S SG  . CYS A 1 5  ? -2.324  5.801   15.939 1.00 20.85 ? 5   CYS A SG  1 
ATOM   44  N N   . LYS A 1 6  ? -4.590  3.537   12.104 1.00 21.24 ? 6   LYS A N   1 
ATOM   45  C CA  . LYS A 1 6  ? -5.484  2.557   11.517 1.00 22.87 ? 6   LYS A CA  1 
ATOM   46  C C   . LYS A 1 6  ? -4.961  2.032   10.193 1.00 23.28 ? 6   LYS A C   1 
ATOM   47  O O   . LYS A 1 6  ? -5.588  1.177   9.586  1.00 23.32 ? 6   LYS A O   1 
ATOM   48  C CB  . LYS A 1 6  ? -6.915  3.026   11.349 1.00 25.96 ? 6   LYS A CB  1 
ATOM   49  C CG  . LYS A 1 6  ? -7.606  3.533   12.585 1.00 28.73 ? 6   LYS A CG  1 
ATOM   50  C CD  . LYS A 1 6  ? -8.834  4.376   12.173 1.00 30.11 ? 6   LYS A CD  1 
ATOM   51  C CE  . LYS A 1 6  ? -9.462  4.996   13.369 1.00 29.92 ? 6   LYS A CE  1 
ATOM   52  N NZ  . LYS A 1 6  ? -10.555 5.981   12.896 1.00 33.32 ? 6   LYS A NZ  1 
ATOM   53  N N   . LEU A 1 7  ? -3.792  2.544   9.754  1.00 22.24 ? 7   LEU A N   1 
ATOM   54  C CA  . LEU A 1 7  ? -3.206  2.053   8.506  1.00 22.31 ? 7   LEU A CA  1 
ATOM   55  C C   . LEU A 1 7  ? -2.786  0.615   8.670  1.00 20.05 ? 7   LEU A C   1 
ATOM   56  O O   . LEU A 1 7  ? -2.401  0.143   9.764  1.00 19.85 ? 7   LEU A O   1 
ATOM   57  C CB  . LEU A 1 7  ? -2.002  2.964   8.165  1.00 22.63 ? 7   LEU A CB  1 
ATOM   58  C CG  . LEU A 1 7  ? -2.264  4.371   7.758  1.00 23.56 ? 7   LEU A CG  1 
ATOM   59  C CD1 . LEU A 1 7  ? -1.040  5.240   7.690  1.00 23.80 ? 7   LEU A CD1 1 
ATOM   60  C CD2 . LEU A 1 7  ? -3.143  4.495   6.500  1.00 28.50 ? 7   LEU A CD2 1 
ATOM   61  N N   . PRO A 1 8  ? -2.826  -0.164  7.621  1.00 20.65 ? 8   PRO A N   1 
ATOM   62  C CA  . PRO A 1 8  ? -2.390  -1.572  7.718  1.00 20.49 ? 8   PRO A CA  1 
ATOM   63  C C   . PRO A 1 8  ? -0.884  -1.691  7.967  1.00 19.50 ? 8   PRO A C   1 
ATOM   64  O O   . PRO A 1 8  ? -0.071  -0.826  7.567  1.00 19.58 ? 8   PRO A O   1 
ATOM   65  C CB  . PRO A 1 8  ? -2.661  -2.077  6.271  1.00 22.43 ? 8   PRO A CB  1 
ATOM   66  C CG  . PRO A 1 8  ? -2.736  -0.840  5.441  1.00 27.24 ? 8   PRO A CG  1 
ATOM   67  C CD  . PRO A 1 8  ? -3.338  0.217   6.316  1.00 24.51 ? 8   PRO A CD  1 
ATOM   68  N N   . LYS A 1 9  ? -0.527  -2.801  8.593  1.00 17.38 ? 9   LYS A N   1 
ATOM   69  C CA  . LYS A 1 9  ? 0.856   -3.182  8.662  1.00 17.10 ? 9   LYS A CA  1 
ATOM   70  C C   . LYS A 1 9  ? 1.449   -3.269  7.275  1.00 17.81 ? 9   LYS A C   1 
ATOM   71  O O   . LYS A 1 9  ? 0.886   -3.948  6.391  1.00 19.66 ? 9   LYS A O   1 
ATOM   72  C CB  . LYS A 1 9  ? 0.919   -4.569  9.384  1.00 18.71 ? 9   LYS A CB  1 
ATOM   73  C CG  . LYS A 1 9  ? 2.301   -5.107  9.432  1.00 19.63 ? 9   LYS A CG  1 
ATOM   74  C CD  . LYS A 1 9  ? 2.310   -6.542  9.844  1.00 25.92 ? 9   LYS A CD  1 
ATOM   75  C CE  . LYS A 1 9  ? 2.257   -7.487  8.679  1.00 31.79 ? 9   LYS A CE  1 
ATOM   76  N NZ  . LYS A 1 9  ? 2.602   -8.861  9.055  1.00 41.05 ? 9   LYS A NZ  1 
ATOM   77  N N   . ASP A 1 10 ? 2.623   -2.683  7.075  1.00 17.70 ? 10  ASP A N   1 
ATOM   78  C CA  . ASP A 1 10 ? 3.270   -2.711  5.750  1.00 18.57 ? 10  ASP A CA  1 
ATOM   79  C C   . ASP A 1 10 ? 4.756   -2.986  5.905  1.00 16.59 ? 10  ASP A C   1 
ATOM   80  O O   . ASP A 1 10 ? 5.573   -2.172  6.282  1.00 16.67 ? 10  ASP A O   1 
ATOM   81  C CB  . ASP A 1 10 ? 3.009   -1.346  5.129  1.00 19.81 ? 10  ASP A CB  1 
ATOM   82  C CG  . ASP A 1 10 ? 3.533   -1.113  3.789  1.00 23.09 ? 10  ASP A CG  1 
ATOM   83  O OD1 . ASP A 1 10 ? 4.091   -2.089  3.202  1.00 23.78 ? 10  ASP A OD1 1 
ATOM   84  O OD2 . ASP A 1 10 ? 3.389   0.039   3.269  1.00 30.32 ? 10  ASP A OD2 1 
ATOM   85  N N   . GLU A 1 11 ? 5.108   -4.271  5.602  1.00 16.51 ? 11  GLU A N   1 
ATOM   86  C CA  . GLU A 1 11 ? 6.461   -4.732  5.731  1.00 17.35 ? 11  GLU A CA  1 
ATOM   87  C C   . GLU A 1 11 ? 7.351   -4.124  4.654  1.00 17.74 ? 11  GLU A C   1 
ATOM   88  O O   . GLU A 1 11 ? 8.564   -4.115  4.768  1.00 16.10 ? 11  GLU A O   1 
ATOM   89  C CB  . GLU A 1 11 ? 6.452   -6.298  5.582  1.00 20.48 ? 11  GLU A CB  1 
ATOM   90  C CG  . GLU A 1 11 ? 5.833   -6.921  6.839  1.00 22.18 ? 11  GLU A CG  1 
ATOM   91  C CD  . GLU A 1 11 ? 5.759   -8.435  6.739  1.00 28.64 ? 11  GLU A CD  1 
ATOM   92  O OE1 . GLU A 1 11 ? 5.952   -8.921  5.606  1.00 34.19 ? 11  GLU A OE1 1 
ATOM   93  O OE2 . GLU A 1 11 ? 5.322   -9.072  7.688  1.00 35.22 ? 11  GLU A OE2 1 
ATOM   94  N N   . GLY A 1 12 ? 6.782   -3.562  3.621  1.00 18.61 ? 12  GLY A N   1 
ATOM   95  C CA  . GLY A 1 12 ? 7.584   -2.865  2.631  1.00 18.03 ? 12  GLY A CA  1 
ATOM   96  C C   . GLY A 1 12 ? 8.441   -3.866  1.851  1.00 17.63 ? 12  GLY A C   1 
ATOM   97  O O   . GLY A 1 12 ? 8.123   -5.044  1.711  1.00 19.82 ? 12  GLY A O   1 
ATOM   98  N N   . THR A 1 13 ? 9.504   -3.258  1.301  1.00 18.37 ? 13  THR A N   1 
ATOM   99  C CA  . THR A 1 13 ? 10.487  -3.984  0.503  1.00 19.18 ? 13  THR A CA  1 
ATOM   100 C C   . THR A 1 13 ? 11.884  -3.456  0.809  1.00 17.61 ? 13  THR A C   1 
ATOM   101 O O   . THR A 1 13 ? 12.062  -2.712  1.804  1.00 18.97 ? 13  THR A O   1 
ATOM   102 C CB  . THR A 1 13 ? 10.169  -3.888  -0.972 1.00 22.08 ? 13  THR A CB  1 
ATOM   103 O OG1 A THR A 1 13 ? 10.926  -4.960  -1.667 0.66 23.40 ? 13  THR A OG1 1 
ATOM   104 O OG1 B THR A 1 13 ? 9.832   -2.480  -1.280 0.34 22.11 ? 13  THR A OG1 1 
ATOM   105 C CG2 A THR A 1 13 ? 10.486  -2.587  -1.606 0.66 24.08 ? 13  THR A CG2 1 
ATOM   106 C CG2 B THR A 1 13 ? 8.943   -4.603  -1.425 0.34 22.67 ? 13  THR A CG2 1 
ATOM   107 N N   . CYS A 1 14 ? 12.888  -3.935  0.100  1.00 18.49 ? 14  CYS A N   1 
ATOM   108 C CA  . CYS A 1 14 ? 14.257  -3.676  0.431  1.00 19.08 ? 14  CYS A CA  1 
ATOM   109 C C   . CYS A 1 14 ? 14.771  -4.631  1.497  1.00 19.98 ? 14  CYS A C   1 
ATOM   110 O O   . CYS A 1 14 ? 13.937  -5.375  2.035  1.00 20.14 ? 14  CYS A O   1 
ATOM   111 C CB  . CYS A 1 14 ? 14.538  -2.235  0.756  1.00 20.61 ? 14  CYS A CB  1 
ATOM   112 S SG  . CYS A 1 14 ? 14.261  -1.239  -0.693 1.00 22.22 ? 14  CYS A SG  1 
ATOM   113 N N   . ARG A 1 15 ? 16.039  -4.755  1.697  1.00 22.61 ? 15  ARG A N   1 
ATOM   114 C CA  . ARG A 1 15 ? 16.646  -5.771  2.550  1.00 23.79 ? 15  ARG A CA  1 
ATOM   115 C C   . ARG A 1 15 ? 17.477  -5.177  3.644  1.00 22.43 ? 15  ARG A C   1 
ATOM   116 O O   . ARG A 1 15 ? 18.447  -5.721  4.169  1.00 26.12 ? 15  ARG A O   1 
ATOM   117 C CB  . ARG A 1 15 ? 17.359  -6.832  1.731  1.00 26.94 ? 15  ARG A CB  1 
ATOM   118 C CG  . ARG A 1 15 ? 16.563  -7.482  0.631  1.00 31.49 ? 15  ARG A CG  1 
ATOM   119 C CD  . ARG A 1 15 ? 15.793  -8.700  1.100  1.00 35.82 ? 15  ARG A CD  1 
ATOM   120 N NE  . ARG A 1 15 ? 14.901  -9.225  0.013  1.00 39.37 ? 15  ARG A NE  1 
ATOM   121 C CZ  . ARG A 1 15 ? 15.191  -10.264 -0.736 1.00 39.98 ? 15  ARG A CZ  1 
ATOM   122 N NH1 . ARG A 1 15 ? 16.177  -11.087 -0.358 1.00 41.69 ? 15  ARG A NH1 1 
ATOM   123 N NH2 . ARG A 1 15 ? 14.521  -10.565 -1.858 1.00 45.69 ? 15  ARG A NH2 1 
ATOM   124 N N   . ASP A 1 16 ? 17.039  -3.957  4.104  1.00 21.56 ? 16  ASP A N   1 
ATOM   125 C CA  . ASP A 1 16 ? 17.697  -3.374  5.286  1.00 20.06 ? 16  ASP A CA  1 
ATOM   126 C C   . ASP A 1 16 ? 16.783  -3.560  6.469  1.00 18.44 ? 16  ASP A C   1 
ATOM   127 O O   . ASP A 1 16 ? 16.124  -2.649  6.958  1.00 18.80 ? 16  ASP A O   1 
ATOM   128 C CB  . ASP A 1 16 ? 18.049  -1.869  5.129  1.00 22.17 ? 16  ASP A CB  1 
ATOM   129 C CG  A ASP A 1 16 ? 18.694  -1.306  6.373  0.55 25.01 ? 16  ASP A CG  1 
ATOM   130 C CG  B ASP A 1 16 ? 18.882  -1.581  3.916  0.45 22.21 ? 16  ASP A CG  1 
ATOM   131 O OD1 A ASP A 1 16 ? 19.267  -1.990  7.220  0.55 26.98 ? 16  ASP A OD1 1 
ATOM   132 O OD1 B ASP A 1 16 ? 19.797  -2.321  3.668  0.45 23.51 ? 16  ASP A OD1 1 
ATOM   133 O OD2 A ASP A 1 16 ? 18.657  -0.019  6.529  0.55 30.93 ? 16  ASP A OD2 1 
ATOM   134 O OD2 B ASP A 1 16 ? 18.671  -0.600  3.176  0.45 26.00 ? 16  ASP A OD2 1 
ATOM   135 N N   . PHE A 1 17 ? 16.603  -4.811  6.871  1.00 17.06 ? 17  PHE A N   1 
ATOM   136 C CA  . PHE A 1 17 ? 15.606  -5.194  7.835  1.00 15.02 ? 17  PHE A CA  1 
ATOM   137 C C   . PHE A 1 17 ? 15.793  -4.660  9.225  1.00 13.73 ? 17  PHE A C   1 
ATOM   138 O O   . PHE A 1 17 ? 16.848  -4.806  9.810  1.00 19.38 ? 17  PHE A O   1 
ATOM   139 C CB  . PHE A 1 17 ? 15.414  -6.722  7.899  1.00 18.66 ? 17  PHE A CB  1 
ATOM   140 C CG  . PHE A 1 17 ? 14.930  -7.258  6.582  1.00 19.64 ? 17  PHE A CG  1 
ATOM   141 C CD1 . PHE A 1 17 ? 13.614  -7.190  6.244  1.00 22.92 ? 17  PHE A CD1 1 
ATOM   142 C CD2 . PHE A 1 17 ? 15.836  -7.886  5.705  1.00 21.26 ? 17  PHE A CD2 1 
ATOM   143 C CE1 . PHE A 1 17 ? 13.190  -7.704  4.995  1.00 25.60 ? 17  PHE A CE1 1 
ATOM   144 C CE2 . PHE A 1 17 ? 15.409  -8.475  4.564  1.00 23.35 ? 17  PHE A CE2 1 
ATOM   145 C CZ  . PHE A 1 17 ? 14.087  -8.245  4.161  1.00 25.40 ? 17  PHE A CZ  1 
ATOM   146 N N   . ILE A 1 18 ? 14.707  -4.071  9.693  1.00 14.11 ? 18  ILE A N   1 
ATOM   147 C CA  . ILE A 1 18 ? 14.672  -3.500  11.027 1.00 14.08 ? 18  ILE A CA  1 
ATOM   148 C C   . ILE A 1 18 ? 13.339  -3.844  11.682 1.00 13.78 ? 18  ILE A C   1 
ATOM   149 O O   . ILE A 1 18 ? 12.294  -3.754  11.068 1.00 12.84 ? 18  ILE A O   1 
ATOM   150 C CB  . ILE A 1 18 ? 14.880  -1.977  11.037 1.00 15.50 ? 18  ILE A CB  1 
ATOM   151 C CG1 A ILE A 1 18 ? 16.281  -1.488  10.685 0.43 15.61 ? 18  ILE A CG1 1 
ATOM   152 C CG1 B ILE A 1 18 ? 15.141  -1.300  12.361 0.57 14.80 ? 18  ILE A CG1 1 
ATOM   153 C CG2 A ILE A 1 18 ? 14.571  -1.512  12.519 0.43 15.05 ? 18  ILE A CG2 1 
ATOM   154 C CG2 B ILE A 1 18 ? 13.904  -1.311  10.120 0.57 14.63 ? 18  ILE A CG2 1 
ATOM   155 C CD1 A ILE A 1 18 ? 16.397  0.022   10.774 0.43 14.34 ? 18  ILE A CD1 1 
ATOM   156 C CD1 B ILE A 1 18 ? 15.645  0.122   12.192 0.57 16.02 ? 18  ILE A CD1 1 
ATOM   157 N N   . LEU A 1 19 ? 13.417  -4.257  12.918 1.00 13.10 ? 19  LEU A N   1 
ATOM   158 C CA  . LEU A 1 19 ? 12.179  -4.598  13.681 1.00 13.70 ? 19  LEU A CA  1 
ATOM   159 C C   . LEU A 1 19 ? 11.562  -3.281  14.146 1.00 13.33 ? 19  LEU A C   1 
ATOM   160 O O   . LEU A 1 19 ? 12.179  -2.413  14.725 1.00 17.45 ? 19  LEU A O   1 
ATOM   161 C CB  . LEU A 1 19 ? 12.647  -5.363  14.934 1.00 16.47 ? 19  LEU A CB  1 
ATOM   162 C CG  . LEU A 1 19 ? 12.658  -6.836  14.868 1.00 22.30 ? 19  LEU A CG  1 
ATOM   163 C CD1 . LEU A 1 19 ? 13.189  -7.366  16.211 1.00 29.70 ? 19  LEU A CD1 1 
ATOM   164 C CD2 . LEU A 1 19 ? 11.332  -7.491  14.554 1.00 23.44 ? 19  LEU A CD2 1 
ATOM   165 N N   . LYS A 1 20 ? 10.274  -3.171  13.807 1.00 11.05 ? 20  LYS A N   1 
ATOM   166 C CA  . LYS A 1 20 ? 9.432   -2.059  14.103 1.00 10.87 ? 20  LYS A CA  1 
ATOM   167 C C   . LYS A 1 20 ? 8.165   -2.470  14.825 1.00 10.72 ? 20  LYS A C   1 
ATOM   168 O O   . LYS A 1 20 ? 7.892   -3.674  14.896 1.00 11.80 ? 20  LYS A O   1 
ATOM   169 C CB  . LYS A 1 20 ? 9.093   -1.297  12.828 1.00 12.18 ? 20  LYS A CB  1 
ATOM   170 C CG  . LYS A 1 20 ? 10.263  -0.676  12.069 1.00 13.25 ? 20  LYS A CG  1 
ATOM   171 C CD  . LYS A 1 20 ? 10.860  0.466   12.845 1.00 14.69 ? 20  LYS A CD  1 
ATOM   172 C CE  . LYS A 1 20 ? 11.820  1.282   11.999 1.00 15.71 ? 20  LYS A CE  1 
ATOM   173 N NZ  . LYS A 1 20 ? 12.323  2.468   12.697 1.00 20.26 ? 20  LYS A NZ  1 
ATOM   174 N N   . TRP A 1 21 ? 7.372   -1.525  15.260 1.00 10.81 ? 21  TRP A N   1 
ATOM   175 C CA  . TRP A 1 21 ? 6.069   -1.841  15.889 1.00 10.29 ? 21  TRP A CA  1 
ATOM   176 C C   . TRP A 1 21 ? 4.995   -1.093  15.115 1.00 10.10 ? 21  TRP A C   1 
ATOM   177 O O   . TRP A 1 21 ? 5.188   0.031   14.655 1.00 11.58 ? 21  TRP A O   1 
ATOM   178 C CB  . TRP A 1 21 ? 6.084   -1.264  17.330 1.00 12.35 ? 21  TRP A CB  1 
ATOM   179 C CG  . TRP A 1 21 ? 7.067   -2.007  18.205 1.00 12.64 ? 21  TRP A CG  1 
ATOM   180 C CD1 . TRP A 1 21 ? 8.408   -1.784  18.304 1.00 13.64 ? 21  TRP A CD1 1 
ATOM   181 C CD2 . TRP A 1 21 ? 6.765   -3.102  19.074 1.00 13.52 ? 21  TRP A CD2 1 
ATOM   182 N NE1 . TRP A 1 21 ? 8.976   -2.702  19.166 1.00 15.26 ? 21  TRP A NE1 1 
ATOM   183 C CE2 . TRP A 1 21 ? 7.971   -3.510  19.668 1.00 14.31 ? 21  TRP A CE2 1 
ATOM   184 C CE3 . TRP A 1 21 ? 5.607   -3.771  19.393 1.00 13.65 ? 21  TRP A CE3 1 
ATOM   185 C CZ2 . TRP A 1 21 ? 8.020   -4.562  20.585 1.00 15.62 ? 21  TRP A CZ2 1 
ATOM   186 C CZ3 . TRP A 1 21 ? 5.637   -4.800  20.296 1.00 14.66 ? 21  TRP A CZ3 1 
ATOM   187 C CH2 . TRP A 1 21 ? 6.850   -5.196  20.889 1.00 15.42 ? 21  TRP A CH2 1 
ATOM   188 N N   . TYR A 1 22 ? 3.806   -1.677  15.025 1.00 11.50 ? 22  TYR A N   1 
ATOM   189 C CA  . TYR A 1 22 ? 2.642   -1.083  14.455 1.00 12.06 ? 22  TYR A CA  1 
ATOM   190 C C   . TYR A 1 22 ? 1.439   -1.272  15.407 1.00 11.29 ? 22  TYR A C   1 
ATOM   191 O O   . TYR A 1 22 ? 1.424   -2.222  16.150 1.00 11.91 ? 22  TYR A O   1 
ATOM   192 C CB  . TYR A 1 22 ? 2.294   -1.651  13.066 1.00 14.13 ? 22  TYR A CB  1 
ATOM   193 C CG  . TYR A 1 22 ? 1.595   -2.949  13.068 1.00 15.68 ? 22  TYR A CG  1 
ATOM   194 C CD1 . TYR A 1 22 ? 2.331   -4.119  13.350 1.00 15.91 ? 22  TYR A CD1 1 
ATOM   195 C CD2 . TYR A 1 22 ? 0.228   -3.071  12.871 1.00 18.09 ? 22  TYR A CD2 1 
ATOM   196 C CE1 . TYR A 1 22 ? 1.655   -5.357  13.362 1.00 17.97 ? 22  TYR A CE1 1 
ATOM   197 C CE2 . TYR A 1 22 ? -0.391  -4.286  12.861 1.00 18.38 ? 22  TYR A CE2 1 
ATOM   198 C CZ  . TYR A 1 22 ? 0.331   -5.422  13.139 1.00 18.09 ? 22  TYR A CZ  1 
ATOM   199 O OH  . TYR A 1 22 ? -0.310  -6.645  13.208 1.00 23.25 ? 22  TYR A OH  1 
ATOM   200 N N   . TYR A 1 23 ? 0.472   -0.374  15.286 1.00 12.17 ? 23  TYR A N   1 
ATOM   201 C CA  . TYR A 1 23 ? -0.756  -0.512  16.083 1.00 12.99 ? 23  TYR A CA  1 
ATOM   202 C C   . TYR A 1 23 ? -1.800  -1.349  15.326 1.00 13.10 ? 23  TYR A C   1 
ATOM   203 O O   . TYR A 1 23 ? -2.094  -1.083  14.163 1.00 13.68 ? 23  TYR A O   1 
ATOM   204 C CB  . TYR A 1 23 ? -1.339  0.836   16.387 1.00 14.57 ? 23  TYR A CB  1 
ATOM   205 C CG  . TYR A 1 23 ? -2.563  0.836   17.261 1.00 14.53 ? 23  TYR A CG  1 
ATOM   206 C CD1 . TYR A 1 23 ? -2.502  0.521   18.610 1.00 16.65 ? 23  TYR A CD1 1 
ATOM   207 C CD2 . TYR A 1 23 ? -3.790  1.107   16.678 1.00 17.36 ? 23  TYR A CD2 1 
ATOM   208 C CE1 . TYR A 1 23 ? -3.618  0.510   19.421 1.00 17.61 ? 23  TYR A CE1 1 
ATOM   209 C CE2 . TYR A 1 23 ? -4.948  1.116   17.512 1.00 19.04 ? 23  TYR A CE2 1 
ATOM   210 C CZ  . TYR A 1 23 ? -4.829  0.840   18.836 1.00 20.32 ? 23  TYR A CZ  1 
ATOM   211 O OH  . TYR A 1 23 ? -5.993  0.799   19.614 1.00 22.54 ? 23  TYR A OH  1 
ATOM   212 N N   . ASP A 1 24 ? -2.348  -2.323  16.035 1.00 13.06 ? 24  ASP A N   1 
ATOM   213 C CA  . ASP A 1 24 ? -3.424  -3.142  15.522 1.00 15.38 ? 24  ASP A CA  1 
ATOM   214 C C   . ASP A 1 24 ? -4.760  -2.694  16.136 1.00 16.01 ? 24  ASP A C   1 
ATOM   215 O O   . ASP A 1 24 ? -5.001  -3.004  17.295 1.00 16.26 ? 24  ASP A O   1 
ATOM   216 C CB  . ASP A 1 24 ? -3.172  -4.605  15.828 1.00 15.28 ? 24  ASP A CB  1 
ATOM   217 C CG  . ASP A 1 24 ? -4.162  -5.560  15.204 1.00 17.07 ? 24  ASP A CG  1 
ATOM   218 O OD1 . ASP A 1 24 ? -5.244  -5.144  14.754 1.00 20.74 ? 24  ASP A OD1 1 
ATOM   219 O OD2 . ASP A 1 24 ? -3.922  -6.767  15.235 1.00 21.84 ? 24  ASP A OD2 1 
ATOM   220 N N   . PRO A 1 25 ? -5.652  -2.061  15.345 1.00 17.12 ? 25  PRO A N   1 
ATOM   221 C CA  . PRO A 1 25 ? -6.917  -1.619  15.960 1.00 18.51 ? 25  PRO A CA  1 
ATOM   222 C C   . PRO A 1 25 ? -7.795  -2.731  16.408 1.00 18.56 ? 25  PRO A C   1 
ATOM   223 O O   . PRO A 1 25 ? -8.634  -2.527  17.305 1.00 21.74 ? 25  PRO A O   1 
ATOM   224 C CB  . PRO A 1 25 ? -7.529  -0.690  14.954 1.00 20.03 ? 25  PRO A CB  1 
ATOM   225 C CG  . PRO A 1 25 ? -6.879  -1.005  13.647 1.00 23.43 ? 25  PRO A CG  1 
ATOM   226 C CD  . PRO A 1 25 ? -5.533  -1.608  13.976 1.00 19.11 ? 25  PRO A CD  1 
ATOM   227 N N   . ASN A 1 26 ? -7.604  -3.926  15.859 1.00 18.17 ? 26  ASN A N   1 
ATOM   228 C CA  . ASN A 1 26 ? -8.472  -5.031  16.278 1.00 17.76 ? 26  ASN A CA  1 
ATOM   229 C C   . ASN A 1 26 ? -8.163  -5.596  17.614 1.00 19.42 ? 26  ASN A C   1 
ATOM   230 O O   . ASN A 1 26 ? -9.003  -6.124  18.333 1.00 21.81 ? 26  ASN A O   1 
ATOM   231 C CB  . ASN A 1 26 ? -8.384  -6.135  15.192 1.00 18.31 ? 26  ASN A CB  1 
ATOM   232 C CG  . ASN A 1 26 ? -8.844  -5.614  13.867 1.00 19.90 ? 26  ASN A CG  1 
ATOM   233 O OD1 . ASN A 1 26 ? -9.778  -4.817  13.843 1.00 22.48 ? 26  ASN A OD1 1 
ATOM   234 N ND2 . ASN A 1 26 ? -8.170  -6.028  12.825 1.00 24.31 ? 26  ASN A ND2 1 
ATOM   235 N N   . THR A 1 27 ? -6.847  -5.480  18.002 1.00 19.00 ? 27  THR A N   1 
ATOM   236 C CA  . THR A 1 27 ? -6.492  -5.943  19.352 1.00 19.65 ? 27  THR A CA  1 
ATOM   237 C C   . THR A 1 27 ? -6.269  -4.775  20.294 1.00 19.01 ? 27  THR A C   1 
ATOM   238 O O   . THR A 1 27 ? -5.980  -4.978  21.458 1.00 24.76 ? 27  THR A O   1 
ATOM   239 C CB  . THR A 1 27 ? -5.214  -6.809  19.312 1.00 18.73 ? 27  THR A CB  1 
ATOM   240 O OG1 . THR A 1 27 ? -4.149  -5.999  18.829 1.00 17.75 ? 27  THR A OG1 1 
ATOM   241 C CG2 . THR A 1 27 ? -5.399  -8.029  18.454 1.00 21.05 ? 27  THR A CG2 1 
ATOM   242 N N   . LYS A 1 28 ? -6.282  -3.555  19.745 1.00 20.78 ? 28  LYS A N   1 
ATOM   243 C CA  . LYS A 1 28 ? -6.043  -2.343  20.504 1.00 20.69 ? 28  LYS A CA  1 
ATOM   244 C C   . LYS A 1 28 ? -4.702  -2.332  21.146 1.00 19.55 ? 28  LYS A C   1 
ATOM   245 O O   . LYS A 1 28 ? -4.472  -1.900  22.282 1.00 23.44 ? 28  LYS A O   1 
ATOM   246 C CB  . LYS A 1 28 ? -7.225  -2.033  21.426 1.00 22.93 ? 28  LYS A CB  1 
ATOM   247 C CG  . LYS A 1 28 ? -8.550  -2.050  20.775 1.00 32.22 ? 28  LYS A CG  1 
ATOM   248 C CD  . LYS A 1 28 ? -9.581  -1.205  21.536 1.00 32.55 ? 28  LYS A CD  1 
ATOM   249 C CE  . LYS A 1 28 ? -10.259 -0.305  20.514 1.00 37.04 ? 28  LYS A CE  1 
ATOM   250 N NZ  . LYS A 1 28 ? -11.759 -0.318  20.736 1.00 48.85 ? 28  LYS A NZ  1 
ATOM   251 N N   . SER A 1 29 ? -3.707  -2.883  20.434 1.00 18.64 ? 29  SER A N   1 
ATOM   252 C CA  . SER A 1 29 ? -2.359  -2.939  20.990 1.00 16.99 ? 29  SER A CA  1 
ATOM   253 C C   . SER A 1 29 ? -1.340  -2.980  19.829 1.00 15.12 ? 29  SER A C   1 
ATOM   254 O O   . SER A 1 29 ? -1.715  -3.217  18.698 1.00 14.67 ? 29  SER A O   1 
ATOM   255 C CB  . SER A 1 29 ? -2.138  -4.154  21.859 1.00 18.79 ? 29  SER A CB  1 
ATOM   256 O OG  . SER A 1 29 ? -2.280  -5.310  21.080 1.00 23.65 ? 29  SER A OG  1 
ATOM   257 N N   . CYS A 1 30 ? -0.093  -2.710  20.166 1.00 13.68 ? 30  CYS A N   1 
ATOM   258 C CA  . CYS A 1 30 ? 0.972   -2.740  19.147 1.00 13.79 ? 30  CYS A CA  1 
ATOM   259 C C   . CYS A 1 30 ? 1.684   -4.060  19.089 1.00 13.72 ? 30  CYS A C   1 
ATOM   260 O O   . CYS A 1 30 ? 1.804   -4.802  20.078 1.00 16.54 ? 30  CYS A O   1 
ATOM   261 C CB  . CYS A 1 30 ? 2.020   -1.651  19.577 1.00 13.98 ? 30  CYS A CB  1 
ATOM   262 S SG  . CYS A 1 30 ? 1.315   0.008   19.487 1.00 15.04 ? 30  CYS A SG  1 
ATOM   263 N N   . ALA A 1 31 ? 2.138   -4.405  17.879 1.00 13.99 ? 31  ALA A N   1 
ATOM   264 C CA  . ALA A 1 31 ? 2.815   -5.683  17.653 1.00 14.00 ? 31  ALA A CA  1 
ATOM   265 C C   . ALA A 1 31 ? 4.054   -5.466  16.801 1.00 13.13 ? 31  ALA A C   1 
ATOM   266 O O   . ALA A 1 31 ? 4.175   -4.435  16.117 1.00 12.67 ? 31  ALA A O   1 
ATOM   267 C CB  . ALA A 1 31 ? 1.842   -6.647  17.026 1.00 17.75 ? 31  ALA A CB  1 
ATOM   268 N N   . ARG A 1 32 ? 4.998   -6.392  16.786 1.00 13.22 ? 32  ARG A N   1 
ATOM   269 C CA  . ARG A 1 32 ? 6.217   -6.240  16.027 1.00 13.84 ? 32  ARG A CA  1 
ATOM   270 C C   . ARG A 1 32 ? 6.065   -6.693  14.603 1.00 12.93 ? 32  ARG A C   1 
ATOM   271 O O   . ARG A 1 32 ? 5.317   -7.595  14.308 1.00 14.87 ? 32  ARG A O   1 
ATOM   272 C CB  . ARG A 1 32 ? 7.299   -7.209  16.510 1.00 17.50 ? 32  ARG A CB  1 
ATOM   273 C CG  . ARG A 1 32 ? 7.936   -6.820  17.876 1.00 24.50 ? 32  ARG A CG  1 
ATOM   274 C CD  . ARG A 1 32 ? 9.127   -7.687  18.206 1.00 30.08 ? 32  ARG A CD  1 
ATOM   275 N NE  . ARG A 1 32 ? 9.773   -7.595  19.488 1.00 35.20 ? 32  ARG A NE  1 
ATOM   276 C CZ  . ARG A 1 32 ? 9.373   -7.917  20.703 1.00 37.78 ? 32  ARG A CZ  1 
ATOM   277 N NH1 . ARG A 1 32 ? 8.248   -8.651  20.836 1.00 35.74 ? 32  ARG A NH1 1 
ATOM   278 N NH2 . ARG A 1 32 ? 10.010  -7.503  21.757 1.00 41.06 ? 32  ARG A NH2 1 
ATOM   279 N N   . PHE A 1 33 ? 6.878   -6.106  13.748 1.00 12.40 ? 33  PHE A N   1 
ATOM   280 C CA  . PHE A 1 33 ? 6.935   -6.536  12.364 1.00 12.03 ? 33  PHE A CA  1 
ATOM   281 C C   . PHE A 1 33 ? 8.312   -6.205  11.830 1.00 11.76 ? 33  PHE A C   1 
ATOM   282 O O   . PHE A 1 33 ? 8.993   -5.310  12.317 1.00 12.05 ? 33  PHE A O   1 
ATOM   283 C CB  . PHE A 1 33 ? 5.847   -5.949  11.496 1.00 13.06 ? 33  PHE A CB  1 
ATOM   284 C CG  . PHE A 1 33 ? 5.984   -4.530  11.076 1.00 13.04 ? 33  PHE A CG  1 
ATOM   285 C CD1 . PHE A 1 33 ? 5.702   -3.477  11.989 1.00 13.75 ? 33  PHE A CD1 1 
ATOM   286 C CD2 . PHE A 1 33 ? 6.326   -4.168  9.816  1.00 14.65 ? 33  PHE A CD2 1 
ATOM   287 C CE1 . PHE A 1 33 ? 5.778   -2.209  11.548 1.00 13.63 ? 33  PHE A CE1 1 
ATOM   288 C CE2 . PHE A 1 33 ? 6.402   -2.893  9.388  1.00 15.10 ? 33  PHE A CE2 1 
ATOM   289 C CZ  . PHE A 1 33 ? 6.113   -1.864  10.263 1.00 13.78 ? 33  PHE A CZ  1 
ATOM   290 N N   . TRP A 1 34 ? 8.733   -6.911  10.810 1.00 11.58 ? 34  TRP A N   1 
ATOM   291 C CA  . TRP A 1 34 ? 9.991   -6.630  10.116 1.00 11.59 ? 34  TRP A CA  1 
ATOM   292 C C   . TRP A 1 34 ? 9.746   -5.740  8.920  1.00 11.92 ? 34  TRP A C   1 
ATOM   293 O O   . TRP A 1 34 ? 8.908   -6.003  8.075  1.00 14.40 ? 34  TRP A O   1 
ATOM   294 C CB  . TRP A 1 34 ? 10.575  -7.973  9.590  1.00 12.38 ? 34  TRP A CB  1 
ATOM   295 C CG  . TRP A 1 34 ? 11.140  -8.835  10.646 1.00 13.08 ? 34  TRP A CG  1 
ATOM   296 C CD1 . TRP A 1 34 ? 10.582  -9.939  11.221 1.00 13.62 ? 34  TRP A CD1 1 
ATOM   297 C CD2 . TRP A 1 34 ? 12.434  -8.661  11.214 1.00 14.26 ? 34  TRP A CD2 1 
ATOM   298 N NE1 . TRP A 1 34 ? 11.455  -10.431 12.137 1.00 14.70 ? 34  TRP A NE1 1 
ATOM   299 C CE2 . TRP A 1 34 ? 12.606  -9.704  12.179 1.00 15.17 ? 34  TRP A CE2 1 
ATOM   300 C CE3 . TRP A 1 34 ? 13.462  -7.740  11.061 1.00 14.95 ? 34  TRP A CE3 1 
ATOM   301 C CZ2 . TRP A 1 34 ? 13.733  -9.822  12.917 1.00 18.68 ? 34  TRP A CZ2 1 
ATOM   302 C CZ3 . TRP A 1 34 ? 14.606  -7.861  11.791 1.00 18.20 ? 34  TRP A CZ3 1 
ATOM   303 C CH2 . TRP A 1 34 ? 14.767  -8.886  12.703 1.00 18.31 ? 34  TRP A CH2 1 
ATOM   304 N N   . TYR A 1 35 ? 10.432  -4.584  8.948  1.00 11.58 ? 35  TYR A N   1 
ATOM   305 C CA  . TYR A 1 35 ? 10.326  -3.598  7.849  1.00 12.05 ? 35  TYR A CA  1 
ATOM   306 C C   . TYR A 1 35 ? 11.627  -3.681  7.030  1.00 12.33 ? 35  TYR A C   1 
ATOM   307 O O   . TYR A 1 35 ? 12.718  -3.617  7.556  1.00 14.43 ? 35  TYR A O   1 
ATOM   308 C CB  . TYR A 1 35 ? 10.177  -2.220  8.461  1.00 12.07 ? 35  TYR A CB  1 
ATOM   309 C CG  . TYR A 1 35 ? 10.115  -1.086  7.450  1.00 12.51 ? 35  TYR A CG  1 
ATOM   310 C CD1 . TYR A 1 35 ? 9.230   -1.112  6.414  1.00 14.80 ? 35  TYR A CD1 1 
ATOM   311 C CD2 . TYR A 1 35 ? 11.016  -0.003  7.550  1.00 14.37 ? 35  TYR A CD2 1 
ATOM   312 C CE1 . TYR A 1 35 ? 9.163   -0.098  5.413  1.00 15.76 ? 35  TYR A CE1 1 
ATOM   313 C CE2 . TYR A 1 35 ? 10.927  0.992   6.584  1.00 15.29 ? 35  TYR A CE2 1 
ATOM   314 C CZ  . TYR A 1 35 ? 10.028  0.943   5.579  1.00 17.14 ? 35  TYR A CZ  1 
ATOM   315 O OH  . TYR A 1 35 ? 9.969   1.972   4.606  1.00 18.86 ? 35  TYR A OH  1 
ATOM   316 N N   . GLY A 1 36 ? 11.427  -3.762  5.687  1.00 13.68 ? 36  GLY A N   1 
ATOM   317 C CA  . GLY A 1 36 ? 12.563  -3.896  4.817  1.00 14.43 ? 36  GLY A CA  1 
ATOM   318 C C   . GLY A 1 36 ? 13.320  -2.662  4.476  1.00 14.89 ? 36  GLY A C   1 
ATOM   319 O O   . GLY A 1 36 ? 14.464  -2.751  3.983  1.00 15.69 ? 36  GLY A O   1 
ATOM   320 N N   . GLY A 1 37 ? 12.793  -1.481  4.814  1.00 15.11 ? 37  GLY A N   1 
ATOM   321 C CA  . GLY A 1 37 ? 13.544  -0.268  4.601  1.00 17.36 ? 37  GLY A CA  1 
ATOM   322 C C   . GLY A 1 37 ? 12.974  0.648   3.576  1.00 17.83 ? 37  GLY A C   1 
ATOM   323 O O   . GLY A 1 37 ? 13.357  1.859   3.556  1.00 20.39 ? 37  GLY A O   1 
ATOM   324 N N   . CYS A 1 38 ? 12.124  0.138   2.698  1.00 18.41 ? 38  CYS A N   1 
ATOM   325 C CA  . CYS A 1 38 ? 11.520  0.969   1.649  1.00 21.06 ? 38  CYS A CA  1 
ATOM   326 C C   . CYS A 1 38 ? 10.006  0.706   1.630  1.00 21.42 ? 38  CYS A C   1 
ATOM   327 O O   . CYS A 1 38 ? 9.536   -0.409  1.933  1.00 21.76 ? 38  CYS A O   1 
ATOM   328 C CB  . CYS A 1 38 ? 12.016  0.495   0.231  1.00 21.99 ? 38  CYS A CB  1 
ATOM   329 S SG  . CYS A 1 38 ? 13.782  0.550   0.055  1.00 22.35 ? 38  CYS A SG  1 
ATOM   330 N N   . GLY A 1 39 ? 9.238   1.640   1.144  1.00 20.86 ? 39  GLY A N   1 
ATOM   331 C CA  . GLY A 1 39 ? 7.872   1.490   0.871  1.00 22.66 ? 39  GLY A CA  1 
ATOM   332 C C   . GLY A 1 39 ? 6.930   1.283   1.987  1.00 22.55 ? 39  GLY A C   1 
ATOM   333 O O   . GLY A 1 39 ? 5.804   0.773   1.729  1.00 25.27 ? 39  GLY A O   1 
ATOM   334 N N   . GLY A 1 40 ? 7.196   1.696   3.183  1.00 20.44 ? 40  GLY A N   1 
ATOM   335 C CA  . GLY A 1 40 ? 6.286   1.561   4.284  1.00 20.71 ? 40  GLY A CA  1 
ATOM   336 C C   . GLY A 1 40 ? 5.302   2.689   4.411  1.00 20.74 ? 40  GLY A C   1 
ATOM   337 O O   . GLY A 1 40 ? 5.126   3.539   3.501  1.00 25.74 ? 40  GLY A O   1 
ATOM   338 N N   . ASN A 1 41 ? 4.597   2.726   5.518  1.00 18.62 ? 41  ASN A N   1 
ATOM   339 C CA  . ASN A 1 41 ? 3.625   3.760   5.835  1.00 18.59 ? 41  ASN A CA  1 
ATOM   340 C C   . ASN A 1 41 ? 3.911   4.290   7.246  1.00 15.66 ? 41  ASN A C   1 
ATOM   341 O O   . ASN A 1 41 ? 4.850   3.798   7.858  1.00 16.09 ? 41  ASN A O   1 
ATOM   342 C CB  . ASN A 1 41 ? 2.216   3.313   5.643  1.00 19.58 ? 41  ASN A CB  1 
ATOM   343 C CG  . ASN A 1 41 ? 1.726   2.247   6.604  1.00 18.65 ? 41  ASN A CG  1 
ATOM   344 O OD1 . ASN A 1 41 ? 2.096   2.188   7.787  1.00 17.53 ? 41  ASN A OD1 1 
ATOM   345 N ND2 . ASN A 1 41 ? 0.844   1.364   6.118  1.00 19.17 ? 41  ASN A ND2 1 
ATOM   346 N N   . GLU A 1 42 ? 3.118   5.208   7.747  1.00 15.51 ? 42  GLU A N   1 
ATOM   347 C CA  . GLU A 1 42 ? 3.361   5.852   8.991  1.00 15.95 ? 42  GLU A CA  1 
ATOM   348 C C   . GLU A 1 42 ? 2.957   5.099   10.236 1.00 14.39 ? 42  GLU A C   1 
ATOM   349 O O   . GLU A 1 42 ? 3.285   5.587   11.360 1.00 15.59 ? 42  GLU A O   1 
ATOM   350 C CB  . GLU A 1 42 ? 2.962   7.290   9.003  1.00 18.62 ? 42  GLU A CB  1 
ATOM   351 C CG  . GLU A 1 42 ? 3.697   8.135   7.933  1.00 19.30 ? 42  GLU A CG  1 
ATOM   352 C CD  . GLU A 1 42 ? 2.776   9.326   7.590  1.00 21.44 ? 42  GLU A CD  1 
ATOM   353 O OE1 . GLU A 1 42 ? 1.654   9.026   7.127  1.00 29.08 ? 42  GLU A OE1 1 
ATOM   354 O OE2 . GLU A 1 42 ? 3.177   10.418  7.904  1.00 29.60 ? 42  GLU A OE2 1 
ATOM   355 N N   . ASN A 1 43 ? 2.312   3.977   10.116 1.00 13.48 ? 43  ASN A N   1 
ATOM   356 C CA  . ASN A 1 43 ? 2.007   3.152   11.319 1.00 13.23 ? 43  ASN A CA  1 
ATOM   357 C C   . ASN A 1 43 ? 3.199   2.213   11.580 1.00 12.89 ? 43  ASN A C   1 
ATOM   358 O O   . ASN A 1 43 ? 3.195   1.033   11.259 1.00 13.13 ? 43  ASN A O   1 
ATOM   359 C CB  . ASN A 1 43 ? 0.772   2.330   11.066 1.00 14.11 ? 43  ASN A CB  1 
ATOM   360 C CG  . ASN A 1 43 ? 0.259   1.649   12.296 1.00 13.40 ? 43  ASN A CG  1 
ATOM   361 O OD1 . ASN A 1 43 ? 0.817   1.741   13.386 1.00 13.52 ? 43  ASN A OD1 1 
ATOM   362 N ND2 . ASN A 1 43 ? -0.837  0.913   12.157 1.00 15.57 ? 43  ASN A ND2 1 
ATOM   363 N N   . LYS A 1 44 ? 4.260   2.869   12.079 1.00 11.07 ? 44  LYS A N   1 
ATOM   364 C CA  . LYS A 1 44 ? 5.551   2.237   12.176 1.00 11.69 ? 44  LYS A CA  1 
ATOM   365 C C   . LYS A 1 44 ? 6.371   3.059   13.212 1.00 10.76 ? 44  LYS A C   1 
ATOM   366 O O   . LYS A 1 44 ? 6.542   4.240   13.072 1.00 14.82 ? 44  LYS A O   1 
ATOM   367 C CB  . LYS A 1 44 ? 6.257   2.380   10.812 1.00 13.88 ? 44  LYS A CB  1 
ATOM   368 C CG  . LYS A 1 44 ? 7.702   1.958   10.782 1.00 14.72 ? 44  LYS A CG  1 
ATOM   369 C CD  . LYS A 1 44 ? 8.196   1.721   9.387  1.00 18.25 ? 44  LYS A CD  1 
ATOM   370 C CE  . LYS A 1 44 ? 8.121   2.879   8.408  1.00 20.40 ? 44  LYS A CE  1 
ATOM   371 N NZ  . LYS A 1 44 ? 8.906   4.099   8.768  1.00 26.38 ? 44  LYS A NZ  1 
ATOM   372 N N   . PHE A 1 45 ? 6.756   2.402   14.282 1.00 11.08 ? 45  PHE A N   1 
ATOM   373 C CA  . PHE A 1 45 ? 7.376   3.027   15.405 1.00 11.72 ? 45  PHE A CA  1 
ATOM   374 C C   . PHE A 1 45 ? 8.618   2.205   15.866 1.00 11.57 ? 45  PHE A C   1 
ATOM   375 O O   . PHE A 1 45 ? 8.709   1.023   15.620 1.00 12.34 ? 45  PHE A O   1 
ATOM   376 C CB  . PHE A 1 45 ? 6.368   3.049   16.583 1.00 12.20 ? 45  PHE A CB  1 
ATOM   377 C CG  . PHE A 1 45 ? 5.099   3.783   16.271 1.00 12.37 ? 45  PHE A CG  1 
ATOM   378 C CD1 . PHE A 1 45 ? 4.000   3.184   15.776 1.00 12.43 ? 45  PHE A CD1 1 
ATOM   379 C CD2 . PHE A 1 45 ? 5.013   5.156   16.583 1.00 13.46 ? 45  PHE A CD2 1 
ATOM   380 C CE1 . PHE A 1 45 ? 2.870   3.876   15.450 1.00 14.56 ? 45  PHE A CE1 1 
ATOM   381 C CE2 . PHE A 1 45 ? 3.882   5.842   16.275 1.00 14.86 ? 45  PHE A CE2 1 
ATOM   382 C CZ  . PHE A 1 45 ? 2.791   5.249   15.753 1.00 14.69 ? 45  PHE A CZ  1 
ATOM   383 N N   . GLY A 1 46 ? 9.569   2.906   16.457 1.00 13.00 ? 46  GLY A N   1 
ATOM   384 C CA  . GLY A 1 46 ? 10.801  2.213   16.835 1.00 14.82 ? 46  GLY A CA  1 
ATOM   385 C C   . GLY A 1 46 ? 10.746  1.464   18.101 1.00 14.59 ? 46  GLY A C   1 
ATOM   386 O O   . GLY A 1 46 ? 11.655  0.656   18.371 1.00 17.51 ? 46  GLY A O   1 
ATOM   387 N N   . SER A 1 47 ? 9.690   1.708   18.932 1.00 14.38 ? 47  SER A N   1 
ATOM   388 C CA  . SER A 1 47 ? 9.597   0.959   20.202 1.00 15.77 ? 47  SER A CA  1 
ATOM   389 C C   . SER A 1 47 ? 8.130   0.679   20.489 1.00 14.89 ? 47  SER A C   1 
ATOM   390 O O   . SER A 1 47 ? 7.251   1.435   20.000 1.00 14.05 ? 47  SER A O   1 
ATOM   391 C CB  . SER A 1 47 ? 10.209  1.792   21.330 1.00 16.79 ? 47  SER A CB  1 
ATOM   392 O OG  . SER A 1 47 ? 9.454   2.979   21.505 1.00 18.69 ? 47  SER A OG  1 
ATOM   393 N N   . GLN A 1 48 ? 7.850   -0.331  21.286 1.00 15.21 ? 48  GLN A N   1 
ATOM   394 C CA  . GLN A 1 48 ? 6.448   -0.562  21.676 1.00 15.31 ? 48  GLN A CA  1 
ATOM   395 C C   . GLN A 1 48 ? 5.866   0.597   22.455 1.00 15.57 ? 48  GLN A C   1 
ATOM   396 O O   . GLN A 1 48 ? 4.738   0.961   22.303 1.00 14.48 ? 48  GLN A O   1 
ATOM   397 C CB  . GLN A 1 48 ? 6.425   -1.816  22.558 1.00 17.14 ? 48  GLN A CB  1 
ATOM   398 C CG  . GLN A 1 48 ? 5.013   -2.309  22.792 1.00 17.60 ? 48  GLN A CG  1 
ATOM   399 C CD  . GLN A 1 48 ? 4.931   -3.587  23.601 1.00 20.22 ? 48  GLN A CD  1 
ATOM   400 O OE1 . GLN A 1 48 ? 5.880   -4.020  24.208 1.00 23.31 ? 48  GLN A OE1 1 
ATOM   401 N NE2 . GLN A 1 48 ? 3.808   -4.303  23.418 1.00 24.78 ? 48  GLN A NE2 1 
ATOM   402 N N   . LYS A 1 49 ? 6.706   1.252   23.282 1.00 15.81 ? 49  LYS A N   1 
ATOM   403 C CA  . LYS A 1 49 ? 6.287   2.268   24.205 1.00 17.58 ? 49  LYS A CA  1 
ATOM   404 C C   . LYS A 1 49 ? 5.805   3.470   23.390 1.00 16.57 ? 49  LYS A C   1 
ATOM   405 O O   . LYS A 1 49 ? 4.802   4.115   23.663 1.00 15.82 ? 49  LYS A O   1 
ATOM   406 C CB  . LYS A 1 49 ? 7.380   2.641   25.180 1.00 21.74 ? 49  LYS A CB  1 
ATOM   407 C CG  . LYS A 1 49 ? 6.947   3.882   25.977 1.00 31.01 ? 49  LYS A CG  1 
ATOM   408 C CD  . LYS A 1 49 ? 7.895   4.258   27.024 1.00 35.66 ? 49  LYS A CD  1 
ATOM   409 C CE  . LYS A 1 49 ? 7.246   5.024   28.171 1.00 39.89 ? 49  LYS A CE  1 
ATOM   410 N NZ  . LYS A 1 49 ? 7.312   4.260   29.451 1.00 51.21 ? 49  LYS A NZ  1 
ATOM   411 N N   . GLU A 1 50 ? 6.566   3.848   22.320 1.00 15.92 ? 50  GLU A N   1 
ATOM   412 C CA  . GLU A 1 50 ? 6.146   4.995   21.512 1.00 16.07 ? 50  GLU A CA  1 
ATOM   413 C C   . GLU A 1 50 ? 4.856   4.715   20.772 1.00 14.21 ? 50  GLU A C   1 
ATOM   414 O O   . GLU A 1 50 ? 3.958   5.541   20.687 1.00 15.97 ? 50  GLU A O   1 
ATOM   415 C CB  . GLU A 1 50 ? 7.269   5.448   20.586 1.00 15.94 ? 50  GLU A CB  1 
ATOM   416 C CG  . GLU A 1 50 ? 6.922   6.653   19.769 1.00 17.55 ? 50  GLU A CG  1 
ATOM   417 C CD  . GLU A 1 50 ? 6.772   7.917   20.628 1.00 21.10 ? 50  GLU A CD  1 
ATOM   418 O OE1 . GLU A 1 50 ? 6.895   7.891   21.817 1.00 25.73 ? 50  GLU A OE1 1 
ATOM   419 O OE2 . GLU A 1 50 ? 6.585   8.998   19.997 1.00 22.03 ? 50  GLU A OE2 1 
ATOM   420 N N   . CYS A 1 51 ? 4.741   3.500   20.202 1.00 14.15 ? 51  CYS A N   1 
ATOM   421 C CA  . CYS A 1 51 ? 3.505   3.090   19.489 1.00 14.25 ? 51  CYS A CA  1 
ATOM   422 C C   . CYS A 1 51 ? 2.304   3.173   20.431 1.00 13.43 ? 51  CYS A C   1 
ATOM   423 O O   . CYS A 1 51 ? 1.264   3.694   20.026 1.00 13.63 ? 51  CYS A O   1 
ATOM   424 C CB  . CYS A 1 51 ? 3.768   1.673   18.978 1.00 13.61 ? 51  CYS A CB  1 
ATOM   425 S SG  . CYS A 1 51 ? 2.377   0.961   18.053 1.00 13.77 ? 51  CYS A SG  1 
ATOM   426 N N   . GLU A 1 52 ? 2.470   2.674   21.656 1.00 14.51 ? 52  GLU A N   1 
ATOM   427 C CA  . GLU A 1 52 ? 1.337   2.704   22.565 1.00 15.66 ? 52  GLU A CA  1 
ATOM   428 C C   . GLU A 1 52 ? 0.921   4.107   22.978 1.00 16.33 ? 52  GLU A C   1 
ATOM   429 O O   . GLU A 1 52 ? -0.241  4.453   23.048 1.00 18.33 ? 52  GLU A O   1 
ATOM   430 C CB  . GLU A 1 52 ? 1.624   1.845   23.762 1.00 16.13 ? 52  GLU A CB  1 
ATOM   431 C CG  . GLU A 1 52 ? 1.719   0.365   23.479 1.00 16.00 ? 52  GLU A CG  1 
ATOM   432 C CD  . GLU A 1 52 ? 0.337   -0.246  23.346 1.00 17.66 ? 52  GLU A CD  1 
ATOM   433 O OE1 . GLU A 1 52 ? -0.497  0.188   24.205 1.00 19.25 ? 52  GLU A OE1 1 
ATOM   434 O OE2 . GLU A 1 52 ? 0.173   -1.142  22.578 1.00 19.28 ? 52  GLU A OE2 1 
ATOM   435 N N   . LYS A 1 53 ? 1.926   4.992   23.140 1.00 17.19 ? 53  LYS A N   1 
ATOM   436 C CA  . LYS A 1 53 ? 1.589   6.393   23.541 1.00 19.77 ? 53  LYS A CA  1 
ATOM   437 C C   . LYS A 1 53 ? 0.787   7.074   22.451 1.00 18.88 ? 53  LYS A C   1 
ATOM   438 O O   . LYS A 1 53 ? -0.160  7.793   22.719 1.00 19.54 ? 53  LYS A O   1 
ATOM   439 C CB  . LYS A 1 53 ? 2.851   7.197   23.792 1.00 23.88 ? 53  LYS A CB  1 
ATOM   440 C CG  . LYS A 1 53 ? 3.542   6.981   25.115 1.00 30.74 ? 53  LYS A CG  1 
ATOM   441 C CD  . LYS A 1 53 ? 4.593   8.148   25.268 1.00 35.85 ? 53  LYS A CD  1 
ATOM   442 C CE  . LYS A 1 53 ? 5.071   8.161   26.707 1.00 40.19 ? 53  LYS A CE  1 
ATOM   443 N NZ  . LYS A 1 53 ? 6.460   8.775   26.821 1.00 44.93 ? 53  LYS A NZ  1 
ATOM   444 N N   . VAL A 1 54 ? 1.236   6.905   21.200 1.00 17.42 ? 54  VAL A N   1 
ATOM   445 C CA  . VAL A 1 54 ? 0.613   7.635   20.107 1.00 16.67 ? 54  VAL A CA  1 
ATOM   446 C C   . VAL A 1 54 ? -0.750  7.075   19.698 1.00 18.20 ? 54  VAL A C   1 
ATOM   447 O O   . VAL A 1 54 ? -1.646  7.867   19.365 1.00 20.86 ? 54  VAL A O   1 
ATOM   448 C CB  . VAL A 1 54 ? 1.565   7.593   18.874 1.00 16.46 ? 54  VAL A CB  1 
ATOM   449 C CG1 . VAL A 1 54 ? 0.848   8.174   17.693 1.00 17.37 ? 54  VAL A CG1 1 
ATOM   450 C CG2 . VAL A 1 54 ? 2.831   8.402   19.206 1.00 16.89 ? 54  VAL A CG2 1 
ATOM   451 N N   . CYS A 1 55 ? -0.942  5.726   19.862 1.00 18.85 ? 55  CYS A N   1 
ATOM   452 C CA  . CYS A 1 55 ? -2.017  5.041   19.237 1.00 19.74 ? 55  CYS A CA  1 
ATOM   453 C C   . CYS A 1 55 ? -3.087  4.395   20.149 1.00 20.69 ? 55  CYS A C   1 
ATOM   454 O O   . CYS A 1 55 ? -4.254  4.208   19.746 1.00 25.06 ? 55  CYS A O   1 
ATOM   455 C CB  . CYS A 1 55 ? -1.545  3.977   18.254 1.00 20.64 ? 55  CYS A CB  1 
ATOM   456 S SG  . CYS A 1 55 ? -0.876  4.662   16.753 1.00 19.39 ? 55  CYS A SG  1 
ATOM   457 N N   . ALA A 1 56 ? -2.712  3.898   21.305 1.00 25.66 ? 56  ALA A N   1 
ATOM   458 C CA  . ALA A 1 56 ? -3.573  3.111   22.167 1.00 28.95 ? 56  ALA A CA  1 
ATOM   459 C C   . ALA A 1 56 ? -4.534  3.980   22.928 1.00 29.46 ? 56  ALA A C   1 
ATOM   460 O O   . ALA A 1 56 ? -4.248  5.144   23.209 1.00 29.40 ? 56  ALA A O   1 
ATOM   461 C CB  . ALA A 1 56 ? -2.776  2.169   23.085 1.00 30.96 ? 56  ALA A CB  1 
ATOM   462 N N   . PRO A 1 57 ? -5.713  3.400   23.198 1.00 34.23 ? 57  PRO A N   1 
ATOM   463 C CA  . PRO A 1 57 ? -6.835  4.125   23.748 1.00 34.10 ? 57  PRO A CA  1 
ATOM   464 C C   . PRO A 1 57 ? -6.655  4.746   25.076 1.00 39.30 ? 57  PRO A C   1 
ATOM   465 O O   . PRO A 1 57 ? -6.882  5.965   25.249 1.00 48.93 ? 57  PRO A O   1 
ATOM   466 C CB  . PRO A 1 57 ? -8.005  3.184   23.595 1.00 35.90 ? 57  PRO A CB  1 
ATOM   467 C CG  . PRO A 1 57 ? -7.385  1.804   23.614 1.00 36.20 ? 57  PRO A CG  1 
ATOM   468 C CD  . PRO A 1 57 ? -6.006  1.968   23.023 1.00 35.47 ? 57  PRO A CD  1 
ATOM   469 N N   . VAL A 1 58 ? -6.141  3.998   26.045 1.00 44.99 ? 58  VAL A N   1 
ATOM   470 C CA  . VAL A 1 58 ? -5.797  4.618   27.364 1.00 49.39 ? 58  VAL A CA  1 
ATOM   471 C C   . VAL A 1 58 ? -4.610  5.565   27.011 1.00 50.58 ? 58  VAL A C   1 
ATOM   472 O O   . VAL A 1 58 ? -4.744  6.216   25.980 1.00 50.17 ? 58  VAL A O   1 
ATOM   473 O OXT . VAL A 1 58 ? -3.630  5.481   27.740 1.00 58.77 ? 58  VAL A OXT 1 
HETATM 474 P P   . PO4 B 2 .  ? 11.307  -2.265  22.113 1.00 31.73 ? 59  PO4 A P   1 
HETATM 475 O O1  . PO4 B 2 .  ? 12.316  -1.124  22.730 1.00 36.60 ? 59  PO4 A O1  1 
HETATM 476 O O2  . PO4 B 2 .  ? 11.356  -2.088  20.536 1.00 39.85 ? 59  PO4 A O2  1 
HETATM 477 O O3  . PO4 B 2 .  ? 9.831   -1.943  22.637 1.00 31.52 ? 59  PO4 A O3  1 
HETATM 478 O O4  . PO4 B 2 .  ? 11.824  -3.665  22.558 1.00 38.99 ? 59  PO4 A O4  1 
HETATM 479 O O   . HOH C 3 .  ? 1.545   6.687   5.630  1.00 28.03 ? 200 HOH A O   1 
HETATM 480 O O   . HOH C 3 .  ? -1.720  -8.227  15.614 1.00 32.96 ? 201 HOH A O   1 
HETATM 481 O O   . HOH C 3 .  ? 11.678  -7.504  -1.679 1.00 33.41 ? 202 HOH A O   1 
HETATM 482 O O   . HOH C 3 .  ? 9.660   -7.699  5.910  1.00 24.95 ? 203 HOH A O   1 
HETATM 483 O O   . HOH C 3 .  ? 18.074  -3.130  0.041  1.00 34.83 ? 204 HOH A O   1 
HETATM 484 O O   . HOH C 3 .  ? 13.981  1.842   14.897 1.00 36.24 ? 205 HOH A O   1 
HETATM 485 O O   . HOH C 3 .  ? -1.616  5.169   25.940 1.00 42.15 ? 206 HOH A O   1 
HETATM 486 O O   . HOH C 3 .  ? 5.448   0.475   7.260  1.00 18.30 ? 207 HOH A O   1 
HETATM 487 O O   . HOH C 3 .  ? -3.054  -1.822  11.612 1.00 25.72 ? 208 HOH A O   1 
HETATM 488 O O   . HOH C 3 .  ? 10.000  4.096   13.135 1.00 32.44 ? 209 HOH A O   1 
HETATM 489 O O   . HOH C 3 .  ? 6.961   -9.127  9.946  1.00 23.84 ? 210 HOH A O   1 
HETATM 490 O O   . HOH C 3 .  ? 3.081   -0.342  8.888  1.00 17.13 ? 211 HOH A O   1 
HETATM 491 O O   . HOH C 3 .  ? 11.839  -7.083  1.735  1.00 30.23 ? 212 HOH A O   1 
HETATM 492 O O   . HOH C 3 .  ? -2.800  -1.019  24.195 1.00 25.84 ? 213 HOH A O   1 
HETATM 493 O O   . HOH C 3 .  ? 9.847   -6.726  3.401  1.00 26.67 ? 214 HOH A O   1 
HETATM 494 O O   . HOH C 3 .  ? 9.234   -0.100  24.405 1.00 24.14 ? 215 HOH A O   1 
HETATM 495 O O   . HOH C 3 .  ? 3.499   3.892   26.276 1.00 29.99 ? 216 HOH A O   1 
HETATM 496 O O   . HOH C 3 .  ? 4.573   -8.620  18.654 1.00 30.91 ? 217 HOH A O   1 
HETATM 497 O O   . HOH C 3 .  ? -2.724  -4.728  9.295  1.00 32.89 ? 218 HOH A O   1 
HETATM 498 O O   . HOH C 3 .  ? -2.477  -6.845  11.417 1.00 43.62 ? 219 HOH A O   1 
HETATM 499 O O   . HOH C 3 .  ? 4.751   0.449   -1.071 1.00 43.46 ? 220 HOH A O   1 
HETATM 500 O O   . HOH C 3 .  ? 3.007   -6.059  4.648  1.00 35.94 ? 221 HOH A O   1 
HETATM 501 O O   . HOH C 3 .  ? 13.871  3.958   1.810  1.00 39.48 ? 222 HOH A O   1 
HETATM 502 O O   . HOH C 3 .  ? -1.497  8.586   25.031 1.00 41.53 ? 223 HOH A O   1 
HETATM 503 O O   . HOH C 3 .  ? 7.562   6.741   13.891 1.00 30.44 ? 225 HOH A O   1 
HETATM 504 O O   . HOH C 3 .  ? -4.682  -3.503  10.557 1.00 51.16 ? 226 HOH A O   1 
HETATM 505 O O   . HOH C 3 .  ? 10.133  4.252   -0.062 1.00 34.85 ? 227 HOH A O   1 
HETATM 506 O O   . HOH C 3 .  ? -12.617 -0.333  16.070 1.00 40.18 ? 228 HOH A O   1 
HETATM 507 O O   . HOH C 3 .  ? 5.326   6.992   12.536 1.00 24.51 ? 229 HOH A O   1 
HETATM 508 O O   . HOH C 3 .  ? 18.258  -0.501  0.184  1.00 50.75 ? 230 HOH A O   1 
HETATM 509 O O   . HOH C 3 .  ? 13.739  3.469   10.429 1.00 41.37 ? 231 HOH A O   1 
HETATM 510 O O   . HOH C 3 .  ? 0.467   -7.298  20.563 1.00 50.43 ? 232 HOH A O   1 
HETATM 511 O O   . HOH C 3 .  ? 9.329   6.055   16.677 1.00 40.14 ? 233 HOH A O   1 
HETATM 512 O O   . HOH C 3 .  ? 13.521  4.748   14.900 1.00 50.21 ? 234 HOH A O   1 
HETATM 513 O O   . HOH C 3 .  ? 9.323   8.576   13.246 1.00 46.76 ? 235 HOH A O   1 
HETATM 514 O O   . HOH C 3 .  ? 14.182  1.969   8.250  1.00 40.42 ? 236 HOH A O   1 
HETATM 515 O O   . HOH C 3 .  ? -1.753  -7.615  18.168 1.00 34.60 ? 237 HOH A O   1 
HETATM 516 O O   . HOH C 3 .  ? 15.464  -13.588 -2.699 1.00 53.23 ? 238 HOH A O   1 
HETATM 517 O O   . HOH C 3 .  ? 10.830  4.430   4.990  1.00 52.10 ? 239 HOH A O   1 
HETATM 518 O O   . HOH C 3 .  ? 12.074  1.049   24.532 1.00 59.97 ? 240 HOH A O   1 
HETATM 519 O O   . HOH C 3 .  ? 7.451   8.254   11.376 1.00 50.41 ? 241 HOH A O   1 
HETATM 520 O O   . HOH C 3 .  ? 8.557   -4.037  24.353 1.00 35.93 ? 242 HOH A O   1 
HETATM 521 O O   . HOH C 3 .  ? 16.242  0.241   7.416  1.00 35.84 ? 243 HOH A O   1 
HETATM 522 O O   . HOH C 3 .  ? 14.265  3.511   5.566  1.00 43.24 ? 244 HOH A O   1 
HETATM 523 O O   . HOH C 3 .  ? 8.152   5.388   10.947 1.00 52.19 ? 245 HOH A O   1 
HETATM 524 O O   . HOH C 3 .  ? 10.470  5.640   22.970 1.00 50.46 ? 246 HOH A O   1 
HETATM 525 O O   . HOH C 3 .  ? 0.195   0.885   3.440  1.00 44.21 ? 247 HOH A O   1 
HETATM 526 O O   . HOH C 3 .  ? -11.676 -3.753  18.347 1.00 45.90 ? 248 HOH A O   1 
HETATM 527 O O   . HOH C 3 .  ? 5.323   -6.005  1.528  1.00 46.20 ? 249 HOH A O   1 
HETATM 528 O O   . HOH C 3 .  ? -7.143  4.258   16.254 1.00 50.00 ? 250 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLU 1  1  1  GLU GLU A . n 
A 1 2  THR 2  2  2  THR THR A . n 
A 1 3  ASP 3  3  3  ASP ASP A . n 
A 1 4  ILE 4  4  4  ILE ILE A . n 
A 1 5  CYS 5  5  5  CYS CYS A . n 
A 1 6  LYS 6  6  6  LYS LYS A . n 
A 1 7  LEU 7  7  7  LEU LEU A . n 
A 1 8  PRO 8  8  8  PRO PRO A . n 
A 1 9  LYS 9  9  9  LYS LYS A . n 
A 1 10 ASP 10 10 10 ASP ASP A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 GLY 12 12 12 GLY GLY A . n 
A 1 13 THR 13 13 13 THR THR A . n 
A 1 14 CYS 14 14 14 CYS CYS A . n 
A 1 15 ARG 15 15 15 ARG ARG A . n 
A 1 16 ASP 16 16 16 ASP ASP A . n 
A 1 17 PHE 17 17 17 PHE PHE A . n 
A 1 18 ILE 18 18 18 ILE ILE A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 LYS 20 20 20 LYS LYS A . n 
A 1 21 TRP 21 21 21 TRP TRP A . n 
A 1 22 TYR 22 22 22 TYR TYR A . n 
A 1 23 TYR 23 23 23 TYR TYR A . n 
A 1 24 ASP 24 24 24 ASP ASP A . n 
A 1 25 PRO 25 25 25 PRO PRO A . n 
A 1 26 ASN 26 26 26 ASN ASN A . n 
A 1 27 THR 27 27 27 THR THR A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 SER 29 29 29 SER SER A . n 
A 1 30 CYS 30 30 30 CYS CYS A . n 
A 1 31 ALA 31 31 31 ALA ALA A . n 
A 1 32 ARG 32 32 32 ARG ARG A . n 
A 1 33 PHE 33 33 33 PHE PHE A . n 
A 1 34 TRP 34 34 34 TRP TRP A . n 
A 1 35 TYR 35 35 35 TYR TYR A . n 
A 1 36 GLY 36 36 36 GLY GLY A . n 
A 1 37 GLY 37 37 37 GLY GLY A . n 
A 1 38 CYS 38 38 38 CYS CYS A . n 
A 1 39 GLY 39 39 39 GLY GLY A . n 
A 1 40 GLY 40 40 40 GLY GLY A . n 
A 1 41 ASN 41 41 41 ASN ASN A . n 
A 1 42 GLU 42 42 42 GLU GLU A . n 
A 1 43 ASN 43 43 43 ASN ASN A . n 
A 1 44 LYS 44 44 44 LYS LYS A . n 
A 1 45 PHE 45 45 45 PHE PHE A . n 
A 1 46 GLY 46 46 46 GLY GLY A . n 
A 1 47 SER 47 47 47 SER SER A . n 
A 1 48 GLN 48 48 48 GLN GLN A . n 
A 1 49 LYS 49 49 49 LYS LYS A . n 
A 1 50 GLU 50 50 50 GLU GLU A . n 
A 1 51 CYS 51 51 51 CYS CYS A . n 
A 1 52 GLU 52 52 52 GLU GLU A . n 
A 1 53 LYS 53 53 53 LYS LYS A . n 
A 1 54 VAL 54 54 54 VAL VAL A . n 
A 1 55 CYS 55 55 55 CYS CYS A . n 
A 1 56 ALA 56 56 56 ALA ALA A . n 
A 1 57 PRO 57 57 57 PRO PRO A . n 
A 1 58 VAL 58 58 58 VAL VAL A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-05-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM    'data reduction' . ? 1 
AGROVATA  'data reduction' . ? 2 
AMoRE     phasing          . ? 3 
SHELXL-93 refinement       . ? 4 
AGROVATA  'data scaling'   . ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              16 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              16 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             A 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              16 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             A 
_pdbx_validate_rmsd_angle.angle_value                123.97 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            5.67 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 14 ? ? 83.31   163.98 
2 1 ASP A 16 ? ? -103.73 67.57  
3 1 LYS A 44 ? ? -160.69 118.60 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A VAL 58 ? CB  ? A VAL 58 CB  
2 1 Y 1 A VAL 58 ? CG1 ? A VAL 58 CG1 
3 1 Y 1 A VAL 58 ? CG2 ? A VAL 58 CG2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1  59  59  PO4 PO4 A . 
C 3 HOH 1  200 200 HOH HOH A . 
C 3 HOH 2  201 201 HOH HOH A . 
C 3 HOH 3  202 202 HOH HOH A . 
C 3 HOH 4  203 203 HOH HOH A . 
C 3 HOH 5  204 204 HOH HOH A . 
C 3 HOH 6  205 205 HOH HOH A . 
C 3 HOH 7  206 206 HOH HOH A . 
C 3 HOH 8  207 207 HOH HOH A . 
C 3 HOH 9  208 208 HOH HOH A . 
C 3 HOH 10 209 209 HOH HOH A . 
C 3 HOH 11 210 210 HOH HOH A . 
C 3 HOH 12 211 211 HOH HOH A . 
C 3 HOH 13 212 212 HOH HOH A . 
C 3 HOH 14 213 213 HOH HOH A . 
C 3 HOH 15 214 214 HOH HOH A . 
C 3 HOH 16 215 215 HOH HOH A . 
C 3 HOH 17 216 216 HOH HOH A . 
C 3 HOH 18 217 217 HOH HOH A . 
C 3 HOH 19 218 218 HOH HOH A . 
C 3 HOH 20 219 219 HOH HOH A . 
C 3 HOH 21 220 220 HOH HOH A . 
C 3 HOH 22 221 221 HOH HOH A . 
C 3 HOH 23 222 222 HOH HOH A . 
C 3 HOH 24 223 223 HOH HOH A . 
C 3 HOH 25 225 225 HOH HOH A . 
C 3 HOH 26 226 226 HOH HOH A . 
C 3 HOH 27 227 227 HOH HOH A . 
C 3 HOH 28 228 228 HOH HOH A . 
C 3 HOH 29 229 229 HOH HOH A . 
C 3 HOH 30 230 230 HOH HOH A . 
C 3 HOH 31 231 231 HOH HOH A . 
C 3 HOH 32 232 232 HOH HOH A . 
C 3 HOH 33 233 233 HOH HOH A . 
C 3 HOH 34 234 234 HOH HOH A . 
C 3 HOH 35 235 235 HOH HOH A . 
C 3 HOH 36 236 236 HOH HOH A . 
C 3 HOH 37 237 237 HOH HOH A . 
C 3 HOH 38 238 238 HOH HOH A . 
C 3 HOH 39 239 239 HOH HOH A . 
C 3 HOH 40 240 240 HOH HOH A . 
C 3 HOH 41 241 241 HOH HOH A . 
C 3 HOH 42 242 242 HOH HOH A . 
C 3 HOH 43 243 243 HOH HOH A . 
C 3 HOH 44 244 244 HOH HOH A . 
C 3 HOH 45 245 245 HOH HOH A . 
C 3 HOH 46 246 246 HOH HOH A . 
C 3 HOH 47 247 247 HOH HOH A . 
C 3 HOH 48 248 248 HOH HOH A . 
C 3 HOH 49 249 249 HOH HOH A . 
C 3 HOH 50 250 250 HOH HOH A . 
#